3FE3A

Crystal structure of the kinase mark3/par-1: t211a-s215a double mutant
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
317
structure length
317
Chain Sequence
QPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Crystal structure of the kinase MARK3/Par-1: T211A-S215A double mutant
rcsb
source organism Homo sapiens
total genus 102
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3fe3A03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fe3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fe3A01
1UKIA 2RFNA 4G5JA 3ZC6A 4ORKA 4PTGA 3A61A 3CJFA 1YDRE 1GIHA 2V55A 1MP8A 3F88A 3C5IA 4LL5A 1YWNA 3AT3A 3V8TA 3MMPA 2ITTA 4HCVA 1A9UA 2F7XE 2RRUA 4XLIA 4UMRA 4GL9A 2ZTDA 3OY1A 4ZY6A 4DEDA 3EKKA 4HCTA 4OBOA 4B0GA 1PMUA 4O81A 1ZY5A 3BIZA 1U46A 2ZVAA 3O17A 1OBGA 2E2BA 1CKPA 5IUHA 5I5ZA 2X2MA 1F5QA 5GNKA 3KREA 1NA7A 2ETKA 2VWUA 5AP0A 2BROA 4U79A 4OTIA 2YM7A 4MNEB 2NP8A 2ITVA 2OH4A 2W17A 3R71A 1A5TA 4R1VA 3R8LA 3HYHA 5JRQA 2PZIA 4DTBA 3QUEA 4JJRA 4V04A 4WBOA 4BHNA 1JNKA 4ZLYA 3OWJA 4FEXA 5BPYA 5IH6A 3Q5IA 4Z7GA 5IPJA 2OLCA 2XEYA 3FC1X 2C68A 4U41A 2PVJA 1IXSA 5AUXA 5IF1A 1X8BA 4L42A 3VHKA 3E93A 2EB2A 3LPBA 4O6EA 4E93A 5FXQA 4R77A 4RX5A 1H07A 2YJRA 4QP1A 1Y6AA 4EKLA 5L2WA 3HX4A 4LOOA 5GINE 2QO2A 2BZHB 3EFLA 2QO9A 4DGGA 5HQ0A 4XG7A 3OEZA 1M17A 3QCQA 4NW6A 5ETAA 3ZLSA 1BVSA 3GQIA 3O51A 2IW6A 4M13A 4V01A 4EL9A 5M53A 4WOVA 2O0UA 3KKVA 3UOLA 4BCIA 5I9WA 1VEGA 4GK2A 1OTRA 2XRUA 2BIKB 4RIWB 4FV4A 4FVQA 3VS0A 1OBDA 4G5PA 5ETIA 1RW8A 5CVGA 4WSQA 1REJA 4OTFA 2BHEA 3LCOA 2VWVA 1NV8A 2W1GA 3MH1A 2E9NA 3FQSA 4EHZA 3LJ0A 3ZOSA 4EH8A 3M42A 4ZIMA 2BKKA 1FMKA 3KRXA 4RQVA 3DTWA 4UY9A 5AUTA 2RFSA 4X3FC 1H28A 4MQ2A 4DEHA 3LQ8A 3OOGA 3O50A 5IMXA 3CKXA 4QPMA 3Q6WA 4F2LA 2YWPA 3MSSA 2ZM3A 4UMPA 5KMJA 4BCFA 2QLQA 2QURA 2XKDA 4QD6A 4ASXA 3QD3A 3OWLA 2WO6A 2PWLA 5ETCA 3VBXA 2E9VA 2W1HA 4BIDA 4CTCA 3D4QA 4FX3A 3NAYA 1QZEA 5AADA 1TQPA 1CDKA 4HEOA 3GVUA 4RJ4A 3ORKA 4DBNA 4FIJA 2RGPA 4E3CA 2W9FB 2OH0E 4BTFA 2W5HA 3VJOA 3JUHA 4XV3A 3BHHA 3SD0A 3R2YA 5BVNA 3ATSA 4AT3A 4RZVA 2YIXA 4ALUA 4FNWA 3CEKA 4MD7E 2QLUA 3WI6A 5KO1A 4BI0A 4FYOA 5HVYA 3L9MA 2V7AA 5EHOA 3SC1A 2ESMA 2QOCA 1M14A 3UZRA 2CHLA 4YUQA 5BVDA 4JIKA 4FOCA 5IG1A 2NNWB 2VO6A 1T43A 5HX8A 1J7IA 4R6VA 3EKNA 3QA0A 4YPDA 3Q4CA 4AFJA 1ZWSA 4PMMA 4R7HA 3RHKA 4KRDA 3TIZA 2PMIA 3DKOA 4ANMA 4ASEA 5HX6A 5HG8A 5A4TA 3MB6A 1Y8YA 5HE0A 2PYWA 1Y91A 4O91A 4XBUA 1R0PA 2YA9A 4DEGA 2XYUA 5I0BA 4WG3A 4FV2A 4F7SA 5J1WA 3HZTA 4TL0A 3BYOA 3JY0A 5BVFA 4JR7A 2H9VA 4FTAA 4LM5A 4AZEA 3U6IA 3DK3A 3F3ZA 4OTDA 3PG1A 4ZXTA 2X2LA 3W2QA 4IIRA 5CSXA 4XOZA 3QHWA 3C50A 4N70A 2QU5A 4O83A 2G3QA 4HYUA 1OPLA 4GFOA 4QP2A 2C6LA 4KUJA 3LFSA 4BBEA 2QOKA 3Q53A 2W7XA 4YJQA 2J2IB 4FIIA 2IG7A 3LOKA 5HNIX 1E1XA 2ITQA 3UNJA 5DT0A 3CE3A 4O0SA 3A60A 2X8IA 4O0XA 3F69A 2VTIA 4H3PA 1J1CA 4AAAA 4XG8A 4IWQA 4B8LA 4BDBA 3QCYA 4EZ5A 4XH6A 2C30A 2HW6A 3EN7A 4HPUE 5DIAA 4EK4A 3KMMA 5IA3A 4MD9E 4U8ZA 4ANLA 2R3KA 3GCQA 4D2TA 1DI9A 1H26A 5CWZA 3VAPA 5J9LA 3NAXA 4G3EA 2QVSE 3HRFA 5KMMA 3HP5A 4G3DA 5IISA 4JQ8A 3VN9A 4C57A 2GPHA 1F3MC 2PVMA 3TV7A 4JL9A 4M0YA 4KRCA 2UW3A 3QBNA 2LAVA 3PPKA 4KWPA 4QP8A 4FG7A 3WIKA 2VTMA 4PDYA 2P2HA 4D2SA 3FXWA 5IZFA 2Y6OA 4DEBA 3GUBA 2GSFA 4Q5EA 5HBJA 3UTOA 3V5WA 4C02A 3PJ3A 5LJJA 2WMRA 5JFXA 5JRSA 4HW7A 2HENA 1XBCA 4I1ZA 2HZ4A 3ORXA 4FYNA 4EYJA 2HY81 5CU4A 3BRBA 1PW2A 3OD6X 4XCUA 2BR1A 3EZVA 4FE2A 4ZSLA 2VWXA 1U59A 4BIBA 4CQEA 2GFCA 2XNGA 5IEYA 2DENA 4NKAA 3LXNA 2WFYA 4XV9A 2LGCA 4YLKA 3WIGA 4BL1A 2R7BA 5DNRA 3CJGA 3RBWA 3K5VA 3QUPA 2C47A 3TNHA 4G9CA 1AD5A 4OUCA 3KXZA 5E7RA 5ETFA 2XNEA 3MYGA 4FZAB 3ID6C 3WF5A 2WMSA 4AA4A 2ITPA 2J0JA 2A1AB 5M51A 1HT2E 4I5CA 3ZM9A 3GXLA 3D5VA 3T3VA 3M11A 5BMMA 1OKVA 2BUJA 3ZXTA 1KE5A 2I1MA 4RWJA 3OY3A 3PE1A 2C1BA 5A4LA 2VX3A 3UMWA 4LUEA 5DWRA 4FBXA 1NXKA 3ROCA 3ZLYA 4RIYB 4YMJA 2W1EA 4YTHA 4QMOA 2YM3A 4WG5A 4GG7A 1JPAA 4BDFA 4JIAA 2Z02A 3CBLA 5EM5A 2G9XA 3FMLA 4JAIA 5JH6A 3LJ2A 2QI8A 3H9OA 5A6NA 3UIMA 3DZOA 4WRSA 4C37A 4D2VA 3BHTA 5LOHA 2ZV8A 4FICA 2FUMA 4BYJA 5E8XA 3A7GA 2FH9A 2XK9A 1JAMA 1OMWA 4M69B 4D1SA 2J9MA 3PXYA 4AG8A 3RKBA 4O0WA 5LWMA 2UW5A 4F65A 2WTIA 4PNKA 5L2QA 1MN3A 1PKDA 3TIYA 3PRIA 3RGFA 2A19B 2WEIA 3LFCA 3R8UA 4OR5A 5A4EA 2XJ2A 4P90A 3H9FA 4TN6A 5EHYA 4RRVA 3FV8A 4PMTA 1VYZA 3IGGA 5CASA 3D5UA 3FI3A 2L4EA 3MH2A 3QX4A 1GIJA 3QTIA 3Q2JA 2C5XA 4D2PA 4HVIA 4Y46A 2VWZA 1QPJA 4A07A 3R21A 4CSVA 3A99A 2JITA 2X7FA 3DK6A 1DS5A 2NO3A 3NUXA 1OIQA 4L6QA 3EQDA 4U9AA 1Q3WA 2Y4IC 3BU3A 1SZMA 1ZOEA 2BRGA 4GFGA 3D83A 1FVVA 4D5HA 4EOSA 4J95A 5KBQA 1WR1B 3O7LB 2X8DA 3PWYA 3GLGE 2ACXA 3WZEA 4GV1A 2V7OA 2JIVA 5EM7A 2UZNA 3PXFA 3R9HA 2GNGA 1P4OA 5AR2A 4DYMA 3GCVA 4UWBA 2PVHA 5AFVA 5JQ5A 1W84A 2YIRA 3AD5A 4GIHA 4R71A 1OL1A 4YO6A 4BGQA 3PA5A 4XG3A 4EK3A 1YI6A 3EQRA 3G0EA 4MTAA 3E62A 2XMYA 4WNOA 4X7QA 1ZY4A 4CZYB 2DAMA 2VNWA 1UNGA 1XH9A 4IDTA 4RIXA 4S31A 5AMNA 4BCMA 3RMFA 2UW8A 4YSMA 4F64A 3WE8A 4RPVA 4TYIA 5EDRA 4F70A 2NRUA 3ACJA 5L2IA 3S3IA 2YAAA 2XIZA 3BLRA 4I94A 1IG1A 3TI1A 1V1KA 4BTMA 2WOUA 3VS6A 