4LFCM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfcM02
2E5LM 4DR3M 3TWKA 3U6QA 1L2BA 3SAUA 1I94M 3A42A 4LFCM 4ITQA 3TWMA 3GQ5A 3U6PA 1IBLM 1Q3BA 1N33M 4X62M 4B3RM 5ITXA 1IBKM 2F5OA 1MX0A 4JI3M 3SAWA 4DV6M 1K82A 4GKKM 1Q39A 4JI4M 4DV2M 2UXBM 4CISA 4LFAM 3U6DA 4JI8M 1N32M 3GPYA 4GKJM 2F5NA 1J5EM 3GPUA 4X66M 3GPXA 2XZUA 4NRVA 5ITUA 3A45A 5ITQA 4DV7M 1R2YA 1KFVA 4JI7M 1HNZM 3GO8A 3GQ3A 3GQ4A 5FLXS 1L2DA 4X65M 4MB7A 4NXNM 5ITXE 1XC8A 4DUYM 1Q3CA 3U6CA 4DR5M 4G4RA 4DV5M 2Q2EB 3VK7A 1MU5A 5LMUM 3U6SA 4NXMM 4JI2M 2F4VM 1K3WA 5IWAM 4YY3M 4G4NA 1L2CA 3U6LA 5ITTA 3W0FA 4JI1M 2UXDM 4B3SM 3U6MA 1Z5CA 4B3TM 3U6EA 4PDIA 4LF9M 1FJGM 3SASA 4DUZM 3TWLA 2UUBM 1XNQM 5ITRA 4LF4M 4DR4M 4PD2A 2UXCM 2EA0A 1EE8A 3JAMS 2OQ4A 3SBJA 4JI5M 4KHPM 4DR2M 4LF7M 4K0KM 4OX9M 2F5SA 1PJIA 4JI6M 1HR0M 4G4OA 4PCZA 2UUAM 1XMQM 1Z59A 4DR1M 4PDGA 4G4QA 1L1TA 1L1ZA 1HNWM 1TDHA 1N36M 4DV1M 1Z5AA 3DOAA 2UU9M 1Z5BA 4DR7M 3J81S 3SAVA 4LF6M 4JYAM 1TDZA 4YHHM 1PJJA 1K3XA 1XNRM 3JR4A 3J7AS 3SARA 1IBMM 4DR6M 4DV4M 4JV5M 5BR8M 5A2QS 2ZM6M 1NNJA 4LF5M 5IT9S 3JR5A 1N34M 2XZFA 3OTOM 4LF8M 5LMNM 4AQYM 3SATA 4X64M 3A46A 3T1HM 4JI0M 3T1YM 1HNXM 3VK8A 4B3MM 2VQFM 2VQEM 1PM5A 2F5QA 5ITYA 2ZBKB 3J80S 3GP1A 4DV0M 2F5PA 4LFBM 1XMOM 1R2ZA 4DV3M 3C58A 2UUCM 4NRWA 3U6OA 2HKJA 2OPFA 3GPPA 2HHHM
chains in the Genus database with same CATH superfamily
4TUWA 2DAMA 4P17A 4FWGA 2E5LM 4EIWA 3LW5F 3VFDA 3U6QA 3DA1A 1IQPA 4R71A 2LVAA 3Q8GA 3RE8A 3B74A 4L4UA 3K1JA 1SXJE 3GQ5A 3TWMA 1IY1A 4GIPA 4IBDA 3U6PA 1IBLM 2O01F 1MJGM 1IY0A 1Q3BA 4G6ZA 3HJSA 1QAQA 5ITXA 2J7OA 1MX0A 4JI3M 1GKIA 2DI0A 2JZ0A 1DO2A 4JI4M 2DAGA 1UFZA 3KOZE 2UXBM 1LV7A 2LVQD 4L15A 3GPYA 2FS1A 4GKJM 2WSCF 4FCVA 1R7RA 2L4FA 1J5EM 3GPUA 2HL7A 2DKLA 3GPXA 2XZUA 4NRVA 4JXJA 1IXSB 4DV7M 3CGWA 2CHVA 1IXRC 4IBCA 4NOOB 3DZDA 4RF0A 5EP2A 3J27B 1MN3A 2HCBA 3GO8A 5FTKA 1HNZM 1X37A 2WSEF 1V33A 1WIVA 4GC5A 3KSXA 2OO9A 1JB0F 4FWHA 4NXNM 1UM8A 1DGBA 4B7GA 5ITXE 4MGZE 2R62A 3L28A 2EJSA 1VEGA 2YFQA 1L8QA 3H4MA 4RKUF 2C5RA 3AOEA 4AKGA 1TH2A 3AKZA 4NXMM 3K2LA 3GRUA 3B9PA 4G4NA 3J2PB 5ITTA 2V1UA 3KXEC 1NO1A 2XGNA 4B3TM 1WR1B 2CV0A 2RGHA 4DBGB 4FVMA 3AJIB 1XNQM 3HJ8A 1G4AE 5EXTA 3L26A 1NSFA 4GRIA 4QOZC 5EP3A 2CHQA 2JY8A 4NC6A 3U61A 3HHYA 1R4GA 2KZSA 5KPTA 4KHPM 3T38A 4MGYE 3L29A 3U60A 1N75A 1VG5A 4OX9M 2AHMA 3QWLA 3FYCA 4IBIA 3E21A 4JI6M 1PJTA 3B7ZA 5DFLA 1JR3E 4PCZA 4NSOB 2XLJA 5E6JA 4Q7JA 4B7FA 3GLFA 1NHWC 4QHSA 1NY5A 1Z59A 4G4QA 1XHBA 2KZUA 4DV1M 1NV9A 1ORYB 1Z5AA 1DGGA 3Q8XA 3KOWE 4KT0F 1Z5BA 3SAVA 1G59A 2H1RA 3HU3A 4YHHM 4LCBA 4LF6M 2JY6B 3D8LA 1XNRM 4JYAM 2K9DA 2OOBA 1QUSA 2Z7JA 3I04M 3SARA 3GLHA 1T3TA 4LY6A 3R8FA 4JV5M 1GJTA 2X49A 2DNAA 2QSFX 3MHVC 3V76A 2ZM6M 2DZOB 4UN2B 3GLIA 2KRUA 5H37D 2FH0A 1OKSA 4GEWA 4M9XA 4B08A 3A46A 4AKHA 3UGJA 3T1HM 3K9PA 1P3QQ 1E9SA 1C1KA 3T1YM 4FCTA 1T6OA 5ITYA 3J80S 1GL6A 2VF8A 2DHRA 3BOSA 3CTWB 1DV0A 4IBBA 1ZMVA 2R0IA 4HEOA 3BXWA 1IN8A 1Q02A 3C3EA 4Y28F 3U6OA 3HY5A 4GMQA 3GLHE 1VEKA 3NWLA 2C99A 4MM3B 2O5RA 3U61B 1NY6A 4I81A 1IXZA 4DR3M 2LH0A 4MGHA 2RRUA 1QAOA 2QHOB 4ITQA 4L16A 3U60B 2CUZA 4KLNA 1OAOC 1GABA 3RFWA 1SXJD 2RKOA 5KO3A 2DWLA 2L4EA 4LJ7A 1TGUA 3GLFB 1QYRA 1WGLA 3GRVA 8CATA 2OOAA 2LTUA 3SAWA 4A3VB 1IBKM 4DV6M 3FUWA 2FFJA 7CATA 1G8PA 1Q39A 2R65A 3PNVA 1TF0B 3UK6A 2X4AA 1GJSA 4LRSA 4CISA 2LVPC 3FE3A 4CJ6A 2F5NA 4M0WA 4CHTB 4FCWA 3C3DA 4HL4A 4HLQA 1HJPA 5ITUA 2LVOC 2G8LA 1R2YA 3E9SA 5FTNA 4JI7M 2BJWA 2BWBA 2R44A 4B7HA 2J7NA 4IJFA 1WXQA 4BLCA 2ZAMA 3GLIB 2JP7A 4MB7A 2ZTCA 5IREB 1IN4A 2XF3A 5BPVA 1A5TA 3RGPA 1DGFA 1R6BX 4DUYM 3U6CA 1NVMA 2K47A 3KW6A 3I01M 2GNOA 4DR5M 1C7YA 3KFUG 2R4JA 1WHCA 1QZMA 3B7QA 2QPAA 3AOEC 4QNRA 5LMUM 3U6SA 2F4VM 5DYGA 4LGMA 5EXPA 4AG5A 5IWAM 2YQZA 3TE6A 4F2LA 4YY3M 4BB9A 3U6LA 3W67A 1OFIA 3SMSA 4QNMA 4XBOA 3M6AA 3VLFB 2UXCM 1V34A 1XWIA 4OW0A 4JI1M 5JI3E 1Z5CA 3KDSE 3U6EA 2A5YB 4LF9M 1IN5A 