3UK6A

Crystal structure of the tip48 (tip49b) hexamer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
318
structure length
298
Chain Sequence
b'AHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRITVSLHEIDVINSFLALFKSEVREQINAKVAEWREEGKIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvB-like 2
publication title Large-Scale Conformational Flexibility Determines the Properties of AAA+ TIP49 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 298
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06068 TIP49 TIP49 P-loop domain
A PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uk6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uk6A01
2F1HA 1QHHB 4WIAA 4CVNA 1J8MF 2GEVA 3SBDA 3L8YA 4LJ4A 1QHXA 3ADBA 3NTUA 3THYB 1CRPA 5LD2C 3ZVNA 3FKSA 1E2NA 1DAMA 4KVGA 4C30A 4B6FA 1EFRA 1U9IA 5HE9A 3E70C 3DMNA 1QHNA 1R5NA 3CB4A 4TSFA 1PUIA 1YR6A 4HLCA 5DE3A 4DLZA 4DCVA 4DLVA 1KI1A 2BBOA 3OE7D 1DG1G 1OHHA 3K0EA 5IHPA 3RRNA 3I92A 2N42A 2H57A 3KX2A 4MUBA 3AGPA 4DCUA 2V1XA 4M21A 4L5BA 3CRQA 2VRWA 1DADA 4KV9A 5CYPA 2ZTSA 2IC5A 3CZPA 4MRSA 3ADKA 4WBSA 3AVWA 4DVGA 2WWIA 2BBSA 1KO5A 2VP0A 2P6NA 3MMPA 3KQNA 1LVGA 2IS1A 4QM6A 2GEUA 1E98A 2C9CA 5FTNA 4P4SB 1CRQA 1J99A 1E2LA 2GAOA 2PX3A 2J0UB 2L0XA 2IUTA 2UZ3A 2VP2A 1V43A 4IJMA 3I61A 2WJYA 3CKLA 5JJKA 4RD2A 3T1QA 4ZCLA 4MKGA 4BFTA 1G8HA 5TDHA 5LBIA 1U2RA 1Z3IX 3MHVC 4XH9B 2CE7A 2GBLA 4CEJB 3GFPA 4B76A 5FI0B 5L3QA 2ZSAA 3MWJA 1XTKA 4QHSA 4OQFA 4Q7MB 4EKDA 3QPVA 3ZH9B 5K8LA 5IRCD 3Q7PA 4WZAE 1ZBDA 2F7SA 3VNUA 4HZIA 1XRJA 2IL1A 1XD2B 1CLUA 1HT2E 3B9PA 3AM1A 1Z0DA 3BFVA 1M1YE 1U0LA 1G5TA 4GT1A 5EP1A 1SXJD 1GDDA 2GEDA 4Q9JA 5GADl 3NC0C 1NJFA 2GF9A 3RHFA 4B6EA 1YKSA 4TMVA 2IXGA 1Z6GA 1YJ5A 3AF3A 2C96A 2J9RA 1Z63A 4J0QA 4KHZA 4JLBA 4FCVA 1US8B 1E9FA 4FI3C 3KKOA 4X8LA 3QVUA 4QJ3A 3MAAC 1KI6A 2DCUA 2ZI5A 3EZ9A 3QE0A 4FWIB 5CM8B 1PVOA 2CNWD 4Z1MA 2KE5A 4MYTA 3DO6A 3N2IA 4I1SA 4QJ5A 3CH5A 4Z51A 3UXMA 3C4JA 2Z43A 1JQJC 3CX8A 4H1VA 4IFEA 1F48A 3CNNA 3IIKA 4LGMA 3U7HB 4D26A 4KLNA 1G4AE 2BBTA 4RFSB 3SEAA 4A8JC 3GP8A 1Z0AA 3SNHA 4JLNA 4EPYA 2ODEA 1TX4B 3O8RA 3RNLA 3AVYA 3DKVA 3L0PA 4LBWA 1SXJE 4KYUA 4P31A 1CJKC 4C2UA 1RFLA 3T15A 3I8SA 4JS0A 1F2UB 2YC4C 5IDVA 3D6TB 5B64A 2ODBA 3I72A 4YDHB 5EXXA 1KSHA 2ZQ5A 3ICQB 2IHBA 4I99A 1AKYA 3E1SA 2RGDA 1A2BA 2RHDA 2OE2A 1VIYA 3WNDA 1N6RA 1ZIOA 5JJLA 5BXQC 5EXTA 1JJVA 1GTVA 3GLIA 4HDOB 2FE4A 5KHOC 1P62B 3HYRA 1Z6YA 1KO8A 4RKEA 3PJRA 3MG9A 2ZJ2A 4E07A 4M1KA 2PX0A 2H92A 3B6EA 1NMYA 4NCNA 2XOKA 4A3VB 3GJ6A 1G3MA 4DRZA 3DVLA 5DISB 1AS0A 4OBEA 3D7MA 1Q1QA 2LWIA 4D2IA 2HF8A 1X37A 3BIFA 3A37A 4KBFA 3RS4A 2RGCA 2JLXA 4RZ2A 1M8PA 421PA 3OEHD 1S1MA 2QGNA 4MRRA 4M53A 5FBWB 4CYMA 2DB3A 3V9PA 2ZSEA 3FFAA 2X2FA 2XNDA 1KY3A 5TVKA 4P0TA 4IDNA 4GP6A 4OK5A 1FTSA 4CIDA 5EP2A 3SS8A 5FOVA 2PT7A 2ZITA 5AJZA 1AM4D 1D9XA 2IBMA 3DZDA 1OH6A 3RRZA 2UVQA 4K8OA 2CL7X 1Z28A 2EWWA 1VMAA 1Y63A 4M22A 3ASYA 3I5XA 2J0VA 3PEYA 1G7CA 1G18A 3CRW1 4GZLA 3BXZA 1W0JD 1TQDA 1UEJA 1W2GA 4CW7A 4LYAA 2HV8A 1D2MA 3RS7A 2OV2A 3SQWA 3DOEA 4JLPA 2AK3A 2FA9A 1XEFA 1HURA 1PZNA 2JCSA 2QE7D 4ZDWA 1E1RD 2YV5A 3TK1A 5HCIA 4A2QA 3CIOA 4B33A 3NDBB 3K0CC 1KK2A 4MKIA 1ZM4A 3ZVLA 2I3BA 1KZGB 4Z54A 1KO7A 1OXSC 2W6JA 2V1UA 3X1YA 1MABA 1T9HA 2WBLC 3LAWA 3QF4B 1GL7A 1WF3A 2V7QD 4E22A 3JVUA 2G3YA 1VPLA 3T1OA 5JHHB 1TF2A 1WDTA 4C0HA 3HU3A 4B3XA 4CZ2A 3CLVA 4PHHA 1DELA 4KYIB 4TMWA 3TSZA 4M2LA 5BWMA 4G5OA 1EWRA 4Q21A 4B71A 4ARZB 4NYIQ 1W7AA 4BZXA 1VG1A 4M1TA 2ZJAA 5L8VA 2V6IA 4LV8B 1XB2A 3WMGA 5FL3A 4WW0A 3CO5A 2PMKA 3CR7A 3IO3A 1TU4A 4KAXA 2A2ZA 5DH9A 3VU9B 2ZROA 5JECA 2P3SA 3EASA 2DZNB 5F9HA 2WZQA 2IX3A 4WXRA 4F4CA 4MDEA 1HTWA 2FH5B 3FOZA 2Z4SA 3W90A 3AVXA 2XTMA 1N6PA 2ODNA 2ZSFA 3ZGXA 2YKGA 5FBRB 3GMTA 4ON9A 1SKYE 2IYYA 1A7JA 2CCKA 3KFXA 2CEAA 1QHGA 5FR2A 1LF0A 3TJZA 5C1BA 5FL7D 4PPGA 4DSUA 5KSYA 2VSFA 3OE7A 2A5FA 3F3YA 2WM9B 2ZYWX 3R20A 5M04A 3SN6A 3I3SR 2Z6VA 4HZUA 2CE2X 1IBRA 2BMFA 1W46A 2DPXA 2J7PD 3PUYA 1KSGA 1SVKA 4E03A 2WWXA 4A6XA 1VYTA 1DEKA 2JJ2D 5L3VA 3BBPA 3QXHA 1R4AA 3SBEA 2VP5A 3F5FA 2QAGB 1YU9A 3SJZA 3KTAB 1KAGA 4XD7D 5CK5A 1PV4A 3KQHA 1OFHA 1CTQA 4Q4HB 4A9AA 2Y8EA 2B8WA 1R0ZA 1OIXA 2RGAA 4QBFA 4YMVA 2OHFA 4LJ9A 1U99A 3EZ6A 3HP1A 4MGYR 5CK4A 2ZJOA 5E7MA 4MGIR 4CEHB 1JALA 4LOAA 2OEPA 4ZV4A 1FX0A 2OCAA 1KKMA 3G82C 5EE3A 1QG2A 3AVQA 3A36A 4MQBA 2D62A 5L3SB 1GZSA 3VR2A 5E4FA 1KK3A 4R98A 2QPOA 3JVVA 2F1RA 2ZRBA 4S2EA 1GKIA 4CF7A 2ZYTX 4JVMA 1W4AA 2VHJA 2ZU0C 3L43A 1XEXA 3THWB 2Q9BA 2QTHA 4QBHA 2ZRNA 4HYYA 3VR3A 2C98A 2OAP1 3AVOA 3HR8A 3QPUA 1FNMA 2ANCA 2BEJA 1SXJA 1P60A 3BE4A 2LKCA 3VHXA 5JRJA 4PPFA 4L15A 2QTFA 3QQ5A 4Q9HA 4DCNA 5L3QB 1W1WA 3GEIA 3IO5A 5BQ5A 3EA5A 2CBZA 3O8DA 4B47A 1CEEA 2JLRA 1KIMA 4NYMQ 4I81A 1VCOA 4CDGA 1CJUC 1E9EA 2F9MA 2QP3A 3KDSE 3K9LA 1UPTA 2X77A 5J4KA 1FL9A 3CW2A 1XMIA 1RRGA 1E2EA 1H8ED 1JPJA 4UNQA 1KYIA 1IHUA 2Z5FA 3SE0A 3CPJB 1XFAA 4JL5A 4A82A 1X8LA 4JVLA 2IHYA 3WYFA 2Z83A 1M74A 2ZI3A 2A5GA 5B2ZA 3SHFA 1F5NA 2ZUCA 2OILA 1ONBA 5H8WA 1R6BX 3LFUA 1BMFD 1G291 2VYFA 5DHFA 3REGA 3M6AA 1HUQA 1XDBA 3AF1A 