4E5AX 4XUFA 2W4JA 4GJ2A 2IVSA 2R64A 3GB2A 5AV1A 5J9ZA 3RHXA 2XYNA 4APCA 4ZAUA 2YCFA 4TWNA 4EH5A 2OFUA 2XK6A 5HNGA 4DEIA 2W05A 5ANKA 1XWSA 1B6CB 3POOA 4CNHA 3K9PA 3FC2A 4LV8A 3ZDIA 2YJSA 5E8ZA 2GS2A 2BZKB 3LFNA 5EOLA 4PMSA 4IAAA 3BE2A 5DLSA 2BHHA 1UU3A 3DZQA 3NCZA 3MVJA 3P4KA 3R1SA 3VRZA 4QMSA 3OMVA 3UJGA 3F7ZA 5JZJA 2XRWA 2ZMCA 3NUSA 5AP2A 3Q04A 3MJ1A 5E92A 5IMEA 4U0IA 5D12A 4ERKA 2C3JA 5AAFA 4IMYA 4OGRA 2G2FA 2XK7A 4X2KA 5ANOA 4BKYA 3QYZA 1ZMWA 3VIDA 3F92A 2GHGA 1Q8UA 5C9CA 2XZSA 5JSMA 1W0XC 5IA4A 5JQ8A 4GSBA 1AGWA 2FO0A 3L9NA 3Q6UA 4FK6A 5CI6A 5DG5A 4TW9A 1YQJA 5AEPA 3K3JA 2CCIA 1BL6A 4FT5A 2A0CX 3OROA 4KBCA 4XG2A 4E7WA 4EOOA 4TXCA 4F7JA 4QTEA 5M07A 3A4PA 3NW5A 2J0MB 4QQCA 4DTAA 2OIDA 4D55A 5JFSA 3EQFA 3UE4A 5HVJA 4CKJA 5JT2A 3R73A 5M4CA 4PL5A 2C6OA 1VEKA 3HUBA 5BVKA 4FODA 4WNMA 3UC3A 4XG4A 3KRLA 5LVLA 5AUVA 5IQCA 4NL0A 2R3NA 2KNZA 3SV0A 5HO8A 4FVPA 5DH3A 2WTWA 4LFIA 1I44A 1OL7A 3G9NA 2YABA 4HGEA 2X7OA 3OCSA 3I81A 4RQKA 5CANA 1SM2A 4K11A 3FHIA 5HLNA 4R7IA 4FUXA 2RF9A 5CXHA 4AOIA 4YZMA 2QHMA 3DS6A 2IZSA 4GFMA 4IAIA 4U5JA 4U81A 2KHHA 4EOMA 1Q8WA 2PE2A 1UU7A 1YWRA 3EJ1A 1RQQA 4IAYA 3GU6A 4OTQA 3VBYA 4KS7A 3TDWA 2O25A 5HE1A 3JYAA 3QQJA 3GLHE 4TKSA 4NFMA 3EB0A 4R3PA 5K3YA 4C62A 1YRPA 4KIKB 1BKXA 3U9CA 3ZCLA 3OTUA 5FTOA 4BVUA 3KK8A 3QQFA 2BFYA 4ENYA 3QRKA 4GYIA 1PXPA 3ZO1A 4O7RA 5L8LA 3P7AA 5AM7A 3I5ZA 4L68A 4RA4A 5LVNA 3QCSA 1Y57A 2DAIA 2VO3A 2CP8A 2DUVA 5CYIA 5AIRA 4RJ7A 3NRMA 3MPAA 4KD1A 4M66A 2W9ZB 2PZPA 3MGYA 4XG6A 3W1FA 5GIPE 4FZ7A 4DGNA 5DI1A 4DH7A 5AV0A 3QTUA 2VWWA 4QYEA 1G3NA 4PTEA 3ZEWA 4L00A 1OAIA 3QTRA 4BY9E 2BRMA 4C0TA 4IQ6A 4MF1A 4X6RA 3B2TA 4ZJIA 3E8EA 3WF7A 4TYHA 2R3JA 3F3WA 4QNAA 3LFDA 4DH5A 4NFNA 5FEQA 4KKEA 3AMBA 4QT1A 5T68A 1OKYA 1OITA 4ZSEA 3TCPA 3VJNA 2VX0A 1WZYA 5GHVA 4XP2A 3IDCA 2JEDA 3ANQA 4N6YA 4RIWA 4J97A 5DBXA 5AX9A 1FGIA 3CR0A 5BMSA 5FLFA 4G3GA 4FT0A 2IPXA 1R39A 3R30A 1URWA 5CQUA 2UZDA 2YIWA 5KKRB 1YHVA 3KMWA 4IB3A 4QMXA 4RZWA 1CSNA 1SMHA 3I7BA 3IW4A 5HIDA 4DHFA 2R3QA 2PZRA 5CEQA 4PP7A 4Z16A 2Q83A 3SG9A 2O64A 3G9LX 2EXEA 4XX9A 1R4GA 3HV6A 1XKKA 3F6XA 3MH3A 5AJQA 5F4NA 3BX5A 2KNAA 2QODA 4FSUA 3CD3A 2JNHA 3COKA 5LVOA 5EH0A 3VS4A 3GCUA 4BCJA 3HLLA 3BBZA 2G2IA 3KRJA 2OIQA 4AP7A 4BCOA 3UPZA 4AW0A 3PSDA 3TJCA 3OF0A 3KRRA 2XIKA 4F9BA 3DV3A 4FV5A 4MXAA 1WVYA 4DCEA 4M8TA 2C3LA 4NSTA 4CT1A 1J7LA 3QRIA 1OUKA 4BGGA 5IQAA 2BDFA 1WMKA 4NTTA 3NMUF 3QALE 3VS3A 2OBJA 4AZVA 4B7TA 5T3QA 4BCPA 2PU8A 3F2NA 2UW7A 2XBAA 1E94E 1UNHA 3P7BA 4YBKA 3R00A 3KFAA 1KOBA 4MXZA 3GC8A 4F9WA 3PIZA 3V5QA 4N57A 5CZHA 4ITJA 3UO5A 5JI2E 1OL6A 3CXWA 4PWNA 2F49A 3KXNA 4U7ZA 3EH9A 3MV5A 3P86A 2XJ1A 4CTBA 4CQGA 3CCNA 4R3RA 5IA5A 4CLJA 3A8WA 3HEGA 4H3QA 5AP7A 5AX3A 3TL8A 5HTIA 2R3LA 4PQNA 3IW8A 3NYNA 3D2IA 4UYAA 1BI7A 1U5RA 3HV5A 5CEMA 1M7NA 4IDVA 4RVMA 4XHKB 5DPVA 3UO4A 4UWCA 2WHBA 3PIXA 2OG8A 4BDCA 4FL3A 2JDVA 2ZDTA 4KIQA 1XR1A 2YIQA 1J3HA 1DAYA 4BDJA 3DLSA 1Q41A 5KCVA 3H10A 3CIKA 2BRBA 3NR9A 1JWHA 3C4ZA 2NPQA 2ZTCA 3C5UA 4HZSA 4XG9A 1WGLA 4J52A 4FMQA 4NIFB 4D2WA 2ITWA 5IH5A 2O2UA 3H3CA 4WT6A 3FEGA 3Q52A 4JBVA 2JKMA 5GZ9A 3JVRA 3V3VA 4AZFA 5HEZA 5FD2A 5FWKK 3UIBA 4FT9A 4O86A 5B7VA 4MXCA 1Q8ZA 3VS7A 4W4VA 3LMGA 4DFNA 4H1MA 4FIHA 2DAKA 3U9NA 3IG7A 4M12A 4FTJA 3DAKA 4XS2A 4C2WA 4QP6A 1WBPA 4FKPA 5CX9A 3R9NA 3SX9A 4EH7A 1OECA 2WU6A 2OICA 4EUUA 5J5SA 3JR1A 4I5HA 4PDPA 3TT0A 3V5LA 3HP2A 4O7TA 3UVQA 2OJGA 4YZ9A 4QPSA 3POZA 5AR7A 1WFCA 2WQBA 3R1NA 2VTRA 5D11A 3TXOA 3ZYAA 5F9EA 2YFXA 4ZEGA 1PXMA 3MBLA 1YWVA 1V0BA 4ITIA 3LCUA 4JR3A 4KBAA 4ZSGA 2GCDA 5CI7A 2QU6A 1P3QQ 3PG3A 4FTKA 5FEEA 4TZRA 4Q5HA 4IJ9A 2HWOA 4TYEA 2VWYA 3VUHA 4C3PA 3HGKA 4QTBA 3U87A 4L01A 5A4QA 3IOKA 4M84A 4O1OA 5A46A 3W8LA 3ELJA 2YDJA 3RINA 1TQMA 2YM6A 1LP4A 4GU9A 2BTRA 4A9RA 3GC7A 4WD5A 3Q3BA 1PXJA 3ZFYA 4XYFA 3WF9A 3FL4A 5CF6A 3FI2A 2GS6A 4JDIA 3DXPA 2PPQA 2BMCA 5L8KA 1ND4A 4QPAA 4EORA 4BDKA 3DA6A 5IUIA 3KCFA 3NW7A 5ANGA 4WKQA 3ROYA 2ZM4A 3O2MA 4AZSA 5CAPA 3FPMA 2I0EA 4M15A 4CFVA 4U45A 4CG8A 3R8VA 2CKPA 4IWDA 4MWIA 5M44A 1SVEA 4O0YA 1OPKA 2YM4A 4KBKA 2Y4IB 4X6QC 1R1WA 1H00A 5EYDA 2JDSA 1KV1A 3FSKA 2HELA 4IVDA 3LHJA 2RSVA 3T8OA 3S1HA 4V0GA 2ZDUA 4H58A 3L8PA 1UWJA 4WUAA 5HCZA 2QOHA 2XUUA 4ASZA 4C35A 4EONA 5H3QA 4ACHA 3LQ3A 4ZTMA 4RIYA 2JD5A 3HAMA 1JSUA 3QWJA 2QOQA 4TYGA 5I9XA 1P4FA 4CCBA 2JAVA 3C4EA 5JZNA 3V6RA 4D0XA 5CU0A 2YN8A 3A7HA 5EM8A 4QQTA 1CKJA 4IC8A 4JAJA 2GDOA 4XNEA 4NJDA 3NW6A 3F82A 2VGPA 2PMOX 1W82A 4GH2A 3QQKA 1OL2A 4MYGA 3ET7A 5AR8A 3QU0A 2X6DA 3F3TA 4CYJA 4DEAA 3HVCA 3KULB 4L44A 2IVTA 5D7AA 3TM0A 2WIPA 4RLLA 2C1AA 3BEGA 5HG9A 4GT3A 2CGWA 3QRUA 4RMZA 3ZONA 3FMHA 3BQCA 1JVPP 1Z5MA 2WAJA 1G3IA 2IN6A 2XM9A 3H0ZA 3LE6A 4TY1A 4WRGA 3EN4A 5DOSA 2MJ5B 3GNIB 2CLQA 3RVGA 1FBNA 4WO5A 2QSFX 2BRNA 2WMVA 2VTOA 3BQRA 4MCVA 4JG6A 3DY7A 3SRVA 5L2SA 4FSNA 2EUFB 2JY6B 4X2GA 5D9HA 1JSVA 2UW0A 4F0FA 3T6PA 1VQ1A 4JQ7A 3WARA 2VUWA 2RFEA 3K9OA 1GY3A 4PF4A 5EYKA 3SW7A 5FXRA 1A48A 5C27A 3F5XA 5CSVA 2R4BA 3MIAA 4OTHA 3WZDA 3A62A 3JS2A 4GYGA 3PXZA 4AW1A 4ZSAA 3D7ZA 3DKCA 4HYHA 4FKLA 5M57A 