2DZNB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
b'MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 17
structure length 57
sequence length 57
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dznB00
4FCVA 1G3IA 4LJ8A 5FTLA 1IY2A 1SXJD 1E94E 1IM2A 5FTNA 2C9CA 3PFIA 4LY6A 3DZDA 2R65A 3EIEA 3GLHA 4GITA 4QHSA 2R62A 3GLFB 4Z8XA 1IN7A 2KRKA 4FD2A 2DHRA 1G41A 3B9PA 5EQTA 5EXTA 1IN5A 3CF2A 2QENA 2DZNB 3MHVC 4A3VB 3K1JA 1XWIA 4LJAA 1OJLA 3KDSE 1DO2A 3GLGB 5EP3A 3KW6A 1IY0A 1XXHA 3U60B 2QP9X 4LJ4A 4LGMA 1SXJC 3H4MA 3WHLA 3VLFB 1DO0A 1SXJA 4WW0A 1FNNA 4LJ7A 3M0EA 3GLGA 2C99A 5EP2A 5JI2E 2XSZD 2Z4RA 4QHTA 1R7RA 1LV7A 4LJ6A 3SC3A 3U61B 3AJIB 1NSFA 4L15A 4KO8A 2ZANA 2V6ZM 2ZAMA 3BOSA 4FCTA 1NJGA 1KSFX 4D82A 1IXZA 3SYKA 1E32A 4D80A 5EXSA 1XXHB 2C98A 2CHVA 4L16A 2QPAA 1IQPA 1X37A 1G4AE 5DYIA 5FTJA 1IN6A 1SXJB 2DZOB 3HWSA 4QOSA 4FCWA 1QVRA 2DWZB 4QNMA 5EP1A 2QBYB 1IXRC 1KYIA 3GLIA 2Z4SA 4QNRA 3EIHA 1J7KA 5C1BA 4FWHA 1JR3D 1OFHA 2V1UA 3SYLA 1HT1E 3PVSA 1IY1A 2FNAA 2QBYA 4KODA 2CHGA 2XSZA 3HU1A 3HU2A 2RKOA 4LJ5A 1SXJE 4LRTA 2DVWB 3PXGA 3GLIB 5EP4A 3D8BA 1D2NA 4L4UA 1UM8A 1HQCA 1C1KA 1L8QA 3VFDA 2X8AA 2CEAA 1NVMA 1W5TA 4I81A 4D81A 4I4LA 3U5ZB 4KLNA 1HT2E 5DYGA 1NJFA 5FTMA 3HU3A 1HQYE 1JR3A 2CE7A 1IXSB 4ZPXA 4LCBA 3ZH9B 3WHKA 4FWDA 5C18A 4FW9A 3R8FA 1NY5A 1QZMA 2QZ4A 1R6BX 4EIWA 1IN4A 2C9OA 2VIIA 1S3SA 2HCBA 2BJVA 2ZAOA 4LRSA 2BJWA 2CHQA 5EXPA 5FTKA 5JI3E 1IN8A 3CF0A 1OFIA 1JQJC 4JN6A 3GLFA 4LJ9A 5EXXA 3UK6A 3M6AA 4FWGA 2C96A 1W5SA 1NY6A 3GLHB 4LZZA
chains in the Genus database with same CATH superfamily
3F92A 3W0FA 3SAWA 3IHPA 4B7HA 2R0IA 4LJ8A 3UJNA 3RE8A 3LW5F 3JR4A 1L2DA 5KPZA 3AOEC 3HJ8A 3KS4A 3GQ4A 4LY6A 1Q39A 2LTUA 2MGWA 4I5SA 3LQRA 3QYEA 2K6BA 3HY5A 4NSOB 3SBJA 2R62A 3GLFB 2Z3XA 4Z8XA 1IN7A 3CTWB 2J7NA 4BBAA 3AV0A 4CHTB 5EQTA 3U6OA 2I7NA 3CF2A 3FE3A 2F4VM 3MHVC 2DENA 2CV2A 3L25A 1MJGM 3KP0E 1XB2B 4MGYE 4DV5M 1GLNA 2DAEA 3KDSE 1DO2A 1YSYA 3HHYA 3UMMA 2JXNA 5ITYA 4HEOA 1R5LA 2R18A 1IY0A 3U60B 2M60A 4GC9A 5IZ7D 1IBKM 1VDLA 3C58A 1HNZM 2P5TA 5ITXA 2XEPA 3RFWA 1T3TA 1OKSA 2UXDM 3VLFB 1J5EM 2DHYA 3KOZE 2O5RA 2VF8A 3NBXX 4LJ7A 3SFZA 5GKNA 4BLCA 1E9SA 1PGYA 3KOXE 1D0MA 2XSZD 5JI2E 3GLGA 3D8LA 4II7A 2JY5A 4LJ6A 4DBGB 2HL7A 4L15A 1ZMWA 3GRVA 2V6ZM 2ZAMA 3BOSA 3FKEA 4FCTA 3VDPA 4KT0F 2CHVA 2K9DA 2KNAA 2QPAA 2CP8A 3GLHE 4X65M 1IQPA 4YHHM 2K0BX 3T15A 3SHGB 2DNAA 3SATA 4B3MM 4NRVA 1N34M 2LH0A 2N35A 4R3DA 2D7EA 3L29A 1IXRC 1VG5A 3LVVA 3LMMA 3EIHA 1J7KA 3E4RA 4JI3M 4YY3M 2VF7A 3TWLA 2Y0QA 1EIJA 2GNOA 2D7HA 4DR5M 2UU9M 1WR1B 2JNHA 4I8OA 2YR0A 3HX3A 4XK8F 1T43A 4LG2A 2HWJA 4P17A 4DUYM 4DV7M 3U6LA 1XNRM 2KDLA 1SXJE 2L6OA 2LHGA 1H6UA 1Y8GA 2DVWB 3GRRA 1J09A 3PXGA 3SARA 2YFQA 3MK6A 4AQYM 2F5NA 4DUZM 4L8RC 2YNMD 3U6QA 2XFSA 4GHLA 2H5XA 2LVOC 2Z7JA 4AKGA 4W5WA 3KFUG 1K3WA 2CEAA 1NVMA 2QSFX 1QYRA 2UUCM 3R9XB 2UXBM 5DYGA 2UXCM 3SMPA 4WURA 1HQYE 1JR3A 1LTMA 2JY6B 4S12A 4G3OA 3ZH9B 1GKIA 4GRIA 1C7YA 2DZLA 3I04M 5C18A 4FW9A 2F5OA 1OAOC 3GPYA 3TE6A 1WGLA 4EIWA 2JY8A 1XNQM 5KPRA 1ORYB 1UFZA 4RF1A 1IXSA 3GRUA 2ZM6M 2BJWA 5EXPA 3KOYE 4JI0M 3BBZA 4CIZA 4G4QA 1OFIA 1JQJC 2XFTA 2DWLA 1CUKA 4LF7M 1Q02A 4CGYB 2OOAA 3KW6A 3GLHB 4FCVA 4LGYA 2OQ4A 1G3IA 1L1ZA 1Z5CA 4BB9A 1HNWM 3J81S 5FTLA 1RU3A 4OU7A 2Q2EB 2R46A 4DR7M 1E94E 2BWEA 1V34A 1IM2A 1ZMUA 2JA2A 1GVNA 2MJ5B 4GH9A 4HLQA 2LVNC 2O01F 5DFLA 1AUAA 3JAMS 2FS1A 3T1YM 4IBGA 3C3EA 4AG6A 2E5LM 1G41A 1XMQM 1Z5BA 1GO5A 1IN5A 4JI6M 1WXQA 3A42A 3C9PA 3U61A 2EUCA 4OW0A 4OVZB 3FTFA 1HNXM 1GJSA 2VQFM 2X4AA 5F3WA 2QP9X 2UUAM 4NL4H 3GPPA 4LGMA 1QUSA 3L27A 4IJEA 3H4MA 3WHLA 3CGWA 4IBIA 4GIPA 1FNNA 2XF3A 3A46A 1P3QQ 3M0EA 1NNUC 2G8LA 1E9RA 3SAUA 2Z4RA 3JR5A 1F4IA 1N75A 3AOEA 1NO1A 3U60A 3U61B 4G4RA 3AJIB 4KO8A 2ZANA 4JI8M 5ITRA 1L1TA 4D82A 3TWMA 1E32A 1YE9A 3J80S 1VDDA 2ZBKB 1XC8A 2RGOA 4P16A 3SASA 3AL0C 1X37A 1G4AE 5DYIA 3SAVA 1QDTA 4F1IA 2DXIA 4JI2M 3T1HM 1QVRA 