4LY6A

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
247
Chain Sequence
b'EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 55
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ly6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ly6A01
2AK3A 1RYHA 1KDRA 5J4VA 3I73A 4QRHA 3AVXA 2V7QD 1Q22A 1Z6GA 3ICQB 3REGA 4HZUB 2KI5A 2J45A 1KMHA 1WA5A 4URZR 1GSIA 5P21A 4QM6A 1Q1ZA 3EZFA 4Q66C 4OQXA 2VBCA 3Q5EA 3GLHB 4KFUA 3A36A 4PC7A 1SVWA 3WRXC 1UEJA 4B34A 3CRW1 1OV4A 1YRBA 3MWLA 4P3YA 1JQLB 3QXHA 3VNVA 4JKIA 5CITA 5BN3A 4CEJB 3BB3A 2CMKA 2H57A 3A8TA 2ZR0A 1KI4A 2O8BA 2YOFA 1KY2A 4JLDA 2ZE7A 1WQ1R 2RGNA 5FR2A 2G0NA 2FFHA 4XD7D 4AWXA 1M1YE 4QHTA 2ODEA 4MRPA 2JLYA 2J0UB 3NBFA 4WVFA 2VQSA 4XTCS 3DZ8A 1UBFA 4FWGA 4M0LA 2IF2A 2OEPA 2QA5A 4PC3A 2OBNA 2EU8A 3C5HA 4Z54A 1P5ZB 1HURA 1ZNYA 2GJKA 4C0KA 1GNQA 2WWXA 3B1WA 1BOFA 1KHTA 1FNMA 2XNDA 2NOAA 4H1UA 1JXOA 4D4KA 2HEIA 1D5CA 3ADKA 2WWYA 1TADA 4MDEA 1SXJD 4CT4B 3HR7A 4FWTA 3MWYW 1L7VC 1KSHA 2JLWA 1SULA 3LH5A 3NIBA 2YYZA 1DADA 1YZQA 2CDNA 4KLZA 3U3JA 4LJ4A 4DC9A 2O52A 4OK3A 2ZI7A 3OE7D 1SVKA 1V5WA 5AUOB 1U0JA 1QRAA 1UKEA 1GILA 4FW9A 2JLSA 2Q9BA 4PSAA 2BMEA 5HCNA 3KJGA 3TUZC 2Q9CA 2NPFA 2GXSA 1XU4A 1NMXA 3SYNA 1E79D 1KY3A 1OXUA 4HLCA 2GJSA 5ELXA 4PZLA 2F1RA 4OJKA 3DPUA 1II8A 2OUKA 4Q5IA 3TR5A 3ZGXA 3RS0A 4KBFA 1ZD9A 4Q48A 1DE0A 1S8FA 1C4OA 4NKRA 5EP2A 4RVCA 1BO6A 4NPHA 3X1WA 1CEEA 1XDBA 1EFHA 1SVIA 1KI2A 2GESA 5EUMA 3KB1A 4NYIR 1BH2A 1ONBA 4IFBA 2CK3D 1MRNA 2D4HA 2ZRMA 1N6OA 1VDZA 2IF0A 3E5HA 4PAMA 3CRRA 4JL6A 3C41J 2IXEA 3EZ6A 2ORVA 1G7RA 2H7VA 4FI3C 4IHQA 3X2SA 4JN6A 1YR7A 1ZNXA 3EZ2A 1ETUA 2BOVA 4CVNA 2CL0X 2AX4A 1P62B 3LBNA 1R0XA 1HYQA 4AG6A 3V9PA 4O3MA 4CT5A 1XD9A 3Q7PA 2G6BA 1E0AA 2DYKA 2FSIA 3EIQA 3VR5A 4ZDKA 5L3RA 4NCJA 1GRQA 3AVQA 4F38A 2O8DB 3M0EA 1WF3A 4YXWD 1Z83A 3ASYA 4JLAA 4KV9A 4DSOA 3FMFA 4Q4HA 3ZZ0A 2EW1A 3MJHA 4M4SA 2G77B 3H84A 2QROA 2ZRDA 3SFZA 5KHOC 2GWHA 1KOFA 3NH6A 3WXMA 5KTYA 1Q1QA 3QE0A 3ADDA 5KDDA 1R6BX 3QEOA 4B71A 2ZSBA 4G5RA 2ZJ2A 3GJ4A 4DLSA 1KSFX 5JCZA 3RHFA 2ZRFA 2KE5A 1LY1A 4IKEA 4OI0A 2C96A 5FOSA 1S3GA 1YKSA 4C4PA 3JVUA 1JR3D 3T15A 1VG9B 4D4JA 4LJ6A 2OV2A 4GP7A 1G20E 3W6NA 2HT1A 4AY2A 4KBGA 4I1UA 4V03A 2CHQA 3TH5A 1J2JA 3FFBA 4HUQA 3TSOA 3L0OA 1GNPA 1E9SA 4FXPA 5EXSA 1OKKD 3U3MA 3LA6A 3T5GA 4KCGA 4HLUA 3NG1A 3DZDA 4TQUS 4GL2A 1R4AA 4XSGA 4PO1A 2BC9A 1P4SA 1G9XA 4TT3A 2WWHA 2WKPA 3FFAA 4MGKR 4Q4LA 3BORA 1NMZA 1E9DA 5FUWA 3NXSA 4DWJA 3G5UA 2ZRIA 1F2TA 4MRRA 4XJXA 5H1YA 1NN5A 4A3VB 3BERA 4A2PA 4RZ2A 5CB8A 5DN6A 4IXNA 1G3IA 1JR6A 2HLDA 2DR3A 4GDFA 1W0JD 4LDJA 2QGZA 4YDSA 4KODA 1IY0A 5CLLA 4HYYA 5CYOA 1OXVA 3KZ1E 5EQTA 2BMJA 1E2QA 1X1RA 1NN3A 3QXXA 2DVWB 4LHVA 4IOJA 4HLQB 1CRPA 1DAIA 2KB0A 5L3QA 1VIAA 2AFIE 3P20A 1XCGB 3VR2A 3ZS8A 2IUTA 3EWAA 1HTWA 1G8YA 4WOPA 4A0HA 1C9KA 4DZZA 5JRJA 3QUSA 2AD5A 1FUKA 4JLBA 2I1QA 2WPDA 1VMAA 3Q72A 3CR8A 4PPQA 4B33A 3VKGA 1Q12A 5KSPA 3G82C 1R8QA 3NDBB 4LX0A 5UKDA 1JEDA 1GRRA 3EIEA 3DO6A 3AVYA 1X8LA 1ZYUA 3I8XA 2A5DA 3QIAA 4Q9LA 3U44B 1I2MA 1OXTA 2NZ8A 3QKSB 1DAKA 2KJQA 4RKEA 4DB4A 2X2FA 5KDLA 1CTQA 5DGXA 4LJ5A 4IEEA 1OH6A 5FUYA 3T34A 4GI7A 2AXNA 5FI0B 1XJQA 4BFXA 5FPKA 3UMFA 2GVDC 1E3MA 5TMPA 3AJIB 1X6VA 3QEJA 4HAZA 3LBIA 1L4UA 4MITA 1JQJC 2RB4A 1OLOA 1UF9A 5FBWB 2JJ2A 1RKBA 5JCPA 3DEFA 1NLZA 3BXZA 2J5XA 5J4HA 3AVUA 1AS3A 3ZD6A 2VP4A 3WHLA 2JLVA 2GCOA 3B85A 2FG5A 3G0HA 6Q21A 2UZ3A 1CBUA 2ZU6A 3NBYC 2ZRLA 2ZRHA 3RSLA 3F5FA 3ZD7A 1XEXA 2QAGB 4US1R 2NO0A 3Q8XB 3HP1A 1DAGA 1MABA 1SKYB 2LCFA 3QPVA 3BIFA 5C1BA 3DMDA 3MGCA 4C30A 1P9WA 1Y3AA 5EXTA 4DLTA 4Q01A 1WXQA 2RHDA 3CPEA 3QG5A 3I62A 1QHGA 2QP4A 1FMLA 1EX6A 2ZSEA 1G3UA 2W00A 2OCPA 3F3YA 3HPRA 1FW6A 1QHYA 1F48A 5JJLA 5EUQB 2R44A 1IONA 4RD2A 3T1VA 3T1QA 4ZDIA 5GVSA 2PMDA 3LW7A 4URVR 1AZTA 5E7MA 2CLDX 4MYUA 3SBDA 1UAAA 3C7KA 2CLSA 2ASEA 2A7QA 2D06A 5C18A 1O87A 4MYCA 1YE8A 5SZHB 2R6FA 4KYUA 2R62A 1XNJA 5SZJA 4LJ8A 3IEUA 3QBTA 3CR7A 4KJZA 2Q0HA 5CLQA 1E2FA 2W6JA 4PANA 4Q03A 5LDDC 1QHIA 3ASZA 2DFLA 4I1VA 2OBLA 4D82A 3AVPA 1KSGA 4U02A 4AIIA 4DDUA 3HU3A 3FTQA 4KU4A 5HCIA 1KAOA 5EXXA 2V6ZM 2ZRBA 2YV5A 4H9GA 4TWZA 4QGFA 1E32A 1N0WA 1M7HA 2KBFA 4DIEA 1F3OA 2YWGA 2F43A 1P2UA 1DAEA 4JJZA 2C8VA 2C77A 2CL6X 3U3RA 2IYTA 1Z0KA 2P3SA 4HLDA 2ZR9A 2RGCA 3IBGA 4B32A 1DS6A 3LFUA 1Z29A 3U7GA 2AK2A 1E98A 2EWVA 3HU2A 1OPXA 1UPTA 1ZBDA 3H0KA 3OIWA 4P4UA 3W8NA 4D6PA 2V4ZA 4JJKA 1W2HA 1FX0A 5FBVB 3FE2A 2I1VB 4Q4JA 5KSZA 4LOAA 1Q20A 2NPIA 3SYLA 2ZM5A 3T12A 5JBQA 3U7FB 3R7WA 4RJLA 3ZH9B 1R5BA 3QSYA 1OHHD 2YC2C 2FN4A 3AGPA 2J41A 2N46A 3NBXX 3ZZUA 4GZLA 4EJSB 1HT1E 4B74A 3VNUA 4HSEA 3MRSA 2GDJA 2NO1A 3ETLA 4LV8B 2IWRA 5GJBA 4JVLA 2A5YB 2OBMA 4AYTA 2XGJA 1Z0IA 1Z22A 3X1ZA 2VRWA 4OKSA 5CIQA 4W5JA 5HZKA 4R2HA 3I8SA 1GL6A 4TYQA 2G1JA 1Z28A 1EX7A 2OZEA 2C2HA 1Z06A 1IBRA 3S1AB 3B2EA 4M1OA 4CDGA 3GLIE 3MD0A 4BASA 4PC6A 1E0KA 5BQ5A 4GSYA 2QN6A 5JSZB 4D0GA 1W36D 2HYIC 5JWRA 2ZROA 4K81B 1RRFA 3UWOA 5KUTA 2CNWA 4JT2A 3IHLA 5HKKA 3MG9A 5FPSA 4QGHA 1FZQA 1U9IC 5SZKB 1M2OB 3WYGA 2IS4A 