1CUKA 3SASA 3TWLA 4LF4M 2HWJA 4IJEA 1EIJA 2ERCA 2RGOA 3ZH9B 3GRRA 3KS4A 1LTMA 2K0BX 2CRUA 2XSZD 3FRIA 3MMPA 3ZCBB 1IY2A 2W82A 4IBEA 4WW0A 2EA0A 2DXIA 3JAMS 2OQ4A 3CF2A 4LZZA 2XFSA 4DR2M 4JI5M 1I4WA 4K0KM 1XXHA 2MGWA 1RU3A 3SHFA 2VIIA 4M9ZA 1HR0M 4G4OA 4D82A 3LVVA 4NL4H 1GLNA 2P5TA 1JR3D 4D80A 3LCVB 1HT2E 2L2DA 1WGNA 1PJSA 3K9OA 4IIWA 3FUUA 3HJQA 4LZJA 2UU9M 1HQCA 4DR7M 5EP4A 3GLGA 3K92A 2C96A 2JY7A 2XEPA 3LVWA 1K3XA 3M0EA 1T43A 3HGIA 3J7AS 4DR6M 2EKFA 5BR8M 5A2QS 1XXHE 1QQWA 1E32A 1N34M 1OQYA 2XZFA 3M7GA 3FYDA 5LMNM 4AQYM 2CE7A 1OTRA 2LNHC 1D0LA 2JXNA 3ILKA 2FOIC 2VDBB 2WSFF 1HQYE 4LJ5A 3TPZA 2Y21A 1BVSA 2EKKA 1OIZA 1QVRA 2EO2A 2V6ZM 4KO8A 4DV0M 2Y0QA 2VF7A 4CGYB 1QDRA 4LJ4A 4LRTA 2JA2A 3ZC7B 4AW4A 1YSYA 3GPPA 4B3RM 1G71A 2HHHM 2QENA 1ZV1A 2CHGA 3WHLA 1VQ1A 1DO0A 3CF0A 3TWKA 1L2BA 2CWBA 2M60A 3SAUA 4I5SA 4G3OA 2CEAA 2CP8A 1Z6TA 3IG5A 4CIZA 1XXHB 2FE8A 3SHGB 3KSJA 2KDLA 4OU7A 3FUXA 3AOGA 2D7GA 4IBJA 4M0DA 3TL4X 3FRHA 1N33M 3GLFE 1GL7A 4X62M 2Z3XA 2F5OA 3KS8A 1K82A 1IM2A 3FTCA 4GHLA 4DV2M 3TQSA 1AIPC 2QZ4A 4LFAM 3U6DA 2I7PA 3GLGB 2Z4SA 3KOXE 3H4JA 4X66M 4GH9A 1TTEA 4IBKA 1ZMWA 2R46A 3I51A 3QYBA 2JY5A 4WURA 3A45A 4LJ8A 5ITQA 3FTEA 5EXSA 1KFVA 2H5XA 2KXEA 5DNYA 3IG8A 1G41A 3FD9A 2JNHA 5C18A 5FLXS 2L6OA 1L2DA 2MROB 3UZUA 2ZANA 4QHTA 3GLIE 2BWEA 1NNUC 2LWXA 3WHKA 2YR0A 4G4RA 2O25A 2LXEA 2DWNA 3VK7A 2LBCA 2R45A 3NBIA 3AV0A 1VDDA 4IBFA 4JI2M 4RF1A 2ZAOA 4L78A 1L2CA 3B89A 3W0FA 1QDTA 3U5ZA 2FNAA 4S12A 1ZAEA 4B3SM 2UXDM 3HU1A 1ZMUA 3VDPA 4L6V6 2QQ8A 3LQRA 2C9CA 2N35A 3MK6A 4PDIA 2QBYA 2KHHA 2KNZA 1FJGM 2D7EA 1OIPA 1Y8GA 4I4LA 3ZQJA 4DR4M 3E46A 1IFYA 3EIHA 3UJNA 2L7HA 1EE8A 3SBJA 3UMMA 3IHPA 1SXJA 2GQFA 4RNAA 4LJAA 3HZJA 4R7GA 2F5SA 3I4YA 3IECA 1PJIA 1OAIA 2L7IA 1W5TA 3HX3A 4GC9A 3QAUA 4MGKE 4LJ9A 5KQ8A 1TR8A 1XMQM 2CFOA 2NQ8C 1FNNA 1ZQ9A 3PXGA 5C1BA 4BBAA 4PDGA 1L1TA 1TDHA 1PRBA 2Y20A 3R9XB 5L8RF 4AZFA 1SG9A 3KP1E 1TDZA 1PJJA 2DENA 2DWZB 2HAKA 3SMPA 1IBMM 3J7BA 3MJ5A 2KNAA 3T15A 4FW9A 1NNJA 3KOYE 2XH9A 3SYKA 4LF5M 5DYIA 3HWSA 5JI2E 4XK8F 1QZEA 1IN7A 3JR5A 5IT9S 1GVNA 2R6FA 2DAIA 3F92A 3GRYA 4Z6YA 2D7HA 1N77A 3SATA 2B3TA 5EQTA 4FWDA 5FTJA 4X64M 1OFHA 4JI0M 1HNXM 2CV1A 3VK8A 2WZJA 4REZA 3U5ZB 4B3MM 1PM5A 1AUAA 4M9SA 3HU2A 4OVZA 3GP1A 3DFZA 1NJGA 2QBYB 4W5WA 2BNKA 2KNVA 1OJLA 1R2ZA 4DV3M 3HKPA 3C58A 2UUCM 4NRWA 1KSFX 3FUVA 3FTFA 4L8RC 2OPFA 3PVSA 2YNMD 2DHYA 2EUCA 3W68A 3L27A 1I94M 3A42A 4LFCM 1SXJB 3W0LB 4Z8XA 1YE9A 3BBZA 3EIEA 3KVWA 4WP2A 3QYEA 2XSZA 4XGIA 1GO5A 3PNYA 2KW0A 5FTLA 4IBGA 2MH8A 2LHGA 3SFZA 2X8AA 4JN6A 4II7A 4R3DA 4GKKM 3C9PA 3T6PA 2V1CA 4JI8M 4D81A 1JR3A 1N32M 2JWSA 4FD2A 2Z8YM 4ANRA 1YLAA 3HHWA 1R5LA 3GLGE 4ZPXA 2C98A 3PFIA 5E26A 3L25A 1KYIA 1F4IA 3AFHA 4AI6A 1IN6A 3RGSA 1PGYA 2JUJA 3GQ3A 3GQ4A 1DGHA 4X65M 3LMMA 2CV2A 2R18A 2R4EA 2QCUA 5GKNA 1XC8A 1Q3CA 3HHXA 2DAKA 4DV5M 2J5YA 4MH0E 5KQDA 3I4VA 4OVZB 3HHZA 2Q2EB 2DZNB 1MU5A 4QOSA 1E94E 3VKGA 5EXXA 2MJ5B 2DVWB 1K3WA 3KP0E 2M5ZA 1JQJC 1EFUB 3THGA 1VEJA 3K8ZA 3NBXX 5F3WA 3B7NA 2Z4RA 2I7NA 1N78A 2C9OA 3U6MA 1E9RA 1VDLA 1QAMA 2QP9X 2K6BA 2XFTA 2LHCA 5FSWA 1WJ7A 4KODA 4DUZM 2UUBM 3SYLA 5ITRA 1TH3A 5FTMA 3AL0C 4MGIE 1NHGC 1PJQA 4PD2A 3LCUA 2L09A 4PT5A 2DWMA 3VDUA 3E4RA 2KEBA 5EJCA 3FUTA 1SXJC 4LF7M 3VKHA 1TH4A 2G3QA 1V92A 5KPZA 2UUAM 1YUBA 4DR1M 1L1ZA 1HNWM 2Y0TA 1N36M 4AG6A 1QUTA 2DAEA 4LG2A 1DGHB 3DOAA 2APLA 3J81S 5IZ7D 1H6UA 1HT1E 3D8BA 1D0MA 3FTDA 3JR4A 2QNJA 1W5SA 2LVNC 2JZ1A 4F1IA 4AKIA 5KPRA 4DV4M 4NSRA 1IXSA 2KA6B 1NJFA 1XB2B 3L2AA 1D0KA 2BJVA 3CF6E 4LGYA 3FKEA 1S3SA 3OTOM 4LF8M 3SC3A 1NV8A 3A98B 2ZTDA 2KRKA 1D2NA 1J09A 2G5GX 2VQEM 2VQFM 2F5QA 4GHAA 1QANA 2ZBKB 4GITA 2F5PA 4LFBM 1XMOM 2DZLA 4I8OA 1G3IA 3GLHB 2HKJA 3LQQA 1J7KA 4LJ6A 4P16A 2MR9A 5EP1A
chains in the Genus database with same CATH topology
