3UK6A

Crystal structure of the tip48 (tip49b) hexamer
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
318
structure length
298
Chain Sequence
AHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRITVSLHEIDVINSFLALFKSEVREQINAKVAEWREEGKIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvB-like 2
publication title Large-Scale Conformational Flexibility Determines the Properties of AAA+ TIP49 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 90
structure length 298
sequence length 318
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06068 TIP49 TIP49 P-loop domain
A PF17856 TIP49_C TIP49 AAA-lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3uk6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uk6A01
5FPTA 1G8HA 3OIWA 4Q1FA 4IFEA 1AS3A 1MO5A 2WOJA 4ZDKA 1PJRA 5E7JA 2J59A 2GK6A 4Q9JA 1WRBA 1P9NA 4CEIA 1NVVQ 4URZR 1E0AA 1T0HB 3MJRA 3GFTA 2F55A 3NBYC 3UKDA 3KW6A 4L16A 3AF1A 3U3MA 1M6NA 3LVRE 3RS2A 2ATXA 3MLEA 5HKKD 3TLXA 1W49A 1NVVR 1E2MA 3GJ6A 4Q01A 4BZQA 3GLHA 3C16C 2OLKA 5JWHA 4RKFA 4UNSA 1HURA 2IUUA 2ZJAA 3P26A 3LAWA 1US8A 2OCPA 2XTNA 1O87A 1FUKA 2FPKA 3EARA 3RNLA 2VHCA 2IL1A 4JVNA 1H8HA 2ERXA 2Q9CA 2H92A 4EQ6B 4MKHA 1BYUA 3QY0A 1W4RA 2N46A 2OESA 2P67A 1KK3A 4I81A 1FNMA 2D7CA 1CJVC 2CXXA 4X8LA 5JSZB 4C9BA 2IWRA 4DVGA 1TQ2A 4G01B 4M0LA 4QRHA 3CF6R 3U7EB 2IYRA 2YC2C 1MO4A 3B9QA 4MGIR 4B6FA 2C77A 3REGA 1EFHA 2VSFA 3X1DA 2O8CA 4R71A 1FUUA 1UPTA 3PENA 3PEYA 2ZI7A 4W7SA 1ZD8A 4HI0E 3N2EA 3WRXC 2ZPTX 4BFXA 5J4VA 2J7PA 2OFWA 2WBLC 3OAAD 4NHOA 3I8XA 4F38A 2DWZB 1XXHA 2H18A 2YWFA 4C0HA 2HT6A 2JJ1D 2IUTA 1EFTA 4C2TA 2JLRA 2CVFA 4BUJA 2C96A 2GJ9A 3A4MA 2C99A 3KKMA 5CITA 4NONA 4OI2A 2I1VB 3GLFA 2REXB 3AVOA 4AKEA 4OQMA 5TY0A 2ZI5A 3TUIC 4WZAE 2H8KA 1GNRA 2OBLA 3DDCA 3TMKA 3FB4A 1MO6A 4X8OA 1TQ4A 2AD5A 5CYPA 3ZD6A 3CR8A 2RCNA 2VL7A 2DHRA 2IYUA 1OYWA 4OQLA 4B35A 721PA 3EPLA 1Q0UA 5JCPA 2W58A 2ZI4A 2AD1A 5KSOA 3WNCA 1U8YA 3TAUA 4ARZB 4TT3D 1E79D 1T91A 3GLHB 2YHSA 1WP9A 4GSYA 4PC6A 4LBVA 5GJBA 3CPHA 2ZSAA 3EZ9A 3ADCA 2ZJ2A 3QEJA 2QBYB 4FCVA 4AG5A 1GNPA 1M34E 2IEZA 1MOZA 1G3QA 4FWDA 2ZTSA 4LBWA 1KDTA 5IRCD 1AKYA 3EPHA 5JHHB 1XTKA 1M7BA 4IKEA 4D80A 3AJIB 1KK0A 3GJ3A 3GLIE 3DM9B 3H2YA 1MKYA 3QXXA 4LSGA 1E2HA 1VDZA 2Q3MA 3QBVA 1MRSA 1IN5A 2GCOA 1VCNA 4AYXA 2A5YB 5EE5B 5TMPA 4PO8A 1KI2A 1M8PA 2VA8A 4OHYA 2XXAA 1XZPA 3AEZA 3AKYA 1G291 2VF7A 3O8DA 3LLMA 4EIWA 5JZVA 1W44A 3AUXA 3GJXC 1TEXA 3QE0A 3THXA 1DAFA 1DPFA 3TSOA 2O8FB 1IOZA 2J5XA 3KFVA 1OXXK 3TAHA 1KDRA 2IYWA 4DCTA 1CR2A 2Z4RA 1SXJC 3EC1A 4RZXA 3PFIA 2GVZC 4JVLA 3TR5A 2JATA 4BFYA 4JLOA 3AP1A 1JPJA 1IM2A 1AGRA 1E99A 2OFOA 3G5UA 1KNQA 2NO9A 4FMCB 3I72A 1W36C 2PJRA 3T35A 2YINC 5P21A 3MWJA 4D4KA 2C03A 2GWHA 1BKDR 1XDBA 1U99A 5KU1A 5EUMA 1KI7A 1X1RA 3DPUA 4MRSA 2C78A 2WSMA 1GL7A 3OIVA 4QL3A 3PUZA 1NL3A 3UMFA 1P4SA 4C0KA 3V4RA 4JLVA 5CIWA 2ZRBA 3A58B 4M9XA 2C98A 1R8SA 4PZLA 3G0HA 3BK7A 4CEJB 4LJ6A 3ZVRA 1LF0A 4M1YA 1S2MA 2ZJZA 4GBMA 3M4YA 3D31A 1KYIA 2HLDD 2CDNA 4D0LB 5JECA 1UEIA 4Q7JB 4TL7A 1XMIA 2NQ2C 1KO1A 2NTYC 2QT1A 4FI3C 4QGFA 4YQFA 3V4FA 1EESA 3X1WA 1XTQA 4YC7A 1NF3A 2HF8A 1J70A 1N5LA 1RC8A 3SYKA 3B1YA 5FOSA 5KDLA 4NCNA 3MHVC 1ZW6A 3RS5A 4Y0VA 1G8PA 1JEDA 3C14C 1OFHA 2ZI9A 1QZXA 5HPYB 3LNCA 4DDVA 1TF2A 4B3BA 1F6BA 2ZR9A 3Q7PA 4KFRA 2CE7A 1S0UA 3SI7A 3RSLA 3W3ZB 4MRNA 4A92A 1OHHA 1CTQA 1NLZA 3Q7QA 2AXNA 2VEDA 2B6HA 3FMFA 4V0NA 4IEIA 5A4JA 4PZYA 2DB3A 4IJMA 3V9PA 3KQHA 1XTIA 3QKRA 3K8YA 5BN3A 2HF9A 1SXJA 2EFDB 3EIEA 3SS8A 3MRSA 3F8TA 2QP9X 1KOFA 3I1FA 4CIDA 1CJMA 1S3GA 2A5FA 2ZITA 1J7KA 2RGXA 1TAGA 4IHQA 3K53A 4BFZA 2ZJ5A 2ZUDA 4KO8A 1T8UA 3B60A 3J81k 2BM1A 3A4LA 2OSBA 4Q4HA 3M6AA 3QIAA 3DEFA 3E5HA 1NLFA 5EZ6B 2E87A 1HE1C 4KVGA 1ZIPA 2FZ4A 1KI3A 2QPAA 1NN0A 4B43A 2V9PA 4WZBE 4EFLA 3ASYA 1RJ9B 1BMFD 1EX6A 2NZJA 3C8UA 2YYZA 4EPWA 6Q21A 1UBGA 1NBME 1G3MA 4JL5A 4PHHA 1T5IA 3QSYA 1XF9A 2F1JA 1QG2A 1TU3A 4FWIB 2IYSA 3WMFA 4TMZA 2I4IA 4LYFA 4BEBA 1NG9A 2CL7X 4Z1MD 2PLRA 3NEYA 4G5QA 1ZC4A 1ZUHA 2J1LA 2RGGA 2FEMA 2QY9A 5EE1A 2FSHA 3IKJA 2CVHA 4A0GA 4Q18A 3U4QB 2XSZA 1GDDA 2EFCB 5CJPA 5DYGA 5IK2D 3CONA 1Z0AA 2ATVA 4BFTA 4V0ME 3THOA 3A1SA 4YXWD 2B7CA 2SHKA 3PUWA 3A37A 3NWJA 2WZQA 3OIYA 3ZQJA 3IUYA 3TQFA 3CZPA 2REBA 4XIGS 1E1RA 5GJCA 1ZBDA 3UATA 4GP7A 2VHQA 3W8RA 5CB8A 2D74A 2V6JA 1U9IC 1OJLA 1Q20A 3UIEA 4B47A 4MDFA 3BC1A 1GKUB 3CUEF 3WP0A 4DB2A 3C5HA 3WBKA 3K70D 3DKVA 4FIDA 4PQFA 2HXYA 1N6KA 3B2EA 1Z28A 4GFDA 3RAPR 3Q72A 3WRYC 2KBFA 3FOZA 2J0UB 2CE2X 2GJKA 5JRJA 1G5PA 4OYHA 1E1QD 5JJIA 2BMJA 3PCRB 2FDCA 1NIJA 2XNDD 1N6OA 3K09C 1SXJB 2BEJA 4QBGB 2A3RA 3LDAA 2C9YA 2ZRDA 3FVQA 4BLRA 2ZYTX 5KNDA 4LY6A 1N5IA 1W36B 3I8SA 1ZNXA 4TTRA 5KPJA 2NPFA 1QRAA 3VX3A 5JWOA 1AS2A 2WWFA 4AKGA 2W2VA 2H5EA 4BFSA 2GJAA 1DAMA 1DG1G 1WQ1R 3EWAA 1KSFX 2R2AA 4JBXA 3RYTC 4EAQA 1XD8A 2HXSA 4LWZA 2BKEA 1P2SA 3IEVA 5CDFE 4HZUA 1JECA 4UNRA 2ODWA 3R20A 4Q66C 5JI2E 4GNKA 4NP6A 4RD4A 5FBRB 2L0XA 5EE0A 5FBVB 3CX6A 5FFMA 3F3YA 4HSEA 2AL7A 4J0QA 1HT2E 1RIFA 3R8FA 2HJGA 1QHGA 1RZ3A 4P32A 2X8AA 1Y3AA 5HKKA 2FZLA 2QN6A 1W0KD 1XJCA 2QA5A 3O8RA 