3VLFB

Crystal structure of yeast proteasome interacting protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
MDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone/protein binding
molecule keywords DNA mismatch repair protein HSM3
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vlfB00
4LJ9A 1E94E 2C96A 4A3VB 2ZANA 1E32A 3SYKA 3HWSA 4LJ6A 1XWIA 3VFDA 1JR3D 5EP3A 2V6ZM 2FNAA 4KODA 4LJ7A 3SYLA 3H4MA 3HU2A 3WHKA 3VLFB 4LCBA 1HQCA 3KDSE 5DYGA 3EIEA 1SXJE 3GLFA 4LY6A 4D80A 1SXJC 2C9OA 2R62A 3R8FA 2DZOB 2R65A 3M0EA 5EXXA 3CF2A 1IXZA 4QHSA 5EQTA 2X8AA 2VIIA 4FWHA 2C9CA 2CHQA 1NVMA 1SXJB 4L15A 1NY5A 3PFIA 3GLHA 5C18A 3GLGA 4FW9A 3HU1A 2QZ4A 2Z4RA 3ZH9B 1QVRA 2HCBA 3MHVC 5FTKA 4FCVA 3DZDA 2QBYB 2DHRA 4LRTA 2CEAA 2C98A 4Z8XA 5DYIA 5C1BA 1D2NA 1J7KA 4LZZA 3GLIA 1IXSB 1XXHA 3PVSA 1IQPA 5EXPA 1W5TA 4JN6A 4LJ5A 3U61B 1KSFX 4GITA 1IY0A 1KYIA 1HT1E 1IN4A 1S3SA 4KLNA 5EXSA 1FNNA 2QPAA 2V1UA 1R6BX 4LGMA 1LV7A 3SC3A 1G4AE 3WHLA 1HT2E 3BOSA 3M6AA 1IM2A 3EIHA 5FTJA 1R7RA 1IY1A 2QP9X 4EIWA 3KW6A 4L4UA 3U5ZB 4FWGA 4FWDA 2BJWA 3GLFB 4D81A 1X37A 5FTLA 1UM8A 2ZAOA 5EP2A 5EP1A 1QZMA 4LJAA 3PXGA 1IN6A 3UK6A 2RKOA 4LRSA 1G41A 2QENA 3GLHB 1C1KA 2KRKA 1L8QA 4ZPXA 4QNMA 4D82A 1DO0A 1NJGA 1NSFA 3GLGB 1SXJA 2XSZA 4L16A 3AJIB 4QNRA 3U60B 1IN8A 2Z4SA 1IXRC 4WW0A 1OJLA 4I4LA 3B9PA 5EXTA 4QOSA 1OFHA 1IN7A 1W5SA 1OFIA 4FD2A 5JI2E 1JQJC 3HU3A 2CE7A 4LJ8A 2QBYA 2DVWB 5EP4A 5FTMA 1NY6A 4FCTA 3GLIB 4QHTA 1XXHB 1IN5A 4LJ4A 3D8BA 1IY2A 1HQYE 1JR3A 1SXJD 2DZNB 2XSZD 2ZAMA 5JI3E 4FCWA 1G3IA 2BJVA 2C99A 4KO8A 5FTNA 1DO2A 2CHGA 3K1JA 3CF0A 2CHVA 2DWZB 1NJFA 4I81A
chains in the Genus database with same CATH superfamily
2XEPA 3HY5A 1E94E 2C96A 4A3VB 3J2PB 1T43A 3E4RA 3L2AA 3A46A 3SYKA 2FOIC 2XZFA 1Z6TA 3K8ZA 4RF0A 5A2QS 4MM3B 1GKIA 2XZUA 3VFDA 1JR3D 5EP3A 5IZ7D 1K3XA 4KHPM 3GPPA 2V6ZM 2LVQD 1BVSA 3MMPA 4G3OA 4KODA 2F5QA 5IREB 1NNJA 2N35A 3H4MA 3U5ZA 3FE3A 1K3WA 2EA0A 2DENA 2K47A 1L2BA 3I4YA 5LMNM 2R62A 1WXQA 2WSFF 2R4JA 4OW0A 3KS8A 1GVNA 1EIJA 4HLQA 2D7HA 2R65A 3V76A 4GMQA 2RGHA 3GLFE 3FUVA 4NSRA 4DBGB 2KZSA 4NXMM 3GRYA 4FVMA 4AKIA 1LTMA 4L8RC 1JR3E 2CHQA 2UXCM 1NY5A 3HJSA 4FW9A 2DAMA 4JI8M 1QVRA 3MHVC 3KSXA 2CV1A 2HL7A 2QBYB 3FTFA 3TWMA 4IIWA 4LZJA 3HGIA 1QAOA 5ITRA 4M0WA 1N33M 4DR7M 2C98A 3FTEA 3R9XB 4Z8XA 1RU3A 1D2NA 1IXSB 1PJIA 1IQPA 1YUBA 1W5TA 3DOAA 3FRHA 3LCUA 4DV1M 4DV2M 2R18A 4S12A 1IY0A 1HT1E 2KNVA 1AIPC 1IN4A 3SHGB 2QPAA 3SAWA 4LGMA 2LVNC 5DFLA 2YNMD 1D0LA 1G59A 1DGBA 3BOSA 5F3WA 3ZQJA 2KZUA 5FTJA 4WURA 3FUTA 3GP1A 3AOEA 2V1CA 3U5ZB 3LCVB 3U6MA 1L2CA 2K6BA 1VEKA 3KOYE 3C9PA 3GRUA 1ZMUA 3LMMA 3BBZA 3QYEA 2CUZA 4Y28F 4II7A 5EJCA 4Z6YA 2NQ8C 1UM8A 2CFOA 2ZAOA 5EP2A 3L25A 2CV2A 1P3QQ 1E9SA 4K0KM 1Z5BA 2E5LM 3L29A 3VDUA 3UK6A 4X64M 1WGLA 5ITTA 4LRSA 1PJQA 3B7QA 1PJTA 1SG9A 2GQFA 3KOZE 4X65M 4ZPXA 2K9DA 4D82A 3KS4A 1NSFA 3DA1A 4LFBM 4DV5M 3J27B 1IN8A 4DV7M 1Z5AA 1IXRC 4HEOA 4REZA 3DFZA 4B3MM 3B9PA 4BB9A 4QOSA 4B3RM 1W5SA 1OFIA 2WZJA 1R2ZA 3HKPA 2J5YA 3GO8A 2DXIA 2UUAM 1E9RA 3HHWA 1NY6A 4LF4M 4GEWA 4LJ4A 3AOGA 3D8BA 1IY2A 2Q2EB 1JR3A 3UZUA 4TUWA 2LTUA 3W0FA 2MH8A 4FCWA 1G3IA 2L4EA 3TL4X 3SBJA 1EE8A 2C99A 2LWXA 3AOEC 5FTNA 3F92A 3U61A 3J80S 3SATA 3NBIA 3K92A 3H4JA 2LVPC 1XNRM 4LJ9A 2KXEA 1JB0F 2Z7JA 1ZMVA 1HR0M 3THGA 1E32A 2QQ8A 2RRUA 4LJ6A 1D0KA 3KXEC 1R2YA 1C7YA 4LF5M 1XWIA 4IBKA 2I7NA 2ZTDA 4R71A 3HU2A 3WHKA 2CWBA 2EUCA 1HQCA 4LCBA 5DYGA 1Q02A 1WHCA 4DR2M 1TH2A 2DAEA 4MH0E 3R8FA 2LXEA 1IXSA 1T6OA 5KO3A 2R45A 5KPTA 3M0EA 2H1RA 5EXXA 1XNQM 1N75A 1IXZA 2CV0A 2FH0A 3AKZA 1K82A 4GH9A 4LG2A 2X8AA 3RFWA 2C9CA 2EJSA 5C18A 3D8LA 1PM5A 1VDLA 2QZ4A 2B3TA 2Z4RA 1HNZM 1IBLM 5FTKA 2HCBA 2L7HA 2R6FA 1WJ7A 3U60A 1EFUB 3ZC7B 3GLHE 1Q3BA 2L2DA 3GLGE 3NBXX 2RGOA 5DYIA 1ZQ9A 2BWEA 2DNAA 1XXHA 4XK8F 3U6LA 3LW5F 3PVSA 5EXPA 8CATA 3U6PA 3GRRA 1D0MA 1DGHA 5L8RF 3SAUA 2R44A 4GITA 3U61B 3HJQA 1IBKM 1KYIA 4BBAA 1QQWA 3B7ZA 2BNKA 2LH0A 