4TUWA 4FWGA 2E5LM 4EIWA 3VFDA 3U6QA 3DA1A 1IQPA 3RE8A 4L4UA 3K1JA 1SXJE 3GQ5A 3TWMA 1IY1A 4GIPA 4IBDA 3U6PA 1IBLM 1IY0A 1Q3BA 4G6ZA 3HJSA 1QAQA 5ITXA 2J7OA 1MX0A 4JI3M 1GKIA 1DO2A 4JI4M 3KOZE 2UXBM 1LV7A 4L15A 3GPYA 4GKJM 4FCVA 1R7RA 1J5EM 3GPUA 2HL7A 3GPXA 2XZUA 4NRVA 4JXJA 1IXSB 4DV7M 2CHVA 1IXRC 4IBCA 4NOOB 3DZDA 4RF0A 5EP2A 3J27B 3GO8A 2HCBA 1HNZM 5FTKA 1X37A 4GC5A 3KSXA 4NXNM 4FWHA 4B7GA 1UM8A 1DGBA 5ITXE 4MGZE 2R62A 3L28A 2YFQA 1L8QA 3H4MA 2C5RA 3AOEA 4AKGA 1TH2A 3AKZA 4NXMM 3K2LA 3GRUA 3B9PA 4G4NA 3J2PB 5ITTA 2V1UA 3KXEC 2XGNA 4B3TM 2CV0A 2RGHA 4FVMA 3AJIB 1XNQM 3HJ8A 1G4AE 5EXTA 3L26A 1NSFA 4GRIA 4QOZC 5EP3A 2CHQA 3U61A 3HHYA 5KPTA 2KZSA 4KHPM 3T38A 4MGYE 3L29A 3U60A 1N75A 4OX9M 2AHMA 3QWLA 3FYCA 4IBIA 4JI6M 4PCZA 4NSOB 2XLJA 5E6JA 4B7FA 3GLFA 1NHWC 4QHSA 1NY5A 1Z59A 4G4QA 1XHBA 2KZUA 4DV1M 1ORYB 1Z5AA 1DGGA 3Q8XA 3KOWE 1Z5BA 3SAVA 1G59A 2H1RA 3HU3A 4YHHM 4LCBA 4LF6M 4JYAM 3D8LA 1XNRM 2Z7JA 3SARA 3GLHA 1T3TA 4LY6A 3R8FA 4JV5M 2X49A 3MHVC 2ZM6M 2DZOB 3GLIA 2KRUA 5H37D 4M9XA 4B08A 3A46A 4AKHA 3UGJA 3T1HM 3T1YM 1E9SA 1C1KA 4FCTA 5ITYA 3J80S 1GL6A 3CTWB 2DHRA 3BOSA 4IBBA 1IN8A 3U6OA 4GMQA 3NWLA 2C99A 4MM3B 2O5RA 3U61B 1NY6A 4I81A 1IXZA 4DR3M 2LH0A 4MGHA 1QAOA 4ITQA 4L16A 3U60B 2CUZA 4KLNA 3RFWA 1SXJD 2RKOA 5KO3A 2DWLA 4LJ7A 1TGUA 3GLFB 1QYRA 3GRVA 8CATA 1IBKM 3SAWA 4A3VB 4DV6M 3FUWA 2FFJA 7CATA 1G8PA 1Q39A 2R65A 3PNVA 3UK6A 2X4AA 4LRSA 4CISA 2F5NA 4M0WA 4CHTB 4FCWA 4HL4A 4HLQA 5ITUA 2G8LA 1R2YA 3E9SA 5FTNA 4JI7M 2BJWA 4B7HA 2J7NA 4IJFA 1WXQA 4BLCA 2ZAMA 3GLIB 4MB7A 5BPVA 5IREB 1IN4A 2XF3A 3RGPA 1DGFA 1R6BX 4DUYM 3U6CA 1NVMA 2K47A 3KW6A 4DR5M 3KFUG 2R4JA 1QZMA 2QPAA 3AOEC 4QNRA 5LMUM 3U6SA 2F4VM 5DYGA 4LGMA 5EXPA 4AG5A 5IWAM 2YQZA 3TE6A 4YY3M 4BB9A 3U6LA 1OFIA 3SMSA 4QNMA 4XBOA 3M6AA 3VLFB 1XWIA 4OW0A 4JI1M 5JI3E 1Z5CA 3KDSE 3U6EA 2A5YB 4LF9M 1IN5A 3SASA 3TWLA 4LF4M 4IJEA 2ERCA 2RGOA 3ZH9B 3GRRA 3KS4A 2UXCM 2XSZD 3ZCBB 1IY2A 2W82A 4IBEA 4WW0A 2EA0A 2DXIA 3JAMS 2OQ4A 3CF2A 4LZZA 2XFSA 4DR2M 4JI5M 1I4WA 4K0KM 1XXHA 3SHFA 2VIIA 4M9ZA 1HR0M 4G4OA 4D82A 3LVVA 4NL4H 1GLNA 2P5TA 1JR3D 4D80A 1HT2E 4IIWA 3FUUA 3HJQA 4LZJA 2UU9M 1HQCA 4DR7M 5EP4A 3GLGA 3K92A 2C96A 2XEPA 3LVWA 1K3XA 3M0EA 3HGIA 3J7AS 4DR6M 5BR8M 5A2QS 1QQWA 1E32A 1N34M 2XZFA 3M7GA 3FYDA 5LMNM 4AQYM 2CE7A 2LNHC 3ILKA 2FOIC 1HQYE 4LJ5A 3TPZA 2Y21A 4KO8A 1QVRA 2EO2A 2V6ZM 4DV0M 2Y0QA 4CGYB 4LJ4A 4LRTA 2JA2A 3ZC7B 4AW4A 1YSYA 3GPPA 4B3RM 2HHHM 2QENA 2CHGA 3WHLA 1DO0A 3CF0A 3TWKA 1L2BA 2M60A 3SAUA 4I5SA 2CEAA 1Z6TA 3IG5A 1XXHB 2FE8A 3SHGB 3KSJA 4OU7A 3FUXA 3AOGA 2D7GA 4IBJA 4M0DA 3TL4X 1N33M 1GL7A 4X62M 2Z3XA 2F5OA 3KS8A 1K82A 1IM2A 3FTCA 4GHLA 4DV2M 3TQSA 2QZ4A 4LFAM 3U6DA 2I7PA 3GLGB 2Z4SA 3KOXE 4X66M 4GH9A 4IBKA 3I51A 2R46A 4WURA 3FTEA 3A45A 4LJ8A 5ITQA 5EXSA 1KFVA 5DNYA 2KXEA 3IG8A 1G41A 3FD9A 5FLXS 5C18A 1L2DA 2L6OA 3UZUA 2ZANA 4QHTA 1NNUC 2LWXA 3WHKA 2YR0A 4G4RA 2LXEA 2DWNA 3VK7A 2R45A 3NBIA 3AV0A 1VDDA 4IBFA 4JI2M 4RF1A 2ZAOA 4L78A 1L2CA 3W0FA 3U5ZA 2FNAA 4S12A 1ZAEA 4B3SM 2UXDM 3HU1A 3VDPA 3LQRA 2C9CA 3MK6A 4PDIA 2QBYA 1FJGM 2D7EA 4I4LA 4DR4M 3EIHA 3UJNA 2L7HA 1EE8A 3SBJA 3UMMA 1SXJA 4RNAA 4LJAA 4R7GA 2F5SA 3I4YA 1PJIA 2L7IA 4MGKE 1W5TA 4GC9A 3QAUA 4LJ9A 5KQ8A 1XMQM 2CFOA 2NQ8C 1FNNA 1ZQ9A 3PXGA 5C1BA 4BBAA 4PDGA 1L1TA 1TDHA 2Y20A 3R9XB 4AZFA 3KP1E 1TDZA 1PJJA 2DWZB 3SMPA 1IBMM 3J7BA 3MJ5A 3T15A 4FW9A 1NNJA 3KOYE 2XH9A 3SYKA 4LF5M 5DYIA 3HWSA 5JI2E 3JR5A 5IT9S 1IN7A 1GVNA 4Z6YA 3GRYA 2D7HA 1N77A 3SATA 4X64M 5EQTA 4FWDA 5FTJA 2CV1A 1OFHA 4JI0M 1HNXM 3VK8A 4REZA 3U5ZB 4B3MM 1PM5A 4M9SA 3HU2A 4OVZA 3GP1A 3DFZA 1NJGA 2QBYB 4W5WA 2BNKA 1R2ZA 1OJLA 3FTFA 4DV3M 3HKPA 3C58A 2UUCM 4NRWA 1KSFX 3FUVA 4L8RC 2OPFA 3PVSA 2YNMD 2EUCA 3L27A 1I94M 3A42A 4LFCM 1SXJB 3W0LB 4Z8XA 1YE9A 3EIEA 3KVWA 2XSZA 4XGIA 2KW0A 5FTLA 4IBGA 3SFZA 2X8AA 4JN6A 4II7A 4R3DA 4GKKM 2V1CA 4JI8M 4D81A 1JR3A 1N32M 4FD2A 3HHWA 4ZPXA 2C98A 3PFIA 5E26A 3L25A 1KYIA 3AFHA 4AI6A 1IN6A 3RGSA 