4LY6A

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 55
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ly6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ly6A01
1SVKA 2GWHA 4M1TA 1JQJC 1P6XA 2GCOA 3MWKA 1AS0A 221PA 4Q19A 2AXNA 4D0GA 2A5JA 4LJ6A 1S9DA 4AWXA 4PC1A 4G1UC 5CB6A 4TQAA 2H17A 2ZE6A 4RD1A 4XD7D 2NPFA 2CLSA 2J5XA 2Q6TA 3EA0A 4OQFA 4Z8YA 2OFOA 3W3ZB 2PMKA 2C9YA 1GRQA 1V5WA 4V0OA 1R5OA 1AGPA 2OESA 2F6RA 3NIBA 1I2MA 1YJ5A 4JSYA 3GLGB 1UJ2A 3GJ5A 4BFTA 1SXJB 2BM1A 3O8RA 3SZRA 1OXUA 1T9HA 1AZTA 1GVNB 5FBQB 5FR1A 4ERNA 3A4MA 3MMPA 3IPXA 3DPUA 2ZYUX 3MRSA 1E99A 4RD0A 3ADKA 1KI3A 2W6IA 1E0KA 1Y63A 1CKEA 2Q3MA 1JAHA 1RW4A 5EP1A 1TTTA 4K81B 3VKHA 2QENA 4AYWA 1RJ9A 1G8YA 3NHBA 4HLUC 3HU3A 2D2EA 3EWAA 4B32A 3EASA 2BMEA 4AYTA 1YZUA 4LK2A 4IJMA 5H70A 4W7SA 3K0AA 4TYPA 1LTQA 2OBMA 2ZRAA 1YHNA 3AKCA 2VP2A 5AJZA 2OO7A 3VHLB 4CEIA 1XJQA 2OBLA 2ZM5A 3OIVA 4M21A 1W4BA 3MLEA 1S9HA 4NYJQ 1OXVA 2JLSA 1R0XA 1TQ4A 1TX4B 2E1RA 3PQCA 5EP3A 4JKYA 2ZEJA 4MRPA 3QG5A 1ZUIA 4UQOA 4EJSB 1AKEA 4Q02A 1TNDA 4PQYA 2XJ9A 3QF7A 2DPXA 4PZYA 3GMTA 1M74A 2QRNA 4PZLA 3DM5A 4GSYA 3P4YA 4C0BA 1G9XA 3NDPA 4XD7A 1OLOA 2OHFA 5F9FA 4TTRA 2QU8A 2G83A 5B58C 5FTLA 4DXAA 5EXSA 5LDDC 3T1TA 1WXQA 2IEZA 3CM0A 3H86A 1QF9A 2WWFA 5TARA 1XTSA 4D81A 2B8WA 3RS0A 1VIYA 3OE7D 3THOA 4BLSA 4XJXA 3R8FA 4F4CA 1ZU4A 4HUTA 2ZRIA 4DCVA 2E87A 4F7WA 1P2UA 1DBSA 4JBYA 1M8PA 4WXRA 5TY0A 3BE4A 4M1WA 3QPWA 1NN3A 4KAXA 3SI7A 1MT0A 1PV4A 4PX9A 2QT0A 4A9AA 4D6PA 4CF7A 4C9BA 2F7SA 3U6KA 1UEIA 3UMFA 1E6CA 1P62B 3BH0A 2HXSA 2JLRA 1E2JA 4TYWA 2ZJAA 4CVNA 2HT1A 1NVUQ 1E0AA 1T5LA 3QPVA 4YDSA 3NTUA 5AUOB 4TQUS 3T1VA 5CLQA 3GLGA 1SXJA 3GEIA 1R8QA 3L8YA 4WOPA 2DZOB 1E2IA 3GLFE 2RH5A 5JFGA 1II9A 1PJRA 2X19A 1X8JA 4JS0A 4EUNA 2IYXA 2KWIA 2PEZA 1UKZA 3GJXC 3UK6A 2V4ZA 1D2MA 1EFTA 1E1QD 4YMVA 2XNDD 1OFHA 2C2HA 3NBFA 2Z5FA 4A6XA 4C2UA 5HTKA 1MO5A 2HYDA 1ZVQA 2X2EA 3CX6A 3PXGA 4HB4A 4IDPA 4QGFA 3W9YA 3PIRA 4M1OA 3TQCA 3WRYC 4AK9A 2DFTA 1L8QA 3NEYA 1P61B 4NH0A 2FDCA 4CT5A 1HUQA 4K8OA 3ND8A 4P3YA 4QNRA 3TUJC 4ZDWA 2O8FB 3R9IA 1ZYUA 1G3IA 4WW0A 1V43A 2VL7A 4JVMA 4PAMA 2BKUA 1H65A 5CK5A 2OUKA 1PLJA 4DB4A 3OE7A 3RHFA 1W0KD 4B76A 1Z29A 1W44A 3OAAD 1Q0UA 3WYFA 4CT4B 2MSCB 4EJSA 2XGJA 1RE0A 3KJHA 4PSAA 2JLUA 5CYOA 4IKEA 5IHPA 5A4JA 3BB3A 5FH9A 3WRXC 2ONJA 1E2KA 2PCJA 2OLKA 5DN6D 1OH8A 4B3GA 1MO6A 3HU2A 3CIOA 2XNSA 2GEDA 2C04A 3LLMA 5C1BA 3MFYA 4I1OA 1ZCBA 2GBLA 1UBEA 3GCGA 2HJVA 2REOA 2QEQA 3CPJB 3P1JA 4CDGA 4P31A 4BFUA 4ESHA 1S4QA 2GAAA 4PHTA 4EQ6B 4URZR 2C9OA 4XTCS 1U8AA 1YR6A 2KJQA 4QJ5A 2BDTA 3M4YA 4KXFB 2ZU6A 3EA5A 2IEYA 1VG8A 3T15A 2VQSA 2WJYA 4UNQA 1E1QA 4LJYA 2XNDA 2OILA 1GL6A 1XMJA 3RC3A 2XOKD 4LPSA 4F91B 3QSYA 1KKLA 2ANBA 2PEYA 2RMKA 1L4YA 3PG5A 1AK2A 3UATA 3NKVA 4DDVA 5CITA 1NMXA 2NOAA 2IWHA 4Q1AA 2AD5A 1P73A 1SVSA 4KSCA 2VHJA 4WAUA 3TJZA 3VTKA 2BHRA 5KNDA 4YXWD 2QA5A 1UF9A 3AP3A 4QM6A 2HXYA 3B5JA 3U7EB 2RGNC 2GILA 2IL1A 4QFMA 4EFLA 2QMEA 4KFTA 3HP1A 1KK1A 1N3BA 5BWMA 3R7WB 3IHWA 2GJAA 2PT5A 3HR8A 6Q21A 5IT5A 2WTUA 4NDZA 2J87A 1IN7A 3RS3A 3B85A 1II8B 4JLMA 4M8NE 1VDZA 3FVQA 1T3LA 2ZSEA 4D4LA 1HQCA 3KZ1E 2I4IA 5DN6A 1XXHE 1SGWA 1D8TA 4EFMA 4FW9A 1NG9A 4AIIA 1HH4A 1NVXQ 2UVQA 1KI4A 3GFTA 4NZYA 8OHMA 4JLKA 5FPSA 1G3RA 3TGPA 1II0A 5AJVB 4PHGA 3D31A 2O8FA 3VFDA 4IDQA 1VG0B 4U7DA 4PANA 4PSKA 1UAAA 2BBSA 2WOOA 1CJVC 3K9HA 2ZANA 3NBYC 3ZZTA 2JJ2D 3BJIC 4B44A 1XZPA 4FWGA 2J1LA 4LJ4A 1DS6A 1PZNA 4TLEA 2IHBA 3G5UA 2MSDB 2ZE5A 2DWQA 2A5FA 2Z4RA 421PA 4MRVA 4BZQA 2GTPA 3A4NA 4V0LA 4JVNA 4DLUA 3BFXA 1XDBA 4Q7KA 1N6KA 2SHKA 4B2IA 1R10A 5FOVA 1U8YA 2BKEA 1OXSC 2YWGA 5J4VA 1EFHA 5TXGA 1E2QA 4MH0R 2DFKB 2LCFA 3NBXX 1NSFA 4HLDA 2VPPA 4KBFA 2FMXA 3EARA 1JXOA 3MUFA 2ZRJA 5KSOA 3A4LA 1EESA 4EQ6A 1XPOA 1U9IC 2IUUA 4RZXA 1W4CA 2HCBA 2HT6A 1HE8B 5LD2B 3B9PA 1E1RD 1KOFA 1JB1A 1X1SA 3QXSA 1GNRA 4TL8A 721PA 1KAGA 2C98A 4JL6A 1S3SA 2O52A 2H5EA 3QUSA 1KY2A 4CEHB 1BKDR 2ODNA 4IRUB 1I4LD 4TMXA 4A0GA 2DY1A 2ORWA 4P32A 4B47A 2CHVA 4XIGS 3GEHA 1G5PA 1COWD 3CX7A 4JKIA 4MKHA 3FPAA 3DOEA 4A1FA 5DYGA 1CIPA 1Z6XA 3FOZA 1OIWA 4ZIRB 3KL4A 5DGXA 4OI4A 1VTKA 3F5FA 2YJTD 1MO4A 1W5SA 3K0CA 3LA6A 1DAHA 5G53C 4B33A 3UANA 4LDJA 2F1IA 4HLUA 5KO2A 3C5CA 1G3MA 3R7WA 2JJ2A 4A2WA 4ZDJA 1GUAA 4IVPA 4JVLA 4TYYA 4RZ3A 3CRVA 3UPUA 1Z6AA 1II8A 1T91A 3LLUA 1KMQA 2R6GA 1FFHA 2XXAB 2QM7A 1X37A 1WRBA 1P72A 1K5DA 2PT7A 3A1TA 3QPUA 1G6OA 2H57A 2ZRBA 3KJIA 4HAVA 2FX3A 3DZ8A 5G3YA 1DELA 2BBOA 1ETUA 2OXCA 1KZGB 1NN0A 2WAXA 2ZR7A 4NU0A 4Q7LA 3UMSA 1T0HB 2ZROA 2CLDX 1DAIA 2W2VA 1IJEA 1N6PA 1A1VA 1QHHB 1U81A 4RCYA 1W4AA 1G7SA 1OFUX 4IVRA 2X1VA 4X8LA 1YQTA 4RFVA 2P6UA 2IF0A 2RGXA 1ELOA 3LW7A 4NYMR 2C96A 2OM2A 4R2HA 4DUGD 1G8GA 1T8UA 2DCUA 4HAYA 1E1RA 4EDHA 2IYZA 1OSNA 1CR0A 3AP1A 2LWIA 5FUYA 3TR0A 1YZGA 4W5WA 3CRMA 4TMVA 1KSHA 2ZYTX 5FUWA 3CH5A 3FDIA 5GJWC 4A92A 1K5GA 1M7BA 4MQBA 5FBVB 1KDRA 5AR1A 3A1WA 2Q9AA 4M22A 4DDWA 4PC2A 2ZRGA 1COWA 3LW8A 3B6EA 2QRZA 3W3AA 1ZM7A 4WZAE 1SVLA 1R0WA 1TEXA 1WBDA 2FGKA 1OPXA 1P9NA 