2DZNB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 17
structure length 57
sequence length 57
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dznB00
1FNNA 2ZANA 4ZPXA 1IN6A 4L4UA 4D82A 2QZ4A 1SXJD 1E32A 3KDSE 3MHVC 4FCWA 4FCVA 4QHTA 2C96A 4FW9A 4FCTA 2C99A 4WW0A 5FTLA 4LY6A 5EXXA 2QENA 5C1BA 2C9OA 1JR3A 2DZOB 2Z4RA 1IY0A 5EP2A 4QNMA 4FWDA 4KODA 1SXJE 5EXTA 3GLIA 1XXHB 1OFHA 3B9PA 4LZZA 1IXSB 2BJVA 3GLIB 4FD2A 1NJFA 1IN5A 1D2NA 1NY5A 3GLHB 1J7KA 3M6AA 5EP1A 3WHKA 2QPAA 1G41A 3BOSA 5EXPA 4LCBA 4QHSA 2QP9X 3PVSA 5EP4A 4D80A 2BJWA 2QBYA 4L15A 1IN4A 2C98A 1DO2A 2DWZB 3U61B 4L16A 4A3VB 1IM2A 1NSFA 5EXSA 3HWSA 4QOSA 5JI2E 3GLGB 2KRKA 2R65A 1QVRA 1NY6A 2XSZA 2C9CA 1IY1A 3CF0A 4LJ9A 1G4AE 1IY2A 1SXJB 3WHLA 1W5SA 4QNRA 4FWHA 1KSFX 2X8AA 3U60B 1R7RA 2QBYB 4I81A 3SYKA 1C1KA 4EIWA 1HQYE 3H4MA 4LJ5A 1E94E 2XSZD 1LV7A 3R8FA 1HT2E 2HCBA 3EIEA 1IN7A 3HU2A 4JN6A 1XWIA 2R62A 4LRSA 4LJ4A 5FTNA 4Z8XA 1QZMA 5EQTA 1SXJC 4KLNA 3VFDA 2CE7A 3AJIB 4LRTA 3GLFA 3M0EA 2V1UA 3KW6A 1OFIA 3HU3A 1NJGA 1SXJA 5DYIA 2ZAMA 2DVWB 2DZNB 1IXRC 5FTMA 3SYLA 1HQCA 1HT1E 4GITA 4LJ7A 3VLFB 4D81A 1IQPA 3PFIA 3GLGA 1JQJC 2RKOA 1S3SA 1JR3D 4LJ6A 1G3IA 1L8QA 5DYGA 4LJ8A 3ZH9B 3U5ZB 1X37A 5C18A 3K1JA 1NVMA 1XXHA 2FNAA 4KO8A 4LJAA 4I4LA 2CEAA 1UM8A 1DO0A 2CHVA 3GLHA 5EP3A 1IN8A 3PXGA 3GLFB 1IXZA 5FTJA 2V6ZM 1R6BX 1W5TA 3SC3A 2Z4SA 3HU1A 3CF2A 2CHQA 4FWGA 5JI3E 2VIIA 1OJLA 3DZDA 3UK6A 2DHRA 2ZAOA 2CHGA 3D8BA 4LGMA 3EIHA 5FTKA 1KYIA
chains in the Genus database with same CATH superfamily
1PJSA 2EA0A 3DA1A 2FH0A 4IBBA 4D82A 2QZ4A 4JI6M 4BBAA 4NL4H 3KDSE 3VK7A 4QHTA 2K9DA 1VEKA 3T15A 4CHTB 2L09A 4LF5M 2UU9M 3IG5A 2KXEA 3FRIA 2LHCA 5H37D 3LCVB 4GKKM 3SAWA 4AKHA 1J5EM 4YHHM 3FUUA 3J80S 2Z8YM 5EP2A 4AKIA 4QNMA 4KODA 2WSCF 4AZFA 2R0IA 1XXHB 1MN3A 2C5RA 2RRUA 3U6QA 4LZZA 4X64M 4G4QA 4FD2A 1TH2A 2R46A 2DHYA 3E46A 2JY5A 4NSRA 1NY5A 2JZ0A 1WXQA 1VDLA 1MU5A 1I4WA 3LQRA 3AFHA 5F3WA 5A2QS 2F4VM 2QPAA 2Z3XA 4DV7M 3BOSA 3F92A 3SBJA 4QHSA 3PVSA 3KSXA 2R4JA 3HHXA 3NWLA 5ITXA 1D0LA 8CATA 3CTWB 1MX0A 1IN4A 2C98A 5KQDA 4MGIE 4NRVA 4A3VB 1R5LA 3KVWA 2R44A 4DBGB 2HAKA 4QOSA 1TGUA 1HR0M 3I4YA 2KZSA 3K2LA 3GLGB 3U6PA 2R6FA 2UUAM 1QVRA 4B7FA 2XSZA 4NXMM 2KW0A 2MR9A 1IY1A 1ZAEA 3CF0A 4IBJA 4LJ9A 1QUSA 3GLHE 2L2DA 4DV0M 2LBCA 2DKLA 4JI2M 4B08A 1YE9A 1R7RA 2M60A 1H6UA 4I81A 4II7A 1K3XA 2LVNC 4LFCM 1VDDA 3FE3A 2BNKA 3SHGB 4GMQA 4AG5A 4EIWA 1DGGA 4NXNM 1E94E 1GVNA 2XSZD 3UZUA 1LV7A 2HCBA 3EIEA 2UUCM 1IN7A 2JNHA 4OVZA 3I4VA 4G4NA 3HHWA 1FJGM 1SXJC 3JR5A 1XB2B 2CE7A 4JXJA 4B3RM 4AKGA 4AI6A 2CP8A 4F2LA 1XMQM 4JI8M 3M0EA 4RKUF 1PM5A 3K9OA 3AL0C 1BVSA 2K0BX 3VKHA 5DYIA 4IBIA 3UMMA 2DZNB 5FTMA 1Q3CA 2D7EA 3TE6A 3LMMA 3NBIA 2JA2A 4LJ7A 1QYRA 4GIPA 1IQPA 1KFVA 4XBOA 2UXDM 2O25A 2E5LM 1ZMVA 4GHAA 1S3SA 5DFLA 1PJTA 3AOGA 1G3IA 1ORYB 2L7HA 1NV8A 1A5TA 2P5TA 3FUVA 2JZ1A 1PJIA 2CV2A 4JI7M 1G71A 1T6OA 1Z5CA 1OKSA 1RU3A 3J27B 2DWMA 4PDIA 4IJEA 2A5YB 4LJAA 4CIZA 4I4LA 1IBLM 2DWLA 1UM8A 5EP3A 3T38A 1L2CA 3PNVA 3GLFB 4PCZA 2V6ZM 3H4JA 2X49A 4DV1M 4MGHA 2EUCA 5ITUA 1TF0B 3HU1A 5BR8M 2CHQA 1JR3E 2DNAA 1OJLA 1UFZA 3W68A 1OIPA 1L1ZA 1V34A 3TWKA 2YR0A 2CWBA 1KYIA 4ITQA 3GRVA 1TDHA 1FNNA 4I8OA 1N34M 4S12A 2I7PA 4L4UA 4B3SM 1PGYA 3K9PA 1SXJD 4RF0A 1E32A 5ITRA 1NNUC 4REZA 1XNRM 2NQ8C 3A98B 3KSJA 3TWMA 1VEJA 3FRHA 4GHLA 4LY6A 2FE8A 4GEWA 2QENA 1ZMUA 3U6MA 3LCUA 2R45A 1QQWA 1QAOA 1JR3A 1CUKA 1ZV1A 2DZOB 2Z4RA 5IWAM 3QYBA 4Z6YA 2YNMD 1N75A 1SXJE 2AHMA 1OFHA 3B9PA 2D7HA 4G3OA 5KPRA 3GLIB 3KFUG 3FTDA 4NOOB 4PT5A 1OQYA 1NJFA 3SMSA 3GRUA 1GLNA 2EJSA 4NSOB 4CGYB 3GLHB 2F5QA 3WHKA 4M9XA 4CJ6A 5DNYA 1I94M 1EIJA 4GC5A 4B3TM 4OU7A 3LVVA 1V33A 2MJ5B 2OO9A 3B89A 4DR1M 4F1IA 2BJWA 3U60A 3U6EA 2QBYA 3TWLA 3AOEC 4FVMA 2DWZB 1MJGM 2R18A 3T1YM 3U61B 4DR6M 5EXSA 1HJPA 2WSEF 2F5NA 4GKJM 3J7AS 3FYCA 3RFWA 2KRKA 2KHHA 2R65A 4WURA 4QOZC 1NY6A 1XHBA 3Q8XA 4B7HA 4AQYM 2C9CA 1G4AE 3W0LB 