4LFCM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfcM02
4LF7M 4OX9M 5LMNM 3OTOM 2UU9M 4YHHM 3SARA 2EA0A 4LF4M 4DV2M 1XC8A 3SATA 4X62M 1XMOM 4DR3M 4JI1M 1N32M 1KFVA 1K3WA 4DR1M 1XMQM 2UXBM 1N36M 1Q39A 2F5PA 1L2BA 1TDHA 4NRWA 4JV5M 2ZBKB 2ZM6M 5ITXE 4PD2A 3SAVA 2UXDM 4JI7M 1Z5CA 4JI6M 4LF8M 4PDGA 4NXMM 3GPUA 1HNWM 1XNRM 3TWMA 4NRVA 1EE8A 3SBJA 2XZUA 1L2DA 1I94M 4B3MM 2VQEM 1L1ZA 3U6MA 4DV5M 1FJGM 5FLXS 4JI2M 4PDIA 4B3RM 2OQ4A 4LFCM 1R2ZA 3GPYA 3GQ4A 3T1HM 2UUCM 1XNQM 3U6EA 4X65M 4MB7A 4G4OA 1Q3BA 4LFAM 1IBMM 2F5OA 3A45A 4DUYM 1Q3CA 4JI3M 3C58A 4KHPM 3GPXA 3U6PA 5ITQA 1HNXM 2XZFA 3GQ3A 3GQ5A 3SAWA 4DV7M 4DR7M 4LF9M 1PJIA 4GKKM 4YY3M 4G4QA 4DR6M 1R2YA 4ITQA 3J81S 3U6QA 1PJJA 3U6SA 4LF5M 4DR4M 2UUAM 3A46A 3GPPA 3U6LA 1L1TA 2F5QA 3JR5A 4CISA 4DV0M 4DV1M 4G4NA 2Q2EB 2UUBM 4DR2M 1N33M 1K3XA 4JI5M 4JI4M 3DOAA 3A42A 3VK8A 4DUZM 3J80S 1IBKM 3TWKA 4DR5M 3SASA 4X64M 4JI8M 4K0KM 2OPFA 4DV3M 4G4RA 5IT9S 5IWAM 5ITRA 3W0FA 4GKJM 4B3SM 2HKJA 3GP1A 1N34M 1J5EM 1HNZM 2E5LM 1IBLM 1Z59A 1Z5BA 4B3TM 4DV4M 5ITYA 1MU5A 4AQYM 1NNJA 1K82A 2F5NA 2UXCM 3U6DA 2F5SA 5BR8M 3VK7A 2F4VM 2HHHM 5ITUA 4NXNM 5ITXA 2VQFM 4X66M 3U6CA 5ITTA 3GO8A 5LMUM 4JYAM 3SAUA 5A2QS 3TWLA 1HR0M 1Z5AA 1MX0A 4PCZA 4DV6M 4LF6M 4LFBM 3JAMS 1L2CA 3JR4A 1TDZA 3U6OA 1PM5A 3J7AS 4JI0M 3T1YM
chains in the Genus database with same CATH superfamily
3FRIA 2HAKA 4LF7M 2KA6B 2CP8A 2D7GA 3U5ZB 3D8BA 1DGGA 4YHHM 3B7QA 3K2LA 4DV2M 3FKEA 3SMPA 3UMMA 1XC8A 3SATA 3CF0A 4CISA 2EUCA 3BXWA 4LJ9A 3L2AA 3RFWA 2KRUA 3M7GA 3ZC7B 1N32M 2H5XA 4XK8F 8CATA 4Z8XA 1V92A 3AKZA 3E21A 2QENA 1IN5A 3A98B 3ILKA 1YUBA 4IBDA 3GLFB 4NRWA 3HHZA 4L4UA 3GLIA 2X49A 1UM8A 3FUVA 1TR8A 2JP7A 3MJ5A 1YLAA 2GNOA 2L2DA 4LJAA 4PT5A 4PD2A 3SAVA 2UXDM 2MGWA 1WHCA 4LF8M 1XWIA 2DAMA 2EO2A 3TPZA 4JXJA 1QDRA 1QZEA 2D7HA 2XH9A 1YSYA 1D0KA 3SBJA 2XZUA 1L2DA 2DWNA 3FYCA 1L1ZA 2KXEA 2Z3XA 4M0WA 3U6MA 1OAOC 3L28A 3K9PA 1L8QA 1FJGM 3SYKA 4BBAA 2K0BX 1V34A 4HLQA 1DO0A 2XSZA 1OFIA 2Z4SA 1IXRC 2JXNA 4LFAM 1IBMM 1NO1A 1TH4A 1QVRA 2OOAA 1ZMWA 3A45A 3PNYA 3V76A 5KQDA 1IFYA 3KOXE 1X37A 4IBEA 2YNMD 5E26A 3LVWA 4A3VB 3GPXA 1HNXM 1AUAA 1QAQA 1NV9A 2DKLA 1AIPC 1TH2A 3DA1A 4M0DA 1J09A 4LY6A 2KNVA 4P16A 2GQFA 4LF9M 4G4QA 3J7BA 3I01M 4ITQA 5IREB 2LVQD 2O5RA 1WR1B 1DV0A 3HJSA 3VFDA 4DR4M 2HL7A 4G6ZA 2DWLA 1E9RA 3LCVB 2UUBM 4AI6A 1E94E 3C3EA 3PNVA 5KPTA 1K3XA 1SG9A 2LBCA 2WSCF 4NOOB 4JI4M 4F2LA 4L15A 2YR0A 1WIVA 1E32A 4JI8M 4K0KM 5C18A 5JI3E 2DZLA 4GEWA 1GL6A 4G4RA 3GRYA 2KEBA 3QAUA 4Z6YA 3AOGA 3FUUA 2CFOA 2DZOB 2R45A 3HX3A 3T15A 5KPRA 5DYGA 1Z5BA 2CV2A 1G59A 2CWBA 2X8AA 2ZAOA 4AG5A 1JR3E 4HEOA 4B7HA 2DZNB 1K82A 4GMQA 4LJ8A 2UXCM 1VG5A 1IN8A 4LRTA 1HT1E 1Y8GA 1QAMA 3J2PB 5ITUA 2RKOA 5EXTA 2VQFM 4FCVA 2CV1A 2C98A 2L7IA 3SHFA 3T38A 3GLFA 1ORYB 4AW4A 2HWJA 3F92A 1PM5A 1A5TA 4XBOA 5EP4A 1XXHB 3D8LA 1XXHA 1TF0B 1PGYA 1HQCA 2BNKA 3IHPA 3L27A 3KVWA 4FWGA 1OKSA 2P5TA 3CGWA 3CTWB 4NSOB 4GHLA 2FE8A 3GLHA 3OTOM 2UU9M 2JA2A 4I8OA 1PJTA 1ZV1A 4IBKA 1D0LA 3HHXA 2OO9A 3E4RA 2V1UA 1GKIA 2LVOC 2XF3A 1OIZA 3NBIA 4DR3M 4RKUF 1OAIA 1XMOM 4JI1M 3LVVA 3PVSA 4REZA 3SYLA 3AOEA 2C5RA 4CGYB 4QNRA 4LRSA 1KFVA 3WHKA 4KLNA 4D82A 2J7NA 2UXBM 2R6FA 1DGHB 1V33A 2FH0A 3KS4A 1N36M 1Q39A 4FWDA 4JV5M 5FTNA 3UGJA 2ZM6M 3FTCA 2ZTCA 4WP2A 2KNAA 4FCTA 1Z5CA 4HL4A 4NXMM 1IXZA 3PFIA 2BJVA 4IBIA 3GPUA 2O25A 3E46A 4NRVA 2VDBB 2VF8A 4MM3B 2CHGA 2FFJA 3SFZA 2J7OA 3ZCBB 3MHVC 2DWMA 1GABA 1NY5A 5KO3A 2ZAMA 4IIWA 2Y20A 3PXGA 4CHTB 4PDIA 5EP3A 1T43A 1VDDA 2HCBA 2Y21A 3B7ZA 3LCUA 2DNAA 4LZZA 3GQ4A 4LZJA 1XNQM 3U6EA 1TGUA 4X65M 2CV0A 4MB7A 3HGIA 4FVMA 1Q3CA 4M9SA 2DAGA 1KSFX 2RGHA 4M9XA 5ITQA 1HT2E 3HZJA 1WGNA 1N78A 1DO2A 2L7HA 3FD9A 1XHBA 4FD2A 1KYIA 1UFZA 2C99A 4DV7M 1G71A 3GRUA 2CHVA 2C96A 3B7NA 4L78A 3CF2A 3HWSA 1PJIA 2QBYA 4BLCA 1W5SA 2G8LA 3J81S 1GVNA 3Q8GA 2B3TA 3KOZE 2XEPA 3AJIB 1J7KA 3KXEC 2JY7A 1IN6A 