4LY6A

Nucleotide-induced asymmetry within atpase activator ring drives s54-rnap interaction and atp hydrolysis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
247
Chain Sequence
EYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELKNVIERAVLFSEGKFIDRGELSCLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (NtrC family)
publication title Nucleotide-induced asymmetry within ATPase activator ring drives sigma 54-RNAP interaction and ATP hydrolysis.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 55
structure length 247
sequence length 247
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00158 Sigma54_activat Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ly6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ly6A01
1I4LD 4Q4LA 3U44B 4O3MA 2A2ZA 2AX4A 3L0PA 2EFHB 2RGGA 1XMVA 2NO7A 4UQOA 5GADl 4DUGD 4C0QC 1R0WA 721PA 3SQXA 4ESVA 3X1WA 2IYZA 1WF3A 1IN6A 1HUQA 1OXSC 1YR7A 3AKCA 5CDFA 1XNJA 3RABA 1P60A 2UKDA 4L5BA 4BQSA 2YNMA 3Q5DA 1W7AA 5DIFA 5C1BA 2ZSFA 4HATA 2RGBA 2QBYA 3WMFA 4CEIA 4ACBA 3KQKA 1OH5A 3NDPA 4ITRC 3PEYA 1JPNA 2OBNA 2JLQA 2RGCA 3KX2A 4DZZA 2AD1A 2J59A 2CHGA 4FMCB 2GEVA 2GWHA 5CK5A 2WOOA 4JLNA 5AUQA 4CVNA 2W0SA 2OLKA 3T61A 2Q3FA 4MYCA 4AYWA 5JWOA 4KXFB 2CMKA 2QBYB 3GLFE 2WAYA 1SKYE 2OFWA 4CEIB 4XTCS 4JBXA 3HPQA 1XEWX 1KY3A 1KMHA 3CNOA 3NEYA 3KFVA 2XXAA 3UANA 3UWOA 4M21A 2J5XA 4D4JA 4GOXA 1XJQA 4Q01A 2MSDB 1EX7A 1RIFA 3LWNA 3EZ7A 2PEZA 4S2EA 3PUVA 5FBVB 2ORWA 5FL3A 1XXHB 1Z06A 1QBKC 1PV4A 3BFKA 2QROA 2REBA 3TAUA 2BEJA 2ZEJA 3NEJA 4IVPA 1KMHB 1UPTA 2Z43A 1GFIA 3RAPR 3VX4A 4DRZA 3Q5EA 5KSYA 1XRJA 1TPZA 4GT1A 1FTSA 4KFRA 2CXXA 2GDJA 1C4OA 2C98A 4URYR 4G3XA 1E94E 2HCBA 4DCSA 1JR6A 1UEIA 3OZXA 4Q47A 1TADA 3QENA 3GP8A 3TUZC 3E2IA 1MV5A 1OFTA 3P27A 3CPEA 1RVDA 3ZYCA 3AVTA 1G7RA 1G4UR 4PC2A 4JLBA 1E2JA 4MGKR 2WJIA 4GMDA 1OB2A 1R8QA 1ODFA 2WWHA 2D7DA 1XB2A 5EE3A 2DBYA 4WA7A 5FTLA 3A58B 4KBFA 2GEDA 1DEKA 2KI5A 3W90A 1Q12A 4JL5A 2ATXA 1UJ2A 2ASEA 4MRRA 3RRMA 4D0NA 1E98A 4JSYA 4CT4B 1SVOA 1YE8A 1G1MA 2J7PD 1VYUA 4NYIR 3M4YA 1XPOA 4IFEA 1W46A 3L2OB 1EFRA 1R8SA 1Y63A 4EFLA 3P20A 2VSXA 3WBJA 3BD9A 3DKVA 3BH6A 1SQ5A 4HAYA 4KYUA 4FWIB 5L3QA 1OFUX 3ZVLA 1ZMXA 1X8LA 2YWFA 4H9GA 5DLQC 3ZQJA 2YKGA 2DB3A 5EP4A 2IS4A 4NE2A 2ZANA 3W8NA 3GLHE 1S1CA 4B75A 2WBLC 3OFNA 1IOZA 3MWJA 2GHIA 2RGNC 3KUDA 1Z28A 3SE0A 2N1BA 4HI0E 2OG2A 3QG1A 2OV2A 3FFAA 1OW3B 1G8FA 1X3SA 3LXXA 1KI2A 1NKTA 4TWZA 1K6MA 4DBLC 1JAIA 2FFHA 2ZRNA 3A1VA 3K0EA 1E9BA 1BO6A 5FTKA 1KDPA 1YU9A 1RJ9A 3RVBA 1E2IA 2QZ4A 2WMNB 3QVUA 5DISB 1LY1A 1ZC4A 3B85A 3EG5A 3AVPA 4OI0A 4RD6A 2HF8A 4BZXA 4WW0A 1A2BA 3T1QA 4QBHA 2RHMA 2JJ2A 1HY3A 2GNOA 3MHVC 5DHAA 1XJCA 1YZLA 4LX0A 4B2IA 5JSZA 2IK8A 4LV6A 3EPLA 3Q7QA 3ZGXA 2IHBA 1G8YA 1XTQA 5AJYA 3U2QA 2FH5B 2NZ8A 4YMTA 2YWHA 5FUXA 1U8YA 1QHHA 3A37A 4LRSA 1QRAA 4UNRA 1E0JA 2BKEA 1P7CA 1E9FA 4PO9A 4IFBA 1N6KA 1XD2A 2D74A 1IAQA 2N42A 1KDTA 1F2TB 3CRMA 4RZXA 4DDVA 3EZ2A 3IKJA 3PFIA 2ZE6A 1JB1A 1R0XA 4JMPA 2JLRA 3AP1A 3AM1A 2VBCA 4MGYR 1QHHB 2OEPA 2VIIA 3B9PA 2BC9A 4JL6A 4DKXA 2ZS7A 4HZIA 4JSTA 3U3JA 4Q1EA 4P0TA 2PZFA 1KO1A 1UDWA 1X1SA 3WBKA 4WZAE 4WZ6A 2CL0X 3QG5A 1IJEA 1NN1A 1II8A 2ZS9A 3H86A 4R98A 5SZKB 2NPFA 2GJ8A 4B32A 4EPYA 1L2TA 3CNNA 2ZRDA 1HTWA 2QU8A 2V6JA 2MMGA 2Z5FA 4GNKA 1OKKD 1A1VA 1R5BA 5JHHB 2NZJA 2QSZA 3EWSA 1XFAA 3K9NA 2WJGA 2BDTA 1QHGA 5A0FA 4A2PA 2HJVA 4QKQA 3FKSA 4JVLA 1ZCBA 1TF2A 4DIEA 1P2VA 2DR3A 1II8B 1XTJA 1RFLA 5EZ6B 3BIFA 1YR8A 2C78A 4TLDA 2B6HA 1R5NA 5DH9A 3VR2A 4KFUA 3W3ZB 1OHHD 3UWKA 3WYFA 1C1YA 2DWOA 4FMCF 4D2IA 5B58C 1SXJC 5EQTA 4BFYA 1P9WA 2V6IA 1ZUIA 1E2GA 3RDPA 4PPFA 2IYLD 2JJ1D 2BM0A 1KYIA 3NG1A 5CYOA 5FPYA 3U7FB 4D80A 1QG4A 4Q66C 3FHTA 3JVUA 6Q21A 2IS6A 1H8HD 3N2EA 1GITA 4ZDJA 4R7ZA 3PEWA 2J0SA 5JLJA 3SYNA 5AJWA 4OHVA 1MABB 3I62A 3AKYA 4LJ8A 2PJZA 4DLXA 5BYKA 1Z0IA 4OKSA 4ASUD 1R7RA 4DVGA 4KBGA 4GITA 2QA5A 2ZI7A 2ZUCA 3L8ZA 2ZIAA 1KI6A 3ZZUA 4D0GA 4G5RA 4NHOA 1EWQA 5KU1A 2C95A 1JEDA 2QE7A 3N70A 1TQDA 4OHXA 1YZUA 3TRFA 4DLVA 5EE5B 4LDJA 4YMWA 5M04A 3TSWA 4DCTA 1T3LA 3U3KA 2P0EA 1OYWA 4V0LA 3GLFA 4WBSA 3FFBA 1E9SA 4XVUA 3ADCA 1VCIA 2NMVA 4M1TA 1VIYA 1KI6B 3KQNA 1J8YF 1NL3A 3MWLA 4GOJA 2OCYC 2ZYTX 1YZTA 2W6ID 5L8VA 1HQCA 2IT1A 2ZJ5A 3EPHA 3OAAD 2ZI4A 4TMVA 1EFCA 1SKYB 4ZI2A 1E9EA 3FKQA 1FUUA 1OFIA 5ANRB 2IS2A 5JJLA 3IPYA 2W0MA 1W4CA 2VP5A 1RRFA 3RSOA 1RYFA 2XGJA 2QEQA 2R6AA 2MMCA 1BYIA 5GJVC 2V7QD 2WIAA 3IIMA 1TU4A 4Z8YA 5LD2C 1JI0A 5CB8A 2A78A 2NO6A 2DZOB 1SULA 4NZYA 5L3SA 4NYJQ 1OFHA 3SU8A 3ETLA 3QXSA 2LKDA 3FWYA 1FMLA 1G3UA 1GL6A 4RCZA 3BB1A 4IOMA 3VR6A 1IXSB 1VIAA 3L0SA 4DWJA 1NNEA 1DBSA 2YHSA 5HE8A 1LS6A 3L0OA 2A9KA 5E7IA 5BN5A 5L3VA 3Q7PA 3AVXA 2Z4SA 5KNCA 4GOKA 4EUNA 2WM9B 4BFZA 1W2GA 1J2JA 1E2KA 1DARA 4Y0AA 1R0ZA 3UMFA 5L3SB 4US1R 4PAQA 2YC2C 2ZS8A 4DLZA 4LV5B 3TE6A 4LJ9A 4C3ZA 3QBTA 1FQJA 1N3BA 2CCKA 4BRUA 3QQ5A 4A8JC 4Q7KA 1TTTA 2HUPA 2OHFA 2V9PA 3QBVA 4E22A 2HT6A 3LRPA 1UBEA 4IOKA 4YLGA 1JALA 2IYWA 5DI9A 3AF3A 2KB0A 2AK2A 3I92A 3W6OA 4H1UA 3I73A 1YR9A 2VA8A 2RGEA 2PZGA 4CIDA 2OBMA 4OBEA 2XITA 1LTQA 1T0JB 1W0KA 