3FE3A

Crystal structure of the kinase mark3/par-1: t211a-s215a double mutant
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
317
structure length
317
Chain Sequence
QPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITATYLLLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Crystal structure of the kinase MARK3/Par-1: T211A-S215A double mutant
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3fe3A03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fe3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fe3A01
4JBVA 1LUFA 4XP3A 4MK0A 5BUEA 3HP2A 3CPBA 5EDQA 3WIGA 3A7FA 2BKKA 1V0BA 1JKTA 1NVQA 2CCIA 1XWSA 1IAHA 2YISA 3DFCB 5E7RA 5BVKA 4FKRA 3R7GA 4JR7A 2W9FB 3EZRA 4QRCA 3R8MA 2WMXA 3DKOA 2B9IA 4QNYA 2YWPA 3U51A 5J7BA 2JEDA 2NPQA 4KIKB 3CQWA 1UWJA 5J7HA 3ERKA 3EWHA 5DR6A 5AX3A 3RK9A 4AW5A 2Y4IC 4FTJA 3ZFMA 5FM3A 3QUDA 4C38A 3O7LB 4PF4A 3Q4ZA 5A4CA 4CGAA 4BDFA 2JBPA 4F0GA 2GFCA 2XVDA 2YIRA 1T45A 4ZSAA 1IG1A 3VF8A 3ZFYA 5IQFA 1ZRZA 2UZTA 3RHXA 3ZC6A 4FKPA 5F20A 2J4ZA 3VJNA 4BTJA 3MW1A 2GNHA 5LJJA 4U6RA 4AN3A 4IAIA 1FVVA 4DITA 4G3GA 4L6QA 3LJ2A 3U6IA 5I9VA 4RLLA 2FA2A 3GGFA 3HGKA 4FTUA 5KZIA 3R8LA 2JIVA 2C3JA 2GQGA 2DAEA 2HXLA 4PL5A 2YWVA 3Q2MA 3F9NA 3OW4A 4ALVA 3E46A 2H5XA 1MRYA 2YLFA 3QTWA 3C0IA 1Q8YA 1W98A 3HMIA 3WARA 5CEOA 5J79A 3MTFA 4YPSA 3L8SA 3POZA 1IEPA 1FOTA 4BI0A 3C9WA 3MPAA 3DLSA 2GS6A 5IH6A 4EOLA 2JAMA 2JGZA 2OIDA 3OTVA 1R39A 1TQPA 3E8NA 4J98A 5AAGA 2YCQA 3VWAA 3D7TA 4KBCA 4BB4A 3QKLA 4HGSA 4F9YA 2K9DA 3E7VA 3NR9A 2YCSA 3MYGA 5J5SA 4NH1A 3HA8A 5IH5A 5AR2A 5IDNA 1O6KA 3Q4UA 1KV1A 3UIBA 2A0CX 2JIUA 2IJMA 3UG2A 4C3PA 1UFZA 1TQIA 2DENA 5AP4A 5JQ8A 1YWRA 3GC8A 3QQHA 4IACA 3FI8A 3ZOSA 1JOWB 3TM0A 4ASDA 5EW9A 5TT7A 1M2PA 5DRBA 5CWZA 4JOAA 1OVEA 5EYDA 2BWEA 4I5HA 2BIKB 3FQHA 2J50A 4IW0A 3KK9A 4EH5A 2X81A 4FSQA 4RX8A 2VTQA 3BHHA 4HVSA 3FXZA 4TWCA 3FEGA 1RQQA 5GZAA 3CEKA 3ZONA 1MN3A 1F3MC 2WAJA 3FL5A 4HGTA 4EJNA 5I3OA 4HOKA 3EJ1A 4GIHA 2G3QA 3RJCA 4GKIA 3LE6A 2ZJWA 5CVGA 4E6QA 3OVVA 3FQSA 5A9UA 4B8MA 1AIPC 3EKKA 3PP0A 3ALNA 4L42A 2BTRA 2ZV8A 2WPAA 3SLSA 2E9PA 2XKEA 5AUTA 5KKRB 3G0EA 2ETMA 2WD1A 4APPA 3QHRA 1MRVA 4BFMA 4QMUA 1R1WA 4IM0A 3W10A 2C6DA 3FE3A 5C8MA 4KKHA 4YGAA 4BCQA 2NP8A 1M2RA 3E88A 1U4DA 2DUVA 2GCDA 3KFAA 3PRFA 4U44A 3V04A 3B8QA 3G15A 4AGUA 2ERZE 2X9EA 4RIYA 5J1WA 2BDFA 3PXRA 4WRGA 3A4OX 3T9TA 4BICA 3MESA 1OECA 2YDKA 3COMA 5IUGA 3FDNA 4N4SA 4RBLA 3KVWA 4X0MA 5M09A 5BVDA 4AZTA 3FLZA 4CFFA 1G8SA 2CKOA 1WCCA 1F4IA 2W0JA 4BN1A 5H9BA 4JIAA 2Y4PA 3G51A 4FTNA 5CAVA 4QP8A 5G1XA 3GC9A 5AV0A 3H9RA 5C4KA 3W32A 3HMMA 4A9YA 5A4TA 1U59A 4M7IA 2C0TA 3NUYA 5FDXA 4EONA 5BPYA 1XXHE 2W1HA 3WF5A 2XJ1A 2Y6MA 1WBOA 3GLHE 2ZM1A 3KMUA 5AUXA 2DYLA 3NAYA 3TTIA 1XH5A 3RGFA 4FGRA 1G41A 4FODA 3SAYA 3DBEA 5CTPA 3EZVA 3PG1A 3EYGA 4XV2A 4DFBA 3FC2A 2DWBA 1JSVA 4EBWA 5AP3A 2OLCA 4DH3A 4PDPA 4QMPA 2H34A 5FDPA 4TY1A 5CQUA 1JLUE 4O0TA 2Y9QA 4UEUA 2UV2A 3DK3A 3E8EA 5DBXA 4ARKA 2PVKA 1JSUA 1XHAA 3L9MA 4BTMA 3FZTA 2YN8A 4QPAA 3QQJA 1YVJA 4R3RA 4JT3A 5DT0A 1R0PA 3VJOA 2V7AA 3F5PA 3I79A 1OUYA 1U46A 2BAJA 3BLQA 2XIRA 3DK7A 5LQFA 3Q6UA 5M06A 1H0VA 3GCQA 1EFUB 4NUSA 4ZSLA 4AA0A 2EXEA 3LM5A 3R9OA 3JVSA 3W1FA 3S0OA 3FXWA 3NMUF 3VQUA 3BYMA 3C5IA 5FTQA 2XK7A 3QTIA 3U55A 4B9DA 3QRJA 4E1ZA 2R7BA 1E94E 1J7IA 3QD4A 4RA4A 4EH6A 2OOAA 4BR3A 3O50A 3Q60A 4O82A 3LFEA 4WD5A 3ORIA 3S95A 4FKOA 4F08A 5E1SA 4OGRA 4FV1A 3NUPA 5CSVA 2YM8A 5J87A 5C1QB 5BMSA 3I0QA 4JR3A 2P55A 3W2SA 4YLLA 3JVRA 5EQPA 2QODA 3HV5A 3O0GA 4JIKA 3GOKA 4FG7A 3ZRKA 4E93A 3UQGA 3R8ZA 3KXZA 4PV0A 1BLXA 1OITA 3RKBA 4DTAA 1FMKA 4KB8A 3IDPA 5E8SA 3SXFA 5HVYA 5LCJA 3EQGA 1UU8A 5ETIA 3CJGA 5KE0A 3DCVA 3V5LA 5ACBC 5CNOA 5K0XA 2IWIA 2WKMA 3GENA 3MY1A 4MAOA 1Q41A 4HJOA 3I1AA 1UKHA 3ID6C 4F6UA 4FV9A 4MVFA 4GS6A 1UKIA 4UMPA 1O6YA 4YC6A 2YFXA 3GP0A 4BF2A 2DZLA 4CV9A 1B6CB 4RPVA 3ZLWA 3E62A 3RM7A 4YURA 2YM6A 4L68A 4M67A 4IX3A 5GHVA 5HOAA 5J95A 3TN8A 5CF4A 2ZTCA 5EYKA 2IZTA 3V51A 2ONLC 3MFUA 5M44A 1PRYA 3L8PA 3SGCA 4G3DA 4AG8A 4JS8A 3TZ8A 1WJ7A 4QP6A 4A06A 5IISA 1O9UA 2MGWA 4V0GA 4ASXA 5J1VA 4R6VA 5CF6A 4EOQA 3LQ5A 3MDYA 3RPVA 3ULZA 3RVGA 2ITWA 1OL7A 4YJNA 3CQEA 3VUHA 2UVXA 5HBEA 4GFGA 2G15A 4G6OA 4CLJA 2PHKA 1CMKE 1JKLA 2RF9A 4GT4A 5E8TA 4I5CA 4N6ZA 2VO0A 4IVBA 4DLJA 1Q62A 3NNUA 2MJ5B 2ZTDA 1QL6A 1TTEA 4PP9A 4NL0A 1AGWA 3COKA 2C6TA 3O7LD 4FOCA 3LAUA 3BQRA 4FKLA 2QOCA 4CYIA 4FYOA 2HZ0A 1URWA 4LGDA 2L2DA 2JIIA 4I41A 3PZHA 4F2LA 4BHZA 1FINA 2VX1A 2RFEA 3GQLA 4TWOA 1H25A 5JRQA 1GZ8A 3UP7A 3MMPA 3CJFA 3NPCA 5IZFA 3GCSA 1VEBA 3RINA 4WNOA 2DI0A 4G6NA 5JQ5A 4OAUC 4M68A 4KUJA 3AC1A 2C30A 5HESA 2I40A 4C02A 4JI9A 4FKIA 3BELA 5JZNA 4UYAA 4C36A 5KMOA 3EN4A 2PMNX 4Z16A 4ZTHA 3V5PA 2O63A 3I7BA 3O8PA 1GAGA 3C4ZA 2W96B 4NK9A 3I4BA 4FIGA 5ETAA 3I6WA 4IAKA 4NW6A 3QA0A 4NEUA 4LM5A 1M2QA 4OW8A 3HYHA 2JZ0A 4AT4A 1J3HA 3FMJA 3HV6A 4BDBA 2R0IA 2WMRA 4X2KA 2WO6A 3NS9A 4QQJA 4LGHA 5DNRA 5AAFA 1U5RA 2CMWA 3COIA 4BZOA 5C27A 3NVKI 5IA5A 3WYYA 2BRBA 2W4JA 2XNEA 2B54A 2X2KA 4HNFA 2C6EA 3KMMA 3CS9A 3P7AA 5IQHA 5IEXA 2J0MB 