3UK6A

Crystal structure of the tip48 (tip49b) hexamer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
318
structure length
298
Chain Sequence
AHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRITVSLHEIDVINSFLALFKSEVREQINAKVAEWREEGKIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RuvB-like 2
publication title Large-Scale Conformational Flexibility Determines the Properties of AAA+ TIP49 ATPases.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 298
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06068 TIP49 TIP49 P-loop domain
A PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uk6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uk6A01
2YZ2A 4FIDA 5IHPA 4TLEA 1ZM7A 3K0AA 3M1IA 3SZRA 1P2VA 1RYFA 3EIQA 2P6UA 3K9LA 5P21A 3CH4B 2R6AA 3AQ4A 5EE9A 4G5GA 2WKQA 4NH0A 5K8IA 2EYQA 4PC1A 3TVDA 1S3SA 1TPZA 1FMJA 3ZIAA 2IWHA 1G17A 2CCGA 1E2DA 2BKUA 3LX8A 4MKIA 4OQNA 3GLFA 2D62A 4OK3A 4PHHA 4QGGA 4EPYA 3MRSA 2BVNA 4Q47A 4WXRA 2WWIA 3L0SA 1IY0A 2REOA 1SHKA 4QL3A 5FPHA 1GDDA 4RD2A 2OEPA 3EZ7A 3R7WB 2GKSA 4IDNA 1E9CA 2XEXA 4CYMA 3IHWA 3TSWA 3EPLA 5JWOA 4X8LA 3CPJB 4F93B 2F1JA 4M9SA 2VP0A 4GNKA 4A0GA 1GKUB 421PA 1P5ZB 4URVR 2GCNA 3W34A 3BH7A 1VDZA 5CK5A 5CDFA 2EU8A 4AYXA 1Q44A 2H18A 2VO1A 4DBLC 4KU4A 1FW6A 1SKQA 5J4LA 2GESA 1IXRC 3TR5A 4PZZA 3I4LA 1KJZA 1R6BX 4YXWA 4XVRA 4JLDA 2IW3A 4XOIA 2I4IA 3RWMB 5BN4A 2O8BA 1T0JB 4QHYA 5C2JB 3EARA 1L4UA 2FE4A 4HAYA 4DVGA 3B1YA 2ZRGA 4LHWA 1SVLA 1C1KA 3DZ8A 4TYPA 1WB9A 4KXFB 5BN5A 2W2VA 3SC3A 1KI9A 2HCJB 4OQLA 4PR0A 3W3AA 4ABYA 3AVVA 4URWR 1ZU4A 2UVQA 5CITA 2AWNA 5EP3A 1T3LA 1CKEA 2B92A 1Z83A 4EAQA 2ZJAA 3QE0A 1SXJD 5DI3B 5SZKB 3L82B 2ZI6A 3FHCB 2IT1A 3ADKA 1TF2A 3TIFA 4LV5B 4TQAA 3F5FA 3O8BA 4CVNA 1W48A 1E9EA 2QRZA 3D7MA 3SBDA 4B2IA 4D82A 4HZUA 2OO7A 3GLIE 4LPSA 1E79A 3QXSA 4FMCF 4JYCA 4G5RA 4D0GA 1TL7C 3T35A 4I81A 1VIYA 1O87A 3W5JA 1ELOA 4U02A 2AKYA 1QHYA 3RC8A 1P61B 2GZAA 3IQXA 1FUUA 4JVSB 1DELA 1N6OA 2BCJQ 4HAUA 3CIOA 2DFTA 5J47A 2P65A 5UKDA 4YONB 3AEZA 1FOEB 3PIRA 2Y8EA 1OPXA 4R71A 3B1WA 3AKEA 5E7MA 1E4VA 2NG1A 5JHHB 1L4YA 1E99A 1FMLA 2B7CA 4MRVA 3QEOA 1MT0A 2DWPA 2NIPA 4MGIR 1U81A 2QGNA 2CE2X 1KI4A 2IF2A 1FX0B 3BB1A 4KBFA 1W5TA 4AG5A 3N2IA 2XOKA 4C9BA 2DB3A 4F4JA 1B23P 3AVYA 3SYNA 4JN6A 1COWD 1G7SA 1MRNA 1N6HA 3U3KA 1SZPA 4BPBA 3GLFE 3EPJA 4ZCIA 5KNDA 4DB4A 1VCOA 4LDJA 3RS2A 3HR8A 3T1OA 2DFKB 2WMOB 4Q4LA 4QBHA 2O8FA 1U8AA 3TKLA 4JMPA 4LBZA 3KUDA 4ZKEA 3LVRE 2BMJA 4DCVA 2NZJA 1FFHA 3J81k 3M0EA 1NBMD 3SJCA 3X1WA 4IEEA 3L0PA 1ZNYA 3D8BA 4BZQA 3BERA 1KO8A 1SVSA 1AGRA 3AP2A 2ZRDA 3FKSA 3GMTA 4Q1BA 5FI1B 4KV9A 4Q48A 3W5IA 1P60A 3GJ7A 4H1VA 2JGNA 1T8UA 3OF5A 5CIQA 2CVFA 3AF1A 1D6JA 4R98A 1U8YA 1VG9B 5B2ZA 1Q1QA 2ZRBA 2QAJA 5EJEA 2PL3A 2NTYC 4M8NE 2WJIA 1R4AA 2F7SA 3BFVA 4PO8A 2GVDC 4NE2A 4OYHA 1P6XA 2X2FA 2KBEA 1T4GA 2DWZB 2FN4A 2XSZD 1R0XA 1U2RA 4A2WA 1W36D 2ZJZA 2ORWA 2V7QD 5AWFC 2WICA 2A5JA 2QP9X 4AKEA 4UNRA 3O8RA 3CPEA 1PUJA 3VR1A 2JLZA 4JLBA 3NXSA 4CRWB 3LLMA 1KY3A 3ETLA 1P62B 2VSOA 2YWEA 1US8B 3GP8A 2FV8A 1P72A 4PTLA 2CHGA 1NN1A 1ZBDA 4US0R 4V0NA 1OB5A 4IW3B 2DCUA 1CLUA 1U98A 3L43A 3SFVA 3TJZA 2LKCA 3GJ4A 1LS1A 1X8LA 4KYIB 4V0ME 5E3HA 2EVWX 4GOJA 4EPVA 2MMCA 3QY0A 4NBSA 5SZHB 1X8JA 1KZGB 4KI0A 4UXIA 2FH5B 1FTSA 2ZI9A 1DAFA 2Q3MA 3ZYCA 3QSYA 4MUBA 1BH2A 2JCSA 5AJZA 1WF3A 2YYZA 1NKSA 4GOXA 1SVMA 2W2XA 2XB2A 4RZUA 1BKDR 1DPFA 3RHFA 3UXMA 1KJYA 4M2LA 1CR0A 5LD2B 2RGNC 4GFDA 1LF5A 3TUIC 1F60A 2OLJA 5KSOA 5L3QA 1FTNA 1TUIA 5B30A 3RDPA 4PO1A 1E1QD 3LO5A 1Z6TA 4DCSA 4DLZA 5F98A 4LYHA 4A6XA 4IRUB 2DBYA 1YR7A 4Q5IA 3UATA 3MWKA 1E2NA 4RD0A 3NEYA 3QXHA 4O0MA 2VIIA 1CJUC 1PLLA 2RHDA 1QZXA 2CK3A 3BJIC 1NVVQ 4ZIRB 3TBKA 2C99A 4KLNA 4Q1EA 1NVUQ 5BXQC 5HPYB 5JJIA 3UPUA 2ZSBA 4EQ6B 1OV4A 4B2LA 3PUWA 4O2LA 2B7BA 2GEVA 4HAWA 5FUXA 1SQ5A 2A2ZA 4NZYA 4PPQA 5D3QA 3AF3A 3ZZ0A 1ZIOA 2V4ZA 4FWTA 1HURA 1N5KA 4L16A 1NLFA 1OIWA 2YJTD 2BC9A 4S35A 1PLKA 2AFHE 2VRWA 3SFZA 1E2LA 1OSNA 2DR3A 1N6IA 1W4RA 4B32A 2BEJA 2OFOA 3GLHA 3RRYA 1VTKA 2BIFA 2G0NA 4XTCS 3SBEA 1ZU5A 2IUUA 3B9QA 2JJ8A 1SXJC 3CPHA 4II7A 4M53A 3AF4A 2AKAB 1D9XA 2QBYA 4B73A 3JVVA 2WOOA 5E95A 1VYTA 2ZYUX 3CNLA 2ZJ8A 2P0EA 3EZ2A 5TY0A 4ERNA 1LFDB 1QHXA 1HE8B 3TW4A 4OK6A 1NJGA 1KI2A 1V43A 4HUQA 5FOXA 4KSCA 4MYUA 4ASUD 5EXXA 3AVTA 1A4RA 1NVWQ 5A5GA 4UXJA 2OZEA 1XTJA 1K5DA 4Q19A 1SVKA 4ARZA 4JLVA 2V1XA 3BWDD 3LBHA 3KXIA 4IFEA 3WMFA 1O3YA 1CRPA 3EPKA 1OH7A 2F9MA 1NL3A 1X86B 4PXAA 5E4FA 3U3JA 5IT5A 4AI6A 1I4DD 3THOA 5FUVA 4LYAA 2PX3A 4TWZA 2A5DA 4K46A 1LNZA 2CL0X 4R2HA 1K8RA 3GJ8A 2WAYA 1XD8A 3BD9A 4PSAA 4WAUA 3W6PA 4CEHA 4QNMA 2W2TA 2GZHA 2ZSFA 3EIEA 3CW2A 3AB3A 4M4SA 2FA9A 4BGDA 1W4CA 4N3NA 4PHTA 2V6ZM 1OJLA 4PHFA 4D0LB 3I73A 3QXJA 5IK2A 3KUCA 3LLUA 5B58C 1NMXA 2ZQ5A 3GQBA 3NH6A 4C0QC 2FPKA 3PEUA 3OESA 1N6LA 3ZS8A 5FFMA 4URXR 2PBRA 5H70A 1HQYE 2RGNA 5DIFA 4S2EA 1NG1A 3MJHA 1KK1A 2FFQA 2BWJA 5TXGA 1BIFA 4BFSA 2ZEJA 4FN5A 4POAA 1Q3HA 4DLWA 3RVBA 2RAPA 2CHQA 1OXXK 5FUWA 3WMGA 2QROA 1CRQA 1T9HA 2QNRA 4JL8A 5J4YA 2H92A 4I1SA 4PZYA 1KSFX 5K8TA 1G41A 3PV0A 5L3SB 