4LFCM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfcM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfcM02
1Z5AA 1Z5CA 1N34M 1L2DA 1MU5A 3SAUA 1NNJA 5ITRA 4B3TM 4LFCM 1HNWM 3U6LA 4JI7M 2VQEM 1XC8A 2F5OA 4KHPM 3GQ5A 1L1ZA 3W0FA 4LF5M 5ITTA 1R2ZA 4JI3M 1K3WA 1Z5BA 4NXNM 2F5QA 2F5PA 4B3SM 3A45A 2HHHM 2F4VM 3SAVA 4PD2A 3GPYA 4DR2M 3JR5A 4ITQA 3TWMA 4JI8M 1L2CA 2F5NA 1FJGM 1EE8A 3GPPA 5ITXE 4NRVA 4MB7A 4DR1M 3U6PA 1IBLM 3U6DA 4DUYM 5FLXS 1XMOM 4JI6M 4DR3M 4DV7M 1N36M 2UXDM 4X65M 5ITXA 2OQ4A 3J81S 1KFVA 4CISA 4K0KM 3VK8A 5LMNM 4DV2M 1L2BA 4GKKM 5LMUM 1Q39A 2UUAM 4JV5M 1Z59A 3OTOM 2XZFA 4G4OA 1XMQM 1I94M 1HNXM 4G4NA 3SASA 3U6MA 1HR0M 3JR4A 3TWKA 1XNRM 3JAMS 2HKJA 3U6OA 3GQ3A 4DV0M 3SAWA 2UUBM 2EA0A 2UU9M 3VK7A 3DOAA 3SBJA 4B3RM 4JYAM 4YY3M 4G4QA 4LFBM 4PCZA 4PDIA 2E5LM 4NXMM 1HNZM 2ZM6M 2VQFM 1N32M 1MX0A 1L1TA 3SATA 3U6CA 3C58A 4GKJM 3J80S 5IT9S 2UXBM 3T1HM 3U6SA 2F5SA 3GP1A 4DR7M 4X64M 4DV5M 3A46A 3T1YM 4LF4M 4DR6M 4LF6M 3GPUA 1XNQM 3J7AS 4JI4M 1R2YA 4X62M 1K82A 5A2QS 3GO8A 2ZBKB 5IWAM 4JI5M 1IBMM 4JI0M 1TDZA 4LFAM 4YHHM 3GPXA 2XZUA 1PJIA 4JI1M 4NRWA 4PDGA 4JI2M 4DR4M 5ITQA 1PM5A 4X66M 4DV4M 3GQ4A 1N33M 3SARA 3U6QA 4LF7M 4AQYM 1Q3BA 4G4RA 4OX9M 4DR5M 4DV6M 1K3XA 5ITYA 3U6EA 3A42A 1IBKM 2UUCM 2OPFA 4DV1M 4B3MM 4LF8M 1PJJA 2UXCM 4DV3M 2Q2EB 5BR8M 1TDHA 1Q3CA 4LF9M 3TWLA 5ITUA 1J5EM 4DUZM
chains in the Genus database with same CATH superfamily
3AJIB 2ZAMA 3KOXE 1N34M 2ERCA 3FRHA 5EJCA 4LZJA 4NC6A 2QBYB 3ZC7B 2VF8A 4Q7JA 4A3VB 4F2LA 1DV0A 3E21A 4GHAA 4AZFA 1XC8A 1WGNA 2C9CA 4KHPM 3FTEA 3HHZA 2R18A 3PNYA 4I5SA 3W0FA 5JI2E 3FTCA 1CUKA 3HJQA 4JI3M 4GHLA 3FYDA 2J7OA 5F3WA 2F5PA 2FNAA 2OO9A 2HHHM 3W68A 2MJ5B 2C99A 4MGKE 3SAVA 2CHQA 7CATA 4DR2M 3C3EA 1YLAA 1NY5A 2C98A 2J5YA 1L2CA 3B74A 3T15A 2CHGA 2QP9X 1EE8A 2APLA 1JB0F 5DNYA 3UGJA 3K9PA 3U6PA 1GL6A 4DUYM 3QWLA 1HQCA 3H4JA 2L7HA 1XXHA 3GRVA 4RF1A 5FLXS 4DV7M 4QOZC 3FTFA 1IY1A 2XFSA 2UXDM 3B7NA 5DFLA 1KFVA 3KP1E 1EFUB 5LMNM 1W5TA 4LJAA 2WSEF 1OJLA 3AOEA 2HCBA 1SXJA 4MGIE 3GLHA 3IECA 3K92A 3KVWA 2KRKA 3KXEC 3A98B 3TL4X 2JP7A 1IXRC 1XMQM 3T6PA 2LHCA 1YUBA 4LRSA 3SMPA 1IM2A 3TQSA 3JR4A 1G71A 3TWKA 3GLFE 3ILKA 1XNRM 2R4EA 4IBJA 2DAIA 3JAMS 2FOIC 2CRUA 1NHWC 2JUJA 3GQ3A 3U6OA 1N77A 2G5GX 3J2PB 1QYRA 3DOAA 3KP0E 1IN6A 4JYAM 2DWZB 1NJGA 2BWEA 1EIJA 4PDIA 2E5LM 4NXMM 3L27A 5EQTA 1MX0A 3NWLA 3F92A 2LTUA 3C58A 4OU7A 2RGHA 1IQPA 4NL4H 3J80S 1NY6A 4GKJM 3T1HM 5IT9S 4ZPXA 1X37A 3IHPA 4L16A 3U6SA 1VEGA 4XBOA 4DR7M 4X64M 3SFZA 4NSRA 2KEBA 1GL7A 4DV5M 3EIEA 2VIIA 2K0BX 3KS8A 4DR6M 2OOAA 3HJ8A 4R7GA 2ZTDA 3CF2A 1YSYA 5EXSA 2HWJA 4X62M 4JI4M 5A2QS 2FH0A 3J27B 5KPTA 4IBKA 2XF3A 1VDLA 4WW0A 2W82A 1IBMM 1J7KA 2N35A 3GLGE 1PJTA 2P5TA 2XZUA 4NRWA 4IJEA 1WGLA 1OFHA 5ITQA 5KO3A 1DGHB 1ORYB 1NJFA 2LWXA 1N33M 3I51A 3SARA 4L8RC 4LRTA 4AQYM 3LMMA 1WIVA 4P17A 1D0LA 3L2AA 2DWMA 2O5RA 1NNUC 1S3SA 1IBKM 3U6EA 2K47A 3A42A 4ANRA 2UXCM 3LCUA 1N78A 2LVNC 1PJJA 1I4WA 1MJGM 2QQ8A 4QNMA 5BR8M 4CHTB 4HLQA 1WR1B 4L4UA 4LF9M 1SG9A 2JXNA 3CGWA 3TWLA 1OAOC 1J5EM 3FUXA 1E94E 3K8ZA 1NNJA 1BVSA 2KRUA 3KDSE 1JR3D 3PFIA 3Q8GA 2EJSA 4MGZE 3KFUG 1R4GA 4KODA 2CP8A 3U6LA 4JI7M 4AKIA 2X49A 5E6JA 4BLCA 3M6AA 1PJQA 4LZZA 5C18A 1YE9A 1L1ZA 2JWSA 4GRIA 2DI0A 3BOSA 2J7NA 2QHOB 2HL7A 3UMMA 3GRUA 1T6OA 5ITTA 3GLGB 3GLIE 1Z5BA 3LVWA 1K3WA 4L6V6 4FWDA 4B3SM 3PVSA 1IY2A 5IREB 1IN8A 2KDLA 4AG6A 2F4VM 2H1RA 2CV2A 1NVMA 3GPYA 5FTNA 3CF0A 2L4FA 4AI6A 1OQYA 3L29A 3U60B 2JY5A 2R6FA 2F5NA 1FJGM 1TH4A 1NHGC 4MB7A 2DXIA 1F4IA 4I81A 2FS1A 3U6DA 3IG5A 4IJFA 2EUCA 4JI6M 1D0MA 2XFTA 3AOGA 2X4AA 3MJ5A 2OQ4A 4K0KM 2R44A 3VK8A 1OAIA 1QUTA 3KOYE 2LXEA 4OVZB 4GKKM 1XHBA 1QANA 4LJ5A 2EKFA 5EXPA 1Q39A 1IXSB 3DFZA 3FUWA 3FYCA 3KS4A 2V6ZM 3NBIA 3OTOM 2R65A 2WSFF 4FW9A 2GQFA 3L25A 4AG5A 1TH3A 3GLFB 1R2ZA 4MM3B 4MGHA 1QVRA 4G4OA 2JA2A 2XZFA 3U61B 4G4NA 1V33A 2DAMA 2X8AA 3QYEA 4XGIA 