2RCNA 5FBWB 2ONJA 5K8LA 1II0A 1MO5A 4RJLA 2ZR0A 1VYTA 3MMPA 4Q9KA 521PA 4BUJA 1TQ2A 1QHNA 2L0XA 1JQJC 3VQTA 1LF5A 4OL0A 1J90A 3GJ8A 3KJEA 2VLIA 4Q02A 3TQFA 3ZVRA 1WXQA 2C99A 1P6XA 5FR2A 4LYFA 4MITA 5KSOA 4I1OA 3C14C 3IILA 3OIWA 4KVAA 2GAOA 1G3IA 1KI3A 4QNRA 1KAOA 2QAGA 1EGAA 4JS0A 2FN4A 5EP3A 4OK3A 1EXMA 4TMWA 1XZQA 4DSNA 4CZ2A 3TK1A 3QUSA 4EPXA 4TTPA 2WWFA 4PPQA 2J3EA 2V1UA 1SVIA 4WOPA 3SZRA 3EASA 2GEUA 2WMOB 3EZ6A 3U6KA 3KQLA 1D2MA 2AFIE 2GZDA 2ZJ2A 3WXMA 4MGIR 3RNLA 1JJ7A 1LW7A 1VHLA 1IY0A 3DM5A 2QAGB 1II9A 1P9NA 1VHTA 4DSTA 2XZLA 1VTKA 2XNDA 1XEFA 1FP6A 1JQLB 4HUQB 3I61A 2CHVA 3DMDA 2IYTA 3THYA 1DVRA 4TT3A 1OB5A 3ICQB 1NN5A 2W00A 3IO5A 4OYHA 4BLRA 4OQLA 4C0AC 1G4AE 3LXRA 3NHBA 3DZ8A 1EWRA 4MRPA 3CRRA 3K0CC 2X2FA 2OSBA 1CJVC 4NCKA 4L4UA 3OEEA 5SZHB 1XXHE 3KJHA 1ZNYA 1R5OA 4TN1A 2VTKA 3THYB 1TNDA 3KTAA 2XZPA 2QMUA 1LNZA 2XSZA 4PAOA 3BWDD 1QHXA 3L43A 5IHPA 1RPZA 1P2SA 2GXSA 3CPHA 4ACAA 3QPWA 5EZ5A 1AS2A 3A4NA 4EPTA 1Q44A 2K5UA 4KSBA 5TARA 2VO1A 3EIHA 4D4KA 3O8BA 4A1FA 1XEWY 2XOKD 4B34A 2G83A 1Z6AA 2Q9AA 2X77A 3LX5A 1W4AA 3KTAB 2VF8A 3E5HA 3GPLA 2VSOA 4K8OA 3ND8A 2ODNA 4DDWA 1G41A 3U7HB 3GLGE 1NBME 3PVSA 1Z07A 3A4MA 3X1YA 4CYMA 3GJ0A 4RKEA 4B6EA 2WPDD 2AFHE 3GJ5A 3BXZA 3SJAA 1FQKA 4Q48A 1MR3F 3IHLA 1IXRC 1E9CA 4MRNA 1PZNA 1TEVA 4MRVA 4N1AA 4PX9A 4V02A 1QHSA 1M7HA 4JLVA 4JYBA 1E0SA 1XTIA 3CWQA 2QTHA 1XMJA 1PUJA 2O8CA 5GVSA 3REGA 5EXPA 3QXCA 5DN6A 5AUOB 4CEHA 2BVNA 5J47A 3OEHD 2QY9A 4PANA 1GOTA 1LV7A 5FTNA 2D4HA 4DCNA 2ZU0C 5FPSA 1KK1A 1R0YA 3Q3JB 5BWMA 1Z63A 3NVAA 3ONWA 4KI0A 4IXMA 3REFA 1VG9B 1QVAA 2ZR9A 5HZHA 1Q3TA 3WHLA 3HPRA 1CS4C 1J99A 1OIXA 1Z6GA 2O8CB 3C4JA 2C2HA 2WSSD 3WMGA 4DLRA 2DYKA 2XX3A 4CEHB 3LA6A 1E6CA 1KI4A 1Z08A 4LI0A 2BMJA 5FFMA 1M2OB 4DLTA 1FZQA 2JGNA 2P67A 4MYHA 2IYVA 1G20E 4Q1AA 5G40A 2Q9BA 2R6CA 5JRJA 4PR0A 4BRWA 1G7TA 3SYKA 3QVVA 4CF7A 4U02A 1KJYA 1HT1E 1ZBDA 2A5JA 1RRGA 4ZPXA 1NJFA 1GILA 2HEIA 2CCJA 1HV8A 4P31A 2CK3A 2QM8A 4Q4JA 4DHEA 5LD2B 3RHFA 1OPXA 4LJ6A 121PA 1S1MA 3UATA 4YONB 5KTYA 3B1YA 1NG1A 1HT2E 4WZBE 3ECCA 1G19A 5AR1A 4EQ6A 1E1RD 4AYTA 1B23P 1TX4B 5CB6A 2NTYC 4IOLA 2OCBA 5HCNA 4D25A 1GRRA 3QIAA 4JVNA 4A8JA 1D2NA 5DNYB 5IDVA 4Z51A 4YXWD 4Q4JB 4DEXA 1FP7A 1C9KA 5JEEA 3GQBA 2WWYA 1U81A 5CLQA 4JIMA 2BOVA 2RHDA 4LCBA 2CDNA 5J4YA 3PENA 2BMDA 3OE7A 2J7KA 4HB4A 4JBWA 3JZMA 3N5CA 4O2RA 4Z1MA 3FGNA 1Z0KA 1AK2A 2XAUA 3C16C 3UMSA 4X8HA 3W34A 2ODWA 5TB5A 3IBGA 4PHTA 4M1YA 2FNAA 3O8RA 4U00A 4QHTA 2YOHA 2ERXA 1UBGA 3MGCA 4UNNA 1E96A 3CRQA 5EP1A 4C7OA 2HXSA 1BYUA 1VYVA 4IDHA 1SVLA 1VCNA 3D8BA 3NBZC 1DS6A 4G5SA 3BAFA 1ANKA 3DDCA 1V43A 4NCIA 5FR1A 3FOZA 2VQSA 4FI3C 2C5LA 4JJKA 3K0AA 3MCAA 2OFOA 2P6UA 2ZRJA 1N6PA 3LH5A 2OT3B 5E4FA 5KNBA 4AG5A 3CWZA 2GESA 4OQMA 2R65A 1NP6A 2EU8A 1DO0A 1VCOA 4QGGA 3A6PC 1DAIA 4RVCA 4OHYA 4C7OB 4QGHA 3IHWA 3GMTA 5HKKA 2G1JA 1MRSA 2J7PA 3H1TA 3M0EA 1XMSA 1M7GA 2FSFA 3BE4A 4PC7A 2BKUA 4FWTA 1T4GA 1KK2A 1G7SA 2W2VA 3K0AB 4HSEA 2F9LA 4MA4A 4RD2A 1YVDA 2SHKA 2Z0MA 1BMFD 2LWIA 2ZYUX 3RWMB 4LYAA 2AXNA 3EZ9A 4M8NE 4QBIA 2C9OA 4FMBB 1KGDA 2WICA 1UF9A 2Z83A 4BZPA 1G6OA 2IYQA 4LHVA 4RY2A 5EXSA 1HA3A 1XJ0A 4M9XA 2H7VA 3W5IA 3QY0A 3VKHA 5IT5A 4LRTA 2RGAA 3L82B 5D3MB 3TUJC 2GA8A 2Q3HA 4MUAA 3P1JA 4TLBA 2F1RA 4OHZA 2W83A 1PLLA 1W48A 4OQFA 3T1VA 1ZUNB 1JNYA 1N5JA 3HDTA 3DPUA 4IJMA 1WMSA 1XP8A 3PCRB 3U5ZB 3B60A 3TVDA 4HB3A 1U98A 1Z8FA 2ZITA 4PC6A 4XIGS 4HAUA 1XBTA 1XF9A 5EP2A 1DAGA 2O8FA 1NI3A 4I1UA 4OI2A 4TYQA 5JBQA 4BLTA 1UKZA 4BPBA 3P26A 3DM9B 1E79D 2FGJA 3C15C 4Z54A 4BLOA 2GAAA 2YOFA 4QHSA 1XDBA 1XXHA 1CF4A 4B3CA 3K09A 4NL4H 2ZVQX 1X6VA 4HDQB 5FL7D 4TL9A 2QPAA 5GJWC 1CP2A 3AVUA 4FMDB 2TMKA 3BBPA 5JRZA 4BEBA 1U99A 4C30A 3AVYA 3R20A 1HURA 2IA5A 2O8FB 1KNQA 4UJ3A 1NN0A 1GNPA 4BLQA 5C4GB 1FFHA 1G8GA 1YRAA 5D3QA 1YJ5A 1I2MA 2QENA 2CLSA 4P32A 5IK2D 1GRNA 1ZM4A 2IYYA 3BERA 3DVLA 2IWRA 2RGXA 3RS0A 1YR6A 3LV8A 3HWSA 3V00A 5HCIA 2C96A 1NY5A 2FFQA 3X1ZA 1E3MA 4PQFA 3GLGA 1NBMA 2IEZA 3LX8A 2EVWX 4HB2A 1CIPA 1MRNA 1E9RA 3O8DA 4DLWA 2DFKB 4V0ME 2ZYWX 3RS4A 3PG5A 2J87A 1JR3E 3NC1C 2GTPA 4NCJA 4YMSA 1OH6A 3K0SA 2HYIC 1Z0DA 4Y0VA 4IKEA 4BFSA 3F8TA 2GXQA 5BYJA 3GLGB 2FG5A 3MFYA 4DSUA 4DC9A 4BZQA 3IQXA 3WHKA 2ZSDA 1OXVA 2VF7A 4PO8A 4F4CA 2H5EA 3LBNA 4LBZA 3VR5A 4P4SA 5KPJA 2YOGA 4BEJA 4AD8A 4LBWA 2FSHA 1FPMA 1VECA 1G5TA 4OQNA 1YZKA 2W2XA 4P3YA 5KDOA 3LLUA 1DAEA 2QN6A 2H18A 3GJ4A 4PSAA 1E99A 2Q0HA 4LJYA 5KDLA 4AI6A 4Z8XA 1COWD 5AUPB 1RW4A 3MSXA 1WBBA 2DHRA 1CJKC 4RD0A 2DWQA 4P4SB 4B43A 2WZQA 3B9QA 4B73A 2PMDA 2VPPA 4QJ3A 4R71A 3C7KA 3RRZA 1EFHA 2ZE7A 2ZI5A 5K8UA 1IM2A 3KB2A 5DYGA 1H65A 4PQRA 2AK3A 4XVRA 3Q9LA 2YJTD 4MDEA 1KJWA 2IYUA 1LF0A 3M1IA 3NC0C 1X37A 3PEUA 4NDZA 2YC4C 2R6GA 3WRXC 3RRNA 2BMFA 1G21E 1RC8A 5CIWA 2ZJAA 2Y8EA 5BW8A 1E32A 2ORIA 4UNQA 1U8ZA 4QOSA 4NBSA 3FMOB 3U60B 1P5ZB 5JMTA 3HYRA 1AS0A 1RZ3A 4PC1A 2PH1A 1H8EA 3K53A 1CRPA 1D9ZA 1IJFA 4JKYA 3T15A 2W6IA 2B7BA 3WYGA 4LYJA 2FEOA 2ZRHA 2ZJBA 4DCUA 1Q57A 2Z4RA 3E70C 1YRBA 3OAAA 4MGZR 1SVMA 1OYYA 2VP6A 3IGFA 1F2TA 1KI7A 2ORVA 2V54A 2IC5A 4PO1A 3AGQA 1W5SA 4AC9A 3K0FB 2EYQA 2A5YB 