5FPTA 2BMDA 1FUKA 2GBLA 4QC2A 5EE1A 1CS4C 4C2TA 1Z0IA 5DN6D 2ZRLA 4OHYA 1KGDA 2XB4A 3O47A 2H16A 1KZ7B 2ZE8A 4MGYR 1FP7A 3K70B 4FWIB 2Q21A 4E5UA 2QPOA 1JR6A 5BYKA 2XAUA 3TSOA 2GWHA 3AVXA 5KNBA 3HU3A 2GAAA 2WJGA 3MAAC 3CRRA 1E9RA 3CONA 3GLHE 4GMDA 4QBFA 2OBLA 2PEYA 2FEMA 1GNPA 3RABA 1MR3F 4HB0A 4YC7A 5DI9A 4C0KA 4C0HA 1SXJA 5EE3A 3GCGA 3TW8B 1E2EA 1ZUIA 4P0TA 4F7WA 3ONWA 1VG0B 4G5QA 1EX7A 4NDZA 3BOSA 4B48A 2CVHA 1AN0A 2HV8A 4LC0A 2C9OA 4L5BA 5GJCA 1OHHA 2IS2A 3QIAA 1N6PA 1FP6A 4XWOA 3N5CA 1IAQA 3QG5A 5KPDA 3THYB 3TQCA 2D7CA 4TYWA 1N25A 5K8UA 1GKYA 1G291 2MMGA 5KTYA 3CNNA 2F43A 5HZHA 2H8KA 2PJZA 3H2YA 3U4QA 4KFRA 2C77A 1JXMA 1KI3A 1XJ0A 3HP1A 1JR3D 3RRMA 1QBKC 4PQYA 1UAAA 2NO7A 4LBWA 3E5HA 4LRTA 2A5YB 1EWRA 3WNBA 1G18A 2RGGA 2A30A 1NSTA 2QMOA 2IXFA 3WBKA 4WW0A 1KDPA 3B9PA 1CP2A 1W5SA 4ZDJA 2AD1A 1KSHA 1XRJA 3Q7QA 3PEVA 1II8A 2B8WA 3W3ZB 2DWOA 3NBYC 3U7GA 3QF7A 4DDVA 2ZYWX 2O0KA 3W9YA 5B64A 5FTKA 3LRPA 1E2MA 2CE7A 4YLGA 1NY6A 3U44B 1MO6A 4ILEA 4DCNA 1NBMA 4HDCA 3CKLA 2ZR0A 4LJ8A 1E9FA 2PMDA 4FMCB 4GT1A 2XXAB 1TQDA 4P32A 1UBGA 2VP5A 2CMKA 4PAMA 3ZS9A 3JZMA 1YR8A 3GEIA 5F2EA 1Q57A 1KK2A 1Z2CA 2QT1A 1XBTA 5CM8B 3FHOA 3HYRA 1YQTA 4A36A 2OSBA 3DM5A 4XVUA 1Y3AA 4ACAA 2JATA 3MD0A 2ZRIA 1V5WA 2OCYC 2XJ9A 5AJXA 4K81B 4TQUS 3FWYA 3SI7A 2RGBA 5JJKA 3CF2A 2V7QA 3UG7A 1DAEA 1KAGA 2ORVA 1II0A 1QHHA 4QXAA 2YC4C 4EPTA 5JZVA 3GLGB 1FNNA 5JFGA 4P3YA 5GJVC 2GEDA 2G83A 1E2FA 1P2TA 2FSGA 1NMZA 3I8XA 2HJVA 1EWQA 1W36B 5DO9A 4UNQA 4BFYA 3DOEA 4EKDA 1YHNA 3QVVA 3SYKA 3A4NA 1QHHB 1YKSA 2OAQ1 4NCHA 5EXTA 3IKJA 3VLFB 5KNCA 3TQFA 1UFQA 4FMBB 1KMHB 1TF7A 2X2EA 5L3VA 3WXMA 1M34E 5EE0A 1U90A 2D4HA 3NHBA 5LB4A 3JZAA 4JLPA 1KOFA 4OJQA 3AVOA 1KNQA 1OXUA 3IEUA 1JALA 3QG1A 3IQWA 4NL4H 5HCNA 4C7OA 1RRPA 2VF8A 4Q9HA 2B6HA 3SOPA 4B74A 1UKEA 2P2LA 1KJWA 3A37A 1Z0FA 3RSOA 4NCNA 4AWXA 3U7FB 2YWGA 4YQFA 4IDHA 4TL6A 3KJIA 2ZRAA 4JT2A 1ODFA 5EXPA 2XX3A 1ZNXA 1E96A 2N1BA 1R7RA 4JVNA 4A8JA 2AFIE 1U0LA 4HLUC 4RJLA 3NBXX 4Q9KA 3Q3JB 2PH1A 4IOJA 1T6NA 3KTAB 2W6JD 1R8QA 2XJ4A 1E1QA 3FMIA 2BMFA 4GI7A 4AIIA 4A8JB 5AJYA 2ZYVX 1HH4A 4D25A 4TQ9A 4V0KA 1J99A 2BKEA 2NO9A 1EFHA 2YOHA 5JSZB 2AL7A 1ZRHA 4NYJQ 1F2UA 3VU9A 1ETUA 5FR2A 2PLRA 3QKRA 2WHXA 1NKTA 1S9HA 3IO3A 3VMFA 2Q9AA 1R10A 1E32A 2CLSA 4FWDA 2BBSA 1XXHB 2WJYA 2PX0A 1OXTA 4TL7A 1G8FA 3FYHA 1U8ZA 4B43A 4CIDA 2J0VA 2WSSD 3ADCA 2V3CC 1AGPA 2C9YA 4RD4A 4RCYA 3KQKA 2QGZA 4HLCA 3H1TA 2WJJA 1J8YF 1IY1A 1VHLA 1GILA 2N46A 3GFOA 3KKPA 3GFTA 1UBFA 4XWKA 1GL7A 1G1MA 2D74A 3QENA 2ECKA 4Q1AA 2W83A 3OFND 4Z8YA 1RKBA 1ZM4A 3WHLA 3QF4B 4LYFA 4LHVA 4YMSA 3WYFA 2G0TA 3TK1A 5FPSA 1DAGA 2C8VA 2R6GA 4A1FA 1W0KD 2JJ1A 5SZJA 2REXB 1VMAA 1CF4A 4NYIQ 4LJ9A 1Z2AA 4LV8B 4M1YA 5FH9A 4JKYA 3X1DA 4Q4AA 2QZ4A 1DEKA 2R6FA 2O8EB 4OI2A 3I92A 4D80A 1AQYA 221PA 2ZRFA 1OH8A 2QY9A 3UK6A 1EGAA 1W2GA 1UEIA 1PZNA 4P4TA 4HZIA 4JL5A 4WBSA 2ANBA 2CCKA 1DO2A 4BRWA 2FPLA 4DLYA 3IBGA 4OHWA 4Q4AB 3PFIA 3QBVA 2P6RA 3EA5A 4PX9A 2CNWD 4AURA 2ZRKA 1SKYE 1WE2A 1U0HC 1SVOA 4HEJA 1NVXQ 1EX6A 2OBNA 4DKXA 2R44A 4HATA 3R7WA 5A4JA 1IXZA 4MYHA 2FX3A 4Q18A 2WAXA 4JJKA 3RS4A 3K1JA 3TNFA 4JBWA 3V9PA 1TTTA 5FTMA 3RRNA 3GLIB 5JWHA 3SS8A 3U3RA 5AK0A 2RHMA 2IYRA 4OKSA 3NIBA 4B2PA 2YOFA 5FOVA 1X37A 4HLUA 3T12A 1YR6A 1IM2A 1W4BA 2O0JA 2J7KA 1P9RA 1L8QA 1XPRA 4RZ3A 2ATVA 1Q12A 1OKKD 4EPRA 1JJVA 1FQJA 4M1KA 3AP3A 4GL2A 2JDIA 1Z28A 1KO4A 1TEXA 1OW3B 3K0CC 2VHJA 1UPTA 3B82A 2FWRA 1OFTA 1QZMA 4Q9LA 2VLIA 2IYUA 3EC2A 4LWZA 3K70D 4YMUA 3M6AA 3I5XA 1M7BA 2I1VB 2O0HA 3AF0A 3HPRA 4KFUA 4FW9A 2ZI4A 1RIFA 1R2QA 2J59A 3OIVA 3THXB 2ZJOA 4EPWA 1YE8A 2ZUBA 2VP2A 5DI3A 4M1MA 1KO1A 1NIJA 1W47A 2GXQA 2IEYA 4EFNA 2ZSDA 1EG7A 4TMVA 3RS5A 3W8RA 3VKGA 2ZUCA 4CEIB 2KRKA 4M1SA 1IBRA 4OK5A 2H17A 3FFBA 2GVZC 3A36A 4GDFA 2W58A 1OF1A 2J3EA 3KJGA 1A2KC 5KU1A 4D4MA 1ZIPA 4FCVA 2F1IA 4G01B 2BBOA 2C03A 2PZFA 4HYYA 4QBIA 5C18A 3W6NA 4BZXA 1Q0UA 3S1AB 5KPJA 1W4AA 1Z8FA 3FKQA 1Q1EA 1AIPA 2V9PA 4HB2A 3H0KA 4KYUA 5DYGA 1GOTA 1MO5A 4MITA 3BH0A 4D4KA 2KSQA 5LD2C 5KSZA 2XGJA 1JEEA 2MSDB 4A15A 4OHZA 2IS4A 3VNUA 1ZP6A 5K8LA 2A9KA 1FX0A 1Z0KA 1GRNA 2JLVA 4Y0AA 4N0DA 3ICEA 2CLDX 1NVMA 4LJ6A 3R8FA 2BJWA 1KI7A 2ZYTX 3LVQE 4LRWA 3HYTA 4WZAE 4C4PA 4Z54A 2RGXA 3WYAA 1JR3A 1T5LA 4JYBA 5G53C 1I2MA 1XFAA 1IN6A 1OH6A 2DWQA 3UKDA 1XD2B 1WMSA 3MHVC 1G5PA 4IVRA 2ZAOA 2IC5A 4M9XA 2RGCA 5EZ5A 3Q8XB 3VKHA 2ZUDA 3CWZA 4QJ5A 1Z63A 4TSFD 3KXKA 4WVFA 3VQTA 4DDWA 3Q85A 5KDOA 4R9UC 4JLNA 3ZZUA 1G3MA 2ZS7A 1TADA 2QMHA 3C4JA 3NWJA 5KDDA 1E9AA 1UBCA 3DMDA 1B0UA 1ANKA 1S1MA 2YHSA 1GWNA 1TQ6A 1VKJA 3PXGA 3QOFA 4TTPA 1XD9A 1LTQA 5JBQA 3K0CA 5CDFE 5FPYA 1BO6A 3LBIA 1WP9A 4OJKA 1LB1B 4RCZA 3SHFA 5G3ZA 1NNEA 3KKQA 2OT3B 4MRSA 5FI0B 1E0AA 5H68A 1JBKA 5TV2A 2G9NA 2AD5A 3EASA 4IDPA 1UBEA 1II9A 2KE5A 4EUNA 2UZ3A 2ATXA 3ASYA 5EUQB 2X77A 5AUQA 1US8A 2HXSA 4PZLA 1PJRA 1KO5A 4DT1A 3QXCA 3DMNA 2X8AA 2XTNA 2PJRA 3T5DA 3TUZC 1E0SA 1IHUA 1QVAA 4IEIA 5AUNB 2VYFA 4G3XA 4UNNA 4DDUA 2FFHA 1Z0JA 3FFAA 4BZPA 5JECA 1W46A 1TUEA 5EP4A 2FGJA 2C5LA 4C0AC 5BN3A 4HLQB 1ZAKA 3GEHA 3L0IB 4I99A 4DT1B 1HYQA 1Q1ZA 