2LNHC 3HU3A 3K2LA 2EO2A 3B7ZA 3VFDA 3SMSA 5L8RF 4G3OA 3SAWA 4IBDA 2DNAA 2KNVA 1G59A 1RU3A 1QDTA 2DAEA 4IBCA 2ZTCA 2JNHA 4R3DA 3CF6E 3I01M 4Y28F 4PCZA 4G4QA 4LFBM 1HNZM 5FTMA 2ZM6M 2M5ZA 3D8LA 3E9SA 1GO5A 2QCUA 4LJ8A 4R71A 1L1TA 3SATA 1OFIA 2RGOA 3C9PA 2QENA 4Z6YA 1VQ1A 2MR9A 1IN7A 1DGHA 2WSCF 4QHTA 3GP1A 4IBGA 1R7RA 3HHWA 4REZA 5KQDA 2ZANA 1JR3E 4RKUF 3FTDA 1R2YA 3BXWA 4UN2B 2R46A 2C5RA 2I7NA 3K1JA 4KT0F 4L78A 3I4YA 2CWBA 4JI0M 4LFAM 1XB2B 5EXTA 4LF5M 3KOWE 2Z7JA 2XSZA 3HJSA 4FCTA 4GEWA 4HEOA 4MGYE 4P16A 4PDGA 2NQ8C 4FWHA 4X66M 3MHVC 4DV4M 3R9XB 1WXQA 3GQ4A 2H5XA 4LGYA 4L15A 4LF7M 5H37D 2LH0A 4DR5M 2L4EA 3FUVA 1R6BX 3FUTA 3LVVA 1V92A 4B3MM 3AKZA 2DAKA 5FTKA 2UUCM 4LF8M 4GIPA 2LBCA 4W5WA 2V1CA 4S12A 5EXXA 1XWIA 2Q2EB 2L2DA 2QZ4A 1IN5A 1Q3CA 3I4VA 2Y20A 2JZ0A 3B7QA 1Z5AA 1Z5CA 1MU5A 4QNRA 4B7GA 4BBAA 4KLNA 5ITRA 3GLFA 1J09A 4LFCM 8CATA 3L28A 1HNWM 1ZAEA 2KHHA 4F1IA 1IN4A 1TTEA 2KNAA 2O01F 1QDRA 3HX3A 1LTMA 4CIZA 2F5OA 4OVZA 3GQ5A 1PJSA 2YQZA 1HT2E 4LJ4A 5EP2A 3J7BA 2DHRA 1D0KA 2BJVA 1QAMA 2DENA 4M9XA 2LVPC 3C3DA 1VEKA 2BNKA 4XK8F 1XXHB 3VDPA 3A45A 3QYBA 2XSZD 1LV7A 5IZ7D 4IBEA 3DA1A 4RNAA 4PD2A 1WJ7A 2D7HA 2Z4SA 1GLNA 3AOEC 1XXHE 1T43A 3CTWB 3V76A 1WHCA 3Q8XA 2JY7A 1IBLM 4QHSA 2BWBA 5C1BA 2R45A 2DZOB 4FD2A 4NOOB 1XMOM 2L09A 3SHFA 2O25A 3FUUA 4IBFA 4CISA 3J81S 3GLIB 3UK6A 4DV2M 1H6UA 4LCBA 3AFHA 4B7FA 2DHYA 4B08A 5LMUM 2UUAM 3U61A 4JV5M 1Z59A 3GRRA 4IIWA 2LVQD 4B7HA 3HU1A 2DZLA 1OTRA 3FE3A 2HAKA 2B3TA 2V1UA 2Z3XA 3E46A 3SC3A 1ZMWA 5KQ8A 1NO1A 3RE8A 3ZQJA 1IXSA 2C9OA 2BJWA 3GLHE 4JXJA 1HNXM 3SASA 1E9RA 3ZCBB 1DGGA 2KZSA 2XLJA 3U6MA 5DYGA 2M60A 1SXJC 2HKJA 4OW0A 2L6OA 1E9SA 2D7EA 2UUBM 2EA0A 4QOSA 4B3RM 1AIPC 1SXJD 4TUWA 3FKEA 1TF0B 5JI3E 1N32M 3UJNA 1T3TA 3VKGA 3U60A 1W5SA 1V34A 3SHGB 3B9PA 5EP1A 3KSJA 3VLFB 1N75A 4M9ZA 4D80A 3LCVB 1AUAA 1MN3A 4G6ZA 3I04M 3A46A 3T1YM 3HHYA 3R8FA 1VG5A 2QPAA 3AV0A 3W0LB 4LF4M 4AKGA 4DBGB 3GLGA 1XNQM 4I4LA 4BB9A 3HZJA 3J7AS 3RGSA 4GMQA 2DAGA 2AHMA 2KZUA 1QUSA 2K6BA 5FTLA 3KW6A 3KSXA 1TDZA 3H4MA 1E32A 2CV0A 1DGBA 1DGFA 1PJIA 2QBYA 4JI1M 1ZMUA 2K9DA 4WURA 1R5LA 4LG2A 1PM5A 1NV8A 3GRYA 5FTJA 2RKOA 2CV1A 4FWGA 2FE8A 2ZAOA 2MGWA 3HY5A 3RFWA 2C96A 3IG8A 1Q3BA 4OX9M 2R4JA 2DKLA 4M0DA 4DV6M 3ZH9B 1K3XA 2G8LA 2LHGA 5ITYA 2OOBA 4DV1M 4DV3M 3T38A 2FFJA 1G3IA 1GABA 4JN6A 2JZ1A 1QZMA 3LW5F 2DWNA 2MH8A 3HKPA 2VDBB 2DZNB 4NXNM 1TH2A 1A5TA 1Q02A 5ITUA 1OKSA 4D81A 1L2DA 4GITA 3SAUA 3D8BA 2KA6B 4B3TM 2L7IA 1QQWA 3HU2A 3THGA 2WZJA 1HQYE 2VQEM 4EIWA 3AL0C 3SYKA 3RGPA 4LJ7A 1IXZA 2Y21A 3QAUA 3LQRA 3U5ZB 1UM8A 1VDDA 2MROB 3TE6A 4AW4A 2CFOA 2F5QA 5KPRA 4LY6A 2A5YB 2YFQA 2VF7A 4M0WA 2GNOA 4ITQA 2I7PA 2KXEA 3JR5A 3TWMA 4JI8M 1DO0A 3GLIA 1KSFX 3GPPA 4NRVA 5GKNA 5ITXE 3LQQA 4MH0E 1QAQA 4PT5A 1C1KA 3SYLA 4DR1M 1Z6TA 4II7A 5E26A 3E4RA 2G3QA 2R62A 1TGUA 2RRUA 2CHVA 2Y0TA 3NBXX 4DR3M 1N36M 1IFYA 1TR8A 2Z4RA 2YNMD 3PNVA 5ITXA 1ZMVA 4NSOB 4CGYB 5BPVA 4X65M 4AKHA 2LVOC 1L2BA 3KOZE 2Y0QA 3VKHA 2JY6B 4RF0A 4LJ9A 3W67A 1GKIA 1G4AE 3EIHA 1G8PA 1I94M 1Y8GA 1GJTA 1KYIA 2Z8YM 3GLHB 1SXJB 1C7YA 4FCWA 5KPZA 1HR0M 1FNNA 1GVNA 3FD9A 2D7GA 4KO8A 4GC5A 4GH9A 3HGIA 4DV0M 2XEPA 2XH9A 4IBIA 3TPZA 2UU9M 3VK7A 1NV9A 3SBJA 3M0EA 2DWLA 4HL4A 4YY3M 5DYIA 1ZV1A 3HWSA 2R0IA 4FVMA 2VQFM 3WHLA 4M9SA 1OIZA 2CEAA 3L26A 3U6CA 1IY0A 4LJ6A 4FCVA 1JR3A 1ZQ9A 4I8OA 2UXBM 1VEJA 1NSFA 2F5SA 3K9OA 2YR0A 4LF6M 3GPUA 1HT1E 4Z8XA 4GC9A 1SXJE 3UZUA 1K82A 3DZDA 5FSWA 3HHXA 3GO8A 1UFZA 3VDUA 2ZBKB 5IWAM 1PGYA 4YHHM 3MMPA 2EKKA 1P3QQ 3GPXA 3U5ZA 2CE7A 4JI2M 4DR4M 2CUZA 1L8QA 1QAOA 3B89A 2KW0A 1HJPA 3M7GA 1DO2A 2QSFX 2QNJA 2XGNA 4IBBA 3U6QA 4CJ6A 4G4RA 1GJSA 4D82A 1D2NA 3MK6A 4LGMA 1PRBA 1OIPA 2OPFA 3FRIA 2KNZA 1QZEA 5EP4A 1TDHA 2DVWB 5EP3A 2LVAA 3WHKA 3PXGA 1G41A 2JY8A 1JQJC 4WP2A 3BBZA 4JI5M 4DUZM
chains in the Genus database with same CATH topology