1SGWA 3CR7A 2GK6A 1WP9A 5E95A 3QKSA 1DO2A 4NYIQ 3ICEA 1HE1C 1I2DA 1UADA 1A5TA 2NPIA 2PT5A 3SS8A 2J9RA 3T12A 1T91A 5FOWA 1Z5ZA 2X19A 3BC1A 2JCSA 4URUR 4HEJA 5J40A 3QJYA 2OCAA 1OSNA 3DOFA 2R62A 3AKEA 2IW3A 3RS5A 3GEIA 4ZV4A 4CGZA 3I3SR 2IXGA 2QAGC 1CTQA 1N6LA 3I4LA 4ZDWA 4GI7A 4D4MA 3GEHA 4B2PA 3GD7A 3QKSB 2WSMA 3IO3A 1ZD1A 2NIPA 3WP0A 4IXNA 4LJ5A 5EXXA 1GG2A 2FJUA 2EYUA 2GZHA 1OV4A 3CZQA 3P32A 4GZLA 3SBDA 2ZM5A 4EDHA 4HLDA 1TEXA 1AM4D 1S3SA 1OE0A 1JEEA 4CEJB 5C18A 1D5CA 2BJWA 1AZSC 2CLCX 4QM6A 3IDQA 2OFXA 2GJSA 3B7GA 2QP3A 5AJXA 5EE0A 4B2LA 5H70A 3AF2A 1GWNA 1T3HA 1CEEA 1TU3A 1L4UA 2O8DB 2ERYA 3EA0A 2QUZA 4C0LA 4AKEA 3R9XA 3A4LA 3KL4A 3QNUA 4B3FX 4FD2A 1E0AA 2FWRA 3SHWA 1KK3A 1GP2A 1MABA 1JPJA 3W6PA 1DE0A 3BB3A 2F3TA 3CH4B 1AS3A 1N2CE 4PPNA 5SZJA 4XWOA 4ZI3A 3KKNA 1GNQA 5DSZA 4X8LA 1E2HA 1TAGA 4A36A 1W36D 3EAQA 2QL6A 1F60A 3ADBA 1NMXA 1M6NA 4OI4A 4TTRA 3AVOA 3B5JA 3KKPA 3KKMA 1GTVA 2OBLA 5GJCA 2CNWA 2GRJA 5HPYB 4JVMA 4XVQA 3GJXC 4UNPA 2BV3A 5HTKA 3AP3A 4FMDF 2JAQA 1J8MF 4ILEA 3X1XA 1SHKA 1DTSA 1KDOA 4Q21A 3T06B 2OO7A 5CITA 1CR1A 1D6JA 3FTQA 1TQ6A 3A1WA 1AKEA 1NSFA 5CJ2A 2MSEB 5FOVA 1T5IA 2UZIR 2Q6TA 2IXEA 1UBCA 2CJWB 1SZPA 1ZNXA 1VPLA 5FTMA 1ZNWA 3ZZ0A 4F93B 1JAHA 1YZQA 3LQQA 4J0QA 2AKYA 2JA1A 3CM0A 3NWJA 1CR0A 2IUTA 4JJZA 2RGDA 3ZQ6A 4FWGA 4TMZA 2HT1A 4IVQA 1ZD9A 5BN4A 5FI0B 4L15A 621PA 3LQRA 4PHFA 4ON9A 3OFND 4N3NA 1FNNA 4CW7A 3CUEF 5C46F 3M6AA 2WWIA 2BBOA 2GF0A 4JLJA 2HXYA 2WWXA 3UG7A 1R6BX 2YYZA 3WP1B 2F7SA 5E7MA 5KSPA 5KDDA 1F6BA 2MSCB 2ZRFA 4QNMA 3T34A 2J0VA 1LFDB 5FBQB 3B1WA 4RZUA 2Q3MA 3TGPA 1RRCA 2GK7A 3JVVA 3IEUA 4V0MA 1N5IA 2H92A 2IXFA 1JR3A 1WE2A 4XD7D 5DHFA 1CR2A 4W5HA 3SDZA 4OK6A 1IY1A 2QT1A 3MWYW 5G41A 2WJYA 3TJZA 3WRYC 3ZH9B 1CJUC 4IDQA 1KY2A 2ZUDA 4KLNA 2ZYVX 4LJ4A 2YZ2A 5FPHA 3F5FA 1LS1A 4M53A 1IQPA 4YMVA 3AVQA 4URXR 3GCGA 4A15A 1G3QA 1Z3IX 3NIBA 2ZSBA 4Q9LA 1W0JA 2ZAOA 2FF7A 5IF9A 1QG2A 2O0KA 1Y3AA 3EARA 2D3WA 1PVOA 2ZRKA 4U5XA 1KI9A 2JASA 3PJRA 2VHQA 4KLZA 3RS3A 2GVZC 1WA5A 5F9HA 2JDIA 4DCVA 1M1YE 2F43A 3CNLA 1K8RA 4F92B 4R9UC 4F4IA 2QAJA 1FX0B 4EAQA 3K70D 2ZI9A 3IQWA 1BH2A 2WJJA 2JIZD 3K8YA 1ZW6A 3W8RA 4QJ5A 3LLMA 3NXSA 3KXLA 4PTLA 5K8TA 3TVTA 3CH5A 3AVVA 2XNSA 4AK9A 3TUIC 3HU3A 2A30A 2F43B 2OXRA 1E0KA 4DJTA 4FW9A 4V0NA 1KOFA 1QVRA 2ZREA 2A5DA 1IXZA 2CCGA 1GRQA 4A3VB 1WCV1 1XCGB 1XTRA 2BEKA 2QPOA 4M22A 3EPJA 3ADDA 1JXMA 1NRJB 1NVUQ 2WOJA 4JT4A 2GJKA 1ELOA 4LWZA 3KXIA 1XD8A 2WHXA 1NVXQ 2QTFA 2ZAMA 2V6ZM 1F2UB 4ZDKA 2PLRA 2FMXA 5UKDA 3QF4A 2PLFA 2WKRA 2JLZA 3SC3A 1FL9A 1G7CA 3H4MA 5DI3B 4HUQA 3GJ7A 2O8EA 1Z2AA 3UK6A 2R8RA 2ZETA 1N25A 4TQUS 2JLYA 4RD4A 5LBIA 3QXXA 3TIFA 1E2FA 2A3RA 1KSFX 4ZO4A 4GZMA 3K9HA 2B8WA 2ECKA 3AV0B 4L9SA 5FPTA 2BHRA 4B76A 5E3HA 4C4PA 221PA 1JXOA 1UKVY 3QF4B 4BWYA 4BE7B 4MKIA 5A5GA 1CJTC 1JECA 3NH6A 2FV8A 4GP7A 3AF4A 2O8EB 4C0JA 2VP2A 3X2SA 2RAPA 1K5DA 3ZIAD 1X8KA 1VG0B 2QGZA 4LHWA 1E9AA 4JLKA 2OE2A 2EFEB 4TMKA 5F98A 3CRW1 4KYIB 3RS7A 2F9MA 1UKEA 4A2QA 1T6NA 4TL8A 2QQ0A 2JLWA 1KO8A 4E07A 1XEXA 2BCJQ 2XTZA 2ZRPA 1P3JA 4NKRA 1HYQA 2GETA 3V4FA 2HV8A 3H0KA 2ZUBA 4P33A 4X8MA 2P3SA 3TW8B 2J1LA 4Q19A 4UXHA 1NVWQ 1XU4A 2DPXA 4KODA 2YINC 2G6BA 3W5JA 4YDHB 2V3CC 1RKBA 1IN8A 3BJIC 2FFBA 1XEXB 1Z0JA 5C2JB 3QSYA 1QHYA 4NU0A 2D2FA 3ZDQA 4EFNA 3LY5A 1GM5A 1GSIA 3G82C 2F1HA 1W44A 1J7KA 2ZE8A 3KUCA 4NONA 4A9AA 4BGDA 1ZJ6A 3GFTA 1E2NA 3NTUA 3T35A 2W6JA 3ZZTA 4W9MC 1AZTA 3MLEA 1T8UA 4HZUA 1KI8A 1DG1G 4I81A 5GJBA 3KZ1E 2HDNB 2WWWA 4TSFA 5JJKA 1Z0AA 3DEFA 3K09C 1QF9A 3D6TB 4LHZA 5TV2A 1CBUA 3HR8A 1QDEA 5ELXA 4B3DA 2ANBA 1E1QA 1U0JA 4AYXA 2ZSAA 1S3GA 1GKIA 2OILA 3TKLA 2P6NA 1E2QA 4HZUB 4V0OA 4TYPA 2DWPA 3QEOA 2IYRA 5CM9C 4PXAA 1OF1A 1P73A 2BBSA 1AA9A 2BWJA 2CL7X 2HLDA 2P2LA 2PL3A 3OF5A 4M9SA 5L3RA 4US2R 1Z6TA 1MO3A 2FDCA 2JLVA 2ZU6A 4XH9B 3PIRA 1ZYUA 5FUWA 1Z6XA 2ZRBA 2F1JA 3EW9A 1E4YA 2LKCA 1WBDA 3FMFA 4DUGA 1DG3A 3A1SA 3NKVA 5LPNA 4LBYA 4Q1CA 2ZR7A 3U6BA 4M0LA 3THWA 4Q7MB 1KO7A 2IL1A 4TYWA 3DOEA 2WTUA 2DWZB 3AH8A 1NVMA 2OUKA 2I4IA 3P4YA 2DFTA 1TL7C 3EC2A 2XZOA 4B33A 2CBZA 2EWVA 4QGFA 4TL7A 1U90A 3SNHA 3OHMA 1NVVR 1XWIA 4W5JA 1W0KD 5KHOC 2QSYA 4A4DA 4GPTA 3CIOA 2I3BA 5J4VA 2W58A 1M34E 3THWB 3R8FA 4LJAA 1NSTA 4C0KA 4RSGA 1G9XA 1TF5A 2QPTA 4I1VA 4ABYA 5SZIA 4FXPA 4A0RA 3B8HA 3BOSA 1MT0A 3QXHA 3BFVA 3HU2A 4O0MA 4KSCA 2RB4A 1UBFA 3BRWD 4MKGA 1S2MA 3OESA 4E03A 3B1XA 1W5TA 4IHQA 4JT2A 2J0QA 4G5GA 3SI7A 3VAAA 5IRCD 1A7JA 4O25A 3MWKA 1KSGA 1N6RA 1UDXA 5EE9A 3J81k 5DGXA 3D31A 3LBHA 5F2EA 1N5LA 2XEXA 2PX0A 3MJHA 4PZLA 5J4LA 1N0VC 1P9RA 1Q0UA 2VHCA 2X8AA 3B82A 3G0HA 4LHXA 3TLXA 4IEIA 3ZD7A 1U9IA 1R4AA 2IYSA 1NMZA 3LVRE 5JS8A 3WNCA 2PJRA 1A82A 1AQUA 1PLKA 3DKPA 1FUKA 4V03A 5KO2A 2C9YA 2NO1A 4N0DA 4RZ2A 4OI1A 5KYKA 3QKTA 1NN3A 1YZGA 5K8IA 5JHGB 1P61B 4TLCA 1XX6A 1WB9A 3PUZA 4R2IA 3TAHA 3ZVNA 4BFUA 4C0SA 3W3AA 4N0EA 3R9IA 5EXTA 1Z2CA 3DHWC 3QKUA 1NVVQ 4MKHA 1ZIPA 1Q1QA 1SXJD 1G5PA 1RE0A 3EZFA 421PA 2XSZD 1R2QA 4L8GA 2WV9A 3AUXA 4GRAA 1N6IA 5AJZA 3CX6A 2G0NA 4RKFA 2G9NA 3AF1A 4C2UA 4AIIA 2GBLC 2JLUA 3RSLA 5CYPA 3OIVA 2VP9A 1COWA 1G6HA 4NCHA 