4LFCM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfcM02
4DR3M 4AQYM 3U6CA 1XC8A 1HNZM 4GKKM 4DV7M 1HR0M 2F5NA 3A46A 5IT9S 1XNQM 1XNRM 4JI5M 2XZFA 1XMOM 1PM5A 3JR4A 4LF7M 3SAVA 1R2YA 3GQ3A 3DOAA 2F5PA 4DR5M 1HNWM 2XZUA 4PDIA 1Q3BA 4DV5M 5LMNM 4DV2M 3SATA 4DV6M 1I94M 4NXNM 2HKJA 4ITQA 4B3MM 2UXDM 2EA0A 3T1YM 1KFVA 4JI1M 2F5SA 4PDGA 2UUAM 4NRWA 4CISA 4PD2A 4B3RM 1HNXM 3A45A 4JI3M 4G4OA 3SBJA 1FJGM 5BR8M 1N36M 1L2BA 4NRVA 3OTOM 1PJIA 3TWLA 1MX0A 3W0FA 2UU9M 3J80S 5ITXA 1Z5BA 4PCZA 5A2QS 4DR2M 1IBMM 4KHPM 1Z5AA 1MU5A 4DR1M 4JV5M 4X66M 4DV3M 4JI4M 4LF9M 4K0KM 1Q3CA 3GPXA 4LFBM 1N32M 2UUBM 4JI7M 5ITUA 4JI0M 1TDHA 2F5QA 2UXCM 3GPUA 1PJJA 3C58A 3GP1A 4DR4M 3U6LA 1EE8A 4B3TM 4LF8M 1Q39A 4JI2M 4YHHM 2UXBM 1K3XA 4OX9M 3GQ4A 2E5LM 1IBLM 1N33M 3SARA 5ITQA 4YY3M 4DV4M 4LFCM 3SAUA 4NXMM 1Z59A 3U6OA 4DUZM 2F5OA 1TDZA 4JI8M 4DUYM 3U6DA 1N34M 1L2DA 5ITTA 3VK7A 5IWAM 3TWMA 3U6SA 5ITYA 3GQ5A 4GKJM 3J81S 3GO8A 5FLXS 1R2ZA 4X64M 3GPPA 5LMUM 3SAWA 3T1HM 4G4NA 4DV1M 4JYAM 2ZM6M 3U6PA 3U6QA 4G4RA 1K3WA 2VQFM 3JR5A 4LF5M 5ITRA 1J5EM 4DR6M 4DV0M 1L1ZA 1XMQM 1IBKM 3J7AS 4LF6M 2UUCM 1NNJA 4LF4M 3U6MA 1L2CA 2F4VM 2OQ4A 2Q2EB 3SASA 4LFAM 2HHHM 4G4QA 1Z5CA 3A42A 3JAMS 4X62M 3GPYA 3U6EA 1L1TA 4B3SM 4JI6M 4DR7M 1K82A 2OPFA 5ITXE 4X65M 3VK8A 2VQEM 4MB7A 2ZBKB 3TWKA
chains in the Genus database with same CATH superfamily
3U60B 4AQYM 2LH0A 2GNOA 2OOAA 2WZJA 1VDDA 2ZAOA 4GRIA 4DV7M 3AV0A 4M9SA 4KODA 2F5NA 4JI5M 2C99A 1PM5A 3UZUA 3JR4A 3QAUA 2O25A 1HJPA 1NVMA 2H1RA 3HHYA 2J7OA 3DOAA 3R8FA 1HNWM 4QNMA 2R0IA 2DVWB 3EIHA 4R7GA 4IBIA 2C96A 4DV5M 3AL0C 4IBEA 1MJGM 4MGIE 2XSZA 3KP0E 5H37D 3VFDA 2CE7A 4DV6M 1SXJE 2CP8A 2DAEA 1I94M 3AOEC 2HKJA 2G8LA 4FWHA 5EXTA 2DAGA 4NC6A 2CHVA 3GLIA 3KFUG 2FOIC 2R18A 3SMPA 3KS8A 1HQCA 1R5LA 2DI0A 3AOGA 2XEPA 3FUTA 2LTUA 1OAIA 4NRWA 1W5TA 4FD2A 2VDBB 3LVVA 4WP2A 1T43A 4NOOB 2W82A 2P5TA 1V34A 3UJNA 4Z6YA 5EP4A 2HAKA 2FNAA 1NNUC 3OTOM 1GKIA 1PJIA 1PRBA 2DWNA 3PNVA 3J80S 5ITXA 1IBMM 3LMMA 2C9CA 4IBDA 2K0BX 3U5ZB 4AW4A 3FTCA 2KEBA 4DV3M 3GLFE 3GPXA 4MGHA 1N32M 1P3QQ 2JY7A 2EO2A 5ITUA 4JI0M 1ZMWA 1TDHA 3SHFA 3T38A 2CV2A 1XXHE 4AG6A 3C58A 1WGNA 4Y28F 2X49A 5EQTA 3GQ4A 2JZ1A 2L4FA 1IBLM 4TUWA 4QHTA 1I4WA 2R45A 4D82A 2QBYA 3UK6A 1TH2A 3A98B 4DV4M 2QENA 4NXMM 1Z59A 3F92A 5FTNA 2QCUA 2F5OA 1TDZA 4JI8M 4DUYM 3U6DA 1YLAA 3VK7A 2C98A 2JA2A 1R2ZA 2N35A 3CF6E 4GH9A 3B9PA 2QNJA 2ZM6M 3LQRA 4EIWA 5E6JA 4LF5M 1AIPC 1IXZA 2EKFA 3M7GA 1J5EM 1VDLA 4GMQA 1DGFA 2D7EA 2KW0A 4NSOB 3UMMA 3GLGE 1E9SA 1S3SA 3GLFA 2DNAA 3SFZA 1IM2A 5DFLA 3K2LA 4LCBA 3FUXA 4B7HA 1IN5A 3GRVA 4LFAM 3THGA 1HT1E 5EXSA 1Z5CA 2JY5A 1XXHA 2FS1A 3A42A 3ZQJA 4OVZA 3GRYA 3GLIB 5DYIA 1H6UA 3U61A 2JWSA 2JUJA 3WHKA 5JI3E 1QVRA 3LCVB 4NL4H 4QOSA 2D7HA 4FW9A 2XH9A 3GRRA 1HR0M 3FYDA 2Z4SA 3A46A 2X4AA 1XNRM 2AHMA 2XZFA 1XMOM 2L2DA 2JY8A 3MMPA 1C7YA 2XFSA 3TE6A 1DGBA 2DWMA 4CJ6A 2DXIA 4IBKA 2B3TA 1W5SA 2Y20A 3FD9A 1VG5A 4P16A 5FSWA 4WURA 1Q02A 3GLHE 1G71A 1Q3BA 3B74A 3FTDA 3AFHA 4DV2M 1TTEA 4Q7JA 1ZQ9A 3LVWA 3TPZA 5JI2E 2XSZD 4REZA 4W5WA 4I81A 2VF7A 2I7NA 3L29A 1SG9A 4IBJA 1GLNA 1KFVA 1WJ7A 3MJ5A 3J7BA 2KZSA 4BBAA 1C1KA 2QPAA 4LJ6A 1QANA 2QBYB 2UUAM 4ZPXA 3GLGA 1JR3E 5EXPA 4AZFA 2M60A 2LVNC 2KNZA 4LJ4A 4CISA 8CATA 1J7KA 4JI3M 1DO2A 3T15A 4F2LA 1QDTA 4L8RC 2XF3A 3W0FA 4GC5A 3FRHA 4PCZA 4DR2M 5A2QS 4B7GA 1TR8A 2MGWA 1PJSA 1Z5AA 1MU5A 5EP2A 1RU3A 2YFQA 3T6PA 4DR1M 4JV5M 1GL7A 3HGIA 3I51A 5IREB 4JI4M 4LFBM 4K0KM 2UUBM 3L26A 2I7PA 1JQJC 1IN6A 4L16A 2UXCM 1PJJA 2DHYA 1G3IA 2JP7A 1IN7A 2LNHC 5FTLA 2CV0A 3D8BA 4LF8M 4JI2M 4YHHM 2EJSA 4AKHA 3BXWA 2DAIA 2JY6B 2KNAA 3KVWA 1N75A 1MN3A 3UGJA 2CHQA 3GLFB 3GLHA 4M0DA 2QP9X 4YY3M 4LFCM 5E26A 1WHCA 3B7ZA 1XXHB 1ZAEA 4OVZB 1IY2A 4AG5A 7CATA 1SXJD 1NV8A 3R9XB 3KOWE 1R7RA 5KQ8A 1NY6A 4IIWA 3U6SA 3BOSA 3U61B 4PT5A 1DGHA 2XLJA 2DZOB 3EIEA 2RRUA 3RFWA 4IBBA 2LHCA 3GO8A 