3VLFB

Crystal structure of yeast proteasome interacting protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
MDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone/protein binding
molecule keywords DNA mismatch repair protein HSM3
total genus 23
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vlfB00
2CE7A 4I4LA 5FTNA 4A3VB 2BJVA 2DZNB 4KODA 4KLNA 3U61B 4L4UA 1OJLA 2ZANA 3UK6A 2HCBA 3GLGA 2QP9X 3ZH9B 2Z4RA 3EIEA 3GLHB 1SXJE 4FD2A 3WHLA 1IY2A 1SXJD 1DO0A 3VLFB 1SXJA 1E32A 2QENA 5EP1A 1SXJC 2XSZD 3M6AA 1NSFA 4Z8XA 1NJFA 5EQTA 5EP3A 1IQPA 3GLFA 1C1KA 4LY6A 5EP2A 4FWDA 3WHKA 1L8QA 3PFIA 4D80A 1HQCA 2DWZB 4FWGA 2CHVA 3BOSA 1R7RA 5EXPA 2DZOB 4FWHA 4WW0A 3KDSE 1G4AE 2C9OA 4L15A 2C96A 1IN4A 1IN5A 1D2NA 3H4MA 4FCTA 2QBYB 5JI2E 4LRTA 1HT2E 2C98A 2CEAA 2KRKA 5EP4A 3SYLA 1JQJC 3HU1A 5FTJA 2V6ZM 2CHGA 4QHTA 3GLGB 4LJ9A 1QVRA 1KYIA 2VIIA 1KSFX 2QZ4A 3EIHA 3HU2A 3GLHA 2R62A 3KW6A 4GITA 4LCBA 4LJ8A 1W5SA 3U5ZB 4JN6A 2X8AA 1XWIA 4D82A 1G3IA 5C18A 1IN8A 2R65A 4QHSA 3CF2A 4ZPXA 3DZDA 4FCWA 3PVSA 3GLFB 4L16A 1IXRC 1UM8A 5JI3E 1NJGA 2DVWB 1HQYE 2BJWA 4LRSA 1JR3A 1SXJB 2C9CA 4QNMA 3GLIA 1JR3D 3HWSA 4LJ4A 2RKOA 1NY6A 4EIWA 4FW9A 4LJAA 1OFIA 4LZZA 4FCVA 3SYKA 4LJ6A 3CF0A 3HU3A 2C99A 1E94E 3M0EA 1J7KA 1R6BX 2Z4SA 3R8FA 5DYIA 1W5TA 2ZAOA 2QPAA 1IY0A 1HT1E 2CHQA 2FNAA 3AJIB 3D8BA 1OFHA 4LGMA 1X37A 1NY5A 1NVMA 1IN6A 1S3SA 3K1JA 5FTMA 1XXHA 3B9PA 3SC3A 1FNNA 1DO2A 4LJ7A 3VFDA 5C1BA 1XXHB 5FTKA 1IXSB 1QZMA 4QOSA 1G41A 2QBYA 3U60B 5EXSA 3GLIB 1LV7A 1IM2A 5FTLA 4D81A 1IN7A 4LJ5A 4I81A 4QNRA 1IY1A 5DYGA 2DHRA 2XSZA 3PXGA 4KO8A 1IXZA 3MHVC 5EXXA 2ZAMA 2V1UA 5EXTA
chains in the Genus database with same CATH superfamily
2CP8A 1YE9A 2BWEA 3I4VA 4DR1M 2D7HA 4I4LA 2CV1A 3DA1A 4B3RM 1YSYA 4A3VB 1F4IA 5ITXA 2WSCF 3U61B 2Y0TA 4IBIA 3UK6A 3GLGA 2OOBA 4IBEA 3ZH9B 3EIEA 4NOOB 1QDTA 3MK6A 4GC5A 5KPZA 2EJSA 2E5LM 2LVAA 2KNVA 4R71A 4R3DA 2LBCA 1QYRA 3SBJA 1T3TA 1SXJA 2LVOC 5F3WA 1SXJC 4CHTB 1NSFA 1GO5A 1C1KA 5EP2A 3VK8A 4Y28F 1TH4A 2KHHA 3HHXA 3E46A 4DV6M 1Q3CA 4DR5M 2LNHC 3BOSA 1R7RA 5FSWA 1E9SA 1D0LA 3I04M 2R0IA 2WSFF 3KDSE 5BR8M 3T38A 2C9OA 4AW4A 3GQ5A 1K3WA 3ZCBB 3H4MA 3B7NA 1ORYB 3GRYA 3FTDA 2KRKA 3KOZE 3KSXA 3FD9A 4NXNM 2DWLA 1XB2B 3HHYA 1GVNA 3M7GA 2VF8A 3CGWA 4LJ9A 1KSFX 2G3QA 2D7GA 2R62A 4GITA 3KS4A 4R7GA 2O25A 1EE8A 1W5SA 4DR7M 4LF8M 1G3IA 5LMUM 1RU3A 4JI0M 2I7PA 2DNAA 4PT5A 2I7NA 4X62M 5DFLA 4RF1A 3SAWA 1IXRC 3L28A 3GLIE 3NWLA 1YLAA 3JAMS 3GP1A 4QNMA 2M60A 2ZTDA 4AQYM 3HWSA 4KT0F 4LF9M 3KVWA 1TH3A 4MB7A 2Q2EB 4JI7M 5ITRA 1IBMM 3K9PA 3W67A 4IJFA 3HGIA 3LQRA 4LZZA 1XMOM 3U6PA 1I94M 1Z6TA 1TR8A 2JZ0A 1DGBA 3AOEC 4DV1M 1XNQM 5FLXS 3TWMA 1ZMWA 1W5TA 2WZJA 2F5NA 1D0KA 2FNAA 3AJIB 3K2LA 1VG5A 2XZUA 1DV0A 1VDLA 1NHGC 1S3SA 4REZA 3KS8A 4IIWA 5KPRA 3UMMA 1V33A 2UXCM 4GHLA 3IG8A 1N34M 3B9PA 3FUWA 3GPUA 1FNNA 1VEKA 1L2DA 2UXBM 1AIPC 1XXHB 4F2LA 1IXSB 3NBXX 3VK7A 4QOSA 4DV3M 4XK8F 5KO3A 3U60B 1EFUB 1N77A 1BVSA 3GLIB 1IM2A 4D81A 4LF7M 4MM3B 1DGHB 4QNRA 4YHHM 4AKGA 3PXGA 5L8RF 1J5EM 1N33M 1MU5A 1HNWM 2YFQA 4LFAM 4KHPM 4OW0A 2MR9A 4I5SA 3QAUA 3GPYA 3KXEC 2LVPC 3U6QA 2FS1A 4DV7M 2QNJA 2OPFA 2JY5A 2CE7A 3T1HM 1XHBA 2QHOB 4KODA 1I4WA 2KEBA 4L4UA 2A5YB 2ZANA 3KP0E 3GQ3A 1OKSA 2QP9X 3E9SA 4FD2A 2G8LA 3SHFA 3SASA 1DO0A 4OX9M 4RKUF 2EA0A 2L7HA 1MN3A 1XC8A 2XSZD 4Z8XA 4BB9A 2K47A 4XGIA 4GMQA 1Z5CA 1IQPA 5EP3A 1NNUC 3FTCA 4LFCM 3JR4A 1PJJA 2L09A 1L8QA 2R18A 1JR3E 2DWZB 1Q02A 3CTWB 4FWGA 4PCZA 2CHVA 3QWLA 1OQYA 3I01M 3PNYA 2F4VM 4DR6M 3L29A 4FWHA 4AKHA 1PJQA 3GRVA 5GKNA 5ITXE 1G4AE 4JI5M 5IREB 4ITQA 1DGGA 5IWAM 4L15A 4M9XA 1D2NA 3C3DA 4NSRA 2DENA 2OQ4A 4LF6M 4LGYA 4NXMM 1GL7A 2C98A 1MJGM 3K8ZA 1IBKM 2JY7A 3FKEA 3SYLA 4B08A 4G4NA 3VKHA 1JQJC 2R45A 5FTJA 1VEGA 4JI1M 2CV2A 4AI6A 3HY5A 3IHPA 5BPVA 4LFBM 4PD2A 1QANA 2APLA 3QYEA 5EJCA 3SMSA 4FVMA 4M9ZA 1L2CA 2QZ4A 3EIHA 3FYDA 3RGPA 2CWBA 3GLHA 3TQSA 3TPZA 2FFJA 1OTRA 4LJ8A 4MGHA 3I51A 