3VX3A 3H84A 4BFXA 2P65A 1Q3HA 4FINA 3I1FA 4JBYA 5D3MA 3BH0A 3U4QA 1XPRA 4A92A 2GCPA 1T3SA 2YWEA 1WRBA 2GJAA 4D6PA 4A6XA 2ZTSA 3AVWA 2X2EA 1DAHA 1FOEB 821PA 3SBEA 1XTKA 3A36A 1U0LA 4DLSA 1DPFA 2BBTA 2KWIA 2OLJA 1HEIA 1ZP6A 2Q9CA 4WIAA 3U4QB 3IPXA 4G5QA 2C9CA 4UXJA 4OHWA 5H68A 1BIFA 2QP9X 2F6RA 2ZRMA 4X8OA 2C77A 3WY9A 5DN6D 3NH9A 3W9YA 1KJZA 4HYYA 3U3MA 4AWXA 3SYLA 4RCYA 1ZM7A 3KB1A 2JEOA 3CX7A 3I72A 1N6NA 5BXQC 2JLXA 5TVKA 2F3RA 1I4TD 4EFMA 3PITA 4JKIA 2GCNA 4LUCA 1CU1A 3I8XA 1Q21A 4GL2A 2QT0A 2CHQA 2E1RA 5EUMA 3A1TA 4FCTA 2V55B 1KHTA 3PUXA 4IVRA 3VKWA 5JJIA 1Q1ZA 3UMRA 4D81A 1MKYA 3BB4A 3TMKA 4BLPA 1T9HA 2REOA 1Q22A 4TYNA 1AJEA 2I1QA 1Q1EA 2XB2A 1M8PA 1N6HA 1P72A 1XCPA 2CK3D 4BECA 2B92A 4ZIRA 5DE3A 5FOUA 1XCMA 1TUIA 3SFVA 2ZRGA 1EG7A 1M74A 2ZJYA 1SVKA 4IOJA 4EIWA 4QXAA 4E5UA 3PEVA 2BBWA 3KKQA 2GF9A 4RZ3A 3AUYA 2ZI6A 1G8HA 3U3RA 5DYIA 4IRUB 2X1VA 3TR5A 4FWHA 1D2EA 5F9FA 1OT3A 1NY6A 4BFVA 3D3QA 2PT7A 4ZIRB 5B2ZA 4TQAA 5B30A 3JZAA 3P4XA 5FBLB 4AKGA 2EFDB 4PZZA 3VKGA 1OKKA 4QBGB 1G5RA 2BJVA 4NMMA 2D06A 3OE7D 1ZINA 4MRSA 4MKFA 4Z1MD 3U7EB 3AQ4A 2FPKA 4H1VA 3A8TA 2XXAB 1CLUA 3B2EA 2FGKA 4B71A 1GUAA 1IN5A 1DAFA 5GVRA 5G3YA 3QF7A 2O0HA 4XWKA 1PJRA 4HLCA 5BN3A 3R9WA 3VTKA 3B6EA 3SFZA 3V9PA 1LB1B 2AXPA 4LC0A 5CLLA 1OHHA 3DZDA 1N5KA 2CL6X 2GZAA 3RS2A 3ZLJA 2QGNA 8OHMA 1N0WA 2QG6A 1MH1A 1ZD8A 2JJ1A 3ASZA 4KFSA 4WAUA 1EX6A 4Q5IA 1H8HA 4NCNA 1ONBA 3AKDA 2R2AA 5AJVB 1GIAA 1KMQA 1F5NA 4G1UC 4RD3A 2QP4A 5KSZA 5KNDA 4JYCA 3RC3A 5B57C 3ZS9A 4D82A 1OXUA 2IUUA 4MYUA 4ASUA 1ZNZA 5CM8B 2H1LA 4PHHA 3ADKA 3QE0A 1W36B 2KBEA 3LW7A 2B21A 5HKKD 1SHZA 1CKEA 4DB2A 2FZLA 4WVFA 1HH4A 3PUYA 4D4LA 4L9WA 2DFNA 2FA9A 1G16A 2PCLA 4KCGA 3GLIE 1SVSA 3UKDA 1NLZA 3B78A 3C8UA 3Q72A 4WXPA 4A82A 1ZCAA 4OJKA 5EUQB 2JATA 3K0FA 2ZRLA 3LAWA 1AN0A 3RRYA 4A2WA 5EJEA 4XSHA 4DXAA 2VL7A 1XTSA 4QBFA 4TQ9A 4EJSA 3K9LA 1IN7A 1U2RA 2FU5C 2QNRA 1ZM3A 2PEYA 3FYHA 2IYXA 3I32A 3Q8XB 5CIQA 1WQ1R 5TXGA 2RH5A 1HE8B 4HDCA 4DIDA 5L3QB 2HCJB 2ZRIA 2DY1A 2O52A 2V1XA 4LRWA 2F55A 4MDFA 4TZ0A 2GKSA 4E09A 5E7JA 5KUTA 3A1UA 4LY6A 5JS7A 3THXA 2G77B 2E87A 4EJSB 4HUTA 1IN4A 2GBLA 3CO5A 2V7QA 4TL6A 4P4UA 2ATVA 4O2LA 3IIKA 5JCPA 2V4ZA 3NDBB 4XD7A 2WJHA 1T0HB 2O0JA 3X1DA 3KDSE 1YKSA 4ZDIA 4CEJA 2DVWB 2NGRA 3BK7A 3L8YA 3O8CA 3THXB 1ETUA 1RJ9B 5FOTA 3OIUA 1T8TA 2OXCA 2AR7A 5HZKA 1AGRA 4LOAA 1KIMA 1HQYE 2J46A 4FCWA 1VG1A 3K9GA 4LSGA 1XPUA 1KO5A 1ZU4A 1G3MA 4NTZA 2NO9A 2O8DA 5TY0A 2RKOA 1G8PA 2FPLA 3ASYA 1Z6YA 4G0NA 4KJZA 1ESMA 3WNBA 2FFAA 4HAXA 4M4SA 4XSGA 4EKDA 1Z22A 5JSZB 3EA5A 1ZAKA 3ZS8A 3DMNA 3I5XA 1E2EA 3ND9A 2ODBA 4YQFA 1KKLA 3EWAA 2QMEA 2VHUA 4R2HA 1E2LA 2IS1A 1ESNA 4JN6A 3PXGA 4DLYA 4DB4A 1KKMA 3MUFA 1IY2A 2JIZA 3SJBA 4B44A 1TUEA 3MD0A 4XWAA 4OK5A 4RFVA 1SXJE 1XD2B 2AL7A 2ZE5A 1NBMD 3C5CA 1DADA 3D7MA 4C9BA 1KK0A 3LD9A 4BFWA 1OXTA 3IBYA 1VKJA 4QM7A 4D0LB 4HLUC 4KAXA 3MJRA 4LHYA 4P4TA 3HU1A 4RD1A 1OXXK 2VEDA 3VR4A 4JLDA 3FDIA 1VCMA 5CJPA 4KFTA 4L16A 4MUBA 4Q7LA 1FW6A 3K70B 1AKYA 4S35A 2EFCB 2Z6VA 4BASA 3AB3A 2G3YA 4DDUA 4Q1DA 1KTVA 3I8SA 1A2KC 1UKYA 2CJWA 1G64A 1T5LA 2VH5R 3FVQA 1GKYA 1S4QA 4GBMA 4PPGA 3KKOA 1NIPA 1CRQA 3GEEA 3SJZA 1E69A 4URZR 1A4RA 1DOAA 4Q4HA 4QHYA 1Z47A 4LV8B 4DSOA 1Q1BA 2G88A 1X86B 3SQWA 2H17A 2BCGY 3WMEA 5JI3E 3UXMA 1MOZA 3ZD6A 1QZXA 2PZEA 1P75A 4OQXA 4XOIA 1W4RA 1TQ4A 4QL3A 1EFRD 1NIJA 2IF0A 2P5TB 3U61B 4NYJR 3B13B 4ZCIA 1N0UA 3TH5A 1RYHA 4Q4HB 1GNRA 4XJXA 4TZ6A 2ZRAA 2O8BA 3TNFA 1XZPA 1K5GA 2VP4A 3QEJA 3ZIAA 4B6FA 1UFQA 3C41J 2GVDC 3SOPA 2OAQ1 5FOXA 4ZKEA 2XTNA 4IDPA 4DLUA 2ZROA 1ZIOA 4YDSA 4AURA 3CRVA 2ONKA 5BQ5A 4HLQB 1Z29A 4Q1BA 4A0FA 2O8BB 1NMYA 1I4DD 2KJQA 1BOFA 3R8CA 1YQTA 3CBQA 4M1KA 4AKIA 4Q03A 3SHFA 1AGPA 3K1JA 2EQBA 1H8ED 5FUYA 1EK0A 2QM7A 5FTJA 2J41A 2JJ8A 3GFOA 1S8FA 4IDNA 2NG1A 4M9QA 1GAJA 1L7VC 2JJ2D 1IHUA 3GLFB 3FMIA 2FZ4A 3DO6A 3Q85A 4DT1A 1NJGA 1L4YA 4CT5A 2XOKA 1SKQA 4PHGA 2O5VA 2UVQA 2CEAA 2QRNA 4LGMA 1R10A 4JLMA 1ZU5A 1OIVA 1W49A 4EPRA 2H16A 4TMXA 4WXRA 1FX0A 5JWHA 3EIEA 1S0UA 1DAKA 4YMUA 1L8QA 1ZM9A 1P2UA 4US0R 3MAAC 3CLVA 3FE2A 3N2IA 1D9XA 2WPDA 4JL8A 4DT1B 5AK0A 4IW3B 1X1RA 1P62B 1KDRA 4MYTA 4DDTA 2WKPA 5FOSA 2DZNB 2D2EA 5FPKA 3CPJB 5J5CA 1UM8A 3VNUA 1RRPA 2ZVPX 2C03A 3EPKA 1XMIA 5P21A 3W6NA 2FEMA 4UNSA 5FBRB 3FB4A 4OJQA 4PC3A 1G291 1YZNA 2RGNA 1OH8A 4KO8A 1OH7A 3HJNA 4M1OA 3OEHA 3VLFB 5CK4A 1OLOA 3TQCA 1NF3A 1CJMA 4AG6A 2ZI3A 1O87A 1FTNA 3VHLB 1F2UA 1W1WA 2XJ4A 4A0HA 3TR0A 4M2LA 5JEDA 1U9IC 2AKAB 2KE5A 3WNDA 3PQCA 4QRHA 2YV5A 3LFUA 1D8TA 5DI3A 2I1VB 2WSSA 2VHJA 1S9HA 2VHTA 1U0HC 3GLIA 1KO4A 4RFSA 2WWGA 4QFMA 4F7WA 2OZEA 2XJ9A 3FKSD 1P2TA 1LVGA 2GCOA 2ZSEA 4GSYA 4I99A 3RLFA 5F3WB 1OIWA 4B3GA 4JLPA 2OM2A 4QG7A 3I5YA 3O47A 1GVNB 3VMFA 4JLOA 3GLHA 2NO0A 2QMOA 2E9SA 4D26A 4FCVA 3RYTC 2CE2X 4FN5A 4II7A 1KSHA 1N6OA 3CF6R 3GLIB 4NP6A 2AWOA 2FX3A 2Q21A 2A7QA 4RFSB 2B8TA 3VU9A 3AJIB 2GCOB 2J0UA 3EXAA 4LBVA 3AP2A 1NLFA 3L0IB 4M9ZA 4PSVA 2NQ2C 4PZYA 4B74A 1E2DA 5JCZA 2CNWD 5DO9A 1E1RA 3GLHB 1F48A 4M1MA 2EWWA 4Q1FA 4Q7JB 5LB2A 4JVSB 2AN9A 1S96A 2QORA 5AWFC 1PLJA 3BH7A 4HAVA 4PSKA 4YXWA 1E2MA 