3ICQB 1NVVR 2ZQ5A 4WZ6A 1GP2A 3OIWA 1Q1EA 3WNDA 5UKDA 2WKQA 2OT3B 5FR2A 2QORA 5C2JB 1Z07A 3EW9A 4FMDB 3NEJA 5KPDA 1ZU5A 4CEHA 2P5SA 4FWHA 2WMNB 4Q03A 5F2EA 4ZDKA 2Z6VA 4KJZA 3TW8B 4OI1A 2PJRA 4TTQA 3B7GA 4TLBA 3FWYA 3BD9A 2IS1A 1Q1QA 5TB5A 2ZJZA 4M9XA 1WF3A 2H8KA 3TMKA 2GEVA 2QMUA 3L2OB 3AUYA 5B30A 2JDID 1JJVA 3QE0A 3O8BA 2IS2A 1E2EA 4Q9LA 1OYYA 4ZIRA 1FP6A 5EXTA 2CHQA 3Q7PA 1EGAA 1FL9A 2QG6A 3A36A 2H7VA 3C14C 5CDFA 4DHEA 4DKXA 4KVAA 2Q9BA 4KFUA 4DIEA 1I2DA 3A8TA 4DUGA 1NLZA 2VTKA 2EYQA 3SJCA 2EFHB 3RVBA 4EIWA 2XXAA 2L0XA 3RRMA 3WMEA 4D0NA 2BMJA 2CBZA 2P67A 4D26A 2ZYVX 1TUEA 2OCPA 1N5KA 2G3YA 4GZMA 1G64A 1G16A 1LNZA 1TF5A 3GPLA 4O2RA 3ZVMA 4L15A 1U99A 4LSGA 4HAZA 2ANCA 1ZUHA 4XOIA 5HKKD 1QHHA 2J46A 2Z4SA 4B43A 3C5HA 1HE1C 3LXXA 1W47A 3X1YA 1TQ6A 1VECA 3ZVLA 1SXJC 1A7JA 1OT3A 1G3QA 1JPJA 2QP4A 2VRWA 2WPDA 3WBKA 1GZSA 1Z06A 4JLBA 1CJMA 4DIDA 2CXXA 4BPBA 1JR6A 1O3YA 1C1YA 1FTNA 4A0RA 1HURA 4KLZA 1OH6A 3NVAA 2IXEA 1F2TB 2FWRA 1EK0A 3K70B 2I1QA 4NBSA 2W00A 3HPQA 3OZXA 2XB2A 3KB1A 3H2YA 4QL3A 1M34E 3K8YA 2EFEB 2NZ8A 3PENA 2ZI5A 2JDIA 1E69A 3WXMA 2XZOA 2MMGA 4TWZA 3KQKA 3CR8A 4Q9KA 1IM2A 3QJYA 2O8EB 1Z28A 3U3MA 3K9GA 2B92A 4IFEA 4WVFA 1SKYE 2ZSAA 2GJ9A 4B73A 5FBRB 5C46F 5P21A 5LPNA 4DJTA 1YZTA 1ZUNB 3K70D 2J7KA 2Y8EA 3GLIE 3V00A 3TE6A 1Z0AA 2KBFA 2WWWA 2XSZD 1ANKA 3DO6A 3OF5A 4RD6A 1R0YA 4E5UA 3RC8A 2VHTA 1Z0KA 3EZ6A 1W1WA 3CWZA 5HKKA 1U0LA 1FW6A 2QROA 1F6BA 4URVR 1YVDA 2G77B 1BYIA 2CJWB 1RFLA 4MYHA 3W5JA 2YYZA 3IQWA 4Q4AB 4ZCLA 1KNXA 1ZINA 2YHSA 4WZBE 1CP2A 1ZIOA 3DZDA 1P2TA 4MKIA 4PPGA 4C3ZA 2C9CA 1GFIA 2J9RA 4NYIR 3KXIA 2R9VA 4OHWA 3BOSA 2OFWA 3CKLA 2N46A 4LHVA 4UXHA 4X8OA 4URXR 3UXMA 2DFLA 2IHYA 1CU1A 1MKYA 1TU4A 4Q4JB 3EX7C 1ZNZA 4TMTA 4F93B 2PJZA 2C03A 2I1VB 4A36A 3B60A 5KOYA 3KB2A 4EPRA 2A5DA 2ZRKA 5CIWA 2RGBA 2R6DA 2IUSA 2G1KA 4MGYR 1K6MA 3DOFA 4MDEA 2EU8A 1G7TA 3SYLA 3UG7A 1E98A 1NY5A 1J90A 5KDOA 2W6JD 4LV6A 5FI0B 3FFBA 4KITB 1JR3E 5JECA 4H1VA 1U90A 5CJPA 2O0HA 3ZS9A 4QGGA 2A78A 4QOSA 2AXPA 3BBPA 1QBKC 1TMKA 1F2TA 1P4SA 4PHHA 3PV0A 5KDLA 3BK7A 4LHWA 3DM9B 1YR7A 3PCRB 5JLJA 1YE8A 3QKUA 1LFDB 1OIVA 1KZ7B 3HPRA 5D3QA 2XSZA 3UIEA 3PEWA 2NO7A 3UWKA 1OH7A 1FMJA 3R9WA 4R71A 2J3EA 3CR7A 3HJNA 1LV7A 5HCIA 4BFVA 3RS5A 4FCWA 4Q1EA 2FF7A 5DI9A 4B3DA 4Q7MB 1F3OA 4QBHA 4GI7A 3THYB 4JLPA 3UG6A 2CNWA 2O0KA 1X6VA 3BH6A 2Q21A 4OJQA 4M53A 3D6TB 2O8EA 2W6ID 1H8ED 5M04A 1XXHB 2C99A 1OV4A 4FWDA 3AVQA 3U7HB 3TUZC 1QVRA 2QGZA 1QG2A 4OQXA 1CJTC 2C5LA 4NCJA 5HE8A 5IRCD 1N2CE 2GZHA 3JZMA 1NI3A 1NL3A 1ZAKA 2QQ0A 4TN1A 1TU3A 2EYUA 1JECA 1FQKA 4QHYA 1IN4A 2GCPA 4A82A 2WWIA 1KI7A 1VHTA 2IYVA 3IEVA 1D5CA 1VHLA 3GJ7A 1BMFD 4KYUA 1MABB 1W2GA 3RSOA 4B3BA 2GHIA 3V4RA 2ZJ2A 2CJWA 3C8UA 4GL2A 2GEUA 2UZIR 2R6FA 4DSUA 4JVSB 2G88A 4UJ5A 4X8MA 5HZKA 1UKYA 1ZM3A 3I61A 1WBBA 3LQQA 4NL4H 2W6JA 2A5GA 1GL7A 2R6CA 4PO1A 1NLFA 3U5ZB 2W0SA 3N5CA 1IY2A 1L2TA 2DB3A 4PC7A 2HF8A 5SZKB 1YZLA 1EXMA 3B9QA 2QSYA 3K09A 1W48A 4Q4JA 3I3SR 3U6BA 4DLWA 3KFVA 4PPQA 2GNOA 3SBDA 4LBZA 3IHLA 1QVAA 1AQYA 3OEED 4YMWA 3TSOA 4JYBA 3RSLA 5JBQA 1BH2A 1VCOA 2O5VA 5AJXA 2JATA 4G5OA 1DPFA 3AUXA 4MITA 1T3SA 3SYNA 3PR1A 4DCUA 3PEVA 1OF1A 1DEKA 2CVFA 1FPMA 1QZXA 1XMSA 2H1LA 1I4TD 4JLAA 5FPHA 2IK8A 4HB2A 1H8EA 4MKFA 1KI1A 1LW7A 2WSSA 2ZE7A 1E9AA 1LF0A 4QKQA 4JSTA 3K0CC 5J4HA 4MDFA 3B8HA 4O3MA 4AY2A 2QE7A 2WJGA 2DBYA 3LX8A 4UNPA 1QHIA 2JA1A 4IW3B 4BEJA 2NG1A 1VCNA 1KHTA 3FMIA 1X8KA 3U3JA 3BB1A 4FI3C 4M4SA 1G8HA 1JXMA 5LB4A 4TMZA 4LBVA 1SXJD 4PHFA 4I4LA 4ILEA 3RABA 1XD2B 4B2PA 2ZI3A 1BMFA 3I1FA 3THYA 1YU9A 2R62A 2ODWA 2B6HA 1ZNXA 821PA 3L0OA 3X1ZA 1A2BA 5TMPA 1XTJA 2ZTSA 3NXSA 1NJFA 3AKYA 3WNBA 5GVSA 4PPNA 1Z0IA 4LY6A 2C78A 4WBSA 3L82B 4QGHA 1A4RA 2XX3A 3RDPA 2RHMA 2PX0A 5CM9C 2GVDC 2D4HA 5CJ2A 4B3CA 4M9SA 4EKDA 5FOWA 4A4DA 2JJ1D 1KDTA 3QOFA 1M2OB 4TYQA 2BJVA 5JI2E 1FX0B 4GOXA 4ARZB 4EPVA 3PJRA 2H18A 2C95A 5LB2A 3NWJA 1MABA 3GLHE 3OEEA 2HDNB 1ODFA 2REXB 3I5XA 2GZDA 2IYQA 3TAUA 3VR4A 1T4GA 1RKBA 2TMKA 3AVYA 1LS6A 1EG7A 1N5IA 2PX3A 1J99A 2ORVA 2CE2X 1DAFA 2FEMA 4LCBA 1WMSA 4BFYA 4KFRA 5LD2C 1RC8A 3O47A 5KHOC 3T1QA 2VA8A 2VSOA 3CF0A 4V0ME 2C77A 2VSFA 4LWZA 4AKEA 2A5YB 1ZRHA 2QTVB 4DC9A 4BECA 2X77A 2LKDA 2K5UA 3LRPA 2YNMA 2ZR0A 2NIPA 5DO9A 1AA9A 2HCJB 4N1AA 2HEIA 4QBFA 3VR3A 2JEOA 5EUMA 3VHXA 3W8NA 5ELXA 1FQJA 3QVUA 4QXAA 5JJIA 4KLNA 1R4AA 1B0UA 3EZ2A 2YC4C 1P75A 4BGDA 1JEDA 3Q3JB 1J70A 1KJZA 3QXJA 4HEJA 2ZXUA 2D74A 3TIFA 2ZI4A 2YINC 3MWLA 2D06A 2EFCB 3ADBA 1EFCA 2OFXA 1E9RA 2JJ1A 5JWOA 3FHTA 1C1KA 1XD2A 3MAAC 1KJWA 1NIPA 3QXXA 4MUAA 4ZPXA 5DISB 2IUTA 1OYWA 1TUIA 2FEOA 1X8LA 4S35A 3D8BA 1W46A 1GITA 2QT1A 2QGNA 2DWPA 4DLZA 3PITA 2QPTA 2UKDA 2YOGA 3IKJA 1NMZA 2GETA 1S96A 4DSOA 2AN9A 4URUR 2IXFA 4DLYA 2CMKA 4RKFA 1XEWY 2G6BA 2QZ4A 3SJBA 4IEEA 2CE7A 1FMLA 3GJ0A 4EPTA 1E4VA 1Z0FA 4U5XA 3LAWA 1F5NA 5CIQA 1FNMA 3WYAA 2WKRA 4IVQA 4LC1A 1Q57A 4FMCB 3SHWA 4PAOA 1FX0A 4P33A 4ARZA 4XWOA 3KQUA 2R6AA 5EUQB 3AVUA 3RWMB 3BWDD 1XEXB 3MWJA 1TQDA 3EC2A 3SR0A 4N3NA 2FPKA 5KNBA 1GSIA 