3UK6A

Crystal structure of the tip48 (tip49b) hexamer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
318
structure length
298
Chain Sequence
AHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRITVSLHEIDVINSFLALFKSEVREQINAKVAEWREEGKIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Conformational Flexibility Determines the Properties of AAA+ TIP49 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords RuvB-like 2
total genus 90
structure length 298
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06068 TIP49 TIP49 P-loop domain
A PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uk6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uk6A01
5CYPA 1U90A 3CH5A 3VNVA 3O8CA 4JN6A 2C9OA 4BUJA 4DCTA 2GAAA 4LYFA 4M1WA 3X1YA 1W0JA 1G21E 1OE0A 2IXGA 3KKPA 4ILEA 4O2LA 4GFDA 2EFCB 4QGHA 2VHJA 4BFUA 2OAP1 1ESMA 1YZKA 4V0NA 1SXJD 3SQWA 1E9SA 1XFAA 4LGMA 2ZYTX 5AR1A 5L3SA 1OH5A 1RRCA 1MKYA 4XD7A 5EUQB 3KKOA 4I1SA 1ZNXA 4RD6A 3DL0A 2XZLA 1ZNYA 5HCNA 4YMWA 3K9GA 4PPQA 4TTPA 2BV3A 5F9FA 4F93B 2PBRA 2MSCB 1XRJA 4MUAA 2WWHA 3CB4A 4Q48A 1Z0JA 5J4YA 3AJIB 1Y3AA 4HATA 1KMQA 1JQLB 4D25A 1GZSA 1JAIA 4XTRA 3N2EA 3L8YA 1UPTA 4U00A 1N5IA 1JBKA 5EJEA 1DBSA 4ZPXA 2IX3A 1II9A 3EZFA 2IHYA 2KRKA 1G3RA 4XOIA 4FMDB 4KXFB 1OPXA 2JLXA 1NMXA 2JLZA 3RRMA 4JL8A 2WIBA 1YVDA 3K0FB 1XEWX 1AKYA 4JLVA 5KPJA 4NMMA 3KXIA 2Q0HA 2Q3MA 2O8CA 1W36D 2CLDX 1I4DD 5SZJA 3CPHA 1MO5A 4D0GA 4OI1A 3AKCA 3O8RA 5GVRA 4YXWA 1R0XA 4BLSA 3EARA 3A8TA 1GSIA 5KU1A 1OKKA 1YR9A 5H1YA 1NJGA 4X8HA 2GETA 3EPLA 1J7KA 1ZU5A 1AQUA 2AK3A 2O8DB 1SXJC 2PT5A 3TRFA 2R6CA 1BMFD 3HWSA 1EFCA 4LYAA 4B43A 1HE8B 3QF4B 2OFXA 3K8YA 4HAZA 1GAJA 1XDBA 2J9RA 2CHQA 1FX0B 2HEIA 3Q8XB 2BEKA 4JVLA 2QTFA 1G8HA 3NH6A 4G5OA 1XMVA 4AKIA 1IJFA 3S1AB 1W4RA 2UZ3A 2ODWA 4DCNA 2EFGA 3RLFA 2ZJOA 4HAUA 3HYRA 4XTCS 3SYKA 4F38A 4RY2A 3EASA 3CONA 4A6PA 4Q1AA 1JJVA 3VHLB 2DCUA 3TLXA 3W5IA 4PPGA 1CLUA 2BVNA 2V3CC 3OEHD 2XXAB 1Z0KA 3FFAA 4PANA 2D62A 4MKGA 1FZQA 2ZJAA 4PR0A 5F3WB 1R2QA 2J45A 1Z6XA 1FNMA 5J47A 1EWRA 3BH0A 4UQOA 2ZXUA 2GNOA 5EXSA 3BFKA 4PO9A 1SVOA 5L8VA 3A1WA 3KFXA 4US1R 1Q22A 1OB2A 1NF3A 3EPJA 1ZBDA 3O47A 5J4LA 3OEEA 1NIJA 3LLMA 4Q9HA 3RSLA 1HH4A 1NMYA 1NMZA 2ZUCA 4URWR 3THYA 2OT3B 1R0YA 4B2PA 3QBTA 4M1YA 2JCSA 3GLFA 2RB4A 4TYNA 2CJWA 1I4LD 3IO5A 3C5CA 1D8TA 3VHXA 2V1UA 4RZXA 3MWKA 3CH4B 3QKTA 3WHKA 3OEHA 4RZUA 5FBQB 3B13B 2HT6A 5KTYA 4II7A 3ETLA 3QPUA 1GDDA 2PMKA 3QOFA 1WMSA 4B3GA 1UBFA 1ZCBA 2ATXA 4HLUA 4DLXA 1WCV1 4PO8A 4F4JA 2ODEA 1EG7A 2WWXA 1S8FA 3K09A 2WOJA 3X1ZA 1T9HA 3TUIC 4ZDKA 2X2EA 2OCAA 4MQBA 3TQCA 3ZIAD 4B6FA 4B33A 4CF7A 3Q7QA 4A2PA 2GCPA 4CZ2A 1E9FA 4BFWA 2QU8A 4UNRA 1TADA 2VP9A 2WICA 1KI6A 3LX8A 2IWHA 3AVWA 3AVQA 4WA7A 4RCYA 1KSGA 4AWXA 3J81k 2H92A 4WBSA 1Q21A 1JALA 1T5LA 4Q9IA 5EE1A 2QAGC 3PUVA 5FOSA 3PG5A 1WDTA 3GJXC 3B1YA 3QPWA 1EXMA 1KK0A 3TMKA 3B1WA 4LJYA 4FWTA 3CF2A 1IXZA 3V4RA 1Z6YA 3A6PC 2C2HA 3U3RA 1WA5A 2BDTA 4HB3A 1X1RA 3M0EA 1M74A 1NSTA 2CXXA 3OAAD 3RS2A 5UKDA 1XD8A 5FPHA 1G7SA 4JL5A 3QXCA 3MG9A 4C0HA 4Z1MA 5JS8A 2QE7A 1SGWA 3KKQA 821PA 1KO4A 4V0MA 5FOXA 2REOA 5F9HA 2HJVA 4E03A 2VSOA 3HJNA 2XNDA 2ZI7A 4MRVA 4Q19A 4NYJQ 4AY2A 5EXPA 3NVAA 4FWIB 3KDSE 4KFTA 4PSVA 1QHGA 2IYUA 2ZJ8A 3DEFA 1Q12A 3U3MA 1SKYE 1VDZA 1DEKA 2R9VA 2RAPA 4LJ7A 3NC0C 5CYOA 5DHAA 4DSTA 2AXNA 4WAUA 3CRW1 5SZKB 2OXCA 1XJ0A 3LLUA 3LVRE 4NBSA 1OB5A 2IYVA 4A1FA 3A36A 5AUOB 4H1VA 2XJ9A 1CR1A 1F6BA 1NVWQ 4ZDIA 2RMKA 4GZLA 4IEEA 2IS4A 3VR1A 3GLGE 3RC8A 2R65A 3BRWD 4QJ3A 1S3SA 4M21A 3WYGA 5DH9A 4AC9A 1US8A 4JMPA 2YJTD 4BFVA 1BH2A 4Q1EA 1LY1A 2OSBA 3KXKA 4L15A 4EFMA 2ZVPX 1DS6A 2AL7A 3VX4A 4EQ6B 1NLYA 4IVQA 1JXMA 5FOTA 4RKEA 2DWZB 1SHKA 2WWYA 1MH1A 3W90A 1JXOA 1KNXA 3EIEA 2IF2A 1KZGB 1R5NA 5D3MA 2ECKA 3O8BA 1PUJA 1WQ1R 3I62A 2WJJA 3E2IA 2EWWA 2F6RA 3WRXC 3SOPA 1P7CA 3RRNA 2FFQA 2P3SA 3TAUA 1COWD 1S4QA 2IBMA 1F48A 4BPBA 1UF9A 2BOVA 4JLMA 2ZAOA 4YONB 2GKSA 1UBGA 3MWJA 4F92B 2IEZA 1ANKA 4EAQA 3E70C 4B3BA 3AF1A 2JJ2D 1XEXB 4G5QA 4NKRA 3FGNA 4JLKA 5HCIA 1KSJA 2B8TA 3BORA 3ZDQA 2BM1A 4POAA 4RFVA 1U9IC 3RANA 4MKIA 2PJZA 3UWOA 2VL7A 5IK2A 3EPHA 1LTQA 2GCNA 2WWWA 3I5XA 4HSEA 4CRWB 1TEXA 5JHGB 5FOWA 5KSPA 2QMHA 4FWHA 4MGKR 4Q4JA 4YMTA 1TPZA 4Q9LA 2QQ0A 3R8FA 4TT3D 4C0QC 2J87A 2D7DA 3W9YA 3N70A 1Z8FA 1DE0A 1HEIA 1VG8A 1RRPA 3L0OA 1E2DA 4O2RA 2BBSA 5JRZA 2FEOA 2OHFA 4BFSA 3U44A 2QY9A 4Q5IA 2YOFA 4AKHA 3HU3A 1QHNA 4JBYA 1IN7A 3D6TB 2DZOB 1DAEA 2VEDA 2VYFA 2ZE5A 2ZI4A 2C5LA 3MCAA 1U81A 3FKSD 4LHWA 2YC2C 3HP1A 1ZM4A 1R0WA 3Q5DA 5IK2D 4FCVA 2A9KA 2QSZA 2QUZA 3C7KA 1J90A 5IRCD 4A0RA 4LBWA 3WNDA 1QZXA 2BMEA 2J0QA 2FWRA 2NMVA 3BE4A 4LJAA 3SR0A 1ZUHA 1ZNWA 3AP2A 2P65A 4P3YA 3OIVA 1N5JA 2ONJA 4FWDA 4GMXA 3D8BA 4NCJA 2BKEA 1RFLA 2IXFA 4I99A 5FI0B 1BKDR 3HU2A 2Z83A 2HT1A 1YZLA 3AGPA 2HUPA 4N0EA 4JLJA 1P3JA 4HDQB 4YC7A 3FDIA 4DSOA 3T5GA 3A4NA 2XX3A 3H86A 2OV2A 1NBMD 2WBLC 1G3UA 2ODNA 4B3FX 3W6OA 5J40A 1E1RD 3SC3A 2X77A 3SYNA 2XSZD 1J70A 1N0WA 1I2MA 3EA0A 4LOAA 2NG1A 2XEXA 4V0LA 3T5DA 1HE1C 4FD2A 3HYTA 3LRPA 2AWOA 2AFHE 3H4MA 2NO1A 4QGGA 3V4FA 