3VLFB

Crystal structure of yeast proteasome interacting protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
b'MDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA mismatch repair protein HSM3
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/protein binding
total genus 23
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vlfB00
1IXZA 4FCVA 2V1UA 3KDSE 1QZMA 3U61B 3WHLA 2DHRA 5DYGA 3B9PA 5EXSA 4A3VB 3UK6A 4FCTA 4LJ6A 3KW6A 5EP3A 4LRSA 3PVSA 5FTJA 1KYIA 1R6BX 3U5ZB 2C96A 4L4UA 3GLIB 2Z4RA 4KLNA 5EXXA 3SYLA 3WHKA 1SXJE 3SC3A 5JI3E 2CHGA 1IY2A 3GLHB 4LZZA 4LRTA 1JQJC 1G4AE 1IN6A 3GLIA 1IN4A 2R62A 3GLHA 3MHVC 5EP1A 1DO2A 5JI2E 1NVMA 4FD2A 1DO0A 4FWHA 1W5SA 1HQCA 4L16A 5EXTA 1OFIA 5EP4A 1JR3A 5DYIA 4QHTA 4LGMA 1HT2E 1IXSB 3GLGB 1IN5A 4FW9A 5FTMA 4ZPXA 2DZNB 5FTKA 5C18A 2ZANA 1IN7A 2CEAA 3K1JA 1C1KA 3HU3A 3HWSA 4FCWA 3VFDA 3GLGA 4L15A 4LJ8A 2CE7A 1SXJC 4WW0A 2QZ4A 1NY6A 3U60B 3VLFB 2BJWA 2C9CA 4KO8A 4LJ7A 1SXJD 1XWIA 4LJ5A 1E32A 2CHQA 4LCBA 1QVRA 2XSZD 1LV7A 4FWGA 4GITA 3GLFB 5C1BA 1NJFA 2C98A 3PFIA 4QNMA 3DZDA 2KRKA 5EXPA 2DVWB 2V6ZM 1SXJB 5FTLA 2FNAA 2QP9X 4FWDA 3ZH9B 3GLFA 3HU2A 1KSFX 4LJ9A 1X37A 4LY6A 3HU1A 4I4LA 1SXJA 1UM8A 4Z8XA 2R65A 1FNNA 4I81A 5EP2A 1J7KA 1NJGA 1NSFA 1E94E 4D82A 5EQTA 4D80A 3R8FA 1OJLA 1W5TA 1XXHB 3H4MA 4D81A 3EIEA 3CF0A 2DZOB 3M0EA 3SYKA 2DWZB 1OFHA 2Z4SA 1IM2A 1HT1E 2QENA 2CHVA 1XXHA 2BJVA 1JR3D 4LJAA 4LJ4A 1IY0A 2C9OA 2C99A 2ZAMA 2QBYB 1G3IA 2ZAOA 3PXGA 1R7RA 5FTNA 1L8QA 4QNRA 3BOSA 1NY5A 4JN6A 4QOSA 4KODA 1IQPA 2HCBA 1D2NA 3D8BA 2VIIA 2X8AA 2QPAA 2RKOA 2XSZA 1IY1A 1HQYE 4EIWA 3M6AA 2QBYA 1G41A 3CF2A 1S3SA 3AJIB 1IN8A 3EIHA 4QHSA 1IXRC
chains in the Genus database with same CATH superfamily
1IXZA 4MB7A 2LHCA 4FCVA 1QUTA 4L78A 3B89A 3WHLA 2GNOA 3SAUA 4A3VB 2Y0QA 3B9PA 5EXSA 3UK6A 1DGHA 4LJ6A 3KW6A 3DA1A 3PVSA 1R6BX 3UZUA 4DV7M 2G5GX 4CGYB 5IWAM 4OW0A 5JI3E 2JXNA 4JI8M 1SXJE 1PJQA 1TH2A 2CHGA 2D7HA 2L4FA 1E9RA 4BB9A 2JY8A 4LRTA 4XGIA 2VDBB 2LVAA 4MGYE 1GL6A 4JV5M 2KHHA 2ZM6M 3FYCA 2V1CA 1V33A 3LCVB 3QYBA 4HEOA 3U6DA 1Q02A 2FS1A 3SHGB 3J2PB 5JI2E 1NVMA 4FD2A 1DO0A 5KQDA 1XMQM 4AKGA 3B7ZA 1OFIA 1OTRA 3KXEC 4Y28F 4AW4A 3UJNA 5BR8M 4QHTA 4B7HA 3GLGB 4FW9A 4MGZE 2L6OA 4OU7A 2ZTDA 3TQSA 1MJGM 1V34A 1XXHE 1IN7A 2UXCM 5IT9S 3E46A 4I8OA 2K47A 4FCWA 3FTDA 2XEPA 4AG5A 4L15A 1IXSA 3W0FA 1N34M 3OTOM 2KDLA 1HNZM 4ANRA 1IBKM 2C9CA 3AV0A 1YUBA 4IJEA 2O5RA 4MGKE 5ITRA 2CHQA 2X4AA 2LVOC 1I4WA 1MX0A 3GP1A 1QDRA 3IG8A 5KO3A 3U60A 4GITA 4GIPA 1JB0F 4IBDA 4OX9M 2RGHA 5H37D 3QWLA 1Q3CA 3SASA 1NHGC 3J81S 4FWDA 3ZH9B 2LXEA 4RF1A 3HU2A 4BBAA 1KSFX 4QOZC 4LY6A 3HHXA 2CV1A 1QANA 2O01F 2OO9A 1MU5A 2I7PA 4RNAA 2J7OA 5ITYA 2FE8A 3PNVA 1D0MA 5EP2A 2JNHA 5ITQA 1G59A 3AL0C 1J7KA 1SG9A 3LQQA 1NO1A 2W82A 1NSFA 3A45A 4IBCA 5DNYA 5EQTA 5FLXS 4AKIA 1WXQA 4CIZA 4I5SA 1PJTA 3GLIE 3J27B 4LG2A 4IIWA 1HNWM 4D81A 4LFBM 3B74A 2P5TA 3EIEA 4IBKA 5BPVA 1K82A 1EE8A 3C58A 3SYKA 2DWZB 2EO2A 2LVQD 1IM2A 4X66M 2BNKA 1GABA 2J7NA 3F92A 2R4EA 1GLNA 2BJVA 1TH3A 1JR3D 4LJAA 3K9PA 1XNRM 1N78A 1WIVA 3U6CA 5GKNA 1WGLA 4IBIA 3GRYA 2KZUA 4AG6A 2QBYB 1L8QA 2XH9A 4LF5M 2HWJA 4GC5A 2HCBA 2MJ5B 2DHYA 3CTWB 2UUAM 1ZMVA 2Y21A 1HQYE 1QQWA 2APLA 4AQYM 1R2YA 1AUAA 4MGHA 4JI5M 1G41A 1IFYA 4OVZA 3HHWA 2KXEA 3A98B 3NBIA 1HJPA 1IBMM 3AJIB 2EA0A 3EIHA 4QHSA 1R4GA 2XGNA 4FVMA 3FTCA 2DWLA 2V1UA 3U61B 3SAVA 4JI3M 2KEBA 4MGIE 1ZAEA 2JY7A 2I7NA 3TWLA 2L09A 4CJ6A 1BVSA 4JI4M 3Q8GA 3FRHA 3U5ZB 2C96A 2QNJA 1HR0M 4LF6M 3HJSA 3SYLA 2DWNA 4YY3M 4II7A 3SC3A 3WHKA 4X62M 2F5OA 4X64M 3GLHB 2DAIA 3U6OA 1FJGM 1HNXM 2KNVA 1H6UA 2G3QA 3KFUG 5ITUA 4DV5M 1IN4A 2R62A 1VDDA 2YQZA 3MHVC 1OAIA 4KT0F 7CATA 4JI7M 3L26A 2XLJA 1VQ1A 2L2DA 2L7HA 2MGWA 4B7FA 4DV1M 4AI6A 4S12A 4HLQA 2WSCF 2XF3A 4LGMA 3HHYA 4NXMM 4G3OA 1OKSA 4IBFA 5FTMA 3V76A 1ZQ9A 2WSFF 4NSOB 2C5RA 2CEAA 2CP8A 3Q8XA 2CV0A 2XZFA 3VFDA 3KOYE 3GLGA 4LJ8A 5KPTA 2CE7A 1L2DA 2R45A 2OOBA 2QZ4A 