1O9UA 5C8NA 4A4XA 3V8WA 4AT5A 1GNGA 3LKMA 2HZNA 4UXQA 1FQ1B 5KMKA 3CPBA 4C4HA 4IB5A 4MH7A 3HRCA 4G3CA 3UQGA 2WQNA 4C7TA 2R3PA 4BYIA 4C3RA 5HG5A 2W0JA 4GIIA 4RG0A 3DXQA 4A4OA 1BLXA 3NSZA 2BILB 3TZMA 2CWBA 5JGAA 2OK1A 4TYHB 2VWIA 5EI8A 3VS2A 2C0IA 3Q96A 3ORZA 4QMVA 3CLYA 2O3PA 3C13A 3ZM4A 1XO2B 2IVUA 2OJ9A 3FYJX 3H0YA 4UB7A 1QPCA 1UV5A 2CDZA 5J95A 3GFWA 5CZIA 1AIPC 3V5PA 3CTQA 2VX1A 1IEPA 5CAUA 1XH5A 4PX6A 2MGWA 3D94A 3MESA 2XNMA 4LRKA 3SHEA 4BIEA 2C6DA 3LCKA 5M06A 5K5XA 1Q8TA 2OKRA 2X0GA 3NGAA 4H1JA 4ACGA 2OFVA 5H8EA 5A3XA 4DE4A 3KXMA 3LFEA 3R6XA 2FGIA 4FKGA 2PMNX 3A7IA 4LGHA 3BWFA 4GVJA 5EW3A 3VVHA 3ZRMA 3VUKA 2FYSA 3EL8A 4WSYA 5BVOA 2KNVA 3GU4A 1UNLA 3BZ3A 4CG9A 3KA0A 3DKGA 5TOZA 4IANA 3EZRA 4NKSA 4TPTA 2EXCX 4C3FA 3MVHA 4GUBA 1K9AA 3P0MA 4I6FA 1OI9A 3NCGA 3VW6A 2LVOC 2GNHA 2RFDA 3FLQA 4HGLA 3GEQA 4QQ5A 2AC5A 2CN8A 2Y8OA 4Y5QA 4F99A 4YHJA 4JT3A 3MFUA 2WTKB 4OTGA 4LV5A 3FPQA 3FSFA 3QAME 3QZIA 4RJ8A 5CEOA 2XCHA 2O65A 4DG2E 3GC9A 1REKA 3L8SA 4MEDA 3QWKA 4OTWA 2EKFA 3O8PA 5LMKC 2DKLA 2OI4X 3CTJA 2OF2A 1G41A 4IX5A 5DGZA 5J7BA 5IUGA 2WZJA 2WQOA 2J5EA 3R1QA 4J7BA 4PL3A 1YLAA 4BDDA 4DGLC 4FKQA 1T46A 2OGVA 4IACA 4MK0A 1TQIA 4EJ7A 3BU5A 1B39A 3AXWA 2AC3A 3PLAE 3S2PA 4K9YA 4B4LA 2X1NA 1J1BA 4EHGA 4I5PA 1JBPE 3PWDA 3GP0A 5IU2A 1OGUA 2P33A 3C0GA 2VTTA 3OTVA 5HGIA 2FSMX 5EYCA 4ZTRA 3T9IA 1SVGA 2VZ6A 5CQWA 2OJJA 4O0RA 1VG5A 4D0WA 5EG3A 4R5YA 4I6HA 2BTSA 4RWIA 1V0PA 5CTPA 3LFQA 2FB8A 3GQLA 3LFFA 3MFSA 4E26A 5CF5A 1W83A 2PE0A 1VR2A 5AP6A 1BX6A 3BLHA 2QQ7A 3IK3A 4GUEA 4KIKA 4FTRA 2PE1A 3FWQA 4O7ZA 4DG3E 3HDMA 2BZJA 4G2FA 5ACBC 4AOTA 2OIBA 2BVAA 4PDOA 3LJ1A 2WIHA 4II5A 4A9TA 5FQDC 1K3AA 5HO7A 3NX8A 2PUIA 4E6QA 1SNXA 2A27A 2WMWA 4CT2A 1Q4LA 3QZFA 4AW5A 3PJ8A 2UUEA 2VTSA 3FMEA 1MQBA 1FINA 5BYYA 4AN2A 4O7WA 3FMMA 5DYJA 4FG8A 4YZCA 1WCCA 1KOAA 2C0OA 4LL0A 4FL1A 1BUHA 3BKBA 3SG8A 4FUYA 3MFRA 4IWOA 3PSBA 4AFEA 1IA9A 1JKLA 4IVBA 2DZLA 5AP3A 3GLFE 4RJ3A 3PY0A 1U4DA 4GCJA 4TYJA 4EBVA 2QKRA 4ZOGA 3RPOA 3VULA 4QO9A 3F5UA 2ZB1A 3W8QA 3MI9A 3R7UA 4EK5A 4IX6A 2BDWA 2B9JA 4K6ZA 5HHWA 4MD8E 3PJCA 3CQEA 4RC2A 4QMWA 4XJ0A 1UWHA 2WMAA 1PMEA 1QPEA 3QX2A 4M0ZA 1ZLTA 5CNOA 1PMVA 3TV6A 4ZZNA 1M2QA 3MA6A 4LMUA 1SYKA 3DDPA 2ETMA 5L3AA 4YJTA 2XKFA 1PXOA 3M2WA 1NVQA 4W4XA 4EOLA 3LCDA 5JMSA 4J99A 3QTSA 4H3BA 4NCTC 1QMZA 2DNAA 3VUTA 4RIOA 2F9GA 3FQHA 4YC3A 4DFZE 4MWHA 4NU1A 4FV7A 3LLTA 4QP3A 3PJ1A 1VEBA 3HA6A 4RFMA 3BYMA 4YTFA 2C6EA 2YAKA 1IR3A 3FMJA 1S9JA 3R22A 3UG2A 3ZXZA 3B8QA 4BN1A 2Z7SA 2XNNA 1L3RE 5I9ZA 1APME 4EH3A 2B53A 3VC4A 4QQJA 3O71A 1XH6A 4W8DA 1GO5A 1ERKA 5AP4A 3GI3A 3UVRA 4AF3A 4CEGA 2XB7A 3G6HA 4JDHA 2LVQD 3GOKA 1BI8A 3I79A 4GT4A 4P7EA 3VWAA 4HVGA 1NVRA 1PXIA 4FV3A 3V51A 3VF9A 3L9LA 3VHEA 4V0GB 1F4IA 3OC1A 5HESA 4BFMA 1Y6BA 3MTLA 4ANSA 5J87A 4OTPA 4CGAA 3QTXA 2BWEA 4BZOA 1JSTA 3LCSA 5HU9A 2JZ0A 3E64A 3HECA 4R3CA 4F0GA 2QOBA 4IEBA 4CFNA 3PXRA 2PY3A 3NUYA 2OJFE 4YHFA 4KSPA 3C1XA 4FTOA 4P5QA 2J0IA 2WOTA 5CU2A 3WYYA 3W33A 2Z2WA 4CMOA 2UW4A 2XK4A 2ZAZA 4I6BA 2ZYBA 3AC4A 5AUUA 4A4LA 2GNFA 1KYIA 4ZP5A 3FLZA 3IW7A 4D2RA 3N4TA 2UZTA 4G3FA 5FBNC 5HIEA 4YJVA 4AN9A 1ZRZA 4EOJA 5AP5A 4PUZA 4B9DA 3NPCA 5HU3A 4NIFA 5FG8A 4ZJVA 4AGUA 1O6KA 3D5WA 3PP0A 3KB7A 4KINA 4JBQA 3SRVB 3LXPA 2WTDA 2ONLC 4E6AA 3EYHA 3FKOA 2DWBA 3D7TB 3MH0A 2X9FA 4G3OA 4BWKA 4IAKA 5DN3A 3TNIA 2XP2A 3W2RA 2JIIA 3ZBFA 5M4IA 5IQHA 4BDEA 4D1ZA 3C4FA 4JS8A 4ZTLA 5EK7A 4F1MA 1GOLA 2Z8CA 4EQUA 4ZJJA 3TZ7A 4DINA 1Q62A 2JY7A 4FKUA 4NWMA 3EHAA 3LZBA 4E5BA 4E6CA 3O7LD 3CC6A 2B9FA 3RP9A 4ZZMA 3TN8A 5KHWA 2L2DA 1XH7A 4QTAA 3DNEA 5FP5A 3U55A 3KL8A 2YEXA 3QXOA 4CFFA 3ORMA 2X7GA 1OB3A 4EQMA 3TUBA 5HOAA 3FDNA 2E9PA 2HAKA 2IW8A 1BMKA 5FBOA 2IZTA 4YP8A 2CLXA 5FUTA 3IKAA 4A9YA 4QP7A 4BC6A 4AGDA 4IHPA 3UVPA 3WOWA 2XBJA 4CMUA 5AR4A 3FXXA 3NUPA 3VQUA 5C4KA 2DYLA 2W1FA 3RAKA 4ANQA 5FXSA 3ZTXA 1PY5A 3JPVA 1DV0A 4M67A 4RGJA 3W55A 1H1SA 3OFMA 3G15A 3ORNA 1STCE 2CCHA 2R7IA 3EQBA 3BHUA 4G6OA 3QD4A 5E8YA 4YTCA 3G2FA 1KE8A 4QMYA 3FLSA 5ITAA 2J7TA 2PK9A 2BAQA 4I41A 1A06A 1KE7A 1YOJA 3MIYA 3PY3A 2X4FA 3OP5A 4JI9A 2GS7A 4XLVA 2ITUA 2QC6A 2V5QA 3COIA 4XV1A 4FKOA 1PKGA 4LRJA 4RX7A 4XMOA 4X3JA 5J9YA 2I6LA 3FI8A 3DBQA 1Q61A 4RWKA 5HLPA 2O5KA 3O0GA 3OS3A 3HAVA 5DFLA 3UC4A 2H8HA 1O6LA 4GG5A 2CMWA 2UW9A 4AZWA 4O2ZA 4HYSA 2HXLA 3A7JA 1AQ1A 1CMKE 3MA3A 4K33A 3KVWA 4MF0A 2EVAA 2F57A 2WU7A 3KF4A 4NM0A 1G5SA 3NEWA 4F7NA 5TO8A 2XS0A 4K1BA 3E63A 1PYEA 3LCVB 2JKKA 3GU7A 3R7IA 4CFXA 4B99A 3RWQA 3ODYX 3U51A 3AQVA 3PUPA 3TACA 4IC7A 4U43A 5FGKA 3RJCA 1WBVA 1YOMA 3VF8A 2B4SB 2ZB0A 4JOAA 3KGAA 2JBOA 2J51A 2OO9A 3TV4A 4IAFA 4I92A 5T6KA 3OXIA 1UKHA 4AZTA 2XIYA 4LRMA 3W2PA 3ZUVA 1ZYCA 4I21A 3FE3A 5E9EA 4C34A 2R3HA 3H30A 1LPUA 2UZWE 3IOPA 3QZGA 4GJ3A 3PLSA 5E1EA 5FDXA 4ACDA 3VBVA 2WMUA 4JG8A 3RI1A 4BI2A 1S9IA 4E73A 4OAVB 5LMBA 3I0OA 5E90A 4QMNA 3TNWA 1PXKA 4I0TA 4S2ZA 1U54B 4U40A 3KULA 4OT6A 2P2IA 4LMNA 4MHAA 4UZHA 4YJRA 3R7EA 4AUAA 3P23A 5ACKA 4CKIA 2VTHA 3FZPA 4AE9A 4YJOA 4ZY5A 4IH8A 4ID7A 4O27B 5EYMA 3VS5A 3UG1A 3E5AA 3DDQA 3AT2A 2KTYA 4GKHA 4O84A 3T9TA 