4LFCM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfcM02
3GQ5A 1Q39A 5ITRA 5ITQA 4DR2M 1N32M 1Q3CA 3A46A 4DR3M 1R2YA 3J81S 4G4NA 1FJGM 1IBLM 2UXCM 3U6OA 3J7AS 4GKKM 5BR8M 2F5OA 4DV0M 1XMOM 1Z5AA 1L2BA 5LMNM 3GQ4A 4DV7M 2F5NA 4X66M 4JI0M 3SAWA 1XMQM 1J5EM 1XNRM 4LFBM 4G4OA 1I94M 1IBKM 2VQEM 1XC8A 2HHHM 4OX9M 3GPXA 3T1YM 3SATA 2ZBKB 4G4RA 5IT9S 4DV1M 4X65M 2XZUA 5ITXE 4DV6M 1IBMM 4LF4M 4DR6M 1N33M 4PCZA 4JI8M 3GPUA 1Q3BA 3U6CA 4NXNM 1L1TA 4DR7M 4LF8M 3GPYA 4YHHM 4DV3M 2F5SA 3SAUA 2UXBM 3JAMS 4B3TM 3VK7A 4PDGA 3VK8A 4X64M 1TDZA 4DR5M 4LFAM 1PM5A 4JI6M 4B3RM 1KFVA 2UXDM 3A45A 5FLXS 1L1ZA 1HR0M 2UUBM 1HNXM 1XNQM 4JI3M 5ITXA 1Z5CA 2UUAM 2VQFM 4GKJM 5A2QS 4B3MM 2UUCM 5ITYA 1MX0A 4JI5M 3U6PA 1K82A 3DOAA 4PD2A 2UU9M 4JI7M 5ITTA 4YY3M 1PJIA 3J80S 2F4VM 4JI2M 1HNZM 4JYAM 4CISA 1K3WA 2OQ4A 4DV4M 4G4QA 1PJJA 1N34M 1N36M 4JV5M 3TWKA 3GP1A 2XZFA 4ITQA 2F5PA 4NXMM 4LF6M 1HNWM 3A42A 4MB7A 3GO8A 3U6LA 4DV2M 5ITUA 4KHPM 1MU5A 2OPFA 3T1HM 2EA0A 4K0KM 3U6SA 3W0FA 5IWAM 4X62M 3SASA 1R2ZA 3SBJA 4JI1M 4LF5M 5LMUM 3GPPA 2HKJA 3SARA 4B3SM 1Z5BA 2F5QA 1L2CA 1L2DA 3U6QA 1K3XA 4LF7M 1NNJA 3U6DA 2E5LM 3C58A 1Z59A 3TWLA 4AQYM 4NRWA 4DV5M 2ZM6M 4DR1M 4PDIA 3JR4A 1TDHA 3SAVA 3U6MA 4JI4M 3OTOM 3TWMA 3JR5A 4DUYM 2Q2EB 1EE8A 4NRVA 4DUZM 4DR4M 4LFCM 3U6EA 4LF9M 3GQ3A
chains in the Genus database with same CATH superfamily
1QQWA 1GKIA 3TE6A 3GQ5A 5ITRA 3FE3A 1OTRA 3FYCA 4IIWA 4EIWA 4LJ6A 2K47A 1PRBA 2DZOB 4Z8XA 2J7NA 3KVWA 2K0BX 2RGHA 4AG6A 1OIZA 1TH2A 2R44A 3CF6E 3VDUA 3U5ZB 3E46A 2QBYA 4L15A 3VKHA 1E94E 1AUAA 4L78A 2F5OA 4GKKM 1XMOM 4LJAA 2ZANA 5EXPA 1L2BA 3HX3A 2APLA 3KP1E 2QCUA 4A3VB 5LMNM 3GQ4A 2L4EA 4L6V6 4D80A 5FTLA 3SAWA 4OU7A 1I94M 2VDBB 1JQJC 3M6AA 1XC8A 1WXQA 1TTEA 2CHVA 4L16A 4G6ZA 4AW4A 3U61B 5IT9S 4LJ8A 2DAEA 5EP3A 3SYKA 4QNMA 4FCWA 1N33M 3E4RA 3L29A 4MGYE 4NC6A 4PCZA 3AV0A 3RGSA 4B7GA 2KRKA 1GVNA 3UK6A 1Q3BA 1L1TA 1BVSA 3FKEA 3GRRA 1D2NA 1QAOA 1VEKA 4YHHM 2F5SA 2LVAA 3AOGA 4B3TM 1OIPA 4Z6YA 5KPTA 1IN7A 5C18A 1TDZA 2VF8A 2R62A 3J7BA 1PM5A 4B3RM 1E9RA 1ZQ9A 5DFLA 2DWMA 4RF0A 4B08A 3A45A 3KS4A 4BBAA 1D0LA 2QP9X 4CHTB 1HR0M 1RU3A 3KOWE 4R71A 5IZ7D 3GLGB 2KRUA 5ITXA 1Z5CA 3KOZE 2I7NA 2DAGA 2HWJA 4M9ZA 5ITYA 3QYEA 1MX0A 2LTUA 3QWLA 3GLHB 1PJTA 3U6PA 5E26A 1OJLA 2C98A 2UU9M 1DV0A 3K9OA 2W82A 3C9PA 4GMQA 2F4VM 1QAQA 3M7GA 2KNZA 3NBXX 2DHYA 1QUSA 4CISA 3B7NA 1VDDA 1PJJA 4G4QA 4GITA 4JV5M 3TWKA 3GP1A 4ITQA 1VEJA 3UJNA 2F5PA 1R4GA 1NV8A 3FUXA 5IREB 3MK6A 3A42A 3GO8A 3HWSA 4GIPA 1L8QA 1XWIA 3DA1A 3VFDA 2EJSA 2L6OA 4DV2M 2OPFA 4PT5A 4IJEA 3U6LA 4KHPM 1GL6A 4LCBA 4K0KM 5FTJA 2YFQA 3BBZA 4JN6A 3LMMA 5IWAM 5DNYA 4X62M 3R8FA 4JI1M 2HKJA 1V34A 2MH8A 5F3WA 3SARA 5EXSA 3GLFE 2O25A 4MM3B 3U6QA 4M0DA 2EUCA 2KZSA 1E32A 4QOZC 1QUTA 4AKGA 2MROB 3IG5A 3TWLA 4AQYM 4DR1M 1Q02A 2YNMD 2Y0QA 3GRYA 4LRSA 2XEPA 2BJWA 1YSYA 4PDIA 1PGYA 3C3EA 3U6MA 4JI4M 1IXRC 4RF1A 3OTOM 3QAUA 3FTCA 2C9CA 3NBIA 4IBCA 4B7HA 3I4VA 4LF9M 3GQ3A 5EJCA 1NO1A 4IBEA 3D8LA 3THGA 2J7OA 4GH9A 3LQRA 2LHGA 2JUJA 3L27A 3HHYA 4DR3M 2DAKA 3J81S 1IBLM 3SC3A 2XLJA 2UXCM 1LTMA 4IJFA 3J7AS 2N35A 4DV0M 1G59A 1I4WA 2JY7A 4LY6A 4LZJA 2F5NA 1NHWC 4JI0M 5FSWA 3FUTA 3K9PA 4G4OA 2XGNA 4GHLA 4GRIA 2HHHM 3T38A 3W0LB 3T1YM 3Q8GA 4F1IA 4G4RA 2MR9A 4X65M 2X4AA 5ITXE 1IBMM 2BWEA 1VEGA 1W5SA 3CF2A 3E9SA 5BPVA 2ERCA 1NJFA 4JXJA 3ILKA 3U6CA 3AOEA 1YE9A 2CEAA 1SG9A 2KW0A 3GLFA 3CGWA 1DGHA 2XSZA 3FUWA 3SAUA 2UXBM 2Z7JA 3VK8A 2QENA 4DR5M 3HHXA 3I04M 4LFAM 4OVZA 2CUZA 2XSZD 1QZMA 1NV9A 1SXJC 2R18A 2UXDM 4IBDA 1TF0B 2RGOA 4AZFA 5FLXS 1GLNA 4IBFA 3PXGA 2MJ5B 2LXEA 2CV1A 3T15A 3L26A 4AKIA 1XB2B 2Z3XA 4LG2A 3B7ZA 2X8AA 5A2QS 4GKJM 3FRHA 2UUCM 2DKLA 2ZAOA 4QHSA 2CE7A 3ZCBB 3DOAA 4HEOA 4PD2A 1NJGA 4REZA 1VDLA 1S3SA 4HL4A 4R7GA 2D7HA 2WSCF 4OW0A 2P5TA 4LZZA 1F4IA 1HNZM 4JYAM 4B7FA 1V92A 2KXEA 2WSFF 3IHPA 2DWNA 4DV4M 1N34M 1N36M 3VDPA 1C1KA 1UM8A 