4RD0A 3U3KA 1DAFA 4IDPA 4PSVA 3MLEA 3QEJA 5G40A 4JBXA 4JLJA 2FPKA 1OB2A 2WJGA 4DWJA 2V54A 1JR3D 4QGGA 1LV7A 1KI6B 5CJPA 3JZMA 2AR7A 2G1JA 1Z08A 3NKVA 4BLTA 1TTTA 2PJRA 3T1TA 4Q02A 1UF9A 3RS2A 1HYQA 3HPQA 2ZYVX 2D7DA 4HDCA 5ELXA 4JBYA 2VHQA 1MOZA 1Z07A 2PLRA 1XEWY 4M1MA 4ACBA 2OT3B 2FSIA 3PFIA 2NO0A 1MH1A 4XWKA 1HE8B 5FUYA 2G6BA 4R7ZA 2A30A 4Q66C 2FG5A 5LDDC 2OSBA 3GEHA 4A2WA 2D7CA 4EPXA 1OHHD 1U81A 1Z0JA 5TXGA 2RGXA 1U8YA 3EIHA 4V0NA 2IYTA 3TW8B 1J8YF 4LBYA 3LDAA 4Q4AA 4YONB 3WMFA 3CZQA 3QJYA 3NBZC 1XTQA 1ZP6A 2O8DB 1TQ2A 4WAUA 1MR3F 1Y3AA 1MO6A 3RWOA 4DSTA 3EX7C 2E1RA 1K8RA 3RC3A 4JLVA 1H8HA 2AX4A 4ZPXA 2GXQA 1E2JA 1JR3E 2YWEA 4NHOA 3RVBA 3W5IA 2ZRAA 5BN3A 4MUAA 5IK2D 5E3HA 3GLIB 4MRVA 1YRBA 1WA5A 3AKCA 4C0BA 3OEHA 1NIPA 1DVRA 4HAVA 3SOPA 2Q0HA 3CPHA 3FB4A 1RYHA 4AIIA 4EPTA 4OHXA 4PXAA 4RVCA 2DBYA 2W2XA 3KKQA 1T91A 1SVWA 4AD8A 1A2KC 1E9SA 3W8NA 4IHQA 2WJHA 1G17A 3H1TA 4FMCF 1AQYA 3W9YA 4PQFA 4QBIA 1DAGA 3P32A 1DG3A 2QEQA 3FE2A 5GJCA 2ZIAA 1A4RA 2D2EA 4PZLA 1UKVY 1VTKA 5ANRB 5FPTA 1EXMA 2FF7A 5CM9C 1W0JA 1IJEA 1KNXA 5JEEA 4DT1A 1MKYA 2REXB 1IQPA 1XTRA 3QIAA 2ORIA 4NYJQ 5JCZA 2J59A 5FTMA 3ND9A 3WRYC 4JKIA 3QKUA 3U44A 5JI3E 2P2LA 2FX3A 2KRKA 2QE7A 1E1RA 5KNBA 2QAGC 4BZQA 2WOOA 3CONA 3QKSA 4JYCA 1U0HC 2H18A 3TNFA 2QENA 1CR4A 1IXSB 5BYJA 4W9MC 5CIQA 4WOPA 4D6PA 4LZZA 3TR0A 5AJXA 1NLZA 3VQTA 3VHLB 2G0NA 5DI3A 1QRAA 2GA8A 2PEYA 2V7QA 1P2TA 3NXSA 3VMFA 1AKEA 3UANA 4UQOA 3RLFA 1FPMA 3L2OB 4Z1MD 2J87A 2WJVA 3TSWA 4F7WA 5SZIA 1EFHA 4C4PA 3WBKA 3THXA 2QP9X 1X1RA 1IXZA 4HB0A 3PG5A 4JT2A 4QG7A 4D0NA 1GFIA 4PR0A 5P21A 1KI7A 4IXNA 4A92A 4OKSA 1WMSA 4JVNA 2REOA 1E9DA 4CEIA 1T8TA 4G5QA 1QZXA 4RD3A 2DFKB 2CL6X 4FW9A 1MABB 1D2NA 1YR9A 1ZCBA 2VA8A 3K9NA 4KU4A 4NPHA 2GRJA 4FWHA 1X8JA 3R9IA 5KDDA 1Z29A 4M1SA 3VKGA 1VYUA 3KUCA 1RW4A 3R7WA 3D8BA 3AH8A 1DBSA 4DLTA 5EXPA 1ZUNB 2D2FA 2R62A 3PUZA 2OFXA 4B32A 3J81k 1X3SA 3G0HA 2P6RA 3X1DA 2ZRJA 2A9KA 1IOZA 1IONA 3M0EA 3GQBA 3ASZA 4IVRA 4JSYA 4KLZA 4B3BA 3RC8A 1W36C 1GP2A 4GZMA 3EPHA 1M7HA 2CVFA 2C8VA 2JJ8A 4KXFB 1G5RA 5FL7A 3V4FA 3ADDA 2EYQA 2CL0X 3LWNA 4AKIA 2EFEB 3GJ8A 2AKAB 2JLZA 3KJGA 4DCTA 3S1AB 4LYJA 3IBYA 1JI0A 1MV5A 2IYZA 3K09C 4TTRA 4MDFA 2XJ9A 2J7PA 2JIZA 3HJNA 3MD0A 5F9FA 3BERA 1QHYA 4RSGA 2JJ2A 1JB1A 1WE2A 4URVR 1EFCA 4V0KA 1LF5A 3K9GA 5FR1A 2ZE6A 1FW6A 2VHUA 1SKQA 3VAAA 1NKSA 4IVQA 4RD4A 1P4SA 4XD7A 4FMDB 2PCLA 2GVDC 4BASA 4DDWA 4NCJA 1W0KA 4Z8YA 3LA6A 1ZNWA 2QL6A 3LQRA 4HUTA 2IUSA 3AKEA 4HUQA 4NL4H 4GOXA 1K5DA 1D2EA 2BMEA 2OG2A 3EWAA 3F0TA 3NBYC 4NYJR 1KHTA 3W6OA 2WKPA 4PTLA 2VHCA 1KZ7B 2FEMA 2ZPTX 4B73A 3C7KA 5DSZA 2EYUA 2XGJA 3CNLA 5CDFA 3AF0A 3UMSA 3UMRA 1I4DD 3B85A 2J7KA 1E0AA 2WTUA 1G6OA 5H68A 1RKBA 2PBRA 3BD9A 4ILEA 1GNQA 1Z06A 5TV2A 3ZQ6A 2BWJA 3MGCA 2GJAA 1OV4A 4RCYA 1P75A 1OXUA 2DHRA 2FN4A 2NPFA 2GXUA 3CR8A 3ZD7A 1PUJA 1NF3A 1T8UA 5JSZA 1P2SA 1S96A 4PZZA 5AUQA 5TY0A 2FFAA 4X8HA 1XEXB 3K0FA 1H8EA 1K5GA 3Q7QA 4LHYA 5F2EA 3U6KA 2WWYA 4ZCIA 1W4CA 1IN6A 4M1WA 4RJLA 3WP1B 1SXJB 4HAXA 1KMQA 4TMTA 3K70C 1KI3A 3BFKA 2ZU6A 3EIQA 4AY2A 1KOFA 2E9SA 2ONKA 5EJEA 1NIJA 3GJ0A 3X1XA 1VYVA 2ERYA 1DPFA 1ZC4A 3U4QA 1W44A 4Q18A 3Q8XB 5F3WB 1JR3A 4OL0A 2H16A 3EG5A 5HR5A 5EZ6B 4DCSA 2WHXA 2GVZC 2QROA 2W58A 1F60A 4UNPA 2CJWB 5K8UA 4QXAA 4DDUA 1TNDA 4YMWA 1ZIPA 3O8CA 2FOLA 4C0SA 1T5LA 2R6CA 1Q1ZA 2BJWA 3MCAA 4P32A 4BFUA 4HAUA 1XU4A 3AVUA 1F2TA 1XTIA 2EFCB 1ZJ6A 1ZRHA 4Q4JB 4FWDA 4RD1A 2DY1A 5FBQB 4B3GA 2Q9CA 3EXAA 3K9HA 2FPMA 4IEEA 4KFTA 2NO6A 3NEJA 2YHSA 4RCZA 1LNZA 1W2HA 1P72A 4TYQA 3AV0B 3PUVA 1AZTA 1OT3A 1TU3A 3BB1A 4C9BA 3UPUA 3RSOA 2QUZA 2O8BB 3KKMA 3PIRA 2F55A 1XJ0A 1NN0A 1SGWA 5C4GB 4EPVA 1DAHA 1ESNA 2J1LA 5SZJA 5FBLB 5GVRA 5IK2A 3QXXA 1ZYUA 2WSMA 4MRNA 2O0JA 2ZRIA 3AUYA 3LBNA 3PITA 2NQ2C 1R2QA 5JLJA 1C1KA 1T3HA 3GCGA 1TEXA 4Q4AB 1EWQA 1SVMA 3EW9A 3NHBA 2QT0A 3PEUA 4AC9A 3CUEF 2N1BA 2YVUA 4TLEA 2R2AA 2YNMA 3FDIA 1OKKD 2OBMA 4A0FA 1NBMD 2KSQA 1UAAA 4QNMA 1G21E 1B0UA 1GRRA 2VF7A 3RSLA 3UKDA 2H7VA 1UBEA 3H2YA 2NTYC 5KSZA 2PEZA 2QRNA 1S8FA 1NJGA 1NI3A 4PPNA 3T35A 1E0KA 3NDPA 4EQ6A 3ZIAD 1N6LA 3BGWA 3OIWA 2QMEA 3B60A 2QGZA 5DI9A 4TYPA 2YJTD 3TH5A 2ZJBA 1GRNA 3NH6A 4Z8XA 3P1JA 4NDZA 1XTSA 2F43B 2EWVA 3BC1A 1NNEA 4UNNA 4O0MA 1NG9A 4AKGA 2ZI4A 2QBYB 4OYHA 3SYKA 3DPUA 3BFXA 3TUIC 3FVQA 2QMHA 3MJRA 2WICA 3K09A 2CCGA 1CJTC 3QKSB 1G3QA 1OH7A 1JAHA 4FCWA 3LW8A 1NBME 3B1YA 4BEBA 1SKYB 1ZD9A 3SFVA 1TF5A 3GJ4A 3L0SA 4JVSB 2A3RA 1G7SA 1UDXA 5KUTA 5FOSA 3BB3A 1N2CE 1E2IA 5C46F 2WWWA 4FN5A 2GK6A 2HXYA 1M2OB 4TLAA 4O25A 3KQUA 4ESHA 2CLCX 1QHIA 3VKWA 1G4UR 5EUQB 2XEXA 3W3ZB 1TF7A 2Q21A 3AF4A 1EG7A 1CR1A 3C16C 4IOLA 4URYR 3QVVA 4BEJA 3VKHA 4P4UA 5H70A 4TZ6A 3I73A 4LCBA 4BLQA 2GDJA 4QNRA 4HEJA 4AKHA 5TB5A 4Q1FA 4PHTA 1Q20A 2YINC 1OSNA 3QKRA 4GITA 1HEIA 4Q9LA 2V8OA 4AG5A 1NKTA 4BFVA 4RZUA 1KK1A 1RRPA 3R8CA 4Q9IA 1Q3HA 3RWMB 1BH2A 2JLQA 3NBFA 1H8HD 3OHMA 2N46A 1N6HA 4H9GA 3E5HA 3I4LA 2QSZA 2BKUA 2FWRA 2DWQA 1P61B 5D3MA 4B74A 5J4LA 3TSOA 2RKOA 2QG6A 1KJZA 4GMDA 4DLSA 5KSPA 4M9XA 4BPBA 3OFND 1JEDA 1FQKA 1TQ6A 3ZZ0A 2OXRA 5JCPA 2B8TA 2VSXA 