3AJIB 2ZAMA 3KOXE 1N34M 2ERCA 5EJCA 4LZJA 2QBYB 3ZC7B 4A3VB 4GHAA 4AZFA 1XC8A 4KHPM 2C9CA 3FTEA 3HHZA 2R18A 3PNYA 4I5SA 3W0FA 5JI2E 3FTCA 3HJQA 4JI3M 4GHLA 3FYDA 2J7OA 5F3WA 2F5PA 2FNAA 2HHHM 2C99A 4MGKE 3SAVA 2CHQA 7CATA 4DR2M 1NY5A 2C98A 1L2CA 3T15A 2CHGA 2QP9X 1EE8A 5DNYA 3UGJA 3U6PA 1GL6A 4DUYM 3QWLA 1HQCA 5FLXS 2L7HA 1XXHA 3GRVA 1JQJC 4RF1A 4DV7M 4QOZC 3FTFA 1IY1A 2XFSA 2UXDM 1KFVA 3KP1E 5LMNM 1W5TA 4LJAA 1OJLA 3AOEA 2HCBA 1SXJA 4MGIE 3GLHA 3K92A 3KVWA 2KRKA 3KXEC 3A98B 3TL4X 1XMQM 1IXRC 1YUBA 4LRSA 3SMPA 1IM2A 3TQSA 3JR4A 3TWKA 1XNRM 3ILKA 2R4EA 4IBJA 3JAMS 2FOIC 3U6OA 1NHWC 3GQ3A 1N77A 2G5GX 3J2PB 1QYRA 3DOAA 3KP0E 1IN6A 4JYAM 2DWZB 1NJGA 4PDIA 2E5LM 4NXMM 3L27A 5EQTA 1MX0A 3NWLA 3C58A 4OU7A 2RGHA 1IQPA 4NL4H 3J80S 1NY6A 4GKJM 3T1HM 5IT9S 4ZPXA 1X37A 3U6SA 4L16A 4XBOA 4DR7M 4X64M 3SFZA 4NSRA 2KEBA 1GL7A 4DV5M 3EIEA 2VIIA 3KS8A 4DR6M 3HJ8A 4R7GA 3CF2A 5EXSA 1YSYA 4JI4M 4X62M 5A2QS 3J27B 5KPTA 4IBKA 2XF3A 4WW0A 2W82A 1IBMM 1J7KA 2P5TA 2XZUA 4NRWA 4IJEA 1OFHA 5ITQA 5KO3A 1DGHB 1ORYB 1NJFA 2LWXA 1N33M 3I51A 3SARA 4L8RC 4LRTA 4AQYM 3LMMA 3L2AA 2DWMA 2O5RA 1NNUC 1S3SA 1IBKM 3U6EA 2K47A 3A42A 2UXCM 1N78A 1PJJA 1I4WA 4QNMA 5BR8M 4CHTB 4HLQA 4L4UA 4LF9M 3TWLA 1J5EM 3FUXA 1E94E 3K8ZA 1NNJA 2KRUA 1JR3D 3PFIA 4MGZE 3KFUG 4KODA 3U6LA 4JI7M 4AKIA 2X49A 5E6JA 4BLCA 3M6AA 4LZZA 5C18A 1YE9A 1L1ZA 4GRIA 3BOSA 4LF5M 2J7NA 2HL7A 3UMMA 5ITTA 3GRUA 3GLGB 1R2ZA 1K3WA 1Z5BA 3LVWA 4FWDA 4B3SM 3PVSA 1IY2A 5IREB 1IN8A 4AG6A 2F4VM 2H1RA 2CV2A 1NVMA 3GPYA 5FTNA 3CF0A 4AI6A 3L29A 3U60B 2F5NA 1FJGM 1TH4A 1NHGC 4MB7A 2DXIA 4I81A 3U6DA 3IG5A 4IJFA 2EUCA 4JI6M 2XFTA 3AOGA 2X4AA 3MJ5A 2OQ4A 4K0KM 3VK8A 3KOYE 2LXEA 4OVZB 4GKKM 1XHBA 1QANA 4LJ5A 5EXPA 1Q39A 1IXSB 3DFZA 3FUWA 3FYCA 3KS4A 2V6ZM 3NBIA 3OTOM 2R65A 4FW9A 3L25A 4AG5A 1TH3A 3GLFB 4MM3B 4MGHA 1QVRA 4G4OA 2JA2A 2XZFA 3U61B 4G4NA 2X8AA 4XGIA 2LNHC 3HU3A 3K2LA 2EO2A 3VFDA 3SMSA 3SAWA 4IBDA 1G59A 4IBCA 4R3DA 3CF6E 4G4QA 4PCZA 4LFBM 1HNZM 5FTMA 2ZM6M 2M5ZA 3D8LA 3E9SA 2QCUA 4LJ8A 1L1TA 3SATA 1OFIA 2RGOA 2QENA 4Z6YA 1IN7A 1DGHA 4QHTA 3GP1A 4IBGA 1R7RA 3HHWA 4REZA 5KQDA 2ZANA 3FTDA 1R2YA 2R46A 2I7NA 3K1JA 4L78A 3I4YA 4JI0M 4LFAM 5EXTA 3KOWE 2Z7JA 2XSZA 3HJSA 4FCTA 4PDGA 4P16A 4MGYE 2NQ8C 4FWHA 4X66M 3MHVC 4DV4M 3R9XB 1WXQA 3GQ4A 4LGYA 4L15A 4LF7M 5H37D 2LH0A 4DR5M 3FUVA 1R6BX 3FUTA 3LVVA 4B3MM 3AKZA 5FTKA 2UUCM 4LF8M 4GIPA 4W5WA 2V1CA 4S12A 5EXXA 1XWIA 2Q2EB 2QZ4A 1IN5A 1Q3CA 3I4VA 2Y20A 1Z5AA 1Z5CA 1MU5A 4QNRA 4B7GA 4BBAA 4KLNA 5ITRA 3GLFA 1J09A 4LFCM 8CATA 3L28A 1HNWM 1ZAEA 1IN4A 2F5OA 4OVZA 3GQ5A 2YQZA 1HT2E 4LJ4A 5EP2A 3J7BA 2DHRA 2BJVA 4M9XA 1QAMA 2BNKA 1XXHB 3VDPA 3A45A 2XSZD 1LV7A 5IZ7D 4IBEA 3DA1A 4RNAA 4PD2A 2D7HA 2Z4SA 1GLNA 3AOEC 3CTWB 3Q8XA 1IBLM 4QHSA 5C1BA 2R45A 2DZOB 4FD2A 4NOOB 1XMOM 2L09A 3SHFA 3FUUA 4IBFA 4CISA 3J81S 3GLIB 3UK6A 4DV2M 1H6UA 4LCBA 3AFHA 4B7FA 4B08A 5LMUM 2UUAM 3U61A 4JV5M 1Z59A 3GRRA 4IIWA 4B7HA 3HU1A 2V1UA 2Z3XA 3SC3A 5KQ8A 3RE8A 2C9OA 1HNXM 2BJWA 4JXJA 3SASA 1E9RA 3ZCBB 1DGGA 2KZSA 2XLJA 3U6MA 5DYGA 2M60A 1SXJC 2HKJA 4OW0A 2L6OA 1E9SA 2D7EA 2UUBM 2EA0A 4QOSA 4B3RM 1SXJD 4TUWA 3FKEA 5JI3E 1N32M 3UJNA 1T3TA 3VKGA 3U60A 1W5SA 3SHGB 3B9PA 5EP1A 3KSJA 3VLFB 1N75A 4M9ZA 4D80A 4G6ZA 3A46A 3T1YM 3HHYA 3R8FA 4LF4M 2QPAA 3AV0A 3W0LB 4AKGA 3GLGA 1XNQM 4I4LA 4BB9A 3J7AS 3RGSA 4GMQA 2KZUA 2AHMA 5FTLA 3KW6A 3KSXA 1TDZA 3H4MA 1E32A 2CV0A 1DGBA 1DGFA 1PJIA 2QBYA 4JI1M 4WURA 4LG2A 1PM5A 3GRYA 5FTJA 2RKOA 2CV1A 4FWGA 2FE8A 2ZAOA 3RFWA 2C96A 3IG8A 1Q3BA 4OX9M 2R4JA 4M0DA 4DV6M 3ZH9B 1K3XA 2G8LA 5ITYA 4DV1M 4DV3M 3T38A 2FFJA 1G3IA 4JN6A 1QZMA 2DWNA 3HKPA 2DZNB 4NXNM 1TH2A 5ITUA 4D81A 1L2DA 4GITA 3SAUA 3D8BA 2KA6B 4B3TM 2L7IA 1QQWA 3HU2A 3THGA 1HQYE 2VQEM 4EIWA 3AL0C 3SYKA 3RGPA 4LJ7A 1IXZA 2Y21A 3QAUA 3LQRA 3U5ZB 1UM8A 1VDDA 3TE6A 4AW4A 2CFOA 2F5QA 5KPRA 4LY6A 2A5YB 2YFQA 4M0WA 4ITQA 2I7PA 2KXEA 3JR5A 3TWMA 4JI8M 1DO0A 3GLIA 1KSFX 3GPPA 