3GLFE 4DV0M 1N33M 1GO5A 2L6OA 2Q2EB 4DR2M 4JI5M 3DOAA 5GKNA 2R65A 3FRHA 4ANRA 3A42A 2QP9X 4DUZM 4OVZA 3IECA 1TH3A 3FUWA 1JR3D 1VEJA 1XXHE 3IG5A 3KOWE 4AKHA 4X64M 4FW9A 3DFZA 1LV7A 2OPFA 3QYEA 2V1CA 3HU1A 1IM2A 1ZMVA 3L25A 3GLGA 4B3SM 1HNZM 2DVWB 1Q02A 2QCUA 3KS8A 2LTUA 3MMPA 3LQRA 1VQ1A 5C1BA 2G5GX 2C9CA 4KT0F 4DV4M 1XB2B 3U61B 2DHYA 2Y0TA 3CF6E 4L6V6 4AQYM 1R5LA 2F5NA 1SXJD 2X4AA 3WHLA 4TUWA 4UN2B 2QSFX 2KHHA 2C9OA 1OJLA 3NWLA 3I51A 3GLHB 4X66M 5ITTA 4JN6A 3KW6A 2MR9A 1TTEA 2G3QA 1DGHA 2A5YB 2Z7JA 2JWSA 3SAUA 2JZ1A 2QZ4A 1N75A 2XSZD 3TWLA 5A2QS 1MX0A 3L26A 2APLA 4PCZA 4LG2A 4LFBM 1NY6A 3HY5A 2RGOA 3JAMS 4S12A 5DYIA 1C7YA 2QPAA 1TDZA 2ZTDA 4MGHA 4I4LA 3J7AS 2JY8A 1QZMA 4JI0M 3LW5F 3R9XB 1D2NA 2CRUA 3HHYA 4OX9M 7CATA 4CIZA 4B7FA 1IN4A 5FTLA 3TL4X 2KZSA 2EA0A 3SARA 5EXPA 3LQQA 4MGKE 4X62M 1IN7A 1NV8A 2K6BA 4R71A 5BPVA 2JUJA 2LVAA 1JR3A 2MH8A 2R46A 3HHWA 1YE9A 1K3WA 2L4FA 2VF7A 1T6OA 1SXJB 2KW0A 3AFHA 3I04M 4WW0A 3W67A 5L8RF 3KSXA 2CEAA 4DBGB 2K9DA 2VIIA 1ZMUA 1L2BA 1FNNA 1W5TA 2NQ8C 2ZBKB 4MH0E 1WXQA 4L16A 3U61A 2WSFF 4KODA 3VDUA 4JI7M 2XGNA 4JI6M 3RGSA 1PRBA 2BJWA 1HNWM 2Z8YM 3TWMA 1NJFA 1E9SA 3QYBA 4ZPXA 3T1YM 4AKGA 3H4JA 2WZJA 4G3OA 3HKPA 4QNMA 4B3MM 4RF1A 1BVSA 2W82A 1GJSA 1LTMA 4I81A 4B7GA 1G4AE 3THGA 2EKKA 4DV5M 2JY6B 1JQJC 2R18A 4JI2M 2Z4RA 2OQ4A 4LJ7A 1R2ZA 1QAOA 5FSWA 3GPYA 4D81A 3C3DA 2UUCM 5E6JA 1ZQ9A 4DUYM 1G3IA 4IJEA 4Q7JA 3EIHA 2R4JA 2YFQA 2XZFA 3GQ3A 2JNHA 5FTKA 5EQTA 2Y0QA 2KNZA 5EJCA 3LMMA 3U60B 4GKKM 1I4WA 3HJ8A 4CJ6A 3AL0C 1R2YA 2QNJA 1R6BX 4LCBA 3U6QA 2R62A 1PJJA 3U6SA 4LF5M 1S3SA 3E9SA 2XFSA 1QDTA 2UUAM 1H6UA 1NSFA 3U6LA 1F4IA 1L1TA 3GLIE 3U60A 1CUKA 1R7RA 2F5QA 4DV1M 2I7PA 1SXJA 5EXXA 3VLFB 5FTMA 4G4NA 2L09A 3FTDA 2JZ0A 3B89A 3B9PA 2FS1A 3B74A 3KP1E 1G41A 1IBKM 3TWKA 4DR5M 4BB9A 2JY5A 2KZUA 4DV3M 3RE8A 1WJ7A 5IT9S 1MJGM 3FUXA 5ITRA 2QBYB 3W0FA 4GKJM 2LH0A 3GLGB 3ZQJA 2E5LM 1IBLM 5FTJA 4AG6A 2DI0A 4B3TM 4OVZB 2RRUA 2XFTA 3VKGA 2DAKA 4IJFA 2N35A 3TE6A 4GHAA 1NNJA 1OQYA 2J5YA 4GH9A 4GRIA 2F5SA 3HU3A 3VK7A 2F4VM 3EIEA 2OOBA 2HHHM 4NXNM 1HQYE 3U6CA 3ZH9B 5LMUM 2DAEA 3SC3A 2I7NA 1SXJC 4FCWA 2FNAA 5DNYA 3UJNA 4II7A 3FUTA 1Z5AA 4DV6M 1HR0M 2MROB 2BWBA 4NSRA 5DFLA 3K1JA 1MN3A 1L2CA 5EXSA 1VDLA 4IBGA 3JR4A 1NHWC 3U6OA 3H4MA 4LGMA 4NL4H 2KDLA 1HJPA 3DZDA 3T6PA 1WGLA 4QHSA 3GRRA 3L29A 2R44A 4MGIE 5KPZA 2K47A 4MGZE 5LMNM 3M6AA 1QYRA 1QANA 2BWEA 3KP0E 2LWXA 3KDSE 3KSJA 4LF4M 1EIJA 1R4GA 4IBFA 4LJ6A 2EJSA 4DR1M 1XMQM 1G8PA 5JI2E 2F5PA 1TDHA 1GL7A 3RGPA 3GLIB 1C1KA 3W68A 5ITXE 1VEKA 1Z6TA 4R3DA 4AZFA 5KQ8A 3C9PA 2D7EA 5IZ7D 4PDGA 3FE3A 2LNHC 1XNRM 4QHTA 2M5ZA 4WURA 4XGIA 1QUSA 1EE8A 1I94M 1IXSB 2VQEM 2L4EA 2XLJA 3AV0A 3VDPA 3R8FA 2KRKA 3BBZA 2DWZB 5FLXS 3GLGE 4B3RM 2R4EA 4LFCM 1OFHA 3T1HM 2LHCA 3J27B 2F5OA 3BOSA 1Q3BA 4G4OA 4LGYA 5EP2A 4AKIA 1T3TA 1NNUC 4JI3M 3C58A 4KHPM 3U6PA 1DGFA 3GQ5A 2DAIA 2LVPC 3K8ZA 4M9ZA 3SMSA 3SAWA 1JB0F 1N77A 4OW0A 4GC9A 2ERCA 3UK6A 3I4YA 3I4VA 4DR7M 2MJ5B 2CUZA 2LHGA 4YY3M 3U5ZA 4DR6M 1OIPA 3K9OA 4D80A 1P3QQ 3HU2A 4NC6A 1GLNA 4GC5A 3A46A 4OU7A 3GPPA 2AHMA 1IY0A 4IBCA 3KOYE 3JR5A 1VEGA 2FOIC 4R7GA 3W0LB 1ZAEA 2QHOB 4FWHA 3VK8A 1PJQA 1PJSA 1NHGC 4I5SA 3J80S 2DHRA 3IG8A 2CHQA 4EIWA 4KO8A 4GITA 3SASA 3K92A 4P17A 2O01F 1NJGA 1RU3A 1QUTA 2ZANA 2LVNC 1EFUB 3AOEC 3FYDA 4MGYE 1IY2A 4F1IA 5IWAM 1D0MA 2DXIA 3Q8XA 4IBBA 2HKJA 3GP1A 1N34M 3QWLA 1QQWA 1J5EM 3M0EA 1Z59A 3VKHA 2M60A 1GJTA 5F3WA 4RNAA 2LXEA 2DENA 2YQZA 4LJ4A 5ITYA 3SHGB 4B08A 1MU5A 1IXSA 3UZUA 2WSEF 3U6DA 2QQ8A 5BR8M 3TQSA 1DGBA 3FTEA 4W5WA 3HJQA 5ITXA 2H1RA 1IQPA 4LJ5A 3MK6A 4Y28F 3GO8A 3FTFA 3GLHE 4IBJA 4JYAM 2CE7A 2EKFA 2V6ZM 1SXJE 5H37D 4LF6M 5EP1A 4QOZC 4GIPA 1NVMA 3NBXX 4RF0A 4L8RC 4QOSA 1OTRA 3GRVA 2R0IA 3KFUG 1IY1A
chains in the Genus database with same CATH topology