2VHQA 4V02A 2IT1A 2QPAA 1AIPA 2YWEA 3IQXA 3P27A 5L3RA 4GZLA 5A0FA 1ZW6A 4GITA 4B2LA 3O8CA 2AD1A 4B3FX 3ZVRA 5DYIA 1RRFA 2CK3A 4BRUA 1RIFA 2GF9A 1BO6A 1P2VA 4X8HA 3DKPA 1DO0A 3EPLA 2XZPA 1S8FA 1Z3IX 1H8HA 2REBA 3X2SA 1N6IA 3SJZA 3Q85A 3CLVA 3CWQA 1SKYB 3VKWA 4J0QA 4Z8XA 3AH8A 3RWOA 4TL9A 4DVGA 1D2EA 2ONKA 4OJKA 2HLDD 3SU8A 1KJYA 3GLIB 4ON9A 1DADA 1SVWA 1E2FA 3G82C 2N42A 4MRSA 3CONA 1YR8A 4FMDF 4OK6A 2V55B 3G0HA 2XTNA 1G5RA 3IGFA 3L0IB 1Q22A 3TQFA 3P26A 4Q21A 3AVOA 3VAAA 5K8UA 4I1UA 2FU5C 3SFZA 4ZO4A 4KYIB 1ZM9A 3CNNA 3PVSA 3LY5A 1G21E 2ZRCA 4LHYA 4TL6A 2V6IA 1L4UA 4A2QA 4D80A 1SHKA 1M7GA 3QI2A 4NYMQ 3DDCA 1CR2A 1W0JA 4PQRA 4GPTA 4KU4A 2CVHA 2IF2A 3FMFA 1E9EA 1R5BA 3LVRE 4GMDA 1Q20A 5IDVA 2FJUA 3OESA 4DLXA 1E2HA 4LGMA 4G01B 3ZQJA 1S3GA 3QXHA 4URWR 2IXGA 4PO9A 4POAA 5JHGB 3VMFA 1J7KA 2WWHA 3HWSA 3U60B 5JHHB 2W58A 2FOLA 4LBWA 3Q5EA 3ZS8A 3BFKA 5EE5B 5FPYA 1U2RA 4TZ0A 4WA7A 3OHMA 2AFHE 1XFAA 5IF9A 4C7OB 3QXCA 3T61A 4BLTA 3AF4A 1UM8A 1NVVQ 3K70C 3AVTA 4PC3A 2ZSDA 3K0SA 2IS4A 1XEXA 3ZD7A 2ZJ5A 5AK0A 5IK2D 3NH9A 2ORIA 3FMPB 2HLDA 3F3YA 2OSBA 1Z08A 4IEIA 3KTAB 1CBUA 5JS7A 2ATXA 3KKOA 2Z0MA 2ZI7A 3L0PA 4JJZA 2XTMA 1Q3HA 4YC7A 2QAGC 1DTSA 4OYHA 1T3HA 4H1UA 1XJ0A 1N6NA 5C4GB 3W90A 1E2DA 2GK6A 2DHRA 1IY1A 1FOEB 3QY0A 4LYHA 1Z6GA 4ITRC 1OB5A 2AWNA 3R20A 2QL6A 2VF7A 1JALA 2GKSA 5FPTA 4OQLA 2F9LA 4W5HA 1T0JB 4MGIR 4TYNA 4KSBA 2V9PA 2J0QA 2AK2A 3AF0A 4L4UA 4HUQB 2J0SA 1TADA 3GLIA 1YKSA 2YOFA 4B74A 1NBME 1VCMA 4KVGA 4YQFA 2ZR9A 5EZ5A 2CL7X 1GKUB 1VKJA 4IOKA 4N0DA 4DWJA 1RRGA 3QKSB 1F2UB 3RS4A 3GP8A 3FMOB 3KFXA 4AG6A 1KO8A 1NRJB 1WCV1 2ERYA 2GAOA 3T5GA 3ONWA 5FBWB 3ZVNA 4IOLA 1RVDA 1NIJA 1J2JA 4DDTA 2IYRA 5F98A 5H1YA 1Z2AA 4GBMA 3K09C 4AYXA 3CPHA 2V7QD 4L5BA 4W5JA 1TF7A 5CYPA 3X1DA 4B34A 1UBGA 2PCLA 2PH1A 5IK2A 1OJLA 1SZPA 1M1YE 1BYUA 2PL3A 4QM7A 5FTKA 4YDHB 3AB3A 4JBXA 1W5TA 4Q4LA 5AJWA 1AKYA 2WSMA 4LX0A 5DHAA 2QSZA 4KI0A 3ZD6A 3ETLA 3DHWC 3Q9LA 3MJRA 2P65A 5C4MA 1JNYA 1D9XA 1MRNA 1S1CA 2ZVPX 5FFMA 4GP7A 3BH7A 2O8DB 3KKQA 5KUTA 4S2EA 1FUUA 3KKMA 4IFBA 1CRQA 3PUWA 4TLCA 2WJHA 4MYCA 1R6BX 1DG1G 1SVIA 1XD9A 2ZJYA 3RLFA 5BXQC 3EPJA 2JLVA 4C7OA 4JZKA 1D6JA 1GAJA 3C15C 3GFPA 3MG9A 1HYQA 1AM4D 4RFSB 3FB4A 5KNCA 4BFZA 1SKQA 4XVRA 3B1YA 3A6PC 1EX7A 3KTAA 4LJ9A 5SZJA 2WPDD 3I72A 4LHZA 3VNVA 4P0TA 3FHOA 4HZUB 4M1SA 4R7ZA 2VYFA 4ASUD 4HAWA 4XWAA 2QP3A 2JJ8A 4PAQA 3AEZA 1GIAA 3B1WA 4LJ7A 2KSQA 2RHDA 4TTPA 1KO1A 4IDOA 4B6EA 3LH5A 2AR7A 3ASYA 4JLOA 2A30A 2V7QA 4CYMA 1IY0A 2JIZD 4HUQA 2ZJ8A 4Z1MA 4NYIQ 5J47A 3U61B 3VX4A 2ZI9A 4CIDA 1Z6TA 4Q1BA 3ZZUA 1DARA 3P32A 2CDNA 4QC2A 4LOAA 4B48A 1Z63A 2CCGA 3WHKA 1G19A 3QKSA 1F2UA 4KFSA 1R7RA 4L8GA 3TRFA 2E9SA 4NP6A 1CEEA 2RKOA 3GLHB 3TK1A 1CS4C 1C4OA 1T6NA 5CK4A 4D4MA 4G5RA 3TH5A 3AVWA 2NQ2C 2ZJOA 1HTWA 3QG1A 3DMNA 3KUDA 2JLWA 4DEYA 1HEIA 3OIUA 4MYTA 2OE2A 3T34A 3EIQA 1UBFA 2ZI6A 4K46A 4FIDA 5E7JA 2W83A 3BGWA 4QRHA 3ADCA 1E94E 1IONA 2BV3A 3KKNA 4FMBB 4P4UA 2GF0A 4BE7B 2R2AA 1UKVY 4IOJA 4NCKA 3AVPA 4AKHA 3NH6A 1KKMA 2ZREA 2OAP1 1E9CA 3W6PA 1XB2A 4CGZA 1DVRA 2NO0A 4AKIA 4UXIA 5C18A 1Z83A 2VP4A 3ZJYA 3C7KA 4Q66C 2BOVA 2EWVA 2X2FA 5EE0A 1G18A 2ZVQX 1NNEA 1KTVA 4ASUA 2OV2A 2O8DA 4A8JB 2VH5R 1KI6B 4JLJA 3W34A 3B78A 2IX3A 3CUEF 5H8WA 1VYUA 4O0MA 5AUPB 2VP0A 4FWIB 3GLFB 1KY3A 1KO7A 5B57C 1GKIA 2IC5A 2NPIA 4RFSA 5JRJA 1G1MA 4JYCA 5EJEA 4P4SB 4RD2A 3QKRB 3CZQA 4GNKA 5AUNB 5L8VA 1XMVA 1KAOA 2QUZA 1XBTA 1S0UA 2F9MA 2GESA 2KE5A 4US2R 2WJJA 2VHCA 2JIZA 1RRPA 1CULC 4QJ4A 5BN4A 2QAGB 4ESVA 4HZUA 3NC1C 2O8CB 1CF4A 3TLXA 4A0HA 1DO2A 1P60A 3IILA 3R9XA 4D4JA 1NLYA 1CJKC 2VF8A 3RS7A 1HT2E 4C0AC 2GA8A 3V9PA 5TDHA 1AN0A 2WWYA 1HA3A 1R8SA 3BS4A 5FBLB 2ASEA 3IBYA 3ND9A 3AVVA 1DAMA 1E2GA 3FYHA 2WVJA 2AK3A 1GNQA 1I4DD 2CL0X 1WB9A 5BYJA 4BZXA 4V0KA 4NMMA 2ZUDA 1G17A 3T06B 4MGKR 2CNWD 3EZ9A 4OI0A 3RRZA 2ZIAA 4PSVA 3GJ4A 3H84A 2MSEB 3U2QA 2OG2A 2YV5A 1NY6A 5EXXA 4LPKA 3BC1A 1XEWX 3QEOA 4GRAA 1QHSA 3T1OA 1E9FA 3CNLA 4TL7A 4ZKDA 5GJCA 1NVWQ 2NO6A 2V1XA 4DT1B 3NBZC 4GT1A 5BYKA 4I99A 3H1TA 4JLNA 5GJVC 1XEFA 2GDJA 1TQ2A 5HPYB 3GJ3A 3H0KA 3LVQE 3GJ8A 1BOFA 1TEVA 2GJ8A 3WYGA 2JCSA 4HYYA 2FSFA 1G4AE 2FE4A 2GK7A 1G6HA 5FUVA 5J4LA 2PLFA 121PA 1RPZA 4GOJA 1P9RA 1XU4A 4R98A 1Q3TA 3VU9B 3AJIB 2VSXA 4RCZA 3EZ7A 5JRZA 3MCAA 1GDDA 1ZD1A 4ZI2A 1W49A 1N25A 5KU1A 5G3ZA 5DH9A 1JEEA 3ASZA 1E32A 1HQYE 3X1XA 3ZLJA 4DCTA 1XD8A 3I92A 2CL6X 5G41A 2ZU0C 3ZZ0A 4M9QA 1Z0DA 5FI1B 4A8JA 2GVZC 1KI6A 1DG3A 2P3SA 4H9GA 1ZM4A 4HZIA 4EAQA 2WAYA 3FKSA 3HU1A 1E0SA 3GLFA 2F1JA 3PUXA 4PR0A 1G4UR 3LNCA 5JCZA 4P4SA 3IIMA 3I8SA 3QKRA 4JL8A 2ZS9A 4CRWB 4OK5A 3SC3A 1WP9A 4GFDA 1VG1A 1VMAA 2XEXA 5EE1A 2QPOA 2ERXA 3KKPA 3OEHD 1U98A 2OCBA 3TR5A 2QAGA 3PUVA 1XWIA 4D4KA 2WSSD 2O8CA 3E1SA 4B75A 1W36B 2VIIA 1OFTA 2QE7D 4UNNA 3ZQ6A 2BCGY 3U4QB 2BJWA 4DSNA 3CZPA 2QY9A 1OH5A 1IN5A 4DRZA 1QHGA 3L8ZA 3TSZA 2F3TA 2WKPA 1G20E 4L16A 4HAUA 2WM9B 1JBKA 4C0JA 5JSZB 3PUYA 1IHUA 1Q1BA 3CW2A 1YZQA 3A58B 3ICEA 1P3JA 4DSTA 1Q44A 2FZ4A 2VBCA 1OXTA 1SQ5A 4JT4A 4Q1DA 