1R5OA 2B21A 5B57C 4G1UC 4PAOA 1E9EA 4EFNA 1G8FA 721PA 2BKEA 1OFTA 1LF5A 3LX8A 4NU0A 1YQTA 3BFKA 4TMWA 4X8LA 3SQXA 2DPXA 3DHWC 3EZ7A 1QG4A 1W48A 1E1RA 2IYZA 3UG7A 2WWGA 4TSFD 4LRSA 1LNZA 1SKQA 2BDTA 4NBSA 3BFVA 3PUWA 4Q7MB 4IXMA 3NC0C 4O25A 4EQ6A 1TQ2A 5BYKA 2NMVA 1QBKC 3KKMA 3B6EA 1E9FA 2PZEA 3QVVA 3BRWD 2DWQA 4AKGA 2JA1A 4XWKA 1VCMA 4LPSA 3RDPA 1XX6A 3B9PA 2WSSA 4R9UC 1XXHA 3SJCA 4FIDA 4C0AC 4Q9JA 1NSFA 3NH9A 5HR5A 3UATA 3TGPA 1G41A 1HY3A 1E2DA 1JR3E 2R9VA 4OK5A 2QBYA 2MSEB 3EASA 1PLJA 3LX5A 1G7TA 4MYHA 4Q7KA 3P26A 4IOMA 2QMUA 3NEJA 4X8OA 2IK8A 1NLYA 1F2UB 1G8HA 5AJVB 4PHGA 1AN0A 3OIYA 4DSNA 1W4RA 1G4AE 1GKYA 2FEOA 5JMTA 4BWYA 1S96A 3WNDA 2IUUA 1WRBA 3LY5A 3B9QA 1N5JA 2GXUA 2ZRNA 1UKYA 2IWHA 4L9SA 4P4SA 2OESA 4XOIA 5G53C 5G3ZA 4TL7A 2RGEA 4ZKDA 1UM8A 3PUXA 2D3WA 1TEVA 1EG7A 1KYIA 4Z1MD 4V0KA 5DLQC 4B75A 3K53A 3CPHA 1COWA 2GILA 4HAWA 2VP9A 4MH0R 4RFVA 5A0FA 3Q5DA 4PO8A 1TQ4A 2GCNA 2W58A 2ZRJA 4L8GA 2GA8A 3MCAA 2OHFA 2FMXA 3P4YA 4NDZA 1NVVR 3AP1A 4JLPA 2VA8A 2PH1A 4HUQB 5AUNB 4FMDF 2W6IA 2F7SA 4L15A 1R10A 1D9ZA 4G01B 4HDOB 3CLVA 1VIYA 3U60B 3PIRA 2GBLA 2NTYC 2IHYA 3TKLA 3IEVA 2E9SA 2HYDA 2ZE6A 4TTRA 5IK2D 4II7A 5DE3A 4QHSA 1NF3A 5IF9A 4DSTA 2DWOA 4ASUD 4MRVA 5JI2E 4F4IA 2X1VA 1F2TB 2ZSAA 2G3YA 3OZXA 3EAQA 4B43A 4IVQA 1K8RA 2PLRA 4CGZA 4V0MA 3WMEA 1KI8A 2A9KA 2FH5B 1L4YA 1RYFA 3GJXC 2BEKA 2D2EA 4ACBA 3I61A 1E2HA 1G21E 4RKFA 1I4TD 2QI9C 4PZYA 4Q00A 4BLRA 4IDPA 1EFRA 2GAOA 4AD8A 3THWB 1RRPA 4BLSA 3HU1A 1OYYA 3EARA 5FL3A 4DT1A 2N1BA 2QAGC 2OT3B 2PT7A 1IJFA 4NH0A 4ZO4A 2QSYA 5HZHA 1NJFA 1W4BA 2J3EA 1Z6YA 2ZI5A 1Z3IX 3FGNA 1HQCA 3KUCA 1I2DA 2HXYA 4QM7A 1KO5A 4GOXA 2BBSA 5CJPA 4M9XA 2XZPA 2QSZA 1J99A 1E2EA 1AZSC 4JZKA 1G3RA 3EPHA 2CXXA 1OFIA 1TL7C 1WDTA 5IRCD 2J0QA 3RLFA 2GXAA 2FZLA 4P32A 2WSMA 1JPNA 1CP2A 2VSXA 1NI3A 2WAXA 4NP6A 2JAQA 1IN5A 5DI3B 1PJRA 3LVQE 3P27A 2YC4C 2G9NA 2FOLA 5L3SA 3AP2A 2IYWA 3A58B 3W6PA 3A6PC 2V7QA 4M2LA 1ESNA 4KLNA 3BJIC 3L0IB 2PLFA 5FPTA 3IO5A 3RWOA 3QQ5A 2A5JA 4IVRA 4LHZA 3LBHA 1E2JA 1EGAA 2ZIAA 4NMMA 3MHVC 3LLUA 1KDOA 1ZU5A 2O0KA 1EFUA 1G6OA 1U90A 3MUFA 5JWOA 5A5GA 1KI1A 1KO8A 2H5EA 1D2NA 3KFVA 4B76A 4QNRA 3AKCA 2QENA 3QXSA 1W47A 1CRQA 3TSZA 1XEXB 2OAP1 4IOKA 5J4LA 1XD2A 1YZTA 1MABB 4M8NE 2NO7A 4E07A 3CB4A 1KDTA 1TX4B 3CPJB 3N2EA 4XD7A 4TZ0A 4I81A 3SU8A 3GEIA 4TN1A 2QNRA 1DG1G 1GZSA 2QP3A 1E9AA 1S0UA 4M53A 1TQDA 2D2FA 2PEYA 2WMOB 5JS8A 1JAIA 3V4RA 4TYWA 1T5IA 2Q3HA 3KKNA 4DEYA 1GIAA 1X3SA 4Q9HA 4BFSA 3HJNA 2RGNC 2F9MA 3HR8A 1YRAA 1VHLA 4EPVA 4JLVA 1KK2A 3F8TA 2GJ8A 4G5QA 5JEDA 2V55B 4LZZA 5FH9A 2SHKA 3AF3A 4EJSC 1E9RA 1T4GA 3RRNA 5EE0A 2WVJA 2X2EA 1AGPA 4LHXA 4C0SA 2V3CC 3AVTA 1SXJA 1A82A 5B58C 4WW0A 1GM5A 1KI6A 4MUBA 3IKJA 2ZS8A 3K0FA 4UJ5A 5AJXA 4AC9A 1JECA 3K0CA 2LKCA 4DCNA 2ZS7A 1GL9B 1VKJA 2FEMA 3OE7A 4WZAE 3TR0A 4NYMQ 3GLFE 4JLKA 3WBKA 1DELA 1TAGA 1CIPA 1S9DA 1E94E 1VYVA 1EXMA 1SGWA 3D7MA 3LQRA 3MFYA 1XBTA 4DLVA 2YWFA 1YZKA 4JIMA 1N6HA 4QBGB 1E79A 3GMTA 2O8CA 2F43B 1YZNA 3PUZA 1FTNA 3C16C 2CVFA 1XP8A 1U99A 1N0VC 1K5GA 1N5IA 5AUPB 5BN4A 1WMSA 2FFBA 2QMOA 2ZUDA 3N70A 2J7PD 2CK3A 2VHUA 3VMFA 3TUIC 4Q4JB 2AN9A 5D3QA 4FMBB 5J47A 3GLIA 1E9BA 2YNMA 2PX0A 2XTNA 3CIOA 4A2WA 4JYBA 2FZ4A 3R7WB 1EK0A 3RS3A 1OIVA 1H8ED 2AR7A 4NHOA 5DI9A 5J4YA 3OIUA 3UK6A 3IIMA 2J46A 1G7CA 4C2UA 4QHYA 5FFMA 2O0HA 1ZAKA 2ERYA 1Z0FA 4PPFA 4MGYR 1SHKA 2GJ9A 4N3NA 4E5UA 1IOZA 3UPUA 1LW7A 4YXWA 4QL3A 4OHWA 2DCUA 5KYKA 2JGNA 4Z8XA 5F2EA 4DUGD 1OB5A 2BVNA 1KI9A 4A4DA 2GETA 3OHMA 3FMPB 2PEZA 3E70C 1ZUHA 2ATXA 3TAUA 1NY6A 4LUCA 3MWKA 1RE0A 1UJ2A 1Q3TA 2IS1A 3FHOA 3LAWA 4D81A 2VF8A 5AWFC 1RRCA 1U8YA 4Z51A 5HTKA 3PFIA 4LJAA 5FOXA 3EIHA 2MSDB 4TLEA 2EWWA 4RFSB 1AGRA 3EW9A 3LWNA 3DM9B 2R6CA 1KDPA 4DIDA 3AEZA 4ON9A 1JR3A 1TF5A 2GF0A 1MO5A 3IDQA 1CR1A 1S2MA 2TMKA 2FWRA 3B1XA 3DOEA 3TSWA 4MKIA 1RC8A 1M8PA 3QVUA 4CIDA 2KBEA 2R6AA 4YMWA 1ZW6A 4OHZA 3PENA 2H17A 4TYYA 4G5SA 1YJ5A 4FMCF 1UKVY 1IN6A 8OHMA 1OKKA 1XMJA 3R9IA 2IYVA 4GRAA 1SVLA 5JS7A 1TUEA 3SE0A 1A2BA 3NVAA 4EQ6B 3OEED 2BCGY 2Q9AA 4DKXA 1ZD8A 3FHCB 4NL4H 4Q4AB 4KSBA 3X1XA 1BYIA 4D26A 3LDAA 3PEVA 1V43A 1UEIA 3BE4A 3DKVA 3KQNA 3THYA 1IXZA 2EYQA 1N25A 1AKEA 1B0UA 2QGNA 1XWIA 3IIJA 3GLGA 1Z6XA 3SEAA 3TBKA 121PA 4LC0A 5KSOA 1M74A 3KJIA 3PG5A 3L82B 2BBWA 3U7EB 2F3TA 1W0JA 2QBYB 2RGDA 3MSXA 5H70A 4G0NA 3VKHA 2VIIA 3O47A 1GDDA 1GUAA 2I4IA 4AK9A 1RJ9A 3B1YA 4IDQA 3CWZA 1HH4A 3BFXA 1UKZA 3ND8A 2ZRAA 2ZSFA 1PUIA 1G3QA 1Q1EA 1VG0B 3E1SA 4RD0A 4TQ9A 4W5HA 2QE7D 1II0A 4V02A 1Q3HA 5TVKA 1XXHE 3R9XA 1F60A 4FINA 1OJLA 4DLXA 1WP9A 1W44A 2QQ0A 2ZYTX 1Z07A 1T6NA 2PJRA 4DLYA 1T0HB 3U2QA 4HDQB 3RAPR 3F0TA 4XVUA 2K5UA 1DEKA 2CJWA 4IFEA 4HDCA 1MO6A 2UKDA 3K9HA 3QPWA 5E3HA 3ZZTA 4JLJA 3WY9A 4BEBA 1AIPA 1W49A 1ZNWA 2LKDA 2C9YA 1NG9A 4R2IA 3U4QA 2QZ4A 1NMYA 1KMQA 2ZUCA 4A8JB 3KQKA 2H18A 2VHCA 3MJRA 4PPNA 4XIGS 5LBIA 1UFQA 3QPUA 4NCHA 3KDSE 5DH9A 2Z0MA 3ZLJA 3WNBA 4W9MC 3C5CA 4M1TA 1R0WA 3IGFA 4B2IA 3K09A 1IAQA 1DAMA 4I1OA 2Z6VA 4JBWA 3W9YA 3K70B 1QZXA 1SVMA 5FUXA 4LHYA 3B78A 