3VLFB

Crystal structure of yeast proteasome interacting protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
MDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA mismatch repair protein HSM3
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/protein binding
total genus 23
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vlfB00
2CE7A 1NY5A 4LRSA 5FTKA 3UK6A 2DZNB 4QOSA 1S3SA 1IM2A 1D2NA 3GLHB 1NJFA 4QHTA 5DYGA 3WHKA 4EIWA 5JI2E 1SXJC 1NJGA 2QPAA 4JN6A 3M0EA 2C98A 5DYIA 3ZH9B 1HQCA 5EQTA 4LCBA 3GLFB 2Z4RA 2R62A 3HU2A 4LJ6A 4D82A 1OJLA 4LJ8A 2BJWA 4LJ5A 4QNMA 1IXZA 2ZAOA 3VFDA 4LJ7A 2C9CA 1IN5A 2QP9X 4FCVA 1SXJD 3EIEA 1IY2A 3HU3A 3KDSE 2DHRA 3WHLA 1IXRC 2ZAMA 3U61B 2KRKA 5EP1A 2X8AA 2CHGA 4LGMA 3PXGA 2BJVA 1G41A 1X37A 1HT1E 3HU1A 4A3VB 1NVMA 2HCBA 2Z4SA 1FNNA 4FD2A 5EP2A 3U5ZB 1OFHA 2C99A 3K1JA 4LJAA 3EIHA 4WW0A 1HQYE 1SXJA 1KYIA 3CF2A 4FW9A 4FCWA 1KSFX 2RKOA 4Z8XA 1JR3D 3GLGA 3SYLA 3DZDA 2ZANA 1E32A 4I81A 4FWDA 1XWIA 2C9OA 5FTMA 4I4LA 1JQJC 3B9PA 2QENA 5FTLA 3GLHA 5EXTA 1DO2A 4LJ9A 1LV7A 3GLIB 1W5TA 3AJIB 2QBYB 1G3IA 4L15A 1DO0A 5EP4A 3MHVC 1JR3A 2CHVA 5C1BA 5EP3A 2XSZD 5EXSA 4D81A 1XXHA 5FTNA 4ZPXA 3GLFA 4KO8A 4FCTA 3SC3A 2DWZB 3R8FA 3PVSA 1UM8A 2V6ZM 1C1KA 4GITA 4KLNA 1IY1A 1OFIA 2V1UA 1IQPA 1NY6A 5JI3E 3H4MA 1QZMA 4L16A 3HWSA 2FNAA 1IN6A 3GLGB 2XSZA 4L4UA 1SXJE 1IN4A 4LY6A 2C96A 3D8BA 1G4AE 1R6BX 4LZZA 1J7KA 1R7RA 3VLFB 1IXSB 1IN8A 2VIIA 4FWGA 4FWHA 2CHQA 2QZ4A 3SYKA 1HT2E 4QHSA 1L8QA 2DVWB 5EXXA 1W5SA 4LJ4A 1NSFA 3KW6A 2DZOB 5FTJA 1XXHB 3M6AA 5EXPA 3BOSA 1IY0A 3PFIA 1IN7A 4D80A 4QNRA 4KODA 5C18A 1E94E 4LRTA 2R65A 2CEAA 1SXJB 3GLIA 3CF0A 1QVRA 3U60B 2QBYA
chains in the Genus database with same CATH superfamily
4DUZM 2KA6B 3DOAA 4NXMM 4LRSA 2Y21A 2Z8YM 5LMUM 1ZMVA 2DZNB 1IBMM 4DV2M 3HHXA 3KSXA 4P16A 4LFCM 3KP0E 3L2AA 4QHTA 4DR3M 3C3EA 2JY7A 2GQFA 4OVZB 4CGYB 1PM5A 4GC5A 4CISA 4B3RM 1NJGA 3BXWA 2XFTA 2C98A 4GIPA 5DYIA 2UXDM 1HQCA 1TH2A 5KPTA 2FH0A 4LCBA 3GLFB 3GQ3A 3FTDA 3SARA 4XBOA 1N33M 1OJLA 4QNMA 2Y0QA 1IXZA 4DV4M 5ITYA 3E9SA 2C9CA 1XHBA 3DA1A 1IN5A 3GQ5A 3U6SA 2P5TA 4MGIE 2APLA 2DHRA 3LVVA 3AOEC 1IXRC 3WHLA 4PT5A 4TUWA 4GH9A 1DGHB 2KRKA 4B7GA 2X8AA 2BJVA 3K9OA 4JXJA 1X37A 3GP1A 2YQZA 3GPXA 4JI5M 4DR7M 1OAOC 2L7HA 3KOYE 2DAEA 3L25A 1MU5A 1SG9A 2Z4SA 3GRRA 2JUJA 3U5ZB 3KSJA 3AL0C 2C99A 3K1JA 1QZEA 3B74A 2M5ZA 2OOBA 4IBKA 2JP7A 2WSCF 5IWAM 1T6OA 4JI0M 1WHCA 4BBAA 4JI6M 1MN3A 1YLAA 4I81A 4FWDA 4REZA 2XZFA 1GABA 5DNYA 1T43A 3KVWA 3E46A 4GMQA 1JQJC 2JXNA 2J7NA 3GLHA 1ORYB 3I4VA 1CUKA 2RGHA 3GLIB 2EO2A 1H6UA 3NBIA 2QBYB 3SBJA 5EP4A 1L1TA 2CHVA 4AZFA 1PRBA 5EP3A 5BPVA 3HJSA 3LCUA 2XSZD 3LQQA 4D81A 1XXHA 2OPFA 2UUBM 2MH8A 3HZJA 3KOWE 3SC3A 3I01M 5IZ7D 3R8FA 3U6DA 3IG8A 4W5WA 4GRIA 1TDZA 4R3DA 3FYCA 2DWLA 4MGZE 5JI3E 2LVNC 1TTEA 3K92A 4NSOB 3RE8A 3T15A 2FFJA 2XSZA 1SXJE 2CUZA 1NHGC 2G8LA 3GRUA 2L2DA 3A46A 1QANA 3SAUA 1GVNA 1IN8A 2FE8A 1Z59A 1GJTA 4X65M 1NV9A 3SYKA 3UZUA 1R4GA 2H1RA 2LVOC 4CJ6A 4IBDA 2LWXA 2B3TA 2K9DA 1D0MA 2D7HA 2MROB 3L28A 3RGSA 2LVPC 4K0KM 1JR3E 3PFIA 2VQFM 1R2ZA 4AG6A 1EIJA 4IBJA 2HAKA 3FRHA 2M60A 3TL4X 2FS1A 3VKHA 4DV0M 3CF0A 3LW5F 1N75A 1G8PA 4GC9A 4NRVA 2RRUA 3JAMS 1Z5BA 2O5RA 2LNHC 3L27A 4IBFA 2CE7A 2V1CA 3J2PB 3LCVB 5FTKA 4B08A 1VEJA 4BLCA 5KQDA 2G3QA 1TR8A 3W68A 2BWBA 4DR5M 1D2NA 3GLHB 2DAGA 3C3DA 3QWLA 1Q3CA 4EIWA 5KPRA 5IT9S 3LMMA 4IBIA 1R5LA 1XB2B 1SXJC 2XGNA 2YNMD 4JN6A 3J80S 4OU7A 4IBEA 1ZV1A 1G59A 3B7NA 4AG5A 4G4RA 2KW0A 4M0WA 3E21A 2JY8A 1Z5AA 1D0KA 2I7PA 4OW0A 3U6OA 2Z4RA 3U6PA 4D82A 3HU2A 4LJ6A 1GO5A 4MM3B 3V76A 4LJ5A 2ZAOA 1HJPA 4DR2M 3I4YA 2F5NA 2Z3XA 1SXJD 1TH4A 2EJSA 1IY2A 1GL6A 3MJ5A 2QNJA 2LBCA 4NOOB 2ZAMA 3U61B 2J7OA 2KZUA 3CTWB 3FKEA 4IBBA 4LF6M 4OX9M 3PXGA 3SMPA 2KNVA 3VDPA 2N35A 1QQWA 2EA0A 1G71A 3KFUG 4A3VB 4HL4A 1AIPC 5EP2A 1PJJA 1OFHA 4LJAA 1SXJA 4DV6M 5E26A 4MGYE 2RKOA 4Z8XA 3J7AS 1Z6TA 3K9PA 4P17A 1JR3D 2WSFF 2RGOA 2MGWA 1ZQ9A 