5EKOA 4CV8A 1IM2A 2OWBA 2PZ5A 3GBZA 2C6IA 4PDSA 3PZHA 4X21A 3CKWA 3VUGA 3QLFA 5HTCA 5IA1A 5K5NA 4UZDA 3FQEA 4NH1A 2H96A 4JX3A 1LR4A 4L7SA 5HNBA 3Q9XA 3A4OX 4S32A 4FG9A 5D41A 3KK9A 4AOJA 2CGVA 2GQRA 4QMTA 4X3FB 3V5JA 4FTLA 3REPA 3UODA 4L52A 1GZ8A 5AUYA 1FPUA 3PVBA 3ZZWA 3HUCA 5IQGA 3CY3A 4DGMA 1KE6A 4CVAA 5K9IA 1R78A 4I0SA 3IW6A 2JIUA 4EI4A 1OPJA 1J7UA 2Q0BA 3BGPA 3BBWA 2VO7A 3BGQA 3LXKA 4XV2A 3SAYA 3R2BA 2FSLX 3NUNA 2GNIA 3IHPA 2J90A 3UP7A 4USFA 2EXMA 4JX7A 3ZLWA 4AS0A 4DTKA 3LFAA 5I9UA 4BWXA 4W8EA 2EU9A 5EQYA 4WIHA 1H1WA 2PMLX 4I3ZA 3R01A 5C03A 1WHCA 1GJOA 2UVYA 1SNUA 3GENA 3B8RA 4FKWA 2GNJA 5BVWA 3D14A 2BRHA 5C4LA 1G4AE 4FTNA 2QONA 2XM8A 1JKTA 3QKMA 4XRLA 2V62A 4MAOA 3RM7A 3W2SA 3DKFA 2KULA 3SOCA 3ZFXA 4AU8A 2HW7A 3KMUA 3NNXA 2G01A 3Q60A 5AA8A 4DG0E 3EWHA 2XIRA 1W8CA 4CFWA 3ETAA 3ULZA 4M3QA 4K0YA 3UO6A 4EC8A 5F1ZA 4FSTA 3PSCA 2XNOA 4GS6A 3THBA 1OZ1A 4BZNA 3IDPA 3OWPA 1MRUA 2R5TA 4YJPA 4TRLA 3MJ2A 1V0OA 4BWPA 4YR8A 4BICA 3SDJA 4ACCA 5J79A 3C7QA 3GU5A 2R0UA 4CFUA 5BNJA 2QO7A 2UVZA 3PA4A 4O0UA 3ERKA 3OXZA 3FLWA 4O7VA 2ITOA 3H9RA 1O6YA 4FSZA 1CM8A 2WTCA 2A2AA 3R63A 4UALA 5AR3A 4FNYA 3RK9A 4CD0A 4Z55A 4DF3A 3PPZA 4RLKA 4O0TA 3A2CA 4YGAA 3R7YA 2CNVA 3N4UA 4Q9SA 2R3GA 2DI0A 3AGLA 2HK5A 2JUJA 3E7VA 4Y72A 2UZBA 3RTPA 3DGKA 4AQCA 1KUTA 5CALA 4IAZA 2UZOA 4LG4A 4EH2A 4QNYA 4KAOA 3NUAA 1Y8GA 1TVOA 2ETRA 4G6LA 2CNQA 4ANOA 1M52A 4ASDA 2ITXA 4IM2A 2IZRA 4IW0A 3PPJA 3ORLA 3Q9YA 3BLQA 2ZM1A 4CRLA 3AT4A 4IZAA 2ITZA 4UYNA 4NT4A 2GTNA 3IO7A 3MY1A 2R3IA 3FJQE 4FV6A 4J71A 3TTJA 2PVRA 4N6ZA 3EN6A 4FKRA 1IRKA 5TR6A 2PTKA 4FZDB 4Q2AA 3SA0A 4FSYA 1I09A 4RVLA 3W2OA 4BKJA 5CSPA 2FSOX 4JNWA 4BGHA 4A9UA 3OG7A 4PP9A 3TKHA 2QHOB 2WXVA 4YTIA 4F9YA 4RC3A 5L8JA 3AD6A 4IX3A 3UOKA 2XA4A 1FMOE 3KN6A 4IXPA 3QTZA 4G9RA 5DR2A 2F7EE 2HIWA 2HXQA 2HY0A 4Y8DA 2JY5A 1ZYSA 3V01A 3OCTA 4W4YA 3AMAA 4MX9A 5M4UA 3EOCA 4X2NA 5HLWA 3B2WA 5BX0A 2VTPA 3BU6A 3F7WA 4XP3A 4R7BA 3F66A 2VV9A 3EL7A 5F95A 3W18A 4AE6A 1NV9A 1XH4A 2YDIA 5I9YA 4L3PA 4YC8A 4CXAA 5BYZA 4DGOA 3PDTA 3VNTA 2BFXA 2VAGA 3MVLA 3ZUUA 3TG1A 3RALA 5EW8A 2BCJA 4C61A 4L45A 4IVCA 4F4PA 3D2KA 4IM3A 3TUDA 4JRVA 4ANNA 1ZZLA 3C0HA 2PVLA 4ACMA 3I5NA 5GJDA 5IA2A 3VUMA 4LI5A 3ANRA 3F5PA 4ZS4A 2YCQA 4EJNA 1ATPE 5CF8A 3U4UA 3ORTA 3UIXA 4FEQA 1XBBA 1YI4A 5BVEA 2B55A 2JBPA 1VJYA 3DLZA 3F3UA 2L4FA 3CSVA 4BHZA 3WE4A 4F6UA 3HMOA 3I60A 5I3OA 3ACKA 3QTWA 5HORA 3BV3A 4L8MA 4GT5A 4NTSA 4AACA 1NW1A 1K2PA 4MVFA 5B2MA 2JAMA 4UN2B 4AA5A 4YHTA 1Q3DA 2QG7A 4H05A 1CTPE 2QR7A 1E1VA 3PVWA 4FV9A 2EKKA 2ZV7A 4YNEA 4ZMEA 3DTCA 4D4SA 3KEXA 3KXXA 2G1TA 4WUNA 2YACA 3RPYA 4D4YA 4FT7A 2Q0NA 5ANIA 2CSNA 4TWCA 4L9IA 5CEKA 2CNUA 3NYVA 3COHA 2CPKE 2WQMA 5E8WA 2NRYA 3FL5A 4F7LA 4PPBA 4E20A 3C4CA 1PRYA 4RT7A 1OKSA 4Y83A 4HNFA 4W4WA 5CAQA 4EK8A 2HZIA 3FAAA 4HGSA 4I4EA 4KS8A 5E8UA 1EH4A 3SXFA 5DRDA 1PYXA 4EBWA 2VD5A 3UMXA 4FGRA 4Z9LA 1H08A 3P78A 4NUSA 1RE8A 3TKUA 4EOIA 4JRNA 4QMPA 4X2JA 1TR8A 1HOWA 2J50A 3CQUA 3FMKA 4FEUA 3OWKA 3U8WA 4Y95A 3VUDA 4D1XA 4IZ7A 1JQHA 5DHJA 5LQFA 3LIJA 3DBFA 4HYIA 4O22A 3U6JA 1NVSA 1OIUA 1GAGA 4FIEA 5DEYA 4LQMA 4E4NA 5AAGA 3AGMA 1R0EA 4RA5A 3QXPA 4LUDA 5TKDA 5HBEA 4U3ZA 5AIKA 3QYWA 5DRBA 5DR9A 2YWVA 5I3RA 3QQLA 2PUUA 2JZ1A 4N4SA 4NYEA 3EQHA 2W4OA 5FRIA 5G1XA 3N4VA 4DT9A 4P2KA 2BDJA 2YZLA 3ZC5A 3ALOA 4EH4A 1ZYJA 1NY3A 4NW5A 5KZIA 4AW2A 3O96A 5L6PA 4K8AA 2JLDA 4QYHA 2Y9QA 4ITHA 5GJFA 5TT7A 4HVDA 2XNPA 3PIYA 4DH8A 3HMMA 2WB8A 5JFVA 2H5XA 4ENXA 4QYFA 4USEA 5KMIA 3RZFA 4YURA 3SLSA 3QLGA 3NZ0A 4I5MA 5BYLA 1W98A 3E8NA 3QRTA 3UGCA 4APPA 2X4ZA 5EHLA 4F0IA 3DOGA 4JLCA 3VO3A 3CPCA 4QMLA 3C4XA 3DAEA 2WEVA 4YBJA 5E8VA 2Z7RA 1C7YA 1Q02A 3DBCA 3GLIE 2JDRA 3FZOA 4KA3A 4MXYA 1JKSA 4R1YA 2JDTA 5HO6A 3S95A 2F7ZE 4FTTA 3IGOA 5I9VA 3D7TA 2C6KA 3S00A 2VGOA 1CKIA 5JN2A 2HWJA 2J6MA 2WNTA 4LGDA 5IQEA 1OKZA 3G33A 5ANJA 3AC2A 2W5BA 1XXHE 3HMPA 3FYKX 3FRHA 4AGCA 5E4HA 1BYGA 3MY5A 5F20A 3FXZA 4KNBA 4U97A 3BWJA 4RX8A 4DLIA 2WQEA 5KNJA 3QQGA 3HNGA 1OM1A 4BTJA 2VTLA 4S30A 5FM2A 5EI2A 2IO6A 1ZZ2A 3OUNB 5M4FA 1ZOGA 3Q9ZA 4FNXA 3ALNA 3RPRA 4F6SA 5CAVA 3ZUTA 1JLUE 4QMQA 3G0FA 2ZMDA 3OOMA 4IBMA 4BDHA 5FTQA 3U4WA 2FA2A 2C0TA 3K2LA 3R04A 4KIPA 4L3JA 4AWIA 2ITNA 3EFJA 2LVPC 5IH4A 1G8AA 1H27A 3IS5A 2B52A 5C26A 3R7GA 4MXXA 3BCEA 3MPMA 4F1OA 4O7YA 3OT8A 3I6WA 3WZKA 2B7AA 5KBRA 4XP0A 3VBWA 4DT8A 1IAJA 2WTVA 1WBWA 3CP9A 4J53A 3EMGA 2GU8A 3MY0A 4W9WA 4CYIA 2R3MA 3L1SA 4EOKA 5LXMA 3D9VA 3OXTA 4YLJA 1M2PA 4KABA 3FZ1A 3VQHA 5DT4A 4NEUA 2ZV2A 5H9BA 4DAWA 1ZV1A 4BZDA 4PV0A 2QNJA 5AM6A 4BR3A 1H0WA 4OLIA 2LVNC 4YJSA 1Q8YA 1ZMUA 2YM8A 3TEIA 3SVVA 2QKWB 1SVHA 3DU8A 2H6DA 4DH1A 4FV8A 4MBIA 1DM2A 1P14A 2VWBA 5FTGA 3KY2A 2OOAA 1T45A 4JDJA 2CN5A 2X6EA 2C5YA 4MXOA 2XF0A 2GHLA 1TTEA 3TKIA 2WMQA 3PA3A 1QL6A 1JOWB 3Q32A 4OW8A 4QTDA 2OZAA 4FKVA 4L7FA 5E8TA 5EW9A 2DAEA 4TNDA 1KE9A 1GZOA 4L53A 5TE0A 5JKGA 2GHMA 2PHKA 3LVPA 3UP2A 2IWIA 3OW4A 3UQFA 5C8MA 3UQCA 4YZNA 5KMLA 5JEBA 2UZEA 2PUPA 5L6WL 3BGZA 1FOTA 5EM6A 4F08A 5AA9A 5CS6A 2C5NA 2X81A 2OSCA 4G34A 4ANBA 1R3CA 3MPTA 4FIGA 2XK8A 3DK7A 