2YJTD 3R8CA 2MMCA 4CYMA 2VHQA 1DPFA 1VCNA 2ODNA 2YOGA 1VTKA 3O8BA 2GHIA 4RD1A 1U0HC 3GPLA 1US8A 4OQMA 4EPTA 4DEXA 2OE2A 4ARZB 2AKAB 1TPZA 4B6FA 4UNSA 4GZMA 4NONA 2C9OA 1QF9A 1U8AA 4DT1B 2RAPA 2D7DA 1MH1A 4BFTA 2ZR7A 1DVRA 1DG3A 4L5BA 3IO3A 4G3XA 2XX3A 4WXRA 5FBLB 4V0ME 1J8YF 1XEWX 4YONB 5D3MB 2QP9X 1L2TA 4JBYA 1E2PA 2VP0A 3J81k 1TMKA 3SHFA 2CE2X 5FR1A 2OO7A 2JDID 1FQKA 2ZJOA 4C2TA 1U2RA 4F93B 2WHXA 1ANKA 3R9WA 4V0LA 2O5VA 4RD3A 4LV6A 5L3SB 5FTKA 4ESVA 3VU9A 5FOVA 1CR4A 4E03A 2DFTA 3OIVA 4XTRA 3NWJA 4M9SA 4XSHA 4PAQA 4OYHA 4TLCA 5E7JA 2A3RA 3QI2A 2MMGA 1IHUA 1P7CA 4A92A 5B30A 5F3WB 2KWIA 2W2TA 4PHFA 3CNLA 4IVPA 4U00A 1KKMA 3CH4B 1N6PA 3A4LA 1W0KD 2ONJA 2PL3A 1TU3A 3AF1A 1ZD1A 4AKHA 3K0SA 4ZI3A 1FNNA 3TVTA 1NVWQ 4FN5A 4Q1DA 4KITB 4CZ2A 2C95A 1LV7A 3SFVA 2HF8A 3FPAA 4PHHA 3GLFA 1GTVA 1YR6A 1U94A 1UDWA 1Z0JA 4ABYA 1SVSA 1OHHA 2DZOB 1A4RA 1XPOA 4LJ7A 3SR0A 3LV8A 2FFAA 3QOFA 1YR9A 4BGDA 4BECA 4QXAA 3BBPA 1LF0A 1QHHA 1W1WA 3CONA 4D4MA 5L3VA 3O8DA 4I99A 1U81A 1OT3A 2FFQA 3A1TA 4D80A 2VP2A 3T1TA 2RH5A 1G18A 2CVHA 4I1SA 3WMGA 4PQFA 2Z5FA 2ZE8A 1YVDA 1NLFA 1NVXQ 4JLOA 4Y0AA 2CHVA 3U7HB 2JLQA 2GAAA 1A1VA 1II9A 1G6HA 3NTUA 4JL8A 3Q9LA 1KMHB 1RIFA 3E2IA 4F92B 2Q3MA 3QENA 4O2LA 4PSVA 4LY6A 1DARA 5FTJA 4Q1BA 2KSQA 1KI7A 1UBGA 2W2XA 1N6LA 3FKQA 4LJYA 1YZGA 1E2GA 1XZQA 3K9NA 3OAAD 4U5XA 3D6TB 2OXRA 3NBZC 3PUYA 2O8CB 4HZUA 4POAA 4Q1CA 1KZGB 2O8FA 1N0UA 4KXFB 1SXJE 1W2GA 1E0JA 4GITA 1CF4A 3SYKA 3RANA 2O8BB 1R0ZA 2A5GA 2IYYA 3ECCA 1T5LA 3T1OA 1GOTA 5FTNA 3NEYA 3GLHA 4TSFA 5FOUA 3GLIB 2IYLD 2RHMA 2H1LA 3EPJA 1OSNA 5KNDA 4CEJA 4F4CA 1AKYA 2IYUA 4PQRA 1AA9A 2HT6A 2AL7A 1P9NA 2I3BA 4IDOA 2O8EA 5CJ2A 1R0YA 1P2SA 5CDFA 1P61B 4QBHA 4TTPA 5EE3A 2HV8A 4BLTA 2CE7A 1Z8FA 2XSZD 4A0GA 3THXA 1E0SA 3C4JA 4W5WA 4A36A 3SBEA 2J9RA 1RRGA 2XTMA 2VLIA 1MR3F 4C0QC 3OESA 2P2LA 4LHWA 4S35A 4HB3A 2RGXA 4C7OA 1W4CA 3M4YA 5KPJA 3VHLB 2IYRA 1L8QA 1ZC4A 1EWRA 3W90A 1ZM9A 1IY1A 2OLJA 1Z2CA 3QBVA 4XWOA 1XFAA 4YMTA 1FUUA 4QGGA 5CB6A 4JKYA 2V1XA 2FPLA 3BC1A 3AV0B 1NBMD 4KHZA 2VEDA 1II8B 2LWIA 4Z1MA 2BWJA 821PA 4M1YA 3VR4A 3I5YA 1GRNA 3HWSA 4DCVA 2OCYC 3HYRA 4URWR 1B23P 4ITRC 1N6NA 2KRKA 4M1SA 2Z83A 4AI6A 3W5JA 1KO4A 1ZUIA 4B3CA 1IM2A 4I4LA 2YKGA 1AM4D 1QVRA 2XEXA 3ZIAD 4OI4A 1Z08A 1T3HA 4PR0A 4D2IA 4PQYA 4LI0A 3KX2A 3OEHD 1CJMA 3I5XA 2WIBA 1AJEA 2DHRA 4B3GA 5IK2A 4EPYA 3D31A 2C04A 5K8LA 1VYUA 4ASUA 4HUTA 4LBYA 4A8JC 4ZPXA 4XWAA 2GBLC 4BFUA 3THYB 1E2IA 1H8HD 4GNKA 5AJWA 3ICEA 2IBMA 3HYTA 5HPYB 4MA4A 4UNQA 5EZ6B 4Q4HB 2CBZA 2D62A 2BM0A 4PC1A 3UXMA 4HB4A 4RCZA 1RPZA 1G64A 4HAYA 3O8CA 1GP2A 4EUNA 2QT0A 1Z63A 1RJ9B 4DLUA 1KNXA 3CX8A 1PLLA 5EJEA 3K70C 4UNPA 2ATVA 2QG6A 3CZQA 1A7JA 5HE9A 3SHWA 1T8TA 4URXR 3H2YA 4EKDA 4NE2A 4WIAA 1DO0A 4ZCMA 2V6JA 4QJ4A 1FFHA 4UNNA 4JVNA 3FVQA 5DHFA 1P75A 1P2TA 1XTKA 1JBKA 2QORA 3CRQA 4NCKA 5FOWA 4EAQA 4A0FA 2XITA 2VHJA 4NYJR 4ZV4A 3GLGE 2F1JA 5G3YA 3KUDA 1HV8A 3C14C 4QFMA 1U9IA 4QG7A 4TLBA 1R8SA 2VYFA 3PXGA 3U6BA 2D7CA 1JEEA 3OF5A 4JT4A 3SZRA 3GCGA 3QJYA 1BMFD 3DDCA 4LRWA 1CR0A 3CF6R 5DISB 2CJWB 5FBQB 3ADCA 2WKRA 4KFTA 4OBEA 4LBWA 2QM8A 2JJ1D 1UBCA 3A1SA 1ZCAA 4GP6A 4L4UA 4KFSA 4WAUA 3UKDA 3L2OB 2XZOA 4M9ZA 3U4QB 4FD2A 2W83A 3RS7A 5LD2B 4US0R 2FSHA 5C2JB 2GZHA 3PJRA 4QNMA 1M6NA 2A78A 2JIZD 3KQHA 5CM9C 3QY0A 5BXQC 1E9CA 1KSJA 1IN7A 3L0PA 3LQQA 1T9HA 3EXAA 2P65A 1O3YA 2RMKA 4TMKA 2OILA 3BWDD 1U98A 4ZDWA 3GJ3A 2IL1A 4GT1A 2QRZA 1YU9A 5JRZA 4PTLA 3AQ4A 4YDHB 5L3QB 4NTZA 2FNAA 4JSYA 1OH7A 2GEDA 1QDEA 2OCAA 1ZP6A 4TL6A 4MKFA 1IXSB 2VL7A 3L8YA 4TZ6A 4L9WA 2G88A 3BH0A 1US8B 1W7AA 1C1KA 2BHRA 4NYJQ 1S9HA 3A1WA 2ZAMA 3NHBA 5AUQA 5TY0A 3WP0A 4D0NA 3REFA 1Q1BA 1ESMA 5FUVA 3SI7A 3ZVMA 3B7GA 3I32A 4RZUA 3OFND 4WZBE 1IJEA 3QXCA 4C3ZA 3I3SR 1WBBA 2GKSA 2JJ8A 2ZRPA 3MLEA 1IQPA 3AKEA 5KDOA 2PZFA 2WWFA 2QAJA 4PO9A 2A2ZA 1G8PA 1OE0A 3N5CA 4DJTA 5DYGA 1E96A 1YZLA 2CCJA 3SJAA 2W0MA 2HUPA 4FCVA 2IYSA 2REOA 1OXSC 1TF7A 5LB2A 4D25A 1VPLA 1XEFA 3QG1A 4KVAA 4A2QA 1X8KA 2ODWA 2H92A 4V0NA 1OFUX 1P6XA 3FOZA 1X1SA 2IC5A 2VSFA 3U44A 3CH5A 4BFZA 2BCJQ 1GL7A 2VTKA 4B2LA 1G5TA 3VU9B 4B3FX 4NYMR 1E2NA 2BM1A 3K0CC 2YVUA 1S4QA 1MO4A 2WJHA 4JS0A 2IUSA 2ZQ5A 2GCOB 1CLUA 1GNRA 5GVRA 4PHTA 1S3SA 2ORIA 1XCPA 3SDZA 3KKPA 2OFWA 3UWKA 5FI1B 4YLGA 5FBRB 2DZNB 3VKWA 2OAQ1 4BZQA 1CJTC 2J0VA 1E69A 3EG5A 3LNCA 5KPDA 2B7CA 2J7PA 4W7SA 3TK1A 2JLXA 1BIFA 4TYNA 2X19A 3VAAA 2ONKA 3KJHA 4LYJA 1G291 1HE8B 1OXXK 1TQ6A 1XRJA 3GLFB 2UVQA 2EFHB 4NZYA 1H8EA 5JECA 2ZVPX 3WP1B 2XXAA 1R2QA 2R2AA 3GFTA 1ZJ6A 1P73A 4YC7A 4ERNA 1X37A 2IW3A 4ACAA 1E1QD 3KXIA 2VP6A 1XMVA 3IIKA 3X1DA 4ESHA 2HDNB 2J1LA 4CW7A 3JZMA 4G5GA 1CU1A 3QKRA 4JLMA 2QTHA 5FL7D 5KSYA 1MOZA 4LWZA 3BH6A 1T0JB 3GFPA 5J40A 1E2LA 5TXGA 5DSZA 2CHGA 4IJMA 1IN8A 1XD8A 2AXPA 2FPKA 2ZRCA 3GEEA 4G5OA 4DUGA 3GJ8A 4EFLA 4E22A 2ZJ8A 3CBQA 4QOSA 2F1IA 2D74A 3LVRE 2AD1A 4P4TA 2WJIA 2OM2A 3GD7A 3FKSD 1NL3A 2ZS9A 2ZSDA 3CW2A 1W36B 4R71A 3AKYA 4P33A 4HB2A 2J7KA 5J5CA 3CRMA 3VLFB 1N6RA 2C98A 3AUYA 3VR6A 3EZ9A 1KJWA 4RZXA 4FWIB 2ORWA 