4NRVA 5GKNA 5ITXE 3LQQA 4MH0E 1QAQA 4PT5A 1C1KA 3SYLA 4DR1M 1Z6TA 4II7A 5E26A 3E4RA 2R62A 1TGUA 4DR3M 2CHVA 2Y0TA 1N36M 2Z4RA 5BPVA 2YNMD 3PNVA 5ITXA 4NSOB 4CGYB 4X65M 4AKHA 1L2BA 3KOZE 2Y0QA 3VKHA 4RF0A 4LJ9A 1GKIA 1G4AE 3EIHA 1G8PA 1I94M 3GLHB 1KYIA 1SXJB 4FCWA 5KPZA 1HR0M 1FNNA 1GVNA 3FD9A 2D7GA 4KO8A 4GC5A 4GH9A 3HGIA 4DV0M 2XEPA 2XH9A 4IBIA 3TPZA 2UU9M 3VK7A 3SBJA 3M0EA 2DWLA 4HL4A 4YY3M 5DYIA 3HWSA 4FVMA 2VQFM 4M9SA 2CEAA 3L26A 3U6CA 1IY0A 4LJ6A 4FCVA 1JR3A 1ZQ9A 4I8OA 2UXBM 1NSFA 2F5SA 2YR0A 4LF6M 3GPUA 1HT1E 4Z8XA 4GC9A 1SXJE 3UZUA 1K82A 3DZDA 5FSWA 3HHXA 3GO8A 3VDUA 2ZBKB 5IWAM 4YHHM 3GPXA 3U5ZA 2CE7A 4JI2M 4DR4M 2CUZA 1L8QA 1QAOA 2KW0A 3M7GA 1DO2A 2XGNA 3U6QA 4IBBA 4G4RA 4D82A 1D2NA 3MK6A 4LGMA 2OPFA 5EP4A 1TDHA 2DVWB 5EP3A 3WHKA 3PXGA 1G41A 3KDSE 3WHLA 2C5RA 4JI5M 4DUZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5A A;  1Z5C A;  1N34 M;  1L2D A;  1MU5 A;  3SAU A;  1NNJ A;  5ITR A;  4B3T M;  4LFC M;  1HNW M;  3U6L A;  4JI7 M;  2VQE M;  1XC8 A;  2F5O A;  4KHP M;  3GQ5 A;  1L1Z A;  3W0F A;  4LF5 M;  5ITT A;  1R2Z A;  4JI3 M;  1K3W A;  1Z5B A;  4NXN M;  2F5Q A;  2F5P A;  4B3S M;  3A45 A;  2HHH M;  2F4V M;  3SAV A;  4PD2 A;  3GPY A;  4DR2 M;  3JR5 A;  4ITQ A;  3TWM A;  4JI8 M;  1L2C A;  2F5N A;  1FJG M;  1EE8 A;  3GPP A;  5ITX E;  4NRV A;  4MB7 A;  4DR1 M;  3U6P A;  1IBL M;  3U6D A;  4DUY M;  5FLX S;  1XMO M;  4JI6 M;  4DR3 M;  4DV7 M;  1N36 M;  2UXD M;  4X65 M;  5ITX A;  2OQ4 A;  3J81 S;  1KFV A;  4CIS A;  4K0K M;  3VK8 A;  5LMN M;  4DV2 M;  1L2B A;  4GKK M;  5LMU M;  1Q39 A;  2UUA M;  4JV5 M;  1Z59 A;  3OTO M;  2XZF A;  4G4O A;  1XMQ M;  1I94 M;  1HNX M;  4G4N A;  3SAS A;  3U6M A;  1HR0 M;  3JR4 A;  3TWK A;  1XNR M;  3JAM S;  2HKJ A;  3U6O A;  3GQ3 A;  4DV0 M;  3SAW A;  2UUB M;  2EA0 A;  2UU9 M;  3VK7 A;  3DOA A;  3SBJ A;  4B3R M;  4JYA M;  4YY3 M;  4G4Q A;  4LFB M;  4PCZ A;  4PDI A;  2E5L M;  4NXM M;  1HNZ M;  2ZM6 M;  2VQF M;  1N32 M;  1MX0 A;  1L1T A;  3SAT A;  3U6C A;  3C58 A;  4GKJ M;  3J80 S;  5IT9 S;  2UXB M;  3T1H M;  3U6S A;  2F5S A;  3GP1 A;  4DR7 M;  4X64 M;  4DV5 M;  3A46 A;  3T1Y M;  4LF4 M;  4DR6 M;  4LF6 M;  3GPU A;  1XNQ M;  3J7A S;  4JI4 M;  1R2Y A;  4X62 M;  1K82 A;  5A2Q S;  3GO8 A;  2ZBK B;  5IWA M;  4JI5 M;  1IBM M;  4JI0 M;  1TDZ A;  4LFA M;  4YHH M;  3GPX A;  2XZU A;  1PJI A;  4JI1 M;  4NRW A;  4PDG A;  4JI2 M;  4DR4 M;  5ITQ A;  1PM5 A;  4X66 M;  4DV4 M;  3GQ4 A;  1N33 M;  3SAR A;  3U6Q A;  4LF7 M;  4AQY M;  1Q3B A;  4G4R A;  4OX9 M;  4DR5 M;  4DV6 M;  1K3X A;  5ITY A;  3U6E A;  3A42 A;  1IBK M;  2UUC M;  2OPF A;  4DV1 M;  4B3M M;  4LF8 M;  1PJJ A;  2UXC M;  4DV3 M;  2Q2E B;  5BR8 M;  1TDH A;  1Q3C A;  4LF9 M;  3TWL A;  5ITU A;  1J5E M;  4DUZ M; 
#chains in the Genus database with same CATH topology
 3AJI B;  2ZAM A;  3KOX E;  1N34 M;  2ERC A;  3FRH A;  5EJC A;  4LZJ A;  4NC6 A;  2QBY B;  3ZC7 B;  2VF8 A;  4Q7J A;  4A3V B;  4F2L A;  1DV0 A;  3E21 A;  4GHA A;  4AZF A;  1XC8 A;  1WGN A;  2C9C A;  4KHP M;  3FTE A;  3HHZ A;  2R18 A;  3PNY A;  4I5S A;  3W0F A;  5JI2 E;  3FTC A;  1CUK A;  3HJQ A;  4JI3 M;  4GHL A;  3FYD A;  2J7O A;  5F3W A;  2F5P A;  2FNA A;  2OO9 A;  2HHH M;  3W68 A;  2MJ5 B;  2C99 A;  4MGK E;  3SAV A;  2CHQ A;  7CAT A;  4DR2 M;  3C3E A;  1YLA A;  1NY5 A;  2C98 A;  2J5Y A;  1L2C A;  3B74 A;  3T15 A;  2CHG A;  2QP9 X;  1EE8 A;  2APL A;  1JB0 F;  5DNY A;  3UGJ A;  3K9P A;  3U6P A;  1GL6 A;  4DUY M;  3QWL A;  1HQC A;  3H4J A;  2L7H A;  1XXH A;  3GRV A;  4RF1 A;  5FLX S;  4DV7 M;  4QOZ C;  3FTF A;  1IY1 A;  2XFS A;  2UXD M;  3B7N A;  5DFL A;  1KFV A;  3KP1 E;  1EFU B;  5LMN M;  1W5T A;  4LJA A;  2WSE F;  1OJL A;  3AOE A;  2HCB A;  1SXJ A;  4MGI E;  3GLH A;  3IEC A;  3K92 A;  3KVW A;  2KRK A;  3KXE C;  3A98 B;  3TL4 X;  2JP7 A;  1IXR C;  1XMQ M;  3T6P A;  2LHC A;  1YUB A;  4LRS A;  3SMP A;  