3K92A 3VLFB 2BJWA 3C3EA 2Z7JA 1YE9A 4KO8A 2YNMD 2DI0A 4IBEA 4LJ5A 5FSWA 4LCBA 5KPZA 2M60A 4JI1M 2XSZD 2DAMA 4Z6YA 3L27A 1NJFA 4B08A 4PDGA 3DZDA 3GRRA 2HHHM 3SMPA 4GHAA 2DVWB 4G4QA 3SATA 3GPXA 3QAUA 1SXJB 5FTLA 2K6BA 4L8RC 2JUJA 5LMNM 5ITXA 1ZMUA 2DAGA 2FFJA 1Z6TA 2DAEA 3H4JA 1VEJA 4LJ9A 4MH0E 3TWKA 2F5NA 1X37A 1TH4A 2OQ4A 3RE8A 3VKGA 3SHFA 1G8PA 3THGA 1WHCA 2F5QA 2Q2EB 4Z8XA 1GL7A 3KS4A 4PCZA 2R0IA 3SARA 3HKPA 3R9XB 3FD9A 3HHZA 3PNYA 2CV2A 2H5XA 3TE6A 4D80A 4M9XA 2DKLA 1WGNA 1OJLA 4M0DA 2LNHC 4RF0A 1XXHB 3H4MA 3CF0A 2DZOB 1R5LA 1F4IA 5KPRA 3VDUA 3LVVA 1WJ7A 1OFHA 2HKJA 3IG5A 3FRIA 3NWLA 4AZFA 2QENA 2QCUA 4P17A 3BBZA 4AKHA 1CUKA 2D7GA 3L28A 3GO8A 4R3DA 1IY0A 3ZC7B 2C99A 4LF9M 3SMSA 2HAKA 3GPPA 3FTEA 2LBCA 3NBXX 1VG5A 3BOSA 4JN6A 3D8LA 3KP1E 2QHOB 1D2NA 3T6PA 2VIIA 3E21A 4LZJA 4GC9A 2X49A 3VK7A 4LF4M 1IY1A 2RGOA 4EIWA 3M6AA 2QBYA 2DWMA 1OIZA 3FTFA 2DENA 3CF2A 1WR1B 1R2ZA 1TR8A 2D7EA 1IXRC 4NOOB 1T6OA 4DR2M 3K9OA 2RRUA 2JWSA 2Z8YM 3KDSE 1QZMA 4DR6M 2R46A 1PM5A 1P3QQ 5DYGA 2E5LM 2FH0A 2EKKA 4HL4A 1RU3A 3L29A 1GO5A 3KOZE 3JR5A 5FTJA 4LRSA 2HL7A 2LTUA 3MMPA 2WZJA 3MK6A 1QZEA 3I4VA 3U61A 2DAKA 3GLIB 2Z4RA 3GRUA 4KLNA 5EXXA 4YHHM 4DV4M 3J80S 1J5EM 3VKHA 1IY2A 1Z5AA 4IBGA 4LZZA 4NSRA 1GJSA 2JY6B 2CRUA 2MROB 1JQJC 2UXDM 1G4AE 3U5ZA 1Z5CA 2JY5A 2ZBKB 4G4NA 3KS8A 2ERCA 2KNAA 3E4RA 1XHBA 4NRVA 3GLHA 1DO2A 3TL4X 2UUCM 3HZJA 1N32M 1W5SA 1HQCA 4LGYA 1L1ZA 4G6ZA 4MM3B 2JZ1A 1JR3A 1D0LA 5DYIA 2KW0A 3HJQA 2DZLA 2JP7A 1IN5A 1YLAA 2MH8A 3A42A 4GKKM 2VQFM 2GQFA 1IBLM 3FE3A 1PGYA 5C18A 5FTKA 2O25A 1TTEA 4UN2B 2VF8A 2B3TA 8CATA 3U6PA 3AOEC 1SXJC 2F4VM 2XFTA 5E26A 2AHMA 4IBBA 3T1YM 1Y8GA 4DV6M 1SXJD 1XWIA 3GPYA 1E32A 2VQEM 3J7BA 4JI6M 4DV0M 4F1IA 4TUWA 2BWBA 1LV7A 4XBOA 1L1TA 2KNZA 3RGPA 3GLHE 1NHWC 5KQ8A 5A2QS 3PFIA 3GQ3A 3GLFB 3ILKA 2KRKA 1AIPC 1ZV1A 3QYEA 3LMMA 5L8RF 1E9SA 1JR3E 4DV3M 2F5PA 3T15A 2BWEA 4M0WA 3UMMA 4IJFA 1T3TA 1OQYA 3B7NA 3GQ4A 1PJSA 2KZSA 3LW5F 2J5YA 4GHLA 1GKIA 3B7QA 1OAOC 3DFZA 1UFZA 3HU1A 4G4RA 2QSFX 3FUUA 1SXJA 1UM8A 2LH0A 3CF6E 2ZTCA 3U6EA 3C9PA 4IBJA 2Z3XA 2R65A 1QUSA 4DR3M 2R44A 1A5TA 1NV9A 1DV0A 3J7AS 2LVPC 3IECA 4DV2M 3E9SA 1TF0B 5IREB 1VDLA 2WSEF 3R8FA 4NRWA 4LF8M 2N35A 2R18A 3K8ZA 3I4YA 2JA2A 3KSXA 3M0EA 1NV8A 2R6FA 3FUXA 3I01M 5DFLA 3U6MA 5IZ7D 4DR7M 2Z4SA 1HT1E 3BXWA 3DOAA 3VDPA 2CHVA 2L7IA 1N36M 1XXHA 4WP2A 4WURA 1DGGA 2F5SA 4LJ4A 1XB2B 4DR4M 3TWMA 2ZAMA 2FOIC 2UUBM 1OIPA 1G3IA 4GMQA 4JXJA 3U6QA 1K3XA 5FTNA 3GLGE 4QNRA 1IQPA 1Q3BA 3D8BA 2X8AA 4ITQA 2L4EA 2XSZA 3IHPA 3AOGA 4LFAM 1S3SA 4CHTB 4CISA 2LHGA 3LVWA 1XNQM 1DGHB 1G71A 3HX3A 3JR4A 3FUWA 3C3DA 4GRIA 1DGBA 1XC8A 4BLCA 4NC6A 4DUYM 1QAOA 1QAQA 2CUZA 2M5ZA 3VK8A 4GH9A 4G4OA 3KOWE 1PJJA 2DHRA 1N33M 4GEWA 4FCTA 2Y0TA 3JAMS 5ITXE 1TGUA 5EP3A 2DNAA 2XFSA 3HY5A 1KYIA 2YFQA 1V92A 1D0KA 4L4UA 4RKUF 4NXNM 3AKZA 1Z5BA 5ITTA 1C7YA 1VEKA 3KVWA 3LCUA 1J09A 3I04M 1IN6A 3GLIA 1L2BA 4B3SM 5EP1A 3T1HM 3FUTA 4JI0M 3TPZA 4KHPM 4FWHA 4L16A 5EXTA 4W5WA 5EP4A 4PD2A 5LMUM 1HT2E 1IXSB 4Q7JA 3ZQJA 3FUVA 1T43A 3AFHA 4DUZM 5F3WA 4ZPXA 2DZNB 3K2LA 1GJTA 1NNUC 2ZANA 1N77A 3K1JA 1C1KA 2Y20A 3HU3A 2EJSA 3HWSA 1ZMWA 3W68A 1PRBA 4WW0A 4REZA 3T38A 1NY6A 3SAWA 3U60B 2OOAA 4LJ7A 4LFCM 3M7GA 2CFOA 2EUCA 4X65M 3CGWA 4NL4H 4B7GA 1QVRA 4M9ZA 4FWGA 4PDIA 5C1BA 2C98A 4QNMA 4L6V6 5EXPA 3RGSA 2V6ZM 1QDTA 1TDHA 1MN3A 3HJ8A 2K0BX 4XK8F 2FNAA 2H1RA 1YSYA 2G8LA 2MR9A 2QP9X 2UXBM 3GLFA 2K9DA 3L2AA 1QAMA 3U6SA 1QYRA 1Q39A 2VF7A 4P16A 3GPUA 4I4LA 2DXIA 1LTMA 2A5YB 2JZ0A 2KA6B 2NQ8C 3I51A 1K3WA 1FNNA 4I81A 1PJIA 1NJGA 2R4JA 3LQRA 2YR0A 3RFWA 1E94E 4D82A 3ZCBB 2CWBA 4K0KM 3KOXE 2LWXA 4F2LA 4GKJM 1W5TA 2XZUA 3GQ5A 4M9SA 3GRVA 4JI2M 1ORYB 2QQ8A 3FKEA 3HGIA 4R7GA 3SFZA 1KFVA 1DGFA 2KRUA 3KP0E 2OPFA 2EKFA 3GLFE 1XMOM 1GVNA 1L2CA 1VEGA 2C9OA 1I94M 1NNJA 4LF7M 3SBJA 2LVNC 4R71A 2ZAOA 3A46A 4PT5A 1R7RA 4OVZB 3PXGA 3UGJA 3AOEA 4QOSA 1NY5A 4DBGB 3U6LA 4KODA 1EFUB 4B3MM 3MJ5A 3KSJA 4DR1M 3FYDA 3L25A 1Z59A 2QPAA 2RKOA 4B3TM 2UU9M 1N75A 4DR5M 1EIJA 1TDZA 3W0LB 5EJCA 1IN8A 4B3RM 4JYAM 5E6JA 3W67A