3B7NA 3C58A 1I94M 1L1ZA 1N77A 2LNHC 3CTWB 4G4OA 5BPVA 4LFCM 2D7GA 3AL0C 1UFZA 4L78A 1XMOM 4B7HA 2JP7A 3L28A 1DV0A 3EIHA 2A5YB 1HNXM 1IY1A 2DWNA 2KNAA 4L4UA 3TWKA 3KP0E 3NWLA 4FWGA 4JXJA 1OKSA 2BJWA 3IHPA 3J7BA 4IBCA 1KFVA 3VKHA 4MB7A 1TH4A 2D7EA 1QAMA 1NNUC 3TWLA 1X37A 2KEBA 3U6SA 3LVWA 3UJNA 5EP1A 2Y21A 2CRUA 3HHXA 1I4WA 2G5GX 3GRVA 4F2LA 2UXBM 2OOBA 3PXGA 3T1HM 1NHWC 1TF0B 4ANRA 3UMMA 3U6DA 3CGWA 2DWMA 4GC5A 1C1KA 1G8PA 2KRKA 1GJTA 3I51A 3I04M 7CATA 1OAIA 2Z3XA 1NV9A 3LQRA 3KFUG 1V33A 3K9PA 3U60B 1VG5A 2OQ4A 2AHMA 2Z8YM 4I4LA 2VDBB 5EXTA 2L09A 1OFHA 4CJ6A 2Y20A 4IBEA 2L4FA 3MK6A 2J7NA 5EP4A 2MR9A 4FCTA 5FTMA 1ORYB 4BLCA 4JI4M 1XXHB 2R46A 1IN5A 4PDIA 4PD2A 1H6UA 3IECA 1XB2B 1SXJD 1DGHB 2DZNB 2XSZD 1WIVA 2ZAMA 5GKNA 3U6QA 2BJVA 3KVWA 3MJ5A 1AUAA 2JY8A 3T6PA 3FYDA 4IBDA 2X4AA 1R4GA 1DGFA 5EQTA 4GC9A 3LQQA 3ILKA 1PJSA 1J09A 4ITQA 1NO1A 4AG5A 1DGGA 2YFQA 4RF1A 1N78A 4JI0M 2FNAA 2KA6B 4LJ7A 1QAQA 3AFHA 4CHTB 3KDSE 1YLAA 2DKLA 3EIEA 4AG6A 1SXJE 3GLFA 1VDDA 2UUBM 5ITQA 4P17A 2C9OA 2X49A 2F5SA 2DZOB 4GKKM 2O25A 1WGNA 2QHOB 4I8OA 2VQEM 4DUZM 4G4NA 1Q3CA 2R4EA 3CF2A 2ZBKB 4YHHM 1OIZA 2UXDM 3FYCA 2VIIA 3K9OA 1MN3A 3M7GA 4FWHA 4R3DA 5DNYA 2JY5A 4L15A 3PFIA 4JI1M 3HZJA 3U6EA 3HX3A 3HU1A 4DR5M 1PRBA 3ZH9B 2EKFA 4FCVA 4WP2A 5IWAM 4JI5M 2DAGA 1GL7A 4LF7M 3C3DA 2L7IA 4LRTA 1GJSA 2CEAA 2HWJA 1R5LA 1GO5A 2YQZA 4JI7M 5KQDA 5C1BA 4AQYM 4NRWA 2Y0QA 4B7GA 1IBMM 3I01M 4DR6M 2P5TA 4JN6A 4LJ5A 1KSFX 2G3QA 3A42A 2M60A 3VK7A 4KLNA 3JR4A 1FNNA 2V1UA 5FSWA 1R6BX 3K2LA 1LV7A 5KQ8A 2WSCF 3GPXA 2FE8A 2L6OA 1T3TA 3E21A 3B74A 2MROB 4I5SA 2XF3A 3WHLA 2OO9A 3KOXE 2KRUA 4G4RA 5KPRA 1R7RA 2DAKA 4EIWA 3KW6A 4KT0F 3FTCA 1N32M 3GLFB 3E46A 2JNHA 2H5XA 1A5TA 2CP8A 5E6JA 2ZTCA 4PT5A 3GQ3A 4D81A 5FTLA 1PJJA 5FLXS 1OTRA 2JWSA 4IBJA 4M9ZA 2JXNA 2LVOC 4M9SA 3SMSA 3T1YM 2O5RA 3A98B 4JI3M 4CIZA 3QWLA 1ZV1A 2QSFX 4GKJM 5ITUA 3GLIE 2ERCA 4OVZA 4DR4M 2K0BX 1G41A 4M0DA 3SASA 3FD9A 3LVVA 1CUKA 2EKKA 1DO0A 1GL6A 3SARA 1SXJA 2XSZA 4L16A 4NRVA 1N34M 1V92A 2KNZA 2Z4SA 2DAIA 4MGIE 1OJLA 2JZ0A 4IJEA 1IFYA 1IN7A 4FD2A 1JQJC 2CE7A 4AW4A 2HHHM 3BXWA 2DVWB 1GABA 2QNJA 3W68A 4QHTA 3A45A 4AKGA 1VQ1A 4IJFA 1GLNA 4DV6M 2W82A 3U6CA 4MGKE 4RNAA 4YY3M 3Q8XA 4DV0M 3L26A 4CGYB 4KO8A 2DI0A 2LHCA 3GPUA 4DR1M 4CISA 2CHGA 3KP1E 3J81S 1QUTA 3CF0A 2CHVA 4IBBA 2OPFA 1NJFA 1FJGM 3HJ8A 4IBGA 3IG5A 4DV3M 4P16A 3SFZA 2ZANA 3AV0A 5LMUM 3VK8A 2LVAA 1QYRA 1VEGA 2HKJA 3HWSA 2BWBA 3FRIA 3OTOM 4LGYA 1V34A 3RE8A 3GPYA 2G8LA 1NHGC 4JI6M 4PDGA 2WSEF 3FTDA 3SYLA 3T15A 3VLFB 3GQ5A 4LF8M 4HL4A 4OX9M 2JZ1A 4NOOB 1Z59A 4LY6A 2XH9A 4D80A 1SXJC 3QYBA 2LHGA 1TDZA 2JA2A 1QZEA 1G71A 4F1IA 4GHAA 4M9XA 4OVZB 1VEJA 2I7PA 2UUCM 4QHSA 4GHLA 4JYAM 4RKUF 4OU7A 1TDHA 4W5WA 1NVMA 1SXJB 4G4QA 2EO2A 3GLHA 5KPZA 2VQFM 4G6ZA 5ITXE 3PNYA 3GLGA 3TPZA 3KOWE 3C3EA 1NV8A 2GNOA 3FUXA 4B7FA 2ZM6M 3DZDA 3VDPA 2VF7A 1YSYA 2DHRA 3HHYA 5BR8M 2XFSA 2JUJA 3FKEA 1QDTA 4GRIA 3RGPA 1Z5CA 1HNWM 5IT9S 1L2DA 1J7KA 3GLIA 4LZZA 4IBIA 2F5PA 2JY6B 2UU9M 2HAKA 3GQ4A 4LF9M 4X62M 3TQSA 1YE9A 1QANA 2DZLA 3E9SA 4XGIA 3FUWA 2JY7A 4AKHA 2Y0TA 1PGYA 1HJPA 1S3SA 5EXSA 1XXHE 3L27A 4X66M 5E26A 1J5EM 2OOAA 3KSJA 3SC3A 1G4AE 3UGJA 4UN2B 3VKGA 3SMPA 2C5RA 4NC6A 1XHBA 3Q8GA 1HT2E 3M6AA 3TE6A 2KW0A 2J7OA 2DWLA 2KHHA 1IM2A 4DV4M 5H37D 2QP9X 3U6OA 4R7GA 3J7AS 1TH3A 4FWDA 2F4VM 4B08A 4QOZC 2F5OA 3JR5A 2APLA 3W0LB 1N36M 4MGYE 5ITYA 2XLJA 4L6V6 4IBFA 1XMQM 3HHZA 1TTEA 1QUSA 4LFAM 2F5NA 1MU5A 4LF6M 1OQYA 2DHYA 1Q39A 4NXNM 1QZMA 3I4VA 4MGHA 4LJAA 2QCUA 1IN6A 1XC8A 4AI6A 1L1TA 2RKOA 1TGUA 2LBCA 2XGNA 2QENA 2MJ5B 3GLHB 4B3SM 4B3TM 1L8QA 3B89A 4QNMA 3GLGB 1NJGA 3RGSA 4GIPA 4QNRA 2O01F 2R0IA 2XFTA 3AJIB 4PCZA 3ZCBB 2FS1A 4AZFA 4WW0A 4NL4H 1QDRA 1F4IA 5JI2E 4JI2M 4JV5M 3SAVA 3QAUA 2QBYA 3HU3A 4LJ8A 4Q7JA 1OAOC 1TR8A 1MX0A 3GLIB 2KDLA 2FFJA 3CF6E 3W67A 2VF8A 4DUYM 3SHFA 1MJGM 1HQYE 1WR1B 3IG8A 4DR3M 5JI3E 2M5ZA 4XBOA 3T38A 4MGZE 5ITXA 3JAMS 1DO2A 1Y8GA 1OIPA 1ZAEA 1ZMWA 2MGWA 3FUUA 3K1JA 4NSOB 2YR0A 2DWZB 3PNVA 4I81A