4Q7MB 4LX0A 3SYLA 1OFUX 4HLUC 2QT0A 2BCGY 4C7OA 1W2HA 3FHOA 1NSTA 1N25A 3PITA 3R8CA 5KDOA 4RZ2A 3D7MA 4TLEA 2WSSD 3EG5A 2IWHA 2JJ8A 3ETLA 1XPUA 5FBWB 3KB1A 1EFRA 3OE7A 4PPFA 1XJ0A 2CHGA 1RPZA 4HYYA 1WBDA 3OZXA 1U9IA 2WJYA 4DUGD 2GILA 3X1YA 4ZDWA 2ZQ5A 3NVAA 2AKAB 5LDDC 3EW9A 3RABA 4A0HA 2EQBA 2WMOB 3FKQA 4Q48A 4TTQA 4N1AA 2E9SA 4HDCA 2EVWX 5J4LA 2DR3A 2VHJA 1YQTA 1DAHA 2ZYWX 2F43A 1Z63A 1E32A 5ANRB 2KSQA 2EWVA 3AF4A 1W46A 3P4YA 4PTLA 1VYVA 4KLZA 5DN6D 4HLCA 1GP2A 2BVNA 4BECA 3OAAA 2IK8A 5DLQC 1DBSA 2OG2A 3AVQA 3THYB 3ZD7A 4IDQA 3C41J 3W90A 1JNYA 2JJ1A 2VP2A 1ELOA 1WDTA 3NDBB 3VNVA 1T3LA 5TVKA 1Q22A 4MYTA 4FN5A 4LV6A 3K0CC 3A1UA 4LCBA 1NVUQ 1U0JA 1U81A 2ZS9A 4B48A 5FR2A 4US1R 1GKIA 2J45A 1G16A 4IDNA 4C0BA 2Q3FA 1G19A 3VFDA 1CJKC 4YMWA 4V02A 3K9GA 3U5ZB 2O8EA 3VLFB 1PZNA 4GZLA 3SR0A 2ZI3A 5C1BA 3LH5A 3TSWA 4RCZA 1XMJA 3RRYA 4CT4B 1B23P 1EG7A 1XEXB 5TDHA 1J8YF 2XTMA 2DFKB 1KSHA 4UXJA 2VIIA 2B21A 3SJZA 3T5DA 3R9XA 4DCVA 4HLUA 1PUIA 3KL4A 4A6PA 3KTAA 3QVUA 3ZH9B 4ZDJA 4TT3A 2O8DB 2OAQ1 5BQ5A 5CK5A 1Z0KA 2F1IA 2NO6A 4HAXA 4C7OB 1IJEA 2ZJOA 1E96A 4XVUA 4G1UC 1XPRA 4KV9A 4LRTA 3CR7A 3CM0A 2CJWB 2UVQA 3CW2A 1S9HA 4X8HA 3QPWA 2AN9A 2PBRA 5FUWA 2FE4A 4AKIA 1ESNA 3LBHA 5AR1A 1YZLA 2RGNC 3TUZC 4M9ZA 1DO2A 4BLPA 2GCPA 4MRPA 1OT3A 2GEUA 4QC2A 4IW3B 4MKFA 1N0VC 3SC3A 1EX7A 1SGWA 1W4CA 3I32A 3NEJA 3KKPA 1ZM9A 5CIQA 2D2FA 2ORIA 1ZP6A 1Z0FA 2F43B 1FP7A 4BEJA 1P9RA 1ZM2A 4FW9A 2OCYC 4M22A 4QBHA 1YE8A 1X37A 3DHWC 1GNQA 4JT4A 1J90A 3QNUA 3AVVA 3HU1A 1G21E 3WXMA 4AI6A 2IYYA 3LRPA 1Q21A 5DI3B 4WIAA 2P6RA 4LBZA 4BWYA 1ZUIA 2O8BA 3K0CA 4RD2A 1Z8FA 1TX4B 3BIFA 3IILA 5LD2B 4L9WA 5K8LA 4NCIA 5FTKA 5C2JB 1EGAA 2GAOA 4HUQB 3DZ8A 4LRSA 1S1CA 4TLAA 2PT5A 5AUPB 2PX0A 5AK0A 1SHZA 2FMXA 2YOGA 2O8EB 2ZRGA 2NG1A 3FHTA 2WV9A 2XAUA 1QHXA 1YR6A 2VTKA 3NBFA 4PHGA 3VKGA 3BE4A 4DXAA 4M9SA 4PXAA 1NY6A 1OKKD 3HU2A 1Z29A 5M04A 2VP4A 2UZIR 2BMFA 2Q6TA 5FUVA 3KB2A 2IYTA 4OHZA 1N6LA 3A36A 1F2TA 1F2UA 3AKCA 5FBLB 1E9FA 5FR1A 4LJ9A 2HLDA 3H0KA 3HPQA 2B8WA 4PQYA 4TZ0A 4NYIQ 1GRRA 4HLDA 3GPLA 4A6XA 2RGNA 1SKQA 4W5JA 5HCNA 1I4LD 2OZEA 2CK3D 2IF2A 4KSCA 1CIPA 3FMPB 4CYMA 1OFTA 2DZOB 5J4YA 1HY3A 4B32A 4NYIR 3B9PA 1LV7A 4ESHA 3U3OA 4OKSA 2FF7A 2A7QA 3E70C 4DDTA 1JQJC 3DMNA 1MABB 3L0SA 3M0EA 2IHYA 2JJ2D 3UWOA 4YDSA 3SEAA 1NMXA 4GITA 4G5RA 1C1YA 5BXQC 1ZVQA 2OBMA 4ZO4A 1ZCBA 3K70C 4RFSA 2YNMA 4HB2A 3W5IA 1TADA 1D5CA 2QM8A 3ZZ0A 1YU9A 3UANA 4OQFA 5SZHB 4Z51A 3AB3A 4EPVA 5B30A 2FG5A 2VSXA 2RKOA 1YR8A 4M1TA 1YVDA 3SJBA 2WJIA 4V03A 5E3HA 4YMTA 3U3KA 2GEVA 5BYJA 1KI9A 1NVWQ 4ASUD 2BV3A 5BYKA 3OF5A 3AF0A 8OHMA 1BO6A 1U94A 4ZDIA 2AFHE 1IBRA 2BIFA 3CX8A 4EJSC 3EPKA 2GZDA 2IS2A 4TMWA 1BMFA 4B74A 4II7A 5JSZA 4UQOA 4M1SA 2LKDA 3KQKA 4YDHB 4ON9A 3WHKA 4FWHA 4Q9KA 2XEXA 2YKGA 4JLBA 5C18A 421PA 3RRNA 3RVBA 4DHEA 1FPMA 2FEOA 2DWQA 2GVDC 1ZNWA 3WY9A 3HP1A 3ZQ6A 2GBLC 4Z1MA 5L3RA 4L8GA 2ZE6A 2G88A 1F2TB 3CB4A 1F2UB 2O0KA 3ZDQA 1CKEA 1Z6XA 5SZJA 5IK2A 3U7GA 3L2OB 5K8TA 2QMUA 3UMSA 1T3SA 1E9EA 1XJQA 2C04A 4GOJA 3QPVA 4B6EA 4YXWA 1G64A 2A30A 1RFLA 2IF0A 1GUAA 2WICA 2KWIA 1SVKA 2R62A 2OLJA 4GL2A 1KI4A 2QU8A 5HZHA 3EPJA 2J46A 3I3SR 3BB1A 4P31A 4RJLA 2MSCB 4LYHA 2EYUA 2ZE5A 1P2TA 2IW3A 4TMVA 4DLYA 3NDPA 1E2EA 3SE0A 1L2TA 5EE3A 3QXHA 2G1KA 4P4TA 4RFSB 1FL9A 2XNDA 5KDDA 3RS4A 1P7CA 3T5GA 1OXUA 4CRWB 3VNUA 4ARZA 3QOFA 3EASA 4QKQA 2KBEA 1FOEB 1JR3E 3BORA 4CW7A 4LK2A 4B34A 1P73A 1GFIA 4A8JC 2JA1A 2IS1A 1U98A 2QBYA 4WVFA 4Q00A 1P62B 2ZYVX 1KJYA 4IVRA 2FV8A 3U3JA 3CPEA 1QHSA 3IIKA 3WHLA 1UBEA 2ONJA 4LV5B 4A2PA 3PUYA 4WOPA 1OB5A 2BC9A 1SVSA 3LY5A 4JKYA 1CJTC 1NBMD 221PA 1UKYA 2QMOA 1GAJA 2ZAOA 2GBLA 3EZFA 5B64A 1TTTA 1O3YA 2GXQA 3B7GA 1G6OA 2WWXA 1DAEA 1AQUA 1JI0A 4KBFA 2QGZA 1W0KA 1Z5ZA 2YOFA 1FQKA 1MH1A 3PEUA 4CT5A 1VG9B 2NMVA 4JLJA 2HEIA 1VPLA 3GFPA 3IIJA 1D2MA 2Z43A 2O8FA 1D8TA 4N3NA 4LDJA 1COWD 5FOTA 5L3SB 5E7IA 1II0A 1MT0A 4QOSA 2WSSA 3HR8A 4DSOA 3PQCA 2FSIA 2BBOA 1UBCA 1G6HA 4DCSA 1HQYE 1AGPA 2BOVA 3NHBA 4DUGA 1JAIA 1N6IA 2QAGC 4KJZA 3Q85A 521PA 1OIXA 5LBIA 4Q19A 3RWMB 3SHFA 4JJZA 1E2FA 1F48A 3EXAA 4F4CA 4D4MA 1CU1A 2WMNB 1QZMA 2GEDA 1G8GA 2V8OA 2VLIA 3P20A 3K70B 4OK3A 1Z22A 2B92A 2XOKD 2IYQA 3ADBA 1KY3A 1SVLA 5DN6A 5SZKB 4TL8A 1VECA 3JZMA 3BB4A 1AN0A 2DPXA 4CEJA 4P33A 1Z83A 4EPTA 4A8JA 5TV2A 2ZSFA 1FW6A 1GZSA 4ZPXA 4PANA 1T6NA 1XX6A 2OEPA 4MRRA 1W5SA 2CLSA 1SKYE 1P5ZB 2W2TA 1KHTA 2JAQA 4EJSB 1H8ED 4ZKDA 4GI7A 1OH5A 4KAXA 2OXRA 3EWSA 1TQ6A 1ANKA 3W6NA 1AK2A 5DHAA 5H70A 2QP4A 3RRMA 1Q3TA 3CF2A 4A82A 2CHQA 3IO5A 4B71A 2GXAA 2YWEA 2ZE7A 1CP2A 1P3JA 2JIZD 4Q5IA 3GEHA 1KMHB 1KI8A 3MJHA 3GFOA 4DLXA 2NO1A 1CR0A 2QI9C 2MSDB 3TE6A 3REFA 1XEWX 3R9WA 4TQ9A 2QQ0A 2WAYA 2B7BA 5HE9A 3SFVA 2AR7A 3QG5A 2J87A 4A0RA 4D6PA 2QAGA 4P3YA 4OK5A 3I5YA 5FTNA 2RAPA 3U44A 3LQRA 4LJ5A 4IEEA 3GEIA 2G6BA 3QQ5A 1VCMA 4XH9B 4PX9A 2GJSA 3MSXA 1K6MA 4POAA 4EUNA 2D7DA 4PSVA 3K0EA 3LX5A 4P0TA 2CMKA 4I1SA 1RJ9A 4DCNA 1NJGA 3AH8A 1CR1A 4JLNA 1T0JB 4DLSA 2QE7D 1R6BX 3BH7A 4QHYA 4OJQA 2G9NA 2ZRCA 4TYPA 4LC1A 1M7HA 3LWNA 2ZRAA 1E98A 4XWAA 4LOAA 1W5TA 2OFXA 1ZAKA 3GP8A 