3UK6A

Crystal structure of the tip48 (tip49b) hexamer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
318
structure length
298
Chain Sequence
AHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRITVSLHEIDVINSFLALFKSEVREQINAKVAEWREEGKIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvB-like 2
publication title Large-Scale Conformational Flexibility Determines the Properties of AAA+ TIP49 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 298
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06068 TIP49 TIP49 P-loop domain
A PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uk6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uk6A01
1Q0UA 1LF5A 3OE7D 4GMXA 2VIIA 4QGGA 4NMMA 5FUYA 1MO4A 1KNXA 3WMGA 3BK7A 2QGNA 2IWHA 3PUXA 3BH0A 4S2EA 1FTNA 2OILA 5LPNA 4NYMQ 1RYFA 4QC2A 5AJZA 1IY2A 1Z6TA 2AXNA 1MABA 1G6HA 4M8NE 3LXRA 2ZRLA 3BOSA 1ZCAA 4MUBA 4N0DA 4MRNA 1ZUNB 2HJGA 5IHPA 2QP3A 3TE6A 1T6NA 3KL4A 1YZQA 4RVCA 4LY6A 1KAOA 4NHOA 5FUXA 4MGIR 2ZI6A 3FMOB 4HAZA 4EFMA 3PEYA 2PCJA 2WAXA 3AF3A 5KNBA 3BFXA 1U90A 421PA 3WP0A 3WNBA 2YWEA 4C0KA 3QBTA 4A15A 5BN5A 5LD2C 3SJAA 5AWFC 2GK7A 1CRPA 3O8RA 4PPFA 1M7BA 2ZE8A 3N2IA 3T35A 2R65A 5HZHA 3TUJC 3R7WA 4GOJA 3K0CC 1P4SA 1H8HD 3MAAC 5L8VA 4QM6A 1ZNXA 4N0EA 5FR1A 3MJRA 221PA 5FPYA 2H16A 3U3OA 2FPKA 2WJVA 5HCNA 4OK5A 5FTMA 2IHYA 4Q7KA 1BKDR 4NCJA 1F2UA 2IYUA 4I4LA 2FU5C 2DWQA 3EW9A 1UF9A 4KAXA 4TMXA 2DY1A 4KJZA 3VX4A 4DCTA 3TVDA 4FXPA 2XOKA 1YZTA 1RVDA 3CNNA 5BN4A 1ZD9A 4W5JA 1G19A 4OK3A 4OYHA 5EE3A 1H8EA 2Q9AA 4WVFA 621PA 4RD2A 1Z07A 3NDPA 4DC9A 1NSTA 2VP0A 3LA6A 2PCLA 1G9XA 4JS0A 3G82C 3OAAA 2GK6A 1HE8B 4E22A 1ZJ6A 2Y8EA 1ZYUA 1L4UA 2X8AA 3KJIA 4R2IA 3EPHA 3AKDA 4FMCF 1K6MA 1WXQA 3B1ZA 4LZZA 1T8UA 1T9HA 2FSHA 3K0EA 2AFHE 4EPXA 3VMFA 3T1OA 3I4LA 4ZIRA 1GILA 1G7CA 4ZPXA 3Q9LA 4Y0AA 4DSTA 4C4PA 2OE2A 2O8CB 1II0A 1U99A 1CBUA 2FGJA 6Q21A 2FF7A 2Q0HA 4CEIA 5CJPA 1AZSC 4BUJA 2P2LA 3W6NA 3MRSA 4BEBA 1E2EA 1X1RA 5C4GB 2B7BA 2RGCA 2J0UA 3NIBA 4OHXA 1CIPA 3DO6A 2DWZB 2F6RA 2QI9C 2J46A 4D4JA 4GI7A 1UBEA 4BWYA 3AUXA 2H8KA 3BXZA 1T8TA 4MUAA 4G5OA 4TQUS 3G0HA 3EARA 5B58C 1C1YA 3U6KA 3EZ9A 4AG6A 2ZU6A 2H1LA 4IFEA 1S1MA 2DWPA 4BGDA 3KQNA 4B75A 2WWYA 5J5CA 2EW1A 1Z28A 2B8WA 4L5BA 1J7KA 2BMFA 2OBLA 2ZYTX 4AD8A 1EG7A 3PIRA 3GJ3A 2NO9A 3M4YA 3F0TA 3DEFA 4UXIA 2O8FB 1NI3A 1DPFA 3ZYCA 4GOXA 1ZNWA 4UNQA 1DAHA 4JLMA 4US0R 4TLEA 2NMVA 2B7CA 5CITA 1QG2A 2IYTA 4Q1CA 1P60A 1CLUA 2VL7A 2W2VA 5KNDA 5F3WB 1XTJA 4NL4H 1U8ZA 4PXAA 1QHHB 4GRAA 5HTKA 4KYIB 1EFCA 4ZDIA 3K70B 1QVRA 2FGKA 2GRJA 2ZI3A 3OHMA 3GQBA 4MKIA 4TYNA 1VG1A 3EAQA 3THOA 4TMVA 1XTKA 4LHWA 2BM1A 4MYTA 3TUZC 2ZAMA 4IEIA 2V4ZA 1N5IA 2XZOA 1UKEA 2A7QA 4PZYA 3AKYA 1SZPA 1GRRA 4CEHA 1TQ6A 3W5JA 1TL7C 3K0FA 3HWSA 4UNRA 2VTKA 2W6IA 1KIMA 4OL0A 2O0JA 1W0KD 1W0JD 3QJYA 4HAVA 4ZO4A 1NNEA 2P6RA 2ORIA 4OI0A 3P27A 2QPAA 4HUQA 4LYJA 4CYMA 4Z1MD 1KZGB 1F2TA 2AN9A 4LJ8A 1S1CA 3CH5A 5GVRA 4LYFA 5CK4A 2C9OA 4X8MA 2ZYUX 1XB2A 1BOFA 4LI0A 2C5LA 3G5UA 2ZRNA 5IK2A 4NONA 2RCNA 2ONJA 4ZV4A 3KJHA 2FH5B 1JNYA 4IHQA 2WICA 1UFQA 1A5TA 5AUNB 2KBEA 1O3YA 4BFVA 3ETLA 2C95A 4QGHA 2IEZA 2QBYB 1E1RA 3QKSA 1HY3A 2VHJA 3W8RA 2VP2A 1T0JB 1SXJC 4OQXA 1VG8A 5KDDA 3REFA 2D2EA 5TVKA 1SQ5A 1NIPA 3RABA 3AGPA 1D6JA 3JVUA 3ZDQA 4GFDA 1COWD 5LB4A 3QEOA 5CIWA 1K5GA 3K1JA 2HUPA 1UPTA 2ZREA 4M9ZA 4POAA 1NBME 2G9NA 3BS4A 2OFXA 2UVQA 3IKJA 3LLUA 4Q4LA 1TTTA 1NN0A 1IJEA 3FFAA 3P4YA 2QY9A 4RCYA 3KB1A 3ZIAD 3W6PA 2CCGA 2WJIA 1XMVA 2O0KA 1JEDA 2ZS8A 2GXUA 1E1QA 5AJWA 1BYUA 3A8TA 2CNWA 3U44B 2OZEA 1E99A 3GLFB 1TQDA 2ZR7A 5DHFA 4TZ0A 4A3VB 2WMOB 3NWJA 2MSCB 1YR9A 5TB5A 3T1QA 3QKRB 4P4UA 2JDIA 3I62A 4QFMA 4Z8YA 4Q03A 4A2WA 3QVUA 4C2UA 4R98A 3K0CA 2GEUA 4OQMA 3SYKA 3KQUA 1FMLA 2OCAA 2CJWB 2K5UA 5TY0A 4LBZA 4LJAA 4JLDA 3MWKA 3KKOA 3PUWA 4XTCS 1HUQA 1JB1A 2A5JA 3EZFA 3UANA 2QU8A 1WBBA 1W49A 2W2TA 1DAMA 4G1UC 1H65A 3AP3A 2FPMA 1Z8FA 4QBFA 3ZVRA 4ZCIA 1QVAA 4PPNA 1OW3B 3ZJYA 1E2MA 4PPQA 3EWSA 2BBTA 5FPKA 5C2JB 3I5YA 1Z6AA 3QF7A 3UPUA 1JAIA 1Q44A 4JL5A 1IN8A 1Z0JA 3QG5A 1II8A 3WNDA 3K70D 3BFVA 1ZAKA 2YOGA 2DFKB 3ND9A 4PQYA 2EYUA 1GNPA 3R20A 2EWVA 3RDPA 2I3BA 2EU8A 2G6BA 3W34A 3R9WA 4M22A 1YHNA 1E32A 1MH1A 5JECA 2GJ8A 3QKUA 3CKLA 2ZE7A 1JALA 3GJ0A 4BFYA 4MRPA 1GWNA 2ZRAA 1GKIA 4AIIA 3U4QA 1Z2CA 2XNSA 3TSOA 4IDPA 4BZQA 4LK2A 4UNPA 1DVRA 2ZSBA 2AWOA 2FEMA 3DM5A 4ZDWA 4NBSA 4RZUA 3TLXA 1X1SA 3T15A 5TV2A 3WBJA 2LKDA 1KOFA 2MSEB 2WWIA 5FOWA 5UKDA 1XEWY 2AK3A 1N25A 1CRQA 1AJEA 3U6BA 1NN5A 2BMJA 2QPTA 3L43A 2R9VA 3EX7C 3K0SA 3SBEA 1FTSA 2REXB 2Z0MA 3WNCA 2PH1A 3E70C 4JBXA 1ZM3A 4PZZA 4C0JA 5J40A 1TADA 3V9PA 4U00A 2QM8A 1PUIA 1G16A 2XOKD 4NCNA 4TZ6A 3LQRA 5DIFA 1VPLA 3NHAA 3ADCA 5CLLA 4FWDA 2ZR9A 3CNLA 5AR1A 2J0VA 4MGYR 3RS5A 2ONKA 3OEEA 4O25A 3CLVA 3GEEA 2QMHA 5JBQA 4DCSA 3I8XA 1N6IA 2WWFA 3H86A 5CYOA 4A0RA 3OAAD 3C4JA 3LRPA 2O8DA 2R44A 4GNKA 2FDCA 5J4HA 1XTIA 1PV4A 2HJVA 4AK9A 1R5BA 3DHWC 5GJWC 1KI6B 3TW8B 2IS2A 4QNRA 3SU8A 3KKQA 1UEIA 4F4CA 1NG9A 5FUWA 1IN4A 1J8MF 5JI3E 4C0AC 4PAQA 3W90A 2QN6A 3HYRA 1Z83A 1CS4C 2XJ4A 4M4SA 