2G5GX 4TUWA 3J7AS 5EP1A 3L28A 5E26A 1A5TA 1PJSA 1QAMA 2OO9A 3KP1E 3GPXA 4LFBM 3NWLA 1JR3D 3QWLA 3SHFA 4DV1M 1OFHA 3DA1A 3FYCA 4B08A 1HT1E 4B3TM 2D7GA 3ILKA 2DAGA 3B7NA 2FNAA 2LBCA 4NC6A 2JUJA 1NHWC 1BVSA 2EO2A 1XXHE 5KQDA 3GP1A 2YQZA 4B3SM 1MX0A 1Z6TA 2DWNA 2QQ8A 4JV5M 3E46A 5BPVA 2CV1A 4L78A 3KVWA 3B89A 4JYAM 4GHAA 1GL7A 1Q3CA 5KPTA 2J7OA 3LCVB 1N33M 2L4EA 1UM8A 3HHXA 2VDBB 2BWBA 5EJCA 1L8QA 3GQ3A 3FRIA 4AZFA 4K0KM 4I4LA 2VQEM 4LFAM 1VQ1A 2I7PA 4IBEA 5FTMA 5A2QS 4Y28F 4MB7A 4ZPXA 1DGGA 1OIZA 3THGA 1Z5AA 3BXWA 2MR9A 1OIPA 2KZSA 2XGNA 1XHBA 2R4JA 1QZMA 2DAMA 2QZ4A 2CV0A 3DFZA 1FJGM 1IN4A 2DAIA 3FYDA 2VIIA 4MGKE 3I51A 4LRSA 3GO8A 4B3RM 5JI3E 4ANRA 1G59A 2OOBA 4MGIE 2FOIC 1IN8A 2F5SA 3E9SA 1D0KA 1Z59A 3B7ZA 4JN6A 3AFHA 4XBOA 3T6PA 5EXXA 2KNVA 2XH9A 3IG8A 4LZZA 4LF4M 2WSFF 3L26A 2LVQD 7CATA 3U6SA 3DOAA 2KZUA 1IY2A 1NV8A 5ITTA 2R6FA 1I4WA 5FLXS 1PRBA 3FD9A 5LMUM 3PFIA 3DZDA 3EIEA 3GLHA 4GITA 1PM5A 1WIVA 3U6CA 4PDIA 3FRHA 5ITQA 1R2ZA 2KRKA 2KEBA 3QYBA 2LVPC 2LVAA 2LHCA 3I01M 5EXTA 2KHHA 3IECA 2QENA 2DZNB 3HGIA 4A3VB 5KO3A 4B7FA 1XWIA 1OJLA 2LXEA 2JZ1A 1PJTA 5EP3A 3OTOM 4G6ZA 3HHWA 1GABA 4LF8M 4PDGA 4M9SA 3FTEA 3LQQA 1L2CA 5LMNM 3L2AA 1OTRA 1SXJC 3GQ5A 3VKHA 4GC5A 2MH8A 1SXJA 2DI0A 1L2BA 4NOOB 3A98B 3KS8A 1V33A 3FTCA 4OVZA 2CRUA 1JB0F 4QHTA 1LV7A 4IBBA 3W67A 3SC3A 4X64M 2R4EA 2UUBM 5H37D 3K92A 3SMSA 3SYKA 5IREB 3ZCBB 2L4FA 2C98A 3PNYA 3Q8XA 5EXSA 1ZV1A 3I4VA 1NV9A 4R71A 5FTJA 3FUXA 1SXJB 2DZOB 3HWSA 4QOSA 4M9XA 4FCWA 1AIPC 3HKPA 3VDUA 2WZJA 4QNMA 2QBYB 4NXMM 2KW0A 1PJIA 4M0WA 1WGNA 2Z4SA 4QNRA 2F5PA 4ITQA 1TTEA 4MH0E 3I4YA 2XZFA 4FWHA 4CJ6A 4GKKM 3PVSA 1IY1A 4GMQA 4UN2B 1OQYA 3FUVA 4XGIA 3FUUA 4DV0M 2RGHA 1Q3BA 2CHGA 3T38A 1GJTA 1V92A 5ITXE 2MROB 1KFVA 3HU2A 2RKOA 1K3XA 3GRYA 3GLGE 4M9ZA 1IBLM 2JWSA 3KOWE 4DV2M 4B7GA 1HJPA 3M7GA 3Q8GA 5EP4A 2W82A 1D0LA 3K2LA 4IBFA 3D8BA 4MGHA 3U6PA 2O25A 3VK8A 2KNZA 1D2NA 4L4UA 3V76A 1HQCA 1C1KA 1G71A 2K47A 4G4NA 2X8AA 1W5TA 2LWXA 4D81A 1HT2E 2EJSA 1NJFA 5KQ8A 3HU3A 1YUBA 1DGBA 1WHCA 3J2PB 2JY7A 2QNJA 3B7QA 3RGSA 4JI5M 2ZTCA 3FTDA 2X49A 3MMPA 4LF5M 4Q7JA 3UZUA 4PD2A 4IJFA 3R8FA 1NY5A 3PNVA 3TPZA 5DNYA 1N32M 2H1RA 2KRUA 1R6BX 4REZA 1S3SA 2HCBA 2BJVA 2L09A 3GPUA 5FTKA 4DR2M 4Z6YA 4AKIA 1TF0B 3ZC7B 3K9OA 1QUTA 4LJ9A 2FE8A 1WJ7A 3HZJA 3CF6E 4WP2A 3TQSA 4FWGA 3UK6A 2C96A 1W5SA 3W0LB 2C5RA 2F5QA 3VKGA 3LCUA 2V1CA 2ZTDA 1EFUB 1SXJD 3J27B 2FH0A 5FTNA 2C9CA 2ERCA 4IBJA 4DR1M 3U6DA 1QANA 2KXEA 3GLIE 1XMOM 1TDZA 2R65A 1TH2A 1G8PA 1ZAEA 3TL4X 1DGFA 1JR3E 1ZQ9A 3IG5A 4PT5A 4NRWA 4QHSA 1K82A 2Y0TA 1TH3A 1YLAA 2EKFA 2QCUA 2CFOA 2R44A 3TWKA 4FD2A 2DHRA 5IT9S 3B9PA 4AI6A 1MN3A 1PJQA 4LF9M 2LNHC 3K1JA 4LJAA 1QZEA 3RGPA 4LZJA 2KA6B 4KHPM 3GLGB 1I94M 1VEKA 3KSJA 4AKHA 3E21A 1NHGC 4DV6M 1XXHA 3FUTA 1VEJA 2FFJA 4LJ4A 2WSCF 2DAKA 4G4OA 4JXJA 3U6EA 1DO0A 4LFCM 1QQWA 3U6MA 4WW0A 1PJJA 3UGJA 4JI7M 3LVWA 4IBKA 1VEGA 1QAOA 2C99A 1NNJA 1R4GA 5EP2A 4IIWA 1QDRA 4GEWA 1N36M 4M0DA 1R7RA 4IBCA 2Y21A 1NSFA 2CUZA 3FUWA 1QAQA 3H4JA 3KSXA 4IBDA 4MGZE 1NJGA 5BR8M 4DV4M 2AHMA 1KSFX 4RNAA 3K9PA 4R7GA 1IXZA 2B3TA 4D80A 4RF0A 5IWAM 1XXHB 3K8ZA 4L16A 2NQ8C 3KXEC 4FVMA 2GQFA 4DR3M 3QAUA 4JI1M 2DWMA 1IN6A 3AOGA 3ZQJA 1R2YA 2DWZB 1KYIA 2XLJA 3GLIA 1HR0M 4DV3M 1TGUA 4X66M 5C1BA 4AW4A 2OPFA 1IBMM 2V1UA 3SYLA 1SG9A 3GLFE 1GL6A 3HJQA 2XZUA 2L7IA 2M5ZA 2QBYA 4KODA 2BNKA 3MJ5A 3U5ZA 2XSZA 1DGHA 1MU5A 2JZ0A 4AG5A 3HU1A 4DR4M 1TH4A 4NSRA 1IFYA 2APLA 2CWBA 4LJ5A 4NXNM 1EE8A 4LRTA 5ITUA 3A45A 5E6JA 4MM3B 3AKZA 3NBIA 3GLIB 4F2LA 1T6OA 3J7BA 4RKUF 5L8RF 2Y20A 4L6V6 2G3QA 3HHZA 3VFDA 2L2DA 5FSWA 4I81A 4PCZA 3U5ZB 2L7HA 4KLNA 1DGHB 2HKJA 1TDHA 3B74A 4CISA 2CE7A 1IXSB 4LCBA 3WHKA 4HL4A 4X62M 4FWDA 1TR8A 2HHHM 2J5YA 8CATA 2EA0A 4LF6M 1N77A 1OAIA 2C9OA 3VK7A 2ZAOA 2WSEF 2HAKA 2R45A 2CHQA 3W68A 2RRUA 2JP7A 3C3DA 3CF0A 4QOZC 2Z8YM 4OX9M 2A5YB 1N78A 1DV0A 2QHOB 3GLFA 2DKLA 3HJSA 3M6AA 1ZMVA 2EKKA 4JI4M 4DR6M 4GKJM 1NY6A