chains in the Genus database with same CATH topology
1IXZA 4MB7A 4FCVA 4L78A 3WHLA 3SAUA 4A3VB 2Y0QA 3B9PA 5EXSA 3UK6A 1DGHA 4LJ6A 3KW6A 3DA1A 3PVSA 1R6BX 3UZUA 4DV7M 2G5GX 4CGYB 5IWAM 4OW0A 5JI3E 4JI8M 1SXJE 1TH2A 2CHGA 2D7HA 1E9RA 4BB9A 4LRTA 4XGIA 4MGYE 1GL6A 4JV5M 2ZM6M 3FYCA 2V1CA 3U6DA 3SHGB 3J2PB 5JI2E 1NVMA 4FD2A 1DO0A 5KQDA 1XMQM 4AKGA 1OFIA 3KXEC 3UJNA 4AW4A 5BR8M 4QHTA 4B7HA 3GLGB 4FW9A 4MGZE 2L6OA 4OU7A 3TQSA 1IN7A 2UXCM 5IT9S 4I8OA 2K47A 4FCWA 3FTDA 2XEPA 4AG5A 4L15A 3W0FA 1N34M 3OTOM 1HNZM 1IBKM 2C9CA 3AV0A 1YUBA 4IJEA 2O5RA 4MGKE 5ITRA 2CHQA 2X4AA 1I4WA 1MX0A 3GP1A 3IG8A 5KO3A 3U60A 4GITA 4GIPA 4IBDA 4OX9M 2RGHA 5H37D 3QWLA 1Q3CA 3SASA 1NHGC 3J81S 4FWDA 3ZH9B 2LXEA 4RF1A 3HU2A 4BBAA 1KSFX 4QOZC 4LY6A 3HHXA 2CV1A 1QANA 1MU5A 2I7PA 4RNAA 2J7OA 5ITYA 2FE8A 3PNVA 5ITQA 5EP2A 3AL0C 1G59A 1J7KA 3LQQA 2W82A 1NSFA 3A45A 4IBCA 5DNYA 5EQTA 5FLXS 4AKIA 1WXQA 4I5SA 3J27B 4LG2A 4IIWA 1HNWM 4D81A 4LFBM 3EIEA 2P5TA 4IBKA 5BPVA 1K82A 1EE8A 3C58A 3SYKA 2DWZB 2EO2A 1IM2A 4X66M 2BNKA 2J7NA 2R4EA 1GLNA 2BJVA 1TH3A 1JR3D 4LJAA 1XNRM 1N78A 3U6CA 5GKNA 4IBIA 3GRYA 2KZUA 4AG6A 2QBYB 1L8QA 2XH9A 4LF5M 4GC5A 2HCBA 3CTWB 2UUAM 2Y21A 1HQYE 1QQWA 4AQYM 1R2YA 4MGHA 4JI5M 1G41A 4OVZA 3HHWA 2KXEA 3A98B 3NBIA 1IBMM 3AJIB 2EA0A 3EIHA 4QHSA 2XGNA 4FVMA 3FTCA 2DWLA 2V1UA 3U61B 3SAVA 4JI3M 2KEBA 4MGIE 1ZAEA 2I7NA 3TWLA 2L09A 4JI4M 3U5ZB 2C96A 1HR0M 3HJSA 3SYLA 2DWNA 4YY3M 4II7A 3SC3A 3WHKA 4X62M 2F5OA 4X64M 3GLHB 3U6OA 1FJGM 1HNXM 1H6UA 3KFUG 5ITUA 4DV5M 1IN4A 2R62A 1VDDA 2YQZA 3MHVC 4JI7M 7CATA 4LF6M 3L26A 2XLJA 4B7FA 2L7HA 4DV1M 4AI6A 4S12A 4HLQA 4LGMA 2XF3A 3HHYA 4NXMM 4IBFA 5FTMA 1ZQ9A 4NSOB 2C5RA 2CEAA 3Q8XA 2CV0A 2XZFA 3VFDA 3KOYE 3GLGA 4LJ8A 5KPTA 2CE7A 1L2DA 2R45A 2QZ4A 3K92A 3VLFB 2BJWA 2Z7JA 1YE9A 4KO8A 2YNMD 4IBEA 4LJ5A 5FSWA 4LCBA 5KPZA 2M60A 4JI1M 2XSZD 4Z6YA 3L27A 1NJFA 4B08A 4PDGA 3DZDA 3GRRA 2HHHM 3SMPA 4GHAA 2DVWB 4G4QA 3SATA 3GPXA 3QAUA 1SXJB 5FTLA 4L8RC 5LMNM 5ITXA 2FFJA 1Z6TA 3TWKA 4MH0E 4LJ9A 2F5NA 1X37A 1TH4A 2OQ4A 3RE8A 3VKGA 3SHFA 1G8PA 3THGA 2F5QA 2Q2EB 4Z8XA 1GL7A 3KS4A 4PCZA 3SARA 3HKPA 3R9XB 3FD9A 3HHZA 3PNYA 2CV2A 3TE6A 4D80A 4M9XA 1OJLA 4M0DA 2LNHC 4RF0A 1XXHB 3H4MA 3CF0A 2DZOB 5KPRA 3VDUA 3LVVA 3IG5A 1OFHA 2HKJA 4AZFA 3NWLA 2QENA 2QCUA 4AKHA 2D7GA 3L28A 3GO8A 4R3DA 1IY0A 3ZC7B 2C99A 4LF9M 3SMSA 3GPPA 3FTEA 3BOSA 4JN6A 3D8LA 3KP1E 1D2NA 2VIIA 4LZJA 4GC9A 2X49A 3VK7A 4LF4M 1IY1A 2RGOA 4EIWA 3M6AA 2QBYA 2DWMA 3FTFA 3CF2A 1R2ZA 2D7EA 1IXRC 4NOOB 4DR2M 3KDSE 1QZMA 4DR6M 2R46A 1PM5A 5DYGA 2E5LM 4HL4A 3L29A 3KOZE 3JR5A 5FTJA 4LRSA 2HL7A 3MK6A 3I4VA 3U61A 3GLIB 2Z4RA 3GRUA 4KLNA 5EXXA 4YHHM 4DV4M 3J80S 1J5EM 3VKHA 1IY2A 1Z5AA 4IBGA 4LZZA 4NSRA 2UXDM 1JQJC 1G4AE 3U5ZA 1Z5CA 2ZBKB 4G4NA 3KS8A 2ERCA 3E4RA 1XHBA 4NRVA 3GLHA 1DO2A 3TL4X 2UUCM 1N32M 1W5SA 1HQCA 4LGYA 1L1ZA 4G6ZA 4MM3B 1JR3A 5DYIA 2KW0A 3HJQA 1IN5A 3A42A 4GKKM 2VQFM 1IBLM 5C18A 5FTKA 3U6PA 8CATA 3AOEC 1SXJC 2F4VM 2XFTA 5E26A 2AHMA 4IBBA 3T1YM 4DV6M 1SXJD 1XWIA 3GPYA 1E32A 2VQEM 3J7BA 4JI6M 4DV0M 4TUWA 1LV7A 4XBOA 1L1TA 3RGPA 5A2QS 1NHWC 5KQ8A 3GLFB 3PFIA 3GQ3A 3ILKA 2KRKA 4DV3M 3LMMA 1E9SA 2F5PA 3T15A 4M0WA 3UMMA 4IJFA 1T3TA 3GQ4A 2KZSA 4GHLA 1GKIA 3DFZA 3HU1A 4G4RA 3FUUA 1SXJA 1UM8A 2LH0A 3CF6E 3U6EA 4IBJA 2Z3XA 2R65A 4DR3M 3J7AS 4DV2M 3E9SA 5IREB 3R8FA 4NRWA 4LF8M 3K8ZA 3KSXA 3I4YA 2R18A 2JA2A 3M0EA 3FUXA 4X65M 3U6MA 5IZ7D 4DR7M 2Z4SA 1HT1E 3DOAA 3VDPA 2CHVA 2L7IA 1N36M 1XXHA 4WURA 1DGGA 2F5SA 4LJ4A 4DR4M 3TWMA 2ZAMA 2FOIC 2UUBM 1G3IA 4GMQA 4JXJA 3U6QA 1K3XA 5FTNA 4QNRA 1IQPA 1Q3BA 3D8BA 2X8AA 4ITQA 2XSZA 3AOGA 4LFAM 1S3SA 4CHTB 4CISA 1XNQM 3LVWA 1DGHB 3JR4A 3FUWA 4GRIA 1XC8A 1DGBA 4BLCA 4DUYM 1QAOA 1QAQA 2CUZA 2M5ZA 3VK8A 4GH9A 4G4OA 3KOWE 1PJJA 2DHRA 1N33M 4FCTA 2Y0TA 3JAMS 5ITXE 1TGUA 5EP3A 2XFSA 1KYIA 2YFQA 4L4UA 