5BW8A 2ATVA 2ZETA 2J45A 1NL3A 1EESA 3QBTA 3U6BA 3M1IA 2PJZA 3VTKA 2JLWA 4D4JA 3PUWA 4FINA 4TLCA 1KO4A 2OFOA 4NE2A 3WMEA 2ZYUX 2Q3FA 3GLFA 4MITA 4DKXA 5DNYB 1BKDR 3VR1A 4UJ5A 1XCPA 3LW7A 1QZMA 4BFSA 3K8YA 2ZRHA 3RYTC 3UIEA 3OF5A 3A4LA 3MSXA 4FXPA 4H1UA 1E2PA 1VHLA 2ZRGA 1BOFA 2IYLD 1XWIA 5HTKA 2WIBA 1UKYA 1ZD8A 1D9ZA 1XXHB 4PSKA 4F4IA 3FFBA 1Z0IA 4V0ME 1M7GA 2WKQA 5JS7A 5A0FA 2BIFA 3AJIB 3KB1A 2DWPA 2WSSD 4GSYA 2VP6A 2IT1A 1KO1A 1NLFA 4M8NE 4C0JA 1II8B 1O87A 4N3NA 4KSBA 4A4DA 4U00A 2F9LA 3AQ4A 4LWZA 2ZSDA 2R65A 2F3TA 3BJIC 2OO7A 5AUNB 2IWHA 1SZPA 2RH5A 2HUPA 1C4OA 2QP4A 3DM9B 4B35A 3WYAA 1UBCA 3U7GA 2GCOB 4AI6A 1M34E 4MYCA 1MO3A 1Z5ZA 5JSZB 3U7EB 4M9QA 4A0HA 3Q5EA 1E9AA 1UJ2A 3KJEA 3MFYA 3HPRA 3TW4A 2GCPA 4EJSB 4W5WA 1Q44A 3BOSA 2SHKA 3LX5A 2IK8A 2QAJA 2VTKA 2F1IA 2QTVB 4O2RA 4JBWA 1YHNA 4N0EA 1Q1EA 3M4YA 4B48A 2IS2A 5DYIA 1R5BA 3RRMA 1W5TA 2GJKA 4LX0A 1FNNA 2AWNA 3H0KA 4Q19A 3GLGA 4PAOA 2ZI6A 2REBA 1T3SA 4F38A 3U3MA 5B57C 3K53A 4NONA 5JMTA 3P4XA 5LPNA 2ZVQX 3N2EA 4M1OA 3OEED 4ZDJA 5J4VA 3IKJA 4ASUD 2HT1A 1GVNB 5HCNA 3LXXA 4HB2A 2JIZD 2ZRMA 2W2TA 3IPYA 1AGPA 5FTJA 2VH5R 4BWYA 2HJVA 3GLHE 4QGAA 1G8PA 1F2TB 2MMGA 1AIPA 5CIWA 3T61A 5IF9A 3IQXA 4BLOA 1BYIA 2Q9AA 1VCMA 1U90A 3A58B 1ODFA 2K5UA 4BFWA 1W0KD 2Z4RA 1JJ7A 2H5EA 121PA 2NO9A 3L0OA 4HAWA 1Z8FA 4UXIA 1XPOA 1I2MA 4QL3A 2YC2C 4JZKA 1AA9A 2GF0A 3OIUA 3P26A 1JXOA 2O8EA 3LNCA 4OI4A 3IHLA 5J4YA 4I1UA 1OKKA 2OXCA 4V0OA 1YZTA 3CWZA 1CIPA 1P9WA 4HDQB 4JL6A 1XEWX 4A2PA 4ACAA 4A8JA 521PA 3UG7A 1E3MA 1NBMA 3A1SA 3U3JA 3O47A 1E4VA 3FHCB 2FZLA 5FTKA 1RJ9A 3KJIA 4KO8A 2FMXA 2IYWA 3IIMA 3ZS9A 2P5TB 3K0AA 5IT5A 3RANA 2PCJA 1UKEA 4IOMA 2O8CA 1DTSA 2EW1A 1Q0UA 3X1WA 3ZIAA 1Z6AA 4QFMA 1YZGA 3EPLA 3R9WA 3WHKA 1OXXK 2OCPA 1OIVA 1P3JA 1AS2A 4US0R 4GI7A 3A1VA 4LV6A 2PH1A 5GVSA 1TUIA 1NLYA 8OHMA 3HDTA 4W5JA 4D0LB 2OESA 5JWOA 1S4QA 2BMDA 3L8ZA 1BS1A 3CWQA 1R8QA 1GNPA 5KU1A 1XCGB 4TWZA 2HEIA 2IYRA 4EQ6B 2O5VA 4IOJA 1D8TA 5CDFE 4A1FA 1KK0A 3ONWA 2UKDA 3SYLA 3Q85A 1P2VA 1R0YA 4L16A 2QPTA 3AB3A 2I4IA 4JSTA 4QGHA 2PL3A 2D74A 3THYA 2FFHA 1HQYE 5FOWA 3VX3A 2XZLA 1EFTA 4XIGS 1R0WA 2KWIA 2HT6A 3DMDA 1ZUIA 2ZAMA 4TMZA 4F91B 2IEZA 2BMJA 1W4RA 2QT1A 4X8OA 5HZHA 4QBGB 4DSOA 5E95A 3ZDQA 2QA5A 1HQCA 2WWFA 5CITA 4KI0A 1NVVQ 4TL6A 3EZFA 1Z6XA 3SI7A 1XTJA 2FSHA 2BCJQ 3SJBA 4DDVA 2BBWA 2IF0A 5KO2A 2C95A 2QY9A 4NP6A 3T5GA 2BM0A 2VQSA 5BYKA 5LB4A 2BKEA 4ZIRA 2WJIA 5FH9A 3EPKA 3ICEA 4LHVA 5EZ5A 4M4SA 4FWTA 1E9RA 1P7CA 3KKPA 5A5GA 5CYOA 5JFGA 3QF7A 2WJJA 1LS1A 2OBLA 5H1YA 4XSHA 5DO9A 2YOHA 4OHWA 1G8YA 3DDCA 1FMLA 3AP3A 4PQRA 1NSTA 2I1VB 2IF2A 2QQEA 3ZLJA 2JEOA 3K0CA 3ETLA 3ZVMA 3C8UA 1DAEA 4P4SA 1C1YA 4V0MA 2C03A 1OE0A 1GKYA 2NGRA 4JYBA 5EE0A 3TVDA 3GD7A 4YQFA 2J0UA 3WP0A 4FMBB 4DUGA 3A6PC 3CF0A 5FOTA 5G3YA 3W3AA 3OFNA 4PX9A 4TL7A 2ZS8A 1AQUA 1COWD 2XAUA 2GK7A 2H17A 1E9CA 1LW7A 2FJUA 1DAKA 1XD9A 1DO2A 2CHQA 4UNRA 3PVSA 2WMNB 4R2IA 2R6GA 1OFTA 1U8ZA 1RVDA 1OH5A 3MWLA 1E2DA 2GJSA 1R10A 5D3MB 3K0SA 2BM1A 3WHLA 2JASA 3CBQA 3CH4B 3CX7A 4US1R 1PJRA 4F93B 2CLSA 4GOKA 1E9BA 2LKDA 2NZ8A 5K8TA 2J41A 2B6HA 1KDTA 4B43A 2QMOA 3SQXA 1ZW6A 1JXMA 3SYNA 2IS6A 4LBVA 1LFDB 1AK2A 3I62A 1E32A 2FFBA 1F3OA 2RCNA 1W36D 4DSNA 4A0RA 4MGKR 1G3RA 4FCTA 2VP4A 2AWOA 3FMPB 1US8A 1I2DA 3MWYW 3V00A 1IY0A 2WSSA 4OQLA 4GBMA 1W48A 2V6ZM 2ZRCA 1UBGA 2WAYA 1G16A 2ZJYA 2ZVPX 4FMDF 2BV3A 1R8SA 5AWFC 4A15A 2CXXA 1QBKC 2GJ8A 5LD2B 1TAGA 2CMKA 1G5PA 2FFQA 4F4JA 4MKHA 1GM5A 2X2EA 2O52A 4RFSA 1EK0A 3L0IB 4JLAA 4Y0VA 4M0LA 2VO1A 1YQTA 3ZZUA 3GJ3A 3GLHA 1N6OA 2C2HA 3DM5A 3MWKA 4NCKA 1N6KA 1C9KA 2ZR0A 1NVVR 4I1OA 2IXEA 2FGJA 3L82B 2A5JA 2OBNA 1AJEA 1IN5A 1OYYA 2QM7A 1XZQA 3FMOB 5JWHA 1F2UA 1L4YA 1ZNYA 2AL7A 3KB2A 3U7FB 2GBLC 4UXJA 1IN7A 1GNRA 2ORWA 2JATA 4AYXA 4D4KA 5FPKA 2QPAA 1GWNA 2IUUA 3TLXA 1T3LA 1HA3A 4TZ0A 3PCRB 4OI2A 4PO1A 5TARA 3B78A 5DLQC 4KFSA 2ZRKA 4PPQA 3PUXA 1CJMA 3AEZA 1DO0A 3P20A 4C3ZA 1ZC3A 1E69A 1Q12A 2W83A 3PV0A 3AF2A 3UK6A 2O8FA 3A1UA 3QKTA 3OEEA 4B2PA 4ASUA 4Q5IA 4JJZA 1E4YA 4D80A 1HT1E 1ZU4A 4E5UA 3QXCA 3DOFA 1UEIA 4LV5B 4URUR 1YR7A 1S3GA 2ZS7A 1WQ1R 3SJAA 2WIAA 2ZE8A 2YWFA 3GFTA 4AG6A 5GJVC 4B34A 3B13B 1CF4A 2CVHA 2O0HA 3EC2A 3I5YA 2CHVA 2ATXA 2R6AA 2ZSBA 2RB4A 4HZUB 1S2MA 3QG5A 2AXPA 4Q48A 2VP9A 5DN6A 4CGZA 1QVRA 1GAJA 3B8HA 4FD2A 3OIVA 3B1ZA 1UM8A 1OH8A 1DAIA 3F8TA 2GXAA 4OQMA 2HCJB 2A78A 1VCIA 3K70D 1XMSA 1J90A 4BFXA 1WCV1 1R5OA 4IRUB 1QF9A 4Q7JB 4XVRA 1N0WA 4C0AC 1XF9A 3EPJA 1E1QD 1G6HA 2MSCB 4OQNA 4R71A 2XSZD 3TAHA 3LRPA 2MSEB 3WRXC 1JBKA 4E09A 1UADA 3IUYA 4B2LA 1MT0A 3T06B 3C5CA 4TN1A 3UMFA 1FX0B 1KSFX 4KVAA 3AVVA 1ZD1A 3NHAA 1BO6A 4LK2A 4Q00A 5AJVB 4BFZA 3CPEA 4M9ZA 4PC3A 2ZR7A 2ZM5A 1A5TA 2GZDA 1U0JA 2WWGA 1P2UA 1YZKA 2PZFA 2RGEA 2DFLA 5FTLA 5JI2E 4PC6A 2EQBA 3B1VA 4RD6A 4A8JB 2WV9A 3QF4A 5FUXA 3IPXA 2XZPA 1OXVA 3NG1A 1E2GA 2C5LA 2PLFA 5FOXA 3VR5A 1KAOA 3NC1C 1TQ4A 4KJZA 2R44A 2W6IA 4GPTA 2OM2A 3P4YA 2D06A 2RAPA 2W00A 4RZXA 4NTZA 2VBCA 3LY5A 5HKKA 4ARZA 2WPDD 4W5HA 3EWSA 4LPKA 1GG2A 2C77A 2ZRPA 1RRFA 2YYZA 4HLUC 3KUDA 1DS6A 2B7CA 1E79A 1QDEA 2P5SA 