1TTTA 3CRVA 2WKQA 4UXHA 4AKIA 1VHTA 3M6AA 2O8FB 2VSOA 1P3JA 1UADA 2FGKA 4QBFA 5J4KA 2G83A 3C8UA 1FX0B 1AQUA 4IRUB 2XTZA 1CKEA 3D8BA 1JXMA 1SQ5A 4WXPA 2XOKD 3RRZA 4OJQA 4LK2A 3GJ7A 5IDVA 3B13B 2B92A 1CXZA 3BGWA 3AF2A 1WB9A 4KSCA 3OEEA 3AH8A 2UZIR 2EFGA 3RS2A 3GEHA 3LD9A 1SHZA 4MUAA 3L43A 3ZYCA 2PJZA 3ND9A 4LV5B 2O8EB 3B82A 4JYCA 1NBME 2ZEJA 1Q21A 3EA5A 2OCBA 4WZ6A 4CEIA 4DDTA 2NO9A 4BE7B 5IHPA 3BB1A 5EE9A 4D0LB 1QHSA 1HA3A 3GFOA 4QJ3A 5FTLA 4FMDB 3EC2A 4EJSA 5FPYA 4OHYA 3GLHE 3N2IA 3MMPA 4JMPA 3U61B 1D9XA 1N6IA 5TDHA 3SJZA 4C7OB 1E4YA 2ZI3A 5AJZA 3MAAC 3FHTA 1KI3A 5EZ5A 2ZANA 1X86B 2P6NA 3NDPA 4Y0VA 2NGRA 4JBXA 2ECKA 3DL0A 2QE7A 4DVGA 5JFGA 1N6KA 2QMEA 2OXCA 5CDFE 1JI0A 1ZCBA 1J90A 1FOEB 3KXLA 3LXXA 4TYPA 5AJYA 4UQOA 3S1AA 1GAJA 2AWNA 4OQFA 2OG2A 2ZYUX 3RWMB 4Q1EA 3QKTA 5JSZA 2AKYA 3K0AA 3ZJYA 1UBEA 1E4VA 1JJVA 4LCBA 1AK2A 2VPPA 3WBJA 3T06B 1JPJA 4K46A 2JLUA 4ILEA 1G16A 2NZJA 1N5LA 4TTQA 4DCSA 1GVNB 1N3BA 3RC3A 3TQFA 1S1CA 1VG1A 3KKOA 3EPLA 4Q9IA 2WBLC 2QY9A 4BUJA 4GFDA 4IOLA 3EPKA 2ZYVX 2V6IA 1DAHA 3VTKA 2OLKA 5DO9A 3PR1A 5JHHB 4O2RA 2XJ9A 4PZZA 4RZ3A 5GJCA 1KIMA 2EFEB 4HLUC 1XF9A 1XXHB 2GNOA 1Q44A 4EIWA 2ZE5A 1KK1A 1LS1A 3PEUA 4YMSA 5L8VA 4KYIB 1YR8A 2V1UA 1GKUB 3I4LA 5LD2C 2PX3A 3KQLA 3SOPA 5JEEA 2BJVA 3NKVA 4C0LA 2ZJAA 4A1FA 2FV8A 4LBZA 2CLCX 1F6BA 1G17A 3KL4A 4MGIR 2B8TA 2AWOA 4LBVA 2WAYA 1S1MA 3IBYA 3RC8A 3RABA 2XNDD 3HPQA 1XMIA 1XTSA 3K09C 3P4XA 3WRYC 4BQSA 5EP4A 1GKIA 5JZVA 1ZMXA 2DFNA 1BKDR 3HDTA 2QT1A 2ANBA 2ODBA 1FP6A 2QPAA 4P4SB 2E87A 1N5KA 5GJWC 1A5TA 1XEWY 3QF4A 1GFIA 3KFXA 1HE1C 1ZC3A 3KTAA 1F2UA 2PCLA 3BAFA 1W5SA 1ZUNB 1OB2A 2P5SA 2JLRA 3C15C 5BWMA 4J0QA 1OIWA 2Z4SA 2QEQA 2WOJA 1FMJA 2JATA 4UXJA 4LYHA 2DBYA 5LB4A 5FPHA 4BFVA 1ZM2A 4ZIRA 4MKGA 2W0SA 3GJ5A 2R8RA 2WMNB 4OQNA 1EESA 5CK5A 5SZIA 4DB2A 5IT5A 4A15A 1NKTA 2JDIA 1XTRA 1VYTA 3FB4A 2ZJYA 3B1ZA 1J8MF 4NYIQ 3W34A 3Q7QA 1TF2A 4HAVA 1NIPA 5G40A 1ZIPA 1XMSA 3JZAA 4NCNA 1DO2A 1K5DA 3IILA 2BBTA 1XJCA 2GEVA 3LXRA 4BFYA 4LYFA 3TAHA 4HAXA 4JVMA 4PPGA 2FE4A 2RCNA 2AHOA 1NVMA 2EFCB 3WMFA 4X8MA 3DVLA 3SN6A 3T5DA 1ZRHA 2QPTA 2FJUA 3TW4A 4B44A 1KAGA 4F7WA 2NO6A 2FPMA 3BH7A 1ZM4A 3VQTA 4F4JA 3Q3JB 1FPMA 1NY5A 2VP5A 4JLNA 621PA 4DLWA 1NJGA 1CR2A 1KGDA 1W0KA 5GJVC 2IYQA 3A37A 3FYHA 1MRSA 3W6OA 1DTSA 1NG1A 4URYR 1K6MA 3IPYA 3AF4A 1XPUA 4FCTA 1OIXA 4ZI2A 3DM5A 4KO8A 3FMOB 3TQCA 5F9FA 2WZQA 3QKUA 3KJEA 4H1VA 2HCBA 1RFLA 1Z6TA 5EP1A 1Z0AA 5DYIA 2WIAA 4ZDJA 1BS1A 4B48A 3O8RA 4EPXA 5EXPA 2VH5R 3KW6A 4BPBA 1D2EA 3THWA 2MSCB 2IS6A 2IXFA 1FTSA 4Q02A 1Z2AA 4Q18A 3SS8A 4EDHA 2A5FA 4ZKEA 2XNSA 3VR1A 3I92A 3AVWA 4Q9KA 1IN4A 3EA0A 1LFDB 1VG8A 3AF0A 5FOTA 3FWYA 4FCWA 4O0MA 1Z5ZA 3AKDA 1KKLA 2QTVB 3W3ZB 5B64A 5F98A 1CJKC 2FDCA 5BN5A 2VO1A 2RGBA 3TIFA 2WOOA 1MT0A 4NCIA 1OF1A 4L16A 4TLDA 3JVVA 4XVRA 2IT1A 4B2PA 1Y63A 4BZXA 1KJYA 1VECA 5FTMA 3RRYA 2R65A 4KVGA 3BS4A 1YZUA 1KK3A 2FGJA 2N42A 4P31A 1FL9A 4TT3D 4S2EA 5DI3A 521PA 3PCRB 4DDVA 1ZM7A 2Q3FA 3VHXA 4CEHA 2BBOA 3OAAA 3K9LA 2B8WA 4US2R 5JI3E 4BZPA 1KNQA 4IW3B 1W36C 4N0EA 2ZAOA 4XH9B 4M21A 4LGMA 4BEJA 4Q19A 5DN6D 5CM8B 4LYAA 3KKQA 2REXB 3B8HA 2HLDD 1XD2B 1ZVQA 5TARA 2YOHA 4JVSB 1Z6AA 4RCYA 4QJ5A 1JAHA 1G4UR 2R6GA 2YWHA 3CWQA 4MDFA 4GBMA 3UMSA 3TMKA 1HQYE 2V54A 1DOAA 2IX3A 4TMZA 4BRWA 3B5JA 1KJZA 1PLKA 1N2CE 3UMRA 3A4MA 2DB3A 3H4MA 2QQEA 1ZINA 2XXAB 1A2KC 5CK4A 1TUIA 4UNRA 2JASA 1KK0A 1OYWA 3GQBA 4N1AA 4Q21A 3MWJA 2QL6A 2XAUA 2WPDD 1AS0A 3LLMA 4TMXA 2XSZA 4V0OA 2F1HA 4A82A 5EE5B 1SXJB 3UIEA 1JJ7A 1PUJA 2FSFA 1JB1A 3AVOA 3QKRB 1KI6B 4FMCB 4DBLC 4DRZA 3QF7A 3K0FB 1NNEA 2WWIA 5KO2A 2P6RA 2ANCA 2PT5A 5TV2A 2H16A 2J87A 4AKEA 2FA9A 5JLJA 2GTPA 2GJAA 1SVOA 2C03A 4GOJA 1JALA 2H8KA 4OI1A 2GZAA 3GP8A 2DY1A 5JHGB 4UXIA 3ZS9A 2GK6A 3WNCA 1D2MA 221PA 2PMKA 2ZPTX 4TMVA 1HT2E 2P6UA 2P5TB 1ZU4A 3ZVNA 3GJ0A 4A6PA 5LPNA 1SKYE 3BB4A 4WBSA 2ZI9A 2EQBA 4DLRA 3BOSA 3A1VA 2QPOA 3QXJA 2ZJZA 1SZPA 5AK0A 2ZREA 1XB2A 1NBMA 2XJ4A 2Y8EA 4ZCLA 4M9QA 5DNYB 4F91B 4R98A 1G19A 1NVUQ 4A9AA 1HUQA 1E2KA 3SJBA 5EE1A 3IPXA 3DMNA 2JJ2D 1WCV1 1NKSA 3VX3A 4LSGA 2F3RA 4OI2A 2FF7A 3RYTC 5KNBA 2WJGA 2Z4RA 1NP6A 3CX6A 2O0JA 4HZIA 4GMXA 3ZIAA 1P60A 4OL0A 1E6CA 4CRWB 2WJVA 3A1UA 3OEHA 3L8ZA 3GJ6A 1XTIA 3SNHA 5B2ZA 1QHXA 3U3OA 4DDWA 5BW8A 1RW4A 3TLXA 4DCUA 1E99A 1WBDA 2J0UA 2VF7A 2GF9A 4E09A 5KU1A 3I1FA 1H8HA 1OFHA 5H68A 4CEIB 1F5NA 2B6HA 2GVZC 1NN1A 5CIWA 4DHEA 2B7BA 2F55A 3CF2A 1EWQA 1GITA 2GCPA 3TNFA 4AYWA 5JJKA 3CF0A 1XPRA 1ODFA 3KB2A 5GADl 2W6JD 1G5RA 1FP7A 1YHNA 2IS2A 1H65A 421PA 4MGZR 2BV3A 2DFKB 2ZI4A 4WA7A 1XTQA 2PBRA 4A6XA 5K8TA 1PVOA 2ERXA 2REBA 3DOFA 3SQWA 5C4GB 1G5PA 2XZLA 3DKPA 3AP3A 3ONWA 3CM0A 3CZPA 5C4MA 4Q1AA 3LW8A 2BJWA 3K0AB 4JSTA 4UKDA 1RVDA 2CL7X 3PQCA 4OK6A 4KFRA 1AQYA 3U6KA 2YWEA 5KNCA 1R7RA 1CJUC 1BMFA 4RFSA 4PC2A 4QBIA 1G7SA 2BIFA 2PCJA 3THOA 3CKLA 2GZDA 4B3DA 2JJ1A 3AGQA 5DIFA 2BMFA 1HEIA 2QUZA 1G3MA 4LJ9A 2V9PA 4BLPA 1W5TA 2DWPA 4ZCIA 4AURA 4QKQA 3KXKA 2JLZA 4LC1A 3ADBA 4DSUA 2C5LA 3GLGB 2HJGA 2JIZA 2ZJBA 2ZU0C 4QC2A 4Z8YA 2ZXUA 