4ZCLA 2QP9X 2AHOA 2IYQA 5L3RA 5JEEA 3N2IA 1KMHB 4M8NE 4QHYA 2QPTA 1N6LA 2ATVA 2LCFA 3AP1A 4RZ3A 1XD9A 1F60A 3KZ1E 4OHZA 4LPSA 2IHBA 4LDJA 4ERNA 4NP6A 3I1FA 1G8GA 1ZM9A 5JCPA 1KSHA 1NN3A 2Q3HA 1GRQA 3C41J 4BLPA 3MLEA 2CEAA 2RGXA 2CHVA 3RAPR 1EESA 2GILA 1ZW6A 4I4LA 5KDOA 2F3RA 2O0JA 3K0FA 5FPYA 4BZQA 2JLWA 3FTQA 4R2HA 1E2HA 1GRNA 4CGZA 3QXXA 3EX7C 4LPKA 4TWZA 1VKJA 3VQTA 1N0VC 4HLDA 2BJWA 2JJ2A 2KE5A 2ZVQX 1XPUA 1LB1B 4MYHA 2DB3A 1RYHA 4YDSA 4Q03A 3T1QA 4BRUA 3IIMA 4C0KA 2IUSA 2HYDA 4QJ5A 3HPQA 1G5TA 3THXB 4HZUB 2KSQA 3CNLA 5HE8A 2P5SA 4IDPA 2ZSFA 2O52A 2PZFA 1JAHA 2HLDA 1VHTA 4AD8A 2W6ID 2ZE7A 4MYCA 4IDOA 3RRZA 1RYFA 1XCPA 1YR6A 2Q6TA 3FMPB 5AK0A 1TMKA 3MUFA 4LCBA 4MH0R 3AH8A 3KQHA 2VA8A 4KFUA 2G88A 1W2HA 3AEZA 3NHAA 2C95A 4PO1A 4CEJB 1KK2A 1K5GA 5FOUA 4D0LB 1E94E 1NLZA 3VR4A 4PZLA 5A5GA 1KI2A 2PX3A 2KBEA 4B32A 4TMKA 1NG1A 2B7CA 1E2GA 3IILA 2ZRFA 1K5DA 3VTKA 2JJ1A 4JJZA 2GEDA 4ON9A 2ZRHA 4TLEA 4C0JA 4OQFA 4B2IA 2XOKA 4OJKA 2V54A 4JLDA 4KFRA 4KYIB 4ZI3A 3BGWA 1KI7A 3MAAC 5FTJA 2PZEA 1M6NA 2N42A 5EZ6B 2UKDA 1Q1ZA 1XTIA 2OXRA 4IOKA 5JFGA 1WRBA 1KDOA 2ODBA 1KAGA 3VAAA 1H8HA 4CT4B 2EWVA 4JL6A 1FMJA 1N6NA 4M1SA 1D2NA 5TXGA 3RS0A 3SYLA 4Q00A 4GOXA 2V4ZA 4QBGB 1W0KD 1VPLA 2VP0A 4PHTA 1V43A 4QKQA 3VNUA 1S2MA 2ZIAA 3KW6A 5AJVB 4LSGA 2C78A 3OHMA 4TQ9A 5KNCA 4BLRA 5C2JB 2QT1A 2IYWA 2H1LA 2ZJ5A 2RGEA 4RKFA 4C0LA 4ZCIA 3ZVNA 5JZVA 2EYQA 5CM8B 5G41A 3U5ZB 2GRJA 1RJ9A 2GJ9A 3SJBA 4EDHA 3NEJA 1JR3A 1MABB 3CLVA 2REBA 3LH5A 2ANCA 2ZS9A 1XPOA 4JT4A 1KK1A 3OESA 3F8TA 3SBEA 2AX4A 3ND9A 2KI5A 4CDGA 1DPFA 3SEAA 2JJ8A 2RGNA 4FXPA 3QSYA 1DAFA 2EFHB 4LYJA 2IUUA 3TW8B 5FUWA 3DO6A 3GJ6A 2ZSDA 2ZR7A 3TH5A 2F43A 4TTQA 4F91B 2CDNA 1E9DA 3CRVA 3PFIA 4D81A 4UXJA 3SNHA 4QNRA 4PC6A 4TZ6A 2F1JA 1LF0A 3QF4A 2QPAA 5FBVB 1X86B 1Q20A 2SHKA 4KBGA 2F1RA 3ZS8A 5EQTA 3ASYA 4QHTA 1M7HA 3BC1A 1EK0A 3PUXA 3LBIA 5KPDA 3MJRA 1XD2B 3OFND 2IC5A 1HQCA 3T15A 4C0BA 1G8PA 1C1YA 2C9CA 2FF7A 2WWIA 3D7MA 4JLOA 2YNMA 4DWJA 1ZC4A 3TUZC 1M2OB 1EFRD 4PXAA 1MOZA 4Q47A 3X1DA 2J5XA 5KSOA 4O3MA 2OUKA 3TSWA 1NN5A 2OZEA 1C1KA 1P2UA 1YKSA 2W58A 2A5DA 2A5YB 4TYQA 1YU9A 1ETUA 1LNZA 3OEED 4JS0A 2IUTA 3W34A 3WP0A 2RCNA 2ZI6A 2Z4RA 5JJLA 3A4MA 4PSKA 1LW7A 3SHWA 4Q4AA 3CPEA 1N6IA 5EE3A 4V02A 1KYIA 3DOEA 4TL9A 4CEJA 4H9GA 4AKGA 1HURA 3NIBA 4GITA 5EE0A 3IHLA 5FUYA 1F2TB 4ZO4A 1GKYA 4MA4A 2VP4A 2KJQA 3FKSA 3FPAA 4LHXA 1SXJE 3VKHA 2QP4A 5DN6A 4C3ZA 3UMRA 4IDQA 2Z0MA 2Z4SA 4TTRA 4DCSA 4BFXA 3CF6R 1RW4A 4NU0A 2ZU0C 4R98A 4XD7D 2QBYA 1RE0A 3SE0A 1ZAKA 1DOAA 3K0AB 1D9XA 3D3QA 4E22A 3RYTC 2WJYA 4KCGA 4FCTA 1I4TD 2W0MA 4W5WA 3CRMA 3IQXA 4Q7JB 4Q4JB 4QGFA 1C4OA 3PR1A 1EWQA 2JLRA 2WIAA 2G3YA 3AVUA 3CM0A 1G4AE 2OESA 3Q3JB 1OXVA 3SHFA 1TUIA 3B9QA 1ZM7A 5JMTA 3AB3A 1G5RA 3KFVA 3VLFB 1OSNA 2KWIA 2RGDA 3EG5A 4A6XA 2HYIC 3NBFA 3TSOA 2PCLA 3RNLA 4A2WA 2F55A 4B35A 5ANRB 4HZUA 3P27A 4DIEA 1G5PA 3PITA 1NVVQ 4Q1BA 3Q7PA 1VIAA 2IW3A 1XF9A 2RGAA 4CYMA 1OH6A 4US2R 4NH0A 1COWA 2PT7A 2XTNA 3B82A 3T06B 2BJVA 1SVIA 4JLBA 1J99A 4EJSC 1T3HA 4M4SA 4P4UA 1W5SA 4I1UA 1G7RA 1TEVA 1KY3A 1ESNA 2VHQA 3RWOA 1HTWA 4GDFA 4MRNA 1CIPA 5JS7A 3U3JA 5FL7A 1X6VA 3VU9A 2VSFA 4PC1A 2IT1A 4LHZA 3EIQA 4JLNA 4NCNA 4A2QA 3ZZTA 2JA1A 4M9QA 4ZDWA 3K9NA 3SJZA 1CKEA 3B7GA 4A92A 4WW0A 1Z08A 4D82A 3I32A 1XXHB 3OIWA 1XMIA 3B8HA 1SXJA 3AVPA 3WP1B 2WAYA 1GOTA 3C16C 4URUR 3TK1A 5FL7D 1CJVC 2EFEB 4QG7A 2XJ4A 2RH5A 2BMDA 3ZJYA 1DO0A 5EP4A 3QKUA 3PXGA 1L7VC 3R9XA 3CW2A 1X8LA 3BERA 1ZCAA 1IY2A 1I2DA 2YOGA 4YMVA 1X8KA 2F9LA 5K8LA 4LZZA 2QMEA 4U7DA 3PJRA 4XJXA 4X8OA 2ZAMA 3F3YA 5E7JA 4DEYA 1JECA 3IDQA 1OYYA 3U3KA 1B23P 2A3RA 5P21A 2XB4A 1KK3A 1JR3D 2W6JD 1OH8A 4NCIA 3GJ7A 1M8PA 3B5JA 1FTSA 4M0LA 2O8DA 1YZGA 1G17A 2P6RA 3CNOA 3LA6A 1DO2A 1P73A 3T61A 2OG2A 2G1JA 1IN8A 4MRPA 4LRTA 2FFHA 2J0UB 1DTSA 2ZRKA 5K8IA 2YWHA 5CJPA 3IIKA 3JVVA 1U8ZA 4IW3B 2BWJA 4KI0A 2JASA 1W0KA 1E0KA 2PL3A 1V5WA 3JZAA 1IY0A 2J1LA 1SVLA 4D80A 4HLQB 4LHYA 4WOPA 4F4IA 3H84A 4ZIRB 3TGPA 3GP8A 2CL6X 2NIPA 3M6AA 1E2LA 2F9MA 3EWSA 5DI3A 2O8FA 2ORVA 2OLKA 3IEUA 1PJRA 4M53A 2QTVB 1T0JB 3ZH9B 1CP2A 4NTZA 4HZIA 3EPKA 1MO4A 3TR0A 1W4BA 4EJSB 5TARA 3UK6A 4TLDA 1M34E 1GFIA 1II8B 2GK7A 4LBVA 4AG6A 4B3CA 1VCNA 2H7VA 5AUPB 1A5TA 1H8ED 1OIVA 1GTVA 3K9HA 2PZGA 2BCJQ 3L82B 1IXSB 2GCOA 2QI9C 3LW7A 5BW8A 5BYKA 2OBNA 4NYMQ 3BD9A 3DKPA 2MSDB 2ZR0A 2IS2A 3IPYA 1FQJA 3L43A 1TF2A 5TB5A 1E9CA 1QHHA 3QEOA 4DLRA 4ABYA 3QENA 3B1XA 4B2LA 3IBGA 1KKLA 1M7BA 1T3LA 5JJIA 5C18A 2WJVA 1D2MA 1S3GA 2FPKA 3REGA 3SS8A 1GKUB 2IS6A 2O0KA 1XMJA 1KO8A 4ACAA 4TL7A 3OIUA 4NHOA 2QP3A 2V6ZM 2QGZA 1DAIA 1X37A 4LV6A 3OFNA 1TNDA 1AGPA 2JEOA 2ONKA 3EAQA 4DDUA 3SJAA 2VQSA 4EFLA 4EPXA 3KJEA 5TV2A 1KMHA 4A15A 2GEVA 3WBKA 1J8YF 2ZE6A 1N6PA 4P32A 1OV4A 2EW1A 4R7ZA 1KIMA 4A8JC 1KKMA 3M1IA 1OIWA 1A82A 1AGRA 3EXAA 4GP6A 1VCOA 5JWOA 1IM2A 1EX7A 2OCYC 3KL4A 1E0AA 4OJQA 4PHHA 2ZRPA 4ACBA 1G8YA 3GJ5A 5E4FA 2WKQA 5GADl 4DCVA 4MRRA 5EE5B 1CJUC 4QJ4A 4ESHA 3LVQE 3B9PA 1E2EA 3B1ZA 1JR6A 2BC9A 1NL3A 2C77A 4LV5B 4D6PA 3SFZA 3QIAA 4B3DA 5FUVA 3FMIA 4V03A 1XXHE 3SFVA 4GOJA 2Q21A 1Q44A 