4Q21A 3P27A 4A8JB 1VYTA 4M8NE 2ZSDA 3GLGE 3BFVA 3CNNA 2K5UA 1K5GA 5B2ZA 2JLWA 1U8ZA 2R6DA 4A2WA 1ZU5A 1LFDB 1T9HA 1UDXA 2QM7A 3OEED 1JBKA 4HAZA 1PV4A 1II8B 3LW8A 5GADl 4BLTA 3DO6A 2CLCX 3KFXA 5B57C 3EAQA 2GZHA 3RDPA 2YZ2A 3L43A 4ITRC 5DHFA 1XZQA 2ZIAA 1LS6A 1GIAA 5JBQA 3A1WA 2BBWA 5G53C 3TKLA 2VHUA 3UK6A 4QFMA 5GJVC 3ZIAD 2Z0MA 1IN7A 3QEOA 1C1KA 4I1UA 4XTCS 4JLDA 4LZZA 3WMGA 4OI0A 1KMQA 1T8TA 1WF3A 3I5XA 1NG1A 1OIWA 1GM5A 1H65A 1TUEA 4LC0A 2GRJA 1D2NA 2J0UA 4EFMA 4L9SA 2QTHA 2V54A 3CLVA 1XWIA 5TXGA 1MRNA 4CDGA 2GJ8A 4B75A 1Z6GA 3KUCA 4LJYA 3L0PA 1E2GA 3BWDD 2H57A 4NYJQ 2ZRLA 5J4KA 2CK3A 1DADA 4WW0A 2QAGB 3OESA 3FYHA 4WXPA 4WAUA 4MGZR 2PH1A 4QNRA 3U44B 2V7QD 2C8VA 1Z0DA 3BRWD 4MYCA 2Z5FA 4NYJR 4F4JA 4W9MC 1OYYA 1E2LA 1E9AA 2ZUBA 4G3XA 4DSUA 2RMKA 4DEYA 3U4QA 4MRVA 4IXNA 2FU5C 1DG3A 2NIPA 3R7WB 4JKIA 1FFHA 5C4MA 3SQWA 1M2OB 1JALA 1XTRA 2ZRMA 3RLFA 2FPMA 1E4YA 5CLLA 1R0WA 3D8BA 1U8AA 4O25A 4D2IA 4FMCF 4PHFA 4TQUS 4Q4AB 2GDJA 3EC2A 1N3BA 5C4GB 2CNWD 1FTNA 1G5RA 1ZRHA 1OE0A 1LF5A 2J0QA 2KE5A 1E9CA 2VO1A 2P3SA 4DLVA 3AF2A 4L4UA 1UKVY 2FFAA 5KPDA 4AYWA 3GJ4A 2FGJA 1OF1A 3EA0A 1M74A 4I1VA 1XPOA 2D3WA 2DYKA 1HTWA 2OUKA 4HAVA 1ZMXA 3CX7A 4DB4A 1VIYA 4BZPA 2V1XA 3GEEA 4QGHA 5KSYA 1HA3A 5CYOA 5JMTA 4QHSA 2VHTA 2FJUA 4HDQB 2W00A 2WJVA 2KB0A 2IBMA 1NLYA 1TNDA 1VYUA 2R8RA 4GZMA 1HEIA 1CF4A 2OCAA 2CLDX 4D4LA 2IXGA 3LD9A 5FBQB 3T1QA 1FMLA 1TQDA 4I4LA 2ZXUA 4PZZA 4GOKA 2ERYA 4C0AC 3U7HB 1QBKC 4TSFD 4Q9IA 1E2PA 4Z8YA 1NNEA 3NKVA 2ASEA 4QJ4A 1VCIA 3THYA 3NTUA 3BAFA 3IIMA 3KJGA 3NC1C 1RVDA 3TIFA 1FZQA 3SDZA 4F92B 3ADKA 3THWA 3H1TA 2PEYA 2Z6VA 3GLIB 1Z07A 3C5CA 5LD2C 5G40A 3H86A 2ZJBA 1ETUA 4PC7A 5FOWA 1QG4A 2JGNA 3AP2A 3O8CA 2WIAA 2JLYA 2HYIC 3IDQA 3BH6A 1S3SA 2CHVA 3KXLA 4G5GA 4PHTA 4A1FA 3PV0A 4BRUA 4EPYA 5EP1A 4FD2A 1LW7A 4XWOA 1W1WA 1XEXA 1E94E 2QSYA 3A4NA 4TWZA 1IN4A 1D6JA 1I4TD 3U7FB 2EU8A 1KK1A 3IGFA 4ZIRB 4AWXA 4KCGA 2O8DA 3CRMA 1KKLA 2O0HA 3WYFA 3TR0A 1S4QA 4MUBA 2X2EA 4XTRA 5AUOB 3MWYW 5J5CA 1CEEA 2Y8EA 1PLKA 4TLDA 4UNQA 1QHNA 2CJWA 2ZRJA 4P4SA 4B2IA 4C4PA 3KX2A 4E5UA 2QRZA 2ZRIA 4XOIA 3NH9A 1T4GA 1J8MF 2ZM5A 3AP3A 1BH2A 3W34A 1WXQA 4KI0A 1LNZA 1N0UA 5TB5A 1OIVA 4JMPA 4XJXA 1JAHA 4QNMA 1NBMA 1W2GA 1CULC 1E9SA 3NBXX 1WB9A 1LB1B 1UF9A 3LXXA 3RRZA 5AUNB 4LPKA 3ZS8A 2J7PD 2D62A 4KFTA 1KZGB 3K09A 5DH9A 1ZC3A 4LHZA 2X1VA 4ACBA 1II9A 3AVWA 3B8HA 1Q1BA 4NL4H 3MD0A 1OH8A 1HUQA 4A3VB 1HV8A 1R2QA 1XFAA 1G7SA 1XU4A 1CRPA 4KFUA 1FQJA 4TQAA 3GLGB 1COWA 5DI3A 4JSTA 2DVWB 1Z0IA 5E7MA 2HDNB 4NZYA 5JEEA 1NN5A 4PPNA 4BPBA 3KXIA 1F3OA 1TL7C 4V0MA 1SVIA 2A5GA 2MSEB 3K0FA 3U60B 5EXPA 2PL3A 5EP2A 1N2CE 2D4HA 2ZS8A 2Q9AA 2WWWA 2DFLA 4ZCMA 3T1VA 3THWB 1XMSA 4HUQA 1I4DD 4U7DA 4CVNA 3PVSA 2X77A 2HYDA 2MMCA 2KRKA 3KQLA 4Q03A 1G7CA 4Q1BA 4KU4A 1XEWY 4MA4A 1OXVA 1AZSC 2ZROA 3L0IB 4Q4LA 1CXZA 1RRFA 2XOKA 1L7VC 1X1SA 3UPUA 2I1QA 1E9BA 4HB4A 4DWJA 1NMZA 3U3RA 1G3IA 1G3RA 4MGKR 1XCMA 4TYNA 2W0SA 4IOMA 1AA9A 1E79A 4V0LA 4PSAA 2BBSA 4XWKA 1JR3D 1IY0A 1AZTA 3FKSD 2V6ZM 2LCFA 4RD6A 2WTUA 1DTSA 1UADA 1NKSA 3KQNA 3OIUA 1RE0A 2JEOA 4XD7D 3ASZA 3IO3A 5CLQA 4RSGA 1G41A 2W6ID 4P4SB 1H8EA 4DLZA 1DAKA 2IYLD 3RS3A 3ZVLA 4AURA 4D26A 1AKEA 2EYQA 1UDWA 1ZNZA 1PLLA 5IDVA 5AWFC 5J47A 5CDFA 3NG1A 3SFZA 3AKDA 2PJZA 2QRNA 3I61A 3E2IA 5JS7A 2GF0A 5FL3A 3H84A 1MABA 4TZ6A 1JXMA 2AWOA 4BFVA 1QVAA 3VKHA 2ZR7A 3KQUA 5BN4A 2X19A 1GTVA 1ZM7A 2JIZA 1BS1A 5JFGA 1GITA 5AJYA 3T34A 3WNDA 5F9FA 4CF7A 3R9IA 2GK7A 2QUZA 3NC0C 4PAMA 4R98A 2IYZA 3TBKA 1DOAA 5DGXA 2IA5A 1AQYA 2GETA 3I73A 5AJVB 1R5OA 4TMTA 2XB4A 2IS4A 2AXPA 4NYMQ 1RW4A 2QEQA 3LO5A 2G83A 4KITB 3ND9A 4URXR 1GG2A 3AQ4A 5KNCA 3K0FB 5JLJA 4DJTA 1P61B 3ZLJA 1R0YA 2ZAMA 2XITA 3LFUA 1YJ5A 2F7SA 4JBYA 1FX0A 4JL6A 1DVRA 4RY2A 2EFHB 1IXSB 4NYMR 3ZZTA 4XSGA 4PAQA 3WYAA 4FINA 1R7RA 5L3QB 1ZD1A 1EWQA 5JI3E 4B3GA 1KIMA 3QVVA 2XGJA 2QE7A 4DT1A 3QPUA 2XZLA 3FDIA 4GP6A 3CRVA 3ZS9A 2J3EA 2AKYA 4FCTA 2QROA 3AKEA 1G17A 3CNOA 5H68A 3DZDA 5H8WA 4HB3A 3EIQA 3TW4A 1Z6AA 1FP6A 4G0NA 2P0EA 4KSBA 4YONB 5EP4A 2W6JD 1XD2A 1Z06A 1ZYUA 3LV8A 1L4UA 4FXPA 1E3MA 3SN6A 1S1MA 5JHGB 3OEEA 1E2NA 1N6NA 3C7KA 3CO5A 2BDTA 5FH9A 2YWHA 2REOA 5LPNA 4F93B 2EWWA 2J9RA 1NI3A 4URUR 1R5BA 3B78A 4LJ7A 2YJTD 2G0NA 2BEKA 3QI2A 4NTZA 2BWJA 2G77B 5F98A 1YZKA 5J40A 5KOYA 1L4YA 3ZIAA 3T1TA 1U0HC 2O0JA 4B3XA 3PR1A 3GD7A 4Q47A 2WWYA 1G4AE 4NU0A 4G5SA 1FNNA 3GLHE 2HV8A 4BLOA 4GDFA 4OL0A 5FPHA 2VQSA 3TVTA 3IPXA 2CBZA 1HYQA 4IVQA 3NXSA 4XSHA 1YZQA 2EFEB 2XZPA 4ZCIA 3CH4B 4UXIA 2ZJYA 2VF8A 3O8BA 3VTKA 4US0R 4TYYA 4I1OA 5GVRA 2IX3A 4KYIB 3VAAA 3HYTA 4JLKA 1ESMA 1A5TA 3T15A 1NKTA 4Q02A 1P2VA 4H1UA 4M4SA 4LHVA 1G1MA 3IBGA 2Q3HA 3KZ1E 1XRJA 2V7QA 4JVMA 1KO7A 1FX0B 3LW7A 4LHWA 5CJ2A 3QJYA 3HDTA 4TYQA 2BCJQ 2VSOA 4DRZA 3B6EA 2H7VA 3FMOB 4OK6A 4PSKA 1IAQA 1KKMA 1SULA 1NY5A 2F3TA 2IYXA 3MGCA 4NH0A 4B33A 3CF0A 4DT1B 1QHHA 1E69A 4JN6A 2VPPA 3K0AB 3E1SA 1K8RA 4GT1A 3QKTA 1VKJA 1E2QA 1GOTA 1XXHE 4OI1A 1RRCA 4M9QA 4O2LA 4IVPA 2QMEA 3QBTA 4IOLA 2JLXA 4IDHA 2CNWA 2IC5A 2Z4SA 1R4AA 1XD2B 2C2HA 3BS4A 4BFUA 4AD8A 1E0KA 1P9WA 5L3SA 3GLFE 2WJHA 