3GQ3A 3GQ4A 1DGHA 4X65M 3LMMA 2CV2A 2R18A 2R4EA 2QCUA 5GKNA 1XC8A 1Q3CA 3HHXA 4DV5M 4MH0E 5KQDA 3I4VA 4OVZB 3HHZA 2Q2EB 2DZNB 1MU5A 4QOSA 1E94E 3VKGA 5EXXA 2DVWB 1K3WA 3KP0E 2M5ZA 1JQJC 3THGA 5F3WA 3K8ZA 2Z4RA 2I7NA 1N78A 2C9OA 3U6MA 1E9RA 1QAMA 2QP9X 2XFTA 5FSWA 4KODA 4DUZM 2UUBM 3SYLA 5ITRA 1TH3A 5FTMA 3AL0C 4MGIE 1NHGC 4PD2A 2L09A 4PT5A 2DWMA 3VDUA 3E4RA 2KEBA 5EJCA 3FUTA 1SXJC 4LF7M 3VKHA 1TH4A 5KPZA 2UUAM 1YUBA 4DR1M 1L1ZA 1HNWM 2Y0TA 1N36M 4AG6A 4LG2A 1DGHB 3DOAA 3J81S 5IZ7D 1H6UA 1HT1E 3D8BA 3FTDA 3JR4A 1W5SA 4AKIA 5KPRA 4DV4M 4NSRA 2KA6B 1NJFA 3L2AA 2BJVA 3CF6E 4LGYA 3FKEA 1S3SA 3OTOM 4LF8M 3SC3A 3A98B 2KRKA 1D2NA 1J09A 2G5GX 2VQEM 2VQFM 2F5QA 4GHAA 1QANA 2ZBKB 4GITA 2F5PA 4LFBM 1XMOM 4I8OA 1G3IA 3GLHB 2HKJA 3LQQA 1J7KA 4LJ6A 4P16A 3PNYA 5EP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L M;  4DR3 M;  3TWK A;  3U6Q A;  1L2B A;  3SAU A;  1I94 M;  3A42 A;  4LFC M;  4ITQ A;  3TWM A;  3GQ5 A;  3U6P A;  1IBL M;  1Q3B A;  1N33 M;  4X62 M;  4B3R M;  5ITX A;  1IBK M;  2F5O A;  1MX0 A;  4JI3 M;  3SAW A;  4DV6 M;  1K82 A;  4GKK M;  1Q39 A;  4JI4 M;  4DV2 M;  2UXB M;  4CIS A;  4LFA M;  3U6D A;  4JI8 M;  1N32 M;  3GPY A;  4GKJ M;  2F5N A;  1J5E M;  3GPU A;  4X66 M;  3GPX A;  2XZU A;  4NRV A;  5ITU A;  3A45 A;  5ITQ A;  4DV7 M;  1R2Y A;  1KFV A;  4JI7 M;  1HNZ M;  3GO8 A;  3GQ3 A;  3GQ4 A;  5FLX S;  1L2D A;  4X65 M;  4MB7 A;  4NXN M;  5ITX E;  1XC8 A;  4DUY M;  1Q3C A;  3U6C A;  4DR5 M;  4G4R A;  4DV5 M;  2Q2E B;  3VK7 A;  1MU5 A;  5LMU M;  3U6S A;  4NXM M;  4JI2 M;  2F4V M;  1K3W A;  5IWA M;  4YY3 M;  4G4N A;  1L2C A;  3U6L A;  5ITT A;  3W0F A;  4JI1 M;  2UXD M;  4B3S M;  3U6M A;  1Z5C A;  4B3T M;  3U6E A;  4PDI A;  4LF9 M;  1FJG M;  3SAS A;  4DUZ M;  3TWL A;  2UUB M;  1XNQ M;  5ITR A;  4LF4 M;  4DR4 M;  4PD2 A;  2UXC M;  2EA0 A;  1EE8 A;  3JAM S;  2OQ4 A;  3SBJ A;  4JI5 M;  4KHP M;  4DR2 M;  4LF7 M;  4K0K M;  4OX9 M;  2F5S A;  1PJI A;  4JI6 M;  1HR0 M;  4G4O A;  4PCZ A;  2UUA M;  1XMQ M;  1Z59 A;  4DR1 M;  4PDG A;  4G4Q A;  1L1T A;  1L1Z A;  1HNW M;  1TDH A;  1N36 M;  4DV1 M;  1Z5A A;  3DOA A;  2UU9 M;  1Z5B A;  4DR7 M;  3J81 S;  3SAV A;  4LF6 M;  4JYA M;  1TDZ A;  4YHH M;  1PJJ A;  1K3X A;  1XNR M;  3JR4 A;  3J7A S;  3SAR A;  1IBM M;  4DR6 M;  4DV4 M;  4JV5 M;  5BR8 M;  5A2Q S;  2ZM6 M;  1NNJ A;  4LF5 M;  5IT9 S;  3JR5 A;  1N34 M;  2XZF A;  3OTO M;  4LF8 M;  5LMN M;  4AQY M;  3SAT A;  4X64 M;  3A46 A;  3T1H M;  4JI0 M;  3T1Y M;  1HNX M;  3VK8 A;  4B3M M;  2VQF M;  2VQE M;  1PM5 A;  2F5Q A;  5ITY A;  2ZBK B;  3J80 S;  3GP1 A;  4DV0 M;  2F5P A;  4LFB M;  1XMO M;  1R2Z A;  4DV3 M;  3C58 A;  2UUC M;  4NRW A;  3U6O A;  2HKJ A;  2OPF A;  3GPP A;  2HHH M; 
#chains in the Genus database with same CATH topology
 4TUW A;  2DAM A;  4P17 A;  4FWG A;  2E5L M;  4EIW A;  3LW5 F;  3VFD A;  3U6Q A;  3DA1 A;  1IQP A;  4R71 A;  2LVA A;  3Q8G A;  3RE8 A;  3B74 A;  4L4U A;  3K1J A;  1SXJ E;  3GQ5 A;  3TWM A;  1IY1 A;  4GIP A;  4IBD A;  3U6P A;  1IBL M;  2O01 F;  1MJG M;  1IY0 A;  1Q3B A;  4G6Z A;  3HJS A;  1QAQ A;  5ITX A;  2J7O A;  1MX0 A;  4JI3 M;  1GKI A;  2DI0 A;  2JZ0 A;  1DO2 A;  4JI4 M;  2DAG A;  1UFZ A;  3KOZ E;  2UXB M;  1LV7 A;  2LVQ D;  4L15 A;  3GPY A;  2FS1 A;  4GKJ M;  2WSC F;  4FCV A;  1R7R A;  2L4F A;  1J5E M;  3GPU A;  2HL7 A;  2DKL A;  3GPX A;  2XZU A;  4NRV A;  4JXJ A;  1IXS B;  4DV7 M;  3CGW A;  2CHV A;  1IXR C;  4IBC A;  4NOO B;  3DZD A;  4RF0 A;  5EP2 A;  3J27 B;  1MN3 A;  2HCB A;  3GO8 A;  5FTK A;  1HNZ M;  1X37 A;  2WSE F;  1V33 A;  1WIV A;  4GC5 A;  3KSX A;  2OO9 A;  1JB0 F;  4FWH A;  4NXN M;  1UM8 A;  1DGB A;  4B7G A;  5ITX E;  4MGZ E;  2R62 A;  3L28 A;  2EJS A;  1VEG A;  2YFQ A;  1L8Q A;  3H4M A;  4RKU F;  2C5R A;  3AOE A;  4AKG A;  1TH2 A;  3AKZ A;  4NXM M;  3K2L A;  3GRU A;  3B9P A;  4G4N A;  3J2P B;  5ITT A;  2V1U A;  