3RHFA 1S0UA 4G5GA 1X1SA 3LFUA 5AUQA 3K70D 4LK2A 3GLGB 4GL2A 2ASEA 4MRSA 5BN5A 1CXZA 1OKKD 5DO9A 3TBKA 1JJ7A 2RKOA 1XTKA 2ZJZA 4HAVA 2IYSA 3LW8A 3OF5A 3KJGA 4BECA 1E9EA 1Z5ZA 1NVVR 5A4JA 4D26A 2NQ2C 3DMDA 2QG6A 5EUMA 5JEDA 5B2ZA 4CEHB 4LY6A 1G3MA 1GL9B 1YQTA 1AZSC 2AK2A 3BAFA 4XWAA 4YDHB 3VKGA 5DSZA 4DT1A 3TW4A 1U8AA 2FPLA 3A58B 1XTQA 4Q7MB 4B73A 2BMJA 1IN4A 1GITA 5JI3E 2WTUA 1D2EA 4F4CA 2WVJA 4FINA 3KB1A 4CW7A 4N0DA 4QM6A 2JLSA 2IYXA 4V0OA 2C99A 1SULA 3A1SA 4PAQA 3KUCA 2QRNA 5DI3B 2O8FB 2VP6A 2ZRLA 3B78A 1G20E 1LV7A 3VU9B 1OHHD 2ZJBA 3WNBA 3WYAA 2DFLA 3AVVA 2P67A 3BFXA 3RABA 4BZXA 4GOKA 4HI0E 2CK3A 1UBEA 3K0CC 1XEWY 4PHFA 2NO6A 3AVYA 3MRSA 4HYYA 5JLJA 2CBZA 2UVQA 1KI6B 2DFTA 4BLQA 4TL6A 2YV5A 4RVCA 3TKLA 1LFDB 3UG6A 4K81B 2GEUA 2J7PD 4TYYA 4PFSA 1H8EA 2J0UA 3W8NA 3GLFB 1Z22A 4OI4A 3NDPA 4LRSA 4ZV4A 1NI3A 2CMKA 2FSFA 3QKSA 4TLBA 1L8QA 1Z47A 3HDTA 1AK2A 1PLJA 1E2KA 4U02A 5KOYA 1W7AA 3QE0A 3ZQJA 4M2LA 1AN0A 1XJQA 3AM1A 4PC3A 4V0KA 4BLOA 1XD2A 5L3VA 2X19A 2CCJA 5G40A 5EP2A 1Q1QA 4HB2A 4O0MA 5DLQC 1T8TA 1L4UA 1RVDA 2GZDA 2W6IA 5G3ZA 4QXAA 4M9ZA 4N3NA 5FOVA 2ORWA 3RSOA 4A9AA 1AM4D 4YXWD 1SHZA 3PEYA 2ZR9A 2FZLA 1XPRA 4AI6A 1MRSA 4RSGA 2F7SA 3TAHA 4EKDA 4TN1A 3VR3A 3RRYA 4KHZA 1ZVQA 3U61B 1E6CA 1XZQA 2ZE8A 5LD2B 2D4HA 1HV8A 3AP3A 2W0SA 2ZREA 5KNBA 4KSCA 4J0QA 4QFMA 4I1VA 4CVNA 4JIMA 4RD3A 1R8SA 1JPJA 5FI1B 4ZCMA 3BWDD 2BBTA 1E9BA 4DSUA 2OEPA 3C14C 4W7SA 2XZOA 1UJ2A 5JJKA 2R6FA 3LX5A 2VO1A 1XWIA 1D6JA 3SBDA 1P4SA 4DZZA 3DVLA 1OJLA 1UKVY 3LXRA 2IS1A 4NYJR 4A8JA 3FE2A 3QXJA 3UIEA 1Z0DA 3DPUA 4GZMA 5KYKA 4QNMA 1R4AA 4OI0A 2ZRNA 3GEIA 1WP9A 2NO9A 2WMOB 4NONA 4QOSA 4DLYA 5TVKA 1DAGA 5JCZA 1Z0AA 1MT0A 1CJKC 2QA5A 5EP3A 2IA5A 3BIFA 3FFBA 3VMFA 3CRQA 4S35A 1W44A 4IXMA 3FOZA 1ZM2A 3LBNA 4QL3A 4I81A 1NBMA 1YHNA 3E1SA 5CJ2A 3L8ZA 1KGDA 2VTKA 4C0SA 5D3QA 3PUWA 3GLHB 1KJYA 1UEJA 5G53C 2FMXA 3L0IB 1CTQA 1G9XA 1S9HA 4GRAA 1N5KA 2I3BA 1XTSA 4P4TA 4BRWA 3SQXA 4Q4HA 1ZMXA 2R6DA 3GJ0A 2WKPA 4TMZA 1CF4A 4LV8B 3LY5A 1Z2AA 3ZZ0A 2J59A 1CR0A 3GJ8A 1M1YE 1N6RA 3NHBA 1CEEA 4Q9KA 3GFOA 3QXSA 3F0TA 3P32A 2GAOA 1VECA 3R9WA 2ZITA 2AKAB 4IHQA 2DWOA 1R10A 2YHSA 3WNCA 3GLIA 2H8KA 2NOAA 4PQRA 4EJSA 3K0SA 2QNRA 1S1MA 1AQYA 4WVFA 4URXR 4IDHA 3KKMA 2A30A 5B64A 2WJHA 1KOFA 4ITRC 4AIIA 2HV8A 3W3ZB 3KJHA 2C03A 1UFQA 5IDVA 2JIZA 2NTYC 2ERXA 1EFUA 3I4LA 2JLQA 4ZKDA 2CE2X 4HUQB 3FHTA 3THOA 1DAHA 2CL7X 2NO0A 2A2ZA 3TVDA 4QBFA 3BBPA 1NVUQ 2PJRA 2HCBA 1OT3A 3LQQA 3B6EA 3QQ5A 2J7PA 2W00A 2YZ2A 2C96A 4TLCA 421PA 1YRAA 4LBZA 5FTMA 3NKVA 1CU1A 1P75A 1P9WA 2QGNA 4ARZA 2VRWA 4C0AC 4BZPA 3KQLA 1KHTA 4LX0A 1NY5A 3ADBA 1XTJA 1F2UB 1G1MA 2VSXA 3P4XA 4JYCA 3WHLA 4OBEA 5H8WA 2ZRCA 4QHSA 3ZD6A 1NN1A 1G64A 1NP6A 3LD9A 1QBKC 4LJ8A 1QZMA 3E5HA 1T8UA 3K70C 3THWB 4C9BA 1KI3A 3PEWA 2WM9B 2GK6A 4HLCA 4HLUC 3T34A 2HLDD 4OQLA 3S1AA 4ASUD 1G6HA 2H18A 2BCGY 1U0JA 2NPIA 4DT1B 4GNKA 2F1IA 2GBLC 3ECCA 4ZIRA 1AS2A 1UM8A 3DHWC 4H1UA 4PZYA 4CEHA 3G5UA 1WB9A 1AZTA 1HY3A 3GLHA 3ADDA 3AGQA 5FPTA 1SXJB 3QVUA 5JECA 3WMGA 1FP7A 1XXHA 5AUNB 3UANA 4U5XA 4LC0A 3TQFA 3IUYA 2ZANA 1TAGA 3IPXA 4HAWA 1LS1A 2B21A 3T12A 3ADCA 4HUQA 1E1QD 3BH6A 3B1VA 5FTLA 3KJIA 5LPNA 3U6KA 3VR6A 1XB2A 3SDZA 3GPLA 3FMFA 1ZUIA 2Q3FA 4M1OA 4NDZA 3IGFA 4QBHA 4LUCA 4NZYA 221PA 4Q01A 2D06A 2G77B 2C9YA 3K09C 2EU8A 2PX0A 4TMTA 5CDFA 3AUXA 5DYGA 4PC2A 4W5JA 2G6BA 2B8WA 1IHUA 4A36A 1RKBA 2VP2A 5KUTA 2WSMA 5KNDA 3U3OA 2GXSA 1LS6A 2D2FA 4MDFA 4B48A 1UKEA 2CNWD 2PLFA 1OHHA 2WAXA 1JR3E 2OCBA 3IBYA 1RZ3A 4QC2A 2QTHA 3BJIC 5BN3A 2NZJA 4DRZA 1HQYE 3TJZA 4D0NA 2ZJYA 2DYKA 1US8B 1IBRA 1MABA 5FH9A 3Q85A 3ADKA 5JSZA 1Z0IA 4FMCB 1VG9B 4G5RA 4D2IA 3BB1A 2GJSA 1BYIA 4L16A 1FQKA 2FDCA 1Z0FA 5HKKD 2QMOA 4TMWA 3BB3A 4A3VB 4R2IA 4IDNA 3IQWA 2BBOA 3RS7A 2G0NA 6Q21A 5TMPA 2L0XA 3P1JA 4A4DA 1T5IA 1U2RA 3A1UA 3BK7A 3SU8A 4IFBA 3T1TA 3PUYA 1PZNA 1TU4A 3K0EA 1GL7A 3DMNA 1QVRA 3DDCA 1E79D 5FL3A 4BEJA 3RS5A 1OW3B 3Q5EA 2VF7A 4PX9A 2H16A 2WV9A 2PCJA 5AJWA 4IOJA 5FPKA 4EPTA 4B3XA 1RC8A 1K6MA 5KDLA 4RFSA 4LJ6A 1U99A 4OHVA 4TMXA 3PENA 1VIYA 2ZRAA 4A82A 3I61A 3BH7A 4Q1FA 1QG2A 2X2FA 1XBTA 4Q4LA 5A0FA 2OLJA 5J4VA 1E32A 2C8VA 2Z5FA 1F3OA 1G19A 2UZIR 3N5CA 4KVAA 4XIGS 3NDBB 2NO7A 2ZROA 3A1TA 3I72A 5CB6A 4ESVA 4DUGA 4GP7A 1AJEA 3K70B 3QKRA 4Q9JA 1A2KC 4MDEA 4O25A 3C4JA 4C2UA 4IFEA 4PQFA 3AQ4A 5CIWA 2KB0A 3CR8A 3DKVA 3I8XA 1UKZA 2R44A 4G5SA 2FPMA 2ZRJA 3NBXX 4Z51A 3CR7A 5K8TA 4UNQA 5DIFA 5LB4A 4QGAA 4RD1A 5DI9A 1G3IA 2A5FA 5JI2E 3R7WA 1QHYA 3KQUA 2AXPA 2ZRMA 3PEVA 3IEVA 2I1QA 2HXYA 2XTZA 2FSGA 2A7QA 3FHOA 1N2CE 1N3BA 1S9DA 1XP8A 4R9UC 2OCPA 1NNEA 4BASA 1KO5A 1TQDA 4Q7KA 3PUZA 2FZ4A 3K53A 3UWKA 3MWYW 2DWQA 2ZU6A 1BYUA 1G8FA 1FL9A 2V55B 2GBLA 2G1KA 4KO8A 2D7CA 1A4RA 1E3MA 4P0TA 3W5JA 4WZAE 4R71A 5SZHB 3AKEA 5IF9A 5E3HA 1E0SA 4UXHA 2QT0A 4Z8YA 5FPSA 4LJ5A 2TMKA 3GCGA 4WXRA 1NG9A 1P2TA 2A5GA 5F98A 4Q21A 3THWA 1E2MA 3HR7A 1XZPA 2YVUA 3P4YA 1OXUA 4UKDA 1PLKA 2WOOA 3BFVA 3SZRA 1NBME 5B30A 1X3SA 1HA3A 2KBFA 2AKYA 1GILA 3KQNA 1KAOA 2CCGA 2WJIA 4LRWA 3P26A 2RGCA 3IO3A 4GPTA 2JIZD 3EZ6A 3IHWA 2XB2A 1G7TA 2JGNA 