4BLSA 3Q5EA 5A5GA 2IEYA 1W0JD 2ZRKA 5FOXA 1ZJ6A 3K1JA 1Z2CA 4JLMA 3U2QA 1QF9A 3ZZUA 2WPDD 1X6VA 5EP3A 2P5SA 3TQCA 2HT1A 3LXRA 2X2FA 4TL6A 2ZREA 3QXCA 5LB4A 5JEDA 1KAGA 1W4BA 2PMKA 4X8MA 3AVPA 2EW1A 4PO9A 3CPJB 4O2RA 3F0TA 1GKYA 1YZUA 4M1OA 1UAAA 3RANA 2G0TA 2MMGA 3RS7A 4JL8A 2PMDA 4ILEA 5JCZA 3CRQA 2OCBA 1KSJA 2DFNA 3AUYA 2BJWA 1E1QA 1Q12A 1T5LA 1ZM4A 4LHXA 1JJVA 3H4MA 4TSFA 2GKSA 1N6RA 4PPGA 5EE9A 1E2DA 4KXFB 3IQWA 4K46A 4JJKA 4B2LA 2RGAA 4FMBB 1TMKA 2PLFA 4EPRA 4M2LA 1SVWA 2JLQA 2V55B 4JZKA 1WCV1 2FGKA 2GHIA 2EFGA 1VTKA 4EJSA 3VX4A 2WAXA 3SBEA 1BOFA 3MMPA 2IXEA 4EKDA 4D0GA 4LUCA 3MCAA 2GXSA 4M53A 4NDZA 5FPYA 5FL7D 3W9YA 2QP3A 4WA7A 4AKHA 3T06B 3DMDA 1WA5A 1XD9A 4ZI2A 2I3BA 2ORWA 4Z8XA 3MFYA 1KO5A 1QHHB 2A2ZA 4UJ5A 2QSZA 5E95A 5EXXA 5KO2A 2OO7A 4FMDF 2ZEJA 5DNYB 3ADDA 4F4IA 4YMVA 2AWNA 2HCJB 4HLQB 3PUVA 4JIMA 4PPQA 3PUXA 1FMJA 1KMHA 1VG1A 1EFRD 4GPTA 2ZJ8A 3OE7D 1ONBA 5TARA 3P1JA 2WM9B 1A2KC 5DIFA 3VKWA 4TMXA 1NP6A 3AV0B 3PJRA 4KYUA 4ZI3A 3PXGA 3VQTA 1DO0A 4JSYA 4UJ3A 3AVTA 4R2IA 2W0MA 3G82C 4UNNA 1Q3HA 3PEVA 1ODFA 5K8IA 1X86B 3FHCB 4H1VA 1ZUNB 4XVRA 3AM1A 1KAOA 1UM8A 4E09A 2QAJA 4C0SA 2FFHA 4PC3A 3LVQE 5EXTA 4MQBA 4ACAA 4URVR 2HCBA 1A1VA 1DAIA 1CRQA 1E2JA 1Z3IX 1KI1A 4BQSA 4M1MA 1VHLA 4YMSA 3SQXA 2HJVA 4AYTA 1N6HA 3WMEA 4HAYA 3JVUA 2WKRA 4CZ2A 2OILA 2IT1A 2BMDA 2JCSA 4N0EA 2LKCA 2FFQA 4ZKEA 4IDPA 4O0MA 3OFND 3RSOA 5GVSA 3FGNA 3T1OA 4W5WA 1PUJA 2F6RA 2ZSEA 1YKSA 4JYCA 2FOLA 3VR4A 4BGDA 1G9XA 2Z83A 2BBTA 3L0OA 4OBEA 1C9KA 1II8A 2DWOA 3OEHD 2XB2A 4CEIB 2PZEA 2ANBA 3W6PA 2W83A 3B1XA 1N5KA 2QNRA 4Q1EA 4DLRA 2VH5R 1XCGB 2QORA 3IQXA 2W2XA 3ZYCA 1TUIA 5KSPA 1E9DA 4R9UC 5IHPA 2RGEA 2F1RA 2H16A 1AM4D 1U0LA 2ZU0C 4M21A 1SXJE 1G8YA 4E22A 1VIAA 4GMXA 4DCUA 5D3QA 1US8B 2ODEA 4MUAA 1N0WA 3SOPA 4BLQA 1UKZA 3WP1B 2NOAA 4MKGA 4A15A 4G5OA 3W5JA 1JR3A 1TEVA 3FKSA 4JYBA 4WXRA 1AIPA 1C4OA 2F9MA 1JPNA 2DBYA 4XD7A 3C15C 2DWPA 4C30A 2W6IA 4HEJA 4WZ6A 5GJWC 1VMAA 5CB6A 2FX3A 2ONKA 2QGNA 3FPAA 2ORVA 3GJ7A 5BWMA 3SJCA 3TNFA 1DAGA 3IHWA 3CBQA 1OV4A 1EWRA 3KUDA 4JVSB 1DARA 3FMIA 4HB0A 3I62A 1IQPA 3B5JA 4HAUA 4BE7B 5E4FA 4ERNA 4NBSA 3KDSE 1KI6A 2FA9A 2PX3A 3LX8A 4PO1A 4DZZA 4U02A 2QL6A 1Q1EA 3ICEA 2LWIA 2RB4A 3M1IA 5FTJA 5FTLA 4PAOA 2JDID 5EXSA 3R7WA 1UJ2A 1NJFA 2PCJA 1SZPA 5EZ5A 1XXHB 1SVOA 2R6AA 1KK2A 2WWGA 1J2JA 1XEFA 2VP6A 5DO9A 2N42A 1YHNA 3MWLA 1Q44A 4Q4AA 5BW8A 3EIHA 1KJZA 3GLFB 1YRAA 3DM5A 1F60A 3SBDA 4B3CA 4D0NA 2CCGA 3UG6A 1E2KA 1UEJA 4PC1A 5IF9A 4LPSA 3PEWA 5KUTA 2VP9A 4Q1DA 3HYRA 1A7JA 3BH0A 4HUTA 5EQTA 1R0ZA 2YV5A 3BBPA 1ZNYA 2B8TA 3QENA 4MYHA 2XX3A 2ZETA 4C3ZA 2ZSBA 3D3QA 2GZAA 3HWSA 3TRFA 3DOEA 5AJXA 3GMTA 3WYGA 2J7KA 3CRW1 2ZE8A 5IT5A 1KZ7B 2E1RA 1OKKA 4URWR 5B58C 2FFBA 4EPXA 1EXMA 3B1VA 3BOSA 1GSIA 2Q21A 621PA 1UKEA 4YMUA 2VBCA 5L8VA 1P72A 2ZRNA 3DVLA 1RKBA 1IN6A 1DELA 2ODBA 2DCUA 4TMKA 3NBZC 2W6JA 1XB2A 2P5TB 4RZ3A 2IHBA 1IHUA 4LV8B 121PA 2WJGA 3GJ5A 4R2HA 4TN1A 4E07A 1U90A 2GCOB 1B0UA 1F5NA 2ZUCA 4MITA 1TF7A 4HAWA 4A4DA 4S35A 2ZI6A 1EFCA 1QHIA 3EA5A 2XXAB 1I2DA 2P6NA 3GLIA 3L8ZA 2R6FA 5HTKA 5HCIA 2O8CB 1SHKA 1Z47A 1KI6B 3TVDA 3THXB 4IFBA 1WMSA 5FPKA 2JJ2A 4QGGA 3K9LA 4Z54A 4WBSA 1L8QA 4B73A 5L3VA 3Q5DA 4IXMA 5ELXA 4UNPA 3B1WA 5AJZA 3WNBA 2OV2A 1RRGA 5SZIA 2CL0X 3VMFA 4RZUA 2IXFA 3CH5A 1NSFA 3SZRA 2V3CC 4DIDA 2ZS7A 2YVUA 3RWOA 4NPHA 1W7AA 1Q57A 3SHWA 4ZIRA 5DI9A 2QPTA 4ZV4A 2TMKA 2GCNA 4LJAA 3HJNA 3F5FA 2IUSA 4D4JA 1NMYA 1G4UR 1I2MA 2ZYUX 3EX7C 2RH5A 4KBGA 2OBNA 3N70A 4ASUA 4L5BA 4PQRA 2CEAA 3BXZA 4LJ8A 2A9KA 2AFIE 4A9AA 3NHAA 2FH5B 3LBIA 5JJLA 1TU4A 1R5NA 1S9DA 1M7GA 3QXSA 2ANCA 2BJVA 3W8NA 3MUFA 4BFWA 4QBFA 2QPOA 1J99A 2AK2A 2ODNA 4K8OA 3IPYA 2F9LA 5FPSA 2D2EA 3GJ8A 3VR3A 4RVCA 4MH0R 1X8JA 3SJAA 1DS6A 3ZVMA 3VHLB 2NO7A 4LJ4A 4EFNA 4DLWA 4B3DA 5JS8A 2FSFA 3PG5A 4RFVA 1R0XA 1GL9B 3CRRA 4JT2A 3RC3A 3GLGA 4R7ZA 2J0VA 4OQXA 1E2IA 2ZVPX 3TH5A 4B44A 3A1TA 4DC9A 4NCHA 4QM7A 1SKYB 5F9HA 5F3WB 4BRWA 1W0JA 2C95A 2XTZA 1OXSC 4B2PA 1XBTA 3EZ6A 2WPDA 2A5JA 2OXCA 3I4LA 3X2SA 2O5VA 3HR7A 5FOVA 1KJWA 1RYFA 3A1VA 4AK9A 2JLVA 1XP8A 1GWNA 4DLTA 4QHTA 1Q1ZA 3CZQA 3QKRB 4HATA 2YOHA 4LGMA 2OM2A 4TLCA 5AUQA 5HR5A 2CCJA 3VU9A 1T3HA 4D25A 1NN1A 4BZXA 1GL6A 4JLAA 4DDUA 4ABYA 1E0SA 3ICQB 1PLJA 4AY2A 5FI1B 4LBYA 4JS0A 4PC2A 3ZVNA 3AVUA 3IHLA 4C2UA 4NMMA 1P75A 4Q4HB 1H8HD 4KODA 3VR1A 1ZD9A 2IYVA 2R65A 3QUSA 2Q0HA 5KYKA 1TPZA 1JEEA 4ESVA 2JLSA 4GRAA 3DOFA 1U2RA 1X8LA 2YWGA 1IXZA 3QF7A 3LQQA 1SQ5A 3UWKA 4ZCLA 5D3MA 4LHYA 2JLZA 5FL7A 3W6OA 1AS0A 4Q4JA 3FFBA 3DL0A 1R8QA 4UKDA 2WVJA 5HE8A 3UG7A 2NO0A 2JLUA 1PVOA 3LBNA 4HDOB 2HUPA 2CCKA 1GRQA 5C46F 3C4JA 1KY2A 5FUYA 1JQLB 1G3UA 1VG8A 4IRUB 3VR5A 1QVRA 1MR3F 3DKPA 4I99A 4C0LA 4IDOA 1IN8A 3QXJA 3AF3A 1KDOA 3KKOA 2RHDA 1W4AA 1KO8A 4S2EA 3D6TB 5EJEA 4MDEA 4W5HA 1BIFA 1Z6TA 2O52A 1VCOA 1XTSA 2UZ3A 3CNLA 3UXMA 2BHRA 4K81B 3TSZA 3CIOA 1Q1QA 5BN5A 1Z08A 1P6XA 4MKIA 3V00A 4KVAA 4LI0A 2AK3A 1CR4A 2DZNB 4F91B 3MG9A 4TL9A 5L3QA 4NCKA 1G7TA 3BERA 2BKUA 3I92A 1IY1A 3JVVA 3VU9B 4OHVA 3LA6A 2FWRA 3K9NA 3B1ZA 4Q7LA 4F7WA 2DFTA 4OI4A 3KXKA 4V0KA 5DISB 