4NXNM 3AKZA 1Z5BA 5ITTA 3KVWA 1J09A 1IN6A 3GLIA 1L2BA 4B3SM 5EP1A 3T1HM 3FUTA 4JI0M 3TPZA 4KHPM 4FWHA 4L16A 5EXTA 4W5WA 5EP4A 4PD2A 5LMUM 1HT2E 1IXSB 3FUVA 3AFHA 4DUZM 5F3WA 4ZPXA 2DZNB 3K2LA 2ZANA 1NNUC 1N77A 3K1JA 1C1KA 2Y20A 3HU3A 3HWSA 4WW0A 4REZA 3T38A 1NY6A 3SAWA 3U60B 4LJ7A 4LFCM 3M7GA 2CFOA 2EUCA 4NL4H 4B7GA 1QVRA 4M9ZA 4FWGA 4PDIA 5C1BA 2C98A 4QNMA 5EXPA 3RGSA 2V6ZM 1TDHA 3HJ8A 2FNAA 2H1RA 1YSYA 2G8LA 2QP9X 2UXBM 3GLFA 3L2AA 1QAMA 3U6SA 1QYRA 1Q39A 4P16A 3GPUA 4I4LA 2DXIA 2A5YB 2KA6B 2NQ8C 3I51A 1K3WA 1FNNA 4I81A 1PJIA 1NJGA 2R4JA 3LQRA 2YR0A 3RFWA 1E94E 4D82A 3ZCBB 4K0KM 3KOXE 2LWXA 4GKJM 1W5TA 2XZUA 3GQ5A 4M9SA 3GRVA 4JI2M 1ORYB 3FKEA 3HGIA 4R7GA 3SFZA 1KFVA 1DGFA 2KRUA 3KP0E 2OPFA 1XMOM 1GVNA 1L2CA 2C9OA 1I94M 1NNJA 4LF7M 3SBJA 2ZAOA 3A46A 4PT5A 1R7RA 4OVZB 3PXGA 3UGJA 3AOEA 4QOSA 1NY5A 3U6LA 4B3MM 4KODA 3MJ5A 3KSJA 4DR1M 3FYDA 3L25A 1Z59A 2QPAA 2RKOA 4B3TM 2UU9M 1N75A 4DR5M 1TDZA 3W0LB 5EJCA 1IN8A 4B3RM 4JYAM 5E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXZ A;  4FCV A;  2V1U A;  3KDS E;  1QZM A;  3U61 B;  3WHL A;  2DHR A;  5DYG A;  3B9P A;  5EXS A;  4A3V B;  3UK6 A;  4FCT A;  4LJ6 A;  3KW6 A;  5EP3 A;  4LRS A;  3PVS A;  5FTJ A;  1KYI A;  1R6B X;  3U5Z B;  2C96 A;  4L4U A;  3GLI B;  2Z4R A;  4KLN A;  5EXX A;  3SYL A;  3WHK A;  1SXJ E;  3SC3 A;  5JI3 E;  2CHG A;  1IY2 A;  3GLH B;  4LZZ A;  4LRT A;  1JQJ C;  1G4A E;  1IN6 A;  3GLI A;  1IN4 A;  2R62 A;  3GLH A;  3MHV C;  5EP1 A;  1DO2 A;  5JI2 E;  1NVM A;  4FD2 A;  1DO0 A;  4FWH A;  1W5S A;  1HQC A;  4L16 A;  5EXT A;  1OFI A;  5EP4 A;  1JR3 A;  5DYI A;  4QHT A;  4LGM A;  1HT2 E;  1IXS B;  3GLG B;  1IN5 A;  4FW9 A;  5FTM A;  4ZPX A;  2DZN B;  5FTK A;  5C18 A;  2ZAN A;  1IN7 A;  2CEA A;  3K1J A;  1C1K A;  3HU3 A;  3HWS A;  4FCW A;  3VFD A;  3GLG A;  4L15 A;  4LJ8 A;  2CE7 A;  1SXJ C;  4WW0 A;  2QZ4 A;  1NY6 A;  3U60 B;  3VLF B;  2BJW A;  2C9C A;  4KO8 A;  4LJ7 A;  1SXJ D;  1XWI A;  4LJ5 A;  1E32 A;  2CHQ A;  4LCB A;  1QVR A;  2XSZ D;  1LV7 A;  4FWG A;  4GIT A;  3GLF B;  5C1B A;  1NJF A;  2C98 A;  3PFI A;  4QNM A;  3DZD A;  2KRK A;  5EXP A;  2DVW B;  2V6Z M;  1SXJ B;  5FTL A;  2FNA A;  2QP9 X;  4FWD A;  3ZH9 B;  3GLF A;  3HU2 A;  1KSF X;  4LJ9 A;  1X37 A;  4LY6 A;  3HU1 A;  4I4L A;  1SXJ A;  1UM8 A;  4Z8X A;  2R65 A;  1FNN A;  4I81 A;  5EP2 A;  1J7K A;  1NJG A;  1NSF A;  1E94 E;  4D82 A;  5EQT A;  4D80 A;  3R8F A;  1OJL A;  1W5T A;  1XXH B;  3H4M A;  4D81 A;  3EIE A;  3CF0 A;  2DZO B;  3M0E A;  3SYK A;  2DWZ B;  1OFH A;  2Z4S A;  1IM2 A;  1HT1 E;  2QEN A;  2CHV A;  1XXH A;  2BJV A;  1JR3 D;  4LJA A;  4LJ4 A;  1IY0 A;  2C9O A;  2C99 A;  2ZAM A;  2QBY B;  1G3I A;  2ZAO A;  3PXG A;  1R7R A;  5FTN A;  1L8Q A;  4QNR A;  3BOS A;  1NY5 A;  4JN6 A;  4QOS A;  4KOD A;  1IQP A;  2HCB A;  1D2N A;  3D8B A;  2VII A;  2X8A A;  2QPA A;  2RKO A;  2XSZ A;  1IY1 A;  1HQY E;  4EIW A;  3M6A A;  2QBY A;  1G41 A;  3CF2 A;  1S3S A;  3AJI B;  1IN8 A;  3EIH A;  4QHS A;  1IXR C; 
#chains in the Genus database with same CATH topology
 1IXZ A;  4MB7 A;  2LHC A;  4FCV A;  1QUT A;  4L78 A;  3B89 A;  3WHL A;  2GNO A;  3SAU A;  4A3V B;  2Y0Q A;  3B9P A;  5EXS A;  3UK6 A;  1DGH A;  4LJ6 A;  3KW6 A;  3DA1 A;  3PVS A;  1R6B X;  3UZU A;  4DV7 M;  2G5G X;  4CGY B;  5IWA M;  4OW0 A;  5JI3 E;  2JXN A;  4JI8 M;  1SXJ E;  1PJQ A;  1TH2 A;  2CHG A;  2D7H A;  2L4F A;  1E9R A;  4BB9 A;  2JY8 A;  4LRT A;  4XGI A;  2VDB B;  2LVA A;  4MGY E;  1GL6 A;  4JV5 M;  2KHH A;  2ZM6 M;  3FYC A;  2V1C A;  1V33 A;  3LCV B;  3QYB A;  4HEO A;  3U6D A;  1Q02 A;  2FS1 A;  3SHG B;  3J2P B;  5JI2 E;  1NVM A;  4FD2 A;  1DO0 A;  5KQD A;  1XMQ M;  4AKG A;  3B7Z A;  1OFI A;  1OTR A;  3KXE C;  4Y28 F;  4AW4 A;  3UJN A;  5BR8 M;  4QHT A;  4B7H A;  3GLG B;  4FW9 A;  4MGZ E;  2L6O A;  4OU7 A;  2ZTD A;  3TQS A;  1MJG M;  1V34 A;  1XXH E;  1IN7 A;  2UXC M;  5IT9 S;  3E46 A;  4I8O A;  2K47 A;  