1IM2 A;  3TQS A;  3JR4 A;  1G71 A;  3TWK A;  3GLF E;  3ILK A;  1XNR M;  2R4E A;  4IBJ A;  2DAI A;  3JAM S;  2FOI C;  2CRU A;  1NHW C;  2JUJ A;  3GQ3 A;  3U6O A;  1N77 A;  2G5G X;  3J2P B;  1QYR A;  3DOA A;  3KP0 E;  1IN6 A;  4JYA M;  2DWZ B;  1NJG A;  2BWE A;  1EIJ A;  4PDI A;  2E5L M;  4NXM M;  3L27 A;  5EQT A;  1MX0 A;  3NWL A;  3F92 A;  2LTU A;  3C58 A;  4OU7 A;  2RGH A;  1IQP A;  4NL4 H;  3J80 S;  1NY6 A;  4GKJ M;  3T1H M;  5IT9 S;  4ZPX A;  1X37 A;  3IHP A;  4L16 A;  3U6S A;  1VEG A;  4XBO A;  4DR7 M;  4X64 M;  3SFZ A;  4NSR A;  2KEB A;  1GL7 A;  4DV5 M;  3EIE A;  2VII A;  2K0B X;  3KS8 A;  4DR6 M;  2OOA A;  3HJ8 A;  4R7G A;  2ZTD A;  3CF2 A;  1YSY A;  5EXS A;  2HWJ A;  4X62 M;  4JI4 M;  5A2Q S;  2FH0 A;  3J27 B;  5KPT A;  4IBK A;  2XF3 A;  1VDL A;  4WW0 A;  2W82 A;  1IBM M;  1J7K A;  2N35 A;  3GLG E;  1PJT A;  2P5T A;  2XZU A;  4NRW A;  4IJE A;  1WGL A;  1OFH A;  5ITQ A;  5KO3 A;  1DGH B;  1ORY B;  1NJF A;  2LWX A;  1N33 M;  3I51 A;  3SAR A;  4L8R C;  4LRT A;  4AQY M;  3LMM A;  1WIV A;  4P17 A;  1D0L A;  3L2A A;  2DWM A;  2O5R A;  1NNU C;  1S3S A;  1IBK M;  3U6E A;  2K47 A;  3A42 A;  4ANR A;  2UXC M;  3LCU A;  1N78 A;  2LVN C;  1PJJ A;  1I4W A;  1MJG M;  2QQ8 A;  4QNM A;  5BR8 M;  4CHT B;  4HLQ A;  1WR1 B;  4L4U A;  4LF9 M;  1SG9 A;  2JXN A;  3CGW A;  3TWL A;  1OAO C;  1J5E M;  3FUX A;  1E94 E;  3K8Z A;  1NNJ A;  1BVS A;  2KRU A;  3KDS E;  1JR3 D;  3PFI A;  3Q8G A;  2EJS A;  4MGZ E;  3KFU G;  1R4G A;  4KOD A;  2CP8 A;  3U6L A;  4JI7 M;  4AKI A;  2X49 A;  5E6J A;  4BLC A;  3M6A A;  1PJQ A;  4LZZ A;  5C18 A;  1YE9 A;  1L1Z A;  2JWS A;  4GRI A;  2DI0 A;  3BOS A;  2J7N A;  2QHO B;  2HL7 A;  3UMM A;  3GRU A;  1T6O A;  5ITT A;  3GLG B;  3GLI E;  1Z5B A;  3LVW A;  1K3W A;  4L6V 6;  4FWD A;  4B3S M;  3PVS A;  1IY2 A;  5IRE B;  1IN8 A;  2KDL A;  4AG6 A;  2F4V M;  2H1R A;  2CV2 A;  1NVM A;  3GPY A;  5FTN A;  3CF0 A;  2L4F A;  4AI6 A;  1OQY A;  3L29 A;  3U60 B;  2JY5 A;  2R6F A;  2F5N A;  1FJG M;  1TH4 A;  1NHG C;  4MB7 A;  2DXI A;  1F4I A;  4I81 A;  2FS1 A;  3U6D A;  3IG5 A;  4IJF A;  2EUC A;  4JI6 M;  1D0M A;  2XFT A;  3AOG A;  2X4A A;  3MJ5 A;  2OQ4 A;  4K0K M;  2R44 A;  3VK8 A;  1OAI A;  1QUT A;  3KOY E;  2LXE A;  4OVZ B;  4GKK M;  1XHB A;  1QAN A;  4LJ5 A;  2EKF A;  5EXP A;  1Q39 A;  1IXS B;  3DFZ A;  3FUW A;  3FYC A;  3KS4 A;  2V6Z M;  3NBI A;  3OTO M;  2R65 A;  2WSF F;  4FW9 A;  2GQF A;  3L25 A;  4AG5 A;  1TH3 A;  3GLF B;  1R2Z A;  4MM3 B;  4MGH A;  1QVR A;  4G4O A;  2JA2 A;  2XZF A;  3U61 B;  4G4N A;  1V33 A;  2DAM A;  2X8A A;  3QYE A;  4XGI A;  2LNH C;  3HU3 A;  3K2L A;  2EO2 A;  3B7Z A;  3VFD A;  3SMS A;  5L8R F;  4G3O A;  3SAW A;  4IBD A;  2DNA A;  2KNV A;  1G59 A;  1RU3 A;  1QDT A;  2DAE A;  4IBC A;  2ZTC A;  2JNH A;  4R3D A;  3CF6 E;  3I01 M;  4Y28 F;  4PCZ A;  4G4Q A;  4LFB M;  1HNZ M;  5FTM A;  2ZM6 M;  2M5Z A;  3D8L A;  3E9S A;  1GO5 A;  2QCU A;  4LJ8 A;  4R71 A;  1L1T A;  3SAT A;  1OFI A;  2RGO A;  3C9P A;  2QEN A;  4Z6Y A;  1VQ1 A;  2MR9 A;  1IN7 A;  1DGH A;  2WSC F;  4QHT A;  3GP1 A;  4IBG A;  1R7R A;  3HHW A;  4REZ A;  5KQD A;  2ZAN A;  1JR3 E;  4RKU F;  3FTD A;  1R2Y A;  3BXW A;  4UN2 B;  2R46 A;  2C5R A;  2I7N A;  3K1J A;  4KT0 F;  4L78 A;  3I4Y A;  2CWB A;  4JI0 M;  4LFA M;  1XB2 B;  5EXT A;  4LF5 M;  3KOW E;  2Z7J A;  2XSZ A;  3HJS A;  4FCT A;  4GEW A;  4HEO A;  4MGY E;  4P16 A;  4PDG A;  2NQ8 C;  4FWH A;  4X66 M;  3MHV C;  4DV4 M;  3R9X B;  1WXQ A;  3GQ4 A;  2H5X A;  4LGY A;  4L15 A;  4LF7 M;  5H37 D;  2LH0 A;  4DR5 M;  2L4E A;  3FUV A;  1R6B X;  3FUT A;  3LVV A;  1V92 A;  4B3M M;  3AKZ A;  2DAK A;  5FTK A;  2UUC M;  4LF8 M;  4GIP A;  2LBC A;  4W5W A;  2V1C A;  4S12 A;  5EXX A;  1XWI A;  2Q2E B;  2L2D A;  2QZ4 A;  1IN5 A;  1Q3C A;  3I4V A;  2Y20 A;  2JZ0 A;  3B7Q A;  1Z5A A;  1Z5C A;  1MU5 A;  4QNR A;  4B7G A;  4BBA A;  