1Q20A 2FE4A 3AEZA 2GXUA 3U3OA 5JWRA 4I1SA 3VU9B 1P4SA 2N46A 1MO4A 2J0UB 1VG8A 3NHAA 1CR4A 2R6FA 2D62A 3MRSA 4C0BA 4MH0R 3KFXA 2QE7D 3SJCA 4BLSA 1E4VA 4HDOB 5J4KA 3EX7C 1Z83A 3CX8A 2BMEA 3VFDA 4HLUA 2HF9A 5CDFE 3V4RA 4IDOA 5EE1A 1NLYA 2OESA 4LJ7A 1JBKA 4QC2A 4EPVA 4B3BA 1VMAA 4TTQA 1ZM2A 3EIQA 2ZXUA 1QHIA 3PV0A 3U7GA 2IF2A 1KNXA 2CVFA 2WVJA 1O3YA 3QI2A 4Q9IA 1G17A 1W47A 3F3YA 3VR1A 1GKUB 1FNMA 2VYFA 2YVUA 1E9DA 2ODEA 3KJIA 2GJ9A 5LB4A 3NBYC 3IIJA 1OJLA 1EFTA 3H2YA 1S9DA 3HR7A 1AIPA 4UJ5A 4LZZA 3IEVA 2DFLA 2IUSA 4UXIA 3BGWA 2REXB 4I4LA 5JZVA 2FPMA 1SXJA 4MQBA 2R9VA 5KOYA 3SEAA 3WYAA 2IBMA 3BS4A 3MG9A 3LNCA 3ZVMA 2NOAA 2PCJA 3TSZA 1YHNA 2R44A 1UEJA 3GFPA 1AQYA 3GJ6A 5HE9A 3FHOA 4B3XA 3T1TA 3RWOA 4AY2A 1JR3D 3IUYA 3LW8A 4NYMR 5TDHA 2AWNA 2GILA 3LO5A 4B48A 1J70A 5JFGA 2WJVA 2FSGA 2C8VA 1SXJB 2UZ3A 5FI1B 4F38A 3PUWA 1BMFA 4NH0A 4Q00A 2QI9C 1Z0FA 1NKSA 1KI1A 1U8AA 3TBKA 1DAMA 2QTVB 1W0JD 3VHXA 2HYDA 3T1OA 3AGPA 2V8OA 1B0UA 4C2TA 1QZMA 1GZSA 2C04A 2IHYA 2J45A 1KZ7B 1NG9A 4TYYA 4Q18A 3AF0A 1BS1A 2JDID 1U94A 2P5SA 4URVR 2DCUA 5AUNB 3B1VA 4GDFA 5A4JA 3QKRA 1ZUHA 3QPUA 2ZJOA 1SVWA 1M7BA 1ZVQA 5H8WA 2VRWA 3UPUA 1KSJA 2A5FA 2GXAA 2QQEA 2XB4A 4BFTA 5LDDC 4QJ4A 3NBFA 4KU4A 1IONA 1C1KA 4PFSA 3T5GA 4W5WA 2RMKA 2ZRCA 3QKRB 2KBFA 1E2PA 3F0TA 4HB0A 1JJVA 5B64A 2BM1A 2ZQ5A 4F91B 4U7DA 1E79A 4A6PA 3LBIA 4FIDA 4LYHA 3RANA 2YWGA 1W2HA 3OIYA 4PQYA 4CDGA 3HP1A 4LPSA 2A5GA 3C5HA 3DL0A 4NYMQ 4TMTA 4ZKDA 2FSIA 2JLSA 5FL7A 4CRWB 3FMPB 2PX3A 5H1YA 1W36C 1GDDA 2P6RA 2R6DA 4LC1A 1US8A 3PR1A 4UKDA 1G18A 4Q9JA 4ZCLA 4B35A 2QMHA 1PUIA 2H57A 4QGAA 4Q4AA 2CE7A 1DELA 1MO6A 4EPWA 4M1WA 5IK2A 5JECA 1EESA 5FH9A 3KJGA 3NBXX 2HJGA 2OCPA 4V0KA 4K46A 2G1KA 4KVGA 3THOA 3UG6A 1F3OA 4DEYA 1X8JA 4FWDA 3CZPA 4K81B 3TSOA 1BKDR 2ZJZA 1US8B 2XNDD 2AD5A 4YC7A 2VSFA 1IBRA 5G53C 3VR3A 4ESHA 5JI2E 4ARZA 1ZC3A 1CXZA 4Q4AB 3KXKA 2KRKA 3CONA 4TT3D 3CW2A 3G5UA 4KITB 2OAP1 4NPHA 3T5DA 3SR0A 3EC1A 4EQ6B 5HR5A 3KW6A 3FPAA 4EJSC 3KQUA 2PBRA 2LCFA 4A8JB 3BFXA 3OEED 3QOFA 4ARZB 1TF7A 4G5OA 4F4JA 4ZCMA 3FHCB 2IEYA 4XTRA 4B47A 4HAZA 2XTMA 4LPKA 2IX3A 2G0TA 4KV9A 4POAA 2QRZA 4GMXA 3R7WA 3CKLA 2PMKA 3LVQE 2WKQA 4TLEA 4C0HA 3KQHA 1WDTA 1EFUA 1GL9B 4LK2A 4HAWA 5FUVA 2D7CA 1UAAA 2F1IA 3BORA 1W4BA 3LDAA 3GJ3A 4TLAA 4Q9HA 5KPDA 2ANCA 1TMKA 1CULC 3R7WB 3ZJYA 1FMJA 3TW4A 4ERNA 2W6JD 2WIBA 3CB4A 4KHZA 3CF2A 5TMPA 3CR8A 3QPVA 4TSFD 4IEEA 1XD9A 1VDZA 3HYTA 1V5WA 2KSQA 3S1AA 4M1SA 5G3ZA 3RC8A 2EW1A 4GP6A 2WAXA 2IWHA 3U44A 4A0GA 2B7CA 1E1QD 2EFGA 3QXJA 1G3RA 2W2TA 2ZPTX 2BIFA 1KZGB 2CVHA 4PAMA 4JZKA 1ZRHA 5J4HA 4JLAA 2ZJ8A 4AKHA 4URWR 2CLDX 3B1ZA 4G01B 1GL7A 5C4MA 3CF0A 2H8KA 1KAGA 2AHOA 2HLDD 2VP0A 4W7SA 2FOLA 3SN6A 3K0CA 3S1AB 3VNVA 3K70C 3UIEA 3E1SA 4GFDA
chains in the Genus database with same CATH superfamily
2XDYA 721PA 4L2IB 4OXXA 2IYZA 3GVIA 1WUJS 3Q5DA 1W7AA 1TU0A 2YL2A 2PLNA 3G2HA 4IRMA 4H3SA 3NDPA 3M5WA 3V1NA 1LJ8A 3DFIA 3EGWA 5AUQA 4BNMA 1E8MA 1K3UB 4ZALA 3NUGA 4H1WA 3LWNA 2PEZA 1JMYA 2OXIA 3L40A 1P6QA 3C1TA 1Z06A 3QE4A 5TR9A 3R3JA 3VX4A 4JGGA 3H97A 3SASA 1FTSA 2IDZA 2CXXA 1RWQA 1IBMB 3UKJA 1JR6A 2VDOB 4B4KA 1RQ7A 3VR5H 1T3ZA 2QKYA 4Y9RA 3A58B 4U2FA 4IINA 4NOKA 5HQTA 1PG5A 2QD2A 4DBLE 2KM1A 4KIFA 4CT4B 4RKQA 3TM5A 3KCNA 3LVWA 1EFRA 2EJBA 2J85A 3VH1A 3ZCTA 2WUEA 4KYUA 4IBJA 2FSSA 4JH0A 2RHWA 1TVKA 2WINI 1N5DA 3PDWA 4S0ZA 4IIYA 3O0DA 4KR0A 1CV2A 3FFAA 3KKZA 3QLTA 2VJCA 1BJTA 1PRBA 3H5LA 1YU9A 3PDHA 4B46A 4Y28F 2L6OA 4DUZB 3I58A 4HNAB 1T9GS 1P4GA 4QOHA 2D2XA 1G8YA 1XTQA 2QLJA 3HA7A 4TWBA 2RCYA 2YWHA 4B3JA 5BQ3A 5F7OA 3EFOB 3WYCA 4GKJM 3MK31 1N6KA 1TQHA 4N6NA 3CTPA 3PFIA 4M37A 4I1PA 4DA8A 2IW1A 3U3JA 4PDIA 4LZOA 4EO7A 1X1SA 3HO6A 3RGPA 4RHYA 1II8A 2ZS9A 2JIOA 3HB9A 5A7HA 3HHWA 2ZRDA 1RQNA 1JR2A 2P5TA 3TL2A 3ZXUB 3V8QA 5SYNA 2HHJA 5FWNA 2BM0A 3HGQA 3MYRA 4Q66C 1H8HD 3OTOB 3FYDA 4OKSA 5JXGA 3IH5A 2ZI7A 3PU6A 1X80B 2QRQA 4WESA 1EWQA 3QMWA 4LDNA 2GN0A 4AFNA 5CVDA 3W2EA 4YMHA 1V5EA 2YVQA 5HJ5A 2JVKA 3EGCA 5EIWA 2LVNC 2I8AA 4TMVA 1NVAA 1QRUA 2W0MA 1W4CA 1WIVA 4XSVA 1TMGE 2RI1A 2QEQA 2P3OA 2ZYAA 2BHLA 2GLXA 1VPVA 2JVJA 2V7PA 2Z6AA 4MYDA 1IXSB 4YJGA 1UMCA 3AVXA 1O0SA 3KE8A 4DQLA 1R0ZA 3ENKA 1S2OA 3A3OA 4D4HA 4DLZA 1E4EB 1M0WA 5CCEA 7ADHA 2OHFA 3B20A 2AK2A 4R9SA 3R0JA 3Q8MA 2VCHA 4YAWA 4TTSA 1G0OA 2VA8A 3LA8A 5BYAA 3H2JA 4XX1A 4DMHA 2UZ4A 1II0A 4CN9A 3H8JA 1GEEA 3OOJA 4BE4A 2Y0BA 1PFVA 5CA0A 3GRVA 5AW0A 4GMGA 3ZV3A 5DYTA 4PPQA 3VV2A 3LSTA 3JSAA 3WXMA 4MGIR 1TM7E 5JO0A 3LKZA 2ZUUA 4TLLB 3GA5A 5A6SB 1FDSA 3QNWA 3F96A 1RBYA 5KVAA 4UAUA 4WCDA 1ZQ9A 1J9EA 2H00A 3N87A 4L73A 1TNDA 2VSYA 4PAOA 1ZXLA 4MX8A 3I2GA 1TM5E 4U5QA 5KBYA 1SY7A 3EIHA 2BMAA 1R37A 3Q10A 5JANA 2D00A 1Z7EA 4BE9A 3GPLA 2D0OB 4ZZ0A 3EFHA 2VUHB 1YDGA 3U7HB 3KSUA 4LFCM 4C6TB 2OZLA 2AFHE 2NUPA 3LCCA 1M7HA 1L4BA 5GVSA 3QXCA 2PWYA 4CEHA 3CVXA 5CT5A 3STUA 3IELA 3LJKA 5TRTA 4KI0A 1K5PA 1JILA 2P7IA 2C2HA 2J3HA 4XQ9A 1THTA 4FR0A 3AY0A 4GI1A 5JRJA 4PR0A 3TQIA 3QJGA 4QUJA 2W90A 1B0ZA 1AV7A 3O8QA 2QQ5A 4XCVA 4AYTA 2XZTA 3RGWS 2OCBA 1D2NA 3RGSA 1K06A 2EF0A 2C4WA 3LGSA 4LFBM 1GJTA 4LCBA 