3ND8A 1NRJB 4DEXA 2DY1A 3I5YA 4LZZA 1GFIA 1A82A 521PA 2RGEA 3ZGXA 1AS2A 1P2SA 1XTRA 4FMDF 821PA 2GK7A 1AQUA 3IDQA 3LXXA 2AN9A 3K0SA 4TLBA 1A1VA 4D26A 1P3JA 2F3RA 4DDTA 1G8PA 3QEJA 1QF9A 4JLOA 5EP2A 1G6OA 3LQRA 3LAWA 2P5TB 1YRAA 4U5XA 3AH8A 3T15A 2W00A 1XZQA 3EZ6A 2J9RA 1ZUNB 2WSMA 1D8TA 1P73A 4YMTA 4W5JA 1EFCA 2MSEB 1FL9A 2Z43A 4X8HA 2G6BA 4TYNA 1NP6A 2FSFA 3GJ0A 1M7GA 1YZNA 1XCMA 3BBPA 5JWRA 3EAQA 2EQBA 2CHVA 1DOAA 4YMWA 2XNDA 4TT3A 4ZIRA 2NO6A 4O3MA 2W6JA 4E22A 1WA5A 4EQ6A 3EG5A 4PSVA 1F2TA 1Z47A 2G1JA 1UADA 1XEWY 2XZPA 2J41A 3SDZA 3BGWA 4F4CA 1MO3A 3KKOA 2ZJBA 3NHAA 1YR9A 5TVKA 3UG6A 3K70C 1IOZA 2JLSA 4UQOA 4XD7D 3NDBB 1N3BA 1F2TB 3U7EB 2QE7D 5LDDC 2GBLC 1NI3A 5CIWA 3CH5A 3LNCA 2YNMA 3IPYA 2IXGA 1LF0A 4DSTA 3BFKA 4UJ5A 2B21A 5EUMA 2MSCB 2FSHA 3TLXA 5D3MB 3C8UA 3ECCA 1CTQA 1HV8A 3KW6A 2QL6A 1GKIA 3B8HA 2B8TA 4IDOA 3AUXA 3SN6A 1G5RA 4IFBA 3VHXA 5IRCD 5FTNA 1JQJC 2QPAA 1S1CA 4LUCA 1Z0AA 2ODEA 4EPXA 1DS6A 4DSUA 4J0QA 1TU3A 4NONA 1KYIA 2ERXA 2NO1A 3OE7D 5IF9A 4JLKA 4W9MC 4CEJB 2ORIA 2KWIA 1XMVA 4I4LA 1QVRA 4BQSA 1J8MF 3K9HA 1Z0DA 4BLQA 4G5OA 3I72A 3PITA 1W0KA 1DADA 2QQEA 1E2IA 2HLDD 2QG6A 5HZKA 2GJSA 3QNUA 2GK6A 2C78A 5GVRA 4R7ZA 1XPUA 3A8TA 2J0SA 3QJYA 3MMPA 2YWFA 1VG1A 2FJUA 2R6CA 3OAAA 1DE0A 1KK3A 2ZJYA 3Q7PA 4PAQA 4BWYA 5JEEA 1E1RA 4PC3A 1A7JA 3C5HA 4PC7A 1CR4A 2PT7A 2Q9CA 2R62A 2IBMA 3WP0A 4JBYA 5JLJA 4RZXA 1T91A 2QTVB 5C46F 4D0NA 3BORA 4Q4HB 3ZJYA 4OQXA 3ZVLA 1WCV1 2D7DA 1IONA 3PR1A 4D6PA 1QHGA 2D2EA 3CUEF 3IIKA 1GIAA 1G64A 1ONBA 2IUTA 2EWVA 3GPLA 4H1UA 2HT6A 2PLFA 2VHCA 3L8YA 4Q4JA 1RRCA 3CX8A 1CJKC 3CM0A 2VHTA 2AX4A 3B2EA 4HAZA 1HY3A 1GSIA 2O5VA 4WA7A 1OKKA 4FWHA 3RS3A 5L3SA 3C5CA 3KKNA 4CT5A 4P31A 2IYSA 1GP2A 1N0VC 1EXMA 3JVUA 5FL7D 4Q4JB 4RKFA 2FPMA 5GJWC 4MQBA 3CRVA 1AK2A 1TQ2A 4KCGA 4OBEA 1WXQA 4NMMA 4B6FA 3CF0A 1GAJA 3VR3A 3T1TA 2OAP1 3ZVRA 3R9WA 2NPIA 4MUAA 1RW4A 1W36C 2EFHB 2BBTA 2WM9B 3CLVA 4MKHA 1Z29A 3AKCA 1M1YE 4Q9JA 2FSIA 2WPDD 1R0WA 1Z3IX 3K8YA 2QORA 4NPHA 4WOPA 5AJVB 4ZDWA 4CT4B 1SGWA 2ZRNA 2FNAA 4I1UA 1RE0A 2IYVA 4DCUA 5BQ5A 1WDTA 2OESA 2BHRA 1N0UA 1YVDA 4PSKA 4RVCA 2W6ID 4DLRA 5JI2E 4KAXA 1H8HD 3CWQA 4ZDIA 4M1TA 1D2NA 2VSFA 2X1VA 5ANRB 1DVRA 5JS8A 3TAUA 1XJCA 3VKWA 1U99A 4E07A 4TZ6A 2IA5A 2ZJ5A 1G16A 2FG5A 2GCOB 2IHBA 5KDLA 4C0LA 4CGZA 2FFBA 5DH9A 3RRZA 3K0FB 3THYA 4NYMR 1ZC3A 4RFSB 3AV0B 1GL6A 1Q20A 1KSJA 2ODWA 1VYVA 1G6HA 4G5SA 2OUKA 2QP4A 5TDHA 3EPHA 3FDIA 1WBDA 3AF2A 5EP1A 1GL9B 1UDXA 4C3ZA 2OBMA 3MLEA 2ZU6A 5E7IA 3THWB 1N5JA 4XH9B 2ZPTX 3P1JA 5FL3A 3F3YA 1S3GA 2ZSAA 1JJ7A 4A8JC 1T3SA 3C16C 3MCAA 1UDWA 3K53A 1XZPA 1E79D 2IXEA 1KKMA 4PANA 2ZI7A 4H9GA 2Z6VA 2ODNA 2OILA 1G3IA 2QTFA 5L3RA 3SR0A 3HU1A 5HKKD 4ZV4A 3UIEA 2IF0A 4B3FX 3LH5A 4QJ4A 4DLSA 2V55B 3AGQA 3U44A 1OXSC 3KFXA 1PLJA 2QI9C 2JLUA 2IS1A 4GP6A 1COWA 2WZQA 1CULC 2VF7A 4N0EA 2ZS9A 1UKYA 4DLTA 4TSFA 2ZSEA 1IN8A 5BW8A 1E6CA 2FZLA 4GSYA 1H8ED 2G1KA 3U3MA 2TMKA 4C0BA 1JPJA 2XXAA 5CB6A 3MWJA 4DSOA 1NN3A 2AHOA 3NG1A 4EJSB 3N2EA 3B1XA 4Q66C 1OFHA 2JLWA 1W2HA 2XOKD 4BFTA 1RJ9B 1FQKA 2QN6A 1QHIA 3K09C 2P67A 1P9NA 4TLDA 2OXCA 2O8DB 4U00A 3UMRA 2G3YA 3WNDA 3CX6A 2DPXA 1ZVQA 1Z08A 2QAGB 3VX3A 3GLGA 4JSTA 1Y63A 4NHOA 4QFMA 3FVQA 2ODBA 1GNQA 4KODA 1XMJA 2AR7A 1RRFA 2XSZA 1GZSA 1HUQA 4LSGA 1G7CA 2ZE5A 2GTPA 1C1YA 1T0HB 2IS6A 1S4QA 1DAHA 3P32A 4TYQA 3MJRA 1E2HA 1KDRA 1KMHA 4NP6A 5FPKA 1D5CA 3LY5A 2WWXA 2CL6X 4HLDA 4NCIA 2H5EA 3VX4A 2QPTA 1MO4A 2ZRCA 1ZUHA 1SXJE 4MRNA 4MH0R 2BOVA 2JIZD 3I3SR 4URZR 2VH5R 3LBNA 3EW9A 1HEIA 4Q02A 5F9HA 2ZRJA 2UKDA 1N5IA 3CNOA 2F55A 2QM7A 1TQ4A 2QSYA 3CZPA 1DO0A 2F1HA 3P4XA 1Z06A 3A1SA 1YJ5A 4GITA 3HWSA 4A0RA 4NKRA 3I62A 4Z51A 1ESMA 2GCPA 3D3QA 4A3VB 1CJMA 1FPMA 2Z0MA 4BLSA 5DGXA 4DIEA 4TMXA 2AXNA 2DHRA 2ZRPA 1TX4B 2RMKA 2WIAA 4LGMA 1VHTA 2W0MA 4NU0A 4OL0A 1UKZA 5IDVA 4PAOA 3KQHA 2IYZA 3KTAA 3B6EA 4WIAA 4XSHA 1L2TA 4F92B 1VCNA 1TNDA 3WMEA 4PFSA 4R2IA 3QKSB 4QRHA 2PT5A 2YWHA 2WJVA 4Q1DA 4I1OA 4DRZA 2J7PD 2VPPA 4DXAA 1NN0A 2YC2C 3AUYA 4PQRA 1LY1A 4HB3A 4NCJA 5JSZA 3OEHD 3ASZA 1KY2A 3LXRA 1W0JD 2Z4RA 4ZI2A 1TEVA 3BXZA 1DAIA 1GRQA 1ZYUA 4ZO4A 3DKVA 2GJ8A 4FXPA 3U2QA 5CB8A 1N0WA 1VYUA 1XXHA 5FTLA 2Z5FA 1UM8A 1ZC4A 3DVLA 3PUXA 4JKIA 1EFRD 4TTRA 5EE5B 2ZR9A 3EC1A 3OIUA 4FI3C 5AJWA 4XTRA 3QKUA 4QHTA 4V02A 4XD7A 4JVLA 1DBSA 1E2QA 4FMDB 4BFUA 5TMPA 1NBME 3C15C 1Q22A 4BUJA 4MGZR 1TMKA 3ZQ6A 8OHMA 2CJWB 2NMVA 1QHSA 2HF9A 5CYPA 2RH5A 1F5NA 4QGHA 3K09A 3QF4A 3C41J 1X1SA 4TLAA 2VQSA 4JVMA 4B71A 5FTJA 1MABB 1XX6A 3WP1B 3FE2A 1F6BA 3M4YA 4FWGA 4B3XA 1N2CE 1G8GA 1T3HA 1ZD9A 3OE7A 4Q1CA 4M1OA 5FR1A 2JJ2D 3VR4A 1UJ2A 3L2OB 1MKYA 2HYIC 4C0SA 3WY9A 4JLAA 2A78A 5L8VA 2CCJA 1ZW6A 5C4GB 4ESVA 3KB1A 3KX2A 2O8EA 2HDNB 3KJEA 1AKYA 4ASUA 4QG7A 4PQFA 4P4SB 1RYHA 2HYDA 3U3OA 4LPKA 1Q21A 1ZMXA 3L0OA 4M0LA 1EESA 2JLRA 2QMUA 3BIFA 4I1VA 1JQLB 4CW7A 2ZTSA 4CDGA 4GP7A 3SU8A 5HE8A 4IOKA 1LVGA 2NGRA 4GRAA 4OHVA 4TMTA 3AVWA 1Z6GA 1GM5A 1Z6YA 3NC0C 1XEXB 3GLIA 4TMWA 1IQPA 1G3QA 5HE9A 1GG2A 4M21A 2ONJA 1OYYA 4MA4A 1I2DA 2PCLA 2GAOA 3HDTA 3R8CA 3DL0A 3RWOA 3DM9B 2CBZA 2HF8A 2AXPA 2OFWA 