3SYLA 3DZDA 2ZANA 1E32A 3FTCA 5ITXE 3W0LB 1NO1A 1NV8A 2KRUA 2XF3A 1I94M 5BR8M 5A2QS 3FRIA 2OO9A 2ZTDA 2QENA 2JA2A 3AV0A 2JZ0A 4GHAA 2D7GA 2R6FA 4G6ZA 1DV0A 1W5TA 5L8RF 2DENA 2HWJA 4DR6M 3FYDA 1XMOM 1JR3A 3HHYA 5C1BA 3AOGA 1GLNA 2R45A 2LHGA 3PNYA 4ZPXA 1PJSA 3M7GA 4FCTA 2KEBA 2JY5A 3PVSA 1UM8A 3KXEC 4GITA 4DBGB 5FSWA 2CV0A 1DGBA 4AW4A 4JI4M 1OAIA 1ZAEA 3MMPA 1NY6A 4LF9M 1QAOA 4KT0F 5KQ8A 3W0FA 3FE3A 3RFWA 3GLGB 3SAWA 3J81S 1IN4A 4CHTB 3D8BA 4MGHA 1YE9A 4X62M 3FUTA 2YR0A 5H37D 1P3QQ 1G4AE 2CRUA 3B7ZA 3GLGE 3TWMA 1V92A 3Q8XA 1OTRA 1F4IA 2R4EA 2JY6B 3HJ8A 1UFZA 2KNAA 2QZ4A 2LVQD 3C9PA 2R46A 4UN2B 3AOEA 5FLXS 1N77A 1W5SA 3E4RA 1NSFA 3THGA 3KW6A 3ILKA 4GKJM 2DZOB 1NNJA 2XEPA 3FD9A 3TE6A 1OQYA 2L09A 3BOSA 1IY0A 2EKKA 2GNOA 4R71A 1LTMA 2XH9A 5C18A 4B7FA 4LRTA 2R65A 1SXJB 3LVWA 2X49A 4PDIA 4M9SA 2OOAA 1QVRA 1FJGM 3U61A 3I04M 2R18A 2MJ5B 2F5SA 1A5TA 3B7QA 4PDGA 1MX0A 3RGPA 3A45A 4R7GA 4LFAM 3WHKA 1N36M 2F5PA 4DV1M 2Q2EB 4B3SM 3M0EA 4F2LA 2DXIA 3TWKA 1D0LA 3F92A 5ITXA 2JWSA 1V34A 1Q39A 1QUTA 4LGYA 3TQSA 3ZCBB 2VQEM 3QYEA 4M9XA 2R62A 1J5EM 1E9SA 2BJWA 4LFBM 4IJEA 4XK8F 4X66M 2UXCM 1VEKA 1WXQA 3VFDA 3FTFA 1DGFA 4Y28F 4B7HA 1QUSA 2D7EA 3BBZA 4XGIA 2W82A 1QDRA 1HR0M 2JNHA 3A98B 1EE8A 3EIEA 3HU3A 3MK6A 2AHMA 4X64M 2DNAA 5EP1A 4L6V6 4AKHA 1QAQA 2L6OA 3VK8A 1HT1E 3K8ZA 4Q7JA 2Z7JA 4G3OA 4LF8M 2YFQA 1V33A 2ZTCA 2VF8A 4II7A 3NBXX 2R4JA 2UUCM 4Z6YA 3EIHA 2FOIC 2HL7A 4FW9A 4FCWA 4JI3M 3U6MA 3GLGA 4HLQA 1QAMA 4BB9A 2LTUA 3FUVA 1TGUA 4PCZA 2K6BA 3JR4A 2QSFX 4L78A 5GKNA 5KO3A 3U6EA 2E5LM 1XC8A 3AFHA 5EXTA 2QHOB 1N32M 2UXBM 1LV7A 3KS4A 2HKJA 3UGJA 4NSRA 1K3WA 3HJQA 3SATA 1G3IA 2R0IA 1DO0A 3MHVC 5ITQA 2OQ4A 4WURA 2DWNA 1N78A 3QAUA 4MB7A 5EXSA 1WIVA 2DZLA 4DUYM 3J27B 2DWZB 2VF7A 3DFZA 4IIWA 2KDLA 2V6ZM 1GKIA 1C1KA 2I7NA 3HY5A 4KLNA 3HGIA 1VEGA 1OFIA 2XLJA 4ITQA 5EJCA 3VK7A 1JB0F 1QZMA 2L4FA 1PJIA 1VQ1A 2FNAA 4G4NA 1TH3A 4L4UA 2C96A 1IFYA 3AKZA 1EFUB 1TF0B 2C5RA 4LZZA 4AKGA 1J7KA 1R7RA 2DAIA 2KXEA 3HKPA 4JI1M 1IXSB 1PJTA 5E6JA 4FWHA 2CHQA 4KHPM 4I8OA 8CATA 2Y0TA 3KOXE 3HHZA 4QHSA 3IHPA 2DVWB 7CATA 4LJ4A 1IBLM 5FTJA 2KNZA 2BNKA 4GKKM 1L2CA 5EXPA 4D80A 2CV1A 2UUAM 3SFZA 1OIPA 1K82A 3T38A 3GLFE 2JZ1A 1AUAA 1WR1B 2K47A 4IBGA 4DV5M 1DGGA 1PGYA 4DR1M 1HNXM 3L29A 3U60B 2L4EA 3HHWA 4LZJA 4GHLA 1KFVA 3PNVA 1NY5A 1VDDA 3UK6A 4B3TM 2CFOA 2NQ8C 4QOSA 3A42A 2CV2A 1S3SA 2MR9A 3LQRA 4MGKE 1Q02A 3SMSA 2F4VM 1IM2A 1NJFA 5DYGA 4RNAA 5LMNM 5JI2E 3GO8A 3U6CA 2QPAA 2F5OA 4NL4H 1YUBA 3W67A 2HHHM 4DR4M 3ZH9B 4G4QA 5EQTA 4F1IA 2DAMA 3H4JA 2XZUA 1IBKM 4RF1A 4G4OA 1NNUC 4IJFA 1K3XA 4LF5M 4RKUF 3OTOM 4LJ8A 3KS8A 3IG5A 3CGWA 2BWEA 3T1HM 1MJGM 1T3TA 1BVSA 4LJ7A 4NC6A 3TWLA 2DKLA 2QP9X 4FCVA 4DV7M 5F3WA 5ITTA 3KDSE 3CF6E 3Q8GA 4HEOA 2DWMA 1ZMUA 3UMMA 1TDHA 3GLIE 1XNQM 2CHGA 4LGMA 1G41A 3QYBA 4AQYM 2F5QA 3HU1A 3SHFA 4CIZA 1YSYA 3I51A 3L26A 4NXNM 4I5SA 1NVMA 2HCBA 4FD2A 1FNNA 2UU9M 2ERCA 2Y20A 2R44A 4LF7M 4WW0A 1HQYE 4ANRA 1KYIA 3CF2A 4YHHM 1KSFX 5ITUA 3KOZE 3U6QA 4L8RC 5ITRA 1Z5CA 2LVAA 4FVMA 4S12A 2LH0A 1XWIA 1L1ZA 4WP2A 2C9OA 5FTMA 4I4LA 3FUWA 2K0BX 2L7IA 3B9PA 4JI7M 5FTLA 4RF0A 1HNZM 3VKGA 1HNWM 1IXSA 1DO2A 4LJ9A 4OVZA 3AJIB 2CWBA 1PJQA 1Q3BA 1XMQM 1C7YA 1QYRA 1WGNA 3FUUA 3UJNA 2J5YA 4JV5M 4L15A 1WJ7A 4PD2A 3GQ4A 3ZC7B 1QDTA 4NRWA 1GL7A 2XFSA 3K2LA 3GPPA 1Y8GA 5FTNA 3GLFA 4M0DA 1E9RA 4KO8A 4MH0E 2KHHA 5DFLA 5IREB 3JR5A 2X4AA 2QCUA 2QQ8A 3SHGB 2DHYA 3GPYA 1IY1A 2V1UA 1IQPA 3U60A 3H4MA 4DV3M 3SASA 4YY3M 4GEWA 1VDLA 3GRYA 3HWSA 1IN6A 4L16A 3U6LA 3KP1E 1OIZA 1DGHA 2WSEF 4LY6A 1OKSA 2DI0A 4M9ZA 2A5YB 3VDUA 1RU3A 1VG5A 1R6BX 2ZBKB 4JYAM 2EUCA 3TPZA 3T1YM 4JI2M 2O01F 1GJSA 2WZJA 3GPUA 2DAKA 3VLFB 1N34M 2H5XA 3U5ZA 2VIIA 4FWGA 3R9XB 3IECA 4AKIA 2LHCA 1HT2E 3T6PA 2ZM6M 1L8QA 2VDBB 3NWLA 3B89A 3GLHE 4LG2A 5EXXA 4QOZC 1ZMWA 1I4WA 2G5GX 1NHWC 1XXHB 3FUXA 3M6AA 1XNRM 4LF4M 3FTEA 1WGLA 4JI8M 3ZQJA 1IN7A 3C58A 3GRVA 4QNRA 2LXEA 2KZSA 4KODA 1R2YA 1L2DA 1E94E 1XXHE 2CP8A 2O25A 3HX3A 4IBCA 4B3MM 2CEAA 2EKFA 4AI6A 3J7BA 3GLIA 5KPZA 1J09A 3D8LA 1L2BA 2QBYA 3SAVA