5CT7A 1HCLA 4MKCA 5A6OA 2HYYA 3QKLA 3Q2MA 1WBTA 5CLPA 1ZYDA 4BKZA 2Y4PA 4FKJA 2WGJA 2IZUA 3R7VA 1U54A 4PPAA 3P08A 4D4RA 3BYUA 3MTFA 4HZRA 5HE2A 3QGYA 3I0QA 3P7CA 1U5QA 3R0TA 4E4XA 4GMYA 3GCSA 4RC4A 1WBOA 4EUTA 2Y7JA 4HGTA 5AWMA 3UOJA 1GZKA 3LXLA 3PXKA 4O7LA 2GMXA 4ZLOA 5D1JA 4FIFA 3LM5A 3Q5ZA 3ZMMA 1L8TA 4FKSA 3FMNA 3QKKA 1UU8A 5LMAA 3VBTA 3BHYA 4WBBB 5AV4A 3BE9A 3QFVA 5K0XA 3BEAA 4C8BA 5CY3A 3QTQA 2Y0AA 4K18A 3ZO3A 4A7CA 3P79A 5BUEA 4I24A 4WHZA 4YU2A 4X3FA 4I4FA 3BBTB 4RWLA 5AR5A 4WA9A 4G17A 5IDPA 3FBVA 1ZAOA 2XKCA 4O1PA 4ZTNA 5KKRC 4EOPA 3R9RA 5J7HA 1YVJA 2OF4A 4QTCA 4BBMA 3WZJA 3PXQA 2VTNA 3VW8A 3PFQA 3RAWA 4ZZOA 3NVKI 1XQZA 4IB0A 4O96A 3VS1A 4F1TA 5HBHA 5JFWA 5HG7A 1P2AA 4IZYA 4S34A 2WMXA 4XOYA 4QOXA 4D9TA 3MN3A 3TTIA 4QMMA 4EWQA 3ULIA 2C4GA 1QCFA 3ZSGA 3F3VA 4QRCA 2BPMA 3E92A 3K5UA 5D7VA 4FTMA 1HT1E 4AT4A 4QYYA 3RK5A 2YISA 3LLAA 1NT2A 2BALA 4O0VA 3RCJA 5LMKA 4KIOA 5B0XA 3WYXA 1H0VA 3SQQA 4QMUA 4IADA 2Y6MA 3UYSA 4G16A 3NWWA 1XJDA 4EH9A 5A14A 3OEFX 3N51A 4IX4A 1XB2B 4BCQA 2XVDA 5HE3A 3EQIA 3ZRLA 4O2PA 3LMHA 2H34A 4C4IA 5CSHA 2J5FA 3IDBA 2B54A 2PVFA 3MB7A 5J5TA 5GIOE 1FVRA 3E8DA 4IJPA 4U3YA 2V22A 4FL2A 3UDBA 5KX8A 1G8SA 4J98A 2BIYA 1OIYA 3GC0A 3OVVA 2C5VA 4YPSA 1CUKA 3M1SA 4A9SA 3TDVA 3TNQB 4G31A 4IFCA 2EB3A 3KXHA 3WF8A 5A4CA 1IAHA 3EYGA 3QC9A 2HOGA 3RK7A 4YJUA 4AGWA 4CFMA 4A06A 4ALWA 3BYSA 4K2RA 4ZSJA 4B8MA 1WGNA 3PTGA 1LUFA 2BAJA 2C3IB 1JKKA 2YIYA 2YDKA 4I0RA 4ZTHA 4M7IA 4DN5A 3DNDA 3QZHA 3NDMA 2I0HA 5DE2A 2X2KA 5I4NA 4CMTA 3C0IA 4EZ7A 3V6SA 1YXUA 3K54A 4YSJA 3O8TA 1H25A 1QPDA 1J91A 4BCHA 5HCYA 4DBXA 4M97A 4B6LA 3EIDA 3OCGA 5CENA 2XEZA 4C38A 5LCJA 4XEYA 5CEIA 3UYTA 1YOLA 3ZSIA 4FTIA 2MR9A 1XH8A 2PVYA 3PE2A 3NYOA 4DFUA 4BDGA 1DI8A 1YW2A 4BRXA 2VNYA 2Z60A 3R83A 1KSWA 1VZOA 2HWPA 2JFLA 2W5AA 2ZOQA 3QD0A 3BPRA 4LYNA 4E1ZA 3RZBA 2E9UA 4FZFB 3OBJA 5EFQA 2W1IA 3AC5A 4IM0A 4ZTSA 5IKWA 2XKEA 4RFYA 1WBNA 5M08A 3HMNA 3D5XA 3RPSA 3CGFA 5EKNA 5KMNA 2W99B 3SOAA 4WNPA 5DR6A 4PTCA 5K0KA 2PVNA 5HD4A 4UX9A 2OJIA 1WAKA 3MW1A 5E1SA 5LWNA 2W96B 4O21A 3EQPA 5DEWA 4CRSA 1MUOA 3JY9A 1VYWA 3LCTA 3ZEPA 3ODZX 4NCTA 3S0OA 3W16A 1PXNA 4O6LA 3HV4A 4I23A 4S33A 5CU3A 3PP1A 3ZSHA 1YXSA 2QD9A 3CD8A 3KXGA 3R02A 4W9XA 3AOXA 3KF7A 5IQDA 1RDQE 4BDAA 3CS9A 4ZTQA 2F2UA 1UFZA 5E8SA 2UVXA 3R8PA 4ALVA 4EWHA 4H36A 2LVAA 2JKQA 5CVHA 2QOOA 4ZLZA 2OXDA 4I6QA 2G15A 4Y73A 4D28A 3AC3A 3R8ZA 1ZARA 2PL0A 2VRXA 3E7OA 4GVAA 4LOQA 2WMBA 1PJKA 2FSTX 4F63A 4UMUA 3EQCA 4J96A 4FEVA 3ENMA 4UMTA 4NJ3A 4J8MA 4FZ6A 4M14A 3R9DA 2ERZE 4FSWA 2GQGA 5H2UA 4JBOA 5GZAA 3BELA 3HV7A 3QGWA 4DCAA 5IA0A 2P0CA 4CZUA 4GK3A 2Z7QA 5AUZA 2UZLA 3BYVA 3FI4A 2E9OA 3GFEA 2I0YA 5IDNA 1OUYA 3F2RA 3ZBXA 3KRWA 4RVKA 2MROB 1RJBA 1OIRA 1PXLA 4BI1A 2RKUA 4UN0C 2OOBA 1M7QA 3OZ6A 4JVGA 2C5OA 4UWYA 5KMOA 2W06A 3SKCA 4DITA 3HA8A 5EDPA 5JGBA 4IFGA 2YLEA 5C8KA 5EDQA 3SGCA 3RWPA 4TTHB 4HOKA 4JG7A 4MBJA 2IW9A 5J1VA 5C01A 3IW5A 2C6TA 3FRIA 3D15A 3ORPA 3FHRA 4YO4A 4L3LA 3E21A 2REIA 4EKKA 4ZMFA 4Y5HA 2I0VA 4EHEA 2VN9A 3OW3A 4IB1A 4UMQA 4C4JA 3OBGA 2ONLA 4E6DA 5L6OA 2OZAB 4WNKA 5HD7A 3G51A 1UA2A 5KUPA 4RJ5A 4OBQA 5FP6A 4FVRA 4ONAA 5JGDA 2P55A 5KZ0A 4CLIA 3LQ5A 1FGKA 2Z7LA 1OVEA 2OO8X 2O63A 3IONA 3R28A 4PY1A 4ARKA 4FV0A 5HCXA 4LOPA 3FMDA 2LBCA 1MQ4A 2VTAA 3EFWA 4C4GA 5ANEA 2PZYA 3N9XA 4AXAA 4WP2A 1ZMVA 5ANDA 4AN3A 5LARA 3F2AA 1Q5KA 5M56A 2I7QA 4R5SA 4EK6A 3DAJA 3TWJA 4ZK5A 2XNBA 3BI6A 2VO0A 4CV9A 4FTCA 2R3FA 2J0KA 2R3OA 4DH3A 2PUNA 2WPAA 3F5GA 4CKRA 3TUCA 1H01A 2R3RA 2ZV9A 3AC8A 1KV2A 4J1RA 2PVKA 2BKZA 3DXNA 5CAOA 4FEWA 4FTUA 2R0IA 3G6GA 3VRYA 5GJGA 3E3BX 1YXXA 5EQEA 3OUKA 3RNYA 3V8SA 2W1DA 3DFAA 4FSQA 4QMZA 1IA8A 3FKLA 5BQ0A 4Y85A 3WILA 4DBGB 2X8EA 3UPXA 4FKTA 3ZFMA 5M09A 3TZ9A 3HKOA 3Q4UA 4MQ1A 1HCKA 5GZ8A 1KWPA 2J4ZA 2C3KA 4PL4A 2ITYA 3V5TA 3IQ7A 4USDA 4DFBA 5G6VA 4HNIA 4U44A 3A8XA 3VBQA 3DB8A 3P9JA 3FLNC 4GW8A 5D10A 1UU9A 2WKMA 5CEPA 3OHTA 2XCKA 3QQUA 3OT3A 3QCXA 3LAUA 4P4CA 4C4FA 4YC6A 2QR8A 1F0QA 3EN5A 3CY2A 5CXZA 2PSQA 3I6UA 4MBLA 1Z9XA 3RAIA 5F94A 3COMA 3FY2A 2XH5A 4FTQA 4QYGA 4F6WA 4G1WA 3I4BA 2AYPA 5AV3A 3PVUA 3SXSA 3CTHA 4BBFA 2YITA 1H1RA 1H1QA 1YDSE 2YCRA 4EC9A 4FR4A 5K4IA 1T6OA 4MNEA 4F9AA 3PY1A 4UEUA 2W1CA 3UIUA 2YLFA 2ERKA 5KHXA 3S4QA 5AV2A 4NZWB 4AA0A 2JKOA 3I1AA 1Q97A 2K9DA 5HIBA 3KQ7A 2WTKC 4JBPA 3E3PA 4C59A 3LW0A 3FUPA 4YJNA 4OBPA 4NM5A 5A9UA 4RBLA 4P5ZA 1LEWA 1URCA 2C6MA 3KCKA 3QUDA 1Z57A 2WELA 3HMIA 3MS9A 4BCNA 2UZVA 1XBAA 4FGBA 2UV2A 2JP7A 4X0MA 3UOHA 2B0QA 1Q99A 4PRJA 5L2TA 3V04A 2OU7A 2VTQA 1M2RA 3NNUA 2QCSA 5BUIA 3MDYA 3FY0A 3II5A 4C58A 5BUJA 1JR3E 4GEWA 3QHRA 2EWAA 3AC1A 3GOPA 2SRCA 4D58A 5C1QB 2WTJA 2P4IA 2F4JA 2P3GX 4OT5A 5CNNA 1HQYE 3RPVA 4FOBA 5EOBA 4E8AA 1IFYA 3UNKA 3UZPA 1BL7A 3A7FA 3DT1A 3JXWA 3QA8A 5B2KA 2EJSA 4FF8A 4D5KA 4ZY4A 5K4JA 4YZBA 4L46A 3DFCB 1MRVA 4IZ5A 4U80A 3ZH8A 4C33A 2FVDA 4D9UA 3RAHA 2ZJWA 1PGYA 3W10A 4DFXE 4EYMA 4FT3A 4ERWA 1MRYA 1PHKA 4HJOA 2GFSA 1YHWA 3FZTA 3NS9A 4BF2A 3E87A 5FEDA 3EFKA 4O7NA 3CQWA 3AD4A 3Q4ZA 1W7HA 4RSSA 3ZZEA 2G2HA 2XIXA 1YI3A 4D4VA 3DBDA 3R7OA 