4V01A 4C0TA 3F3WA 4JDIA 5JGDA 2XIKA 2NRYA 3HMPA 4C61A 2HIWA 3EQCA 3BYOA 2XK3A 1L8TA 2YIXA 2QSFX 4UWYA 2WMUA 3OEFX 3QZFA 2EXCX 3NCGA 3BV3A 3R2BA 5FBNC 4MKCA 4LG4A 2OO8X 2B0QA 1YI6A 4IVCA 2LVOC 2VTPA 2X8DA 4X3FC 5BYZA 3UODA 4JXFA 5M55A 4IAZA 1PMVA 4X2FA 4D2VA 4AZEA 4WNPA 3ZZWA 3U54A 1ZLTA 4PWNA 4D28A 3LJ1A 3ORZA 2OFUA 2OG8A 2QCSA 1LEWA 2QU6A 2QR8A 3R7VA 5AAEA 4Q9ZA 2QO9A 1BL6A 2I6LA 2AC3A 2R3IA 2YIYA 4UZDA 4D58A 4EHGA 4YR8A 3AD5A 3NWWA 4JDHA 2R3GA 2F4JA 4DCEA 3OZ6A 2VZ6A 4A9TA 3EFLA 2OGVA 1P4OA 4QTCA 2O8YA 3ZMMA 2KNZA 4DG3E 2QHMA 2OIBA 2DAGA 1PF8A 3BQCA 4YC8A 5GIPE 3GC7A 1T46A 1OKWA 2JBOA 1YWVA 2Y6OA 2VX0A 4D0XA 1PXJA 2I1MA 1RW8A 3BPRA 4XLVA 4II5A 5M51A 3NUSA 4I0SA 4C35A 4O0UA 3BEAA 4FEVA 3AGMA 3NYVA 5EM8A 3FV8A 4FKTA 4Y83A 5I9YA 3UOKA 2UZOA 4LOQA 3ORLA 5I9XA 3R9NA 2OZAB 3QRUA 1XR1A 2PVLA 5D11A 4I22A 2R3OA 2FUMA 2QOHA 5A54A 2X7GA 2VTNA 2IZSA 3DV3A 4MQ2A 2WNTA 2BMCA 2G2IA 4IIRA 4OBPA 5AP6A 3TTJA 5BVNA 1H1PA 5C26A 2WTDA 4LL5A 3RZBA 4BTKA 5K5NA 5TE0A 5A14A 2PULA 4N6YA 3VIDA 2VWWA 3Q2JA 4LI5A 2XNMA 4W8DA 1M7QA 3CTQA 4WNMA 4AZSA 2OJGA 4BCJA 5L8JA 5H3QA 2Y4IB 4RWLA 2YM3A 2Q0NA 4GYIA 4F0FA 4O86A 3VBXA 4RC3A 2BDJA 2VN9A 3DKFA 3H30A 4A7CA 3FI3A 3JY9A 3KVXA 4CEGA 3ZXTA 4H1MA 5JI2E 1HCKA 3EQIA 4BKZA 2VAGA 3EFJA 4M97A 1YXTA 4EQUA 4TYIA 5EW8A 4C62A 2V0DA 4DH1A 4YPDA 5HQ0A 2VTOA 4X6RA 3C5UA 2LVNC 2LVPC 2YZLA 2O5KA 5CSPA 3NUNA 2JKQA 3RK5A 1GO5A 5A4QA 3V6SA 2F49A 4A07A 3QUEA 4O38A 2WELA 4EOIA 5TOZA 4BYJA 4HYIA 2GTNA 4RJ5A 2C68A 5DFPA 4BIBA 4DFNA 3OCBA 2EJSA 4Q9SA 3CIKA 4DEDA 4X3FA 3DPKA 4LOOA 4IX5A 3P7CA 3UVQA 4YTCA 2UUEA 3A7JA 4IB0A 4JAIA 1STCE 3R30A 3RWPA 4K9YA 3T6PA 5M56A 3UPZA 5F4NA 4IDTA 2XM9A 4WBOA 3AMYA 2CPKE 3DQXA 3BYUA 2W5BA 4FKSA 2X2LA 4EH4A 1YXXA 1Q8TA 2XEZA 3P86A 4RSSA 3TNPC 4I1ZA 3F3VA 3R1SA 1Z9XA 3IDBA 3IW7A 3AGLA 4XOZA 2IZUA 3UYTA 3TNWA 2ERKA 4AUAA 2WMSA 4EZ5A 1G5SA 4FTAA 4ZS0A 2BRHA 4QT1A 3PY0A 1PXLA 5A3XA 2WB8A 4AQCA 1SVGA 3B8RA 4RFZA 4ERWA 4BIDA 4NIFA 1PXNA 2YHVA 5B2KA 5CSHA 4XNEA 4DEAA 1FPUA 3IQ7A 4BDCA 5M4CA 5HI2A 1ZOHA 3D5UA 3HVCA 2VNWA 5HG5A 3S2PA 1YXVA 5CU0A 4IH8A 2GPHA 4GT3A 3P9JA 5JFVA 5ANDA 3FZSA 3OOGA 4XG3A 3ZCLA 5DT3A 2X6DA 2RFDA 3PPJA 3UPXA 4I93A 2P33A 1SG9A 2J5EA 3PUPA 3R0TA 5ANOA 1B38A 3G9LX 3EQHA 2R4BA 3Q5IA 4YZ9A 3KXMA 4D4SA 3QCXA 4NJ3A 1I09A 3VS6A 5F1ZA 4RIOA 4WIHA 4J7BA 3DKGA 4YJTA 5IUIA 3IW4A 1YDSE 2C6MA 4BWPA 3HMNA 3RK7A 4D1XA 3E87A 1YHWA 2XB7A 4FNYA 4D4RA 1Q3WA 4QP3A 4EKKA 4DE4A 4QYFA 4FKGA 4DINA 4CFMA 4EHZA 2R3LA 3BX5A 3KCFA 5CEKA 4HVHA 4FKUA 4JLCA 4O83A 3ELJA 2DAKA 3KULB 5HTBA 4FUXA 3U4UA 3PVWA 4YO6A 1OUKA 4ANQA 3MVMA 3ZO1A 3ORTA 5HCZA 3SVVA 4TYEA 4YHTA 3IO7A 4Z7HA 5M08A 1MQBA 1E9HA 4ACGA 4EJ7A 4PMSA 3RAWA 3MVHA 4W4VA 3RZFA 5M53A 4YJRA 1WVWA 1T43A 2XNPA 3OWLA 5JGBA 4FSYA 3PA4A 1M14A 1PW2A 4U43A 3RAHA 3R22A 2B9JA 4EC9A 1Y8GA 3BBWA 4WG4A 5JFWA 4A4XA 4CSVA 4C2WA 2JAVA 4AX8A 4BCNA 3PPZA 4IANA 3O96A 2MR9A 1WBTA 4FT3A 2VNYA 3JPVA 4GK3A 5HU3A 5IH4A 4GUEA 3MV5A 5JMSA 5HU9A 3BYVA 3O71A 5HTIA 1SNXA 5HICA 4ASEA 5K3YA 1CKJA 4QMLA 5CXZA 3W2RA 2PSQA 1WBPA 2XK4A 4RIWB 4RVKA 2UW3A 2UZDA 3A7HA 4O0VA 2XS0A 4RJ6A 3A7IA 4MTAA 3PJ3A 5JN2A 4AA5A 2EKKA 3NZ0A 4FI1A 4L45A 4M69A 4B4LA 4PDYA 3ZSHA 3C0GA 5DOSA 3BU5A 2JP7A 4O7LA 4NM7A 3T8OA 4WG5A 4S2ZA 1P5EA 2MROB 1SNUA 4XG7A 3SA0A 2FSTX 3IK3A 3PPKA 4K6ZA 4OT6A 4AF3A 4OAVB 1PKDA 1VYZA 4IE9A 2R3RA 4YBJA 3SG8A 4Q5EA 1MQ4A 2V7OA 4O7YA 4C37A 3UGCA 5I9ZA 3E7OA 4Y72A 5T3QA 4EK8A 3O2MA 2DKLA 1Q61A 3AMBA 3M1SA 3QQFA 2OJJA 3FLQA 4IC8A 3UMXA 3ZXZA 5KMLA 3GOPA 2UZWE 1DAWA 4YSMA 2PUUA 5DHJA 4HVDA 2OF2A 5EK7A 2UVYA 4YLJA 3OXTA 2R0UA 2WQBA 3ZTXA 1XBBA 4FF8A 5L6OA 5FEDA 2VWYA 4DF3A 3PJCA 4IX4A 2BRMA 5HD4A 3SW7A 4M13A 4D2RA 4ZK5A 4XS2A 1OKVA 5HTCA 3OT8A 4FV5A 5AUYA 4O0WA 4ZAUA 3F5XA 5KMNA 3F3TA 3OFMA 5C8KA 3TG1A 4FEWA 2OXXA 2QO2A 4ZTRA 3WF8A 4H39A 5EKOA 3DGKA 4X21A 1PYXA 1Q8UA 4P5ZA 4O22A 3FYKX 1ZOGA 2R64A 1TKIA 2X2MA 4DFLA 2PPQA 4CRLA 3R9RA 4XLIA 2I0YA 2QO7A 3TIYA 4FT7A 5H8GA 5HKMA 3SOAA 4I5MA 3E8DA 2BAQA 1BL7A 3PXZA 4YJPA 2F7XE 5CEMA 3UZPA 1OIUA 4EK6A 4Z3VA 5FTOA 4YZNA 1DAYA 3A8WA 3R73A 3DBFA 2PMOX 4TYJA 1PY5A 2WTKB 3OUNB 2QNJA 4DEIA 1HT2E 1IFYA 1PMNA 2VWUA 3QC4A 4KIOA 1ZMVA 4LV8A 4B8LA 4TZRA 3BYSA 3PJ8A 4C4IA 3SHEA 3TDVA 2OJIA 2WTCA 4TN6A 5B7VA 4ACHA 3DB8A 2BFXA 2BZIB 3FHIA 3U4WA 3OEZA 4AOIA 1WBVA 3OROA 3UOHA 3MVLA 3QLGA 4R8QA 3AMAA 3VS7A 4EUUA 3GUBA 3QX2A 5AUVA 3NYXA 4RC4A 3V01A 4AFJA 2ITQA 4TWPA 4ID7A 5HG9A 2IW8A 5AV1A 3U87A 4CG9A 2YM4A 2P4IA 2J51A 3C4XA 5CVFA 3VS2A 3PVBA 3RNIA 4KNBA 3FMEA 1YW2A 1M52A 4AOJA 2Y8OA 2JY6B 2I0EA 2WTWA 3KXHA 4IX6A 3DXNA 3R83A 5C03A 1OTRA 3ANRA 4CFVA 3NDMA 3VC4A 3QTZA 2JKOA 4K33A 3K2LA 2QC6A 1ZYDA 1WGNA 3IG7A 3HV3A 3LVPA 1Y57A 3TNIA 3BWJA 5KHXA 4QP4A 2ZMCA 2C1BA 5GINE 3H0YA 5HVKA 3LHJA 4D2TA 3SDJA 5BVEA 3VN9A 3R71A 3DBDA 2EVAA 3BE2A 3QXPA 4QQTA 3U6HA 2Z7LA 3QX4A 4FEQA 3MY0A 3O23A 2W05A 5ICPA 1KE7A 1JNKA 4BDKA 3DU8A 3Q04A 3NIEA 1NV8A 2PVYA 2OO9A 2VTHA 3CKXA 4RJ8A 4WA9A 5E8XA 4ZJVA 3UQFA 2FH9A 4QYHA 2KULA 3Q3BA 4RT7A 1VJYA 3PTGA 3LFFA 4FV0A 4ANBA 4BKJA 3QTRA 2B7AA 