chains in the Genus database with same CATH topology
4DUZM 2KA6B 3DOAA 4NXMM 4LRSA 2Y21A 5LMUM 2DZNB 1IBMM 4DV2M 3HHXA 3KSXA 4P16A 4LFCM 3KP0E 3L2AA 4QHTA 4DR3M 4OVZB 4CGYB 1PM5A 4CISA 4B3RM 4GC5A 1NJGA 2XFTA 2C98A 4GIPA 5DYIA 2UXDM 1HQCA 1TH2A 5KPTA 4LCBA 3GLFB 3GQ3A 3FTDA 3SARA 4XBOA 1N33M 1OJLA 4QNMA 2Y0QA 1IXZA 4DV4M 5ITYA 3E9SA 2C9CA 1XHBA 3DA1A 1IN5A 3GQ5A 3U6SA 2P5TA 4MGIE 2DHRA 3LVVA 3AOEC 1IXRC 3WHLA 4PT5A 4TUWA 4GH9A 1DGHB 2KRKA 4B7GA 2X8AA 2BJVA 3GP1A 4JXJA 1X37A 3GPXA 2YQZA 4JI5M 4DR7M 2L7HA 3KOYE 3L25A 1MU5A 2Z4SA 3GRRA 3U5ZB 3KSJA 3AL0C 2C99A 3K1JA 2M5ZA 4IBKA 5IWAM 4JI0M 4BBAA 4JI6M 4I81A 4REZA 4FWDA 2XZFA 5DNYA 3KVWA 4GMQA 1JQJC 2J7NA 3GLHA 1ORYB 3I4VA 2RGHA 3GLIB 2EO2A 1H6UA 3NBIA 2QBYB 3SBJA 5EP4A 1L1TA 2CHVA 4AZFA 5BPVA 5EP3A 3HJSA 2OPFA 2XSZD 3LQQA 4D81A 1XXHA 2UUBM 3KOWE 3SC3A 5IZ7D 3R8FA 3U6DA 3IG8A 4W5WA 4GRIA 1TDZA 4R3DA 3FYCA 2DWLA 4MGZE 5JI3E 3K92A 4NSOB 3RE8A 3T15A 2FFJA 2XSZA 1SXJE 2CUZA 1NHGC 2G8LA 3GRUA 3A46A 1QANA 3SAUA 1GVNA 1IN8A 2FE8A 1Z59A 4X65M 3SYKA 3UZUA 2H1RA 4IBDA 2LWXA 2D7HA 3L28A 3RGSA 4K0KM 3PFIA 2VQFM 1R2ZA 4AG6A 4IBJA 2M60A 3TL4X 3VKHA 4DV0M 3CF0A 1N75A 1G8PA 4GC9A 4NRVA 3JAMS 1Z5BA 2O5RA 2LNHC 3L27A 4IBFA 2CE7A 2V1CA 3J2PB 5FTKA 4B08A 4BLCA 5KQDA 4DR5M 1D2NA 3GLHB 4EIWA 5KPRA 3QWLA 1Q3CA 5IT9S 3LMMA 4IBIA 2YNMD 2XGNA 1SXJC 3J80S 4OU7A 4JN6A 4IBEA 1G59A 4AG5A 4G4RA 2KW0A 4M0WA 1Z5AA 2I7PA 4OW0A 3U6OA 2Z4RA 3U6PA 4D82A 3HU2A 4LJ6A 4MM3B 4LJ5A 2ZAOA 4DR2M 3I4YA 2F5NA 2Z3XA 1SXJD 1TH4A 3MJ5A 1IY2A 1GL6A 4NOOB 2ZAMA 3U61B 2J7OA 2KZUA 3CTWB 3FKEA 4IBBA 4LF6M 4OX9M 3PXGA 3SMPA 3VDPA 1QQWA 2EA0A 3KFUG 4A3VB 4HL4A 5EP2A 1PJJA 1OFHA 4LJAA 1SXJA 4DV6M 5E26A 4MGYE 2RKOA 4Z8XA 3J7AS 1Z6TA 1JR3D 2RGOA 1ZQ9A 3SYLA 3DZDA 2ZANA 1E32A 3FTCA 5ITXE 3W0LB 2XF3A 2KRUA 1I94M 5BR8M 5A2QS 2QENA 2JA2A 3AV0A 4GHAA 2D7GA 4G6ZA 1W5TA 4DR6M 3FYDA 1XMOM 1JR3A 3HHYA 5C1BA 3AOGA 1GLNA 2R45A 3PNYA 4ZPXA 3M7GA 4FCTA 2KEBA 3PVSA 1UM8A 3KXEC 4GITA 5FSWA 2CV0A 1DGBA 4AW4A 4JI4M 1ZAEA 1NY6A 4LF9M 1QAOA 5KQ8A 3W0FA 3RFWA 3GLGB 3SAWA 3J81S 1IN4A 4CHTB 3D8BA 4MGHA 1YE9A 4X62M 3FUTA 2YR0A 5H37D 1G4AE 3TWMA 3Q8XA 2R4EA 3HJ8A 2QZ4A 1N77A 2R46A 5FLXS 3AOEA 1W5SA 3E4RA 1NSFA 3THGA 3KW6A 3ILKA 4GKJM 2DZOB 1NNJA 2XEPA 3FD9A 3TE6A 2L09A 3BOSA 1IY0A 2XH9A 5C18A 4B7FA 4LRTA 2R65A 1SXJB 3LVWA 2X49A 4PDIA 4M9SA 1QVRA 1FJGM 3U61A 2R18A 2F5SA 4PDGA 1MX0A 3RGPA 3A45A 4R7GA 4LFAM 3WHKA 1N36M 2F5PA 4DV1M 2Q2EB 4B3SM 3M0EA 2DXIA 3TWKA 5ITXA 3ZCBB 1Q39A 4LGYA 3TQSA 2VQEM 4M9XA 2R62A 1J5EM 1E9SA 2BJWA 4LFBM 4IJEA 4X66M 2UXCM 1WXQA 3VFDA 3FTFA 1DGFA 4B7HA 1HR0M 2D7EA 4XGIA 2W82A 3A98B 1EE8A 3EIEA 3HU3A 3MK6A 2AHMA 4X64M 5EP1A 4AKHA 1QAQA 2L6OA 3VK8A 1HT1E 3K8ZA 2Z7JA 4LF8M 2YFQA 4II7A 2R4JA 2UUCM 4Z6YA 3EIHA 2FOIC 2HL7A 4FW9A 4FCWA 4JI3M 3U6MA 3GLGA 4HLQA 1QAMA 4BB9A 3FUVA 1TGUA 4PCZA 3JR4A 4L78A 5GKNA 5KO3A 3U6EA 2E5LM 1XC8A 3AFHA 5EXTA 1N32M 2UXBM 1LV7A 3KS4A 2HKJA 3UGJA 4NSRA 1K3WA 3HJQA 3SATA 1G3IA 1DO0A 3MHVC 5ITQA 2OQ4A 4WURA 2DWNA 1N78A 3QAUA 4MB7A 5EXSA 4DUYM 3J27B 2DWZB 3DFZA 4IIWA 2V6ZM 1GKIA 1C1KA 2I7NA 4KLNA 3HGIA 2XLJA 1OFIA 4ITQA 5EJCA 3VK7A 1QZMA 1PJIA 2FNAA 4G4NA 1TH3A 4L4UA 2C96A 3AKZA 2C5RA 4LZZA 4AKGA 1J7KA 1R7RA 2KXEA 3HKPA 4JI1M 1IXSB 5E6JA 4FWHA 2CHQA 4KHPM 4I8OA 8CATA 2Y0TA 3KOXE 3HHZA 4QHSA 2DVWB 7CATA 4LJ4A 1IBLM 5FTJA 2BNKA 4GKKM 1L2CA 5EXPA 4D80A 2CV1A 2UUAM 3SFZA 1K82A 3T38A 2K47A 4IBGA 4DV5M 4DR1M 1DGGA 1HNXM 3L29A 3U60B 3HHWA 4LZJA 4GHLA 1KFVA 3PNVA 1NY5A 1VDDA 3UK6A 4B3TM 2CFOA 2NQ8C 4QOSA 3A42A 2CV2A 1S3SA 4MGKE 3LQRA 3SMSA 2F4VM 1IM2A 1NJFA 5DYGA 4RNAA 5LMNM 5JI2E 3GO8A 3U6CA 2QPAA 2F5OA 4NL4H 1YUBA 2HHHM 4DR4M 3ZH9B 4G4QA 5EQTA 2XZUA 1IBKM 4RF1A 4G4OA 1NNUC 4IJFA 1K3XA 4LF5M 3OTOM 4LJ8A 3KS8A 3IG5A 3T1HM 1T3TA 4LJ7A 3TWLA 2QP9X 4FCVA 4DV7M 5F3WA 5ITTA 3KDSE 3CF6E 