3GLIA 1K8RA 1Q1QA 1BYIA 4JBWA 3B82A 5JJKA 3P26A 2HXYA 4OQLA 1V5WA 2GCOA 3UXMA 1Q57A 4FMBB 3FOZA 5JCZA 2I4IA 4HEJA 4V02A 4PFSA 2WIAA 5BQ5A 4OJQA 1OIXA 3U3MA 4HAUA 5CB6A 3VU9A 2OCPA 4RFVA 4F38A 1Z08A 1N5KA 1P2TA 4L15A 1TU4A 2Q9CA 4XVQA 721PA 1IONA 1EWRA 3CX8A 2ZE6A 2I1QA 3VR3A 3C7KA 4CT5A 1XXHB 3TJZA 1AM4D 1DAEA 5EP2A 1ZU4A 2HDNB 4YDHB 1ZIOA 1E2LA 1S3SA 1A1VA 1LV7A 3N5CA 2NO6A 3QPWA 2GETA 2MMCA 3KJEA 3GJ5A 1DARA 3FFBA 1O87A 1VMAA 2QMUA 2ZRHA 4Q4JB 3A1VA 2WJHA 1JECA 3BD9A 1G17A 3MCAA 4I1VA 2Q6TA 3QXCA 4IOKA 4NE2A 1ZMXA 4NTZA 3TH5A 4IVQA 4G01B 4UQOA 5KOYA 1G3MA 2RHDA 5KU1A 2IXEA 2CK3D 1UBCA 3BC1A 4XOIA 2HCBA 1L2TA 1GP2A 4LC0A 5JZVA 4EIWA 2O8EB 1GG2A 2KE5A 4FMCB 4WW0A 2XB4A 1EFRD 4EDHA 4RCZA 2C03A 3AQ4A 1DO0A 1OKKA 4DLVA 1TQ2A 4TLAA 5JWOA 5L3QA 2ZS7A 1IQPA 2W6ID 4ARZB 4EPTA 4ITRC 4YMTA 2WAYA 3RS3A 4DRZA 2PEYA 4CEJB 3NG1A 1TQ4A 1E2QA 1XZPA 1TF2A 4KSBA 4PC6A 2VP4A 2ZJOA 4LHVA 3PR1A 3O47A 3AVOA 4B44A 2NZ8A 1F3OA 1XTSA 5KSOA 1FNMA 2OFWA 4OI2A 5IK2D 3CZQA 2W00A 4IXMA 1SVMA 1JBKA 2OEPA 3GLHB 4TYYA 1J90A 4TMTA 2IUTA 3L0PA 3PQCA 2X77A 1FUUA 3FKQA 1OXVA 4URZR 5DO9A 4P4SA 1YRBA 1ZNYA 4UNNA 2BV3A 2A5DA 3CONA 1YE8A 1T3SA 1E1RD 2EFCB 2ERYA 1ZU5A 4OI1A 4EPRA 4AKEA 3K09A 3V4RA 821PA 4TMZA 4A8JA 4IDQA 3RC8A 3CPHA 5A5GA 2WJYA 2YWGA 4Q1BA 1KI2A 3TBKA 3HYTA 4DT1B 1NMXA 1ZM4A 1JI0A 1EGAA 1E9CA 1WB9A 1E1QD 2D4HA 3IDQA 1RRFA 1LS1A 1X8LA 3AVPA 4QJ4A 3EWAA 5HPYB 5G53C 3Q7PA 2QQEA 1KSFX 2IBMA 2F1IA 3OESA 1GIAA 5FH9A 4KLNA 4GITA 3AKEA 3ZD6A 5JLJA 3PVSA 2JDID 4D0LB 2CBZA 2A9KA 5FPSA 5D3QA 4HAWA 5AUOB 1KSJA 2IYVA 3VX3A 4DUGD 5DYIA 3QE0A 2P65A 3H0KA 1X8JA 2JIZA 3L2OB 4KU4A 1AGRA 3LBNA 5KPDA 1XPRA 2C78A 1KI8A 2PZEA 4L9SA 1FX0A 1CF4A 4PC3A 2B8TA 4Q4AA 4CVNA 4ZCMA 4LOAA 4U7DA 4NYIQ 3L8YA 1W4BA 4WXPA 1TPZA 1OE0A 2V3CC 4TLDA 4UJ5A 3I5XA 4A82A 4I1OA 3AF2A 2ZM5A 3M6AA 2ZVQX 1IM2A 2AKAB 4JLBA 1UDWA 2J0QA 1M34E 2RHMA 3QF4B 1XPOA 4NH0A 2ODWA 2E9SA 2R6GA 2I1VB 4XVRA 1SHKA 3C14C 1FL9A 1RJ9A 1UKVY 2ZRFA 1SXJB 4RFSA 4V0MA 1WBDA 3IEVA 3H4MA 2CHVA 2ZRKA 3LDAA 5BXQC 4EJSA 2XAUA 5KO2A 5B64A 4PC7A 4DBLC 1ZM7A 4OHYA 1LFDB 5DHAA 4HAYA 1E9AA 5H70A 2GF0A 2R6FA 5EE5B 1R0WA 2FFQA 2JA1A 1CULC 1MT0A 1XTQA 1U0JA 1XD2B 4KCGA 5JJLA 1LS6A 3RC3A 1XEXA 4JVMA 4YMUA 4KBFA 4HB0A 3THXA 4M1TA 5EXPA 4P4TA 3RRNA 2AD1A 3PG5A 1X6VA 1QRAA 2H7VA 3I73A 2R6AA 3BH7A 4BFTA 3I8SA 1VG0B 4AWXA 1AS2A 2GKSA 3Q85A 4DIDA 5JRZA 2HV8A 1IXZA 1YZGA 4B48A 1M6NA 1L4YA 1PLKA 1CR0A 1ETUA 3TUIC 4XWAA 1WMSA 2O5VA 4LCBA 4AI6A 5D3MA 4Q1AA 1B23P 1CEEA 3NBXX 3FWYA 3PXGA 1YU9A 5HE9A 2OHFA 3TAUA 3IEUA 3D3QA 4WBSA 3AP2A 3O8DA 4ZKDA 1OB2A 2ANCA 2BC9A 3UWOA 4ZKEA 4FN5A 4V0ME 4TN1A 2D74A 4PPGA 3SNHA 4CW7A 4RSGA 3P32A 3DMNA 2C96A 4DJTA 2KJQA 3K9LA 3MD0A 5CLQA 3U60B 2ZJ5A 3B1VA 1SVKA 1E2DA 3HR8A 2ODNA 4TWZA 3LW8A 3FMFA 1CJTC 3RRYA 3N70A 1RRPA 1YJ5A 2OG2A 5F2EA 3GLGB 4F92B 1KMHB 5CDFE 2RGEA 4AKHA 1AA9A 1KDPA 2VHTA 3BRWD 3LW7A 2WJGA 5E7IA 3LX8A 3NC0C 3P4XA 4DEYA 3K8YA 3S1AA 1NLZA 3W5IA 1E9RA 4DEXA 4D6PA 1R5NA 1OJLA 3KQHA 2J59A 1E9DA 3RVBA 2IWRA 2WPDD 5L3SB 4A36A 1KDOA 3A37A 5IDVA 2VRWA 4TL9A 3TR5A 3FPAA 3QENA 3B2EA 4TQ9A 2OCYC 1YZLA 2OAQ1 2ZITA 3CZPA 1MRNA 3LH5A 1U2RA 4Q9KA 4R2HA 3DZ8A 3RS2A 1QBKC 4DWJA 2RAPA 3P20A 1XP8A 1AZTA 2H92A 4ON9A 1UEJA 2WTUA 1IN5A 2Q3FA 3HPRA 2QMEA 2JJ8A 3FDIA 5DLQC 1KJYA 2GXSA 4PQRA 3IHWA 4JT2A 4A6XA 1SXJD 3A1SA 2VLIA 3KB2A 1D2MA 3W9YA 3BB4A 2ZI4A 2DZOB 2HLDA 2ZRBA 2H17A 2ZSEA 4MRRA 1G20E 3IIJA 3SJZA 4F4IA 2QROA 5FOUA 2DBYA 1AK2A 1SKYB 2X2FA 1GRQA 2QG6A 4DDTA 1CTQA 3QXHA 2G88A 1RRCA 4A4DA 1KI9A 2CL6X 2IUSA 2QORA 2WWGA 5C46F 1OKKD 5JJIA 3VFDA 1KKLA 4JT4A 2GZAA 1NVWQ 2WOOA 2IYWA 5EXTA 4FCVA 4AURA 4ZI2A 1U94A 2W58A 3T06B 3MGCA 3TIFA 1T4GA 2J0SA 4Q9LA 2DWOA 1EX7A 1F48A 5H1YA 4YMWA 3D7MA 3ZGXA 5CYPA 3RYTC 4DCUA 2O8BA 4K81B 3WYGA 4TT3A 3NBFA 3MMPA 4B3BA 2ASEA 3DVLA 3NH9A 4UNSA 4B6EA 4D82A 4K46A 3QG1A 4NYMR 2IL1A 4OI4A 2V1XA 4YQFA 3I61A 1CKEA 1TUEA 2O0HA 5JHHB 1ZINA 3F5FA 2XGJA 1XCGB 2ZSDA 4LHZA 1ZCBA 2FOLA 2XZPA 4FCWA 3A1WA 3TQCA 4GDFA 3VKWA 1PZNA 2YC2C 4QL3A 3IIKA 2DCUA 4H9GA 2ORVA 3EZ6A 5TMPA 1E2GA 5B57C 2WWHA 3R8CA 1PUJA 1OFHA 2F7SA 1JXOA 2FWRA 2PLFA 3CRW1 1N5LA 1XTRA 1AS3A 1CR4A 1HYQA 2ANBA 1SKQA 4D25A 2GF9A 2V6JA 3DKPA 3TNFA 2F1JA 1MO6A 2IC5A 1RE0A 2GDJA 4LYHA 4LWZA 4RD3A 3LAWA 3KUCA 5DI9A 2PX0A 3SDZA 3SN6A 5H8WA 3F8TA 4LJ7A 4C7OB 1OIVA 2PLRA 5C18A 2PT5A 3DL0A 3T61A 1C9KA 1HT2E 1GL7A 2B92A 3X1DA 4CRWB 3ICEA 3B13B 2QM7A 4B74A 1ZD1A 1DG3A 4HDOB 1UKYA 4G5RA 4Q9JA 1VHTA 3A58B 3NEJA 3CH4B 5LBIA 4IDOA 3J81k 2AR7A 1ELOA 3WY9A 2R2AA 1YZNA 2X1VA 2JIZD 1OFUX 1DOAA 3CRVA 1IAQA 4AY2A 4E03A 4CZ2A 1I4DD 2N42A 1IJFA 1HURA 1T5IA 1MABB 4RKFA 4O2RA 3U3JA 4DLZA 1NBMA 4QBIA 2JATA 4BRUA 2ERXA 4MKFA 2YOHA 2ZVPX 1R6BX 1JAHA 1ZBDA 4HSEA 4Q01A 4UJ3A 4YMSA 1PLLA 1DBSA 1OXUA 3SHWA 2JLWA 4I99A 3R9IA 2CCJA 1JXMA 4GBMA 4B32A 3KKPA 4Q7MB 3WP1B 3GLFE 4FD2A 1N2CE 1NVVR 3BIFA 4HZUA 4C0SA 1ANKA 5FL7A 2OESA 1NP6A 4QG7A 1W47A 4BFUA 2A30A 2G1KA 3VHXA 4ESVA 3U61B 2FA9A 4KV9A 4Q48A 4F93B 1RC8A 4PHTA 3IBGA 2FSFA 3R7WB 4JYCA 4ACAA 4DB2A 4TL6A 1KY3A 4PX9A 4URUR 