chains in the Genus database with same CATH topology
3W0FA 3SAWA 4B7HA 3UJNA 4LJ8A 3RE8A 3JR4A 1L2DA 5KPZA 3AOEC 3HJ8A 3KS4A 3GQ4A 4LY6A 1Q39A 4I5SA 3LQRA 3SBJA 4NSOB 2R62A 3GLFB 2Z3XA 4Z8XA 1IN7A 3CTWB 2J7NA 4BBAA 3AV0A 4CHTB 5EQTA 3U6OA 2I7NA 3CF2A 2F4VM 3L25A 3MHVC 2CV2A 3KP0E 4MGYE 4DV5M 1GLNA 3KDSE 3UMMA 1DO2A 1YSYA 3HHYA 5ITYA 2R18A 1IY0A 3U60B 2M60A 4GC9A 5IZ7D 1IBKM 3C58A 1HNZM 2P5TA 5ITXA 2XEPA 3RFWA 1T3TA 2UXDM 3VLFB 1J5EM 3KOZE 2O5RA 4LJ7A 3SFZA 1I94M 3GLGA 5GKNA 4BLCA 1E9SA 3KOXE 5JI2E 2XSZD 3D8LA 4II7A 4LJ6A 2HL7A 4L15A 3GRVA 2V6ZM 2ZAMA 3BOSA 3FKEA 4FCTA 3VDPA 2CHVA 4X65M 4YHHM 2QPAA 1IQPA 3T15A 3SHGB 3SATA 4B3MM 4NRVA 1N34M 2LH0A 4R3DA 2D7EA 3L29A 1IXRC 3LVVA 3LMMA 3EIHA 1J7KA 3E4RA 4JI3M 4YY3M 3TWLA 2Y0QA 2D7HA 4DR5M 2UU9M 4I8OA 2YR0A 4LG2A 4DUYM 4DV7M 3U6LA 1XNRM 1SXJE 2L6OA 1H6UA 2DVWB 3GRRA 1J09A 3PXGA 3SARA 2YFQA 3MK6A 4AQYM 2F5NA 4DUZM 4L8RC 2YNMD 3U6QA 2XFSA 4GHLA 2Z7JA 4AKGA 4W5WA 3KFUG 1K3WA 2CEAA 1NVMA 1QYRA 2UUCM 3R9XB 2UXBM 5DYGA 2UXCM 3SMPA 4WURA 1HQYE 1JR3A 4S12A 3ZH9B 1GKIA 4GRIA 5C18A 4FW9A 2F5OA 3GPYA 3TE6A 4EIWA 1XNQM 5KPRA 1ORYB 4RF1A 3GRUA 2ZM6M 2BJWA 5EXPA 3KOYE 4JI0M 4G4QA 1OFIA 1JQJC 2XFTA 2DWLA 4LF7M 4CGYB 3KW6A 3GLHB 4FCVA 4LGYA 2OQ4A 1G3IA 1L1ZA 1Z5CA 4BB9A 1HNWM 3J81S 5FTLA 4OU7A 2Q2EB 2R46A 4DR7M 1E94E 4DR3M 1IM2A 2JA2A 1GVNA 4GH9A 4HLQA 3T1YM 4IBGA 4AG6A 2E5LM 1G41A 1XMQM 1Z5BA 1IN5A 4JI6M 1WXQA 3A42A 3U61A 2EUCA 4OW0A 4OVZB 3FTFA 1HNXM 2VQFM 2X4AA 5F3WA 2QP9X 2UUAM 4NL4H 3GPPA 4LGMA 3L27A 4IJEA 3H4MA 3WHLA 4IBIA 4GIPA 1FNNA 2XF3A 3A46A 3M0EA 1NNUC 2G8LA 1E9RA 3SAUA 2Z4RA 3JR5A 1N75A 3AOEA 3U60A 3U61B 4G4RA 3AJIB 4KO8A 2ZANA 4JI8M 5ITRA 1L1TA 4D82A 3TWMA 1E32A 1YE9A 3J80S 1VDDA 2ZBKB 1XC8A 2RGOA 4P16A 3SASA 3AL0C 1X37A 1G4AE 5DYIA 3SAVA 2DXIA 4JI2M 3T1HM 1QVRA 2G5GX 4TUWA 3J7AS 5EP1A 3L28A 5E26A 4LFBM 1QAMA 3KP1E 3GPXA 3NWLA 1JR3D 3QWLA 3SHFA 4DV1M 1OFHA 3DA1A 3FYCA 4B08A 1HT1E 4B3TM 2D7GA 3ILKA 2FNAA 1NHWC 2EO2A 5KQDA 4B3SM 3GP1A 2YQZA 1MX0A 1Z6TA 2DWNA 4JV5M 5BPVA 2CV1A 4L78A 3KVWA 4JYAM 4GHAA 1GL7A 1Q3CA 5KPTA 2J7OA 1N33M 1UM8A 3HHXA 5EJCA 1L8QA 3GQ3A 4AZFA 4K0KM 4I4LA 2VQEM 4LFAM 2I7PA 4IBEA 5FTMA 5A2QS 4MB7A 4ZPXA 1DGGA 3THGA 1Z5AA 2KZSA 2XGNA 1XHBA 2R4JA 1QZMA 2QZ4A 2CV0A 3DFZA 1FJGM 1IN4A 3FYDA 2VIIA 4MGKE 3I51A 4LRSA 3GO8A 4B3RM 5JI3E 1G59A 4MGIE 2FOIC 1IN8A 2F5SA 3E9SA 1Z59A 4JN6A 3AFHA 4XBOA 5EXXA 2XH9A 3IG8A 4LZZA 4LF4M 3L26A 7CATA 3U6SA 3DOAA 2KZUA 1IY2A 5ITTA 5FLXS 1I4WA 3FD9A 5LMUM 3PFIA 3DZDA 3EIEA 3GLHA 4GITA 1PM5A 4PDIA 5ITQA 1R2ZA 2KRKA 2KEBA 5EXTA 2QENA 2DZNB 3HGIA 4A3VB 5KO3A 4B7FA 1XWIA 1OJLA 2LXEA 5EP3A 3OTOM 4G6ZA 3HHWA 4LF8M 4PDGA 4M9SA 3FTEA 3LQQA 1L2CA 5LMNM 3L2AA 1SXJC 3GQ5A 3VKHA 4GC5A 1SXJA 1L2BA 4NOOB 3A98B 3KS8A 3FTCA 4OVZA 4QHTA 1LV7A 4IBBA 3SC3A 4X64M 2R4EA 2UUBM 5H37D 3K92A 3SMSA 3SYKA 5IREB 3ZCBB 5EXSA 2C98A 3PNYA 3Q8XA 3I4VA 5FTJA 3FUXA 1SXJB 2DZOB 3HWSA 4QOSA 4M9XA 4FCWA 3HKPA 3VDUA 3JAMS 4NXMM 4QNMA 2QBYB 2KW0A 1PJIA 4M0WA 2Z4SA 4QNRA 2F5PA 4ITQA 4MH0E 3I4YA 2XZFA 4FWHA 4GKKM 3PVSA 1IY1A 4GMQA 3FUVA 4XGIA 3FUUA 4DV0M 2RGHA 1Q3BA 2CHGA 3T38A 5ITXE 1KFVA 3HU2A 2RKOA 1K3XA 3GRYA 1IBLM 4M9ZA 3KOWE 4DV2M 4B7GA 3M7GA 5EP4A 2W82A 3K2LA 4IBFA 3D8BA 4MGHA 3U6PA 3VK8A 1D2NA 4L4UA 1HQCA 1C1KA 2K47A 4G4NA 2X8AA 1W5TA 2LWXA 4D81A 1HT2E 1NJFA 5KQ8A 3HU3A 1YUBA 1DGBA 3J2PB 3RGSA 4JI5M 3FTDA 2X49A 4LF5M 3UZUA 4PD2A 4IJFA 3R8FA 1NY5A 3PNVA 3TPZA 5DNYA 1N32M 2H1RA 2KRUA 1R6BX 4REZA 1S3SA 2HCBA 2BJVA 2L09A 3GPUA 5FTKA 4DR2M 4Z6YA 4AKIA 3ZC7B 4LJ9A 2FE8A 3UK6A 3CF6E 3TQSA 3W0LB 4FWGA 2C5RA 2C96A 1W5SA 2F5QA 3VKGA 2V1CA 1SXJD 3J27B 5FTNA 4DR1M 2C9CA 2ERCA 4IBJA 3U6DA 1QANA 2KXEA 1XMOM 1TDZA 2R65A 1TH2A 1G8PA 1ZAEA 3TL4X 1DGFA 3IG5A 1ZQ9A 4PT5A 4NRWA 4DR4M 4QHSA 1K82A 2Y0TA 1TH3A 2QCUA 2CFOA 3TWKA 5IT9S 4FD2A 2DHRA 3B9PA 4AI6A 4LF9M 2LNHC 3K1JA 4LJAA 3RGPA 4LZJA 2KA6B 4KHPM 3GLGB 3KSJA 4AKHA 1NHGC 4DV6M 