2DWMA 3UMMA 1TDHA 1XNQM 2CHGA 4LGMA 1G41A 4AQYM 2F5QA 3HU1A 3SHFA 1YSYA 3I51A 3L26A 4NXNM 4I5SA 1NVMA 2HCBA 4FD2A 1FNNA 2UU9M 2ERCA 2Y20A 4LF7M 4WW0A 1HQYE 1KYIA 3CF2A 4YHHM 1KSFX 5ITUA 3KOZE 3U6QA 4L8RC 5ITRA 1Z5CA 4FVMA 4S12A 2LH0A 1XWIA 1L1ZA 2C9OA 5FTMA 4I4LA 3FUWA 2L7IA 3B9PA 4JI7M 5FTLA 4RF0A 1HNZM 3VKGA 1HNWM 1DO2A 4LJ9A 4OVZA 3AJIB 1XMQM 1Q3BA 1QYRA 3UJNA 3FUUA 4JV5M 4L15A 3GQ4A 4PD2A 3ZC7B 4NRWA 1GL7A 2XFSA 3K2LA 3GPPA 5FTNA 3GLFA 4M0DA 1E9RA 4KO8A 4MH0E 5IREB 3JR5A 2X4AA 2QCUA 3SHGB 3GPYA 1IY1A 2V1UA 1IQPA 3U60A 3H4MA 4DV3M 3SASA 4YY3M 3GRYA 3HWSA 4L16A 1IN6A 3U6LA 3KP1E 4LY6A 1DGHA 4M9ZA 2A5YB 3VDUA 2ZBKB 1R6BX 4JYAM 2EUCA 3TPZA 3T1YM 4JI2M 3GPUA 3VLFB 1N34M 3U5ZA 2VIIA 4FWGA 3R9XB 4AKIA 2ZM6M 1HT2E 1L8QA 3NWLA 4LG2A 5EXXA 4QOZC 1I4WA 2G5GX 1NHWC 1XXHB 3FUXA 3M6AA 1XNRM 4LF4M 3FTEA 4JI8M 1IN7A 3C58A 3GRVA 4QNRA 2LXEA 2KZSA 4KODA 1R2YA 1L2DA 1E94E 4IBCA 4B3MM 2CEAA 4AI6A 3J7BA 3GLIA 5KPZA 1J09A 3D8LA 1L2BA 2QBYA 3SAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE7 A;  1NY5 A;  4LRS A;  5FTK A;  3UK6 A;  2DZN B;  4QOS A;  1S3S A;  1IM2 A;  1D2N A;  3GLH B;  1NJF A;  4QHT A;  5DYG A;  3WHK A;  4EIW A;  5JI2 E;  1SXJ C;  1NJG A;  2QPA A;  4JN6 A;  3M0E A;  2C98 A;  5DYI A;  3ZH9 B;  1HQC A;  5EQT A;  4LCB A;  3GLF B;  2Z4R A;  2R62 A;  3HU2 A;  4LJ6 A;  4D82 A;  1OJL A;  4LJ8 A;  2BJW A;  4LJ5 A;  4QNM A;  1IXZ A;  2ZAO A;  3VFD A;  4LJ7 A;  2C9C A;  1IN5 A;  2QP9 X;  4FCV A;  1SXJ D;  3EIE A;  1IY2 A;  3HU3 A;  3KDS E;  2DHR A;  3WHL A;  1IXR C;  2ZAM A;  3U61 B;  2KRK A;  5EP1 A;  2X8A A;  2CHG A;  4LGM A;  3PXG A;  2BJV A;  1G41 A;  1X37 A;  1HT1 E;  3HU1 A;  4A3V B;  1NVM A;  2HCB A;  2Z4S A;  1FNN A;  4FD2 A;  5EP2 A;  3U5Z B;  1OFH A;  2C99 A;  3K1J A;  4LJA A;  3EIH A;  4WW0 A;  1HQY E;  1SXJ A;  1KYI A;  3CF2 A;  4FW9 A;  4FCW A;  1KSF X;  2RKO A;  4Z8X A;  1JR3 D;  3GLG A;  3SYL A;  3DZD A;  2ZAN A;  1E32 A;  4I81 A;  4FWD A;  1XWI A;  2C9O A;  5FTM A;  4I4L A;  1JQJ C;  3B9P A;  2QEN A;  5FTL A;  3GLH A;  5EXT A;  1DO2 A;  4LJ9 A;  1LV7 A;  3GLI B;  1W5T A;  3AJI B;  2QBY B;  1G3I A;  4L15 A;  1DO0 A;  5EP4 A;  3MHV C;  1JR3 A;  2CHV A;  5C1B A;  5EP3 A;  2XSZ D;  5EXS A;  4D81 A;  1XXH A;  5FTN A;  4ZPX A;  3GLF A;  4KO8 A;  4FCT A;  3SC3 A;  2DWZ B;  3R8F A;  3PVS A;  1UM8 A;  2V6Z M;  1C1K A;  4GIT A;  4KLN A;  1IY1 A;  1OFI A;  2V1U A;  1IQP A;  1NY6 A;  5JI3 E;  3H4M A;  1QZM A;  4L16 A;  3HWS A;  2FNA A;  1IN6 A;  3GLG B;  2XSZ A;  4L4U A;  1SXJ E;  1IN4 A;  4LY6 A;  2C96 A;  3D8B A;  1G4A E;  1R6B X;  4LZZ A;  1J7K A;  1R7R A;  3VLF B;  1IXS B;  1IN8 A;  2VII A;  4FWG A;  4FWH A;  2CHQ A;  2QZ4 A;  3SYK A;  1HT2 E;  4QHS A;  1L8Q A;  2DVW B;  5EXX A;  1W5S A;  4LJ4 A;  1NSF A;  3KW6 A;  2DZO B;  5FTJ A;  1XXH B;  3M6A A;  5EXP A;  3BOS A;  1IY0 A;  3PFI A;  1IN7 A;  4D80 A;  4QNR A;  4KOD A;  5C18 A;  1E94 E;  4LRT A;  2R65 A;  2CEA A;  1SXJ B;  3GLI A;  3CF0 A;  1QVR A;  3U60 B;  2QBY A; 
#chains in the Genus database with same CATH topology
 4DUZ M;  2KA6 B;  3DOA A;  4NXM M;  4LRS A;  2Y21 A;  2Z8Y M;  5LMU M;  1ZMV A;  2DZN B;  1IBM M;  4DV2 M;  3HHX A;  3KSX A;  4P16 A;  4LFC M;  3KP0 E;  3L2A A;  4QHT A;  4DR3 M;  3C3E A;  2JY7 A;  2GQF A;  4OVZ B;  4CGY B;  1PM5 A;  4GC5 A;  4CIS A;  4B3R M;  1NJG A;  3BXW A;  2XFT A;  2C98 A;  4GIP A;  5DYI A;  2UXD M;  1HQC A;  1TH2 A;  5KPT A;  2FH0 A;  4LCB A;  3GLF B;  3GQ3 A;  3FTD A;  3SAR A;  4XBO A;  1N33 M;  1OJL A;  4QNM A;  2Y0Q A;  1IXZ A;  4DV4 M;  5ITY A;  3E9S A;  2C9C A;  1XHB A;  3DA1 A;  1IN5 A;  3GQ5 A;  3U6S A;  2P5T A;  4MGI E;  2APL A;  2DHR A;  3LVV A;  3AOE C;  1IXR C;  3WHL A;  4PT5 A;  4TUW A;  4GH9 A;  1DGH B;  2KRK A;  4B7G A;  2X8A A;  2BJV A;  3K9O A;  4JXJ A;  1X37 A;  3GP1 A;  2YQZ A;  3GPX A;  4JI5 M;  4DR7 M;  1OAO C;  2L7H A;  3KOY E;  2DAE A;  3L25 A;  1MU5 A;  1SG9 A;  2Z4S A;  