4KLN A;  5ITR A;  3GLF A;  1J09 A;  4LFC M;  8CAT A;  3L28 A;  1HNW M;  1ZAE A;  2KHH A;  4F1I A;  1IN4 A;  1TTE A;  2KNA A;  2O01 F;  1QDR A;  3HX3 A;  1LTM A;  4CIZ A;  2F5O A;  4OVZ A;  3GQ5 A;  1PJS A;  2YQZ A;  1HT2 E;  4LJ4 A;  5EP2 A;  3J7B A;  2DHR A;  1D0K A;  2BJV A;  1QAM A;  2DEN A;  4M9X A;  2LVP C;  3C3D A;  1VEK A;  2BNK A;  4XK8 F;  1XXH B;  3VDP A;  3A45 A;  3QYB A;  2XSZ D;  1LV7 A;  5IZ7 D;  4IBE A;  3DA1 A;  4RNA A;  4PD2 A;  1WJ7 A;  2D7H A;  2Z4S A;  1GLN A;  3AOE C;  1XXH E;  1T43 A;  3CTW B;  3V76 A;  1WHC A;  3Q8X A;  2JY7 A;  1IBL M;  4QHS A;  2BWB A;  5C1B A;  2R45 A;  2DZO B;  4FD2 A;  4NOO B;  1XMO M;  2L09 A;  3SHF A;  2O25 A;  3FUU A;  4IBF A;  4CIS A;  3J81 S;  3GLI B;  3UK6 A;  4DV2 M;  1H6U A;  4LCB A;  3AFH A;  4B7F A;  2DHY A;  4B08 A;  5LMU M;  2UUA M;  3U61 A;  4JV5 M;  1Z59 A;  3GRR A;  4IIW A;  2LVQ D;  4B7H A;  3HU1 A;  2DZL A;  1OTR A;  3FE3 A;  2HAK A;  2B3T A;  2V1U A;  2Z3X A;  3E46 A;  3SC3 A;  1ZMW A;  5KQ8 A;  1NO1 A;  3RE8 A;  3ZQJ A;  1IXS A;  2C9O A;  2BJW A;  3GLH E;  4JXJ A;  1HNX M;  3SAS A;  1E9R A;  3ZCB B;  1DGG A;  2KZS A;  2XLJ A;  3U6M A;  5DYG A;  2M60 A;  1SXJ C;  2HKJ A;  4OW0 A;  2L6O A;  1E9S A;  2D7E A;  2UUB M;  2EA0 A;  4QOS A;  4B3R M;  1AIP C;  1SXJ D;  4TUW A;  3FKE A;  1TF0 B;  5JI3 E;  1N32 M;  3UJN A;  1T3T A;  3VKG A;  3U60 A;  1W5S A;  1V34 A;  3SHG B;  3B9P A;  5EP1 A;  3KSJ A;  3VLF B;  1N75 A;  4M9Z A;  4D80 A;  3LCV B;  1AUA A;  1MN3 A;  4G6Z A;  3I04 M;  3A46 A;  3T1Y M;  3HHY A;  3R8F A;  1VG5 A;  2QPA A;  3AV0 A;  3W0L B;  4LF4 M;  4AKG A;  4DBG B;  3GLG A;  1XNQ M;  4I4L A;  4BB9 A;  3HZJ A;  3J7A S;  3RGS A;  4GMQ A;  2DAG A;  2AHM A;  2KZU A;  1QUS A;  2K6B A;  5FTL A;  3KW6 A;  3KSX A;  1TDZ A;  3H4M A;  1E32 A;  2CV0 A;  1DGB A;  1DGF A;  1PJI A;  2QBY A;  4JI1 M;  1ZMU A;  2K9D A;  4WUR A;  1R5L A;  4LG2 A;  1PM5 A;  1NV8 A;  3GRY A;  5FTJ A;  2RKO A;  2CV1 A;  4FWG A;  2FE8 A;  2ZAO A;  2MGW A;  3HY5 A;  3RFW A;  2C96 A;  3IG8 A;  1Q3B A;  4OX9 M;  2R4J A;  2DKL A;  4M0D A;  4DV6 M;  3ZH9 B;  1K3X A;  2G8L A;  2LHG A;  5ITY A;  2OOB A;  4DV1 M;  4DV3 M;  3T38 A;  2FFJ A;  1G3I A;  1GAB A;  4JN6 A;  2JZ1 A;  1QZM A;  3LW5 F;  2DWN A;  2MH8 A;  3HKP A;  2VDB B;  2DZN B;  4NXN M;  1TH2 A;  1A5T A;  1Q02 A;  5ITU A;  1OKS A;  4D81 A;  1L2D A;  4GIT A;  3SAU A;  3D8B A;  2KA6 B;  4B3T M;  2L7I A;  1QQW A;  3HU2 A;  3THG A;  2WZJ A;  1HQY E;  2VQE M;  4EIW A;  3AL0 C;  3SYK A;  3RGP A;  4LJ7 A;  1IXZ A;  2Y21 A;  3QAU A;  3LQR A;  3U5Z B;  1UM8 A;  1VDD A;  2MRO B;  3TE6 A;  4AW4 A;  2CFO A;  2F5Q A;  5KPR A;  4LY6 A;  2A5Y B;  2YFQ A;  2VF7 A;  4M0W A;  2GNO A;  4ITQ A;  2I7P A;  2KXE A;  3JR5 A;  3TWM A;  4JI8 M;  1DO0 A;  3GLI A;  1KSF X;  3GPP A;  4NRV A;  5GKN A;  5ITX E;  3LQQ A;  4MH0 E;  1QAQ A;  4PT5 A;  1C1K A;  3SYL A;  4DR1 M;  1Z6T A;  4II7 A;  5E26 A;  3E4R A;  2G3Q A;  2R62 A;  1TGU A;  2RRU A;  2CHV A;  2Y0T A;  3NBX X;  4DR3 M;  1N36 M;  1IFY A;  1TR8 A;  2Z4R A;  2YNM D;  3PNV A;  5ITX A;  1ZMV A;  4NSO B;  4CGY B;  5BPV A;  4X65 M;  4AKH A;  2LVO C;  1L2B A;  3KOZ E;  2Y0Q A;  3VKH A;  2JY6 B;  4RF0 A;  4LJ9 A;  3W67 A;  1GKI A;  1G4A E;  3EIH A;  1G8P A;  1I94 M;  1Y8G A;  1GJT A;  1KYI A;  2Z8Y M;  3GLH B;  1SXJ B;  1C7Y A;  4FCW A;  5KPZ A;  1HR0 M;  1FNN A;  1GVN A;  3FD9 A;  2D7G A;  4KO8 A;  4GC5 A;  4GH9 A;  3HGI A;  4DV0 M;  2XEP A;  2XH9 A;  4IBI A;  3TPZ A;  2UU9 M;  3VK7 A;  1NV9 A;  3SBJ A;  3M0E A;  2DWL A;  4HL4 A;  4YY3 M;  5DYI A;  1ZV1 A;  3HWS A;  2R0I A;  4FVM A;  2VQF M;  3WHL A;  4M9S A;  1OIZ A;  2CEA A;  3L26 A;  3U6C A;  1IY0 A;  4LJ6 A;  4FCV A;  1JR3 A;  1ZQ9 A;  4I8O A;  2UXB M;  1VEJ A;  1NSF A;  2F5S A;  3K9O A;  2YR0 A;  4LF6 M;  3GPU A;  1HT1 E;  4Z8X A;  4GC9 A;  1SXJ E;  3UZU A;  1K82 A;  3DZD A;  5FSW A;  3HHX A;  3GO8 A;  1UFZ A;  3VDU A;  2ZBK B;  5IWA M;  1PGY A;  4YHH M;  3MMP A;  2EKK A;  1P3Q Q;  3GPX A;  3U5Z A;  2CE7 A;  4JI2 M;  4DR4 M;  2CUZ A;  1L8Q A;  1QAO A;  3B89 A;  2KW0 A;  1HJP A;  3M7G A;  1DO2 A;  2QSF X;  2QNJ A;  2XGN A;  4IBB A;  3U6Q A;  4CJ6 A;  4G4R A;  1GJS A;  4D82 A;  1D2N A;  3MK6 A;  4LGM A;  1PRB A;  1OIP A;  2OPF A;  3FRI A;  2KNZ A;  1QZE A;  5EP4 A;  1TDH A;  2DVW B;  5EP3 A;  2LVA A;  3WHK A;  3PXG A;  1G41 A;  2JY8 A;  1JQJ C;  4WP2 A;  3BBZ A;  4JI5 M;  4DUZ M; 
#chains in the Genus database with same CATH homology
 3AJI B;  2ZAM A;  3KOX E;  1N34 M;  2ERC A;  5EJC A;  4LZJ A;  2QBY B;  3ZC7 B;  4A3V B;  4GHA A;  4AZF A;  1XC8 A;  4KHP M;  2C9C A;  3FTE A;  3HHZ A;  2R18 A;  3PNY A;  4I5S A;  3W0F A;  5JI2 E;  3FTC A;  3HJQ A;  4JI3 M;  4GHL A;  3FYD A;  2J7O A;  5F3W A;  2F5P A;  2FNA A;  2HHH M;  2C99 A;  4MGK E;  3SAV A;  2CHQ A;  7CAT A;  4DR2 M;  1NY5 A;  2C98 A;  1L2C A;  3T15 A;  2CHG A;  2QP9 X;  1EE8 A;  5DNY A;  3UGJ A;  3U6P A;  1GL6 A;  4DUY M;  3QWL A;  1HQC A;  5FLX S;  2L7H A;  1XXH A;  3GRV A;  1JQJ C;  4RF1 A;  4DV7 M;  4QOZ C;  3FTF A;  1IY1 A;  2XFS A;  2UXD M;  1KFV A;  3KP1 E;  5LMN M;  1W5T A;  4LJA A;  1OJL A;  3AOE A;  2HCB A;  1SXJ A;  4MGI E;  3GLH A;  3K92 A;  3KVW A;  2KRK A;  3KXE C;  3A98 B;  3TL4 X;  1XMQ M;  1IXR C;  1YUB A;  4LRS A;  3SMP A;  1IM2 A;  3TQS A;  3JR4 A;  3TWK A;  1XNR M;  3ILK A;  2R4E A;  4IBJ A;  3JAM S;  2FOI C;  3U6O A;  1NHW C;  3GQ3 A;  1N77 A;  2G5G X;  3J2P B;  1QYR A;  3DOA A;  3KP0 E;  1IN6 A;  4JYA M;  2DWZ B;  1NJG A;  4PDI A;  2E5L M;  4NXM M;  3L27 A;  5EQT A;  1MX0 A;  3NWL A;  3C58 A;  4OU7 A;  2RGH A;  1IQP A;  4NL4 H;  3J80 S;  1NY6 A;  4GKJ M;  3T1H M;  5IT9 S;  4ZPX A;  1X37 A;  3U6S A;  4L16 A;  4XBO A;  4DR7 M;  4X64 M;  3SFZ A;  4NSR A;  2KEB A;  1GL7 A;  4DV5 M;  3EIE A;  2VII A;  3KS8 A;  4DR6 M;  3HJ8 A;  4R7G A;  3CF2 A;  5EXS A;  1YSY A;  4JI4 M;  4X62 M;  5A2Q S;  3J27 B;  5KPT A;  4IBK A;  2XF3 A;  4WW0 A;  2W82 A;  1IBM M;  1J7K A;  2P5T A;  2XZU A;  4NRW A;  4IJE A;  1OFH A;  5ITQ A;  5KO3 A;  1DGH B;  1ORY B;  1NJF A;  2LWX A;  1N33 M;  3I51 A;  3SAR A;  4L8R C;  4LRT A;  4AQY M;  3LMM A;  3L2A A;  2DWM A;  2O5R A;  1NNU C;  1S3S A;  1IBK M;  3U6E A;  2K47 A;  3A42 A;  2UXC M;  1N78 A;  1PJJ A;  1I4W A;  4QNM A;  5BR8 M;  4CHT B;  4HLQ A;  4L4U A;  4LF9 M;  3TWL A;  1J5E M;  3FUX A;  1E94 E;  3K8Z A;  1NNJ A;  2KRU A;  1JR3 D;  3PFI A;  4MGZ E;  3KFU G;  4KOD A;  3U6L A;  4JI7 M;  4AKI A;  2X49 A;  5E6J A;  4BLC A;  3M6A A;  4LZZ A;  5C18 A;  1YE9 A;  1L1Z A;  4GRI A;  3BOS A;  4LF5 M;  2J7N A;  2HL7 A;  3UMM A;  5ITT A;  3GRU A;  3GLG B;  1R2Z A;  1K3W A;  1Z5B A;  3LVW A;  4FWD A;  4B3S M;  3PVS A;  1IY2 A;  5IRE B;  1IN8 A;  4AG6 A;  2F4V M;  2H1R A;  2CV2 A;  1NVM A;  3GPY A;  5FTN A;  3CF0 A;  4AI6 A;  3L29 A;  3U60 B;  2F5N A;  1FJG M;  1TH4 A;  1NHG C;  4MB7 A;  2DXI A;  4I81 A;  3U6D A;  3IG5 A;  4IJF A;  2EUC A;  4JI6 M;  2XFT A;  3AOG A;  2X4A A;  3MJ5 A;  2OQ4 A;  4K0K M;  3VK8 A;  3KOY E;  2LXE A;  4OVZ B;  4GKK M;  1XHB A;  1QAN A;  4LJ5 A;  5EXP A;  1Q39 A;  1IXS B;  3DFZ A;  3FUW A;  3FYC A;  3KS4 A;  2V6Z M;  3NBI A;  3OTO M;  2R65 A;  4FW9 A;  3L25 A;  4AG5 A;  1TH3 A;  3GLF B;  4MM3 B;  4MGH A;  1QVR A;  4G4O A;  2JA2 A;  2XZF A;  3U61 B;  4G4N A;  2X8A A;  4XGI A;  2LNH C;  3HU3 A;  3K2L A;  2EO2 A;  3VFD A;  3SMS A;  3SAW A;  4IBD A;  1G59 A;  4IBC A;  4R3D A;  3CF6 E;  4G4Q A;  4PCZ A;  4LFB M;  1HNZ M;  5FTM A;  2ZM6 M;  2M5Z A;  3D8L A;  3E9S A;  2QCU A;  4LJ8 A;  1L1T A;  3SAT A;  1OFI A;  2RGO A;  2QEN A;  4Z6Y A;  1IN7 A;  1DGH A;  4QHT A;  3GP1 A;  4IBG A;  1R7R A;  3HHW A;  4REZ A;  5KQD A;  2ZAN A;  3FTD A;  1R2Y A;  2R46 A;  2I7N A;  3K1J A;  4L78 A;  3I4Y A;  4JI0 M;  4LFA M;  5EXT A;  3KOW