3GLFE 2V55B 4HSEA 4LYFA 1GL9B 4LJ8A 2DWOA 3I8XA 3VU9A 1KMHA 4MGZR 4QC2A 5J4HA 4JJKA 3X2SA 2AN9A 4IEIA 2XZOA 1MRNA 5FUWA 1UFQA 2YOGA 3LLUA 5EE1A 3W6PA 3D31A 3QEOA 1IXRC 1SHKA 2HYIC 4DZZA 1N5IA 1JECA 1P73A 1N3BA 3CF2A 4AURA 4LHZA 1ANKA 2CHGA 1OW3B 2R8RA 3TE6A 2RHMA 5AUPB 1E2FA 4WZBE 5CLLA 4YDSA 2B21A 1CXZA 4LBZA 2OCYC 3LBIA 4TL8A 1AGRA 2IEYA 3SFZA 3R9XA 1NVWQ 4RZ3A 1NN3A 5JBQA 3IDQA 2NO1A 3QY0A 1LY1A 4HLDA 4G3XA 2ZRFA 3IEUA 5AJWA 2Q6TA 1T4GA 2GKSA 3BRWD 4AWXA 4PO9A 1IM2A 2AKYA 4OHVA 4Q1AA 3ZYCA 3BORA 5EQTA 4BZPA 3QSYA 2QAGA 5L3RA 1VG8A 3T34A 3KTAA 1IN8A 2ODWA 2FZ4A 2ZE5A 2JLUA 1SULA 2ZRDA 2D4HA 5KNCA 2G88A 2GILA 2R6DA 1JEEA 3NEYA 4L9SA 4LC0A 4PQYA 4Q4HA 4YMTA 4QRHA 2A7QA 4OK3A 5EE5B 4ZIRB 1BIFA 1GRQA 3WXMA 4P4TA 1MRSA 4Q7KA 1WBBA 4CEHA 1N5JA 1COWA 2NPIA 3FYHA 4DLRA 4JT4A 1Z0FA 2H8KA 1M6NA 2VF8A 3H4MA 4G1UC 2KBFA 3SC3A 4IKEA 4II7A 1XMVA 2NZJA 2G0TA 3C14C 1E0JA 5L3SA 3GLGE 4AYWA 1Z47A 2HXSA 3DEFA 4IXMA 3TQCA 1ZU5A 1N5LA 4WXPA 3WY9A 4BUJA 2ZXUA 2QZ4A 4LUCA 3THWA 2OLKA 2RGGA 3H84A 1CP2A 1E2MA 4KSCA 1FQJA 2NIPA 2GJ9A 2KJQA 1Z0KA 1W5SA 3EA0A 3ECCA 1MO5A 1JQLB 1S9DA 4D0GA 4PHGA 4OK6A 3QUSA 1RC8A 4TMXA 4UJ3A 3C41J 3LD9A 1GUAA 2HDNB 2ZJ8A 4X8MA 2FU5C 4KCGA 2P6UA 5FPHA 2J0QA 3G5UA 2GZAA 4HLQB 1G64A 3W6NA 1T0HB 4L9WA 2F6RA 1N5KA 4UXHA 4TTQA 4DT1B 4BRWA 2GAAA 4U7DA 2CK3D 4LJ5A 4DDTA 2AK2A 1T0JB 5DGXA 4B75A 4LRTA 3FGNA 4PANA 3LBHA 1D5CA 3H86A 3U44B 1OF1A 4LDJA 2GESA 1SQ5A 4PAQA 4C0QC 3ADCA 4FIDA 1CS4C 3B9QA 4MRPA 1CR0A 1G9XA 1LS6A 2VPPA 2QORA 4HB3A 4V03A 1I4LD 2WWHA 3AP2A 3U5ZB 2ZAOA 3P27A 4U02A 5B58C 5DI3B 4PC7A 1YRAA 2NMVA 4BECA 4C2TA 4NU0A 2G1KA 5KSOA 2ZS9A 1Z6TA 1HY3A 4R9UC 4OI1A 2MSDB 3EC1A 3OAAD 3U60B 3SHWA 1WBDA 3OZXA 4LHXA 1P5ZB 1N0VC 1E0SA 3D3QA 3THXB 1OFUX 4MH0R 4YMUA 2ZRLA 2HYDA 1FOEB 2DFTA 4B44A 2YOFA 1OLOA 5FPYA 1YR8A 1SVLA 3TKLA 2DVWB 4TYWA 1OYWA 5G3ZA 4CEIB 4Q03A 4GL2A 3GLHB 1XMJA 4YXWD 4LC1A 1O3YA 3TMKA 4FWGA 1G19A 3N70A 4TLBA 4HAZA 3R8FA 4YLGA 1KJWA 1SXJC 3R7WB 2R6FA 3ZZTA 5CJ2A 1WP9A 5FPSA 2DWZB 4NCHA 2O8DA 1N6NA 3A1TA 4LY6A 4GP7A 2A5DA 5KDLA 1CULC 2VIIA 2AFIE 2KB0A 2P67A 621PA 5KDOA 2IS4A 1CKEA 1FUKA 4DLYA 2ZI7A 1EX7A 3PEWA 4ERNA 3QBVA 5A4JA 3Q72A 5KYKA 1I4TD 3FHOA 3I1FA 3CX6A 2G83A 1XNJA 2RMKA 2O8FB 2ZANA 4JLDA 4DUGD 1WRBA 2VEDA 4KFRA 4F92B 2X8AA 4ITRC 2J3EA 4Q9KA 4TMKA 4OHZA 2IWRA 2QM8A 1E2KA 3FKQA 2ZE7A 2CLDX 3IEVA 4URWR 1NMXA 1EFUA 4GNKA 4OJQA 2LCFA 4LJAA 1UKZA 3T5DA 2PZEA 4BLRA 2V9PA 2ZUBA 1QVAA 3SU8A 3IIJA 4XVUA 1WXQA 4HLUA 1E1QA 2QMUA 2XSZA 2YWGA 1TEVA 3IQWA 4C7OA 5BN5A 2QSYA 4QOSA 1GITA 2BDTA 1E2HA 2GCNA 4IDHA 4D82A 4KODA 3CM0A 3GEEA 4HUQB 3N5CA 4TT3D 4V02A 5AUOB 1TL7C 2Q3MA 2V3CC 4QHYA 5JS8A 1F6BA 1WB9A 1EGAA 1V5WA 2IYUA 1J2JA 1NG1A 3DKPA 1T6NA 1XJQA 2NO7A 2X19A 3KQLA 4TLDA 4NBSA 3UWOA 4XOIA 1U98A 4K81B 4XWAA 4P33A 2O0KA 2G77B 1G8FA 2XITA 3GPLA 3TQFA 1J70A 4CRWB 2XB2A 4PZYA 3BS4A 5KOYA 2XXAA 4G5SA 5JJIA 4AYTA 1SVIA 2BC9A 2WPDA 3JZAA 4PO8A 4BGDA 4EDHA 4CT4B 5EP3A 4Q1DA 3RAPR 3TUJC 2F1JA 3FWYA 2PZGA 3T12A 3WBJA 3OESA 1KI8A 1PLLA 1ZM7A 3QXSA 4A0GA 3GJXC 1S0UA 2H1LA 221PA 4DHEA 2DZOB 3K0FB 1A82A 1GKUB 2VLIA 1KGDA 1RE0A 4A6PA 2WOJA 5FFMA 2B92A 4O2LA 4ZI2A 1MO4A 4IOKA 1OXTA 1TMKA 2JDID 5DYGA 2FDCA 1AZSC 3QXJA 4EFLA 4LSGA 4D81A 1NN5A 2Q3HA 4DIDA 1II0A 2JLSA 2ZREA 5EE9A 2FGKA 3LH5A 4XJXA 4XVQA 1NSFA 3U3RA 5HE8A 2ZEJA 3CRMA 1VKJA 3K1JA 1OJLA 4DJTA 3U4QB 1IY2A 1FMJA 5GJWC 5JEDA 4TQUS 2IYXA 1KMHB 2W0SA 2GWHA 2ECKA 3MRSA 3S1AA 3TRFA 2J0SA 1RZ3A 4ZI3A 4ZKDA 4JLMA 2J46A 4KITB 3QPWA 4O3MA 5F98A 4GMXA 3THOA 3T1VA 1NP6A 4I4LA 4B3DA 1W47A 4Q4LA 4BLPA 3V4RA 3WYGA 2HLDD 5FUVA 5C4MA 1CBUA 1GILA 2JJ1D 1G8GA 1XZPA 4LJYA 3A4MA 2TMKA 3EAQA 4QKQA 1FP6A 1SHZA 2WVJA 2JGNA 1QHSA 5E7IA 4B3CA 3LLMA 3FHTA 4Q1EA 4XTCS 4LYHA 2F3RA 4BRUA 1KI9A 5DN6D 4NMMA 1II9A 4QGFA 4EUNA 1Q22A 3U61B 2NG1A 1XX6A 1RPZA 4JL8A 1M7BA 3NVAA 1G7RA 1SVSA 1NY6A 4RY2A 1P9RA 4PHFA 3CRVA 3LV8A 4A36A 2OAQ1 4JN6A 2RGNC 4K46A 721PA 2EFHB 1G7TA 1ZMXA 4EFNA 4UNSA 3ZD6A 1B23P 1E2QA 1K6MA 4LRWA 3RDPA 5JHGB 1D6JA 5CB8A 1DARA 4Q7LA 1E94E 3HU1A 2IYQA 3KKNA 4M1YA 3QOFA 4BLSA 1ZUHA 3AP1A 3EARA 2Z0MA 4TQ9A 4YMSA 1BYUA 4JLOA 5G53C 1Q3TA 2W0MA 4KFUA 1VG9B 2IYSA 1RIFA 3TAUA 3C5HA 4D4LA 1JAIA 1ZM2A 2ZR9A 1FZQA 2CK3A 2PT5A 1S9HA 3EZ2A 1H65A 1KDRA 2GNOA 2P0EA 2W6ID 2OZEA 3TGPA 4DB4A 2BHRA 3PENA 3RS5A 1NMZA 5HKKD 1E99A 3HR7A 4LJ7A 1YVDA 2FSGA 5AK0A 3EZ7A 1OPXA 3Q5DA 3B5JA 1E79D 1S1CA 4NYIR 3IILA 3KL4A 2QN6A 2R9VA 1W36B 1QHHA 3DL0A 1JPNA 3RS0A 4BQSA 4NKRA 4DLXA 2FV8A 1ZINA 2QQ0A 4TL9A 3NH9A 1CJVC 2ONJA 1Z22A 2CDNA 2CNWA 1HE1C 2ZJZA 2YWHA 3I32A 3KQKA 2CJWA 4PAMA 5J40A 3OAAA 3O8BA 2C9YA 1XPRA 2GTPA 1XXHE 3X1ZA 2RGBA 2IXFA 3FMFA 4PSAA 5LB2A 1FUUA 2XB4A 2FEOA 3IBGA 3REFA 5AJYA 2JLVA 1W4BA 4JMPA 4ABYA 2OFWA 1T5IA 4Q4JA 4YC7A 2KBEA 5DHAA 1ZNXA 4YXWA 1L2TA 3NWJA 2BVNA 3VNVA 1XJCA 2EU8A 2XX3A 1XBTA 4DBLC 1IN4A 1OB5A 3TR5A 5SZKB 5TMPA 3MJHA 2C04A 3FKSD 1VCNA 1HH4A 2O8BA 4MKFA 3SDZA 4HI0E 1XPUA 2CCJA 3TIFA 1EFRD 4GOJA 1ZM9A 3QI2A 4NCIA 3IHWA 1LTQA 2EVWX 2NOAA 5FI1B 1YZNA 3AVPA 1HV8A 1PLKA 4N1AA 4TSFD 2WAXA 4LPSA 4TQAA 