2DZNB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 17
structure length 57
sequence length 57
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dznB00
3KW6A 1W5TA 5FTMA 4A3VB 2Z4SA 4LGMA 1SXJC 2QENA 1UM8A 2VIIA 5DYGA 5C1BA 1S3SA 3EIEA 2V6ZM 3K1JA 4I4LA 4FWGA 4D81A 5JI2E 3H4MA 1E94E 4LJ6A 5EP4A 3DZDA 2R65A 1IY2A 1IN4A 1HQCA 1X37A 1QVRA 1G41A 4LY6A 4QHTA 4LJ9A 2FNAA 3GLGA 4FCWA 3GLGB 1W5SA 1IQPA 3GLFA 4FCTA 3GLIA 3GLFB 3PVSA 3GLIB 3GLHA 5FTKA 1IN6A 1R7RA 2DZNB 2CHVA 2CHQA 2RKOA 3GLHB 4FW9A 4L16A 1OJLA 2CHGA 4QOSA 1IN8A 5C18A 1IY0A 4LJ7A 1QZMA 4KLNA 1IN7A 2BJWA 2DHRA 3SC3A 3R8FA 1NSFA 1XXHA 1R6BX 1HT1E 4LJAA 2V1UA 1XXHB 4LRTA 1FNNA 1C1KA 4KO8A 4L4UA 4D82A 5EP3A 3HU2A 4D80A 1L8QA 1OFIA 2QP9X 3HWSA 1G4AE 1SXJE 2XSZD 3CF0A 1E32A 1D2NA 2C98A 3VLFB 3M0EA 1DO0A 4WW0A 2C9OA 3BOSA 2QBYB 4L15A 1DO2A 1IM2A 4KODA 1NJGA 4LRSA 2DWZB 4ZPXA 1JQJC 4LCBA 2KRKA 2CEAA 1XWIA 2HCBA 3SYLA 3U60B 1KYIA 3SYKA 5EP2A 3PXGA 3U61B 5JI3E 2BJVA 5EXXA 4FCVA 1J7KA 4FD2A 5EQTA 1IXSB 2R62A 5DYIA 1IY1A 1SXJD 2QPAA 2DZOB 4JN6A 3HU3A 3D8BA 1HQYE 4LZZA 3WHKA 3B9PA 3PFIA 2ZAOA 3AJIB 3M6AA 2DVWB 5FTNA 2CE7A 2ZAMA 5EXPA 4EIWA 2QBYA 3ZH9B 2C9CA 1SXJA 1NVMA 3VFDA 1IN5A 1NY5A 2Z4RA 4QNMA 1SXJB 1LV7A 1JR3D 2XSZA 4GITA 2C99A 3U5ZB 1IXRC 1KSFX 2C96A 1OFHA 4LJ4A 1IXZA 3HU1A 1HT2E 2ZANA 1NY6A 5EXTA 1NJFA 4LJ5A 4FWDA 5EXSA 1JR3A 4FWHA 3CF2A 4Z8XA 5FTJA 1G3IA 3WHLA 5FTLA 4I81A 4QNRA 2X8AA 5EP1A 3KDSE 3EIHA 2QZ4A 3MHVC 4LJ8A 4QHSA 3UK6A
chains in the Genus database with same CATH superfamily
4G4RA 5KQ8A 1QZEA 1W5TA 2LTUA 4MGIE 4A3VB 1L2CA 4LF8M 1HNWM 4I8OA 2JA2A 4P16A 1SXJC 1YSYA 1UM8A 4OVZB 2DWLA 5C1BA 1ORYB 3LVWA 4I4LA 2Q2EB 3J80S 5BR8M 3FTEA 4CJ6A 3FUXA 3J81S 4LJ6A 3D8LA 3FRIA 2R65A 3T1HM 1ZV1A 3GRYA 2DZLA 2JY5A 2J7OA 2HWJA 1TH4A 2QSFX 3GLGA 3GLIE 3LVVA 4GHLA 1GL7A 3W0LB 1VEKA 4NRWA 1XB2B 3T15A 3GLHE 1W5SA 3PNYA 3TE6A 4K0KM 3FUTA 1G71A 2HKJA 4FCTA 3GLFB 2P5TA 3GLIB 3K2LA 2F5PA 1HNXM 3SHGB 2RKOA 1R7RA 5KPRA 3GLHB 4OX9M 2FOIC 1OKSA 1DGFA 1QQWA 4G4NA 4GKJM 2EUCA 4B3TM 1HNZM 3M7GA 1XXHE 1OJLA 3JR5A 1PJJA 2R6FA 3C3EA 5C18A 1IY0A 1QZMA 1IBLM 4DV2M 4DV6M 2DHRA 3GRRA 4MGHA 3SC3A 1NSFA 3GPPA 3HHXA 1HT1E 1D0MA 2V1UA 1XXHB 3KOWE 1EE8A 3AKZA 1Q39A 1N75A 1R2YA 3HHYA 3SBJA 2UUAM 5KO3A 3NBIA 4OW0A 1N33M 2R46A 3HWSA 2CV1A 4ITQA 2JZ0A 1E32A 2OQ4A 2A5YB 3AV0A 2KDLA 2VDBB 4LZJA 1ZMVA 3FD9A 3TWLA 1OAIA 1NHWC 2H5XA 1Z5AA 4L8RC 1DO0A 2LVNC 1QAMA 1DO2A 4NOOB 1NJGA 3J7AS 1I94M 3GPYA 3FYDA 4ZPXA 