1TF7A 1OB5A 4JLAA 2QUZA 2ZS9A 1E9FA 1NLFA 2YJTD 3CWZA 1E79D 2QE7A 4Q66C 1WA5A 3NBZC 5J4VA 2IT1A 4M9XA 1DAKA 1F2UB 2R6CA 2G83A 2NZJA 3IQXA 1UJ2A 1FP6A 2IXGA 2ZJ2A 3KDSE 3EPJA 2D7DA 1W4AA 2FFAA 2ZRMA 1QHIA 1TEVA 1ZUHA 2MSDB 3VR4A 4NKRA 1EXMA 2QA5A 2WWWA 3GJ4A 1OXSC 1Q1ZA 1JJ7A 2D3WA 4F4JA 3EC1A 2KRKA 1ZVQA 3I3SR 3IILA 3ZQJA 4M2LA 2DHRA 1SVLA 1U98A 3U7EB 5IF9A 1G4AE 5IRCD 3W3ZB 5K8IA 2PBRA 2FE4A 1FPMA 4ZIRB 3KXIA 4KODA 2EQBA 3ECCA 1S4QA 1SVIA 1A82A 1X8KA 4LJ6A 3BE4A 2P6NA 5K8LA 3GMTA 2AD5A 1JPNA 1W7AA 4CEIB 2BCJQ 4TL7A 3MHVC 5HCIA 1I2MA 2XTNA 1W36D 1Z0KA 2BDTA 2J0UB 1NLYA 2J1LA 3C16C 2NG1A 4XIGS 2VSFA 3CPJB 3IHLA 4Z51A 4PZLA 2V1UA 1AQYA 1KY2A 4YONB 5FOVA 3ZH9B 3FE2A 4GT1A 4B3XA 5DI3A 3HR7A 1YVDA 1P75A 1SVOA 3PUYA 1OF1A 2XTZA 4DXAA 1YZUA 1LVGA 1FZQA 2ZYWX 4FWIB 1XD9A 3AF1A 3EASA 2GNOA 2BEKA 4EFLA 4ZDKA 5EP4A 1KDTA 3K53A 3CIOA 4FCTA 4LJ5A 4A1FA 1Y63A 2QQ0A 3ICQB 3T34A 1WF3A 4URXR 3K09C 3FMIA 1NJGA 3GEHA 2CXXA 1KO8A 4W5WA 4XH9B 4L8GA 4A8JC 1VYTA 5AK0A 3IIMA 1N0WA 1U81A 3QPVA 2C9CA 1GAJA 4F7WA 4PAMA 3VHLB 2HEIA 1P6XA 4ASUA 1OLOA 1VCIA 1KNQA 4WXRA 1A2BA 4Q9IA 5CM9C 3U3RA 3GFOA 4Z8XA 1T3HA 2VHUA 2Z83A 1XJQA 5FL3A 1ZIPA 1YZKA 3VNVA 2KI5A 2NO0A 2HCJB 1M7GA 5BYJA 3BGWA 4HATA 4D81A 3EA5A 4BRWA 3PFIA 4JBYA 5EE1A 1IXSB 2P0EA 2CDNA 2VHQA 1R0YA 5CM8B 1P2SA 2QSYA 1X86B 1XBTA 3K0AA 4JKIA 4Q4HA 4V0OA 1Z06A 1TNDA 4CEHB 3HP1A 1II9A 1IY0A 3AKCA 5FTNA 4QBGB 3RS4A 3B1YA 5HKKA 1X3SA 2KB0A 1AN0A 2GJSA 4V0KA 4X8LA 5C4MA 4B47A 5GJVC 4GZMA 4TTPA 2QTHA 5G41A 1F2TB 2SHKA 3FHOA 1XXHE 3C15C 1Z47A 1US8A 1XEWX 4AYTA 3IO3A 3T12A 2WKQA 1HA3A 2R6DA 4NDZA 1H8ED 1ONBA 4D4LA 1EESA 1KO4A 2BMEA 3D6TB 4Q7LA 4EQ6A 1JR3A 4F91B 4JIMA 4PO9A 5JSZA 5KDOA 5HE8A 5F9HA 4Q1FA 4IDNA 3LLMA 3UG7A 3JVVA 1AIPA 3EIQA 2ZRJA 4O3MA 1D2EA 4HAXA 2IXFA 1KO7A 1KDRA 3ZVLA 3Q5EA 1W2GA 1G5RA 1L8QA 4EJSC 3LVRE 4NCHA 2ZRDA 2ZXUA 4TT3D 4NP6A 3HDTA 4P3YA 4W7SA 4EPWA 4OBEA 2IYYA 4DLXA 1VYUA 1W44A 3LX5A 5KSYA 3ND8A 1Q3TA 4DDVA 3LFUA 2ZUBA 2IX3A 2BM0A 2MMGA 4A0GA 1T0HB 1FNNA 5G3ZA 4ZDJA 2X2EA 3AM1A 4P0TA 2X19A 2H5EA 4BQSA 4JVLA 4XSGA 4CT4B 4B73A 1KYIA 1TF5A 1UKZA 3RLFA 5LD2B 2YV5A 1UADA 5J4YA 1G8GA 1NVXQ 5AJXA 2QT1A 3QNUA 4JL6A 2YZ2A 4C0BA 1P61B 2OLJA 1SGWA 4NYJR 5FTLA 5K8UA 1ZP6A 3SI7A 2JCSA 3ZQ6A 1X37A 3VAAA 4FINA 3VLFB 2B6HA 2XNDA 3GLHE 1E2PA 2ODBA 4MGKR 2NPIA 1JR3E 3U7HB 1QHNA 4KXFB 5GJCA 3R8FA 3AVQA 1Z0DA 4B3DA 2L0XA 2GVZC 4BFXA 3L8ZA 1W36C 3CUEF 4DLSA 1AS0A 2P5SA 4MQBA 3KQKA 1G4UR 3CF0A 4PTLA 2HF9A 1E9BA 5EUMA 2OCBA 1A2KC 4Q1EA 3B8HA 1II8B 4XVUA 5EZ6B 4L4UA 4LPKA 4LV5B 1KMQA 2LKCA 3BB3A 1XX6A 3T5GA 2BMDA 1SVWA 2IYSA 3IPYA 3NVAA 1GM5A 3WMEA 1NBMD 1XMIA 4ILEA 2VP9A 2IEYA 3BBPA 4LYAA 3UKDA 1P9RA 3I32A 1G7SA 3IUYA 1GSIA 4H1UA 4JMPA 4D4KA 1KK3A 3MG9A 4X8HA 1RW4A 4PHHA 2NGRA 1TAGA 1QHYA 4YMVA 3U4QB 5L3VA 3KTAA 1YRAA 4GP6A 4BLPA 3A4MA 1XZQA 5FL7D 1NF3A 2F43A 1DO2A 4FW9A 3AV0B 2E1RA 1G5PA 1M2OB 2HYDA 4V03A 4DSNA 3AVWA 2ZAOA 2GILA 2XSZA 2QAGA 3I72A 1N6NA 2CL7X 5FPHA 1CR1A 4DSUA 1G41A 3O8BA 2XXAA 5E7MA 1PJRA 1WP9A 3SQWA 3ZLJA 2V54A 1ESMA 4R7ZA 4DLRA 3CPEA 3KW6A 1P2VA 1Z22A 3B1WA 1N6OA 2QE7D 3JZMA 4ESHA 4LJYA 4QHYA 4TQAA 4Q9HA 5M04A 2WHXA 3T1TA 3EPKA 1DEKA 2AWNA 4FWHA 1NL3A 3QEJA 3VR5A 3TGPA 4BFSA 4LBVA 3RANA 4HB4A 4A0FA 3THYA 1KJWA 5FUVA 4KVGA 4URVR 4HLQB 4C2TA 1G21E 1KI4A 4JL8A 5CIQA 1Q1EA 4WA7A 3OIYA 3CRQA 2V6IA 3PEVA 2N46A 4QXAA 4B71A 2RGNA 3HU1A 2G0TA 3E1SA 3LY5A 2ATVA 4N3NA 1JQLB 1KGDA 5JI2E 5EE9A 2VSOA 2O8DB 1VCMA 2IYZA 3B5JA 3WRXC 4CIDA 4PO1A 1KTVA 2QP4A 5AUPB 2RMKA 2CNWD 1CXZA 3RWOA 1TEXA 1HH4A 3B1XA 3PEUA 2EFEB 4C3ZA 1G1MA 1R10A 1E0JA 1GRNA 4L9WA 2W0MA 4R9UC 4IXNA 3GLIB 1RYHA 2J41A 3C41J 4PHGA 4IOJA 1G64A 3THWA 2GESA 1E4VA 2OV2A 2GCOB 2FV8A 4MYHA 5J47A 1E3MA 5G3YA 3WHLA 4GOKA 4RD1A 5FOXA 4M21A 2VH5R 5JWRA 1GZSA 1QHXA 1R5OA 1VYVA 2BEJA 4A2PA 5JCPA 4PHFA 1S9DA 3W6OA 3VU9B 1CJUC 4PC2A 1FMJA 5LB2A 4I1SA 1P9WA 3A36A 2WMNB 1M74A 1C4OA 2QRZA 3ZZUA 3A6PC 5DNYB 1S8FA 4M0LA 1YKSA 3SJBA 3FHTA 5JS7A 4WIAA 3PEWA 4M9SA 1S2MA 2OBMA 2H57A 1OFIA 5DGXA 4W9MC 2PL3A 1EFUA 3WHKA 3X1YA 4LRWA 3V4FA 1W5TA 2YKGA 4QHSA 2GXAA 1E96A 4BEJA 1DAIA 4BLRA 1XWIA 1KI3A 3T1VA 3OF5A 4B2IA 4HZIA 4TTRA 2EVWX 3TVTA 4ASUD 1Z0AA 4U02A 2JLZA 2DFLA 1W2HA 4OKSA 1ZNZA 2WM9B 3VKGA 2IUUA 2FFBA 1NKTA 2IF0A 2QL6A 3CBQA 4NZYA 4HB3A 3SZRA 1AKEA 3FKSA 4PSKA 2WOJA 4OQFA 2YYZA 3PV0A 1KSGA 1GUAA 4GSYA 2ZE5A 1Q1BA 2AK2A 2ZI5A 5KUTA 1OH6A 2W2XA 4BFWA 1JJVA 3GLGE 1KO1A 1R0XA 4FIDA 2A5YB 5CDFA 1KO5A 2PJRA 3FB4A 4Z1MA 4PO8A 1D9ZA 1QG4A 1NSFA 1G7RA 2YINC 2ZROA 4R71A 5L3QB 2REBA 4FWGA 2F3TA 1EFTA 4G5QA 1XJCA 1R8SA 4JSYA 1XF9A 3KJGA 5HKKD 3GJ6A 4MYUA 1F60A 2O52A 3FGNA 2P5TB 4QJ5A 1NVUQ 1OYWA 2GEDA 3CW2A 3VQTA 2V8OA 1Q20A 2RB4A 4YC7A 3KQLA 1CJMA 4FMDF 3EZ7A 4DVGA 4A0HA 1ZM2A 2FEOA 3CR7A 4AG5A 5J4KA 1GNRA 4BLSA 3A1TA 4BLQA 2OO7A 1TMKA 1Z3IX 2B21A 2IYRA 3OEED 4HLDA 4KFTA 1MO5A 2GXQA 2FNAA 4P4SB 2CEAA 3QQ5A 2O8CA 1OPXA 2LWIA 1JR3D 5DE3A 3WBKA 4IVPA 1G8PA 2JAQA 3LD9A 3X2SA 3QVVA 1TX4B 2D7CA 2PX3A 2ZPTX 4RD0A 2FG5A 4I81A 2C2HA 3KXLA 3OFNA 3PCRB 2BOVA 3QXSA 4DSOA 3SYLA 2ZI9A 1I2DA 