3LQQA 3LVVA 4JN6A 3GLHE 2X8AA 4GKKM 5C18A 1IN8A 4IBBA 3R9XB 4DV0M 4FCWA 4AG6A 4L16A 3TWLA 2EO2A 4WURA 3GLFE 3NBIA 4DV4M 2JP7A 5IT9S 3HZJA 1HQYE 2BJWA 2VF7A 1WHCA 3FUUA 4PDIA 1NO1A 1SXJB 2DAGA 2DZLA 3HJSA 3U6LA 4M0WA 4DUZM 4HLQA 4G6ZA 3FRHA 4BLCA 1NY6A 4GRIA 4DV5M 2RRUA 1OAIA 4FCVA 4LJ6A 4LF4M 3HU3A 3J2PB 3THGA 2FE8A 5E6JA 3T1YM 1N36M 3K9OA 2KW0A 1CUKA 2Z4SA 3K92A 4IBDA 3GO8A 4YY3M 1R2ZA 1Z5BA 2J5YA 5KQDA 2B3TA 3GRRA 2WSEF 1X37A 3AOEA 4LGMA 1NVMA 2UUAM 2VQEM 4G4RA 1IN6A 5E26A 2XGNA 2C5RA 4IBFA 4IBJA 5FTMA 3SAUA 4B7GA 2ZM6M 2LHCA 2QCUA 1T43A 2DKLA 3HJ8A 3SC3A 1DO2A 4IBCA 2HKJA 4P16A 1QQWA 4CIZA 2O01F 3RE8A 3U61A 4JXJA 1GJTA 1NV8A 2QBYA 3D8LA 1LV7A 1WXQA 4Q7JA 4AZFA 5FTLA 4S12A 1IN7A 4LJ5A 3BXWA 4I81A 5DYGA 4JI3M 2F5OA 1QAQA 5IZ7D 2XSZA 4LG2A 1VQ1A 1ZV1A 4GHAA 2DHYA 1QUTA 3QYBA 2P5TA 2Y20A 5ITTA 3L2AA 3CF2A 2MGWA 2KNZA 1L1TA 3HKPA 5EXTA 1L2BA 4L78A 2LHGA 4GIPA 3AL0C 5FTNA 2BJVA 1A5TA 2DAIA 1OJLA 2HCBA 4JI2M 3SAVA 1QZEA 2OOAA 2Z4RA 1SXJE 1Z5AA 1PJIA 3U6EA 1R2YA 3LVWA 3C58A 2RGHA 1E9RA 4GC9A 1E32A 2QENA 3AV0A 3CF6E 1TDZA 1GABA 4MGZE 1C7YA 5EQTA 3SARA 2DAEA 3VDPA 3F92A 2HWJA 4Z6YA 4FWDA 3WHKA 5LMNM 4D80A 1HR0M 3GRUA 1Q39A 2L2DA 3RGSA 4JV5M 4ANRA 5EXPA 2F5PA 1N75A 4OVZA 4WW0A 1K82A 2DWNA 2R4EA 2MH8A 2JA2A 1T6OA 1IN4A 4K0KM 1XNRM 3U60A 3FUTA 5JI2E 5KPTA 2XH9A 2CEAA 2L4FA 4MGIE 1LTMA 4MH0E 1GJSA 2XLJA 2UUBM 3T6PA 1WIVA 1QUSA 1HNZM 5H37D 1TTEA 1GLNA 2L6OA 2V6ZM 3LCUA 4QHTA 3I4YA 3B7QA 4DBGB 3GPXA 1QVRA 2CRUA 2Z3XA 4L6V6 3SMPA 3GLGE 1IFYA 3JR5A 4B3TM 3KW6A 4LCBA 3HHZA 3FRIA 1IBLM 4TUWA 1WJ7A 3UJNA 4JI8M 2RGOA 3U5ZB 1D0MA 2KRUA 1Y8GA 1XWIA 3TWKA 3BBZA 2FOIC 2R65A 4ZPXA 4AG5A 4JYAM 3GLFB 3W68A 1UM8A 2HAKA 2ZTCA 4M9SA 5JI3E 1NJGA 3IECA 2FH0A 4LRSA 1JB0F 1WGLA 3DFZA 3GLIA 3AFHA 3TL4X 2LVNC 2EKKA 3E4RA 4W5WA 2BNKA 2MJ5B 3LCVB 4CISA 4FW9A 4CJ6A 4LJAA 3LW5F 4RF0A 3SFZA 4GKJM 1IXSA 2ERCA 3SYKA 3U6MA 1E94E 1AUAA 2G5GX 3M0EA 4DV2M 1XMQM 2HHHM 1R6BX 2JNHA 3KOYE 3R8FA 3FTEA 3MMPA 1OIZA 1N78A 1HT1E 3D8BA 2CHQA 3J27B 2N35A 1P3QQ 3Q8GA 2R6FA 3GPPA 1Q3BA 4NRVA 4UN2B 3V76A 1XXHE 1Z59A 2LTUA 3B89A 2F5QA 4B3SM 3PNVA 3AOGA 3K1JA 1PRBA 3KOWE 2JY8A 1SG9A 2XFTA 1XXHA 2VQFM 1N32M 2EUCA 4GH9A 4LJ7A 1H6UA 2LXEA 4XBOA 1G8PA 3VFDA 5FTKA 5C1BA 3AKZA 1QZMA 4GEWA 4G3OA 3FYCA 3J80S 1G41A 4B7FA 3U6DA 1NHWC 2L7IA 3HHWA 3SHGB 3ZC7B 1QAMA 2Y21A 4HEOA 2D7EA 5ITQA 3A46A 2V1CA 4JI4M 1IY1A 4OVZB 2KZUA 4MGKE 4LF5M 4DR4M 1R4GA 1QAOA 1IXZA 4PDGA 4X64M 8CATA 2AHMA 1TF0B 2YNMD 2Z8YM 5EXXA 5EP1A 4QOZC 3HX3A 1PJTA 2Z7JA 2JUJA 4NL4H 1ZQ9A 1VDDA 2DZNB 2H5XA 4DR3M 2F5SA 3HJQA 4DR2M 4DUYM 4KLNA 1VEJA 3MJ5A 3B74A 3KP1E 4IBKA 4F1IA 3FUVA 3GLHB 3WHLA 2JXNA 1HNXM 1IY2A 1SXJD 3VLFB 4JI6M 2DAKA 1GKIA 2J7NA 1PM5A 4P17A 1KFVA 2ZBKB 3IG5A 1NV9A 3M6AA 1NJFA 3DOAA 1GL6A 4CGYB 3GLFA 2LWXA 4LY6A 4G4OA 1YUBA 1PJSA 4NC6A 4AKIA 3PFIA 1TGUA 2CV0A 4G4QA 1HQCA 3T15A 4NRWA 2YR0A 2HL7A 1G59A 1ZAEA 2DZOB 4WP2A 4II7A 3B7ZA 2JZ1A 2O5RA 3FTFA 1EIJA 2C96A 1IN5A 1G71A 4FCTA 2QBYB 1R5LA 2CUZA 2K0BX 4LRTA 1HT2E 1TDHA 5EP4A 3Q8XA 4OU7A 1OIPA 1J09A 3UZUA 2VDBB 3HU1A 2XEPA 3U6CA 2DAMA 5KQ8A 2CHGA 2CFOA 1V92A 3GLGB 3RFWA 1KYIA 2VIIA 3A42A 3HU2A 2KA6B 2OO9A 4IBGA 2DWMA 5DNYA 1PGYA 1OAOC 2JY6B 2KXEA 2J7OA 3KSJA 4D82A 2BWBA 2M5ZA 3UGJA 3OTOM 4QHSA 3U6SA 3SATA 3KFUG 3FE3A 3L26A 1DGHA 3DZDA 3PVSA 2KNAA 3W0FA 2R44A 3W0LB 3J7AS 4BBAA 4HL4A 4B7HA 2DVWB 2UUCM 1DGFA 4L8RC 1JR3A 2C9CA 1HJPA 2XF3A 3C3EA 1JR3D 1FJGM 2GNOA 2W82A 1UFZA 3VKGA 2XFSA 4LJ4A 4M0DA 2UXDM 2RKOA 3LMMA 2KZSA 3FUXA 4EIWA 2KDLA 3ILKA 4IJEA 1OFIA 3U6OA 1NNJA 1ZMUA 2LH0A 1K3XA 3A98B 3CF0A 2L4EA 2C99A 3A45A 2JWSA 1J7KA 3GQ4A 4I8OA 5DYIA 3J7BA 4B3MM 1ZMVA 2ZAOA 2K9DA 2QPAA 1V34A 4RNAA 5ITUA 1IY0A 3E21A 3U5ZA 2XZFA 7CATA 2X49A 1OFHA 4X66M 1NY5A 2UU9M 2K6BA 2H1RA 3J81S 2Y0QA 2MROB 2QQ8A 3C9PA 2GQFA 2R46A 2EKFA 4LZJA 5A2QS 1WR1B 2YQZA 1MX0A 2LVQD 3TE6A 3VDUA 1L1ZA 5ITYA 3L27A 3ZQJA 2X4AA 2R4JA 1TH2A 2QSFX 5EXSA 3KOXE 3L25A 2DI0A 1WGNA 2DHRA 1QDRA 4KO8A 4MGYE 4NSOB 3H4JA 3MHVC 4X65M 2NQ8C 2ZAMA 2DXIA 2V1UA