2J6MA 2ZVAA 2Z02A 3ATSA 2JDVA 5HE2A 2IN6A 5GJGA 5HE1A 4HW7A 3C4CA 4FVPA 4E20A 4EQCA 2JUJA 4DBXA 4TYHB 3DDQA 4I24A 4W9WA 5ACKA 1H8FA 4QMSA 3MH0A 2XKDA 5TR6A 4C57A 3SRVA 5HBHA 1B39A 3IW5A 2QI8A 4QMVA 2RFNA 5DH3A 3FI4A 2J0LA 3VS0A 5AM6A 2ZM4A 1XO2B 3Q53A 4EYJA 2V62A 2GHGA 3VRYA 4FICA 2GHLA 2QKWB 2VGOA 3FL4A 4L3PA 4WT6A 4IAFA 2EB2A 4BDHA 2ITYA 1ZOEA 2ZDUA 1KV2A 5BQ0A 3CD8A 2GNIA 4FVRA 4R7BA 2WMVA 3LFDA 2G2FA 4NJDA 2WFYA 3VUIA 3KN6A 2YITA 3BRBA 4LV5A 4G1WA 2XJ0A 4DT8A 3KN5A 4X3FB 4K2RA 4FSZA 4U9AA 1H4LA 1GIJA 1ZYLA 4L00A 1OIQA 3LMGA 4RWKA 4DFXE 2G2HA 4Q7JA 1OZ1A 4MXXA 2H6DA 2W1DA 5LXMA 3OMVA 3QHWA 2W1FA 4R3PA 3HX4A 2R9SA 4S34A 4C4FA 3F61A 4HYSA 1ZYJA 3MJ1A 4N0SA 2XRUA 4RX5A 5DEYA 3CGOA 3ZSIA 2YACA 3P23A 5E8WA 5G6VA 3BKBA 1WMKA 2WU6A 3LXKA 1SM2A 5CEPA 2RIOA 2VD5A 4K77A 3GU7A 2ZOQA 4WBBB 2J0KA 3DT1A 1GNGA 4IC7A 3L9NA 3WOWA 1J1CA 1WBWA 4GMYA 4ZZMA 3FPQA 2XIXA 3PXQA 3MWUA 3DAJA 4L67A 3GLFE 4CFXA 3TXOA 4CTCA 2ESMA 4PPCA 5AIRA 4NM5A 3T9IA 1F5QA 2PE2A 4FMQA 3K9PA 3JXWA 4I94A 2QG5A 5IEYA 4TKSA 1V1KA 4A4OA 5CY3A 4CNHA 3CE3A 3PE2A 2J0JA 4Y46A 3REPA 4ZMFA 3IOPA 2WZJA 1HCLA 2QLQA 3GB2A 3TI1A 2PE1A 3VVHA 4PL3A 4I23A 4O2PA 3UC3A 4ALUA 1IRKA 4G16A 4YTIA 5HX8A 4UY9A 2HK5A 4JRNA 3OT3A 1G3IA 3KU2A 4IBMA 4ZY6A 1W8CA 3FWQA 3MFTA 4NFMA 4U0IA 4K0YA 2IW9A 4E6CA 4PNKA 1DI8A 3JS2A 4TNDA 3HDNA 3VUMA 3H10A 5JSMA 1JQHA 5C4LA 2XYNA 2X0GA 4FNWA 4MXOA 3UVPA 5AA8A 2CJMA 1OL1A 3CLYA 3OCTA 2W06A 4HGEA 4JX7A 4Z9LA 4AGCA 4BY9E 3KRXA 2DHYA 3KRWA 4F64A 4FTLA 4ZZNA 1RJBA 2XCHA 5AUZA 4QPMA 1QPDA 3F88A 5JGAA 1NA7A 5AWMA 4XYFA 3HECA 1JBPE 1BKXA 2J2IB 3QD0A 2VGPA 3MFSA 4ANNA 4KSQA 4W9XA 2LTUA 2A2AA 2QOLA 5H2UA 4GU9A 5AR8A 4L44A 4YP8A 3HAVA 4R5YA 4C34A 3Q4TA 2QVSE 2CGVA 3W2OA 1XKKA 4O21A 4BGGA 4DG0E 2PZRA 3FPMA 3ZEPA 3W2CA 4BTFA 2FO0A 4I20A 4RFYA 1PXOA 5IMXA 5B0XA 1IAJA 3ZLXA 4IM3A 1Y8YA 2AUHA 2Z7RA 4FL1A 1PJKA 2PZIA 3V3VA 3IHPA 4BDEA 3R8PA 3HRFA 3D0EA 5FXSA 3AT3A 4WUNA 2OH4A 1ZWSA 4L9IA 4O1PA 2VWXA 2YA9A 1NV9A 3ANQA 2WMAA 3PJ1A 2BVAA 4MD8E 2UW6A 2WEVA 3F82A 4C2VA 5HNIX 4MNEB 1I44A 5HLNA 5L6PA 1KOBA 2OU7A 1ZY5A 3IONA 4IDVA 3U8WA 5CAOA 3T3UA 4M84A 2J9MA 4XP0A 4ZJJA 3UOLA 4HPTE 3I7CA 4J8NA 3F7WA 4O6EA 4EBVA 5I9WA 4GUBA 3A99A 4QTDA 2C47A 5LMKA 2WMBA 4FBXA 4KSPA 1PXPA 4RWIA 1P3QQ 3LFSA 4QQ5A 5FRIA 2J90A 4NU1A 3OW3A 4DH7A 4AXAA 3C50A 4J53A 1OKSA 2VO7A 4FSNA 2JDOA 2XNOA 3PLSA 4GG5A 3ZC5A 4DN5A 4YU2A 3NW7A 4AZFA 3FY0A 3NUUA 4UMRA 3FZOA 5CYIA 2HW6A 3MIAA 4ZLYA 3F92A 1NVRA 1YOLA 3IS5A 5H8EA 3DOGA 3ZUTA 3F2RA 5JKGA 3TWJA 4FSRA 3QA8A 4Y5QA 3HA6A 3ZLSA 1ATPE 4AGWA 4LRMA 4DHFA 5GIOE 3PXYA 4G3CA 3UQCA 4E73A 4F7LA 4F63A 1YDRE 1A9UA 1KE8A 2C0IA 2WXVA 2W4OA 2YERA 1DO0A 1XB2B 5EOLA 2QU5A 3AD6A 3AC2A 3TZMA 4BI2A 2UZLA 4GK4A 2Q0BA 3JY0A 4S31A 4AN9A 2ITTA 3DJ6A 1U54A 4CFWA 2JLDA 4NM0A 4O0SA 2O2UA 3B2WA 4JRVA 3UO4A 2ITVA 4M0YA 2YAKA 3TNHA 4BBMA 3C4FA 4O7ZA 3OY1A 4ZY4A 4DGOA 4FNZA 5ETCA 3EYHA 2HAKA 4RMZA 4YTHA 4MH7A 1XQZA 2FVDA 2QOFA 3R6XA 5DR2A 3R9HA 2RG6A 4KAOA 3VRZA 2QD9A 5GZ9A 1XH4A 4F6SA 5IF1A 4XV3A 1URCA 3KXNA 4F9CA 1HT1E 3ATTA 4FZAB 3KREA 4H3BA 2WU7A 4DGLC 1CM8A 1M7NA 3ACKA 4I21A 3F5GA 3M42A 2XUUA 4D4VA 5BX0A 3LZBA 4J97A 4FTMA 4V04A 4CMTA 4GJ3A 3V5TA 4AZVA 3FLNC 3BU3A 3KQ7A 4FTIA 3P4KA 5HLPA 4JBPA 1H07A 4MHAA 3MPMA 2Z8CA 2BKZA 3IW6A 4D55A 5DRDA 2BRGA 3DAKA 4L52A 1CDKA 5D10A 2O25A 3DBCA 2Y7JA 4CKRA 4YNOA 5EI2A 5AR3A 5FEQA 3VNTA 1OIRA 3GBZA 4CKJA 2CGXA 4XG9A 1W84A 2XKFA 2C1AA 5K0KA 3NCZA 1OGUA 4V05A 1UWHA 5A6NA 4JBOA 3HV4A 2CLXA 4B99A 3CBLA 4TRLA 2UW5A 3QWKA 4D2SA 2P2IA 4FSTA 4PDSA 3ZM4A 3QL8A 2HW7A 2X8EA 4FV7A 4GK2A 4MWHA 3GT8A 4XJ0A 3C7QA 2JY7A 5BVOA 2OSCA 3LJ0A 2PVHA 1GZNA 2UZVA 1VG5A 1OBGA 1WGLA 3EKNA 2B53A 3D9VA 4XUFA 4BWKA 1WR1B 4RVMA 3GLIE 1QPCA 3PA3A 4HVGA 2E9VA 3QTUA 3HUBA 2YEXA 4BC6A 3G33A 3TDWA 3FMDA 2VRXA 3BZ3A 2R3JA 4KRCA 2CCHA 4EH3A 4OUCA 4ANSA 3BEGA 3F3ZA 2C3LA 4TPTA 4CRSA 4DA5A 3E21A 2XZSA 3F3UA 4O6LA 4BDDA 2BTSA 3EL8A 2BZJA 3OC1A 4G5PA 3PSBA 2CP8A 3MS9A 4QMZA 3KKVA 3LFQA 3BBTB 5E4HA 3Q52A 4MF1A 1Z5MA 3FJQE 4U3ZA 3ZS5A 4UV0A 3O17A 4P7EA 3B2TA 3JYAA 4QP9A 4R3CA 3TIZA 4C3RA 4QMQA 4BI1A 3RMFA 4IJ9A 5DFLA 1APME 2GS2A 3CKWA 1IA8A 2VTIA 3KF4A 3LW0A 3MH2A 4ZP5A 1KE6A 3K5VA 5CSWA 3EHAA 3O8TA 3P0MA 5EFQA 1GIIA 4EK4A 3BHUA 4AT3A 2FSLX 2YIQA 3MBLA 5IMEA 4CYJA 2HZIA 3O51A 2W17A 3JUHA 2XKCA 2C5OA 4IWPA 3TKUA 3FUPA 3HNGA 4F1MA 4IXPA 3E3PA 2H96A 2DQ7X 5EHLA 4E4LA 1OPLA 4FKWA 2R3KA 4FOBA 1PMUA 3KB7A 4YJOA 2HYYA 2BROA 4X3JA 4IVDA 3U6JA 2OH0E 3RI1A 1KOAA 4IEBA 4NWMA 5K9IA 1VQ1A 4BCGA 2GNLA 3LFBA 2HZ4A 1P14A 3GCVA 4IWQA 5IUHA 1ZV1A 2B55A 3D7TB 4FTRA 4MX9A 4D2WA 2R3NA 3Q9WA 1A48A 1SVEA 2H8HA 4EOPA 3FZ1A 3A8XA 4GYGA 1H28A 4FIIA 1LP4A 5FM2A 2A27A 2CGUA 4JX3A 3HRCA 3VBTA 2PWLA 4WP2A 1Y91A 1IR3A 2IVSA 4AN2A 4CT2A 4ACDA 4PTGA 4PPBA 4R5SA 1H00A 3IGOA 4G2FA 4IFCA 3PSDA 4X2GA 5CI7A 4F7SA 4KIPA 3MB6A 5KKRC 5EM6A 3PYYA 3RAKA 3VAPA 4BL1A 5CSXA 4FX3A 4K18A 3V8TA 3VBVA 4BZDA 4KIKA 3RPYA 5I4NA 5H8BA 2W99B 3KA0A 5L2TA 2WTIA 4K8AA 1DM2A 1LR4A 3OS3A 4GEOA 4O2ZA 3HDMA 5E9EA 4RJ3A 3WF6A 4APCA 3KRJA 1G3NA 3E93A 