4LF7M 2KA6B 2D7GA 3U5ZB 3D8BA 1DGGA 4YHHM 3K2LA 4DV2M 3FKEA 3SMPA 3UMMA 1XC8A 3SATA 3CF0A 2EUCA 4LJ9A 3RFWA 3L2AA 2KRUA 3M7GA 3ZC7B 1N32M 8CATA 4Z8XA 3AKZA 2QENA 1IN5A 3A98B 3ILKA 1YUBA 4IBDA 3GLFB 4NRWA 3HHZA 4L4UA 3GLIA 2X49A 1UM8A 3FUVA 4LJAA 3MJ5A 4PT5A 4PD2A 3SAVA 2UXDM 4LF8M 1XWIA 2EO2A 3TPZA 4JXJA 2D7HA 2XH9A 1YSYA 3SBJA 2XZUA 1L2DA 2DWNA 3FYCA 1L1ZA 2KXEA 2Z3XA 4M0WA 3U6MA 3L28A 1FJGM 1L8QA 3SYKA 4BBAA 4HLQA 1DO0A 2XSZA 1OFIA 2Z4SA 1IXRC 4LFAM 1IBMM 1TH4A 3A45A 1QVRA 5KQDA 3PNYA 3KOXE 1X37A 4IBEA 2YNMD 5E26A 3LVWA 4A3VB 3GPXA 1HNXM 1QAQA 1TH2A 3DA1A 4M0DA 1J09A 4LY6A 4P16A 4LF9M 4G4QA 3J7BA 4ITQA 5IREB 2O5RA 3HJSA 3VFDA 4DR4M 2HL7A 4G6ZA 2DWLA 1E9RA 2UUBM 4AI6A 1E94E 3PNVA 5KPTA 1K3XA 4JI4M 4NOOB 4L15A 2YR0A 1E32A 4JI8M 4K0KM 5C18A 5JI3E 4G4RA 1GL6A 3GRYA 3QAUA 2KEBA 4Z6YA 3AOGA 3FUUA 2CFOA 2DZOB 2R45A 3T15A 5KPRA 5DYGA 1Z5BA 2CV2A 1G59A 2X8AA 2ZAOA 4AG5A 4B7HA 2DZNB 1K82A 4GMQA 4LJ8A 2UXCM 1IN8A 4LRTA 1HT1E 1QAMA 3J2PB 5ITUA 2RKOA 5EXTA 2VQFM 4FCVA 2CV1A 2C98A 2L7IA 3SHFA 3T38A 3GLFA 1ORYB 4AW4A 1PM5A 4XBOA 5EP4A 3D8LA 1XXHB 4FWGA 1XXHA 3T1YM 1HQCA 2BNKA 3L27A 4NSOB 3KVWA 4BB9A 2P5TA 3CTWB 4GHLA 2FE8A 3GLHA 3OTOM 2UU9M 2JA2A 4I8OA 4IBKA 3HHXA 3E4RA 2V1UA 1GKIA 2XF3A 3NBIA 4DR3M 1XMOM 4JI1M 3LVVA 3PVSA 4REZA 3SYLA 3AOEA 2C5RA 4CGYB 4QNRA 4LRSA 1KFVA 3WHKA 4KLNA 4D82A 2J7NA 2UXBM 1DGHB 3KS4A 1N36M 1Q39A 4FWDA 4JV5M 5FTNA 3UGJA 2ZM6M 3FTCA 4FCTA 1Z5CA 4HL4A 4NXMM 1IXZA 3PFIA 2BJVA 4IBIA 3GPUA 4NRVA 4MM3B 2CHGA 2FFJA 3SFZA 2J7OA 3ZCBB 3MHVC 2DWMA 1NY5A 5KO3A 2ZAMA 4IIWA 2Y20A 3PXGA 4CHTB 4PDIA 5EP3A 1VDDA 2HCBA 2Y21A 4LZZA 3GQ4A 4LZJA 1XNQM 3U6EA 1TGUA 4X65M 2CV0A 4MB7A 3HGIA 4FVMA 1Q3CA 4M9SA 1KSFX 2RGHA 4M9XA 5ITQA 1HT2E 1N78A 1DO2A 2L7HA 3FD9A 1XHBA 4FD2A 1KYIA 2C99A 4DV7M 3GRUA 2CHVA 2C96A 4L78A 3CF2A 3HWSA 1PJIA 2QBYA 4BLCA 1W5SA 2G8LA 3J81S 1GVNA 3KOZE 2XEPA 3AJIB 1J7KA 3KXEC 1IN6A 4DV0M 1N33M 2L6OA 2Q2EB 4DR2M 4JI5M 3DOAA 5GKNA 2R65A 3A42A 2QP9X 4DUZM 4OVZA 1TH3A 3FUWA 1JR3D 3KOWE 4AKHA 3IG5A 4X64M 4FW9A 3DFZA 1LV7A 2OPFA 2V1CA 3HU1A 1IM2A 3L25A 3GLGA 4B3SM 1HNZM 2DVWB 2QCUA 3KS8A 3LQRA 5C1BA 2G5GX 2C9CA 4DV4M 3U61B 2Y0TA 3CF6E 4AQYM 2F5NA 1SXJD 2X4AA 3WHLA 4TUWA 2C9OA 1OJLA 3NWLA 3I51A 3GLHB 4X66M 5ITTA 4JN6A 3KW6A 1DGHA 2A5YB 2Z7JA 3SAUA 2QZ4A 1N75A 2XSZD 3TWLA 5A2QS 1MX0A 3L26A 4PCZA 4LG2A 4LFBM 1NY6A 2RGOA 3JAMS 4S12A 5DYIA 2QPAA 1TDZA 4MGHA 4I4LA 3J7AS 1QZMA 4JI0M 3R9XB 1D2NA 3HHYA 4OX9M 7CATA 4B7FA 1IN4A 5FTLA 3TL4X 2KZSA 2EA0A 3SARA 5EXPA 3LQQA 4MGKE 4X62M 1IN7A 5BPVA 1JR3A 2R46A 3HHWA 1YE9A 1K3WA 2KW0A 1SXJB 3AFHA 4WW0A 3KSXA 2CEAA 1L2BA 2VIIA 1FNNA 1W5TA 2NQ8C 2ZBKB 4MH0E 1WXQA 4L16A 3U61A 4KODA 3VDUA 4JI7M 2XGNA 4JI6M 3RGSA 2BJWA 1HNWM 3TWMA 1NJFA 1E9SA 4ZPXA 4AKGA 3HKPA 4QNMA 4B3MM 4RF1A 2W82A 4I81A 4B7GA 1G4AE 3THGA 4DV5M 1JQJC 2R18A 4JI2M 2Z4RA 2OQ4A 4LJ7A 1R2ZA 1QAOA 5FSWA 3GPYA 4D81A 2UUCM 5E6JA 1ZQ9A 4DUYM 1G3IA 4IJEA 3EIHA 2R4JA 2YFQA 2XZFA 3GQ3A 5FTKA 5EQTA 2Y0QA 5EJCA 3LMMA 3U60B 4GKKM 1I4WA 3HJ8A 3AL0C 1R2YA 1R6BX 4LCBA 3U6QA 2R62A 1PJJA 3U6SA 4LF5M 1S3SA 3E9SA 2XFSA 2UUAM 1H6UA 1NSFA 3U6LA 1L1TA 3U60A 2F5QA 1R7RA 4CISA 4DV1M 2I7PA 1SXJA 5EXXA 3VLFB 5FTMA 4G4NA 2L09A 3FTDA 3B9PA 3KP1E 1G41A 1IBKM 3TWKA 4DR5M 2KZUA 4DV3M 3RE8A 5IT9S 3FUXA 5ITRA 2QBYB 3W0FA 4GKJM 2LH0A 3GLGB 2E5LM 1IBLM 5FTJA 4AG6A 4B3TM 4OVZB 2XFTA 3VKGA 4IJFA 3TE6A 4GHAA 1NNJA 4GH9A 4GRIA 2F5SA 3HU3A 3VK7A 2F4VM 3EIEA 2HHHM 4NXNM 1HQYE 3U6CA 3ZH9B 5LMUM 3SC3A 2I7NA 1SXJC 4FCWA 2FNAA 5DNYA 3UJNA 4II7A 3FUTA 1Z5AA 4DV6M 1HR0M 4NSRA 3K1JA 1L2CA 5EXSA 4IBGA 3JR4A 1NHWC 3U6OA 3H4MA 4LGMA 4NL4H 3DZDA 4QHSA 3GRRA 3L29A 5KPZA 4MGIE 2K47A 4MGZE 5LMNM 3M6AA 1QYRA 1QANA 3KP0E 2LWXA 3KDSE 3KSJA 4LF4M 4IBFA 4LJ6A 4DR1M 1XMQM 1G8PA 5JI2E 2F5PA 1TDHA 1GL7A 3RGPA 3GLIB 1C1KA 5ITXE 5KQ8A 1Z6TA 4R3DA 4AZFA 2D7EA 5IZ7D 4PDGA 2LNHC 1XNRM 4QHTA 2M5ZA 4WURA 4XGIA 1EE8A 1I94M 1IXSB 2VQEM 2XLJA 3AV0A 3VDPA 3R8FA 2KRKA 5FLXS 2DWZB 