2XZFA 2CP8A 1QDRA 5E6JA 1OFIA 4LF6M 4NXMM 3MMPA 2GQFA 1ZV1A 2DZLA 3HKPA 1C7YA 3SYLA 3W67A 1AIPC 2QNJA 3PNYA 2K6BA 4FCTA 2QBYB 3FD9A 3U6SA 3W0FA 3KW6A 4LF5M 5DYGA 2G3QA 4B3SM 2V1UA 2KNAA 4FWHA 1Z5BA 1IN8A 4GC9A 2JZ1A 3FTEA 3J27B 1OFHA 2O01F 2OO9A 1GJSA 3H4MA 4I8OA 3VKGA 1GL7A 1IN6A 2BNKA 3U6DA 2CV0A 4LJ9A 2E5LM 3LCUA 3C58A 2FH0A 1Z59A 4D81A 4NRWA 4Q7JA 2C9OA 1QZEA 2M5ZA 3JR4A 1QAMA 2WSEF 4GC5A 2DWLA 2B3TA 1HQYE 2YQZA 2D7EA 3JR5A 3V76A 4NRVA 3ZC7B 3PFIA 2LNHC 3U6EA 3CTWB 3KOXE 4LFCM 2G5GX 5ITUA 3HU3A 1XXHA 7CATA 3BOSA 3B74A 2C99A 5JI2E 3E21A 3HZJA 4TUWA 1A5TA 1DGGA 1HQCA 1Q3CA 1YLAA 2CFOA 3HY5A 4IBJA 3A46A 2LHCA 2OOAA 4M0WA 1SXJD 4FWDA 5EQTA 2DAMA 3PVSA 5BR8M 2DVWB 2DI0A 3CF0A 2JXNA 1Z5AA 2LVQD 2VIIA 3EIEA 2NQ8C 2C5RA 1G41A 4DV7M 1N78A 2ZTCA 1J5EM 2DNAA 3SMSA 5C1BA 1OKSA 3DFZA 4IBKA 1NVMA 1IN5A 3GPXA 1E9SA 4D82A 1VQ1A 3KP0E 4FW9A 4OX9M 2CHQA 1IM2A 2ZBKB 3SATA 1HT1E 2XZUA 1WHCA 1DGFA 4BB9A 4S12A 4LF4M 3I51A 2DZNB 2R4JA 3W68A 3IECA 3SHFA 3WHLA 1N77A 2DAIA 2CV2A 1QDTA 3GPUA 4KO8A 3GLIE 5FTKA 3UGJA 3GPYA 4DV3M 4FWGA 2BWBA 3KS8A 5GKNA 3VK7A 2LVNC 2EKKA 1DGBA 1PJQA 3K92A 4BLCA 4X64M 5KQDA 2R45A 3GRVA 2XFSA 1ZMUA 4RNAA 4XGIA 4JI6M 3TL4X 4AI6A 2D7GA 1DO0A 2DWZB 4QHTA 1IY0A 1QYRA 2L2DA 4ZPXA 2L7IA 2LVPC 1HNXM 2DXIA 5JI3E 4IBGA 4JI3M 1XNQM 1GJTA 4MGHA 3ZH9B 2VQFM 2X49A 5DYIA 3HHZA 4B3MM 5FTMA 2JWSA 4LGYA 1R5LA 2QQ8A 2QHOB 4IBBA 1K82A 3U61A 4IBIA 5ITTA 3KFUG 2G8LA 4NOOB 1PJIA 4II7A 3J80S 2HCBA 1CUKA 2LBCA 2KA6B 5KPZA 1TH3A 2JA2A 2XF3A 1K3WA 4P17A 2OQ4A 3L2AA 3MHVC 5EXTA 1WIVA 3RFWA 4WW0A 1T3TA 3LVVA 3K2LA 1EIJA 1HNWM 1XXHE 4MB7A 1P3QQ 4FCVA 3HJQA 2GNOA 5KO3A 2OOBA 3A98B 1MU5A 3PNVA 1SXJE 5FTNA 4QNRA 2EA0A 2J5YA 4AKHA 5EXXA 4LRTA 3HGIA 1ZMWA 1MJGM 3SBJA 2Z8YM 1R2ZA 8CATA 3BXWA 2F5QA 1L2CA 2H5XA 3TQSA 4GEWA 1Y8GA 4MH0E 4FD2A 4L4UA 3GLGA 3GLIA 3DZDA 1TH4A 1NNJA 3UMMA 5KPRA 3LQQA 4DV5M 1ORYB 3VLFB 3GLHA 4G3OA 2Y21A 2JY6B 2C96A 1TDHA 3SAVA 3SMPA 2M60A 3T6PA 4DUYM 2FOIC 3TWMA 1T43A 2HL7A 2CRUA 1TGUA 2EKFA 3FUUA 4MGKE 2K9DA 2A5YB 3AFHA 1TR8A 3IG8A 4DUZM 4DR4M 1HT2E 1N75A 3B7QA 4I5SA 3RGPA 3F92A 1NY6A 1JR3E 4WURA 2BJVA 3KOYE 1Q39A 1J7KA 1QVRA 3C3DA 1NY5A 4UN2B 1DGHB 1IY2A 3L28A 3GLFB 5ITQA 2FNAA 4DR2M 2KNVA 3HU1A 4NSRA 1N32M 2H1RA 5EP4A 2FFJA 4CIZA 2L4FA 3D8BA 4L8RC 1R2YA 3ZQJA 1PJSA 4OVZB 4G4NA 1FJGM 1GO5A 1IXZA 3U60A 2DHRA 4KLNA 4RKUF 3FYDA 3AJIB 1ZAEA 3U6OA 4I4LA 2MGWA 3HJ8A 2HAKA 2FS1A 3B89A 3Q8XA 2R46A 1IN4A 1JB0F 1R6BX 1R7RA 4X66M 1J09A 1XMQM 1XNRM 1OQYA 4LFBM 4NL4H 1IBKM 2Z4SA 3TPZA 1NSFA 2KEBA 5KQ8A 2V6ZM 2VQEM 2R6FA 3HHWA 4LGMA 3QYBA 2JY5A 1NHGC 2L7HA 1WR1B 4DV1M 4I81A 4M9SA 3GLIB 1GABA 3FUVA 4DV6M 4DR6M 4W5WA 2R4EA 1VG5A 3I4YA 1NNUC 2FE8A 1D0MA 2QSFX 1V33A 1SXJA 1X37A 2XFTA 3J2PB 4ANRA 5EP1A 4CGYB 2LVOC 2Y0TA 4KT0F 3RE8A 2O5RA 4NXNM 4DR7M 4LF8M 4AG5A 1IY1A 3UZUA 2I7PA 2LWXA 3KSXA 3JAMS 2KHHA 1QANA 1EFUB 4PDGA 1IXSA 2R65A 2LH0A 2V1CA 2Y20A 2ZAMA 3B9PA 3HU2A 4LJ4A 4WP2A 1Z6TA 3HJSA 2QPAA 1KYIA 4M9XA 1KFVA 3MJ5A 3FTDA 1G3IA 1OAOC 1ZMVA 2RKOA 3NWLA 1G71A 1WGNA 3AOEC 4LJ5A 5EP2A 3AKZA 2KZUA 3K8ZA 1L1ZA 2UUBM 1WJ7A 3U60B 2EO2A 2CHGA 1G4AE 1MN3A 2Z4RA 3LW5F 1H6UA 2CWBA 4QOSA 2UUAM 1JR3A 2JZ0A 4R3DA 3M0EA 3KSJA 2VF7A 4JI5M 3L25A 3KDSE 3KXEC 4KODA 2KDLA 3AL0C 3GLGE 4JI7M 2YR0A 1JR3D 2XH9A 4YY3M 3WHKA 3R9XB 1T6OA 4CJ6A 4JI2M 3GLHE 5H37D 4P16A 4NSOB 3K1JA 1XXHB 1KSFX 3SHGB 4JI8M 1D0KA 1G8PA 3EIHA 3U5ZA 1IQPA 1HJPA 1SXJB 1IFYA 4XK8F 4XBOA 1UFZA 4MGZE 1DO2A 1YUBA 2R0IA 4GHAA 3T1HM 2RRUA 2L09A 2JY8A 2JNHA 3SASA 1IXSB 2QZ4A 1WGLA 5LMUM 3LVWA 1OAIA 3GPPA 1FNNA 2AHMA 2JP7A 4HLQA 4LJ7A 3I01M 3H4JA 1L2DA 1K3XA 4LF7M 4FVMA 1XHBA 4DBGB 2ZTDA 2DENA 3FRIA 3LCVB 2ZM6M 5L8RF 3GRUA 1W5TA 2Q2EB 1EE8A 4Y28F 4F2LA 4MGIE 2WZJA 1LV7A 3SFZA 3FTFA
chains in the Genus database with same CATH topology