1XXHA 3FUTA 2FFJA 4LJ4A 4G4OA 3U6EA 4JXJA 1DO0A 4LFCM 1QQWA 3U6MA 4WW0A 1PJJA 3UGJA 4JI7M 3LVWA 4IBKA 1QAOA 2C99A 1NNJA 5EP2A 4IIWA 1N36M 4M0DA 1R7RA 4IBCA 2Y21A 1NSFA 2CUZA 3FUWA 3KSXA 1QAQA 4IBDA 5BR8M 4MGZE 1NJGA 4DV4M 3U6CA 2AHMA 1KSFX 4RNAA 4R7GA 1IXZA 4D80A 5IWAM 4RF0A 1XXHB 3K8ZA 4L16A 2NQ8C 3KXEC 4FVMA 3QAUA 4JI1M 2DWMA 1IN6A 3AOGA 1R2YA 2DWZB 1KYIA 2XLJA 3GLIA 1HR0M 4DV3M 1TGUA 4X66M 5C1BA 4AW4A 2OPFA 1IBMM 2V1UA 3SYLA 1GL6A 3HJQA 2XZUA 2L7IA 2M5ZA 2QBYA 4KODA 2BNKA 3MJ5A 3U5ZA 2XSZA 1DGHA 1MU5A 4AG5A 3HU1A 1TH4A 4NSRA 4NXNM 4LJ5A 1EE8A 4LRTA 5ITUA 3A45A 5E6JA 4MM3B 3AKZA 3NBIA 3GLIB 3J7BA 2Y20A 3HHZA 3VFDA 5FSWA 4I81A 4PCZA 3U5ZB 2L7HA 4KLNA 1DGHB 2HKJA 1TDHA 4CISA 2CE7A 1IXSB 4LCBA 3WHKA 4HL4A 4X62M 4FWDA 2HHHM 8CATA 2EA0A 4LF6M 1N77A 2C9OA 3VK7A 2ZAOA 2R45A 2CHQA 3CF0A 4QOZC 4OX9M 1N78A 2A5YB 3GLFA 3HJSA 3M6AA 4GKJM 4JI4M 4DR6M 1NY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCV A;  1G3I A;  4LJ8 A;  5FTL A;  1IY2 A;  1SXJ D;  1E94 E;  1IM2 A;  5FTN A;  2C9C A;  3PFI A;  4LY6 A;  3DZD A;  2R65 A;  3EIE A;  3GLH A;  4GIT A;  4QHS A;  2R62 A;  3GLF B;  4Z8X A;  1IN7 A;  2KRK A;  4FD2 A;  2DHR A;  1G41 A;  3B9P A;  5EQT A;  5EXT A;  1IN5 A;  3CF2 A;  2QEN A;  2DZN B;  3MHV C;  4A3V B;  3K1J A;  1XWI A;  4LJA A;  1OJL A;  3KDS E;  1DO2 A;  3GLG B;  5EP3 A;  3KW6 A;  1IY0 A;  1XXH A;  3U60 B;  2QP9 X;  4LJ4 A;  4LGM A;  1SXJ C;  3H4M A;  3WHL A;  3VLF B;  1DO0 A;  1SXJ A;  4WW0 A;  1FNN A;  4LJ7 A;  3M0E A;  3GLG A;  2C99 A;  5EP2 A;  5JI2 E;  2XSZ D;  2Z4R A;  4QHT A;  1R7R A;  1LV7 A;  4LJ6 A;  3SC3 A;  3U61 B;  3AJI B;  1NSF A;  4L15 A;  4KO8 A;  2ZAN A;  2V6Z M;  2ZAM A;  3BOS A;  4FCT A;  1NJG A;  1KSF X;  4D82 A;  1IXZ A;  3SYK A;  1E32 A;  4D80 A;  5EXS A;  1XXH B;  2C98 A;  2CHV A;  4L16 A;  2QPA A;  1IQP A;  1X37 A;  1G4A E;  5DYI A;  5FTJ A;  1IN6 A;  1SXJ B;  2DZO B;  3HWS A;  4QOS A;  4FCW A;  1QVR A;  2DWZ B;  4QNM A;  5EP1 A;  2QBY B;  1IXR C;  1KYI A;  3GLI A;  2Z4S A;  4QNR A;  3EIH A;  1J7K A;  5C1B A;  4FWH A;  1JR3 D;  1OFH A;  2V1U A;  3SYL A;  1HT1 E;  3PVS A;  1IY1 A;  2FNA A;  2QBY A;  4KOD A;  2CHG A;  2XSZ A;  3HU1 A;  3HU2 A;  2RKO A;  4LJ5 A;  1SXJ E;  4LRT A;  2DVW B;  3PXG A;  3GLI B;  5EP4 A;  3D8B A;  1D2N A;  4L4U A;  1UM8 A;  1HQC A;  1C1K A;  1L8Q A;  3VFD A;  2X8A A;  2CEA A;  1NVM A;  1W5T A;  4I81 A;  4D81 A;  4I4L A;  3U5Z B;  4KLN A;  1HT2 E;  5DYG A;  1NJF A;  5FTM A;  3HU3 A;  1HQY E;  1JR3 A;  2CE7 A;  1IXS B;  4ZPX A;  4LCB A;  3ZH9 B;  3WHK A;  4FWD A;  5C18 A;  4FW9 A;  3R8F A;  1NY5 A;  1QZM A;  2QZ4 A;  1R6B X;  4EIW A;  1IN4 A;  2C9O A;  2VII A;  1S3S A;  2HCB A;  2BJV A;  2ZAO A;  4LRS A;  2BJW A;  2CHQ A;  5EXP A;  5FTK A;  5JI3 E;  1IN8 A;  3CF0 A;  1OFI A;  1JQJ C;  4JN6 A;  3GLF A;  4LJ9 A;  5EXX A;  3UK6 A;  3M6A A;  4FWG A;  2C96 A;  1W5S A;  1NY6 A;  3GLH B;  4LZZ A; 
#chains in the Genus database with same CATH topology
 3F92 A;  3W0F A;  3SAW A;  3IHP A;  4B7H A;  2R0I A;  4LJ8 A;  3UJN A;  3RE8 A;  3LW5 F;  3JR4 A;  1L2D A;  5KPZ A;  3AOE C;  3HJ8 A;  3KS4 A;  3GQ4 A;  4LY6 A;  1Q39 A;  2LTU A;  2MGW A;  4I5S A;  3LQR A;  3QYE A;  2K6B A;  3HY5 A;  4NSO B;  3SBJ A;  2R62 A;  3GLF B;  2Z3X A;  4Z8X A;  1IN7 A;  3CTW B;  2J7N A;  4BBA A;  3AV0 A;  4CHT B;  5EQT A;  3U6O A;  2I7N A;  3CF2 A;  3FE3 A;  2F4V M;  3MHV C;  2DEN A;  2CV2 A;  3L25 A;  1MJG M;  3KP0 E;  1XB2 B;  4MGY E;  4DV5 M;  1GLN A;  2DAE A;  3KDS E;  1DO2 A;  1YSY A;  3HHY A;  3UMM A;  2JXN A;  5ITY A;  4HEO A;  1R5L A;  2R18 A;  1IY0 A;  3U60 B;  2M60 A;  4GC9 A;  5IZ7 D;  1IBK M;  1VDL A;  3C58 A;  1HNZ M;  2P5T A;  5ITX A;  2XEP A;  3RFW A;  1T3T A;  1OKS A;  2UXD M;  3VLF B;  1J5E M;  2DHY A;  3KOZ E;  2O5R A;  2VF8 A;  3NBX X;  4LJ7 A;  3SFZ A;  5GKN A;  4BLC A;  1E9S A;  1PGY A;  3KOX E;  1D0M A;  2XSZ D;  5JI2 E;  3GLG A;  