chains in the Genus database with same CATH topology
2XEPA 1E94E 2C96A 4A3VB 3J2PB 3E4RA 3L2AA 3A46A 3SYKA 2FOIC 2XZFA 1Z6TA 3K8ZA 4RF0A 5A2QS 4MM3B 1GKIA 2XZUA 3VFDA 1JR3D 5EP3A 5IZ7D 1K3XA 4KHPM 3GPPA 2V6ZM 4KODA 2F5QA 5IREB 1NNJA 3H4MA 3U5ZA 1K3WA 2EA0A 2K47A 1L2BA 3I4YA 5LMNM 2R62A 1WXQA 4OW0A 2R4JA 3KS8A 1GVNA 4HLQA 2D7HA 2R65A 4GMQA 2RGHA 3FUVA 4NSRA 2KZSA 4NXMM 3GRYA 4FVMA 4AKIA 4L8RC 2CHQA 2UXCM 1NY5A 3HJSA 4FW9A 4JI8M 1QVRA 3MHVC 3KSXA 2CV1A 2HL7A 2QBYB 3FTFA 3TWMA 4IIWA 4LZJA 3HGIA 1QAOA 5ITRA 4M0WA 1N33M 4DR7M 2C98A 3FTEA 3R9XB 4Z8XA 1D2NA 1IXSB 1PJIA 1IQPA 1YUBA 1W5TA 3DOAA 4DV1M 4DV2M 2R18A 4S12A 1IY0A 1HT1E 3SHGB 1IN4A 2QPAA 3SAWA 4LGMA 2YNMD 1G59A 1DGBA 3BOSA 5F3WA 2KZUA 5FTJA 4WURA 3FUTA 3GP1A 3AOEA 2V1CA 3U5ZB 3U6MA 1L2CA 3KOYE 3GRUA 3LMMA 2CUZA 4II7A 5EJCA 4Z6YA 2NQ8C 1UM8A 2CFOA 2ZAOA 5EP2A 3L25A 2CV2A 1E9SA 4K0KM 1Z5BA 2E5LM 3L29A 3VDUA 3UK6A 4X64M 5ITTA 4LRSA 3KOZE 4X65M 4ZPXA 4D82A 3KS4A 1NSFA 3DA1A 4LFBM 4DV5M 3J27B 1IN8A 4DV7M 1Z5AA 1IXRC 4REZA 3DFZA 4B3MM 3B9PA 4BB9A 4QOSA 4B3RM 1W5SA 1OFIA 1R2ZA 3HKPA 3GO8A 2DXIA 2UUAM 1E9RA 3HHWA 1NY6A 4LF4M 4LJ4A 3AOGA 3D8BA 1IY2A 2Q2EB 1JR3A 3UZUA 4TUWA 3W0FA 4FCWA 1G3IA 3TL4X 3SBJA 1EE8A 2C99A 2LWXA 3AOEC 5FTNA 3U61A 3J80S 3SATA 3NBIA 3K92A 1XNRM 4LJ9A 2KXEA 2Z7JA 1HR0M 3THGA 1E32A 1R2YA 4LJ6A 3KXEC 4LF5M 1XWIA 4IBKA 2I7NA 3HU2A 3WHKA 2EUCA 1HQCA 4LCBA 5DYGA 4DR2M 1TH2A 4MH0E 3R8FA 2LXEA 5KO3A 2R45A 5KPTA 3M0EA 2H1RA 5EXXA 1XNQM 1N75A 1IXZA 2CV0A 3AKZA 1K82A 4GH9A 4LG2A 2X8AA 3RFWA 2C9CA 5C18A 3D8LA 1PM5A 2QZ4A 2Z4RA 1HNZM 1IBLM 5FTKA 2HCBA 2L7HA 3U60A 3ZC7B 1Q3BA 2RGOA 5DYIA 1ZQ9A 1XXHA 3U6LA 3PVSA 5EXPA 3U6PA 8CATA 3GRRA 1DGHA 3SAUA 3U61B 4GITA 3HJQA 1IBKM 1KYIA 4BBAA 1QQWA 2BNKA 2LH0A 3C58A 1I94M 1L1ZA 1N77A 2LNHC 3CTWB 4G4OA 5BPVA 4LFCM 2D7GA 3AL0C 4L78A 1XMOM 4B7HA 3L28A 3EIHA 2A5YB 1HNXM 1IY1A 2DWNA 4L4UA 3TWKA 3KP0E 3NWLA 4FWGA 4JXJA 2BJWA 3J7BA 4IBCA 1KFVA 3VKHA 4MB7A 1TH4A 2D7EA 1QAMA 1NNUC 3TWLA 1X37A 2KEBA 3U6SA 3LVWA 3UJNA 5EP1A 2Y21A 3HHXA 1I4WA 2G5GX 3GRVA 2UXBM 3T1HM 3PXGA 1NHWC 3UMMA 3U6DA 2DWMA 4GC5A 1C1KA 1G8PA 2KRKA 3I51A 7CATA 2Z3XA 3LQRA 3KFUG 3U60B 2OQ4A 2AHMA 4I4LA 5EXTA 2L09A 1OFHA 2Y20A 4IBEA 3MK6A 2J7NA 5EP4A 5FTMA 4FCTA 1ORYB 4BLCA 4JI4M 1XXHB 2R46A 1IN5A 4PDIA 4PD2A 1H6UA 1SXJD 1DGHB 2DZNB 2XSZD 2ZAMA 5GKNA 3U6QA 2BJVA 3KVWA 3MJ5A 3FYDA 4IBDA 2X4AA 1DGFA 5EQTA 4GC9A 3LQQA 3ILKA 1J09A 4ITQA 4AG5A 1DGGA 2YFQA 4RF1A 1N78A 4JI0M 2FNAA 2KA6B 4LJ7A 1QAQA 3AFHA 4CHTB 3KDSE 4AG6A 3EIEA 1SXJE 3GLFA 1VDDA 2UUBM 5ITQA 2C9OA 2X49A 2F5SA 2DZOB 4GKKM 2VQEM 4I8OA 4DUZM 4G4NA 1Q3CA 2R4EA 3CF2A 2ZBKB 4YHHM 2UXDM 3FYCA 2VIIA 3M7GA 4FWHA 4R3DA 5DNYA 4L15A 3PFIA 4JI1M 3U6EA 3HU1A 4DR5M 3ZH9B 4FCVA 5IWAM 4JI5M 4LF7M 1GL7A 2L7IA 4LRTA 2CEAA 2YQZA 4JI7M 5KQDA 5C1BA 4AQYM 4NRWA 2Y0QA 4B7GA 1IBMM 4DR6M 2P5TA 4JN6A 4LJ5A 1KSFX 3A42A 2M60A 3VK7A 4KLNA 3JR4A 1FNNA 2V1UA 5FSWA 1R6BX 3K2LA 1LV7A 5KQ8A 3GPXA 2FE8A 2L6OA 1T3TA 4I5SA 2XF3A 3WHLA 3KOXE 2KRUA 4G4RA 5KPRA 1R7RA 4EIWA 3KW6A 3FTCA 1N32M 3GLFB 5E6JA 4PT5A 3GQ3A 4D81A 5FTLA 1PJJA 5FLXS 4IBJA 4M9ZA 4M9SA 3SMSA 3T1YM 2O5RA 3A98B 4JI3M 3QWLA 4GKJM 5ITUA 2ERCA 4OVZA 4DR4M 1G41A 4M0DA 3SASA 3FD9A 3LVVA 1DO0A 1GL6A 3SARA 1SXJA 2XSZA 4L16A 4NRVA 1N34M 2Z4SA 4MGIE 1OJLA 4IJEA 1IN7A 4FD2A 1JQJC 2CE7A 4AW4A 2HHHM 2DVWB 4QHTA 3A45A 4AKGA 4IJFA 1GLNA 4DV6M 2W82A 3U6CA 4MGKE 4RNAA 4YY3M 3Q8XA 4DV0M 3L26A 4CGYB 4KO8A 3GPUA 4CISA 4DR1M 2CHGA 3KP1E 3J81S 3CF0A 2CHVA 4IBBA 2OPFA 1NJFA 1FJGM 3HJ8A 4IBGA 3IG5A 4DV3M 4P16A 3SFZA 2ZANA 3AV0A 5LMUM 3VK8A 1QYRA 2HKJA 3HWSA 3OTOM 4LGYA 3RE8A 3GPYA 2G8LA 1NHGC 4JI6M 4PDGA 3FTDA 3SYLA 3T15A 3VLFB 3GQ5A 4LF8M 4HL4A 4OX9M 4NOOB 1Z59A 4LY6A 2XH9A 4D80A 1SXJC 1TDZA 2JA2A 4GHAA 4M9XA 4OVZB 2I7PA 2UUCM 4QHSA 4GHLA 4JYAM 4OU7A 1TDHA 4W5WA 1NVMA 1SXJB 4G4QA 2EO2A 3GLHA 5KPZA 