3SBEA 3M6AA 2ODBA 3F0TA 4I81A 1ZNWA 3BB4A 2BEKA 2V6JA 4KV9A 3QENA 4Q4AA 3E5HA 3KXKA 3DKVA 1EFRD 1EWRA 3A1VA 1UDXA 4LV5B 3KQLA 4PTLA 1OIXA 2A3RA 4E22A 2XITA 4DT1A 4ACBA 5CDFE 2FFAA 3LX5A 3QKTA 5FUXA 3QEJA 4RZ2A 5B2ZA 4B3XA 1MV5A 5DHFA 3VQTA 3CO5A 5J5CA 4LRSA 2RGDA 4RSGA 3IIKA 3TSWA 3U44B 2F43B 1XMIA 2EW1A 5EXPA 2J0VA 5CLLA 4BUJA 3ZH9B 4MA4A 3RYTC 2YWHA 3C4JA 1TF2A 3E70C 3A37A 2YWFA 2WMOB 1WDTA 4NE2A 1KSFX 5E95A 2RGCA 3VU9A 1G8FA 4BFXA 3WMFA 1E79D 1XTRA 2B7BA 3OEHA 1FP7A 2ZS8A 2OCYC 2KI5A 3SN6A 1QHXA 1E0JA 3Q72A 4TQ9A 3CX8A 4Q7JB 3EXAA 1CR4A 4ZDIA 1KDOA 4M1KA 3RAPR 4A6PA 4LYAA 5GADl 1NKTA 3L43A 4JJKA 1U8ZA 1ZD8A 1ZBDA 5K8IA 1A5TA 2JASA 5EP4A 3RRNA 1GNPA 1PUIA 5HZHA 4C0HA 1PUJA 2D62A 1JI0A 2GXQA 3E2IA 1JPNA 2P6NA 3SJAA 3UWOA 2HV8A 3DEFA 3D3QA 1ESNA 3EIHA 2AX4A 2NO1A 4LJ5A 1KNQA 2ZRMA 2CCJA 1BS1A 4MUBA 4NPHA 4Q47A 4B71A 1XXHA 3AP2A 2YZ2A 4LUCA 2WV9A 5B64A 4F92B 1G7CA 3RANA 5BN3A 1EFRA 4XVQA 1OB2A 3MHVC 4G3XA 1NN5A 3U4QA 1MO3A 2GXUA 2IYWA 4Q48A 4Y0VA 1NBMD 2AHOA 2QMHA 3QBVA 5JSZA 1Q1ZA 2A7QA 2Z83A 2B21A 3KUCA 4C0QC 2BBTA 2J0UB 4FN5A 2Q9CA 4OI2A 4F4JA 2P2LA 1M6NA 4MRNA 1HT1E 3WP0A 2R44A 1CXZA 1E79A 4TSFD 3SQWA 4A3VB 2RGEA 4V0NA 1VCIA 4Q1CA 5DLQC 1NMYA 4FCTA 1O87A 2ZRDA 3DMDA 5CM8B 3VR1A 3ZYCA 2CCKA 2ZE8A 5FTJA 1S1MA 1TPZA 2XB4A 1KSGA 5SZHB 3R8CA 4XVUA 3SQXA 2ZS7A 4RKEA 4QGAA 2VP6A 4BQSA 4IXMA 1M7HA 4BRWA 4HI0E 3BAFA 3U44A 2F43A 2R65A 5HR5A 1MH1A 4TLDA 1JAIA 4ZCIA 3KQNA 3K1JA 1QHYA 1N6RA 4A2PA 1Q12A 2FPLA 1XNJA 2OLJA 1NJGA 3BERA 1P2SA 1XF9A 1N5JA 2JLZA 3M1IA 1GL9B 4KBGA 2LKCA 1J8YF 1IBRA 4A15A 2OXRA 1NF3A 1XZQA 3JZAA 5AJYA 5EE9A 1XPUA 3O8DA 1L7VC 4RD3A 4FD2A 4OHZA 2GJSA 3H4MA 1XCPA 4OHYA 2CK3D 2IW3A 3SHFA 3B13B 2WJVA 3QNUA 1NBMA 2HYIC 1EWQA 4TT3D 1H8HD 1D9ZA 1KYIA 2H92A 3GQBA 3VR2A 3T12A 4PFSA 4OK3A 1OXXK 1Z47A 4M9ZA 3T5DA 1YZNA 4HDQB 4LC0A 4LI0A 3S1AB 1US8B 2P5TB 2VLIA 2BC9A 3JVUA 4HB0A 4HDOB 4OHXA 4PPFA 4RY2A 521PA 4PC6A 2F1RA 3LBNA 3GJ6A 2QBYB 4C30A 2BMFA 5L3SB 1A2KC 4TSFA 4BLOA 4OHVA 2GRJA 3W6NA 3TNFA 4G5QA 3MWYW 4BLQA 2IYYA 5KSZA 1N6OA 4YLGA 4LYFA 3QBTA 4C0SA 2W0MA 3W5IA 2ZRFA 4DCNA 3QIAA 1KK0A 4DLRA 3N2EA 1ONBA 4OBEA 4YMUA 1KO5A 1U94A 1NP6A 5DE3A 1W4RA 1XTKA 1GILA 4Z51A 1XCMA 1NN1A 1SULA 5FL3A 1W0JD 2J0UA 3TVDA 1E2MA 3I4LA 3BFVA 1TL7C 1D2NA 2HUPA 5FOTA 3N2IA 2JLQA 5BW8A 5L3VA 1IXSB 4D82A 3T35A 4EPWA 2QNRA 4NYJR 4DCSA 3K9NA 4DLSA 2ZRPA 4OL0A 4QBIA 5JMTA 1QRAA 4GP6A 1F48A 4UXJA 2JAQA 1AS2A 4KODA 3SOPA 2XJ4A 4G0NA 4Q9JA 1HY3A 1GRNA 2DR3A 4AD8A 2WWXA 4O2LA 2QTFA 4HLQB 1IAQA 2QI9C 4KHZA 2O8BB 1UPTA 3HYRA 3FKQA 1E9SA 2RGAA 4TT3A 3M0EA 4IOMA 4JLDA 5HE9A 1R0ZA 5TV2A 3CF2A 5JEEA 1CTQA 1JJ7A 1XX6A 4KO8A 2BEJA 2D2FA 4AURA 2NMVA 1IXZA 4XTRA 5DSZA 1RYFA 1ZIPA 1IJFA 4ZI3A 3HDTA 3I73A 3BORA 2XAUA 3AKEA 4QG7A 3D7MA 3OIYA 3ZGXA 2FSGA 2EWWA 4P4TA 4QBGB 3NC0C 3CRW1 1XJCA 3EZFA 2FGJA 2F1HA 4Q18A 3B1ZA 2B8TA 4HB3A 3PUZA 3K9LA 2BWJA 1TAGA 3NHAA 2WIBA 4DEXA 2ZSBA 5FOXA 5CB8A 2GXAA 1FNNA 4RD4A 3WHLA 2F55A 1Z0JA 2ZYWX 1A82A 2BIFA 4HSEA 4WXPA 4ZV4A 5L3QB 1W0KA 1X1RA 1KI2A 1KMHB 1KO4A 3OAAA 2FH5B 1QG4A 3S1AA 3AM1A 1T5IA 1US8A 5KSPA 1UADA 3GFOA 3AV0B 4URYR 1G3UA 4PZZA 3K53A 3KDSE 5K8TA 2N1BA 5L3SA 5DNYB 4RZUA 2QBYA 1DAGA 3J81k 4I1VA 4D0LB 3TVTA 4JBWA 3THWB 3LDAA 2BMDA 2Q3FA 2QTHA 4FXPA 1VG9B 4R9UC 1PVOA 3TW4A 1E2PA 1VIAA 1GG2A 3WNCA 4CEJB 1N5LA 4LYJA 4RVCA 4US0R 1UBCA 4MKGA 1HV8A 2EFDB 3LWNA 3CH4B 1IN6A 2ZUCA 2DZNB 1ZM2A 4A8JC 4V03A 2R8RA 2P0EA 4IXNA 1GRRA 1ZMXA 2HF9A 5EE3A 1IQPA 1UDWA 3WBJA 2NGRA 4G5SA 1W2HA 3K0EA 2QP9X 4BFSA 2YOHA 2PZEA 2C8VA 2KBEA 2XOKA 1WA5A 4NCNA 1AQUA 4CZ2A 3P4XA 4L9SA 1LVGA 2NZJA 4C0LA 4LBYA 3SDZA 4EPYA 2ATVA 2ECKA 2XZLA 4B35A 4R2IA 1NKSA 3LBIA 2BM0A 3CBQA 4E09A 1K8RA 2ZAOA 2O8BA 2P6RA 3PFIA 1VYTA 2NTYC 1Z22A 1JR3D 2DWZB 4YXWA 1BIFA 2DFNA 1U0JA 2WICA 5JJLA 4JMPA 4QJ3A 3SNHA 3QVVA 4ZKEA 2A2ZA 3SYKA 1CJUC 5DI3B 1QHNA 4M1MA 4GDFA 3DVLA 3EPHA 4EPXA 1ZD9A 2OEPA 4TMWA 1E9DA 4DZZA 2RAPA 3GLGE 1SXJE 1CLUA 3I8XA 1IN8A 2KRKA 2RB4A 3IIJA 3U7FB 2W2XA 5K8LA 5E4FA 2WWGA 1E2NA 3L0SA 2MMCA 3RNLA 3ZIAD 1U0HC 3THXB 1PLKA 4D25A 4Q9IA 5EZ6B 3U7GA 1ZNYA 4JL5A 2PZFA 2GJKA 3AGQA 5A5GA 2V6ZM 2RGGA 2YKGA 1UEJA 4JT2A 2FNAA 3AF3A 4TLAA 5L3QA 4C2TA 2OBNA 4Q4HB 1KMHA 4UNSA 4CW7A 4F38A 2YC2C 5FTNA 4Z1MD 1XP8A 4YMTA 1C9KA 3W6OA 2EFGA 3V4FA 3LO5A 1KK3A 3FE2A 1Q21A 3THWA 3CF6R 5BQ5A 3LQRA 2KB0A 2FFQA 5HCNA 3CRQA 3LBHA 3WY9A 4CEJA 2V8OA 1AS3A 3HR7A 2RCNA 3HYTA 2QN6A 2FV8A 4Q5IA 3AVXA 4UNRA 2J7PD 3PEYA 1ESMA 1KGDA 3IPYA 3C41J 1UKEA 3EPKA 1XCGB 3IDQA 2D3WA 2ZSFA 2PZGA 1G7RA 1GKYA 5EQTA 1JR3A 3CB4A 2ZRHA 3U3KA 4NHOA 4UKDA 3CPEA 4W9MC 1KI9A 3MD0A 1AZSC 3KJEA 4EFNA 3OFND 3IBGA 2J41A 5TVKA 4BZPA 2WHXA 1X86B 4OQMA 4ACAA 3IEUA 3VR5A 1MOZA 4C4PA 3Q7QA 2G9NA 5KYKA 1E2LA 2W2TA 3EG5A 5JEDA 3QQ5A 3F8TA 5LBIA 3KXLA 1G41A 3QF4B 4G5GA 1KK2A 2IWRA 1N6LA 1W36C 3ZIAA 1GM5A 1B23P 4Q00A 1KIMA 1YR9A 3AGPA 4PO8A 1QDEA 2PBRA 5JS8A 2G0NA 4XH9B 2VP5A 5DI3A 5KTYA 1GTVA 1IXRC 2X8AA 5E3HA 5JI3E 2D7DA 1S2MA 4AC9A 4LHXA 1E3MA 3KQHA 3MJHA 3I5YA 4FCVA 