1OW3B 3LO5A 2IHBA 2HCJB 3D3QA 3Q85A 1CULC 4Q4AA 2NG1A 2QTFA 3WYFA 3RS5A 3AVVA 2OFOA 4C0HA 3L0SA 2RGGA 2ZRGA 2O8DA 2VHTA 3NHAA 4PX9A 1XJ0A 4RSGA 2WJJA 1CS4C 1T91A 4EPRA 3CO5A 3PITA 2ZITA 1KTVA 1MKYA 1M34E 3EX7C 3T35A 1UDXA 4RY2A 4RD6A 2CEAA 2E1RA 3BK7A 1AS2A 4Q7LA 1I4DD 2C78A 4D4LA 2ZI6A 2OFXA 4FWDA 2L0XA 4U7DA 1Q57A 4DXAA 1GG2A 3CNNA 3QF4B 3KTAB 4M1MA 4PSKA 1W46A 1ZNZA 2W2VA 2IA5A 4LPKA 4PXAA 4B6EA 5K8IA 5H8WA 2PZGA 1Q0UA 3OFNA 3K1JA 4K8OA 3AUXA 3RNLA 2IEYA 1G8GA 4GMDA 3KQUA 2CNWD 3TE6A 3UANA 4ZIRB 1LS6A 4R7ZA 5HKKD 2ZETA 1KO1A 2FX3A 3W3AA 2YZ2A 1ZIOA 3P1JA 4QGAA 3ZQJA 2EYUA 2HF9A 5DHAA 3SC3A 3RSOA 3TW8B 1JNYA 4BFWA 1NN0A 4TL9A 4EFMA 1CJVC 1LB1B 1QVAA 1J70A 4BRUA 3PV0A 1T3LA 2ZTSA 2WTUA 4P0TA 1Z47A 1C1YA 3X1YA 4B35A 1IXRC 3R8FA 2X77A 1E1RD 2QU8A 3IHWA 1DBSA 3M1IA 5EP3A 5G41A 2QMHA 4OQLA 4Q7JB 1M7BA 1U8ZA 3ZVLA 5F9HA 2F9LA 4MKHA 4AYXA 5E95A 1E2MA 3AM1A 2YINC 4A8JA 2GXQA 2GRJA 2QM7A 3VFDA 3CNOA 5E4FA 1BYUA 1D6JA 3VX4A 3ZDQA 2WSSD 1EFTA 3CUEF 4AG5A 4B47A 3WHKA 4KAXA 4Q47A 2XB4A 1T8UA 4MYTA 3RVBA 1P9RA 2RKOA 2NQ2C 4X8HA 1IY2A 3K8YA 4Q1FA 3W5IA 5A4JA 1T3SA 4TQAA 3RRMA 1W4AA 4GOKA 4TL8A 2ZUBA 1NSTA 2R6DA 3QNUA 2Q6TA 3NC1C 1XTJA 2FU5C 5KOYA 2ZYWX 4GPTA 1NIJA 1U0LA 2JCSA 2C99A 4BLOA 5HE8A 3H1TA 4MRSA 3ZQ6A 1OH5A 4HI0E 3WYAA 1J7KA 4MRNA 2J59A 2JEOA 3B60A 3LRPA 2WV9A 3ZVRA 4ARZA 4HB0A 3TJZA 2V8OA 4HAUA 3TRFA 1E1QA 3PEWA 5JWHA 4YMUA 2G1KA 4JL5A 5JJIA 1NRJB 2P67A 2WWWA 4OHVA 2FSGA 4C0JA 2DWZB 2A30A 5CYPA 1PZNA 2ZVQX 4RD4A 3P32A 5FL7A 1COWD 3PUVA 4CF7A 1D8TA 1ELOA 1TNDA 1GWNA 4EPWA 2F6RA 3B1VA 4M1WA 1NVVQ 2XB2A 1MO3A 3K9GA 5D3MA 4B3BA 1I4LD 2C9CA 2IEZA 3EWSA 2P0EA 1SXJC 4OHXA 4XVQA 3IUYA 3QKSA 4PFSA 5TB5A 3IQXA 1X8JA 1Z0DA 2CCKA 2W6ID 2OSBA 1TU4A 3R20A 4MQBA 2CCGA 3FKSA 1VCOA 4KI0A 1P72A 4UJ3A 4C9BA 3THXB 2EFDB 4YMVA 2WJYA 1QHNA 5AR1A 1LTQA 3PVSA 4B73A 1RZ3A 4CEHB 1KZ7B 2GEUA 2RGAA 3U5ZB 2HJVA 1PV4A 4TMTA 3TVDA 3U3KA 3W8RA 5K8UA 3K70D 3I72A 2QRNA 4IDNA 4BLQA 2Q21A 2IYXA 2YHSA 1KO7A 4FWHA 2XOKA 4YQFA 1XCMA 4URUR 4A0RA 2QAGA 2BKUA 4N0DA 3V4FA 1EFRD 3PEYA 3RS4A 2X8AA 4LRTA 2GK7A 4HATA 4M1KA 2ZRKA 4DLZA 1M7GA 1QG2A 3K0EA 1QHHB 2NIPA 4HEJA 3BD9A 1P2VA 1VCIA 4IEIA 4B3XA 3VR3A 2ZJ5A 3H86A 3V00A 5M04A 1G1MA 2Z43A 2WICA 1TEXA 2BEJA 5E7IA 1MV5A 3FMIA 2J0SA 4C0BA 1EFCA 2WM9B 3CX7A 3AB3A 1FQJA 2AFHE 4M22A 1ZM3A 5BYJA 2G0TA 5ANRB 1QZMA 2BMDA 3FDIA 3A4NA 4TLAA 3T61A 2EVWX 1OH8A 3TUJC 1LVGA 3UG6A 3IQWA 1R5NA 3EC1A 1DAFA 1WE2A 4DCTA 2HXSA 1XZPA 5C46F 4IDHA 2IXGA
chains in the Genus database with same CATH superfamily
2R1UA 3HADA 1Q3KA 2C92A 3OX2A 2YY5A 4HZUB 4WXHA 2X8BA 2GBFA 3LYHA 4IX9A 4E32A 3AUJB 1GV1A 2D1TA 4R3NA 3PUIA 2RK3A 3MWLA 3O2SB 5CITA 4LDRA 5IP5A 5AK5A 1KI4A 2YOFA 3WV4A 4RLHA 4X1YA 4QHTA 4K1XA 4MRPA 1IK6A 2PXAA 4FWGA 3F1LA 1G2IA 2C7OA 1X2BA 1C9EA 4EG4A 3M81A 4OLBA 2HSGA 4GI3A 4E08A 1DV2A 4R41A 1L7VC 3L7AA 1I7NA 2QYOA 4KRGA 1ISFA 4DC9A 3SX4A 3MWDB 4FW9A 2JLSA 4PSAA 3HZJA 4KMRA 1KY3A 1X8XA 4DR7M 1JE1A 1M6WA 4MAAA 2F1RA 5IU6A 1II8A 4AS3A 3I58A 5J5VA 2JJQA 4XEHA 2V7BA 4IXWA 2EGGA 2P41A 4ALMA 3I9LA 3BAZA 2WHRA 3EGDB 4ZDKA 4QAQA 4KV9A 4ENSA 1SEPA 4M4SA 2XUJA 2GWHA 1P4HA 4LF9B 2ZK7A 2OGSA 1JTVA 3S99A 2PUBA 4C4PA 1Y1PA 2KNZA 3MPOA 1IUKA 1KXJA 4G97A 4I1UA 1LDGA 3JSXA 1GNPA 5EXSA 2GFHA 3HN7A 2JHAA 1R6XA 1D2RA 2WKPA 3ZIUA 3HJRA 4TQGA 5I4KA 3VDNB 3QXXA 4I4IA 4V2IA 4Z4FA 1G0NA 3A4IA 3P20A 3GUZA 5FDFA 1AQLA 3EWAA 4A0HA 3WNQA 3ORQA 1GKKA 3F78A 2AZMA 4YV0A 4X6YA 3LMMA 1CZNA 3G82C 1DINA 1Z0ZA 1KRHA 3PHJA 3DO6A 1ZYUA 3I8XA 4BYGA 3QIAA 2OD7A 5EWMB 4UVIA 2NZ8A 1H0HA 2PZKA 5F78A 3LWDA 1CY4A 1CTQA 5FUYA 3IKTA 2ZBVA 4H7HA 3DFUA 2PTGA 3C45A 2RB4A 8ABPA 5WRFA 5FBWB 5LL6P 4BMNA 2AFHA 1NLZA 5IYZF 1TYEB 5EFOA 2JB9A 5COQA 2ZU6A 1V5FA 3BXXA 2QJRA 4OLFA 3LKDA 3PT5A 2CLFB 3SMSA 1ISMA 3KOZA 2COKA 3I62A 2FPOA 1EX6A 1QHYA 3HO6A 3WB9A 5JJLA 2R44A 1IONA 5TMDA 3CH7A 2Z30A 2PD3A 4HS4A 3SZMA 3R0QA 1Q91A 4MCAA 1P5JA 3U6SA 2FQXA 3PLAE 4AIIA 1GTL1 4J94A 1CPYA 2V6ZM 2YV5A 4QGFA 4AMYA 3MT8A 3ZQKA 3FUUA 1KA9H 3BD7A 2AG0A 2J48A 1E98A 2EWVA 2WQZA 1TGYA 2B2CA 2N46A 4JI7B 4FD3A 1UBRS 4HSEA 3MRSA 3ZTTA 5HF6A 4M7PA 4NPCA 1WCYA 3R7DA 4I4NA 2ZJ0A 2FPXA 1XNQB 2AJTA 2GPNA 3U61A 5I8WA 2PGOA 4OCZA 5HMLA 4TKZA 4ZU1X 1ZOPA 4K81B 4HRXA 5KUTA 1LQ2A 2GD1O 3QI7A 3EQ2A 1W0CA 5MHTA 3BJEA 2BKEA 1SELA 3BFKA 1I6LA 4LZNA 4OXRA 4UU8A 4G0MA 3BFVA 4H6VA 4EQ6A 2FKNA 2EL7A 1Y4ZA 3B6EA 3BL6A 1CRLA 1YCGA 4CIZA 5ESWA 5HOQA 4R9UC 2BSXA 3KYJB 3DXYA 3JATB 4CMJA 3TL6A 2Y1DA 3OIYA 4R8RA 1WRBA 3LY5A 4M8SA 2X42A 5LDGA 1ZUWA 2LZ0A 3RFVA 2DM6A 2CXOA 4MNTA 4PO8A 4UBKA 1RAEA 3P4YA 3D59A 4A5OA 1QTIA 4HDOB 4IDBA 2QX9A 1HLGA 4TTRA 3CXUA 5IF9A 2XXBA 5B3KA 2R8EA 1P1RA 4V1CI 1RYFA 3OZ7A 1E2HA 3S8EA 1WD7A 2GAOA 2R8XA 3GDHA 2GUGA 3EQ6A 1UBUS 4RESA 1Z3IX 3FGNA 3V97A 5H59A 1ADCA 3A10A 4OXYA 1M73E 3G0CA 5EMKA 1T5SA 4L08A 3ZKWB 1HNNA 2NN3C 5LBTA 2ALJA 2FOLA 4MP3A 2C29D 2NSHA 4MS3B 3N2GB 3UXEA 2R66A 1ZRNA 2PRKA 1Y1LA 3USZA 3FPHA 4LY9A 3U0VA 2FZWA 3EAFA 4CUJA 2VJBA 3A1FA 4B76A 3BG5A 4BXOB 1CRQA 4JR2A 2YZGA 