3GRR A;  2JUJ A;  3U5Z B;  3KSJ A;  3AL0 C;  2C99 A;  3K1J A;  1QZE A;  3B74 A;  2M5Z A;  2OOB A;  4IBK A;  2JP7 A;  2WSC F;  5IWA M;  1T6O A;  4JI0 M;  1WHC A;  4BBA A;  4JI6 M;  1MN3 A;  1YLA A;  4I81 A;  4FWD A;  4REZ A;  2XZF A;  1GAB A;  5DNY A;  1T43 A;  3KVW A;  3E46 A;  4GMQ A;  1JQJ C;  2JXN A;  2J7N A;  3GLH A;  1ORY B;  3I4V A;  1CUK A;  2RGH A;  3GLI B;  2EO2 A;  1H6U A;  3NBI A;  2QBY B;  3SBJ A;  5EP4 A;  1L1T A;  2CHV A;  4AZF A;  1PRB A;  5EP3 A;  5BPV A;  3HJS A;  3LCU A;  2XSZ D;  3LQQ A;  4D81 A;  1XXH A;  2OPF A;  2UUB M;  2MH8 A;  3HZJ A;  3KOW E;  3SC3 A;  3I01 M;  5IZ7 D;  3R8F A;  3U6D A;  3IG8 A;  4W5W A;  4GRI A;  1TDZ A;  4R3D A;  3FYC A;  2DWL A;  4MGZ E;  5JI3 E;  2LVN C;  1TTE A;  3K92 A;  4NSO B;  3RE8 A;  3T15 A;  2FFJ A;  2XSZ A;  1SXJ E;  2CUZ A;  1NHG C;  2G8L A;  3GRU A;  2L2D A;  3A46 A;  1QAN A;  3SAU A;  1GVN A;  1IN8 A;  2FE8 A;  1Z59 A;  1GJT A;  4X65 M;  1NV9 A;  3SYK A;  3UZU A;  1R4G A;  2H1R A;  2LVO C;  4CJ6 A;  4IBD A;  2LWX A;  2B3T A;  2K9D A;  1D0M A;  2D7H A;  2MRO B;  3L28 A;  3RGS A;  2LVP C;  4K0K M;  1JR3 E;  3PFI A;  2VQF M;  1R2Z A;  4AG6 A;  1EIJ A;  4IBJ A;  2HAK A;  3FRH A;  2M60 A;  3TL4 X;  2FS1 A;  3VKH A;  4DV0 M;  3CF0 A;  3LW5 F;  1N75 A;  1G8P A;  4GC9 A;  4NRV A;  2RRU A;  3JAM S;  1Z5B A;  2O5R A;  2LNH C;  3L27 A;  4IBF A;  2CE7 A;  2V1C A;  3J2P B;  3LCV B;  5FTK A;  4B08 A;  1VEJ A;  4BLC A;  5KQD A;  2G3Q A;  1TR8 A;  3W68 A;  2BWB A;  4DR5 M;  1D2N A;  3GLH B;  2DAG A;  3C3D A;  3QWL A;  1Q3C A;  4EIW A;  5KPR A;  5IT9 S;  3LMM A;  4IBI A;  1R5L A;  1XB2 B;  1SXJ C;  2XGN A;  2YNM D;  4JN6 A;  3J80 S;  4OU7 A;  4IBE A;  1ZV1 A;  1G59 A;  3B7N A;  4AG5 A;  4G4R A;  2KW0 A;  4M0W A;  3E21 A;  2JY8 A;  1Z5A A;  1D0K A;  2I7P A;  4OW0 A;  3U6O A;  2Z4R A;  3U6P A;  4D82 A;  3HU2 A;  4LJ6 A;  1GO5 A;  4MM3 B;  3V76 A;  4LJ5 A;  2ZAO A;  1HJP A;  4DR2 M;  3I4Y A;  2F5N A;  2Z3X A;  1SXJ D;  1TH4 A;  2EJS A;  1IY2 A;  1GL6 A;  3MJ5 A;  2QNJ A;  2LBC A;  4NOO B;  2ZAM A;  3U61 B;  2J7O A;  2KZU A;  3CTW B;  3FKE A;  4IBB A;  4LF6 M;  4OX9 M;  3PXG A;  3SMP A;  2KNV A;  3VDP A;  2N35 A;  1QQW A;  2EA0 A;  1G71 A;  3KFU G;  4A3V B;  4HL4 A;  1AIP C;  5EP2 A;  1PJJ A;  1OFH A;  4LJA A;  1SXJ A;  4DV6 M;  5E26 A;  4MGY E;  2RKO A;  4Z8X A;  3J7A S;  1Z6T A;  3K9P A;  4P17 A;  1JR3 D;  2WSF F;  2RGO A;  2MGW A;  1ZQ9 A;  3SYL A;  3DZD A;  2ZAN A;  1E32 A;  3FTC A;  5ITX E;  3W0L B;  1NO1 A;  1NV8 A;  2KRU A;  2XF3 A;  1I94 M;  5BR8 M;  5A2Q S;  3FRI A;  2OO9 A;  2ZTD A;  2QEN A;  2JA2 A;  3AV0 A;  2JZ0 A;  4GHA A;  2D7G A;  2R6F A;  4G6Z A;  1DV0 A;  1W5T A;  5L8R F;  2DEN A;  2HWJ A;  4DR6 M;  3FYD A;  1XMO M;  1JR3 A;  3HHY A;  5C1B A;  3AOG A;  1GLN A;  2R45 A;  2LHG A;  3PNY A;  4ZPX A;  1PJS A;  3M7G A;  4FCT A;  2KEB A;  2JY5 A;  3PVS A;  1UM8 A;  3KXE C;  4GIT A;  4DBG B;  5FSW A;  2CV0 A;  1DGB A;  4AW4 A;  4JI4 M;  1OAI A;  1ZAE A;  3MMP A;  1NY6 A;  4LF9 M;  1QAO A;  4KT0 F;  5KQ8 A;  3W0F A;  3FE3 A;  3RFW A;  3GLG B;  3SAW A;  3J81 S;  1IN4 A;  4CHT B;  3D8B A;  4MGH A;  1YE9 A;  4X62 M;  3FUT A;  2YR0 A;  5H37 D;  1P3Q Q;  1G4A E;  2CRU A;  3B7Z A;  3GLG E;  3TWM A;  1V92 A;  3Q8X A;  1OTR A;  1F4I A;  2R4E A;  2JY6 B;  3HJ8 A;  1UFZ A;  2KNA A;  2QZ4 A;  2LVQ D;  3C9P A;  2R46 A;  4UN2 B;  3AOE A;  5FLX S;  1N77 A;  1W5S A;  3E4R A;  1NSF A;  3THG A;  3KW6 A;  3ILK A;  4GKJ M;  2DZO B;  1NNJ A;  2XEP A;  3FD9 A;  3TE6 A;  1OQY A;  2L09 A;  3BOS A;  1IY0 A;  2EKK A;  2GNO A;  4R71 A;  1LTM A;  2XH9 A;  5C18 A;  4B7F A;  4LRT A;  2R65 A;  1SXJ B;  3LVW A;  2X49 A;  4PDI A;  4M9S A;  2OOA A;  1QVR A;  1FJG M;  3U61 A;  3I04 M;  2R18 A;  2MJ5 B;  2F5S A;  1A5T A;  3B7Q A;  4PDG A;  1MX0 A;  3RGP A;  3A45 A;  4R7G A;  4LFA M;  3WHK A;  1N36 M;  2F5P A;  4DV1 M;  2Q2E B;  4B3S M;  3M0E A;  4F2L A;  2DXI A;  3TWK A;  1D0L