chains in the Genus database with same CATH topology
1YE9A 3I4VA 4DR1M 4B3RM 2D7HA 4I4LA 2CV1A 3DA1A 1YSYA 4A3VB 5ITXA 3U61B 2Y0TA 4IBIA 3UK6A 3GLGA 4IBEA 3ZH9B 3EIEA 4NOOB 3MK6A 5KPZA 4GC5A 2E5LM 4R3DA 1QYRA 3SBJA 1T3TA 1SXJA 5F3WA 1SXJC 4CHTB 1NSFA 1C1KA 5EP2A 3VK8A 1TH4A 3HHXA 4DV6M 1Q3CA 4DR5M 2LNHC 3BOSA 1R7RA 5FSWA 1E9SA 3KDSE 5BR8M 3T38A 2C9OA 4AW4A 3GQ5A 1K3WA 3ZCBB 3H4MA 1ORYB 3GRYA 3FTDA 2KRKA 3KOZE 3KSXA 3FD9A 4NXNM 2DWLA 3HHYA 1GVNA 3M7GA 4LJ9A 1KSFX 4R7GA 2D7GA 2R62A 4GITA 3KS4A 1EE8A 1W5SA 4DR7M 4LF8M 1G3IA 5LMUM 4JI0M 2I7PA 4PT5A 2I7NA 4X62M 4RF1A 3SAWA 1IXRC 3L28A 3NWLA 3JAMS 3GP1A 4QNMA 2M60A 4AQYM 3HWSA 4LF9M 3KVWA 1TH3A 4MB7A 2Q2EB 4JI7M 5ITRA 1IBMM 4IJFA 3HGIA 3LQRA 4LZZA 1XMOM 3U6PA 1I94M 1Z6TA 1DGBA 3AOEC 4DV1M 1XNQM 5FLXS 3TWMA 1W5TA 2F5NA 2FNAA 3AJIB 3K2LA 2XZUA 1NHGC 1S3SA 4REZA 3KS8A 4IIWA 5KPRA 3UMMA 2UXCM 4GHLA 3IG8A 1N34M 3B9PA 3FUWA 3GPUA 1FNNA 1L2DA 2UXBM 1XXHB 1IXSB 3VK7A 4QOSA 4DV3M 5KO3A 3U60B 1N77A 3GLIB 1IM2A 4D81A 4LF7M 4MM3B 1DGHB 4QNRA 4YHHM 4AKGA 3PXGA 1J5EM 1N33M 1MU5A 1HNWM 2YFQA 4LFAM 4KHPM 4OW0A 4I5SA 3GPYA 3QAUA 3KXEC 3U6QA 4DV7M 2OPFA 2CE7A 3T1HM 1XHBA 4KODA 1I4WA 2KEBA 4L4UA 2A5YB 2ZANA 3KP0E 3GQ3A 2QP9X 3E9SA 4FD2A 2G8LA 3SHFA 3SASA 1DO0A 4OX9M 2EA0A 2L7HA 1XC8A 2XSZD 4Z8XA 4BB9A 2K47A 4XGIA 4GMQA 1Z5CA 1IQPA 5EP3A 1NNUC 3FTCA 4LFCM 3JR4A 1PJJA 2L09A 1L8QA 2R18A 3CTWB 2DWZB 4FWGA 4PCZA 2CHVA 3QWLA 4AKHA 3PNYA 4DR6M 2F4VM 3L29A 4FWHA 3GRVA 5GKNA 5ITXE 1G4AE 4JI5M 5IREB 4ITQA 1DGGA 5IWAM 4L15A 4M9XA 1D2NA 4NSRA 2OQ4A 4LF6M 4LGYA 4NXMM 1GL7A 2C98A 3K8ZA 1IBKM 3FKEA 3SYLA 4B08A 4G4NA 3VKHA 1JQJC 2R45A 5FTJA 4JI1M 2CV2A 4AI6A 5BPVA 4LFBM 4PD2A 1QANA 1L2CA 5EJCA 3SMSA 4FVMA 4M9ZA 2QZ4A 3EIHA 3FYDA 3RGPA 3GLHA 3TQSA 3TPZA 2FFJA 4MGHA 4LJ8A 3I51A 3LQQA 3LVVA 4JN6A 2X8AA 4GKKM 5C18A 1IN8A 4IBBA 3R9XB 4DV0M 4FCWA 4AG6A 4L16A 3TWLA 2EO2A 4WURA 3NBIA 4DV4M 5IT9S 1HQYE 2BJWA 3FUUA 4PDIA 1SXJB 3HJSA 3U6LA 4M0WA 4DUZM 4HLQA 4G6ZA 4BLCA 1NY6A 4GRIA 4DV5M 4FCVA 4LJ6A 4LF4M 3HU3A 3J2PB 3THGA 2FE8A 5E6JA 3T1YM 1N36M 2KW0A 2Z4SA 3K92A 4IBDA 3GO8A 4YY3M 1R2ZA 1Z5BA 5KQDA 3GRRA 4LGMA 1X37A 3AOEA 1NVMA 2UUAM 2VQEM 4G4RA 1IN6A 5E26A 2XGNA 2C5RA 4IBFA 4IBJA 5FTMA 3SAUA 4B7GA 2ZM6M 3HJ8A 2QCUA 3SC3A 1DO2A 4IBCA 2HKJA 4P16A 1QQWA 3RE8A 3U61A 4JXJA 2QBYA 3D8LA 1LV7A 1WXQA 4AZFA 5FTLA 4S12A 1IN7A 4LJ5A 4I81A 5DYGA 4JI3M 2F5OA 1QAQA 5IZ7D 2XSZA 4LG2A 4GHAA 2P5TA 2Y20A 5ITTA 3L2AA 3CF2A 1L1TA 3HKPA 5EXTA 1L2BA 4L78A 4GIPA 3AL0C 5FTNA 2BJVA 1OJLA 2HCBA 4JI2M 3SAVA 2Z4RA 1SXJE 1Z5AA 1PJIA 3U6EA 1R2YA 3LVWA 3C58A 2RGHA 1E9RA 4GC9A 1E32A 2QENA 3AV0A 3CF6E 1TDZA 4MGZE 5EQTA 3SARA 3VDPA 4Z6YA 4FWDA 3WHKA 5LMNM 4D80A 1HR0M 3GRUA 1Q39A 3RGSA 4JV5M 5EXPA 2F5PA 1N75A 4OVZA 4WW0A 1K82A 2DWNA 2R4EA 2JA2A 1IN4A 4K0KM 1XNRM 3U60A 3FUTA 5JI2E 5KPTA 2XH9A 2CEAA 4MGIE 4MH0E 2XLJA 2UUBM 1HNZM 5H37D 2V6ZM 1GLNA 2L6OA 4QHTA 3I4YA 3GPXA 1QVRA 2Z3XA 3SMPA 3JR5A 4B3TM 3KW6A 4LCBA 3HHZA 1IBLM 4TUWA 3UJNA 4JI8M 2RGOA 3U5ZB 2KRUA 1XWIA 3TWKA 2FOIC 2R65A 4ZPXA 4AG5A 4JYAM 3GLFB 1UM8A 4M9SA 5JI3E 1NJGA 4LRSA 3DFZA 3GLIA 3AFHA 3TL4X 3E4RA 4W5WA 2BNKA 4CISA 4FW9A 4LJAA 4RF0A 3SFZA 4GKJM 2ERCA 3SYKA 3U6MA 1E94E 2G5GX 4DV2M 3M0EA 1XMQM 2HHHM 1R6BX 3KOYE 3R8FA 3FTEA 1N78A 1HT1E 3D8BA 2CHQA 3J27B 3GPPA 1Q3BA 4NRVA 1Z59A 2F5QA 4B3SM 3PNVA 3AOGA 3K1JA 3KOWE 2XFTA 1XXHA 2VQFM 1N32M 2EUCA 4GH9A 4LJ7A 1H6UA 2LXEA 4XBOA 1G8PA 3VFDA 5FTKA 5C1BA 3AKZA 1QZMA 3FYCA 3J80S 1G41A 4B7FA 3U6DA 1NHWC 2L7IA 3HHWA 3SHGB 3ZC7B 1QAMA 2Y21A 2D7EA 5ITQA 3A46A 2V1CA 4JI4M 1IY1A 4OVZB 2KZUA 4MGKE 4LF5M 4DR4M 1QAOA 1IXZA 4PDGA 4X64M 8CATA 2AHMA 2YNMD 5EXXA 5EP1A 4QOZC 2Z7JA 4NL4H 1ZQ9A 1VDDA 2DZNB 4DR3M 2F5SA 3HJQA 4DR2M 4KLNA 3MJ5A 3KP1E 4IBKA 3FUVA 3GLHB 3WHLA 4JI6M 1HNXM 1IY2A 1SXJD 3VLFB 1GKIA 2J7NA 1PM5A 1KFVA 2ZBKB 3IG5A 3M6AA 1NJFA 