3WBJA 2QZ4A 2GF9A 5FOUA 3TUJC 1ZINA 4Q1CA 5G41A 3TK1A 4URYR 5FI0B 1HQCA 4QXAA 5CM8B 1X8KA 5A0FA 2WKPA 3OFNA 1OH7A 2R44A 2OAP1 3KJEA 2R6GA 4RD1A 3GJ0A 1GVNB 4KLNA 2R6CA 3HPRA 3P4XA 4HZUB 4MYUA 4U00A 5KTYA 3OEHA 2RGCA 1OW3B 4HZIA 4QJ3A 1KDPA 1NIPA 1ZIOA 2GESA 4JBWA 3ZGXA 5D3MB 4Q4JB 3Q9LA 4LRWA 4US2R 2J41A 4PR0A 1OH6A 2GXUA 3N5CA 4LYAA 5DYIA 2WHXA 3RHFA 3ONWA 3AGPA 1VG0B 2J0SA 4U5XA 4FWTA 1M1YE 2F3RA 1GILA 4M1WA 4Q1AA 1IXRC 2VP0A 4V0OA 3KJIA 1VHTA 4MGYR 5CM9C 3TW8B 4QBIA 2FSGA 1JR6A 821PA 4CEHA 3O47A 1D9XA 2G3YA 2ZANA 4OHWA 3AVYA 3MWKA 5KHOC 1IJFA 4OJKA 2XJ9A 1MO3A 3Q8XB 5H1YA 4FCWA 1K5DA 4RKEA 3B85A 3TJZA 2QMHA 1W48A 4A2QA 2KI5A 3B13B 3QKSA 1OB2A 1OFIA 4QGAA 1KTVA 4L15A 2P2LA 3BJIC 2D06A 1G18A 4YLGA 4A36A 1NN3A 2BMEA 4NKRA 2FN4A 1Y63A 3GQBA 2N1BA 1HH4A 1G5TA 3P32A 5EUQB 3VR2A 5JRZA 1YR7A 4AIIA 2GNOA 1A4RA 1S8FA 2BM0A 1KO4A 1UBFA 2JASA 2WWIA 3BFXA 1JB1A 2JDIA 4KHZA 4QJ5A 1WE2A 3SU8A 1V5WA 1Z6YA 3K0AA 4C0QC 3SYNA 1XMVA 3L82B 4DBLC 3BGWA 3FTQA 2PT7A 4TLBA 2QTFA 3TGPA 5AJWA 3CWQA 4C0JA 1N6PA 4RCYA 2FNAA 4XVQA 4AG6A 3RC8A 1LVGA 1R10A 1G8FA 2UKDA 4DEXA 5G3YA 3VR6A 3KJHA 4QM6A 1EFUA 1QDEA 2GA8A 3AVXA 1CLUA 3QKUA 1A2BA 1E6CA 4D81A 3L8YA 1Z2AA 2A5DA 4DSNA 2NPIA 1KNXA 1RRPA 2G1JA 2VP5A 1N5JA 2H1LA 1E0JA 1AJEA 5UKDA 3B82A 1MV5A 1OHHD 1RYHA 4GOXA 2RHMA 3NIBA 3KKNA 3KTAB 1HT1E 1NVMA 2C9CA 3ND8A 2ZVQX 4M1KA 3VHXA 4Y0AA 3AGQA 5KSZA 1KGDA 1SXJD 3QF4A 3HU3A 1JXOA 4DLUA 4IOJA 3N2IA 4OQNA 2F1HA 3BD9A 4OHXA 1DEKA 1G20E 1W36D 4P4UA 1HE8B 2QQEA 2WIBA 3U6KA 3MAAC 4DDWA 4CEHB 1LY1A 3BB3A 3GCGA 3FE2A 1GRNA 3ECCA 1SVMA 4LYJA 1D9ZA 3QG1A 3T61A 2PZGA 3S1AA 5JWRA 2OT3B 3OHMA 4Q9LA 3SNHA 2WOOA 5CK4A 4JLPA 4BASA 1XNJA 1X3SA 2KJQA 2ZU6A 4H9GA 4DSTA 2P6UA 2CL6X 4A0FA 4KFSA 1W47A 2V1UA 1V43A 2QG6A 4Q9HA 2NZ8A 3FWYA 2AHOA 2FPLA 3QKSB 4B3FX 3LLUA 2GTPA 3EZ7A 1EK0A 5JJKA 3U61B 3A6PC 3W3AA 2C9OA 1ZM3A 5KNBA 1ZCAA 2ECKA 3X1XA 1WBBA 4IOKA 2WJJA 4AC9A 2ZRFA 3T12A 1YZGA 2IS6A 3JZAA 4E03A 4NE2A 3Q3JB 4UXHA 3U6BA 3K9HA 2Q9BA 3EZ2A 4FMDB 3IEUA 2O8BB 4EDHA 1YRBA 2P65A 2XZOA 5DE3A 2ZRHA 1A82A 2XSZD 1D2EA 4GMDA 1NRJB 4O3MA 1FTSA 2AX4A 2RGBA 1YR9A 1E9RA 1CJUC 3PIRA 1CBUA 1E4VA 2H17A 2XJ4A 4EQ6A 5J4HA 2PEZA 3CWZA 2PZFA 3RS0A 5G3ZA 4N0DA 2RGDA 2QENA 4TYWA 2WKQA 1KSGA 1E1RD 2ZR0A 3FFAA 2OE2A 2V4ZA 2VRWA 2VYFA 1OLOA 5HZKA 1LTQA 1CS4C 2WWHA 3BFKA 4RD0A 1LS1A 1NVXQ 2R9VA 3KKQA 5DSZA 1QHYA 1XTJA 1IONA 4FWGA 1DE0A 2OHFA 2ZRPA 4TTPA 4CGZA 1BYIA 4DKXA 1P2UA 4RD3A 1ZU4A 3UMRA 1IY2A 3ZJYA 1JJ7A 5K8UA 1TF5A 2V6IA 1YZTA 1G7RA 4B76A 3QF4B 2A78A 1OXTA 1UFQA 1YZNA 5FTMA 5FUXA 4D82A 2GAAA 2DY1A 2YC4C 4QG7A 3K0SA 4NCJA 5LB2A 1S96A 1Z0JA 4Q7KA 3CKLA 3X1ZA 3S1AB 2PCLA 3IBYA 1P60A 2XNSA 2C5LA 2QTVB 2NGRA 3A8TA 3NH6A 1OSNA 5F2EA 4DIEA 4PFSA 1XCPA 1OPXA
chains in the Genus database with same CATH superfamily
3RF7A 1PAUA 4JT8A 2C3UA 3UNXA 3A9VA 4IJUA 1CEQA 3VDUA 1KJQA 1R27A 1GAWA 4NEQA 3KVRA 4CKWA 3LVRE 3D4LA 1DAPA 1KZ4A 1VJ5A 3GRAA 4DNQA 1ATIA 5FTWA 1J5EB 4PFJA 1O87A 1FUKA 4LZWA 1EVEA 1HQKA 3IAS6 3ANSA 4XDZA 4MWZA 4C9BA 2IWRA 4NENB 1NHWC 4B6FA 4R6XA 2LDBA 4WNIA 2RRUA 4JU8A 4GHWA 3OQ6A 2EWMA 2PGAA 1N9KA 5LZ4A 5CITA 4OI2A 4Y2JA 1GR0A 3KSDO 4ZQEA 3S8EA 3FB4A 5KTKA 4NAVA 3D54D 2H4FA 1TA0A 2BKAA 4BAGA 1E18A 1LRLA 2H2IA 4I8DA 2W58A 5EHZA 3TAUA 2QHOB 4TT3D 1E79D 3GD5A 1SQFA 1TO6A 4EY6A 4XUEA 1MOZA 5FJIA 5EPEA 4GPEA 3F90A 3GJ3A 4U2EA 3EVNA 1E2HA 4F1IA 5B12A 2KEBA 2A67A 2FPWA 5JZVA 4PYRA 4IQ0A 1KZHA 5AP9A 2XD9A 4DCTA 3S7TA 3AP1A 3D3KA 1Y9JA 1Y1LA 4EYEA 3P2MA 3A2NA 4GXQA 2RDMA 1Y34E 4F11A 4OIFA 1A8HA 3N2ZB 3RNOA 3TBHA 3QTTA 3UGTA 2PS0A 3ADOA 3MGKA 5F64A 1NE7A 1L5VA 1OBCA 2XYVA 2Y1KA 4AP5A 1CS0A 1JDUA 1PR2A 4IBIA 3B2QA 2BR4A 2XLJA 1QQBA 5AKYA 4DDVA 1TF2A 4KW7A 1R6AA 2ZR9A 4HWTA 5KNCH 4QDZA 1NLZA 4B08A 1TTEA 4WESB 1XTIA 2C59A 4Q4DA 2VXYA 1EH5A 5CNIA 3GNLA 4QRIA 2VJDA 1JAZA 1JSXA 1AN9A 3HWWA 5A06A 2XHEA 2V9PA 2FW8A 5KYVA 2YIDA 4MQFB 4JL5A 1Y98A 4WBNB 1AKNA 4F5YA 1GQ2A 5DBEX 4BGEA 4N65A 2HDOA 3V5NA 1MD9A 3H9EO 2XSZA 1GDDA 1V4NA 2PRIA 1KS2A 1ZDMA 2P35A 3NDRA 1U2DC 3IP3A 4IDEA 4Q3NA 3A1SA 3SKYA 2H2FA 5HUJA 5L95A 3G2JA 1MT3A 1WUJS 3BFJA 3C7CB 2DCMA 3IMKA 5AO9A 3VYWA 4UU1A 4UPEA 1TK9A 2HHHB 2FDCA 1GAEO 4YUXA 3FVQA 1FRQA 5E38A 3FGZA 2Q2QA 4TTRA 1GFSA 2OCDA 4WXEA 3NHKA 2JIBA 4BFSA 1WQ1R 2PIDA 4M0UA 1AGYA 1PBNA 1OLUB 4JBXA 4RVHA 2BH2A 4PGGA 3VZPA 1W85B 4GMQA 4HSGA 1NURA 3I1JA 3F3YA 3KP1E 1J0EA 1OASA 1YMQA 3A6DA 3SYLA 4QT0A 2BCGY 1N25A 3H04A 5IBQA 1N2GA 4CQMD 4Z4EA 2PRYA 2VJYA 2YHBA 4YRSA 2O6HA 3OKAA 5DK6A 2WMOB 3BYZA 2I7VA 1T9DA 4XM0A 4N1AA 2V4UA 4O59O 1EDEA 5JAZA 2UUOA 5I7VA 1JG7A 1C8KA 1DBSA 1GQSA 5LWHA 4IDQA 1NXPA 4RF2A 2XRMA 4W8OA 4O1HA 3PNSA 4BATA 4V02A 5IDWA 4BNFA 4XYMA 1PZNA 4P4GA 3NTLA 1NXOA 3HVJA 2BTQB 1S3FA 2B21A 2ZIUB 1I51A 2OAQ1 1XDDA 3TNLA 3EDOA 2GFQA 4ZCRA 3CR7A 3RU3A 2CXHA 2RONA 3O3OB 2Q2NA 2JI8A 2ZT7A 2Y0CA 3FMVA 3HKPA 2D1TA 4F4FA 4CDNA 1UMBA 1FP7A 1JE1A 5EKTA 5EYPB 1G21E 1YFLA 5T8KA 3L4JA 1TJYA 3PJFA 3F78A 2NXNA 1GPH1 4UE2A 4AU1A 3QE3A 1PR6A 3D64A 3NBFA 1QHXA 1LUAA 3RQSA 1NY6A 1R15A 1QYVA 5FUVA 4XPIB 3QEMB 4E4RA 2HLDA 2YYAA 