3G2NA 5F9MA 2AQ8A 4QECA 3B70A 2WHYA 1NXPA 1KVRA 3TG2A 13PKA 4M1YA 4MS1B 3DO8A 5ALJA 5KC8A 1PYOA 5AICA 3CUVA 2Z4TA 1GRCA 3BAFA 1ANKA 1VJ0A 4YT4A 4CMIA 4DLNA 3DW1X 2R65A 1T5SA 2DHQA 1FJGM 1YA4A 5HKKA 3BGDA 1PV2A 2W2VA 3SXPA 3IKMB 4ISCA 3KELA 4UDYX 1Q7BA 1P44A 1DWQA 1SU8A 3U5ZA 3NHKA 1K8YB 5EXSA 3W5IA 2Q3HA 4MUAA 2W83A 3RUDA 1L8LA 3LC1O 1K9VF 1Y8RB 3DVQX 5EKSA 3U09A 5KTTA 4X5OA 4PC6A 2FEWB 1DRVA 3PC8A 4IUDS 4BX8A 2CXRA 4QICA 1DGHA 4R40A 1SCJA 5JPDA 3GRFA 4Z0TA 2HKIA 2YOFA 5K20A 3E5MA 4BS9A 2EKFA 1LJLA 4C30A 1LWNA 3WWCA 4JB3A 5IK2D 1TIPA 1XQ9A 3RS0A 1WV0A 2FXIA 3TOCA 3EVNA 1QOQB 3NP7A 4EG4A 4EKGA 5ETJA 4BFSA 4EX7A 1KJJA 1PD1A 3VJRA 4KMOA 4AJNA 4F4CA 4R4JA 5K99A 1ACLA 3K6KA 4DJDC 3Q3EA 1IAVA 1RW4A 2GN9A 2ONZA 4B43A 2VPPA 2B2NA 4MR9A 1COZA 3LRTA 3H75A 4AN4A 2YVAA 3D4BA 1GCGA 1TJNA 2FSVC 4LMPA 1W75A 3FZQA 1V33A 2GH1A 4LFAM 1ILEA 3TSYA 3RUHA 2FZGA 3LT1A 1Z5ZA 1XTPA 2JFWA 3OU2A 4L78A 1V8BA 3P8ZA 3GRUA 4CG3A 1KU0A 4ZDWA 3S27A 3UY4A 3WB1A 5BQXA 3TFWA 1A9PA 2OFFA 2NSLA 1YE3A 4WKOA 2V9CA 1NU6A 2OXTA 4ZAGA 5C18A 3I5AA 1H1LB 7REQB 2ZSJA 1TJYA 5ALEA 3EA0A 4C0LA 2HMYB 1I1QB 4HEA1 4OHOA 4OB8A 5AJTA 4EBBA 1N2CE 3EAQA 2XA1A 1T2VA 1F8YA 3MUOA 4RGYA 2A67A 4Z99A 5HPYB 4UNPA 5CVCA 3NASA 1KFBB 1PIWA 2Z9BA 1ZMWA 3IVCA 1UXJA 3A1WA 3IAM1 1DBVO 3T3IA 4CL3A 2CXHA 1FLDA 3NWJA 4KE9A 4M9RA 4BO7A 1U3VA 2WYUA 5I9BA 3K30A 5J2TF 1I2CA 4DV5M 2WSFF 5TE9A 1H0KA 1Q6YA 1LFDB 1Z26A 1ISJA 4DNXA 4HRVA 1RRCA 2PGIA 1C30B 2H92A 3V7UA 3MWYW 5EJ7A 1J24A 5JMOA 4KLNA 1DIHA 1A76A 3S7ZA 3ZTWA 1WEHA 4HVAA 4BNXA 1C5KA 2CD9A 3Q3IA 4KEAA 1C4WA 4XWYA 1UFZA 3AR8A 5F9HA 2VJMB 4M0EA 1QZZA 4WPGA 2ZI9A 3IQWA 2O0MA 4PTLA 3CH5A 2PANA 2A30A 2EUCA 2IIPA 5M2QA 2FPPA 3BDAA 1ZV1A 2BEKA 4J8PA 3EPJA 4DV1B 4QBKA 3DV0A 3I30X 5UKDA 3O03A 3AY3A 3W8EA 2PL5A 4F2DA 1Y48E 2WTEA 4PGGA 1VM6A 4UE2A 3N58A 2O1XA 1I1HA 2W70A 3TIFA 4DIFA 2GN8A 1FTWA 1K75A 4B84A 4U7GA 4LN1A 2HWJA 3J80S 4OBXA 4PN3A 2IPOA 5HGJA 1PEYA 4ZI7B 2EF1A 3IB3A 2YMMA 4E07A 5IUKC 1U7HA 2VT2A 5DTRA 1NRIA 1YRHA 2UZ1B 3NBUA 5B12A 4MGYE 2WE8A 4S1TA 4P17A 1EVYA 2E4WA 1SUFA 1RP1A 4QYTA 3ZHOA 3F6CA 2W6JA 3L79A 3A9CA 4HZUA 3TQSA 3NYWA 1OX4B 3SC4A 1C3XA 2YYYA 2REQA 4MNTA 1R50A 2HLDA 1PWHA 2PL3A 5L3RA 4Z3KA 4ZEVA 2B4RO 4FN4A 2Q5IA 4S04A 2UV8A 2DRIA 4MWOA 1YA8A 3U6BA 4FQ7A 4EYKA 4DV3M 2IL1A 1L4NA 4M49A 1ZS9A 3AH8A 3EUFA 2EWVA 3P2OA 3G88A 3SNHA 3OHMA 3R7AA 2C3YA 2J07A 2A94A 1VPWA 5JNLA 3HU2A 4QUHA 1H94A 3OESA 1IB6A 3B1XA 1WCIA 1PL7A 1TM2A 2NT4A 3F47A 3AFHA 1A82A 1PLKA 4FMPA 3A06A 4QUDA 4UCXA 4OI1A 1DFIA 2YJ5A 3E3AA 3HU5A 4R2IA 4FHEA 2Q7DA 1GDHA 2AMLA 3EZFA 2WY2D 5T57A 1R2QA 2NUBA 3LECA 3SIXA 3CX6A 5HJEA 2I54A 3VC1A 4RK5A 1COWA 1VCHA 2Y1CA 1BEUB 3AERB 3VBCA 5D01A 5IFLA 1K4MA 5HVNA 2I2WA 3CLKA 2Y0TA 1FXWA 4UXJA 4JEHA 2F6RA 2PUGA 4IIUA 2IZZA 2UZ0A 5EGSA 3KB1A 4ZAVA 3PKIA 3KOWA 5K0JA 3GLTA 2QT0A 1L2DA 2P4SA 1FLAA 2PD6A 3TMKA 4HX5A 3MMNA 2OSVA 2DEUA 4GQAA 1FBTA 3ROTA 2ZI6A 1QP4A 4FWHA 3QVGB 4M55A 5B30A 4IIJF 3P4XA 4Z1MD 4HC4A 3A8TA 1IN5A 1OGYA 1BRTA 1OHHA 1YUMA 1N0WA 1ESZA 2E4ZA 2R8OA 3D59A 3ZDFA 5EJ5A 2XDWA 1JDTA 4JYCA 1OROA 3AI2A 4PNPA 1YJ8A 2A3NA 4PHHA 1OYOA 4B85A 3ZIDA 3VOBA 4U3JB 2E49A 4H7JA 4A82A 1IUPA 3D4PA 2Z5GA 1DKPA 1M0EA 2FU5C 2HSZA 4LGVA 4DIDA 4URFA 1RDFA 3IEPA 1Z68A 1CRZA 1I13A 5HIKA 3IIKA 2NTEA 4DLBA 3DSRA 3X1DA 4ZDIA 5T8KC 5EZYA 2HBRA 4L0MA 2JNWA 1SPBS 3L4EA 3V34A 1UR5A 5BNTA 3ELDA 2PXCA 1R8XA 1ZAKA 3IAS6 3RRJA 1FVFA 5CMLA 2M5ZA 2I7CA 1C8VB 1SU4A 1ESNA 2VK2A 2JGIA 3SJBA 4RNAA 4OK5A 5ESRA 4RV9A 3WYEA 3W5CA 1VKJA 1OX6A 4D0LB 1UBKS 2VT7A 1CT9A 4G0PA 1TVCA 1Q3KA 1G64A 3SJZA 3JQFA 1P7YA 1ABBA 1A4RA 1GZ3A 4LV8B 2PY6A 2BCGY 1PR5A 1MAVA 4M87A 4EELA 1AC5A 3TBFA 1G55A 3MJEA 5E6SA 2O57A 3LHKA 2FEAA 4LY0A 1RYHA 4TZ6A 2HNAA 2Y6UA 4FOPA 1GXSA 2SKCA 3UMCA 2QNBA 3SQOA 3AOGA 5JRDS 1U4OA 3L49A 2W11A 3O7WA 1OMOA 4YRBA 4O2AB 1BOFA 1KVQA 1YQTA 3BHJA 1ZIYA 1H9BA 2QSUA 3V1YA 4ZQFA 3JD4A 1L9XA 2ZYGA 1ISGA 1W35A 4PX2A 2QVZX 2PSJA 5JD3A 3GLUA 2CMFA 1ZD5A 1Q0SA 5FIUA 1W49A 1JDJA 3AV3A 1DAKA 4US0R 3BDIA 2IOQA 4UBNA 1JE0A 4MAFA 4MQ4A 1NTRA 1IHPA 1LJUA 4TWRA 1W88B 2YIMA 3UTCA 3FB4A 3PDJA 2Z8ZA 2BEUA 1YIAA 1KEUA 1S3IA 4D98A 3R5XA 4J1TC 3W0LB 2Y68A 2YV5A 4IBFA 4R54A 4TM8A 3FVWA 3GT4A 2CFSA 4FZRA 3BWYA 4KG7A 4MZDA 4OL9A 4FCVA 3AI7A 4WN9A 5LJIA 1E59A 3IXQA 3U9LA 3AJIB 4P5DA 2VNHA 3L0IB 4BJ6A 1AZLA 4DANA 1CUXA 5JY6A 3KQSA 2WHQA 4HAVA 2FE4A 3AEZA 3U3OA 3M2TA 2J0UB 3G8YA 3TPFA 2Q9UA 1E4VA 4BJ1A 2OESA 1YBMA 4C76A 4EPVA 1N7HA 1YKGA 3MTDA 4OHUA 1CY0A 5E6UA 3IAUA 2XCUA 1V1JA 2XHZA 5J5AA 3DDZX 4MHTA 2FR1A 4UJ5A 3I51A 4MMYB 1WAMA 2R9VA 3RWOA 4CPDA 1O94D 5TDHA 1WPRA 2B9VA 3HEBA 3JYOA 5A3SA 2X3YA 3E22B 3PUWA 4Q00A 3KZKA 1KI1A 1DAMA 4F04A 5HXAA 4FNGA 3DJYA 3CJTA 2R66A 1KZ7B 2I4RA 2DCUA 4QYSA 5A4JA 1H0SA 2OBFA 1ZVQA 1ZGJA 4YAFA 1NI4A 1VJ1A 1PDWA 4FYYA 5DV9A 5E0KB 4GIPA 2DQSA 4I9NA 3Q6MA 4HAIA 4NXMB 2VCEA 4M8SA 2HQBA 3HDJA 1ULUA 4TGLA 3WGHA 1D7OA 1TVEA 4EPWA 2GKOA 3S2IA 1X7YB 3A25A 3MMSA 3C8ZA 3HL0A 2MHCA 1ZGAA 1US8B 2XNDD 3EIXA 4XBOA 3VC3A 1XVTA 5A0VA 1HG1A 3NLLA 1KJ8A 4IYJA 4U2GA 3VAYA 1D0MA 1ZVKA 2FPUA 4QLOA 1A9TA 