3EFKA 4NKSA 5LMAA 3U9NA 2AC5A 3H0ZA 2C6IA 4PMMA 2QQ7A 4EOSA 2C3KA 3PSCA 4YTFA 2E9NA 3V5WA 1Q8WA 1OL5A 3GU8A 3AC4A 1Q24A 1XJDA 3LCOA 4IB3A 4C3FA 4MEDA 4QMWA 4EOOA 5IA4A 3LKMA 4IWDA 4EEVA 4QMXA 2CLQA 2H9VA 4RIYB 2OZOA 4F7JA 3FMHA 2E9OA 3LCKA 3FLYA 4IMYA 3O8UA 3R7IA 3TJDA 4XOYA 4AGDA 3HAMA 2YAAA 4BBFA 5B2LA 5EHOA 2BPMA 3FAAA 2W1GA 3KXGA 4DGMA 2YDJA 5EM7A 3R7UA 4M12A 3TZ7A 4C4JA 5E91A 5F94A 4IZAA 4GW8A 3CC6A 1BI8A 2G01A 3LLTA 5CNNA 2HCKA 3BU6A 5IA2A 5CQWA 2YJSA 5IU2A 1Q3DA 4EH2A 3QBNA 4EC8A 1VDLA 3QKKA 3BBZA 1REJA 3PRIA 2I0HA 4FKJA 3UNKA 1JWHA 1XH8A 3SW4A 2XIYA 2LVQD 3IGGA 5K4IA 2JDRA 2OICA 4ZJIA 5FTGA 2VWZA 3FMKA 3FQEA 4S33A 3VBYA 4G5JA 2O0UA 5KBRA 1Y6AA 2FYSA 2XJ2A 3M2WA 1K9AA 2OF4A 4YHJA 5A4EA 5FXQA 3A60A 1YI3A 2BZKB 1A5TA 3H4JA 4FZFB 4NSTA 5AP5A 4U3YA 2ZAZA 4ALWA 5E1EA 2PVJA 4WNKA 4CQEA 2HWOA 2CKEA 3GU5A 3OBGA 4GEWA 3Q9XA 4ACMA 4HEOA 3PWYA 2W5HA 5EW3A 4DCAA 4FZ7A 5T68A 1U5QA 3FKOA 1GZOA 4TNBA 1IXSA 2XK9A 4IWOA 4CMOA 3SXRA 3BIZA 3VS5A 1BX6A 3EH9A 4I6FA 2QOKA 2PVMA 3E5AA 3H9FA 4L43A 3UE4A 4QPSA 1R0EA 4W4WA 4ZXTA 5FQDC 4ZZOA 4FYNA 3ZDUA 3ZBFA 3GFEA 5JK3A 2VUWA 3TACA 3DFAA 3WF7A 4F9WA 4O7WA 4DT9A 2X9FA 4CV8A 1OL2A 5ANIA 3BCEA 4IM2A 2IO6A 4TYGA 5EM5A 2XK8A 3OXZA 5HORA 4QYEA 2GQRA 1H01A 3QQLA 5D12A 4X2JA 2CN8A 4XRLA 4XP2A 3TUCA 5C01A 2O64A 4JG6A 3P08A 2GMXA 2HWJA 4NTSA 4UALA 3HRBA 3WE8A 5LVPA 2B1PA 3QTSA 4RA5A 4CZYB 2ZB1A 4P90A 4MXZA 4OBQA 5A4LA 4YZBA 4J8MA 2I0VA 1YHVA 3FRIA 3I81A 3K5UA 4XBRA 1QPJA 3L8VA 3D4QA 3QQGA 1ZYSA 5EQEA 4QTBA 3D94A 5E8YA 3ENHA 5DEWA 4LRJA 4ZY5A 5M4FA 4BCFA 5CT7A 3D83A 3WZEA 3DS6A 2GHMA 1PXMA 4G6LA 3ZO3A 3HMOA 3LCVB 5CEIA 3OP5A 3K9OA 3QYWA 3EL7A 3FHRA 3EQPA 1ZZ2A 4FKVA 4KD1A 2EU9A 5TO8A 4O7NA 4YBKA 5A6OA 4YJSA 1T6OA 3RWQA 2YCRA 4XX9A 3Q9ZA 4HCVA 3UP2A 2W9ZB 2BALA 4KKGA 4MCVA 5D7VA 1KUTA 4FV8A 4ONAA 3GNIB 3ZEWA 1XH9A 4O84A 1Q02A 4BRXA 1YDTE 3VHKA 3KEXA 3TEIA 5D7AA 4BWXA 2I7QA 5IA0A 3CQUA 4FT0A 5IG1A 3FC1X 4MXCA 4XG4A 1REKA 4L3JA 3W16A 2W1ZA 4U42A 2CNVA 1FGIA 2GTMA 1PKGA 4M0ZA 5AV3A 4E5WA 4FTQA 2KHHA 4GIIA 2W7XA 3OG7A 1U54B 2HENA 5DG5A 4EYMA 4R71A 2CNUA 3PZEA 1OM1A 1H08A 3EN5A 5CX9A 3CGFA 4V0GB 2P2HA 2PY3A 2QONA 3PJ2A 3OUKA 4PY1A 3OCSA 4Z55A 4E7WA 3SC1A 3I5ZA 3NSZA 4RZWA 2VO6A 2WHBA 4XEYA 4MYGA 3NNVA 3UZTA 3VBWA 1NW1A 4PDOA 4ZOGA 4D2PA 4F7NA 3FMNA 4F65A 5AV4A 3IECA 4USDA 2XEYA 4RQVA 4AE9A 5CALA 4X7QA 2X1NA 4JDKA 2ZDTA 4CZUA 2WMTA 3CPCA 1UNHA 2BUJA 5DVRA 3GFWA 2YCFA 5JZJA 3DKCA 4FR4A 4Y95A 3SD0A 4CVAA 3TV4A 3UIMA 3EMGA 3FBVA 3QXOA 5AEPA 4BGQA 2ZYBA 4JBQA 5AX9A 3NYNA 1QZEA 5HG8A 3FY2A 4RLKA 3PA5A 4RX7A 3LMIA 3F6XA 4WRSA 5C9CA 3ULIA 4DH5A 2WIPA 5C8NA 1NT2A 5J9ZA 5L4QA 2RRUA 4ZIMA 5CAQA 5IDPA 4O7VA 3VS4A 2XNGA 5ITAA 4I4EA 3V8WA 3DXPA 2XNBA 3NUAA 5HVJA 3R00A 3WILA 3VHEA 2BHEA 5DE2A 4I6BA 2KNVA 3PWDA 5CS6A 4U81A 4EOJA 2C6OA 4G3OA 2Z2WA 4G3FA 4UN2B 2C5YA 5HG7A 3GXLA 3Q9YA 3DK6A 4YZCA 3VF9A 2EB3A 1F0QA 3IOKA 4FG8A 5D1JA 2HZNA 3EIDA 4ZMEA 3WZDA 1V0OA 1G8AA 2BWBA 1IASA 3VBQA 3IPHA 1ERKA 4E3CA 1YKRA 3NGAA 1JKKA 4K1BA 1UA2A 4J52A 4O27B 3RPSA 4QNAA 4BGHA 4HYUA 5JT2A 2R3PA 2WQEA 3BGZA 4BCHA 3UVRA 4ZSEA 1YOMA 2VO3A 3IKAA 3L8XA 4FNXA 4L7FA 4E26A 2F7EE 2J0IA 4FV4A 2DAIA 3VUGA 5KMMA 2VTJA 4EHVA 3R9DA 4CT1A 4UWBA 5HEZA 5KMIA 3C13A 4FSWA 3N4VA 5FWKK 5GJFA 2VTAA 4FL3A 3FSKA 5EKNA 5LVNA 2J5FA 4GL9A 4NKAA 1OL6A 3QCQA 3K3IA 3G2FA 3RCDA 4D5HA 2Z7SA 4U40A 2W1IA 3TKHA 4E6AA 4RX9A 4TW9A 4UMTA 4AZWA 4B6LA 4UX9A 4IZ7A 1WVXA 4ZTSA 4ENYA 4DEGA 3S1HA 4Z7GA 3QUPA 3KRLA 5A46A 2WEIA 3ZLYA 3WZUA 3D15A 2QLUA 2QOQA 3KL8A 5EG3A 4EQMA 3Q6WA 2PUPA 4XV9A 1WVYA 4IFGA 4JL9A 1J7UA 2QKRA 4YZMA 3MN3A 5BYYA 1KE9A 5I9UA 3BLRA 4XBUA 3ZO4A 2JD5A 3ZBXA 3OWJA 5HE3A 3D2KA 3HP5A 3QGWA 4G34A 5KMKA 1FVTA 5L3AA 4NCTC 3AXWA 1LEZA 3WZJA 4PP7A 4IHPA 3DJ5A 5CU4A 3LXPA 1BYGA 4KS7A 3QD2B 3TUBA 4NT4A 2GDOA 3ZSGA 3P7BA 4QMTA 3L9PA 1MUOA 3H9OA 2F7ZE 4PNIA 1UU9A 3FLWA 3OY3A 3L1SA 4J95A 2PZYA 3WZKA 2CKQA 1GZKA 4L8MA 4A9UA 2XBAA 4BHNA 2BHHA 4MBIA 5FP5A 4UN0C 1E1VA 3LQ3A 4AE6A 5HLWA 3T3VA 4W4XA 4J1RA 4G3EA 4JQEA 4AACA 5I0BA 3SOCA 3KY2A 4EK3A 1JSTA 4BCOA 4XCUA 2CNQA 3ALOA 5HHWA 5AR5A 3BV2A 4JDJA 5HIBA 3PDTA 4CQGA 4IJPA 3QRTA 4TL0A 5IQBA 3R7YA 2R3MA 2XIZA 4IB1A 2PZ5A 2SRCA 4GSBA 5E8VA 4LQMA 3TV7A 1MP8A 5JFSA 5IQEA 2B4SB 4ZS4A 1DS5A 2VTTA 1H1WA 4YNEA 2GNFA 5CZIA 1QPEA 4AAAA 3OF0A 4D9UA 1V92A 5CXHA 4KABA 4BCPA 2J7TA 5LARA 4PMTA 3UOJA 4LYNA 2FSOX 4M15A 5LCKA 5JFXA 2C6LA 4FZDB 1GY3A 4C59A 4QMYA 5KNJA 1SZMA 1VYWA 4R7IA 2RSVA 3UIXA 3ITZA 3KXXA 4NZWB 2WOUA 1S9IA 4IZ5A 3ZHPC 1ZY4A 4EOKA 3RP9A 2KTYA 3QU0A 4CMUA 5AUWA 3ENMA 2JFLA 4OBOA 4GFMA 4L3LA 5FG8A 1ZAOA 4C33A 4D4YA 3DNEA 4ZSJA 5EDRA 3UNZA 5CVHA 2QOBA 4PMPA 5T6KA 1P4FA 3OTUA 2VTLA 3QC9A 1QCFA 3S00A 1OPJA 1ND4A 2X4ZA 3S3IA 5CASA 4YHFA 2OI4X 2PL0A 3G0FA 4DEBA 2V55A 1O6LA 4ZTLA 4AP7A 2JY8A 5TF9A 5DA3A 5AP0A 3N9XA 4WKQA 4F0IA 4GKHA 5BYLA 3Q32A 1XBCA 5CZHA 3ROYA 3UO5A 4H05A 5K5XA 1ZARA 3GU6A 5CAPA 1CUKA 2Z7QA 5DLSA 5LMKC 3G6GA 5E92A 3HL7A 4KS8A 3EQFA 5K4JA 2XK6A 5JH6A 3LQ8A 3W2QA 2WQNA 5E90A 1SVHA 5ETFA 3G5DA 1HOWA 1OB3A 3D5XA 3W18A 