4B3RM 2R4EA 4LFCM 1OFHA 3T1HM 3J27B 2F5OA 3BOSA 1Q3BA 4G4OA 4LGYA 5EP2A 4AKIA 1T3TA 1NNUC 4JI3M 3C58A 4KHPM 3U6PA 1DGFA 3GQ5A 3K8ZA 4M9ZA 3SMSA 3SAWA 1N77A 4OW0A 4GC9A 2ERCA 3UK6A 3I4YA 3I4VA 4DR7M 3U5ZA 2CUZA 4YY3M 4DR6M 3HU2A 1GLNA 4GC5A 3A46A 4OU7A 3GPPA 2AHMA 1IY0A 4IBCA 3KOYE 3JR5A 2FOIC 4R7GA 3W0LB 1ZAEA 4FWHA 3VK8A 4I5SA 1NHGC 3J80S 2DHRA 3IG8A 2CHQA 4EIWA 4KO8A 4GITA 3SASA 3K92A 4D80A 1NJGA 2ZANA 3AOEC 3FYDA 5IWAM 4MGYE 1IY2A 2DXIA 3Q8XA 4IBBA 2HKJA 3GP1A 1N34M 3QWLA 1QQWA 1J5EM 3M0EA 1Z59A 3VKHA 2M60A 5F3WA 4RNAA 2LXEA 4LJ4A 2YQZA 5ITYA 3SHGB 4B08A 1MU5A 3UZUA 3U6DA 5BR8M 3TQSA 1DGBA 3FTEA 4W5WA 3HJQA 5ITXA 2H1RA 1IQPA 4LJ5A 3MK6A 3GO8A 3FTFA 4IBJA 4JYAM 2CE7A 5H37D 2V6ZM 1SXJE 4LF6M 5EP1A 4QOZC 4GIPA 1NVMA 4RF0A 4L8RC 4QOSA 3GRVA 3KFUG 1IY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 M;  4OX9 M;  5LMN M;  3OTO M;  2UU9 M;  4YHH M;  3SAR A;  2EA0 A;  4LF4 M;  4DV2 M;  1XC8 A;  3SAT A;  4X62 M;  1XMO M;  4DR3 M;  4JI1 M;  1N32 M;  1KFV A;  1K3W A;  4DR1 M;  1XMQ M;  2UXB M;  1N36 M;  1Q39 A;  2F5P A;  1L2B A;  1TDH A;  4NRW A;  4JV5 M;  2ZBK B;  2ZM6 M;  5ITX E;  4PD2 A;  3SAV A;  2UXD M;  4JI7 M;  1Z5C A;  4JI6 M;  4LF8 M;  4PDG A;  4NXM M;  3GPU A;  1HNW M;  1XNR M;  3TWM A;  4NRV A;  1EE8 A;  3SBJ A;  2XZU A;  1L2D A;  1I94 M;  4B3M M;  2VQE M;  1L1Z A;  3U6M A;  4DV5 M;  1FJG M;  5FLX S;  4JI2 M;  4PDI A;  4B3R M;  2OQ4 A;  4LFC M;  1R2Z A;  3GPY A;  3GQ4 A;  3T1H M;  2UUC M;  1XNQ M;  3U6E A;  4X65 M;  4MB7 A;  4G4O A;  1Q3B A;  4LFA M;  1IBM M;  2F5O A;  3A45 A;  4DUY M;  1Q3C A;  4JI3 M;  3C58 A;  4KHP M;  3GPX A;  3U6P A;  5ITQ A;  1HNX M;  2XZF A;  3GQ3 A;  3GQ5 A;  3SAW A;  4DV7 M;  4DR7 M;  4LF9 M;  1PJI A;  4GKK M;  4YY3 M;  4G4Q A;  4DR6 M;  1R2Y A;  4ITQ A;  3J81 S;  3U6Q A;  1PJJ A;  3U6S A;  4LF5 M;  4DR4 M;  2UUA M;  3A46 A;  3GPP A;  3U6L A;  1L1T A;  2F5Q A;  3JR5 A;  4CIS A;  4DV0 M;  4DV1 M;  4G4N A;  2Q2E B;  2UUB M;  4DR2 M;  1N33 M;  1K3X A;  4JI5 M;  4JI4 M;  3DOA A;  3A42 A;  3VK8 A;  4DUZ M;  3J80 S;  1IBK M;  3TWK A;  4DR5 M;  3SAS A;  4X64 M;  4JI8 M;  4K0K M;  2OPF A;  4DV3 M;  4G4R A;  5IT9 S;  5IWA M;  5ITR A;  3W0F A;  4GKJ M;  4B3S M;  2HKJ A;  3GP1 A;  1N34 M;  1J5E M;  1HNZ M;  2E5L M;  1IBL M;  1Z59 A;  1Z5B A;  4B3T M;  4DV4 M;  5ITY A;  1MU5 A;  4AQY M;  1NNJ A;  1K82 A;  2F5N A;  2UXC M;  3U6D A;  2F5S A;  5BR8 M;  3VK7 A;  2F4V M;  2HHH M;  5ITU A;  4NXN M;  5ITX A;  2VQF M;  4X66 M;  3U6C A;  5ITT A;  3GO8 A;  5LMU M;  4JYA M;  3SAU A;  5A2Q S;  3TWL A;  1HR0 M;  1Z5A A;  1MX0 A;  4PCZ A;  4DV6 M;  4LF6 M;  4LFB M;  3JAM S;  1L2C A;  3JR4 A;  1TDZ A;  3U6O A;  1PM5 A;  3J7A S;  4JI0 M;  3T1Y M; 
#chains in the Genus database with same CATH topology
 3FRI A;  2HAK A;  4LF7 M;  2KA6 B;  2CP8 A;  2D7G A;  3U5Z B;  3D8B A;  1DGG A;  4YHH M;  3B7Q A;  3K2L A;  4DV2 M;  3FKE A;  3SMP A;  3UMM A;  1XC8 A;  3SAT A;  3CF0 A;  4CIS A;  2EUC A;  3BXW A;  4LJ9 A;  3L2A A;  3RFW A;  2KRU A;  3M7G A;  3ZC7 B;  1N32 M;  2H5X A;  4XK8 F;  8CAT A;  4Z8X A;  1V92 A;  3AKZ A;  3E21 A;  2QEN A;  1IN5 A;  3A98 B;  3ILK A;  1YUB A;  4IBD A;  3GLF B;  4NRW A;  3HHZ A;  4L4U A;  3GLI A;  2X49 A;  1UM8 A;  3FUV A;  1TR8 A;  2JP7 A;  3MJ5 A;  1YLA A;  2GNO A;  2L2D A;  4LJA A;  4PT5 A;  4PD2 A;  3SAV A;  2UXD M;  2MGW A;  1WHC A;  4LF8 M;  1XWI A;  2DAM A;  2EO2 A;  3TPZ A;  4JXJ A;  1QDR A;  1QZE A;  2D7H A;  2XH9 A;  1YSY A;  1D0K A;  3SBJ A;  2XZU A;  1L2D A;  2DWN A;  3FYC A;  1L1Z A;  2KXE A;  2Z3X A;  4M0W A;  3U6M A;  1OAO C;  3L28 A;  3K9P A;  1L8Q A;  1FJG M;  3SYK A;  4BBA A;  2K0B X;  1V34 A;  4HLQ A;  1DO0 A;  2XSZ A;  1OFI A;  2Z4S A;  1IXR C;  2JXN A;  4LFA M;  1IBM M;  1NO1 A;  1TH4 A;  1QVR A;  2OOA A;  1ZMW A;  3A45 A;  3PNY A;  3V76 A;  5KQD A;  1IFY A;  3KOX E;  1X37 A;  4IBE A;  