4OTRA 4O82A 3QC4A 4KKHA 3BHVA 3NVMB 1DO0A 3TNPC 4FKIA 1ZYLA 1HJPA 4TWPA 4DEEA 3L8XA 4N0SA 1SG9A 3FLYA 4K77A 4TNBA 3E8CA 1WVXA 3T3UA 2R9SA 4EEVA 3PVGA 2QOIA 3JVSA 3PZEA 2DHYA 1YXVA 5CSWA 3U54A 3H4JA 3DCVA 2R2PA 3C9WA 3UBDA 2DS1A 4JQEA 2QG5A 3W2CA 1H4LA 2GTMA 2B9HA 5A54A 5IQIA 4E4LA 1VDLA 3ENHA 4IVAA 3RM6A 3WF6A 2GQSA 3P1AA 4FA2A 1IASA 3R9OA 1OKWA 3EN9A 5H8GA 1XHAA 3UNZA 2F2CB 3AMYA 5KE0A 5H8BA 5EQPA 1WVWA 3ZO2A 3EQGA 3C51A 1PMNA 3L8VA 3Q9WA 3RNIA 4CCUA 5FM3A 4EQCA 2CGUA 1TKIA 2UZUE 3WZUA 3IECA 3K3IA 1UVRA 3MVMA 3RCDA 3SW4A 3SXRA 5DT3A 4LGGA 5CT0A 4O7SA 5DMZA 1P5EA 4BCKA 4C2VA 2JFMA 4G6NA 3ZRKA 2JC6A 4I22A 3NUUA 4DA5A 3GCPA 3LFBA 3DJ6A 5CVFA 2IVVA 3HL7A 4FC0A 4U42A 4F9CA 4PMPA 4UXLA 4HCUA 3U6HA 4X2FA 1FVTA 4M68A 2DQ7X 2VU3A 5DFPA 3DJ5A 5J8IA 2YERA 1OL5A 2CJMA 3TJDA 4AX8A 2PULA 2CKQA 4L43A 2QOLA 4R78A 5HTBA 3DPKA 2BAKA 2OW3A 5HICA 2BZIB 3QL8A 5IQFA 1V92A 4GU6A 4EH6A 1H8FA 4R8QA 4GKIA 2CGXA 4BB4A 5HI2A 5IQBA 3BV2A 2A4LA 3ZLXA 5CU6A 2AUHA 3O8UA 2YZAA 3FZSA 2CKEA 4Q9ZA 4WG4A 2J0LA 4NM7A 2IJMA 2O8YA 4HPTE 3HV3A 4EHVA 3NYXA 5TF9A 3DJ7A 2W4KA 1YDTE 4MNFA 3PYYA 3O23A 2JY8A 1WBSA 3GT8A 4DC2A 5HZNA 4QP4A 1WIVA 1YXTA 3HDNA 4RX9A 2JGZA 5FDPA 3E88A 2YCSA 3G90X 4BTKA 2XK3A 3DB6A 3CGOA 3PRFA 4Z3VA 4DLJA 4FNZA 4ZS0A 5IEVA 2UW6A 3OCBA 4BCGA 3UZTA 3B89A 4CZTA 4RIXB 5LVPA 4U6RA 3KN5A 3FKNA 5LCKA 3KU2A 1VEJA 1GIIA 2X9EA 4YNOA 5AP1A 5M55A 3ZDUA 4RVTA 3ZO4A 5JK3A 2WMTA 3WBLA 4DFLA 3NNWA 2RG5A 3TZ8A 1DO2A 3ORIA 5HKMA 2OXYA 4EZ3A 2QOFA 1E9HA 1YHSA 3DQWA 4H39A 2GNLA 3D0EA 4FK3A 3QRJA 3C4WA 4GK4A 4KB8A 4O38A 5B2LA 2VTJA 5CF4A 5AAEA 2K0BX 4FSRA 4E5WA 1H24A 2HZ0A 4E4MA 4RJ6A 4IE9A 4C4EA 4JDKA 3GU8A 1PF8A 3NIZA 3GGFA 3QD2B 4NK9A 3W32A 4F09A 2V0DA 2CKOA 3MFTA 4FSMA 3PJ2A 3R1YA 2OZOA 2RG6A 3L9PA 2XJ0A 4YZDA 4FI1A 3NLBA 2YM5A 3ZHPC 5ICPA 3LMIA 3F9NA 2C69A 2YHVA 3HRBA 4JXFA 5HVKA 4XBRA 2BWBA 4KKGA 3I7CA 4BDIA 2QHNA 4KSQA 4V05A 4DFYA 2DAGA 1Q24A 3MWUA 3KC3A 2B1PA 4I20A 3DBEA 3QF9A 4J8NA 4FV1A 2X39A 4UV0A 4YLLA 5EI6A 4C36A 4PNIA 3ATTA 2HCKA 3LM0A 1EFUB 2B3TA 4NM3A 4L67A 5AUWA 4HVSA 2B9IA 3ZS5A 1WJ7A 4UBAA 4XRJA 4Z7HA 4F1IA 1ZXEA 4OAUC 5L4QA 3KVXA 1LEZA 4HVHA 2OXXA 5LVMA 4TT7A 3ITZA 4Q7JA 3F61A 4RFZA 3VUIA 4GEOA 2W1ZA 3DQXA 4EOQA 4IWPA 3IPHA 3NIEA 1GZNA 2RIOA 1B38A 3QQHA 2I40A 1OQYA 1H1PA 2WD1A 4TWOA 5E91A 3NNVA 4I93A 4QP9A 5DVRA 2JDOA 4GRBA 3E46A 1DAWA 3AG9A 3Q4TA 2LTUA 4PPCA 3R8MA 2RL5A 1ZOHA 3FZRA 3G5DA 3P5KA 5IEXA 4M69A 1YKRA 3ZU7A 5DA3A
chains in the Genus database with same CATH superfamily
4ORKA 4PTGA 1GIHA 4NSOB 1A9UA 1QAOA 4DEDA 3OY1A 4O81A 3BIZA 1CKPA 5GNKA 3KREA 1TFFA 2ITVA 2OH4A 1A5TA 3HYHA 4DTBA 3QUEA 4JJRA 4V04A 1JNKA 2Z7JA 3FC1X 5IF1A 2PVJA 5FXQA 1H07A 5GINE 3QCQA 4EL9A 4BCIA 1VEGA 4GK2A 2BIKB 3VS0A 4G5PA 4MM3B 3GRRA 4FWDA 3LCOA 4EHZA 1NNJA 3ZOSA 3M42A 1FMKA 4RQVA 3DTWA 3O50A 4L78A 4QPMA 4UMPA 2ZM3A 4BCFA 2QURA 4QD6A 4DINA 2E9VA 5AADA 4RJ4A 3ORKA 4FIJA 3B7ZA 3UDSA 3JUHA 2D7HA 3SD0A 4ALUA 3CEKA 1QUTA 3SC1A 2ESMA 4JIKA 2NNWB 4LJ7A 2VO6A 1T43A 1J7IA 3EKNA 4PMMA 1FNNA 2LWXA 4DR7M 5HG8A 4O91A 4F7SA 4TL0A 4JR7A 3F3ZA 4JYAM 3DZDA 3QHWA 4FJVA 4N70A 2QU5A 1IQPA 4HYUA 3TQSA 4GFOA 2QOKA 4YJQA 2IG7A 3LOKA 3CE3A 3F69A 2VTIA 3QCYA 2C30A 3EN7A 1DI9A 1H26A 3NAXA 3HRFA 2PVMA 4JL9A 5FTKA 2Y6OA 3UTOA 3PJ3A 1W2DA 2WMRA 4HW7A 2HENA 3BRBA 2XNGA 4NKAA 2WFYA 4XV9A 4BL1A 5DNRA 3HZJA 1AD5A 3CTWB 4OUCA 3MYGA 3ID6C 3U5ZA 1HT2E 4I5CA 5BMMA 4RWJA 3ROCA 3ZLYA 2YM3A 4JIAA 4JAIA 3H9OA 4D2VA 5LOHA 2ZV8A 2FH9A 3PXYA 4AG8A 3RKBA 5LWMA 4PNKA 1MN3A 2A19B 2WEIA 3LFCA 5EHYA 4RRVA 3FV8A 3FI3A 3MH2A 1QPJA 4A07A 3R21A 3A99A 2JITA 2X7FA 1Q3WA 2Y4IC 3BU3A 4DR2M 1SZMA 2BRGA 2KZSA 3D83A 1FVVA 4EOSA 2X8DA 3PWYA 4IBIA 2ACXA 4GV1A 3WZEA 3GCVA 5AFVA 5JQ5A 1OL1A 4EK3A 4XG3A 1YI6A 3TWMA 3G0EA 3P5JC 4WNOA 1ZY4A 5AMNA 4RPVA 4F70A 2NRUA 3BLRA 3VS6A 3GB2A 5EP3A 2XYNA 4NXMM 2XK6A 1XWSA 4CNHA 4LV8A 2YJSA 3BE2A 5DLSA 3MVJA 3P4KA 3VRZA 5E6JA 2UXBM 2ZMCA 3NUSA 3Q04A 3FYCA 2G2FA 2XK7A 3K8ZA 3D8LA 1ZMWA 3VIDA 3F92A 1IBMM 1Q8UA 1W0XC 1AGWA 3Q6UA 4FK6A 4E7WA 4KBCA 4EOOA 3OROA 4QTEA 4TXCA 4KT0F 1N36M 5M07A 4QQCA 5LVLA 4NL0A 5IEYA 4EJNA 1I44A 4HGEA 4RQKA 4K11A 3FUXA 5CXHA 3KS8A 1IN7A 4OTQA 2V6ZM 1SXJB 2QBYA 4TKSA 4NFMA 4AQKA 2M60A 4BVUA 3QQFA 1PXPA 3HX3A 5AM7A 5LVNA 3BOSA 4KD1A 2PZPA 3W1FA 4DH7A 5AV0A 2NYAA 2VWWA 3AKKA 4C0TA 3F3WA 4DH5A 3VJNA 3IDCA 4N6YA 3CR0A 5FLFA 1L2CA 2IPXA 1URWA 2VF7A 2UZDA 1YHVA 3KMWA 4QMXA 1QAMA 3I7BA 3IW4A 2Q83A 2PZRA 2O64A 4XX9A 5AJQA 5F4NA 2QODA 5EH0A 3KRJA 4BCOA 3UPZA 4F9BA 3PSDA 3OF0A 3KRRA 4MXAA 4MUQA 2C3LA 4LF4M 3QRIA 1WMKA 3M6AA 3I4YA 3QALE 4AZVA 4BCPA 2UW7A 1E94E 1KOBA 3GC8A 4N57A 5EJCA 3WHLA 3CCNA 4CLJA 3A8WA 3HEGA 4H3QA 5AX3A 3D2IA 4UYAA 3PIXA 3CIKA 3NR9A 1IN5A 3H3CA 4JBVA 3JVRA 4AZFA 5FD2A 5FWKK 4FT9A 3LMGA 4FIHA 4M12A 4FTJA 4QP6A 3L29A 1OECA 5J5SA 3UVQA 4IBEA 5D11A 3TXOA 5F9EA 4HLQA 1V0BA 4REZA 4ZSGA 4LJ5A 4Q5HA 4WW0A 4IJ9A 2VWYA 4QTBA 5A46A 2QQ8A 3RINA 3Q3BA 3ZFYA 3FL4A 4II7A 2BMCA 4EORA 3KCFA 5ANGA 5CAPA 4M15A 4CFVA 4KBKA 4CGYB 1H00A 4H58A 4EONA 5I9XA 1P4FA 3V6RA 5CU0A 