3DOAA 1GL6A 4CGYB 3GLFA 2LWXA 4LY6A 4G4OA 1YUBA 4AKIA 3PFIA 1TGUA 2CV0A 4G4QA 1HQCA 3T15A 4NRWA 2YR0A 2HL7A 1G59A 1ZAEA 2DZOB 4II7A 2O5RA 3FTFA 2C96A 1IN5A 4FCTA 2QBYB 2CUZA 4LRTA 1HT2E 1TDHA 5EP4A 3Q8XA 4OU7A 1J09A 3UZUA 3HU1A 2XEPA 3U6CA 5KQ8A 2CHGA 2CFOA 3GLGB 3RFWA 1KYIA 2VIIA 3A42A 3HU2A 2KA6B 4IBGA 2DWMA 5DNYA 2KXEA 2J7OA 3KSJA 4D82A 3OTOM 2M5ZA 3UGJA 3U6SA 4QHSA 3SATA 3KFUG 3L26A 1DGHA 3DZDA 3PVSA 3W0FA 3W0LB 3J7AS 4BBAA 4HL4A 4B7HA 2DVWB 2UUCM 1DGFA 4L8RC 1JR3A 2C9CA 2XF3A 1FJGM 1JR3D 2W82A 3VKGA 2XFSA 4LJ4A 4M0DA 2UXDM 2RKOA 3LMMA 2KZSA 3FUXA 4EIWA 3ILKA 4IJEA 1OFIA 3U6OA 1NNJA 2LH0A 1K3XA 3A98B 3CF0A 2C99A 3A45A 1J7KA 3GQ4A 4I8OA 5DYIA 3J7BA 4B3MM 5ITUA 2ZAOA 2QPAA 4RNAA 1IY0A 3U5ZA 2XZFA 7CATA 2X49A 1OFHA 4X66M 1NY5A 2UU9M 2H1RA 3J81S 2Y0QA 4LZJA 4DUYM 2R46A 5A2QS 1L1ZA 2YQZA 1MX0A 3VDUA 3TE6A 5ITYA 3L27A 2X4AA 2R4JA 1TH2A 5EXSA 3KOXE 3L25A 2DHRA 4KO8A 4MGYE 4NSOB 3MHVC 4X65M 2NQ8C 2ZAMA 2DXIA 2V1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE7 A;  4I4L A;  5FTN A;  4A3V B;  2BJV A;  2DZN B;  4KOD A;  4KLN A;  3U61 B;  4L4U A;  1OJL A;  2ZAN A;  3UK6 A;  2HCB A;  3GLG A;  2QP9 X;  3ZH9 B;  2Z4R A;  3EIE A;  3GLH B;  1SXJ E;  4FD2 A;  3WHL A;  1IY2 A;  1SXJ D;  1DO0 A;  3VLF B;  1SXJ A;  1E32 A;  2QEN A;  5EP1 A;  1SXJ C;  2XSZ D;  3M6A A;  1NSF A;  4Z8X A;  1NJF A;  5EQT A;  5EP3 A;  1IQP A;  3GLF A;  1C1K A;  4LY6 A;  5EP2 A;  4FWD A;  3WHK A;  1L8Q A;  3PFI A;  4D80 A;  1HQC A;  2DWZ B;  4FWG A;  2CHV A;  3BOS A;  1R7R A;  5EXP A;  2DZO B;  4FWH A;  4WW0 A;  3KDS E;  1G4A E;  2C9O A;  4L15 A;  2C96 A;  1IN4 A;  1IN5 A;  1D2N A;  3H4M A;  4FCT A;  2QBY B;  5JI2 E;  4LRT A;  1HT2 E;  2C98 A;  2CEA A;  2KRK A;  5EP4 A;  3SYL A;  1JQJ C;  3HU1 A;  5FTJ A;  2V6Z M;  2CHG A;  4QHT A;  3GLG B;  4LJ9 A;  1QVR A;  1KYI A;  2VII A;  1KSF X;  2QZ4 A;  3EIH A;  3HU2 A;  3GLH A;  2R62 A;  3KW6 A;  4GIT A;  4LCB A;  4LJ8 A;  1W5S A;  3U5Z B;  4JN6 A;  2X8A A;  1XWI A;  4D82 A;  1G3I A;  5C18 A;  1IN8 A;  2R65 A;  4QHS A;  3CF2 A;  4ZPX A;  3DZD A;  4FCW A;  3PVS A;  3GLF B;  4L16 A;  1IXR C;  1UM8 A;  5JI3 E;  1NJG A;  2DVW B;  1HQY E;  2BJW A;  4LRS A;  1JR3 A;  1SXJ B;  2C9C A;  4QNM A;  3GLI A;  1JR3 D;  3HWS A;  4LJ4 A;  2RKO A;  1NY6 A;  4EIW A;  4FW9 A;  4LJA A;  1OFI A;  4LZZ A;  4FCV A;  3SYK A;  4LJ6 A;  3CF0 A;  3HU3 A;  2C99 A;  1E94 E;  3M0E A;  1J7K A;  1R6B X;  2Z4S A;  3R8F A;  5DYI A;  1W5T A;  2ZAO A;  2QPA A;  1IY0 A;  1HT1 E;  2CHQ A;  2FNA A;  3AJI B;  3D8B A;  1OFH A;  4LGM A;  1X37 A;  1NY5 A;  1NVM A;  1IN6 A;  1S3S A;  3K1J A;  5FTM A;  1XXH A;  3B9P A;  3SC3 A;  1FNN A;  1DO2 A;  4LJ7 A;  3VFD A;  5C1B A;  1XXH B;  5FTK A;  1IXS B;  1QZM A;  4QOS A;  1G41 A;  2QBY A;  3U60 B;  5EXS A;  3GLI B;  1LV7 A;  1IM2 A;  5FTL A;  4D81 A;  1IN7 A;  4LJ5 A;  4I81 A;  4QNR A;  1IY1 A;  5DYG A;  2DHR A;  2XSZ A;  3PXG A;  4KO8 A;  1IXZ A;  3MHV C;  5EXX A;  2ZAM A;  2V1U A;  5EXT A; 
#chains in the Genus database with same CATH topology
 2CP8 A;  1YE9 A;  2BWE A;  3I4V A;  4DR1 M;  2D7H A;  4I4L A;  2CV1 A;  3DA1 A;  4B3R M;  1YSY A;  4A3V B;  1F4I A;  5ITX A;  2WSC F;  3U61 B;  2Y0T A;  4IBI A;  3UK6 A;  3GLG A;  2OOB A;  4IBE A;  3ZH9 B;  3EIE A;  4NOO B;  1QDT A;  3MK6 A;  4GC5 A;  5KPZ A;  2EJS A;  2E5L M;  2LVA A;  2KNV A;  4R71 A;  4R3D A;  2LBC A;  1QYR A;  3SBJ A;  1T3T A;  1SXJ A;  2LVO C;  5F3W A;  1SXJ C;  4CHT B;  1NSF A;  1GO5 A;  1C1K A;  5EP2 A;  3VK8 A;  4Y28 F;  1TH4 A;  2KHH A;  3HHX A;  3E46 A;  4DV6 M;  1Q3C A;  4DR5 M;  2LNH C;  3BOS A;  1R7R A;  5FSW A;  1E9S A;  1D0L A;  3I04 M;  2R0I A;  2WSF F;  3KDS E;  5BR8 M;  3T38 A;  2C9O A;  4AW4 A;  3GQ5 A;  1K3W A;  3ZCB B;  3H4M A;  3B7N A;  1ORY B;  3GRY A;  3FTD A;  2KRK A;  3KOZ E;  3KSX A;  3FD9 A;  4NXN M;  2DWL A;  1XB2 B;  3HHY A;  1GVN A;  3M7G A;  2VF8 A;  3CGW A;  4LJ9 A;  1KSF X;  2G3Q A;  