2J41A 1RJ9B 1G291 2WJGA 5HZKA 3H0KA 4JSYA 2WMNB 4NYMR 5D3MB 4DLTA 1QDEA 2OFOA 4P4SB 1GNRA 5CLQA 2FG5A 4EPYA 2YKGA 3CWQA 1E9RA 4BQSA 1W2GA 5KDDA 1DAMA 3NEYA 3Q72A 2QROA 1QG4A 4KBFA 4PAMA 5CK5A 3TR5A 1KTVA 4BGDA 3MJHA 5DHFA 4UJ3A 2WZQA 1GIAA 1SQ5A 3K0AA 4TQUS 3QJYA 5C4MA 4KV9A 2IWRA 1QHIA 4M1KA 4K46A 2XNDD 3DZ8A 2W6JA 3L0PA 3CRRA 4MITA 5J4HA 1G7CA 1GKIA 5FUXA 4CT5A 2AD1A 1QF9A 3B60A 3CPJB 2J46A 4RJLA 4UNPA 1EFRA 4M1TA 4MGZR 3X2SA 4DXAA 4A0HA 4DLVA 2BMFA 2GJ8A 3CNNA 3I73A 5CB8A 2FFAA 1QHHB 4YMSA 2QM7A 1AA9A 2FV8A 4WIAA 1GNQA 5DNYB 2OBMA 2HXSA 1GWNA 1PUIA 1CULC 3DOFA 2QL6A 3I92A 4X8LA 1F2UA 2I1VB 4NL4H 2JATA 2FGKA 5B57C 2GTPA 1AS0A 3AUYA 2REXB 3MSXA 2GA8A 1NKSA 1TTTA 1W5TA 1QHXA 3KQKA 2LKCA 1QHSA 3PCRB 5FR2A 4IVPA 1E2QA 1EX6A 2O8EB 2R62A 1IOZA 1ZINA 3OE7A 1KZ7B 2WPDA 1KO7A 4KYUA 2DZNB 1U9IA 2GJKA 2O0HA 4JZKA 2ZYWX 3CX6A 1NRJB 1PLLA 1W4CA 2D2EA 4DEXA 3QI2A 3CWZA 3QG5A 5KSZA 1Q3TA 1G41A 1MO6A 4GI7A 4Q1DA 2PMDA 1E0JA 3ZVRA 4KITB 3C8UA 4FMBB 4RFSB 1VCIA 5H70A 4ZKEA 1VHLA 1ZIPA 1CJMA 4DVGA 1TQ6A 3AKYA 2LKDA 1GVNB 5KO2A 3AF2A 1ELOA 4G0NA 3X1WA 3W6PA 4XVUA 4B76A 2DBYA 1KI1A 3FKQA 2B7BA 3B2EA 4AKEA 1FX0A 3VX3A 2ZI9A 2GF0A 5E95A 1CJTC 3EZ9A 3GD7A 1DAKA 4OQXA 5DGXA 2J0SA 4KAXA 4KODA 4Z1MD 3MD0A 4X8MA 1YZQA 4UNNA 3OZXA 4G1UC 5HKKA 2PLRA 2Z43A 2VBCA 4HB4A 2W83A 1KDPA 3U6BA 2N46A 2ORIA 1P9RA 1CRPA 1DG3A 3W8RA 2RGGA 1SVKA 2ZS7A 4Y0VA 3IIJA 2Q9CA 3P20A 3NC1C 4PC7A 1ZC3A 1S96A 1KJWA 3MMPA 2X8AA 4KLZA 2EQBA 2IK8A 1GUAA 3Q9LA 2R8RA 2RGBA 2CNWA 5DE3A 3CF0A 1BS1A 4UJ5A 4PSAA 1YRBA 2JLVA 5SZIA 4XVQA 5C4GB 4OKSA 4EQ6A 3W6NA 1RIFA 2O8BB 3KUDA 2BIFA 4CEIB 2G0TA 3QNUA 1Q57A 2FJUA 1C9KA 3PQCA 1UDXA 1UADA 5E7IA 1ZNZA 2JAQA 2QRZA 4LWZA 5LB2A 3VFDA 4EPRA 2IL1A 1R5BA 2RHDA 1Z29A 2WWGA 2XITA 2ZRDA 4B71A 1XEFA 3GLFE 2ZTSA 1VYTA 5LBIA 2MMGA 5L3QA 2YWFA 3CX8A 1N0UA 1T4GA 4C7OB 3LV8A 3NH9A 1UBCA 3ZYCA 3EZ7A 3AF4A 4BE7B 2G9NA 4FN5A 1W46A 2P2LA 4OHYA 3QKSB 2DHRA 2E9SA 3REFA 4BFTA 4ZDJA 1SVWA 4AYXA 5C46F 5J4KA 3NWJA 2IYRA 1DARA 2QPOA 1Z6TA 3LQRA 4XSGA 2XTMA 2F1HA 2W2VA 2QZ4A 2FE4A 4GBMA 4GT1A 1D5CA 4KSBA 1E2JA 2QAGB 1EFTA 2ZUDA 1EGAA 2B92A 4RCZA 1G6OA 1R8QA 2GHIA 3IKJA 5L3QB 1E2IA 1NVMA 4HB0A 4QM7A 2I4IA 1YZTA 3U4QA 1G18A 4ASUA 3FB4A 4RD4A 1RRFA 2HDNB 4KU4A 1ONBA 4LYHA 1FFHA 2GXUA 1RRGA 2AFIE 1VG0B 3KTAA 5CM9C 1OXSC 4XSHA 3WXMA 4DLUA 1OH7A 4BWYA 1H8HD 1JI0A 2ZYUX 4IJMA 1KSFX 4TL8A 2W2XA 3EW9A 1ZIOA 3U2QA 2ZJ2A 1TUEA 2DPXA 2D74A 1E4YA 3A1VA 2CVHA 3BB4A 3FHCB 5CIQA 5AJXA 2VHTA 1FOEB 2YOHA 4B44A 5HE9A 2ZM5A 3JVUA 4C2TA 3GJ3A 2PEZA 2CL0X 2P5TB 2E1RA 721PA 4DB4A 1U94A 5FBLB 5HZHA 1KNQA 1QRAA 1OFUX 2X1VA 2XNSA 4UNSA 1T6NA 3CKLA 4JJKA 4DDWA 3QF7A 4W9MC 3O8DA 3OE7D 3EWAA 1U8YA 4LJ4A 1SVSA 1SVMA 1WF3A 1ZD9A 4PTLA 3ZIAA 4DDVA 1U0LA 1IXRC 2FU5C 4P31A 5K8UA 3KX2A 4V0ME 4I1OA 3ZVMA 1BIFA 3QBVA 4HEJA 4JT2A 4DJTA 1L4YA 1MV5A 4B74A 3PVSA 1WE2A 2FX3A 2J7KA 3LWNA 4OQMA 3RS4A 4F7WA 3I5YA 4Q7LA 3LXXA 2YINC 3T35A 5JRJA 5F2EA 2QBYB 1VTKA 1IQPA 1GG2A 1OLOA 2GWHA 2Z6VA 3WY9A 1CBUA 1ZD8A 4C4PA 1XTRA 3KXLA 1E69A 4C30A 1WXQA 3GLIB 1NN0A 2ERYA 2FH5B 2V6IA 4IRUB 3KTAB 2IYYA 3GFTA 3ZZUA 3ASZA 4EUNA 2CJWB 3AKDA 1TQ2A 1GP2A 1YE8A 2PEYA 3JZMA 4RD0A 3ZLJA 2CE7A 2Q9BA 4G01B 1PV4A 2N1BA 2YC4C 2ZSEA 2E87A 2OO7A 3VR5A 3VR2A 4AYTA 5GVSA 1MR3F 3K1JA 1P72A 3ZQ6A 3ZS9A 5EXTA 1DELA 2QAGA 1G16A 3L0SA 4IOMA 5FBWB 1J2JA 1IONA 3CZPA 4XWOA 2GVZC 4OQNA 1WBDA 2XGJA 2FFBA 5IT5A 3V00A 1OYWA 4AG5A 4MGYR 1BO6A 2V9PA 2ZI5A 4PPNA 5TDHA 3A37A 2HJGA 5CLLA 3HPRA 4P4SA 4TLAA 4TMVA 5LD2C 2Y8EA 4K8OA 4DHEA 2FSHA 1FMLA 4LBYA 521PA 1OXTA 3HR8A 1FUKA 1UDWA 4OHWA 4D4JA 1N5LA 5JBQA 2HCJB 5CITA 3FYHA 2FOLA 4L9WA 2YWEA 2CLCX 2EYUA 1Z07A 2WPDD 3WMFA 4OI2A 4JVNA 4DCUA 4LHVA 4TT3A 2GF9A 2ZSBA 4OL0A 5CDFE 2IYTA 3QY0A 4PAOA 5JHHB 2H17A 4HUTA 4DB2A 3GMTA 3T1VA 3CIOA 4Q4HB 2F43B 2GDJA 4KLNA 1YJ5A 3EIHA 2XSZA 1XCGB 5GJBA 4NE2A 1X8JA 4YLGA 1P2SA 4IEIA 3CZQA 2XAUA 1DVRA 2BHRA 3RDPA 4JBWA 4JBXA 1HUQA 3GJ4A 2C04A 1H65A 4LJ9A 1E9AA 1Z06A 2GXQA 3CX7A 3LDAA 2IYZA 1XU4A 2FSIA 2PH1A 4OK5A 4L9SA 2CHGA 5EZ5A 1B0UA 1JNYA 3KKNA 4JLPA 3LNCA 4M22A 4QBIA 2IF0A 1U98A 2GXAA 1O87A 4LC1A 3NG1A 1BOFA 1W36B 2O8BA 3HU1A 1IN6A 4TSFA 4PPFA 1L2TA 3I3SR 3QEJA 4EIWA 2OILA 1Q1BA 3GEHA 1E4VA 4KVGA 3C15C 4FWGA 1ZD1A 1JEDA 2V8OA 4MGIR 4L4UA 4D4LA 3VKWA 4DUGD 4XH9B 4FW9A 1ZUNB 4B75A 8OHMA 5M04A 5EXXA 2VPPA 3RS3A 1SKYB 5FBRB 3DM9B 3AF3A 1O3YA 2QSYA 2DVWB 1ODFA 2H5EA 4YMUA 4Q18A 1Z3IX 2DFKB 4BFZA 2LWIA 4GMDA 4DLZA 2CVFA 5B58C 2ZYVX 3L2OB 3QPVA 1VMAA 1AKEA 2VHCA 2O5VA 2P6NA 4KJZA 5BQ5A 1ZM3A 1N6OA 4XVRA 4MKFA 1IJEA 1E1RA 2FEMA 1ZRHA 1P5ZB 1OFHA 4DSNA 2W2TA 2VHUA 4DDTA 3TIFA 2ZPTX 3GLIE 2J0VA 5GJCA 3X1XA 3I8SA 1J8MF 2DFNA 5AJYA 2WSSA 2V7QA 1TF5A 1DADA 4WZBE 2EFDB 4N1AA 1DG1G 4B34A 3U7FB 3FVQA 5HTKA 4Q02A 4Z8XA 1NKTA 1UKYA 1ZU4A 1OFTA 4JYBA 4E5UA 1G4UR 2GZAA 3NBYC 1NLFA 1N6HA 1JPNA 1W1WA 1KJZA 4LI0A 1KI8A 3ZGXA 4NCKA 2DY1A 4ZI2A 4DKXA 1A2BA 2O8EA 3BS4A 2J3EA 4QRHA 1VYVA 4E07A 2IEYA 4CEIA 1N6KA 3UATA 3FWYA 1XCMA 2ZEJA 5EP1A 1KY2A 4RZ2A 1Z63A 4EFNA 1KDRA 3THYB 4EPVA 3ZD7A 1P60A 4FI3C 3DZDA 