4B0GA 2IVUA 2OZAA 3OBJA 2UVZA 3PP1A 4NCTA 4NIFB 5AP1A 5HE0A 2XF0A 3MB7A 3ROCA 3V5JA 1IA9A 2OFVA 4XH6A 4AA4A 5HIEA 5IA1A 3UTOA 2XP2A 4QYGA 4CZTA 2XBJA 1OAIA 3OCGA 4USEA 4F1OA 4AU8A 2PMLX 1FBNA 3V5QA 2HOGA 2YIWA 3OWKA 3FZPA 3L9LA 4HNIA 1PYEA 2HY0A 4X2NA 3I6UA 2DNAA 4RQKA 4OT5A 4BDAA 1YWNA 2VWIA 4U41A 3LM0A 4FKQA 2UZBA 3GVUA 4JG7A 1OPKA 4O1OA 2G1TA 5FLFA 5TKDA 2P3GX 4IQ6A 4N70A 5HO7A 2CDZA 5DIAA 2XCKA 1H27A 3TV6A 5KCVA 3S4QA 2QOOA 4O7SA 1VR2A 3W33A 5M4IA 3LXNA 2OIQA 3CXWA 2CWBA 2X8IA 3PIXA 2C3IB 3QWJA 3TNQB 4UMUA 3DTCA 1CSNA 5DYJA 3QYZA 4QMOA 3VO3A 2QHOB 4O0XA 4OTDA 4F09A 5ANKA 5BNJA 4FIJA 1H1RA 4RIXA 4DG2E 4NYEA 2Q83A 2ACXA 1C7YA 3F7ZA 4FGBA 2JY5A 2PTKA 3HEGA 4GVAA 2GU8A 3R2YA 2FB8A 1WIVA 4RG0A 2WQOA 4C4HA 5M57A 2LVAA 1S9JA 5IQDA 4R78A 2OXDA 1GIHA 1WHCA 3R1NA 4DAWA 2ZMDA 4FSMA 4EZ7A 3BLHA 4QQCA 4EWQA 4PL4A 3PVUA 4R7HA 4I6HA 3MY5A 3GC0A 4DTBA 2OBJA 5EOBA 1M17A 2V22A 2HWPA 5AM7A 3G90X 3Q96A 3DAEA 4ENXA 4DLIA 5J9LA 4EUTA 2GFSA 3EN7A 3VQHA 3UZRA 3EB0A 4Y5HA 4OTPA 4QMNA 4DC2A 3EN6A 4PQNA 3QF9A 4XV1A 2YABA 3BE9A 3CTHA 2RL5A 1HJPA 4MQ1A 5AR7A 2Z60A 4E5AX 3PFQA 2WTJA 3PY3A 4LL0A 4D0WA 1XH7A 4CFNA 2GNJA 3MA3A 4L46A 1FGKA 5HNBA 5IQAA 1DO2A 4B7TA 1ZMUA 1LPUA 2C5VA 3BHVA 4IADA 1FMOE 3LCSA 4GJ2A 1OIYA 3P1AA 4BDIA 2YDIA 3MPTA 1X8BA 4BDJA 5LWNA 3ACJA 4U7ZA 4TTHB 3LFNA 3KMWA 2F9GA 2E2BA 2L4FA 4FV3A 3W8LA 2C6KA 4XG8A 3LMHA 4FUYA 2L4EA 2ITZA 2X4FA 2XH5A 4M69B 5KX8A 5HZNA 5AP2A 4QP7A 3CR0A 2BILB 2C69A 3KF7A 3VW6A 3M11A 3Q4CA 3W2PA 5IA3A 3G9NA 5ANJA 3SV0A 2UZUE 3EQRA 4S32A 4DFUA 5CU6A 1Z57A 2R3QA 2YM7A 3C0HA 4Y73A 3R02A 4FC0A 4OTFA 4FZ6A 1OBDA 4F9AA 4CG8A 4CXAA 2ITXA 4FG9A 2RFSA 4ZEGA 1HQYE 2GNGA 4YJVA 5AJQA 3AQVA 5HNGA 3FYJX 3UDBA 4BCKA 4BVUA 4E4NA 5LWMA 4X6QC 3QRIA 4U97A 5DT4A 3RPOA 3UG1A 3VS1A 3BGQA 3TKIA 1OKYA 4IAAA 5KMJA 1K2PA 3ZRMA 5FUTA 2UZNA 5FGKA 3A2CA 3E3BX 2YM5A 3ODZX 4ZTQA 4E5BA 3KULA 1OI9A 3EQBA 3ORMA 4A4LA 4D9TA 4DFZE 4RWJA 5HBJA 3A61A 4HPUE 2V5QA 3WBLA 5F9EA 4ZSGA 4PUZA 3CTJA 4NFNA 4Q5HA 4YZDA 5FBOA 5BVWA 2W4KA 2HY81 4GRBA 4H36A 1WBNA 5KHWA 4JNWA 4FIEA 4M3QA 4RZVA 2VTMA 4QTEA 4IB5A 1PXKA 4Q2AA 3FLSA 2BCJA 3PE1A 2EUFB 5CU3A 1AD5A 4QTAA 2B9HA 4DEEA 3MH1A 2IVTA 4E4XA 4YJQA 5LMBA 2WTKC 3AOXA 4NM3A 3AT4A 4UB7A 5IKWA 3B89A 2JNHA 1L3RE 4LUEA 5AR4A 4NW5A 2O3PA 4FTKA 2BIYA 2X6EA 4UBAA 3ZUUA 1YLAA 4I4FA 2OJ9A 3DLZA 1K3AA 4MXAA 2ZB0A 3GQIA 4R1VA 5J5TA 3BWFA 5LVOA 4C4GA 3FZRA 2R3FA 3AD4A 4AOTA 5CAUA 2EKFA 4BDGA 3LCDA 1H1SA 3ZUVA 4LMNA 4RIWA 3LCTA 3SKCA 2UW9A 3KK8A 3COHA 4BIEA 3VUTA 3DBQA 3II5A 4LMUA 1RE8A 5KO1A 2PVFA 3ETAA 1Q4LA 5DN3A 4QP1A 2CHLA 1YHSA 2OJFE 4MWIA 1KYIA 2JZ1A 2A1AB 2RKUA 4PX6A 4KBKA 2JKKA 5DI1A 2B52A 3CY2A 1RDQE 4YC3A 3VW8A 3EQDA 4CCUA 1OKZA 1ZZLA 3QALE 2PYWA 1NY3A 4AW1A 2BRNA 3V6RA 3WI6A 5KBQA 4WO5A 3LFAA 2GQSA 4EH8A 3CCNA 4DGGA 4P2KA 5BMMA 4FSUA 3TCPA 1YI4A 5B2MA 4MBJA 4OR5A 2JFMA 3IW8A 2IVVA 4FIHA 5CANA 1J7LA 3FI2A 3C4EA 3QTQA 4G9RA 3D7ZA 2XRWA 3UYSA 1VZOA 4EOMA 2VWBA 4ZTNA 3NYOA 4OTGA 3QKMA 4U8ZA 3OD6X 5LVLA 1W83A 4QD6A 2VTRA 4FVQA 3WE4A 5FD2A 3PVGA 2ZM3A 4U5JA 5E8UA 3FXXA 2PUNA 5FEEA 4KA3A 4PPAA 5EYCA 5LVMA 2HXQA 2JDSA 3ZZEA 2YJRA 1J91A 5AIKA 4ASZA 4AW0A 3R1QA 4HZRA 4UYNA 5J9YA 2ITOA 3GCUA 3RM6A 1YXSA 4ITHA 5AV2A 2W5AA 5L2WA 4F99A 2VV9A 4GG7A 5BVFA 1H1QA 4WG3A 3NW5A 3UIUA 4W8EA 4MD9E 1BMKA 4IAYA 2RGPA 4DEHA 2Y0AA 1R4GA 2CGWA 4JG8A 4JQ7A 4QYYA 3UO6A 2VTSA 2IW6A 4O91A 3ZRLA 3U9CA 4RJ4A 4M66A 3ZDIA 1QMZA 5BUIA 4O7RA 4JAJA 4J71A 4U80A 2QHNA 3JR1A 5HO8A 4OTIA 3SRVB 5IEVA 3ZM9A 4BZNA 3AG9A 5M07A 3CD3A 2GSFA 4I92A 4M8TA 4FV2A 5CU2A 3GCPA 2F2CB 2OKRA 3ET7A 3LFCA 3NRMA 2ETKA 3HKOA 3QZHA 4I5PA 4YJUA 5CENA 3DNDA 4DYMA 2ONLA 4FEXA 2A19B 4ITJA 5D41A 4ZTMA 3QRKA 4P4CA 3UMWA 2C5XA 1XBAA 2XMYA 3E64A 3ORPA 3R63A 3C4WA 3LLAA 1W82A 4U79A 1VEKA 4FTCA 4FT5A 4BBEA 4R77A 4XHKB 2IZRA 2QG7A 5AFVA 3KC3A 4M14A 2OXYA 3NW6A 4USFA 3D5VA 3MGYA 3QAME 1J1BA 3QZGA 3UBDA 3TJCA 4ACCA 3LCUA 5IQGA 5DPVA 4DBGB 4FE2A 4HGLA 4O96A 4GH2A 4R1YA 3ZH8A 1JKSA 3DQWA 3FMLA 4UMQA 4D5KA 5L8LA 1H26A 3NLBA 2QURA 4LFIA 5HCYA 3FSFA 5HGIA 4EKLA 2OOBA 3MI9A 4H3PA 4OTQA 4DH8A 1JVPP 4CLIA 5I3RA 4WSQA 4EH7A 3UNJA 3BHYA 3TL8A 5GZ8A 4CKIA 2W1EA 5L6WL 3GI3A 1E1XA 3AC5A 1DV0A 2ITPA 3NX8A 3P78A 2X7OA 4AFEA 4BCIA 3MH3A 4RC2A 3RALA 3N4TA 4CTBA 4WSYA 4XMOA 3F69A 3CSVA 4CCBA 3EOCA 2WGJA 3AC3A 2LGCA 1NXKA 1BVSA 4FA2A 4HVIA 2WMQA 3NUXA 1W0XC 1ZXEA 4TXCA 5HCXA 1NVSA 3DZQA 5EDPA 3HLLA 3A62A 4RRVA 4E8AA 3BHTA 1Q8ZA 5L8KA 4TYHA 2JC6A 3ZFXA 4I6QA 3IDCA 4C7TA 3OOMA 4KKEA 4OLIA 2C5NA 4WUAA 5KZ0A 4PTEA 1PGYA 1UNLA 4DGNA 4G9CA 2P0CA 1WFCA 5AMNA 2C4GA 2VX3A 3HZTA 3RHKA 4FK3A 4EH9A 4O0YA 4Y8DA 4YUQA 1Q5KA 3LOKA 4S30A 5JEBA 4IVAA 4HYHA 5GJDA 3E8CA 1DI9A 2PE0A 3F5UA 2OW3A 4IZYA 3QCSA 4GV1A 2CKPA 2W1CA 2VWVA 1KSWA 3P79A 3RCJA 3AT2A 3CY3A 5L2QA 3WIKA 4MD7E 2X7FA 4ANLA 4OTRA 4ORKA 2JKMA 5EQYA 2WQMA 4QP2A 2OK1A 5BUJA 4ANOA 3BI6A 4RVTA 1GOLA 4RIXB 1JPAA 1CKPA 5DGZA 5HX6A 4BKYA 5AA9A 4MXYA 4EK5A 3RNYA 5IQIA 4EL9A 4LRKA 5J8IA 3VULA 4P5QA 4FEUA 2REIA 4HCUA 3DTWA 1SYKA 2QR7A 3EFWA 2IG7A 3PLAE 4Y85A 2CSNA 3ORNA 