3D8L A;  4II7 A;  2JY5 A;  4LJ6 A;  4DBG B;  2HL7 A;  4L15 A;  1ZMW A;  3GRV A;  2V6Z M;  2ZAM A;  3BOS A;  3FKE A;  4FCT A;  3VDP A;  4KT0 F;  2CHV A;  2K9D A;  2KNA A;  2QPA A;  2CP8 A;  3GLH E;  4X65 M;  1IQP A;  4YHH M;  2K0B X;  3T15 A;  3SHG B;  2DNA A;  3SAT A;  4B3M M;  4NRV A;  1N34 M;  2LH0 A;  2N35 A;  4R3D A;  2D7E A;  3L29 A;  1IXR C;  1VG5 A;  3LVV A;  3LMM A;  3EIH A;  1J7K A;  3E4R A;  4JI3 M;  4YY3 M;  2VF7 A;  3TWL A;  2Y0Q A;  1EIJ A;  2GNO A;  2D7H A;  4DR5 M;  2UU9 M;  1WR1 B;  2JNH A;  4I8O A;  2YR0 A;  3HX3 A;  4XK8 F;  1T43 A;  4LG2 A;  2HWJ A;  4P17 A;  4DUY M;  4DV7 M;  3U6L A;  1XNR M;  2KDL A;  1SXJ E;  2L6O A;  2LHG A;  1H6U A;  1Y8G A;  2DVW B;  3GRR A;  1J09 A;  3PXG A;  3SAR A;  2YFQ A;  3MK6 A;  4AQY M;  2F5N A;  4DUZ M;  4L8R C;  2YNM D;  3U6Q A;  2XFS A;  4GHL A;  2H5X A;  2LVO C;  2Z7J A;  4AKG A;  4W5W A;  3KFU G;  1K3W A;  2CEA A;  1NVM A;  2QSF X;  1QYR A;  2UUC M;  3R9X B;  2UXB M;  5DYG A;  2UXC M;  3SMP A;  4WUR A;  1HQY E;  1JR3 A;  1LTM A;  2JY6 B;  4S12 A;  4G3O A;  3ZH9 B;  1GKI A;  4GRI A;  1C7Y A;  2DZL A;  3I04 M;  5C18 A;  4FW9 A;  2F5O A;  1OAO C;  3GPY A;  3TE6 A;  1WGL A;  4EIW A;  2JY8 A;  1XNQ M;  5KPR A;  1ORY B;  1UFZ A;  4RF1 A;  1IXS A;  3GRU A;  2ZM6 M;  2BJW A;  5EXP A;  3KOY E;  4JI0 M;  3BBZ A;  4CIZ A;  4G4Q A;  1OFI A;  1JQJ C;  2XFT A;  2DWL A;  1CUK A;  4LF7 M;  1Q02 A;  4CGY B;  2OOA A;  3KW6 A;  3GLH B;  4FCV A;  4LGY A;  2OQ4 A;  1G3I A;  1L1Z A;  1Z5C A;  4BB9 A;  1HNW M;  3J81 S;  5FTL A;  1RU3 A;  4OU7 A;  2Q2E B;  2R46 A;  4DR7 M;  1E94 E;  2BWE A;  1V34 A;  1IM2 A;  1ZMU A;  2JA2 A;  1GVN A;  2MJ5 B;  4GH9 A;  4HLQ A;  2LVN C;  2O01 F;  5DFL A;  1AUA A;  3JAM S;  2FS1 A;  3T1Y M;  4IBG A;  3C3E A;  4AG6 A;  2E5L M;  1G41 A;  1XMQ M;  1Z5B A;  1GO5 A;  1IN5 A;  4JI6 M;  1WXQ A;  3A42 A;  3C9P A;  3U61 A;  2EUC A;  4OW0 A;  4OVZ B;  3FTF A;  1HNX M;  1GJS A;  2VQF M;  2X4A A;  5F3W A;  2QP9 X;  2UUA M;  4NL4 H;  3GPP A;  4LGM A;  1QUS A;  3L27 A;  4IJE A;  3H4M A;  3WHL A;  3CGW A;  4IBI A;  4GIP A;  1FNN A;  2XF3 A;  3A46 A;  1P3Q Q;  3M0E A;  1NNU C;  2G8L A;  1E9R A;  3SAU A;  2Z4R A;  3JR5 A;  1F4I A;  1N75 A;  3AOE A;  1NO1 A;  3U60 A;  3U61 B;  4G4R A;  3AJI B;  4KO8 A;  2ZAN A;  4JI8 M;  5ITR A;  1L1T A;  4D82 A;  3TWM A;  1E32 A;  1YE9 A;  3J80 S;  1VDD A;  2ZBK B;  1XC8 A;  2RGO A;  4P16 A;  3SAS A;  3AL0 C;  1X37 A;  1G4A E;  5DYI A;  3SAV A;  1QDT A;  4F1I A;  2DXI A;  4JI2 M;  3T1H M;  1QVR A;  2G5G X;  4TUW A;  3J7A S;  5EP1 A;  3L28 A;  5E26 A;  1A5T A;  1PJS A;  1QAM A;  2OO9 A;  3KP1 E;  3GPX A;  4LFB M;  3NWL A;  1JR3 D;  3QWL A;  3SHF A;  4DV1 M;  1OFH A;  3DA1 A;  3FYC A;  4B08 A;  1HT1 E;  4B3T M;  2D7G A;  3ILK A;  2DAG A;  3B7N A;  2FNA A;  2LBC A;  4NC6 A;  2JUJ A;  1NHW C;  1BVS A;  2EO2 A;  1XXH E;  5KQD A;  3GP1 A;  2YQZ A;  4B3S M;  1MX0 A;  1Z6T A;  2DWN A;  2QQ8 A;  4JV5 M;  3E46 A;  5BPV A;  2CV1 A;  4L78 A;  3KVW A;  3B89 A;  4JYA M;  4GHA A;  1GL7 A;  1Q3C A;  5KPT A;  2J7O A;  3LCV B;  1N33 M;  2L4E A;  1UM8 A;  3HHX A;  2VDB B;  2BWB A;  5EJC A;  1L8Q A;  3GQ3 A;  3FRI A;  4AZF A;  4K0K M;  4I4L A;  2VQE M;  4LFA M;  1VQ1 A;  2I7P A;  4IBE A;  5FTM A;  5A2Q S;  4Y28 F;  4MB7 A;  4ZPX A;  1DGG A;  1OIZ A;  3THG A;  1Z5A A;  3BXW A;  2MR9 A;  1OIP A;  2KZS A;  2XGN A;  1XHB A;  2R4J A;  1QZM A;  2DAM A;  2QZ4 A;  2CV0 A;  3DFZ A;  1FJG M;  1IN4 A;  2DAI A;  3FYD A;  2VII A;  4MGK E;  3I51 A;  4LRS A;  3GO8 A;  4B3R M;  5JI3 E;  4ANR A;  1G59 A;  2OOB A;  4MGI E;  2FOI C;  1IN8 A;  2F5S A;  3E9S A;  1D0K A;  1Z59 A;  3B7Z A;  4JN6 A;  3AFH A;  4XBO A;  3T6P A;  5EXX A;  2KNV A;  2XH9 A;  3IG8 A;  4LZZ A;  4LF4 M;  2WSF F;  3L26 A;  2LVQ D;  7CAT A;  3U6S A;  3DOA A;  2KZU A;  1IY2 A;  1NV8 A;  5ITT A;  2R6F A;  1I4W A;  5FLX S;  1PRB A;  3FD9 A;  5LMU M;  3PFI A;  3DZD