4FCW A;  3FTD A;  2XEP A;  4AG5 A;  4L15 A;  1IXS A;  3W0F A;  1N34 M;  3OTO M;  2KDL A;  1HNZ M;  4ANR A;  1IBK M;  2C9C A;  3AV0 A;  1YUB A;  4IJE A;  2O5R A;  4MGK E;  5ITR A;  2CHQ A;  2X4A A;  2LVO C;  1I4W A;  1MX0 A;  3GP1 A;  1QDR A;  3IG8 A;  5KO3 A;  3U60 A;  4GIT A;  4GIP A;  1JB0 F;  4IBD A;  4OX9 M;  2RGH A;  5H37 D;  3QWL A;  1Q3C A;  3SAS A;  1NHG C;  3J81 S;  4FWD A;  3ZH9 B;  2LXE A;  4RF1 A;  3HU2 A;  4BBA A;  1KSF X;  4QOZ C;  4LY6 A;  3HHX A;  2CV1 A;  1QAN A;  2O01 F;  2OO9 A;  1MU5 A;  2I7P A;  4RNA A;  2J7O A;  5ITY A;  2FE8 A;  3PNV A;  1D0M A;  5EP2 A;  2JNH A;  5ITQ A;  1G59 A;  3AL0 C;  1J7K A;  1SG9 A;  3LQQ A;  1NO1 A;  2W82 A;  1NSF A;  3A45 A;  4IBC A;  5DNY A;  5EQT A;  5FLX S;  4AKI A;  1WXQ A;  4CIZ A;  4I5S A;  1PJT A;  3GLI E;  3J27 B;  4LG2 A;  4IIW A;  1HNW M;  4D81 A;  4LFB M;  3B74 A;  2P5T A;  3EIE A;  4IBK A;  5BPV A;  1K82 A;  1EE8 A;  3C58 A;  3SYK A;  2DWZ B;  2EO2 A;  2LVQ D;  1IM2 A;  4X66 M;  2BNK A;  1GAB A;  2J7N A;  3F92 A;  2R4E A;  1GLN A;  2BJV A;  1TH3 A;  1JR3 D;  4LJA A;  3K9P A;  1XNR M;  1N78 A;  1WIV A;  3U6C A;  5GKN A;  1WGL A;  4IBI A;  3GRY A;  2KZU A;  4AG6 A;  2QBY B;  1L8Q A;  2XH9 A;  4LF5 M;  2HWJ A;  4GC5 A;  2HCB A;  2MJ5 B;  2DHY A;  3CTW B;  2UUA M;  1ZMV A;  2Y21 A;  1HQY E;  1QQW A;  2APL A;  4AQY M;  1R2Y A;  1AUA A;  4MGH A;  4JI5 M;  1G41 A;  1IFY A;  4OVZ A;  3HHW A;  2KXE A;  3A98 B;  3NBI A;  1HJP A;  1IBM M;  3AJI B;  2EA0 A;  3EIH A;  4QHS A;  1R4G A;  2XGN A;  4FVM A;  3FTC A;  2DWL A;  2V1U A;  3U61 B;  3SAV A;  4JI3 M;  2KEB A;  4MGI E;  1ZAE A;  2JY7 A;  2I7N A;  3TWL A;  2L09 A;  4CJ6 A;  1BVS A;  4JI4 M;  3Q8G A;  3FRH A;  3U5Z B;  2C96 A;  2QNJ A;  1HR0 M;  4LF6 M;  3HJS A;  3SYL A;  2DWN A;  4YY3 M;  4II7 A;  3SC3 A;  3WHK A;  4X62 M;  2F5O A;  4X64 M;  3GLH B;  2DAI A;  3U6O A;  1FJG M;  1HNX M;  2KNV A;  1H6U A;  2G3Q A;  3KFU G;  5ITU A;  4DV5 M;  1IN4 A;  2R62 A;  1VDD A;  2YQZ A;  3MHV C;  1OAI A;  4KT0 F;  7CAT A;  4JI7 M;  3L26 A;  2XLJ A;  1VQ1 A;  2L2D A;  2L7H A;  2MGW A;  4B7F A;  4DV1 M;  4AI6 A;  4S12 A;  4HLQ A;  2WSC F;  2XF3 A;  4LGM A;  3HHY A;  4NXM M;  4G3O A;  1OKS A;  4IBF A;  5FTM A;  3V76 A;  1ZQ9 A;  2WSF F;  4NSO B;  2C5R A;  2CEA A;  2CP8 A;  3Q8X A;  2CV0 A;  2XZF A;  3VFD A;  3KOY E;  3GLG A;  4LJ8 A;  5KPT A;  2CE7 A;  1L2D A;  2R45 A;  2OOB A;  2QZ4 A;  3K92 A;  3VLF B;  2BJW A;  3C3E A;  2Z7J A;  1YE9 A;  4KO8 A;  2YNM D;  2DI0 A;  4IBE A;  4LJ5 A;  5FSW A;  4LCB A;  5KPZ A;  2M60 A;  4JI1 M;  2XSZ D;  2DAM A;  4Z6Y A;  3L27 A;  1NJF A;  4B08 A;  4PDG A;  3DZD A;  3GRR A;  2HHH M;  3SMP A;  4GHA A;  2DVW B;  4G4Q A;  3SAT A;  3GPX A;  3QAU A;  1SXJ B;  5FTL A;  2K6B A;  4L8R C;  2JUJ A;  5LMN M;  5ITX A;  1ZMU A;  2DAG A;  2FFJ A;  1Z6T A;  2DAE A;  3H4J A;  1VEJ A;  4LJ9 A;  4MH0 E;  3TWK A;  2F5N A;  1X37 A;  1TH4 A;  2OQ4 A;  3RE8 A;  3VKG A;  3SHF A;  1G8P A;  3THG A;  1WHC A;  2F5Q A;  2Q2E B;  4Z8X A;  1GL7 A;  3KS4 A;  4PCZ A;  2R0I A;  3SAR A;  3HKP A;  3R9X B;  3FD9 A;  3HHZ A;  3PNY A;  2CV2 A;  2H5X A;  3TE6 A;  4D80 A;  4M9X A;  2DKL A;  1WGN A;  1OJL A;  4M0D A;  2LNH C;  4RF0 A;  1XXH B;  3H4M A;  3CF0 A;  2DZO B;  1R5L A;  1F4I A;  5KPR A;  3VDU A;  3LVV A;  1WJ7 A;  1OFH A;  2HKJ A;  3IG5 A;  3FRI A;  3NWL A;  4AZF A;  2QEN A;  2QCU A;  4P17 A;  3BBZ A;  4AKH A;  1CUK A;  2D7G A;  3L28 A;  3GO8 A;  4R3D A;  1IY0 A;  3ZC7 B;  2C99 A;  4LF9 M;  3SMS A;  2HAK A;  3GPP A;  3FTE A;  2LBC A;  3NBX X;  1VG5 A;  3BOS A;  4JN6 A;  3D8L A;  3KP1 E;  2QHO B;  1D2N A;  3T6P A;  2VII A;  3E21 A;  4LZJ A;  4GC9 A;  2X49 A;  3VK7 A;  4LF4 M;  1IY1 A;  2RGO A;  4EIW A;  3M6A A;  2QBY A;  2DWM A;  1OIZ A;  3FTF A;  2DEN A;  3CF2 A;  1WR1 B;  1R2Z A;  1TR8 A;  2D7E A;  1IXR C;  4NOO B;  1T6O A;  4DR2 M;  3K9O A;  2RRU A;  2JWS A;  2Z8Y M;  3KDS E;  1QZM A;  4DR6 M;  