2FF7A 1E2KA 3HPQA 3SJAA 2O8CB 4AYTA 2XZOA 2FGKA 4WZ6A 5H8WA 3WYGA 2CLCX 1JNYA 4V0OA 3LQQA 3RS7A 2RB4A 4HSEA 4OI1A 3ZVNA 3D31A 4TN1A 1NF3A 2KB0A 3EWAA 3W6OA 4TMZA 2EWWA 1PV4A 4C2UA 3B1ZA 3VR2A 1UF9A 2YVUA 2HUPA 1F48A 4RD1A 3Q5DA 3KZ1E 2NPFA 1HT2E 3RLFA 1XXHE 2FOLA 3NVAA 1NVVR 3CBQA 2J5XA 3MFYA 4A0FA 5FL7A 5IK2D 3THXA 4LCBA 3K0AB 3MWLA 4TL8A 2IYXA 1G3UA 3DPUA 4D4JA 2JLQA 1KSGA 3SJBA 4DB2A 1M2OB 1XF9A 2IYWA 6Q21A 2OCBA 1HTWA 1R5NA 4GZMA 3ZDQA 1G8HA 4DHEA 2J45A 2ZETA 5DHAA 4QJ3A 2VHQA 3A4LA 1KI8A 5DN6A 3V00A 2XNSA 5LB2A 4CEIA 4BE7B 3GLFB 1KAOA 3AJIB 2WPDA 5EZ6B 721PA 1E2GA 3D6TB 2LCFA 4XJXA 5HR5A 4GPTA 4LJAA 3R20A 4F91B 3FGNA 2QSZA 4HDQB 3NH9A 3AKYA 4LJ7A 1YZLA 3KFVA 1XNJA 5HTKA 4HB4A 2W6IA 3C14C 2WWHA 1S96A 4KJZA 3S1AA 1H8HA 3QVUA 2ZRMA 2H7VA 4AC9A 3B7GA 3X1YA 4BRUA 2BJVA 1KDTA 1GUAA 3A4MA 3DO6A 2QQ0A 3VHLB 3DDCA 3ADDA 3LWNA 2OLKA 1E9DA 2GRJA 4BFZA 2WTUA 1OLOA 3MWYW 2P6NA 4PPFA 4Q1FA 3OEED 1Q3TA 1G20E 4ZPXA 1BS1A 1VIAA 1NSFA 1N5LA 2AK3A 1KI1A 3IEVA 3PEWA 2X19A 2CDNA 4ZCMA 2DFNA 4Q7JB 4WXPA 1KHTA 2O8BB 4MDFA 4PPNA 2QEQA 1XCGB 1FNMA 1WBBA 3QXXA 4QM6A 2EFDB 3ZVMA 4HAVA 3O8CA 1XD2A 3B78A 4B3GA 2IYQA 2ZE6A 4O25A 3SNHA 2BMEA 5CM9C 2GETA 1R5BA 1T5IA 4V0MA 2IHYA 4A2PA 4E09A 4EFMA 2IYTA 4LJ5A 1T8TA 1OHHD 3EZ9A 1YRBA 1XPOA 1WRBA 1HE1C 1MH1A 1S9DA 1NG9A 3DOFA 3B1VA 4IOLA 5HKKA 2IYYA 3AVPA 5JHGB 4MKGA 3TRFA 4PC2A 2OFXA 3KXLA 4HZUB 3IIMA 1Q1BA 5GJBA 2N42A 4LHYA 4L8GA 3GFPA 4NTZA 3EX7C 4D81A 4Q9IA 3RC3A 1H8EA 1I4LD 4KHZA 5AUOB 5J4VA 1ESNA 4W5WA 4JLMA 2G77B 1YU9A 4QHSA 1G8YA 1P75A 4KFSA 1AKEA 1AZSC 2V6JA 1R0YA 3LX5A 4EDHA 5M04A 3BRWD 3MG9A 1EFUA 3UMSA 1BYUA 4KVAA 4RSGA 2F1RA 3WRYC 2FU5C 3REFA 2GF0A 1YZQA 2F3TA 1DG3A 2JAQA 3RYTC 2C95A 3ZD7A 5J5CA 2RGDA 2I3BA 4OI4A 3FMPB 1HQCA 5JJLA 5DE3A 3LW7A 3RS0A 4IVQA 3A1WA 3AVUA 3HU2A 1CR1A 2A7QA 5CK4A 1AS3A 3PVSA 1JB1A 3A1VA 3CR8A 4DLXA 3TMKA 4A0HA 2ZM5A 4CF7A 1YZKA 2XTZA 1JEDA 1M6NA 1H65A 2JEOA 5LBIA 2O8FB 3KKMA 1IJEA 1G21E 5J40A 4B35A 3G0HA 4RKEA 1W44A 4Z8XA 1IN4A 3NBFA 2Z4SA 1WQ1R 2QTHA 2C98A 4JL6A 2ZU0C 4M22A 3REGA 1BMFD 1SVWA 4HDOB 1ZM9A 4B3DA 1ZCAA 5H1YA 3SJZA 3K9GA 2JIZA 2RKOA 2FEOA 1IN7A 2ZRHA 3PG5A 3X1XA 4QKQA 4MDEA 2I1QA 1OIXA 3QPWA 3K0EA 4PC6A 2WKRA 4IJMA 2H57A 2V6IA 4ZCLA 4N1AA 1E2JA 1M74A 2REBA 1X1RA 4B3BA 5DNYB 3U7HB 2GXSA 4WZBE 5CLLA 4LJYA 5EXSA 2EFCB 4LHXA 1E0KA 5DLQC 3HR7A 3A1TA 1XWIA 4JBXA 5CYOA 1P9WA 1R8SA 1G4UR 4U7DA 1XU4A 4ON9A 3A6PC 3G82C 3MGCA 1L7VC 5B57C 1J90A 1NMYA 4GZLA 3DKPA 1D2MA 3BB3A 3LV8A 1JR3E 4LRSA 2J7PA 3IBYA 1GITA 4P33A 4B6EA 1G3RA 4MKFA 2R6DA 1XMIA 2ZROA 3OEHA 1XB2A 3LFUA 3VR6A 3TAHA 3IIJA 1W0JA 2J0QA 2VEDA 3DHWC 4Z1MD 2OHFA 1KNXA 621PA 3H84A 2YV5A 3O8DA 1OFUX 4DSNA 3U61B 1NN5A 3BFXA 4MGKR 2IYLD 3U60B 1EFRA 5G41A 5KUTA 1ZJ6A 2BCGY 1XEWX 3LW8A 5G3YA 4F38A 5D3MA 4K8OA 5FBRB 1X6VA 3T1VA 1DARA 1ZCBA 3DZDA 1VECA 2Z83A 3NDPA 4US1R 2JLXA 3T5GA 2VBCA 1XTQA 2F6RA 4BLOA 3Q5EA 5KHOC 4LYJA 1QRAA 2WSSA 2IEZA 3G5UA 2CL7X 2XITA 3VFDA 3BK7A 4ESHA 5FOUA 3EIHA 4CEJA 5L3QB 2HJGA 4YDHB 1EK0A 2LWIA 4MRRA 4A92A 4W7SA 2YOGA 2JA1A 1MV5A 2VSXA 4G1UC 1OH5A 2ZE7A 2A5GA 4HI0E 2OXRA 3OFNA 1CIPA 1E2PA 1XMSA 2HXYA 5DYIA 3IHLA 1FZQA 1YZUA 3T34A 4IKEA 1Z6XA 2AK2A 3PQCA 4KBGA 4XSGA 4DUGD 2JJ2A 2QP3A 4QGAA 4QGFA 2QU8A 1IN5A 1YZTA 2OV2A 5AUPB 4B33A 1R5OA 5BYJA 3NKVA 2VL7A 5FOTA 3CRQA 2RCNA 2CXXA 1ZD8A 5KO2A 4JT4A 3X1ZA 4ITRC 4BEJA 1A2BA 1KI6A 1K6MA 1YZGA 4KSBA 1N6NA 1G7TA 4AKGA 2YINC 3CB4A 4Q4HA 3NBZC 5ELXA 3OIWA 1KKLA 3GLHB 2V8OA 5KSYA 5JMTA 5FBQB 2VP9A 2DZOB 4URUR 1AJEA 2QA5A 2GXUA 3U6KA 2WKPA 1NLZA 2JJ1D 1X8KA 2QMEA 2DZNB 1J2JA 1KI6B 3SHWA 2QBYB 5F9FA 4BLTA 2CNWA 2BBWA 3I8SA 1RZ3A 1SVIA 1Z5ZA 1UEJA 3Q72A 5J4KA 4M1WA 2ZREA 4OQMA 2IWRA 2A5FA 4L9WA 4EJSC 1S0UA 4HUQB 1QG4A 2DVWB 2R9VA 3CRMA 1A5TA 5FOWA 4JLJA 5JI3E 3QKTA 4TLCA 4KFTA 4Q7KA 3PCRB 1C9KA 4ARZB 4C0JA 2ZVPX 3C7KA 1U0JA 4Q00A 5DSZA 4A82A 3IILA 5C1BA 3T06B 1M7HA 3ICQB 3IUYA 3PENA 2QAGC 2GF9A 2WOJA 4MRPA 4C30A 3GJ5A 5FOSA 2GJ9A 2OG2A 3GD7A 3TE6A 4NYJR 1GVNB 3ZIAD 2ZAMA 3BH6A 2VTKA 4MYTA 5TARA 4Y0VA 4CEHB 4A9AA 2GDJA 1JXOA 4JJZA 1OFIA 3IGFA 1JAIA 3F0TA 3DEFA 2KBFA 4E03A 2H1LA 1VCIA 4IXNA 2FDCA 1XEFA 4TTQA 2XTMA 2C96A 3IO5A 1XJQA 1KO7A 3KL4A 5J4HA 4DWJA 1S8FA 3TVTA 2WIBA 2JASA 2C04A 5AR1A 3A1UA 1PUIA 2HEIA 2ASEA 3I1FA 2JDID 3OIYA 1MOZA 1CU1A 4AYWA 1N6KA 3KB2A 4RZ2A 3Q9LA 3ZQJA 5JCZA 2ZITA 2GCOA 4BFVA 4AKIA 3ADBA 2GNOA 3K0FA 3FMOB 3RNLA 3ZD6A 3P26A 2NZ8A 3U5ZB 5G40A 3CZQA 4LY6A 3NEJA 3P4YA 4TMKA 2G88A 4RFSA 4JS0A 3R9IA 4B34A 2BEKA 3ND9A 2GEUA 1DAKA 4Q03A 3T61A 4YXWD 1AM4D 3KDSE 3PUZA 4B76A 3I61A 5JRZA 1AA9A 2VP6A 2ERYA 2Q9BA 2OE2A 1ZD1A 1G5TA 3THWA 2E1RA 4LV6A 3OEEA 5BWMA 4GMXA 2O52A 4LHZA 4NYIR 2ZXUA 2C2HA 1CJTC 1LS6A 4RY2A 3B5JA 1E98A 1J70A 3CO5A 1W7AA 2GILA 4MYCA 1W49A 3VAAA 4DJTA 2YKGA 4XIGS 3IPXA 1NIPA 1ZNZA 1XTSA 2KJQA 3CR7A 1XP8A 4X8MA 1X3SA 3P20A 2Q0HA 3EA0A 4HUTA 1DAMA 4M9QA 4AKHA 2OCPA 3UANA 3KQUA 4B44A 1G9XA 2GJAA 1KTVA 4HAXA 3BB4A 4IHQA 4CZ2A 2J87A 2QUZA 1S2MA 1SXJB 1K5GA 2P3SA 3GEEA 4LBYA 4RD6A 1Z07A 4KLZA 4UNPA 2FFAA 1JECA 3VR5A 4Q7MB 2XZLA 1TU4A 