1K82A 1NHWC 2J5YA 3TQSA 1F4IA 3CF6E 4FWHA 1KSFX 2KZUA 3QYEA 4L6V6 3HGIA 3U60B 1PJJA 1C7YA 2QBYB 4DR2M 3GPUA 4IBFA 2L4EA 1C1KA 3GO8A 3HHZA 3LW5F 3M7GA 3H4MA 3J81S 3KP0E 5IZ7D 1TDZA 2FS1A 1N77A 1HT2E 3J2PB 2XFSA 2DAIA 4K0KM 3HU2A 4JN6A 1E9SA 2R62A 3VK8A 3MJ5A 3RGSA 3SARA 4R3DA 4Z8XA 5EQTA 4PDGA 1GABA 4WP2A 2HKJA 5EJCA 2RGOA 1QAQA 3GLFA 2L4FA 1TH4A 3KS4A 2XZUA 1GKIA 3TL4X 4DV6M 3GLFE 3ILKA 2LH0A 4RNAA 3GRYA 3HY5A 2LVAA 4LF7M 2Y0QA 3SYLA 1HQCA 1HT1E 1WJ7A 4OX9M 4LFBM 1GJSA 2FFJA 1HNWM 1LTMA 3C3EA 4MB7A 1JQJC 3VDUA 3KOXE 4JI0M 3SFZA 3KOZE 1G8PA 2KDLA 2RKOA 4GRIA 4UN2B 2G8LA 2LHGA 4Y28F 3U6SA 2V1CA 1XC8A 4LJ6A 3B7QA 2JUJA 3LVWA 2VQFM 1XNQM 2DWNA 5DYGA 2F5PA 3AV0A 4Q7JA 3GQ4A 4DR4M 5C18A 3K1JA 2H5XA 2QCUA 4KT0F 1DO0A 2XEPA 4M0DA 4MM3B 4CISA 3SC3A 4LF8M 4IJFA 2WSFF 1DV0A 2VIIA 3SATA 3DZDA 4M9ZA 4W5WA 3UK6A 2DHRA 4DUYM 3HJ8A 1N36M 1DGBA 1Q3BA 2G5GX 3IG8A 2KRUA 4AW4A 2DAEA 5FTKA 3HHYA 4DR3M 2ZANA 4ZPXA 1D0MA 3HKPA 5LMUM 2DENA 5IREB 4FCVA 4FCWA 2C96A 1WIVA 4FCTA 3J7BA 2C99A 2LVOC 4BB9A 3GQ5A 1QANA 3I51A 5FTLA 1Z5AA 5E6JA 1R4GA 4X66M 5EXXA 4G6ZA 3GLGE 4R7GA 2C9OA 4LZJA 4LG2A 1D0KA 1IY0A 2DAMA 2HWJA 4FWDA 5EXTA 1IXSA 2EKKA 2VF7A 3MMPA 2LVPC 5BPVA 1IXSB 2BJVA 3L27A 5E26A 2ZTDA 3GP1A 1IN5A 3U6DA 1IBMM 1D2NA 4HLQA 3QAUA 1J7KA 3M6AA 5EP1A 1PRBA 2GNOA 3VKGA 1NNJA 1G59A 3L28A 4DUZM 1JB0F 2VF8A 1G41A 5EXPA 2FOIC 4LCBA 3L25A 2MGWA 1GO5A 4B7GA 1ZQ9A 3KP1E 4D80A 4L15A 1N33M 4LF4M 4IBGA 2GQFA 1YLAA 4DV5M 1IM2A 1NSFA 2DI0A 3HWSA 5JI2E 4LF9M 1GL6A 1OAOC 5KQ8A 3KS8A 2KEBA 4P17A 4DV3M 1Z5BA 1E9RA 1EFUB 3Q8GA 3E4RA 3VDPA 4PD2A 4HEOA 4DV4M 1W5SA 3HZJA 4QNRA 1IBKM 2ZM6M 1DGFA 4XK8F 2QNJA 3SMPA 3SASA 1Y8GA 4TUWA 5ITQA 3DFZA 3UGJA 1NHGC 2B3TA 2H1RA 3L2AA 2X4AA 2XFTA 1QAMA 2JP7A 4LJ5A 2CUZA 2W82A 3KOYE 3HJSA 3R8FA 1J09A 2YQZA 4B3MM 4LRSA 4LJ4A 2J7OA 4M9SA 1QZMA 4KLNA 3VFDA 1HNZM 1AIPC 3B7NA 2CFOA 1OFIA 2EO2A 3HU3A 2CV0A 4R71A 2BWEA 3SAVA 4YY3M 3KOWE 1VEGA 2ZAMA 2K47A 2MROB 2DVWB 4X65M 3K8ZA 1WR1B 4GITA 1WGLA 2XF3A 2JXNA 3W0FA 2LNHC 7CATA 3GPXA 4IBDA 2J7NA 2OQ4A 1K3WA 3B74A 4MGZE 4GH9A 4NC6A 3GLGA 3V76A 2JWSA 4MGYE 3U6LA 2L6OA 3U61A 1GL7A 2O5RA 3UJNA 4X62M 3U5ZA 1L8QA 3FUTA 2DXIA 2EKFA 4LJ8A 3U5ZB 2XZFA 2O01F 1X37A 2OOBA 2DZLA 1NVMA 2FNAA 3SAUA 4L78A 3B7ZA 4GC9A 3C58A 4L8RC 1Z6TA 2CEAA 2CHVA 3GLHA 4M0WA 3PXGA 5KPTA 5KPZA 2QQ8A 2R4EA 1IXZA 1TTEA 5FTJA 1T43A 1W5TA 3K92A 3A46A 3GLIE 3CF2A 2I7NA 4JI3M 4FWGA 2KA6B 2LWXA 1QZEA 3QWLA 2ZAOA 1YSYA 3C3DA 2JY8A 3GRRA 2CHGA 3AKZA 2F5OA 1VG5A 3D8BA 3TPZA 2XLJA 3KXEC 4BLCA 4LFAM 2QHOB 2CRUA 4DV2M 3IHPA 2ZBKB 1IN6A 1VQ1A 5ITXE 2OPFA 1XMOM 3FTEA 3SHFA 3BBZA 3MHVC 4FW9A 4P16A 3I04M 3T6PA 4WW0A 3FD9A 3C9PA 3DOAA 4IIWA 3T1HM 1AUAA 1DGHA 1YUBA 5C1BA 3GPYA 3FTCA 2DAGA 1DGHB 2APLA 3GLIA 1N32M 2DAKA 3PNYA 5KO3A 5IT9S 2XGNA 2BWBA 2Y20A 3LQQA 2ZTCA 5ITTA 3L26A 2CV1A 4KHPM 2QP9X 3ZCBB 1OTRA 3JAMS 1N78A 5EP4A 2Y21A 3FUXA 5ITYA 4MGKE 3R9XB 1DO2A 1OAIA 4L16A 2LTUA 1HNXM 4DR5M 3GPPA 1Q39A 3FTFA 1Q02A 2LXEA 2QSFX 2G3QA 4AG6A 2YFQA 4G4RA 4HL4A 4JI5M 1TH3A 1IY2A 4LGYA 2KNAA 2VDBB 1SXJB 1WHCA 3WHLA 1XXHE 2OOAA 3JR4A 2X8AA 3U6OA 2UXCM 1L2BA 3CGWA 5L8RF 3SYKA 2WZJA 4IBKA 3E9SA 1HQYE 2KNZA 4OVZB 3FYDA 4JYAM 4ANRA 1IFYA 4NRWA 1P3QQ 3D8LA 1XWIA 5LMNM 3BXWA 1GJTA 5FTNA 1L2DA 2HHHM 3MK6A 3AJIB 4IBCA 2Z7JA 1NV9A 1V92A 3NBXX 4LRTA 2D7GA 2UUBM 2V1UA 2JY7A 2Y0TA 1EE8A 3KW6A 2LVQD 1PJQA 1WGNA 3ZC7B 1NJGA 5FSWA 4XGIA 1SXJA 2MH8A 3I01M 1L1TA 2KNVA 2K6BA 4JV5M 1IXRC 2UXBM 2L7IA 3VLFB 4D81A 3PFIA 1R2ZA 1ZMWA 4IBEA 4LF6M 2XH9A 3OTOM 1OIZA 3FKEA 1JR3D 2M5ZA 3THGA 3RGPA 1T3TA 3GQ3A 3U6CA 4DR7M 3W67A 3ZH9B 1SG9A 1XXHA 4KO8A 2N35A 4OW0A 3A42A 1IN8A 3AOEA 3FUWA 3HJQA 3HX3A 3IECA 1QDRA 1R6BX 4JI4M 5FLXS 2VQEM 2Z4SA 4I5SA 3A45A 2HL7A 5GKNA 2F5SA 5JI3E 1R2YA 4RF1A 2JY6B 4MH0E 2ERCA 1NO1A 1QUTA 3ZQJA 4JI1M 2Q2EB 3RE8A 4G4OA 2RGHA 1Z59A 3E21A 1TR8A 4LGMA 3EIHA 3L29A 1QDTA
chains in the Genus database with same CATH topology