2LCFA 2D5BA 5KPRA 1Z9BA 3KOYA 3GQBB 1TAUA 4KV9A 3HYSA 1DSSG 2F00A 2J48A 2VSQA 4RK7A 4QARA 3OFVA 2XUPA 3PIDA 1X7DA 4DPKA 3CB4A 1EFUB 3RR2A 3UHJA 3A28A 5HJ2A 1PJ3A 2WAXA 4JEUA 1SZCA 1KFVA 1W85B 1X15A 4JZKA 3L0BA 1CHDA 2CLDX 4EFDA 1GL7A 1YL6A 3L7AA 3M89A 3SN6A 4OMFG 4HTFB 5AW8A 2WMYA 2ZT7A 3TLEA 1NU8A 4M0KA 1FS4A 3EHEA 1R8JA 3U7QB 3EF1A 1Z18A 1KDYA 1R9MA 1EDOA 2VC2B 5TQ0A 5BNFA 5EPEA 3PFFA 3U6CA 2WOOA 3V3TA 5ENVA 2G9QA 3ILKA 3E9ZA 5I9TA 4R51A 4BMXA 1T6OA 3M1AA 3I2HA 4LI3X 1TUBB 3U6PA 2V5AA 3VZSA 1JVSA 2NU8A 4AP9A 3ITDA 5EHZA 2HADA 2VNKA 4HVCA 1W30A 1CVRA 1TPZA 3HXMA 3CH6A 1W0CA 3UAVA 4I19A 2BGGA 1MV5A 2ZIVB 3U6LA 3EZLA 4BNIA 3SJUA 3R6TA 3C6BA 1OB2A 1R8QA 1N9ZA 4KBFA 1TRHA 3R5FA 5FULA 4OKNA 4W1PA 2XBLA 4ZU6X 3NZEA 1KVSA 1E1MA 5IT9A 1IPFA 4O0LA 2WIDA 3O1JC 3H8SA 2HWYA 3NCHA 5EP4A 4TKUB 1TTQB 4P53A 1UH5A 1ST2A 4WFJA 2H65A 4LVOA 1RWWA 4F1WA 2FP3A 1E9BA 5F1OA 1PJAA 3L9XA 1J42A 3L05A 2HF8A 3KQYA 3T1QA 3QTBA 3MHVC 5E4JA 4GE3A 4B2IA 4KRFA 3FCUB 4Z9XA 2FH5B 2X40A 5FUXA 1QRAA 1P7CA 3P9NA 4FHGA 4IFBA 2D74A 1IAQA 3S44A 2N42A 4KO4S 2A0XA 3EZ2A 1JB1A 2FUG1 2JLRA 1KYWA 1NW7A 4CUKA 4P0TA 4GKAA 4ABTA 2YJ4A 3RKRA 2BLLA 4J0CA 1L2TA 3OZGA 4GE0A 4CMAA 2QSZA 3M3DA 3K9NA 2O1SA 3CY6A 4B83A 4I4NA 2HN9A 3HCNA 3LHFA 1XQ6A 4G1FA 3UWKA 4FMCF 1XTVA 2W7TA 3F6EX 4PGAA 2IYLD 3U7FB 5FPYA 1B76A 5ICCA 3SYNA 1EFPB 5ERYA 4C7KA 5EJCA 2C2GA 1Z0IA 5JJBA 4ZCQA 2YQ4A 5LZ5A 2H29A 4OAPA 2QE7A 4XI9A 3WK4A 3UOWA 3GLFA 3ENZA 2XF8A 5LL6P 1X2EA 3ZWKA 4KDCA 2B83A 4GOJA 4CKWA 2EARA 2Q4DA 4Z0NA 4HK4A 1VBFA 3NV9A 3RYIB 2PYIA 2VP5A 1L2BA 5GJVC 2DCMA 3VR6H 1YKFA 2QYOA 1OFHA 1GL6A 3KYJB 2ZSHA 2W4IA 1F8XA 1FE8A 3CISA 1ABEA 4DR7B 2JBAB 3ZWPA 1RYDA 1UJ4A 3V6LA 1H2BA 1FQJA 2JI9A 1N3BA 1C1XA 3G49A 3PXAA 4DV2M 4E22A 4IOKA 4WUVA 3UV6A 4H1UA 2H9AA 2PZGA 2FH0A 1N34M 5FBWB 2ZJ1A 4MGEA 3T7EA 2ZR0A 4EVIA 4ECAA 4FKMA 1X1BA 1J90A 2B25A 4QFCA 1SC4A 4JI4M 4L8VA 5KSOA 5E6JA 2BDEA 1TB4A 1Z56C 5EP3A 2AUMA 2JD1A 4OK3A 5JMPA 3E46A 1ZMVA 1E63A 5JZSA 1LW7A 3JAMA 4A2CA 2ZWMA 4YJ2B 4Z6YA 1DVRA 2YW2A 4IX9A 4R1MA 4OQLA 2JI4A 2XW6A 3L07A 3LXRA 3ZGOA 3W2HA 4MRPA 4UOEA 2CT8A 5I51A 2H48A 3CZ4A 3BXXA 4D96A 1KYZA 2CGEA 2F3QA 1PT6A 4C6SA 1VEJA 5A9RA 4ZT6A 3MUNA 3K2LA 5BRNA 3U19A 2ZWOA 3KQPA 5L7TA 3GLQA 1QH8A 4B34A 3H3JA 2VSOA 2PS9A 2EJTA 5AHOA 3A4MA 3T6PA 2J9ZB 3K05A 1ZK0A 4NC6A 4MRNA 3GCZA 3LY8A 4I3GA 1Y1QA 1QTIA 1F8UA 2YJ6A 4AROA 1WTAA 4MWEA 4QOGA 2XZDA 5L9AA 1W59A 3Q3JB 1XCJA 1D1SA 4Y9UA 2WF5A 5CHEA 4ZQIA 4G8BA 2IQIA 4CF7A 4JLSA 2JGDB 1KRHA 1HV8A 1VEGA 2XWJI 3ANXA 3FZEA 1OPXA 3GAAA 4REMA 1NG1A 4K1LA 1B23P 2P11A 2AJ8A 1NUAA 1LBQA 2I6XA 2QHOB 4LISA 4PLGA 1FP7A 3PHLA 2CVQA 3WL4A 3JZMA 1RHQA 3FGNA 3P2JA 3KJZA 4YRRA 3KWMA 1BG6A 5K0GA 4DJAA 5EP1A 4IDHA 3NBZC 2JBHA 3L1IA 4L07A 3NNSA 3CWZA 2GESA 5JV5A 1PL8A 4JXXA 2VRBA 1OASA 2G1JA 1T4GA 4GVPA 1KK2A 3FLAA 3PF8A 4RMGA 2NTNA 3DEJA 2Z0MA 1BMFD 4CIAA 2AXNA 1JU9A 4GUAA 4UTRA 2WICA 1BCSB 4NK5A 1KAMA 3TOXA 3VKHA 2PQ0A 2EZUA 4MCHA 2AFIA 3W04A 3SWWA 2ZXEA 3LT0A 1NJ5A 4H4DA 4IYRA 4O8CA 1TGUA 2Z5LA 1F0KA 3SD7A 3VSCA 1Y7TA 1UKZA 5HTOA 4YBZA 2D5CA 4GWGA 3ZE2B 5BSVA 4PFQA 4IMPA 2HI0A 2EGUA 1MV8A 4TX1A 4BB5A 5ALGA 4UHKA 1P29A 4BLVA 1YJ5A 4KK3A 4E1BA 3KALA 1A4UA 3K8OE 3KQVA 4GI5A 4E7OA 4JI0M 1H66A 1L7OA 3W8FA 1T34A 3F5DA 3H4IA 4D57A 3B6JA 3KG2A 2GXQA 1YD7A 5BYJA 4CM3A 2PKWA 5EFZA 3K73O 3FX2A 3NOVA 2YOGA 2V03A 1HORA 8CATA 5CDTA 4S1NA 2A9RA 3WIOA 4JI8M 5ALWA 4LG1A 4RNDB 1HL3A 5HJ7A 4ZZ2A 1VYHA 4WWHA 5IT4A 1D6SA 1ULAA 5KVCA 2QN7A 1YDEA 4I5FA 1PG0A 4NBSA 3FMOB 3HCRA 5JS2A 4EK9A 2VK4A 2EP7A 4YDRA 3ZQKA 4DCUA 2NNLD 3V9AA 3I4VA 1F2TA 3U7JA 1DBWA 4R6XA 4DCMA 3CR7A 4Q0MA 2GK6A 1U8XX 1POWA 1A5TA 4DY6A 2J9RA 3T12A 1T8PA 3EDOA 1PZHA 4DLAA 2Z56A 3QJYA 2O2GA 1F0PA 2Q41A 4A8PA 1GG2A 2DWUA 3MJFA 4Z9BA 5EMLA 1ZN8A 5LQDA 2BJWA 2CLCX 4YJFA 5IAJA 3BA6A 4XXHA 4KO2S 3R9XA 1J20A 1M2VB 3PLNA 3UJ8A 4EYSA 1GNQA 2R1TA 3L18A 1U3CA 2IHZA 4LNUB 2WZCA 3HBAA 3B5JA 3KKPA 1GTVA 2CNWA 1F14A 4EITA 5D5PA 3T06B 5CITA 4WUTA 1XRSB 3FTQA 3LT5A 3NHRA 4FUTA 4S1PA 4PN7A 4X63A 2BFDB 5FTMA 3ZZ0A 1I94B 5ALPA 2NXCA 4YMIA 3RTCA 2FETA 3FGOA 1GPKA 3HFRA 2JA1A 3H9JA 5EJMA 2HL7A 4TMZA 4L15A 1OQAA 1Q95A 2R8XA 3OFND 4D79A 1IYZA 1AUVA 4NJEB 2G7ZA 2WWIA 2HXYA 2WWXA 2VOEA 3GMIA 5G0TA 5E7MA 2X9VA 1X7HA 2X13A 3T34A 4QNMA 1FLVA 4CKCB 3IAS1 2VAXA 1N5IA 1JL3A 1ZLYA 3WOHA 3I42A 3E9YA 2H4WA 2CMDA 4AZSA 1QG2A 2Y99A 4PCZA 2Z5VA 3RS3A 1ZOSA 5HF9A 3Q3VA 1GHTA 1ORDA 4F4IA 5LXTA 1Q7GA 1UBLS 4I55B 4QJ5A 3KPWA 1QK4A 5I7WA 4G4SP 2CRUA 1H2ZA 4KZPA 2IY8A 4X24A 5FLEX 1IXZA 4N7BA 2CJPA 3P9KA 1XD8A 2QTFA 2CNLA 2V6ZM 4ZDKA 3T4EA 3FTFA 1L5KA 4AMYA 2WKRA 1VP3A 1N2IA 3VR2D 1LI5A 1FDRA 4RDCA 1N25A 3KFUG 1KSFX 2GPNA 4R1SA 3AV0B 3ONDA 2CLEB 2X4DA 4EW3A 3FFWA 4FB5A 3AL2A 4M60A 2J3MA 4XZ3A 2EFEB 3KOWE 3CEAA 4E7PA 2BE7A 2AXQA 1NJ6A 1T24A 2WTBA 1TIBA 4P33A 4RH1A 4UXHA 4WKPA 2QR2A 3ABSB 4EHJA 4QRIA 4H77A 5IJ0B 1UWCA 2JGMA 3RBZA 4M9UA 4GZ6A 2R8PA 1E61A 1PVDA 4XWTA 2K47A 3NTUA 1WSDA 5DGDA 3KZ1E 1JIJA 4P7KA 5E2BA 1V16B 3KLNA 1E1QA 2ZSAA 3A6EA 3GEMA 3QEOA 4MCJA 1DV1A 2RBKA 4HXFB 4QYIA 1IXYA 5CD9A 1C2YA 