2RGOA 2LVPC 3SAWA 2GQFA 2LVAA 2JNHA 4L4UA 3KDSE 1JR3A 3L27A 1QDRA 4ANRA 3T1HM 2LVOC 3Q8XA 4JYAM 4DV1M 3K8ZA 5GKNA 2DAMA 3JR5A 3FRIA 4I5SA 2KHHA 4QOZC 1PJQA 4GEWA 5KPRA 3K9PA 3LQQA 1XMQM 4UN2B 3J7AS 2UUCM 2V1UA 2O01F 1D2NA 1SXJA 3RGPA 1V33A 3I04M 2HHHM 3W0LB 4JN6A 3RGSA 3U6EA 2J7NA 1G4AE 3IECA 4DR7M 3VKGA 2VQEM 2YQZA 4MB7A 2R44A 5DNYA 1IFYA 2Z3XA 1ZMUA 2HWJA 2MR9A 1IY1A 1OKSA 1XWIA 3QWLA 3TWKA 3V76A 4DR3M 3IG5A 3SHGB 3U6CA 1UM8A 1VEGA 2FFJA 1HQYE 1QUTA 1V92A 2R4JA 4I8OA 1XNQM 3IHPA 1A5TA 1OIZA 4CIZA 4LF7M 2DKLA 1KSFX 1R2YA 1OIPA 4BLCA 4NSRA 1FNNA 4DR5M 3DZDA 2XZUA 1PGYA 2R6FA 3HZJA 2LHGA 4FWGA 5L8RF 1EIJA 1NO1A 1GJSA 5LMNM 2Z8YM 3PVSA 4MGKE 1R6BX 3VDPA 1BVSA 3ZH9B 4NXNM 3K1JA 3J27B 3E4RA 1D0KA 2UXDM 1R4GA 3MHVC 1OJLA 4OW0A 2F5SA 1TGUA 2K6BA 3FTFA 3IG8A 2KXEA 3ILKA 4LRSA 2KRKA 4IJFA 5FTKA 3I01M 2QQ8A 5EJCA 2DAKA 1HNXM 5BPVA 3VKHA 3SBJA 1FJGM 1CUKA 5BR8M 4OU7A 1L2BA 3AOEA 1T3TA 4NRVA 3NBIA 3TWLA 4LG2A 2L09A 4D80A 1YSYA 4KHPM 4LJ8A 2KDLA 1GJTA 1DGHB 3QYBA 4HL4A 3ZCBB 3KSJA 3W67A 2JZ0A 4RF0A 4R3DA 2DENA 1J09A 1N78A 1DO0A 3U5ZA 1LV7A 4JI7M 1QAMA 2EKKA 3KXEC 3GPUA 1OTRA 1SXJC 3J2PB 4JXJA 1DGGA 4KO8A 1EE8A 1ORYB 4B3TM 1QUSA 2H5XA 2KNVA 4OX9M 3KS4A 1G59A 1IY0A 1D0LA 3C3EA 4B7FA 2E5LM 2CRUA 1QZMA 5ITQA 2R46A 2CFOA 4LGMA 1G41A 1SXJB 3E46A 4LJ9A 1G8PA 3SAUA 1TF0B 2L7HA 4G6ZA 4CHTB 1YE9A 2LVQD 2OO9A 4WW0A 2LXEA 2MH8A 1N77A 1N34M 2V1CA 1L2DA 4S12A 4XBOA 4D81A 2K9DA 4II7A 3TWMA 2DZNB 4FCTA 3HHZA 4IBGA 2ZTCA 4GKJM 3DFZA 3L28A 3H4MA 3J81S 2KA6B 2KRUA 2Y21A 2K47A 2KZUA 4X64M 5LMUM 1AUAA 1JB0F 5C18A 2APLA 4M9ZA 2YNMD 3B89A 4QNRA 5FTJA 5KPTA 4G4NA 3U6PA 1JR3D 4G4RA 1GL6A 2VQFM 1K3WA 3HY5A 4L6V6 3Q8GA 4MGZE 3FTEA 5ITRA 4MH0E 1HT2E 4DR6M 2A5YB 2R65A 1Z6TA 2CV1A 1L1ZA 1EFUB 3FUUA 5DYGA 4IJEA 5KPZA 1E94E 1IQPA 1GVNA 2DWZB 2NQ8C 3I4YA 3RE8A 1NNJA 4LF4M 3KOYE 4G4QA 4M0WA 3JAMS 1GO5A 3GPYA 3GRUA 2YR0A 3HU3A 2OPFA 3VK8A 5EP1A 1VQ1A 1OFHA 1WIVA 2JXNA 4IBFA 2RKOA 2BNKA 2WSCF 3HJQA 1K82A 2L6OA 3I4VA 3QYEA 4GC9A 1XC8A 2XFTA 1HNZM 4GKKM 4RNAA 5EP3A 2DHRA 4FCVA 1QZEA 2BJWA 1YUBA 1NHWC 5IT9S 4QHSA 1E9RA 1T6OA 4MM3B 3HU2A 2LBCA 4L78A 3SMSA 4LZJA 4LJ5A 4BB9A 3KSXA 3HWSA 2L4EA 4FWDA 4GHAA 1IXRC 3SAVA 3GQ3A 2ZANA 3E9SA 3M6AA 3HJSA 2F5PA 1ZMVA 4FVMA 4B08A 1XHBA 4PDIA 2R4EA 2XGNA 3CTWB 1QAOA 5KO3A 1XB2B 2HL7A 2L7IA 3HHXA 1TH3A 3HHWA 3ZC7B 2O5RA 1VEKA 1IXSA 4KT0F 4LJAA 3SATA 1IN8A 3PFIA 2CEAA 4AKGA 2DWLA 1LTMA 4ITQA 2Y0QA 4B3MM 2D7GA 2EA0A 3T1YM 4JI1M 4LZZA 3KOXE 4HEOA 4A3VB 4PDGA 2QHOB 3HX3A 4F1IA 3GLGB 2C5RA 1OQYA 3U60A 3D8LA 1QQWA 1OAOC 2FH0A 2MROB 4RF1A 2BWEA 3WHLA 1E32A 2EUCA 4PD2A 4B3RM 1D0MA 3B7NA 2QZ4A 3A45A 4G4OA 1QYRA 3LCUA 5C1BA 4CGYB 3C9PA 3M0EA 4LGYA 1N36M 3NBXX 2G5GX 3DA1A 3PNYA 1MX0A 2CHGA 2UU9M 1Z5BA 3FKEA 2RGHA 4FCWA 3MK6A 5EXXA 2LWXA 4M9XA 2ZTDA 3FUVA 1WXQA 4P17A 4X66M 4LF9M 1Q3CA 3H4JA 4IBCA 1Y8GA 3L25A 1GABA 2F5QA 2G3QA 4DR4M 3GP1A 1DV0A 1WGLA 4GITA 3TL4X 2WSEF 2Y0TA 2CWBA 2VIIA 4HLQA 3NWLA 3U6LA 4AI6A 4MGYE 1Q39A 1KYIA 3FUWA 4XK8F 1K3XA 1NJGA 2BWBA 2ZAMA 2MJ5B 1WR1B 2UXBM 3GLHB 3LW5F 3AJIB 1N33M 1NHGC 4XGIA 3SARA 2Z7JA 1ZV1A 3VLFB 3HJ8A 4RKUF 2J5YA 3KP1E 2VF8A 1X37A 3HU1A 4GHLA 3K92A 1VEJA 3U6OA 2WSFF 4DUZM 3SYKA 3VDUA 2X8AA 5ITTA 4I4LA 3K9OA 5IWAM 5F3WA 2QSFX 5ITYA 3GQ5A 3CGWA 3FE3A 3PXGA 2HCBA 3AKZA 5IZ7D 4KLNA 3TQSA 5FLXS 4LJ7A 3GPPA 4LRTA 1NJFA 2M5ZA 1UFZA 3C3DA 3SC3A 4G3OA 3U6QA 3HKPA 4AKIA 4GIPA 4DBGB 3GLIE 1F4IA 2CUZA 4DV0M 3KW6A 2V6ZM 4LY6A 2Z4RA 1NY5A 3B7QA 1L8QA 1IN4A 1QAQA 3L2AA 1IBKM 4LF6M 3E21A 2DZLA 2R62A 3FYCA 2C9OA 2F4VM 3U6MA 1L2CA 2OQ4A 1IXSB 2BJVA 2FE8A 3BBZA 4L15A 5FTMA 2Q2EB 3W68A 3CF0A 4R71A 5KQDA 3SASA 1PJTA 1OFIA 4Z8XA 4X62M 2ERCA 1NV9A 1L1TA 3KOZE 4B3SM 4JI6M 5ITXE 4X65M 1NSFA 2OOBA 1TH4A 3CF2A 3SYLA 2ZBKB
chains in the Genus database with same CATH topology