3M49A 1D3AA 4QREA 5HCNA 4D3FA 4L7VA 1RQ2A 3FTDA 1JHPA 5K51A 2A84A 1YOBA 3MF4A 5KHLB 3TFQA 4ARIA 4GXRA 1V3QE 3COYA 2H1VA 2VNHA 1D5CA 4GLLA 3N1UA 4RHYA 2E5WA 1MTOA 3F5MA 4ZZ3A 1ZESA 2I7XA 1FLDA 4L9RA 4ZDIA 4EJSC 3UMGA 1BMFA 4ETNA 3CG4A 4FEYA 2AFRA 2R0QC 3RIYA 3RRNA 1R0KA 4OYYA 3MXOA 1DJQA 1KARA 1H6BA 5JBNA 4L8GA 2ZE6A 1FU8A 5IVPA 1VI6A 3OCCA 3V4ZA 4C1NA 2C04A 2EJTA 3TLKA 4NI5A 2QU8A 4RQBA 4MTLA 1IIBA 3VJLA 2JHAA 4BO9A 1SVNA 4F84A 2FZEA 2JFYA 4ARZA 3QOFA 4U7PB 3O75A 4DNFA 1P1CA 2ZYVX 2XYQA 2BH9A 3I9FA 3CPEA 5EFOA 5J2TF 4L95C 1LTMA 5IT4A 3HG7A 2IZZA 3QE9Y 2NTEA 3LY7A 3HEMA 1QGAA 1VPLA 1WWKA 2W2MA 3V2UA 3H83A 5AW3A 3Q10A 4DCSA 2UU9B 4LQLA 2V7XA 4WN3A 4OK3A 3WMXA 2YRFA 3ORRA 1NW3A 1Y7PA 1AN0A 1Z83A 5AQ1A 4MQUA 3DNMA 2CLSA 1SKYE 3QWHA 3C3JA 5LQJA 2WQ7A 2J6HA 5JASA 3U6SA 4G0WA 1QS0A 3IPRA 2O2SA 1GFWA 2Q3LA 3PJEA 3C3AA 4QG3A 5IWAB 1KMHB 4TQ9A 2B7BA 1W0CA 2PY6A 1Z5BA 2Y0QA 2BFBA 4CM7A 4P3YA 4OPMA 3I5YA 2AV6A 4MB6A 4WOKA 1XF1A 3AJAA 1EUQA 3TRJA 2ON6A 2GJSA 3IQHX 1RJ9A 4RY8A 4ATNA 4TYPA 1ZWLA 3WIUA 4LOAA 2GH1A 1G5HA 1IXKA 3ZCBB 5AM1A 3TLGB 1QK4A 5CGZA 3LUGA 5CFNA 2QRGA 3CT6A 3W05A 4ZVQA 4YRGA 1UJ4A 5B53A 1O0BA 1WF3A 3UYLA 3QBDA 4DV7B 4HXGA 1MRNA 2P2SA 1QVVA 3DVAA 1QONA 3WKEA 5K0GA 3UMVA 4LDRA 3T6PA 4WXPA 1XVAA 2GFHA 3ML1A 1TZ2A 2DAKA 4F4JA 2JH3A 4AN4A 3ND6A 3T7AA 1DGHA 3C9PA 4IXNA 2H8GA 1FFHA 3L77A 5C4MA 1T43A 3HB0A 1R0WA 4UBLA 1MJFA 3L7IA 3VC2A 5AKLA 4M8SA 2AN4A 4BWFB 1AF7A 5K03A 2NSHA 3CX7A 5CYOA 1LJ8A 4GUDA 2Q3BA 4QXPA 3ZCUA 2AFVA 3T1QA 2XXJA 3W5SA 4YMGA 2OOKA 2O50A 1QOZA 4BXOA 2FWPA 1BJKA 4CTJA 1JQAA 1YTUA 4LY9A 3E7WA 2H0RA 4Z5XA 3GO8A 2XUAA 2OGSA 3UO8B 4LF6B 3ZDDA 2X2EA 3HTXA 1O03A 3GDFA 3OLYA 1PTJC 2ZRJA 2DU8A 4IQFA 1N0UA 2VJNA 5CM2Z 5TB5A 2X22A 1ZMTA 1XK7A 4CG2A 1P0CA 5AUNB 4IX1A 4IM7A 1VKZA 1II9A 1GDHA 4GBED 2VNKA 1PTKA 3U60B 5EXPA 3SZMA 3QIVA 1I4WA 1L1TA 4KVZA 1XMSA 4RACA 2DC1A 3F3SA 4LGYA 5DM0A 3TJRA 1CE8A 1L7VC 3E9RA 1E9BA 1XCMA 2QL9A 4X3CA 1G41A 4RZIA 1H2EA 5H9VA 4EL0A 3EEFA 5AWFC 4B7HA 3F47A 2QRNA 3E2IA 1PRYA 1C3OB 2AWOA 4IJVA 3EXG2 1W8IA 1V8OA 4Y28F 2X9NA 3DAYA 3T34A 3ZDAA 1FJXA 1TKAA 3ANXA 1R5OA 5HOQA 1I3NA 3NALA 2EW8A 5JLJA 2GKGA 2WHYA 1P61B 5IC4A 3BMCA 3FYDA 2XITA 1VJTA 3L26A 2YJ4A 1YJ5A 1D7OA 3ISJA 1W30A 2ZSIA 3J81A 1VLZA 1Z4QA 2IZOA 4TWAA 3FDIA 4GP6A 3AB7A 1U9ZA 4MP3A 2AKYA 3AKEA 5I7EA 3CNOA 3IQFA 3UTDA 3ILYA 1XD2A 1H4QA 2OCXA 3C7KA 2O06A 3GZTB 1GTRA 4F93B 4WXMA 2J9RA 1NI3A 4QAJA 3ZGZA 3V1YA 2GKOA 4OAQA 5J40A 5KOYA 3SHTA 2WWYA 1PYGA 4AW4A 2GN2A 2R8EA 5BN4B 3HDHA 4ZOLA 4IG9A 3NRJA 1ESMA 1T9AA 3AL2A 2QRJA 2Y4NA 1NKTA 5ALLA 1P2VA 4MQ5A 4UDXX 5BO5A 3ZW9A 1IAQA 4MUNA 1KKMA 4NH0A 4E4TA 1WXHA 1K8RA 2VWQA 1X9GA 3LIPA 4UM7A 3AM4A 1YHYA 1MN6A 4NOMA 2IC5A 3BS4A 1XIVA 4BLSA 2XZTA 2YJGA 3MMNA 3QNMA 3QXCA 1W4ZA 5JEDA 1KAGA 1AF4A 3CPJB 1ZONA 3NLLA 2IXTA 1Y6GA 2OG1A 5GY7A 2DSTA 1D6MA 1XMPA 1QFMA 5IEJA 2AG0A 3LYHA 2GGSA 1UUFA 4M54A 5CCDA 1IHXA 3VVBA 1C3EA 4M53A 2GXSA 1AKVA 2CB0A 3WLMA 4NQRA 1UBRS 2HA5A 4E15A 1KO5A 4JR2A 4FMDF 2EBUA 1V11A 3UJ8A 3U1TA 4UHFA 3E4CA 4MK4A 4XI9A 4GPTA 3JPYA 4ZQCB 4D9JA 3I2HA 4D6YA 4BQFA 3UUEA 2XB9A 1NOKA 1ZVVA 1FQWA 1B41A 3SOZA 3GBSA 2HK8A 3EA4A 4PC3A 2HCBA 4NABA 4I6EA 5JQWA 1A1VA 3GRUA 3JVUA 3TLYA 2K4MA 2F5SA 4N03A 4DJJA 3OFND 4P53A 3R6LA 2F6RA 4LKRA 1F38A 4WI1A 3HDJA 3GB9A 3A05A 2XB2A 4MVJD 4K0KM 3ZYCA 4YROA 2F1RA 3VTZA 1HDZA 3UQYS 4RADA 4HNUA 1J23A 4NFYA 3U6MA 4MKGA 3ZKAA 2ATIA 3BM5A 3NM4A 4WACA 2DWPA 4WZ6A 4U9UA 2ORVA 1QLJA 3I62A 2RHRA 1MLDA 4U02A 4Z49A 2CUTA 1DHTA 4X66M 1ULAA 1KK2A 5JJBA 2EX0A 4MR9A 5JVDA 5EA2A 4RKRA 4AN0A 1Q7GA 4EKYA 2HF7A 3EEBA 2LWXA 2XWBF 3A0UA 3R7AA 1U7UA 3AERA 4RMIA 4AJ9A 2I29A 2JGEA 1ZBQA 2W43A 1ARZA 3DVLA 1D6NA 2FTKE 5GIOE 1HZZA 3OA2A 3VSBA 1IHUA 3E84A 121PA 3ABIA 2Q6OA 3I83A 4G1EB 2BWEA 3WBFA 4HQ0A 1KDYA 1Z47A 3E1GA 3TVDA 4QYIB 5CBPA 3R3WA 1L8QA 1O4WA 2RHGB 2AJDA 4OP2A 2PKQP 1Q57A 3SHWA 4LK3A 4ZV4A 2XLCA 4D4JA 3JALB 2CEAA 4UM9B 2AFIE 3KVOA 1Q15A 1OWMA 1NUTA 4KUHA 3PUKA 4WLVA 3L1JA 2HNBA 3I3OA 1FW8A 4BQRA 1DS6A 1Q7CA 4BGUA 3M70A 1Q2UA 3RUCA 4QM7A 3DDUA 3EAGA 3TH5A 2Z08A 4ZD6A 5BR1A 2FXIA 5AW0A 2JLVA 1J8FA 1C3LA 4QHTA 4P1ZA 5JYEA 3ENWA 1OBFO 4O4HF 4FYKA 4PWYA 4ZAWA 5I8ZA 3O84A 5D7BA 5HKAA 1GO2A 4KTVE 3KHSA 2QTGA 1CJBA 1FXSA 3GJTA 5EESA 4RV5A 3VZRA 1UZLA 2YWDA 4OHCA 1VGRA 1DKUA 3FFBA 3GT3A 3ZXUB 1RBYA 5COBA 2FAXA 3HYCA 1EIWA 4HWPA 1K5HA 2OQ4A 4IDOA 1EPUA 2RHDA 1W4LA 5CFMA 3VNBA 1Z6TA 3T7CA 3Q11A 4RA6B 3X2FA 4DM4A 1XTSA 3MC1A 3WQRA 2D5BA 3LP6A 2ID7A 3IDFA 1Q1QA 4QUJA 3PA8A 1TT5A 5JNRA 2LVAA 3R23A 4GMFA 3JVVA 1J22A 3K9NA 4QOJA 4Q1CA 4E11A 4MW1A 4URYR 1HQCA 2JARA 5LKRA 1J8DA 1CY1A 5IKEA 2PUJA 3HPRA 1XTVA 1U4OA 1JQKA 2QIPA 5ILGA 1E1NA 4LYAA 2J0SA 3TWKA 5EIAA 2HA2A 2HGSA 3QUTA 2G3YA 2ZANA 4FKZA 1J0BA 4XKJA 4ZTUB 3LQYA 2D0OB 4OJKA 3UAWA 2DULA 3THSA 3Q8GA 2WY2D 4A2QA 3KOWA 4EW6A 5K6AA 2WJZB 5DX0A 1QNFA 2OGZA 3H2HA 5TQ2A 3DDZX 2WWIA 2NZ2A 3OZFA 4I36A 3SARA 1HJPA 1AUPA 3HKEB 3ID6C 4XUCA 4YVFA 4LOJA 1ZZEA 4RCYA 1WO8A 3PI7A 1LVGA 4K3VA 1T4CB 1TGYA 1AXEA 1BWSA 3KAPA 3OQBA 4D81A 2NPIA 1D2CA 3UGJA 1GZUA 3CLKA 4Z4FA 