2D7G A;  2R62 A;  4GIT A;  3KS4 A;  4R7G A;  2O25 A;  1EE8 A;  1W5S A;  4DR7 M;  4LF8 M;  1G3I A;  5LMU M;  1RU3 A;  4JI0 M;  2I7P A;  2DNA A;  4PT5 A;  2I7N A;  4X62 M;  5DFL A;  4RF1 A;  3SAW A;  1IXR C;  3L28 A;  3GLI E;  3NWL A;  1YLA A;  3JAM S;  3GP1 A;  4QNM A;  2M60 A;  2ZTD A;  4AQY M;  3HWS A;  4KT0 F;  4LF9 M;  3KVW A;  1TH3 A;  4MB7 A;  2Q2E B;  4JI7 M;  5ITR A;  1IBM M;  3K9P A;  3W67 A;  4IJF A;  3HGI A;  3LQR A;  4LZZ A;  1XMO M;  3U6P A;  1I94 M;  1Z6T A;  1TR8 A;  2JZ0 A;  1DGB A;  3AOE C;  4DV1 M;  1XNQ M;  5FLX S;  3TWM A;  1ZMW A;  1W5T A;  2WZJ A;  2F5N A;  1D0K A;  2FNA A;  3AJI B;  3K2L A;  1VG5 A;  2XZU A;  1DV0 A;  1VDL A;  1NHG C;  1S3S A;  4REZ A;  3KS8 A;  4IIW A;  5KPR A;  3UMM A;  1V33 A;  2UXC M;  4GHL A;  3IG8 A;  1N34 M;  3B9P A;  3FUW A;  3GPU A;  1FNN A;  1VEK A;  1L2D A;  2UXB M;  1AIP C;  1XXH B;  4F2L A;  1IXS B;  3NBX X;  3VK7 A;  4QOS A;  4DV3 M;  4XK8 F;  5KO3 A;  3U60 B;  1EFU B;  1N77 A;  1BVS A;  3GLI B;  1IM2 A;  4D81 A;  4LF7 M;  4MM3 B;  1DGH B;  4QNR A;  4YHH M;  4AKG A;  3PXG A;  5L8R F;  1J5E M;  1N33 M;  1MU5 A;  1HNW M;  2YFQ A;  4LFA M;  4KHP M;  4OW0 A;  2MR9 A;  4I5S A;  3QAU A;  3GPY A;  3KXE C;  2LVP C;  3U6Q A;  2FS1 A;  4DV7 M;  2QNJ A;  2OPF A;  2JY5 A;  2CE7 A;  3T1H M;  1XHB A;  2QHO B;  4KOD A;  1I4W A;  2KEB A;  4L4U A;  2A5Y B;  2ZAN A;  3KP0 E;  3GQ3 A;  1OKS A;  2QP9 X;  3E9S A;  4FD2 A;  2G8L A;  3SHF A;  3SAS A;  1DO0 A;  4OX9 M;  4RKU F;  2EA0 A;  2L7H A;  1MN3 A;  1XC8 A;  2XSZ D;  4Z8X A;  4BB9 A;  2K47 A;  4XGI A;  4GMQ A;  1Z5C A;  1IQP A;  5EP3 A;  1NNU C;  3FTC A;  4LFC M;  3JR4 A;  1PJJ A;  2L09 A;  1L8Q A;  2R18 A;  1JR3 E;  2DWZ B;  1Q02 A;  3CTW B;  4FWG A;  4PCZ A;  2CHV A;  3QWL A;  1OQY A;  3I01 M;  3PNY A;  2F4V M;  4DR6 M;  3L29 A;  4FWH A;  4AKH A;  1PJQ A;  3GRV A;  5GKN A;  5ITX E;  1G4A E;  4JI5 M;  5IRE B;  4ITQ A;  1DGG A;  5IWA M;  4L15 A;  4M9X A;  1D2N A;  3C3D A;  4NSR A;  2DEN A;  2OQ4 A;  4LF6 M;  4LGY A;  4NXM M;  1GL7 A;  2C98 A;  1MJG M;  3K8Z A;  1IBK M;  2JY7 A;  3FKE A;  3SYL A;  4B08 A;  4G4N A;  3VKH A;  1JQJ C;  2R45 A;  5FTJ A;  1VEG A;  4JI1 M;  2CV2 A;  4AI6 A;  3HY5 A;  3IHP A;  5BPV A;  4LFB M;  4PD2 A;  1QAN A;  2APL A;  3QYE A;  5EJC A;  3SMS A;  4FVM A;  4M9Z A;  1L2C A;  2QZ4 A;  3EIH A;  3FYD A;  3RGP A;  2CWB A;  3GLH A;  3TQS A;  3TPZ A;  2FFJ A;  1OTR A;  4LJ8 A;  4MGH A;  3I51 A;  3LQQ A;  3LVV A;  4JN6 A;  3GLH E;  2X8A A;  4GKK M;  5C18 A;  1IN8 A;  4IBB A;  3R9X B;  4DV0 M;  4FCW A;  4AG6 A;  4L16 A;  3TWL A;  2EO2 A;  4WUR A;  3GLF E;  3NBI A;  4DV4 M;  2JP7 A;  5IT9 S;  3HZJ A;  1HQY E;  2BJW A;  2VF7 A;  1WHC A;  3FUU A;  4PDI A;  1NO1 A;  1SXJ B;  2DAG A;  2DZL A;  3HJS A;  3U6L A;  4M0W A;  4DUZ M;  4HLQ A;  4G6Z A;  3FRH A;  4BLC A;  1NY6 A;  4GRI A;  4DV5 M;  2RRU A;  1OAI A;  4FCV A;  4LJ6 A;  4LF4 M;  3HU3 A;  3J2P B;  3THG A;  2FE8 A;  5E6J A;  3T1Y M;  1N36 M;  3K9O A;  2KW0 A;  1CUK A;  2Z4S A;  3K92 A;  4IBD A;  3GO8 A;  4YY3 M;  1R2Z A;  1Z5B A;  2J5Y A;  5KQD A;  2B3T A;  3GRR A;  2WSE F;  1X37 A;  3AOE A;  4LGM A;  1NVM A;  2UUA M;  2VQE M;  4G4R A;  1IN6 A;  5E26 A;  2XGN A;  2C5R A;  4IBF A;  4IBJ A;  5FTM A;  3SAU A;  4B7G A;  2ZM6 M;  2LHC A;  2QCU A;  1T43 A;  2DKL A;  3HJ8 A;  3SC3 A;  1DO2 A;  4IBC A;  2HKJ A;  4P16 A;  1QQW A;  4CIZ A;  2O01 F;  3RE8 A;  3U61 A;  4JXJ A;  1GJT A;  1NV8 A;  2QBY A;  3D8L A;  1LV7 A;  1WXQ A;  4Q7J A;  4AZF A;  5FTL A;  4S12 A;  1IN7 A;  4LJ5 A;  3BXW A;  4I81 A;  5DYG A;  4JI3 M;  2F5O A;  1QAQ A;  5IZ7 D;  2XSZ A;  4LG2 A;  1VQ1 A;  1ZV1 A;  4GHA A;  2DHY A;  1QUT A;  3QYB A;  2P5T A;  2Y20 A;  5ITT A;  3L2A A;  3CF2 A;  2MGW A;  2KNZ A;  1L1T A;  3HKP A;  5EXT A;  1L2B A;  4L78 A;  2LHG A;  4GIP A;  3AL0 C;  5FTN A;  2BJV A;  1A5T A;  2DAI A;  1OJL A;  2HCB A;  4JI2 M;  3SAV A;  1QZE A;  2OOA A;  2Z4R