3MJ4A 2FUEA 4I81A 4TN1A 2QNRA 4BB6A 3WLIA 2C5EA 5E7QA 1E9AA 4GQAA 4ZT3A 3O31A 2D2FA 1JSXA 3C7CB 3R5FA 3T7DA 5E0OA 1E64A 2V45A 1UBTS 1T4GA 3ROTA 3D7RA 4MRAA 3K0FA 1WXFA 3OC6A 2RBKA 5TPZD 1QZUA 5B55A 3EIXA 2JI4A 1SGWA 2DWLA 3KD2A 4DLVA 1E79A 1ADYA 5FLEX 1Z73A 3C16C 2CVFA 3CT6A 3NHSA 1ABEA 2D2IA 4YJHA 4JI3M 2QMOA 2EGHA 5CCDA 3TUIC 2QD3A 3H5OA 5KBYA 2A9OA 4NHOA 5DI9A 5HS4A 4PGMA 4PS1A 4C05A 3A9TA 2P9CA 1WPGA 4X93A 2C9DA 4OHWA 3AU9A 1SPXA 5F7JA 4HNGA 2IOFK 1XEAA 1GHTA 1NBWB 3RAJA 3PUJA 4DBLE 2VNHA 4D9FA 1WPRA 3I9KA 5FOXA 5KREA 4ZMBA 3LWNA 2R6CA 2JBHA 1JR3A 4Z9YA 5THXA 1MPTA 2WUEA 2PKYX 3T3HA 1V8DA 2CJPA 4G8CA 1EM8A 4EB3A 4YFVA 1MD9A 1UEXC 2VXCA 3ZHYA 3DD1A 2DENA 1UEIA 3DKVA 4NEGA 1BCSB 3GP5A 2R1ZA 3E8XA 1T34A 4AWBA 1XWIA 2WILA 1SCUB 4GEKA 3RVKA 2RGDA 2PVCA 3N8IA 5EGNA 1GUAA 2VJQA 3ETNA 3P9KA 2DSNA 1Z26A 2YUIA 2VJNA 1TEHA 3G0BA 2RHBA 3QK7A 3O9ZA 3SC2B 1I33A 2H85A 4AUEA 4LF9M 1RQ2A 4HDQB 4ZODA 1Z2DA 2YVKA 4XVUA 4QUIA 2CJWA 1G21A 4U2EA 3NKLA 4OU7A 3EVGA 1ODLA 3KQKA 2Z0MA 1S2GA 3O1HB 1QK3A 1TMYA 1XTUA 5LP6F 3TLYA 1SVMA 3D9QX 1O6BA 4G0UA 4RGYA 3R8CA 3OSUA 1U28A 1DPFA 3FTEA 5EMLA 3GCDA 5AXDA 3FUCA 4GD3Q 3IUPA 4UNSA 3AETB 2C9OA 2FPPB 3IVXA 3R7SA 1DG3A 2ZVDA 4DA9A 2WIGA 3WIVA 3RD5A 5A0VA 5A4IS 3JQAD 1QCCA 2VDKB 4I50B 4K8RB 3NHKA 2A3RA 4A92A 1Z2EA 3I76A 1R27A 3D6AA 2WJ4A 1I1QB 1ZD1A 3N8NA 1VL1A 2FK7A 4NATA 5CDUA 3IOYA 2Y1OA 4FI3F 1UIMA 3LV8A 3OCUA 2IEDA 4BGDA 4BECA 1DIHA 4YUVA 4HQFA 2DPYA 1ZN2A 3NFYA 5ESXA 3NKFA 1XNRB 2WAMA 2XQJA 1ODSA 4YHBA 3E9CA 4G0PA 3KSMA 5JZOA 4QPJC 4X95A 1YZVA 3LU1A 2EIHA 5FTJA 2DHDA 3RBAA 7MHTA 2OXRA 4KQCA 4KPEC 3FM9A 3CW8X 1W2GA 1Z74A 2WM3A 2O8BB 3GQ4A 2O2SA 1ND6A 4WESB 3IG8A 4K2AA 2RHMA 1RCUA 4YCAA 4TS9A 3LUKA 1TYDE 2WVHA 1L3CA 2GCIA 4YAOA 4LJLA 4KRFA 1TVKB 4K9RA 1C7JA 4CV2A 4W5WA 2QTLA 4JI7M 4LHWA 1JDVA 4JSRA 2OLJA 5K2MA 2IYAA 5CB6A 1Z4MA 3RASA 4MKXA 4FJ0A 1XNQM 1JQEA 1ZAYA 1B23P 4DY6A 1KDYA 2KRKA 2JGIA 3P9PA 4N18A 3ZY2A 1YS6A 5BT9A 1N2JA 2XMBA 1TDHA 1NQXA 3MOGA 1YJAA 2P27A 1CJMA 1EXNA 5LLSA 3GAFA 1ITZA 4ZYLA 4ZCSA 3EG9B 3VTAA 4DEVA 4JT8A 1XMPA 3M82A 4PC1A 3J80S 1DEOA 3UUFA 4D5EA 5U9CA 2GO1A 4JVNA 1TCVA 2XITA 2IDJA 1C0PA 2GKGA 3DVAB 3C14C 4TLBA 3LP6A 2C4NA 2D7CA 1QHFA 3DBIA 1YUBA 2QM8A 4E2ZA 2I2XB 1EH5A 1JDBB 2JF0A 5DYWA 4IIXA 1FDVA 4PV7A 4X94A 2I3DA 5HS6A 1GCAA 2QLTA 3QOWA 2CMFA 5B4VA 2VUUA 5IH3A 4EUHA 3NCTA 2IHZA 5BSFA 1F4IA 2PUDA 4UDYX 3TINA 2HL7A 3BRQA 2YW2A 4S1NA 3WP0A 4JB8A 5FUVA 3QXCA 2GKSA 4GSKA 1Q5PA 2A1IA 5HQ3A 2WWFA 3I2JA 1UPFA 1WMAA 1UT5A 1PJLA 3QG1A 3DBRA 3B7ZA 2ODWA 3GFRA 5H02A 2ETXA 4FYWA 4L9AA 4KQEA 4FVMA 5JDCA 4NYMR 4MUJA 1MEEA 5F77A 3MJEA 3SDZA 4B82A 5KHAA 1NYQA 4O8CA 3SAVA 3LNCA 2PWZA 1C7EA 2J7PA 3TIIA 4L74A 2RJOA 2CNDA 3O8QA 2BZSA 3NALA 5I7UA 2IW3A 1TJYA 1E20A 4IBIA 4JUIA 2HDNB 1NF2A 4ECEA 5FL7D 5F1OA 5DEIA 4KQGA 3NORA 2H2DA 3TVYA 3X1KA 3T9AA 3ZU4A 4QOSA 4ZMSA 3Q98A 3OTQA 4YRSA 4WLOA 2Y77A 3DUFB 1EGQA 3AUYA 1SIOA 2FEXA 1Z7YA 4GMQA 2R8YA 5J4KA 1B6RA 1IHDA 3QNWA 1IQUA 1VKOA 4IGEA 3BMOB 2EZ9A 5DBOA 2YICA 2BYTA 3F5DA 1JNXX 2JD2A 3GDGA 4GPAA 4TKUB 3B82A 3DV0B 3N74A 4D0LB 1HA3A 4DY4A 3NTVA 1L7QA 4R6WA 5AW4A 3C3MA 4NXNM 5AJZA 3E03A 1N4AA 2ZANA 1L5ZA 4Y6GB 4DLNA 1DQYA 3EFHA 4FHFA 1J9EA 1RBQA 1S8AA 1TI7A 4HNQA 1SUFA 1A9YA 5CJJA 3S1AA 1FXSA 4QYWA 1OROA 1JPJA 5DSXA 3TQFA 3PXAA 4Z3OA 1J1ZA 1JDNA 3EYWA 1JBEA 2J30A 4YJ2F 1YI0A 1R3UA 3HSSA 3N9IA 2PX3A 2YN2A 1EUDB 4L0MA 1ND5A 2WKSA 4OMUA 1N2ZA 3ZDRA 1QC5A 4J0IA 5EZSA 1FP4A 3KKLA 5F1PA 5BV8A 1IU9A 1UP6A 1QTNA 1Q1NA 4I55B 2JGDA 1Y7IA 2VQEB 2X4LA 1U7ZA 1W5SA 4IV5A 1P5HA 4BFVA 1WXHA 2Q7XA 2JDIA 3WQHA 2R7LA 3Q41A 4BV2A 2BDEA 4N0PA 1A8IA 2F4VM 1BFKA 3AOGA 1LD3A 5JPDA 3WMFA 1FYXA 3GCXA 4F7WA 3MBKA 621PA 4QU9A 3QGMA 2XE6A 1R88A 1CQXA 1XPUA 3MUNA 2X76A 3G0DA 4AJ4A 4BPBA 1TTPB 3UGJA 4Q18A 1H2HA 1UPXA 1K3WA 3QJ5A 3ZDZB 3VZSA 1ENYA 1NM5C 3E9MA 1CQZA 1GSHA 4FOOA 1OF1A 4FDMA 3JVVA 4G0XA 3IFSA 3WSWA 1E60A 2WPNA 4D46A 3RVQA 3THXA 4ETIA 1IQ0A 1ZM7A 5L40A 3P19A 3ANLA 3RUFA 3D4NA 9GPBA 3WL3A 3IT1A 4BEJA 3RRJA 4R69A 3L6EA 1L0BA 4FDAA 5DLYA 2WNHA 3EXIB 3FYUC 4U8GA 4UCXA 2IV2X 3B5JA 4DSAA 4QQNA 4R83A 1H2XA 1SQFA 1PR9A 3Q1LA 3RKRA 4OQQA 2QX7A 1PUJA 4MUGA 4TRRA 3QF7A 4KDEA 3T7AA 2GTPA 1JHOA 1XTBA 2Q5CA 5DYTA 4FBMA 5D00A 4YJ2B 3UFXA 1XNRM 2BN4A 2HFJA 2QPOA 3QXJA 3I4YA 1QVVA 4YHHB 4AWAA 2NZVG 5DNYB 3VH2A 3SVZA 4PSUA 3GGGA 1TM1E 1GABA 1NP6A 2CWDA 1ACJA 3GC6A 3OEHA 3U19A 1QHXA 1RW4A 4U2KA 1Y6QA 4AJ2A 1CUGA 1XAIA 1DIBA 1NN1A 4N40A 5L8RF 4UATA 4AYWA 3VU0A 2VHVA 3BGSA 1LV8A 2WP8J 2D5LA 5E6UA 2PBRA 1VM6A 3BGDA 1LTMA 2ERXA 3DKPA 3TDKA 3E9ZA 2R3SA 4QLAA 4HT3B 4OFZA 1WULS 2OO9A 4K0KM 3AGQA 3GF4A 5E1BA 5H83A 2NW6A 1F9AA 4MK4A 4KO2S 4EJFA 2CP8A 3ILKA 3PNBA 2BEWB 3ONEA 1W29A 4PLPA 3D3QA 1CULC 5CVJA 4K9DA 5E6SA 3QBEA 1JAXA 4QBTA 2P4QA 2PAFA 2QIOA 2ZITA 4WTOA 5IKXA 2OBXA 3R9XB 3W77A 1TMGE 3U17A 4HN4B 5KWIA 5HK9A 3AUXA 4GBJA 4GMDA 1DRJA 3WK7A 2ZYGA 3NNSA 3DGEC 2FX3A 1Z82A 3FPGA 3B36A 3MMXA 2FUCA 1XZIA 4AM8A 2ZTSA 3RVSA 1NUHA 5AOVA 1I7SB 2YVLA 1W6RA 4MWDA 2YINC 