A;  3F92 A;  5ITX A;  2JWS A;  1V34 A;  1Q39 A;  1QUT A;  4LGY A;  3TQS A;  3ZCB B;  2VQE M;  3QYE A;  4M9X A;  2R62 A;  1J5E M;  1E9S A;  2BJW A;  4LFB M;  4IJE A;  4XK8 F;  4X66 M;  2UXC M;  1VEK A;  1WXQ A;  3VFD A;  3FTF A;  1DGF A;  4Y28 F;  4B7H A;  1QUS A;  2D7E A;  3BBZ A;  4XGI A;  2W82 A;  1QDR A;  1HR0 M;  2JNH A;  3A98 B;  1EE8 A;  3EIE A;  3HU3 A;  3MK6 A;  2AHM A;  4X64 M;  2DNA A;  5EP1 A;  4L6V 6;  4AKH A;  1QAQ A;  2L6O A;  3VK8 A;  1HT1 E;  3K8Z A;  4Q7J A;  2Z7J A;  4G3O A;  4LF8 M;  2YFQ A;  1V33 A;  2ZTC A;  2VF8 A;  4II7 A;  3NBX X;  2R4J A;  2UUC M;  4Z6Y A;  3EIH A;  2FOI C;  2HL7 A;  4FW9 A;  4FCW A;  4JI3 M;  3U6M A;  3GLG A;  4HLQ A;  1QAM A;  4BB9 A;  2LTU A;  3FUV A;  1TGU A;  4PCZ A;  2K6B A;  3JR4 A;  2QSF X;  4L78 A;  5GKN A;  5KO3 A;  3U6E A;  2E5L M;  1XC8 A;  3AFH A;  5EXT A;  2QHO B;  1N32 M;  2UXB M;  1LV7 A;  3KS4 A;  2HKJ A;  3UGJ A;  4NSR A;  1K3W A;  3HJQ A;  3SAT A;  1G3I A;  2R0I A;  1DO0 A;  3MHV C;  5ITQ A;  2OQ4 A;  4WUR A;  2DWN A;  1N78 A;  3QAU A;  4MB7 A;  5EXS A;  1WIV A;  2DZL A;  4DUY M;  3J27 B;  2DWZ B;  2VF7 A;  3DFZ A;  4IIW A;  2KDL A;  2V6Z M;  1GKI A;  1C1K A;  2I7N A;  3HY5 A;  4KLN A;  3HGI A;  1VEG A;  1OFI A;  2XLJ A;  4ITQ A;  5EJC A;  3VK7 A;  1JB0 F;  1QZM A;  2L4F A;  1PJI A;  1VQ1 A;  2FNA A;  4G4N A;  1TH3 A;  4L4U A;  2C96 A;  1IFY A;  3AKZ A;  1EFU B;  1TF0 B;  2C5R A;  4LZZ A;  4AKG A;  1J7K A;  1R7R A;  2DAI A;  2KXE A;  3HKP A;  4JI1 M;  1IXS B;  1PJT A;  5E6J A;  4FWH A;  2CHQ A;  4KHP M;  4I8O A;  8CAT A;  2Y0T A;  3KOX E;  3HHZ A;  4QHS A;  3IHP A;  2DVW B;  7CAT A;  4LJ4 A;  1IBL M;  5FTJ A;  2KNZ A;  2BNK A;  4GKK M;  1L2C A;  5EXP A;  4D80 A;  2CV1 A;  2UUA M;  3SFZ A;  1OIP A;  1K82 A;  3T38 A;  3GLF E;  2JZ1 A;  1AUA A;  1WR1 B;  2K47 A;  4IBG A;  4DV5 M;  1DGG A;  1PGY A;  4DR1 M;  1HNX M;  3L29 A;  3U60 B;  2L4E A;  3HHW A;  4LZJ A;  4GHL A;  1KFV A;  3PNV A;  1NY5 A;  1VDD A;  3UK6 A;  4B3T M;  2CFO A;  2NQ8 C;  4QOS A;  3A42 A;  2CV2 A;  1S3S A;  2MR9 A;  3LQR A;  4MGK E;  1Q02 A;  3SMS A;  2F4V M;  1IM2 A;  1NJF A;  5DYG A;  4RNA A;  5LMN M;  5JI2 E;  3GO8 A;  3U6C A;  2QPA A;  2F5O A;  4NL4 H;  1YUB A;  3W67 A;  2HHH M;  4DR4 M;  3ZH9 B;  4G4Q A;  5EQT A;  4F1I A;  2DAM A;  3H4J A;  2XZU A;  1IBK M;  4RF1 A;  4G4O A;  1NNU C;  4IJF A;  1K3X A;  4LF5 M;  4RKU F;  3OTO M;  4LJ8 A;  3KS8 A;  3IG5 A;  3CGW A;  2BWE A;  3T1H M;  1MJG M;  1T3T A;  1BVS A;  4LJ7 A;  4NC6 A;  3TWL A;  2DKL A;  2QP9 X;  4FCV A;  4DV7 M;  5F3W A;  5ITT A;  3KDS E;  3CF6 E;  3Q8G A;  4HEO A;  2DWM A;  1ZMU A;  3UMM A;  1TDH A;  3GLI E;  1XNQ M;  2CHG A;  4LGM A;  1G41 A;  3QYB A;  4AQY M;  2F5Q A;  3HU1 A;  3SHF A;  4CIZ A;  1YSY A;  3I51 A;  3L26 A;  4NXN M;  4I5S A;  1NVM A;  2HCB A;  4FD2 A;  1FNN A;  2UU9 M;  2ERC A;  2Y20 A;  2R44 A;  4LF7 M;  4WW0 A;  1HQY E;  4ANR A;  1KYI A;  3CF2 A;  4YHH M;  1KSF X;  5ITU A;  3KOZ E;  3U6Q A;  4L8R C;  5ITR A;  1Z5C A;  2LVA A;  4FVM A;  4S12 A;  2LH0 A;  1XWI A;  1L1Z A;  4WP2 A;  2C9O A;  5FTM A;  4I4L A;  3FUW A;  2K0B X;  2L7I A;  3B9P A;  4JI7 M;  5FTL A;  4RF0 A;  1HNZ M;  3VKG A;  1HNW M;  1IXS A;  1DO2 A;  4LJ9 A;  4OVZ A;  3AJI B;  2CWB A;  1PJQ A;  1Q3B A;  1XMQ M;  1C7Y A;  1QYR A;  1WGN A;  3FUU A;  3UJN A;  2J5Y A;  4JV5 M;  4L15 A;  1WJ7 A;  4PD2 A;  3GQ4 A;  3ZC7 B;  1QDT A;  4NRW A;  1GL7 A;  2XFS A;  3K2L A;  3GPP A;  1Y8G A;  5FTN A;  3GLF A;  4M0D A;  1E9R A;  4KO8 A;  4MH0 E;  2KHH A;  5DFL A;  5IRE B;  3JR5 A;  2X4A A;  2QCU A;  2QQ8 A;  3SHG B;  2DHY A;  3GPY A;  1IY1 A;  2V1U A;  1IQP A;  3U60 A;  3H4M A;  4DV3 M;  3SAS A;  4YY3 M;  4GEW A;  1VDL A;  3GRY A;  3HWS A;  1IN6 A;  4L16 A;  3U6L A;  3KP1 E;  1OIZ A;  1DGH A;  2WSE F;  4LY6 A;  1OKS A;  2DI0 A;  4M9Z A;  2A5Y B;  3VDU A;  1RU3 A;  1VG5 A;  1R6B X;  2ZBK B;  4JYA M;  2EUC A;  3TPZ A;  3T1Y M;  4JI2 