2VQFM 4G6ZA 5ITXE 3PNYA 3GLGA 3TPZA 3KOWE 3FUXA 4B7FA 2ZM6M 3DZDA 3VDPA 1YSYA 2DHRA 3HHYA 5BR8M 2XFSA 3FKEA 4GRIA 3RGPA 1Z5CA 1HNWM 5IT9S 1L2DA 1J7KA 3GLIA 4LZZA 4IBIA 2F5PA 2UU9M 3GQ4A 4LF9M 4X62M 3TQSA 1YE9A 1QANA 3E9SA 4XGIA 3FUWA 4AKHA 2Y0TA 1S3SA 5EXSA 3L27A 4X66M 5E26A 1J5EM 3KSJA 3SC3A 1G4AE 3UGJA 3VKGA 3SMPA 2C5RA 1XHBA 1HT2E 3M6AA 3TE6A 2KW0A 2J7OA 2DWLA 1IM2A 4DV4M 5H37D 2QP9X 3U6OA 4R7GA 3J7AS 1TH3A 4FWDA 2F4VM 4B08A 4QOZC 2F5OA 3JR5A 3W0LB 1N36M 4MGYE 5ITYA 2XLJA 4IBFA 1XMQM 3HHZA 4LFAM 2F5NA 1MU5A 4LF6M 1Q39A 4NXNM 1QZMA 3I4VA 4MGHA 4LJAA 2QCUA 1IN6A 1XC8A 4AI6A 1L1TA 2RKOA 1TGUA 2XGNA 2QENA 3GLHB 4B3SM 4B3TM 1L8QA 3GLGB 4QNMA 1NJGA 3RGSA 4GIPA 4QNRA 3AJIB 2XFTA 4PCZA 3ZCBB 4AZFA 4WW0A 4NL4H 5JI2E 4JI2M 4JV5M 3SAVA 3QAUA 2QBYA 3HU3A 4LJ8A 1MX0A 3GLIB 2FFJA 3CF6E 4DUYM 3SHFA 1HQYE 3IG8A 4DR3M 5JI3E 2M5ZA 4XBOA 3T38A 4MGZE 5ITXA 3JAMS 1DO2A 1ZAEA 3FUUA 4NSOB 3K1JA 2YR0A 2DWZB 3PNVA 4I81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJ9 A;  1E94 E;  2C96 A;  4A3V B;  2ZAN A;  1E32 A;  3SYK A;  3HWS A;  4LJ6 A;  1XWI A;  3VFD A;  1JR3 D;  5EP3 A;  2V6Z M;  2FNA A;  4KOD A;  4LJ7 A;  3SYL A;  3H4M A;  3HU2 A;  3WHK A;  3VLF B;  4LCB A;  1HQC A;  3KDS E;  5DYG A;  3EIE A;  1SXJ E;  3GLF A;  4LY6 A;  4D80 A;  1SXJ C;  2C9O A;  2R62 A;  3R8F A;  2DZO B;  2R65 A;  3M0E A;  5EXX A;  3CF2 A;  1IXZ A;  4QHS A;  5EQT A;  2X8A A;  2VII A;  4FWH A;  2C9C A;  2CHQ A;  1NVM A;  1SXJ B;  4L15 A;  1NY5 A;  3PFI A;  3GLH A;  5C18 A;  3GLG A;  4FW9 A;  3HU1 A;  2QZ4 A;  2Z4R A;  3ZH9 B;  1QVR A;  2HCB A;  3MHV C;  5FTK A;  4FCV A;  3DZD A;  2QBY B;  2DHR A;  4LRT A;  2CEA A;  2C98 A;  4Z8X A;  5DYI A;  5C1B A;  1D2N A;  1J7K A;  4LZZ A;  3GLI A;  1IXS B;  1XXH A;  3PVS A;  1IQP A;  5EXP A;  1W5T A;  4JN6 A;  4LJ5 A;  3U61 B;  1KSF X;  4GIT A;  1IY0 A;  1KYI A;  1HT1 E;  1IN4 A;  1S3S A;  4KLN A;  5EXS A;  1FNN A;  2QPA A;  2V1U A;  1R6B X;  4LGM A;  1LV7 A;  3SC3 A;  1G4A E;  3WHL A;  1HT2 E;  3BOS A;  3M6A A;  1IM2 A;  3EIH A;  5FTJ A;  1R7R A;  1IY1 A;  2QP9 X;  4EIW A;  3KW6 A;  4L4U A;  3U5Z B;  4FWG A;  4FWD A;  2BJW A;  3GLF B;  4D81 A;  1X37 A;  5FTL A;  1UM8 A;  2ZAO A;  5EP2 A;  5EP1 A;  1QZM A;  4LJA A;  3PXG A;  1IN6 A;  3UK6 A;  2RKO A;  4LRS A;  1G41 A;  2QEN A;  3GLH B;  1C1K A;  2KRK A;  1L8Q A;  4ZPX A;  4QNM A;  4D82 A;  1DO0 A;  1NJG A;  1NSF A;  3GLG B;  1SXJ A;  2XSZ A;  4L16 A;  3AJI B;  4QNR A;  3U60 B;  1IN8 A;  2Z4S A;  1IXR C;  4WW0 A;  1OJL A;  4I4L A;  3B9P A;  5EXT A;  4QOS A;  1OFH A;  1IN7 A;  1W5S A;  1OFI A;  4FD2 A;  5JI2 E;  1JQJ C;  3HU3 A;  2CE7 A;  4LJ8 A;  2QBY A;  2DVW B;  5EP4 A;  5FTM A;  1NY6 A;  4FCT A;  3GLI B;  4QHT A;  1XXH B;  1IN5 A;  4LJ4 A;  3D8B A;  1IY2 A;  1HQY E;  1JR3 A;  1SXJ D;  2DZN B;  2XSZ D;  2ZAM A;  5JI3 E;  4FCW A;  1G3I A;  2BJV A;  2C99 A;  4KO8 A;  5FTN A;  1DO2 A;  2CHG A;  3K1J A;  3CF0 A;  2CHV A;  2DWZ B;  1NJF A;  4I81 A; 
#chains in the Genus database with same CATH topology
 2XEP A;  3HY5 A;  1E94 E;  2C96 A;  4A3V B;  3J2P B;  1T43 A;  3E4R A;  3L2A A;  3A46 A;  3SYK A;  2FOI C;  2XZF A;  1Z6T A;  3K8Z A;  4RF0 A;  5A2Q S;  4MM3 B;  1GKI A;  2XZU A;  3VFD A;  1JR3 D;  5EP3 A;  5IZ7 D;  1K3X A;  4KHP M;  3GPP A;  2V6Z M;  2LVQ D;  1BVS A;  3MMP A;  4G3O A;  4KOD A;  2F5Q A;  5IRE B;  1NNJ A;  2N35 A;  3H4M A;  3U5Z A;  3FE3 A;  1K3W A;  2EA0 A;  2DEN A;  2K47 A;  1L2B A;  3I4Y A;  5LMN M;  2R62 A;  1WXQ A;  2WSF F;  2R4J A;  4OW0 A;  3KS8 A;  1GVN A;  1EIJ A;  4HLQ A;  2D7H A;  2R65 A;  3V76 A;  4GMQ A;  2RGH A;  3GLF E;  3FUV A;  4NSR A;  4DBG B;  2KZS A;  4NXM M;  3GRY A;  4FVM A;  4AKI A;  1LTM A;  4L8R C;  1JR3 E;  2CHQ A;  2UXC M;  1NY5 A;  3HJS A;  4FW9 A;  2DAM A;  4JI8 M;  1QVR A;  3MHV C;  3KSX A;  2CV1 A;  2HL7 A;  2QBY B;  3FTF A;  3TWM A;  4IIW A;  4LZJ A;  3HGI A;  1QAO A;  5ITR A;  4M0W A;  1N33 