3N8IA 4F2HA 2G9QA 1RYHA 4QT4A 3TLZA 3CRNA 5FV4A 3Q7IA 1E5TA 3FD8A 2ZIWB 1YIOA 4RZHA 3MAAC 3U80A 1OA0A 4JLPA 3H6GA 4R68A 3CE9A 2DAPA 4B3FX 3EZ7A 3A6PC 4PCVA 2C9OA 1TCUA 3PRJA 4CV2A 3KAJA 1B8NA 5BSVA 1HNZB 4BO0A 2O8BB 2I2AA 5HIJA 4R1OA 1D2EA 4O3MA 2RGBA 1YR9A 4O8ZA 3RS0A 5AVXA 2PG3A 4N0DA 4FNOA 5JXGA 4J75A 2POCA 4UTPA 5AVZA 4JI2B 2EP8A 4FYJA 1IY2A 3NWOA 4Z7JA 3ORSA 5JDCA 2COKA 5P8WA 4QG7A 1HX7A 1S96A 4MO2A 3KOYA 4ZZIA 5I01A 1EJBA 2A1IA 4OU7A 1DLJA 4Q1FA 3R3VA 1WAMA 5KVVA 4DSZA 1NVVQ 3N8NA 4UN2B 4ZVUA 3HJCA 3T9FA 5D85A 1U0RA 2MJ5B 1J00A 4NPAA 1O54A 4LZAA 1T2UA 1A2OA 2Q5OA 4WINA 3KTOA 1GYQA 2P1ZA 5JSUA 2VQEM 2QNIA 3I1YA 4C87A 4QPDA 3B9QA 1EBFA 4EI7A 5EJAA 1O95A 5CLFA 1JX6A 3T7RA 2VYQA 1W96A 4GKBA 4HI0E 3L6DA 4NHOA 1LCIA 5LBTA 1EFTA 1SRQA 1WDWB 4RAQA 1CQPA 4RXMA 2GAJA 5K0NA 1BG6A 2GN1A 3AWIA 4BNWA 4B35A 1YVEI 4RABA 4EMUA 5TQ0A 4ZO6A 5HVNA 2YHSA 3MTBA 4PC6A 2Q27A 5EHNA 5HKOA 5IN5A 1OTRA 4AG5A 2Y21A 5LQDA 1OVMA 3N39C 4KRFA 2ZB7A 5B55A 4LSGA 3CZ5A 4TS1A 1YBHA 3A3OA 4B3TB 3GJXC 3THXA 2GR9A 1B14A 3AR2A 2PYZA 3I9LA 2GVZC 4MV3A 2N1MA 4OH1A 3IJ5A 1P4GA 4UOZA 4L8FA 2I34A 4PZ9A 3C3CA 5IT0A 2OXEA 3G0HA 3BK7A 4XEUA 2QRMA 4WY2A 5I3ZA 2NTYC 3DC7A 1IPEA 3FZYA 2G4LA 1FMFA 3RIMA 3R3ZA 1LI7A 4DR7B 4B3BA 1LGYA 1F8FA 1S0UA 1NU8A 4HPXB 2DUJA 4TUYA 2XNCA 2ABWA 5TMEA 5JAHA 1SXJA 3NDJA 1S3GA 2K6BA 1T8UA 1D1PA 5HDQA 2OSBA 3LCCA 2R8OA 2VXOA 5EZ6B 2CHEA 4KVGA 4OTZA 1MAUA 2FFRA 6Q21A 1UBGA 5H5JA 4WLFA 1TU3A 3PWTA 2EC5A 3GRYA 5ECDA 3T7TA 3HLKA 3D8LA 1H5UA 3BSYA 3SBXA 4ZK2A 1Z5WA 5DEIA 3IURA 5IYZF 5IK2D 1XKLA 2B7CA 3K6SA 3H5VA 1E7WA 1K8YB 1PR3A 1U9IC 2QRQA 4YJGA 3L7NA 2E49A 4XPZA 1YONA 1PGNA 4X95A 4CU2A 4RPIA 1T5OA 4XGKA 4ZJYA 1P17A 3EHEA 2X41A 3VX3A 3S8MA 1ZJ5A 5AJHA 3EMKA 2FN7A 4Y7DA 2GJAA 3MJ4A 1KSFX 2UYGA 3WO0A 3K0BA 3JS5A 4BU0A 5CDFE 4ZAYA 1JECA 2IV2X 1UJ5A 1WOMA 3AMVA 3HR4A 2NW6A 4J0QA 1HT2E 1Q3BA 3IFSA 1AQNA 1LVHA 1ZOPA 1NSTA 2A9PA 4MW4A 2X0IA 2E1PA 2ZUSA 3LECA 4LMBA 2SCUB 4UVIA 5CEJA 4YCCA 4DV0M 2GK4A 3EW9A 4EX7A 2BMWA 1N2ZA 1U5BB 4FGUA 4Q48A 2OK7A 2J09A 4PTLA 1YRLA 3ANTA 2EJVA 5I4CA 2Y77A 3MRXA 3FJOA 5ESWA 4BE9A 4WHMA 3NDBB 1HE2A 4OATA 1VGVA 1Z4NA 4LCBA 1NVUQ 2XCQA 2ZS9A 4US1R 1G16A 1L0BA 4MV8A 2PKYX 2BE7A 2F64A 4GZLA 4Y2GA 4ZJZA 3O4IA 3WJAA 5EJGA 3CNBA 5TDHA 2KNZA 2QLNA 1GPBA 3SJZA 5DYNA 1H6UA 4L27A 1S89A 1PQWA 2F1IA 4QARA 1TAHA 5KI6A 1E96A 3P2EA 4LRTA 3VPSA 3TZKA 4IV8A 3LBHA 1VDLA 1P4AA 4NY1A 4WEOA 2ZIZA 3LO8A 1Y8RB 1KAEA 1SGWA 1Y37A 4MEJA 5AICA 4BNNA 3ZU6A 4YNBA 1A8UA 1EQ2A 1NI5A 4RD2A 3BQNB 3IILA 1TX4B 3HZHA 4OB7A 2NAPA 4OL9A 3KM0A 1GPJA 4FR0A 2QWXA 3QEAZ 5AUPB 4I5EA 1GGFA 5C5DA 3T9EA 3TEJA 3KOZE 2FPSA 2BMFA 4HDSA 4PGHA 1MIOB 3TNDA 4M37A 2CK3D 1R64A 1CUVA 2VDPB 2VWGA 2C5EA 1HY3A 4B32A 4NYIR 2XNHA 4KGVA 2C58A 2OV3A 3U4HA 3KZCA 2HNAA 2FW9A 3Q2OA 4D0RA 3T0IA 1Q17A 4BNIA 3P52A 2GEVA 3PT5A 1BO6A 4MAMA 2BAGA 5JARA 1GGMA 2YJ6A 2A88A 4YDHB 1RDFA 2GN9A 4Q9KA 5HZGA 4I4TB 3HI4A 1FPMA 4DJEC 5AI0A 1IG3A 4LF5M 2A0KA 2G88A 3IRUA 5A62A 2Y0EA 2C2BA 2O23A 1DQRA 4ZOBA 2R62A 1JIUA 4F4HA 3U4MA 1IBSA 3FUUA 3HGIA 2PUEA 5EY5B 2EYUA 5CEEA 1P2TA 4DLYA 3RUDA 2V6FA 3WISA 1ODKA 3NAGA 1GA6A 1FOEB 4KO3S 3N6XA 1KFKB 3ZY5A 3K16A 1N2EA 3LHSA 4UEKA 4O5OA 4DJFC 2O57A 3U3JA 2CMFA 2ZGVA 4WP2A 2TS1A 1U8XX 3IIKA 4G65A 2ZUTA 5FPPA 5KYGA 3USCS 4C3VA 221PA 1UKYA 4AWAA 4JN6B 1O3YA 4C5AA 2L7HA 3WAJA 2YOFA 3PKIA 4FBLA 4YMIA 2R25B 4N3NA 3L6CA 3HCWA 1AB6A 5JCJD 1L4LA 3EBLA 4YLYA 1N33B 4C3OB 3ZV4A 5A1JA 3M4JA 2ISQA 2RARA 4F4CA 2HQSA 4HEA1 1CERA 3DTTA 4AX8A 2B92A 3U37A 1SVLA 3GVIA 4MUHA 2ZB3A 3KSUA 2ZTHA 4A8JA 1GZSA 2VJPA 2OZPA 5F51A 1P5ZB 3G6KA 1LWOA 4DA8A 2BHTA 3ACDA 2P4SA 1U0BB 5EIXA 2H5IA 3I0ZA 3VSDA 4LF9B 3EWSA 3G2HA 2BGIA 2QP4A 2WHQA 1OAKA 2X4DA 2SKDA 3PC8C 2J3MA 2VDMB 3CEMA 1M83A 3VZDA 3HCFA 3B7NA 4LZPA 1E7YA 1VJGA 4DLXA 1CR0A 1PJ8A 1JG1A 1L1FA 2OVBA 3TI7A 4OY3A 5HHTA 3Q98A 4H1HA 4XH9B 5BMVF 4POAA 3GGPA 2CMKA 1RI5A 1M72A 2O2CA 4JLNA 4DGQA 2HLHA 2DKNA 3UWPA 1QH0A 3I12A 4L1KA 3PNKA 3EIXA 4Q21A 3NT5A 3VI4B 4XASA 3AZOA 1RPNA 3GLGE 4PR3A 3STYA 2DG2A 1HL7A 3OMXA 2E4AA 2L2DA 3LS2A 2XIJA 1QFXA 2YFYA 3ZJ5A 1TZMA 3E23A 5E4JA 2QVYX 4EMBA 3UK6A 3QEOA 4IBCA 1KMQA 5HDBB 1RYDA 3MGGA 2J0UA 5HIAA 4R1TA 3GAMA 4CDGA 4P22A 4MCJA 1E2GA 4K87A 4W7HA 4WAUA 2OPBA 3I6BA 3O82A 4NYJR 2ZUBA 3UBTA 4JUBA 3U4QA 1FJ2A 4EHNA 1JALA 5DHPA 1L7QA 5CLLA 2YYYA 3D8BA 3GFRA 5GWXA 4D8VA 1NJ8A 3G8CA 4N5HX 2FRVA 3EXFB 2AI3A 2FFAA 3B70A 1M6WA 2R47A 3IDOA 4CU5A 2OO3A 4HAVA 2CNNA 1AX9A 1KQOA 3ICCA 5HQ3A 4EG7A 3OCVA 1ZCZA 5LP6C 2WSYB 3THYA 3DB1A 4NHEA 1XRPA 1FZQA 1LSSA 3C3MA 2RSLA 4MVJE 1VDMA 4TWIA 3C5CA 1ETUA 1D4ZA 1T9GS 3A6GA 4KUEA 4BBJA 4D8YA 3EOAI 5JDIA 2FQQA 2R7LA 4BDSA 1T9GR 1KKLA 1Y4AE 5CAEA 1YK0A 1TKBA 4R31A 2EUCA 3H0CA 3JQ7A 1QDRA 1J8VA 1VRVA 3PNVA 2IH2A 5IANA 4YT5A 1NBMA 4MV9A 3UJBA 2J0EA 3ED5A 3A10A 3RF6A 3MD0A 1FUEA 1COWA 2G08A 1HNXB 3UJDA 3A9TA 1MJ5A 4DQ0A 3PGKA 2Q9AA 4ZCMA 3OH8A 3ANMA 4KGXA 5G4KB 4L8VA 1ID8A 5AVJA 3L3BA 4NOLA 4RHUA 4CCAA 1ABFA 6ABPA 3CLHA 4YA6A 1G3IA 3A1DA 4V0LA 4J3NA 3ET4A 2LCFA 2WTUA 3PU6A 1DTSA 4Y6RA 4EF6A 4K9MA 5DZSA 4XD7D 