3U60B 4AQYM 2LH0A 1VDDA 2ZAOA 4GRIA 4DV7M 3AV0A 4M9SA 4KODA 2F5NA 4JI5M 2C99A 1PM5A 3UZUA 3JR4A 3QAUA 1NVMA 2H1RA 3HHYA 2J7OA 3DOAA 3R8FA 1HNWM 4QNMA 2DVWB 3EIHA 4R7GA 4IBIA 2C96A 4DV5M 3AL0C 4IBEA 4MGIE 2XSZA 3KP0E 5H37D 3VFDA 2CE7A 4DV6M 1SXJE 1I94M 3AOEC 2HKJA 2G8LA 4FWHA 5EXTA 3KFUG 2CHVA 3GLIA 2FOIC 2R18A 3SMPA 3KS8A 1HQCA 3AOGA 2XEPA 3FUTA 4NRWA 1W5TA 4FD2A 3LVVA 4NOOB 2W82A 2P5TA 3UJNA 4Z6YA 5EP4A 2FNAA 1NNUC 3OTOM 1GKIA 1PJIA 2DWNA 3PNVA 3J80S 5ITXA 1IBMM 3LMMA 2C9CA 4IBDA 3U5ZB 4AW4A 3FTCA 2KEBA 4DV3M 3GPXA 4MGHA 1N32M 5ITUA 2EO2A 4JI0M 3SHFA 1TDHA 2CV2A 3T38A 4AG6A 3C58A 2X49A 5EQTA 3GQ4A 1IBLM 4TUWA 4QHTA 1I4WA 2R45A 4D82A 2QBYA 3UK6A 1TH2A 3A98B 4DV4M 2QENA 4NXMM 1Z59A 2F5OA 5FTNA 2QCUA 1TDZA 4JI8M 4DUYM 3U6DA 3VK7A 2C98A 2JA2A 1R2ZA 3CF6E 4GH9A 3B9PA 2ZM6M 3LQRA 4EIWA 5E6JA 4LF5M 1IXZA 3M7GA 1J5EM 4GMQA 1DGFA 2D7EA 2KW0A 4NSOB 3UMMA 1E9SA 1S3SA 3GLFA 3SFZA 1IM2A 3K2LA 4LCBA 3FUXA 4B7HA 1IN5A 3GRVA 4LFAM 3THGA 1HT1E 5EXSA 1Z5CA 3A42A 1XXHA 4OVZA 3GRYA 3GLIB 5DYIA 1H6UA 3U61A 3WHKA 5JI3E 1QVRA 4NL4H 4QOSA 2D7HA 4FW9A 2XH9A 3GRRA 1HR0M 3FYDA 2Z4SA 3A46A 2X4AA 1XNRM 2AHMA 2XZFA 1XMOM 2XFSA 3TE6A 1DGBA 2DWMA 2DXIA 4IBKA 1W5SA 2Y20A 3FD9A 4P16A 5FSWA 4WURA 1Q3BA 3FTDA 3AFHA 4DV2M 1ZQ9A 3LVWA 3TPZA 5JI2E 2XSZD 4REZA 4W5WA 4I81A 4IBJA 2I7NA 3L29A 1GLNA 1KFVA 3MJ5A 3J7BA 2KZSA 4BBAA 1C1KA 2QPAA 4LJ6A 1QANA 2QBYB 2UUAM 4ZPXA 3GLGA 4AZFA 5EXPA 2M60A 4CISA 4LJ4A 8CATA 1J7KA 4JI3M 1DO2A 3T15A 4L8RC 2XF3A 3W0FA 4GC5A 4DR2M 4PCZA 5A2QS 4B7GA 1Z5AA 1MU5A 5EP2A 2YFQA 4DR1M 4JV5M 1GL7A 3HGIA 3I51A 5IREB 4JI4M 4LFBM 4K0KM 2UUBM 3L26A 1JQJC 1IN6A 2I7PA 4L16A 2UXCM 1PJJA 1G3IA 1IN7A 2LNHC 5FTLA 2CV0A 3D8BA 4LF8M 4JI2M 4YHHM 4AKHA 3KVWA 1N75A 3UGJA 2CHQA 3GLFB 3GLHA 4M0DA 2QP9X 4YY3M 4LFCM 5E26A 1XXHB 1ZAEA 4OVZB 1IY2A 4AG5A 7CATA 1SXJD 3R9XB 3KOWE 1R7RA 5KQ8A 1NY6A 4IIWA 3U6SA 3BOSA 3U61B 4PT5A 1DGHA 2XLJA 2DZOB 3EIEA 3RFWA 4IBBA 3GO8A 2RGOA 3SAWA 3T1HM 4L4UA 3KDSE 1JR3A 3L27A 3Q8XA 4JYAM 4DV1M 3K8ZA 5GKNA 3JR5A 4I5SA 4QOZC 5KPRA 3LQQA 1XMQM 3J7AS 2UUCM 2V1UA 1D2NA 1SXJA 3RGPA 2HHHM 3W0LB 4JN6A 3RGSA 3U6EA 2J7NA 1G4AE 4DR7M 3VKGA 2VQEM 2YQZA 4MB7A 5DNYA 2Z3XA 1IY1A 3QWLA 1XWIA 3TWKA 4DR3M 3U6CA 3IG5A 3SHGB 1UM8A 2FFJA 1HQYE 2R4JA 4I8OA 1XNQM 4LF7M 1KSFX 1R2YA 4BLCA 4NSRA 1FNNA 4DR5M 3DZDA 2XZUA 4FWGA 5LMNM 3PVSA 4MGKE 1R6BX 3VDPA 3ZH9B 4NXNM 3K1JA 3J27B 3E4RA 2UXDM 3MHVC 1OJLA 4OW0A 2F5SA 1TGUA 3FTFA 3IG8A 2KXEA 3ILKA 4LRSA 2KRKA 4IJFA 5FTKA 5EJCA 1HNXM 3VKHA 5BPVA 3SBJA 1FJGM 5BR8M 4OU7A 1L2BA 3AOEA 1T3TA 4NRVA 3NBIA 3TWLA 4LG2A 2L09A 4D80A 1YSYA 4KHPM 4LJ8A 1DGHB 4HL4A 3ZCBB 3KSJA 4RF0A 4R3DA 1J09A 1N78A 1DO0A 3U5ZA 1LV7A 4JI7M 1QAMA 3KXEC 3GPUA 4JXJA 1SXJC 3J2PB 1DGGA 4KO8A 1EE8A 1ORYB 4B3TM 4OX9M 3KS4A 1G59A 1IY0A 4B7FA 2E5LM 1QZMA 5ITQA 2R46A 2CFOA 4LGMA 1G41A 1SXJB 4LJ9A 1G8PA 3SAUA 2L7HA 4G6ZA 4CHTB 1YE9A 4WW0A 2LXEA 1N77A 1N34M 2V1CA 1L2DA 4S12A 4XBOA 4D81A 4II7A 3TWMA 2DZNB 4FCTA 3HHZA 4IBGA 4GKJM 3L28A 3DFZA 3H4MA 3J81S 2KA6B 2KRUA 2Y21A 2K47A 2KZUA 4X64M 5LMUM 5C18A 4M9ZA 2YNMD 4QNRA 5FTJA 5KPTA 4G4NA 3U6PA 1JR3D 4G4RA 1GL6A 2VQFM 1K3WA 3FTEA 4MGZE 5ITRA 4MH0E 1HT2E 4DR6M 2A5YB 2R65A 1Z6TA 2CV1A 1L1ZA 3FUUA 5DYGA 4IJEA 5KPZA 1E94E 1IQPA 1GVNA 2DWZB 2NQ8C 3I4YA 3RE8A 1NNJA 4LF4M 3KOYE 4G4QA 4M0WA 3JAMS 3GPYA 3GRUA 2YR0A 3HU3A 2OPFA 3VK8A 5EP1A 1OFHA 4IBFA 3HJQA 2BNKA 2RKOA 1K82A 2L6OA 3I4VA 4GC9A 1XC8A 1HNZM 2XFTA 4GKKM 4RNAA 5EP3A 2DHRA 4FCVA 2BJWA 1YUBA 1NHWC 5IT9S 4QHSA 1E9RA 4MM3B 3HU2A 4L78A 3SMSA 4LZJA 4LJ5A 4BB9A 3KSXA 3HWSA 4FWDA 4GHAA 1IXRC 3SAVA 3GQ3A 2ZANA 3E9SA 3M6AA 3HJSA 2F5PA 4FVMA 4B08A 1XHBA 4PDIA 2R4EA 2XGNA 3CTWB 1QAOA 5KO3A 2HL7A 2L7IA 3HHXA 3ZC7B 1TH3A 3HHWA 2O5RA 3SATA 4LJAA 1IN8A 3PFIA 2CEAA 4AKGA 2DWLA 4ITQA 2Y0QA 4B3MM 2D7GA 2EA0A 3T1YM 4JI1M 4LZZA 3KOXE 4A3VB 4PDGA 2C5RA 3GLGB 3U60A 3D8LA 1QQWA 4RF1A 3WHLA 1E32A 2EUCA 4PD2A 4B3RM 2QZ4A 3A45A 4G4OA 1QYRA 5C1BA 4CGYB 3M0EA 4LGYA 