A;  3EIE A;  3GLH A;  4GIT A;  1PM5 A;  1WIV A;  3U6C A;  4PDI A;  3FRH A;  5ITQ A;  1R2Z A;  2KRK A;  2KEB A;  3QYB A;  2LVP C;  2LVA A;  2LHC A;  3I01 M;  5EXT A;  2KHH A;  3IEC A;  2QEN A;  2DZN B;  3HGI A;  4A3V B;  5KO3 A;  4B7F A;  1XWI A;  1OJL A;  2LXE A;  2JZ1 A;  1PJT A;  5EP3 A;  3OTO M;  4G6Z A;  3HHW A;  1GAB A;  4LF8 M;  4PDG A;  4M9S A;  3FTE A;  3LQQ A;  1L2C A;  5LMN M;  3L2A A;  1OTR A;  1SXJ C;  3GQ5 A;  3VKH A;  4GC5 A;  2MH8 A;  1SXJ A;  2DI0 A;  1L2B A;  4NOO B;  3A98 B;  3KS8 A;  1V33 A;  3FTC A;  4OVZ A;  2CRU A;  1JB0 F;  4QHT A;  1LV7 A;  4IBB A;  3W67 A;  3SC3 A;  4X64 M;  2R4E A;  2UUB M;  5H37 D;  3K92 A;  3SMS A;  3SYK A;  5IRE B;  3ZCB B;  2L4F A;  2C98 A;  3PNY A;  3Q8X A;  5EXS A;  1ZV1 A;  3I4V A;  1NV9 A;  4R71 A;  5FTJ A;  3FUX A;  1SXJ B;  2DZO B;  3HWS A;  4QOS A;  4M9X A;  4FCW A;  1AIP C;  3HKP A;  3VDU A;  2WZJ A;  4QNM A;  2QBY B;  4NXM M;  2KW0 A;  1PJI A;  4M0W A;  1WGN A;  2Z4S A;  4QNR A;  2F5P A;  4ITQ A;  1TTE A;  4MH0 E;  3I4Y A;  2XZF A;  4FWH A;  4CJ6 A;  4GKK M;  3PVS A;  1IY1 A;  4GMQ A;  4UN2 B;  1OQY A;  3FUV A;  4XGI A;  3FUU A;  4DV0 M;  2RGH A;  1Q3B A;  2CHG A;  3T38 A;  1GJT A;  1V92 A;  5ITX E;  2MRO B;  1KFV A;  3HU2 A;  2RKO A;  1K3X A;  3GRY A;  3GLG E;  4M9Z A;  1IBL M;  2JWS A;  3KOW E;  4DV2 M;  4B7G A;  1HJP A;  3M7G A;  3Q8G A;  5EP4 A;  2W82 A;  1D0L A;  3K2L A;  4IBF A;  3D8B A;  4MGH A;  3U6P A;  2O25 A;  3VK8 A;  2KNZ A;  1D2N A;  4L4U A;  3V76 A;  1HQC A;  1C1K A;  1G71 A;  2K47 A;  4G4N A;  2X8A A;  1W5T A;  2LWX A;  4D81 A;  1HT2 E;  2EJS A;  1NJF A;  5KQ8 A;  3HU3 A;  1YUB A;  1DGB A;  1WHC A;  3J2P B;  2JY7 A;  2QNJ A;  3B7Q A;  3RGS A;  4JI5 M;  2ZTC A;  3FTD A;  2X49 A;  3MMP A;  4LF5 M;  4Q7J A;  3UZU A;  4PD2 A;  4IJF A;  3R8F A;  1NY5 A;  3PNV A;  3TPZ A;  5DNY A;  1N32 M;  2H1R A;  2KRU A;  1R6B X;  4REZ A;  1S3S A;  2HCB A;  2BJV A;  2L09 A;  3GPU A;  5FTK A;  4DR2 M;  4Z6Y A;  4AKI A;  1TF0 B;  3ZC7 B;  3K9O A;  1QUT A;  4LJ9 A;  2FE8 A;  1WJ7 A;  3HZJ A;  3CF6 E;  4WP2 A;  3TQS A;  4FWG A;  3UK6 A;  2C96 A;  1W5S A;  3W0L B;  2C5R A;  2F5Q A;  3VKG A;  3LCU A;  2V1C A;  2ZTD A;  1EFU B;  1SXJ D;  3J27 B;  2FH0 A;  5FTN A;  2C9C A;  2ERC A;  4IBJ A;  4DR1 M;  3U6D A;  1QAN A;  2KXE A;  3GLI E;  1XMO M;  1TDZ A;  2R65 A;  1TH2 A;  1G8P A;  1ZAE A;  3TL4 X;  1DGF A;  1JR3 E;  1ZQ9 A;  3IG5 A;  4PT5 A;  4NRW A;  4QHS A;  1K82 A;  2Y0T A;  1TH3 A;  1YLA A;  2EKF A;  2QCU A;  2CFO A;  2R44 A;  3TWK A;  4FD2 A;  2DHR A;  5IT9 S;  3B9P A;  4AI6 A;  1MN3 A;  1PJQ A;  4LF9 M;  2LNH C;  3K1J A;  4LJA A;  1QZE A;  3RGP A;  4LZJ A;  2KA6 B;  4KHP M;  3GLG B;  1I94 M;  1VEK A;  3KSJ A;  4AKH A;  3E21 A;  1NHG C;  4DV6 M;  1XXH A;  3FUT A;  1VEJ A;  2FFJ A;  4LJ4 A;  2WSC F;  2DAK A;  4G4O A;  4JXJ A;  3U6E A;  1DO0 A;  4LFC M;  1QQW A;  3U6M A;  4WW0 A;  1PJJ A;  3UGJ A;  4JI7 M;  3LVW A;  4IBK A;  1VEG A;  1QAO A;  2C99 A;  1NNJ A;  1R4G A;  5EP2 A;  4IIW A;  1QDR A;  4GEW A;  1N36 M;  4M0D A;  1R7R A;  4IBC A;  2Y21 A;  1NSF A;  2CUZ A;  3FUW A;  1QAQ A;  3H4J A;  3KSX A;  4IBD A;  4MGZ E;  1NJG A;  5BR8 M;  4DV4 M;  2AHM A;  1KSF X;  4RNA A;  3K9P A;  4R7G A;  1IXZ A;  2B3T A;  4D80 A;  4RF0 A;  5IWA M;  1XXH B;  3K8Z A;  4L16 A;  2NQ8 C;  3KXE C;  4FVM A;  2GQF A;  4DR3 M;  3QAU A;  4JI1 M;  2DWM A;  1IN6 A;  3AOG A;  3ZQJ A;  1R2Y A;  2DWZ B;  1KYI A;  2XLJ A;  3GLI A;  1HR0 M;  4DV3 M;  1TGU A;  4X66 M;  5C1B A;  4AW4 A;  2OPF A;  1IBM M;  2V1U A;  3SYL A;  1SG9 A;  3GLF E;  1GL6 A;  3HJQ A;  2XZU A;  2L7I A;  2M5Z A;  2QBY A;  4KOD A;  2BNK A;  3MJ5 A;  3U5Z A;  2XSZ A;  1DGH A;  1MU5 A;  2JZ0 A;  4AG5 A;  3HU1 A;  4DR4 M;  1TH4 A;  4NSR A;  1IFY A;  2APL A;  2CWB A;  4LJ5 A;  4NXN M;  1EE8 A;  4LRT A;  5ITU A;  3A45 A;  5E6J A;  4MM3 B;  3AKZ A;  3NBI A;  3GLI B;  4F2L A;  1T6O A;  3J7B A;  