2C7VA 2DBQA 1UM9A 2D59A 1ZR2A 1PR0A 3EULA 3KELA 4Q1FA 1EJ2A 2R68A 2ZIFA 3H9EO 3H1TA 3GU3A 1Y9AA 2JEOA 4CFZA 1E8DA 4EHHA 2V8OA 3MSCA 4RELA 4LCEA 2LNDA 1MVLA 3JQBA 8ADHA 2ZVQX 4YRCA 4EPWA 2E82A 3B1VA 3LL4A 4GI2A 2CCGA 2IXAA 1G63A 3L6UA 1ZOLA 4F0JA 2E85A 4IIUA 5CEEA 1PJSA 1DRVA 1XVVA 1GPUA 1J5XA 1LZKA 3V2IA 4FWHA 5KOIA 1WKCA 4GO1A 2QTMA 3LTNC 1FFYA 1Y82A 4M46A 1GUFA 1Z38A 4NV0A 3T7SA 2BMDA 3ELBA 3D8NA 1OH8A 3FD9A 1R5LA 4AO8A 4WDQA 4C4ZA 1G1AA 5J4VA 2PS9A 4DE5A 1KMHA 1R8XA 5GONA 1J00A 2HFKA 3ICVA 4QTTB 5FXMA 2B2NA 3GMDA 4B3HA 4BX3A 4MW1A 5HBGA 4PC7A 1UPBA 4HWPA 4IGKA 2UVPA 1OX4B 2CMKA 2OFPA 3A8TA 2LIVA 4KPUB 2PUJA 3OUTA 1MFPA 2GZ3A 3EXFA 1VE3A 4XIFA 2EU8A 3CTMA 4NWIA 2I62A 4FWTA 3PUHA 1SULA 3SIXA 1OMOA 3HRKA 3R23A 4NFSA 1SVKA 3KKEA 1QO7A 1JMVA 4X6XA 1E79D 2DR0A 4CIAA 4RXMA 4RVCA 1C0EA 1W5BA 2VF5X 3X1WA 3AU8A 1CEEA 5KYNA 5EUMA 3IQFA 3OTGA 3E5HA 4X66B 1EWTA 1N2OA 1G7RA 3IHTA 4WECA 2HMSA 1DL5A 2A0FA 4IDEA 4F38A 3ASYA 3MJHA 4S3MA 5F5NA 3R2JA 2E1PA 1AUVA 2GCGA 3DT8A 2JLAA 3VPCA 4TZKA 3WIUA 1LI5A 2VQEM 3PGXA 4V24A 1MAVA 1J22A 3D7LA 2CHUA 1XLTC 1JR3D 4G6ZA 2EBFX 4H16A 3JZFA 3TH5A 4DBZA 1B0ZA 2PMBA 5IREB 4BP1A 4CHTA 3KOXA 4K40A 5IS2A 3HKBA 5A4DA 3OLZA 2Q8PA 3R8XA 1R00A 4QGSA 4IOJA 1S5PA 4H17A 3LP5A 5JRJA 4RKWA 4B7AA 4Y9DA 2JG3A 1K1EA 1VMAA 2FOIA 4MGYE 2FDXA 4Y1RB 3CZ4A 4LX0A 1C3OA 3I34X 3GRUA 5EERA 3N58A 2NU6A 1ZNQO 2VUTA 2X2FA 2HK9A 2KNAA 3QEJA 1BE6A 1JT9A 1NHGA 1UKAA 1A9TA 2EJBA 1H85A 2HWJA 3NBYC 3HKCA 1IEWA 1XEXA 1SKUA 2XWBF 5EXTA 1AKTA 2H9AA 1X1DA 3HPRA 1NQUA 5ALNA 2HPAA 4WK2B 5GVSA 1A9PA 4D43A 3AEKB 4QGBA 2HHHM 3G5MA 5CLQA 1E2FA 5I9LA 1QHIA 3I64A 2OBLA 3B3GA 5HIAA 4U02A 4GP9A 4DDUA 1X14A 5IC6A 4IG9A 1H4QA 3I5MA 4LVCA 4D99A 3H9BA 4CM5A 4L5YA 2P30A 1JFLA 3HXMA 1Z29A 2Q0SA 1ID1A 4P4UA 1QMPA 3ZK8A 2V4ZA 1FFGA 2OKGA 1VJ0A 5DM2A 4WD3A 3D4LA 1KU6A 4R2KA 2PYDA 4EJSB 4KRXA 2V7VA 1H2BA 1Z4NA 4GXRA 4OATA 1JLMA 3KOYA 3EPPA 4D0RA 1MB2A 3Q0TA 3IULA 4D0GA 2QUJA 3WWEA 1MCZA 3UWOA 4EEXA 1F6DA 4CF6A 1QP7A 4X64B 5CT8A 1VSVA 2OHVA 5E8JA 3NBKA 2AGVA 4BTVA 1JBQA 2ZCVA 2G70A 3TRJA 3O3OB 4NBSA 4JJFA 3PUWA 2D2XA 3QNMA 3UC9A 1E8MA 1PBTA 1NSFA 4REZA 2Q3CA 3G02A 4WXMA 1GTMA 3PJFA 4BWYA 1KC1A 3GJTA 1LBQA 1UKYA 5E4YA 1BX0A 1EG7A 1TEVA 1DX4A 2R8PA 2O14A 5DLQC 2O01F 2C97A 3WK4A 2OHFA 4HUQB 4L15A 2E9SA 1WCWA 3G2KA 4EARA 1CUYA 3K35A 4CF3A 1Q0ZA 5FBKA 1SEVA 1ISHA 4AICA 3M8KA 9MHTA 3IVAA 3CLRC 1FUEA 2ZB8A 7YASA 5IJWA 3MNFA 3DHVA 4M9UA 4Q00A 4XVCA 3WRWA 1DWUA 1WVGA 1SOAA 4DT1A 2N1BA 2PT7A 1YULA 3LX6A 3DTTA 4CTKA 1RYZA 4M9XA 1MZVA 4JV5B 2L2DA 1TL7C 1NW7A 3GO4A 4HDNA 3HY5A 2WSMA 2KW0A 2JAQA 5F23A 2YC4C 4KQ1A 2I34A 2IYWA 3G2OA 3W6PA 1N8KA 3NUQA 3BJIC 4HFMA 5K0EA 4DTCA 3LBHA 1TAHA 2DUMA 3PFGA 5BVGA 2ZULA 1J9GA 3ZE1B 5J4LA 4E07A 2R79A 4FEGA 1SXHA 4XCQA 1O7JA 5FSWA 3V4RA 4BNMA 2Q3HA 1B1CA 2F9MA 2QCUA 4M76B 4JLVA 3F8TA 3JTEA 2FFRA 1PSZA 3AF3A 2YHAA 4C0SA 2WRZA 1AGPA 3O0DA 1IZ8A 2RAVA 3G5LA 3PNVA 5B58T 1GPYA 4H77A 1OVGA 5JEEA 3D7MA 2GHQA 4G8BA 4YR7A 1XPJA 2HBZA 1EVLA 2R48A 2RHCA 2F17A 4ZYWA 3IQDB 4YT2A 2QTWB 3CF6E 4MLZA 3F6PA 2VJPA 5AUPB 5BN4A 4J6EA 2E0IA 2Z5GA 2J7PD 3PHCA 4NV3A 1MIHA 4A2WA 4JYBA 5DTMA 1RPTA 1Y3HA 1IH8A 1SCNE 1BMQA 3PDCA 4RVHA 5EJCA 1NZFA 3DULA 3ZD9A 2QTCA 2IOQA 4GBGA 2IZ5A 5F2EA 5ITUA 1XWFA 5KYGA 4A4DA 3MWKA 1N77A 1RJEA 1NVAA 1OI2A 2OV8A 1SIUA 3PA8A 4EMSA 4IZHA 5A1JA 3CZAA 4YQYA 3OFSA 1YSCA 3FWHA 4MZXA 3DOEA 1L1QA 3AI1A 4B80A 1VGRA 3QVUA 2R6AA 5CP8A 2WJPA 1UKVY 5JS7A 1SVLA 1RHUA 4EO9A 3CLSC 2G5GX 3IDOA 2B30A 1CUJA 2EYQA 4X66M 4ZI7A 5MGNA 1LLDA 1UDRA 4O2AA 3DMFA 1JLSA 4ESEA 1K4MA 2EW8A 3QMWA 1ZOSA 5DNAA 2XRFA 2FB9A 3E0XA 4MP8A 2PS3A 4RE5A 1YA8A 1T0HB 1C7FA 1QGUA 4C5AA 3AB7A 4KUGA 1Z62A 1R6AA 2UZ1B 1NG9A 5GAJA 4R01A 4W8HA 1UFQA 4JI8M 3GCZA 1ML4A 4B2IA 1H0RA 1B3BA 1AKMA 4MARA 2VHQA 2Q1WA 2GHIA 1KQ3A 2QHXA 4ARZB 2FHSA 1U8AA 3S68A 5JT1A 3E2MA 3ENVA 4HFRA 4XRRA 4YONB 4G9EA 2VP0A 3SHFA 3EXG1 3BWCA 2JDID 2HV9A 1JHVA 2X49A 2WHXA 3R9WA 3HUFA 4J49A 3M2TA 1AGYA 1A3CA 4G25A 5A9SA 1A76A 3OF2A 3LXUX 1GGEA 3NWJA 5E7JA 1FBTA 4IVPA 1N36B 3HJAA 2D5AA 4BNIA 2WU0A 4POOA 3W1VA 4YRRA 2N47A 1BN6A 1OLUB 3WAGA 1W1WA 2V6FA 4LHEA 2E4XA 4KVFA 4Y6SA 1P17A 4J2HA 2XWSA 4D5GA 1OC4A 1R8JA 5BNZA 4RWEA 4CM8A 3VISA 5FIUA 1FFXB 4UVHA 2Q3MA 1W88B 1WTAA 2KSQA 4EMUA 1YZGA 2YMQA 3W2IA 4B3MM 2JXNA 3NBAA 1VJTA 1SUDA 3FYUA 4UVEA 1D04A 2G7ZA 1R0ZA 2X3UA 1XSEA 3PXEA 3FRHA 4L6IA 1RYBA 4TSFA 1HKUA 5DM70 5BMVB 1Y5LA 1P9NA 4XRGA 4MGKE 1UL1X 2YFHA 5LQCA 1Z5VA 3EF0A 4MMYB 4CF4A 3IURA 1R64A 2K9DA 4C0QC 2W5UA 4IIJA 1XYGA 5BNWA 1NXQA 1JHRA 4F2DA 5T4FA 2IH4A 1Y4UA 2ZAIA 4KN8A 5L7WA 3T5MA 2Y20A 5JU6A 4U2CA 1WR1B 3CCCA 2C59A 3EMVA 1ID8A 4HQ0A 5DDIP 1ZUIA 4V0RA 4EKNB 1C3LA 1XZLA 3OEHD 5CDHA 1SXIA 1BDJA 5ALPA 3RTDA 4JUAA 2Q46A 1U04A 5AJWA 1P3Y1 3X1MA 4UNQA 3JQ9C 5EZ6B 3COPA 4RCZA 5FULA 3OVMA 4HAYA 1H1LB 2PG3A 3LDUA 1PLLA 1C9MA 3SHWA 4URXR 1ZD5A 1HLFA 1FDTA 4CDNA 4GOLD 1ZUNA 2HF7A 3SWWA 3DB1A 5KC9A 2QRJA 3ZJUA 1SBHA 3LCCA 2I6FA 1NXWA 5I9SA 1I7DA 4DC1A 1I1OA 4GYKA 4H3VA 3W2GA 4MW9A 