2EA0A 3DA1A 4IBBA 4D82A 2QZ4A 4JI6M 4BBAA 4NL4H 3KDSE 3VK7A 4QHTA 3T15A 4CHTB 2L09A 4LF5M 2UU9M 3IG5A 2KXEA 5H37D 4GKKM 3SAWA 1J5EM 4YHHM 3FUUA 3J80S 5EP2A 4AKIA 4QNMA 4KODA 4AZFA 1XXHB 2C5RA 3U6QA 4LZZA 4X64M 4G4QA 4FD2A 1TH2A 2R46A 4NSRA 1NY5A 1WXQA 1MU5A 1I4WA 3LQRA 3AFHA 5F3WA 5A2QS 2F4VM 2QPAA 2Z3XA 4DV7M 3BOSA 3SBJA 4QHSA 3PVSA 3KSXA 2R4JA 3HHXA 3NWLA 5ITXA 8CATA 3CTWB 1MX0A 1IN4A 2C98A 5KQDA 4MGIE 4NRVA 4A3VB 3KVWA 4QOSA 1TGUA 1HR0M 3I4YA 2KZSA 3K2LA 3GLGB 3U6PA 2UUAM 1QVRA 4B7FA 2XSZA 4NXMM 2KW0A 1IY1A 1ZAEA 3CF0A 4IBJA 4LJ9A 4DV0M 4JI2M 4B08A 1YE9A 1R7RA 2M60A 1H6UA 4I81A 4II7A 1K3XA 4LFCM 1VDDA 3SHGB 2BNKA 4EIWA 4GMQA 4AG5A 1DGGA 4NXNM 1E94E 1GVNA 2XSZD 3UZUA 1LV7A 2HCBA 3EIEA 2UUCM 1IN7A 4OVZA 3I4VA 4G4NA 3HHWA 1FJGM 1SXJC 3JR5A 4B3RM 2CE7A 4JXJA 4AKGA 4AI6A 1XMQM 4JI8M 3M0EA 1PM5A 3AL0C 3VKHA 5DYIA 4IBIA 3UMMA 2DZNB 5FTMA 1Q3CA 2D7EA 3TE6A 3LMMA 3NBIA 2JA2A 4LJ7A 1QYRA 4GIPA 1IQPA 1KFVA 4XBOA 2UXDM 2E5LM 4GHAA 1S3SA 3AOGA 1G3IA 1ORYB 2L7HA 2P5TA 2CV2A 3FUVA 1PJIA 4JI7M 1Z5CA 3J27B 2DWMA 4PDIA 4IJEA 2A5YB 4LJAA 2DWLA 4I4LA 1IBLM 1UM8A 5EP3A 3T38A 1L2CA 3PNVA 3GLFB 4PCZA 2V6ZM 4DV1M 2X49A 4MGHA 2EUCA 5ITUA 3HU1A 5BR8M 2CHQA 1OJLA 1L1ZA 3TWKA 2YR0A 1KYIA 4ITQA 3GRVA 1TDHA 1FNNA 4I8OA 1N34M 4S12A 2I7PA 4L4UA 4B3SM 1SXJD 4RF0A 1E32A 5ITRA 1NNUC 4REZA 1XNRM 2NQ8C 3A98B 3KSJA 3TWMA 4GHLA 4LY6A 2FE8A 2QENA 3U6MA 2R45A 1QQWA 1QAOA 1JR3A 2DZOB 2Z4RA 5IWAM 4Z6YA 2YNMD 1N75A 1SXJE 2AHMA 1OFHA 3B9PA 2D7HA 5KPRA 3GLIB 3KFUG 3FTDA 4NOOB 4PT5A 1NJFA 3SMSA 3GRUA 1GLNA 4NSOB 4CGYB 3GLHB 2F5QA 3WHKA 4M9XA 5DNYA 1I94M 4GC5A 4B3TM 4OU7A 3LVVA 4DR1M 2BJWA 3U60A 3U6EA 2QBYA 3TWLA 3AOEC 4FVMA 2DWZB 2R18A 3T1YM 3U61B 4DR6M 5EXSA 2F5NA 4GKJM 3J7AS 3FYCA 3RFWA 2KRKA 2R65A 4WURA 1NY6A 3Q8XA 1XHBA 4B7HA 4AQYM 2C9CA 1G4AE 3W0LB 1K82A 1NHWC 3TQSA 3CF6E 4FWHA 1KSFX 2KZUA 3U60B 1PJJA 3HGIA 2QBYB 4DR2M 3GPUA 4IBFA 1C1KA 3GO8A 3HHZA 3M7GA 3H4MA 3J81S 3KP0E 5IZ7D 1TDZA 4K0KM 1N77A 1HT2E 3J2PB 2XFSA 3HU2A 4JN6A 1E9SA 2R62A 3VK8A 3MJ5A 3RGSA 3SARA 4R3DA 4Z8XA 5EQTA 4PDGA 2HKJA 5EJCA 2RGOA 1QAQA 3GLFA 2XZUA 1TH4A 3KS4A 1GKIA 3TL4X 4DV6M 3ILKA 2LH0A 4RNAA 3GRYA 4LF7M 2Y0QA 3SYLA 1HQCA 1HT1E 4LFBM 4OX9M 2FFJA 1HNWM 4AKHA 4MB7A 1JQJC 3VDUA 3KOXE 4JI0M 3SFZA 3KOZE 1G8PA 2RKOA 4GRIA 5ITXE 3U6SA 2G8LA 1XC8A 2V1CA 4LJ6A 3LVWA 2VQFM 1XNQM 2DWNA 5DYGA 2F5PA 3AV0A 3GQ4A 4DR4M 5C18A 3K1JA 2QCUA 1DO0A 2XEPA 4M0DA 4MM3B 4CISA 3SC3A 4LF8M 4IJFA 2VIIA 3SATA 3DZDA 4M9ZA 4W5WA 3UK6A 2DHRA 4DUYM 3HJ8A 1N36M 1DGBA 1Q3BA 2G5GX 3IG8A 2KRUA 4AW4A 5FTKA 3HHYA 4DR3M 2ZANA 4ZPXA 3HKPA 5LMUM 5IREB 4FCVA 4FCWA 2C96A 4FCTA 3J7BA 2C99A 4BB9A 3GQ5A 1QANA 3I51A 5FTLA 1Z5AA 5E6JA 4X66M 5EXXA 4G6ZA 4R7GA 2C9OA 4LZJA 4LG2A 1IY0A 4FWDA 5EXTA 5BPVA 1IXSB 2BJVA 3L27A 5E26A 3GP1A 1IN5A 3U6DA 1IBMM 1D2NA 4HLQA 3QAUA 1J7KA 3M6AA 5EP1A 3VKGA 1NNJA 1G59A 3L28A 1G41A 5EXPA 2FOIC 4LCBA 3L25A 4B7GA 1ZQ9A 3KP1E 4D80A 4L15A 1N33M 4LF4M 4IBGA 4DV5M 1IM2A 1NSFA 3HWSA 5JI2E 4LF9M 1GL6A 5KQ8A 3KS8A 2KEBA 4DV3M 1Z5BA 1E9RA 3E4RA 3VDPA 4PD2A 4DV4M 1W5SA 1IBKM 4QNRA 2ZM6M 1DGFA 3SASA 3SMPA 4TUWA 5ITQA 3DFZA 3UGJA 1NHGC 3L2AA 2H1RA 2X4AA 2XFTA 1QAMA 4LJ5A 2CUZA 2W82A 3KOYE 3HJSA 3R8FA 1J09A 2YQZA 4B3MM 4LRSA 4LJ4A 2J7OA 4M9SA 1QZMA 4KLNA 3VFDA 1HNZM 2CFOA 1OFIA 2EO2A 3HU3A 2CV0A 3SAVA 4YY3M 3KOWE 2ZAMA 2K47A 2DVWB 4X65M 3K8ZA 4GITA 2XF3A 3W0FA 7CATA 2LNHC 3GPXA 4IBDA 2J7NA 2OQ4A 1K3WA 4MGZE 3GLGA 4GH9A 3U6LA 4MGYE 2L6OA 3U61A 1GL7A 2O5RA 3UJNA 3U5ZA 1L8QA 3FUTA 2DXIA 4LJ8A 3U5ZB 2XZFA 1X37A 4QOZC 3SAUA 1NVMA 2FNAA 4L78A 4GC9A 3C58A 4L8RC 1Z6TA 2CEAA 2CHVA 3GLHA 4M0WA 3PXGA 5KPTA 5KPZA 2R4EA 1IXZA 5FTJA 1W5TA 3K92A 3A46A 3CF2A 2I7NA 4JI3M 4FWGA 2KA6B 2LWXA 3QWLA 2ZAOA 1YSYA 3GRRA 3AKZA 2CHGA 2F5OA 3TPZA 3D8BA 2XLJA 3KXEC 4BLCA 4LFAM 4DV2M 2ZBKB 1IN6A 3FTEA 1XMOM 2OPFA 3SHFA 3MHVC 4FW9A 4P16A 4WW0A 3FD9A 3DOAA 4IIWA 3T1HM 1DGHA 