1N36M 2G5GX 3DA1A 3PNYA 1MX0A 2CHGA 2UU9M 1Z5BA 3FKEA 2RGHA 4FCWA 3MK6A 5EXXA 2LWXA 4M9XA 3FUVA 1WXQA 4X66M 4LF9M 1Q3CA 4IBCA 3L25A 2F5QA 4DR4M 3GP1A 3TL4X 4GITA 2Y0TA 4HLQA 2VIIA 3U6LA 3NWLA 4AI6A 4MGYE 1Q39A 1KYIA 3FUWA 1K3XA 2UXBM 1NJGA 2ZAMA 3GLHB 3AJIB 1N33M 1NHGC 4XGIA 3SARA 2Z7JA 3VLFB 3HJ8A 3KP1E 1X37A 3HU1A 4GHLA 3K92A 3U6OA 4DUZM 3SYKA 3VDUA 2X8AA 5ITTA 4I4LA 5IWAM 5F3WA 5ITYA 3GQ5A 3PXGA 2HCBA 3AKZA 5IZ7D 4KLNA 3TQSA 5FLXS 4LJ7A 3GPPA 4LRTA 1NJFA 2M5ZA 3SC3A 3U6QA 3HKPA 4AKIA 4GIPA 2CUZA 4DV0M 3KW6A 2V6ZM 4LY6A 2Z4RA 1NY5A 1IBKM 1QAQA 1IN4A 1L8QA 3L2AA 4LF6M 2R62A 3FYCA 2C9OA 2F4VM 3U6MA 1L2CA 2OQ4A 1IXSB 2BJVA 2FE8A 4L15A 5FTMA 2Q2EB 3SASA 3CF0A 5KQDA 1OFIA 4Z8XA 4X62M 2ERCA 4B3SM 1L1TA 3KOZE 4JI6M 5ITXE 4X65M 1NSFA 1TH4A 3CF2A 3SYLA 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 M;  4AQY M;  3U6C A;  1XC8 A;  1HNZ M;  4GKK M;  4DV7 M;  1HR0 M;  2F5N A;  3A46 A;  5IT9 S;  1XNQ M;  1XNR M;  4JI5 M;  2XZF A;  1XMO M;  1PM5 A;  3JR4 A;  4LF7 M;  3SAV A;  1R2Y A;  3GQ3 A;  3DOA A;  2F5P A;  4DR5 M;  1HNW M;  2XZU A;  4PDI A;  1Q3B A;  4DV5 M;  5LMN M;  4DV2 M;  3SAT A;  4DV6 M;  1I94 M;  4NXN M;  2HKJ A;  4ITQ A;  4B3M M;  2UXD M;  2EA0 A;  3T1Y M;  1KFV A;  4JI1 M;  2F5S A;  4PDG A;  2UUA M;  4NRW A;  4CIS A;  4PD2 A;  4B3R M;  1HNX M;  3A45 A;  4JI3 M;  4G4O A;  3SBJ A;  1FJG M;  5BR8 M;  1N36 M;  1L2B A;  4NRV A;  3OTO M;  1PJI A;  3TWL A;  1MX0 A;  3W0F A;  2UU9 M;  3J80 S;  5ITX A;  1Z5B A;  4PCZ A;  5A2Q S;  4DR2 M;  1IBM M;  4KHP M;  1Z5A A;  1MU5 A;  4DR1 M;  4JV5 M;  4X66 M;  4DV3 M;  4JI4 M;  4LF9 M;  4K0K M;  1Q3C A;  3GPX A;  4LFB M;  1N32 M;  2UUB M;  4JI7 M;  5ITU A;  4JI0 M;  1TDH A;  2F5Q A;  2UXC M;  3GPU A;  1PJJ A;  3C58 A;  3GP1 A;  4DR4 M;  3U6L A;  1EE8 A;  4B3T M;  4LF8 M;  1Q39 A;  4JI2 M;  4YHH M;  2UXB M;  1K3X A;  4OX9 M;  3GQ4 A;  2E5L M;  1IBL M;  1N33 M;  3SAR A;  5ITQ A;  4YY3 M;  4DV4 M;  4LFC M;  3SAU A;  4NXM M;  1Z59 A;  3U6O A;  4DUZ M;  2F5O A;  1TDZ A;  4JI8 M;  4DUY M;  3U6D A;  1N34 M;  1L2D A;  5ITT A;  3VK7 A;  5IWA M;  3TWM A;  3U6S A;  5ITY A;  3GQ5 A;  4GKJ M;  3J81 S;  3GO8 A;  5FLX S;  1R2Z A;  4X64 M;  3GPP A;  5LMU M;  3SAW A;  3T1H M;  4G4N A;  4DV1 M;  4JYA M;  2ZM6 M;  3U6P A;  3U6Q A;  4G4R A;  1K3W A;  2VQF M;  3JR5 A;  4LF5 M;  5ITR A;  1J5E M;  4DR6 M;  4DV0 M;  1L1Z A;  1XMQ M;  1IBK M;  3J7A S;  4LF6 M;  2UUC M;  1NNJ A;  4LF4 M;  3U6M A;  1L2C A;  2F4V M;  2OQ4 A;  2Q2E B;  3SAS A;  4LFA M;  2HHH M;  4G4Q A;  1Z5C A;  3A42 A;  3JAM S;  4X62 M;  3GPY A;  3U6E A;  1L1T A;  4B3S M;  4JI6 M;  4DR7 M;  1K82 A;  2OPF A;  5ITX E;  4X65 M;  3VK8 A;  2VQE M;  4MB7 A;  2ZBK B;  3TWK A; 
#chains in the Genus database with same CATH topology
 3U60 B;  4AQY M;  2LH0 A;  2GNO A;  2OOA A;  2WZJ A;  1VDD A;  2ZAO A;  4GRI A;  4DV7 M;  3AV0 A;  4M9S A;  4KOD A;  2F5N A;  4JI5 M;  2C99 A;  1PM5 A;  3UZU A;  3JR4 A;  3QAU A;  2O25 A;  1HJP A;  1NVM A;  2H1R A;  3HHY A;  2J7O A;  3DOA A;  3R8F A;  1HNW M;  4QNM A;  2R0I A;  2DVW B;  3EIH A;  4R7G A;  4IBI A;  2C96 A;  4DV5 M;  3AL0 C;  4IBE A;  1MJG M;  4MGI E;  2XSZ A;  3KP0 E;  5H37 D;  3VFD A;  2CE7 A;  4DV6 M;  1SXJ E;  2CP8 A;  2DAE A;  1I94 M;  3AOE C;  2HKJ A;  2G8L A;  4FWH A;  5EXT A;  2DAG A;  4NC6 A;  2CHV A;  3GLI A;  3KFU G;  2FOI C;  2R18 A;  3SMP A;  3KS8 A;  1HQC A;  1R5L A;  2DI0 A;  3AOG A;  2XEP A;  3FUT A;  2LTU A;  1OAI A;  4NRW A;  1W5T A;  4FD2 A;  2VDB B;  3LVV A;  4WP2 A;  1T43 A;  4NOO B;  2W82 A;  2P5T A;  1V34 A;  3UJN A;  4Z6Y A;  5EP4 A;  2HAK A;  2FNA A;  1NNU C;  3OTO M;  1GKI A;  1PJI A;  1PRB A;  2DWN A;  3PNV A;  3J80 S;  5ITX A;  1IBM M;  3LMM A;  2C9C A;  4IBD A;  2K0B X;  3U5Z B;  4AW4 A;  3FTC A;  2KEB A;  4DV3 M;  3GLF E;  3GPX A;  4MGH A;  1N32 M;  1P3Q Q;  2JY7 A;  2EO2 A;  5ITU A;  