4I3ZA 3FKLA 3DJ7A 4KWPA 4MNFA 1XH6A 4FV6A 1H0WA 2JITA 3F2NA 2KNAA 4LOPA 4AS0A 2F57A 5DMZA 4C8BA 1YQJA 1ZMWA 4E4MA 1G4AE 3SQQA 3RBWA 4FTTA 3WF9A 3E92A 2WOTA 2YLEA 3KCKA 2WIHA 4J99A 1MRUA 2C0OA 3AC8A 5IPJA 3V8SA 2UW4A 3ZU7A 3N4UA 2RG5A 4FT9A 3Q5ZA 3RTPA 2VU3A 3F2AA 4J96A 4GU6A 4DTKA 3R1YA 3PG3A 3QZIA 5KUPA 4I0TA 2WTVA 4RVLA 1CTPE 3E63A 1IM2A 1SMHA 3BGPA 4RFMA 4EZ3A 3D5WA 1OMWA 1EH4A 4GVJA 3R21A 5AP7A 1OQYA 3OWPA 2FSMX 3R8UA 2PVNA 3W8QA 1H24A 4BCMA 1R3CA 3K54A 3DXQA 3MVJA 4TT7A 4UXQA 3ZO2A 3HV7A 5HIDA 4F9BA 5CT0A 3PIZA 4FTOA 4O7TA 3DDPA 2R3HA 3MA6A 4A9RA 1GJOA 2XNNA 1TQMA 2R7IA 4QO9A 5LOHA 4XRJA 3VS3A 2IPXA 2B9FA 3MTLA 3I0OA 1YXUA 3I5NA 3MJ2A 4G31A 4A9SA 4XG2A 5IQCA 1CKIA 4WOVA 3KRRA 3ZYAA 3NVMB 2YZAA 5D9HA 2LAVA 4JJRA 4F70A 3A7GA 2PMIA 3QCYA 5CLPA 5EYMA 2O65A 3A4PA 5I5ZA 1KE5A 2X39A 4GT5A 4ANMA 3UJGA 4OTWA 5FXRA 4KIQA 1P2AA 4F1IA 3QQKA 3VUKA 1V0PA 3WYXA 1TR8A 3NNXA 1KWPA 2E9UA 1PMEA 3D14A 3C51A 3SX9A 3FKNA 2QOIA 2ITUA 2R2PA 4PTCA 1VEGA 4ERKA 4DFYA 4UXLA 1PXIA 2G9XA 3RPRA 4DBNA 4H1JA 1BUHA 2B3TA 1FVRA 4D1ZA 5L2SA 3PY1A 4EORA 2PUIA 5EHYA 3PXKA 2BR1A 3GLGE 4NTTA 1WAKA 4O0RA 3FMMA 1FQ1B 1Q99A 3MIYA 1W7HA 2BDWA 2EWAA 4D1SA 4MNEA 3DB6A 3H3CA 5AUUA 2OWBA 3QTXA 5L2IA 5HO6A 4AT5A 4FIFA 1UVRA 1A06A 3OHTA 3OXIA 1Y6BA 2CN5A 3TT0A 1YRPA 5DWRA 2NRUA 3HUCA 4L01A 5AADA 3TUDA 3K3JA 3NNWA 3ORKA 1TVOA 4MBLA 3MSSA 4OTHA 4ZLOA 5E8ZA 3VUDA 3I60A 4GCJA 2XM8A 3QQUA 1UNGA 5CF5A 4N57A 3SG9A 3GU4A 3RAIA 2DAMA 4G17A 4JVGA 3DY7A 5FP6A 4UZHA 5ANGA 4WHZA 2EXMA 4HCTA 4K11A 3LPBA 3KGAA 1UV5A 1PHKA 2UW7A 2ZV2A 3NEWA 4GFOA 2ETRA 3UC4A 2FGIA 2ZV9A 3DA6A 5CF8A 4O81A 1YOJA 4XG6A 3P5KA 4L53A 5ANEA 3QFVA 5CI6A 3F66A 4E6DA 4YO4A 5GNKA 2PU8A 4PRJA 3CP9A 2WMWA 4EHEA 4F4PA 2PK9A 1R78A 3SXSA 2HELA 1VEJA 5EH0A 3DZOA 4FK6A 3R01A 4KBAA 3D2IA 4UWCA 3POOA 4LUDA 2K0BX 3QGYA 2LBCA 1WBSA 4ITIA 5EI6A 4YMJA 3R8VA 3W55A 4LGGA 2NO3A 3C1XA 2BFYA 2JDTA 3ODYX 2ITNA 2PVRA 1AQ1A 5F95A 4AWIA 3EN9A 4CD0A 4QOXA 3THBA 4BYIA 4HZSA 3R7OA 3PXFA 4JQ8A 4KRDA 1Q97A 2UZEA 1UU7A 5JRSA 4C4EA 4EI4A 3TZ9A 4F6WA 5M4UA 2BAKA 3LIJA 2GS7A 4FL2A 3R04A 3PIYA 1BI7A 2UW0A 2PZPA 4AW2A 2NNWB 3ORXA 2DS1A 2F2UA 3R28A 4H58A 4RGJA 5EI8A 4CFUA 4ZLZA 2XA4A 3MFRA 2R5TA 1ZYCA 4W4YA 4C58A 4EWHA 2ZV7A 4RJ7A 4MF0A 4I0RA 4L7SA 3FRHA 3NIZA 4YLKA 4TWNA 2A4LA 3N51A 1WZYA 2AYPA 2UW8A 3NAXA 3G6HA 4H3QA 1JAMA 3GEQA 1UU3A 4QMMA 4U45A 4KINA 4YSJA 3QD3A 5HD7A 3R7EA 4F1TA 3LXLA 2BZHB 3QLFA 5DR9A 2XYUA 5CEQA 1JR3E
chains in the Genus database with same CATH superfamily
1TF0B 3WIGA 1JKTA 1XWSA 5BVKA 4FKRA 3R7GA 3Q8GA 5J7BA 4QNYA 2B9IA 3U51A 1N75A 4AW5A 3LQRA 4FTJA 5FM3A 3Q4ZA 4BDFA 2JBPA 4F0GA 1T45A 5IQFA 3RHXA 4FKPA 2A98A 3VJNA 4L6QA 2DHRA 3U6IA 2FA2A 3GGFA 3HGKA 5KZIA 3PXGA 2YWVA 3T38A 3WARA 3POZA 1IEPA 3MPAA 2GS6A 4EOLA 4KBCA 4HGSA 2A0CX 1TQIA 3GC8A 3QQHA 1JOWB 3TM0A 1H6UA 5EYDA 2BWEA 4LF4M 4GRIA 4FSQA 4RX8A 3BHHA 3FXZA 1MN3A 4HGTA 4HOKA 4GIHA 3RJCA 4GKIA 1TDZA 5A9UA 1AIPC 4L42A 2E9PA 5KKRB 2QZ4A 2NP8A 3E88A 4DHZA 3KFAA 2GCDA 2ERZE 3T9TA 1TZDA 1OECA 2YDKA 4N4SA 4RBLA 4FCTA 3FLZA 4CFFA 1QQWA 1F4IA 4BN1A 4JIAA 2P5TA 4QP8A 3GC9A 4LV7A 4A9YA 5A4TA 1U59A 4M7IA 1XXHE 2Y6MA 1V33A 3GLHE 3RGFA 3SAYA 5CTPA 3FC2A 1JSVA 2OLCA 4DH3A 1IN8A 1OIPA 1JLUE 2UV2A 4ARKA 3FZTA 2YN8A 4QPAA 3QQJA 3I79A 2LHCA 4ZSLA 3QRJA 1J7IA 2OOAA 4WD5A 3S95A 4FKOA 2YM8A 5BMSA 2P55A 3JVRA 2QODA 3O0GA 2YFQA 3ZRKA 3NBXX 1NO1A 5ETIA 3CJGA 1XNQM 3GENA 3MY1A 1Q41A 4HJOA 4MVFA 1UKIA 4YC6A 4BF2A 4RPVA 3ZLWA 4M67A 4L68A 5HOAA 5J95A 2ZTCA 2IZTA 5M44A 3SGCA 4QHTA 4V0GA 3RPVA 3ULZA 3RVGA 1EE8A 4FW9A 4YJNA 3VUHA 4GFGA 2G15A 4GT4A 3B7QA 3LAUA 4FYOA 3FYCA 4BHZA 1FINA 1Q3BA 3MMPA 3GCSA 1VEBA 5JQ5A 5HESA 2I40A 4LF7M 2X0PA 4QHSA 3O8PA 3I4BA 4NW6A 4LM5A 1M2QA 3HYHA 3HV6A 4B3TM 2UU9M 2R0IA 2WMRA 5DNRA 5C27A 5IA5A 1XMQM 3CS9A 4C0TA 2HIWA 3BYOA 2YIXA 2QSFX 4UWYA 2WMUA 3OEFX 3QZFA 3R2BA 4IVCA 5BYZA 4JXFA 3U54A 4D28A 3LJ1A 2OG8A 2QCSA 2QR8A 4Q9ZA 4UZDA 2I6LA 2R3IA 4D58A 3U6CA 4EHGA 4JDHA 2F4JA 3EFLA 3M7GA 2DAGA 1PF8A 3BPRA 4II5A 3FYDA 3NYVA 1IBMM 4LOQA 2PVLA 3MJ5A 2QOHA 5A54A 2IZSA 4IIRA 4OBPA 5BVNA 1H1PA 5A14A 4W8DA 4FD2A 5L8JA 2YM3A 2Q0NA 4F0FA 3ZXTA 1JQJC 5JI2E 2LH0A 3ZCBB 4M97A 1YXTA 2F4VM 2V0DA 4L78A 5HQ0A 2YZLA 3NUNA 3V6SA 2WELA 5TOZA 2GTNA 4DFNA 3DPKA 1W2CA 2UUEA 3A7JA 4JAIA 5M56A 2CPKE 4FKSA 3F3VA 1Z9XA 1G5SA 3J2PB 4QT1A 3SATA 4LF8M 1SVGA 4NIFA 5B2KA 5CU0A 1YXVA 2GPHA 5DT3A 2RFDA 3PPJA 4I93A 2P33A 1SG9A 2J5EA 3EQHA 3QCXA 3DKGA 3RK7A 4D1XA 4D4RA 2XB7A 3HZJA 3I01M 5HTBA 4YO6A 1OUKA 3ZO1A 2DWMA 5M08A 4EJ7A 3RAWA 3MVHA 1WVWA 2XNPA 3OWLA 2Z4RA 3UJNA 1PW2A 2C96A 5JFWA 4CSVA 4IANA 4GK3A 3MV5A 3BYVA 5HICA 5K3YA 4RIWB 3PJ3A 2EKKA 4L45A 3C0GA 5DOSA 3T8OA 1SXJC 1SNUA 4XG7A 2FSTX 1VYZA 4IIWA 4C37A 4D81A 2DKLA 3FLQA 3GOPA 4X62M 2PUUA 5DHJA 2OF2A 3ZTXA 1XBBA 2VWYA 4DF3A 3PJCA 2BRMA 4ZK5A 4FEWA 1Q8UA 4P5ZA 2R64A 2X2MA 3R9RA 2I0YA 4CISA 4I5MA 3PXZA 5FTOA 3DBFA 1PMNA 2VWUA 1ZMVA 3HHYA 3TDVA 1NNUC 1WBVA 4R8QA 3GUBA 3V01A 2UXBM 3C3DA 3GLIB 2J51A 5CVFA 3VS2A 3PVBA 1X37A 1YW2A 1M52A 4AOJA 2Y8OA 3DXNA 