4RKU F;  5L8R F;  2Y20 A;  4L6V 6;  2G3Q A;  3HHZ A;  3VFD A;  2L2D A;  5FSW A;  4I81 A;  4PCZ A;  3U5Z B;  2L7H A;  4KLN A;  1DGH B;  2HKJ A;  1TDH A;  3B74 A;  4CIS A;  2CE7 A;  1IXS B;  4LCB A;  3WHK A;  4HL4 A;  4X62 M;  4FWD A;  1TR8 A;  2HHH M;  2J5Y A;  8CAT A;  2EA0 A;  4LF6 M;  1N77 A;  1OAI A;  2C9O A;  3VK7 A;  2ZAO A;  2WSE F;  2HAK A;  2R45 A;  2CHQ A;  3W68 A;  2RRU A;  2JP7 A;  3C3D A;  3CF0 A;  4QOZ C;  2Z8Y M;  4OX9 M;  2A5Y B;  1N78 A;  1DV0 A;  2QHO B;  3GLF A;  2DKL A;  3HJS A;  3M6A A;  1ZMV A;  2EKK A;  4JI4 M;  4DR6 M;  4GKJ M;  1NY6 A; 
#chains in the Genus database with same CATH homology
 3W0F A;  3SAW A;  4B7H A;  3UJN A;  4LJ8 A;  3RE8 A;  3JR4 A;  1L2D A;  5KPZ A;  3AOE C;  3HJ8 A;  3KS4 A;  3GQ4 A;  4LY6 A;  1Q39 A;  4I5S A;  3LQR A;  3SBJ A;  4NSO B;  2R62 A;  3GLF B;  2Z3X A;  4Z8X A;  1IN7 A;  3CTW B;  2J7N A;  4BBA A;  3AV0 A;  4CHT B;  5EQT A;  3U6O A;  2I7N A;  3CF2 A;  2F4V M;  3L25 A;  3MHV C;  2CV2 A;  3KP0 E;  4MGY E;  4DV5 M;  1GLN A;  3KDS E;  3UMM A;  1DO2 A;  1YSY A;  3HHY A;  5ITY A;  2R18 A;  1IY0 A;  3U60 B;  2M60 A;  4GC9 A;  5IZ7 D;  1IBK M;  3C58 A;  1HNZ M;  2P5T A;  5ITX A;  2XEP A;  3RFW A;  1T3T A;  2UXD M;  3VLF B;  1J5E M;  3KOZ E;  2O5R A;  4LJ7 A;  3SFZ A;  1I94 M;  3GLG A;  5GKN A;  4BLC A;  1E9S A;  3KOX E;  5JI2 E;  2XSZ D;  3D8L A;  4II7 A;  4LJ6 A;  2HL7 A;  4L15 A;  3GRV A;  2V6Z M;  2ZAM A;  3BOS A;  3FKE A;  4FCT A;  3VDP A;  2CHV A;  4X65 M;  4YHH M;  2QPA A;  1IQP A;  3T15 A;  3SHG B;  3SAT A;  4B3M M;  4NRV A;  1N34 M;  2LH0 A;  4R3D A;  2D7E A;  3L29 A;  1IXR C;  3LVV A;  3LMM A;  3EIH A;  1J7K A;  3E4R A;  4JI3 M;  4YY3 M;  3TWL A;  2Y0Q A;  2D7H A;  4DR5 M;  2UU9 M;  4I8O A;  2YR0 A;  4LG2 A;  4DUY M;  4DV7 M;  3U6L A;  1XNR M;  1SXJ E;  2L6O A;  1H6U A;  2DVW B;  3GRR A;  1J09 A;  3PXG A;  3SAR A;  2YFQ A;  3MK6 A;  4AQY M;  2F5N A;  4DUZ M;  4L8R C;  2YNM D;  3U6Q A;  2XFS A;  4GHL A;  2Z7J A;  4AKG A;  4W5W A;  3KFU G;  1K3W A;  2CEA A;  1NVM A;  1QYR A;  2UUC M;  3R9X B;  2UXB M;  5DYG A;  2UXC M;  3SMP A;  4WUR A;  1HQY E;  1JR3 A;  4S12 A;  3ZH9 B;  1GKI A;  4GRI A;  5C18 A;  4FW9 A;  2F5O A;  3GPY A;  3TE6 A;  4EIW A;  1XNQ M;  5KPR A;  1ORY B;  4RF1 A;  3GRU A;  2ZM6 M;  2BJW A;  5EXP A;  3KOY E;  4JI0 M;  4G4Q A;  1OFI A;  1JQJ C;  2XFT A;  2DWL A;  4LF7 M;  4CGY B;  3KW6 A;  3GLH B;  4FCV A;  4LGY A;  2OQ4 A;  1G3I A;  1L1Z A;  1Z5C A;  4BB9 A;  1HNW M;  3J81 S;  5FTL A;  4OU7 A;  2Q2E B;  2R46 A;  4DR7 M;  1E94 E;  4DR3 M;  1IM2 A;  2JA2 A;  1GVN A;  4GH9 A;  4HLQ A;  3T1Y M;  4IBG A;  4AG6 A;  2E5L M;  1G41 A;  1XMQ M;  1Z5B A;  1IN5 A;  4JI6 M;  1WXQ A;  3A42 A;  3U61 A;  2EUC A;  4OW0 A;  4OVZ B;  3FTF A;  1HNX M;  2VQF M;  2X4A A;  5F3W A;  2QP9 X;  2UUA M;  4NL4 H;  3GPP A;  4LGM A;  3L27 A;  4IJE A;  3H4M A;  3WHL A;  4IBI A;  4GIP A;  1FNN A;  2XF3 A;  3A46 A;  3M0E A;  1NNU C;  2G8L A;  1E9R A;  3SAU A;  2Z4R A;  3JR5 A;  1N75 A;  3AOE A;  3U60 A;  3U61 B;  4G4R A;  3AJI B;  4KO8 A;  2ZAN A;  4JI8 M;  5ITR A;  1L1T A;  4D82 A;  3TWM A;  1E32 A;  1YE9 A;  3J80 S;  1VDD A;  2ZBK B;  1XC8 A;  2RGO A;  4P16 A;  3SAS A;  3AL0 C;  1X37 A;  1G4A E;  5DYI A;  3SAV A;  2DXI A;  4JI2 M;  3T1H M;  1QVR A;  2G5G X;  4TUW A;  3J7A S;  5EP1 A;  3L28 A;  5E26 A;  4LFB M;  1QAM A;  3KP1 E;  3GPX A;  3NWL A;  1JR3 D;  3QWL A;  3SHF A;  4DV1 M;  1OFH A;  3DA1 A;  3FYC A;  4B08 A;  1HT1 E;  4B3T M;  2D7G A;  3ILK A;  2FNA A;  1NHW C;  2EO2 A;  5KQD A;  4B3S M;  3GP1 A;  2YQZ A;  1MX0 A;  1Z6T A;  2DWN A;  4JV5 M;  5BPV A;  2CV1 A;  4L78 A;  3KVW A;  4JYA M;  4GHA A;  1GL7 A;  1Q3C A;  5KPT A;  2J7O A;  1N33 M;  1UM8 A;  3HHX A;  5EJC A;  1L8Q A;  3GQ3 A;  4AZF A;  4K0K M;  4I4L A;  2VQE M;  4LFA M;  2I7P A;  4IBE A;  5FTM A;  5A2Q S;  4MB7 A;  4ZPX A;  1DGG A;  3THG A;  1Z5A A;  2KZS A;  2XGN A;  