4JI0 M;  1ZMW A;  1TDH A;  3SHF A;  3T38 A;  2CV2 A;  1XXH E;  4AG6 A;  3C58 A;  1WGN A;  4Y28 F;  2X49 A;  5EQT A;  3GQ4 A;  2JZ1 A;  2L4F A;  1IBL M;  4TUW A;  4QHT A;  1I4W A;  2R45 A;  4D82 A;  2QBY A;  3UK6 A;  1TH2 A;  3A98 B;  4DV4 M;  2QEN A;  4NXM M;  1Z59 A;  3F92 A;  5FTN A;  2QCU A;  2F5O A;  1TDZ A;  4JI8 M;  4DUY M;  3U6D A;  1YLA A;  3VK7 A;  2C98 A;  2JA2 A;  1R2Z A;  2N35 A;  3CF6 E;  4GH9 A;  3B9P A;  2QNJ A;  2ZM6 M;  3LQR A;  4EIW A;  5E6J A;  4LF5 M;  1AIP C;  1IXZ A;  2EKF A;  3M7G A;  1J5E M;  1VDL A;  4GMQ A;  1DGF A;  2D7E A;  2KW0 A;  4NSO B;  3UMM A;  3GLG E;  1E9S A;  1S3S A;  3GLF A;  2DNA A;  3SFZ A;  1IM2 A;  5DFL A;  3K2L A;  4LCB A;  3FUX A;  4B7H A;  1IN5 A;  3GRV A;  4LFA M;  3THG A;  1HT1 E;  5EXS A;  1Z5C A;  2JY5 A;  1XXH A;  2FS1 A;  3A42 A;  3ZQJ A;  4OVZ A;  3GRY A;  3GLI B;  5DYI A;  1H6U A;  3U61 A;  2JWS A;  2JUJ A;  3WHK A;  5JI3 E;  1QVR A;  3LCV B;  4NL4 H;  4QOS A;  2D7H A;  4FW9 A;  2XH9 A;  3GRR A;  1HR0 M;  3FYD A;  2Z4S A;  3A46 A;  2X4A A;  1XNR M;  2AHM A;  2XZF A;  1XMO M;  2L2D A;  2JY8 A;  3MMP A;  1C7Y A;  2XFS A;  3TE6 A;  1DGB A;  2DWM A;  4CJ6 A;  2DXI A;  4IBK A;  2B3T A;  1W5S A;  2Y20 A;  3FD9 A;  1VG5 A;  4P16 A;  5FSW A;  4WUR A;  1Q02 A;  3GLH E;  1G71 A;  1Q3B A;  3B74 A;  3FTD A;  3AFH A;  4DV2 M;  1TTE A;  4Q7J A;  1ZQ9 A;  3LVW A;  3TPZ A;  5JI2 E;  2XSZ D;  4REZ A;  4W5W A;  4I81 A;  2VF7 A;  2I7N A;  3L29 A;  1SG9 A;  4IBJ A;  1GLN A;  1KFV A;  1WJ7 A;  3MJ5 A;  3J7B A;  2KZS A;  4BBA A;  1C1K A;  2QPA A;  4LJ6 A;  1QAN A;  2QBY B;  2UUA M;  4ZPX A;  3GLG A;  1JR3 E;  5EXP A;  4AZF A;  2M60 A;  2LVN C;  2KNZ A;  4LJ4 A;  4CIS A;  8CAT A;  1J7K A;  4JI3 M;  1DO2 A;  3T15 A;  4F2L A;  1QDT A;  4L8R C;  2XF3 A;  3W0F A;  4GC5 A;  3FRH A;  4PCZ A;  4DR2 M;  5A2Q S;  4B7G A;  1TR8 A;  2MGW A;  1PJS A;  1Z5A A;  1MU5 A;  5EP2 A;  1RU3 A;  2YFQ A;  3T6P A;  4DR1 M;  4JV5 M;  1GL7 A;  3HGI A;  3I51 A;  5IRE B;  4JI4 M;  4LFB M;  4K0K M;  2UUB M;  3L26 A;  2I7P A;  1JQJ C;  1IN6 A;  4L16 A;  2UXC M;  1PJJ A;  2DHY A;  1G3I A;  2JP7 A;  1IN7 A;  2LNH C;  5FTL A;  2CV0 A;  3D8B A;  4LF8 M;  4JI2 M;  4YHH M;  2EJS A;  4AKH A;  3BXW A;  2DAI A;  2JY6 B;  2KNA A;  3KVW A;  1N75 A;  1MN3 A;  3UGJ A;  2CHQ A;  3GLF B;  3GLH A;  4M0D A;  2QP9 X;  4YY3 M;  4LFC M;  5E26 A;  1WHC A;  3B7Z A;  1XXH B;  1ZAE A;  4OVZ B;  1IY2 A;  4AG5 A;  7CAT A;  1SXJ D;  1NV8 A;  3R9X B;  3KOW E;  1R7R A;  5KQ8 A;  1NY6 A;  4IIW A;  3U6S A;  3BOS A;  3U61 B;  4PT5 A;  1DGH A;  2XLJ A;  2DZO B;  3EIE A;  2RRU A;  3RFW A;  4IBB A;  2LHC A;  3GO8 A;  2RGO A;  2LVP C;  3SAW A;  2GQF A;  2LVA A;  2JNH A;  4L4U A;  3KDS E;  1JR3 A;  3L27 A;  1QDR A;  4ANR A;  3T1H M;  2LVO C;  3Q8X A;  4JYA M;  4DV1 M;  3K8Z A;  5GKN A;  2DAM A;  3JR5 A;  3FRI A;  4I5S A;  2KHH A;  4QOZ C;  1PJQ A;  4GEW A;  5KPR A;  3K9P A;  3LQQ A;  1XMQ M;  4UN2 B;  3J7A S;  2UUC M;  2V1U A;  2O01 F;  1D2N A;  1SXJ A;  3RGP A;  1V33 A;  3I04 M;  2HHH M;  3W0L B;  4JN6 A;  3RGS A;  3U6E A;  2J7N A;  1G4A E;  3IEC A;  4DR7 M;  3VKG A;  2VQE M;  2YQZ A;  4MB7 A;  2R44 A;  5DNY A;  1IFY A;  2Z3X A;  1ZMU A;  2HWJ A;  2MR9 A;  1IY1 A;  1OKS A;  1XWI A;  3QWL A;  3TWK A;  3V76 A;  4DR3 M;  3IG5 A;  3SHG B;  3U6C A;  1UM8 A;  1VEG A;  2FFJ A;  1HQY E;  1QUT A;  1V92 A;  2R4J A;  4I8O A;  1XNQ M;  3IHP A;  1A5T A;  1OIZ A;  4CIZ A;  4LF7 M;  2DKL A;  1KSF X;  1R2Y A;  1OIP A;  4BLC A;  4NSR A;  1FNN A;  4DR5 M;  3DZD A;  2XZU A;  1PGY A;  2R6F A;  3HZJ A;  2LHG A;  4FWG A;  5L8R F;  1EIJ A;  1NO1 A;  1GJS A;  5LMN M;  2Z8Y M;  3PVS A;  4MGK E;  1R6B X;  3VDP A;  1BVS A;  3ZH9 B;  4NXN M;  3K1J A;  3J27 B;  3E4R A;  1D0K A;  2UXD M;  1R4G A;  3MHV C;  1OJL A;  4OW0 A;  2F5S A;  1TGU A;  2K6B A;  3FTF A;  3IG8 A;  2KXE A;  3ILK A;  4LRS A;  