1QQWA 1GKIA 3TE6A 3GQ5A 5ITRA 3FYCA 4EIWA 4IIWA 4LJ6A 2K47A 4Z8XA 2DZOB 2J7NA 3KVWA 2RGHA 4AG6A 1TH2A 3CF6E 3VDUA 3U5ZB 2QBYA 4L15A 3VKHA 1E94E 4L78A 2F5OA 4GKKM 1XMOM 4LJAA 2ZANA 5EXPA 1L2BA 3KP1E 2QCUA 4A3VB 5LMNM 3GQ4A 4D80A 5FTLA 3SAWA 4OU7A 1I94M 1JQJC 3M6AA 1XC8A 1WXQA 2CHVA 4L16A 4G6ZA 4AW4A 3U61B 5IT9S 4LJ8A 5EP3A 3SYKA 4QNMA 4FCWA 1N33M 3E4RA 3L29A 4MGYE 4PCZA 3AV0A 3RGSA 4B7GA 2KRKA 1GVNA 3UK6A 1Q3BA 1L1TA 3FKEA 3GRRA 1D2NA 1QAOA 4YHHM 2F5SA 3AOGA 4B3TM 4Z6YA 5KPTA 1IN7A 5C18A 1TDZA 2R62A 3J7BA 1PM5A 4B3RM 1E9RA 1ZQ9A 2DWMA 4RF0A 4B08A 3A45A 3KS4A 4BBAA 2QP9X 4CHTB 1HR0M 3KOWE 5IZ7D 3GLGB 2KRUA 5ITXA 1Z5CA 3KOZE 2I7NA 4M9ZA 5ITYA 1MX0A 3QWLA 3GLHB 3U6PA 5E26A 1OJLA 2C98A 2UU9M 2W82A 4GMQA 2F4VM 1QAQA 3M7GA 4CISA 1VDDA 1PJJA 4G4QA 4GITA 4JV5M 3TWKA 3GP1A 4ITQA 3UJNA 2F5PA 5IREB 3FUXA 3MK6A 3A42A 3GO8A 3HWSA 4GIPA 1L8QA 1XWIA 3DA1A 3VFDA 4DV2M 2L6OA 3U6LA 2OPFA 4PT5A 4IJEA 4KHPM 1GL6A 4LCBA 4K0KM 5FTJA 2YFQA 4JN6A 5IWAM 3LMMA 5DNYA 4X62M 3R8FA 4JI1M 2HKJA 3SARA 5F3WA 5EXSA 4MM3B 3U6QA 4M0DA 2EUCA 2KZSA 1E32A 4QOZC 4AKGA 3IG5A 3TWLA 4AQYM 4DR1M 2YNMD 3GRYA 2Y0QA 4LRSA 4PDIA 2XEPA 2BJWA 1YSYA 3U6MA 4JI4M 1IXRC 4RF1A 3OTOM 3QAUA 3FTCA 2C9CA 3NBIA 4IBCA 4B7HA 3I4VA 4LF9M 3GQ3A 5EJCA 4IBEA 3D8LA 3THGA 2J7OA 4GH9A 3LQRA 3L27A 3HHYA 4DR3M 3J81S 1IBLM 3SC3A 2XLJA 2UXCM 4IJFA 3J7AS 4DV0M 1G59A 1I4WA 4LY6A 4LZJA 2F5NA 1NHWC 4JI0M 5FSWA 3FUTA 4G4OA 2XGNA 4GHLA 4GRIA 2HHHM 3T38A 3W0LB 3T1YM 4G4RA 4X65M 2X4AA 5ITXE 1IBMM 1W5SA 3CF2A 3E9SA 5BPVA 2ERCA 1NJFA 4JXJA 3ILKA 3U6CA 3AOEA 1YE9A 2CEAA 2KW0A 3GLFA 3FUWA 1DGHA 2XSZA 3SAUA 2UXBM 2Z7JA 3VK8A 2QENA 4DR5M 3HHXA 4LFAM 4OVZA 2CUZA 2XSZD 1QZMA 1SXJC 2R18A 2UXDM 4IBDA 2RGOA 4AZFA 5FLXS 1GLNA 4IBFA 3PXGA 2LXEA 2CV1A 3T15A 3L26A 4AKIA 4LG2A 2Z3XA 2X8AA 5A2QS 4GKJM 2UUCM 2ZAOA 4QHSA 3ZCBB 2CE7A 3DOAA 4PD2A 1NJGA 4REZA 1S3SA 4HL4A 4R7GA 2D7HA 4OW0A 2P5TA 4LZZA 1HNZM 4JYAM 4B7FA 2KXEA 2DWNA 4DV4M 1N34M 1N36M 3VDPA 1C1KA 1UM8A 2XZFA 5E6JA 4NXMM 1OFIA 4LF6M 3HKPA 3SYLA 3PNYA 4FCTA 2QBYB 3FD9A 3U6SA 3W0FA 3KW6A 4LF5M 5DYGA 4B3SM 2V1UA 4FWHA 1Z5BA 1IN8A 4GC9A 3FTEA 3J27B 1OFHA 3H4MA 4I8OA 3VKGA 1GL7A 1IN6A 2BNKA 3U6DA 2CV0A 4LJ9A 2E5LM 3C58A 1Z59A 4D81A 4NRWA 2C9OA 2M5ZA 3JR4A 1QAMA 4GC5A 2DWLA 1HQYE 2YQZA 2D7EA 3JR5A 4NRVA 3ZC7B 3PFIA 2LNHC 3U6EA 3CTWB 3KOXE 4LFCM 2G5GX 5ITUA 3HU3A 1XXHA 7CATA 3BOSA 2C99A 5JI2E 4TUWA 1DGGA 1HQCA 1Q3CA 2CFOA 4IBJA 3A46A 4M0WA 1SXJD 4FWDA 5EQTA 3PVSA 5BR8M 2DVWB 3CF0A 2C5RA 2VIIA 1Z5AA 3EIEA 2NQ8C 1G41A 4DV7M 1N78A 1J5EM 3SMSA 5C1BA 3DFZA 4IBKA 1NVMA 1IN5A 3GPXA 1E9SA 4D82A 4FW9A 3KP0E 4OX9M 2CHQA 1IM2A 2ZBKB 3SATA 1HT1E 2XZUA 1DGFA 4BB9A 4S12A 4LF4M 3I51A 2DZNB 2R4JA 3SHFA 3WHLA 1N77A 2CV2A 3GPUA 4KO8A 5FTKA 3UGJA 3GPYA 4DV3M 4FWGA 3KS8A 5GKNA 3VK7A 4X64M 1DGBA 3K92A 4BLCA 5KQDA 2R45A 3GRVA 2XFSA 4RNAA 4XGIA 4JI6M 3TL4X 4AI6A 2D7GA 1DO0A 2DWZB 4QHTA 1IY0A 1QYRA 4ZPXA 2L7IA 1HNXM 2DXIA 1XNQM 5JI3E 4IBGA 4JI3M 4MGHA 3ZH9B 2VQFM 2X49A 5DYIA 3HHZA 4B3MM 5FTMA 4LGYA 4IBBA 1K82A 3U61A 4IBIA 5ITTA 3KFUG 2G8LA 4NOOB 1PJIA 4II7A 3J80S 2HCBA 5KPZA 2KA6B 1TH3A 2JA2A 2XF3A 1K3WA 2OQ4A 3L2AA 3MHVC 5EXTA 3RFWA 4WW0A 1T3TA 3LVVA 3K2LA 1HNWM 4MB7A 4FCVA 3HJQA 5KO3A 3A98B 1MU5A 3PNVA 1SXJE 5FTNA 4QNRA 2EA0A 4AKHA 5EXXA 4LRTA 3HGIA 1R2ZA 3SBJA 8CATA 2F5QA 1L2CA 3TQSA 3GLGA 4MH0E 4FD2A 4L4UA 3GLIA 1NNJA 3DZDA 1TH4A 3UMMA 5KPRA 3LQQA 4DV5M 1ORYB 3VLFB 3GLHA 2Y21A 2C96A 1TDHA 3SAVA 3SMPA 2M60A 3TWMA 4DUYM 2FOIC 2HL7A 3FUUA 1TGUA 4MGKE 2A5YB 3AFHA 3IG8A 4DUZM 4DR4M 1HT2E 1N75A 4I5SA 3RGPA 1NY6A 4WURA 2BJVA 3KOYE 1Q39A 1J7KA 1QVRA 3GLFB 1NY5A 1DGHB 1IY2A 3L28A 5ITQA 2FNAA 4DR2M 3HU1A 4NSRA 1N32M 2H1RA 5EP4A 2FFJA 4L8RC 3D8BA 1R2YA 4OVZB 4G4NA 1FJGM 1IXZA 3U60A 2DHRA 4KLNA 3U6OA 3FYDA 3AJIB 1ZAEA 4I4LA 3HJ8A 3Q8XA 2R46A 1IN4A 1R6BX 1R7RA 4X66M 1J09A 1XMQM 1XNRM 4LFBM 4NL4H 1IBKM 2Z4SA 3TPZA 1NSFA 2KEBA 5KQ8A 2V6ZM 2VQEM 4LGMA 3HHWA 1NHGC 2L7HA 4DV1M 4I81A 4M9SA 