A;  1SXJ E;  1Z5A A;  1PJI A;  3U6E A;  1R2Y A;  3LVW A;  3C58 A;  2RGH A;  1E9R A;  4GC9 A;  1E32 A;  2QEN A;  3AV0 A;  3CF6 E;  1TDZ A;  1GAB A;  4MGZ E;  1C7Y A;  5EQT A;  3SAR A;  2DAE A;  3VDP A;  3F92 A;  2HWJ A;  4Z6Y A;  4FWD A;  3WHK A;  5LMN M;  4D80 A;  1HR0 M;  3GRU A;  1Q39 A;  2L2D A;  3RGS A;  4JV5 M;  4ANR A;  5EXP A;  2F5P A;  1N75 A;  4OVZ A;  4WW0 A;  1K82 A;  2DWN A;  2R4E A;  2MH8 A;  2JA2 A;  1T6O A;  1IN4 A;  4K0K M;  1XNR M;  3U60 A;  3FUT A;  5JI2 E;  5KPT A;  2XH9 A;  2CEA A;  2L4F A;  4MGI E;  1LTM A;  4MH0 E;  1GJS A;  2XLJ A;  2UUB M;  3T6P A;  1WIV A;  1QUS A;  1HNZ M;  5H37 D;  1TTE A;  1GLN A;  2L6O A;  2V6Z M;  3LCU A;  4QHT A;  3I4Y A;  3B7Q A;  4DBG B;  3GPX A;  1QVR A;  2CRU A;  2Z3X A;  4L6V 6;  3SMP A;  3GLG E;  1IFY A;  3JR5 A;  4B3T M;  3KW6 A;  4LCB A;  3HHZ A;  3FRI A;  1IBL M;  4TUW A;  1WJ7 A;  3UJN A;  4JI8 M;  2RGO A;  3U5Z B;  1D0M A;  2KRU A;  1Y8G A;  1XWI A;  3TWK A;  3BBZ A;  2FOI C;  2R65 A;  4ZPX A;  4AG5 A;  4JYA M;  3GLF B;  3W68 A;  1UM8 A;  2HAK A;  2ZTC A;  4M9S A;  5JI3 E;  1NJG A;  3IEC A;  2FH0 A;  4LRS A;  1JB0 F;  1WGL A;  3DFZ A;  3GLI A;  3AFH A;  3TL4 X;  2LVN C;  2EKK A;  3E4R A;  4W5W A;  2BNK A;  2MJ5 B;  3LCV B;  4CIS A;  4FW9 A;  4CJ6 A;  4LJA A;  3LW5 F;  4RF0 A;  3SFZ A;  4GKJ M;  1IXS A;  2ERC A;  3SYK A;  3U6M A;  1E94 E;  1AUA A;  2G5G X;  3M0E A;  4DV2 M;  1XMQ M;  2HHH M;  1R6B X;  2JNH A;  3KOY E;  3R8F A;  3FTE A;  3MMP A;  1OIZ A;  1N78 A;  1HT1 E;  3D8B A;  2CHQ A;  3J27 B;  2N35 A;  1P3Q Q;  3Q8G A;  2R6F A;  3GPP A;  1Q3B A;  4NRV A;  4UN2 B;  3V76 A;  1XXH E;  1Z59 A;  2LTU A;  3B89 A;  2F5Q A;  4B3S M;  3PNV A;  3AOG A;  3K1J A;  1PRB A;  3KOW E;  2JY8 A;  1SG9 A;  2XFT A;  1XXH A;  2VQF M;  1N32 M;  2EUC A;  4GH9 A;  4LJ7 A;  1H6U A;  2LXE A;  4XBO A;  1G8P A;  3VFD A;  5FTK A;  5C1B A;  3AKZ A;  1QZM A;  4GEW A;  4G3O A;  3FYC A;  3J80 S;  1G41 A;  4B7F A;  3U6D A;  1NHW C;  2L7I A;  3HHW A;  3SHG B;  3ZC7 B;  1QAM A;  2Y21 A;  4HEO A;  2D7E A;  5ITQ A;  3A46 A;  2V1C A;  4JI4 M;  1IY1 A;  4OVZ B;  2KZU A;  4MGK E;  4LF5 M;  4DR4 M;  1R4G A;  1QAO A;  1IXZ A;  4PDG A;  4X64 M;  8CAT A;  2AHM A;  1TF0 B;  2YNM D;  2Z8Y M;  5EXX A;  5EP1 A;  4QOZ C;  3HX3 A;  1PJT A;  2Z7J A;  2JUJ A;  4NL4 H;  1ZQ9 A;  1VDD A;  2DZN B;  2H5X A;  4DR3 M;  2F5S A;  3HJQ A;  4DR2 M;  4DUY M;  4KLN A;  1VEJ A;  3MJ5 A;  3B74 A;  3KP1 E;  4IBK A;  4F1I A;  3FUV A;  3GLH B;  3WHL A;  2JXN A;  1HNX M;  1IY2 A;  1SXJ D;  3VLF B;  4JI6 M;  2DAK A;  1GKI A;  2J7N A;  1PM5 A;  4P17 A;  1KFV A;  2ZBK B;  3IG5 A;  1NV9 A;  3M6A A;  1NJF A;  3DOA A;  1GL6 A;  4CGY B;  3GLF A;  2LWX A;  4LY6 A;  4G4O A;  1YUB A;  1PJS A;  4NC6 A;  4AKI A;  3PFI A;  1TGU A;  2CV0 A;  4G4Q A;  1HQC A;  3T15 A;  4NRW A;  2YR0 A;  2HL7 A;  1G59 A;  1ZAE A;  2DZO B;  4WP2 A;  4II7 A;  3B7Z A;  2JZ1 A;  2O5R A;  3FTF A;  1EIJ A;  2C96 A;  1IN5 A;  1G71 A;  4FCT A;  2QBY B;  1R5L A;  2CUZ A;  2K0B X;  4LRT A;  1HT2 E;  1TDH A;  5EP4 A;  3Q8X A;  4OU7 A;  1OIP A;  1J09 A;  3UZU A;  2VDB B;  3HU1 A;  2XEP A;  3U6C A;  2DAM A;  5KQ8 A;  2CHG A;  2CFO A;  1V92 A;  3GLG B;  3RFW A;  1KYI A;  2VII A;  3A42 A;  3HU2 A;  2KA6 B;  2OO9 A;  4IBG A;  2DWM A;  5DNY A;  1PGY A;  1OAO C;  2JY6 B;  2KXE A;  2J7O A;  3KSJ A;  4D82 A;  2BWB A;  2M5Z A;  3UGJ A;  3OTO M;  4QHS A;  3U6S A;  3SAT A;  3KFU G;  3FE3 A;  3L26 A;  1DGH A;  3DZD A;  3PVS A;  2KNA A;  3W0F A;  2R44 A;  3W0L B;  3J7A S;  4BBA A;  4HL4 A;  4B7H A;  2DVW B;  2UUC M;  1DGF A;  4L8R C;  1JR3 A;  2C9C A;  1HJP A;  2XF3 A;  3C3E A;  1JR3 D;  1FJG M;  2GNO A;  2W82 A;  1UFZ A;  3VKG A;  2XFS A;  4LJ4 A;  4M0D A;  2UXD M;  2RKO A;  3LMM A;  2KZS A;  3FUX A;  4EIW A;  2KDL A;  3ILK A;  4IJE A;  1OFI A;  3U6O A;  1NNJ A;  1ZMU A;  2LH0 A;  1K3X A;  3A98 B;  3CF0 A;  2L4E A;  2C99 A;  3A45 A;  2JWS A;  