4W5HA 1CP2A 3NHBA 1U9IA 4N1AA 2C99A 1K5DA 3RRMA 4A8JB 4B6FA 1Z63A 1OXTA 4XWOA 2OSBA 2YWHA 4URYR 4OHWA 1XU4A 1Y3AA 4H1VA 2YNMA 2PT7A 4KFRA 4U5XA 5DYGA 2G3YA 4PC1A 3GD7A 4DDWA 2EFDB 1R2QA 1GNQA 4M53A 4Z54A 5FBLB 4FI3C 3KZ1E 2QSZA 2VEDA 3EPLA 2FX3A 5JRJA 5EP1A 2KWIA 3PUVA 3UMRA 2O8FA 5DN6A 1XPUA 1N0VC 2J87A 2YOFA 3E5HA 2V7QA 2HYIC 2W0SA 3CWQA 5BYKA 4FWTA 1KK1A 5L3RA 1NVMA 2CE2X 1N0UA 4M1KA 5TDHA 1QHHA 3ONWA 3OZXA 4QNMA 2XNDD 3ZZ0A 3VKHA 4Q47A 1Z0FA 4M1SA 1FFHA 2GCNA 3DMDA 1FX0B 4QOSA 1U8YA 2QAJA 4Q4AB 1CR2A 2FPLA 2IF2A 5FOTA 4AYXA 4DLUA 1JQJC 3FHCB 4MKHA 3QPUA 1XD8A 4RZ2A 4LSGA 3NC1C 2TMKA 4JLVA 5BW8A 2ZRCA 3B78A 4MDEA 5DISB 5EUQB 3FVQA 3WRYC 4LV8B 1RJ9B 121PA 1F6BA 2EWWA 4RFSB 2F9MA 1KJZA 3IGFA 3ADBA 1S3GA 4EJSB 2NQ2C 2QTFA 5K8TA 1QHSA 2R8RA 1BO6A 3C5HA 1VCNA 2ZJYA 4RD6A 3FYHA 2DPXA 1DELA 3SOPA 3NDBB 2G1JA 1XEXB 1UBFA 2BJWA 2N1BA 4IRUB 4KVAA 3E2IA 4JZKA 2E87A 3SBDA 2OFOA 5KSPA 2ZJBA 1E2JA 2XSZD 1Z6GA 2RGAA 3B9QA 3THXB 1PVOA 2QBYA 2GZHA 3AVTA 3VR2A 3LV8A 2FZLA 4JLKA 1FOEB 1YQTA 2WSMA 1GITA 4US1R 5GADl 4Q00A 2ZU0C 2P67A 4TSFA 2WBLC 3TSWA 1T5LA 1XMSA 2C8VA 3MFYA 4GPTA 4NPHA 1HQCA 4ABYA 2OXRA 5SZJA 2JJ1A 3SHFA 1NKSA 2WKRA 2FSIA 4M1YA 3CB4A 2D2FA 5FTJA 1E9SA 1DE0A 2A3RA 2PZGA 2VF7A 3GJ8A 4QGFA 5D3MB 4LV6A 3B60A 5KDLA 2V6ZM 2JJ2A 2GBLA 1KSHA 2C9YA 4PSVA 3U44A 3GLFA 3AB3A 1NVVQ 3UMSA 2AX4A 3AUYA 2DYKA 1E0KA 2ZUCA 3IQWA 3QI2A 4BZXA 5KPJA 3ZVMA 1W36B 4E09A 3LVQE 2NO1A 3QKRA 3HU2A 2F1HA 2ZR0A 2EYQA 4QGAA 2Z43A 1A4RA 1AKYA 1CJVC 1KAGA 3PENA 4D26A 3WMFA 4C30A 4I1UA 1EWQA 2CJWA 4HLCA 3NTUA 2REOA 5G40A 2IS4A 1NY6A 1J70A 3H84A 1JPJA 2GZDA 4AKGA 3N2EA 1LY1A 2A5FA 1RRGA 1GVNB 1VDZA 2QTVB 3VR6A 3WYAA 4LBYA 1OT3A 1R8QA 3CRMA 3FTQA 5HR5A 2IYXA 1Z0IA 3GP8A 3W8NA 3PITA 4A92A 4HLUA 3S1AB 5F9FA 4RKEA 4HYYA 3RWMB 1R0ZA 4DCNA 2IHBA 3LXXA 1W4RA 3QXJA 3LNCA 3DZDA 3BH6A 2F9LA 4YXWA 4QKQA 1P62B 2IA5A 3TQFA 1OSNA 2JLSA 1TUIA 2VPPA 4TL8A 5JWHA 2A5GA 3OEHA 4V0NA 3FMPB 2RGXA 4LBWA 2RKOA 2VQSA 3I92A 2CHGA 3CX6A 4G5GA 4BLOA 1GFIA 4RY2A 4A9AA 1NN3A 4JSTA 1W4CA 1BMFA 1GTVA 3W3AA 5FI0B 2CK3A 1KI1A 1LNZA 5TARA 4MKGA 4TTQA 4D80A 3TMKA 3BFKA 1KK2A 1KHTA 2Z6VA 3QY0A 2GEVA 3SFZA 4C0QC 1UDXA 3UATA 4TYQA 1EFRA 3AF4A 1VKJA 2HT6A 3AVXA 2F55A 2XB2A 2W6JA 4M9QA 1N6PA 4HDQB 3WYFA 2QRNA 3U5ZB 4LX0A 1OH8A 3FKSD 3HJNA 4B35A 2BJVA 1D2NA 2DFTA 3NH6A 5JMTA 3D8BA 3AVVA 1SVSA 4B3FX 2Q9BA 4L16A 2QT0A 2UZIR 1HV8A 3UIEA 3LWNA 2A78A 3TK1A 4KI0A 4URWR 4Y0VA 4LHXA 2AXPA 2BBOA 2ZUDA 4ACBA 3EG5A 5ANRB 1QHGA 1OXXK 5B2ZA 2RGGA 5FFMA 1P9NA 4B43A 4OJKA 1QF9A 4PQFA 2NOAA 1ZC3A 3AVUA 1V43A 1RFLA 3NBYC 5KHOC 1D8TA 4AYWA 4J0QA 4KHZA 2IK8A 3KKNA 3ZVNA 1NRJB 2YWFA 1IOZA 3U7GA 3ASZA 4M1WA 1OHHA 4PANA 4TMKA 4D4MA 3K9NA 4C0HA 3EA0A 1WRBA 4DKXA 1S96A 2FSGA 1YR6A 2QP9X 3U3KA 1LW7A 2J3EA 2RGDA 4IOMA 3TKLA 2O8BB 4HB2A 1KI6A 1W1WA 4AKIA 3TR0A 1E2KA 5EQTA 1E2NA 3SJCA 5BN3A 1ODFA 5FR2A 2PJZA 1AQUA 1RIFA 3VNUA 1R7RA 1LF0A 3SEAA 2NIPA 2J5XA 1E6CA 1J8YF 1DS6A 2IW3A 2ZSAA 2QAGC 3OFND 3C8UA 5EJEA 3BAFA 4G5SA 3RSOA 1N6RA 4IW3B 1VIYA 1DAGA 2GAAA 1G18A 3RNLA 3QIAA 3QUSA 2ZJ8A 2CLCX 4EFNA 3ZS8A 3B9PA 1G7TA 2XITA 5E7JA 1QZXA 1GKUB 2D06A 4JN6A 2C77A 4UKDA 2CVHA 2VP5A 2OBNA 3SR0A 2G77B 2HF8A 1XXHA 1P72A 3DOFA 3IO5A 3MLEA 4YLGA 4XD7A 4LRSA 8OHMA 1E0AA 4LJ9A 2ATXA 4HI0E 4X8OA 1VIAA 4DUGA 1NJFA 2XZLA 2BBWA 3OIVA 3AP1A 1S9HA 2DB3A 1IHUA 3H1TA 2AHOA 4IKEA 5DN6D 4Q4JA 2V7QD 2RGNC 3KKMA 3UMFA 5CB8A 1U0LA 1WDTA 4LPSA 4WZAE 1ZUIA 1M1YE 2LCFA 2HXSA 2ZQ5A 1E69A 2RH5A 4Q19A 1BS1A 1MV5A 3BB1A 1B0UA 3QSYA 4KFUA 3CX7A 1CJKC 4TLCA 1G8HA 2CVFA 2ZETA 2PEZA 2ZIAA 4PR0A 1XFAA 1D5CA 3OIUA 1P5ZB 2NO7A 1CU1A 1I4LD 3Q72A 3RHFA 1E2IA 3BORA 1XDBA 1E2HA 2PMKA 4QM7A 4FMDB 2ORWA 4TYWA 5SZKB 3TW4A 2O8EA 2RGBA 1DAFA 3K9GA 2WKPA 1E94E 2UKDA 1GDDA 2J7KA 1IN7A 3I1FA 2WSSA 3SC3A 4C9BA 4A2QA 3B85A 3K0FB 5AUQA 2ZI7A 4KLZA 4MGZR 2HLDD 1VHLA 2WWXA 1A7JA 3KFVA 3TSZA 5JS8A 3Q7QA 4KYUA 1RPZA 4HZUB 4Q18A 4ARZA 4B3CA 1Z29A 3KFXA 4B2LA 2GA8A 1NMYA 3M0EA 4HUQB 4CEJA 2GTPA 1HEIA 4BASA 4JLPA 3GCGA 2OM2A 1G3QA 4GP7A 2AKYA 5H68A 4NYJQ 1QZMA 1C1KA 3T5DA 1P73A 2V55B 1G3UA 1VTKA 4EUNA 521PA 4JVNA 2QMOA 2VYFA 2FN4A 2JLQA 2KBFA 1W48A 4EAQA 2VBCA 1UM8A 5JEDA 3AF0A 3GLHA 3BJIC 5FPTA 3RRZA 2WVJA 3EIHA 1KI7A 2XJ9A 5EP3A 4IOLA 3QKSB 1FUKA 3TAHA 4BFZA 1WCV1 3RS0A 2QNRA 4V0LA 2D62A 4B33A 2JLUA 3AH8A 4XSHA 2Z4SA 2J7PA 2VA8A 2WJJA 4IVRA 4TSFD 1YR7A 5BWMA 1OIWA 1RZ3A 3X1ZA 2ZRIA 3PJRA 4D0GA 3IPXA 2OUKA 3DPUA 3B7GA 4QRHA 2G0NA 4M1OA 2CHQA 1XMJA 4CF7A 3SFVA 2VO1A 2JJ1D 1OH5A 3O8CA 4JLOA 1N6HA 2PZFA 3HPQA 2Q3MA 3QOFA 3CRRA 2UZ3A 2WV9A 2JASA 3L0SA 1Z2AA 1DTSA 2PMDA 2IS1A 1J99A 4DT1A 1TU3A 3JZAA 5FBQB 4DHEA 4DCVA 1MOZA 2JJ2D 4K8OA 3WXMA 1E98A 1ZD8A 1NY5A 2OXCA 2CE7A 1LTQA 2BKUA 2FMXA 4JLJA 4CDGA 5FBVB 4JKYA 5FBWB 4C0LA 4US2R 1WQ1R 3OE7A 1P7CA 4MITA 2Q3HA 4LUCA 4TMWA 4OHVA 1JEEA 1GOTA 1L7VC 2EFHB 2BKEA 5KYKA 4MA4A 4Q1DA 5DI3B 5CK5A 5JEEA 4IJMA 4Q21A 4KO8A 1E9EA 1VECA 1Z6XA 4ZCLA 4IEEA 3KX2A 3GPLA 2VHCA 5F98A 2WPDA 1XJ0A 3SE0A 3U7FB 4CGZA 5TXGA 2OAP1 3BWDD 3U2QA 3DKVA 1P3JA 2C98A 5EZ5A 4D2IA 1ESNA 1KK0A 