1KI2A 1Q1BA 1FFHA 2BOVA 3B82A 4EJSC 4IVPA 4OJKA 2AD5A 2I1QA 4NZYA 2DFNA 3BB4A 1N0UA 3BH6A 3LO5A 2OCBA 4DLWA 1N6IA 3QKRB 2BEKA 2FNAA 4C0KA 4DEYA 1G3UA 4JIMA 4HATA 2FSFA 4Q47A 1YE8A 3W34A 3VLFB 1NN1A 4CEJA 2UZIR 1KNQA 1OFIA 1RYFA 4S35A 1RRCA 3U3OA 3FMIA 4DEXA 1DOAA 2WKRA 5EUMA 3MUFA 2C99A 2XJ4A 5KTYA 2PMDA 4LRSA 1XD2A 1UBFA 4RFVA 1CR2A 2XNSA 1VECA 1X86B 1L4UA 3BWDD 2HCBA 1QG4A 1FP7A 5BN4A 2IW3A 1PLJA 4U5XA 1GIAA 2XTNA 4OQXA 1U9IC 3ND8A 3LVQE 2ASEA 2QU8A 4TT3A 1X1SA 1AN0A 1X6VA 2JA1A 3A1WA 1W49A 4IDOA 4Q01A 4Y0AA 3W5JA 1TADA 1E6CA 5FOUA 3SR0A 3DZ8A 3KXLA 3VX4A 3PXGA 3K70B 1EX6A 4P3YA 5KNDA 2ZJ5A 1ZNZA 3KZ1E 3EIEA 2G9NA 1ZVQA 3GJ5A 2F43A 4NYMR 3GLFB 1VIAA 3SZRA 1NY5A 3GFOA 5K8IA 4C7OB 2QBYA 1KKLA 2QRZA 2V4ZA 4G5RA 3AUXA 2DYKA 3LXRA 4I1VA 3BAFA 4N0DA 3QG1A 1ZM3A 4L4UA 4WVFA 3Q3JB 4NH0A 4MYHA 1E96A 2EFGA 1R7RA 4PC2A 3RS3A 1ESMA 1G41A 1Q21A 1R0XA 4LJ6A 4ZDIA 1XD8A 3KXIA 4IDQA 4JKYA 4WZ6A 4ZCMA 1ZAKA 2QNRA 1G3IA 3UG6A 4GDFA 2W2VA 2XTZA 6Q21A 2XXAB 3A8TA 4QJ4A 1GSIA 2JDIA 1KJYA 5JZVA 4PFSA 3QENA 1IAQA 2ERXA 5HPYB 4MYUA 1GOTA 2GETA 4M9SA 4QHTA 1KY2A 2WMOB 3AGQA 3E2IA 3CNOA 4G01B 4TTPA 2B7BA 2YZ2A 1OIWA 1YZLA 4XTRA 4Q1CA 1ZCAA 3WNCA 4GFDA 2HF9A 4C0LA 3BK7A 2RGNA 3IGFA 3SJCA 3PQCA 3ZJYA 3AKYA 4FMCB 3UWKA 4US2R 4WA7A 2HJGA 821PA 2AHOA 1IY1A 1KTVA 3NBXX 2FPLA 3PEVA 3UATA 2OUKA 3C15C 4LHWA 1TPZA 5KPJA 4EAQA 1IJFA 2IYVA 2HLDA 1NRJB 2JJ1A 2AD1A 4HB4A 1L7VC 2MMCA 3GLGB 4IW3B 5HZKA 3NIBA 3ZQJA 1ETUA 5EP4A 1Z2AA 5AR1A 4PC1A 2VHTA 5FBVB 1J7KA 3HU2A 2XOKD 2ZUDA 4ESVA 1KI4A 4OI0A 3AKDA 4DXAA 1X8KA 1N25A 2DR3A 2E87A 3U2QA 5C2JB 1U8AA 2C9OA 3ZS8A 4G0NA 4XWOA 1VHTA 2VSOA 3BH0A 3B2EA 4IFBA 4B3FX 3KXKA 1KDPA 2A5YB 4R2HA 4ZO4A 3RRYA 3QNUA 2ORVA 4AK9A 1TUEA 4GRAA 1VG0B 1AS3A 4POAA 4BE7B 1CU1A 4EPRA 4URXR 2BCGY 4L8GA 4MA4A 1FTNA 3RABA 3B1XA 1G1MA 3PR1A 2VL7A 2XNDD 4JLKA 4OHYA 3B7GA 3HWSA 5E7JA 4EFMA 1JNYA 3TUZC 1XCMA 3A4NA 2JLYA 2GXSA 1UDWA 4AKEA 4B2IA 5G41A 5UKDA 1U94A 2O8EB 1XXHA 1G20E 3HYTA 1YZUA 5SZHB 3FPAA 4EPWA 3GLIE 1JR6A 4UKDA 1Z83A 2D3WA 4TYNA 5EXSA 4DIEA 4RKFA 1Q57A 2C78A 3DHWC 1L8QA 4DB2A 4Q1BA 1XP8A 2GHIA 2BJVA 5JWRA 1II8A 3VR6A 4DC9A 2JAQA 4W7SA 1NVUQ 1RJ9B 1SVOA 3KFVA 2IA5A 3Q9LA 4KBGA 4URZR 1P6XA 1S3SA 1A1VA 2QI9C 3KW6A 3TVTA 5J5CA 3K0AB 1Z2CA 3KJHA 4TYYA 5C18A 2V6JA 3LX8A 4QM7A 3CRRA 3W8RA 5B30A 2O8CB 2GCOA 4V0LA 2AFHE 5CLQA 4ZKEA 3CF6R 2W6JD 2X1VA 2ZI9A 3FTQA 4EIWA 3LVRE 3VR4A 5CB6A 5J47A 1VDZA 1LB1B 1NVXQ 4D25A 3WNBA 2J5XA 4EJSA 2KI5A 5JRZA 2GZHA 5DIFA 3AVTA 1ELOA 2ANBA 4D4MA 1GL6A 4XSGA 4LI0A 1DE0A 1NVMA 3GJ7A 4CT5A 2P65A 3VFDA 1P9NA 3OIYA 4BFYA 3ZVRA 3BH7A 5GJBA 3B1WA 4G5GA 1KDOA 2OLJA 3LQQA 4DLUA 1BMFA 2EFDB 1KSJA 1YZQA 4ZDKA 5KPDA 2AXNA 5D3QA 4HAYA 3TBKA
chains in the Genus database with same CATH superfamily
5TQVA 4CVNA 1J8MF 4TS4A 4RHXA 1MC8A 3ZVNA 4KR7A 1LVUA 1MH9A 3UK0A 1GXSA 5HWSA 4DLZA 5ITWA 2B4RO 1V6CA 3W04A 1TRHA 3VV2A 4FT2A 3CRQA 5KNLA 5D1NA 4DVGA 2G6TA 2VP0A 2CFRA 3GJQA 4NNOA 1U0NA 2FSVA 2VPWA 3IEKA 5IC4A 3MHTA 4RH1A 2WJYA 2QRHA 3A27A 2R1TA 4ZTBA 4CHGA 2EZ4A 3AB7A 5TDHA 3W8EA 5LBIA 5BNWA 3WMRA 1PJQA 4XH9B 3PQ2A 1RXUA 1JX6A 3DDZX 4HWPA 3TDMA 3OQIA 2XQVA 1M75A 3UWMA 4EO9A 2HN9A 1GU1A 3U6CA 1G71A 1X7YB 5BVGA 5J2UA 1I80A 5L9AA 3W67A 1Q7GA 4QX6A 5IKPA 1PR3A 3IJEB 1RJGA 3H2HA 3QNMA 2JNWA 3H4IA 4C2UA 2BKVA 1RCUA 1UZNA 2JGKA 2UUBB 4B17A 2XB9A 1C9DB 2RHDA 2ZPAA 5ITTA 1FNDA 3B6EA 3OFSA 4A3VB 3GJ6A 5ESWA 3R3SA 4KXUA 4ER6A 5B58T 3RIMA 1YULA 2UUCB 1C8BA 1KFJB 4RZ2A 3GVCA 4XFKA 3UYLA 2HQOA 1VEKA 2AHMA 4QQKA 3U48A 2RHTA 3ZUGA 2OV4A 4DQDA 5K0SA 3RVRA 5H7XA 5KOIA 1RPJA 2DAEA 3K0CC 4HF7A 3ZVLA 2EG9A 2CNBA 1Y42X 2CDCA 2W6JA 3X1YA 4YV0A 1WGLA 3DBIA 3EN0A 4C0HA 3VDUA 2YICA 3E9DA 3DLPX 1BS2A 1Z5OA 4DJEC 3CO5A 1DC6A 3OZ7A 1UL1X 5K3EA 1A8QA 3SE7A 3PXCX 1T1EA 2OWEA 4IIVA 2Q5IA 1SU8A 5AI5A 3NV7A 4RCVA 3H5TA 3H7AA 3HEAA 3R9XB 1Z4IA 2NXEA 1RKUA 3QE9Y 4BGIA 1KSGA 1SVKA 4S1WA 3GLQA 4K9KA 1BDHA 1R4AA 3T7AA 3F5FA 4AULA 2Z4TA 5CK5A 2QRPA 1FJGB 1R0ZA 1UQUA 4I55F 2YJGA 1FX0A 1KKMA 5IWAM 2HIHA 4R1LA 3Q7IA 1ZOIA 3KOZE 5JZOA 3VR3A 3S2UA 4BX9A 1N2CA 1H2HA 4UUOA 4EB0A 3KZNA 3I12A 1W1WA 4PYRA 2E5WA 1HG0A 1CB0A 3T3NA 1JLSA 1H8ED 5I9SA 3USZA 1JP7A 1XFAA 4IH9A 1U9JA 3I6QA 1M74A 3KK0A 4LWQA 5SY4A 3LFUA 3VKUA 3HCNA 4JFRA 4MO2A 1NQAO 2FUG1 4X20A 4JLJA 2BF4A 1FFBA 1ORYB 3AEKA 3EVZA 1TFRA 4ACBA 3VC7A 4CXMA 4W9NC 3HO1A 4R7ZA 2A30A 4Y2HA 3OM9A 3B9RA 2R00C 4ID9A 3I4YA 3QIVA 3KBBA 2ZJ0A 3SOPA 4NOOB 2O7NA 5BV2P 3K8OE 3X1KA 4CDRA 2HTEA 2A4KA 3ZW9A 1QKJA 2HSEA 2ZIAA 1BE8A 3WK9A 4HLQA 3PVZA 4NAHA 2ORIA 3JYNA 4H6PA 3L4EA 2Y1KA 1IDN1 3QKSA 4UBKA 5CLHA 4N39A 1WKBA 5AVTA 2OZPA 5DI3A 1QRAA 5C37A 1VE9A 1K8XB 2J87A 2C4VA 2JAOA 3PSHA 4NPCA 3G7NA 3R7DA 4QG7A 1V92A 3Q6MA 3EYWA 4NPHA 3IAM6 3JQPA 1E5TA 2HRDA 1VYUA 3AH8A 1X3SA 2ZRJA 1XR3A 5A5VA 1GP2A 2MR5A 1MJFA 5DM60 1KP3A 5LU8A 2G1PA 1WHTA 2IYZA 3TRJA 4RIIA 2GEJA 4RSGA 1LPAB 4L02A 1UQRA 4WOKA 4ROTA 5CT5A 3JU3A 1VHWA 4GLLA 2WM2A 1TAQA 3H18A 5K0JA 4Z8YA 4XCQA 5FJIA 2DPYA 3I1IA 2WD9A 2Y3IA 4BMNA 5BSWA 2CNLA 2PL1A 3CUKA 3VOAA 2QLNA 2WTUA 4JBHA 4PGMA 1ODIA 