M;  4DR7 M;  2C98 A;  3FTE A;  3R9X B;  4Z8X A;  1RU3 A;  1D2N A;  1IXS B;  1PJI A;  1IQP A;  1YUB A;  1W5T A;  3DOA A;  3FRH A;  3LCU A;  4DV1 M;  4DV2 M;  2R18 A;  4S12 A;  1IY0 A;  1HT1 E;  2KNV A;  1AIP C;  1IN4 A;  3SHG B;  2QPA A;  3SAW A;  4LGM A;  2LVN C;  5DFL A;  2YNM D;  1D0L A;  1G59 A;  1DGB A;  3BOS A;  5F3W A;  3ZQJ A;  2KZU A;  5FTJ A;  4WUR A;  3FUT A;  3GP1 A;  3AOE A;  2V1C A;  3U5Z B;  3LCV B;  3U6M A;  1L2C A;  2K6B A;  1VEK A;  3KOY E;  3C9P A;  3GRU A;  1ZMU A;  3LMM A;  3BBZ A;  3QYE A;  2CUZ A;  4Y28 F;  4II7 A;  5EJC A;  4Z6Y A;  2NQ8 C;  1UM8 A;  2CFO A;  2ZAO A;  5EP2 A;  3L25 A;  2CV2 A;  1P3Q Q;  1E9S A;  4K0K M;  1Z5B A;  2E5L M;  3L29 A;  3VDU A;  3UK6 A;  4X64 M;  1WGL A;  5ITT A;  4LRS A;  1PJQ A;  3B7Q A;  1PJT A;  1SG9 A;  2GQF A;  3KOZ E;  4X65 M;  4ZPX A;  2K9D A;  4D82 A;  3KS4 A;  1NSF A;  3DA1 A;  4LFB M;  4DV5 M;  3J27 B;  1IN8 A;  4DV7 M;  1Z5A A;  1IXR C;  4HEO A;  4REZ A;  3DFZ A;  4B3M M;  3B9P A;  4BB9 A;  4QOS A;  4B3R M;  1W5S A;  1OFI A;  2WZJ A;  1R2Z A;  3HKP A;  2J5Y A;  3GO8 A;  2DXI A;  2UUA M;  1E9R A;  3HHW A;  1NY6 A;  4LF4 M;  4GEW A;  4LJ4 A;  3AOG A;  3D8B A;  1IY2 A;  2Q2E B;  1JR3 A;  3UZU A;  4TUW A;  2LTU A;  3W0F A;  2MH8 A;  4FCW A;  1G3I A;  2L4E A;  3TL4 X;  3SBJ A;  1EE8 A;  2C99 A;  2LWX A;  3AOE C;  5FTN A;  3F92 A;  3U61 A;  3J80 S;  3SAT A;  3NBI A;  3K92 A;  3H4J A;  2LVP C;  1XNR M;  4LJ9 A;  2KXE A;  1JB0 F;  2Z7J A;  1ZMV A;  1HR0 M;  3THG A;  1E32 A;  2QQ8 A;  2RRU A;  4LJ6 A;  1D0K A;  3KXE C;  1R2Y A;  1C7Y A;  4LF5 M;  1XWI A;  4IBK A;  2I7N A;  2ZTD A;  4R71 A;  3HU2 A;  3WHK A;  2CWB A;  2EUC A;  1HQC A;  4LCB A;  5DYG A;  1Q02 A;  1WHC A;  4DR2 M;  1TH2 A;  2DAE A;  4MH0 E;  3R8F A;  2LXE A;  1IXS A;  1T6O A;  5KO3 A;  2R45 A;  5KPT A;  3M0E A;  2H1R A;  5EXX A;  1XNQ M;  1N75 A;  1IXZ A;  2CV0 A;  2FH0 A;  3AKZ A;  1K82 A;  4GH9 A;  4LG2 A;  2X8A A;  3RFW A;  2C9C A;  2EJS A;  5C18 A;  3D8L A;  1PM5 A;  1VDL A;  2QZ4 A;  2B3T A;  2Z4R A;  1HNZ M;  1IBL M;  5FTK A;  2HCB A;  2L7H A;  2R6F A;  1WJ7 A;  3U60 A;  1EFU B;  3ZC7 B;  3GLH E;  1Q3B A;  2L2D A;  3GLG E;  3NBX X;  2RGO A;  5DYI A;  1ZQ9 A;  2BWE A;  2DNA A;  1XXH A;  4XK8 F;  3U6L A;  3LW5 F;  3PVS A;  5EXP A;  8CAT A;  3U6P A;  3GRR A;  1D0M A;  1DGH A;  5L8R F;  3SAU A;  2R44 A;  4GIT A;  3U61 B;  3HJQ A;  1IBK M;  1KYI A;  4BBA A;  1QQW A;  3B7Z A;  2BNK A;  2LH0 A;  3B7N A;  3C58 A;  1I94 M;  1L1Z A;  1N77 A;  2LNH C;  3CTW B;  4G4O A;  5BPV A;  4LFC M;  2D7G A;  3AL0 C;  1UFZ A;  4L78 A;  1XMO M;  4B7H A;  2JP7 A;  3L28 A;  1DV0 A;  3EIH A;  2A5Y B;  1HNX M;  1IY1 A;  2DWN A;  2KNA A;  4L4U A;  3TWK A;  3KP0 E;  3NWL A;  4FWG A;  4JXJ A;  1OKS A;  2BJW A;  3IHP A;  3J7B A;  4IBC A;  1KFV A;  3VKH A;  4MB7 A;  1TH4 A;  2D7E A;  1QAM A;  1NNU C;  3TWL A;  1X37 A;  2KEB A;  3U6S A;  3LVW A;  3UJN A;  5EP1 A;  2Y21 A;  2CRU A;  3HHX A;  1I4W A;  2G5G X;  3GRV A;  4F2L A;  2UXB M;  2OOB A;  3PXG A;  3T1H M;  1NHW C;  1TF0 B;  4ANR A;  3UMM A;  3U6D A;  3CGW A;  2DWM A;  4GC5 A;  1C1K A;  1G8P A;  2KRK A;  1GJT A;  3I51 A;  3I04 M;  7CAT A;  1OAI A;  2Z3X A;  1NV9 A;  3LQR A;  3KFU G;  1V33 A;  3K9P A;  3U60 B;  1VG5 A;  2OQ4 A;  2AHM A;  2Z8Y M;  4I4L A;  2VDB B;  5EXT A;  2L09 A;  1OFH A;  4CJ6 A;  2Y20 A;  4IBE A;  2L4F A;  3MK6 A;  2J7N A;  5EP4 A;  2MR9 A;  4FCT A;  5FTM A;  1ORY B;  4BLC A;  4JI4 M;  1XXH B;  2R46 A;  1IN5 A;  4PDI A;  4PD2 A;  1H6U A;  3IEC A;  1XB2 B;  1SXJ D;  1DGH B;  2DZN B;  2XSZ D;  1WIV A;  2ZAM A;  5GKN A;  3U6Q A;  2BJV A;  3KVW A;  3MJ5 A;  1AUA A;  2JY8 A;  3T6P A;  3FYD A;  4IBD A;  2X4A A;  1R4G A;  1DGF A;  5EQT A;  4GC9 A;  3LQQ A;  3ILK A;  1PJS A;  1J09 A;  4ITQ A;  1NO1 A;  4AG5 A;  1DGG A;  2YFQ A;  4RF1 A;  1N78 A;  4JI0 M;  2FNA A;  2KA6 B;  4LJ7 A;  1QAQ A;  3AFH A;  4CHT B;  3KDS E;  1YLA A;  