1YUBA 5C1BA 3GPYA 3FTCA 1DGHB 3GLIA 1N32M 3PNYA 5KO3A 5IT9S 2XGNA 2Y20A 3LQQA 5ITTA 3L26A 2CV1A 2QP9X 3ZCBB 3JAMS 1N78A 5EP4A 2Y21A 3FUXA 5ITYA 4MGKE 3R9XB 1DO2A 4L16A 1HNXM 4DR5M 3GPPA 1Q39A 3FTFA 2LXEA 4AG6A 2YFQA 4G4RA 4HL4A 4JI5M 1TH3A 1IY2A 4LGYA 1SXJB 3WHLA 3JR4A 2X8AA 3U6OA 2UXCM 1L2BA 3SYKA 4IBKA 3E9SA 1HQYE 4OVZB 3FYDA 4JYAM 4NRWA 3D8LA 1XWIA 5LMNM 5FTNA 1L2DA 2HHHM 3MK6A 3AJIB 4IBCA 2Z7JA 4LRTA 2UUBM 4KHPM 2D7GA 2V1UA 2Y0TA 1EE8A 3KW6A 3ZC7B 5FSWA 4X62M 4DUZM 1NJGA 1L1TA 4XGIA 1SXJA 4JV5M 1IXRC 2UXBM 2L7IA 3VLFB 4D81A 3PFIA 1R2ZA 4IBEA 4LF6M 2XH9A 3OTOM 3FKEA 1JR3D 2M5ZA 3THGA 3RGPA 1T3TA 3GQ3A 3U6CA 4DR7M 3ZH9B 1XXHA 4KO8A 4OW0A 3A42A 1IN8A 3AOEA 3FUWA 3HJQA 1R6BX 4JI4M 5FLXS 2VQEM 2Z4SA 4I5SA 3A45A 2HL7A 5GKNA 2F5SA 5JI3E 1R2YA 4RF1A 4MH0E 2ERCA 4JI1M 2Q2EB 3RE8A 4G4OA 2RGHA 1Z59A 4LGMA 3EIHA 3L29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNN A;  2ZAN A;  4ZPX A;  1IN6 A;  4L4U A;  4D82 A;  2QZ4 A;  1SXJ D;  1E32 A;  3KDS E;  3MHV C;  4FCW A;  4FCV A;  4QHT A;  2C96 A;  4FW9 A;  4FCT A;  2C99 A;  4WW0 A;  5FTL A;  4LY6 A;  5EXX A;  2QEN A;  5C1B A;  2C9O A;  1JR3 A;  2DZO B;  2Z4R A;  1IY0 A;  5EP2 A;  4QNM A;  4FWD A;  4KOD A;  1SXJ E;  5EXT A;  3GLI A;  1XXH B;  1OFH A;  3B9P A;  4LZZ A;  1IXS B;  2BJV A;  3GLI B;  4FD2 A;  1NJF A;  1IN5 A;  1D2N A;  1NY5 A;  3GLH B;  1J7K A;  3M6A A;  5EP1 A;  3WHK A;  2QPA A;  1G41 A;  3BOS A;  5EXP A;  4LCB A;  4QHS A;  2QP9 X;  3PVS A;  5EP4 A;  4D80 A;  2BJW A;  2QBY A;  4L15 A;  1IN4 A;  2C98 A;  1DO2 A;  2DWZ B;  3U61 B;  4L16 A;  4A3V B;  1IM2 A;  1NSF A;  5EXS A;  3HWS A;  4QOS A;  5JI2 E;  3GLG B;  2KRK A;  2R65 A;  1QVR A;  1NY6 A;  2XSZ A;  2C9C A;  1IY1 A;  3CF0 A;  4LJ9 A;  1G4A E;  1IY2 A;  1SXJ B;  3WHL A;  1W5S A;  4QNR A;  4FWH A;  1KSF X;  2X8A A;  3U60 B;  1R7R A;  2QBY B;  4I81 A;  3SYK A;  1C1K A;  4EIW A;  1HQY E;  3H4M A;  4LJ5 A;  1E94 E;  2XSZ D;  1LV7 A;  3R8F A;  1HT2 E;  2HCB A;  3EIE A;  1IN7 A;  3HU2 A;  4JN6 A;  1XWI A;  2R62 A;  4LRS A;  4LJ4 A;  5FTN A;  4Z8X A;  1QZM A;  5EQT A;  1SXJ C;  4KLN A;  3VFD A;  2CE7 A;  3AJI B;  4LRT A;  3GLF A;  3M0E A;  2V1U A;  3KW6 A;  1OFI A;  3HU3 A;  1NJG A;  1SXJ A;  5DYI A;  2ZAM A;  2DVW B;  2DZN B;  1IXR C;  5FTM A;  3SYL A;  1HQC A;  1HT1 E;  4GIT A;  4LJ7 A;  3VLF B;  4D81 A;  1IQP A;  3PFI A;  3GLG A;  1JQJ C;  2RKO A;  1S3S A;  1JR3 D;  4LJ6 A;  1G3I A;  1L8Q A;  5DYG A;  4LJ8 A;  3ZH9 B;  3U5Z B;  1X37 A;  5C18 A;  3K1J A;  1NVM A;  1XXH A;  2FNA A;  4KO8 A;  4LJA A;  4I4L A;  2CEA A;  1UM8 A;  1DO0 A;  2CHV A;  3GLH A;  5EP3 A;  1IN8 A;  3PXG A;  3GLF B;  1IXZ A;  5FTJ A;  2V6Z M;  1R6B X;  1W5T A;  3SC3 A;  2Z4S A;  3HU1 A;  3CF2 A;  2CHQ A;  4FWG A;  5JI3 E;  2VII A;  1OJL A;  3DZD A;  3UK6 A;  2DHR A;  2ZAO A;  2CHG A;  3D8B A;  4LGM A;  3EIH A;  5FTK A;  1KYI A; 
#chains in the Genus database with same CATH topology
 1PJS A;  2EA0 A;  3DA1 A;  2FH0 A;  4IBB A;  4D82 A;  2QZ4 A;  4JI6 M;  4BBA A;  4NL4 H;  3KDS E;  3VK7 A;  4QHT A;  2K9D A;  1VEK A;  3T15 A;  4CHT B;  2L09 A;  4LF5 M;  2UU9 M;  3IG5 A;  2KXE A;  3FRI A;  2LHC A;  5H37 D;  3LCV B;  4GKK M;  3SAW A;  4AKH A;  1J5E M;  4YHH M;  3FUU A;  3J80 S;  2Z8Y M;  5EP2 A;  4AKI A;  4QNM A;  4KOD A;  2WSC F;  4AZF A;  2R0I A;  1XXH B;  1MN3 A;  2C5R A;  2RRU A;  3U6Q A;  4LZZ A;  4X64 M;  4G4Q A;  4FD2 A;  1TH2 A;  2R46 A;  2DHY A;  3E46 A;  2JY5 A;  4NSR A;  1NY5 A;  2JZ0 A;  1WXQ A;  1VDL A;  1MU5 A;  1I4W A;  3LQR A;  3AFH A;  5F3W A;  5A2Q S;  2F4V M;  2QPA A;  2Z3X A;  4DV7 M;  3BOS A;  3F92 A;  3SBJ A;  4QHS A;  3PVS A;  3KSX A;  2R4J A;  3HHX A;  3NWL A;  5ITX A;  1D0L A;  8CAT A;  3CTW B;  1MX0 A;  1IN4 A;  2C98 A;  5KQD A;  4MGI E;  4NRV A;  4A3V B;  1R5L A;  3KVW A;  2R44 A;  4DBG B;  2HAK A;  4QOS A;  1TGU A;  1HR0 M;  3I4Y A;  2KZS A;  3K2L A;  3GLG B;  3U6P