3P45A 7REQA 1RKBA 1NNUC 4AMGA 1BXGA 2DHRA 1CZKA 3CR8A 3AHDA 3ZD7A 1S5PA 3U09A 2QJWA 1QQ6A 4W9NA 4BWFB 2ZZMA 4L8LA 1Q7TA 4HFNA 1BXRA 2CUTA 5CFOA 2HEGA 2R00A 4R2LA 2E9SA 1ZZGA 2HJHA 2PZMA 5D6OA 4XUGB 1VQ1A 2QSUA 1EUDA 3OZSA 2GVZC 2BONA 3O21A 1P9LA 3SEQA 4Y2YA 3UJAA 3SC6A 4LG2A 1N77A 3EW7A 2YJNA 3H9BA 2VDWB 3G2MA 3Q41A 2Y4OA 3D54D 1R4NA 4FFWA 4MRNA 1G98A 1DZ3A 1U0RA 2EZUA 1QZ3A 1R2QA 4LRXA 4BNUA 5K0ZA 1LX6A 5F4ZA 3G2KA 2YJ3A 1P2FA 1IWBB 4B4WA 2X6QA 4IKPA 5JANA 4MJLA 5A0VA 4PLPA 3DXXA 3DSRA 1E0KA 3M6MD 4C43A 5CG2A 1KA9H 1NC1A 2VNHA 1VSTA 3AEUA 4EABA 3PA8A 4OYHA 3DPUA 2GQFA 4TOIA 1AKRA 3W5SA 4OXQA 1JEOA 3R3WA 3ORRA 2P30A 3VKFA 1N2CE 5FD8A 1QVVA 3ELDA 1KPGA 5CURA 5CLJA 4XLZA 2PFGA 3KNZA 3EFEA 3DEZA 3UZUA 2KPOA 1T9GR 3G9XA 4J90A 4Z49A 2WYOA 1EG7A 2O2JA 3P9CA 4HEJA 4RWEA 1Q20A 2XCOA 3IQFA 1GFZA 2JXNA 4GUDA 1ZD5A 1ZESA 2CJPA 5EMJA 1TZ2A 2ZIXA 1KK1A 3BK1A 1REQA 1NNUA 1AE1A 2DWQA 3R5XA 1P61B 2RKOA 1KJZA 4GMDA 4UBJA 1IE3A 2R97A 2VSXA 4J0CA 2WTBA 3EIWA 5FHQA 1BWQA 2I76A 2JLWA 2MINA 5CPBA 4JENA 3WMEA 3ZQUA 1SURA 5KWIA 2RC5A 4QSMA 3C3YA 1EHYA 1RP7A 1Z13A 1HDRA 1W4ZA 1ECBA 1J2YA 3BEDA 1G59A 1XZHA 5T41A 2JKVA 4DR6M 2QG4A 4UE3S 3I1YA 4BQIA 3JW8A 1Z59A 1L0BA 3NBUA 3HKEB 4QLOA 5HK8A 5GY7A 3QELA 3FMVA 4Q19A 4PAOA 3A9TA 3G02A 2D1RA 3SS9X 3LXXA 3DTVB 4ESEA 2NVWA 4BOYA 2VH5R 3LL4A 3H5OA 1AIPA 1P74A 4UULA 4BPRA 4IQFA 1H9BA 3DR3A 5KNDH 4BXOA 4UU1A 2O8EA 2NU8B 4KR9A 1GL3A 4KN8A 1P9WA 3VJMA 1VJGA 1GNVA 3JQ8A 2IIBA 3A28A 3ZZ1A 2YMPA 5I47A 3RANA 4H31A 2R87A 1UOOA 1AKMA 3WHKA 3IP8A 4UOZA 3CY6A 3DOCA 5JWOA 5JO0A 3LKDA 3WTBA 2HEIA 1P2VA 1IOLA 4L16A 3OQMA 4JSTA 4KZKA 4CV3A 2XZLA 2IXAA 3SQNA 1EM8A 5I45A 1T0UA 2QA5A 3OCUA 2WWFA 4TT8A 5C8VA 1L3CA 4HEA1 2FMKA 3BVPA 3HFJA 4C08A 2O5RA 4NEGA 1Z15A 4X6UA 1Z7BA 2FJ0A 1IVSA 3GD7A 3WP0A 3LT0A 1W30A 3R2JA 3C3DA 1AQUA 3J2PB 1LW7A 1DO2A 3OZIA 5JQWA 4R1NA 1E2DA 3EUFA 1G5QA 4GOKA 1OZFA 5ED0A 2QK4A 2P9ZA 3T0FA 4WLUA 4UU0A 3BD7A 3L05A 4RNAA 4MGKR 2Q1UA 6YASA 2AWOA 1YD7A 2CLHB 3AJ9A 4EOGA 5EERA 2FFJA 2VJQA 5ES3A 2OENG 1EEHA 3R5TA 3DCYA 1KAMA 4E6EA 5BO5A 5KMGA 2RHHA 4TXHA 1OVMA 4Y2VA 2EIHA 1QGUA 3PC6A 1OWPA 3QWFA 2P2CA 3LX6A 5DLPA 3HR4A 1F2VA 4PSDA 4UHBA 1NU8A 4CG1A 2NYAA 1XZNA 1P45A 2BCEA 2WP8J 3ZJVA 4D7AA 4YH1A 3LLSA 1MF7A 2BKAA 3N75A 2BELA 4ZARA 2J3HA 3RYHA 4EHBA 2YUTA 1Z4JA 4O4JB 4B34A 2QCUA 4J2OA 4WJLA 4A10A 5LWHA 1M1YB 4UFNA 4CN8A 2EX1A 2HO4A 5JQGA 2WUVA 4FDUA 1E1QD 1EE1A 3LRPA 1UMDA 2RHRA 3T9DA 4FR5A 4B2LA 3TF5A 4H6VA 1PGOA 1VHJA 4IQGA 2IH2A 1ZVJA 4Q0MA 1CUZA 2GI4A 2WJ4A 3ZDEA 1JE1A 5ALYA 1KOGA 4EEKA 3NNDA 2IHTA 3B5EA 3OOJA 3P96A 1R5LA 1PT6A 3I8XA 1IXRC 3H65A 3KOXA 4KR3A 5G0TA 3NM4A 1WXHA 1J1IA 4YDSA 2O20A 2XE6A 1VRWA 1NVWQ 2KLHA 3NU1A 3RC2A 4TXNA 2A3NA 4EK9A 2NU9A 3WNZA 1R8JA 3UK1A 3JATA 1W5EA 5LZ4A 3NBAA 2VJMA 4KWEA 1QH8A 1KYQA 1LK5A 3HUFA 4BRZA 3WWOA 2VWHA 4MS3A 3H5IA 4EP1A 3G5UA 4Y9SA 1M34B 4WCFA 4C5BA 2HADA 1F0PA 3B9QA 3KZXA 1FDOA 2VPPA 4NFLA 2OCIA 6ABPA 1ID8A 4DARA 4KXLA 2XUKA 3P27A 1U4NA 2X23A 5KX5A 1E0SA 5LMNB 2B69A 4WV3A 3MGGA 1SVLA 1XMJA 5IT9A 4LC1A 2H0AA 4IIGA 1KJWA 2QJOA 1WP9A 5FPSA 1XVLA 4ZCQA 1ITZA 4LY6A 4GP7A 5LP1A 2W2KB 1QV7A 5F77A 3G6KA 3I1FA 3JD4A 3PHIA 3FOEC 3IQIX 3IOYA 3SLKA 5LNK1 3WV4A 1K7FB 2V0NA 1MJNA 3WFIA 3IIJA 1S2NA 2RKBA 3LUPA 4NMXB 5EIXA 4QOSA 4HUQB 2B0CA 1B0PA 3QJ5A 4RF3A 3WXBA 1TL7C 1XDUA 3H1AA 1CUAA 2R8YA 1U98A 4NXNM 3UV7A 3GPLA 5KJCA 2G4LA 2BC9A 2PMBA 3A2KA 4Q1DA 2RJ3A 4EA8A 3FWYA 4DHEA 2OCKA 3PUKA 3FF1A 2I9PA 4L74A 4Q7QA 4L1KA 3PXXA 4BJ5A 4FC7A 1VKJA 3VHQA 1ZL2A 2YHUA 1KWGA 1M6YA 1AK9A 5F98A 4ZXFA 1JPVA 3EHDA 1HI9A 2VR1A 3K5PA 3IVMA 1I01A 4BV9A 5IVPA 4P82A 1WY7A 1KMNA 4FDTA 1A4XA 4DCPA 4J3JA 4LAFA 5ICCA 1GJSA 1LDGA 1SC3A 5EJ9A 3AHJA 3DQQA 4K46A 2RGNC 3HH8A 1Q6YA 3ZD6A 4QDXA 3GOQA 5HFAA 2Q6KA 1JVSA 4M1YA 3QOFA 3NHRA 3AP1A 1TDZA 1BYUA 3IH5A 5IVHA 5TGDA 5KOJA 3I3OA 1P2GA 4FXOA 3JQCA 3NVDA 3EDYA 2BR4A 4AAYA 2G5PA 3HR7A 3ZWNA 3NATA 3LC1O 2FSGA 5AK0A 3Q5DA 3B5JA 4DWOA 1E79D 2PKQP 3VR4D 5CIYA 3ABRB 3ZHYA 1S6YA 1HE1C 3GEPA 4IYRA 1N5OX 4UUPA 2XW6A 2P90A 3DGFC 2OY0A 3IBGA 4GG1A 5DEOA 1ZJ5A 4JMPA 4Q4JA 1VLMA 3V1UA 1IN4A 4G0YA 4QFDA 2ZPUA 3N6VA 2D3TA 3Q8KA 3DEAA 4MKFA 4HI0E 1ZIYA 5BVHB 2I80A 2OBXA 4UZEA 2FG7C 1HV8A 5DP2A 4MUYA 5JPCA 2E18A 2I0FA 4YT4A 5LUAA 3ZZMA 5JAHA 1F8YA 3FLAA 2PD3A 3KLMX 4IRMA 3WGJA 1X86B 2HIMA 1NJ5A 4DJ5X 2HGSA 5BN4A 4WZAE 1T9CA 2RGRA 3W5JA 4Q01A 2D54A 3M6LA 4NARA 4IP0A 1X7YA 5KNDA 1GZ7A 3ZDCA 2G9NA 2DWUA 4L85A 1GG5A 3F9CA 4XEUA 3PEEA 5J3JA 4G86A 2QRZA 2QT9A 3EWNA 4MQLA 2QJFA 3MFQA 1HXHA 5I3ZA 4E5MA 4F8YA 1G41A 2K6BA 5LZ7A 5E4JA 1NYQA 4MYUA 1TKAA 1KY2A 4YASA 4M98A 4Q1CA 1E3QA 2HF9A 2RGNA 2KYRA 3ZJYA 4DV5M 3CHYA 3KPYA 4I6JA 4RF2A 2I33A 5CBPA 4GE3A 4FBGA 2Q7OE 2X6TA 4HEOA 1Z2AA 2L7IA 2ATEA 3LKVA 4DIBA 2XOKD 2RK4A 2KZUA 4DXAA 4YPFA 4B3FX 1Z5WA 3W06A 4BNWA 4AK9A 4CISA 3RYIB 5BXYA 1Y7TA 1UJNA 2K9DA 1J1ZA 3N0RA 2CVQA 4AKEA 4WN9B 1G5FA 4DIEA 1EBBA 1PJ2A 4JN6B 2JEYA 5E9QA 3QTBA 1RJ9B 2FMFA 3KFVA 3Q9LA 3O26A 1ULAA 2VQ3A 1U0BB 1XTBA 4TKVB 2JG3A 4LF8B 5CLQA 1FRQA 2RC6A 1LB1B 1FYXA 3S28A 1ELOA 1DDGA 4D4MA 