2R46 A;  1PM5 A;  1P3Q Q;  5DYG A;  2E5L M;  2FH0 A;  2EKK A;  4HL4 A;  1RU3 A;  3L29 A;  1GO5 A;  3KOZ E;  3JR5 A;  5FTJ A;  4LRS A;  2HL7 A;  2LTU A;  3MMP A;  2WZJ A;  3MK6 A;  1QZE A;  3I4V A;  3U61 A;  2DAK A;  3GLI B;  2Z4R A;  3GRU A;  4KLN A;  5EXX A;  4YHH M;  4DV4 M;  3J80 S;  1J5E M;  3VKH A;  1IY2 A;  1Z5A A;  4IBG A;  4LZZ A;  4NSR A;  1GJS A;  2JY6 B;  2CRU A;  2MRO B;  1JQJ C;  2UXD M;  1G4A E;  3U5Z A;  1Z5C A;  2JY5 A;  2ZBK B;  4G4N A;  3KS8 A;  2ERC A;  2KNA A;  3E4R A;  1XHB A;  4NRV A;  3GLH A;  1DO2 A;  3TL4 X;  2UUC M;  3HZJ A;  1N32 M;  1W5S A;  1HQC A;  4LGY A;  1L1Z A;  4G6Z A;  4MM3 B;  2JZ1 A;  1JR3 A;  1D0L A;  5DYI A;  2KW0 A;  3HJQ A;  2DZL A;  2JP7 A;  1IN5 A;  1YLA A;  2MH8 A;  3A42 A;  4GKK M;  2VQF M;  2GQF A;  1IBL M;  3FE3 A;  1PGY A;  5C18 A;  5FTK A;  2O25 A;  1TTE A;  4UN2 B;  2VF8 A;  2B3T A;  8CAT A;  3U6P A;  3AOE C;  1SXJ C;  2F4V M;  2XFT A;  5E26 A;  2AHM A;  4IBB A;  3T1Y M;  1Y8G A;  4DV6 M;  1SXJ D;  1XWI A;  3GPY A;  1E32 A;  2VQE M;  3J7B A;  4JI6 M;  4DV0 M;  4F1I A;  4TUW A;  2BWB A;  1LV7 A;  4XBO A;  1L1T A;  2KNZ A;  3RGP A;  3GLH E;  1NHW C;  5KQ8 A;  5A2Q S;  3PFI A;  3GQ3 A;  3GLF B;  3ILK A;  2KRK A;  1AIP C;  1ZV1 A;  3QYE A;  3LMM A;  5L8R F;  1E9S A;  1JR3 E;  4DV3 M;  2F5P A;  3T15 A;  2BWE A;  4M0W A;  3UMM A;  4IJF A;  1T3T A;  1OQY A;  3B7N A;  3GQ4 A;  1PJS A;  2KZS A;  3LW5 F;  2J5Y A;  4GHL A;  1GKI A;  3B7Q A;  1OAO C;  3DFZ A;  1UFZ A;  3HU1 A;  4G4R A;  2QSF X;  3FUU A;  1SXJ A;  1UM8 A;  2LH0 A;  3CF6 E;  2ZTC A;  3U6E A;  3C9P A;  4IBJ A;  2Z3X A;  2R65 A;  1QUS A;  4DR3 M;  2R44 A;  1A5T A;  1NV9 A;  1DV0 A;  3J7A S;  2LVP C;  3IEC A;  4DV2 M;  3E9S A;  1TF0 B;  5IRE B;  1VDL A;  2WSE F;  3R8F A;  4NRW A;  4LF8 M;  2N35 A;  2R18 A;  3K8Z A;  3I4Y A;  2JA2 A;  3KSX A;  3M0E A;  1NV8 A;  2R6F A;  3FUX A;  3I01 M;  5DFL A;  3U6M A;  5IZ7 D;  4DR7 M;  2Z4S A;  1HT1 E;  3BXW A;  3DOA A;  3VDP A;  2CHV A;  2L7I A;  1N36 M;  1XXH A;  4WP2 A;  4WUR A;  1DGG A;  2F5S A;  4LJ4 A;  1XB2 B;  4DR4 M;  3TWM A;  2ZAM A;  2FOI C;  2UUB M;  1OIP A;  1G3I A;  4GMQ A;  4JXJ A;  3U6Q A;  1K3X A;  5FTN A;  3GLG E;  4QNR A;  1IQP A;  1Q3B A;  3D8B A;  2X8A A;  4ITQ A;  2L4E A;  2XSZ A;  3IHP A;  3AOG A;  4LFA M;  1S3S A;  4CHT B;  4CIS A;  2LHG A;  3LVW A;  1XNQ M;  1DGH B;  1G71 A;  3HX3 A;  3JR4 A;  3FUW A;  3C3D A;  4GRI A;  1DGB A;  1XC8 A;  4BLC A;  4NC6 A;  4DUY M;  1QAO A;  1QAQ A;  2CUZ A;  2M5Z A;  3VK8 A;  4GH9 A;  4G4O A;  3KOW E;  1PJJ A;  2DHR A;  1N33 M;  4GEW A;  4FCT A;  2Y0T A;  3JAM S;  5ITX E;  1TGU A;  5EP3 A;  2DNA A;  2XFS A;  3HY5 A;  1KYI A;  2YFQ A;  1V92 A;  1D0K A;  4L4U A;  4RKU F;  4NXN M;  3AKZ A;  1Z5B A;  5ITT A;  1C7Y A;  1VEK A;  3KVW A;  3LCU A;  1J09 A;  3I04 M;  1IN6 A;  3GLI A;  1L2B A;  4B3S M;  5EP1 A;  3T1H M;  3FUT A;  4JI0 M;  3TPZ A;  4KHP M;  4FWH A;  4L16 A;  5EXT A;  4W5W A;  5EP4 A;  4PD2 A;  5LMU M;  1HT2 E;  1IXS B;  4Q7J A;  3ZQJ A;  3FUV A;  1T43 A;  3AFH A;  4DUZ M;  5F3W A;  4ZPX A;  2DZN B;  3K2L A;  1GJT A;  1NNU C;  2ZAN A;  1N77 A;  3K1J A;  1C1K A;  2Y20 A;  3HU3 A;  2EJS A;  3HWS A;  1ZMW A;  3W68 A;  1PRB A;  4WW0 A;  4REZ A;  3T38 A;  1NY6 A;  3SAW A;  3U60 B;  2OOA A;  4LJ7 A;  4LFC M;  3M7G A;  2CFO A;  2EUC A;  4X65 M;  3CGW A;  4NL4 H;  4B7G A;  1QVR A;  4M9Z A;  4FWG A;  4PDI A;  5C1B A;  2C98 A;  4QNM A;  4L6V 6;  5EXP A;  3RGS A;  2V6Z M;  1QDT A;  1TDH A;  1MN3 A;  3HJ8 A;  2K0B X;  4XK8 F;  2FNA A;  2H1R A;  1YSY A;  2G8L A;  2MR9 A;  2QP9 X;  2UXB M;  3GLF A;  2K9D A;  3L2A A;  1QAM A;  3U6S A;  1QYR A;  1Q39 A;  2VF7 A;  4P16 A;  3GPU A;  4I4L A;  2DXI A;  1LTM A;  2A5Y B;  2JZ0 A;  2KA6 B;  2NQ8 C;  3I51 A;  1K3W A;  1FNN A;  4I81 A;  1PJI A;  1NJG A;  2R4J A;  3LQR A;  2YR0 A;  3RFW A;  1E94 E;  4D82 A;  3ZCB B;  2CWB A;  4K0K M;  3KOX E;  2LWX A;  4F2L A;  4GKJ M;  1W5T A;  2XZU A;  3GQ5 A;  4M9S A;  3GRV A;  4JI2 M;  1ORY B;  2QQ8 A;  3FKE A;  3HGI A;  4R7G A;  3SFZ A;  1KFV A;  1DGF A;  2KRU A;  3KP0 E;  2OPF A;  2EKF A;  3GLF E;  1XMO M;  1GVN A;  1L2C A;  1VEG A;  2C9O A;  1I94 M;  1NNJ A;  4LF7 M;  3SBJ A;  2LVN C;  4R71 A;  2ZAO A;  3A46 A;  4PT5 A;  1R7R A;  4OVZ B;  3PXG A;  3UGJ A;  3AOE A;  4QOS A;  1NY5 A;  4DBG B;  3U6L A;  4KOD A;  1EFU B;  4B3M M;  3MJ5 A;  3KSJ A;  4DR1 M;  3FYD A;  3L25 A;  1Z59 A;  2QPA A;  2RKO A;  4B3T M;  2UU9 M;  1N75 A;  4DR5 M;  1EIJ A;  1TDZ A;  3W0L B;  5EJC A;  1IN8 A;  4B3R M;  4JYA M;  5E6J A;  3W67 A; 
#chains in the Genus database with same CATH homology
 1IXZ A;  4MB7 A;  4FCV A;  4L78 A;  3WHL A;  3SAU A;  4A3V B;  2Y0Q A;  3B9P A;  5EXS A;  3UK6 A;  1DGH A;  4LJ6 A;  3KW6 A;  3DA1 A;  3PVS A;  1R6B X;  3UZU A;  4DV7 M;  2G5G X;  4CGY B;  5IWA M;  4OW0 A;  5JI3 E;  4JI8 M;  1SXJ E;  1TH2 A;  2CHG A;  2D7H A;  1E9R A;  4BB9 A;  4LRT A;  4XGI A;  4MGY E;  1GL6 A;  4JV5 M;  2ZM6 M;  3FYC A;  2V1C A;  3U6D A;  3SHG B;  3J2P B;  5JI2 E;  1NVM A;  4FD2 A;  1DO0 A;  5KQD A;  1XMQ M;  4AKG A;  1OFI A;  3KXE C;  3UJN A;  4AW4 A;  5BR8 M;  4QHT A;  4B7H A;  3GLG B;  4FW9 A;  4MGZ E;  2L6O A;  4OU7 A;  3TQS A;  1IN7 A;  2UXC M;  5IT9 S;  4I8O A;  2K47 A;  4FCW A;  3FTD A;  2XEP A;  4AG5 A;  4L15 A;  3W0F A;  1N34 M;  3OTO M;  1HNZ M;  1IBK M;  2C9C A;  3AV0 A;  1YUB A;  4IJE A;  2O5R A;  4MGK E;  5ITR A;  2CHQ A;  2X4A A;  1I4W A;  1MX0 A;  3GP1 A;  3IG8 A;  5KO3 A;  3U60 A;  4GIT A;  4GIP A;  4IBD A;  4OX9 M;  2RGH A;  5H37 D;  3QWL A;  1Q3C A;  3SAS A;  1NHG C;  3J81 S;  4FWD A;  3ZH9 B;  2LXE A;  4RF1 A;  3HU2 A;  4BBA A;  1KSF X;  4QOZ C;  4LY6 A;  3HHX A;  2CV1 A;  1QAN A;  1MU5 A;  2I7P A;  4RNA A;  2J7O A;  5ITY A;  2FE8 A;  3PNV A;  5ITQ A;  5EP2 A;  3AL0 C;  1G59 A;  1J7K A;  3LQQ A;  2W82 A;  1NSF A;  3A45 A;  4IBC A;  5DNY A;  5EQT A;  5FLX S;  4AKI A;  1WXQ A;  4I5S A;  3J27 B;  4LG2 A;  4IIW A;  1HNW M;  4D81 A;  4LFB M;  3EIE A;  2P5T A;  4IBK A;  5BPV A;  1K82 A;  1EE8 A;  3C58 A;  3SYK A;  2DWZ B;  2EO2 A;  1IM2 A;  4X66 M;  2BNK A;  2J7N A;  2R4E A;  1GLN A;  2BJV A;  1TH3 A;  1JR3 D;  4LJA A;  1XNR M;  1N78 A;  3U6C A;  5GKN A;  4IBI A;  3GRY A;  2KZU A;  4AG6 A;  2QBY B;  1L8Q A;  2XH9 A;  4LF5 M;  4GC5 A;  2HCB A;  3CTW B;  2UUA M;  2Y21 A;  1HQY E;  1QQW A;  4AQY M;  1R2Y A;  4MGH A;  4JI5 M;  1G41 A;  4OVZ A;  3HHW A;  2KXE A;  3A98 B;  3NBI A;  1IBM M;  3AJI B;  2EA0 A;  3EIH A;  4QHS A;  2XGN A;  4FVM A;  3FTC A;  2DWL A;  2V1U A;  3U61 B;  3SAV A;  4JI3 M;  2KEB A;  4MGI E;  1ZAE A;  2I7N A;  3TWL A;  2L09 A;  4JI4 M;  3U5Z B;  2C96 A;  1HR0 M;  3HJS A;  3SYL A;  2DWN A;  4YY3 M;  4II7 A;  3SC3 A;  3WHK A;  4X62 M;  2F5O A;  4X64 M;  3GLH B;  3U6O A;  1FJG M;  1HNX M;  1H6U A;  3KFU G;  5ITU A;  4DV5 M;  1IN4 A;  2R62 A;  1VDD A;  2YQZ A;  3MHV C;  4JI7 M;  7CAT A;  4LF6 M;  3L26 A;  2XLJ A;  4B7F A;  2L7H A;  4DV1 M;  4AI6 A;  4S12 A;  4HLQ A;  4LGM A;  2XF3 A;  3HHY A;  4NXM M;  4IBF A;  5FTM A;  1ZQ9 A;  4NSO B;  2C5R A;  2CEA A;  3Q8X A;  2CV0 A;  2XZF A;  3VFD A;  3KOY E;  3GLG A;  4LJ8 A;  5KPT A;  2CE7 A;  1L2D A;  2R45 A;  2QZ4 A;  3K92 A;  3VLF B;  2BJW A;  2Z7J A;  1YE9 A;  4KO8 A;  2YNM D;  4IBE A;  4LJ5 A;  5FSW A;  4LCB A;  5KPZ A;  2M60 A;  4JI1 M;  2XSZ D;  4Z6Y A;  3L27 A;  1NJF A;  4B08 A;  4PDG A;  3DZD A;  3GRR A;  2HHH M;  3SMP A;  4GHA A;  2DVW B;  4G4Q A;  3SAT A;  3GPX A;  3QAU A;  1SXJ B;  5FTL A;  4L8R C;  5LMN M;  5ITX A;  2FFJ A;  1Z6T A;  3TWK A;  4MH0 E;  4LJ9 A;  2F5N A;  1X37 A;  1TH4 A;  2OQ4 A;  3RE8 A;  3VKG A;  3SHF A;  1G8P A;  3THG A;  2F5Q A;  2Q2E B;  4Z8X A;  1GL7 A;  3KS4 A;  4PCZ A;  3SAR A;  3HKP A;  3R9X B;  3FD9 A;  3HHZ A;  3PNY A;  2CV2 A;  3TE6 A;  4D80 A;  4M9X A;  1OJL A;  4M0D A;  2LNH C;  4RF0 A;  1XXH B;  3H4M A;  3CF0 A;  2DZO