1J7K A;  3GQ4 A;  4I8O A;  5DYI A;  3J7B A;  4B3M M;  1ZMV A;  2ZAO A;  2K9D A;  2QPA A;  1V34 A;  4RNA A;  5ITU A;  1IY0 A;  3E21 A;  3U5Z A;  2XZF A;  7CAT A;  2X49 A;  1OFH A;  4X66 M;  1NY5 A;  2UU9 M;  2K6B A;  2H1R A;  3J81 S;  2Y0Q A;  2MRO B;  2QQ8 A;  3C9P A;  2GQF A;  2R46 A;  2EKF A;  4LZJ A;  5A2Q S;  1WR1 B;  2YQZ A;  1MX0 A;  2LVQ D;  3TE6 A;  3VDU A;  1L1Z A;  5ITY A;  3L27 A;  3ZQJ A;  2X4A A;  2R4J A;  1TH2 A;  2QSF X;  5EXS A;  3KOX E;  3L25 A;  2DI0 A;  1WGN A;  2DHR A;  1QDR A;  4KO8 A;  4MGY E;  4NSO B;  3H4J A;  3MHV C;  4X65 M;  2NQ8 C;  2ZAM A;  2DXI A;  2V1U A; 
#chains in the Genus database with same CATH homology
 1YE9 A;  3I4V A;  4DR1 M;  4B3R M;  2D7H A;  4I4L A;  2CV1 A;  3DA1 A;  1YSY A;  4A3V B;  5ITX A;  3U61 B;  2Y0T A;  4IBI A;  3UK6 A;  3GLG A;  4IBE A;  3ZH9 B;  3EIE A;  4NOO B;  3MK6 A;  5KPZ A;  4GC5 A;  2E5L M;  4R3D A;  1QYR A;  3SBJ A;  1T3T A;  1SXJ A;  5F3W A;  1SXJ C;  4CHT B;  1NSF A;  1C1K A;  5EP2 A;  3VK8 A;  1TH4 A;  3HHX A;  4DV6 M;  1Q3C A;  4DR5 M;  2LNH C;  3BOS A;  1R7R A;  5FSW A;  1E9S A;  3KDS E;  5BR8 M;  3T38 A;  2C9O A;  4AW4 A;  3GQ5 A;  1K3W A;  3ZCB B;  3H4M A;  1ORY B;  3GRY A;  3FTD A;  2KRK A;  3KOZ E;  3KSX A;  3FD9 A;  4NXN M;  2DWL A;  3HHY A;  1GVN A;  3M7G A;  4LJ9 A;  1KSF X;  4R7G A;  2D7G A;  2R62 A;  4GIT A;  3KS4 A;  1EE8 A;  1W5S A;  4DR7 M;  4LF8 M;  1G3I A;  5LMU M;  4JI0 M;  2I7P A;  4PT5 A;  2I7N A;  4X62 M;  4RF1 A;  3SAW A;  1IXR C;  3L28 A;  3NWL A;  3JAM S;  3GP1 A;  4QNM A;  2M60 A;  4AQY M;  3HWS A;  4LF9 M;  3KVW A;  1TH3 A;  4MB7 A;  2Q2E B;  4JI7 M;  5ITR A;  1IBM M;  4IJF A;  3HGI A;  3LQR A;  4LZZ A;  1XMO M;  3U6P A;  1I94 M;  1Z6T A;  1DGB A;  3AOE C;  4DV1 M;  1XNQ M;  5FLX S;  3TWM A;  1W5T A;  2F5N A;  2FNA A;  3AJI B;  3K2L A;  2XZU A;  1NHG C;  1S3S A;  4REZ A;  3KS8 A;  4IIW A;  5KPR A;  3UMM A;  2UXC M;  4GHL A;  3IG8 A;  1N34 M;  3B9P A;  3FUW A;  3GPU A;  1FNN A;  1L2D A;  2UXB M;  1XXH B;  1IXS B;  3VK7 A;  4QOS A;  4DV3 M;  5KO3 A;  3U60 B;  1N77 A;  3GLI B;  1IM2 A;  4D81 A;  4LF7 M;  4MM3 B;  1DGH B;  4QNR A;  4YHH M;  4AKG A;  3PXG A;  1J5E M;  1N33 M;  1MU5 A;  1HNW M;  2YFQ A;  4LFA M;  4KHP M;  4OW0 A;  4I5S A;  3GPY A;  3QAU A;  3KXE C;  3U6Q A;  4DV7 M;  2OPF A;  2CE7 A;  3T1H M;  1XHB A;  4KOD A;  1I4W A;  2KEB A;  4L4U A;  2A5Y B;  2ZAN A;  3KP0 E;  3GQ3 A;  2QP9 X;  3E9S A;  4FD2 A;  2G8L A;  3SHF A;  3SAS A;  1DO0 A;  4OX9 M;  2EA0 A;  2L7H A;  1XC8 A;  2XSZ D;  4Z8X A;  4BB9 A;  2K47 A;  4XGI A;  4GMQ A;  1Z5C A;  1IQP A;  5EP3 A;  1NNU C;  3FTC A;  4LFC M;  3JR4 A;  1PJJ A;  2L09 A;  1L8Q A;  2R18 A;  3CTW B;  2DWZ B;  4FWG A;  4PCZ A;  2CHV A;  3QWL A;  4AKH A;  3PNY A;  4DR6 M;  2F4V M;  3L29 A;  4FWH A;  3GRV A;  5GKN A;  5ITX E;  1G4A E;  4JI5 M;  5IRE B;  4ITQ A;  1DGG A;  5IWA M;  4L15 A;  4M9X A;  1D2N A;  4NSR A;  2OQ4 A;  4LF6 M;  4LGY A;  4NXM M;  1GL7 A;  2C98 A;  3K8Z A;  1IBK M;  3FKE A;  3SYL A;  4B08 A;  4G4N A;  3VKH A;  1JQJ C;  2R45 A;  5FTJ A;  4JI1 M;  2CV2 A;  4AI6 A;  5BPV A;  4LFB M;  4PD2 A;  1QAN A;  1L2C A;  5EJC A;  3SMS A;  4FVM A;  4M9Z A;  2QZ4 A;  3EIH A;  3FYD A;  3RGP A;  3GLH A;  3TQS A;  3TPZ A;  2FFJ A;  4MGH A;  4LJ8 A;  3I51 A;  3LQQ A;  3LVV A;  4JN6 A;  2X8A A;  4GKK M;  5C18 A;  1IN8 A;  4IBB A;  3R9X B;  4DV0 M;  4FCW A;  4AG6 A;  4L16 A;  3TWL A;  2EO2 A;  4WUR A;  3NBI A;  4DV4 M;  5IT9 S;  1HQY E;  2BJW A;  3FUU A;  4PDI A;  1SXJ B;  3HJS A;  3U6L A;  4M0W A;  4DUZ M;  4HLQ A;  4G6Z A;  4BLC A;  1NY6 A;  4GRI A;  4DV5 M;  4FCV A;  4LJ6 A;  4LF4 M;  3HU3 A;  3J2P B;  3THG A;  2FE8 A;  5E6J A;  3T1Y M;  1N36 M;  2KW0 A;  2Z4S A;  3K92 A;  4IBD A;  3GO8 A;  4YY3 M;  1R2Z A;  1Z5B A;  5KQD A;  3GRR A;  4LGM A;  1X37 A;  3AOE A;  1NVM A;  2UUA M;  2VQE M;  4G4R A;  1IN6 A;  5E26 A;  2XGN A;  2C5R A;  4IBF A;  4IBJ A;  5FTM A;  