2YNM D;  5E26 A;  3LVW A;  4A3V B;  3GPX A;  1HNX M;  1AUA A;  1QAQ A;  1NV9 A;  2DKL A;  1AIP C;  1TH2 A;  3DA1 A;  4M0D A;  1J09 A;  4LY6 A;  2KNV A;  4P16 A;  2GQF A;  4LF9 M;  4G4Q A;  3J7B A;  3I01 M;  4ITQ A;  5IRE B;  2LVQ D;  2O5R A;  1WR1 B;  1DV0 A;  3HJS A;  3VFD A;  4DR4 M;  2HL7 A;  4G6Z A;  2DWL A;  1E9R A;  3LCV B;  2UUB M;  4AI6 A;  1E94 E;  3C3E A;  3PNV A;  5KPT A;  1K3X A;  1SG9 A;  2LBC A;  2WSC F;  4NOO B;  4JI4 M;  4F2L A;  4L15 A;  2YR0 A;  1WIV A;  1E32 A;  4JI8 M;  4K0K M;  5C18 A;  5JI3 E;  2DZL A;  4GEW A;  1GL6 A;  4G4R A;  3GRY A;  2KEB A;  3QAU A;  4Z6Y A;  3AOG A;  3FUU A;  2CFO A;  2DZO B;  2R45 A;  3HX3 A;  3T15 A;  5KPR A;  5DYG A;  1Z5B A;  2CV2 A;  1G59 A;  2CWB A;  2X8A A;  2ZAO A;  4AG5 A;  1JR3 E;  4HEO A;  4B7H A;  2DZN B;  1K82 A;  4GMQ A;  4LJ8 A;  2UXC M;  1VG5 A;  1IN8 A;  4LRT A;  1HT1 E;  1Y8G A;  1QAM A;  3J2P B;  5ITU A;  2RKO A;  5EXT A;  2VQF M;  4FCV A;  2CV1 A;  2C98 A;  2L7I A;  3SHF A;  3T38 A;  3GLF A;  1ORY B;  4AW4 A;  2HWJ A;  3F92 A;  1PM5 A;  1A5T A;  4XBO A;  5EP4 A;  1XXH B;  3D8L A;  1XXH A;  1TF0 B;  1PGY A;  1HQC A;  2BNK A;  3IHP A;  3L27 A;  3KVW A;  4FWG A;  1OKS A;  2P5T A;  3CGW A;  3CTW B;  4NSO B;  4GHL A;  2FE8 A;  3GLH A;  3OTO M;  2UU9 M;  2JA2 A;  4I8O A;  1PJT A;  1ZV1 A;  4IBK A;  1D0L A;  3HHX A;  2OO9 A;  3E4R A;  2V1U A;  1GKI A;  2LVO C;  2XF3 A;  1OIZ A;  3NBI A;  4DR3 M;  4RKU F;  1OAI A;  1XMO M;  4JI1 M;  3LVV A;  3PVS A;  4REZ A;  3SYL A;  3AOE A;  2C5R A;  4CGY B;  4QNR A;  4LRS A;  1KFV A;  3WHK A;  4KLN A;  4D82 A;  2J7N A;  2UXB M;  2R6F A;  1DGH B;  1V33 A;  2FH0 A;  3KS4 A;  1N36 M;  1Q39 A;  4FWD A;  4JV5 M;  5FTN A;  3UGJ A;  2ZM6 M;  3FTC A;  2ZTC A;  4WP2 A;  2KNA A;  4FCT A;  1Z5C A;  4HL4 A;  4NXM M;  1IXZ A;  3PFI A;  2BJV A;  4IBI A;  3GPU A;  2O25 A;  3E46 A;  4NRV A;  2VDB B;  2VF8 A;  4MM3 B;  2CHG A;  2FFJ A;  3SFZ A;  2J7O A;  3ZCB B;  3MHV C;  2DWM A;  1GAB A;  1NY5 A;  5KO3 A;  2ZAM A;  4IIW A;  2Y20 A;  3PXG A;  4CHT B;  4PDI A;  5EP3 A;  1T43 A;  1VDD A;  2HCB A;  2Y21 A;  3B7Z A;  3LCU A;  2DNA A;  4LZZ A;  3GQ4 A;  4LZJ A;  1XNQ M;  3U6E A;  1TGU A;  4X65 M;  2CV0 A;  4MB7 A;  3HGI A;  4FVM A;  1Q3C A;  4M9S A;  2DAG A;  1KSF X;  2RGH A;  4M9X A;  5ITQ A;  1HT2 E;  3HZJ A;  1WGN A;  1N78 A;  1DO2 A;  2L7H A;  3FD9 A;  1XHB A;  4FD2 A;  1KYI A;  1UFZ A;  2C99 A;  4DV7 M;  1G71 A;  3GRU A;  2CHV A;  2C96 A;  3B7N A;  4L78 A;  3CF2 A;  3HWS A;  1PJI A;  2QBY A;  4BLC A;  1W5S A;  2G8L A;  3J81 S;  1GVN A;  3Q8G A;  2B3T A;  3KOZ E;  2XEP A;  3AJI B;  1J7K A;  3KXE C;  2JY7 A;  1IN6 A;  3GLF E;  4DV0 M;  1N33 M;  1GO5 A;  2L6O A;  2Q2E B;  4DR2 M;  4JI5 M;  3DOA A;  5GKN A;  2R65 A;  3FRH A;  4ANR A;  3A42 A;  2QP9 X;  4DUZ M;  4OVZ A;  3IEC A;  1TH3 A;  3FUW A;  1JR3 D;  1VEJ A;  1XXH E;  3IG5 A;  3KOW E;  4AKH A;  4X64 M;  4FW9 A;  3DFZ A;  1LV7 A;  2OPF A;  3QYE A;  2V1C A;  3HU1 A;  1IM2 A;  1ZMV A;  3L25 A;  3GLG A;  4B3S M;  1HNZ M;  2DVW B;  1Q02 A;  2QCU A;  3KS8 A;  2LTU A;  3MMP A;  3LQR A;  1VQ1 A;  5C1B A;  2G5G X;  2C9C A;  4KT0 F;  4DV4 M;  1XB2 B;  3U61 B;  2DHY A;  2Y0T A;  3CF6 E;  4L6V 6;  4AQY M;  1R5L A;  2F5N A;  1SXJ D;  2X4A A;  3WHL A;  4TUW A;  4UN2 B;  2QSF X;  2KHH A;  2C9O A;  1OJL A;  3NWL A;  3I51 A;  3GLH B;  4X66 M;  5ITT A;  4JN6 A;  3KW6 A;  2MR9 A;  1TTE A;  2G3Q A;  1DGH A;  2A5Y B;  2Z7J A;  2JWS A;  3SAU A;  2JZ1 A;  2QZ4 A;  1N75 A;  2XSZ D;  3TWL A;  5A2Q S;  1MX0 A;  3L26 A;  2APL A;  4PCZ A;  4LG2 A;  4LFB M;  1NY6 A;  3HY5 A;  2RGO A;  3JAM S;  4S12 A;  5DYI A;  1C7Y A;  2QPA A;  1TDZ A;  2ZTD A;  4MGH A;  4I4L A;  3J7A S;  2JY8 A;  1QZM A;  4JI0 M;  3LW5 F;  3R9X B;  1D2N A;  2CRU A;  3HHY A;  4OX9 M;  7CAT A;  4CIZ A;  4B7F A;  1IN4 A;  5FTL A;  3TL4 X;  2KZS A;  2EA0 A;  3SAR A;  5EXP