1XHB A;  2R4J A;  1QZM A;  2QZ4 A;  2CV0 A;  3DFZ A;  1FJG M;  1IN4 A;  3FYD A;  2VII A;  4MGK E;  3I51 A;  4LRS A;  3GO8 A;  4B3R M;  5JI3 E;  1G59 A;  4MGI E;  2FOI C;  1IN8 A;  2F5S A;  3E9S A;  1Z59 A;  4JN6 A;  3AFH A;  4XBO A;  5EXX A;  2XH9 A;  3IG8 A;  4LZZ A;  4LF4 M;  3L26 A;  7CAT A;  3U6S A;  3DOA A;  2KZU A;  1IY2 A;  5ITT A;  5FLX S;  1I4W A;  3FD9 A;  5LMU M;  3PFI A;  3DZD A;  3EIE A;  3GLH A;  4GIT A;  1PM5 A;  4PDI A;  5ITQ A;  1R2Z A;  2KRK A;  2KEB A;  5EXT A;  2QEN A;  2DZN B;  3HGI A;  4A3V B;  5KO3 A;  4B7F A;  1XWI A;  1OJL A;  2LXE A;  5EP3 A;  3OTO M;  4G6Z A;  3HHW A;  4LF8 M;  4PDG A;  4M9S A;  3FTE A;  3LQQ A;  1L2C A;  5LMN M;  3L2A A;  1SXJ C;  3GQ5 A;  3VKH A;  4GC5 A;  1SXJ A;  1L2B A;  4NOO B;  3A98 B;  3KS8 A;  3FTC A;  4OVZ A;  4QHT A;  1LV7 A;  4IBB A;  3SC3 A;  4X64 M;  2R4E A;  2UUB M;  5H37 D;  3K92 A;  3SMS A;  3SYK A;  5IRE B;  3ZCB B;  5EXS A;  2C98 A;  3PNY A;  3Q8X A;  3I4V A;  5FTJ A;  3FUX A;  1SXJ B;  2DZO B;  3HWS A;  4QOS A;  4M9X A;  4FCW A;  3HKP A;  3VDU A;  3JAM S;  4NXM M;  4QNM A;  2QBY B;  2KW0 A;  1PJI A;  4M0W A;  2Z4S A;  4QNR A;  2F5P A;  4ITQ A;  4MH0 E;  3I4Y A;  2XZF A;  4FWH A;  4GKK M;  3PVS A;  1IY1 A;  4GMQ A;  3FUV A;  4XGI A;  3FUU A;  4DV0 M;  2RGH A;  1Q3B A;  2CHG A;  3T38 A;  5ITX E;  1KFV A;  3HU2 A;  2RKO A;  1K3X A;  3GRY A;  1IBL M;  4M9Z A;  3KOW E;  4DV2 M;  4B7G A;  3M7G A;  5EP4 A;  2W82 A;  3K2L A;  4IBF A;  3D8B A;  4MGH A;  3U6P A;  3VK8 A;  1D2N A;  4L4U A;  1HQC A;  1C1K A;  2K47 A;  4G4N A;  2X8A A;  1W5T A;  2LWX A;  4D81 A;  1HT2 E;  1NJF A;  5KQ8 A;  3HU3 A;  1YUB A;  1DGB A;  3J2P B;  3RGS A;  4JI5 M;  3FTD A;  2X49 A;  4LF5 M;  3UZU A;  4PD2 A;  4IJF A;  3R8F A;  1NY5 A;  3PNV A;  3TPZ A;  5DNY A;  1N32 M;  2H1R A;  2KRU A;  1R6B X;  4REZ A;  1S3S A;  2HCB A;  2BJV A;  2L09 A;  3GPU A;  5FTK A;  4DR2 M;  4Z6Y A;  4AKI A;  3ZC7 B;  4LJ9 A;  2FE8 A;  3UK6 A;  3CF6 E;  3TQS A;  3W0L B;  4FWG A;  2C5R A;  2C96 A;  1W5S A;  2F5Q A;  3VKG A;  2V1C A;  1SXJ D;  3J27 B;  5FTN A;  4DR1 M;  2C9C A;  2ERC A;  4IBJ A;  3U6D A;  1QAN A;  2KXE A;  1XMO M;  1TDZ A;  2R65 A;  1TH2 A;  1G8P A;  1ZAE A;  3TL4 X;  1DGF A;  3IG5 A;  1ZQ9 A;  4PT5 A;  4NRW A;  4DR4 M;  4QHS A;  1K82 A;  2Y0T A;  1TH3 A;  2QCU A;  2CFO A;  3TWK A;  5IT9 S;  4FD2 A;  2DHR A;  3B9P A;  4AI6 A;  4LF9 M;  2LNH C;  3K1J A;  4LJA A;  3RGP A;  4LZJ A;  2KA6 B;  4KHP M;  3GLG B;  3KSJ A;  4AKH A;  1NHG C;  4DV6 M;  1XXH A;  3FUT A;  2FFJ A;  4LJ4 A;  4G4O A;  3U6E A;  4JXJ A;  1DO0 A;  4LFC M;  1QQW A;  3U6M A;  4WW0 A;  1PJJ A;  3UGJ A;  4JI7 M;  3LVW A;  4IBK A;  1QAO A;  2C99 A;  1NNJ A;  5EP2 A;  4IIW A;  1N36 M;  4M0D A;  1R7R A;  4IBC A;  2Y21 A;  1NSF A;  2CUZ A;  3FUW A;  3KSX A;  1QAQ A;  4IBD A;  5BR8 M;  4MGZ E;  1NJG A;  4DV4 M;  3U6C A;  2AHM A;  1KSF X;  4RNA A;  4R7G A;  1IXZ A;  4D80 A;  5IWA M;  4RF0 A;  1XXH B;  3K8Z A;  4L16 A;  2NQ8 C;  3KXE C;  4FVM A;  3QAU A;  4JI1 M;  2DWM A;  1IN6 A;  3AOG A;  1R2Y A;  2DWZ B;  1KYI A;  2XLJ A;  3GLI A;  1HR0 M;  4DV3 M;  1TGU A;  4X66 M;  5C1B A;  4AW4 A;  2OPF A;  1IBM M;  2V1U A;  3SYL A;  1GL6 A;  3HJQ A;  2XZU A;  2L7I A;  2M5Z A;  2QBY A;  4KOD A;  2BNK A;  3MJ5 A;  3U5Z A;  2XSZ A;  1DGH A;  1MU5 A;  4AG5 A;  3HU1 A;  1TH4 A;  4NSR A;  4NXN M;  4LJ5 A;  1EE8 A;  4LRT A;  5ITU A;  3A45 A;  5E6J A;  4MM3 B;  3AKZ A;  3NBI A;  3GLI B;  3J7B A;  2Y20 A;  3HHZ A;  3VFD A;  5FSW A;  4I81 A;  4PCZ A;  3U5Z B;  2L7H A;  4KLN A;  1DGH B;  2HKJ A;  1TDH A;  4CIS A;  2CE7 A;  1IXS B;  4LCB A;  3WHK A;  4HL4 A;  4X62 M;  4FWD A;  2HHH M;  8CAT A;  2EA0 A;  4LF6 M;  1N77 A;  2C9O A;  3VK7 A;  2ZAO A;  2R45 A;  2CHQ A;  3CF0 A;  4QOZ C;  4OX9 M;  1N78 A;  2A5Y B;  3GLF A;  3HJS A;  3M6A A;  4GKJ M;  4JI4 M;  4DR6 M;  1NY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...