A;  2R6F A;  2UUA M;  1QVR A;  4B7F A;  2XSZ A;  4NXM M;  2KW0 A;  2MR9 A;  1IY1 A;  1ZAE A;  3CF0 A;  4IBJ A;  4LJ9 A;  1QUS A;  3GLH E;  2L2D A;  4DV0 M;  2LBC A;  2DKL A;  4JI2 M;  4B08 A;  1YE9 A;  1R7R A;  2M60 A;  1H6U A;  4I81 A;  4II7 A;  1K3X A;  2LVN C;  4LFC M;  1VDD A;  3FE3 A;  2BNK A;  3SHG B;  4GMQ A;  4AG5 A;  4EIW A;  1DGG A;  4NXN M;  1E94 E;  1GVN A;  2XSZ D;  3UZU A;  1LV7 A;  2HCB A;  3EIE A;  2UUC M;  1IN7 A;  2JNH A;  4OVZ A;  3I4V A;  4G4N A;  3HHW A;  1FJG M;  1SXJ C;  3JR5 A;  1XB2 B;  2CE7 A;  4JXJ A;  4B3R M;  4AKG A;  4AI6 A;  2CP8 A;  4F2L A;  1XMQ M;  4JI8 M;  3M0E A;  4RKU F;  1PM5 A;  3K9O A;  3AL0 C;  1BVS A;  2K0B X;  3VKH A;  5DYI A;  4IBI A;  3UMM A;  2DZN B;  5FTM A;  1Q3C A;  2D7E A;  3TE6 A;  3LMM A;  3NBI A;  2JA2 A;  4LJ7 A;  1QYR A;  4GIP A;  1IQP A;  1KFV A;  4XBO A;  2UXD M;  2O25 A;  2E5L M;  1ZMV A;  4GHA A;  1S3S A;  5DFL A;  1PJT A;  3AOG A;  1G3I A;  1ORY B;  2L7H A;  1NV8 A;  1A5T A;  2P5T A;  3FUV A;  2JZ1 A;  1PJI A;  2CV2 A;  4JI7 M;  1G71 A;  1T6O A;  1Z5C A;  1OKS A;  1RU3 A;  3J27 B;  2DWM A;  4PDI A;  4IJE A;  2A5Y B;  4LJA A;  4CIZ A;  4I4L A;  1IBL M;  2DWL A;  1UM8 A;  5EP3 A;  3T38 A;  1L2C A;  3PNV A;  3GLF B;  4PCZ A;  2V6Z M;  3H4J A;  2X49 A;  4DV1 M;  4MGH A;  2EUC A;  5ITU A;  1TF0 B;  3HU1 A;  5BR8 M;  2CHQ A;  1JR3 E;  2DNA A;  1OJL A;  1UFZ A;  3W68 A;  1OIP A;  1L1Z A;  1V34 A;  3TWK A;  2YR0 A;  2CWB A;  1KYI A;  4ITQ A;  3GRV A;  1TDH A;  1FNN A;  4I8O A;  1N34 M;  4S12 A;  2I7P A;  4L4U A;  4B3S M;  1PGY A;  3K9P A;  1SXJ D;  4RF0 A;  1E32 A;  5ITR A;  1NNU C;  4REZ A;  1XNR M;  2NQ8 C;  3A98 B;  3KSJ A;  3TWM A;  1VEJ A;  3FRH A;  4GHL A;  4LY6 A;  2FE8 A;  4GEW A;  2QEN A;  1ZMU A;  3U6M A;  3LCU A;  2R45 A;  1QQW A;  1QAO A;  1JR3 A;  1CUK A;  1ZV1 A;  2DZO B;  2Z4R A;  5IWA M;  3QYB A;  4Z6Y A;  2YNM D;  1N75 A;  1SXJ E;  2AHM A;  1OFH A;  3B9P A;  2D7H A;  4G3O A;  5KPR A;  3GLI B;  3KFU G;  3FTD A;  4NOO B;  4PT5 A;  1OQY A;  1NJF A;  3SMS A;  3GRU A;  1GLN A;  2EJS A;  4NSO B;  4CGY B;  3GLH B;  2F5Q A;  3WHK A;  4M9X A;  4CJ6 A;  5DNY A;  1I94 M;  1EIJ A;  4GC5 A;  4B3T M;  4OU7 A;  3LVV A;  1V33 A;  2MJ5 B;  2OO9 A;  3B89 A;  4DR1 M;  4F1I A;  2BJW A;  3U60 A;  3U6E A;  2QBY A;  3TWL A;  3AOE C;  4FVM A;  2DWZ B;  1MJG M;  2R18 A;  3T1Y M;  3U61 B;  4DR6 M;  5EXS A;  1HJP A;  2WSE F;  2F5N A;  4GKJ M;  3J7A S;  3FYC A;  3RFW A;  2KRK A;  2KHH A;  2R65 A;  4WUR A;  4QOZ C;  1NY6 A;  1XHB A;  3Q8X A;  4B7H A;  4AQY M;  2C9C A;  1G4A E;  3W0L B;  1K82 A;  1NHW C;  2J5Y A;  3TQS A;  1F4I A;  3CF6 E;  4FWH A;  1KSF X;  2KZU A;  3QYE A;  4L6V 6;  3HGI A;  3U60 B;  1PJJ A;  1C7Y A;  2QBY B;  4DR2 M;  3GPU A;  4IBF A;  2L4E A;  1C1K A;  3GO8 A;  3HHZ A;  3LW5 F;  3M7G A;  3H4M A;  3J81 S;  3KP0 E;  5IZ7 D;  1TDZ A;  2FS1 A;  1N77 A;  1HT2 E;  3J2P B;  2XFS A;  2DAI A;  4K0K M;  3HU2 A;  4JN6 A;  1E9S A;  2R62 A;  3VK8 A;  3MJ5 A;  3RGS A;  3SAR A;  4R3D A;  4Z8X A;  5EQT A;  4PDG A;  1GAB A;  4WP2 A;  2HKJ A;  5EJC A;  2RGO A;  1QAQ A;  3GLF A;  2L4F A;  1TH4 A;  3KS4 A;  2XZU A;  1GKI A;  3TL4 X;  4DV6 M;  3GLF E;  3ILK A;  2LH0 A;  4RNA A;  3GRY A;  3HY5 A;  2LVA A;  4LF7 M;  2Y0Q A;  3SYL A;  1HQC A;  1HT1 E;  1WJ7 A;  4OX9 M;  4LFB M;  1GJS A;  2FFJ A;  1HNW M;  1LTM A;  3C3E A;  4MB7 A;  1JQJ C;  3VDU A;  3KOX E;  4JI0 M;  3SFZ A;  3KOZ E;  1G8P A;  2KDL A;  2RKO A;  4GRI A;  4UN2 B;  2G8L A;  2LHG A;  4Y28 F;  3U6S A;  2V1C A;  1XC8 A;  4LJ6 A;  3B7Q A;  2JUJ A;  3LVW A;  2VQF M;  1XNQ M;  2DWN A;  5DYG A;  2F5P A;  3AV0 A;  4Q7J A;  3GQ4 A;  4DR4 M;  5C18 A;  3K1J A;  2H5X A;  2QCU A;  4KT0 F;  1DO0 A;  2XEP A;  4M0D A;  4MM3 B;  4CIS A;  3SC3 A;  4LF8 M;  4IJF A;  2WSF F;  1DV0 A;  2VII A;  3SAT A;  3DZD A;  4M9Z A;  4W5W A;  3UK6 A;  2DHR A;  4DUY M;  3HJ8 A;  1N36 M;  1DGB A;  