3KXE C;  1NO1 A;  2XGN A;  4B3T M;  1WR1 B;  2CV0 A;  2RGH A;  4DBG B;  4FVM A;  3AJI B;  1XNQ M;  3HJ8 A;  1G4A E;  5EXT A;  3L26 A;  1NSF A;  4GRI A;  4QOZ C;  5EP3 A;  2CHQ A;  2JY8 A;  4NC6 A;  3U61 A;  3HHY A;  1R4G A;  2KZS A;  5KPT A;  4KHP M;  3T38 A;  4MGY E;  3L29 A;  3U60 A;  1N75 A;  1VG5 A;  4OX9 M;  2AHM A;  3QWL A;  3FYC A;  4IBI A;  3E21 A;  4JI6 M;  1PJT A;  3B7Z A;  5DFL A;  1JR3 E;  4PCZ A;  4NSO B;  2XLJ A;  5E6J A;  4Q7J A;  4B7F A;  3GLF A;  1NHW C;  4QHS A;  1NY5 A;  1Z59 A;  4G4Q A;  1XHB A;  2KZU A;  4DV1 M;  1NV9 A;  1ORY B;  1Z5A A;  1DGG A;  3Q8X A;  3KOW E;  4KT0 F;  1Z5B A;  3SAV A;  1G59 A;  2H1R A;  3HU3 A;  4YHH M;  4LCB A;  4LF6 M;  2JY6 B;  3D8L A;  1XNR M;  4JYA M;  2K9D A;  2OOB A;  1QUS A;  2Z7J A;  3I04 M;  3SAR A;  3GLH A;  1T3T A;  4LY6 A;  3R8F A;  4JV5 M;  1GJT A;  2X49 A;  2DNA A;  2QSF X;  3MHV C;  3V76 A;  2ZM6 M;  2DZO B;  4UN2 B;  3GLI A;  2KRU A;  5H37 D;  2FH0 A;  1OKS A;  4GEW A;  4M9X A;  4B08 A;  3A46 A;  4AKH A;  3UGJ A;  3T1H M;  3K9P A;  1P3Q Q;  1E9S A;  1C1K A;  3T1Y M;  4FCT A;  1T6O A;  5ITY A;  3J80 S;  1GL6 A;  2VF8 A;  2DHR A;  3BOS A;  3CTW B;  1DV0 A;  4IBB A;  1ZMV A;  2R0I A;  4HEO A;  3BXW A;  1IN8 A;  1Q02 A;  3C3E A;  4Y28 F;  3U6O A;  3HY5 A;  4GMQ A;  3GLH E;  1VEK A;  3NWL A;  2C99 A;  4MM3 B;  2O5R A;  3U61 B;  1NY6 A;  4I81 A;  1IXZ A;  4DR3 M;  2LH0 A;  4MGH A;  2RRU A;  1QAO A;  2QHO B;  4ITQ A;  4L16 A;  3U60 B;  2CUZ A;  4KLN A;  1OAO C;  1GAB A;  3RFW A;  1SXJ D;  2RKO A;  5KO3 A;  2DWL A;  2L4E A;  4LJ7 A;  1TGU A;  3GLF B;  1QYR A;  1WGL A;  3GRV A;  8CAT A;  2OOA A;  2LTU A;  3SAW A;  4A3V B;  1IBK M;  4DV6 M;  3FUW A;  2FFJ A;  7CAT A;  1G8P A;  1Q39 A;  2R65 A;  3PNV A;  1TF0 B;  3UK6 A;  2X4A A;  1GJS A;  4LRS A;  4CIS A;  2LVP C;  3FE3 A;  4CJ6 A;  2F5N A;  4M0W A;  4CHT B;  4FCW A;  3C3D A;  4HL4 A;  4HLQ A;  1HJP A;  5ITU A;  2LVO C;  2G8L A;  1R2Y A;  3E9S A;  5FTN A;  4JI7 M;  2BJW A;  2BWB A;  2R44 A;  4B7H A;  2J7N A;  4IJF A;  1WXQ A;  4BLC A;  2ZAM A;  3GLI B;  2JP7 A;  4MB7 A;  2ZTC A;  5IRE B;  1IN4 A;  2XF3 A;  5BPV A;  1A5T A;  3RGP A;  1DGF A;  1R6B X;  4DUY M;  3U6C A;  1NVM A;  2K47 A;  3KW6 A;  3I01 M;  2GNO A;  4DR5 M;  1C7Y A;  3KFU G;  2R4J A;  1WHC A;  1QZM A;  3B7Q A;  2QPA A;  3AOE C;  4QNR A;  5LMU M;  3U6S A;  2F4V M;  5DYG A;  4LGM A;  5EXP A;  4AG5 A;  5IWA M;  2YQZ A;  3TE6 A;  4F2L A;  4YY3 M;  4BB9 A;  3U6L A;  3W67 A;  1OFI A;  3SMS A;  4QNM A;  4XBO A;  3M6A A;  3VLF B;  2UXC M;  1V34 A;  1XWI A;  4OW0 A;  4JI1 M;  5JI3 E;  1Z5C A;  3KDS E;  3U6E A;  2A5Y B;  4LF9 M;  1IN5 A;  1CUK A;  3SAS A;  3TWL A;  4LF4 M;  2HWJ A;  4IJE A;  1EIJ A;  2ERC A;  2RGO A;  3ZH9 B;  3GRR A;  3KS4 A;  1LTM A;  2K0B X;  2CRU A;  2XSZ D;  3FRI A;  3MMP A;  3ZCB B;  1IY2 A;  2W82 A;  4IBE A;  4WW0 A;  2EA0 A;  2DXI A;  3JAM S;  2OQ4 A;  3CF2 A;  4LZZ A;  2XFS A;  4DR2 M;  4JI5 M;  1I4W A;  4K0K M;  1XXH A;  2MGW A;  1RU3 A;  3SHF A;  2VII A;  4M9Z A;  1HR0 M;  4G4O A;  4D82 A;  3LVV A;  4NL4 H;  1GLN A;  2P5T A;  1JR3 D;  4D80 A;  3LCV B;  1HT2 E;  2L2D A;  1WGN A;  1PJS A;  3K9O A;  4IIW A;  3FUU A;  3HJQ A;  4LZJ A;  2UU9 M;  1HQC A;  4DR7 M;  5EP4 A;  3GLG A;  3K92 A;  2C96 A;  2JY7 A;  2XEP A;  3LVW A;  1K3X A;  3M0E A;  1T43 A;  3HGI A;  3J7A S;  4DR6 M;  2EKF A;  5BR8 M;  5A2Q S;  1XXH E;  1QQW A;  1E32 A;  1N34 M;  1OQY A;  2XZF A;  3M7G A;  3FYD A;  5LMN M;  4AQY M;  2CE7 A;  1OTR A;  2LNH C;  1D0L A;  2JXN A;  3ILK A;  2FOI C;  2VDB B;  2WSF F;  1HQY E;  4LJ5 A;  3TPZ A;  2Y21 A;  1BVS A;  2EKK A;  1OIZ A;  1QVR A;  2EO2 A;  2V6Z M;  4KO8 A;  4DV0 M;  2Y0Q A;  2VF7 A;  4CGY B;  1QDR A;  4LJ4 A;  4LRT A;  2JA2 A;  3ZC7 B;  4AW4 A;  1YSY A;  3GPP A;  4B3R M;  1G71 A;  2HHH M;  2QEN A;  1ZV1 A;  2CHG A;  3WHL A;  1VQ1 A;  1DO0 A;  3CF0 