1DE0A 3SVLA 1E92A 5GJBA 3BTSA 1VBFA 2AXNA 1M54A 4F6RB 3L8YA 4WJZA 4MAMA 1Z75A 3E58A 1N8KA 4B6FA 1OAIA 2IV7A 3LT5A 2BTQB 2GKGA 3GVPA 1EKXA 4X60A 1SRRA 2ISQA 3H1GA 4QGSA 2O3JA 2YXPX 2DQYA 4WKGA 2D00A 1KO5A 1C7EA 2P6NA 3MTBA 1GCUA 3WJ7A 3MGKA 4JGBA 2XYGA 4HGPA 3ACCA 4MLPA 2DF8A 1ORIA 4QYMA 2D1SA 3L93A 1K08A 3MHVC 3FLBA 3OBBA 4NFYA 4UTZA 3LQ4A 5K0NA 1J42A 3T6PA 2C5BA 4R8SA 3VNUA 1QIJA 3A70A 5AVQA 1Z0DA 2JFYA 3E2MA 2AEMA 5L7TA 1G5TA 4ZAXA 3NC0C 4W7IA 3PGLA 4JU8A 5F1OA 5DHRA 1RXWA 4K6HA 2J9RA 3W2TA 1FDVA 4FYMA 1OR8A 1WZ2A 4MB7A 2NV0A 2O06A 2PS3A 3D43A 1GAWA 1WV0A 1DC4A 3CX8A 4H1VA 3CNNA 3KYBA 4RFSB 2XCQA 3GP8A 1PQWA 5CYFA 1XZBA 3RNLA 3I42A 3CNEA 4UAJA 1E1NA 2X5XA 5LQKA 2PVPA 3I8SA 4OB8A 2M60A 3D6TB 3MS7A 3WYDA 4RACA 4JQSA 2FEKA 1YCDA 2FR1A 2WG0A 3EXEA 4IHJB 3JSXA 3DZKA 1P62B 4RKEA 2V7BA 4E7PA 2R7LA 5DJ5A 1R3UA 1ZRNA 1Q1QA 4KBFA 3E8MA 5LBUA 3MS4A 4XWGA 3RVDA 4RDCA 3OEHD 1D1TA 4ZU6X 2AT1A 4ZYLA 8GPBA 4BCDA 4HQKA 1AM4D 2EQAA 2EW2A 5ALHA 3RRZA 1Q0RA 1EFDN 1G9SA 2EWWA 3CX4A 2Z56A 3JQ7B 1I13A 2PR2A 1ZJ4A 4G65A 3EVGA 5AKZA 3T3GA 4H1HA 4O5AA 3GLKA 1COZA 4RDXA 1RFGE 3T1YB 2OO9A 1J0AA 4J2TA 5DDIP 1Q02A 2WBLC 1CX9B 1PT5A 3IOCA 4CZ2A 1TM4E 2OHOA 4K0KB 2GYVA 3NWPA 1W7AA 2D7HA 2Y1XA 2PMKA 3PYMA 2DZNB 2PKEA 1B7GO 1VMDA 1D0KA 3R0XA 2O23A 3PT5A 1UWCA 5FR2A 1YB5A 5C8ZA 2IZ6A 1Z4OA 3RADC 1OXBB 2Z6VA 4R3WA 1N8TA 3LYUA 5FNVB 4F6LA 4BQQA 3LCMA 3FJ1A 4IWYA 4QXMA 1MEOA 3HDJA 1BG6A 4DBZA 3PQFA 1LH0A 5E7MA 3G8AA 3IAS1 3DC2A 4R4JA 1K75A 2W2LA 4XDYA 3SJUA 4JVMA 1PK8A 2ZU0C 4LIPD 4WXEA 2JI6A 1IEWA 1SUWA 3AVOA 1M1XB 4PPFA 2VF5X 5AM4A 4H7HA 5K2MA 3O8DA 1CEEA 2R8EA 3HHEA 1E9EA 2XADA 3F96A 2IIQA 4F4DA 4WE3A 4DF3A 4A82A 3THGA 1F5NA 1JEQA 2ARKA 3RAFC 4FIZA 3GNTA 4B0OA 5IBRA 3QK7A 1UF9A 3U3DA 1O97C 4FGUA 4PSCA 4GYWA 6PFKA 3QVSA 3V7YA 1XHFA 4AZFA 5K51A 3KSUA 4A2WA 2VCYA 5TXGA 4FFPA 4G5YA 4QYIB 4UMVA 3CZQA 2ZT5A 1P8JA 1F8GA 4RK6A 1V2GA 2ZSKA 1BHQ1 2YWEA 2ON6A 3CZ5A 2H2HA 4EHHA 1NT2A 1SVNA 2W2XA 1T91A 1V8DA 1U3TA 2PYDA 5L51A 2G3QA 1IJEA 2P1ZA 1L7EA 1UUFA 5JI3E 1VJRA 3GFGA 4BZQA 2WOOA 3JD2A 1NLZA 1O9GA 3TSWA 3U60A 4FFOA 2PSEA 4TLLB 3K9NA 1VLHA 4ZVUA 3D8BA 5D01A 2OFXA 1IFYA 4BP3A 3EPHA 4RV5A 1M7HA 2C8VA 4KXFB 3QUBA 1G5RA 1G8KA 2EYQA 5D5QA 2EFEB 1ZGHA 4TTRA 3GO8A 5KPTA 5T6MA 3VJRA 1EFCA 1QTRA 3K9GA 4OFWA 3KYCB 5L4NA 1EA7A 3AT1A 2PY6A 3Q1LA 4DR1M 4MZDA 3WGVA 4NZMA 1B8VA 3VU3A 3PICA 2BMEA 3V4SA 1DC5A 4QARA 2IU4A 3NOVA 1HNXM 4HXYA 2PBRA 4QYTA 4RCYA 5A4AA 1A95A 5AUQA 3ESBA 4CR6A 1GAXA 3V8RA 1QNLA 2H2IA 2W9XA 3GW8A 4N7JA 3I4CA 4COKA 2ONKA 5KPRA 3U4QA 3E0XA 5JATA 3EG5A 4E4RA 1YCHA 4I8IA 3DTVA 3O8CA 1T5LA 1FX1A 3LK7A 2LW7A 1XU4A 3STUA 3P0EA 1XTIA 2H4HA 1C1DA 3P71T 1J24A 1P72A 5ER9A 1H6UA 1YR1A 3BGSA 4YAJA 4OAPA 4RENA 3BB1A 4GHAA 1F0NA 2NU8A 2FP4B 1TIPA 5C4GB 1B8PA 3MWFA 2GERA 1ZYUA 2Z3ZA 1YZYA 4MUMA 4UN2B 1TMGE 1UIRA 4HN9A 5KAMA 1GV1A 4Q4AB 3PJFA 3PEUA 4PHCA 4QIHA 2N1BA 1SEVA 1SIOA 3MB5A 4ARAA 4IHJF 2XEDA 4L8WB 1XK7A 2Y0EA 1MTZA 2C1XA 4IJKA 3L7NA 3HP4A 1NI3A 4LYGA 4GEWA 4RK4A 3OIWA 3N7TA 2QMEA 1AB5A 4LY0A 4O8CA 1U8XX 3R3UA 3OIGA 5TEWA 2Q3JA 4F4FA 4CMIA 2OSVA 2ZKIA 4PQEA 1T1SA 1KQPA 1ZOSA 1SKYB 3ORYA 2QW8A 4Q24A 1NP7A 1J8VA 3TTSA 3ZBTA 1TF7A 4NAUA 4UEQA 5B4TA 5AXCA 4Y67A 2EZTA 3ZXYA 3MRTA 4QNRA 4E3WA 2PJUA 2OHXA 2GGSA 4Q9LA 4DRXA 3ZW8A 1GUBA 3OHMA 1EP2B 3JZFA 3GCWA 4FS3A 1NMQA 1XAGA 3L7IA 4IIDA 2IEBA 4RIGA 4DLSA 4RZSA 5EZYF 4IZOA 1KH3A 5E2BA 1U2GA 1TTQB 4NE2A 3TXXA 3BMOB 2WSLA 1ES9A 3K8YA 2ZRHA 3F7OA 3BDAA 1KFEB 4CMAA 1SOWA 4RH0A 4PSKA 5FNVF 1PGPA 2HU7A 1MRZA 1YFKA 3OT4A 5KVQA 4HDSB 5IM4F 4JQZA 4LWZA 5K8VA 1SZPA 2RH5A 5ALEA 1QJ4A 4LZWA 2QP4A 3WYAA 5AK6A 3WJ1A 2PN1A 4KW7A 4UCXA 1XVTA 1I6LA 3THRA 3T7JA 5BSTA 2HA2A 3L1VA 2W70A 5JSQA 1ZH0A 3TLCA 4AXXA 1QMPA 3VNQA 1ISJA 2QD5A 4KUGA 4O4JA 1YS2X 3IKJA 4HLNA 2A67A 1YRHA 2ZYHA 4BLOA 4HH1A 3AUFA 4M55A 4KIUA 1N9GB 2AIRA 1CIVA 2QTNA 4KX3A 1XPOA 1ZXBA 4P22A 1DPGA 4E88A 2GF0A 3OIUA 3LNCA 3HLYA 3I04M 4E3ZA 3T7DA 1OKKA 2SECE 4QU9A 1P1RA 1YZTA 3W1VA 2ZJ7A 1X70A 2WZBA 3KOOA 3N8NA 4Z7QB 3P9PA 5FUBA 4IJ5A 3N2ZB 3AQIA 1T9DA 5LQJA 4IMIB 3RC7A 4PG6A 2XTAA 3AR6A 4Y2PA 3QGMA 2AJBA 2HWYA 3GQ4A 2BMDA 3ZY2A 2B37A 1GNPA 2D5CA 2DG2A 3OF3A 2R11A 3FTNA 3PE4A 4R8RA 4O4IB 4N41A 2QYTA 2AZMA 3C6YA 1LDMA 3AB8A 2D13A 5BMVB 4RIHA 5HDQA 1N2IA 1M1ZA 4TL6A 1D04A 2GZSA 5IULC 1XTJA 4GSLA 4BUZA 2BBWA 2BE9A 3BXGA 4I55B 1SHTX 2NYVA 3EPKA 5A02A 3PPYA 1O96A 1WU8A 5HIJA 2AR9A 2A0YA 5ALQA 5L8RF 3ZVMA 5A4MS 1RXSA 1GKYA 1SCDA 1KC3A 3NMUF 2EDAA 1COWD 2H17A 3AETB 3O38A 4UNRA 5T4FA 1T4CA 1E1LA 2R6GA 3W2IA 5I9MA 3ZXIA 4QOIA 1XUOA 4MB6A 3CH4B 2WEKA 1TKRA 1GPWB 1JU4A 4B43A 4RTKA 2FFRA 3J81A 1XROA 2FFBA 1Z4NA 1US8A 1QK5A 1VBNA 1IOVA 1JN0A 3AUTA 3OLYA 4MQUA 4BKUA 5DHSA 13PKA 4BKMA 2CMHA 2FPGA 2YHAA 1T5HX 1N6KA 1AT1A 1VLVA 3V8PA 4KMMA 4AYXA 3L8GA 4GLFA 2PZAA 2ZM6M 3PCRB 4F2GA 4GBED 1Y6QA 5LXTB 1Z45A 1E69A 2DVMA 3B6IA 4BQFA 1SCIA 1SKMA 3FGZA 2ZTUA 3Q3GE 1E4YA 1JKMA 4PN7A 1ZU4A 5CNMA 4E2XA 4OYLA 3KC2A 3T4XA 2HA6A 3KSAC 2VYQA 1ULBA 1TIKA 4CGZA 4XIYA 4OQMA 1SCNE 4L6V6 3UC9A 1XMSA 1J90A 2GTHA 1VE7A 3HXKA 