2DKL A;  3EIE A;  4AG6 A;  1SXJ E;  3GLF A;  1VDD A;  2UUB M;  5ITQ A;  4P17 A;  2C9O A;  2X49 A;  2F5S A;  2DZO B;  4GKK M;  2O25 A;  1WGN A;  2QHO B;  4I8O A;  2VQE M;  4DUZ M;  4G4N A;  1Q3C A;  2R4E A;  3CF2 A;  2ZBK B;  4YHH M;  1OIZ A;  2UXD M;  3FYC A;  2VII A;  3K9O A;  1MN3 A;  3M7G A;  4FWH A;  4R3D A;  5DNY A;  2JY5 A;  4L15 A;  3PFI A;  4JI1 M;  3HZJ A;  3U6E A;  3HX3 A;  3HU1 A;  4DR5 M;  1PRB A;  3ZH9 B;  2EKF A;  4FCV A;  4WP2 A;  5IWA M;  4JI5 M;  2DAG A;  1GL7 A;  4LF7 M;  3C3D A;  2L7I A;  4LRT A;  1GJS A;  2CEA A;  2HWJ A;  1R5L A;  1GO5 A;  2YQZ A;  4JI7 M;  5KQD A;  5C1B A;  4AQY M;  4NRW A;  2Y0Q A;  4B7G A;  1IBM M;  3I01 M;  4DR6 M;  2P5T A;  4JN6 A;  4LJ5 A;  1KSF X;  2G3Q A;  3A42 A;  2M60 A;  3VK7 A;  4KLN A;  3JR4 A;  1FNN A;  2V1U A;  5FSW A;  1R6B X;  3K2L A;  1LV7 A;  5KQ8 A;  2WSC F;  3GPX A;  2FE8 A;  2L6O A;  1T3T A;  3E21 A;  3B74 A;  2MRO B;  4I5S A;  2XF3 A;  3WHL A;  2OO9 A;  3KOX E;  2KRU A;  4G4R A;  5KPR A;  1R7R A;  2DAK A;  4EIW A;  3KW6 A;  4KT0 F;  3FTC A;  1N32 M;  3GLF B;  3E46 A;  2JNH A;  2H5X A;  1A5T A;  2CP8 A;  5E6J A;  2ZTC A;  4PT5 A;  3GQ3 A;  4D81 A;  5FTL A;  1PJJ A;  5FLX S;  1OTR A;  2JWS A;  4IBJ A;  4M9Z A;  2JXN A;  2LVO C;  4M9S A;  3SMS A;  3T1Y M;  2O5R A;  3A98 B;  4JI3 M;  4CIZ A;  3QWL A;  1ZV1 A;  2QSF X;  4GKJ M;  5ITU A;  3GLI E;  2ERC A;  4OVZ A;  4DR4 M;  2K0B X;  1G41 A;  4M0D A;  3SAS A;  3FD9 A;  3LVV A;  1CUK A;  2EKK A;  1DO0 A;  1GL6 A;  3SAR A;  1SXJ A;  2XSZ A;  4L16 A;  4NRV A;  1N34 M;  1V92 A;  2KNZ A;  2Z4S A;  2DAI A;  4MGI E;  1OJL A;  2JZ0 A;  4IJE A;  1IFY A;  1IN7 A;  4FD2 A;  1JQJ C;  2CE7 A;  4AW4 A;  2HHH M;  3BXW A;  2DVW B;  1GAB A;  2QNJ A;  3W68 A;  4QHT A;  3A45 A;  4AKG A;  1VQ1 A;  4IJF A;  1GLN A;  4DV6 M;  2W82 A;  3U6C A;  4MGK E;  4RNA A;  4YY3 M;  3Q8X A;  4DV0 M;  3L26 A;  4CGY B;  4KO8 A;  2DI0 A;  2LHC A;  3GPU A;  4DR1 M;  4CIS A;  2CHG A;  3KP1 E;  3J81 S;  1QUT A;  3CF0 A;  2CHV A;  4IBB A;  2OPF A;  1NJF A;  1FJG M;  3HJ8 A;  4IBG A;  3IG5 A;  4DV3 M;  4P16 A;  3SFZ A;  2ZAN A;  3AV0 A;  5LMU M;  3VK8 A;  2LVA A;  1QYR A;  1VEG A;  2HKJ A;  3HWS A;  2BWB A;  3FRI A;  3OTO M;  4LGY A;  1V34 A;  3RE8 A;  3GPY A;  2G8L A;  1NHG C;  4JI6 M;  4PDG A;  2WSE F;  3FTD A;  3SYL A;  3T15 A;  3VLF B;  3GQ5 A;  4LF8 M;  4HL4 A;  4OX9 M;  2JZ1 A;  4NOO B;  1Z59 A;  4LY6 A;  2XH9 A;  4D80 A;  1SXJ C;  3QYB A;  2LHG A;  1TDZ A;  2JA2 A;  1QZE A;  1G71 A;  4F1I A;  4GHA A;  4M9X A;  4OVZ B;  1VEJ A;  2I7P A;  2UUC M;  4QHS A;  4GHL A;  4JYA M;  4RKU F;  4OU7 A;  1TDH A;  4W5W A;  1NVM A;  1SXJ B;  4G4Q A;  2EO2 A;  3GLH A;  5KPZ A;  2VQF M;  4G6Z A;  5ITX E;  3PNY A;  3GLG A;  3TPZ A;  3KOW E;  3C3E A;  1NV8 A;  2GNO A;  3FUX A;  4B7F A;  2ZM6 M;  3DZD A;  3VDP A;  2VF7 A;  1YSY A;  2DHR A;  3HHY A;  5BR8 M;  2XFS A;  2JUJ A;  3FKE A;  1QDT A;  4GRI A;  3RGP A;  1Z5C A;  1HNW M;  5IT9 S;  1L2D A;  1J7K A;  3GLI A;  4LZZ A;  4IBI A;  2F5P A;  2JY6 B;  2UU9 M;  2HAK A;  3GQ4 A;  4LF9 M;  4X62 M;  3TQS A;  1YE9 A;  1QAN A;  2DZL A;  3E9S A;  4XGI A;  3FUW A;  2JY7 A;  4AKH A;  2Y0T A;  1PGY A;  1HJP A;  1S3S A;  5EXS A;  1XXH E;  3L27 A;  4X66 M;  5E26 A;  1J5E M;  2OOA A;  3KSJ A;  3SC3 A;  1G4A E;  3UGJ A;  4UN2 B;  3VKG A;  3SMP A;  2C5R A;  4NC6 A;  1XHB A;  3Q8G A;  1HT2 E;  3M6A A;  3TE6 A;  2KW0 A;  2J7O A;  2DWL A;  2KHH A;  1IM2 A;  4DV4 M;  5H37 D;  2QP9 X;  3U6O A;  4R7G A;  3J7A S;  1TH3 A;  4FWD A;  2F4V M;  4B08 A;  4QOZ C;  2F5O A;  3JR5 A;  2APL A;  3W0L B;  1N36 M;  4MGY E;  5ITY A;  2XLJ A;  4L6V 6;  4IBF A;  1XMQ M;  3HHZ A;  1TTE A;  1QUS A;  4LFA M;  2F5N A;  1MU5 A;  4LF6 M;  1OQY A;  2DHY A;  1Q39 A;  4NXN M;  1QZM A;  3I4V A;  4MGH A;  4LJA A;  2QCU A;  1IN6 A;  1XC8 A;  4AI6 A;  1L1T A;  2RKO A;  1TGU A;  2LBC A;  2XGN A;  2QEN A;  2MJ5 B;  3GLH B;  4B3S M;  4B3T