2QMOA 3ECCA 5EP2A 1E96A 2WBLC 2CHGA 4LRTA 4M0LA 2OCAA 2PMDA 1XTQA 3THXA 4NCIA 4NTZA 2OZEA 4PQFA 2ZPTX 2IYTA 4D2IA 2J7PA 3FTQA 3BIFA 4YONB 3IO5A 2VHUA 2JGNA 3GD7A 3IUYA 3K0FB 4GOKA 1MR3F 2DYKA 2H16A 3TKLA 1YZKA 4BFWA 3MGCA 4XSGA 4M2LA 4Q4HA 4DLTA 2V1UA 2V54A 3NG1A 1LS1A 3OFNA 1E4YA 4II7A 4F4IA 3B82A 1LB1B 4FINA 4U02A 2AWOA 2B7CA 1P9WA 4DBLC 1WQ1R 2IBMA 5BN5A 1F60A 4HAXA 5KSYA 5FPKA 4FWTA 4MGZR 5JWRA 1LY1A 2BBWA 2WJIA 5J4KA 1G5TA 5FOSA 3TAHA 5JZVA 4L9WA 2FSIA 4QHSA 1R5NA 1Y3AA 4HATA 3CRRA 4M1YA 4TMKA 1OHHD 2IA5A 4ABYA 3W8RA 3TBKA 5JCPA 2NO9A 4AI6A 4NKRA 2FFBA 1AGRA 1NSTA 2D7CA 2I3BA 3EWSA 3CNOA 2QM8A 1XTIA 1FUKA 3EIEA 1OKKD 3SEAA 4BEBA 1Z8FA 1SVOA 1PLLA 1UFQA 3B2EA 1JQLB 4E03A 4LV8B 3UKDA 4LJ8A 1CR1A 1RYHA 2ZRNA 5KPJA 2ODEA 3AF2A 3QF4A 2AKAB 3I32A 1RZ3A 4HDCA 1J8MF 3KW6A 3BXZA 2VP9A 5D3MB 5JJKA 3FKSD 3GEEA 1XRJA 4N0EA 4XSHA 4BWYA 3AKDA 2ZRLA 4BASA 3X1WA 3LFUA 1IOZA 2O0JA 3TUIC 3A1UA 4OKSA 3JVVA 4Q9HA 2IYSA 3LD9A 4Q01A 3ZDQA 2PLRA 3RS2A 5F3WB 3A1SA 2AKYA 3PEUA 5AUQA 4JIMA 3B1VA 1DAKA 2FA9A 2FZLA 4IHQA 1MRSA 5FTMA 1DAEA 2VEDA 3N70A 1FZQA 1G291 2IYLD 3FGNA 2WZQA 4EJSC 5FOUA 3U3RA 5J40A 2VO1A 3ADDA 2FN4A 1Z5ZA 1W7AA 3GLHA 3I62A 2EQBA 4OQNA 4C0KA 2RGNA 4IDNA 4JLVA 1OHHA 1ZC3A 4IDHA 4DDUA 2IS6A 1SHZA 5GJBA 3K0FA 1T8TA 2IYUA 3RRYA 1AJEA 2GBLC 5AWFC 1N0UA 4U00A 4A0FA 2QAJA 2GCOB 2YVUA 3IO3A 4LJAA 621PA 1RRCA 1XPRA 3KX2A 3MSXA 4LRWA 2EVWX 1OKKA 3FHCB 3SS8A 2ZJBA 2QQEA 2ZETA 4BLRA 5KDDA 2JLXA 2OAQ1 3AQ4A 4V0MA 4DB2A 3UMRA 3NDBB 3VR6A 5J4YA 2ZUBA 3EAQA 3SE0A 2GZAA 2CLCX 1DOAA 2BCJQ 4MYUA 5GVRA 2CEAA 1OE0A 2A9KA 3BRWD 2WOJA 3DL0A 4AG5A 1N0VC 2AFIE 5FL7D 2BVNA 4B6FA 4NONA 1EX6A 1P7CA 1KSJA 4JN6A 3AF1A 2DWOA 1OW3B 2XTZA 2Z43A 2Q0HA 3FFAA 1P5ZB 3U3OA 4TZ6A 1ZCAA 1KDPA 4GMXA 3EC1A 3C16C 1VYVA 1YRBA 2UZ3A 4I1SA 3REFA 5H68A 5SZIA 1YRAA 3LV8A 4Q1FA 4QNMA 4YMSA 3Q8XB 1SVMA 5JWHA 1EFUA 1N6HA 2V3CC 2FPMA 2FFHA 1QZMA 1ZC4A 5E7MA 1OFIA 1RJ9B 2JLYA 3VKGA 1VPLA 4DLVA 3WMGA 3VLFB 3K0AB 2F3RA 4ZCMA 1R2QA 1WE2A 5D3MA 4MRRA 1E9BA 1LF5A 1U9IA 1Z2CA 1ZJ6A 4CEIB 5E7IA 2G0TA 2FSHA 4E07A 5G40A 4NCHA 5ANRB 3VX3A 4RJLA 1DE0A 1CRPA 3SFVA 2HJGA 5F9HA 3LXRA 4UJ3A 2GCNA 2FG5A 1GWNA 2AL7A 4Y0AA 3Q5DA 1G8PA 4KCGA 3VNUA 3REGA 3WP1B 2J59A 2ZAMA 4XWKA 4PXAA 1NG1A 1W36D 1KI8A 1NVMA 4HLCA 4LZZA 1Z6YA 5DIFA 4BLPA 4AKGA 3B1XA 2J45A 2DVWB 2GXSA 2Q3HA 4WIAA 4US1R 1N0WA 1ZP6A 2G1JA 4FMCF 5FL7A 2ZITA 4QHTA 1X3SA 4O25A 1GOTA 3KJGA 4Z54A 3P20A 1FTSA 2WIAA
chains in the Genus database with same CATH superfamily
3JYHA 1P6XA 1AS0A 1YFLA 1PR1A 3FTEA 4QWMA 2H17A 4S1TA 4GUAA 4JXKA 1B0ZA 1Z38A 2IODA 1YB7A 4EVRA 4P35A 3IEPA 3EB9A 4EHFA 3N2YA 1P6UA 4CFZA 2I34A 4TRMA 4EL0A 2GX6A 4HDSB 4AY6A 4Q34A 5G1PA 1HORA 1BMTA 3U39A 3V7FA 2RARA 5J9FA 2OBLA 5CVDA 4YCJA 4B7ZA 3ZHZA 4CM7A 4LGYA 1M2JA 2QRNA 1Y8GA 3MT9A 1ZH4A 1XNHA 3NDPA 4XD7A 2TS1A 5F9FA 4CG1A 5EXSA 1CUXA 5C3UA 4GLBA 5IABA 3ORQA 4BGIA 4DLBA 1EJBA 4NJMA 4F7WA 2JW5A 1P2UA 3GUUA 1MFZA 2CDBA 5B53A 5ETJA 4HNAB 3O3OB 1EDEA 1MT0A 2BWEA 4FMPA 3N1UA 3IODA 5DTRA 2F7SA 3H2KA 1ULBA 3NTLA 1BROA 2JCXA 4TYWA 4CVNA 3L02A 4XCVA 5KMGB 3DF7A 1NSYA 2VCHA 1K6EA 1XCOA 5F4ZA 2AJCA 3V46A 3RJ5A 4D3SA 3WRYC 2Z5GA 1BE8A 1NYLA 1VHDA 4YRPA 4P3YA 4G9EA 1YL5A 1HFEL 5GGXA 2WSYB 3IALA 5ALHA 4NBUA 1Q0UA 3WYFA 1FJGM 4RS4A 2D5CA 3BB3A 3GPCA 4KSYA 3W1WA 4B3GA 2JJMA 4Z4IA 4FYXA 2GEDA 3LLMA 3A6EA 3RAFC 1ZCBA 4DCCA 3D0QA 1RYNA 4EK9A 3CCCA 4ALLA 1UXJA 3VNSA 2A57A 3ISJA 4LCJA 1UP7A 4N0QA 3RUAA 4JNCA 2XVXA 4X71A 4C4ZA 3EMVA 3RR2A 2V6BA 3C87A 1AUPA 2RGNC 5JZSA 2A0UA 1Y80A 1A9QA 2XLCA 4ZWNA 5LZ8A 3RS3A 3OICA 3UYLA 1JE1A 5D5QA 3TWMA 4EFMA 2VUSA 1G3RA 4MVJM 4MAFA 1OAAA 3QFRA 1FIUA 1E92A 4LJ4A 3B5IA 1DS6A 3FPHA 2WNHA 1NHWC 1X39A 3NHLA 4V0LA 2RHRA 3CQ9A 1NSFA 4MV3A 4CDRA 4KBFA 3EF0A 2H0QA 3G85A 3ASVA 1U9IC 2BZ0A 2H5EA 1YCDA 4CQMA 2K4MA 4EUEA 1CUSA 3ZHVA 4JJGA 2WV7A 1QH8A 4XFKA 1CIPA 3FOZA 5F1OA 4AJEA 1A7UA 1T91A 2QM7A 3LUGA 3SBXA 1EINA 4F4DA 2ZRBA 3KP0E 4P4GA 2FFRA 2CSXA 1VPEA 5CFMA 1A1VA 4DL9A 5DM0A 3QVGB 2Z98A 1YQTA 2P6UA 3EIFA 5DFLA 3ET5A 1WV0A 2O07A 2OM2A 1ZRSA 1OSNA 1CR0A 1YZGA 3H75A 3ODGA 4JR0A 5AW8A 1GTG1 5KNBH 3A1WA 5JASA 2I8LA 1COWA 5ALFA 1F6WA 5EJ5A 1P0FA 1I4WA 3HY6A 4WZAE 2OENG 4ND1A 4CEHA 4Y2PA 4YMHA 4KJZA 4HDNA 3C48A 5ESDA 2DXIA 1CLEA 3KVVA 4NC6A 1CD5A 1OYYA 1A04A 3QHPA 2Q4DA 1BA3A 4Y98A 2GDZA 2C2KA 2NNLD 2PWYA 1U2EA 4JEUA 1ZH0A 2RKBA 3UJAA 1XROA 5CD1A 2BFEB 2P8JA 2AE1A 3BD6A 1I30A 3DXYA 2ZYDA 2QP4A 4MV1A 5JNLA 2ECPA 3K70B 1MJ5A 3DH0A 3SSNA 4AULA 1KC3A 4GLFA 4QBTA 2IVFA 2YDYA 4WBNB 2RHOA 2NAPA 4IFEA 1QCZA 2GJ9A 4B73A 2RGOA 4K6GA 5JW6A 3S2EA 1G2IA 4FOPA 1QO0A 3P71T 3E3LA 3CWZA 3GB9A 3UJDA 4IGFA 1RBMA 4CJ6A 1OLSA 3BN3A 2H1OA 2YHSA 1QE5A 1UT8A 2BY4A 3JARB 2W11A 2OFWA 4PX5A 2N46A 4A5SA 1ZKDA 3S7ZA 3KB2A 1TU0A 3PDCA 2J3MA 1DBIA 5JAPA 1O6ZA 1QNFA 1ADCA 1PGNA 2R8PA 4QO8A 3IA7A 2I7DA 4YRDA 3LWDA 5CCXA 3WDLA 1LV7A 2R1ZA 5DB4A 3TNYA 1I1NA 2GYUA 3TVYA 5ALJA 3L05A 5AK5A 1MIOA 3G3EA 2C5LA 1IBKM 2K6GA 2CXHA 1WM1A 3CJRA 2GZHA 1ZG3A 3LPAA 2JFYA 2ZUEA 