4DC9A 2ZJ2A 4ZI3A 1E9SA 2ZR7A 5FBWB 1VCMA 2AWOA 2VP4A 3WBJA 1QG2A 2Q6TA 4O2RA 3T1QA 4A4DA 3RSLA 1PVOA 4G0NA 2C9CA 3CF6R 4EJSA 4BLRA 4V03A 1SHZA 2GA8A 2NQ2C 5GVSA 3UMFA 3TH5A 1RJ9A 3A58B 2A3RA 1HT1E 2QENA 3PJRA 3H86A 4FCWA 3HJNA 3OZXA 2V1UA 4DLVA 4A2QA 2O8DA 1RC8A 5JEDA 3U6BA 3AM1A 1G7RA 3B85A 1XTKA 4UKDA 2FMXA 2F43B 2QAGA 1RFLA 1ZM3A 2K5UA 1HA3A 3U4QB 4NCKA 4TL9A 3OHMA 4FD2A 5EQTA 1C4OA 4KO8A 2IK8A 4FINA 2D06A 3FPAA 3QBTA 4Q01A 1TF5A 2ONKA 1R0ZA 4Q7LA 4QM7A 3QI2A 1KDOA 4TZ0A 1NLYA 3WRXC 2D3WA 3KJHA 4AK9A 4BECA 2EFGA 2E9SA 5CLQA 4KVGA 3N70A 4OHXA 3SYLA 3X2SA 2L0XA 4M9ZA 1II8B 3AP1A 1LW7A 3FKSD 5DHFA 3PEYA 1AZTA 1GTVA 4TYYA 1JI0A 4W5HA 1CEEA 4YDSA 2SHKA 2E87A 3RANA 2JLYA 1P2UA 3F8TA 4RD3A 2ANCA 2ZVQX 1IXSB 2D2FA 4JIMA 4PO9A 3RAPR 3LD9A 4F4IA 4FCTA 2BM1A 3TSZA 1CJVC 1BMFA 2LKDA 2P5SA 1NJFA 1Z6AA 3B60A 3BS4A 3FOZA 4GOKA 1TAGA 1I4TD 3GJ3A 3AVQA 1U9IC 3K9NA 4RFVA 3UWKA 1CR2A 1RPZA 4GBMA 2R8RA 3V4FA 1OYWA 2QT0A 3SQXA 4IOMA 4BFWA 1ZM2A 3TGPA 3LA6A 5CJPA 2KI5A 3ZLJA 4D4LA 3KQNA 3GJ6A 3BAFA 3QKSA 5A0FA 5CJ2A 1BYIA 4DLUA 2W0SA 4UJ3A 5TB5A 1EFTA 2CEAA 4P4UA 1UKVY 3NC1C 1OT3A 2J1LA 2WWWA 2ZS8A 121PA 4LI0A 4EFLA 4ZKDA 2WWYA 2HCBA 4PPGA 4DIDA 1BOFA 2VHUA 2RGAA 3I32A 2BV3A 4DCTA 4BASA 1XCPA 2EFEB 1ZNWA 3V4RA 2BDTA 2WJHA 2VA8A 3E70C 1KIMA 1MRSA 3ZH9B 1M8PA 1RRGA 4LK2A 4EIWA 2V54A 3P27A 4XVQA 3NTUA 5C4MA 3TUJC 4OI0A 1W1WA 4XWAA 3ZZTA 4LC1A 2IUSA 5KSPA 2GJKA 1D9ZA 4ACBA 5LPNA 4V0LA 4Z1MA 5GADl 2ZANA 2J0UA 4B47A 3AKDA 4JSYA 3BC1A 1DTSA 1JPNA 1F3OA 2CJWA 1IY2A 3GJXC 4A6PA 1XTIA 2EW1A 3E2IA 5FBVB 1E0JA 1XDBA 2Q3HA 5FUYA 4C7OB 4LJ4A 4QNRA 1CBUA 3SE0A 1Z22A 1SULA 2WWFA 1NY5A 2WWGA 1SKYB 4IDQA 4URYR 2J0UB 5JCPA 2QE7A 1CXZA 4KITB 1G4AE 4LX0A 2F9LA 2XNDD 3WNCA 4TT3D 4UNSA 2R65A 1MABA 2FZ4A 2Q3FA 2R2AA 4L15A 1GNRA 2WBLC 3W8NA 2WVJA 2IL1A 3PUYA 5E7JA 2PZEA 4PHGA 1AS0A 1OXVA 2NOAA 4QBGB 1VPLA 4AD8A 2J46A 2EYUA 2CK3D 5HCIA 4BFXA 3FB4A 2OCAA 2ZIAA 3GLGE 3B13B 1LV7A 1P7CA 3SEAA 4L4UA 1P4SA 2WMNB 3EWSA 1OIVA 1ZINA 4X8OA 1E9BA 3TR0A 4JZKA 2ZI5A 3E1SA 1J7KA 4BEBA 4P4SA 3MUFA 3WHKA 3KQLA 5JRJA 2GXAA 1IJFA 4LBVA 4D2IA 3SQWA 4LOAA 4DEYA 1F2UB 2PCJA 4DUGA 3VU9B 3LDAA 3MSXA 5JS7A 3L8ZA 1E94E 3W90A 3QKRB 3FTQA 3CRW1 1RVDA 5SZIA 1E3MA 4QOSA 2NO0A 1N6RA 2HLDA 1OB2A 3EXAA 3QPUA 1U94A 3QQ5A 2PZGA 1KK0A 2ZI3A 3UWOA 2HT1A 2UZIR 1XEXA 5F3WB 1E4YA 3BE4A 4IXMA 2WV9A 1VG8A 3CX7A 3QPVA 4B3CA 4BLPA 3AGPA 4L9SA 4AY2A 2DYKA 1G19A 1U9IA 1D2EA 1DG1G 3H4MA 2QM8A 5KOYA 4NYMQ 4DZZA 2O8CA 1GRRA 4OQFA 5FBLB 4Q21A 3VNVA 2GZDA 3EZFA 2IX3A 4ZDKA 3FMFA 1KMQA 1OE0A 1JAHA 2GHIA 2PEZA 2OM2A 4US2R 3FHTA 5DISB 2DFLA 3OAAD 3R9XA 3QUSA 4IVPA 1E69A 4AG6A 2PMKA 2BM0A 3PUVA 1E1RD 1QHNA 4YMVA 1QDEA 4B75A 2QRNA 5KYKA 4UXHA 3VTKA
chains in the Genus database with same CATH superfamily
3MJCA 3K0AA 2LHGA 2VXYA 3MJDA 5L51A 2PGDA 3GDHA 4LIPD 3UGQA 2IPAB 4G5GA 1XQWA 5T7BA 1S3SA 1ECJA 3S3TA 1ULHA 3HJCA 1G17A 3Q3VA 1RE1A 2WWIA 2X6QA 5TMBA 1KEKA 5ALJA 4JBIA 4AECA 1E9CA 5FI3A 5JCOA 5KQGA 1TA0A 1XGKA 2VXBA 1XNRB 2AGVA 1T9GR 3TWKA 3DR5A 4ND6A 4YXWA 3U4GA 2AMLA 4BV8A 3EARA 1SVLA 5IF3A 4S0XA 3BXFA 2PMCA 3WGQA 4OMUA 1ZMTA 1V7ZA 4CI0B 1IIRA 2B92A 4F9GA 5AW0A 5EWLA 3O4FA 5SZKB 5ENDA 1RPTA 4OIFA 3ADKA 5DCWA 2RHTA 3F5FA 4Z0PA 3BE6A 3A11A 1ZG3A 4LEIA 4M88A 1QQBA 3IQDB 3RYFB 2VYQA 3W5JA 4QARA 2MR9A 4WN3A 1NBHA 1QHYA 4KO3S 2DAMA 4W7HA 5J47A 1N6OA 1VRWA 4GE0A 4YRCA 2XUZA 4YONB 4GGMX 1DTEA 1LWNA 1ZOOA 3VDPA 4CTJA 1GU1A 2XOKA 3K6SB 1COWD 2UYGA 1U1DA 1QP8A 3TQTA 1OCEA 3RS2A 4IGEA 3HI4A 1HSOA 3KUDA 3BD6A 3J81k 3NIFB 1AG9A 5FI1B 4BGVA 2G06A 2JGNA 2HR1A 5EJEA 4M8NE 1IQUA 4XJTA 3EUEA 1P0QA 3VDNB 1R0XA 2CLMB 2XYGA 1P1FA 3E58A 1YKGA 3QE3A 1K3WA 4XOUA 1T9BA 2E4YA 5D6NA 3L43A 1U98A 4G65A 4HXEB 1O94A 3GJ4A 1V8BA 5BN3B 3GRCA 3HXLA 5CG2A 1X8JA 3ROZA 1UBJS 2FH5B 3QSYA 1BH2A 1ZOLA 3T8YA 1ZK2A 4TV8B 2JD1A 5IEBA 3BZUA 4BMDA 2VAMA 2PE5A 3OLVA 1IEXA 1L7AA 1E1QD 2X1LA 3HWX1 4IRUB 1HNZB 4YAUA 5HPYB 2PGJA 4CMKA 5LOVB 2RC6A 1N5KA 2EEZA 1X77A 4F04A 1QYCA 5KMGA 2XB9A 3SBJA 1ZHOA 1Q1NA 2P9QA 4II7A 1WTAA 4V0QA 1E3WB 2XMBA 1XWWA 4ERNA 4H6WA 1T35A 1NJGA 2Y77A 5A5GA 2OZEA 3RTBA 4DG9A 4JLVA 4ZYLA 1CRPA 1FRFS 1DUSA 1GGKA 4PXAA 2I2CA 2PX3A 1LNZA 1K8RA 1BW9B 2EUCA 3W6PA 2L42A 3EIEA 3DLCA 2R00A 5AT1A 1GABA 5IK2A 3SVLA 3RF6A 3IBCA 5FEMA 4C0QC 3E18A 4NOKA 3KHKA 1I94M 3NM6B 1HQYE 3SR3A 3U5ZA 1Q02A 1ODJA 4BFSA 3HJUA 1VDMA 4POAA 3WMGA 2QNRA 3LJKA 2G4LA 1O89A 3ZD8A 5EJMA 3EYAA 3HKCA 1NM5A 4C5CA 5BPHA 1U0NA 4F9TA 5DT2A 2JGEA 2IHKA 4MEJA 4DXHA 4DR5M 2RBGA 1GTSA 2WZDA 3LHFA 4MQFB 5TX7A 4EHJA 3ZGLA 4EFDA 4UDXX 2H06A 1EJ6A 3Q8KA 5FWYA 4L2IB 4BY9E 4JQZA 6GPBA 2OCXA 2QMOA 3ITKA 4G8BA 3HHPA 3D3KA 1H5QA 1U5AA 1P9LA 1E7QA 2OY0A 2DWOA 3A1FA 1UKCA 3ZNPA 2BEVA 3D6FA 1RI3A 3PQ6A 3EQ7A 1BFKA 2BRUA 3GZJA 2IV3A 4A36A 2VDJA 3K72B 2V1CA 2IW1A 3MD0A 3H2IA 4RM2A 2ORVA 5JZVA 4D3SA 3WYCA 1U0BB 5DO9A 4H6PA 4UNQA 5JC1A 2UXDB 3DOEA 4DUYB 3EF1A 3O4RA 1TF7A 5FUQA 2QW0X 1EZ4A 4IFTA 1NI4A 1UJ5A 4RZIA 1RRPA 5P8WA 1DSSG 2OSVA 4H17A 1Z0FA 4FFRA 1YUBA 2AFIE 5KPZA 1XK6A 3AONB 5JQGB 4F86A 4F3YA 2O8VA 1R8QA 1XA0A 2PH3A 