1OTRA 3NDMA 1SXJA 3TNIA 2ZMCA 2C1BA 3U6HA 1DGFA 3O23A 3KDSE 2FH9A 1GL7A 4BKJA 2KXEA 3C4CA 2JUJA 1H8FA 4QMSA 3SRVA 4QMVA 1QUTA 4PDGA 2GHGA 1KFVA 3FL4A 1J09A 4IAFA 2ZDUA 5BQ0A 3CD8A 2GNIA 4FVRA 4R7BA 3LFDA 4G1WA 3KN5A 3V76A 4KHPM 2G2HA 4AKGA 4MXXA 1QUSA 3HX4A 4S34A 4HYSA 3CGOA 4I8OA 1WMKA 3LXKA 5CEPA 2Z4SA 1QDTA 3FPQA 3PXQA 1F5QA 3K9PA 2QG5A 5IEYA 1TH2A 3PE2A 4ZMFA 2QLQA 3GB2A 3VVHA 4PL3A 4O2PA 4ALUA 4IBMA 4ZY6A 3FWQA 4U0IA 4E6CA 1DI8A 3VUMA 1JQHA 2XYNA 4FNWA 5AA8A 2CJMA 4JX7A 4Z9LA 4ZZNA 2XCHA 5JGAA 1BKXA 2VGPA 4R5YA 3Q4TA 3W2OA 1XKKA 4RFYA 5IMXA 5B0XA 1PJKA 2PZIA 3R8PA 3D0EA 3AT3A 4O1PA 1NV9A 5HNIX 4MNEB 5L6PA 1ZY5A 4IDVA 5CAOA 3W0QA 4ZJJA 3I7CA 4O6EA 5I9WA 4GUBA 4FBXA 1P3QQ 2AEGA 4NU1A 3C50A 4AQKA 3CF6E 4GG5A 3NW7A 2XGNA 1L2DA 2HW6A 3F92A 5H8EA 3HA6A 3PXYA 3V5WA 4ENYA 4BI2A 1W5TA 4NM0A 4L16A 2YAKA 3TNHA 4O7ZA 4DGOA 4RMZA 4YTHA 2DZNB 1XQZA 3VRZA 4XV3A 4I21A 3ACKA 4D4VA 5ITXA 4LRSA 3BU3A 5HLPA 4AXFA 4MHAA 4DUYM 4L52A 3DAKA 4JI3M 4AXCA 1OIRA 2XKFA 3A45A 2CLXA 4D2SA 3ZM4A 5BVOA 2NYAA 2UZVA 2B53A 1WR1B 4H05A 3GLIE 1QPCA 2E9VA 2ZFYA 4BC6A 2R3JA 2CCHA 4DA5A 1HNXM 3F3UA 2BTSA 3PSBA 3LFQA 5E4HA 4UV0A 3O17A 4QP9A 2CV0A 5AA9A 5ANJA 1KE6A 3P0MA 1GIIA 2FSLX 5IMEA 4CYJA 4IWPA 4IXPA 4E4LA 3SC3A 3KB7A 2HYYA 4BCGA 5IUHA 4MX9A 4EOPA 3A8XA 2L7IA 2ZM6M 1H28A 4FIIA 1YSYA 4QDEA 4WP2A 1IR3A 4LFCM 4AN2A 4CT2A 4PTGA 1H00A 3IGOA 4IFCA 3MB6A 3PYYA 4K18A 3V8TA 1GKIA 3KA0A 2WTIA 3HDMA 5E9EA 4APCA 3H0ZA 2QQ7A 1OL5A 4BJJA 1Q24A 1NSFA 4IB3A 4EOOA 4IWDA 4QMXA 3BOSA 4F7JA 4DV1M 3LCKA 4IMYA 2YAAA 3R7UA 4C4JA 3VK7A 3CC6A 1BI8A 3U6SA 2HCKA 5CQWA 2YJSA 5IU2A 3PRIA 4LJ8A 2I0HA 3SW4A 4S33A 4G5JA 1Y6AA 3M2WA 5A4EA 5FXQA 1YI3A 1LV7A 5AP5A 2PVJA 1NHGC 1NVMA 2HWOA 2CKEA 3GU5A 3OBGA 3PWYA 3SASA 4TNBA 1GZOA 3VS5A 4I6FA 3EH9A 4L43A 5J9LA 2PVMA 3H9FA 3UE4A 5FQDC 3WF7A 4O7WA 4DT9A 2IO6A 2XK8A 4X2JA 4I81A 2CN8A 2O64A 4JG6A 3P08A 2HWJA 5LVPA 2B1PA 4P90A 4OBQA 4AG5A 2I0VA 3K5UA 1QPJA 3D4QA 4QTBA 5E8YA 5DEWA 4BCFA 5CT7A 3WZEA 3AOEC 1GABA 5FLXS 4G6LA 3HMOA 3EL7A 1ZZ2A 4KD1A 1QYRA 4O7NA 4YJSA 3RWQA 2BALA 5D7VA 4O84A 3GNIB 3U6DA 4BRXA 3KS4A 3VHKA 5IA0A 3CQUA 1FGIA 4JYAM 2KHHA 2W7XA 5CX9A 4V0GB 2P2HA 2PY3A 3SC1A 3I5ZA 3NSZA 3UZTA 4D2PA 2XEYA 5CALA 3CPCA 3TV4A 4B7GA 3FBVA 3QXOA 5AX9A 5HG8A 1QZEA 4RLKA 3LMIA 3F6XA 5C9CA 1NT2A 3B7ZA 4O7VA 2XNBA 4AKIA 5DE2A 4I6BA 5CS6A 4EOJA 4G3FA 4G3OA 2C5YA 3GXLA 3VF9A 2EB3A 3AOEA 4ZMEA 1V0OA 1G8AA 2BWBA 1IASA 4YY3M 1UA2A 4BGHA 3BGZA 4ZSEA 2VO3A 3IKAA 4E26A 2F7EE 3R9DA 5HEZA 3C13A 4FSWA 5FWKK 2VTAA 2J5FA 4NKAA 3QCQA 3G2FA 4XK8F 4GHAA 2Z7SA 2W1IA 4IZ7A 1WVXA 4ZTSA 3S1HA 4Z7GA 5A46A 2WEIA 3ZLYA 3U6MA 2QOQA 5EG3A 4OX9M 1WVYA 4IFGA 1DGHA 3MN3A 5I9UA 3ZO4A 2JD5A 3ZBXA 5KMKA 3HP5A 3QGWA 1LEZA 4IHPA 3DJ5A 3ZSGA 3L9PA 3WZKA 1GZKA 4L8MA 1S3SA 5HLWA 2V1CA 3KIOC 4G3EA 4AACA 5I0BA 4XCUA 5HIBA 3PDTA 5JI3E 2QP9X 2PZ5A 3TV7A 1MP8A 5IQEA 3GRUA 4ZS4A 1DS5A 2VTTA 1QPEA 4BCPA 1JR3A 4QMYA 3ITZA 2CHGA 4EOKA 4C33A 3QC9A 4YHFA 2V55A 4GKHA 5DA3A 4WKQA 1XBCA 5CZHA 3ROYA 3GU6A 2Z7QA 5DLSA 3VFDA 3EQFA 2XK6A 2I7NA 1IXSB 5ETFA 3G5DA 3L27A 5HE0A 2OZAA 4NIFB 3V5JA 2OFVA 5HIEA 4ANRA 2PMLX 1FBNA 3U6PA 3OWKA 1L2CA 3FZPA 3L9LA 1PYEA 4X2NA 3I6UA 4OT5A 1K82A 3GVUA 4JG7A 1OPKA 2G1TA 2P3GX 2CDZA 1VR2A 3LXNA 2OIQA 3CXWA 2CWBA 2X8IA 4UMUA 4OTDA 4RIXA 4DG2E 4GVAA 4C4HA 5M57A 2WQOA 1S9JA 3HJSA 3WHLA 4EWQA 3BLHA 2OBJA 5AM7A 4ENXA 3Q96A 3DAEA 3EB0A 3EN6A 4IJFA 2RL5A 1HJPA 3CTHA 4E5AX 4DDGA 3PY3A 4LL0A 1XH7A 3GLFA 1DO2A 5IQAA 1ZMUA 1FMOE 3LCSA 3P1AA 2YDIA 3W67A 4U7ZA 4FV3A 3QWLA 3FUUA 2X0QA 4FUYA 5KX8A 2X4FA 3VW6A 4DFUA 1Z57A 2R3QA 2YM7A 1OBDA 2ITXA 1Z5BA 2RFSA 1HQYE 2GNGA 4BVUA 3AQVA 3QRIA 3RPOA 4P17A 4E5BA 3ODZX 3J80S 3EQBA 3GQ5A 2VDBB 4ZSGA 4PUZA 4Q5HA 5FBOA 2W4KA 2HY81 1WBNA 4M3QA 2EUFB 4DEEA 2IVTA 4E4XA 4YJQA 2WTKC 4LUEA 2BIYA 4NSOB 4O4FA 3ZUUA 2OPFA 5J5TA 4I4FA 4MXAA 4R1VA 3AKJA 5LVOA 3FZRA 4QNRA 2CV1A 5FTNA 5CAUA 1H1SA 4LMNA 3LCTA 3II5A 4LMUA 5KO1A 1YHSA 4MWIA 4B3RM 4KBKA 4YC3A 3VW8A 3QALE 2PYWA 1NJFA 1OGYA 2BRNA 3WI6A 5KBQA 3CCNA 4B08A 4FIHA 3ML1A 1SXJB 3D7ZA 2XRWA 4EOMA 3NYOA 2FE8A 4U5JA 4PPAA 5LVMA 3TL4X 4ASZA 4AW0A 3R1QA 2ITOA 2W5AA 5BVFA 2K6BA 4GG7A 1H1QA 3GPPA 3UIUA 4MD9E 4IAYA 2FS1A 4QYYA 4RF0A 3RFWA 3ZRLA 4RJ4A 1VLRA 4M66A 4J71A 4U80A 3SRVB 5M07A 4I92A 3GCPA 3NRMA 3HKOA 4DYMA 4FEXA 4ITJA 1T3TA 2XMYA 1XBAA 1W82A 4U79A 1VEKA 4BBEA 1ORYB 2OXYA 3NW6A 4USFA 3ZC7B 3QAME 4JI6M 4JI2M 4ACCA 5DPVA 4O96A 4GH2A 4R1YA 3DQWA 2QURA 2R4JA 4LFIA 3GO8A 2OOBA 1JVPP 3GI3A 1E1XA 3NX8A 1DV0A 3N4TA 3MH3A 3CSVA 4CCBA 2WGJA 1NXKA 3W0SA 4HVIA 5EDPA 3A62A 1Q8ZA 5L8KA 4IJEA 4TYHA 3IDCA 4WUAA 5KZ0A 1PGYA 1WFCA 5AMNA 2VX3A 3HZTA 4FCWA 3RHKA 3KP1E 4O0YA 4HYHA 5GJDA 1DI9A 4LFBM 2CRUA 3F5UA 2W1CA 4LJAA 3WIKA 4ANLA 2X7FA 4ORKA 4QP2A 4RVTA 3HY5A 3FD9A 4EK5A 4P5QA 4HCUA 3PLAE 4Y85A 4L15A 3ORNA 3DJ7A 1XH6A 1H0WA 4C8BA 3SQQA 4FTTA 4LZZA 2YLEA 3KCKA 3DA1A 3AC8A 4P16A 3L26A 4I0TA 1IM2A 4EZ3A 1OQYA 3L28A 3OWPA 3W8QA 2EUCA 4AQYM 4O7TA 3DDPA 4A9RA 3DZDA 2L09A 1YXUA 4A9SA 3KRRA 2WSCF 4F70A 3A7GA 2PMIA 2O65A 5FXRA 1V0PA 