A;  3TWK A;  1L2B A;  2CWB A;  2M60 A;  3SAU A;  4I5S A;  4G3O A;  2CEA A;  2CP8 A;  1Z6T A;  3IG5 A;  4CIZ A;  1XXH B;  2FE8 A;  3SHG B;  3KSJ A;  2KDL A;  4OU7 A;  3FUX A;  3AOG A;  2D7G A;  4IBJ A;  4M0D A;  3TL4 X;  3FRH A;  1N33 M;  3GLF E;  1GL7 A;  4X62 M;  2Z3X A;  2F5O A;  3KS8 A;  1K82 A;  1IM2 A;  3FTC A;  4GHL A;  4DV2 M;  3TQS A;  1AIP C;  2QZ4 A;  4LFA M;  3U6D A;  2I7P A;  3GLG B;  2Z4S A;  3KOX E;  3H4J A;  4X66 M;  4GH9 A;  1TTE A;  4IBK A;  1ZMW A;  2R46 A;  3I51 A;  3QYB A;  2JY5 A;  4WUR A;  3A45 A;  4LJ8 A;  5ITQ A;  3FTE A;  5EXS A;  1KFV A;  2H5X A;  2KXE A;  5DNY A;  3IG8 A;  1G41 A;  3FD9 A;  2JNH A;  5C18 A;  5FLX S;  2L6O A;  1L2D A;  2MRO B;  3UZU A;  2ZAN A;  4QHT A;  3GLI E;  2BWE A;  1NNU C;  2LWX A;  3WHK A;  2YR0 A;  4G4R A;  2O25 A;  2LXE A;  2DWN A;  3VK7 A;  2LBC A;  2R45 A;  3NBI A;  3AV0 A;  1VDD A;  4IBF A;  4JI2 M;  4RF1 A;  2ZAO A;  4L78 A;  1L2C A;  3B89 A;  3W0F A;  1QDT A;  3U5Z A;  2FNA A;  4S12 A;  1ZAE A;  4B3S M;  2UXD M;  3HU1 A;  1ZMU A;  3VDP A;  4L6V 6;  2QQ8 A;  3LQR A;  2C9C A;  2N35 A;  3MK6 A;  4PDI A;  2QBY A;  2KHH A;  2KNZ A;  1FJG M;  2D7E A;  1OIP A;  1Y8G A;  4I4L A;  3ZQJ A;  4DR4 M;  3E46 A;  1IFY A;  3EIH A;  3UJN A;  2L7H A;  1EE8 A;  3SBJ A;  3UMM A;  3IHP A;  1SXJ A;  2GQF A;  4RNA A;  4LJA A;  3HZJ A;  4R7G A;  2F5S A;  3I4Y A;  3IEC A;  1PJI A;  1OAI A;  2L7I A;  1W5T A;  3HX3 A;  4GC9 A;  3QAU A;  4MGK E;  4LJ9 A;  5KQ8 A;  1TR8 A;  1XMQ M;  2CFO A;  2NQ8 C;  1FNN A;  1ZQ9 A;  3PXG A;  5C1B A;  4BBA A;  4PDG A;  1L1T A;  1TDH A;  1PRB A;  2Y20 A;  3R9X B;  5L8R F;  4AZF A;  1SG9 A;  3KP1 E;  1TDZ A;  1PJJ A;  2DEN A;  2DWZ B;  2HAK A;  3SMP A;  1IBM M;  3J7B A;  3MJ5 A;  2KNA A;  3T15 A;  4FW9 A;  1NNJ A;  3KOY E;  2XH9 A;  3SYK A;  4LF5 M;  5DYI A;  3HWS A;  5JI2 E;  4XK8 F;  1QZE A;  1IN7 A;  3JR5 A;  5IT9 S;  1GVN A;  2R6F A;  2DAI A;  3F92 A;  3GRY A;  4Z6Y A;  2D7H A;  1N77 A;  3SAT A;  2B3T A;  5EQT A;  4FWD A;  5FTJ A;  4X64 M;  1OFH A;  4JI0 M;  1HNX M;  2CV1 A;  3VK8 A;  2WZJ A;  4REZ A;  3U5Z B;  4B3M M;  1PM5 A;  1AUA A;  4M9S A;  3HU2 A;  4OVZ A;  3GP1 A;  3DFZ A;  1NJG A;  2QBY B;  4W5W A;  2BNK A;  2KNV A;  1OJL A;  1R2Z A;  4DV3 M;  3HKP A;  3C58 A;  2UUC M;  4NRW A;  1KSF X;  3FUV A;  3FTF A;  4L8R C;  2OPF A;  3PVS A;  2YNM D;  2DHY A;  2EUC A;  3W68 A;  3L27 A;  1I94 M;  3A42 A;  4LFC M;  1SXJ B;  3W0L B;  4Z8X A;  1YE9 A;  3BBZ A;  3EIE A;  3KVW A;  4WP2 A;  3QYE A;  2XSZ A;  4XGI A;  1GO5 A;  3PNY A;  2KW0 A;  5FTL A;  4IBG A;  2MH8 A;  2LHG A;  3SFZ A;  2X8A A;  4JN6 A;  4II7 A;  4R3D A;  4GKK M;  3C9P A;  3T6P A;  2V1C A;  4JI8 M;  4D81 A;  1JR3 A;  1N32 M;  2JWS A;  4FD2 A;  2Z8Y M;  4ANR A;  1YLA A;  3HHW A;  1R5L A;  3GLG E;  4ZPX A;  2C98 A;  3PFI A;  5E26 A;  3L25 A;  1KYI A;  1F4I A;  3AFH A;  4AI6 A;  1IN6 A;  3RGS A;  1PGY A;  2JUJ A;  3GQ3 A;  3GQ4 A;  1DGH A;  4X65 M;  3LMM A;  2CV2 A;  2R18 A;  2R4E A;  2QCU A;  5GKN A;  1XC8 A;  1Q3C A;  3HHX A;  2DAK A;  4DV5 M;  2J5Y A;  4MH0 E;  5KQD A;  3I4V A;  4OVZ B;  3HHZ A;  2Q2E B;  2DZN B;  1MU5 A;  4QOS A;  1E94 E;  3VKG A;  5EXX A;  2MJ5 B;  2DVW B;  1K3W A;  3KP0 E;  2M5Z A;  1JQJ C;  1EFU B;  3THG A;  1VEJ A;  3K8Z A;  3NBX X;  5F3W A;  3B7N A;  2Z4R A;  2I7N A;  1N78 A;  2C9O A;  3U6M A;  1E9R A;  1VDL A;  1QAM A;  2QP9 X;  2K6B A;  2XFT A;  2LHC A;  5FSW A;  1WJ7 A;  4KOD A;  4DUZ M;  2UUB M;  3SYL A;  5ITR A;  1TH3 A;  5FTM A;  3AL0 C;  4MGI E;  1NHG C;  1PJQ A;  4PD2 A;  3LCU A;  2L09 A;  4PT5 A;  2DWM A;  3VDU A;  3E4R A;  2KEB A;  5EJC A;  3FUT A;  1SXJ C;  4LF7 M;  3VKH A;  1TH4 A;  2G3Q A;  1V92 A;  5KPZ A;  2UUA M;  1YUB A;  4DR1 M;  1L1Z A;  1HNW M;  2Y0T A;  1N36 M;  4AG6 A;  1QUT A;  2DAE A;  4LG2 A;  1DGH B;  3DOA A;  2APL A;  3J81 S;  5IZ7 D;  1H6U A;  1HT1 E;  3D8B A;  1D0M A;  3FTD A;  3JR4 A;  2QNJ A;  1W5S A;  2LVN C;  2JZ1 A;  4F1I A;  4AKI A;  5KPR A;  4DV4 M;  4NSR A;  1IXS A;  2KA6 B;  1NJF A;  1XB2 B;  3L2A A;  1D0K A;  2BJV A;  3CF6 E;  4LGY A;  3FKE A;  1S3S A;  3OTO M;  4LF8 M;  3SC3 A;  1NV8 A;  3A98 B;  2ZTD A;  2KRK A;  1D2N A;  1J09 A;  2G5G X;  2VQE M;  2VQF M;  2F5Q A;  4GHA A;  1QAN A;  2ZBK B;  4GIT A;  2F5P A;  4LFB M;  1XMO M;  2DZL A;  4I8O A;  1G3I A;  3GLH B;  2HKJ A;  3LQQ A;  1J7K A;  4LJ6 A;  4P16 A;  2MR9 A;  5EP1 A; 