2GZ1A 3GCWA 1MH9A 5AJYA 1HH4A 1T2CA 2BMWA 1KDVA 2HU5A 5JPCA 3GHYA 4GH5A 4NYJQ 1AKTA 2FP4B 2OGSA 3CZ5A 1NKTA 1XTBA 3VC3A 3HA5A 3FYHA 2V3CC 2CZCA 3COVA 4ZEMA 3ERCA 1TVCA 1UBFA 1SUDA 3QENA 4MYRA 5FULA 2PSEA 5AVRA 3WYFA 3TK1A 4L3OA 2VDQB 1TYBE 3KQMA 4MV7A 4Q4AA 2HLNA 2BH2A 2NXWA 1N3LA 2R85A 1GKKA 3HDVA 4ALMA 4K6OA 3DHEA 3LVWA 1SKYE 4DR1M 4HEJA 1NVXQ 4DKXA 1R4MB 4MYHA 2WAXA 3DZBA 1RQ7A 1L3CA 3HJ8A 5AK0A 4LF7B 4DA8A 2Q0SA 5LNK6 1QLJA 5FPPA 3I0MA 1OKKD 3ZUGA 5GQSA 4MVJM 1ZKDA 4OREX 4Q9LA 3BD7A 1VGQA 4KR0A 3OIVA 4ZVPA 3H9CA 1AUVA 2QJFA 4KRGA 4P7JA 4EFNA 1TMYA 3JRXA 4PDIA 2AN4A 3VKGA 5IVKA 2VPWA 4IF4A 5K03A 4W6ZA 3IYLW 4U9HS 4NULA 1J9ZA 1Z8FA 4IR7A 1AIPA 2P9GA 3O93A 4D4KA 4Y18A 3KOYE 2XGJA 3U7QA 1QU3A 1JEEA 4ZAVA 4DR7M 1X7YA 1CUUA 2ZYTX 4WOCA 4WZBB 1JR3A 4JYBA 1JEYA 3VYRB 3SIRA 3OTQA 3T9CA 2RJ3A 3VKHA 2GQ0A 5FCDA 1L2DA 4X93A 1FF9A 1NNSA 3I5MA 4N41A 5F73A 3R5XA 2QMHA 5IX8A 1ANKA 5JYCA 5CLGA 1KVRA 4KXWA 1F8XA 1JBKA 1VSVA 4FUTA 2AD5A 2WYOA 3U40A 1QVAA 1WNTA 5AUNB 4MP8A 4C0AC 5CVJA 3ND8A 3PCTA 3I5YA 4LZZA 2HUNA 2W5UA 4INZA 4G23A 1ZA1A 4NZZA 3JAKA 1FC0A 3GF4A 1K8XB 1PW5A 4L4XA 4GGPA 3OF2A 3EZ6A 2J9RA 4B80A 2UV8A 3SY8A 1I4WA 3FAKA 3QY9A 1WUHS 4RESA 1L6RA 4O2BF 5JT1A 2JARA 4O3MA 4RKYA 1JHXA 3AU9A 4EY5A 3I51A 1X42A 4LRSB 1PR5A 3TIXB 3RAFC 5DK6A 3WAKA 3CH5A 2X14A 2PYDA 2IUFA 3BFKA 2ZUEA 2A1IA 1KRXA 4BBPA 3GGSA 1ORHA 3C3WA 1AB6A 4QZVA 3WWEA 4D79A 2HGZA 1GTRA 1JLLA 3GUHA 1KYIA 1U0FA 2QQEA 1E5XA 3ABQB 2QMZA 3MNFA 2J0SA 1N4DA 4UAVA 2GKOA 3OAAA 1DE0A 4PAQA 4KIJA 1GA1A 3RRXA 2R79A 1NR1A 4DJAA 2LBCA 1G2IA 4XM0A 5TT0A 3EQ9A 5LLTA 5IM4F 3JYLA 1PEKE 2R5NA 4JOQA 1U2GC 2IUTA 3RS8A 1N2XA 2C5RA 2AOTA 4HLNA 3LCVB 1QZEA 4C2BA 2VHTA 2AX4A 1E6MA 3BWXA 4XR4A 3L0DA 1B1CA 4FWHA 5L3SA 1MIHA 3QWFA 4GKJM 3TTTA 3CRVA 3Q41A 1QIHA 4DA4A 3BMCB 4G37A 1PK8A 3V7UA 1FRZA 4ZQIA 2AVDA 2Q8PA 2L7IA 1H0RA 2B3TA 3UWPA 1GNLA 4K9DA 3QNWA 5I3CA 3K0BA 1DIAA 4MR8A 1ZJ4A 4WXEA 3E0XA 1G16A 3K2BA 3EODA 3Q3IA 4RFSB 4UMFA 1G6HA 1ZXXA 4RIIA 2ECOA 4KGVA 3EDRA 2HMSA 2VT3A 3O83A 1XDUA 5A7HA 3GZNB 4WCFA 3HC7A 5J58A 4CM6A 5HKKD 2IF0A 1HEYA 4JYAB 3OOYA 2ZSEA 1IN8A 5BW8A 1CNFA 4KV7A 4DSOA 3RFVA 1YB7A 5K0GA 4L7QA 4OVKA 3EXG2 3GLVA 4F45A 2C2XA 3S28A 4EDFA 1Q7EA 3A0RB 1X19A 3N8DA 3FTFA 4IICA 3UUGA 2QAGB 4K28A 2R7MA 2AR7A 5ILGA 4O4JF 4OH7A 1QAOA 5JD3A 3PVCA 4MI1A 4GRDA 1C3VA 4K1XA 3MJRA 1KDRA 2TS1A 3QRWA 1P4GA 2XI4A 5ECWA 2BOVA 4DQKA 3KVOA 2QSYA 2F1HA 1D0LA 2NZVG 4AJKA 3W77A 1DJMA 4BLSA 2ZRPA 1B8UA 2J6BA 4ZOLA 2HEGA 3UMCA 5B55A 1TGYA 1E4OA 4CMCA 5C8YF 1U63A 1I2AA 2PBLA 3IMGA 3P2YA 4X20B 1EE1A 3HSYA 3IOYA 1P77A 2BFDA 5AI8A 1GO2A 3DHYA 3RWBA 1KJNA 3EC1A 3OIDA 4PYJA 3VU3A 1G5HA 4BFUA 1SCIA 4F2HA 1N1GA 3CSUA 3ZDZB 2BN4A 2DCMA 4RBNA 4DCJA 1NVFA 3K09A 1Z8DA 3JASB 1F6BA 1XYYA 5CM2Z 3BWMA 2ONCA 4NJEB 3L8MA 4P3OA 3O7WA 5HE8A 1HI9A 4AT1A 5AKHA 3EXFA 4MVJH 4C04A 2YVLA 4KMOA 4W8HA 2F5QA 3HDTA 2IXBA 1NA5A 1UJCA 1PFWA 2RBKA 2YIDA 3F6BX 3WK7A 3WYGA 4PINA 4DWVA 4BAZA 2MWMA 3L0ZA 2VJKA 2C97A 3QBEA 5DNDA 4TN1A 3KP1E 5BVHA 3Q5DA 2Y71A 1GCAA 1NVVR 2BZGA 1SU8A 3C6XA 3MWLA 3W5HA 1M54A 4XB2A 4Q0MA 5A05A 1PX0A 2ZR8A 4EEXA 3EGEA 1I94B 3O1HB 3I4YA 8CATA 1V3VA 4F91B 4HDQB 1T36A 3L6UA 4BKRA 1ZX1A 3OHSX 1HDYA 4BB6A 3HP4A 4LWPA 3X1YA 2W48A 1D0VA 2JFOA 1OLOA 4DMKA 2RAFA 2AZTA 2ZTDA 2VJMA 4IBJA 5BN4B 2Z6AA 3DL4A 1TZ2A 3LPNA 2O9JA 3SBOA 2KQUA 2XCUA 3VZQA 3PI6A 2FZ5A 3FFTA 3N2GB 3DLHA 4IOLA 5JHGB 2I7VA 1RZUA 2D8AA 2Q6LA 3D6HA 4UNIA 4JEMA 5KOHA 3DWIA 3KUKA 3DSRA 4UBNA 2PWZA 3F1LA 2UUOA 4Q05A 1LJLA 4AMVA 4UCXA 4QO8A 3PT9A 4N8DA 5AH0A 1G8MA 3LX5A 2IOYA 3LLVA 1DUVG 1HDXA 1WR8A 3R23A 2FU5C 3IELA 3WRYC 2CLHB 4NBTA 3Q12A 5EG5A 4OI4A 1XNHA 4YAJA 3H13A 4PFQA 5BP7A 1T3GA 3HU2A 1A7AA 3CR8A 1SXGA 3EXEB 2DAGA 1GSAA 1IN4A 3KZKA 1GDTA 2Z4SA 1SVWA 2FWJA 1OA0A 3KR9A 3SJZA 2BM8A 1DWQA 2ZRHA 4MDEA 3MMZA 4Y1GA 2CVZA 2QRHA 4GXQA 4LGVA 4C4TA 1H6UA 5F9MA 1ZI9A 2WKRA 4IJMA 4N1AA 5B2FA 3U7HB 2CNKA 5EXSA 1YQEA 2WUVA 2AH5A 1L7VC 3GRYA 2WIJA 3C6QA 1XMIA 2J0QA 4FQ8A 4S3MA 4TWIA 1X2EA 2R8ZA 3HN7A 1TZMA 3KOZE 2CDCA 3EGWA 3HWRA 3IJEB 1ZJ6A 1Y4DE 4K8OA 3QWHA 1JP7A 4YRMA 1ZJZA 5KHOC 4JV5M 4HX9A 2WSSA 2HRBA 1DKPA 3PXCX 4X6YA 3PWTA 1ZVVA 3CUTA 1IXKA 2YOGA 3WK8A 1MV5A 3QV1A 1ZWLA 4H6VA 2ZE7A 4IP0A 4IKEA 2QU8A 3EW7A 2OV2A 1JAXA 5D84A 5DGCA 3HZZA 3OY7A 1JU4A 3HLYA 1A2BA 4GLLA 1WUKS 3QVXA 4AKGA 5JNSA 4LZJA 4CL3A 3U6KA 2GTHA 2QMEA 2ABWA 1GQ2A 5DV9A 4PG8A 3RIHA 2IWRA 2A0KA 5I9NA 2DVWB 1K3TA 2Q5QA 1RYMA 4QYIB 1M7HA 2GF9A 1MRZA 4LNUB 2YZNA 5DRYA 1QXSA 1W93A 3D43A 2WSEF 4M8IA 1UPFA 1XJQA 4F06A 3E61A 4Q34A 1J97A 3TEJA 5I01A 2O2XA 2NZ8A 4B34A 3NEJA 3P4YA 4CCWA 1KQGA 3ND9A 2F67A 4EY3A 2ERYA 3T3HA 1GTL1 5BWMA 3BE8A 3V2IA 3F7TA 4KMMA 3LDHA 1TA4A 1M75A 1OX4B 4CQMD 3DZJA 3N6VA 1SXJB 2NUAB 3IT2A 1ODSA 4DC9A 3M5WA 3DZIA 3H4JA 2GFQA 1WMAA 3P9KA 2X5OA 4TV9F 3PK0A 1KEVA 4MGHA 1VL5A 4K0KM 1REQB 3SMVA 1KE1A 3AM1A 5CEFA 2LW7A 3B85A 1XV5A 3A14A 4XGQA 5EQTA 1C4OA 2D06A 4Q01A 3KLOA 1Z8HA 4LRTB 1G71A 3MT8A 4NXNM 4MB2A 2ZLBA 2EFGA 4NMLA 5AHRA 1JF8A 2JGIA 1LTKA 2Q1SA 1JI0A 3A7DA 4F4IA 1JWAB 1QKIA 2RGYA 3L84A 