A;  3LQQ A;  4MGK E;  4X62 M;  1IN7 A;  1NV8 A;  2K6B A;  4R71 A;  5BPV A;  2JUJ A;  2LVA A;  1JR3 A;  2MH8 A;  2R46 A;  3HHW A;  1YE9 A;  1K3W A;  2L4F A;  2VF7 A;  1T6O A;  1SXJ B;  2KW0 A;  3AFH A;  3I04 M;  4WW0 A;  3W67 A;  5L8R F;  3KSX A;  2CEA A;  4DBG B;  2K9D A;  2VII A;  1ZMU A;  1L2B A;  1FNN A;  1W5T A;  2NQ8 C;  2ZBK B;  4MH0 E;  1WXQ A;  4L16 A;  3U61 A;  2WSF F;  4KOD A;  3VDU A;  4JI7 M;  2XGN A;  4JI6 M;  3RGS A;  1PRB A;  2BJW A;  1HNW M;  2Z8Y M;  3TWM A;  1NJF A;  1E9S A;  3QYB A;  4ZPX A;  3T1Y M;  4AKG A;  3H4J A;  2WZJ A;  4G3O A;  3HKP A;  4QNM A;  4B3M M;  4RF1 A;  1BVS A;  2W82 A;  1GJS A;  1LTM A;  4I81 A;  4B7G A;  1G4A E;  3THG A;  2EKK A;  4DV5 M;  2JY6 B;  1JQJ C;  2R18 A;  4JI2 M;  2Z4R A;  2OQ4 A;  4LJ7 A;  1R2Z A;  1QAO A;  5FSW A;  3GPY A;  4D81 A;  3C3D A;  2UUC M;  5E6J A;  1ZQ9 A;  4DUY M;  1G3I A;  4IJE A;  4Q7J A;  3EIH A;  2R4J A;  2YFQ A;  2XZF A;  3GQ3 A;  2JNH A;  5FTK A;  5EQT A;  2Y0Q A;  2KNZ A;  5EJC A;  3LMM A;  3U60 B;  4GKK M;  1I4W A;  3HJ8 A;  4CJ6 A;  3AL0 C;  1R2Y A;  2QNJ A;  1R6B X;  4LCB A;  3U6Q A;  2R62 A;  1PJJ A;  3U6S A;  4LF5 M;  1S3S A;  3E9S A;  2XFS A;  1QDT A;  2UUA M;  1H6U A;  1NSF A;  3U6L A;  1F4I A;  1L1T A;  3GLI E;  3U60 A;  1CUK A;  1R7R A;  2F5Q A;  4DV1 M;  2I7P A;  1SXJ A;  5EXX A;  3VLF B;  5FTM A;  4G4N A;  2L09 A;  3FTD A;  2JZ0 A;  3B89 A;  3B9P A;  2FS1 A;  3B74 A;  3KP1 E;  1G41 A;  1IBK M;  3TWK A;  4DR5 M;  4BB9 A;  2JY5 A;  2KZU A;  4DV3 M;  3RE8 A;  1WJ7 A;  5IT9 S;  1MJG M;  3FUX A;  5ITR A;  2QBY B;  3W0F A;  4GKJ M;  2LH0 A;  3GLG B;  3ZQJ A;  2E5L M;  1IBL M;  5FTJ A;  4AG6 A;  2DI0 A;  4B3T M;  4OVZ B;  2RRU A;  2XFT A;  3VKG A;  2DAK A;  4IJF A;  2N35 A;  3TE6 A;  4GHA A;  1NNJ A;  1OQY A;  2J5Y A;  4GH9 A;  4GRI A;  2F5S A;  3HU3 A;  3VK7 A;  2F4V M;  3EIE A;  2OOB A;  2HHH M;  4NXN M;  1HQY E;  3U6C A;  3ZH9 B;  5LMU M;  2DAE A;  3SC3 A;  2I7N A;  1SXJ C;  4FCW A;  2FNA A;  5DNY A;  3UJN A;  4II7 A;  3FUT A;  1Z5A A;  4DV6 M;  1HR0 M;  2MRO B;  2BWB A;  4NSR A;  5DFL A;  3K1J A;  1MN3 A;  1L2C A;  5EXS A;  1VDL A;  4IBG A;  3JR4 A;  1NHW C;  3U6O A;  3H4M A;  4LGM A;  4NL4 H;  2KDL A;  1HJP A;  3DZD A;  3T6P A;  1WGL A;  4QHS A;  3GRR A;  3L29 A;  2R44 A;  4MGI E;  5KPZ A;  2K47 A;  4MGZ E;  5LMN M;  3M6A A;  1QYR A;  1QAN A;  2BWE A;  3KP0 E;  2LWX A;  3KDS E;  3KSJ A;  4LF4 M;  1EIJ A;  1R4G A;  4IBF A;  4LJ6 A;  2EJS A;  4DR1 M;  1XMQ M;  1G8P A;  5JI2 E;  2F5P A;  1TDH A;  1GL7 A;  3RGP A;  3GLI B;  1C1K A;  3W68 A;  5ITX E;  1VEK A;  1Z6T A;  4R3D A;  4AZF A;  5KQ8 A;  3C9P A;  2D7E A;  5IZ7 D;  4PDG A;  3FE3 A;  2LNH C;  1XNR M;  4QHT A;  2M5Z A;  4WUR A;  4XGI A;  1QUS A;  1EE8 A;  1I94 M;  1IXS B;  2VQE M;  2L4E A;  2XLJ A;  3AV0 A;  3VDP A;  3R8F A;  2KRK A;  3BBZ A;  2DWZ B;  5FLX S;  3GLG E;  4B3R M;  2R4E A;  4LFC M;  1OFH A;  3T1H M;  2LHC A;  3J27 B;  2F5O A;  3BOS A;  1Q3B A;  4G4O A;  4LGY A;  5EP2 A;  4AKI A;  1T3T A;  1NNU C;  4JI3 M;  3C58 A;  4KHP M;  3U6P A;  1DGF A;  3GQ5 A;  2DAI A;  2LVP C;  3K8Z A;  4M9Z A;  3SMS A;  3SAW A;  1JB0 F;  1N77 A;  4OW0 A;  4GC9 A;  2ERC A;  3UK6 A;  3I4Y A;  3I4V A;  4DR7 M;  2MJ5 B;  2CUZ A;  2LHG A;  4YY3 M;  3U5Z A;  4DR6 M;  1OIP A;  3K9O A;  4D80 A;  1P3Q Q;  3HU2 A;  4NC6 A;  1GLN A;  4GC5 A;  3A46 A;  4OU7 A;  3GPP A;  2AHM A;  1IY0 A;  4IBC A;  3KOY E;  3JR5 A;  1VEG A;  2FOI C;  4R7G A;  3W0L B;  1ZAE A;  2QHO B;  4FWH A;  3VK8 A;  1PJQ A;  1PJS A;  1NHG C;  4I5S A;  3J80 S;  2DHR A;  3IG8 A;  2CHQ A;  4EIW A;  4KO8 A;  4GIT A;  3SAS A;  3K92 A;  4P17 A;  2O01 F;  1NJG A;  1RU3 A;  1QUT A;  2ZAN A;  2LVN C;  1EFU B;  3AOE C;  3FYD A;  4MGY E;  1IY2 A;  4F1I A;  5IWA M;  1D0M A;  2DXI A;  3Q8X A;  4IBB A;  2HKJ A;  3GP1 A;  1N34 M;  3QWL A;  1QQW A;  1J5E M;  3M0E A;  1Z59 A;  3VKH A;  2M60 A;  1GJT A;  5F3W A;  4RNA A;  2LXE A;  2DEN A;  2YQZ A;  4LJ4 A;  5ITY A;  3SHG B;  4B08 A;  1MU5 A;  1IXS A;  3UZU A;  2WSE F;  3U6D A;  2QQ8 A;  5BR8 M;  3TQS A;  1DGB A;  3FTE A;  4W5W A;  3HJQ A;  5ITX A;  2H1R A;  1IQP A;  4LJ5 A;  3MK6 A;  4Y28 F;  3GO8 A;  3FTF A;  3GLH E;  4IBJ A;  4JYA M;  2CE7 A;  2EKF A;  2V6Z M;  1SXJ E;  5H37 D;  4LF6 M;  5EP1 A;  4QOZ C;  4GIP A;  1NVM A;  3NBX X;  4RF0 A;  4L8R C;  4QOS A;  1OTR A;  3GRV A;  2R0I A;  3KFU G;  1IY1 A; 