M;  2O01 F;  1GJS A;  2WZJ A;  3GPU A;  2DAK A;  3VLF B;  1N34 M;  2H5X A;  3U5Z A;  2VII A;  4FWG A;  3R9X B;  3IEC A;  4AKI A;  2LHC A;  1HT2 E;  3T6P A;  2ZM6 M;  1L8Q A;  2VDB B;  3NWL A;  3B89 A;  3GLH E;  4LG2 A;  5EXX A;  4QOZ C;  1ZMW A;  1I4W A;  2G5G X;  1NHW C;  1XXH B;  3FUX A;  3M6A A;  1XNR M;  4LF4 M;  3FTE A;  1WGL A;  4JI8 M;  3ZQJ A;  1IN7 A;  3C58 A;  3GRV A;  4QNR A;  2LXE A;  2KZS A;  4KOD A;  1R2Y A;  1L2D A;  1E94 E;  1XXH E;  2CP8 A;  2O25 A;  3HX3 A;  4IBC A;  4B3M M;  2CEA A;  2EKF A;  4AI6 A;  3J7B A;  3GLI A;  5KPZ A;  1J09 A;  3D8L A;  1L2B A;  2QBY A;  3SAV A; 
#chains in the Genus database with same CATH homology
 4DUZ M;  2KA6 B;  3DOA A;  4NXM M;  4LRS A;  2Y21 A;  5LMU M;  2DZN B;  1IBM M;  4DV2 M;  3HHX A;  3KSX A;  4P16 A;  4LFC M;  3KP0 E;  3L2A A;  4QHT A;  4DR3 M;  4OVZ B;  4CGY B;  1PM5 A;  4CIS A;  4B3R M;  4GC5 A;  1NJG A;  2XFT A;  2C98 A;  4GIP A;  5DYI A;  2UXD M;  1HQC A;  1TH2 A;  5KPT A;  4LCB A;  3GLF B;  3GQ3 A;  3FTD A;  3SAR A;  4XBO A;  1N33 M;  1OJL A;  4QNM A;  2Y0Q A;  1IXZ A;  4DV4 M;  5ITY A;  3E9S A;  2C9C A;  1XHB A;  3DA1 A;  1IN5 A;  3GQ5 A;  3U6S A;  2P5T A;  4MGI E;  2DHR A;  3LVV A;  3AOE C;  1IXR C;  3WHL A;  4PT5 A;  4TUW A;  4GH9 A;  1DGH B;  2KRK A;  4B7G A;  2X8A A;  2BJV A;  3GP1 A;  4JXJ A;  1X37 A;  3GPX A;  2YQZ A;  4JI5 M;  4DR7 M;  2L7H A;  3KOY E;  3L25 A;  1MU5 A;  2Z4S A;  3GRR A;  3U5Z B;  3KSJ A;  3AL0 C;  2C99 A;  3K1J A;  2M5Z A;  4IBK A;  5IWA M;  4JI0 M;  4BBA A;  4JI6 M;  4I81 A;  4REZ A;  4FWD A;  2XZF A;  5DNY A;  3KVW A;  4GMQ A;  1JQJ C;  2J7N A;  3GLH A;  1ORY B;  3I4V A;  2RGH A;  3GLI B;  2EO2 A;  1H6U A;  3NBI A;  2QBY B;  3SBJ A;  5EP4 A;  1L1T A;  2CHV A;  4AZF A;  5BPV A;  5EP3 A;  3HJS A;  2OPF A;  2XSZ D;  3LQQ A;  4D81 A;  1XXH A;  2UUB M;  3KOW E;  3SC3 A;  5IZ7 D;  3R8F A;  3U6D A;  3IG8 A;  4W5W A;  4GRI A;  1TDZ A;  4R3D A;  3FYC A;  2DWL A;  4MGZ E;  5JI3 E;  3K92 A;  4NSO B;  3RE8 A;  3T15 A;  2FFJ A;  2XSZ A;  1SXJ E;  2CUZ A;  1NHG C;  2G8L A;  3GRU A;  3A46 A;  1QAN A;  3SAU A;  1GVN A;  1IN8 A;  2FE8 A;  1Z59 A;  4X65 M;  3SYK A;  3UZU A;  2H1R A;  4IBD A;  2LWX A;  2D7H A;  3L28 A;  3RGS A;  4K0K M;  3PFI A;  2VQF M;  1R2Z A;  4AG6 A;  4IBJ A;  2M60 A;  3TL4 X;  3VKH A;  4DV0 M;  3CF0 A;  1N75 A;  1G8P A;  4GC9 A;  4NRV A;  3JAM S;  1Z5B A;  2O5R A;  2LNH C;  3L27 A;  4IBF A;  2CE7 A;  2V1C A;  3J2P B;  5FTK A;  4B08 A;  4BLC A;  5KQD A;  4DR5 M;  1D2N A;  3GLH B;  4EIW A;  5KPR A;  3QWL A;  1Q3C A;  5IT9 S;  3LMM A;  4IBI A;  2YNM D;  2XGN A;  1SXJ C;  3J80 S;  4OU7 A;  4JN6 A;  4IBE A;  1G59 A;  4AG5 A;  4G4R A;  2KW0 A;  4M0W A;  1Z5A A;  2I7P A;  4OW0 A;  3U6O A;  2Z4R A;  3U6P A;  4D82 A;  3HU2 A;  4LJ6 A;  4MM3 B;  4LJ5 A;  2ZAO A;  4DR2 M;  3I4Y A;  2F5N A;  2Z3X A;  1SXJ D;  1TH4 A;  3MJ5 A;  1IY2 A;  1GL6 A;  4NOO B;  2ZAM A;  3U61 B;  2J7O A;  2KZU A;  3CTW B;  3FKE A;  4IBB A;  4LF6 M;  4OX9 M;  3PXG A;  3SMP A;  3VDP A;  1QQW A;  2EA0 A;  3KFU G;  4A3V B;  4HL4 A;  5EP2 A;  1PJJ A;  1OFH A;  4LJA A;  1SXJ A;  4DV6 M;  5E26 A;  4MGY E;  2RKO A;  4Z8X A;  3J7A S;  1Z6T A;  1JR3 D;  2RGO A;  1ZQ9 A;  3SYL A;  3DZD A;  2ZAN A;  1E32 A;  3FTC A;  5ITX E;  3W0L B;  2XF3 A;  2KRU A;  1I94 M;  5BR8 M;  5A2Q S;  2QEN A;  2JA2 A;  3AV0 A;  4GHA A;  2D7G A;  4G6Z A;  1W5T A;  4DR6 M;  3FYD A;  1XMO M;  1JR3 A;  3HHY A;  5C1B A;  3AOG A;  1GLN A;  2R45 A;  3PNY A;  4ZPX A;  3M7G A;  4FCT A;  2KEB A;  3PVS A;  1UM8 A;  3KXE C;  4GIT A;  5FSW A;  2CV0 A;  1DGB A;  4AW4 A;  4JI4 M;  1ZAE A;  1NY6 A;  4LF9 M;  1QAO A;  5KQ8 A;  3W0F A;  3RFW A;  3GLG B;  3SAW A;  3J81 S;  1IN4 A;  4CHT B;  3D8B A;  4MGH A;  1YE9 A;  4X62 M;  3FUT A;  2YR0 A;  5H37 D;  1G4A E;  3TWM A;  3Q8X A;  2R4E A;  3HJ8 A;  2QZ4 A;  1N77 A;  2R46 A;  5FLX S;  3AOE A;  1W5S A;  3E4R A;  1NSF A;  3THG A;  3KW6 