E;  2Z7J A;  2XSZ A;  3HJS A;  4FCT A;  4PDG A;  4P16 A;  4MGY E;  2NQ8 C;  4FWH A;  4X66 M;  3MHV C;  4DV4 M;  3R9X B;  1WXQ A;  3GQ4 A;  4LGY A;  4L15 A;  4LF7 M;  5H37 D;  2LH0 A;  4DR5 M;  3FUV A;  1R6B X;  3FUT A;  3LVV A;  4B3M M;  3AKZ A;  5FTK A;  2UUC M;  4LF8 M;  4GIP A;  4W5W A;  2V1C A;  4S12 A;  5EXX A;  1XWI A;  2Q2E B;  2QZ4 A;  1IN5 A;  1Q3C A;  3I4V A;  2Y20 A;  1Z5A A;  1Z5C A;  1MU5 A;  4QNR A;  4B7G A;  4BBA A;  4KLN A;  5ITR A;  3GLF A;  1J09 A;  4LFC M;  8CAT A;  3L28 A;  1HNW M;  1ZAE A;  1IN4 A;  2F5O A;  4OVZ A;  3GQ5 A;  2YQZ A;  1HT2 E;  4LJ4 A;  5EP2 A;  3J7B A;  2DHR A;  2BJV A;  4M9X A;  1QAM A;  2BNK A;  1XXH B;  3VDP A;  3A45 A;  2XSZ D;  1LV7 A;  5IZ7 D;  4IBE A;  3DA1 A;  4RNA A;  4PD2 A;  2D7H A;  2Z4S A;  1GLN A;  3AOE C;  3CTW B;  3Q8X A;  1IBL M;  4QHS A;  5C1B A;  2R45 A;  2DZO B;  4FD2 A;  4NOO B;  1XMO M;  2L09 A;  3SHF A;  3FUU A;  4IBF A;  4CIS A;  3J81 S;  3GLI B;  3UK6 A;  4DV2 M;  1H6U A;  4LCB A;  3AFH A;  4B7F A;  4B08 A;  5LMU M;  2UUA M;  3U61 A;  4JV5 M;  1Z59 A;  3GRR A;  4IIW A;  4B7H A;  3HU1 A;  2V1U A;  2Z3X A;  3SC3 A;  5KQ8 A;  3RE8 A;  2C9O A;  1HNX M;  2BJW A;  4JXJ A;  3SAS A;  1E9R A;  3ZCB B;  1DGG A;  2KZS A;  2XLJ A;  3U6M A;  5DYG A;  2M60 A;  1SXJ C;  2HKJ A;  4OW0 A;  2L6O A;  1E9S A;  2D7E A;  2UUB M;  2EA0 A;  4QOS A;  4B3R M;  1SXJ D;  4TUW A;  3FKE A;  5JI3 E;  1N32 M;  3UJN A;  1T3T A;  3VKG A;  3U60 A;  1W5S A;  3SHG B;  3B9P A;  5EP1 A;  3KSJ A;  3VLF B;  1N75 A;  4M9Z A;  4D80 A;  4G6Z A;  3A46 A;  3T1Y M;  3HHY A;  3R8F A;  4LF4 M;  2QPA A;  3AV0 A;  3W0L B;  4AKG A;  3GLG A;  1XNQ M;  4I4L A;  4BB9 A;  3J7A S;  3RGS A;  4GMQ A;  2KZU A;  2AHM A;  5FTL A;  3KW6 A;  3KSX A;  1TDZ A;  3H4M A;  1E32 A;  2CV0 A;  1DGB A;  1DGF A;  1PJI A;  2QBY A;  4JI1 M;  4WUR A;  4LG2 A;  1PM5 A;  3GRY A;  5FTJ A;  2RKO A;  2CV1 A;  4FWG A;  2FE8 A;  2ZAO A;  3RFW A;  2C96 A;  3IG8 A;  1Q3B A;  4OX9 M;  2R4J A;  4M0D A;  4DV6 M;  3ZH9 B;  1K3X A;  2G8L A;  5ITY A;  4DV1 M;  4DV3 M;  3T38 A;  2FFJ A;  1G3I A;  4JN6 A;  1QZM A;  2DWN A;  3HKP A;  2DZN B;  4NXN M;  1TH2 A;  5ITU A;  4D81 A;  1L2D A;  4GIT A;  3SAU A;  3D8B A;  2KA6 B;  4B3T M;  2L7I A;  1QQW A;  3HU2 A;  3THG A;  1HQY E;  2VQE M;  4EIW A;  3AL0 C;  3SYK A;  3RGP A;  4LJ7 A;  1IXZ A;  2Y21 A;  3QAU A;  3LQR A;  3U5Z B;  1UM8 A;  1VDD A;  3TE6 A;  4AW4 A;  2CFO A;  2F5Q A;  5KPR A;  4LY6 A;  2A5Y B;  2YFQ A;  4M0W A;  4ITQ A;  2I7P A;  2KXE A;  3JR5 A;  3TWM A;  4JI8 M;  1DO0 A;  3GLI A;  1KSF X;  3GPP A;  4NRV A;  5GKN A;  5ITX E;  3LQQ A;  4MH0 E;  1QAQ A;  4PT5 A;  1C1K A;  3SYL A;  4DR1 M;  1Z6T A;  4II7 A;  5E26 A;  3E4R A;  2R62 A;  1TGU A;  4DR3 M;  2CHV A;  2Y0T A;  1N36 M;  2Z4R A;  5BPV A;  2YNM D;  3PNV A;  5ITX A;  4NSO B;  4CGY B;  4X65 M;  4AKH A;  1L2B A;  3KOZ E;  2Y0Q A;  3VKH A;  4RF0 A;  4LJ9 A;  1GKI A;  1G4A E;  3EIH A;  1G8P A;  1I94 M;  3GLH B;  1KYI A;  1SXJ B;  4FCW A;  5KPZ A;  1HR0 M;  1FNN A;  1GVN A;  3FD9 A;  2D7G A;  4KO8 A;  4GC5 A;  4GH9 A;  3HGI A;  4DV0 M;  2XEP A;  2XH9 A;  4IBI A;  3TPZ A;  2UU9 M;  3VK7 A;  3SBJ A;  3M0E A;  2DWL A;  4HL4 A;  4YY3 M;  5DYI A;  3HWS A;  4FVM A;  2VQF M;  4M9S A;  2CEA A;  3L26 A;  3U6C A;  1IY0 A;  4LJ6 A;  4FCV A;  1JR3 A;  1ZQ9 A;  4I8O A;  2UXB M;  1NSF A;  2F5S A;  2YR0 A;  4LF6 M;  3GPU A;  1HT1 E;  4Z8X A;  4GC9 A;  1SXJ E;  3UZU A;  1K82 A;  3DZD A;  5FSW A;  3HHX A;  3GO8 A;  3VDU A;  2ZBK B;  5IWA M;  4YHH M;  3GPX A;  3U5Z A;  2CE7 A;  4JI2 M;  4DR4 M;  2CUZ A;  1L8Q A;  1QAO A;  2KW0 A;  3M7G A;  1DO2 A;  2XGN A;  3U6Q A;  4IBB A;  4G4R A;  4D82 A;  1D2N A;  3MK6 A;  4LGM A;  2OPF A;  5EP4 A;  1TDH A;  2DVW B;  5EP3 A;  3WHK A;  3PXG A;  1G41 A;  3KDS E;  3WHL A;  2C5R A;  4JI5 M;  4DUZ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...