1Q3B A;  2G5G X;  3IG8 A;  2KRU A;  4AW4 A;  2DAE A;  5FTK A;  3HHY A;  4DR3 M;  2ZAN A;  4ZPX A;  1D0M A;  3HKP A;  5LMU M;  2DEN A;  5IRE B;  4FCV A;  4FCW A;  2C96 A;  1WIV A;  4FCT A;  3J7B A;  2C99 A;  2LVO C;  4BB9 A;  3GQ5 A;  1QAN A;  3I51 A;  5FTL A;  1Z5A A;  5E6J A;  1R4G A;  4X66 M;  5EXX A;  4G6Z A;  3GLG E;  4R7G A;  2C9O A;  4LZJ A;  4LG2 A;  1D0K A;  1IY0 A;  2DAM A;  2HWJ A;  4FWD A;  5EXT A;  1IXS A;  2EKK A;  2VF7 A;  3MMP A;  2LVP C;  5BPV A;  1IXS B;  2BJV A;  3L27 A;  5E26 A;  2ZTD A;  3GP1 A;  1IN5 A;  3U6D A;  1IBM M;  1D2N A;  4HLQ A;  3QAU A;  1J7K A;  3M6A A;  5EP1 A;  1PRB A;  2GNO A;  3VKG A;  1NNJ A;  1G59 A;  3L28 A;  4DUZ M;  1JB0 F;  2VF8 A;  1G41 A;  5EXP A;  2FOI C;  4LCB A;  3L25 A;  2MGW A;  1GO5 A;  4B7G A;  1ZQ9 A;  3KP1 E;  4D80 A;  4L15 A;  1N33 M;  4LF4 M;  4IBG A;  2GQF A;  1YLA A;  4DV5 M;  1IM2 A;  1NSF A;  2DI0 A;  3HWS A;  5JI2 E;  4LF9 M;  1GL6 A;  1OAO C;  5KQ8 A;  3KS8 A;  2KEB A;  4P17 A;  4DV3 M;  1Z5B A;  1E9R A;  1EFU B;  3Q8G A;  3E4R A;  3VDP A;  4PD2 A;  4HEO A;  4DV4 M;  1W5S A;  3HZJ A;  4QNR A;  1IBK M;  2ZM6 M;  1DGF A;  4XK8 F;  2QNJ A;  3SMP A;  3SAS A;  1Y8G A;  4TUW A;  5ITQ A;  3DFZ A;  3UGJ A;  1NHG C;  2B3T A;  2H1R A;  3L2A A;  2X4A A;  2XFT A;  1QAM A;  2JP7 A;  4LJ5 A;  2CUZ A;  2W82 A;  3KOY E;  3HJS A;  3R8F A;  1J09 A;  2YQZ A;  4B3M M;  4LRS A;  4LJ4 A;  2J7O A;  4M9S A;  1QZM A;  4KLN A;  3VFD A;  1HNZ M;  1AIP C;  3B7N A;  2CFO A;  1OFI A;  2EO2 A;  3HU3 A;  2CV0 A;  4R71 A;  2BWE A;  3SAV A;  4YY3 M;  3KOW E;  1VEG A;  2ZAM A;  2K47 A;  2MRO B;  2DVW B;  4X65 M;  3K8Z A;  1WR1 B;  4GIT A;  1WGL A;  2XF3 A;  2JXN A;  3W0F A;  2LNH C;  7CAT A;  3GPX A;  4IBD A;  2J7N A;  2OQ4 A;  1K3W A;  3B74 A;  4MGZ E;  4GH9 A;  4NC6 A;  3GLG A;  3V76 A;  2JWS A;  4MGY E;  3U6L A;  2L6O A;  3U61 A;  1GL7 A;  2O5R A;  3UJN A;  4X62 M;  3U5Z A;  1L8Q A;  3FUT A;  2DXI A;  2EKF A;  4LJ8 A;  3U5Z B;  2XZF A;  2O01 F;  1X37 A;  2OOB A;  2DZL A;  1NVM A;  2FNA A;  3SAU A;  4L78 A;  3B7Z A;  4GC9 A;  3C58 A;  4L8R C;  1Z6T A;  2CEA A;  2CHV A;  3GLH A;  4M0W A;  3PXG A;  5KPT A;  5KPZ A;  2QQ8 A;  2R4E A;  1IXZ A;  1TTE A;  5FTJ A;  1T43 A;  1W5T A;  3K92 A;  3A46 A;  3GLI E;  3CF2 A;  2I7N A;  4JI3 M;  4FWG A;  2KA6 B;  2LWX A;  1QZE A;  3QWL A;  2ZAO A;  1YSY A;  3C3D A;  2JY8 A;  3GRR A;  2CHG A;  3AKZ A;  2F5O A;  1VG5 A;  3D8B A;  3TPZ A;  2XLJ A;  3KXE C;  4BLC A;  4LFA M;  2QHO B;  2CRU A;  4DV2 M;  3IHP A;  2ZBK B;  1IN6 A;  1VQ1 A;  5ITX E;  2OPF A;  1XMO M;  3FTE A;  3SHF A;  3BBZ A;  3MHV C;  4FW9 A;  4P16 A;  3I04 M;  3T6P A;  4WW0 A;  3FD9 A;  3C9P A;  3DOA A;  4IIW A;  3T1H M;  1AUA A;  1DGH A;  1YUB A;  5C1B A;  3GPY A;  3FTC A;  2DAG A;  1DGH B;  2APL A;  3GLI A;  1N32 M;  2DAK A;  3PNY A;  5KO3 A;  5IT9 S;  2XGN A;  2BWB A;  2Y20 A;  3LQQ A;  2ZTC A;  5ITT A;  3L26 A;  2CV1 A;  4KHP M;  2QP9 X;  3ZCB B;  1OTR A;  3JAM S;  1N78 A;  5EP4 A;  2Y21 A;  3FUX A;  5ITY A;  4MGK E;  3R9X B;  1DO2 A;  1OAI A;  4L16 A;  2LTU A;  1HNX M;  4DR5 M;  3GPP A;  1Q39 A;  3FTF A;  1Q02 A;  2LXE A;  2QSF X;  2G3Q A;  4AG6 A;  2YFQ A;  4G4R A;  4HL4 A;  4JI5 M;  1TH3 A;  1IY2 A;  4LGY A;  2KNA A;  2VDB B;  1SXJ B;  1WHC A;  3WHL A;  1XXH E;  2OOA A;  3JR4 A;  2X8A A;  3U6O A;  2UXC M;  1L2B A;  3CGW A;  5L8R F;  3SYK A;  2WZJ A;  4IBK A;  3E9S A;  1HQY E;  2KNZ A;  4OVZ B;  3FYD A;  4JYA M;  4ANR A;  1IFY A;  4NRW A;  1P3Q Q;  3D8L A;  1XWI A;  5LMN M;  3BXW A;  1GJT A;  5FTN A;  1L2D A;  2HHH M;  3MK6 A;  3AJI B;  4IBC A;  2Z7J A;  1NV9 A;  1V92 A;  3NBX X;  4LRT A;  2D7G A;  2UUB M;  2V1U A;  2JY7 A;  2Y0T A;  1EE8 A;  3KW6 A;  2LVQ D;  1PJQ A;  1WGN A;  3ZC7 B;  1NJG A;  5FSW A;  4XGI A;  1SXJ A;  2MH8 A;  3I01 M;  1L1T A;  2KNV A;  2K6B A;  4JV5 M;  1IXR C;  2UXB M;  2L7I A;  3VLF B;  4D81 A;  3PFI A;  1R2Z A;  1ZMW A;  4IBE A;  4LF6 M;  2XH9 A;  3OTO M;  1OIZ A;  3FKE A;  1JR3 D;  2M5Z A;  3THG A;  3RGP A;  1T3T A;  3GQ3 A;  3U6C A;  4DR7 M;  3W67 A;  3ZH9 B;  1SG9 A;  1XXH A;  4KO8 A;  2N35 A;  4OW0 A;  3A42 A;  1IN8 A;  3AOE A;  3FUW A;  3HJQ A;  3HX3 A;  3IEC A;  1QDR A;  1R6B X;  4JI4 M;  5FLX S;  2VQE M;  2Z4S A;  4I5S A;  3A45 A;  2HL7 A;  5GKN A;  2F5S A;  5JI3 E;  1R2Y A;  4RF1 A;  2JY6 B;  4MH0 E;  2ERC A;  1NO1 A;  1QUT A;  3ZQJ A;  4JI1 M;  2Q2E B;  3RE8 A;  4G4O A;  2RGH A;  1Z59 A;  3E21 A;  1TR8 A;  4LGM A;  3EIH A;  3L29 A;  1QDT A; 