A;  3ILK A;  4GKJ M;  2DZO B;  1NNJ A;  2XEP A;  3FD9 A;  3TE6 A;  2L09 A;  3BOS A;  1IY0 A;  2XH9 A;  5C18 A;  4B7F A;  4LRT A;  2R65 A;  1SXJ B;  3LVW A;  2X49 A;  4PDI A;  4M9S A;  1QVR A;  1FJG M;  3U61 A;  2R18 A;  2F5S A;  4PDG A;  1MX0 A;  3RGP A;  3A45 A;  4R7G A;  4LFA M;  3WHK A;  1N36 M;  2F5P A;  4DV1 M;  2Q2E B;  4B3S M;  3M0E A;  2DXI A;  3TWK A;  5ITX A;  3ZCB B;  1Q39 A;  4LGY A;  3TQS A;  2VQE M;  4M9X A;  2R62 A;  1J5E M;  1E9S A;  2BJW A;  4LFB M;  4IJE A;  4X66 M;  2UXC M;  1WXQ A;  3VFD A;  3FTF A;  1DGF A;  4B7H A;  1HR0 M;  2D7E A;  4XGI A;  2W82 A;  3A98 B;  1EE8 A;  3EIE A;  3HU3 A;  3MK6 A;  2AHM A;  4X64 M;  5EP1 A;  4AKH A;  1QAQ A;  2L6O A;  3VK8 A;  1HT1 E;  3K8Z A;  2Z7J A;  4LF8 M;  2YFQ A;  4II7 A;  2R4J A;  2UUC M;  4Z6Y A;  3EIH A;  2FOI C;  2HL7 A;  4FW9 A;  4FCW A;  4JI3 M;  3U6M A;  3GLG A;  4HLQ A;  1QAM A;  4BB9 A;  3FUV A;  1TGU A;  4PCZ A;  3JR4 A;  4L78 A;  5GKN A;  5KO3 A;  3U6E A;  2E5L M;  1XC8 A;  3AFH A;  5EXT A;  1N32 M;  2UXB M;  1LV7 A;  3KS4 A;  2HKJ A;  3UGJ A;  4NSR A;  1K3W A;  3HJQ A;  3SAT A;  1G3I A;  1DO0 A;  3MHV C;  5ITQ A;  2OQ4 A;  4WUR A;  2DWN A;  1N78 A;  3QAU A;  4MB7 A;  5EXS A;  4DUY M;  3J27 B;  2DWZ B;  3DFZ A;  4IIW A;  2V6Z M;  1GKI A;  1C1K A;  2I7N A;  4KLN A;  3HGI A;  2XLJ A;  1OFI A;  4ITQ A;  5EJC A;  3VK7 A;  1QZM A;  1PJI A;  2FNA A;  4G4N A;  1TH3 A;  4L4U A;  2C96 A;  3AKZ A;  2C5R A;  4LZZ A;  4AKG A;  1J7K A;  1R7R A;  2KXE A;  3HKP A;  4JI1 M;  1IXS B;  5E6J A;  4FWH A;  2CHQ A;  4KHP M;  4I8O A;  8CAT A;  2Y0T A;  3KOX E;  3HHZ A;  4QHS A;  2DVW B;  7CAT A;  4LJ4 A;  1IBL M;  5FTJ A;  2BNK A;  4GKK M;  1L2C A;  5EXP A;  4D80 A;  2CV1 A;  2UUA M;  3SFZ A;  1K82 A;  3T38 A;  2K47 A;  4IBG A;  4DV5 M;  4DR1 M;  1DGG A;  1HNX M;  3L29 A;  3U60 B;  3HHW A;  4LZJ A;  4GHL A;  1KFV A;  3PNV A;  1NY5 A;  1VDD A;  3UK6 A;  4B3T M;  2CFO A;  2NQ8 C;  4QOS A;  3A42 A;  2CV2 A;  1S3S A;  4MGK E;  3LQR A;  3SMS A;  2F4V M;  1IM2 A;  1NJF A;  5DYG A;  4RNA A;  5LMN M;  5JI2 E;  3GO8 A;  3U6C A;  2QPA A;  2F5O A;  4NL4 H;  1YUB A;  2HHH M;  4DR4 M;  3ZH9 B;  4G4Q A;  5EQT A;  2XZU A;  1IBK M;  4RF1 A;  4G4O A;  1NNU C;  4IJF A;  1K3X A;  4LF5 M;  3OTO M;  4LJ8 A;  3KS8 A;  3IG5 A;  3T1H M;  1T3T A;  4LJ7 A;  3TWL A;  2QP9 X;  4FCV A;  4DV7 M;  5F3W A;  5ITT A;  3KDS E;  3CF6 E;  2DWM A;  3UMM A;  1TDH A;  1XNQ M;  2CHG A;  4LGM A;  1G41 A;  4AQY M;  2F5Q A;  3HU1 A;  3SHF A;  1YSY A;  3I51 A;  3L26 A;  4NXN M;  4I5S A;  1NVM A;  2HCB A;  4FD2 A;  1FNN A;  2UU9 M;  2ERC A;  2Y20 A;  4LF7 M;  4WW0 A;  1HQY E;  1KYI A;  3CF2 A;  4YHH M;  1KSF X;  5ITU A;  3KOZ E;  3U6Q A;  4L8R C;  5ITR A;  1Z5C A;  4FVM A;  4S12 A;  2LH0 A;  1XWI A;  1L1Z A;  2C9O A;  5FTM A;  4I4L A;  3FUW A;  2L7I A;  3B9P A;  4JI7 M;  5FTL A;  4RF0 A;  1HNZ M;  3VKG A;  1HNW M;  1DO2 A;  4LJ9 A;  4OVZ A;  3AJI B;  1XMQ M;  1Q3B A;  1QYR A;  3UJN A;  3FUU A;  4JV5 M;  4L15 A;  3GQ4 A;  4PD2 A;  3ZC7 B;  4NRW A;  1GL7 A;  2XFS A;  3K2L A;  3GPP A;  5FTN A;  3GLF A;  4M0D A;  1E9R A;  4KO8 A;  4MH0 E;  5IRE B;  3JR5 A;  2X4A A;  2QCU A;  3SHG B;  3GPY A;  1IY1 A;  2V1U A;  1IQP A;  3U60 A;  3H4M A;  4DV3 M;  3SAS A;  4YY3 M;  3GRY A;  3HWS A;  4L16 A;  1IN6 A;  3U6L A;  3KP1 E;  4LY6 A;  1DGH A;  4M9Z A;  2A5Y B;  3VDU A;  2ZBK B;  1R6B X;  4JYA M;  2EUC A;  3TPZ A;  3T1Y M;  4JI2 M;  3GPU A;  3VLF B;  1N34 M;  3U5Z A;  2VII A;  4FWG A;  3R9X B;  4AKI A;  2ZM6 M;  1HT2 E;  1L8Q A;  3NWL A;  4LG2 A;  5EXX A;  4QOZ C;  1I4W A;  2G5G X;  1NHW C;  1XXH B;  3FUX A;  3M6A A;  1XNR M;  4LF4 M;  3FTE A;  4JI8 M;  1IN7 A;  3C58 A;  3GRV A;  4QNR A;  2LXE A;  2KZS A;  4KOD A;  1R2Y A;  1L2D A;  1E94 E;  4IBC A;  4B3M M;  2CEA A;  4AI6 A;  3J7B A;  3GLI A;  5KPZ A;  1J09 A;  3D8L A;  1L2B A;  2QBY A;  3SAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...