1W4AA 1R7RA 1E99A 1Z6GA 1ZP6A 3R8CA 4W5HA 3A4LA 3U60B 3G82C 4BFYA 4E09A 4NYIQ 3GLGA 3T1OA 5ELXA 1TU3A 5H68A 3SI7A 3TSZA 4D4KA 4US0R 1T0HB 2XOKD 2XXAA 2GJAA 1E98A 5KHOC 2BM0A 2QQEA 5AJZA 1HT2E 1JQJC 2QAJA 2QN6A 2ZQ5A 4NPHA 1GNPA 2JJ1D 4IOLA 5IHPA 3G0HA 1K8RA 3RWMB 2CLSA 5DYIA 2RHMA 2WHXA 4GSYA 5JSZB 2HF9A 1Q3HA 3GLHE 4FMCF 3V9PA 1P2VA 3TVTA 3BXZA 5BYJA 3THXA 2AD5A 4M9SA 5E7MA 1JEEA 4Q1CA 1JB1A 5FR1A 1E79A 2JLYA 5BN4A 2CK3D 1D9ZA 4JVSB 2C98A 4OK3A 3WBJA 3WRYC 1Z28A 2YYZA 4URVR 2OBLA 1HYQA 4JKIA 3OIYA 1XNJA 4AURA 3AV0B 3AVOA 2JDIA 1T91A 3QKRB 1Q0UA 3GFPA 1PVOA 1CR4A 1QVAA 2AR7A 4RD2A 3U7EB 4L8GA 2V6JA 4DC9A 2NGRA 2B6HA 3ZVLA 4EPWA 2K5UA 3MGCA 3TUJC 3AVTA 4JKYA 3EC1A 3CBQA 3W3AA 1II0A 4TYPA 2ZUBA 1FP6A 2GVDC 2P6UA 2JDID 3NXSA 2G83A 3R7WB 5BWMA 3R20A 1OF1A 1TL7C 2D3WA 2QMUA 5JWRA 5L3SB 3UMSA 2FN4A 2ZSAA 3UPUA 4PHGA 4HDCA 4DLSA 1F5NA 1KO1A 3LO5A 4PQYA 3QXHA 2ZRGA 3CUEF 1XMSA 2NZ8A 1XJCA 2V7QD 1YR8A 2WSSD 4NCHA 1R6BX 4AK9A 3D31A 3MHVC 1IY1A 2VIIA 1NIPA 1S1CA 1U0HC 2FA9A 2VLIA 4S2EA 2FNAA 5J5CA 3UG7A 1HT1E 3MFYA 1YR7A 4MKHA 5LDDC 4L5BA 1FNNA 2XZPA 4MYUA 3TE6A 4CIDA 5HR5A 4P33A 3NTUA 2MMCA 4MYTA 4MUBA 1E2NA 1VCMA 1A1VA 1R5OA 1IAQA 5FFMA 121PA 1F2TA 4A0FA 3C5HA 3ND8A 1R0ZA 5HPYB 2QEQA 4OK6A 1GM5A 1E2FA 2ZETA 3PEUA 1MRNA 1CRQA 4Q4AB 3CO5A 3AVXA 4TQAA 4HDOB 4OHXA 3BOSA 5DISB 1TX4B 1N25A 1LVGA 1VYUA 3LAWA 2QE7D 2V1XA 5JWHA 4BEBA 3U4QB 3DM5A 3SN6A 1XEXA 4URYR 5C1BA 5GJVC 4KFSA 5GJWC 1Z6AA 1KI9A 3ICQB 2QM8A 4TSFD 1UAAA 3OAAA 1T3SA 3ICEA 3UMFA 1KDTA 1YZUA 4JLAA 2HF8A 1YZNA 3QVVA 1TQ4A 1W49A 1GRRA 2QENA 4URZR 4AYWA 4FIDA 4DIDA 3LBHA 4Q66C 5KSYA 3FMOB 2JLUA 1GL6A 1Q1EA 1FTNA 3EC2A 1A7JA 1II8A 4OYHA 4TZ0A 1OFIA 3EZ2A 621PA 3U44B 3QUSA 2QORA 4FCWA 3M4YA 4IKEA 5BXQC 1WBBA 3K0CA 2OE2A 4G3XA 4WXPA 4M1MA 4XWKA 2VF8A 4IXNA 3RVBA 4Z54A 2R6AA 2BKUA 1RPZA 1G3QA 2VH5R 2WWFA 3GQBA 5TY0A 4TYWA 1NY6A 2CCKA 2OAQ1 4DLWA 4FMDF 1UEIA 1W47A 2IYLD 3QG1A 2GZHA 2AN9A 2FGJA 3ONWA 2DWPA 4PZZA 1E1QA 1W0JD 3GEEA 1VG1A 5EE9A 2H57A 1BMFA 4A8JB 1CS4C 2YWGA 2A78A 4BLTA 4Y0AA 1E96A 3K9LA 4YQFA 1FW6A 2ZRBA 3H2YA 5CK4A 1ZJ6A 1FPMA 3UKDA 2DR3A 4B47A 3KB2A 3B85A 1M7GA 1SKQA 2AWNA 5DN6D 1Y63A 2O8CB 1W48A 4C7OA 1KI4A 2ANBA 2ZRIA 5FTNA 3H1TA 1EFHA 2R2AA 3WYFA 3EA5A 1IN5A 1AS3A 2F3TA 2EVWX 4ARZB 2GESA 5AWFC 2OM2A 1Z83A 4IVRA 4M9XA 4D4MA 3UXMA 1P62B 3F5FA 2R6GA 4HAXA 2P0EA 4JVMA 4A0GA 1AIPA 1OXXK 2ZS8A 4WZ6A 1ZYUA 2BEJA 5G3YA 3R9IA 2GCOB 5FTKA 2ZI3A 1TF7A 2RGNC 1OIXA 2OFWA 1P6XA 4JSTA 2NPFA 4B6EA 1MO3A 2WKRA 3MWLA 3NBZC 3PIRA 1NVXQ 1NJFA 1P9NA 2Q9AA 1FUUA 2IXEA 1E2PA 3SJCA 3PV0A 3TNFA 2A5JA 4DBLC 2VP5A 3AF0A 4UXIA 1XX6A 2BBWA 4HAYA 3RC3A 3U7GA 3U7HB 1NSFA 1LF5A 2MSEB 1CR2A 1P61B 4NYIR 3WMEA 1W36C 1SZPA 1Z2CA
chains in the Genus database with same CATH superfamily
1H69A 2OHGA 4JN6A 4MS4A 1OQYA 2IP1A 5D7NA 4BUJA 2RBKA 1R0CA 2VZEA 3X1YA 5AHXA 3GF4A 1OE0A 4OEHA 4KPFC 2ZWOA 1VIVA 3KKPA 4X3CA 1YZYA 1QCZA 3CNEA 1R9NA 4GFDA 4UHEA 1BW9A 2B83A 3ONDA 3GPPA 1O5IA 4V0NA 4E0BA 1SXJD 5H81A 2OENG 4L8WB 2DSNA 2F64A 3ZY2A 3DPIA 4HDNB 1OH5A 4K6KA 5EPOA 1RRCA 2IX9A 4EW3A 5EUQB 4I1SA 1ZNXA 4MH0E 1TM3E 3DL0A 3OIGA 4IJFA 1FSGA 1RPJA 1ZNYA 4MWTA 4WTOA 1NZFA 2W37A 5HCNA 3WDMA 4C01A 4EY4A 2P2DA 1YRYE 2GMWA 1X7YA 2JI7A 2WE8A 3K9GA 4PPQA 4X41A 4ROSA 4TTPA 2BV3A 2Z9DA 2ZIUB 4GIBA 2MSCB 4PYQA 5KOHA 3IVAA 4DQLA 4A5OA 3CB4A 3CZCA 1KPHA 1UBRS 4IWNA 4DR1B 1Y6GA 3GEPA 4I0WB 4MWGA 2MT9A 1GZSA 1G59A 2VATA 3HHPA 3EFOB 2OOBA 4L9RA 4XTRA 3J7AC 3ENQA 5BY2A 1U7PA 4U00A 1JBKA 1TZCA 2R85A 1K06A 3TS1A 3R75A 4L6AA 1MEJA 1X15A 2QV7A 2XWPA 3W2IA 3EZXA 1C9NA 2DGDA 1RKVA 2V8BA 2FEWB 3QGMA 2C61A 1MDBA 4MW5A 3SHVA 3ZI7A 3MWDA 4ZAZA 1INLA 1NMXA 2O6LA 2PU7A 4ZFNA 3RRMA 2WAAA 3EGOA 3IMFA 1EWTA 5E8JA 3K0FB 1XEWX 4X91A 5KCMA 2K47A 3E22B 3KXIA 4PTZA 3KXEC 2VRNA 3KELA 3EZLA 4I6JA 4C6TA 3KSRA 1LV8A 3CN7A 3FCOA 2EUCA 4CQLA 4ZGGA 2PIAA 5BSMA 1SR8A 5CVCA 4XM1A 1TR8A 1MF7A 3F9RA 3LLSA 4IR7A 5GVRA 4YXWA 3EARA 4L0DA 2NSHA 1U3FA 1T2FA 1ZXLA 1XZAA 3IV7A 4BXOB 3GG2A 2XMPA 2KYRA 3KALA 2EKBA 5T4FA 1GZDA 3C1AA 4ZO9A 2AK3A 3R5XA 1H23A 4BDTA 4Z3KA 2VDBB 3CEHA 1R3UA 3E5MA 4Y6SA 3LKVA 3G23A 3P2IA 2H5JA 4B43A 2WD9A 3QF4B 2OFXA 4ARIA 5DLDA 3QLUA 4UAVA 4CXMA 1S3IA 4M0CA 3G68A 1PRYA 5HYVA 2BEKA 3GGJA 4C7MA 4YJGA 4YUVA 4B7HA 1GTMA 5DBOA 5B2FA 1W4RA 4S24A 4X1YB 3RLFA 5JD3A 4IHJA 4QJBA 3T95A 3DBVO 5JXGA 3EFBA 5FB3A 1M0SA 1S01A 3FLMA 1VJ1A 3HYRA 2BH9A 3RQSA 2QG4A 2F62A 1GRCA 4A6PA 1X1QA 2HAKA 4MV8A 1F38A 1N8SA 1O9HA 2JGMA 3KD2A 3PHBE 4TV9B 2HLNA 4H3VA 3OEHD 2FJ0A 2XXAB 4PANA 4MKGA 4AKTA 1XL1A 1EVQA 2ZB8A 1R2QA 3C6KA 2H2DA 4L8RC 1Y3CE 1ISSA 1Q0SA 2FG7C 4UQOA 5CLHA 1LLDA 5C31A 3ZU2A 5EXSA 7REQA 3Q1KA 1SVOA 5T5QA 4US1R 1NE2A 1EP2B 1T2DA 3B6MA 3OETA 1ZXXA 1JPUA 1VE3A 4R1QA 4Q9HA 1J1ZA 4NJMB 1TDJA 4URWR 3P94A 4Q3OA 4UVEA 3QBTA 3IA2A 3E5NA 2JCSA 3DTTA 2KZUA 3B8EA 2I2AA 1KMMA 4YK7A 1WGLA 3IMCA 3HBLA 3CNBA 5IAEA 4DARA 2FPOA 5LYJF 1Y80A 4PLFA 2QLLA 3C5CA 4PGGA 5TQVA 1QRSA 1T10A 2W42A 3UMMA 1TTEA 2BF7A 2Q3EA 3CJTA 3UO8B 4H7FA 3QNMA 5EPUA 4HAIA 3QKTA 3WHKA 3EVGA 4J0FA 2QAIA 4NY1A 3ZCXA 4FBLA 