#chains in the Genus database with same CATH homology
 2EA0 A;  3DA1 A;  4IBB A;  4D82 A;  2QZ4 A;  4JI6 M;  4BBA A;  4NL4 H;  3KDS E;  3VK7 A;  4QHT A;  3T15 A;  4CHT B;  2L09 A;  4LF5 M;  2UU9 M;  3IG5 A;  2KXE A;  5H37 D;  4GKK M;  3SAW A;  1J5E M;  4YHH M;  3FUU A;  3J80 S;  5EP2 A;  4AKI A;  4QNM A;  4KOD A;  4AZF A;  1XXH B;  2C5R A;  3U6Q A;  4LZZ A;  4X64 M;  4G4Q A;  4FD2 A;  1TH2 A;  2R46 A;  4NSR A;  1NY5 A;  1WXQ A;  1MU5 A;  1I4W A;  3LQR A;  3AFH A;  5F3W A;  5A2Q S;  2F4V M;  2QPA A;  2Z3X A;  4DV7 M;  3BOS A;  3SBJ A;  4QHS A;  3PVS A;  3KSX A;  2R4J A;  3HHX A;  3NWL A;  5ITX A;  8CAT A;  3CTW B;  1MX0 A;  1IN4 A;  2C98 A;  5KQD A;  4MGI E;  4NRV A;  4A3V B;  3KVW A;  4QOS A;  1TGU A;  1HR0 M;  3I4Y A;  2KZS A;  3K2L A;  3GLG B;  3U6P A;  2UUA M;  1QVR A;  4B7F A;  2XSZ A;  4NXM M;  2KW0 A;  1IY1 A;  1ZAE A;  3CF0 A;  4IBJ A;  4LJ9 A;  4DV0 M;  4JI2 M;  4B08 A;  1YE9 A;  1R7R A;  2M60 A;  1H6U A;  4I81 A;  4II7 A;  1K3X A;  4LFC M;  1VDD A;  3SHG B;  2BNK A;  4EIW A;  4GMQ A;  4AG5 A;  1DGG A;  4NXN M;  1E94 E;  1GVN A;  2XSZ D;  3UZU A;  1LV7 A;  2HCB A;  3EIE A;  2UUC M;  1IN7 A;  4OVZ A;  3I4V A;  4G4N A;  3HHW A;  1FJG M;  1SXJ C;  3JR5 A;  4B3R M;  2CE7 A;  4JXJ A;  4AKG A;  4AI6 A;  1XMQ M;  4JI8 M;  3M0E A;  1PM5 A;  3AL0 C;  3VKH A;  5DYI A;  4IBI A;  3UMM A;  2DZN B;  5FTM A;  1Q3C A;  2D7E A;  3TE6 A;  3LMM A;  3NBI A;  2JA2 A;  4LJ7 A;  1QYR A;  4GIP A;  1IQP A;  1KFV A;  4XBO A;  2UXD M;  2E5L M;  4GHA A;  1S3S A;  3AOG A;  1G3I A;  1ORY B;  2L7H A;  2P5T A;  2CV2 A;  3FUV A;  1PJI A;  4JI7 M;  1Z5C A;  3J27 B;  2DWM A;  4PDI A;  4IJE A;  2A5Y B;  4LJA A;  2DWL A;  4I4L A;  1IBL M;  1UM8 A;  5EP3 A;  3T38 A;  1L2C A;  3PNV A;  3GLF B;  4PCZ A;  2V6Z M;  4DV1 M;  2X49 A;  4MGH A;  2EUC A;  5ITU A;  3HU1 A;  5BR8 M;  2CHQ A;  1OJL A;  1L1Z A;  3TWK A;  2YR0 A;  1KYI A;  4ITQ A;  3GRV A;  1TDH A;  1FNN A;  4I8O A;  1N34 M;  4S12 A;  2I7P A;  4L4U A;  4B3S M;  1SXJ D;  4RF0 A;  1E32 A;  5ITR A;  1NNU C;  4REZ A;  1XNR M;  2NQ8 C;  3A98 B;  3KSJ A;  3TWM A;  4GHL A;  4LY6 A;  2FE8 A;  2QEN A;  3U6M A;  2R45 A;  1QQW A;  1QAO A;  1JR3 A;  2DZO B;  2Z4R A;  5IWA M;  4Z6Y A;  2YNM D;  1N75 A;  1SXJ E;  2AHM A;  1OFH A;  3B9P A;  2D7H A;  5KPR A;  3GLI B;  3KFU G;  3FTD A;  4NOO B;  4PT5 A;  1NJF A;  3SMS A;  3GRU A;  1GLN A;  4NSO B;  4CGY B;  3GLH B;  2F5Q A;  3WHK A;  4M9X A;  5DNY A;  1I94 M;  4GC5 A;  4B3T M;  4OU7 A;  3LVV A;  4DR1 M;  2BJW A;  3U60 A;  3U6E A;  2QBY A;  3TWL A;  3AOE C;  4FVM A;  2DWZ B;  2R18 A;  3T1Y M;  3U61 B;  4DR6 M;  5EXS A;  2F5N A;  4GKJ M;  3J7A S;  3FYC A;  3RFW A;  2KRK A;  2R65 A;  4WUR A;  1NY6 A;  3Q8X A;  1XHB A;  4B7H A;  4AQY M;  2C9C A;  1G4A E;  3W0L B;  1K82 A;  1NHW C;  3TQS A;  3CF6 E;  4FWH A;  1KSF X;  2KZU A;  3U60 B;  1PJJ A;  3HGI A;  2QBY B;  4DR2 M;  3GPU A;  4IBF A;  1C1K A;  3GO8 A;  3HHZ A;  3M7G A;  3H4M A;  3J81 S;  3KP0 E;  5IZ7 D;  1TDZ A;  4K0K M;  1N77 A;  1HT2 E;  3J2P B;  2XFS A;  3HU2 A;  4JN6 A;  1E9S A;  2R62 A;  3VK8 A;  3MJ5 A;  3RGS A;  3SAR A;  4R3D A;  4Z8X A;  5EQT A;  4PDG A;  2HKJ A;  5EJC A;  2RGO A;  1QAQ A;  3GLF A;  2XZU A;  1TH4 A;  3KS4 A;  1GKI A;  3TL4 X;  4DV6 M;  3ILK A;  2LH0 A;  4RNA A;  3GRY A;  4LF7 M;  2Y0Q A;  