4RSGA 3DE7X 4P4SB 5DX8A 5EUBA 3IUNA 3ZVLA 4C4OA 5KOHB 2Z5LA 5D8DA 1RRMA 4J1SA 3DEZA 1VIVA 3CNEA 2PJZA 5JS7A 3T5MA 4F2LA 5CTJA 2P77A 2X9VA 4DBLE 1EGHA 3AFOA 3OM1A 2GYYA 3NC0C 4R98A 3RYIB 5DGXA 2HSGA 5KCZA 4TMTA 3NJRA 2CFCA 3LFUA 1JDZA 1RXSA 1DVRA 1GGKA 3UAOA 3DZJA 2HMVA 3QVVA 2PX8A 3CRVA 5AM2A 3H5TA 2QROA 1G17A 5H68A 5H8WA 3NHWA 3EIQA 3KSMA 2PSJA 4U0JA 1SWWA 5JHGB 4BFLA 2IEBA 3FDFA 3A6HA 5BV8A 4BDTA 1X87A 3HJUA 2VN8A 1BCRA 4TSRA 4GX0A 9GPBA 5I9SA 1RLOA 2AEMA 5CFQA 3BF8A 1YFZA 3WRWA 5BWBA 4UPDA 5DF1A 4G8CA 3U4GA 5FPHA 1N32B 2OQIA 1HLFA 3VTKA 5GVRA 2IX3A 3HYTA 2Q4BA 3JYLA 3UFXB 2Z2JA 3AUFA 2EA0A 4ZT7A 4JVMA 3F7NA 2EQAA 2VSOA 3GIWA 4HVTA 2R751 2FOIA 2IYXA 1MW9X 2PPLA 2VPPA 1MIHA 4N48A 3UTCA 2QMYA 4KBYA 2C2HA 3OOJA 3DLAA 2IEYA 2FY8A 1JYSA 1FFGA 3U2QA 1KJJA 3TQCA 3WAKA 2X2FA 3IUJA 2H5LA 1BSVA 3ORQA 2VTVA 4MARA 4O2RA 5FLKA 4B3SB 2B9VA 1A96A 3F3KA 2PMDA 1OGJA 4HGNA 4CIXA 3NUZA 5DASA 4LXUA 1WKCA 2JGAA 4Y1FA 1OGIA 3IQWA 1OAOA 3EY4A 2PLFA 4XEHA 1WCV1 5JJCA 2WAXA 3AK4A 4YP6A 3ORFA 5CX1B 3HSSA 4ER3A 4I7EA 3VUFA 3PDJA 3ULKA 3HA3A 4P3KA 2PZJA 1F17A 3PUVA 1UMCB 3C1UA 1T13A 1OFUA 5TPZD 3M5CA 4OHKA 5AKXA 3FPFA 1SAYA 4TMXA 4RPGA 4J6EA 4PZ0A 1JEJA 4GKJM 4JWKA 1VL1A 2JY6B 1K63A 3SC2B 1DCMA 1ZJ4A 1U2GA 1ZPDA 2J32A 1Z15A 1EVQA 3JR5A 3SEQA 3D5EA 4N7RA 1KMIY 4DYDA 4MQ4A 5F4ZA 3ERCA 3TMYA 2Y0PA 3BGOS 3PR2B 3UT5B 1Z33A 1SIOA 2W83A 2EKLA 3C6MA 5K0FA 5KSPA 3NV7A 4M9CA 2IHNA 3JTMA 4FDVA 1NF9A 4DPLA 1W8DA 1JR3A 1ZMOA 4QU8A 2GLUA 3ZU5A 1ZL2A 1QAQA 2Z3ZA 1SC3A 3U9LA 2AFHB 3V2HA 3CBQA 1OV4A 2XQGA 4IF6A 4G81A 2PX3A 1TJ4A 1O94D 5FTLA 3IECA 3J7AS 2Z09A 2FZKA 4BC0A 1K2VN 1Y3BE 1HKUA 4J2HA 1CZHA 2XUPA 3GLFB 3PJGA 3F6YA 2CCGA 2V9ZA 2O9JA 3SASA 4ZEXA 2XGSA 2VP9A 5CT5A 4RNCA 3B7WA 4IJKA 2ZSBA 3WYGA 2ZE8A 2LVQD 2UZAA 4ICIA 1ZMBA 1D0SA 1LDNA 1H9CA 4D9HA 1MU0A 4HX2A 2K7FA 2JCVA 1PX0A 3NIWA 1R8YA 4RSHA 4TN1A 1IZ7A 1KJIA 4H7EA 4F6RB 2GCOB 3OIDA 2P9YA 1D7AA 3RSHA 1GEGA 5FPKA 3KTFA 4JQZA 4BGVA 5IH3A 5LJLA 3CH5A 5EWMA 2M5ZA 4ND8B 1JE0A 1GABA 2PUWA 4OVKA 1P2FA 2ZYUX 4FOOA 2OBNA 1LSJA 1DB3A 4XAQA 2J5KA 4QTXA 1S9DA 4BVKA 4PE5B 2AK2A 2BGJA 1Z2OX 2GD0A 4G4RA 1U4SA 4K8OA 5CLIA 3O0DA 5F1OA 2H1HA 4RTPA 1O6BA 4MDYA 4LXHA 3A1TA 2QG4A 1U1EA 1OXSC 4B2PA 2JRLA 2F3SA 4GDMA 1NBOA 3VDRA 4N4AA 3CZQA 3OT1A 2W2NA 1PLJA 2H2GA 1VMDA 1X0VA 4NMMA 1ZD9A 2C5AA 3PGA1 1CUIA 1K6IA 1XZKA 2JANA 2FHPA 3LE8A 4B7UA 1KQ3A 4I50F 4NWIA 5JNVA 2I8CA 2NO0A 4E88A 2FE8A 3HJSA 5FUYA 3DE2X 2FG7C 2B83A 3KOUA 1TM2A 4OX9M 5A4KA 1N5RA 1T10A 2DTEA 3Q40A 3WYNA 3IAS1 4JNCA 2ZCVA 4F7WA 4TV8F 4RGBA 1RJGA 3ASVA 5A4FS 1XZ8A 3EGEA 1J21A 3GLSA 4MQEB 3R7DA 4PR0A 1OH6A 2W98A 2I62A 3ROZA 3B6JA 1C1DA 3AGPA 5D86A 1YE9A 1GA4A 4FDAA 3EYAA 4F4UA 2BKVA 3KHUA 3UAVA 4OHWA 5DRTA 1V5FA 2G5GX 4IHJF 1ZQ9A 1J33A 1NJ2A 2FXVA 4WFKA 4FDUA 4YLGA 1F4VA 5JNWA 1WKBA 3MUNA 1YR7A 5DW0A 1RYEA 1JB1A 4KQ9A 4QTZA 3AZQA 3JQCA 3ZI7A 4AIRA 2Y1OA 5C3MA 1R74A 5JSKA 1G2OA 3RC8A 3TD9A 4OU4A 4QM6A 3PRKE 4PGMA 2HGZA 5SICE 3C7AA 1RRPA 2C3MA 2HRQA 3L7CA 1E3SA 5KQDA 1M8KA 4Y0AA 1QJCA 3Q3IA 4DLUA 2V7TA 2IP2A 2G28A 3EVCA 5CB4B 3P2KA 2XWPA 2Q1UA 1N2OA 4EEXA 4A0FA 1W47A 4RXTA 3QJGA 2PGXA 2ZULA 4Y2QA 4IOKA 1V7ZA 1XAJA 1X39A 3CX4A 3EZ2A 2Y9PB 1KETA 2AX4A 2J3IA 2VAVA 2PGNA 3L7DA 4F4DA 5G3ZA 2RGDA 4MRAA 1EFUB 2DP4E 4KKXB 4FSDA 1N2CB 3DHNA 4QXQA 2ZRPA 4B4UA 1YSYA 4CGZA 2I1LA 3ZJYA 4L8LA 4R3WA 1A8SA 3RTCA 2VZLA 4NCJA 3CGGA 3BWCA 3IKVA 3HKBB 4IUCS 1NV8A 1AHPA 5DP2A 5K9ZA 4DIEA 4EUFA 1QE3A 3L7LA 3QGMA 1P9NA 3ZK8A 4R2JA 4ALIA 3DFUA 3CUTA 3UKDA 3G7SA 1UP6A 2BELA 2I2DA 2IUUA 4BV2A 1FRNA 3FZEA 2VHCA 2H92A 2VCHA 3GXOA 2X5NA 3M89A 5ILQA 1EA5A 4NCXA 3LSYA 4DV5M 2QJTA 2I22A 4RH0A 1JXQA 1FUUA 2IHVA 1ZD8A 4BCBA 4BFXA 4UQPA 5C81A 4R9SA 2JLRA 2ZWPA 4AT1A 2O54A 1ZKMA 3WOVA 4NCBA 4J90A 3DDCA 3TMKA 1ISRA 5HQTA 1TQ4A 2W90A 4IBGA 4CMJA 3QWLA 4NV0A 3LW5F 1RJWA 3GPPA 2C4TA 2O1WA 3G1TA 3ZC3A 3C3BA 2FHSA 4DWVA 4LBVA 1PEYA 4ENPA 4XD2A 1Y8QA 3T1YM 1M34E 2ZTSA 5IRCD 3MD9A 3G0OA 4TZKA 3TLBA 4WOJA 2ZZMA 4FVTA 1M2VA 1B0AA 5IJWA 3IHTA 5KREA 1M8PA 1J2YA 1XZPA 2VF7A 3EQ2A 1U7OA 3STTA 4DNOA 1OWLA 1I2ZA 3TAHA 4JASB 1SKBA 3NFRA 1CR2A 2WJPA 5L40A 3ABOB 4PLYA 3PFIA 5ERGB 3KSAC 4BFYA 2NU9A 2PO7A 4OLBA 5ER6A 1VJ1A 2GWHA 3EB9A 3BICA 2VBIA 1GL7A 2ZOSA 4AQ7A 3INGA 2ZIEA 2CUKA 3RTEA 4L3VA 4CEJB 1DRUA 1T8YA 4L5JA 1ZH2A 4ZALA 8LDHA 1D0IA 1NFQA 1AUVA 2P9TA 1RHJA 3PI6A 4EAAA 4D1YA 4MX8A 4NRWA 3C14C 1QZXA 3RG2A 2Z2YA 3G79A 4OOFA 1CPYA 3W3ZB 3D7LA 3FMFA 5EIHA 1KPIA 1GJSA 4IJMA 3MRSA 2ZITA 2WF8A 4HQNA 5F2NA 1ZOOA 4IHQA 3EOZA 4G9GA 5E0KB 1A9XB 3LKZA 5F5NA 4LS3A 1QH9A 2CLKB 1NLFA 1RPTA 3H8VA 3CTWB 3RV3A 4U4AA 1V96A 3FSJX 1XTPA 2VJCA 2CMDA 1ZVKA 3QYFA 4G4GA 2PSDA 2RGGA 3U4CA 3R3XA 4AZ0A 1PZGA 3THOA 1USUA 1ECBA 4F46A 3DKKA 4L07A 4OJYA 5KPZA 3AINA 4OB8A 2TRSB 2VZ0A 2PNFA 1FU7A 2DETA 1SEPA 3H1GA 5JRJA 1G5PA 1AHNA 5IUNC 1QRSA 3K09C 4FQ5A 4ZWNA 4HQLA 2ZYTX 5DTEA 3MRVA 3VKUA 3QVTA 2F1OA 1DL5A 3O95A 2DWMA 4I55F 4RTOA 1PJJA 1XVTA 4C29A 3NM6B 5EHIA 4P32A 4OVZB 1XJCA 3EXHB 2XF8A 4HLUC 5DBIA 5KDOA 4JJFA 2WSSD 3KB1A 3SPXA 3OZXA 1H0SA 4FXOA 2ZQ5A 1GNSA 1YB6A 3WRYA