3GLIB 3FUVA 4DV6M 4DR6M 4W5WA 2R4EA 3I4YA 1NNUC 2FE8A 4JI8M 1SXJA 1X37A 2XFTA 3J2PB 4CGYB 5EP1A 2Y0TA 3RE8A 2O5RA 4NXNM 4DR7M 4LF8M 4AG5A 1IY1A 3UZUA 2I7PA 2LWXA 3KSXA 3JAMS 1QANA 4PDGA 2V1CA 2R65A 2LH0A 2Y20A 2ZAMA 3B9PA 4LJ4A 3HU2A 1Z6TA 3HJSA 2QPAA 1KYIA 4M9XA 1KFVA 3MJ5A 3FTDA 1G3IA 2RKOA 3NWLA 5EP2A 4LJ5A 3AOEC 3AKZA 2KZUA 3K8ZA 1L1ZA 2UUBM 3U60B 2EO2A 2CHGA 1G4AE 2Z4RA 1H6UA 4QOSA 2UUAM 1JR3A 4R3DA 3M0EA 3KSJA 4JI5M 3L25A 3KDSE 3KXEC 4KODA 3AL0C 4JI7M 2YR0A 1JR3D 2XH9A 4YY3M 3WHKA 3R9XB 4JI2M 5H37D 4P16A 4NSOB 3K1JA 1XXHB 1KSFX 3SHGB 1G8PA 3EIHA 3U5ZA 1IQPA 1SXJB 4XBOA 4MGZE 1DO2A 1YUBA 4GHAA 3T1HM 2L09A 3SASA 1IXSB 2QZ4A 5LMUM 3LVWA 3GPPA 1FNNA 2AHMA 4HLQA 4LJ7A 1L2DA 1K3XA 4LF7M 4FVMA 1XHBA 2ZM6M 3GRUA 1W5TA 2Q2EB 1EE8A 4MGIE 1LV7A 3SFZA 3FTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ5 A;  1Q39 A;  5ITR A;  5ITQ A;  4DR2 M;  1N32 M;  1Q3C A;  3A46 A;  4DR3 M;  1R2Y A;  3J81 S;  4G4N A;  1FJG M;  1IBL M;  2UXC M;  3U6O A;  3J7A S;  4GKK M;  5BR8 M;  2F5O A;  4DV0 M;  1XMO M;  1Z5A A;  1L2B A;  5LMN M;  3GQ4 A;  4DV7 M;  2F5N A;  4X66 M;  4JI0 M;  3SAW A;  1XMQ M;  1J5E M;  1XNR M;  4LFB M;  4G4O A;  1I94 M;  1IBK M;  2VQE M;  1XC8 A;  2HHH M;  4OX9 M;  3GPX A;  3T1Y M;  3SAT A;  2ZBK B;  4G4R A;  5IT9 S;  4DV1 M;  4X65 M;  2XZU A;  5ITX E;  4DV6 M;  1IBM M;  4LF4 M;  4DR6 M;  1N33 M;  4PCZ A;  4JI8 M;  3GPU A;  1Q3B A;  3U6C A;  4NXN M;  1L1T A;  4DR7 M;  4LF8 M;  3GPY A;  4YHH M;  4DV3 M;  2F5S A;  3SAU A;  2UXB M;  3JAM S;  4B3T M;  3VK7 A;  4PDG A;  3VK8 A;  4X64 M;  1TDZ A;  4DR5 M;  4LFA M;  1PM5 A;  4JI6 M;  4B3R M;  1KFV A;  2UXD M;  3A45 A;  5FLX S;  1L1Z A;  1HR0 M;  2UUB M;  1HNX M;  1XNQ M;  4JI3 M;  5ITX A;  1Z5C A;  2UUA M;  2VQF M;  4GKJ M;  5A2Q S;  4B3M M;  2UUC M;  5ITY A;  1MX0 A;  4JI5 M;  3U6P A;  1K82 A;  3DOA A;  4PD2 A;  2UU9 M;  4JI7 M;  5ITT A;  4YY3 M;  1PJI A;  3J80 S;  2F4V M;  4JI2 M;  1HNZ M;  4JYA M;  4CIS A;  1K3W A;  2OQ4 A;  4DV4 M;  4G4Q A;  1PJJ A;  1N34 M;  1N36 M;  4JV5 M;  3TWK A;  3GP1 A;  2XZF A;  4ITQ A;  2F5P A;  4NXM M;  4LF6 M;  1HNW M;  3A42 A;  4MB7 A;  3GO8 A;  3U6L A;  4DV2 M;  5ITU A;  4KHP M;  1MU5 A;  2OPF A;  3T1H M;  2EA0 A;  4K0K M;  3U6S A;  3W0F A;  5IWA M;  4X62 M;  3SAS A;  1R2Z A;  3SBJ A;  4JI1 M;  4LF5 M;  5LMU M;  3GPP A;  2HKJ A;  3SAR A;  4B3S M;  1Z5B A;  2F5Q A;  1L2C A;  1L2D A;  3U6Q A;  1K3X A;  4LF7 M;  1NNJ A;  3U6D A;  2E5L M;  3C58 A;  1Z59 A;  3TWL A;  4AQY M;  4NRW A;  4DV5 M;  2ZM6 M;  4DR1 M;  4PDI A;  3JR4 A;  1TDH A;  3SAV A;  3U6M A;  4JI4 M;  3OTO M;  3TWM A;  3JR5 A;  4DUY M;  2Q2E B;  1EE8 A;  4NRV A;  4DUZ M;  4DR4 M;  4LFC M;  3U6E A;  4LF9 M;  3GQ3 A; 
#chains in the Genus database with same CATH topology
 1QQW A;  1GKI A;  3TE6 A;  3GQ5 A;  5ITR A;  3FE3 A;  1OTR A;  3FYC A;  4IIW A;  4EIW A;  4LJ6 A;  2K47 A;  1PRB A;  2DZO B;  4Z8X A;  2J7N A;  3KVW A;  2K0B X;  2RGH A;  4AG6 A;  1OIZ A;  1TH2 A;  2R44 A;  3CF6 E;  3VDU A;  3U5Z B;  3E46 A;  2QBY A;  4L15 A;  3VKH A;  1E94 E;  1AUA A;  4L78 A;  2F5O A;  4GKK M;  1XMO M;  4LJA A;  2ZAN A;  5EXP A;  1L2B A;  3HX3 A;  2APL A;  3KP1 E;  2QCU A;  4A3V B;  5LMN M;  3GQ4 A;  2L4E A;  4L6V 6;  4D80 A;  5FTL A;  3SAW A;  4OU7 A;  1I94 M;  2VDB B;  1JQJ C;  3M6A A;  1XC8 A;  1WXQ A;  1TTE A;  2CHV A;  4L16 A;  4G6Z A;  4AW4 A;  3U61 B;  5IT9 S;  4LJ8 A;  2DAE A;  5EP3 A;  3SYK A;  4QNM A;  4FCW A;  1N33 M;  3E4R A;  3L29 A;  4MGY E;  4NC6 A;  4PCZ A;  3AV0 A;  3RGS A;  4B7G A;  2KRK A;  1GVN A;  3UK6 A;  1Q3B A;  1L1T A;  1BVS A;  3FKE A;  3GRR A;  1D2N A;  1QAO A;  1VEK A;  4YHH M;  2F5S A;  2LVA A;  3AOG A;  4B3T M;  1OIP A;  4Z6Y A;  5KPT A;  1IN7 A;  5C18 A;  1TDZ A;  2VF8 A;  2R62 A;  3J7B A;  1PM5 A;  4B3R M;  1E9R A;  1ZQ9 A;  5DFL A;  2DWM A;  4RF0 A;  4B08 A;  3A45 A;  3KS4 A;  