3MWLA 4QBHA 3C5CA 2P6UA 4KITB 2CLDX 3BERA 2JLRA 2HT1A 4JYBA 4PSAA 1U9IC 4DLWA 3NEYA 2JGNA 3CF6R 4YXWD 2ZRPA 3KUDA 4BECA 3QF4A 4WAUA 1PLJA 2ZYVX 3OEHD 1G8YA 4NCIA 3ADDA 3REGA 2W83A 1SXJA 2CCKA 4HDCA 3UK6A 4Q5IA 2CL0X 1BMFD 2CMKA 5GJBA 1H8HA 1T3LA 2ZSFA 3LBHA 3CF2A 2Q21A 1W46A 1XD2A 2KSQA 2JLYA 4P33A 3F3YA 3GLIE 4JJKA 1G3IA 3CNOA 2AFIE 4LJ4A 4II7A 3IBYA 2CLSA 4P32A 4E07A 4RJLA 3K0AB 2ZEJA 4JVSB 4Q4HB 4MYCA 2W6JD 4B34A 4G3XA 4WZBE 4Q02A 2QGZA 1N6KA 1VG9B 2ZANA 3V00A 3AVYA 3ASYA 1G3RA 1U8AA 1F5NA 2YC4C 2DZNB 1ZW6A 2FZ4A 4BLTA 3SQXA 4KFSA 3NKVA 3AJIB 1G291 5KNCA 1EK0A 4NU0A 2NPFA 4B3GA 3K70C 4LGMA 3L0IB 4PAOA 4EKDA 4MH0R 1FP7A 1US8B 2GHIA 4MRSA 3GJXC 2XX3A 3M1IA 1T91A 3LO5A 4GL2A 1HE1C 1HT1E 2IYQA 2WZQA 5LDDC 4ZI3A 1Q3HA 2EFGA 1OFTA 4M1MA 2GJKA 1Q12A 5P21A 2AL7A 5E4FA 5GVSA 5E3HA 3A4NA 3ZD7A 4AC9A 4EQ6B 5JSZB 1DG1G 1Z6YA 1W5SA 1VCOA 3ZZTA 1XNJA 3QKTA 4QJ3A 4LRTA 1DADA 1SXJE 3CM0A 1HQYE 1OHHD 2VP6A 3NXSA 3EC2A 2BHRA 4DIEA 4D0NA 3SYNA 1G5TA 3D31A 2YHSA 2IYLD 2OT3B 3DDCA 2BIFA 3EIEA 2XTMA 1SULA 4BPBA 1IBRA 3B6EA 4TYPA 2OLKA 2JLVA 3AGQA 4UXJA 4JJZA 4Q7JB 1XCPA 3KXKA 1OV4A 4UXHA 2ODEA 4E5UA 3GLGA 1HTWA 4O2LA 4IFBA 1KMHA 3K9HA 5AJYA 1NG1A 4O0MA 3X1XA 4EPVA 4A6PA 1Q22A 1LB1B 4BE7B 1MRSA 1MO3A 4OK6A 2BCGY 4MRVA 4KSCA 4JLNA 4LDJA 4WOPA 2IS6A 4WZ6A 3UWKA 4RZXA 3GEIA 5KTYA 5L3SA 5EXXA 1E2FA 1G8FA 5DH9A 1BH2A 5JHGB 3LQQA 1G6OA 4MDFA 2WIBA 3PUZA 4XD7D 2ECKA 2F3RA 2A2ZA 3AEZA 3X1WA 2V9PA 3CO5A 4B76A 5A4JA 1N5JA 5E95A 2JLXA 5FOSA 5DSZA 1YR8A 4GZLA 2GBLC 4DLYA 2Z4RA 3GFPA 4XTRA 4IDHA 4EPYA 5IT5A 2BWJA 3OIWA 3RS7A 1NMZA 2FJUA 2H18A 1GKYA 1N6LA 3MWJA 2FFHA 1EX6A 1FQKA 1UBGA 3MUFA 4TLBA 1SHZA 2DR3A 1XEFA 2ZRGA 4HUTA 4GMDA 1W0KA 1W0JA 3MJHA 4XJXA 2GJAA 3SS8A 4DDUA 1BIFA 4P31A 2F1RA 3VTKA 5HZKA 1XCMA 3Q3JB 5FTKA 4S35A 1D9XA 2WSSD 3Q8XB 3CR8A 2VSXA 3QXXA 4HLUC 3H2YA 4YDSA 4B2PA 4XWKA 1ZM9A 5SZHB 1IXRC 3KTAB 4LC1A 5KSZA 3HU3A 1IY1A 2YVUA 2BBSA 2R62A 1I4TD 2F43B 2P3SA 1E79A 1NN1A 2QENA 1KKMA 2QAGB 2Z5FA 3RSLA 1M8PA 5A0FA 2XEXA 2QEQA 4RZ3A 2GWHA 3LBIA 5EXSA 1RKBA 2ZJZA 5AJVB 1E4YA 4DLTA 1J2JA 1IN6A 1FQJA 4RD4A 5ELXA 1GL9B 2XXAB 3DM9B 3ZS9A 4DB4A 2ZTSA 2VF8A 1M7HA 3L82B 4DZZA 1COWA 2NTYC 1U0HC 1JR6A 1Z5ZA 2GAOA 3MSXA 2DFNA 4OHZA 3UG6A 1AGPA 3TRFA 3A1UA 1Q21A 2J9RA 4NYIR 2J45A 4KBGA 2DVWB 3ZIAA 1QDEA 2J7PD 3GJ7A 1NIJA 3VR1A 1P2UA 3THYB 3A4LA 5JFGA 3EXAA 4LHYA 1N3BA 2BVNA 4OQNA 5B30A 4QHTA 3R9XA 2GCPA 2GVDC 3MWYW 1OYYA 1SKYE 3QBVA 2C04A 3DOEA 5C1BA 1UAAA 1MR3F 1FW6A 1EFHA 3GFTA 2GJ9A 1GL6A 1XRJA 2JEOA 3L0OA 1ZRHA 4BZPA 3P1JA 4G0NA 2QZ4A 3ADKA 1ZC4A 5SZIA 3EZ2A 1S0UA 4ERNA 5J4LA 5CJ2A 4C7OA 1WE2A 2ZJAA 5EE0A 1OH7A 1MKYA 3Q5DA 5FBRB 1R4AA 2QPOA 5FI1B 3RAPR 1KZ7B 3THWB 1E0SA 4NCKA
chains in the Genus database with same CATH superfamily
2OXTA 2VIIA 4PFKA 3A7DA 1PK8A 3TPZA 1TH3A 5B12A 2KW5A 4FC7A 1FTNA 5F78A 4D99A 1N2HA 3EISA 4M8NE 3KZCA 3KYIB 3Q9NA 2JGIA 1Z7EA 1EVLA 1T6NA 4RVCA 3FSGD 3TIVA 3EDRA 3DQZA 1T9BA 3KS4A 1USKA 2FCAA 1ISPA 5CXUA 4ZZ2A 2XRZA 3R7AA 2UUBB 2XKBA 4JIGA 2P41A 3HKEB 1ZD9A 4I4TF 1LPOA 1P77A 4K2HA 4WVFA 1NSTA 3HVHA 1SC3A 3KS8A 4FUTA 3I9NA 1M2GA 4EPXA 1JIJA 4ZPXA 3U62A 2VTBA 4OJNA 1UP7A 2NAPA 5F2OA 1ZN7A 4ZCQA 2UDPA 3DEHA 4HO1X 1PX0A 3JQAB 1G8MA 2GPSA 4GI7A 4K5QA 3AUXA 3EE6A 5FNVA 3AEYA 3U6KA 4MQ4A 3LKDA 4YJ3B 5J5CA 3IUSA 5LWQA 2OBLA 3PIRA 2W2LA 1ONOA 3ZYCA 3KXPA 5IZCA 3RFFA 1FYVA 1RWVA 1DQNA 2G9ZA 1P60A 1D0KA 3DR3A 5BYBA 2NPOA 2DC1A 1BU8A 4M0WA 3K70B 5JAPA 3E35A 4LHWA 2BM1A 5JCOA 4DCMA 4MYTA 4PY2A 5DBOA 4IF6A 3HV0A 5TPZA 4A1OA 3GU3A 1NNEA 1H9CA 1YB1A 4ML3A 1XV5A 5CK4A 1GHTA 1WNFA 2Z9CA 3BWMA 2C5LA 1B6SA 1WB4A 1H6DA 4P98A 1UFQA 5AUNB 1RHJA 4H35A 2YDYA 4UTVA 2A9RA 1KY4A 4BWFB 2M9MA 1D6JA 3UYLA 1IPFA 1COWD 2RAVA 4OEHA 2QUKA 1EGHA 4FYXA 3FSRA 1B3BA 2VXBA 3CT6A 1XMVA 4LK3A 4WRRA 4HDNA 4QPJC 2V7GA 3NWJA 2NVUB 3T1QA 4HVAA 1IJKA 4Q03A 2VZ9A 5EC8A 3AU8A 1HYGA 2BFFA 1YQUA 3FPEA 2NVBA 4C7JA 1PJQA 3ANSA 3FRJA 3NPAA 4YNBA 3TCXB 1GNPA 2EWVA 3HG7A 2P90A 5TJHA 3K9WA 4AIIA 2EARA 2XNSA 4FYKA 1NDUA 4EJFA 2ZSBA 3Q2OA 4BX0A 5JTUA 2HRZA 5TF0A 5I3ZA 3MQFA 3E8SA 4CIVA 4GSKA 1MGOA 2QYSA 4WVLA 4CTJA 1LVUA 2QPTA 2REXB 2Z0MA 4JBXA 4PZZA 1PUIA 4NCNA 4PLFA 3LQRA 4FYPA 3NS7A 1OTXA 5JDIC 2CXRA 4O25A 4Y6LA 2C9BA 3U6OA 3VYTB 1XTIA 1OI4A 3ICWA 1Q19A 1Y5NA 4QDJA 5JDCA 4BFLA 3VYVA 4LVCA 4DY6A 5AI0A 2C58A 3VKFA 5HKBA 1MNQA 4ISCA 1DAEA 1LV7A 1LBEA 3AR3A 3QU2A 1RLMA 4Q4JB 1O94A 3AIOA 1PNOA 1JLKA 1EGMB 5K6AC 2J3QA 2IE0A 2NVOA 2JXNA 2II6A 5HFNA 3V7YA 4HNUA 1ID1A 1RLJA 4EO4A 4U2CA 3VU1A 1O7JA 5JWOA 3L6BA 3CURA 1M6VA 4H17A 3FNHA 3OZUA 2P5TA 1PJLA 4C4YA 2HIMA 1I1QB 4OMDA 3IP8A 5DN9A 4HN4B 5DWDA 3TRHA 4CMJA 3L8HA 4ZYXA 4HYTA 1QIIA 1SBZA 3CONA 5ERYA 4YP0A 2ERYA 1EDBA 4E4YA 3N2GA 4ZO6A 3K6SB 4JJ6A 5JBIA 4PLYA 5CCEA 821PA 2BSXA 1WXGA 1IVYA 4BE9A 3LP5A 2JI8A 1Y6QA 3TBKA 3UHPA 4DT1B 2OORC 2IDMA 1YVEI 5ESDA 3EWAA 4AP5A 1KSFX 2OZKA 4D9IA 3FY4A 3FNIA 4PXYA 3DF9A 2IYVA 1VLVA 3L7IA 3KKLA 1AGRA 3ZBTA 1Q84A 3T9BA 1ACJA 4HFRA 4CVNA 1UAGA 4ZHQF 4R31A 1W4BA 4QZVA 4E15A 4UE2A 4PS0A 4BTLA 2A14A 5A7HA 2ZRFA 2XQGA 4YAIA 