4GGPA 1FFBA 1VHLA 1ZEMA 4XEUA 4TV8B 5CJJA 2X9GA 4IDCA 2GEUA 3DDZX 4CLRB 1WBBA 1GL7A 3K7EA 2W0SA 5HZMA 5SZKB 1W48A 5E8RA 2VJKA 3VVLA 4IKPA 2AG1A 2OHVA 2IP1A 1MAHA 4QKQA 2WDPA 3FJ1A 4PFKA 2QE7A 1T2NA 2BKXA 1J2EA 2Y0BA 1VCNA 1L2BA 1SWWA 1XD2B 3EHEA 2B6HA 4LF7B 4F0JA 5ERXA 4AROA 3F92A 3W6ZA 1NWHA 4QAQA 2R25B 3K9OA 2JY5A 3RDPA 4K1LA 2O2CA 5AVKA 3B1JA 3BJRA 3E3OA 2H85A 4W5OA 3B2NA 3NWJA 3GLHE 4GXTA 5IUJC 3L1KA 3WDKA 1P29A 3I42A 1T9ZA 5KKCA 3OLZA 3LYAA 2FEMA 4LCBA 1WMSA 3KV1A 3T1QA 2VSOA 3G59A 2B98A 2VSFA 3JQ6A 1GVNA 4ZI7A 2ZR0A 2AKEA 3SF0A 4N1AA 4JVOA 5AJHA 3N8HA 3QVUA 4ETWA 6CHYA 2V7UA 4OU7A 4YUVA 2AE2A 1SOWA 3FYUB 1EFCA 3FOWA 5ER6A 2Q0XA 3MAAC 4L5CA 1GA1A 5DISB 2EG5A 2WYWA 3D8BA 3RBXA 2QT1A 4JDUA 2QGNA 1H9BA 4EGCB 1C1HA 4URUR 3KP1A 2DFDA 4ZCQA 1XEWY 3I6YA 4BJ3A 3AY3A 4I1YA 4RK0A 1X0VA 3PUHA 3D8UA 4W4TA 3DBLA 2CMGA 3F1KA 3A06A 4GITA 1W93A 4B2LA 2D7HA 3QWHA 3BRQA 3UAWA 2EBHX 1N6IA 2JS7A 3NM6B 3JQBA 4IJQA 3P8ZA 2DFVA 1EM6A 2V55B 1SCIA 4Q21A 5TVGA 4QOIA 3MIIA 5ECDA 3NCTA 3M3DA 4A2QA 3QI2A 1P2GA 2EEPA 2ZYRA 3DCIA 5CVCA 1VB3A 2IEIA 1PO7A 4EB8A 4DYHA 1E2HA 4LGMA 1PFYA 3N86A 4W5RA 3GO4A 3ANSA 3ENWA 4XSVA 4YCCA 4F06A 2W58A 4HN2A 4I50F 3G7SA 4PGGA 2XZFA 5C5EA 1U2RA 1DXQA 2HNKA 1TVCA 2ZYIA 4L2IA 3QXCA 4BLTA 3AF4A 4DV7B 4HCJA 3ZD7A 1HFKA 2Q1TA 4DUZB 1PFKA 1Q2XA 3R5FA 3Q3HA 1JZQA 1R8JA 3RUEA 1KYWA 2DHRA 1FOEB 3QY0A 2P9JA 2A5LA 4RF3A 2J0SA 1N7JA 1XZDA 1YKSA 1VCMA 1DT5A 2ZZKA 5C8DA 2GO1A 3D8SA 1GKUB 3MTBA 3DUWA 3H8VA 2GBGA 1RE1A 3RS4A 2XBMA 1EDBA 5CNMA 4MPTA 4DR5B 1BYUA 4CG0A 3VJMA 3DHWC 3GN2A 1JNYA 2VA9A 3FE3A 2ZVPX 4FT2A 1QQAA 1JZSA 2CL5A 3NHWA 5JFTA 1GAJA 1NPDA 2Q7OE 4MEJA 4J3JA 2P2ZA 4C89A 2WPDD 3LHKA 3GFQA 2VVTA 4P0TA 4JBNA 1CE8A 2QR5A 2VPZA 4PAQA 4QVIA 4F71A 1H0SA 2DY0A 4CKXA 4B6EA 2WJZB 4RPJA 5ECWA 4NG5A 3ZE1B 4OQQA 4HN4B 4JQSA 1ORRA 3WS7A 5KO3A 3JQDA 3KOYA 1JTVA 3GLVA 1HTWA 1ABFA 4MYTA 4PG8A 4KQEA 4FKZA 2W83A 4P4UA 2N0SA 3CUKA 2A88A 2NT3A 3SGLA 1CFJA 4HGZA 4K05A 3D4LA 4IILA 1KVRA 3AHHA 1S3FA 2BFPA 3SEZA 4FWIB 3M5WA 3I2YX 3U6EA 1O96A 1XBTA 4US2R 3ZNQA 4WLOA 5A3RA 1B43A 4CKYA 3QQPA 5CXSA 2Q3EA 4A0HA 4WT7A 3E3AA 5EMKA 1GJSA 3WKBA 3SXUA 4C0WA 3FYHA 2QW1A 1TJPB 4HEHA 3AW9A 5F7ZA 4MGKR 1C3JA 1W4LA 1J8DA 3DE0X 2MSEB 3T54A 1A3CA 2JIOA 3D4IA 4M1ZA 3OPYI 4LDAA 1TJNA 4B6OA 3RK1A 4D9MA 1N78A 4GOMD 5A3JA 3ND5A 4I5SA 1BOFA 3KYCB 1DJOA 1S2IA 2QDXA 3A7DA 4X66M 1Y4SA 1G6HA 3LUPA 3DLHA 1D1QA 3U4GA 3KUXA 1T29A 1Z0UA 3ZLJA 3R6GA 1XQXA 4M9QA 3BK2A 4OLHA 1VIVA 3FKSA 1Y1SA 5TQ2B 4GFDA 2FUKA 1WOYA 4GNRA 4JI8B 4GPZA 3VC2A 1G21B 3H6HA 3ZDEA 1JXAA 1L1FA 1QVVA 5EMHA 1PQWA 3FVTA 1DJQA 4RENA 4MW5A 4L50A 1Q44A 4N0MA 1AKUA 5E6UB 4KV9A 4DRXA 2E4WA 3BHMA 2B8EA 3WWDA 3F4KA 4H7HA 4OL9A 3HV2A 4JI3M 5LU8A 3QEJA 2OOKA 4Q7QA 2NT4A 4MDYA 2YWHA 2YICA 4EUFA 1XZLA 2CYBA 1KSFX 4PLPA 5AT1A 1P1RA 3E8MA 3GEDA 3NEAA 2R11A 1R4MB 4KN5A 2CLIB 4PSCA 3HCWA 4P53A 5IDWA 5IWAB 2WUEA 2ZUWA 4D6XA 2ADMA 4NDNE 2PANA 7ABPA 4Q47A 2WWVD 4NPHA 5KAPA 3RANA 1XL1A 4ND7A 3U4QA 2H2WA 3RARA 3FUWA 3QBVA 2JNHA 3TZKA 3H4VA 4L74A 4O63O 4P38A 3LXMA 5DU2A 4OI2A 5CW2A 1NAHA 5EYPA 3A26A 2WU4A 4FCTA 1O87A 4CMKA 3I2IA 5JS1A 4WZAB 4HI0E 2F43A 2O4CA 5BRJA 2MYPA 5KKAA 2LKCA 3V7NA 3OX1A 2VSQA 3W9SA 4UPDA 3RJMA 3FUVA 3O8DA 4RD3A 2GNPA 4ZTUB 5A2QS 1PYOA 4WK2B 4TT3D 4YCSA 1D9ZA 4P3XA 3L41A 4P2GA 2BL4A 4PFSA 2V9CA 1N33M 4HDQB 2Y92A 3S1AB 5CCDA 1US8B 3AERB 5JAIA 4A0QA 2YXDA 2AOWA 3GT4A 5AVQA 2GD6A 3KQQA 2YMLA 1ONBA 4GYYA 3AY0A 4I2NA 5IULC 3CKYA 4YAFA 5ICCA 1SQ0A 1NXOA 2OO3A 2XUPA 3EQ6A 3GOHA 1H1LB 2CLKB 3CZ4A 5JMTA 3JQAD 4KODA 3CIFA 4RE5A 3CZ9A 1RMYA 3M0EA 1A8IA 4JLDA 4DLKA 3AJDA 3FA2A 3IDOA 5CH5A 3EULA 3BORA 4EB3A 4L8WB 4QBGB 3WA7A 4BNNA 5LJIA 2Y05A 4UPEA 4S1VA 4ODIA 3RYFA 2Z2IA 1V3UA 3RVRA 4BQIA 1EFLA 3JAMS 2H52A 1ZMOA 4QU9A 4ZV4A 1X1RA 2I4MA 4UDOA 1H66A 5KSPA 3TL4X 4EO9A 1PT8A 4ZMBA 1NLMA 1CEYA 1DKUA 3KAPA 1A9XB 4DV1B 4JV5M 1S7CA 3EXHB 2QL5A 1LK7A 5AM2A 4HH3C 3GMDA 2XOKA 3FD8A 2JJYA 2J9FA 1CETA 2ECKA 1A5BB 1E3WA 1VP9A 2G36A 4LFCB 1CY6A 3L6DA 3DLIA 4WFIA 3PL5A 2WWGA 3L0SA 4HYQA 1HLGA 3A0UA 4BC1A 3OU7A 3JQ9C 2WILA 4JC8A 1UIMA 4CW7A 2PR2A 4F38A 1CWUA 1C9KA 5DNYA 2W2KB 4RL6A 2KB0A 1HSOA 1AV6A 2PX4A 3ROKA 3MD0A 4J2HA 2XUHA 3KKKA 3RSFA 4R5MA 5IJZA 2R8EA 5LZ4A 2BE9A 1Z5BA 3E27A 3AI3A 3W8FA 3VOTA 1QGUB 4GI5A 1K08A 3CNQS 5LP6A 4CM4A 2G0NA 1DCTA 1MTZA 3NDJA 4HX5A 5EWLB 3OM0A 4LNUA 3KQHA 3MJHA 2RHJA 4J4BA 3SF8A 1L2CA 4NCIA 2OZEA 3CE9A 3IAS1 3GD7A 3NTVA 3WLFA 2X8WA 3MGCA 3BE6A 4YTEA 3L8CA 2PSSA 4N5HX 4U02A 3BMOB 1P9WA 2ZAGA 1F7VA 3U16A 5FOSA 1P2DA 4DQUA 4V0QA 5A7HA 2NO9A 3I1YA 4UMFA 8MHTA 2B9VA 4DRYA 3KHSA 4L5IA 2X4LA 4KR6A 1ZGAA 4BP9A 3D1JA 1TGYA 3UKDA 3P9PA 4HDCA 3QYAA 3QE3A 2B30A 2JGJA 2I80A 4LDQA 3RIHA 2KPOA 2QJFA 3Q9NA 3BWEA 1IE3A 4DNPA 3BX1A 1KE2A 2FPGA 4C04A 3TIIA 4QYMA 3GCXA 4BBJA 3ONFA 5DSXA 2IZ5A 3ZCBB 3W9BA 3RQSA 4OQNA 3M6XA 4Q9AA 4IDNA 4F7DA 3OM1A 3FMVA 2F8LA 4MH0E 5JU6A 1NBAA 5IJ0A 1YSYA 2GCOB 3IO3A 1GL3A 3A32A 2ACVA 1OKKA 3FHCB 4V0MA 2VOJA 3D02A 2C2WA 5DSTA 1XDDA 1OE0A 