4BBA A;  1D0L A;  2QP9 X;  4CHT B;  1HR0 M;  1RU3 A;  3KOW E;  4R71 A;  5IZ7 D;  3GLG B;  2KRU A;  5ITX A;  1Z5C A;  3KOZ E;  2I7N A;  2DAG A;  2HWJ A;  4M9Z A;  5ITY A;  3QYE A;  1MX0 A;  2LTU A;  3QWL A;  3GLH B;  1PJT A;  3U6P A;  5E26 A;  1OJL A;  2C98 A;  2UU9 M;  1DV0 A;  3K9O A;  2W82 A;  3C9P A;  4GMQ A;  2F4V M;  1QAQ A;  3M7G A;  2KNZ A;  3NBX X;  2DHY A;  1QUS A;  4CIS A;  3B7N A;  1VDD A;  1PJJ A;  4G4Q A;  4GIT A;  4JV5 M;  3TWK A;  3GP1 A;  4ITQ A;  1VEJ A;  3UJN A;  2F5P A;  1R4G A;  1NV8 A;  3FUX A;  5IRE B;  3MK6 A;  3A42 A;  3GO8 A;  3HWS A;  4GIP A;  1L8Q A;  1XWI A;  3DA1 A;  3VFD A;  2EJS A;  2L6O A;  4DV2 M;  2OPF A;  4PT5 A;  4IJE A;  3U6L A;  4KHP M;  1GL6 A;  4LCB A;  4K0K M;  5FTJ A;  2YFQ A;  3BBZ A;  4JN6 A;  3LMM A;  5IWA M;  5DNY A;  4X62 M;  3R8F A;  4JI1 M;  2HKJ A;  1V34 A;  2MH8 A;  5F3W A;  3SAR A;  5EXS A;  3GLF E;  2O25 A;  4MM3 B;  3U6Q A;  4M0D A;  2EUC A;  2KZS A;  1E32 A;  4QOZ C;  1QUT A;  4AKG A;  2MRO B;  3IG5 A;  3TWL A;  4AQY M;  4DR1 M;  1Q02 A;  2YNM D;  2Y0Q A;  3GRY A;  4LRS A;  2XEP A;  2BJW A;  1YSY A;  4PDI A;  1PGY A;  3C3E A;  3U6M A;  4JI4 M;  1IXR C;  4RF1 A;  3OTO M;  3QAU A;  3FTC A;  2C9C A;  3NBI A;  4IBC A;  4B7H A;  3I4V A;  4LF9 M;  3GQ3 A;  5EJC A;  1NO1 A;  4IBE A;  3D8L A;  3THG A;  2J7O A;  4GH9 A;  3LQR A;  2LHG A;  2JUJ A;  3L27 A;  3HHY A;  4DR3 M;  2DAK A;  3J81 S;  1IBL M;  3SC3 A;  2XLJ A;  2UXC M;  1LTM A;  4IJF A;  3J7A S;  2N35 A;  4DV0 M;  1G59 A;  1I4W A;  2JY7 A;  4LY6 A;  4LZJ A;  2F5N A;  1NHW C;  4JI0 M;  5FSW A;  3FUT A;  3K9P A;  4G4O A;  2XGN A;  4GHL A;  4GRI A;  2HHH M;  3T38 A;  3W0L B;  3T1Y M;  3Q8G A;  4F1I A;  4G4R A;  2MR9 A;  4X65 M;  2X4A A;  5ITX E;  1IBM M;  2BWE A;  1VEG A;  1W5S A;  3CF2 A;  3E9S A;  5BPV A;  2ERC A;  1NJF A;  4JXJ A;  3ILK A;  3U6C A;  3AOE A;  1YE9 A;  2CEA A;  1SG9 A;  2KW0 A;  3GLF A;  3CGW A;  1DGH A;  2XSZ A;  3FUW A;  3SAU A;  2UXB M;  2Z7J A;  3VK8 A;  2QEN A;  4DR5 M;  3HHX A;  3I04 M;  4LFA M;  4OVZ A;  2CUZ A;  2XSZ D;  1QZM A;  1NV9 A;  1SXJ C;  2R18 A;  2UXD M;  4IBD A;  1TF0 B;  2RGO A;  4AZF A;  5FLX S;  1GLN A;  4IBF A;  3PXG A;  2MJ5 B;  2LXE A;  2CV1 A;  3T15 A;  3L26 A;  4AKI A;  1XB2 B;  2Z3X A;  4LG2 A;  3B7Z A;  2X8A A;  5A2Q S;  4GKJ M;  3FRH A;  2UUC M;  2DKL A;  2ZAO A;  4QHS A;  2CE7 A;  3ZCB B;  3DOA A;  4HEO A;  4PD2 A;  1NJG A;  4REZ A;  1VDL A;  1S3S A;  4HL4 A;  4R7G A;  2D7H A;  2WSC F;  4OW0 A;  2P5T A;  4LZZ A;  1F4I A;  1HNZ M;  4JYA M;  4B7F A;  1V92 A;  2KXE A;  2WSF F;  3IHP A;  2DWN A;  4DV4 M;  1N34 M;  1N36 M;  3VDP A;  1C1K A;  1UM8 A;  2XZF A;  2CP8 A;  1QDR A;  5E6J A;  1OFI A;  4LF6 M;  4NXM M;  3MMP A;  2GQF A;  1ZV1 A;  2DZL A;  3HKP A;  1C7Y A;  3SYL A;  3W67 A;  1AIP C;  2QNJ A;  3PNY A;  2K6B A;  4FCT A;  2QBY B;  3FD9 A;  3U6S A;  3W0F A;  3KW6 A;  4LF5 M;  5DYG A;  2G3Q A;  4B3S M;  2V1U A;  2KNA A;  4FWH A;  1Z5B A;  1IN8 A;  4GC9 A;  2JZ1 A;  3FTE A;  3J27 B;  1OFH A;  2O01 F;  2OO9 A;  1GJS A;  3H4M A;  4I8O A;  3VKG A;  1GL7 A;  1IN6 A;  2BNK A;  3U6D A;  2CV0 A;  4LJ9 A;  2E5L M;  3LCU A;  3C58 A;  2FH0 A;  1Z59 A;  4D81 A;  4NRW A;  4Q7J A;  2C9O A;  1QZE A;  2M5Z A;  3JR4 A;  1QAM A;  2WSE F;  4GC5 A;  2DWL A;  2B3T A;  1HQY E;  2YQZ A;  2D7E A;  3JR5 A;  3V76 A;  4NRV A;  3ZC7 B;  3PFI A;  2LNH C;  3U6E A;  3CTW B;  3KOX E;  4LFC M;  2G5G X;  5ITU A;  3HU3 A;  1XXH A;  7CAT A;  3BOS A;  3B74 A;  2C99 A;  5JI2 E;  3E21 A;  3HZJ A;  4TUW A;  1A5T A;  1DGG A;  1HQC A;  1Q3C A;  1YLA A;  2CFO A;  3HY5 A;  4IBJ A;  3A46 A;  2LHC A;  2OOA A;  4M0W A;  1SXJ D;  4FWD A;  5EQT A;  2DAM A;  3PVS A;  5BR8 M;  2DVW B;  2DI0 A;  3CF0 A;  2JXN A;  1Z5A A;  2LVQ D;  2VII A;  3EIE A;  2NQ8 C;  2C5R A;  1G41 A;  4DV7 M;  1N78 A;  2ZTC A;  1J5E M;  2DNA A;  3SMS A;  5C1B A;  1OKS