1P8AA 1UPXA 3FPBA 4Y6QA 1QC5A 1SUFA 2AI3A 4QOIA 2R6FA 1RKUA 4BKMA 3A3YA 3NX4A 1ULBA 3RGPA 4JVMA 3A45A 3G2QA 4OHBA 4HB0A 2NSHA 5TQ2B 3SS9X 4I3HA 2IHUA 5EHGA 4CTMA 4E5YA 2QNBA 3Q85A 2PFSA 4BVBA 3KWJA 3U4HA 3HUUA 4BCCA 4OQYA 1CEEA 4IIJA 3RVOA 4GI2A 1V11B 3NMUF 3P32A 1WTCA 5J2UA 1U7WA 2ZJ5A 3B1VA 3O9MA 4HQOA 4S04A 3UWPA 3L4BA 2LW7A 4BVLA 3ZY4A 2QTVA 2I4LA 1KYTA 3S2SA 4BNYA 2I7NA 5B1DA 2I6TA 3NQ41 4OM8A 2PLAA 2W2KB 1GV0A 2PKRA 3LQKA 3OJFA 6YASA 2VLIA 1ZJYA 4YT5A 5B4TA 3ISVA 4N3AA 2XGNA 2O5CA 2QD5A 3BK2A 5FOUA 4FFPA 3V76A 4UUBA 4IIHA 3TS1A 2CL6X 2AE2A 4N40A 4BBPA 2I9KA 2PMCA 4RVSA 4GPEA 5E26A 2PV7A 2WWVD 3BRSA 3PDWA 1A8IA 2ASEA 3LF1A 4PM4A 9LDTA 2V1XA 3O5AA 3UUFA 4XM2A 1ZCBA 2FOLA 3HRHA 4FCWA 2VF2A 4FHFA 3VR6H 3R9XB 2LCIA 3QX9A 4UPVA 1OLUB 2MINB 1Y34E 2GLTA 2WQZA 4MW1A 2FWRA 2PLFA 1N5LA 1CLEA 3K9PA 1O96B 1OIVA 3T61A 3ZDFA 5KNDH 3K73O 1A5ZA 4NMHA 1SQ6A 3T1YM 5AHRA 5JARA 1X9GA 5LBIA 3ZE2B 2WT8A 3V48A 2OZLA 2Z8ZA 4ZV9A 5EAIA 3O3MB 4KR6A 3TX2A 1C1DB 1HO3A 4IXWA 3ONEA 4UJ3A 4R01A 3LY9A 3AR4A 2ONZA 3WE7A 4X6XA 1W47A 1GZDA 1ENPA 1DQSA 2QZZA 2Y1DA 1RC8A 4PHTA 4QXMA 3UH0A 1PL7A 2Q1YA 4UTZA 3IQXA 2R6CA 4ITUA 1VEKA 4R83A 3RSHA 5I7VA 1NYTA 4TV9F 3NTOA 4I5EA 5LMCA 2UVPA 5HHTA 1WHCA 1XMPA 3COPA 3NHYA 3VTFA 1YRLA 1L4HA 3TI7A 1JBEA 2BFPA 3W78A 4BN4A 1JJBA 5SY6A 3VU8A 2H5JA 1T0BA 5CFPA 1XZEA 1HDZA 5DI3A 4FOPA 4ZGGA 4EA7A 3OCVA 3OT4A 1X1AA 4ND7A 4FWIB 1VDLA 1VPTA 2HIGA 1W4LA 2GNOA 3W2IA 4EFLA 1HLGA 5CEFA 2VYCA 5DYYA 1CUYA 3DPIA 3H11A 1SHTX 3DB1A 3GVIA 1BW9A 1ZK4A 2PA3A 3M6WA 3GCWA 2LRHA 1KZ9A 2NO0A 3L93A 1A7AA 1O97D 1UC5B 4LQLA 3CG4A 2BGUA 3DMHA 4OUDB 4RLSA 1Z06A 2MSNA 4CLEA 2J3HA 3EXEA 3FLEA 3N8KA 4D46A 5GJVC 4KB5A 4KK4A 1Z47A 4M83A 2WKQA 1TIBA 1T0UA 3HS3A 5DBIA 2BGTA 3TLGB 2QVGA 3RFWA 1NE2A 4EQ6A 2AYXA 4Q1FA 2LH0A 3M6IA 4O3MA 4MWGA 3ZVLA 3CZ5A 3PQ6A 3Q5EA 1SELA 5G4KB 4JR1A 3U6LA 4G0PA 3DE0X 1FTYA 4HDKA 2MMGA 3E23A 1T0HB 2X2EA 3WGZA 1W9HA 2V74B 4LVNA 1PYGA 3D64A 1DX4A 2QLLA 5BN1A 4WI1A 3IMCA 4I5IA 1JXQA 5LD2B 2IV7A 1MN3A 3H9JA 4YH1A 3GLRA 1K3XA 5AI9A 1P61B 3IP7A 4N49A 2VDLB 3P9SA 5TVGA 5DNCA 2B6HA 5U1PA 3QVGA 3PDIA 4Q0MA 1LFAA 2GASA 4PYNA 1JJAA 3PKZA 3LUCA 1FDTA 1NQVA 2H63A 2YUIA 3DGEC 4YROA 3B8HA 2VCHA 1INLA 1NTRA 2H6EA 1Q2XA 4LTDA 3N2KA 2DZDA 1GSIA 3MG9A 1JYSA 1LRKA 5KNCH 5LMZA 2NGRA 4GX0A 1YRAA 2SCUB 3A4MA 1M72A 2LV8A 4DLAA 1LLFA 2GILA 1I4WA 1T34A 1C0PA 1HT0A 3ZVKA 3ICOA 4CKEA 5E7MA 5SV2A 1I6LA 4R7ZA 4BX3A 2WR8A 1YQ9A 1P2VA 1Z22A 4QPPA 2JFVA 1GNSA 4PWYA 1KDZA 2RHJA 5BSUA 3HWRA 3AI7A 1TK3A 1XVVA 2RGNA 3W8FA 1WXXA 3SIRA 2P6MA 1D04A 3WRXC 1I5RA 1KTVA 1AXRA 3H2ZA 1CXZA 4C3ZA 3SM3A 2FOIC 1CB7A 3RU2A 2D4AA 1GUBA 2WF5A 4WZBB 2Z2YA 1LZKA 1K7YA 1KOLA 3G2LA 4BC0A 4PZCA 4NFYA 4EVIA 1C4OA 2WSBA 1R12A 2QL7A 3OZCA 1T9AA 3CLRD 1K3UB 2H57A 4E7PA 2PL3A 1EFUA 3H5LA 4BEJA 1RYNA 2HAKA 1KI3A 1Z37A 4EKYA 1W2HA 4OKSA 3WLHA 3QEMB 5AMXA 3AJDA 1J4AA 5ITXE 3GMSA 1JILA 2W2XA 1R0XA 4PO8A 1DFHA 4LF9B 4UHCA 1HR0M 4MYUA 5B7GA 1BXKA 3L7JA 1YAJA 1OX4A 3D2AA 2IYRA 3H97A 1Z74A 4IVPA 1GT6A 1FS5A 1DKLA 3CCCA 1I2ZA 4B6FA 1SG9A 4MHSA 5DNDA 5LQUA 4H1VA 3PFKA 3RK4A 1XPJA 2X4IA 1R2QA 1NNJA 1KZYC 1MZPA 4YWJA 1LSSA 3A6LA 1JWLA 3EVGA 1GZ5A 1KJNA 4CNQA 1W76A 5F3WA 4YUXA 3OZXA 2OVBA 4M88A 4YQYA 3A32A 4M55A 1FX0B 1CR2A 3PVCA 3IERA 5I9IA 4DLUA 1CE8B 3I37X 4WESA 2RG7A 5E8RA 3M6VA 2BMVA 4KQGA 3ZWQA 4Y6RA 3HDJA 1VLHA 2HD4A 1YZHA 5HIMA 3TXAA 1KJZA 1TW2A 4DUPA 1YO6A 5EMLA 3B7WA 3LRTA 1V96A 2OGWA 1TVKA 1YJ8A 3THXB 5CBPB 1PRYA 4DF3A 4YCSA 1EUQA 2WFMA 2XMGA 1CUGA 4X84A 3B38A 1C1HA 1YCGA 1KP2A 1G5FA 4PSVA 3AUYA 4R8MA 1QIMA 1CJVC 5F77A 4D26A 2QNJA 2WU8A 5G40A 1VMDA 1RRGA 4ZO7A 2IYOA 3V4LA 4G0QA 4A92A 1QE5A 1H2RS 2VT3A 1ORIA 1AKRA 3AG6A 4JI2B 1WCXA 3DWIA 1TUIA 4V0NA 3VYUB 3CX6A 1VL1A 2AFHB 1NN3A 2HI0A 3AHFA 8ADHA 3MD9A 3IP3A 1GFSA 5TS2A 2BEVA 2HT6A 4AZWA 4WK0B 1NOKA 1QYXA 4LFAM 4PD2A 1E6MA 5JMTA 1L1TA 4CM7A 1SBHA 3PNBA 1SU4A 3OICA 3ZJVA 2HNKA 1KU0A 3ADOA 2POCA 4HL6A 4E31A 3OCWA 4IVNA 4PANA 1BD4A 1E62A 2VQFB 4HWRA 3AR8A 4FGKA 2ZSAA 5AM3A 1Z5BA 4DJ5X 1MJHA 1C29B 1VIYA 2L4FA 4EFNA 1G7TA 2I22A 4EUEA 3EVAA 3ISJA 8ATCA 1VIVA 1DZ3A 1U0FA 8OHMA 2BD0A 4LRXA 3KQOA 3LC0A 2DB3A 3SHOA 4DMLA 1I7QB 1KVSA 3E9QA 4WZAE 2CFOA 4PLGA 3P2OA 2FWJA 4F6RB 1T4CA 3DA1A 4K86A 3U26A 1XFAA 1W5FA 3K1TA 1D5CA 2YIMA 4KAFA 1QGUB 1G59A 1UMBA 3TW4A 2WSSA 3FVTA 1R16A 3TSZA 4HZUB 5HMLA 3SVTA 1HOXA 3HKBB 1CUDA 3ME5A 1R50A 4BASA 1S3FA 2X2PA 3CWCA 3DZJA 5I8ZA 2QS9A 2EZ8A 4UUAA 4YASA 2UXCB 4JWTA 4YCDA 4EHJA 1EIZA 1GUZA 1DQPA 4QWWA 1R9MA 2OL4A 4CF7A 3KAPA 3SFVA 1SOAA 2XQJA 2UZ3A 2DAPA 4YQEA 3JZAA 3OY2A 1MOZA 3ZDCA 2WWTA 4RH3A 4IQ8A 2BEUB 1QB8A 4C4ZA 1P7CA 2Q3HA 2VKTA 5FWXA 2ZRQA 1LNQA 5AI5A 1YD7A 3BWDD 3DKVA 3UNXA 1KK0A 3FSGA 1Z75A 1P0PA 1U9IC 1JLRA 2WMYA 3AL0C 2YHBA 5ILGA 3CUUA 1AQ6A 2ZATA 3PPWA 4YMGA 1SXJA 3U4IA 1WCWA 3D6NB 4OG2A 3ZHRA 4Z4QA 3KSXA 3A9TA 4LJ4A 1JLMA 1LDYA 4Q4HB 4OA5A 4G36A 1SWWA 2FZ4A 5CA1B 5K0TA 3ONVA 4HPWA 2LCQA 4LGMA 5KBYA 1NW7A 1SHLA 4X41A 3HY4A 4QUBA 1FYXA 5JSZB 4CGYA 4RFLA 4BS9A 3CM0A 4K87A 1OHHD 2BHRA 4E6EA 1T35A 4TX1A 2JZ0A 4KUEA 3EIEA 