#chains in the Genus database with same CATH homology
 4TUW A;  4FWG A;  2E5L M;  4EIW A;  3VFD A;  3U6Q A;  3DA1 A;  1IQP A;  3RE8 A;  4L4U A;  3K1J A;  1SXJ E;  3GQ5 A;  3TWM A;  1IY1 A;  4GIP A;  4IBD A;  3U6P A;  1IBL M;  1IY0 A;  1Q3B A;  4G6Z A;  3HJS A;  1QAQ A;  5ITX A;  2J7O A;  1MX0 A;  4JI3 M;  1GKI A;  1DO2 A;  4JI4 M;  3KOZ E;  2UXB M;  1LV7 A;  4L15 A;  3GPY A;  4GKJ M;  4FCV A;  1R7R A;  1J5E M;  3GPU A;  2HL7 A;  3GPX A;  2XZU A;  4NRV A;  4JXJ A;  1IXS B;  4DV7 M;  2CHV A;  1IXR C;  4IBC A;  4NOO B;  3DZD A;  4RF0 A;  5EP2 A;  3J27 B;  3GO8 A;  2HCB A;  1HNZ M;  5FTK A;  1X37 A;  4GC5 A;  3KSX A;  4NXN M;  4FWH A;  4B7G A;  1UM8 A;  1DGB A;  5ITX E;  4MGZ E;  2R62 A;  3L28 A;  2YFQ A;  1L8Q A;  3H4M A;  2C5R A;  3AOE A;  4AKG A;  1TH2 A;  3AKZ A;  4NXM M;  3K2L A;  3GRU A;  3B9P A;  4G4N A;  3J2P B;  5ITT A;  2V1U A;  3KXE C;  2XGN A;  4B3T M;  2CV0 A;  2RGH A;  4FVM A;  3AJI B;  1XNQ M;  3HJ8 A;  1G4A E;  5EXT A;  3L26 A;  1NSF A;  4GRI A;  4QOZ C;  5EP3 A;  2CHQ A;  3U61 A;  3HHY A;  5KPT A;  2KZS A;  4KHP M;  3T38 A;  4MGY E;  3L29 A;  3U60 A;  1N75 A;  4OX9 M;  2AHM A;  3QWL A;  3FYC A;  4IBI A;  4JI6 M;  4PCZ A;  4NSO B;  2XLJ A;  5E6J A;  4B7F A;  3GLF A;  1NHW C;  4QHS A;  1NY5 A;  1Z59 A;  4G4Q A;  1XHB A;  2KZU A;  4DV1 M;  1ORY B;  1Z5A A;  1DGG A;  3Q8X A;  3KOW E;  1Z5B A;  3SAV A;  1G59 A;  2H1R A;  3HU3 A;  4YHH M;  4LCB A;  4LF6 M;  4JYA M;  3D8L A;  1XNR M;  2Z7J A;  3SAR A;  3GLH A;  1T3T A;  4LY6 A;  3R8F A;  4JV5 M;  2X49 A;  3MHV C;  2ZM6 M;  2DZO B;  3GLI A;  2KRU A;  5H37 D;  4M9X A;  4B08 A;  3A46 A;  4AKH A;  3UGJ A;  3T1H M;  3T1Y M;  1E9S A;  1C1K A;  4FCT A;  5ITY A;  3J80 S;  1GL6 A;  3CTW B;  2DHR A;  3BOS A;  4IBB A;  1IN8 A;  3U6O A;  4GMQ A;  3NWL A;  2C99 A;  4MM3 B;  2O5R A;  3U61 B;  1NY6 A;  4I81 A;  1IXZ A;  4DR3 M;  2LH0 A;  4MGH A;  1QAO A;  4ITQ A;  4L16 A;  3U60 B;  2CUZ A;  4KLN A;  3RFW A;  1SXJ D;  2RKO A;  5KO3 A;  2DWL A;  4LJ7 A;  1TGU A;  3GLF B;  1QYR A;  3GRV A;  8CAT A;  1IBK M;  3SAW A;  4A3V B;  4DV6 M;  3FUW A;  2FFJ A;  7CAT A;  1G8P A;  1Q39 A;  2R65 A;  3PNV A;  3UK6 A;  2X4A A;  4LRS A;  4CIS A;  2F5N A;  4M0W A;  4CHT B;  4FCW A;  4HL4 A;  4HLQ A;  5ITU A;  2G8L A;  1R2Y A;  3E9S A;  5FTN A;  4JI7 M;  2BJW A;  4B7H A;  2J7N A;  4IJF A;  1WXQ A;  4BLC A;  2ZAM A;  3GLI B;  4MB7 A;  5BPV A;  5IRE B;  1IN4 A;  2XF3 A;  3RGP A;  1DGF A;  1R6B X;  4DUY M;  3U6C A;  1NVM A;  2K47 A;  3KW6 A;  4DR5 M;  3KFU G;  2R4J A;  1QZM A;  2QPA A;  3AOE C;  4QNR A;  5LMU M;  3U6S A;  2F4V M;  5DYG A;  4LGM A;  5EXP A;  4AG5 A;  5IWA M;  2YQZ A;  3TE6 A;  4YY3 M;  4BB9 A;  3U6L A;  1OFI A;  3SMS A;  4QNM A;  4XBO A;  3M6A A;  3VLF B;  1XWI A;  4OW0 A;  4JI1 M;  5JI3 E;  1Z5C A;  3KDS E;  3U6E A;  2A5Y B;  4LF9 M;  1IN5 A;  3SAS A;  3TWL A;  4LF4 M;  4IJE A;  2ERC A;  2RGO A;  3ZH9 B;  3GRR A;  3KS4 A;  2UXC M;  2XSZ D;  3ZCB B;  1IY2 A;  2W82 A;  4IBE A;  4WW0 A;  2EA0 A;  2DXI A;  3JAM S;  2OQ4 A;  3CF2 A;  4LZZ A;  2XFS A;  4DR2 M;  4JI5 M;  1I4W A;  4K0K M;  1XXH A;  3SHF A;  2VII A;  4M9Z A;  1HR0 M;  4G4O A;  4D82 A;  3LVV A;  4NL4 H;  1GLN A;  2P5T A;  1JR3 D;  4D80 A;  1HT2 E;  4IIW A;  3FUU A;  3HJQ A;  4LZJ A;  2UU9 M;  1HQC A;  4DR7 M;  5EP4 A;  3GLG A;  3K92 A;  2C96 A;  2XEP A;  3LVW