3SYL A;  1HQC A;  1HT1 E;  4LFB M;  4OX9 M;  2FFJ A;  1HNW M;  4AKH A;  4MB7 A;  1JQJ C;  3VDU A;  3KOX E;  4JI0 M;  3SFZ A;  3KOZ E;  1G8P A;  2RKO A;  4GRI A;  5ITX E;  3U6S A;  2G8L A;  1XC8 A;  2V1C A;  4LJ6 A;  3LVW A;  2VQF M;  1XNQ M;  2DWN A;  5DYG A;  2F5P A;  3AV0 A;  3GQ4 A;  4DR4 M;  5C18 A;  3K1J A;  2QCU A;  1DO0 A;  2XEP A;  4M0D A;  4MM3 B;  4CIS A;  3SC3 A;  4LF8 M;  4IJF A;  2VII A;  3SAT A;  3DZD A;  4M9Z A;  4W5W A;  3UK6 A;  2DHR A;  4DUY M;  3HJ8 A;  1N36 M;  1DGB A;  1Q3B A;  2G5G X;  3IG8 A;  2KRU A;  4AW4 A;  5FTK A;  3HHY A;  4DR3 M;  2ZAN A;  4ZPX A;  3HKP A;  5LMU M;  5IRE B;  4FCV A;  4FCW A;  2C96 A;  4FCT A;  3J7B A;  2C99 A;  4BB9 A;  3GQ5 A;  1QAN A;  3I51 A;  5FTL A;  1Z5A A;  5E6J A;  4X66 M;  5EXX A;  4G6Z A;  4R7G A;  2C9O A;  4LZJ A;  4LG2 A;  1IY0 A;  4FWD A;  5EXT A;  5BPV A;  1IXS B;  2BJV A;  3L27 A;  5E26 A;  3GP1 A;  1IN5 A;  3U6D A;  1IBM M;  1D2N A;  4HLQ A;  3QAU A;  1J7K A;  3M6A A;  5EP1 A;  3VKG A;  1NNJ A;  1G59 A;  3L28 A;  1G41 A;  5EXP A;  2FOI C;  4LCB A;  3L25 A;  4B7G A;  1ZQ9 A;  3KP1 E;  4D80 A;  4L15 A;  1N33 M;  4LF4 M;  4IBG A;  4DV5 M;  1IM2 A;  1NSF A;  3HWS A;  5JI2 E;  4LF9 M;  1GL6 A;  5KQ8 A;  3KS8 A;  2KEB A;  4DV3 M;  1Z5B A;  1E9R A;  3E4R A;  3VDP A;  4PD2 A;  4DV4 M;  1W5S A;  1IBK M;  4QNR A;  2ZM6 M;  1DGF A;  3SAS A;  3SMP A;  4TUW A;  5ITQ A;  3DFZ A;  3UGJ A;  1NHG C;  3L2A A;  2H1R A;  2X4A A;  2XFT A;  1QAM A;  4LJ5 A;  2CUZ A;  2W82 A;  3KOY E;  3HJS A;  3R8F A;  1J09 A;  2YQZ A;  4B3M M;  4LRS A;  4LJ4 A;  2J7O A;  4M9S A;  1QZM A;  4KLN A;  3VFD A;  1HNZ M;  2CFO A;  1OFI A;  2EO2 A;  3HU3 A;  2CV0 A;  3SAV A;  4YY3 M;  3KOW E;  2ZAM A;  2K47 A;  2DVW B;  4X65 M;  3K8Z A;  4GIT A;  2XF3 A;  3W0F A;  7CAT A;  2LNH C;  3GPX A;  4IBD A;  2J7N A;  2OQ4 A;  1K3W A;  4MGZ E;  3GLG A;  4GH9 A;  3U6L A;  4MGY E;  2L6O A;  3U61 A;  1GL7 A;  2O5R A;  3UJN A;  3U5Z A;  1L8Q A;  3FUT A;  2DXI A;  4LJ8 A;  3U5Z B;  2XZF A;  1X37 A;  4QOZ C;  3SAU A;  1NVM A;  2FNA A;  4L78 A;  4GC9 A;  3C58 A;  4L8R C;  1Z6T A;  2CEA A;  2CHV A;  3GLH A;  4M0W A;  3PXG A;  5KPT A;  5KPZ A;  2R4E A;  1IXZ A;  5FTJ A;  1W5T A;  3K92 A;  3A46 A;  3CF2 A;  2I7N A;  4JI3 M;  4FWG A;  2KA6 B;  2LWX A;  3QWL A;  2ZAO A;  1YSY A;  3GRR A;  3AKZ A;  2CHG A;  2F5O A;  3TPZ A;  3D8B A;  2XLJ A;  3KXE C;  4BLC A;  4LFA M;  4DV2 M;  2ZBK B;  1IN6 A;  3FTE A;  1XMO M;  2OPF A;  3SHF A;  3MHV C;  4FW9 A;  4P16 A;  4WW0 A;  3FD9 A;  3DOA A;  4IIW A;  3T1H M;  1DGH A;  1YUB A;  5C1B A;  3GPY A;  3FTC A;  1DGH B;  3GLI A;  1N32 M;  3PNY A;  5KO3 A;  5IT9 S;  2XGN A;  2Y20 A;  3LQQ A;  5ITT A;  3L26 A;  2CV1 A;  2QP9 X;  3ZCB B;  3JAM S;  1N78 A;  5EP4 A;  2Y21 A;  3FUX A;  5ITY A;  4MGK E;  3R9X B;  1DO2 A;  4L16 A;  1HNX M;  4DR5 M;  3GPP A;  1Q39 A;  3FTF A;  2LXE A;  4AG6 A;  2YFQ A;  4G4R A;  4HL4 A;  4JI5 M;  1TH3 A;  1IY2 A;  4LGY A;  1SXJ B;  3WHL A;  3JR4 A;  2X8A A;  3U6O A;  2UXC M;  1L2B A;  3SYK A;  4IBK A;  3E9S A;  1HQY E;  4OVZ B;  3FYD A;  4JYA M;  4NRW A;  3D8L A;  1XWI A;  5LMN M;  5FTN A;  1L2D A;  2HHH M;  3MK6 A;  3AJI B;  4IBC A;  2Z7J A;  4LRT A;  2UUB M;  4KHP M;  2D7G A;  2V1U A;  2Y0T A;  1EE8 A;  3KW6 A;  3ZC7 B;  5FSW A;  4X62 M;  4DUZ M;  1NJG A;  1L1T A;  4XGI A;  1SXJ A;  4JV5 M;  1IXR C;  2UXB M;  2L7I A;  3VLF B;  4D81 A;  3PFI A;  1R2Z A;  4IBE A;  4LF6 M;  2XH9 A;  3OTO M;  3FKE A;  1JR3 D;  2M5Z A;  3THG A;  3RGP A;  1T3T A;  3GQ3 A;  3U6C A;  4DR7 M;  3ZH9 B;  1XXH A;  4KO8 A;  4OW0 A;  3A42 A;  1IN8 A;  3AOE A;  3FUW A;  3HJQ A;  1R6B X;  4JI4 M;  5FLX S;  2VQE M;  2Z4S A;  4I5S A;  3A45 A;  2HL7 A;  5GKN A;  2F5S A;  5JI3 E;  1R2Y A;  4RF1 A;  4MH0 E;  2ERC A;  4JI1 M;  2Q2E B;  3RE8 A;  4G4O A;  2RGH A;  1Z59 A;  4LGM A;  3EIH A;  3L29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...