2KRK A;  4IJF A;  5FTK A;  3I01 M;  2QQ8 A;  5EJC A;  2DAK A;  1HNX M;  5BPV A;  3VKH A;  3SBJ A;  1FJG M;  1CUK A;  5BR8 M;  4OU7 A;  1L2B A;  3AOE A;  1T3T A;  4NRV A;  3NBI A;  3TWL A;  4LG2 A;  2L09 A;  4D80 A;  1YSY A;  4KHP M;  4LJ8 A;  2KDL A;  1GJT A;  1DGH B;  3QYB A;  4HL4 A;  3ZCB B;  3KSJ A;  3W67 A;  2JZ0 A;  4RF0 A;  4R3D A;  2DEN A;  1J09 A;  1N78 A;  1DO0 A;  3U5Z A;  1LV7 A;  4JI7 M;  1QAM A;  2EKK A;  3KXE C;  3GPU A;  1OTR A;  1SXJ C;  3J2P B;  4JXJ A;  1DGG A;  4KO8 A;  1EE8 A;  1ORY B;  4B3T M;  1QUS A;  2H5X A;  2KNV A;  4OX9 M;  3KS4 A;  1G59 A;  1IY0 A;  1D0L A;  3C3E A;  4B7F A;  2E5L M;  2CRU A;  1QZM A;  5ITQ A;  2R46 A;  2CFO A;  4LGM A;  1G41 A;  1SXJ B;  3E46 A;  4LJ9 A;  1G8P A;  3SAU A;  1TF0 B;  2L7H A;  4G6Z A;  4CHT B;  1YE9 A;  2LVQ D;  2OO9 A;  4WW0 A;  2LXE A;  2MH8 A;  1N77 A;  1N34 M;  2V1C A;  1L2D A;  4S12 A;  4XBO A;  4D81 A;  2K9D A;  4II7 A;  3TWM A;  2DZN B;  4FCT A;  3HHZ A;  4IBG A;  2ZTC A;  4GKJ M;  3DFZ A;  3L28 A;  3H4M A;  3J81 S;  2KA6 B;  2KRU A;  2Y21 A;  2K47 A;  2KZU A;  4X64 M;  5LMU M;  1AUA A;  1JB0 F;  5C18 A;  2APL A;  4M9Z A;  2YNM D;  3B89 A;  4QNR A;  5FTJ A;  5KPT A;  4G4N A;  3U6P A;  1JR3 D;  4G4R A;  1GL6 A;  2VQF M;  1K3W A;  3HY5 A;  4L6V 6;  3Q8G A;  4MGZ E;  3FTE A;  5ITR A;  4MH0 E;  1HT2 E;  4DR6 M;  2A5Y B;  2R65 A;  1Z6T A;  2CV1 A;  1L1Z A;  1EFU B;  3FUU A;  5DYG A;  4IJE A;  5KPZ A;  1E94 E;  1IQP A;  1GVN A;  2DWZ B;  2NQ8 C;  3I4Y A;  3RE8 A;  1NNJ A;  4LF4 M;  3KOY E;  4G4Q A;  4M0W A;  3JAM S;  1GO5 A;  3GPY A;  3GRU A;  2YR0 A;  3HU3 A;  2OPF A;  3VK8 A;  5EP1 A;  1VQ1 A;  1OFH A;  1WIV A;  2JXN A;  4IBF A;  2RKO A;  2BNK A;  2WSC F;  3HJQ A;  1K82 A;  2L6O A;  3I4V A;  3QYE A;  4GC9 A;  1XC8 A;  2XFT A;  1HNZ M;  4GKK M;  4RNA A;  5EP3 A;  2DHR A;  4FCV A;  1QZE A;  2BJW A;  1YUB A;  1NHW C;  5IT9 S;  4QHS A;  1E9R A;  1T6O A;  4MM3 B;  3HU2 A;  2LBC A;  4L78 A;  3SMS A;  4LZJ A;  4LJ5 A;  4BB9 A;  3KSX A;  3HWS A;  2L4E A;  4FWD A;  4GHA A;  1IXR C;  3SAV A;  3GQ3 A;  2ZAN A;  3E9S A;  3M6A A;  3HJS A;  2F5P A;  1ZMV A;  4FVM A;  4B08 A;  1XHB A;  4PDI A;  2R4E A;  2XGN A;  3CTW B;  1QAO A;  5KO3 A;  1XB2 B;  2HL7 A;  2L7I A;  3HHX A;  1TH3 A;  3HHW A;  3ZC7 B;  2O5R A;  1VEK A;  1IXS A;  4KT0 F;  4LJA A;  3SAT A;  1IN8 A;  3PFI A;  2CEA A;  4AKG A;  2DWL A;  1LTM A;  4ITQ A;  2Y0Q A;  4B3M M;  2D7G A;  2EA0 A;  3T1Y M;  4JI1 M;  4LZZ A;  3KOX E;  4HEO A;  4A3V B;  4PDG A;  2QHO B;  3HX3 A;  4F1I A;  3GLG B;  2C5R A;  1OQY A;  3U60 A;  3D8L A;  1QQW A;  1OAO C;  2FH0 A;  2MRO B;  4RF1 A;  2BWE A;  3WHL A;  1E32 A;  2EUC A;  4PD2 A;  4B3R M;  1D0M A;  3B7N A;  2QZ4 A;  3A45 A;  4G4O A;  1QYR A;  3LCU A;  5C1B A;  4CGY B;  3C9P A;  3M0E A;  4LGY A;  1N36 M;  3NBX X;  2G5G X;  3DA1 A;  3PNY A;  1MX0 A;  2CHG A;  2UU9 M;  1Z5B A;  3FKE A;  2RGH A;  4FCW A;  3MK6 A;  5EXX A;  2LWX A;  4M9X A;  2ZTD A;  3FUV A;  1WXQ A;  4P17 A;  4X66 M;  4LF9 M;  1Q3C A;  3H4J A;  4IBC A;  1Y8G A;  3L25 A;  1GAB A;  2F5Q A;  2G3Q A;  4DR4 M;  3GP1 A;  1DV0 A;  1WGL A;  4GIT A;  3TL4 X;  2WSE F;  2Y0T A;  2CWB A;  2VII A;  4HLQ A;  3NWL A;  3U6L A;  4AI6 A;  4MGY E;  1Q39 A;  1KYI A;  3FUW A;  4XK8 F;  1K3X A;  1NJG A;  2BWB A;  2ZAM A;  2MJ5 B;  1WR1 B;  2UXB M;  3GLH B;  3LW5 F;  3AJI B;  1N33 M;  1NHG C;  4XGI A;  3SAR A;  2Z7J A;  1ZV1 A;  3VLF B;  3HJ8 A;  4RKU F;  2J5Y A;  3KP1 E;  2VF8 A;  1X37 A;  3HU1 A;  4GHL A;  3K92 A;  1VEJ A;  3U6O A;  2WSF F;  4DUZ M;  3SYK A;  3VDU A;  2X8A A;  5ITT A;  4I4L A;  3K9O A;  5IWA M;  5F3W A;  2QSF X;  5ITY A;  3GQ5 A;  3CGW A;  3FE3 A;  3PXG A;  2HCB A;  3AKZ A;  5IZ7 D;  4KLN A;  3TQS A;  5FLX S;  4LJ7 A;  3GPP A;  4LRT A;  1NJF A;  2M5Z A;  1UFZ A;  3C3D A;  3SC3 A;  4G3O A;  3U6Q A;  3HKP A;  4AKI A;  4GIP A;  4DBG B;  3GLI E;  1F4I A;  2CUZ A;  4DV0 M;  3KW6 A;  2V6Z M;  4LY6 A;  2Z4R A;  1NY5 A;  3B7Q A;  1L8Q A;  1IN4 A;  1QAQ A;  3L2A A;  1IBK M;  4LF6 M;  3E21 A;  2DZL A;  2R62 A;  3FYC A;  2C9O A;  2F4V M;  3U6M A;  1L2C A;  2OQ4 A;  1IXS B;  2BJV A;  2FE8 A;  3BBZ A;  4L15 A;  5FTM A;  2Q2E B;  3W68 A;  3CF0 A;  4R71 A;  5KQD A;  3SAS A;  1PJT A;  1OFI A;  4Z8X A;  4X62 M;  2ERC A;  1NV9 A;  1L1T A;  3KOZ E;  4B3S M;  4JI6 M;  5ITX E;  4X65 M;  1NSF A;  2OOB A;  1TH4 A;  3CF2 A;  3SYL A;  2ZBK B; 