B;  5KPR A;  3VDU A;  3LVV A;  3IG5 A;  1OFH A;  2HKJ A;  4AZF A;  3NWL A;  2QEN A;  2QCU A;  4AKH A;  2D7G A;  3L28 A;  3GO8 A;  4R3D A;  1IY0 A;  3ZC7 B;  2C99 A;  4LF9 M;  3SMS A;  3GPP A;  3FTE A;  3BOS A;  4JN6 A;  3D8L A;  3KP1 E;  1D2N A;  2VII A;  4LZJ A;  4GC9 A;  2X49 A;  3VK7 A;  4LF4 M;  1IY1 A;  2RGO A;  4EIW A;  3M6A A;  2QBY A;  2DWM A;  3FTF A;  3CF2 A;  1R2Z A;  2D7E A;  1IXR C;  4NOO B;  4DR2 M;  3KDS E;  1QZM A;  4DR6 M;  2R46 A;  1PM5 A;  5DYG A;  2E5L M;  4HL4 A;  3L29 A;  3KOZ E;  3JR5 A;  5FTJ A;  4LRS A;  2HL7 A;  3MK6 A;  3I4V A;  3U61 A;  3GLI B;  2Z4R A;  3GRU A;  4KLN A;  5EXX A;  4YHH M;  4DV4 M;  3J80 S;  1J5E M;  3VKH A;  1IY2 A;  1Z5A A;  4IBG A;  4LZZ A;  4NSR A;  2UXD M;  1JQJ C;  1G4A E;  3U5Z A;  1Z5C A;  2ZBK B;  4G4N A;  3KS8 A;  2ERC A;  3E4R A;  1XHB A;  4NRV A;  3GLH A;  1DO2 A;  3TL4 X;  2UUC M;  1N32 M;  1W5S A;  1HQC A;  4LGY A;  1L1Z A;  4G6Z A;  4MM3 B;  1JR3 A;  5DYI A;  2KW0 A;  3HJQ A;  1IN5 A;  3A42 A;  4GKK M;  2VQF M;  1IBL M;  5C18 A;  5FTK A;  3U6P A;  8CAT A;  3AOE C;  1SXJ C;  2F4V M;  2XFT A;  5E26 A;  2AHM A;  4IBB A;  3T1Y M;  4DV6 M;  1SXJ D;  1XWI A;  3GPY A;  1E32 A;  2VQE M;  3J7B A;  4JI6 M;  4DV0 M;  4TUW A;  1LV7 A;  4XBO A;  1L1T A;  3RGP A;  5A2Q S;  1NHW C;  5KQ8 A;  3GLF B;  3PFI A;  3GQ3 A;  3ILK A;  2KRK A;  4DV3 M;  3LMM A;  1E9S A;  2F5P A;  3T15 A;  4M0W A;  3UMM A;  4IJF A;  1T3T A;  3GQ4 A;  2KZS A;  4GHL A;  1GKI A;  3DFZ A;  3HU1 A;  4G4R A;  3FUU A;  1SXJ A;  1UM8 A;  2LH0 A;  3CF6 E;  3U6E A;  4IBJ A;  2Z3X A;  2R65 A;  4DR3 M;  3J7A S;  4DV2 M;  3E9S A;  5IRE B;  3R8F A;  4NRW A;  4LF8 M;  3K8Z A;  3KSX A;  3I4Y A;  2R18 A;  2JA2 A;  3M0E A;  3FUX A;  4X65 M;  3U6M A;  5IZ7 D;  4DR7 M;  2Z4S A;  1HT1 E;  3DOA A;  3VDP A;  2CHV A;  2L7I A;  1N36 M;  1XXH A;  4WUR A;  1DGG A;  2F5S A;  4LJ4 A;  4DR4 M;  3TWM A;  2ZAM A;  2FOI C;  2UUB M;  1G3I A;  4GMQ A;  4JXJ A;  3U6Q A;  1K3X A;  5FTN A;  4QNR A;  1IQP A;  1Q3B A;  3D8B A;  2X8A A;  4ITQ A;  2XSZ A;  3AOG A;  4LFA M;  1S3S A;  4CHT B;  4CIS A;  1XNQ M;  3LVW A;  1DGH B;  3JR4 A;  3FUW A;  4GRI A;  1XC8 A;  1DGB A;  4BLC A;  4DUY M;  1QAO A;  1QAQ A;  2CUZ A;  2M5Z A;  3VK8 A;  4GH9 A;  4G4O A;  3KOW E;  1PJJ A;  2DHR A;  1N33 M;  4FCT A;  2Y0T A;  3JAM S;  5ITX E;  1TGU A;  5EP3 A;  2XFS A;  1KYI A;  2YFQ A;  4L4U A;  4NXN M;  3AKZ A;  1Z5B A;  5ITT A;  3KVW A;  1J09 A;  1IN6 A;  3GLI A;  1L2B A;  4B3S M;  5EP1 A;  3T1H M;  3FUT A;  4JI0 M;  3TPZ A;  4KHP M;  4FWH A;  4L16 A;  5EXT A;  4W5W A;  5EP4 A;  4PD2 A;  5LMU M;  1HT2 E;  1IXS B;  3FUV A;  3AFH A;  4DUZ M;  5F3W A;  4ZPX A;  2DZN B;  3K2L A;  2ZAN A;  1NNU C;  1N77 A;  3K1J A;  1C1K A;  2Y20 A;  3HU3 A;  3HWS A;  4WW0 A;  4REZ A;  3T38 A;  1NY6 A;  3SAW A;  3U60 B;  4LJ7 A;  4LFC M;  3M7G A;  2CFO A;  2EUC A;  4NL4 H;  4B7G A;  1QVR A;  4M9Z A;  4FWG A;  4PDI A;  5C1B A;  2C98 A;  4QNM A;  5EXP A;  3RGS A;  2V6Z M;  1TDH A;  3HJ8 A;  2FNA A;  2H1R A;  1YSY A;  2G8L A;  2QP9 X;  2UXB M;  3GLF A;  3L2A A;  1QAM A;  3U6S A;  1QYR A;  1Q39 A;  4P16 A;  3GPU A;  4I4L A;  2DXI A;  2A5Y B;  2KA6 B;  2NQ8 C;  3I51 A;  1K3W A;  1FNN A;  4I81 A;  1PJI A;  1NJG A;  2R4J A;  3LQR A;  2YR0 A;  3RFW A;  1E94 E;  4D82 A;  3ZCB B;  4K0K M;  3KOX E;  2LWX A;  4GKJ M;  1W5T A;  2XZU A;  3GQ5 A;  4M9S A;  3GRV A;  4JI2 M;  1ORY B;  3FKE A;  3HGI A;  4R7G A;  3SFZ A;  1KFV A;  1DGF A;  2KRU A;  3KP0 E;  2OPF A;  1XMO M;  1GVN A;  1L2C A;  2C9O A;  1I94 M;  1NNJ A;  4LF7 M;  3SBJ A;  2ZAO A;  3A46 A;  4PT5 A;  1R7R A;  4OVZ B;  3PXG A;  3UGJ A;  3AOE A;  4QOS A;  1NY5 A;  3U6L A;  4B3M M;  4KOD A;  3MJ5 A;  3KSJ A;  4DR1 M;  3FYD A;  3L25 A;  1Z59 A;  2QPA A;  2RKO A;  4B3T M;  2UU9 M;  1N75 A;  4DR5 M;  1TDZ A;  3W0L B;  5EJC A;  1IN8 A;  4B3R M;  4JYA M;  5E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...