5DULA 1K9VF 1F8GA 2CFCA 3A3YA 3K9NA 3PQ4A 3U6QA 1J2UA 4PCLA 1OYWA 3TGPA 3H65A 3EBLA 1GGMA 3IAHA 1EJBA 4DEVA 1G60A 3I6ZA 4PRLA 2WWYA 1V1JA 3B6JA 1R9GA 2BV3A 5EWMA 5DASA 2B5OA 3KQQA 3WI7A 4Z1MA 5LMUM 4A5SA 3K2IA 1JPNA 3W5SA 3FR7A 2CJWA 3K5WA 5KNLA 1AKVA 1FDOA 2EW1A 1PNRA 2IUEA 3ZE2B 5HTOA 2Q3HA 2J32A 3AT1A 2QE7A 4FBGA 5EFOA 1UT6A 3GQ4A 4KAAA 3UAZA 2CK3D 4EGCB 2UYYA 5HS4A 1J7KA 5JRJA 2OPHA 3DNFA 1E94E 4KRFA 4IIXA 4MPRA 5A71A 2YJ6A 4YJ3A 4ZU6X 4IX9A 3V4SA 1MFZA 2C29D 1HNWM 4ZFNA 2O8CA 3I6QA 2YXBA 3G0IA 3AR8A 3ISTA 3ORSA 3L4EA 1BHSA 5LXTF 3QUSA 3R9XA 5IBRA 3FHLA 3I12A 3OQNA 4N39A 1M6VA 4BB0A 4MAMA 2FMUA 4YWJA 4INJA 3HBJA 4IHJB 1NO1A 3MRSA 4WXRA 5AVWA 4QL3A 1ZO8A 2OEPA 3R7WB 2TMYA 1DAPA 4G0PA 3LP5A 4CYMA 1RMYA 1WMEA 5DEOA 5ARCA 1O5OA 2P2ZA 4JUCA 1ZMUA 2JJQA 4KH0A 2FAXA 2JFVA 1R2ZA 4JLDA 2IW3A 1ODTC 5DCLA 2HDHA 3GN2A 2AOVA 3PNKA 2X42A 3FSEA 2NSDA 2G40A 5A4KA 3AMVA 3D7MA 5IWAB 3GBVA 4G5RA 4D0GA 1TU0A 1ZUD1 3KLMX 5FV4A 3EEQA 1FUUA 3CIOA 3SHGB 5D1HA 3CW8X 3PUJA 2B7CA 2RAVA 4WBNA 3HDGA 4QEDA 1W5TA 3GRVA 1BVHA 3U3KA 1NXSA 3EPJA 2X0RA 1H1LB 1W87A 4JMPA 3F5MA 1EWKA 2YMPA 2R0QC 1SQSA 4TKVA 2F90A 4FKZA 1D07A 3RH0A 1KO8A 2J6CA 3OE1A 1XZCA 3KTDA 4HQRA 3DULA 3OF5A 5CIQA 1FDWA 1D6JA 4BIIA 3V8VA 2R96A 4DMRA 3S8YA 2Z08A 3AXSA 3KR1A 3DB1A 3HCCA 3GOHA 1LTMA 4YLEA 9LDTA 1AKNA 2C8LA 2R4UA 2YWEA 2FV8A 4IQGA 2O06A 3AR3A 1LDMA 1Y6FA 3SFVA 1EDDA 2F3QA 3ETDA 3ZKWA 4Q6BA 1Y1RA 5K3BA 2G3QA 1YS4A 3CCBA 4G6ZA 4U9UA 4F7DA 4TN5A 5AJZA 1EFPA 4MQ4A 1GCGA 3CZ4A 4GC5A 3O0DA 3FSJX 1GPBA 3EDCA 5A4MS 1SURA 2GFHA 5F98A 1YS7A 4HGNA 4MNTA 4D6YA 1F4IA 1XEAA 5BXQC 3UPUA 4OYRA 5IARA 3AF3A 2FOIC 2I3ZA 4JYMA 2QB5A 5T41A 2I7XA 1X9HA 2ROQA 2Y6VA 2CWBA 2BZSA 1I1OA 4FTWA 3DW1X 1MGOA 1V4VA 4K88A 3JVVA 3O7MA 2PSHA 3A6ZA 2DAKA 1FFAA 2A3NA 3DLTA 2VPIA 3K9PA 4C2AA 2JZ0A 2BFEA 3ZTYA 4PX5A 3T0GA 4I55B 2CSUA 1GVNA 3ZI4A 4FU0A 2GD6A 4K6GA 1U7UA 1YFZA 5HKLA 3I73A 3RRBA 3KUCA 1PWXA 3HVRA 2K9DA 2ZQ5A 3GQBA 4TZKA 2Q3LA 3C6KA 3ZTTA 3S55A 4FHFA 4S2EA 3SDBA 2FTKE 4Y2SA 3E3OA 3RB8A 1OXXK 2D0OB 4JASB 2ID9A 1NU6A 1U4NA 2C2WA 1W88B 1CS4C 1Z0IA 5DN6D 2ZE8A 2WTEA 3OCUA 1M67A 2FSUA 4Q3NA 4N3CA 1A4IA 2OBLA 5DI9A 4K6HA 2Q6OA 4Z0HO 1SUPA 2QUKA 3QFTA 1QPGA 1GG9A 1C7ZA 1MNQA 1I7LA 2WM2A 4LC0A 4HQNA 5JIBA 2IEGA 4QNNA 4TT8A 2RAUA 5KJ1A 1RQ2A 1Q84A 2MMGA 4M0KA 4C20A 2NU8B 3HR4A 3PL1A 1D1TA 2AQKA 3RRMA 2EJUA 2NO7A 1LA2A 2Q28A 4RLSA 3WBKA 5AM2A 2JGLA 3RFXA 1VMEA 4BP1A 5MFZA 4QVGA 2PH5A 2B8WA 4AQYM 5JJCA 2AUTA 4DDVA 2J6HA 3U44B 2F8TA 4KHPB 3G49A 2WV7A 5BT9A 2F4NA 2XXAB 2BZ0A 1J22A 2VP5A 1YR8A 1XBTA 4BVEA 3L06A 5CBPB 2W8ZA 5GPBA 4OGFA 1ZGGA 4DMCA 4PN7A 5BNTA 5LJLA 2NYVA 7AT1A 4NMHA 1E2FA 4W6QA 1N2CB 1R5JA 1L4HA 2XADA 3DLPX 3EMDA 1EIWA 1F0NA 3PGVA 5C32A 3I28A 2Y27A 4IQ0A 2DE0X 3ETNA 1UKEA 2UAGA 5BUZA 2PL1A 2BKXA 1KWKA 2GM9A 4JVNA 2PSSA 3Q3JB 3KTAB 3U09A 1EFHA 4ND2A 2QD2A 1JDVA 5FR2A 1PNOA 2BTEA 4JWKA 1LI5A 3CUSA 2Q9AA 3GAZA 2HM7A 2WJYA 3TQIA 4TL7A 3OCVA 4Q9DA 4YRAA 1JRLA 3EGOA 4AJNA 1FS6A 3B9BA 2X0NA 3RAJA 4HLCA 4XCXA 1J8YF 1VHLA 1ISFA 3AUJB 4GIBA 1ZKMA 4MWTA 4YP0A 2KRUA 3S5UA 5CXUA 4B09A 1OXMA 2HLPA 5AOAA 1Z2AA 3D7RA 3TLYA 3D8HA 3UT0A 2O8EB 4KNVA 3E2MA 3FGPA 8MHTA 1RBMA 2EZTA 1P19A 4PLWA 2OV1A 1IXZA 2FX3A 2JI7A 3V9PA 1D6SA 3RGWS 1P1HA 4HGZA 2VOJA 5T67A 4Z4EA 1I13A 3ZV3A 1R18A 3VC1A 3KQSA 1JVSA 3IH5A 4N5IX 1K9SA 4TXLA 2XRFA 1BEEA 1DINA 1CZUA 3SIPA 3N8KA 3SSOA 4YFVA 1QUTA 4DPLA 4GDFA 3ZHBA 1OU4A 3TTWA 4X94A 2PZFA 2Y1WA 1CQJB 3L7OA 2HI0A 2E6UX 4ZJZA 3EWNA 4HMQA 4P22A 3RIMA 3KIPA 4A15A 1HE5A 2IS4A 3CLSD 1PE0A 1VLJA 3HYTA 4CI9A 3I4FA 3VR5D 1Q0SA 2RD2A 3TQHA 4CTNA 2CRUA 4QJ5A 2XMPA 4LF9B 4WVFA 1XYVA 4DDWA 1QZUA 3QBJA 4RTKA 1X3LA 4ZALA 3NWJA 5CCBA 1B0UA 3TLJA 3PXGA 1N36M 1XD9A 3CEAA 2MJLA 2COUA 3BG5A 3OUUA 3T54A 4OJKA 4RCZA 7REQB 4XD2A 4QYXA 2JBAA 1D2HA 2YVQA 4XWGA 1BH6A 3DDOA 2C9MA 5JQGF 3RPEA 5CA1B 4CGYA 1SBNE 5I4BA 2HJWA 1NRJB 4PZUA 3OF3A 3AG5A 3IB6A 2OOBA 1BN6A 3LAWA 1ISMA 1FS4A 3FYSA 3B3QA 1T6ZA 4HJRA 4NH4A 4Z9XA 4TYNA 5B3AA 1X1CA 2DF8A 3GJ0A 5HNKA 4NF2A 1M7GA 3PDIB 3PIDA 2H2HA 3EG5A 1S89A 4PSVA 1UADA 1EVQA 2J41A 4UN2B 3LGAA 4LKOA 1DAOA 1CR6A 4LX8A 4F4CA 4NIMA 5I5EA 4IWNA 2VWHA 1NI3A 3JAWB 5G1PA 3NQ41 5D3MB 4QOHA 3RFTA 2W8BA 4EB3A 4J7UA 4KRXA 4NONA 3W79A 4MW0A 2O8NA 1JHQA 4WLVA 2KWIA 1UQTA 3WIOA 3ESBA 2HLDD 4M7OA 4Q1VA 2GK6A 2C78A 3MELA 2P40A 3QJYA 3OMXA 3PFBA 4RXTA 4MYSA 2PWPA 4YIKA 4MKXA 1V8FA 1UJ4A 1GA6A 4ID3A 4JBYA 5J1SB 1KHHA 1HNWB 1C1DA 3WGMA 3PR1A 3L93A 2D2EA 4BNYA 2FWMX 1RM0A 3SARA 1CUSA 2CZQA 3PLNA 4CT5A 5KYUA 3JVUA 4MPPA 1UIRA 1OFUA 2VXOA 4DCPA 3QOYA 2EFHB 2K47A 2FZEA 1ZMOA 4MW9A 4W1SA 5TGDA 4ED9A 3I58A 1R0WA 4B0PA 2QORA 4JI2M 4KR7A 3E4RA 3WB1A 2GQFA 4CISA 3T3EA 1N5MA 3NASA 3NWLA 4Z7NB 2UYCA 3RODA 1D2AA 4OAPA 2OBMA 3THWB 4C6TA 1S01A 1U28A 3JR7A 3KPUA 4L07A 3MCAA 1I7QB 2XCRB 2ZI7A 1Y6QA 4JEUA 2ODNA 3BRCA 4HYEA 3WBBA 2GLXA 2ATCA 3L7CA 4B3FX 2PKYX 4GP6A 4HPWA 1PT8A 1K7CA 1JNXX 2FZLA 2GDZA 1JI3A 4B7UA 1NN3A 4LFBM 1PEDA 2AHOA 3I23A 3B1XA 1JQ5A 2M6SA 4D5EA 2JLWA 4U0KA 2Q5HA 3LBYA 1N0IA 3A6FA 1ZL0A 4MKZA 1ZVQA 5A0VA 1DC5A 2CDAA 