#chains in the Genus database with same CATH homology
 3U60 B;  4AQY M;  2LH0 A;  1VDD A;  2ZAO A;  4GRI A;  4DV7 M;  3AV0 A;  4M9S A;  4KOD A;  2F5N A;  4JI5 M;  2C99 A;  1PM5 A;  3UZU A;  3JR4 A;  3QAU A;  1NVM A;  2H1R A;  3HHY A;  2J7O A;  3DOA A;  3R8F A;  1HNW M;  4QNM A;  2DVW B;  3EIH A;  4R7G A;  4IBI A;  2C96 A;  4DV5 M;  3AL0 C;  4IBE A;  4MGI E;  2XSZ A;  3KP0 E;  5H37 D;  3VFD A;  2CE7 A;  4DV6 M;  1SXJ E;  1I94 M;  3AOE C;  2HKJ A;  2G8L A;  4FWH A;  5EXT A;  3KFU G;  2CHV A;  3GLI A;  2FOI C;  2R18 A;  3SMP A;  3KS8 A;  1HQC A;  3AOG A;  2XEP A;  3FUT A;  4NRW A;  1W5T A;  4FD2 A;  3LVV A;  4NOO B;  2W82 A;  2P5T A;  3UJN A;  4Z6Y A;  5EP4 A;  2FNA A;  1NNU C;  3OTO M;  1GKI A;  1PJI A;  2DWN A;  3PNV A;  3J80 S;  5ITX A;  1IBM M;  3LMM A;  2C9C A;  4IBD A;  3U5Z B;  4AW4 A;  3FTC A;  2KEB A;  4DV3 M;  3GPX A;  4MGH A;  1N32 M;  5ITU A;  2EO2 A;  4JI0 M;  3SHF A;  1TDH A;  2CV2 A;  3T38 A;  4AG6 A;  3C58 A;  2X49 A;  5EQT A;  3GQ4 A;  1IBL M;  4TUW A;  4QHT A;  1I4W A;  2R45 A;  4D82 A;  2QBY A;  3UK6 A;  1TH2 A;  3A98 B;  4DV4 M;  2QEN A;  4NXM M;  1Z59 A;  2F5O A;  5FTN A;  2QCU A;  1TDZ A;  4JI8 M;  4DUY M;  3U6D A;  3VK7 A;  2C98 A;  2JA2 A;  1R2Z A;  3CF6 E;  4GH9 A;  3B9P A;  2ZM6 M;  3LQR A;  4EIW A;  5E6J A;  4LF5 M;  1IXZ A;  3M7G A;  1J5E M;  4GMQ A;  1DGF A;  2D7E A;  2KW0 A;  4NSO B;  3UMM A;  1E9S A;  1S3S A;  3GLF A;  3SFZ A;  1IM2 A;  3K2L A;  4LCB A;  3FUX A;  4B7H A;  1IN5 A;  3GRV A;  4LFA M;  3THG A;  1HT1 E;  5EXS A;  1Z5C A;  3A42 A;  1XXH A;  4OVZ A;  3GRY A;  3GLI B;  5DYI A;  1H6U A;  3U61 A;  3WHK A;  5JI3 E;  1QVR A;  4NL4 H;  4QOS A;  2D7H A;  4FW9 A;  2XH9 A;  3GRR A;  1HR0 M;  3FYD A;  2Z4S A;  3A46 A;  2X4A A;  1XNR M;  2AHM A;  2XZF A;  1XMO M;  2XFS A;  3TE6 A;  1DGB A;  2DWM A;  2DXI A;  4IBK A;  1W5S A;  2Y20 A;  3FD9 A;  4P16 A;  5FSW A;  4WUR A;  1Q3B A;  3FTD A;  3AFH A;  4DV2 M;  1ZQ9 A;  3LVW A;  3TPZ A;  5JI2 E;  2XSZ D;  4REZ A;  4W5W A;  4I81 A;  4IBJ A;  2I7N A;  3L29 A;  1GLN A;  1KFV A;  3MJ5 A;  3J7B A;  2KZS A;  4BBA A;  1C1K A;  2QPA A;  4LJ6 A;  1QAN A;  2QBY B;  2UUA M;  4ZPX A;  3GLG A;  4AZF A;  5EXP A;  2M60 A;  4CIS A;  4LJ4 A;  8CAT A;  1J7K A;  4JI3 M;  1DO2 A;  3T15 A;  4L8R C;  2XF3 A;  3W0F A;  4GC5 A;  4DR2 M;  4PCZ A;  5A2Q S;  4B7G A;  1Z5A A;  1MU5 A;  5EP2 A;  2YFQ A;  4DR1 M;  4JV5 M;  1GL7 A;  3HGI A;  3I51 A;  5IRE B;  4JI4 M;  4LFB M;  4K0K M;  2UUB M;  3L26 A;  1JQJ C;  1IN6 A;  2I7P A;  4L16 A;  2UXC M;  1PJJ A;  1G3I A;  1IN7 A;  2LNH C;  5FTL A;  2CV0 A;  3D8B A;  4LF8 M;  4JI2 M;  4YHH M;  4AKH A;  3KVW A;  1N75 A;  3UGJ A;  2CHQ A;  3GLF B;  3GLH A;  4M0D A;  2QP9 X;  4YY3 M;  4LFC M;  5E26 A;  1XXH B;  1ZAE A;  4OVZ B;  1IY2 A;  4AG5 A;  7CAT A;  1SXJ D;  3R9X B;  3KOW E;  1R7R A;  5KQ8 A;  1NY6 A;  4IIW A;  3U6S A;  3BOS A;  3U61 B;  4PT5 A;  1DGH A;  2XLJ A;  2DZO B;  3EIE A;  3RFW A;  4IBB A;  3GO8 A;  2RGO A;  3SAW A;  3T1H M;  4L4U A;  3KDS E;  1JR3 A;  3L27 A;  3Q8X A;  4JYA M;  4DV1 M;  3K8Z A;  5GKN A;  3JR5 A;  4I5S A;  4QOZ C;  5KPR A;  3LQQ A;  1XMQ M;  3J7A S;  2UUC M;  2V1U A;  1D2N A;  1SXJ A;  3RGP A;  2HHH M;  3W0L B;  4JN6 A;  3RGS A;  3U6E A;  2J7N A;  1G4A E;  4DR7 M;  3VKG A;  2VQE M;  2YQZ A;  4MB7 A;  5DNY A;  2Z3X A;  1IY1 A;  3QWL A;  