4L4UA 3Q3CA 3TEFA 3H19A 4XWGA 2QGFA 2KQUA 3U7IA 4QNMA 2A78A 1CEQA 3PXBA 3P45A 3LQQA 2P65A 3GI1A 5DBGA 2OILA 4AB1A 3LUFA 1BRTA 5L3QB 2FNAA 1QYCA 4IIFA 4KK4A 5HSGA 4A7PA 1SURA 1WPXA 2PMEA 3ZGVA 4C0XA 1RWQA 1Q1BA 3SZ3A 2F5NA 2TYSB 4NMWA 3K94A 3ZY5A 3F9RA 3ZHCA 4D9BA 3H7AA 4JV5M 2LVBA 3O92A 1X1QA 1S4QA 1ONOA 3ZGOA 4ALKA 1NXSA 1PRBA 3TQTA 1KWKA 1U5CA 2XQKA 2FW9A 4EG8A 2LH0A 3VAAA 4F2HA 4RTPA 4FVTA 3KZOA 4PFKA 4UE3S 3I83A 3HBFA 4LZPA 4IPTA 1FYDA 2VH2A 2AHMA 3ZWOA 1P7VA 3GFPA 3ZQ4A 2PGNA 1B2RA 1V5GA 1WDMA 3FSJX 3GJ8A 5BSVA 1BCRA 3WK5A 4CIWA 1BRMA 1JQKA 2X2OA 1CIJA 4RSMA 1J0DA 1GL3A 4XR4A 4XWYA 1J8FA 2L4EA 2FZ5A 4TX1A 3N0WA 4KX3A 3U4GA 5EJGA 3LUDA 3RRZA 2YJ3A 3PXUA 2B92A 3ZXXA 3RS2A 3AINA 1VIVA 1RWMA 3P5SA 4X91A 2O8EB 4CEIA 3K6JA 1RQGA 4FMDB 1P2FA 4TOIA 1L4FA 3QJGA 4J1QA 2AJLI 1N6IA 4XDGA 2EJSA 3NDPA 2HPZA 4O2BB 4RVDA 2IY7A 4PZDA 4HGPA 2ZYUX 3RWMB 2QRLA 5GKNA 1LW6E 4RF4A 2O7VA 2IP2A 3STXA 5AVZA 4R5MA 1KIMA 1Q02A 3AFMA 5LYYA 4B4OA 1DGBA 1TYBE 1SQGA 4C0LA 3V34A 4MA5A 1SCJA 1PR6A 3DEZA 3I51A 1EMDA 4LBVA 3LF2A 5JD6A 2DFNA 1CFZA 1L4GA 4N03A 3U7QA 4ISBA 3TZCA 1V11A 4JHLA 1N32B 3I9JA 1OIWA 1AZLA 2JIBA 3L4SO 4OQZA 5K0JA 4JB0A 1XU7A 1B8NA 3RAGA 1U8EA 5TNXA 4CMKA 5FUBA 5A2QA 3P71T 2EFCB 1GQQA 4N7BA 1Y6JA 4JLNA 2VN8A 4DNPA 2ZKLA 1O4VA 2OB2A 3W6OA 2XGOA 3GARA 4FCTA 1Y4DE 1XE3A 4JU8A 2WZQA 2V5UA 1CZRA 1AOXA 3D7SA 3KW6A 1XLTA 1M2VB 1XTVA 2PS1A 1Z2AA 1JDUA 3ROXA 3EEYA 2WIKA 2IV7A 2YW9A 2ICAA 3B7WA 2VO1A 1L7AA 5AIBA 4XM1A 2CYBA 1V16A 1CZOA 2RG7A 2IT1A 1KK3A 2N42A 1H9BA 2HK7A 3JD4A 4E5DA 4US2R 2X5OA 3W5VA 5B3LA 1GPH1 2C4KA 4XH9B 3BWEA 1XMOM 4TKVA 1UXOA 2BR5A 4L9RA 5JASA 2V54A 4RDIA 1VA5A 3ZCQA 4JLWA 1N36M 2DB3A 1B3RA 5ESDA 4UNRA 4NULA 1D0KA 4TMXA 4K6CA 5EE5B 4EHAA 1D2CA 1KI6B 3UK7A 2J87A 4FTWA 2GZAA 3OLXA 4CLRA 2ZPTX 4E2YA 1ZU4A 4G5FA 3ANYB 1MHPA 4ND8A 3I42A 3A1VA 4GYYA 4N3AA 4HDRB 4E6EA 4MIOA 1OV6A 4LF4M 1HDGO 3H9QA 1XZKA 4CQMA 4AKSA 1A5AB 4K9SA 3PSAA 4WP2A 1X1BA 1TH2A 4DDWA 2FEWB 2H2IA 5EZYA 2F3QA 4XIJA 2J0UA 1U3FA 1DBRA 4E09A 3U16A 2AEEA 2H1OA 4O33A 4ZT4A 3UICA 3WGVA 3N2KB 4TWAA 4WT7A 2I78A 1ZH6A 4C43A 2OCLA 2IS2A 1H65A 1U3UA 3TOZA 3MQ4A 5JANA 2PT9A 2DFKB 2O3JA 2PX2A 4WA7A 4HF7A 2NACA 2XVAA 5IJ9A 3CM0A 2ADFA 5LVAA 2FYTA 4YPVA 2BIFA 3WGJA 3GDFA 4M38A 2V9PA 2Y99A 5JSKA 4R2WA 4A2CA 4QKQA 5C1IA 4QPNA 2ECPA 2O5EA 4HVAA 3BXEA 5KIAA 2HCJB 4LMRA 1H4VB 1Z0SA 1XJ0A 1M34E 3T35A 5BPHA 4WNAA 4N6NA 5IWCA 2PZGA 1QP8A 5CEJA 1PFKA 1TKAA 1MDBA 2FWPA 4QQRA 3ENNA 2YZ2A 4ZN6A 3X44A 3DWIA 4X00A 2QU8A 2ES4A 4UAGA 4LXHA 3AG5A 2BFFB 2CLEB 1ZCZA 3TSYA 1QONA 3JYPA 3VC3A 3G2HA 3I04M 1YGYA 2ZPAA 3STTA 3SQNA 2NQ2C 4GOKA 3I01A 5I45A 2ZUBA 3G9ZA 3O8OB 1BWQA 3E22A 5EHNA 3RBVA 2VAVA 2XCLA 4N82A 1IG3A 5AQ1A 3W78A 1PKEA 3GNLA 2PMCA 4BNDB 4UQLA 1T9AA 2P67A 1X19A 4M3NA 1R9JA 5A3QA 3GOHA 4WN9A 4X0EA 1GWNA 2A0XA 1NVVQ 4R1TA 3EGEA 1FFAA 4XXHA 2R87A 4OTZA 3FR8A 3VHXB 3BGOS 4OBBA 3Q3IA 3R5HA 1ZMWA 1CDZA 4HCJA 1GUZA 4G4OA 3U3KA 3W8RA 4B9EA 5CFRA 4WBNB 2ZRKA 2G5PA 3H86A 3TGLA 1Q11A 1SUBA 2A0WA 4LWQA 4LNUA 4UM8B 2CT8A 3E5RA 3CNBA 3TXYA 5FQNA 2F9FA 5CLIA 1RU3A 1FMCA 3AI7A 4NOMA 2AOVA 3W9BA 1NVKA 1R6DA 4B83A 3EGIA 1YTLA 3A36A 3H2HA 2IYNA 4BNHA 4B34A 3CRW1 1GPWB 4RDXA 5KOJA 3OOWA 2WU4A 4L2IB 5AI8A 4ALJA 1KZ6A 3AM5A 1Q3BA 4M0LA 4JI5B 2QA5A 5G2OA 2OBNA 4O5AA 1GY8A 3JARA 3CMMA 1T4CB 4I50F 4C0KA 3KUKA 4J1TC 3UAYA 4GKAA 1FRZA 4FNGA 3PUKA 5FNVA 3RIEA 3UJCA 1NHWC 1X7YB 3KJGA 5BSUA 2PPLA 4GMKA 1N1MA 1DBPA 3SICE 2I7PA 3HDJA 3VNRA 2YN4A 4R1LA 1GLGA 4RHCA 4KWTA 3TW0A 3K2EA 3OJLA 1Y37A 1PKXA 4HQ6A 3EZ2A 2VPTA 4CVNA 1M5TA 2JJMA 4YI3A 3Q7PA 1ZEJA 2G6BA 2PKQO 4UBIA 1JWLA 2QJFA 3QWIA 1I4OA 2Q50A 2H1VA 4LZAA 5KTYA 2EERA 3GELA 3UA3A 2REQB 2WR8A 2JFYA 2Q3EA 1UANA 1XDSA 2WHQA 2OGUA 4HRVA 4C4SA 2CVQA 4JJIA 4CKYA 2HT1A 3FFBA 3LUJA 5JCJA 1QUEA 1VKNA 2QJOA 3LQKA 2VAWA 2BC9A 1PJQA 2CFIA 2B0CA 4F97A 1G3IA 4WX2B 1G42A 1U1GA 3FDXA 1IY0A 3RGPA 5CLLA 3M1LA 3LRXA 1CRPA 2PE5A 2FSVC 4C6RA 4WOJA 4WOPA 4OKNA 3AHFA 3DMGA 2P7HA 3IERA 3VKGA 3D4IA 2LGJA 3H4JA 3UENA 1UJ4A 4Y18A 1ZRMA 4WCDA 3PJGA 4ALNA 4LQLA 5KDLA 5KVAA 4LJ5A 5FPKA 3GG2A 3S55A 2DKLA 5AK3A 4U8HA 5EY5B 4EUKA 2D2VA 1SUIA 1K7XB 2B9EA 5EESA 2ZRHA 1TGUA 5JNTA 3Q8XB 1MABA 3BIFA 3MGCA 3FNRA 4H18A 3AEQA 4J90A 4PHCA 1EP1B 3A9UA 1FW6A 2PMDA 9ATCA 1YE8A 4G89A 4YUWA 3ZI4A 4OYYA 1TMOA 5M7EA 1S6YA 4Z9AA 1REQB 1XL0A 5ARDA 4D82A 3GPBA 1UC4B 1WVIA 1ZH0A 2EX1A 2PKXA 4FOPA 4NRDA 5LQNA 3CIFA 2B5WA 3WKBA 3FE2A 4Q4JA 2IX9A 1WS6A 2GZMA 1NZDA 3VBEA 3F49S 4C6TB 1PZGA 2HRCA 4GGPA 1OIPA 4YUZA 3JVDA 3W9UA 4B6GA 5BQFA 4XUGB 5DVZA 4W5JA 4R2HA 1GL6A 5M34A 4G1EB 4MVJH 2OZEA 1P5RA 3DR3A 1HFKA 3BX1A 2J3MA 5JSZB 5JWRA 4UCFA 3M83A 3NBIA 3EH1A 3UUEA 3TQQA 3Q4GA 4W7IA 1FRNA 2B21A 1GAWA 3SQXA 1PTKA 3QQPA 1QG4A 4TSFD 2LCIA 3BL8A 2HCFA 5KVCA 3KXDA 2PZEA 4P08A 4MEAA 4LPSA 2WSSA 4P3PA 4GXNA 1T6BY 3CWCA 2JCYA 2PDAA 3P26A 4ZT5A 3UAXA 2CWBA 3UUGA 2JFZA 3WL6A 2X9VA 4XOIA 1HDZA 2QX8A 3I2HA 3MTJA 3UXHA 2H06A 3MLBA 4HVCA 2IQIA 4E2XA 2HDWA 4EBBA 5K8VA 1D9ZA 3U60B 4ITVA 2ZR8A 2E55A 3JQ9A