#chains in the Genus database with same CATH homology
 4LF7 M;  2KA6 B;  2D7G A;  3U5Z B;  3D8B A;  1DGG A;  4YHH M;  3K2L A;  4DV2 M;  3FKE A;  3SMP A;  3UMM A;  1XC8 A;  3SAT A;  3CF0 A;  2EUC A;  4LJ9 A;  3RFW A;  3L2A A;  2KRU A;  3M7G A;  3ZC7 B;  1N32 M;  8CAT A;  4Z8X A;  3AKZ A;  2QEN A;  1IN5 A;  3A98 B;  3ILK A;  1YUB A;  4IBD A;  3GLF B;  4NRW A;  3HHZ A;  4L4U A;  3GLI A;  2X49 A;  1UM8 A;  3FUV A;  4LJA A;  3MJ5 A;  4PT5 A;  4PD2 A;  3SAV A;  2UXD M;  4LF8 M;  1XWI A;  2EO2 A;  3TPZ A;  4JXJ A;  2D7H A;  2XH9 A;  1YSY A;  3SBJ A;  2XZU A;  1L2D A;  2DWN A;  3FYC A;  1L1Z A;  2KXE A;  2Z3X A;  4M0W A;  3U6M A;  3L28 A;  1FJG M;  1L8Q A;  3SYK A;  4BBA A;  4HLQ A;  1DO0 A;  2XSZ A;  1OFI A;  2Z4S A;  1IXR C;  4LFA M;  1IBM M;  1TH4 A;  3A45 A;  1QVR A;  5KQD A;  3PNY A;  3KOX E;  1X37 A;  4IBE A;  2YNM D;  5E26 A;  3LVW A;  4A3V B;  3GPX A;  1HNX M;  1QAQ A;  1TH2 A;  3DA1 A;  4M0D A;  1J09 A;  4LY6 A;  4P16 A;  4LF9 M;  4G4Q A;  3J7B A;  4ITQ A;  5IRE B;  2O5R A;  3HJS A;  3VFD A;  4DR4 M;  2HL7 A;  4G6Z A;  2DWL A;  1E9R A;  2UUB M;  4AI6 A;  1E94 E;  3PNV A;  5KPT A;  1K3X A;  4JI4 M;  4NOO B;  4L15 A;  2YR0 A;  1E32 A;  4JI8 M;  4K0K M;  5C18 A;  5JI3 E;  4G4R A;  1GL6 A;  3GRY A;  3QAU A;  2KEB A;  4Z6Y A;  3AOG A;  3FUU A;  2CFO A;  2DZO B;  2R45 A;  3T15 A;  5KPR A;  5DYG A;  1Z5B A;  2CV2 A;  1G59 A;  2X8A A;  2ZAO A;  4AG5 A;  4B7H A;  2DZN B;  1K82 A;  4GMQ A;  4LJ8 A;  2UXC M;  1IN8 A;  4LRT A;  1HT1 E;  1QAM A;  3J2P B;  5ITU A;  2RKO A;  5EXT A;  2VQF M;  4FCV A;  2CV1 A;  2C98 A;  2L7I A;  3SHF A;  3T38 A;  3GLF A;  1ORY B;  4AW4 A;  1PM5 A;  4XBO A;  5EP4 A;  3D8L A;  1XXH B;  4FWG A;  1XXH A;  3T1Y M;  1HQC A;  2BNK A;  3L27 A;  4NSO B;  3KVW A;  4BB9 A;  2P5T A;  3CTW B;  4GHL A;  2FE8 A;  3GLH A;  3OTO M;  2UU9 M;  2JA2 A;  4I8O A;  4IBK A;  3HHX A;  3E4R A;  2V1U A;  1GKI A;  2XF3 A;  3NBI A;  4DR3 M;  1XMO M;  4JI1 M;  3LVV A;  3PVS A;  4REZ A;  3SYL A;  3AOE A;  2C5R A;  4CGY B;  4QNR A;  4LRS A;  1KFV A;  3WHK A;  4KLN A;  4D82 A;  2J7N A;  2UXB M;  1DGH B;  3KS4 A;  1N36 M;  1Q39 A;  4FWD A;  4JV5 M;  5FTN A;  3UGJ A;  2ZM6 M;  3FTC A;  4FCT A;  1Z5C A;  4HL4 A;  4NXM M;  1IXZ A;  3PFI A;  2BJV A;  4IBI A;  3GPU A;  4NRV A;  4MM3 B;  2CHG A;  2FFJ A;  3SFZ A;  2J7O A;  3ZCB B;  3MHV C;  2DWM A;  1NY5 A;  5KO3 A;  2ZAM A;  4IIW A;  2Y20 A;  3PXG A;  4CHT B;  4PDI A;  5EP3 A;  1VDD A;  2HCB A;  2Y21 A;  4LZZ A;  3GQ4 A;  4LZJ A;  1XNQ M;  3U6E A;  1TGU A;  4X65 M;  2CV0 A;  4MB7 A;  3HGI A;  4FVM A;  1Q3C A;  4M9S A;  1KSF X;  2RGH A;  4M9X A;  5ITQ A;  1HT2 E;  1N78 A;  1DO2 A;  2L7H A;  3FD9 A;  1XHB A;  4FD2 A;  1KYI A;  2C99 A;  4DV7 M;  3GRU A;  2CHV A;  2C96 A;  4L78 A;  3CF2 A;  3HWS A;  1PJI A;  2QBY A;  4BLC A;  1W5S A;  2G8L A;  3J81 S;  1GVN A;  3KOZ E;  2XEP A;  3AJI B;  1J7K A;  3KXE C;  1IN6 A;  4DV0 M;  1N33 M;  2L6O A;  2Q2E B;  4DR2 M;  4JI5 M;  3DOA A;  5GKN A;  2R65 A;  3A42 A;  2QP9 X;  4DUZ M;  4OVZ A;  1TH3 A;  3FUW A;  1JR3 D;  3KOW E;  4AKH A;  3IG5 A;  4X64 M;  4FW9 A;  3DFZ A;  1LV7 A;  2OPF A;  2V1C A;  3HU1 A;  1IM2 A;  3L25 A;  3GLG A;  4B3S M;  1HNZ M;  2DVW B;  2QCU A;  3KS8 A;  3LQR A;  5C1B A;  2G5G X;  2C9C A;  4DV4 M;  3U61 B;  2Y0T A;  3CF6 E;  4AQY M;  2F5N A;  1SXJ D;  2X4A A;  3WHL