A;  3DFZ A;  4IBK A;  1NVM A;  1IN5 A;  3GPX A;  1E9S A;  4D82 A;  1VQ1 A;  3KP0 E;  4FW9 A;  4OX9 M;  2CHQ A;  1IM2 A;  2ZBK B;  3SAT A;  1HT1 E;  2XZU A;  1WHC A;  1DGF A;  4BB9 A;  4S12 A;  4LF4 M;  3I51 A;  2DZN B;  2R4J A;  3W68 A;  3IEC A;  3SHF A;  3WHL A;  1N77 A;  2DAI A;  2CV2 A;  1QDT A;  3GPU A;  4KO8 A;  3GLI E;  5FTK A;  3UGJ A;  3GPY A;  4DV3 M;  4FWG A;  2BWB A;  3KS8 A;  5GKN A;  3VK7 A;  2LVN C;  2EKK A;  1DGB A;  1PJQ A;  3K92 A;  4BLC A;  4X64 M;  5KQD A;  2R45 A;  3GRV A;  2XFS A;  1ZMU A;  4RNA A;  4XGI A;  4JI6 M;  3TL4 X;  4AI6 A;  2D7G A;  1DO0 A;  2DWZ B;  4QHT A;  1IY0 A;  1QYR A;  2L2D A;  4ZPX A;  2L7I A;  2LVP C;  1HNX M;  2DXI A;  5JI3 E;  4IBG A;  4JI3 M;  1XNQ M;  1GJT A;  4MGH A;  3ZH9 B;  2VQF M;  2X49 A;  5DYI A;  3HHZ A;  4B3M M;  5FTM A;  2JWS A;  4LGY A;  1R5L A;  2QQ8 A;  2QHO B;  4IBB A;  1K82 A;  3U61 A;  4IBI A;  5ITT A;  3KFU G;  2G8L A;  4NOO B;  1PJI A;  4II7 A;  3J80 S;  2HCB A;  1CUK A;  2LBC A;  2KA6 B;  5KPZ A;  1TH3 A;  2JA2 A;  2XF3 A;  1K3W A;  4P17 A;  2OQ4 A;  3L2A A;  3MHV C;  5EXT A;  1WIV A;  3RFW A;  4WW0 A;  1T3T A;  3LVV A;  3K2L A;  1EIJ A;  1HNW M;  1XXH E;  4MB7 A;  1P3Q Q;  4FCV A;  3HJQ A;  2GNO A;  5KO3 A;  2OOB A;  3A98 B;  1MU5 A;  3PNV A;  1SXJ E;  5FTN A;  4QNR A;  2EA0 A;  2J5Y A;  4AKH A;  5EXX A;  4LRT A;  3HGI A;  1ZMW A;  1MJG M;  3SBJ A;  2Z8Y M;  1R2Z A;  8CAT A;  3BXW A;  2F5Q A;  1L2C A;  2H5X A;  3TQS A;  4GEW A;  1Y8G A;  4MH0 E;  4FD2 A;  4L4U A;  3GLG A;  3GLI A;  3DZD A;  1TH4 A;  1NNJ A;  3UMM A;  5KPR A;  3LQQ A;  4DV5 M;  1ORY B;  3VLF B;  3GLH A;  4G3O A;  2Y21 A;  2JY6 B;  2C96 A;  1TDH A;  3SAV A;  3SMP A;  2M60 A;  3T6P A;  4DUY M;  2FOI C;  3TWM A;  1T43 A;  2HL7 A;  2CRU A;  1TGU A;  2EKF A;  3FUU A;  4MGK E;  2K9D A;  2A5Y B;  3AFH A;  1TR8 A;  3IG8 A;  4DUZ M;  4DR4 M;  1HT2 E;  1N75 A;  3B7Q A;  4I5S A;  3RGP A;  3F92 A;  1NY6 A;  1JR3 E;  4WUR A;  2BJV A;  3KOY E;  1Q39 A;  1J7K A;  1QVR A;  3C3D A;  1NY5 A;  4UN2 B;  1DGH B;  1IY2 A;  3L28 A;  3GLF B;  5ITQ A;  2FNA A;  4DR2 M;  2KNV A;  3HU1 A;  4NSR A;  1N32 M;  2H1R A;  5EP4 A;  2FFJ A;  4CIZ A;  2L4F A;  3D8B A;  4L8R C;  1R2Y A;  3ZQJ A;  1PJS A;  4OVZ B;  4G4N A;  1FJG M;  1GO5 A;  1IXZ A;  3U60 A;  2DHR A;  4KLN A;  4RKU F;  3FYD A;  3AJI B;  1ZAE A;  3U6O A;  4I4L A;  2MGW A;  3HJ8 A;  2HAK A;  2FS1 A;  3B89 A;  3Q8X A;  2R46 A;  1IN4 A;  1JB0 F;  1R6B X;  1R7R A;  4X66 M;  1J09 A;  1XMQ M;  1XNR M;  1OQY A;  4LFB M;  4NL4 H;  1IBK M;  2Z4S A;  3TPZ A;  1NSF A;  2KEB A;  5KQ8 A;  2V6Z M;  2VQE M;  2R6F A;  3HHW A;  4LGM A;  3QYB A;  2JY5 A;  1NHG C;  2L7H A;  1WR1 B;  4DV1 M;  4I81 A;  4M9S A;  3GLI B;  1GAB A;  3FUV A;  4DV6 M;  4DR6 M;  4W5W A;  2R4E A;  1VG5 A;  3I4Y A;  1NNU C;  2FE8 A;  1D0M A;  2QSF X;  1V33 A;  1SXJ A;  1X37 A;  2XFT A;  3J2P B;  4ANR A;  5EP1 A;  4CGY B;  2LVO C;  2Y0T A;  4KT0 F;  3RE8 A;  2O5R A;  4NXN M;  4DR7 M;  4LF8 M;  4AG5 A;  1IY1 A;  3UZU A;  2I7P A;  2LWX A;  3KSX A;  3JAM S;  2KHH A;  1QAN A;  1EFU B;  4PDG A;  1IXS A;  2R65 A;  2LH0 A;  2V1C A;  2Y20 A;  2ZAM A;  3B9P A;  3HU2 A;  4LJ4 A;  4WP2 A;  1Z6T A;  3HJS A;  2QPA A;  1KYI A;  4M9X A;  1KFV A;  3MJ5 A;  3FTD A;  1G3I A;  1OAO C;  1ZMV A;  2RKO A;  3NWL A;  1G71 A;  1WGN A;  3AOE C;  4LJ5 A;  5EP2 A;  3AKZ A;  2KZU A;  3K8Z A;  1L1Z A;  2UUB M;  1WJ7 A;  3U60 B;  2EO2 A;  2CHG A;  1G4A E;  1MN3 A;  2Z4R A;  3LW5 F;  1H6U A;  2CWB A;  4QOS A;  2UUA M;  1JR3 A;  2JZ0 A;  4R3D A;  3M0E A;  3KSJ A;  2VF7 A;  4JI5 M;  3L25 A;  3KDS E;  3KXE C;  4KOD A;  2KDL A;  3AL0 C;  3GLG E;  4JI7 M;  2YR0 A;  1JR3 D;  2XH9 A;  4YY3 M;  3WHK A;  3R9X B;  1T6O A;  4CJ6 A;  4JI2 M;  3GLH E;  5H37 D;  4P16 A;  4NSO B;  3K1J A;  1XXH B;  1KSF X;  3SHG B;  4JI8 M;  1D0K A;  1G8P A;  3EIH A;  3U5Z A;  1IQP A;  1HJP A;  1SXJ B;  1IFY A;  4XK8 F;  4XBO A;  1UFZ A;  4MGZ E;  1DO2 A;  1YUB A;  2R0I A;  4GHA A;  3T1H M;  2RRU A;  2L09 A;  2JY8 A;  2JNH A;  3SAS A;  1IXS B;  2QZ4 A;  1WGL A;  5LMU M;  3LVW A;  1OAI A;  3GPP A;  1FNN A;  2AHM A;  2JP7 A;  4HLQ A;  4LJ7 A;  3I01 M;  3H4J A;  1L2D A;  1K3X A;  4LF7 M;  4FVM A;  1XHB A;  4DBG B;  2ZTD A;  2DEN A;  3FRI A;  3LCV B;  2ZM6 M;  5L8R F;  3GRU A;  1W5T A;  2Q2E B;  1EE8 A;  4Y28 F;  4F2L A;  4MGI E;  2WZJ A;  1LV7 A;  3SFZ A;  3FTF A; 