M;  1L8Q A;  3B89 A;  4QNM A;  3GLG B;  1NJG A;  3RGS A;  4GIP A;  4QNR A;  2O01 F;  2R0I A;  2XFT A;  3AJI B;  4PCZ A;  3ZCB B;  2FS1 A;  4AZF A;  4WW0 A;  4NL4 H;  1QDR A;  1F4I A;  5JI2 E;  4JI2 M;  4JV5 M;  3SAV A;  3QAU A;  2QBY A;  3HU3 A;  4LJ8 A;  4Q7J A;  1OAO C;  1TR8 A;  1MX0 A;  3GLI B;  2KDL A;  2FFJ A;  3CF6 E;  3W67 A;  2VF8 A;  4DUY M;  3SHF A;  1MJG M;  1HQY E;  1WR1 B;  3IG8 A;  4DR3 M;  5JI3 E;  2M5Z A;  4XBO A;  3T38 A;  4MGZ E;  5ITX A;  3JAM S;  1DO2 A;  1Y8G A;  1OIP A;  1ZAE A;  1ZMW A;  2MGW A;  3FUU A;  3K1J A;  4NSO B;  2YR0 A;  2DWZ B;  3PNV A;  4I81 A; 
#chains in the Genus database with same CATH homology
 2XEP A;  1E94 E;  2C96 A;  4A3V B;  3J2P B;  3E4R A;  3L2A A;  3A46 A;  3SYK A;  2FOI C;  2XZF A;  1Z6T A;  3K8Z A;  4RF0 A;  5A2Q S;  4MM3 B;  1GKI A;  2XZU A;  3VFD A;  1JR3 D;  5EP3 A;  5IZ7 D;  1K3X A;  4KHP M;  3GPP A;  2V6Z M;  4KOD A;  2F5Q A;  5IRE B;  1NNJ A;  3H4M A;  3U5Z A;  1K3W A;  2EA0 A;  2K47 A;  1L2B A;  3I4Y A;  5LMN M;  2R62 A;  1WXQ A;  4OW0 A;  2R4J A;  3KS8 A;  1GVN A;  4HLQ A;  2D7H A;  2R65 A;  4GMQ A;  2RGH A;  3FUV A;  4NSR A;  2KZS A;  4NXM M;  3GRY A;  4FVM A;  4AKI A;  4L8R C;  2CHQ A;  2UXC M;  1NY5 A;  3HJS A;  4FW9 A;  4JI8 M;  1QVR A;  3MHV C;  3KSX A;  2CV1 A;  2HL7 A;  2QBY B;  3FTF A;  3TWM A;  4IIW A;  4LZJ A;  3HGI A;  1QAO A;  5ITR A;  4M0W A;  1N33 M;  4DR7 M;  2C98 A;  3FTE A;  3R9X B;  4Z8X A;  1D2N A;  1IXS B;  1PJI A;  1IQP A;  1YUB A;  1W5T A;  3DOA A;  4DV1 M;  4DV2 M;  2R18 A;  4S12 A;  1IY0 A;  1HT1 E;  3SHG B;  1IN4 A;  2QPA A;  3SAW A;  4LGM A;  2YNM D;  1G59 A;  1DGB A;  3BOS A;  5F3W A;  2KZU A;  5FTJ A;  4WUR A;  3FUT A;  3GP1 A;  3AOE A;  2V1C A;  3U5Z B;  3U6M A;  1L2C A;  3KOY E;  3GRU A;  3LMM A;  2CUZ A;  4II7 A;  5EJC A;  4Z6Y A;  2NQ8 C;  1UM8 A;  2CFO A;  2ZAO A;  5EP2 A;  3L25 A;  2CV2 A;  1E9S A;  4K0K M;  1Z5B A;  2E5L M;  3L29 A;  3VDU A;  3UK6 A;  4X64 M;  5ITT A;  4LRS A;  3KOZ E;  4X65 M;  4ZPX A;  4D82 A;  3KS4 A;  1NSF A;  3DA1 A;  4LFB M;  4DV5 M;  3J27 B;  1IN8 A;  4DV7 M;  1Z5A A;  1IXR C;  4REZ A;  3DFZ A;  4B3M M;  3B9P A;  4BB9 A;  4QOS A;  4B3R M;  1W5S A;  1OFI A;  1R2Z A;  3HKP A;  3GO8 A;  2DXI A;  2UUA M;  1E9R A;  3HHW A;  1NY6 A;  4LF4 M;  4LJ4 A;  3AOG A;  3D8B A;  1IY2 A;  2Q2E B;  1JR3 A;  3UZU A;  4TUW A;  3W0F A;  4FCW A;  1G3I A;  3TL4 X;  3SBJ A;  1EE8 A;  2C99 A;  2LWX A;  3AOE C;  5FTN A;  3U61 A;  3J80 S;  3SAT A;  3NBI A;  3K92 A;  1XNR M;  4LJ9 A;  2KXE A;  2Z7J A;  1HR0 M;  3THG A;  1E32 A;  1R2Y A;  4LJ6 A;  3KXE C;  4LF5 M;  1XWI A;  4IBK A;  2I7N A;  3HU2 A;  3WHK A;  2EUC A;  1HQC A;  4LCB A;  5DYG A;  4DR2 M;  1TH2 A;  4MH0 E;  3R8F A;  2LXE A;  5KO3 A;  2R45 A;  5KPT A;  3M0E A;  2H1R A;  5EXX A;  1XNQ M;  1N75 A;  1IXZ A;  2CV0 A;  3AKZ A;  1K82 A;  4GH9 A;  4LG2 A;  2X8A A;  3RFW A;  2C9C A;  5C18 A;  3D8L A;  1PM5 A;  2QZ4 A;  2Z4R A;  1HNZ M;  1IBL M;  5FTK A;  2HCB A;  2L7H A;  3U60 A;  3ZC7 B;  1Q3B A;  2RGO A;  5DYI A;  1ZQ9 A;  1XXH A;  3U6L A;  3PVS A;  5EXP A;  3U6P A;  8CAT A;  3GRR A;  1DGH A;  3SAU A;  3U61 B;  4GIT A;  3HJQ A;  1IBK M;  1KYI A;  4BBA A;  1QQW A;  2BNK A;  2LH0 A;  3C58 A;  1I94 M;  1L1Z A;  1N77 A;  2LNH C;  3CTW B;  4G4O A;  5BPV A;  4LFC M;  2D7G A;  3AL0 C;  4L78 A;  1XMO M;  4B7H A;  3L28 A;  3EIH A;  2A5Y B;  1HNX M;  1IY1 A;  2DWN A;  4L4U A;  3TWK A;  3KP0 E;  3NWL A;  4FWG A;  4JXJ A;  2BJW A;  3J7B A;  4IBC A;  1KFV A;  3VKH A;  4MB7 A;  1TH4 A;  2D7E A;  1QAM A;  1NNU C;  3TWL A;  1X37 A;  2KEB A;  3U6S A;  3LVW A;  3UJN A;  5EP1 A;  2Y21 A;  3HHX A;  1I4W A;  2G5G X;  3GRV A;  2UXB M;  3T1H M;  3PXG A;  1NHW C;  3UMM A;  3U6D A;  2DWM A;  4GC5 A;  1C1K A;  1G8P A;  2KRK A;  3I51 A;  7CAT A;  2Z3X A;  3LQR A;  3KFU G;  3U60 B;  2OQ4 A;  2AHM A;  4I4L A;  5EXT A;  2L09 A;  1OFH A;  2Y20 A;  4IBE A;  3MK6 A;  