1ZD3A 1QR2A 1T4CA 3CURA 4LDNA 2B83A 2IDKA 1EIJA 4ENPA 1P5ZB 4TZ6A 2ZBQA 4KNYA 2G4LA 4UMVA 4YRIA 5IZCC 3N07A 3OP1A 1BHQ1 4JBHA 1LI4A 1SC9A 1FDUA 1XU7A 1E9BA 5E7IA 2EERA 5G40A 2Z6QA 1AHIA 2Q29A 1ISSA 3HK2A 4LF5M 3THSA 1F6DA 5DIFA 1T1SA 2YHIB 1VSQA 5KTSA 2DVWB 1Q2UA 4CBVA 3GBVA 1H5QA 2Q9UA 1H94A 1MP0A 3UCFA 1GOTA 2VUIB 1Z7YA 4MWZA 3CUUA 2QRUA 2E6KA 3DS8A 2AXQA 2FW0A 3C3BA 4V3BA 4AWXA 1QX3A 2R60A 2WJ6A 3LHFA 4NPAA 1G0OA 3V34A 1RPJA 3JAWB 1ZI6A 2IOFK 5ENVA 3PC8C 1BKSB 4BBZA 1TUGA 4QA9A 1IVYA 5IM4F 3HU3A 5AVJA 4UDYX 4DDMA 2JAOA 4EATA 4ZREA 1OXVA 3UK2A 3PQCA 4ZU6X 2JJQA 1QUTA 2CWWA 4ZOLB 4ZICA 1J1IA 3GMTA 2OD2A 1K1EA 1GCUA 4AJPA 3V3KA 3A1EA 4D45A 1QH1B 5EIEA 4DXAA 2RFLA 1WHCA 4D81A 3G0OA 3RS0A 4F4CA 1YS9A 4HUTA 1SIOA 2PKQO 2JD1A 5C7IO 4HVLA 1JPUA 4G1VA 3TTUA 5D7NA 2XE6A 1PV4A 1PNQA 1MNQA 3FF4A 1YAJA 3IBCA 4Z9YA 5IKOA 1H2WA 4KXUA 5ICGA 1H1DA 1FW8A 3JD2A 1PTJC 3A42A 2X5JO 4PLVA 4LF8M 4YJ2B 5BPFA 2V4ZA 1K75A 2HYDA 3CX6A 1NFRA 3HKCA 1R3UA 5B6JA 4H31A 3G9ZA 1W85A 3I4FA 4N47A 1YOVB 1ZYUA 3PFCA 1OVMA 2BKUA 2X4DA 1W0KD 2I2DA 3GAFA 4Q4CA 2JFHA 4XDGA 4GR5A 3SSMA 3NAZA 1E2KA 3N0RA 3AI7A 1KEKA 1ARZA 3DE6X 4RH3A 4IIFA 3CPJB 4QDUA 1LRKA 3RF6A 5KYVA 4FDLA 2BDTA 1NDQA 3EA5A 4B7HA 4XW2A 4ER0A 3PG5A 1DOHA 1U3WA 4OAPA 1C9DB 4WAUA 3O2NA 3VTKA 1M6VA 5I4BA 4YXWD 4EMBA 3AP3A 2JBHA 3B5JA 4HQLA 5H3CA 1ZH2A 4KQKA 4KWCA 4IBCA 4ZT4A 2XOEA 4MLPA 3HR8A 4UE3S 2X6RA 5GV7A 1II8B 2VTBB 3U4AA 2ZSEA 4D4LA 4YV1A 3L04A 2ZM6B 2PO7A 4JLKA 2NVUB 3VVMA 2IHVA 4YFVA 3F7MA 4AW9A 1QZ3A 2QZPA 3RSGA 2B2NA 2L09A 3LTNC 3BJIC 4B44A 4JB8A 4YLYA 3UW1A 2DWQA 2A5FA 2YVAA 3UQYS 3ILXA 2OYSA 3RIMA 2GTPA 4X00A 2V5UA 2EZ8A 5FOVA 1TC1A 2VYVA 2R2GA 3UM9A 3QFSA 1YASA 2HT6A 3HCCA 4FILA 1JB1A 3EEBA 1GNRA 3QUCA 2ZAIA 4KC0A 2JIMA 3FPAA 3JZFA 1Q0ZA 1AGXA 1WQ3A 4BKUA 1MTOA 3TZEA 4QYWA 3VDMA 3CRVA 3BSSA 4OB8A 1FFHA 3KJQA 3I3OA 4O8CA 1DELA 2EJTA 4FFWA 3KP1E 1RQ2A 2HI0A 1TDJA 3PLAE 5E1MA 5BQXA 4E5DA 1A9YA 5BR1A 4BO1A 2YFYA 3GZ4A 1IUKA 1Z36A 4A92A 2XA9A 1RZUA 2ZRGA 4Z86A 2XUAA 1HNWM 2FSUA 1TRHA 5B3LA 1KVTA 4DBGB 3HEAA 2YWXA 1UWCA 1MOQA 4Q03A 2EP8A 4U0KA 2ZJZA 3V5NA 1WF3A 1WXHA 3L2OB 2Q45A 1E2EA 3MS7A 3MT8A 2RDMA 2CHQA 3WB9A 3GHHA 4OLFA 4PZDA 3FPCA 3U19A 3ZXXA 3VGJA 4GSKA 3LPDA 2YJZA 2GEKA 2DT8A 4OSOA 1ZUHA 2Q6IA 3PFKA 2FR8C 2H3EA 4J0DA 4AJ1A 1OYOA 1A7JA 4O4LF 1TCAA 4TXHA 1ESDA 1FTNA 3GQ4A 1MAUA 1KZ9A 4NCXA 2I1QA 3M82A 2CJFA 4KQ6A 2WD8A 3WXMA 5ADUS 3TNDA 3KQKA 1FBNA 1JVSA 4HMOA 4WVFA 2GCIA 5TEVA 1GYQA 4AUMA 2E7ZA 5C46F 4Z4FA 1HYHA 1DC7A 1VMDA 5CXUA 4V38A 5FXMA 1VZ3A 1FW6A 1FK8A 2LCQA 1CHNA 3W5JA 5IU6A 3BZBA 4ZCLA 1GV0A 2Y6VA 3KB8A 4J1TA 4J49A 2VOEA 3AUUA 2ONCA 4URXR 3NHUA 5DBGA 3WSWA 4G26A 3SYLA 3NS7A 4AJJA 4KITB 5WRFA 5DX1A 5JECA 4XK8F 2G5GX 2AXPA 1GG5A 1F2TA 3AEKA 1LFDB 3QELB 3A11A 5CFRA 3R9WA 3QKIA 4KAAA 2Q3CA 4C43A 3MCZA 1Y8QA 4Q3LA 3HXKA 3LT4A 2LTAA 1ORHA 1HYBA 1ZH6A 4NCJA 2HTEA 4RA9A 1D0IA 4CKEA 2VDMB 1DRWA 1TU3A 2XXJA 4QHYA 3GJ7A 3LGXA 3KOYE 1FDWA 3HB0A 3M4XA 5B2FA 5JMOA 5E26A 3SP1A 1EXMA 1F1JA 4F5ZA 3WK8A 4WCFB 3GD5A 1RXCA 1R4NA 4RAQA 5C9ZA 4ITVA 3PKIA 1BH2A 1JG1A 1TVKB 1KZHA 3PEVA 2H65A 3NPMA 4UDXX 4IMJB 1FFWA 3RVKA 2ZE7A 4YJHB 3TOCA 1YBHA 4NV3A 5TQJA 3VPDA 1RWWA 4BEJA 1X8KA 4RA6A 1WDLA 1G8SA 2B8JA 2O6LA 4B82A 1NNUA 1U28C 3F3MA 3DCYA 4KQHA 4XPZA 3NJRA 1NTRA 3G2KA 2YMPA 3ZCRA 1PFWA 2QVZX 1V2GA 3AJRA 4OY3A 4BO2A 3PJRA 1CY8A 2D1FA 3BMNA 1IOVA 3VR4A 4RVUA 1LPSA 2V59A 4OREX 3HZHA 1V26A 2PBLA 2PUFA 4C4YA 3WX0A 3B3QA 4U39A 2VA8A 2AOUB 1P9OA 2O01F 2A5YB 1USWA 3HO6A 3O0DA 3MOGA 2WHQA 2AW3A 3VR3A 4EX7A 1BE6A 1P75A 1JJIA 4LC9A 3J7AC 3MWLA 2VRCA 3ADBA 2XWQA 2V6FA 1NASA 2IUTA 4II3A 4X6LA 1E7WA 4RPGA 2OO9A 1GITA 2M6RA 2V5AA 3H2BA 3WK6A 1X2BA 1XMOM 4YJ3B 4ZHQF 3P19A 3OM8A 1Q6ZA 5KJEA 2VPWA 1M2OA 2OORC 4N40A 3AVUA 4XWOA 3ONVA 2R5WA 4ZVKA 5EG5A 1PNTA 2EARA 4N3NA 1YIOA 1I2AA 1X7ZA 1AIPA 4MR8A 2BFWA 4L9AA 1FVXA 3N28A 1FU7A 3E81A 4RHCA 2QIPA 4YI3A 4MS1A 1JVNA 4R2XA 5B1DA 1ZFNA 2DSTA 4DC1A 1VGVA 2LW7A 2IPAB 3JD3A 2L6OA 1Q1AA 1NVAA 3K6KA 5K45A 1SU4A 3CNNA 4NR0A 3ZY5A 4X45A 1V16B 4TL6A 2HDOA 4D80A 2IKQA 4NYMQ 2NUTB 5LYJB 2C5SA 1OWPA 5CVVA 3OU2A 5KYUA 1V6CA 1BHO1 4IJWA 3PHBE 4MI1A 3T8YA 4WA7A 3IECA 1XFAA 3T61A 2A0YA 1C3XA 3L0ZA 3LC1O 3II6X 3V2IA 2QW0X 5AW9A 3KHTA 1DLJA 1EFDN 1M34A 1R0KA 4S05A 2ATXA 1WY7A 4JJZA 4WINA 1LX7A 1G9SA 3RAJA 1RRKA 1JUDA 1UOEA 1PKEA 1NM5A 3ZVKA 3PYMA 1CZHA 1TADA 1DLIA 3N7UA 3FMOB 5T4FA 2NV2B 1KO8A 2OAGA 2XCIA 4QU8A 1WEKA 2V7QD 2PCLA 5IK2A 4COOA 3AB3A 2JNWA 4LX0A 3T9FA 2PU7A 2AFIA 4R8LA 3WADA 3U60A 4EGJA 3DAPA 2YCLA 4DG5A 3PUWA 4O5OA 4IF4A 3T7CA 3EPJA 1DG1G 2B99A 3W79A 3FB4A 1PV2A 4CKBB 1P4GA 3HWRA 4DMUB 2BR4A 4M1SA 2GCGA 2QP3A 2GPJA 1QFZA 2Z09A 1TD9A 1XVAA 3C3CA 3OOJA 1KU6A 2F3SA 5JUWA 4Z1MA 2IXDA 3Q3IA 4L8GA 4LMBA 4B4KA 2RKOA 1N75A 2HHAA 4HYTA 3IPRA 3A9CA 4ARSA 4FIDA 2C9DA 4HL4A 2GF0A 4WDRA 3ZCUA 2C3OA 1VJGA 1T5SA 1EX1A 2P9CA 3VUEA 3K15A 4N6NA 4PWZA 4DPMA 5JDIC 2X3YA 3GNQA 4RFSA 4RV5A 5F52A 2NUAB 3B74A 1S0UA 1MG5A 1CVRA 3H5IA 1EVZA 2E4ZA 1RRPA 1QE3A 