2CHUA 5F7XA 3C3CA 1Z4OA 2GAJA 3VISA 5A3JA 1AGNA 3VX4A 2ZRCA 3DV0B 3FETA 1ZUHA 1SXJE 3UK0A 4J16A 2UKDA 2VC2B 5K20A 5ALXA 1YJ5A 3B7QA 2NSLA 2VNKA 1TFRA 2VBFA 3WLHA 3QVSA 3GGDA 3U0BA 4DIEA 4H3KB 4HDRB 1UKZA 3ORFA 2YHIA 4F92B 3BDAA 4MO9A 1RJFA 1VGVA 1DRUA 3N0TA 1LY1A 3BXZA 1YDFA 1X7WA 4FXPA 1G38A 2EHDA 1OI4A 3WE7A 2HWXA 4J1SA 5JSUA 5TGTA 1SHUX 3L27A 4IFIA 4G24A 1PV2A 3ENZA 4DMGA 5GOTA 5FTJA 1RWPA 3ETHA 3UWSA 3VAYA 1FNSA 1T5DX 2V3VA 2FN7A 2Q49A 3TCXB 2EW8A 4JLAA 1PGQA 3LYHA 1NOIA 3KJEA 1X9GA 2MJ5B 1KU0A 4LPKA 4F60A 4P1ZA 1JQLB 1UK9A 5KTRA 5KKNB 5JXIA 3R7BA 5E6RB 4E5NA 3OH8A 3R7AA 5AKKA 1BX3A 4CKEB 2C58A 1YB5A 4V1CI 1DTWB 3LQQA 1S3IA 1W25A 3PR3A 1LTHR 3IUEA 1E77A 1LBHA 1CUYA 1RDFA 4J90A 1AF7A 3EVEA 4UZEA 3CVJA 4FX5A 3NVAA 4E5PA 5FL7A 2LBPA 3IAM6 3OSZA 1FEZA 1I7NA 3DLAA 1JQBA 2ZETA 3ROEA 1T4MA 4CEIA 1H0SA 1S96A 4BRUA 1P18A 3T1YM 4RTOA 2FUG1 1IC6A 4ZPXA 1Z2OX 2JHGA 3IKMB 4GECA 2DFNA 4HHEA 4LCJA 4O08A 4HAVA 3O8CA 3IAEA 3T1HM 2ZWMA 1WSWA 2X8LA 3SNHA 1N3IA 2NUTA 1R5BA 4V0MA 2IYTA 1T8TA 3OD5A 2YZKA 4HMPA 1RXUA 4K7JA 4E4RA 3COYA 3BHJA 2E4ZA 3V8MA 1I4LD 4KHZA 5J4VA 1TT5B 3K0HA 4BMNA 3ZWNA 3WIBA 4ZWNA 1C7IA 3BRWD 3S1LA 4RSGA 2XH9A 4FYHA 4UMEA 4BUZA 5J5CA 2CXSA 3FMPB 3EDOA 3LW7A 5D51S 4PV7A 4CF7A 3LT1A 3E8SA 1IJEA 1MEEA 4UEWA 4F5ZA 5DMXA 1QTIA 4HDOB 5T4HA 1WW8A 2YZ7A 2V0NA 3I4VA 4HY3A 1PG2A 4HTAA 1O6ZA 1IQRA 4BMZA 3F5SA 1T1IA 5EIAA 3G5TA 3VYVA 3PLAE 4LZNA 4UM9B 4P86A 1OXKB 1X1EA 3PPIA 4EJFA 4KXUA 5CYOA 4C1BA 2UVPB 1DKRA 3CKKA 1V95A 3BB3A 4JP2A 1VGRA 2EZ9A 2WMYA 3CY6A 2H48A 4RA6A 2WYUA 3OLZA 1W94A 3N2YA 4DR4M 5EYPB 3MJEA 3EUWA 2BONA 1JXAA 1PJTA 1CVIA 2GNAA 4RQAA 1PNTA 1ZISA 3DFUA 3FSGA 2KS6A 1P0IA 4C7MA 2Z83A 2RJOA 2ZYHA 2JAWA 3VFDA 4ESHA 3DAGA 2TRSB 3WGNA 4YDHB 1Y8QB 1PR9A 4YV2A 4JI3B 1EU1A 4B82A 3IVMA 1Z4IA 4E3WA 3DKKA 5BYJA 2B6NA 4ETIA 2V3WA 4WASA 3ZHTA 1I3LA 4IZHA 4E7OA 1KI6A 1Y3BE 4U63A 3GLHB 3NM5A 2OG1A 2HA4A 2HL7A 2EJCA 2JVKA 2VWGA 3S7ZA 2DZNB 2AG5A 5F9FA 3BEOA 4B3TB 3I8SA 4DLLA 4CM7A 7YASA 5CD1A 2ZBUA 3L77A 3U3XA 5F12A 3W9SA 2PPLA 3IILA 1DBIA 1NV8A 4OGWA 5EESA 1BS2A 1GYQA 3G6KA 2VTKA 2BFCA 4RETA 1O57A 1I10A 1T6BY 1JAIA 3DEFA 4UHHA 4HNTA 1H3EA 3UJ9A 3OM0A 1Y98A 4QBKA 2AQHA 3KB2A 2Z3VA 1JJFA 4JI8M 3AI1A 3CZQA 4AXBA 3JWEA 2O14A 3KXDA 5B1SA 3KDSE 4JDPA 3SSNA 1IAVA 3OEEA 4AZ3A 1IBMM 4OP3A 5BSUA 4PRYA 3IUMA 1L7PA 4M6WA 1MJFA 3P20A 4EGQA 3VOBA 1G9XA 2MU1A 3M4XA 4JUAA 1JUDA 3RTEA 1E9SA 4MIOA 3TLGB 1NVTA 4UE6A 3ZE8A 1M34B 1QYIA 2EATA 4EGJA 4Z3DA 4BLRA 1N1EA 2ACVA 5KTKA 1G7RA 3DTVA 1PO7A 1WLYA 1MZVA 2FW1A 1ND6A 3GLTA 4H15A 4GMKA 2IK8A 4AWAA 3PU6A 4AK9A 2E9SA 4EK9A 3CSDA 3AP1A 2NU9B 5CT5A 5CH5A 3U9LA 4EO4A 3PFNA 2ZVQX 5LZ7A 4XWTA 2D2FA 1N36B 2C59A 1EDEA 3DXYA 3ICOA 3SX4A 4D57A 1RWOA 4QQRA 3WOVA 1YJCA 2KNZA 3OA2A 2ISQA 4PTYA 1Z0SA 5F5NA 4E7PA 1YZVA 1OT3A 4HC4A 4LI0A 4NV0A 1JS1X 2WRZA 1M9NA 3FTCA 4R2WA 1I30A 2WJHA 1P0FA 3B3GA 2WMDA 3UKOA 1D9ZA 2C8KA 1X7XA 1AO3A 2YW9A 1DTSA 2X22A 4RVGA 1QFSA 3R9KA 5FBVB 3IA2A 1CBUA 3SE0A 4IDQA 2J0UB 1LLFA 1G4AE 1DL5A 4G4SO 4DV4M 3EEBA 4IIFA 3NX4A 2PZEA 2WIDA 1ZJYA 1CE8A 4KOEC 1NJ2A 4YAEA 4YGYA 4XBOA 1RXWA 4DV2M 4H27A 2ILVA 4ZYYA 4H08A 1F2UB 1SC1A 4WJKB 3DCYA 2IOFK 3LTNC 3SP1A 4CFZA 4I6JA 4K9RA 3ZWMA 1OGJA 3AUKA 3UWOA 1E4YA 2WV9A 3PHBE 4A91A 3QPVA 3KETA 1T2VA 4UE2A 3COZA 1QPZA 2DECA 3IJ5A 4WNAA 5K3CA 3DBLA 1KMQA 2GHIA 2OM2A 4US2R 1RHUA 1TCVA 3AZQA 3U6SA 2QRNA 3MPUA 4EJ6A 1P2VA 4NJMA 3CH4B 3SC2B 3A9TA 2ZB3A 1TPZA 3G0GA 2BW0A 3GLFA 2D62A 4GM1A 2BVNA 1M5UA 3PYXA 3C43A 3JZDA 1QP4A 5LYJB 2H0RA 5JWOA 3BIWA 4M9SA 4DDMA 4WKPA 1MB4A 2ALJA 2FPGA 3P19A 3NAQA 4GPZA 4QPDA 2XUAA 3O8NA 1J07A 2HZBA 1EB9A 2V7BA 5TEWA 1L4UA 5EVCA 5B3JC 1X7ZA 2B2CA 4PR0A 4JI2B 4IBBA 4QFBA 1YHZA 3QE0A 1HFEL 1ZXLA 1M3SA 4PAGA 2OWDA 3AEKA 4O4IF 3IDFA 2QM0A 1TZBA 2DAEA 1CCWA 4P3KA 4OSOA 1E62A 1VOTA 3QX7A 1CZOA 1OPXA 2D5CA 3IIEA 5I7UA 2EAUA 3E7XA 1NBWB 3RRJA 4C9BA 5AW2A 5LSAA 3UPTA 2PJUA 1DQYA 2WW8A 2G82A 3UJBA 4HNRA 3B7NA 3I9JA 3PTLA 1WIVA 5CMLA 4BP3A 4LYEA 2BMJA 4WH0A 4CFSA 5JS1A 5CX4A 2DC1A 5SYMA 1PR4A 3GJ7A 2ZWOA 1VG9B 4DV7M 2NTYC 1EBFA 3FUTA 2GVDC 4UBIA 4G63A 3P5SA 2IBTA 1TUGA 1E1YA 1OTRA 1KEEB 1CG6A 3UJPA 2QP9X 4E15A 3W8FA 2VNHA 3I2FA 1YRQA 4FYWA 4YO7A 1KRWA 4ZZ0A 4EPVA 3LCRA 4LNAA 3GRZA 1E7YA 4KI0A 4UM5A 5NLLA 2QL7A 3VBEA 3L04A 2VRNA 2PQ6A 1GR0A 2JCSA 2Y1DA 5C5DA 2BGLA 1FZTA 1KJYA 1CR0A 4AQDA 3X43A 1A0OA 2HA0A 3AX6A 4IJQA 4U2GA 2VJDA 4RD0A 2R48A 2I7PA 5JNLA 2AOXA 1IZ7A 2C99A 1SEVA 5BOSA 2IP1A 3C7CB 1YNSA 2Q1TA 4DV0M 1SQ5A 1CZKA 4FFLA 3E1GA 4M46A 1QQ7A 4O3FA 4CCSA 1H6DA 1K06A 1QU2A 4FFOA 4MX8A 6CHYA 2G17A 1A9OA 2V96A 1VBMA 2XYRA 3AF4A 2XDAA 4IHJF 4HQ6A 1L4FA 2PK3A 1DOHA 1VYTA 4EHKA 2P5UA 4CETA 5CB4B 3F4KA 1MOSA 3GNSA 3H5NA 2QLFA 3ETJA 2HAKA 4Z3OA 4ZOAA 1N5DA 1QQ5A 3PNBA 3KV1A 3V32A 3V3TA 3WHIA 4PSAA 2GZHA 3MGAA 5ESXA 1XIVA 1OJLA 3AHFA 3SMPA 5ED4A 4AJ2A 2IUYA 3VAZA 1NG1A 3OX1A 2ZYRA 4XX0A 2HMWA 2RG1A 2BD0A 5J4YA 2P2SA 2WT4A 5HQ3A 5AKEA 3O47A 5ISMA 3N2NA 4S0ZA 2Q21A 5DN9A 2C7BA 4HTFA 3VYUB 4HB0A 3EYWA 5A4FS 5D00A 3TW8B 3BFJA 1O97D 4KGZA 1MIOB 2UUBM 3H2ZA 1ZK1A 4J9VA