A;  1K3X A;  3M0E A;  3HGI A;  3J7A S;  4DR6 M;  5BR8 M;  5A2Q S;  1QQW A;  1E32 A;  1N34 M;  2XZF A;  3M7G A;  3FYD A;  5LMN M;  4AQY M;  2CE7 A;  2LNH C;  3ILK A;  2FOI C;  1HQY E;  4LJ5 A;  3TPZ A;  2Y21 A;  4KO8 A;  1QVR A;  2EO2 A;  2V6Z M;  4DV0 M;  2Y0Q A;  4CGY B;  4LJ4 A;  4LRT A;  2JA2 A;  3ZC7 B;  4AW4 A;  1YSY A;  3GPP A;  4B3R M;  2HHH M;  2QEN A;  2CHG A;  3WHL A;  1DO0 A;  3CF0 A;  3TWK A;  1L2B A;  2M60 A;  3SAU A;  4I5S A;  2CEA A;  1Z6T A;  3IG5 A;  1XXH B;  2FE8 A;  3SHG B;  3KSJ A;  4OU7 A;  3FUX A;  3AOG A;  2D7G A;  4IBJ A;  4M0D A;  3TL4 X;  1N33 M;  1GL7 A;  4X62 M;  2Z3X A;  2F5O A;  3KS8 A;  1K82 A;  1IM2 A;  3FTC A;  4GHL A;  4DV2 M;  3TQS A;  2QZ4 A;  4LFA M;  3U6D A;  2I7P A;  3GLG B;  2Z4S A;  3KOX E;  4X66 M;  4GH9 A;  4IBK A;  3I51 A;  2R46 A;  4WUR A;  3FTE A;  3A45 A;  4LJ8 A;  5ITQ A;  5EXS A;  1KFV A;  5DNY A;  2KXE A;  3IG8 A;  1G41 A;  3FD9 A;  5FLX S;  5C18 A;  1L2D A;  2L6O A;  3UZU A;  2ZAN A;  4QHT A;  1NNU C;  2LWX A;  3WHK A;  2YR0 A;  4G4R A;  2LXE A;  2DWN A;  3VK7 A;  2R45 A;  3NBI A;  3AV0 A;  1VDD A;  4IBF A;  4JI2 M;  4RF1 A;  2ZAO A;  4L78 A;  1L2C A;  3W0F A;  3U5Z A;  2FNA A;  4S12 A;  1ZAE A;  4B3S M;  2UXD M;  3HU1 A;  3VDP A;  3LQR A;  2C9C A;  3MK6 A;  4PDI A;  2QBY A;  1FJG M;  2D7E A;  4I4L A;  4DR4 M;  3EIH A;  3UJN A;  2L7H A;  1EE8 A;  3SBJ A;  3UMM A;  1SXJ A;  4RNA A;  4LJA A;  4R7G A;  2F5S A;  3I4Y A;  1PJI A;  2L7I A;  4MGK E;  1W5T A;  4GC9 A;  3QAU A;  4LJ9 A;  5KQ8 A;  1XMQ M;  2CFO A;  2NQ8 C;  1FNN A;  1ZQ9 A;  3PXG A;  5C1B A;  4BBA A;  4PDG A;  1L1T A;  1TDH A;  2Y20 A;  3R9X B;  4AZF A;  3KP1 E;  1TDZ A;  1PJJ A;  2DWZ B;  3SMP A;  1IBM M;  3J7B A;  3MJ5 A;  3T15 A;  4FW9 A;  1NNJ A;  3KOY E;  2XH9 A;  3SYK A;  4LF5 M;  5DYI A;  3HWS A;  5JI2 E;  3JR5 A;  5IT9 S;  1IN7 A;  1GVN A;  4Z6Y A;  3GRY A;  2D7H A;  1N77 A;  3SAT A;  4X64 M;  5EQT A;  4FWD A;  5FTJ A;  2CV1 A;  1OFH A;  4JI0 M;  1HNX M;  3VK8 A;  4REZ A;  3U5Z B;  4B3M M;  1PM5 A;  4M9S A;  3HU2 A;  4OVZ A;  3GP1 A;  3DFZ A;  1NJG A;  2QBY B;  4W5W A;  2BNK A;  1R2Z A;  1OJL A;  3FTF A;  4DV3 M;  3HKP A;  3C58 A;  2UUC M;  4NRW A;  1KSF X;  3FUV A;  4L8R C;  2OPF A;  3PVS A;  2YNM D;  2EUC A;  3L27 A;  1I94 M;  3A42 A;  4LFC M;  1SXJ B;  3W0L B;  4Z8X A;  1YE9 A;  3EIE A;  3KVW A;  2XSZ A;  4XGI A;  2KW0 A;  5FTL A;  4IBG A;  3SFZ A;  2X8A A;  4JN6 A;  4II7 A;  4R3D A;  4GKK M;  2V1C A;  4JI8 M;  4D81 A;  1JR3 A;  1N32 M;  4FD2 A;  3HHW A;  4ZPX A;  2C98 A;  3PFI A;  5E26 A;  3L25 A;  1KYI A;  3AFH A;  4AI6 A;  1IN6 A;  3RGS A;  3GQ3 A;  3GQ4 A;  1DGH A;  4X65 M;  3LMM A;  2CV2 A;  2R18 A;  2R4E A;  2QCU A;  5GKN A;  1XC8 A;  1Q3C A;  3HHX A;  4DV5 M;  4MH0 E;  5KQD A;  3I4V A;  4OVZ B;  3HHZ A;  2Q2E B;  2DZN B;  1MU5 A;  4QOS A;  1E94 E;  3VKG A;  5EXX A;  2DVW B;  1K3W A;  3KP0 E;  2M5Z A;  1JQJ C;  3THG A;  5F3W A;  3K8Z A;  2Z4R A;  2I7N A;  1N78 A;  2C9O A;  3U6M A;  1E9R A;  1QAM A;  2QP9 X;  2XFT A;  5FSW A;  4KOD A;  4DUZ M;  2UUB M;  3SYL A;  5ITR A;  1TH3 A;  5FTM A;  3AL0 C;  4MGI E;  1NHG C;  4PD2 A;  2L09 A;  4PT5 A;  2DWM A;  3VDU A;  3E4R A;  2KEB A;  5EJC A;  3FUT A;  1SXJ C;  4LF7 M;  3VKH A;  1TH4 A;  5KPZ A;  2UUA M;  1YUB A;  4DR1 M;  1L1Z A;  1HNW M;  2Y0T A;  1N36 M;  4AG6 A;  4LG2 A;  1DGH B;  3DOA A;  3J81 S;  5IZ7 D;  1H6U A;  1HT1 E;  3D8B A;  3FTD A;  3JR4 A;  1W5S A;  4AKI A;  5KPR A;  4DV4 M;  4NSR A;  2KA6 B;  1NJF A;  3L2A A;  2BJV A;  3CF6 E;  4LGY A;  3FKE A;  1S3S A;  3OTO M;  4LF8 M;  3SC3 A;  3A98 B;  2KRK A;  1D2N A;  1J09 A;  2G5G X;  2VQE M;  2VQF M;  2F5Q A;  4GHA A;  1QAN A;  2ZBK B;  4GIT A;  2F5P A;  4LFB M;  1XMO M;  4I8O A;  1G3I A;  3GLH B;  2HKJ A;  3LQQ A;  1J7K A;  4LJ6 A;  4P16 A;  3PNY A;  5EP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...