2J7N A;  5EP4 A;  5FTM A;  4FCT A;  1ORY B;  4BLC A;  4JI4 M;  1XXH B;  2R46 A;  1IN5 A;  4PDI A;  4PD2 A;  1H6U A;  1SXJ D;  1DGH B;  2DZN B;  2XSZ D;  2ZAM A;  5GKN A;  3U6Q A;  2BJV A;  3KVW A;  3MJ5 A;  3FYD A;  4IBD A;  2X4A A;  1DGF A;  5EQT A;  4GC9 A;  3LQQ A;  3ILK A;  1J09 A;  4ITQ A;  4AG5 A;  1DGG A;  2YFQ A;  4RF1 A;  1N78 A;  4JI0 M;  2FNA A;  2KA6 B;  4LJ7 A;  1QAQ A;  3AFH A;  4CHT B;  3KDS E;  4AG6 A;  3EIE A;  1SXJ E;  3GLF A;  1VDD A;  2UUB M;  5ITQ A;  2C9O A;  2X49 A;  2F5S A;  2DZO B;  4GKK M;  2VQE M;  4I8O A;  4DUZ M;  4G4N A;  1Q3C A;  2R4E A;  3CF2 A;  2ZBK B;  4YHH M;  2UXD M;  3FYC A;  2VII A;  3M7G A;  4FWH A;  4R3D A;  5DNY A;  4L15 A;  3PFI A;  4JI1 M;  3U6E A;  3HU1 A;  4DR5 M;  3ZH9 B;  4FCV A;  5IWA M;  4JI5 M;  4LF7 M;  1GL7 A;  2L7I A;  4LRT A;  2CEA A;  2YQZ A;  4JI7 M;  5KQD A;  5C1B A;  4AQY M;  4NRW A;  2Y0Q A;  4B7G A;  1IBM M;  4DR6 M;  2P5T A;  4JN6 A;  4LJ5 A;  1KSF X;  3A42 A;  2M60 A;  3VK7 A;  4KLN A;  3JR4 A;  1FNN A;  2V1U A;  5FSW A;  1R6B X;  3K2L A;  1LV7 A;  5KQ8 A;  3GPX A;  2FE8 A;  2L6O A;  1T3T A;  4I5S A;  2XF3 A;  3WHL A;  3KOX E;  2KRU A;  4G4R A;  5KPR A;  1R7R A;  4EIW A;  3KW6 A;  3FTC A;  1N32 M;  3GLF B;  5E6J A;  4PT5 A;  3GQ3 A;  4D81 A;  5FTL A;  1PJJ A;  5FLX S;  4IBJ A;  4M9Z A;  4M9S A;  3SMS A;  3T1Y M;  2O5R A;  3A98 B;  4JI3 M;  3QWL A;  4GKJ M;  5ITU A;  2ERC A;  4OVZ A;  4DR4 M;  1G41 A;  4M0D A;  3SAS A;  3FD9 A;  3LVV A;  1DO0 A;  1GL6 A;  3SAR A;  1SXJ A;  2XSZ A;  4L16 A;  4NRV A;  1N34 M;  2Z4S A;  4MGI E;  1OJL A;  4IJE A;  1IN7 A;  4FD2 A;  1JQJ C;  2CE7 A;  4AW4 A;  2HHH M;  2DVW B;  4QHT A;  3A45 A;  4AKG A;  4IJF A;  1GLN A;  4DV6 M;  2W82 A;  3U6C A;  4MGK E;  4RNA A;  4YY3 M;  3Q8X A;  4DV0 M;  3L26 A;  4CGY B;  4KO8 A;  3GPU A;  4CIS A;  4DR1 M;  2CHG A;  3KP1 E;  3J81 S;  3CF0 A;  2CHV A;  4IBB A;  2OPF A;  1NJF A;  1FJG M;  3HJ8 A;  4IBG A;  3IG5 A;  4DV3 M;  4P16 A;  3SFZ A;  2ZAN A;  3AV0 A;  5LMU M;  3VK8 A;  1QYR A;  2HKJ A;  3HWS A;  3OTO M;  4LGY A;  3RE8 A;  3GPY A;  2G8L A;  1NHG C;  4JI6 M;  4PDG A;  3FTD A;  3SYL A;  3T15 A;  3VLF B;  3GQ5 A;  4LF8 M;  4HL4 A;  4OX9 M;  4NOO B;  1Z59 A;  4LY6 A;  2XH9 A;  4D80 A;  1SXJ C;  1TDZ A;  2JA2 A;  4GHA A;  4M9X A;  4OVZ B;  2I7P A;  2UUC M;  4QHS A;  4GHL A;  4JYA M;  4OU7 A;  1TDH A;  4W5W A;  1NVM A;  1SXJ B;  4G4Q A;  2EO2 A;  3GLH A;  5KPZ A;  2VQF M;  4G6Z A;  5ITX E;  3PNY A;  3GLG A;  3TPZ A;  3KOW E;  3FUX A;  4B7F A;  2ZM6 M;  3DZD A;  3VDP A;  1YSY A;  2DHR A;  3HHY A;  5BR8 M;  2XFS A;  3FKE A;  4GRI A;  3RGP A;  1Z5C A;  1HNW M;  5IT9 S;  1L2D A;  1J7K A;  3GLI A;  4LZZ A;  4IBI A;  2F5P A;  2UU9 M;  3GQ4 A;  4LF9 M;  4X62 M;  3TQS A;  1YE9 A;  1QAN A;  3E9S A;  4XGI A;  3FUW A;  4AKH A;  2Y0T A;  1S3S A;  5EXS A;  3L27 A;  4X66 M;  5E26 A;  1J5E M;  3KSJ A;  3SC3 A;  1G4A E;  3UGJ A;  3VKG A;  3SMP A;  2C5R A;  1XHB A;  1HT2 E;  3M6A A;  3TE6 A;  2KW0 A;  2J7O A;  2DWL A;  1IM2 A;  4DV4 M;  5H37 D;  2QP9 X;  3U6O A;  4R7G A;  3J7A S;  1TH3 A;  4FWD A;  2F4V M;  4B08 A;  4QOZ C;  2F5O A;  3JR5 A;  3W0L B;  1N36 M;  4MGY E;  5ITY A;  2XLJ A;  4IBF A;  1XMQ M;  3HHZ A;  4LFA M;  2F5N A;  1MU5 A;  4LF6 M;  1Q39 A;  4NXN M;  1QZM A;  3I4V A;  4MGH A;  4LJA A;  2QCU A;  1IN6 A;  1XC8 A;  4AI6 A;  1L1T A;  2RKO A;  1TGU A;  2XGN A;  2QEN A;  3GLH B;  4B3S M;  4B3T M;  1L8Q A;  3GLG B;  4QNM A;  1NJG A;  3RGS A;  4GIP A;  4QNR A;  3AJI B;  2XFT A;  4PCZ A;  3ZCB B;  4AZF A;  4WW0 A;  4NL4 H;  5JI2 E;  4JI2 M;  4JV5 M;  3SAV A;  3QAU A;  2QBY A;  3HU3 A;  4LJ8 A;  1MX0 A;  3GLI B;  2FFJ A;  3CF6 E;  4DUY M;  3SHF A;  1HQY E;  3IG8 A;  4DR3 M;  5JI3 E;  2M5Z A;  4XBO A;  3T38 A;  4MGZ E;  5ITX A;  3JAM S;  1DO2 A;  1ZAE A;  3FUU A;  4NSO B;  3K1J A;  2YR0 A;  2DWZ B;  3PNV A;  4I81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...