3SAU A;  4B7G A;  2ZM6 M;  3HJ8 A;  2QCU A;  3SC3 A;  1DO2 A;  4IBC A;  2HKJ A;  4P16 A;  1QQW A;  3RE8 A;  3U61 A;  4JXJ A;  2QBY A;  3D8L A;  1LV7 A;  1WXQ A;  4AZF A;  5FTL A;  4S12 A;  1IN7 A;  4LJ5 A;  4I81 A;  5DYG A;  4JI3 M;  2F5O A;  1QAQ A;  5IZ7 D;  2XSZ A;  4LG2 A;  4GHA A;  2P5T A;  2Y20 A;  5ITT A;  3L2A A;  3CF2 A;  1L1T A;  3HKP A;  5EXT A;  1L2B A;  4L78 A;  4GIP A;  3AL0 C;  5FTN A;  2BJV A;  1OJL A;  2HCB A;  4JI2 M;  3SAV A;  2Z4R A;  1SXJ E;  1Z5A A;  1PJI A;  3U6E A;  1R2Y A;  3LVW A;  3C58 A;  2RGH A;  1E9R A;  4GC9 A;  1E32 A;  2QEN A;  3AV0 A;  3CF6 E;  1TDZ A;  4MGZ E;  5EQT A;  3SAR A;  3VDP A;  4Z6Y A;  4FWD A;  3WHK A;  5LMN M;  4D80 A;  1HR0 M;  3GRU A;  1Q39 A;  3RGS A;  4JV5 M;  5EXP A;  2F5P A;  1N75 A;  4OVZ A;  4WW0 A;  1K82 A;  2DWN A;  2R4E A;  2JA2 A;  1IN4 A;  4K0K M;  1XNR M;  3U60 A;  3FUT A;  5JI2 E;  5KPT A;  2XH9 A;  2CEA A;  4MGI E;  4MH0 E;  2XLJ A;  2UUB M;  1HNZ M;  5H37 D;  2V6Z M;  1GLN A;  2L6O A;  4QHT A;  3I4Y A;  3GPX A;  1QVR A;  2Z3X A;  3SMP A;  3JR5 A;  4B3T M;  3KW6 A;  4LCB A;  3HHZ A;  1IBL M;  4TUW A;  3UJN A;  4JI8 M;  2RGO A;  3U5Z B;  2KRU A;  1XWI A;  3TWK A;  2FOI C;  2R65 A;  4ZPX A;  4AG5 A;  4JYA M;  3GLF B;  1UM8 A;  4M9S A;  5JI3 E;  1NJG A;  4LRS A;  3DFZ A;  3GLI A;  3AFH A;  3TL4 X;  3E4R A;  4W5W A;  2BNK A;  4CIS A;  4FW9 A;  4LJA A;  4RF0 A;  3SFZ A;  4GKJ M;  2ERC A;  3SYK A;  3U6M A;  1E94 E;  2G5G X;  4DV2 M;  3M0E A;  1XMQ M;  2HHH M;  1R6B X;  3KOY E;  3R8F A;  3FTE A;  1N78 A;  1HT1 E;  3D8B A;  2CHQ A;  3J27 B;  3GPP A;  1Q3B A;  4NRV A;  1Z59 A;  2F5Q A;  4B3S M;  3PNV A;  3AOG A;  3K1J A;  3KOW E;  2XFT A;  1XXH A;  2VQF M;  1N32 M;  2EUC A;  4GH9 A;  4LJ7 A;  1H6U A;  2LXE A;  4XBO A;  1G8P A;  3VFD A;  5FTK A;  5C1B A;  3AKZ A;  1QZM A;  3FYC A;  3J80 S;  1G41 A;  4B7F A;  3U6D A;  1NHW C;  2L7I A;  3HHW A;  3SHG B;  3ZC7 B;  1QAM A;  2Y21 A;  2D7E A;  5ITQ A;  3A46 A;  2V1C A;  4JI4 M;  1IY1 A;  4OVZ B;  2KZU A;  4MGK E;  4LF5 M;  4DR4 M;  1QAO A;  1IXZ A;  4PDG A;  4X64 M;  8CAT A;  2AHM A;  2YNM D;  5EXX A;  5EP1 A;  4QOZ C;  2Z7J A;  4NL4 H;  1ZQ9 A;  1VDD A;  2DZN B;  4DR3 M;  2F5S A;  3HJQ A;  4DR2 M;  4KLN A;  3MJ5 A;  3KP1 E;  4IBK A;  3FUV A;  3GLH B;  3WHL A;  4JI6 M;  1HNX M;  1IY2 A;  1SXJ D;  3VLF B;  1GKI A;  2J7N A;  1PM5 A;  1KFV A;  2ZBK B;  3IG5 A;  3M6A A;  1NJF A;  3DOA A;  1GL6 A;  4CGY B;  3GLF A;  2LWX A;  4LY6 A;  4G4O A;  1YUB A;  4AKI A;  3PFI A;  1TGU A;  2CV0 A;  4G4Q A;  1HQC A;  3T15 A;  4NRW A;  2YR0 A;  2HL7 A;  1G59 A;  1ZAE A;  2DZO B;  4II7 A;  2O5R A;  3FTF A;  2C96 A;  1IN5 A;  4FCT A;  2QBY B;  2CUZ A;  4LRT A;  1HT2 E;  1TDH A;  5EP4 A;  3Q8X A;  4OU7 A;  1J09 A;  3UZU A;  3HU1 A;  2XEP A;  3U6C A;  5KQ8 A;  2CHG A;  2CFO A;  3GLG B;  3RFW A;  1KYI A;  2VII A;  3A42 A;  3HU2 A;  2KA6 B;  4IBG A;  2DWM A;  5DNY A;  2KXE A;  2J7O A;  3KSJ A;  4D82 A;  3OTO M;  2M5Z A;  3UGJ A;  3U6S A;  4QHS A;  3SAT A;  3KFU G;  3L26 A;  1DGH A;  3DZD A;  3PVS A;  3W0F A;  3W0L B;  3J7A S;  4BBA A;  4HL4 A;  4B7H A;  2DVW B;  2UUC M;  1DGF A;  4L8R C;  1JR3 A;  2C9C A;  2XF3 A;  1FJG M;  1JR3 D;  2W82 A;  3VKG A;  2XFS A;  4LJ4 A;  4M0D A;  2UXD M;  2RKO A;  3LMM A;  2KZS A;  3FUX A;  4EIW A;  3ILK A;  4IJE A;  1OFI A;  3U6O A;  1NNJ A;  2LH0 A;  1K3X A;  3A98 B;  3CF0 A;  2C99 A;  3A45 A;  1J7K A;  3GQ4 A;  4I8O A;  5DYI A;  3J7B A;  4B3M M;  5ITU A;  2ZAO A;  2QPA A;  4RNA A;  1IY0 A;  3U5Z A;  2XZF A;  7CAT A;  2X49 A;  1OFH A;  4X66 M;  1NY5 A;  2UU9 M;  2H1R A;  3J81 S;  2Y0Q A;  4LZJ A;  4DUY M;  2R46 A;  5A2Q S;  1L1Z A;  2YQZ A;  1MX0 A;  3VDU A;  3TE6 A;  5ITY A;  3L27 A;  2X4A A;  2R4J A;  1TH2 A;  5EXS A;  3KOX E;  3L25 A;  2DHR A;  4KO8 A;  4MGY E;  4NSO B;  3MHV C;  4X65 M;  2NQ8 C;  2ZAM A;  2DXI A;  2V1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...