1FFDA 1B3RA 2UXCM 3A6FA 3UZUA 3TLXA 1P60A 3IILA 1R8SA 5FBLB 4ANFA 3ABOB 4AJLA 1CFZA 3ZHOA 1G17A 3DE4X 3PS9A 1Q0SA 4YO7A 2OG2A 1TGVA 5FLEX 4WUTA 3EG9B 1DKQA 3FPEA 1DPGA 4YREA 2FPWA 4JLNA 1UBUS 1JR4A 2GJ8A 1MO2A 1VBMA 3VPBA 4HYYA 121PA 4PONA 1ZMVA 1YWGO 2R79A 2UYQA 3X1XA 1HQYE 2MGWA 3P9ZA 2HLPA 4MI6A 1RCTE 4A8JA 1QIEA 6ADHA 4X24A 3DZKA 4QQFA 4P4SA 2MINB 5JCOA 4ZVOA 2BGUA 2OCBA 2QLLA 1VPWA 4FUQA 4B75A 2FQYA 1M9NA 3OM9A 2GLUA 2QL9A 2VT3A 1GLGA 2R1UA 2HNAA 4C0JA 3B3AA 1AKMA 2QRKA 5G0UA 5L7YA 3ZH2A 4JT4A 1TDHA 3OKFA 4PTLA 5JAHA 3E84A 2P4EA 3HUUA 1LBTA 3FAZA 3LX5A 1MXHA 1YS6A 1YV9A 4O0LA 3R3VA 4UBMA 4IUCS 4CPDA 1PR4A 4BO4A 3IAUA 1KR5A 1SQFA 4GEWA 1ZXBA 4AX4A 1WDTA 1G8FA 2B7BA 2KI5A 2PM8A 1W1IA 3CEAA 3GY0A 4A6PA 2I5PO 1W88A 5DMHA 1CQIB 3UB3A 5HP4A 5K8IA 3MM4A 3LBAA 3D0OA 3SLRA 1GNPA 3VO9A 5JARA 5D8DA 4KQMA 2HV8A 2YWCA 1KNQA 2XZUA 2RE8A 4WVLA 5DKFA 3M6VA 4LA4A 3AHJA 3RTAA 3CX3A 3HMKA 2H2AA 4ARBA 2X3UA 2MIIA 4RQUA 3C39A 3K2QA 1DIBA 4MEBA 1RM0A 1X80A 1N34M 2R1VB 4ND3A 3UB4A 3S2YA 5HQJA 3GPPA 3OTWA 1TJ4A 3R8CA 2ZS7A 3C7AA 3WWZA 3Q9UA 4DJAA 1T8PA 1J8YF 4CKCA 1OMOA 4X65B 4TVOA 1GUDA 3HZJA 2IW3A 1PR9A 1AMNA 4CT0A 1INLA 3B7WA 4ZRMA 2P9HA 1JKJA 1PWXA 1UQRA 1NJ5A 2W8BA 4CFSA 3K35A 4R9RA 3BZUA 3HWX1 5KX5F 1LUAA 4BGUA 5LOVF 3IG5A 4DCNA 3HC7A 3QIAA 2PRZA 1W4RA 2H51A 1NN1A 5CA1F 2XWPA 1D2NA 1JH9A 1QRDA 4RHTA 2JLQA 3K2IA 2KW5A 4NENA 4I14A 4EMTA 5HXAA 1QBGA 2JAQA 3P94A 5AP9A 4A8TA 2XPCA 2ID7A 4J16C 5KVAA 1O5TA 1CX9B 5EERA 5AW4A 3L7KA 5I6DA 3ZDYB 3AKEA 3QBDA 3EZFA 1XJCA 4Q18A 2PIDA 1KMMA 2BWJA 4Y9TA 1A96A 2HPAA 4LRUA 1E6LA 1YQ9A 5KEIA 3DDOA 1UDAA 4CGYB 2YN4A 1JDUA 4G4SP 1UZMA 2A0XA 1E1KA 4PX3A 5K8TA 4W8OA 4D0LB 5DXJA 3HBAA 4Z0NA 4BMSA 2EQAA 4US0R 1GYPA 3INYA 5FX2A 1UDWA 3T4EA 5AESA 5HKLA 2QQFA 4P0QB 2R7AA 3T0FA 3TGWA 4DVJA 4URFA 1SBIA 3ZDBA 4PG4A 3H2ZA 3O26A 1VYTA 1JR3D 2DWZB 5K3FB 4E15A 4PY2A 4HUJA 4OH7A 4EPXA 1HLPA 1DV1A 1WSDA 4TMFA 1YJBA 3HV0A 3R4CA 4MR7A 3THXB 3FCCA 3QLUA 3MJ5A 4XWTA 4Z2AA 5L3QA 1YB4A 1NF8A 4UNSA 1D7OA 4MYDA 3GUCA 3QYJA 3UCXA 4C3UA 3LBHA 1Z4NA 4JUIA 4ZT5A 3A6GA 3HYTA 4JITA 1LKZA 3LP5A 3JQGB 3RADC 1FJHA 3C41J 4Y2VA 3IDQA 2GZ2A 2D3WA 1QUSA 4F3KA 1QF7A 4AO7A 3KJEA 3PJFA 2J41A 3WKDA 1JEOA 1EP9A 4ACAA 4PV7A 3LK6A 4H7DA 1NBOA 1EVQA 4FCCA 2ZULA 1L4MA 3V8EA 5JEDA 1DGBA 5L4LA 3OUZA 1RU3A 4KN6A 1KIMA 1JX6A 1V1RB 1QRSA 2FXIA 4NJEA 1LBSA 1N3LA 3AGPA 2PBRA 4XH9B 4KUEA 1X7XB 2HF7A 3LF1A 1IXRC 2JGMA 2MDTA 3LGSA 3UXEA 3GFVA 3EFHA 2QV7A 4WY5A 4HGQA 1YZKA 1XV5A 2GQFA 4II7A 1YB5A 2JL1A 2PBFA 3SIPA 1R9NA 1FTYA 3MW8A 4RSRA 1OHHD 3MBOA 4AI6A 5BMVF 2Y4NA 1NSTA 4BDTA 3CNOA 1QJCA 1SVOA 1PLLA 3NIDB 3B2EA 4LV8B 2XCOA 1XNRM 1SC3A 2DPYA 2ZT6A 4N0EA 3WYNA 3A1UA 1ZUWA 2Z6UA 2K9DA 1BEUB 5DWVA 5F3WB 2IH4A 3C7TA 5AUQA 4AB1A 1DAKA 1E7SA 2FZLA 5E2IA 3J7BA 5LZ9A 4AECA 2D8AA 2SICE 3ADDA 3MZ0A 4DANA 4INJA 3QA3E 2OCGA 3G1TA 2JGEA 1SHZA 3GUHA 2IYUA 1V33A 5DT9A 4A0FA 3DUFA 4IZIA 3MSXA 1PR6A 3SS8A 2VQEM 4E1AA 4O4JA 4KE9A 1XNGA 1D04A 1HNNA 1I6KA 4MUHA 4P16A 3BRWD 4BAGA 4NK5A 3TZBA 1DO8A 1KSJA 4NNOA 4OJMX 4GWLA 2UZ3A 3SHVA 1V8FA 3FVVA 3CINA 1P1FA 3ZIUA 3BGSA 4O4HA 3V1YA 2KM1A 2BEWB 4BNXA 4KPEC 3I76A 3JS5A 1ZJ6A 4GBGA 1O4WA 3UJ7A 4IBKA 3HVIA 1M2GA 4QPNA 1SCJA 2EP7A 1SG9A 1IM5A 4BLPA 3UMYA 5CB0A 3WGIA 3UOGA 1F3LA 4J4TA 4K9OA 5DXAA 1DHRA 3KYDB 5FL7A 3H5VA 1W0CA 2ZITA 4DTCA 4QHTA 4O25A 4HPWA 2H2IA 3PGKA 2HRRA 2BHSA 2AOTA 2C84A 4XUEA 4RPCA 5T4BA 2BSQA 1KEUA 1T24A 2P7IA 3GJ5A 1NBEA 1RZRD 4IF6A 1T9HA 1VEKA 4LE1A 5FA6A 3DBOB 3VZBA 1DX9A 4MV6A 5EP1A 2P7HA 3JSXA 1P0IA 3EASA 4AYTA 4TYPA 5LWHA 5AJZA 2J67A 3JQFA 3QOXA 4YIHA 3W4IA 4MRPA 2RSLA 5ARCA 1G9XA 1NQUA 1IDOA 1M66A 5LDDC 5T4HA 3H18A 1IXYA 1QF9A 3WMWA 2EKBA 3IP6A 3JQ8A 3OE7D 2PD3A 3Q10A 5JV5A 4S1NA 3KT8A 4FGSA 4A9AA 2JD2A 2ETVA 2MSKA 5DGHA 2NZWA 3KZXA 1SXJA 1C81A 1CERA 2IRWA 4QEZA 4TTJA 2X19A 3OLCX 4YRKA 6ABPA 3KALA 5HTKA 3HYNA 1DGHB 1H22A 1BWQA 1MVOA 2OD7A 4HX9A 4K8OA 5KNDD 5FIUA 4PWYA 5ALSA 4NS4A 5C8XA 4I6GA 3ZWAA 3A3KA 1Z29A 3L46A 2P5YA 2XWJI 2VJBA 4WLFA 3WRXC 3PKZA 2IYNA 4AMGA 5HQ3A 3M6WA 3BJEA 2MYTA 3C6XA 3WGVA 2QMQA 2HIAA 1L4YA 5E6SA 2E85A 3OT1B 2I78A 1NMXA 2IWHA 3S7TA 1SVSA 2FQQA 1GJRA 2VHJA 5FWYA 3TSCA 5E9JA 3U7EB 3HHWA 4KGXA 3HP1A 1N3BA 3IOEA 4B5LA 1KP3A 2VAPA 3M1YA 4TROA 1N2SA 3TQQA 1YTLA 4DNFA 3GFTA 1TE2A 4QXMA 3FIUA 1DEXA 3ZV5A 2XECA 5GZ1A 3KRTA 3PDUA 2CN1A 2EKKA 4NICA 2XRZA 3KE8A 3ZU2A 1TKCA 4FBLA 1UQTA 3QP9A 1DBRA 4PYOA 2UZ4A 3FLBA 2LCFA 2OWDA 4NABA 3A4LA 3EISA 3CSUA 2P3QA 2AH5A 4CMEA 2Y66A 4AZ0B 3QA9A 2W7TA 1H2EA 4XIGS 3GEHA 4D0SA 3CX7A 3KQWA 4D3XA 3H16A 1YACA 3F67A 2DKFA 5G4KB 1ENPA 4NU8X 3ABIA 4EHJA 3RB8A 2X5NA 3IEXA 4CL8A 2H57A 2FX3A 5HKAA 2WAXA 1IJEA 5E1DA 1AB5A 1G7SA 1SXPA 2Z1MA 2LWXA 4EBFA 3UAYA 2HY7A 1T8UA 1E1RA 4B31A 4HNGA 3TR0A 4MZXA 4YALA 1YFJA 1T9AA 1KDRA 1G5QA 1KOJA 3OF2A 3DYVA 4DARA 4EEZA 3CLTC 5SYMA 1W4ZA 2P5SA 3FDXA 3LBYA 3QVMA 1SIBE 4CM5A 1V8OA 1W8DA 5TB5A 2GR9A 1K9VF 5B30A 1QQ5A 2GERA 1SHUX 4Z7QB 4DIEA 4DUGA 4B3HA 3SJCA 3OCXA 1G16A 4UU7A 1BFUA 3PF8A 4TPKA