3FKNA 1VEGA 1PXIA 4H1JA 5EP1A 3T1HM 3KSXA 3PXKA 3GLGE 1FQ1B 2QPAA 2BDWA 3H3CA 3QTXA 5L2IA 1UVRA 3OXIA 1SXJD 2CN5A 4L01A 3K3JA 3MSSA 3VUDA 3I60A 5CF5A 1UNGA 4N57A 2EXMA 4HCTA 2UW7A 3UC4A 5CF8A 4O81A 3F66A 2PK9A 3LVVA 5EH0A 4KBAA 5IZ7D 3D2IA 3R8VA 3EN9A 3THBA 2QQ8A 4KRDA 1Q97A 2UZEA 4F6WA 4FL2A 3PIYA 1BI7A 2NNWB 4AW2A 2F2UA 4H58A 3R28A 4CFUA 4ZLZA 2XA4A 2R5TA 4I0RA 4L7SA 1XMMA 2A4LA 2AYPA 3NAXA 4QMMA 4H3QA 1UU3A 4KINA 3QLFA 3HP2A 3CPBA 1V0BA 1NVQA 2R4EA 5E7RA 4JR7A 2W9FB 3R8MA 2WMXA 3DKOA 2YWPA 2NPQA 3ERKA 2Y4IC 3ZFMA 4PF4A 2XVDA 2VF8A 1IG1A 4QEBA 4BJJB 1ZRZA 2UZTA 2J4ZA 4BTJA 2GNHA 4U6RA 4AN3A 4DITA 4G3GA 2GQGA 2HXLA 4PL5A 4NC6A 3F9NA 3OW4A 3QTWA 5CEOA 3MK6A 3VLFB 3MTFA 4BI0A 3C9WA 2JAMA 4M9XA 4J98A 3W0LB 2YCQA 3VWAA 3D7TA 2K9DA 3E7VA 2YCSA 3MYGA 3HA8A 5AR2A 5IDNA 1O6KA 2IJMA 3UG2A 3ZOSA 5TT7A 4JOAA 1OVEA 2BIKB 2X81A 3FEGA 1RQQA 3FL5A 4EJNA 3EJ1A 2G3QA 4E6QA 3FQSA 4OVZA 5AUTA 3G0EA 4APPA 3QHRA 4X64M 4QMUA 3W10A 4BCQA 4U44A 2DUVA 3PRFA 3V04A 2KDLA 2BDFA 3PXRA 3FDNA 4I6LA 3KVWA 4AZTA 1WCCA 5EXTA 5DNYA 5CAVA 4KLNA 5AV0A 4FVMA 3W32A 3HMMA 5BPYA 2C0TA 3NUYA 5FDXA 3WF5A 1XH5A 3EZVA 2DWBA 2R65A 3GPUA 4EBWA 4CJ6A 4PDPA 4QMPA 5FDPA 4UEUA 1JSUA 4BTMA 4JT3A 5DT0A 1U46A 3DK7A 5M06A 1H0VA 3GCQA 4AA0A 3LM5A 3JVSA 3NMUF 3C5IA 5FTQA 3QTIA 3U55A 4B9DA 2R7BA 4DR3M 4BR3A 3Q60A 1IN7A 3ORIA 2QENA 4FV1A 5CSVA 3W2SA 4YLLA 2FNAA 3HV5A 4FG7A 4E93A 3R8ZA 3C3EA 1OITA 3RKBA 4DTAA 3EQGA 1UU8A 5C18A 4FRFA 3DCVA 5ACBC 4MAOA 3I1AA 3ID6C 3J27B 2YFXA 3E62A 3RM7A 3QYEA 2YM6A 5GHVA 1QAOA 3MFUA 1PRYA 4AG8A 3TZ8A 1O9UA 5J1VA 5CF6A 4NRWA 4EOQA 3MDYA 1OL7A 5HBEA 4G6OA 2PHKA 1CMKE 2RF9A 5E8TA 4I5CA 4N6ZA 1Q62A 2MJ5B 2ZTDA 1TTEA 4PP9A 4FOCA 4CYIA 1URWA 2L2DA 1DGHB 3HHXA 3PZHA 4F2LA 3UP7A 3NPCA 4G6NA 2J7NA 2C30A 3MHVC 4JI9A 5JZNA 3EN4A 2PMNX 4Z16A 1W5SA 3CF2A 4NEUA 2XSZA 4BDBA 1I4WA 5AAFA 3COIA 2XNEA 4PCZA 2C6EA 5IEXA 2J0MB 4JDIA 3FTDA 1J7KA 4C61A 3EQCA 3W0PA 3NCGA 4MKCA 2GNOA 2LVOC 3UODA 1ZLTA 2OFUA 4AI6A 1LEWA 3R7VA 5AAEA 2QO9A 2AC3A 4YR8A 3AD5A 3SBJA 4A9TA 4L8RC 2KNZA 2OIBA 2JBOA 2BNKA 2DVWB 1RW8A 5M51A 3NUSA 4O0UA 3BEAA 5EM8A 4Y83A 3R9NA 2OZAB 2R3OA 2VTNA 4MQ2A 2WNTA 5AP6A 5C26A 2WTDA 4BTKA 5K5NA 5ITYA 2VWWA 3Q2JA 4LI5A 4AZSA 3CTQA 2OJGA 3H30A 4A7CA 3JY9A 3KVXA 4CEGA 1HCKA 4BKZA 3EQIA 1IQPA 3EFJA 5FTMA 4TYIA 5EW8A 3D8LA 4YPDA 2VTOA 4X6RA 3C5UA 2LVNC 3RK5A 1GO5A 5A4QA 2F49A 4A07A 4O38A 4EOIA 4HYIA 2C68A 5DFPA 4BIBA 3OCBA 1NY6A 4LOOA 1GLNA 3R30A 3RWPA 5F4NA 4EH4A 3BYUA 2W5BA 2X2LA 1Q8TA 3P86A 4RSSA 3TNPC 3HJ8A 4I1ZA 3IW7A 3AGLA 3UYTA 2ERKA 3FUWA 4FTAA 4ZS0A 2BRHA 1PXLA 3GLFB 2WB8A 3B8RA 4AQCA 4BIDA 5CSHA 4XNEA 4DEAA 4O4CA 3S2PA 3FZSA 3OOGA 2X6DA 3UPXA 2DZOB 1B38A 3Q5IA 3KXMA 4D4SA 1I09A 3VS6A 5F1ZA 4RIOA 2PULA 5IUIA 4BWPA 4W5WA 5FSWA 4DE4A 1Q3WA 4DINA 4CFMA 3BLAA 3KCFA 4I5SA 3HKPA 4Z8XA 4FUXA 4YHTA 4Z7HA 4PMSA 4O4EA 4FSYA 1OAOC 1J5EM 2B9JA 4BCNA 3O96A 1WBTA 4FT3A 3JPVA 5HU3A 5JMSA 3O71A 5HTIA 3Q8XA 1SNXA 5CXZA 2PSQA 1WBPA 4RVKA 3A7HA 4MTAA 2CE7A 4FI1A 3NZ0A 3ZSHA 2JP7A 4NM7A 4OT6A 4AF3A 2DXIA 2R3RA 3SG8A 4Q5EA 1MQ4A 2V7OA 5I9ZA 5T3QA 2IF8A 3O2MA 2KZSA 4IC8A 3UMXA 5KMLA 4YSMA 2UVYA 2R0UA 2WQBA 4FF8A 5L6OA 5FEDA 1JR3D 3SW7A 4XS2A 5AUYA 3F5XA 5KMNA 2QO2A 4H39A 3DGKA 1HR0M 1MX0A 2J5YA 4XLIA 3GQ3A 4FT7A 1BL7A 4YJPA 2F7XE 1OIUA 1TH4A 4Z3VA 4YZNA 1PY5A 2WTKB 3OUNB 2QNJA 4DEIA 4KIOA 4LV8A 4B8LA 4TZRA 5B7VA 3DB8A 2BZIB 3OEZA 3VS7A 3QLGA 4EUUA 5AUVA 3NYXA 4AFJA 4TWPA 2IW8A 5HG9A 2P4IA 5GKNA 4KNBA 2I0EA 3KXHA 3R83A 3ANRA 3K2LA 1IXRC 4LG2A 5KHXA 5GINE 4D2TA 3DBDA 2EVAA 5ICPA 1KE7A 3DU8A 2CEAA 1NV8A 2PVYA 3CKXA 4WA9A 4ZJVA 2KULA 4RT7A 4FV0A 4ANBA 3ATSA 2B7AA 2JDVA 2IN6A 4FVPA 4E20A 4EQCA 4DBXA 4TYHB 3FI4A 5AM6A 2ZM4A 1XO2B 2V62A 2VGOA 2EB2A 1ZOEA 1KV2A 2WMVA 2G2FA 3HU3A 2WFYA 2YITA 1FNNA 2XJ0A 4X3FB 4LZJA 1GIJA 3LMGA 4RWKA 2W1DA 2R9SA 1ZYJA 4N0SA 5DEYA 3ZSIA 3A46A 2YACA 5E8WA 5G6VA 1SM2A 2RIOA 3E9SA 3GU7A 4WBBB 1GNGA 4IC7A 1WBWA 2XIXA 3DAJA 4L67A 3GLFE 4CFXA 4PPCA 5AIRA 2PE2A 4X65M 1V1KA 4CNHA 2J0JA 4Y46A 2WZJA 2ZAOA 2PE1A 4YTIA 2HK5A 3OT3A 1G3IA 3KU2A 3HDNA 3H10A 3UVPA 1OL1A 3CLYA 4BY9E 3KRXA 4QPMA 1QPDA 3F88A 4XYFA 1JBPE 2Y0TA 3TWKA 2J2IB 3QD0A 3MFSA 4W9XA 2LTUA 1OJLA 2LWXA 2QOLA 4GU9A 4L44A 2QVSE 4LJ5A 4DG0E 2PZRA 3THGA 4BTFA 2FO0A 1OFHA 1PXOA 2AQXA 2Z7RA 4QDVA 3IHPA 4GKKM 4L9IA 2BVAA 4C2VA 3IONA 2J9MA 4XP0A 2C47A 4KSPA 5FRIA 4JI1M 1OKSA 2VO7A 4FSNA 2YR0A 2JDOA 2XNOA 3ZC5A 4AZFA 3RGPA 3FY0A 4UMRA 3FZOA 5CYIA 4ZLYA 3IS5A 4Y5QA 1ATPE 4G3CA 4E73A 4MH0E 1A9UA 2W4OA 4NRVA 2QU5A 3AD6A 3JY0A 4CFWA 1K3XA 1U54A 3VKHA 4O0SA 4JRVA 4BBMA 4ZY4A 3JAMS 2QOFA 3R6XA 4MH7A 3R9HA 5IF1A 1URCA 3KXNA 3KREA 2WU7A 4DGLC 1M7NA 4V04A 4FTMA 3V5TA 4AZVA 3FLNC 3KQ7A 1G59A 4FTIA 3P4KA 2HHHM 5DRDA 4D55A 2BRGA 4B7FA 4GH9A 5EI2A 5AR3A 5FEQA 4CKJA 2CGXA 4XG9A 2C1AA 3HJQA 3NCZA 1OGUA 1UWHA 4JBOA 3QWKA 4FSTA 4PDSA 4FV7A 2X8EA 4GK2A 4XJ0A 3C7QA 1GZNA 3EKNA 4XUFA 4BWKA 4HVGA 2VRXA 3BZ3A 4TPTA 4BDDA 4G5PA 2CP8A 3Q52A 4MF1A 1Z5MA 3FJQE 4U3ZA 3B2TA 3TIZA 4R3CA 4C3RA 1R7RA 1APME 2GS2A 3CKWA 3LW0A 2VTIA 3MH2A 3O