1GL3A 3LUDA 5FLKA 4UXJA 3KXKA 1TK2A 2BTQA 2PSJA 3JQ9C 3ZV4A 3FW1A 2WUVA 4KSCA 1F0PA 4X5OA 3QOXA 5I7HA 5IKEA 5L3SA 4G1EB 2ZYDA 4LSWA 3KEQA 4IDEA 3PUZA 1VRVA 5EIWA 4OYYA 3WZ2A 1GSHA 1FVHA 4IDHA 2BWJA 4OBBA 2IKQA 5B7NA 5AKGA 1EX6A 3KLPX 2JCVA 4ENWA 3CY6A 4GBGA 4JP5A 1F06A 1VE1A 4YV7A 2FPOA 4F60A 4DM3A 1U31A 4S35A 4HLUC 1N2ZA 1ZM9A 4LC1A 2BBSA 4CV3A 2XE7A 5JW6A 1V71A 3S2GA 4DJEC 4RZ3A 1JDSA 3B5EA 2XXAB 1CCWA 3DM9B 3MYYA 4BB0A 3L82B 1COWA 7YASA 3DVRX 1C3LA 2C5FA 1GNTA 3QUBA 1HNZB 5G1NA 2AR9A 2G7ZA 3QBVA 1WY5A 2DUMA 3TLEA 3F6CA 1XRJA 2JEOA 3PFNA 2R1VA 3L0OA 1YZFA 1UIRA 3W5VA 4XK8F 1TUBA 3TQRA 1JHAA 5K3AA 2DGDA 1KJIA 2WHPB 3A9VA 1F6DA 2OILA 3V46A 2EC5A 3MWDB 3LXRA 2H9YA 1JU4A 2HJGA 1F9EA 4EFMA 3KZXA 4E5NA 5LYJB 2CFIA 3DVSX 5T6BA 4IL5A 2ORYA 1NFQA 4K9NA 1FDVA 2Y68A 5HJ7A 3BYZA 3R7WA 4QM6A 5K3FA 1SC4A 1ZNXA 1DUSA 3T0GA 3FNRA 2BFBA 2IYUA 3T9FA 2FU5C 2DWQA 2HHAA 3VX4A 3TFOA 1SC6A 4HZGA 2YHAA 2PCLA 5KHLB 4E22A 5BP7A 4FNOA 4ZEWA 1BU5A 2ZFUA 4R6WA 4GPIB 1NMEA 1P7WA 1PSWA 2OG1A 3DCIA 1QGDA 3QX8A 3PRYA 2Y1OA 4MVJI 3IELA 3JQ6A 1EE1A 3L0YA 3QZUA 3AWIA 4ZODA 5E38A 2ZYTX 4WJLA 3M4YA 2NO9A 1SRRA 1DAHA 1UJNA 2X1LA 5CITA 1FFXB 5C4IA 1CLUA 1W581 3M82A 3GYBA 4CMBA 3N59A 3FYUC 2Z6UA 3OHMA 4IIGA 3BHNA 1IXSA 1UJCA 2J9YB 1AN9A 1YB6A 1D0IA 4U2EA 3HJRA 4H6WA 4UTOA 4N6NA 1RYMA 1R9NA 3ETHA 3W0LB 3NONA 1UBNA 2HMSA 3TL6A 4N5NA 4LYFA 3G49A 1ZVMA 1XB2A 3HGMA 1GLNA 2XMBA 4WZAA 3FUUA 2DSTA 1NASA 3W8RA 2C82A 5TVKA 3FPJA 3C48A 3K1JA 3GZ4A 3LLUA 4Q4LA 3MMSA 2YCLA 3W6PA 3TBFA 2O0KA 4GOOD 3I1IA 4GNRA 2AYZA 2XDQA 2WSCF 2Y9MB 4REQA 2Z1MA 2C2OA 3U1TA 2C00A 3NC4A 4PWZA 4L6IA 1UPBA 1UZLA 2NT3A 3BFJA 1JAIA 1J49A 2P2ZA 4KXWA 1JHRA 3T1HM 4FU0A 2R68A 4I9NA 4ZO9A 5K9ZA 3DE4X 2I3BA 4PN3A 4D3SA 3QJGA 1Y33E 4O4IA 4FOTA 1EMDA 1DVRA 2ZIVB 4RZUA 3Q7RA 1IMOA 5K0LA 4MGYE 3JPWA 1B8PA 4P82A 2AZTA 4PIPA 2FX5A 3ZU3A 3OTQA 2R97A 1SA0A 2RHOA 3GUYA 4KO2S 4K26A 3RS5A 4EARA 1R5LA 3U19A 1WEKA 2MDTA 2WSFF 2G04A 1IVNA 4MUYA 5C5IA 2NP7A 3DHWC 1SOUA 2XUZA 5GJWC 1V1MA 1I80A 4MLPA 4PAQA 5E1BA 5KTPA 1CS4C 1Q1QA 1Q1NA 5TLSA 2GCOA 3OUTA 3D8LA 2ZSJA 2XIJA 4MKZA 2B3TA 1Z68A 2ZG6A 4YCNA 4II2A 3TOVA 1PT8A 2NUBA 4IMRA 3KEFA 1XDUA 4AMYA 5DV9A 4WP2A 2GN6A 2DLCX 1KH3A 5KOYA 4I4TB 2R6HA 1QQTA 5JZMA 2R85A 2KE5A 13PKA 2NXEA 3AQ4A 4DLVA 1Y5IA 1HSOA 3MBOA 1Y8QB 1CR6A 4BCDA 1M5UA 4CEJB 1TCUA 1NW5A 3EMVA 1W8DA 4PC6A 2QLBA 2A5LA 3AEKA 1WU8A 2W2NA 1JBKA 1ZI9A 4OA8A 3L0PA 1J06A 1XI2A 5DHTA 4URZR 1RWBA 4PCUA 5DCLA 1ZNYA 5BQFA 4JQSA 2XODA 1RM0A 2C9ZA 4DZRA 1NUQA 1X13A 1I6MA 5TE9A 1WM1A 1XRSB 2P79A 3RC8A 2ESRA 4Q1BA 3FOWA 2FW9A 1R0SA 4BO5A 1ZM4A 1JI0A 1WBJB 5HPYB 3Q7PA 2G07A 5FH9A 4GITA 3ZD6A 2XUPA 2A9KA 3EF0A 5FPSA 4BMVA 3IJPA 1JT9A 4YUYA 1ZMBA 4KDEA 2C8KA 1F4PA 1AUXA 1XPRA 2X9NA 1L5KA 1XQXA 4N5HX 3IA2A 4NYIQ 5AHWA 3UW1A 3RO7A 1OE0A 2CVPA 3WHPA 4N5MA 2ZVQX 3MTJA 5FNVF 4NH0A 4GKJB 2SICE 5LUBA 2BLNA 3IEVA 3QQPA 4XGQA 5IM5A 3IAUA 2IUYA 2A35A 3WKBA 2JA1A 3ZNNA 3FPHA 4EUKA 4BKPA 4M49A 4I55A 3I2GA 2WYHA 4KBFA 2AD1A 1K6IA 1ORYB 2RK6A 3AM5A 4OXQA 3OWHA 2XVXA 2GKSA 5LN1A 3BG5A 1GGHA 3EA4A 1Z4QA 3L9XA 2WTXA 1LWOA 2XBMA 4FFNA 1XEAA 4UU0A 1VE3A 2B4KA 4TN1A 3LYUA 3EAFA 3MD0A 2OFPA 3PQ4A 3LW8A 3RRYA 4DS3A 4URFA 2BKLA 1GTG1 1TCBA 3GLGB 5D84A 1PG5A 3EFOB 3G2PA 4G67A 1E9DA 3RVBA 3G59A 4A36A 3SXPA 1H5NA 4C4OA 4RTMA 4QNNA 2B9EA 1L5OA 1PU2A 3P20A 2UUBM 1W52X 1Z2OX 3A6JA 3JQ8A 1KJYA 4D43A 2XYRA 3IV7A 4DA7A 3NEAA 5DSTA 1QIDA 5BT9A 4AJPA 5IWAM 1BFDA 2H17A 3HN6A 2QROA 1Y1KE 2IELA 2NU9A 1ZCFA 3QXHA 1I5EA 3WB0A 3LPLA 1KKLA 1DU4A 2H3EA 5B4VA 4TKVB 2PD3A 4Q6BA 4KKVA 4M0DA 3IPAA 1VDMA 1C8KA 1H94A 1QFZA 2V3VA 3PCTA 4NR0A 5KSWB 1OA0A 2WIKA 3HFGA 3SMQA 1OXMA 4LHZA 2XZPA 2PQ6A 5FF9A 4F11A 4LG2A 4I9FA 4X6LA 3IIKA 4JJIA 3DMGA 4DBZA 4B82A 1U7HA 4B81A 5CA1F 1PJ2A 1J56A 5CYGA 1HYQA 4KQXA 4TT8A 1X7XB 1S7CA 2D13A 4ZEXA 2EJVA 3RTDA 3R5HA 2PSHA 5K3CA 2X1VA 4V3BA 2FPGB 3KQQA 2JATA 4HSEA 2RJ3A 4A3SA 4BMSA 3WP1B 1N2CE 1R88A 3W2FA 1LNSA 2YS7A 2A1TS 5B7QA 2H2IA 4FOLA 3TRJA 3SNKA 2ZS9A 1QUEA 3JYQA 4JB2A 4G23A 3NUZA 3QUCA 1IB6A 1JKXA 5BN4B 3EWNA 1T2CA 1ZVQA 3QTLA 3U7EB 2HN9A 2I7PA 2JBAB 5DMXA 2QYTA 5B4UA 3VBEA 4PCZA 3SZUA 4R5MA 4FFLA 1QE3A 3RUFA 3FTDA 3U6SA 3DYVA 1Z0KA 2FQQA 1EJ6A 3CPJB 3A9WA 4B79A 4B3XA 1FLNA 1TA4A 1YZUA 1EXNA 1N7JA 2HF7A 3A4YA 3N7UA 3MRVA 2I29A 3IAFA 4GC5A 4B4UA 1PR4A 3FMIA 3Q7TA 2F8MA 3FD8A 3HYLA 5EPOA 3T7DA 4F7WA 1V8BA 2DOKA 1XLTC 3ZHUA 2EJCA 3HA7A 5EMKA 3LC1O 2PMEA 1UDAA 1XAIA 2FZKA 1U3GA 4DY4A 3EF3A 1MQ8B 5BV8A 1K8QA 1NQAO 3K0AA 3KHTA 4TTTS 4YIKA 1XDWA 1F7VA 5G41A 1DGBA 1OFUA 3DV9A 5LQSA 4AY3A 4RV4A 1EQAA 3U9SA 4R84A 1QH9A 4J1NA 1V5IA 1YSYA 1ZD2P 1KDRA 2D0PB 3ANYB 3TD2A 3R3ZA 2R8ZA 4BRZA 2ZXUA 5LDGA 4OBEA 4DLXA 1VYUA 5C8YA 5JC1A 5HF6A 2I4OA 2Y1KA 3L1KA 2K0BX 1E6WA 1NVXQ 4G4OA 3OPYA 4QQKA 3ORRA 4CCSA 1XELA 5CNMA 4CLRB 3TTTA 1UJMA 4IIJF 2C5RA 4BKUA 3SXUA 5EZYB 5J2UF 2OCBA 3I6BA 3LUJA 1IDN1 1XX6A 2O57A 3MTGA 1IUPA 4ONEA 4B8YA 4TMFA 1WU7A 2YV1A 3BHIA 3U4QB 5L3VA 4G81A 3ZXSA 3WAJA 2HYDA 4UDXX 1JDTA 4LVOA 4YGYA 3TTWA 2LBCA 2HWKA 3KFLA 5LMUM 4HCJA 4Q9AA 2VOEA 4KSYA 