4B9AA 3D1LA 1XCLA 2PMKA 3T3MB 1TIKA 1K89A 3CNQS 2ZUFA 1XMOB 4JK3A 2ATXA 1R15A 4NDNE 4RO0A 4D9JA 4O3FA 3I0NA 2NPOA 3ASVA 3I04M 2NNLD 4F4JA 1DEXA 3EUEA 4GR4A 5F51A 1XN1A 1CNEA 1E3JA 1FEZA 1T35A 2P41A 4Z9AA 1YMQA 4DANA 5KJFA 4B6FA 4WQMA 4XM2A 2QVCA 2JGIA 4MQEA 2GCPA 4MS4B 3C5WP 4BFWA 4QO7A 2WICA 5JYEA 2DAIA 2BP7B 3KWLA 5DM4A 4ZYWA 2V96A 3C6BA 3AVWA 2H54A 3AVQA 1SPXA 3TTWA 1UT8A 2YVLA 4WCVA 1KSGA 1J33A 4N7RA 4C5BA 1BS9A 2H92A 1JTVA 1YZHA 1E63A 1MC1A 1NR1A 3PQ4A 4NC9A 1JYSA 1Q21A 5DX0A 1QOPB 1T5LA 2K2WA 5EE1A 2OA0A 3A27A 3PG5A 3C3YA 1EXMA 3EF0A 3JYNA 4QTXA 2HO5A 1XMOM 1VJTA 3GT0A 1DGHA 3HH8A 4Z4HA 4FWTA 1IXZA 3IEMA 2BDTA 4D74A 1RRVA 4JYAB 3C98A 3D6JA 4IBEA 4HGRA 3W5SA 1HYEA 1X1RA 4JH0A 1JEYA 1M74A 3F74A 3RS2A 1EVIA 2ZT7A 3D8NA 3HJCA 1PEDA 1XD8A 3PFGA 4LRUA 2O19A 1O9BA 4X6UA 4Z1MA 1VE5A 7ADHA 4FKZA 4ZCTA 2REOA 1RYZA 2FUEA 1T9GS 4WCFB 4MCAA 4YRNA 1EUCB 4MV5A 4MRVA 4IX9A 4NYJQ 5FLEX 3A9WA 3RHZA 5ITZA 2AOXA 4OKIA 2HM7A 2YYYA 2WIJA 4FWIB 4KFTA 4Z0PA 4ZZ2A 3DEFA 1WIWA 5A5FA 3UNXA 4F4HA 1NM5A 3WGNA 3NRBA 3RSSA 1AMNA 5CPBA 5I48A 4LJ7A 4AS3A 2H0RA 1SC4A 2WABA 5BYAA 1G38A 1RLJA 3MYYA 5SZKB 4QTYA 2X13A 4NBSA 1OB5A 1XLVA 2Q6VA 4OX9M 2BI4A 1PJSA 2D5CA 2IYVA 3MIZA 3D6AA 4NH4A 4ZZ3A 1SWWA 1NVWQ 5BORA 3G2PA 3HYCA 1JDVA 1EWYA 4RVHA 4YCBA 4IIYA 4RABA 4MDYA 4JU8A 3PFCA 1Q50A 4N5HX 2X8BA 1I33A 3H5RA 3CU5A 3U13A 2GH1A 2ZGVA 5DH9A 2C20A 3K2IA 2YJTD 1N8NA 3KQOA 1LY1A 3W3AH 2OSBA 2H85A 4ZI7A 4L15A 3UJ6A 3V97A 4AJHA 3URMA 5ER9A 4KFCA 1FFBA 4MAAA 2YCBA 3KZMA 3COPA 1R9MA 2OCXA 2VJAA 4G9BA 3E2MA 2BMAA 1D0SA 1LLCA 3PFHA 2Q62A 3BK1A 5COAA 5FQOA 4DCOA 1F2DA 1KDVA 1SHKA 3UJ3X 4EI2A 1MH1A 4IIJF 1JXOA 5J5AA 1OOEA 1Z6PA 3GVIA 3HCOA 1YHYA 4F1WA 1KZGB 1R5NA 1KR2A 1WQ1R 4JT9A 2WW8A 1JA9A 3AI7A 3E2IA 4YPOA 1RQ2A 3A1EA 1P7CA 3RRNA 2HMVA 3ZLUA 2FFQA 2RGRA 2AI2A 4PR3A 3FNIA 1KKUA 1JSLA 3E1GA 1LDYA 5H3HA 2O0LA 3RARA 4KMRA 3K5HA 3VSBA 3H6HA 1UBGA 3IUNA 4HFJA 1NVEA 3GJTA 4YO7A 4MO2A 2QVBA 4EAQA 1HLPA 2JJ2D 2XRYA 4LRSB 4NKRA 3DXXA 5K0NA 1VGVA 3MILA 4MKRA 1PYOA 1KSJA 3H1PA 3JZDA 4GYKA 4UMVA 4K6MA 5SY6A 4A8PA 3OP4A 4HRAA 5AW4A 3WGIA 2BM1A 4POAA 1O2DA 4U1RA 4UM7A 3UW1A 2RH8A 3UWOA 1N2ZA 5LZ5A 1YS9A 3V2HA 1LTQA 1RWKA 2CNNA 2GCNA 2O8VA 2PA3A 3U61A 2WWWA 4G81A 3ZHYA 3RLIA 4PRKA 4LF7M 3E9EA 4I08A 4DRXB 1UMBA 1W4LA 3A6EA 2VNJA 1NMSA 5A1TA 4YMTA 1TPZA 4IS2A 4NOLA 2J87A 3I76A 3N2KB 3UWMA 4LZPA 1V1RB 2CVOA 1QUFA 1Z8FA 1JGTA 1OYVA 3N8DA 1CUIA 1B0PA 1VG8A 3L0OA 5JCJA 1E2DA 3JAKA 3SF8B 1IBCA 1COZA 2WJPA 4E4TA 5JCJD 3ZZMA 5IUNC 2BE9A 4HDMB 4I1IA 4G6ZA 3AETA 4N6GA 1TKRA 4NIMA 1GZHB 5BMVB 5A4DA 2QY9A 2IEGA 3IVRA 1MJHA 1ZWLA 5E1MA 2R5WA 5FBHA 3JYLA 3SM9A 2VEDA 2IIBA 2C4HA 1LK5A 3DOCA 4YLEA 3HI4A 3VDNB 1PYDA 4M54A 1U81A 4LHWA 3ZE1B 2P2CA 2YC2C 2R4EA 5FWXA 3EGDA 3HP1A 4PICA 2JG3A 4FCVA 2C7RA 3DT6A 2AFRA 5C34B 4LBWA 4A0RA 2AG1A 3WNDA 1C5KA 3UJ9A 2BMEA 1A04A 1ENOA 2EGHA 2FWRA 3AESA 3ME5A 4P2BA 1N33M 4LJAA 3T5CA 2H9AA 3WJ2A 3RGGA 1RAFA 2HWUA 3DXYA 3LBYA 3OIVA 2XGOA 3D4PA 2WTAA 4M88A 2AH5A 3UV7A 4FWDA 1XJ5A 2RAFA 4GMXA 1UBUS 5KHAA 1EIJA 4QDTA 5EIOA 2ZZKA 1RFLA 1BKDR 2Z83A 4LGCA 4JC0A 3FHLA 4D42A 1Z16A 3HHXA 3GN2A 3IPCA 3PPWA 3KOYE 3QX9A 1E1KA 1WR8A 2QUJA 4RM3A 3DR5A 2M32A 3KOZA 4CKCA 4MQFA 3T5GA 2XX3A 3H86A 4ESEA 1A8IA 4D1YA 1QVVA 4RWEA 1LPPA 2WBLC 1YDHA 1G3UA 1FE8A 1CRZA 4P2GA 4E88A 1L7RA 3HKBA 1VKOA 1E1RD 2ACWA 3SC3A 3KYCA 2X77A 4M8LA 1GTL1 2I3AA 3SYNA 3CKKA 3ZWBA 4QFDA 2XSZD 2AZXA 4R1SA 1J70A 1WCIA 2GT1A 3EA0A 1S2IA 4LOAA 1R2ZA 2LE0A 1BCRB 4M1QA 4V0LA 4FD2A 2X3UA 4KOEC 1IB6A 2OXIA 3WISA 4HX9A 1BWPA 4CIZA 2R8EA 2AFHE 3NUZA 4FGLA 3ISVA 4RCVA 2BZ1A 1J0CA 4ZCLA 3V4FA 5JEEA 4RNCA 3ZU6A 1KMHB 3IUBA 3IIIA 4U7PB 2QPTA 5TPWB 2PGNA 1HPLA 1N6LA 1YDGA 2ATVA 1XD9A 2V59A 2X0JA 3U37A 5BNZA 2Y68A 2IHBA 1N36B 4C22A 1FJGB 3ENKA 3MPUA 3I1FA 2Q3JA 2VJKA 4CLDA 1KSHA 5JCPA 1PK7A 1Q7GA 1N7HA 3DF9A 1SC6A 3VPAA 2P9HA 3W1WA 1AHPA 1NYTA 1VHQA 1I3OA 3EDOA 3EISA 4ZQGA 4E2XA 1E77A 2CHVA 1QV9A 2RGXA 3KT3A 3EQ7A 1GZVA 3TLYA 1IUPA 4I4LA 3QW2A 1JSCA 1X14A 1XRLA 5JAUA 2O0JA 1SG6A 1UMDB 3ESCA 3MWEB 5J59A 3D54D 1OU0A 3OP1A 4R2HA 1QU2A 1TTQB 3QIVA 3B20A 4ZQCB 4ZHSA 4DY6A 1MDFA 5EUBA 4Y1RA 4J0EA 4G0MA 6ADHA 2BJWA 2KE5A 1LK0A 2ZVQX 3I9V1 4OHFA 1XPUA 4DV0B 5CX1A 1NUPA 2IU4A 1ZO8A 4NBVA 2VQFM 4YN3A 2EWMA 4Q03A 1ONNA 1MGOA 3L1HA 1D4ZA 3N8NA 5CYFA 2X0FA 2Q1YA 3ZHCA 1DXYA 4OQ4A 2KSQA 4CIYA 1EB9A 1PE0A 1Z5NA 2PUJA 2GWRA 3CNLA 3P0HA 1TK3A 5KYYB 1ZIYA 3RC7A 4DR2M 3SOZA 3G2JA 1WDLA 2M1XA 4K9SA 4J1NA 1U1CA 4U2EA 1TECE 4AD8A 1D1PA 3DV2A 1F8UA 1P0IA 2C00A 3WTCA 1U5BB 1Q95A 1TMKA 3JAWB 3MUFA 5EJ9A 1A5BB 2OCKA 4WZAB 1GTJ1 1PFQA 3W5UA 1BRMA 1T6YA 1Z8HA 4GQAA 5LZ7A 1DTWB 1SO8A 1WTAA 1NQXA 4M99A 3F78A 3U6PA 4M0FA 1E5XA 2FETA 1D2GA 3RYCB 1K5GA 1H2WA 1NLZA 1O94A 5DCWA 2K6BA 4FONA 3AM3A 2AT1A 1CUUA 2QRVB 2FTKE 1O4WA 4X45A 3AB7A 2ZRFA 4ZT7A 3RB8A 2H0QA 2HTEA 2FW6A 2I6TA 4ON9A 1BXGA 1VLLA 1XZLA 3A2NA 2C4UA 4ZC1A 4C0JA 4OJKA 2PUWA 2V54A 4JLDA 4KYIB 1JIXA 3V8QA 3Q2IA 5CFMA 4RTOA 4L3OA 2C5EA 3MAAC 5AIAA 1ZBQA 5FTJA 1P9LA 2C5BA 2PZEA 3BRSA 5TGTA 3PD1A 3G2MA 2R00A 2I2DA 