1CKJA 3F82A 4DEAA 3TM0A 2WIPA 5HG9A 3LQQA 3QRUA 4RMZA 2WAJA 2IN6A 2MJ5B 3W0SA 2WMVA 2VTOA 4X62M 1HNWM 5ITXE 5L2SA 2N35A 2EUFB 4X2GA 2UW0A 3T6PA 2RFEA 3SHGB 5FXRA 5C27A 1Z5AA 5CSVA 3MIAA 3WZDA 4OTHA 3AJIB 3A62A 3PXZA 3D7ZA 4HYHA 4B3TM 4C4HA 4MH7A 4G3CA 4C7TA 2WQNA 4BYIA 3J27B 4TYHB 3Q96A 3CLYA 1IY1A 1XO2B 2IVUA 4DV1M 3FYJX 4UB7A 1QPCA 4LFBM 3GFWA 5CZIA 4DV6M 3V5PA 2F5PA 3HY5A 3D94A 2XNMA 4BIEA 5M06A 3R8FA 4ACGA 5H8EA 4DE4A 3BWFA 3ZRMA 3BZ3A 4IANA 4NKSA 3MVHA 2V1CA 1K9AA 3VW6A 2LVOC 2RFDA 2Y8OA 3MFUA 3FPQA 3K1JA 5CEOA 2XCHA 4OTWA 4MEDA 5LMKC 2EKFA 3O8PA 2CV2A 2WQOA 3R1QA 1TQIA 4EJ7A 2AC3A 3OTVA 3T9IA 2OJJA 4R5YA 1SXJA 4RWIA 1V0PA 5AP6A 1VR2A 1GVNA 2PE1A 4DG3E 3HDMA 4AOTA 4G2FA 5ACBC 5IMEA 3GLGB 4II5A 1ORYB 2A27A 3ILKA 3QZFA 2UUEA 3FMMA 5DYJA 2XLJA 1BUHA 4AFEA 4IVBA 5AP3A 1U4DA 4GCJA 3RPOA 3W67A 3PUFC 3R7UA 2BDWA 4JI6M 5KPRA 4QMWA 1UWHA 5ITUA 3TV6A 3HHYA 3SMSA 3M2WA 3LCDA 5JMSA 4J99A 2F9GA 4L6V6 1VEBA 3HA6A 1APME 4EH3A 3VC4A 4QQJA 4W8DA 1GO5A 3UVRA 4LG2A 3GI3A 2XB7A 4JDHA 4FV3A 1F4IA 3KOXE 5J87A 3A46A 4BZOA 1JSTA 4R3CA 4B7HA 4YHFA 4KSPA 3C1XA 3AKLA 2J0IA 3WYYA 3W33A 4CMOA 2ZAZA 4I6BA 4A4LA 3FLZA 3C58A 2UZTA 5FBNC 3HU3A 3NPCA 5FG8A 1O6KA 4E6AA 2WTDA 3EYHA 3FKOA 3D7TB 4G3OA 5DN3A 3ZBFA 5M4IA 1GOLA 2XFTA 2Z8CA 4EQUA 4E5BA 3O7LD 5KHWA 3U55A 2L2DA 5FP5A 4EQMA 3FDNA 2E9PA 2IZTA 4YP8A 4BC6A 3UVPA 2XBJA 5AR4A 3FXXA 5FTJA 3VQUA 5C4KA 2DYLA 3ZTXA 1DV0A 1H1SA 1PJIA 1STCE 4G6OA 3EQBA 5E8YA 4QMYA 4I41A 1A06A 3PY3A 2QC6A 4XV1A 4XMOA 4RX7A 1GJSA 4GMQA 2CMWA 4HYSA 2HXLA 3A7JA 4LFCM 3KF4A 1G5SA 3C3DA 5TO8A 3LCVB 3U51A 2BNKA 3OTOM 2OO9A 4AZTA 2XIYA 1OJLA 4C34A 4GJ3A 5E1EA 3VBVA 4OAVB 5LMBA 4JI0M 3I0OA 1PXKA 1U54B 5E9EA 4OT6A 4MHAA 3R7EA 3FZPA 4O27B 4ID7A 3UG1A 3ZCBB 4O84A 3T9TA 2PZ5A 3GBZA 5K5NA 3PZHA 4X21A 3CKWA 5IA1A 3FQEA 2KRKA 3KK9A 3MHVC 1GZ8A 5AUYA 3ZZWA 4CVAA 4I0SA 4XV2A 3NUNA 2J90A 3LFAA 4W8EA 4I3ZA 1WHCA 2UVYA 4OVZB 2WSEF 2GNJA 5BVWA 2BRHA 2QONA 2XM8A 1JB0F 3W2SA 3KMUA 2G01A 4DG0E 1W8CA 4CFWA 3UO6A 2X0OA 3PSCA 2XNOA 2X8AA 1TDHA 5J79A 2UVZA 3PA4A 3HU1A 4O7VA 4UALA 4FSZA 1CM8A 2A2AA 3RK9A 4CD0A 3C3EA 4O0TA 3R7YA 2R3GA 3AGLA 4Y72A 2UZBA 4B3SM 4LG4A 2ITXA 4IM2A 2IZRA 2ZM1A 2ITZA 3GPYA 4UYNA 3VK8A 3IO7A 3MY1A 4FV6A 4I8OA 3TTJA 2PTKA 1I09A 3W2OA 4BKJA 4JNWA 4BGHA 4A9UA 4IX3A 1PJQA 1ZYSA 2O5RA 3EOCA 2VTPA 4R7BA 2BJWA 1R2YA 3EL7A 4CXAA 4DGOA 2XZUA 5EW8A 4L45A 3D2KA 1ZZLA 3GLGA 5IA2A 1ATPE 1XBBA 4AI6A 3WE4A 4F6UA 4L8MA 2UXDM 5KQDA 2QG7A 4JXJA 1DGFA 3KXXA 1L8QA 2G1TA 4WUNA 4D4YA 5ANIA 5CEKA 3NYVA 2C96A 3COHA 2NRYA 3PNYA 4PPBA 4E20A 2F5SA 4RT7A 4W4WA 4LZZA 2YQZA 4NUSA 4X2JA 3CQUA 3VUDA 4D1XA 5LQFA 3LIJA 4HYIA 4O22A 2YWVA 5HBEA 5DR9A 5I3RA 3QQLA 2PUUA 2D7GA 2YZLA 2RGOA 3U6OA 1ZYJA 4NW5A 4QYHA 4LGMA 4ITHA 3I01M 3HMMA 2H5XA 4QYFA 3SLSA 3UGCA 4APPA 2X4ZA 4F0IA 3DOGA 4PD2A 4GH9A 4YBJA 5E8VA 3SYLA 1C7YA 2JDRA 4R1YA 4GKKM 1JKSA 2F7ZE 5I9VA 3D7TA 2C6KA 1CKIA 1OKZA 2G8LA 5E4HA 1BYGA 3MY5A 4KNBA 4U97A 3BWJA 5KNJA 4LF9M 1ZZ2A 3ALNA 3QYEA 4QMQA 3G0FA 3Q8GA 4AWIA 2LVPC 3AOEA 1H27A 2B52A 5C26A 3OT8A 3WZKA 5KBRA 2WTVA 3CP9A 4J53A 3EMGA 4EOKA 3OXTA 4YLJA 3VQHA 2ZM6M 4BZDA 3DU8A 4FV8A 1T45A 3HWSA 2OZAA 5EW9A 4L53A 1GZOA 4O4DA 4KO8A 1SXJC 4IBKA 2GHMA 3UP2A 3OW4A 3UQFA 2UXCM 3HHZA 1EIJA 4F08A 5CS6A 2C5NA 1R3CA 3MPTA 4FIGA 2XK8A 4MKCA 5A6OA 2Y4PA 4FKJA 2IZUA 1U54A 3P08A 3BYUA 3MTFA 3QGYA 3R0TA 1U5QA 4GMYA 4EUTA 2Y7JA 3HJ8A 4HGTA 5AWMA 3UOJA 3Q5ZA 3ZMMA 4WBBB 3QFVA 3QTQA 5BUEA 4RWLA 4WA9A 3FBVA 2XKCA 5J7HA 4QTCA 3PXQA 4G4RA 3VW8A 3RAWA 3NVKI 1XQZA 4IB0A 4F1TA 2UUBM 4IZYA 4D9TA 4QMMA 2BPMA 5D7VA 3WYXA 1N75A 3Q8XA 3L26A 3AV0A 3N51A 1XB2B 2H34A 4C4IA 5CSHA 2J5FA 5J5TA 2C5VA 3TNQB 3KXHA 1IAHA 3EYGA 3QC9A 2HOGA 4YJUA 4A06A 4ALWA 4LZJA 2YIYA 3QZHA 2CFOA 5I4NA 4CMTA 2RKOA 3V6SA 1YXUA 4B6LA 4C38A 1YOLA 4FTIA 4BRXA 4C4EA 1KSWA 2HWPA 2ZOQA 4LYNA 3RZBA 2E9UA 5EFQA 3VONA 4IM0A 3AC5A 4RFYA 3HMNA 3CGFA 5DR6A 4UX9A 2PVNA 2OJIA 1WAKA 5E1SA 3GLHB 4O21A 3EQPA 3LCTA 3ODZX 3S0OA 1XC8A 4O6LA 2QD9A 5CVHA 3AC3A 1NSFA 3R8ZA 4F63A 4GVAA 4FEVA 3R9DA 2GQGA 5GZAA 4DCAA 2P0CA 4CZUA 3RGSA 2UZLA 3F2RA 3KRWA 1M7QA 2C5OA 4UWYA 4DITA 3GP1A 5EDPA 5JGBA 5EDQA 3RWPA 1OFHA 3FRIA 1V34A 4L3LA 4EHEA 3OW3A 4IB1A 1H6UA 5HD7A 4FVRA 2P55A 5KZ0A 3LQ5A 3IONA 1OVEA 4C4GA 2G5GX 5ANEA 3N9XA 1ZMVA 5ANDA 2I7QA 4EK6A 3TWJA 4ZK5A 3BI6A 2VO0A 4FTCA 4DH3A 2J0KA 2WPAA 4KLNA 2ZV9A 4J1RA 2BKZA 3DXNA 3VRYA 4WURA 3GPUA 3DFAA 4FSQA 4DBGB 3TZ9A 5GZ8A 2C3KA 3V5TA 3P9JA 3FLNC 2XCKA 3QQUA 1VDDA 3CY2A 1Z9XA 3RAIA 3COMA 2UU9M 3CTHA 1H1RA 1H1QA 3GPPA 4UEUA 3UIUA 1KFVA 2ERKA 5KHXA 3S4QA 5AV2A 4PCZA 2JKOA 1V33A 4P5ZA 1URCA 3QUDA 4BCNA 1XBAA 4FGBA 2UV2A 4X0MA 1Q99A 1M2RA 2QCSA 5BUIA 5BUJA 2DXIA 3QHRA 4D58A 2F4JA 4OT5A 1HQYE 3ML1A 5EOBA 1IFYA 3UZPA 3JXWA 3QA8A 4D5KA 4YZBA 3DFCB 4EC8A 1MRVA 4DFXE 2FVDA 2ZJWA 1PGYA 3W10A 4EYMA 4ERWA 1PHKA 1YHWA 4BF2A 3EFKA 3CQWA 3ZZEA 2HL7A 1TZDA 4OTRA 4O82A 3NVMB 1DO0A 3TNPC 4FKIA 1ZYLA 4DEEA 3L8XA 4N0SA 4TNBA 1WVXA 3PZEA 5CSWA 3H4JA 1G8PA 2R2PA 2DS1A 2GTMA 1VDLA 1OKWA 2UUCM 3AMYA 5H8BA 4CCUA 2UZUE 3WZUA 