A;  4TUW A;  2C9O A;  1OJL A;  3NWL A;  3I51 A;  3GLH B;  4X66 M;  5ITT A;  4JN6 A;  3KW6 A;  1DGH A;  2A5Y B;  2Z7J A;  3SAU A;  2QZ4 A;  1N75 A;  2XSZ D;  3TWL A;  5A2Q S;  1MX0 A;  3L26 A;  4PCZ A;  4LG2 A;  4LFB M;  1NY6 A;  2RGO A;  3JAM S;  4S12 A;  5DYI A;  2QPA A;  1TDZ A;  4MGH A;  4I4L A;  3J7A S;  1QZM A;  4JI0 M;  3R9X B;  1D2N A;  3HHY A;  4OX9 M;  7CAT A;  4B7F A;  1IN4 A;  5FTL A;  3TL4 X;  2KZS A;  2EA0 A;  3SAR A;  5EXP A;  3LQQ A;  4MGK E;  4X62 M;  1IN7 A;  5BPV A;  1JR3 A;  2R46 A;  3HHW A;  1YE9 A;  1K3W A;  2KW0 A;  1SXJ B;  3AFH A;  4WW0 A;  3KSX A;  2CEA A;  1L2B A;  2VII A;  1FNN A;  1W5T A;  2NQ8 C;  2ZBK B;  4MH0 E;  1WXQ A;  4L16 A;  3U61 A;  4KOD A;  3VDU A;  4JI7 M;  2XGN A;  4JI6 M;  3RGS A;  2BJW A;  1HNW M;  3TWM A;  1NJF A;  1E9S A;  4ZPX A;  4AKG A;  3HKP A;  4QNM A;  4B3M M;  4RF1 A;  2W82 A;  4I81 A;  4B7G A;  1G4A E;  3THG A;  4DV5 M;  1JQJ C;  2R18 A;  4JI2 M;  2Z4R A;  2OQ4 A;  4LJ7 A;  1R2Z A;  1QAO A;  5FSW A;  3GPY A;  4D81 A;  2UUC M;  5E6J A;  1ZQ9 A;  4DUY M;  1G3I A;  4IJE A;  3EIH A;  2R4J A;  2YFQ A;  2XZF A;  3GQ3 A;  5FTK A;  5EQT A;  2Y0Q A;  5EJC A;  3LMM A;  3U60 B;  4GKK M;  1I4W A;  3HJ8 A;  3AL0 C;  1R2Y A;  1R6B X;  4LCB A;  3U6Q A;  2R62 A;  1PJJ A;  3U6S A;  4LF5 M;  1S3S A;  3E9S A;  2XFS A;  2UUA M;  1H6U A;  1NSF A;  3U6L A;  1L1T A;  3U60 A;  2F5Q A;  1R7R A;  4CIS A;  4DV1 M;  2I7P A;  1SXJ A;  5EXX A;  3VLF B;  5FTM A;  4G4N A;  2L09 A;  3FTD A;  3B9P A;  3KP1 E;  1G41 A;  1IBK M;  3TWK A;  4DR5 M;  2KZU A;  4DV3 M;  3RE8 A;  5IT9 S;  3FUX A;  5ITR A;  2QBY B;  3W0F A;  4GKJ M;  2LH0 A;  3GLG B;  2E5L M;  1IBL M;  5FTJ A;  4AG6 A;  4B3T M;  4OVZ B;  2XFT A;  3VKG A;  4IJF A;  3TE6 A;  4GHA A;  1NNJ A;  4GH9 A;  4GRI A;  2F5S A;  3HU3 A;  3VK7 A;  2F4V M;  3EIE A;  2HHH M;  4NXN M;  1HQY E;  3U6C A;  3ZH9 B;  5LMU M;  3SC3 A;  2I7N A;  1SXJ C;  4FCW A;  2FNA A;  5DNY A;  3UJN A;  4II7 A;  3FUT A;  1Z5A A;  4DV6 M;  1HR0 M;  4NSR A;  3K1J A;  1L2C A;  5EXS A;  4IBG A;  3JR4 A;  1NHW C;  3U6O A;  3H4M A;  4LGM A;  4NL4 H;  3DZD A;  4QHS A;  3GRR A;  3L29 A;  5KPZ A;  4MGI E;  2K47 A;  4MGZ E;  5LMN M;  3M6A A;  1QYR A;  1QAN A;  3KP0 E;  2LWX A;  3KDS E;  3KSJ A;  4LF4 M;  4IBF A;  4LJ6 A;  4DR1 M;  1XMQ M;  1G8P A;  5JI2 E;  2F5P A;  1TDH A;  1GL7 A;  3RGP A;  3GLI B;  1C1K A;  5ITX E;  5KQ8 A;  1Z6T A;  4R3D A;  4AZF A;  2D7E A;  5IZ7 D;  4PDG A;  2LNH C;  1XNR M;  4QHT A;  2M5Z A;  4WUR A;  4XGI A;  1EE8 A;  1I94 M;  1IXS B;  2VQE M;  2XLJ A;  3AV0 A;  3VDP A;  3R8F A;  2KRK A;  5FLX S;  2DWZ B;  4B3R M;  2R4E A;  4LFC M;  1OFH A;  3T1H M;  3J27 B;  2F5O A;  3BOS A;  1Q3B A;  4G4O A;  4LGY A;  5EP2 A;  4AKI A;  1T3T A;  1NNU C;  4JI3 M;  3C58 A;  4KHP M;  3U6P A;  1DGF A;  3GQ5 A;  3K8Z A;  4M9Z A;  3SMS A;  3SAW A;  1N77 A;  4OW0 A;  4GC9 A;  2ERC A;  3UK6 A;  3I4Y A;  3I4V A;  4DR7 M;  3U5Z A;  2CUZ A;  4YY3 M;  4DR6 M;  3HU2 A;  1GLN A;  4GC5 A;  3A46 A;  4OU7 A;  3GPP A;  2AHM A;  1IY0 A;  4IBC A;  3KOY E;  3JR5 A;  2FOI C;  4R7G A;  3W0L B;  1ZAE A;  4FWH A;  3VK8 A;  4I5S A;  1NHG C;  3J80 S;  2DHR A;  3IG8 A;  2CHQ A;  4EIW A;  4KO8 A;  4GIT A;  3SAS A;  3K92 A;  4D80 A;  1NJG A;  2ZAN A;  3AOE C;  3FYD A;  5IWA M;  4MGY E;  1IY2 A;  2DXI A;  3Q8X A;  4IBB A;  2HKJ A;  3GP1 A;  1N34 M;  3QWL A;  1QQW A;  1J5E M;  3M0E A;  1Z59 A;  3VKH A;  2M60 A;  5F3W A;  4RNA A;  2LXE A;  4LJ4 A;  2YQZ A;  5ITY A;  3SHG B;  4B08 A;  1MU5 A;  3UZU A;  3U6D A;  5BR8 M;  3TQS A;  1DGB A;  3FTE A;  4W5W A;  3HJQ A;  5ITX A;  2H1R A;  1IQP A;  4LJ5 A;  3MK6 A;  3GO8 A;  3FTF A;  4IBJ A;  4JYA M;  2CE7 A;  5H37 D;  2V6Z M;  1SXJ E;  4LF6 M;  5EP1 A;  4QOZ C;  4GIP A;  1NVM A;  4RF0 A;  4L8R C;  4QOS A;  3GRV A;  3KFU G;  1IY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...