1TVMA 3P0JA 4LXHA 3ZE6A 1KEZA 3OZBA 4DPKA 4IV5A 3GUUA 2JUJA 3EDQA 4G8CA 3H5LA 3OZEA 4AJJA 2F00A 2I66A 3S2GA 1M1NB 2EWVA 4M1SA 1N6NA 4HQNA 4TVSA 4QX6A 3RS0A 4Q00A 4QBGB 1W0KD 2C94A 4KDEA 2VP0A 1EAMA 1V43A 4O4LF 2O2DA 3FPGA 4CM3A 3Q6MA 3RUCA 1MZVA 2VCYA 4IF6A 1V6SA 2Q3CA 1CJSA 1FQOA 4ZWNA 3WWOA 5LQJA 2PGDA 4TQ9A 4HH3C 1YCGA 1BKYA 3SICE 1YF3A 1SXIA 1EHCA 2J3LA 3P2MA 3DE7X 5AXAA 3OSZA 5JZVA 4NXNB 3QWBA 5AI5A 5G41A 4XSVA 1CEQA 3DYBA 2V5VA 3AR6A 3O91A 4X62B 2CLHB 1JR3A 1MABB 3BBLA 3IBSA 1WKVA 2REBA 3JVDA 4O1HA 4CGYA 1TZKA 4C07A 6PFKA 2UU9M 3N59A 1IULA 3OESA 3SBEA 1AMUA 2MOKA 3OT4A 3ILKA 1B8OA 2KI5A 1XCJA 3STWA 4CDGA 2P9QA 4UCFA 2RGNA 1JDSA 3G8AA 3W04A 1AK1A 3B6IA 4PYJA 1NDUA 3WK9A 4KTTE 4LYJA 2WYIA 1OFUA 1V2GA 2YXLA 2DWNA 4YIKA 1T43A 4CV0A 3WK5A 2R8XA 3E0QA 1PM5A 2P79A 4MINA 2F43A 4NE7A 3CRVA 3E3AA 1NOJA 5TMBA 3SNHA 5C81A 4D43A 3BD6A 3MS2A 3TTVA 1LDBA 3QOXA 4QEKA 3ZKAA 3ZHQA 2TRSB 3G2LA 3HN2A 2HWKA 3D02A 2OQVA 2C07A 3JY6A 1LF0A 1TYEB 5FV4A 3PT5A 3G02A 4HK4A 1P39A 1Z35A 3H4VA 5CBKA 3W5AA 3VR6D 2QPAA 3RVNA 4B5LA 2VJBA 3G2IA 1ZEMA 1WUYA 3I1IA 2A14A 3OX1A 1LBHA 4XGKA 2P4UA 1X86B 1AU9A 4Q3LA 2JGEA 3VO8A 3P0FA 4RK7A 4DCMA 4QHTA 2QLMA 4IJVA 2Q4EA 1Z68A 2IUEA 3KEGA 1K4YA 5FHQA 5DGDA 3PE6A 1DZ3A 1FTQA 5KPDA 1YA6A 3OFND 1HQCA 1LRJA 2FF7A 4JLOA 3D7MA 3U26A 4B3GA 2YNMA 3NDRA 5KSWB 1XQ9A 1X94A 3I34X 5D8DA 4BU0A 5KSOA 2J5XA 2OUKA 3TSWA 4PCLA 2W58A 2A5YB 2A5DA 1PT5A 2UYOA 1PD1A 5ETJA 2RE8A 1WR1B 3QYBA 2RCNA 1DHRA 1V37A 2ZB3A 2P4EA 1LW7A 1MQ9A 2J30A 2F1KA 2P4SA 2X4DA 3UOWA 3OOYA 1DL5A 2N75A 4KQ6A 4V02A 3DOEA 5AKYA 1AKUA 5DKFA 2X5OA 3WRXA 4A91A 4CEJA 1D2RA 3AUKA 3BPSA 4DIMA 4D3DA 4AKGA 1CLEA 1IXKA 3AJ8A 1HURA 4HTAA 4GITA 2TSYB 4Q3AA 3RODA 2PSEA 5FUYA 1QONA 3L4KA 2QTLA 4ZO4A 3DVRX 2OXEA 3FKSA 1BGWA 2KJQA 3FPAA 4KUEA 1XAJA 3PVCA 4KB5A 3BL6A 3KG2A 1I3LA 4A6DA 4IDQA 2Z0MA 1RBYA 3N0RA 4C3ZA 4DCSA 3VC3A 3CF6R 3PDHA 4YWHA 5C5EA 3DHVA 3PGA1 1GSHA 1N1MA 6REQB 3VO2A 4GKVA 1KYZA 3EDCA 3KAQA 2YQ4A 4X20B 3ZU4A 2Z3XA 3BL5A 2O2CA 1DOAA 1D9XA 4HMQA 3SGLA 2AB0A 3LOPA 3B3FA 2VF2A 4W5WA 1I4TD 2WVGA 4RF5A 4RQTA 4DM4A 3CRMA 3D7RA 1H0KA 3CUVA 1PKEA 4AUKA 4H7EA 1MX1A 3DZCA 2D1YA 5IABA 3UB2A 4H0NA 1D0LA 1C4OA 3JR5A 3PLNA 3VZDA 2JLRA 2A59A 4Q3CA 1T0UA 5F7JA 3ZY6A 4DRXA 4YX9A 5LP6C 3AVUA 5KQPA 2C3PA 1TH3A 4AICA 1A5SB 5INTA 3PTAA 2ZYHA 3Q3JB 3T7TA 4R9VA 4BMZA 1R4ZA 3VLFB 1EP9A 1OSNA 4W7IA 3B6ZA 1H2RS 4CHGA 5H9WA 3NBFA 3OX3A 2C59A 4WOBA 3RSFA 4X85A 5ANRB 1G5PA 4UDYX 1NVVQ 3JQBC 4OXQA 4KZKA 3N76A 1NYRA 4XIJA 5KINB 2ZK7A 4BQRA 1MJFA 2IW3A 1XF9A 2RGAA 3WICA 4JXZA 3NBMA 1SBHA 3GEBA 2XTNA 1RU3A 1YJCA 5T3YA 3SQDA 4CWAA 4GI5A 1O5TA 5JQGB 1U80A 4PQGA 3K16A 3U6MA 3BEOA 4JLBA 5C52B 3J81A 4NWIA 4HNRA 1MC5A 1NNJA 5IN5A 1YR2A 3GWZA 4EJSC 4EELA 3JQ9C 4XJVA 1IFYA 1W5SA 5DXAA 4B3IA 3T6PA 4ZZ1A 4RPIA 2AZMA 3C85A 3V7YA 4L51A 4ND5A 1ESNA 1ESCA 4JNCA 1HTWA 1VMIA 3I28A 3RKUA 3U4MA 4BMPB 3PA6A 1PN3A 1YONA 1TYCA 3CH7A 4ICIA 5KVVA 4IQ8A 1TI7A 3VU9A 4IMIB 2PUEA 3H17A 3T94A 5GP1A 3FRJA 4QUHA 2O2JA 3GARA 3RK1A 3DYIA 4II3A 3ZZTA 4ZDWA 3AI1A 4M60A 5KI6A 1J2TA 1CKEA 1QVWA 1KYQA 4BFLA 1N34B 1DRKA 3JALA 2J4CA 4D82A 1BOOA 5EQJB 5FFNA 4BVAA 1JHUA 3GBPA 1XMIA 2CWBA 4Z2AA 1P77A 1EZ1A 1GOTA 3I9NA 5IEBA 1ZCZA 1LSSA 4QG7A 4RORA 3SYRA 3S2ZA 4MV9A 3IUEA 2BMDA 2GHRA 3IDSA 3QKUA 4HFMA 3ZJYA 2DPLA 3R9XA 1H4SA 2CLFB 3CW2A 2DHQA 1ZGBA 2W71A 1ZCAA 1G1AA 3IJEB 4S1NA 1VGRA 2AJLI 3GFGA 1BXRB 5LP1A 5FNVA 3EGVA 2F9LA 5KQGA 1UJCA 4J75A 4M98A 4XLLA 4ZALA 4B6RA 1FFSA 4ZZIA 1Y4DE 2QM0A 1Z12A 2C9ZA 3S2IA 4ZMBA 5KPTA 1FVFA 5EJ8A 3ZI0A 4R1TA 1P44A 1C2TA 1JECA 4KYVA 3O2JA 4GXNA 2CFIA 5P21A 2XB4A 5EG5A 1U6KA 1JR3D 1S8AA 1ADYA 1HC7A 2AJDA 3B5JA 3PDWA 2FPPA 1YTLA 3OQ1A 1A7KA 3NTXA 1DO2A 5D84A 3SX2A 3T61A 4AY5A 4XYLA 5I7VA 4YALA 1AGNA 1VEJA 2WIFA 1SN7A 2ZRKA 3EZGA 3DOUA 3K0HA 4FYYA 4MVJI 2YWHA 4WNYA 4X7PA 2CFTA 3R0QA 1U6IA 4MARA 5I6DA 4UBIA 1SD2A 2QXUA 2WVAA 3AK4A 4UOZA 4Z7OB 1XTBA 3H5OA 3FRHA 4MS1B 4C06A 5AKGA 4KI0A 1C3JA 1W0KA 1GPDG 3HCNA 1ZRNA 3E8SA 1E0KA 4LSWA 2ZZMA 5JSHA 3C6XA 3M34A 3WIUA 3G6KA 4HLQB 4D80A 3BIXA 2PKQP 4LHYA 3ZNQA 4ALIA 1VCHA 4OUKX 5K6AA 1LTKA 2HMAA 1A5AB 1N3IA 2CL6X 4XDZA 4ANFA 5KS2A 3F3KA 1MZPA 2JL1A 2K6GA 5DI3A 5ENZA 1U7ZA 3GLUA 3IEUA 3V1YA 4ETNA 3F3MA 4NTZA 5IVHA 2HMTA 3MJEA 3CW9A 3DXFA 5JXJA 1IAVA 3EPKA 4L7QA 3OVMA 2HFJA 3E48A 5IEJA 2QZPA 3O03A 3K2LA 1RQLA 4X3PA 4UTZA 1M5TA 5G02A 5GV7A 2QZ9A 2ENUA 2EZ8A 4RF2A 3IUMA 5K3OA 2L2DA 5AO9A 1DOHA 3OCXA 4RXUA 1VCNA 2H7VA 4MRAA 3QHPA 3BHNA 4DA6A 3K9HA 1I3NA 3L82B 4WBXC 3WXBA 1U9JA 2GCOA 1G6KA 5FO1A 5BQOA 4DCCA 1PDOA 4NJMA 2OBNA 1NNUA 3DKPA 4DZRA 3HKCA 3E8XA 1SXPA 2O59A 3RK0A 4Y67A 1XN4A 5TB5A 1T9GR 1QHHA 3ETGA 2BKXA 1GKKA 1JILA 4R0MA 3L1JA 5AVJA 4D02A 3ZQ4A 2GM4A 1THGA 1LBIA 5C18A 2WJVA 1S3GA 1JR4A 3EOAI 3IG8A 4FDTA 4IUBS 5DJ5A 5CB4B 1FF9A 1KYTA 1GNVA 2IS6A 3ZD8A 2A1IA 2M2IA 3PU6A 4H7DA 4X1OA 1XMJA 1KO8A 3LQKA 4BTVA 1WMEA 2WZBA 1KFCB 5DHQA 4BJ1A 1XVVA 2QGZA 1ZJZA 2XOXA 1DWOA 2JFYA 5KTOA 2BAGA 4UTPA 4U0KA 3EAQA 1O1YA 4YUAA 2J0SA 4FNAA 4EFLA 4EPXA 1B0ZA 1FSSA 3FSRA 3KJEA 1EGHA 2GEVA 3CRNA 