3JQGA 2CWWA 2CLFB 1J2UA 1Z4IA 4QEDA 1CUAA 3H5NA 2CVQA 1YUBA 1JDZA 1JDBC 2AN4A 2C0PA 4P22A 5CIQA 5KVQA 1AUQA 5DX0A 3NRJA 5IMSA 1K5PA 4XDGA 4G8CA 1TEXA 3Q0EA 2GZ2A 3NAQA 5F64A 3DSRA 4UD2A 2W0MA 1BROA 4IXNA 3WFIA 3TZKA 4F9FA 4EY7A 4DQKA 1MEOA 1L4GA 1E3MA 1VYVA 4WN9B 1CJUC 4OLHA 1R6TA 3IKTA 1ZUNA 5K2OA 1KDVA 4MS1B 1GPYA 4X63A 2AQ8A 1Y1TA 2EVWX 1Z0AA 4OB8A 3ZXUB 4TV9B 5HUHA 2GO7A 1XDSA 4GM4A 3PV0A 2ZE5A 2AK2A 3SX4A 3SX2A 5D7BA 5K3DA 3UV6A 5DWVA 5IYZB 1GQYA 3BD6A 1XJCA 2XW6A 2B4YA 4OKNA 3V1NA 1W94A 1P4AA 4QUIA 1AKWA 2NU7A 1TX4B 3TLMA 1L4NA 3W04A 2QW1A 2D54A 2VZEA 1RPAA 1NXTA 4UQLA 3L7CA 4URYR 1Y5RA 1IQUA 4PLCA 3BILA 5DYWA 2XLCA 1IOLA 4IUBS 2Q5LA 1JZSA 3JYLA 1EP9A 3L8CA 3ONDA 4DTCA 1FDRA 3VPGA 5L3RA 1NVMA 3PC3A 3B7NA 4IM7A 2WVGA 3CA8A 2QTGA 5A5FA 3B12A 3ROQA 1H4SA 1L7DA 5AVKA 2QXUA 3N0WA 3C0KA 2TMKA 4JLVA 3VDQA 3B78A 2C2GA 3CZAA 1EK6A 5D5QA 4MIYA 4GO1A 3EZNA 3C43A 1U0OC 1F6BA 3ADPA 4LMRA 5IJAA 1NUUA 5U9CA 3JQCA 1TIKA 1AHHA 2F59A 3E1GA 5HS6A 2OFOA 2ZJBA 2QLFA 1PVOA 2AMVA 2LBPA 3IA7A 1KKUA 2P67A 1XMSA 2P9BA 3Q8MA 1UR5A 5EG5A 4RK4A 2FSIA 4I1PA 2QG4A 1NM5C 2D2FA 2VF7A 5FTJA 4HOYA 4KUGA 2EKDA 1RXUA 2AQIA 4O1IA 4I1IA 1N2CA 2WNHA 2ECPA 2V7BA 3LVQE 3UA3A 1WSWA 4TWRA 1KAGA 2H1VA 3MOIA 4GE0A 3WKCA 3L6OO 2IS4A 2C4UA 4AKGA 4YAJA 5BURA 3FTQA 2Y0TA 3RIGA 4MVJH 4LNAA 5HDQA 1BFKA 2PUHA 3S2IA 3TF5A 2VPXA 1VYHA 5CTJA 3RQIA 1DKMA 2OUIA 3GT7A 4AF8A 2Q1UA 3L77A 4I3FA 3DAYA 4M1ZA 4A9AA 1P74A 4JSTA 1UOOA 4GKKB 5DCYA 1KEEB 4PG5A 3TMKA 2MSKA 4X66B 3SFZA 3MS7A 4JKOA 3WL7A 4M9QA 4HDQB 1WXFA 2JKYA 3NH6A 4IJKA 3MMZA 3TK1A 1BOOA 4E5DA 4BJ6A 1LKZA 1X8XA 2FPIA 1AV6A 3O2NA 3JWGA 4OJKA 1ZC3A 3A9SA 2DECA 1HF3A 2OD9A 1U1GA 2GWRA 1OHHA 3FLMA 4YRPA 3HA5A 3KYCB 4X7RA 1E1MA 1W1WA 3NW9A 1NYRA 4DJDC 3N2LA 4IG4A 1X7ZA 4EF4A 2VPQA 3F74A 2H2DA 1Q17A 3ZS8A 3EZGA 3WAGA 1GKUB 3B9BA 2C77A 4A23A 3DOFA 4B8ZA 7ABPA 4AKTA 3GD5A 3S3TA 1FQWA 3KKMA 5C7IO 4PBTA 4L2IA 1WOYA 3QSYA 2AGVA 1P5ZB 4F4HA 3WZMA 2QQFA 3PLNA 4TYWA 4KLCA 1H85A 2FDXA 3I9V6 4GLFA 5EIBD 4CTOA 2ZI7A 3O4RA 2TMDA 5FBHA 2FP4A 3OM0A 2PHZA 3HSKA 1HEIA 3RUCA 4C3UA 4GP7A 1XALA 3Q5GA 1XB2B 2BFNA 2ZVDA 1W75A 2OO3A 3N2YA 2A84A 4G85A 3A1EA 3W67A 2EX4A 3HFRA 2G9VA 3IUJA 1OIWA 3IPXA 3FR8A 3DPUA 2DCMA 3OLVA 4M1OA 1XMJA 4BIIA 4A73A 3CLTC 3LL7A 1HG1A 2C2XA 1K2VN 4YUZA 4CDNA 4WNYA 3CLSC 2OXCA 1N1EA 2PJUA 1N4DA 4YDQA 2B34A 5HRCA 4LUCA 4CM4A 2UXBB 3GZTB 5FA6A 2EG9A 3KVRA 1PNTA 2FPXA 4DN6A 1O5OA 1VL8A 3PVZA 4DLWA 3A6DA 2HRDA 1SRQA 2IZOA 4YO7A 3QF4A 4OKIA 2VAWA 3GT0A 1YBHA 1ZAYA 5JAMA 3UK6A 1GCGA 1F8FA 3LBYA 2IBTA 4I66A 3F2VA 4BNGA 2CLSA 4RNDB 1R8XA 4DIOA 3OOEA 1YR3A 1OPRA 4B3JA 3PE3A 2NPFA 4WFIA 3LCCA 4KWIA 4QYIA 4UVIA 2IHZA 5EEGA 2A92A 4XEUA 1Z16A 3NOXA 2IODA 3A4NA 2ETVA 2FWBA 4OQEA 1W5SA 5B3LA 4J90A 1PP4A 2OT3B 3GA5A 3IB6A 3GG9A 4PYJA 2JLVA 1NRIA 4A6PA 4YY3B 4FKZA 2I78A 3C1TA 3P9IA 2NUAB 2OFFA 3LQQA 2GF2A 2WIBA 5ESRA 4LF9M 2GBLC 2Z5GA 2AIRA 3IUNA 4MR7B 4GPZA 3L0CA 1FQKA 1OAIA 1T29A 2YX1A 3E9RA 2R5WA 2ZIEA 2HSGA 1BN7A 4CMEA 2B2CA 1C81A 4IV0A 3HU3A 1WF6A 1UDRA 5IVPA 3ESQA 3RVSA 1PWXA 4YJFA 5EXSA 4DQ0A 1BFUA 3WK6A 2BF7A 5K2MA 3GHHA 4B45A 3H8VA 2HA2A 1YGPA 1IHYA 3ITDA 1H5UA 4IH9A 3UF0A 3THYB 4IINA 4JI7B 2BVNA 1YL6A 4EOGA 2DTXA 1DT5A 2H59A 2CDCA 1YJBA 4EA6A 4L72A 1OH7A 5C32A 4OSEA 5HQ3B 1JXAA 3F96A 1AKVA 5E8JA 4X71A 4RMGA 6ABPA 1UZUA 3G9TA 3L7DA 4W7IA 1PVVA 4YRKA 1Z6TA 1NTOA 1CUSA 2QP3A 1YZQA 4JEMA 1A4XA 5LQMA 5IVHA 2O3RA 3Q4GA 1I0LA 4DA9A 1UZNA 3WNBA 1COZA 5BN5A 2R65A 1P4SA 4CM1A 2I33A 2WUDA 3U3OA 5HCNA 4OK5A 4Q7KA 3U40A 3GZNA 1ZXLA 2DY1A 2YIVX 1WZ2A 1XRLA 3BM5A 1SKUA 3Q0TA 2W4MA 4OK3A 5EZYF 1QV9A 3C7TA 2PD6A 2PYDA 3NDPA 1ZJ6A 2NU6A 1ZYUA 2J3LA 4MAAA 1ES9A 3VMFA 3T1OA 3R3XA 3MT9A 3DFFA 4WLUA 3DEAA 1X14A 4XGKA 2FDRA 5K3BA 5C4GB 3GGSA 1PR6A 3WG9A 4W1SA 2CMDA 1QCDA 3WHIA 1I3LA 4ZANA 1Z28A 1K4MA 2N0SA 2CB0A 1PFKA 2J3IA 2JJMA 5GY7A 1DLIA 3AY0A 4HXFB 1JLLA 2JFYA 1P1CA 3UJCA 2ZI3A 2ZJ1A 3IBTA 4TMVA 4KFCA 4O5AA 2ZUTA 4PX5A 1GADO 4EY6A 1QV6A 4ZZ0A 3V33A 1F2TA 3SC2A 5GVRA 1ZY2A 2EHDA 2ZYUX 2ZRNA 2J9FB 1MVNA 5JNSA 4ZV4A 3KJHA 3ESBA 4TWIA 1ZUWA 3JARB 5BVHA 3IPLA 3NKLA 4AQ7A 4AS3A 2VHJA 4DA6A 2PSFA 1MX1A 2YVLA 1BXRB 1OAAA 4LF4M 3FFAA 1JEDA 1TT7A 5IYZF 2PGOA 3CS3A 1YR9A 4U0JA 2Q7XA 3QKRB 3DWGA 4OQMA 3RHZA 3HKCB 4XFJA 1HUQA 3QVWA 1IOWA 1RYYA 2O2ZA 1SUSA 1WBBA 5ENZA 3FDZB 1Z5GA 4WT7A 3TRKA 4J0JA 4HDRA 3GCDA 5C2JB 1Z6AA 4QGSA 4D97A 2DENA 1Z0SA 4NBRA 1SIWA 2Q27A 1GABA 3GT3A 2WV7A 3QKUA 4XUCA 1DEOA 1QZTA 4IIDA 5AW9A 5L4LA 4NBSA 4GM1A 1YI8A 3MEQA 5FEUA 1DRVA 3EVZA 2B94A 3JQ7B 2WU3A 4GXRA 1MFZA 5J1TB 4IQGA 3EDOA 3T5CA 2CWDA 5AHKA 3FCXA 4RORA 4Y9SA 2PH1A 4X7BA 3TKYA 3K8QA 3KPYA 4L8WB 1E3JA 4PICA 5ETJA 1M3SA 4HLQA 2BL4A 3D02A 4QTXA 1AO3A 4HR7A 1PV4A 2QN8A 4J0HA 3H5AA 3STWA 1GA4A 4DQVA 1BWRA 3PQFA 4PTYA 2ZP1A 3QV2A 4ENUA 1BYIA 4JBWA 4ZJYA 3MHTA 1H69A 1STOA 3DOOA 3VNSA 4KAJA 2PKWA 5FXMA 2D5IA 2NXWA 3H19A 1E2LA 3OQNA 2P1ZA 2OPFA 2FSVC 5FNZA 2DR2A 1M1ZA 4X61A 1XZLA 2UUAM 2QMUA 4LFCB 2CY0A 3PKJA 5JCJA 4E1VA 1ZMXA 1OREA 1JYEA 4OLFA 4C0XA 2E82A 1I7LA 1QPZA 3IODA 4NJMA 5BT8A 5KKCA 4RCZA