#chains in the Genus database with same CATH homology
 1QQW A;  1GKI A;  3TE6 A;  3GQ5 A;  5ITR A;  3FYC A;  4EIW A;  4IIW A;  4LJ6 A;  2K47 A;  4Z8X A;  2DZO B;  2J7N A;  3KVW A;  2RGH A;  4AG6 A;  1TH2 A;  3CF6 E;  3VDU A;  3U5Z B;  2QBY A;  4L15 A;  3VKH A;  1E94 E;  4L78 A;  2F5O A;  4GKK M;  1XMO M;  4LJA A;  2ZAN A;  5EXP A;  1L2B A;  3KP1 E;  2QCU A;  4A3V B;  5LMN M;  3GQ4 A;  4D80 A;  5FTL A;  3SAW A;  4OU7 A;  1I94 M;  1JQJ C;  3M6A A;  1XC8 A;  1WXQ A;  2CHV A;  4L16 A;  4G6Z A;  4AW4 A;  3U61 B;  5IT9 S;  4LJ8 A;  5EP3 A;  3SYK A;  4QNM A;  4FCW A;  1N33 M;  3E4R A;  3L29 A;  4MGY E;  4PCZ A;  3AV0 A;  3RGS A;  4B7G A;  2KRK A;  1GVN A;  3UK6 A;  1Q3B A;  1L1T A;  3FKE A;  3GRR A;  1D2N A;  1QAO A;  4YHH M;  2F5S A;  3AOG A;  4B3T M;  4Z6Y A;  5KPT A;  1IN7 A;  5C18 A;  1TDZ A;  2R62 A;  3J7B A;  1PM5 A;  4B3R M;  1E9R A;  1ZQ9 A;  2DWM A;  4RF0 A;  4B08 A;  3A45 A;  3KS4 A;  4BBA A;  2QP9 X;  4CHT B;  1HR0 M;  3KOW E;  5IZ7 D;  3GLG B;  2KRU A;  5ITX A;  1Z5C A;  3KOZ E;  2I7N A;  4M9Z A;  5ITY A;  1MX0 A;  3QWL A;  3GLH B;  3U6P A;  5E26 A;  1OJL A;  2C98 A;  2UU9 M;  2W82 A;  4GMQ A;  2F4V M;  1QAQ A;  3M7G A;  4CIS A;  1VDD A;  1PJJ A;  4G4Q A;  4GIT A;  4JV5 M;  3TWK A;  3GP1 A;  4ITQ A;  3UJN A;  2F5P A;  5IRE B;  3FUX A;  3MK6 A;  3A42 A;  3GO8 A;  3HWS A;  4GIP A;  1L8Q A;  1XWI A;  3DA1 A;  3VFD A;  4DV2 M;  2L6O A;  3U6L A;  2OPF A;  4PT5 A;  4IJE A;  4KHP M;  1GL6 A;  4LCB A;  4K0K M;  5FTJ A;  2YFQ A;  4JN6 A;  5IWA M;  3LMM A;  5DNY A;  4X62 M;  3R8F A;  4JI1 M;  2HKJ A;  3SAR A;  5F3W A;  5EXS A;  4MM3 B;  3U6Q A;  4M0D A;  2EUC A;  2KZS A;  1E32 A;  4QOZ C;  4AKG A;  3IG5 A;  3TWL A;  4AQY M;  4DR1 M;  2YNM D;  3GRY A;  2Y0Q A;  4LRS A;  4PDI A;  2XEP A;  2BJW A;  1YSY A;  3U6M A;  4JI4 M;  1IXR C;  4RF1 A;  3OTO M;  3QAU A;  3FTC A;  2C9C A;  3NBI A;  4IBC A;  4B7H A;  3I4V A;  4LF9 M;  3GQ3 A;  5EJC A;  4IBE A;  3D8L A;  3THG A;  2J7O A;  4GH9 A;  3LQR A;  3L27 A;  3HHY A;  4DR3 M;  3J81 S;  1IBL M;  3SC3 A;  2XLJ A;  2UXC M;  4IJF A;  3J7A S;  4DV0 M;  1G59 A;  1I4W A;  4LY6 A;  4LZJ A;  2F5N A;  1NHW C;  4JI0 M;  5FSW A;  3FUT A;  4G4O A;  2XGN A;  4GHL A;  4GRI A;  2HHH M;  3T38 A;  3W0L B;  3T1Y M;  4G4R A;  4X65 M;  2X4A A;  5ITX E;  1IBM M;  1W5S A;  3CF2 A;  3E9S A;  5BPV A;  2ERC A;  1NJF A;  4JXJ A;  3ILK A;  3U6C A;  3AOE A;  1YE9 A;  2CEA A;  2KW0 A;  3GLF A;  3FUW A;  1DGH A;  2XSZ A;  3SAU A;  2UXB M;  2Z7J A;  3VK8 A;  2QEN A;  4DR5 M;  3HHX A;  4LFA M;  4OVZ A;  2CUZ A;  2XSZ D;  1QZM A;  1SXJ C;  2R18 A;  2UXD M;  4IBD A;  2RGO A;  4AZF A;  5FLX S;  1GLN A;  4IBF A;  3PXG A;  2LXE A;  2CV1 A;  3T15 A;  3L26 A;  4AKI A;  4LG2 A;  2Z3X A;  2X8A A;  5A2Q S;  4GKJ M;  2UUC M;  2ZAO A;  4QHS A;  3ZCB B;  2CE7 A;  3DOA A;  4PD2 A;  1NJG A;  4REZ A;  1S3S A;  4HL4 A;  4R7G A;  2D7H A;  4OW0 A;  2P5T A;  4LZZ A;  1HNZ M;  4JYA M;  4B7F A;  2KXE A;  2DWN A;  4DV4 M;  1N34 M;  1N36 M;  3VDP A;  1C1K A;  1UM8 A;  2XZF A;  5E6J A;  4NXM M;  1OFI A;  4LF6 M;  3HKP A;  3SYL A;  3PNY A;  4FCT A;  2QBY B;  3FD9 A;  3U6S A;  3W0F A;  3KW6 A;  4LF5 M;  5DYG A;  4B3S M;  2V1U A;  4FWH A;  1Z5B A;  1IN8 A;  4GC9 A;  3FTE A;  3J27 B;  1OFH A;  3H4M A;  4I8O A;  3VKG A;  1GL7 A;  1IN6 A;  2BNK A;  3U6D A;  2CV0 A;  4LJ9 A;  2E5L