4D9MA 1KO7A 1L5ZA 3BGSA 2DBZA 2FKNA 3P4YA 2VRCD 2QSYA 4GU5A 1P1BA 2Q6OA 2Q8PA 4C0KA 1JU4A 2M9MA 4FJ2A 1M10A 1PGJA 2O3QA 3JR7A 3TMAA 3MJTA 2AOTB 2LDBA 1SCDA 2QRMA 4QVGA 4EY4A 4O25A 1KSGA 3KU1A 4XGQA 2QUAA 3LBHA 4QDKA 2AJLI 5J4LA 5C8YB 3DNPA 4ALMA 2C9YA 1KEEB 5C51B 2AW5A 4O59O 2QR5A 3MS2A 2HZ7A 4MUIA 4AVYA 3GQ4A 4BO8A 2WZJA 2XSZD 4Q6BA 1C3EA 1HNWM 1YK1A 3EVCA 4AIIA 4RPHA 1U2GA 3RYFB 3TDKA 2ZTSA 4QGBA 2X2EA 1L4KA 3FTNA 5J43A 1Y5IA 5SV2A 4CR8A 5JSYA 2QRUA 3PUHA 4G0VA 2WA2A 3A2LA 3S2UA 3VVLA 1BXRA 4C01A 2PIAA 4NMHA 1ISPA 2JEOA 1F6WA 2EBWA 2PUHA 5DYYA 5IU6A 2XVYA 2JJYA 4L85A 3GROA 4XIYA 2DHCA 3V55A 3DVAA 2WD8A 2V55B 1KHTA 3PUXA 3W05A 3UWMA 5IC4A 4RESA 3NS7A 3BB4A 1D0VA 1EP3B 3LQ4A 4TSRA 2I2DA 3EEOA 4EL5A 1XCMA 3LMKA 4UHFA 1CZLA 3EVDA 4NPCA 1PZEA 2GBGA 2OK8A 4G89A 4NR0A 3VKGA 5A62A 4MRSA 4KXXA 4FDTA 1EVJA 3JALA 2VWQA 4XWKA 4M3NA 2G5CA 2QGNA 2IZOA 1WHSB 4PSUA 4Q12A 3CH7A 1EG2A 4C3OB 1NT2A 1M2WA 4RABA 4I50A 1C7ZA 1GQSA 3QYPA 1SHZA 5SY9A 1KMCA 3AX6A 4INJA 4RTLA 1SVSA 1NLZA 4ZV9A 4LTNA 4TQ9A 1I6LA 1ZSNA 2QS9A 5TXGA 2RH5A 5DCYA 2DY1A 5AI8A 5DM60 1NBEA 3ZGYA 1MQ9A 1WNTA 4DCCA 5BWOA 4ZOLB 4FSXA 1BU8A 1DHTA 2CNKA 1JG7A 5FOTA 1VLMA 1WABA 2WFAA 5AI9A 1VG1A 3KJQA 2ZTHA 2JCBA 3Q98A 4G0NA 4W8OA 3DMNA 2LHCA 1U2DA 3EVGA 4B80A 1DFGA 3HQ4O 4QM7A 1RWNA 4JROA 3HJGA 4P4TA 4RD1A 2ATEA 1OXXK 3I9NA 4KFTA 5I8PA 5CA1F 4JC4A 1QHEA 4X45A 4P7JA 2HGSA 3LWZA 3F49S 3FOEC 1DO8A 3DB1A 4ZHQF 1DOAA 3WDKA 3ASUA 2LVAA 4HQRA 2XE7A 1QZXA 2GB4A 2X3UA 3LNTA 2POCA 4R1NA 2Z58A 2OMEA 1OBCA 3TYXA 1SC9A 2PS0A 1V1RA 3D6NB 3SOPA 4EGSA 5I7RA 5LC1A 4B3TM 1FNSA 1YE9A 1WJGA 4Q03A 3SHFA 3K1JA 1H8ED 3CKMA 4P2BA 2EJCA 1QLHA 2JJ2D 4XR4A 1ZSVA 5K0LA 3FKJA 4PHGA 2QRNA 2FHSA 2WWRA 3VPBA 2C92A 4YMUA 1ZM9A 1Z62A 1IH8A 1FU4A 1E2UA 3EGVA 1E7YA 2DQ4A 4PLVA 4BCDA 1NPDA 4OJQA 1L8XA 3KOYE 1OLOA 4JR1A 3HMKA 1VL6A 5EWLA 1L5GB 4CIZA 3E9RA 1YNSA 1CUSA 4DR6M 3LFUA 1JQBA 1KO4A 4AZ3B 4IBGA 4JXKA 4JLPA 3O47A 1ZRSA 3BL8A 3CC8A 1TH2A 2C5EA 3CLUC 4LBVA 5LB2A 2AN9A 3U4HA 3PGKA 4MR7A 1UC4B 3VVBA 2D62A 2JC3A 3E3MA 3KDAA 4L0QA 1HZZC 3BJRA 3O4VA 1GKKA 3M7IA 2X76A 2QTWB 2NLOA 2BFCB 5DGTA 1U0FA 3KOZA 3BS4A 3ZVMA 4B7GA 2R44A 3GFPA 4KN9S 2YY7A 1CZNA 2AWNA 1KFKB 5CXXA 2VDRB 1EQUA 1OBVA 4MV8A 1DCMA 3LDUA 2PMCA 2W37A 1YR1A 4YH1A 4ZJPA 4EG0A 2JDID 2P5SA 3A4VA 1DHRA 5F4BA 4YHBA 4WBXC 1B16A 1Y3DE 1YZHA 3AZPA 4KQKA 2Y1XA 2H4XA 3CKYA 1IONA 1UZMA 4MJLA 3ILHA 2QYSA 3OCXA 4F91B 1DIOB 3NUQA 4COKA 2YWGA 4CHTB 3C5HA 4NYMQ 2FSIA 2Q1TA 3H2SA 4DQXA 1EKXA 2H57A 4PLTA 3DR5A 3W9SA 4N6OA 3F71A 3AK4A 3KJGA 4KVGA 3TQRA 4OXYA 3HLTA 4OREX 4AAYA 3VR3A 1JVNA 3DZGA 2O06A 4QLBA 2VTBB 2KRKA 5K0CA 4LRQA 5IC5A 1L1EA 5EJ9A 3QY9A 2AEMA 4RF5A 5LYJA 1V8OA 2OOSA 2Q3JA 1YC5A 3R7SA 4PGHA 3HSYA 1JBQA 1HDYA 5AVKA 4CBVA 1Q7RA 4G86A 1GL9B 8ABPA 3RTGA 4YRQA 3K92A 1W4BA 4TTVA 3VSDA 2LNHC 3UC9A 1MW8X 5GP1A 1RABA 4ZT7A 1E60A 2AZDA 4ML3A 4OXRA 4GP6A 3ZVKA 1V9LA 5D5QA 1XZLA 2YZMA 3MTAA 5J4HA 2JGKA 4Q9DA 4EP1A 3ESBA 4H08A 4W7SA 2FOLA 3HKEA 3OQMA 2H9IA 3VBEA 3U44B 4LYDA 2AX4A 4UQOA 2WG0A 1R0WA 3RYHA 3D2LA 5AVJA 1GU0A 1QGOA 1P60A 4MEAA 5CD1A 1FW8A 1H2AS 3E03A 5LA6F 1K86A 3PEYA 4ITRC 5ARCA 2A0UA 2GEVA 5K0TA 4X62B 2W0SA 4GPZA 2O5CA 3GLFE 3KK0A 3LUHA 3I4YA 3CNOA 2XXAA 3FA2A 3CE9A 1EX7A 2PLWA 4HWOA 3K9FC 3NATA 3JQ9C 3S3TA 1OIPA 4URYR 4G3XA 4HTAA 2HX1A 3X43A 3OZXA 1KA9H 1TADA 1OFTA 4IHJA 1G7RA 1RRKA 4CQLB 2UXBB 4OQYA 4CKEA 1S8OA 1KOGA 4OP2A 3RRMA 3HK2A 2YCLA 4RETA 4Y6QA 3VPDA 3D2BA 3WBJA 1XZNA 4CLDA 3ZQJA 1XZKA 3BAZA 1E92A 1SOMA 3ZY2A 4NENB 3TWOA 2XDQB 2AQHA 1Y6QA 2CLHB 3FPKA 3LXXA 3A45A 4R8VA 1G71A 2FWJA 1LY1A 1VE6A 3AVPA 4BB9A 4NOMA 2P2ZA 1XZIA 1F12A 4ZGGA 2J67A 1ILWA 5KQGA 2ACKA 3GPBA 3R09A 3SLRA 2Q5FA 1WZEA 1X7ZB 4X20A 1SG9A 3PPIA 1KJIA 4K6CA 1QNLA 2K9DA 4IO1A 2C4MA 1NN1A 3D4LA 5SZKB 2CN1A 3GRCA 3EWSA 3W4JA 2SNIE 4QKQA 3V4OA 2L18A 5IJXA 3V2UA 1W581 3E5RA 1XG5A 2KRUA 3BEDA 4D80A 2IS6A 3PEWA 2CXNA 4RTPA 2EGGA 1IK6A 3IS3A 4NHOA 2C95A 5FT9A 1VDDA 2HW8A 1XDSA 1A5AB 2GZMA 1C7IA 3G13A 1E9SA 4KIUA 1U9YA 4CQMA 2JIMA 1G2IA 4P83A 2R6AA 4N12A 1EWVA 3EJ6A 2QQFA 1QAMA 5GAJA 1Q2UA 5B3JC 3DCNA 2A9KA 2WYIA 4A23A 3UMFA 4Y0AA 1HE3A 4PAQA 2VZLA 1KOJA 1K7SN 4LJ9A 1HE2A 3D3KA 2G0AA 2VP3A 3OH8A 1O2DA 1I10A 5BOSB 1ZIXA 2XRYA 5FLYA 5FBHA 2MROB 1A8PA 2HM7A 5JO9A 5IHXA 2QJRA 3HVHA 1J0AA 1THGA 1CJSA 4Q9KA 1JQ5A 1LPNA 3GJ8A 1I2BA 3P94A 2VHXA 4JI3M 1KAOA 3C7AA 2R1VA 3KB8A 2XUAA 4YHHM 4JQZA 4DE5A 3E7XA 1D6NA 2PTHA 4OMCA 5JDCA 3FIUA 2AFIE 3HJSA 1SN7A 3RNLA 2QM0A 3K31A 4BQRA 4CJ6A 3M81A 3OLXA 1P9NA 2C1XA 1VTKA 1V47A 1WMAA 1Q11A 3VZRA 1OB5A 1QSGA 4TSKA 3M3PA 2XUFA 4PDGA 3O0TA 3QW2A 3QQPA 3PWSA 1YFKA 3FNQA 3WZMA 1QFMA 3M6VA 1PK9A 2A0KA 2X8LA 2Q1XA 3WI7A 4NXNB 3A4NA 4RELA 5E1DA 2JEZA 1ESEA 2G83A 1NQVA 2XUIA 1MVLA 2C7VA 2R751 1VSQA 2QTZA 4F86A 3GJ0A 3GJ5A 3CSDA 4J7XA 3UMGA 3ZHBA 3SQLA 2XQIA 3KD2A 4V02A 4BVEA 1XMJA 1PUJA 2VZ8A 4G6ZA 4KQJA 5BV8A 3LLCA 3NDIA 1T1RA 2ZR9A 1C7EA 3D7RA 4C4OA 4NULA 3IP9A 4G2TA 1S5PA 3TRHA 1K68A 4U02A 2EKBA 1DEOA 5ALFA 3B8EA 3E35A 4YASA 1S1MA 4N3BA 2ZOSA 4F2PA 5ERGB 1RRMA 1HEYA 2CHEA 3NU1A 5KB3A 5TEWA 4Z51A