4A15A 4EO7A 2BSQA 3H42B 1U2GC 2FLWA 4GXTA 1K3TA 1OC4A 1Y3IA 4BNIA 2CHUA 4MR8A 4R7ZA 3KOMA 4CISA 4A03A 4A8JC 1CY8A 1KWKA 2OZVA 4JAVC 2XXJA 4WOJA 2XYPA 4GRDA 2CWWA 4CKBB 4YRFA 1GG8A 4QUAA 4KPGA 2YV3A 2AW5A 2IQ5A 5JWOA 5HUQA 2PWYA 3AINA 4JC4A 1CDOA 3DS8A 4FFBA 4I55B 3GJ5A 1FVXA 1RI1A 5E4FA 2WKQA 3S40A 2PQ0A 4B7UA 2QX4A 4DR4B 4ZEXA 4MRRA 4QJ4A 1GY8A 1SRQA 2DU8A 2HCTA 2FUKA 4H4DA 4Y0NA 3UC9A 3B9PA 1AQ6A 2O3UA 3B1ZA 3BL8A 4KQJA 3EEBA 4KIJA 4LV5B 2QTBA 3WAJA 3QIAA 4B3DA 2Z6QA 5FUVA 5CCXA 5FQNA 4GOJA 4LVCA 5HJ2A 3K5IA 2WQ6A 1ZL2A 3PNVA 1P7VA 1Q83A 1S0UA 1UFKA 3ABIA 1XTVA 1PJAA 3B7WA 3HVUA 2Q41A 3LFUA 4UZSA 4EY6A 4PEVA 4F0JA 4BTLA 1Y48E 2ASEA 3VX3A 1I36A 2AOUB 4LE0A 4G85A 4RHEA 4D0RA 5ITWA 3CYFA 3A2LA 4HGQA 3TBKA 1JJ7A 3C9PA 1XTKA 4G4GA 4HAVA 3LLCA 3OQMA 2G07A 3R0XA 1Z5ZA 2PJUA 3HDHA 1R6UA 1NVVR 5JMTA 1H66A 2BGJA 2NQ2C 1CQWA 5EUMA 5JEDA 4RQUA 4DDKA 1SXHA 4CEHB 3F96A 1I6WA 4CIAA 4GPBA 4O1MA 1ZKMA 4EVSA 3DB2A 4G0PA 4YDHB 4DT1A 4TX1A 4IGFA 1XIVA 1VXOA 5EI5A 3A58B 4CN9A 3CEPB 3ENWA 5C8VA 3HP7A 1P1IA 3R0ZA 1VFPA 4JJFA 4GICA 4ID3A 4QOEA 2JEZA 4BQQA 3VSEA 2WVJA 3KB1A 3OM1A 4N0DA 1GZUA 2OD2A 2RI1A 3TW8A 4OQZA 2C99A 3ZE8A 1SULA 4LECA 3Q3IA 2AEJA 3A1SA 3ZCQA 3AW9A 4XQ9A 3TZQA 4EABA 5DI3B 5JMWA 2ZRLA 4R8SA 3TVYA 3B78A 3WNBA 2Q4OA 1C9JA 1KERA 3AVVA 3DOAA 3BFXA 5JYBA 2JJYA 5KWVA 3AG5A 2CK3A 1RI3A 3MT9A 3G5AA 3K0CC 1D09A 1OUMA 1PV2A 4HYYA 1WZ2A 3PD7A 3HKDB 2IBSA 3L6EA 1ZOPA 3MCTA 2UVQA 2WNHA 1Y7IA 2DFTA 1TJ5A 2DZDA 1IZ0A 2XF8A 2YV5A 4N01A 4RJIA 3TKLA 1M6VA 3NM4A 2NTNA 3CH6A 3NIDB 1VP3A 2P5UA 5BV0A 4ZV9A 4TYYA 4PFSA 1P1RA 3JW8A 3IAAA 3SM3A 4KDCA 3PNMA 4OI4A 3FR7A 3S44A 4ZV4A 1NI3A 3I5UA 2PUTA 3VPGA 1EUQA 1V8OA 3GD5A 1Z47A 1RHJA 1AK2A 3JXEA 4PO3X 3L7OA 4EQZA 3RROA 1XU7A 4KO2S 2Z3VA 1XJQA 3CHYA 4ZVSA 2QMYA 4CQMA 4V0KA 5I5GA 1XD2A 4K1XA 1RC1A 2X19A 2CCJA 2HSJA 3AWDA 1CIJA 4L4XA 4YECA 4YRTA 4HB2A 4O0MA 5DLQC 4FS3A 1T8TA 1L4UA 4HXGA 1OLUB 3X3HA 1QV6A 2W6IA 3IXLA 4GWLA 2GK4A 3IT2A 3U09A 3NHMA 2VHYA 3DE4X 3QWIA 3UY4A 4XFKA 6GPBA 3OTOM 3AZOA 3IEIA 3ACBA 4YXWD 1C3OA 2V3VA 3WQBA 5HS4A 1OV6A 4NMHA 4JYPA 4OIFA 1CRLA 4HUJA 3RS8A 4F3YA 4NQZA 4YP1A 3AYZB 3JR3A 1TVKB 1KQ3A 1M1YA 1ONOA 4J6EA 4G1MB 2JH3A 4LVUA 4MUIA 3RRYA 1AO0A 4KHZA 4QTTB 3QTBA 1XZQA 4GMHA 5M34A 5LD2B 1Y3BE 1CQXA 1HV8A 3AP3A 1CUDA 2LVQD 1JFLA 3L46A 5KNBA 1HJPA 3GH3A 1VKZA 2PSSA 3A0RB 1I2BA 2AOUA 1JIJA 3KXDA 4FUQA 4ZOLF 5AM2A 4I1VA 1PT6A 5KQSA 2QYSA 2WP0A 4EZBA 3VV3A 4DV1B 2WSBA 3V8PA 3L1VA 4AUNA 3W4KA 3RK4A 5JVDB 2JARA 3A04A 3HJUA 2BBTA 1E9BA 1T5SA 1POXA 4W7SA 4Y6PA 1T9CA 3C87A 2R6FA 4XUDA 1U04A 2VBGA 2W43A 3SBDA 5AW2A 2M6LA 1X7HA 2FW9A 3N2GA 2FFRA 1MOPA 1L4KA 2BF4A 1C4XA 3FE2A 4NU5A 4YAWA 5KYKA 3ROEA 3NHZA 3NAZA 4QNMA 1VL2A 4ZRMA 3HS3A 1Q6YA 1MJ5A 1T25A 1NT2A 1A50B 1R4AA 2ZRNA 3I52A 3IODA 4YJGB 3L6DA 4P7BA 2W4MA 3FPJA 2NO9A 2V7EA 5DNEA 5I7SA 1UJNA 1NGSA 1X38A 2IHNA 1UBKS 4DQUA 5M2QA 4IBGA 1PNTA 3UOGA 1CQJA 5F73A 1Z0AA 4FNMA 2E4ZA 1ZHHA 3C2QA 1USGA 2VDWB 5J2TA 1T4MA 5H3LA 4BJ5A 2NQTA 3VOBA 3R77A 4AT1A 2VH2A 3LYAA 1BXKA 4S35A 2OHHA 3EMVA 4HWKA 3O90A 4LNAA 4CL2A 4KQ1A 1PWHA 3AZQA 4GOOD 4QD3A 4QL3A 3HCCA 1DHTA 3PRHA 2E3JA 4TOIA 5AM4A 1UM9A 4B40A 1YHNA 1Y6JA 2I54A 1CK4A 3T4EA 9LDBA 2XE4A 3L8ZA 2IZ7A 2JGLA 2WKSA 4Q12A 5AW5A 3C6MA 3QPDA 4I1PA 1KGDA 3N7AA 2KDLA 1X7ZB 1N5RA 2WQZA 1KJ8A 3PUWA 1UEJA 3CW8X 4YFVA 2QU7A 5G53C 4F46A 2G0AA 5BXYA 5FUMA 4ESVA 1CHNA 3HXLA 3L0IB 4B08A 1L9KA 4E5VA 4AUMA 4BNMA 1DIGA 2CMGA 1S9HA 4GRAA 2CFSA 2FW0A 1NVAA 4WERA 4DQVA 3S81A 3VZPA 4DV6M 1J1UA 4CF4A 4RENA 1L7AA 3C97A 2R6DA 3L1IA 1H2BA 1L7QA 2WKPA 1KMIY 4TMZA 2L6OA 4FFSA 1QX4A 3LY5A 1Z2AA 2OB1A 3HR4A 3LVVA 1FW8A 4HH4A 3WQHA 4EGJA 3NHBA 1XC7A 3P9XA 4IZIA 4RVDA 1CEEA 2HTFA 3P32A 3CIFA 3T8YA 5MF6A 3ZTWA 3IL2A 4IHQA 5KEIA 5FP0A 3ZV3A 2R6ZA 3N6XA 1N1GA 5J23A 1L5HB 2NOAA 2QNRA 3O8QB 4OYYA 1OBVA 4X6XA 4URXR 4CIXA 1XXLA 5B64A 2Y4OA 3DC2A 4J2TA 2A86A 4N4AA 4DR4M 3UHJA 4AIIA 3LMKA 3TCKA 2B3DA 1YQGA 1W0CA 1P5HA 1X1DA 2C03A 3V8BA 1KAHA 3E3OA 3PTZA 4I19A 1SOMA 1D6MA 1IRXA 3EEIA 4HQ0A 1GA1A 2GNAA 5THKA 1YD7A 2JY6B 1DAHA 1ZIDA 2CL7X 2NO0A 2A2ZA 3BBPA 1NVUQ 3L8EA 4IBOA 3ORYA 1ESZA 3E15A 1W87A 1N2SA 1OT3A 1OMOA 3VPCA 3P97A 4ERXA 1J0DA 4Y2GA 1YB4A 5DB4A 2R8BA 3KSAC 2Z3ZA 4ZXPA 2FPRA 1JU9A 2YS6A 4QRIA 4WSOA 1P75A 4ARZA 4B8YA 5HOQA 2G4VA 1MJNA 3KQLA 1I51A 4LX0A 4OQEA 4OYRA 3I2HA 1GQOA 2BEUA 5AVRA 1A9TA 2B99A 1EFLA 1WOMA 2EJWA 4OBEA 1OY1A 3BF7A 1EUDA 4QPDA 5JTUA 1TJ3A 4JC8A 2I6XA 4HC4A 5EHZA 2GEBA 1QZMA 5IMSA 3DZKA 4GX2A 2O2XA 4G5HA 1KI3A 1YQDA 3D0QA 1CV2A 1R8YA 3HCAA 4HLCA 3T34A 2Y20A 3DSRA 4C03A 2XT0A 4ZOLA 3RYFB 4ASUD 5IJ9A 1WJGA 3D43A 3TPZA 5HVNA 2HSEA 1THZA 1U0JA 4HXFB 3KFUG 3MBIA 4GNKA 2F1IA 4MTLA 3FTCA 4RIHA 5ALOA 1AS2A 5CNMA 4DJJA 4X66B 1WPRA 2KZSA 3G5UA 4PHCA 4LYDA 3H4JA 3K8OE 5EKDA 1PNQA 3HEBA 4IIVA 2I8LA 5ESWA 2QKYA 1B8UA 3T1NA 3OE1A 4X93A 2X3FA 5I8ZA 1FVHA 3MK31 3S55A 3TZBA 1YFJA 3WMGA 4DBLE 1XXHA 2H59A 4CU5A 3TQFA 5ALFA 4L6CA 2QYTA 3IPXA 2FWAA 4HUQA 2PR7A 5L4SA 1QTNA 1GRVA 3KJIA 4G5FA 4CMJA 5FAKA 4YRZA 3CLUD 3JD4A 3OQHA 3QVWA 4QYMA 4XWYA 3U49A 3FBTA