M;  3C58 A;  1Z59 A;  4D81 A;  4NRW A;  2C9O A;  2M5Z A;  3JR4 A;  1QAM A;  4GC5 A;  2DWL A;  1HQY E;  2YQZ A;  2D7E A;  3JR5 A;  4NRV A;  3ZC7 B;  3PFI A;  2LNH C;  3U6E A;  3CTW B;  3KOX E;  4LFC M;  2G5G X;  5ITU A;  3HU3 A;  1XXH A;  7CAT A;  3BOS A;  2C99 A;  5JI2 E;  4TUW A;  1DGG A;  1HQC A;  1Q3C A;  2CFO A;  4IBJ A;  3A46 A;  4M0W A;  1SXJ D;  4FWD A;  5EQT A;  3PVS A;  5BR8 M;  2DVW B;  3CF0 A;  2C5R A;  2VII A;  1Z5A A;  3EIE A;  2NQ8 C;  1G41 A;  4DV7 M;  1N78 A;  1J5E M;  3SMS A;  5C1B A;  3DFZ A;  4IBK A;  1NVM A;  1IN5 A;  3GPX A;  1E9S A;  4D82 A;  4FW9 A;  3KP0 E;  4OX9 M;  2CHQ A;  1IM2 A;  2ZBK B;  3SAT A;  1HT1 E;  2XZU A;  1DGF A;  4BB9 A;  4S12 A;  4LF4 M;  3I51 A;  2DZN B;  2R4J A;  3SHF A;  3WHL A;  1N77 A;  2CV2 A;  3GPU A;  4KO8 A;  5FTK A;  3UGJ A;  3GPY A;  4DV3 M;  4FWG A;  3KS8 A;  5GKN A;  3VK7 A;  4X64 M;  1DGB A;  3K92 A;  4BLC A;  5KQD A;  2R45 A;  3GRV A;  2XFS A;  4RNA A;  4XGI A;  4JI6 M;  3TL4 X;  4AI6 A;  2D7G A;  1DO0 A;  2DWZ B;  4QHT A;  1IY0 A;  1QYR A;  4ZPX A;  2L7I A;  1HNX M;  2DXI A;  1XNQ M;  5JI3 E;  4IBG A;  4JI3 M;  4MGH A;  3ZH9 B;  2VQF M;  2X49 A;  5DYI A;  3HHZ A;  4B3M M;  5FTM A;  4LGY A;  4IBB A;  1K82 A;  3U61 A;  4IBI A;  5ITT A;  3KFU G;  2G8L A;  4NOO B;  1PJI A;  4II7 A;  3J80 S;  2HCB A;  5KPZ A;  2KA6 B;  1TH3 A;  2JA2 A;  2XF3 A;  1K3W A;  2OQ4 A;  3L2A A;  3MHV C;  5EXT A;  3RFW A;  4WW0 A;  1T3T A;  3LVV A;  3K2L A;  1HNW M;  4MB7 A;  4FCV A;  3HJQ A;  5KO3 A;  3A98 B;  1MU5 A;  3PNV A;  1SXJ E;  5FTN A;  4QNR A;  2EA0 A;  4AKH A;  5EXX A;  4LRT A;  3HGI A;  1R2Z A;  3SBJ A;  8CAT A;  2F5Q A;  1L2C A;  3TQS A;  3GLG A;  4MH0 E;  4FD2 A;  4L4U A;  3GLI A;  1NNJ A;  3DZD A;  1TH4 A;  3UMM A;  5KPR A;  3LQQ A;  4DV5 M;  1ORY B;  3VLF B;  3GLH A;  2Y21 A;  2C96 A;  1TDH A;  3SAV A;  3SMP A;  2M60 A;  3TWM A;  4DUY M;  2FOI C;  2HL7 A;  3FUU A;  1TGU A;  4MGK E;  2A5Y B;  3AFH A;  3IG8 A;  4DUZ M;  4DR4 M;  1HT2 E;  1N75 A;  4I5S A;  3RGP A;  1NY6 A;  4WUR A;  2BJV A;  3KOY E;  1Q39 A;  1J7K A;  1QVR A;  3GLF B;  1NY5 A;  1DGH B;  1IY2 A;  3L28 A;  5ITQ A;  2FNA A;  4DR2 M;  3HU1 A;  4NSR A;  1N32 M;  2H1R A;  5EP4 A;  2FFJ A;  4L8R C;  3D8B A;  1R2Y A;  4OVZ B;  4G4N A;  1FJG M;  1IXZ A;  3U60 A;  2DHR A;  4KLN A;  3U6O A;  3FYD A;  3AJI B;  1ZAE A;  4I4L A;  3HJ8 A;  3Q8X A;  2R46 A;  1IN4 A;  1R6B X;  1R7R A;  4X66 M;  1J09 A;  1XMQ M;  1XNR M;  4LFB M;  4NL4 H;  1IBK M;  2Z4S A;  3TPZ A;  1NSF A;  2KEB A;  5KQ8 A;  2V6Z M;  2VQE M;  4LGM A;  3HHW A;  1NHG C;  2L7H A;  4DV1 M;  4I81 A;  4M9S A;  3GLI B;  3FUV A;  4DV6 M;  4DR6 M;  4W5W A;  2R4E A;  3I4Y A;  1NNU C;  2FE8 A;  4JI8 M;  1SXJ A;  1X37 A;  2XFT A;  3J2P B;  4CGY B;  5EP1 A;  2Y0T A;  3RE8 A;  2O5R A;  4NXN M;  4DR7 M;  4LF8 M;  4AG5 A;  1IY1 A;  3UZU A;  2I7P A;  2LWX A;  3KSX A;  3JAM S;  1QAN A;  4PDG A;  2V1C A;  2R65 A;  2LH0 A;  2Y20 A;  2ZAM A;  3B9P A;  4LJ4 A;  3HU2 A;  1Z6T A;  3HJS A;  2QPA A;  1KYI A;  4M9X A;  1KFV A;  3MJ5 A;  3FTD A;  1G3I A;  2RKO A;  3NWL A;  5EP2 A;  4LJ5 A;  3AOE C;  3AKZ A;  2KZU A;  3K8Z A;  1L1Z A;  2UUB M;  3U60 B;  2EO2 A;  2CHG A;  1G4A E;  2Z4R A;  1H6U A;  4QOS A;  2UUA M;  1JR3 A;  4R3D A;  3M0E A;  3KSJ A;  4JI5 M;  3L25 A;  3KDS E;  3KXE C;  4KOD A;  3AL0 C;  4JI7 M;  2YR0 A;  1JR3 D;  2XH9 A;  4YY3 M;  3WHK A;  3R9X B;  4JI2 M;  5H37 D;  4P16 A;  4NSO B;  3K1J A;  1XXH B;  1KSF X;  3SHG B;  1G8P A;  3EIH A;  3U5Z A;  1IQP A;  1SXJ B;  4XBO A;  4MGZ E;  1DO2 A;  1YUB A;  4GHA A;  3T1H M;  2L09 A;  3SAS A;  1IXS B;  2QZ4 A;  5LMU M;  3LVW A;  3GPP A;  1FNN A;  2AHM A;  4HLQ A;  4LJ7 A;  1L2D A;  1K3X A;  4LF7 M;  4FVM A;  1XHB A;  2ZM6 M;  3GRU A;  1W5T A;  2Q2E B;  1EE8 A;  4MGI E;  1LV7 A;  3SFZ A;  3FTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...