1XWI A;  3TWK A;  4DR3 M;  3U6C A;  3IG5 A;  3SHG B;  1UM8 A;  2FFJ A;  1HQY E;  2R4J A;  4I8O A;  1XNQ M;  4LF7 M;  1KSF X;  1R2Y A;  4BLC A;  4NSR A;  1FNN A;  4DR5 M;  3DZD A;  2XZU A;  4FWG A;  5LMN M;  3PVS A;  4MGK E;  1R6B X;  3VDP A;  3ZH9 B;  4NXN M;  3K1J A;  3J27 B;  3E4R A;  2UXD M;  3MHV C;  1OJL A;  4OW0 A;  2F5S A;  1TGU A;  3FTF A;  3IG8 A;  2KXE A;  3ILK A;  4LRS A;  2KRK A;  4IJF A;  5FTK A;  5EJC A;  1HNX M;  3VKH A;  5BPV A;  3SBJ A;  1FJG M;  5BR8 M;  4OU7 A;  1L2B A;  3AOE A;  1T3T A;  4NRV A;  3NBI A;  3TWL A;  4LG2 A;  2L09 A;  4D80 A;  1YSY A;  4KHP M;  4LJ8 A;  1DGH B;  4HL4 A;  3ZCB B;  3KSJ A;  4RF0 A;  4R3D A;  1J09 A;  1N78 A;  1DO0 A;  3U5Z A;  1LV7 A;  4JI7 M;  1QAM A;  3KXE C;  3GPU A;  4JXJ A;  1SXJ C;  3J2P B;  1DGG A;  4KO8 A;  1EE8 A;  1ORY B;  4B3T M;  4OX9 M;  3KS4 A;  1G59 A;  1IY0 A;  4B7F A;  2E5L M;  1QZM A;  5ITQ A;  2R46 A;  2CFO A;  4LGM A;  1G41 A;  1SXJ B;  4LJ9 A;  1G8P A;  3SAU A;  2L7H A;  4G6Z A;  4CHT B;  1YE9 A;  4WW0 A;  2LXE A;  1N77 A;  1N34 M;  2V1C A;  1L2D A;  4S12 A;  4XBO A;  4D81 A;  4II7 A;  3TWM A;  2DZN B;  4FCT A;  3HHZ A;  4IBG A;  4GKJ M;  3L28 A;  3DFZ A;  3H4M A;  3J81 S;  2KA6 B;  2KRU A;  2Y21 A;  2K47 A;  2KZU A;  4X64 M;  5LMU M;  5C18 A;  4M9Z A;  2YNM D;  4QNR A;  5FTJ A;  5KPT A;  4G4N A;  3U6P A;  1JR3 D;  4G4R A;  1GL6 A;  2VQF M;  1K3W A;  3FTE A;  4MGZ E;  5ITR A;  4MH0 E;  1HT2 E;  4DR6 M;  2A5Y B;  2R65 A;  1Z6T A;  2CV1 A;  1L1Z A;  3FUU A;  5DYG A;  4IJE A;  5KPZ A;  1E94 E;  1IQP A;  1GVN A;  2DWZ B;  2NQ8 C;  3I4Y A;  3RE8 A;  1NNJ A;  4LF4 M;  3KOY E;  4G4Q A;  4M0W A;  3JAM S;  3GPY A;  3GRU A;  2YR0 A;  3HU3 A;  2OPF A;  3VK8 A;  5EP1 A;  1OFH A;  4IBF A;  3HJQ A;  2BNK A;  2RKO A;  1K82 A;  2L6O A;  3I4V A;  4GC9 A;  1XC8 A;  1HNZ M;  2XFT A;  4GKK M;  4RNA A;  5EP3 A;  2DHR A;  4FCV A;  2BJW A;  1YUB A;  1NHW C;  5IT9 S;  4QHS A;  1E9R A;  4MM3 B;  3HU2 A;  4L78 A;  3SMS A;  4LZJ A;  4LJ5 A;  4BB9 A;  3KSX A;  3HWS A;  4FWD A;  4GHA A;  1IXR C;  3SAV A;  3GQ3 A;  2ZAN A;  3E9S A;  3M6A A;  3HJS A;  2F5P A;  4FVM A;  4B08 A;  1XHB A;  4PDI A;  2R4E A;  2XGN A;  3CTW B;  1QAO A;  5KO3 A;  2HL7 A;  2L7I A;  3HHX A;  3ZC7 B;  1TH3 A;  3HHW A;  2O5R A;  3SAT A;  4LJA A;  1IN8 A;  3PFI A;  2CEA A;  4AKG A;  2DWL A;  4ITQ A;  2Y0Q A;  4B3M M;  2D7G A;  2EA0 A;  3T1Y M;  4JI1 M;  4LZZ A;  3KOX E;  4A3V B;  4PDG A;  2C5R A;  3GLG B;  3U60 A;  3D8L A;  1QQW A;  4RF1 A;  3WHL A;  1E32 A;  2EUC A;  4PD2 A;  4B3R M;  2QZ4 A;  3A45 A;  4G4O A;  1QYR A;  5C1B A;  4CGY B;  3M0E A;  4LGY A;  1N36 M;  2G5G X;  3DA1 A;  3PNY A;  1MX0 A;  2CHG A;  2UU9 M;  1Z5B A;  3FKE A;  2RGH A;  4FCW A;  3MK6 A;  5EXX A;  2LWX A;  4M9X A;  3FUV A;  1WXQ A;  4X66 M;  4LF9 M;  1Q3C A;  4IBC A;  3L25 A;  2F5Q A;  4DR4 M;  3GP1 A;  3TL4 X;  4GIT A;  2Y0T A;  4HLQ A;  2VII A;  3U6L A;  3NWL A;  4AI6 A;  4MGY E;  1Q39 A;  1KYI A;  3FUW A;  1K3X A;  2UXB M;  1NJG A;  2ZAM A;  3GLH B;  3AJI B;  1N33 M;  1NHG C;  4XGI A;  3SAR A;  2Z7J A;  3VLF B;  3HJ8 A;  3KP1 E;  1X37 A;  3HU1 A;  4GHL A;  3K92 A;  3U6O A;  4DUZ M;  3SYK A;  3VDU A;  2X8A A;  5ITT A;  4I4L A;  5IWA M;  5F3W A;  5ITY A;  3GQ5 A;  3PXG A;  2HCB A;  3AKZ A;  5IZ7 D;  4KLN A;  3TQS A;  5FLX S;  4LJ7 A;  3GPP A;  4LRT A;  1NJF A;  2M5Z A;  3SC3 A;  3U6Q A;  3HKP A;  4AKI A;  4GIP A;  2CUZ A;  4DV0 M;  3KW6 A;  2V6Z M;  4LY6 A;  2Z4R A;  1NY5 A;  1IBK M;  1QAQ A;  1IN4 A;  1L8Q A;  3L2A A;  4LF6 M;  2R62 A;  3FYC A;  2C9O A;  2F4V M;  3U6M A;  1L2C A;  2OQ4 A;  1IXS B;  2BJV A;  2FE8 A;  4L15 A;  5FTM A;  2Q2E B;  3SAS A;  3CF0 A;  5KQD A;  1OFI A;  4Z8X A;  4X62 M;  2ERC A;  4B3S M;  1L1T A;  3KOZ E;  4JI6 M;  5ITX E;  4X65 M;  1NSF A;  1TH4 A;  3CF2 A;  3SYL A;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...