4MPTA 5KI6A 4BUCA 4LK2A 2DJ5A 1LLCA 3FNQA 3GCZA 1JR2A 2BY4A 3GAMA 2VF4X 4PQGA 3ZZNA 2F1KA 1E2GA 5C51B 1W1UA 2BLLA 3NC1C 3P52A 2R44A 2C7VA 1EIJA 1L5ZA 2YYZA 4QOHA 3ZX4A 5G2OA 4LJ8A 5F2KA 4IRXA 2HF7A 1ISFA 4IEIA 1L4MA 1LRJA 4CCAA 3PXBA 4MV1A 2PWYA 3F71A 1L7PA 3DDNA 2D7EA 3QWLA 1UPUA 1UZAA 5K0TA 4BZPA 3T34A 2AN5A 3L5KA 2ZE5A 4IIWA 3ENQA 2A7QA 4X62M 2HA7A 2AB0A 4IYJA 4CDNA 1ODSA 4WJKB 4OFXA 2CWWA 1A9SA 2VF8A 4U2DA 1YRWA 4IKEA 1BC5A 1TQ8A 1O03A 2R4QA 3DEFA 4DR5M 1ZU5A 4EZIA 1OBFO 2DTXA 5BW4A 1T5DX 3KLBA 4RW0A 3N2GA 3UK2A 5I4IA 2YUIA 2BEUB 4K9MA 1JQLB 5D86A 1LBSA 4Q3KA 1GUAA 2IPLA 2I55A 4B75A 3ESRA 3NPMA 2W2OA 1FVXA 2ONYA 2G0AA 2H51A 4U02A 2D6FA 3ESYA 4BTLA 1Q3BA 3OAAD 3PQDA 3TKLA 3RF6A 4TYWA 4OU4A 1ZPDA 4CEIB 3KZVA 1O3YA 3LWBA 4W1RA 1F17A 3R8FA 3JAMS 1UZUA 4HMQA 1VSBA 1UBJS 2CVOA 3BE6A 4PAWA 3N5KA 3BF7A 2WLTA 4EYQA 5LA6A 3PEWA 5E8JA 1OASA 4E12A 4P7JA 3EXIA 4MI6A 2C29D 2IU6A 1DRWA 1NMXA 1QVAA 1NVDA 3VTAA 3IQWA 2PZ8A 2QSYA 3DR5A 4JOSA 5AUOB 2R4EA 3BGDA 2JFGA 4FZ3A 4OQQA 2HU5A 1NG1A 5JPIA 1RXVA 1L5KA 4G56A 5JXWA 4M86A 4K6CA 5TPZD 2XITA 1RYNA 3HKCA 2WPDA 3NM5A 3N2LA 1ZK2A 3T12A 2VAVA 1R0KA 2ODQA 1X1AA 1JW9B 1OXTA 4DZRA 2FDCA 5FSWA 3WIEA 1G42A 1G5HA 5H3HA 3UOGA 1YMQA 2GWHA 3ZGLA 4HRXA 4ZOCA 3HGMA 3QPWA 3S8EA 5ARBA 2P11A 4I4LA 2EGUA 1E62A 4X6LA 3MIIA 1U1CA 3M89A 3IIEA 3H0CA 3RYIA 3NFYA 4KXMA 4DV3M 5KYGA 4O4IF 5DK6A 1QVWA 4ZVSA 2LIVA 4C7VA 1P9RA 2NUTA 5BMVF 4JN6A 1ZFNA 3N6XA 2XMRA 4D3ZA 3P5SA 4GI3A 2D8MA 1H2FA 1Q3TA 3USES 5AM2A 1ZM2A 1MU0A 3H19A 2PT5A 1S9HA 1OAAA 4MMYB 4LJ7A 5HOQA 4IIXA 4F96A 1XCBA 4ME6A 3SM3A 5TNXA 4PV7A 2BGMA 4KACA 4DLXA 4AG3A 4DLLA 1IYZA 3OJXA 4JUAA 3H2JA 4CKBB 4REQB 3RV4A 3HSKA 2W5UA 2BTQA 4QFCA 3ESXA 3OMXA 3O7WA 2OV3A 4WFKA 4X1KB 1XDWA 5TMPA 2GD2A 3SMVA 1QFXA 3ZNQA 1EP9A 4IQ4A 4GGMX 4AZVA 5FI1B 4ZVMA 4ZT3A 2H48A 1TT5B 3TQIA 1PR6A 4AS2A 2QR2A 4X1YA 3QM1A 1GPJA 1A7AA 4H7DA 2OGTA 2R8BA 5ALFA 4OLAA 2JIOA 5LXTF 3ILKA 5BSFA 4U5XA 1FPQA 1U9IC 2P1RA 4EUKA 4PZ9A 3JTMA 4EI7A 1SU4A 2F2TA 1BFKA 3BSFA 3DZFA 7YASA 4AQ7A 3LYLA 3KU4A 2BJHA 1R0RE 4I1VA 1T8YA 2OKCA 4IMJB 5CU7A 1XD8A 4OATA 3BFJA 4AUNA 2XTZA 3DWFA 1K7XB 4ZEMA 1GSIA 1KJYA 3QENA 2GETA 4KQMA 2WMOB 2E0IA 3RHSA 1JHRA 2GD6A 2OBBA 1ZCAA 4GFDA 4I9UA 2ERCA 3CS3A 3BK7A 5HW0A 1EUZA 3F9IA 1P8AA 3COYA 4ZGWA 2UXDM 4MGIE 1JG3A 1DAOA 2IYVA 2HLDA 3VNBA 4JB3A 2IFTA 3TW0A 5JO9A 4UM8B 5WRFA 2UVPB 3H9UA 1SMKA 3Q8GA 1X8KA 3SS7X 2E87A 3ZS8A 1DJQA 3UWDA 3HE3A 2X9GA 3JQ7A 5FHRA 4POAA 4X41A 2HK7A 4EPRA 2V6MA 4J0IA 2W6QA 4C6HA 4C5CA 3FCEA 2P6PA 3DV0A 3PQ6A 4GKVA 1JTEA 5I48A 1XALA 4CGYA 3KOMA 1MBZA 3HXLA 2VUIB 1NPDA 3LZCA 4MUIA 3B3FA 5DYNA 4N76A 3GIWA 4OBWA 3BGOS 4PEVA 4WDRA 2ANBA 4XSGA 4ND1A 4CT5A 3BH7A 4M54A 7ADHA 1YL6A 4D92A 3SARA 3ADBA 3GRZA 1HL7A 2PQ0A 3NTUA 4C30A 1T0IA 1U9IA 3LF2A 3LP5A 1G5IA 3NT5A 2R45A 4QU5A 4YAKA 3RG2A 1W2WB 5DRTA 1OHHA 4I9FA 1UR5A 3ILXA 3GMSA 3WGOA 1TDJA 3MMPA 2IYEA 3ZCVA 1HPLA 2H29A 1VPVA 4ZICA 1BWPA 2HUNA 1N2XA 3KVOA 2O14A 4A5OA 3GP3A 4H0NA 1Z3IX 2RIPA 3ZI7A 1XAJA 4OQFA 1F7VA 4U9IS 2CV2A 5DEIA 3A1CA 1BJKA 3AM1A 1LQTA 4JCCA 2QX8A 2C31A 5EP1A 1AIPC 2BHLA 2XYPA 1MOSA 3F7NA 5AQEA 1E9FA 4FWIB 3S55A 5AD1A 4NBUA 4PBTA 2ODEA 3SF0A 1Z7YA 4BE4A 4P31A 3FN4A 4JS0A 1TM5E 5JISA 2WNHA 5E1DA 3VGPA 3KJQA 1KRWA 1YI8A 2BDEA 1AKYA 4B80A 2L69A 3QP9A 1ZIOA 5KHOC 1K06A 1AA6A 3E35A 2IH4A 3BSYA 4Z53A 3LUGA 3K7EA 4PCZA 3G7SA 1KAQA 5ITYA 2QL9A 3WDSA 1W29A 4CYMA 2VDVE 2AI2A 2X7XA 5B3AA 4P2GA 1D9XA 1VJDA 5EL0A 3ASYA 4FLMA 1BDMA 1HGXA 3IFSA 1UZLA 2PRIA 2C7OA 3KEMA 4EZBA 1U6IA 4JLPA 5IH3A 1HURA 5EN4A 2CV1A 3C5WP 3TSYA 1Z8DA 1OXSC 5LLTA 3PVCA 1SBYA 1WF3A 3G5TA 4E22A 3H2BA 2VRBA 5BWBA 3IYLW 1RSZA 2Z58A 1ZAEA 5FLEX 4LTDA 2ZJAA 1L5RA 4BCCA 4KAXA 2ZROA 1DUVG 1ND6A 4WXRA 4MDEA 3L77A 3FOZA 3RNOA 3MCTA 1N6PA 1SXHA 4R2MA 5T67A 1QHGA 4BNLA 5GINE 2WM9B 3A11A 3SN6A 4AJKA 4FGLA 2AEEA 5FORA 3ST7A 4F3YA 2GM4A 2VQEB 1FE8A 3ZCSA 2R6JA 2QAGB 1JMYA 3LPLA 2EGGA 1CV2A 3G82C 1PG0A 5EE3A 3R74A 3AVQA 3QMMA 3VC2A 4WLVA 3JVVA 2UVDA 4R8LA 1N2HA 3U4IA 4QBHA 4MI1A 2LKCA 2WD8A 4NRWA 4GWGA 4DCNA 1P81A 1JA9A 4NYMQ 1VCOA 1O0CA 2QD2A 1RRGA 1L6RA 2P2NA 3MLEA 1MFPA 5G40A 1HSOA 1OB2A 4M87A 1DUIA 1KI6B 1LLFA 2NO0A 2DGDA 1I5RA 4NWIA 1P0PA 2IPMA 2IYTA 1XEAA 4LBYA 2Z2ZA 4Q4AA 3DEYX 4FSHA 2JFXA 4MUKA 2OHIA 4WKOA 1TQ2A 3AC0A 3NX4A 3FNRA 4JLVA 5INTA 4MRVA 2FOIA 4LOJA 4ER5A 4MHOA 4RPCA 4EPTA 4L4RA 4RVCA 2D7JA 3NHLA 2Y77A 3STWA 1NULA 3KSRA 1VTKA 4LKOA 1EFVA 4J3NA 1VSVA 3JYHA 2A9OA 4XDZA 2R25B 4ZMSA 3CONA 3ZR4B 1JJAA 5CEFA 2GA8A 3HGTA 1AKEA 2X9LA 1GPH1 1K8ZB 4BO5A 1X1QA 2G9ZA 4AS3A 3O1IC 4R5MA 1WF6A 3FBTA 3ZCRA 4QTUB 1RW4A 1B26A 1V41E 2NNWB 4OFZA 5IXYA 1JSXA 3PJGA 3ASZA 1Y33E 2PO7A 4WCFC 2ZZNA 1ETHA 4HFMA 2IOHA 3OWXA 4BNNA 3SNKA 2ZWAA 1I7PA 2JJ2A 1JB1A 1XCOA 2JIPA 1MB4A 5ETJA 3VI4B 3S2ZA 1U9CA 1I7QB 5AI0A 3OUTA 2B5OA 2JPDA 3R6GA 3WYEA 4MJXA 1D2EA 2QNBA 1KHTA 1QP8A 4EYEA 2M6KA 3SQOA 1DQPA 4W8OA 4HDSA 2PXCA 5DYYA 4F9FA 2CXQA 1ABBA 4DBVO 3VJKA 5CDHA 2AR0A 3I01A 4IFIA 4PT5A 3IMEA 4LX8A 1DWQA 2HAKA 1F4IA 2WMYA 4CF5A 3ER8A 1KI3A 1AKVA 3I2YX 2FHPA 1ZJYA 1FXSA 2WT8A