1XXHB 4BCKA 3GCPA 4FC0A 4HCUA 4EIWA 1OL5A 4AX8A 2PULA 2F4VM 2BZIB 2CGXA 5HI2A 4M0DA 3O8UA 3KDSE 2W4KA 4MNFA 4DC2A 4RX9A 2JGZA 3PRFA 4ZS0A 5IEVA 3B89A 4CZTA 3KN5A 4YNOA 2X9EA 5AP1A 5M55A 3ZO4A 3DQWA 3QRJA 4KB8A 3GU8A 3NIZA 3W32A 4F09A 2RG6A 2Q2EB 5ICPA 1GLNA 2C69A 3HRBA 5HVKA 4J8NA 4I20A 4YLLA 3DBEA 2X39A 1EFUB 5AUWA 3ZS5A 4Z7HA 4F1IA 1ZXEA 4OAUC 4QNMA 5L4QA 4LF8M 4PDGA 4Q7JA 4RFZA 3VUIA 4GEOA 4EOQA 4IWPA 1GZNA 2RIOA 1H1PA 3NNVA 4I93A 4GRBA 3AG9A 3R8MA 2RL5A 4LJAA 5DA3A 4G5JA 3FUUA 2DWLA 3C5IA 4LL5A 1E9RA 3V8TA 2ITTA 4HCVA 2RRUA 4GL9A 2ZTDA 1L2BA 4OBOA 4B0GA 1U46A 3O17A 1OBGA 2E2BA 5IUHA 3GRVA 5I5ZA 1E32A 3R71A 3R8LA 2PZIA 3OWJA 4FEXA 3KP0E 5IPJA 1X8BA 1G71A 4E93A 4MGKE 4EKLA 5L2WA 3HX4A 2QO2A 2BZHB 1QDTA 2QO9A 4DGGA 1BVSA 4V01A 2IW6A 4M13A 5M53A 4WOVA 2O0UA 1OBDA 5ETIA 1RW8A 5CVGA 2BHEA 3FQSA 3LJ0A 4TUWA 4EH8A 4ZIMA 5AUTA 1H28A 3LQ8A 3OOGA 3CKXA 3Q6WA 2YWPA 3MSSA 2QLQA 4CTCA 1X37A 2XSZA 1CDKA 4DBNA 2RGPA 4E3CA 2W9FB 3U6DA 4XV3A 3BHHA 4MD7E 2QLUA 3WI6A 4BI0A 5HVYA 5BVDA 4FOCA 3QA0A 4YPDA 3RHKA 4KRDA 4ASEA 4ANMA 5HX6A 3MB6A 2YA9A 4DEGA 2XYUA 4FTAA 3DK3A 4OTDA 4FD2A 4QP2A 4MGHA 4BBEA 4FIIA 4O0XA 3A60A 1J1CA 4XG8A 4IWQA 4B8LA 4EZ5A 1QAQA 4HPUE 1GKIA 4EK4A 4U8ZA 4ANLA 4D2TA 4G3EA 2QVSE 5KMMA 4G3DA 3VN9A 2LAVA 4QP8A 4FG7A 4PDYA 2VTMA 2P2HA 3V5WA 4C02A 5JFXA 5JRSA 1XBCA 1PW2A 3OD6X 4FE2A 1U59A 4CQEA 2GFCA 2DENA 4F78A 3A98B 3LXNA 4JI5M 2R7BA 5E7RA 1MJGM 3WF5A 3ZM9A 2A1AB 5M51A 3GXLA 3D5VA 3T3VA 2BUJA 3ZXTA 1KE5A 4ZPXA 5A4LA 1QDRA 5DWRA 4FBXA 2W1EA 4YTHA 4GG7A 4BDFA 3CBLA 5EM5A 3UIMA 3DZOA 3A7GA 1JAMA 1XXHA 4M69B 2UW5A 4F65A 2WTIA 1T3TA 3TIYA 3RGFA 3R8UA 1LV7A 1VYZA 2VWZA 4CSVA 3VLFB 2NO3A 1OIQA 1ZOEA 1WR1B 3W0FA 3O7LB 5EM7A 2UZNA 3PXFA 2GNGA 2PVHA 1W84A 3AD5A 4R71A 1IXRC 2XMYA 4X7QA 2O01F 4CZYB 2DAMA 2VNWA 1UNGA 4BCMA 4S31A 3RMFA 2QZ4A 3S3IA 3TI1A 4BTMA 2WOUA 4E5AX 2W4JA 3RHXA 2W05A 5ANKA 1B6CB 2BZKB 3LFNA 2BHHA 1UU3A 1NHWC 4U0IA 4ERKA 2C3JA 4BKYA 3I51A 2GHGA 5JSMA 2XZSA 5JQ8A 5CI6A 2FO0A 1YQJA 3K3JA 1BL6A 3NW5A 4DTAA 2OIDA 5JFSA 3L27A 3R73A 2CV0A 3HUBA 4FODA 4WNMA 3UC3A 3KRLA 5IQCA 3G9NA 3U61A 2YABA 4R7IA 2RF9A 4YZMA 4GFMA 4IAIA 4U5JA 4EOMA 2KHHA 1UU7A 2PE2A 3UGJA 3EJ1A 4JV5M 1RQQA 4IBDA 3GU6A 4B7GA 3GLHE 3ZCLA 3OTUA 2R46A 4ENYA 1Z5CA 4O7RA 5L8LA 1Y57A 2DAIA 2AHMA 5CYIA 3NRMA 3MPAA 4M66A 3MGYA 4FZ7A 4DGNA 5C18A 4PTEA 3ZEWA 4IQ6A 4MF1A 3E8EA 2R3JA 4QNAA 3LFDA 5FEQA 3TCPA 3AMBA 1OITA 2VX0A 4G3GA 4FT0A 1R39A 1S3SA 4RZWA 4Z16A 5HIDA 5CEQA 2EXEA 2L09A 1XKKA 3MH3A 1LTMA 3BBZA 4AP7A 4DDGA 3LMHA 3TJCA 4DCEA 1QYRA 2HKJA 4NSTA 1OUKA 4BGGA 2BDFA 4NTTA 1QZMA 3D8BA 2XBAA 4YBKA 3R00A 3PIZA 3UO5A 4ITJA 1OL6A 2F49A 3KXNA 4CQGA 5IA5A 3TL8A 2IF8A 5HTIA 2R3LA 4PQNA 3NYNA 4RVMA 5DPVA 3UO4A 2WHBA 2OG8A 4BDCA 2X0PA 2YIQA 5KCVA 1Q41A 3H10A 4HZSA 5BR8M 4NIFB 3FEGA 3Q52A 1JQJC 5HEZA 4O86A 5B7VA 2KEBA 3VS7A 4W4VA 3IG7A 1R2ZA 4C2WA 3I4VA 1WBPA 4FKPA 2VQEM 1L2DA 3SX9A 3DOAA 2OICA 4PDPA 3TT0A 2OJGA 4YZ9A 1PXMA 4M9SA 4ITIA 3B74A 5CI7A 2QU6A 4TZRA 4C3PA 4L01A 5A4QA 4O1OA 3W0RA 3ELJA 2YDJA 1TQMA 4GU9A 4XYFA 5CF6A 3DXPA 5L8KA 3L25A 4WKQA 4U45A 1SVEA 4O0YA 4FW9A 2Y4IB 4X6QC 4LJ4A 2JDSA 3LHJA 5HCZA 1UWJA 2QOHA 2XUUA 5H3QA 4ZTMA 3QWJA 2QOQA 4D0XA 2YN8A 5EM8A 4IC8A 2GDOA 4NJDA 2L7IA 4MYGA 3QU0A 2X6DA 3KULB 2IVTA 3PVSA 4GT3A 2CGWA 3EN4A 3GNIB 4XGIA 3RVGA 4WO5A 2QSFX 2BRNA 2DWNA 4JG6A 4FSNA 1GL6A 5D9HA 1JSVA 1VQ1A 4QOSA 4O4CA 3LVVA 1GY3A 1A48A 4LF6M 4QNRA 2R4BA 4ZSAA 3DKCA 4A4XA 3LKMA 4UXQA 3MJ5A 2R3PA 5HG5A 4GIIA 4RG0A 3DXQA 4A4OA 2BILB 1JR3A 2C0IA 1PRBA 3ZM4A 4FCVA 3H0YA 2VX1A 1L1TA 5C1BA 4LRKA 3SHEA 2C6DA 3LCKA 2X0GA 3NGAA 1RU3A 5EQTA 2OFVA 3KXMA 4FKGA 4GVJA 3VUKA 4WSYA 4CG9A 1OI9A 3FLQA 4L15A 1J5EM 3QAME 3GC9A 3SAWA 3QWKA 5DGZA 5J7BA 2WZJA 4PL3A 1T46A 2OGVA 4IACA 4LRSA 3S2PA 4K9YA 4B4LA 4EHGA 3GP0A 3ZSIA 2P33A 2FSMX 4ZTRA 4D0WA 2BTSA 3LFQA 2FB8A 3LFFA 1BX6A 3BLHA 4BCGA 2OIBA 4A9TA 5HO7A 3LJ1A 2WIHA 3NX8A 1SNXA 4CT2A 1J09A 4AW5A 3PJ8A 2VTSA 1MQBA 1FINA 4AN2A 3HKPA 1WCCA 1KOAA 4LL0A 3T15A 3GLFE 2MH8A 3F5UA 4IX6A 4K6ZA 2B9JA 4MD8E 4OU7A 3QX2A 1PMVA 4QHTA 1M2QA 2ETMA 4W4XA 2DNAA 4RIOA 4YC3A 4MWHA 4QP3A 3PJ1A 4BBAA 3BYMA 4YTFA 2YAKA 3UG2A 3B8QA 2B53A 3G6HA 3GOKA 1BI8A 3I79A 4GT4A 4P7EA 4HVGA 1NVRA 1PXIA 3V51A 3L9LA 4V0GB 5HESA 3T38A 3LCSA 2JZ0A 3HECA 4IEBA 3PXRA 2PY3A 4LFAM 2OJFE 1N78A 4P5QA 2GNFA 3IW7A 4D2RA 4G3FA 4YJVA 4EOJA 4PUZA 4B9DA 5HU3A 4NIFA 3PNVA 4KINA 3SRVB 4JBQA 2ONLC 2DWBA 3MH0A 2X9FA 4IAKA 3W2RA 1Q62A 3J80S 3RP9A 3CC6A 3TN8A 4E6CA 4ZZMA 1XH7A 4QTAA 3KL8A 3E9SA 3TUBA 2HAKA 3BL9A 2W1FA 5FXSA 4RGJA 3G15A 1OFIA 2R7IA 5ITAA 3FLSA 3MIYA 4MGZE 1KE7A 3OP5A 2GS7A 3RM6A 2ITUA 5J9YA 4FKOA 4RWKA 5HLPA 3HAVA 3UC4A 2UW9A 4K33A 2EVAA 2WU7A 4F7NA 2XS0A 4K1BA 1PYEA 3GU7A 2JKKA 2Z4SA 4B99A 3QYBA 1YOMA 2VIIA 2J51A 4I92A 3SMPA 2C9CA 3ZUVA 1ZYCA 3QZGA 4FRFA 5LMUM 3PLSA 2WMUA 4MGIE 5E90A 2WSCF 4S2ZA 3KULA 4UZHA 2P2IA 4YJRA 2VTHA 4ZY5A 4YJOA 5EYMA 3VS5A 3E5AA 2KTYA 4GKHA 4BJJB 4PDSA 4PT5A 4UZDA 4JX3A 5HNBA 3Q9XA 3A4OX 4S32A 4AOJA 4X3FB 3V5JA 3REPA 4DGMA 5K9IA 1R78A 4EI4A