3U60A 4G6ZA 3SARA 3KS8A 1KYIA 3GQ3A 5EP2A 4TUWA 3V76A 4DV4M 4BBAA 1WXQA 2KNZA 3U6CA 5EQTA 3W0FA 3JR4A 1SXJD 1DGHB 2KW0A 1N77A 1ZMWA 2QPAA 4AKHA 4X66M 3T38A 3IG8A 4LZZA 1WGLA 3B7ZA 2ZBKB 4B7FA 3MMPA 4JYAM 3Q8GA 4B3MM 2DENA 3HGIA 2QBYA 4FVMA 3ZH9B 1IFYA 3E4RA 1XNRM 2Y21A 1NY5A 3E9SA 1SXJB 2EA0A 4IBGA 2XSZA 3T6PA 4MB7A 3I51A 5KPTA 3A98B 2L7IA 3VKGA 1MN3A 3HY5A 3HU1A 2BWEA 5L8RF 4NL4H 3I04M 3J2PB 2ZANA 1E9RA 2DAGA 5EXTA 2DHYA 2G3QA 3DFZA 4YHHM 4MGZE 3FYCA 3CF2A 3L29A 2KZSA 1CUKA 1DGBA 1QDRA 3IECA 4PD2A 5FTLA 2MJ5B 3ZQJA 4QNRA 2XZUA 2EKFA 4DV0M 3L2AA 4MGYE 5FSWA 3UK6A 1MX0A 3QAUA 2O5RA 4Y28F 3KW6A 5EJCA 2BNKA 1QDTA 2L7HA 5FTMA 3TPZA 1XNQM 4LGMA 2R0IA 2E5LM 4IBIA 2VIIA 3A46A 2G5GX 2M5ZA 1NO1A 4IBJA 4M9SA 3UJNA 1S3SA 3K1JA 2X49A 4KT0F 3H4MA 1T3TA 3TWKA 3UMMA 1AIPC 2R18A 2X4AA 3FUUA 3U6LA 1R2ZA 1HQCA 1X37A 2KRUA 3L25A 3GRVA 3LQRA 4NXNM 2K9DA 2FNAA 1HR0M 4FCWA 1GJTA 4B08A 4G4OA 3UGJA 3B7QA 3GLFA 1QAQA 2G8LA 3H4JA 1PJQA 2KNAA 4HEOA 3GLIA 3A45A 2WSCF 2XH9A 4NRVA 4ANRA 4II7A 3U6DA 1N34M 3NBXX 4Z6YA 3GLHA 3HJSA 2FH0A 1T6OA 3TWMA 2CHVA 2CHQA 2DI0A 4MGKE 4YY3M 4L16A 3J7BA 2F5NA 2UUCM 2UXBM 2DWNA 3MK6A 1C7YA 1IN8A 2KA6B 7CATA 1IN7A 1GO5A 2BJWA 3TQSA 2LNHC 1XXHA 3F92A 4GIPA 2D7HA 2RGOA 4LRTA 3PNVA 1FNNA 1C1KA 1GVNA 4KO8A 4W5WA 5A2QS 3JAMS 3U6MA 4AKGA 1WHCA 1R4GA 2LXEA 4X65M 3CF6E 1J09A 3GPUA 1FJGM 2KXEA 3KOYE 3CF0A 3QYBA 4M9ZA 1DV0A 2DNAA 4PDGA 2JZ1A 2K0BX 2C98A 2XFTA 3FTDA 2JY8A 2NQ8C 4JI0M 3RE8A 3BOSA 2ERCA 1IM2A 4GEWA 4KODA 5E26A 4B7GA 2HL7A 3KOZE 2KRKA 3FTCA 1T43A 4JI5M 1JR3E 2L09A 4IIWA 4REZA 4F2LA 3L28A 3SYKA 3U6SA 3U61B 1PJIA 5JI3E 2BJVA 2O01F 2O25A 4Q7JA 4DUYM 2KZUA 4P17A 4WP2A 3SASA 3GQ5A 3HJQA 4IBBA 4DR6M 1DGHA 1N36M 4B3SM 3LW5F 8CATA 1TDHA 2UUBM 4GH9A 2WSEF 1R5LA 4OU7A 3RFWA 3RGPA 5ITXA 2JUJA 3WHKA 2B3TA 1YLAA 2ZAOA 3THGA 2DVWB 2CE7A 4UN2B 2ZAMA 1ZQ9A 5IWAM 4EIWA 4NC6A 2DAKA 1N78A 2C9CA 1SXJA 2L2DA 2CV0A 4DR3M 2LVPC 1IN5A 4QNMA 3C9PA 4JI8M 4LFBM 3GLGE 4XGIA 4GITA 2C99A 2W82A 1IXRC 2EKKA 2K47A 2C96A 3A42A 3SMSA 1GABA 1WJ7A 1DGGA 1L1TA 1N32M 1HT2E 2DXIA 3FRHA 3HHWA 4RNAA 5ITYA 4IJEA 3GRUA 1NY6A 1OAOC 4GKKM 2VQEM 2OO9A 4LJ5A 4FWDA 5EXSA 4G3OA 2L4FA 2HAKA 3LCUA 3VK7A 1F4IA 1D0LA 2D7EA 4Z8XA 4DV5M 5IT9S 4I81A 2JWSA 2CV2A 2OPFA 2X8AA 2UXCM 5EP1A 4JI7M 2YNMD 2LH0A 4QHSA 2QZ4A 2LHGA 3C58A 2DKLA 2FFJA 2L6OA 4RF1A 2Z8YM 3K92A 1VG5A 3B74A 5DYGA 2DAIA 3AOEC 3EIEA 5JI2E 1K3WA 4D81A 3GO8A 1QUTA 1E94E 5EP4A 3HHZA 3DZDA 2XEPA 1IN4A 3W68A 3GPXA 2LHCA 2Y0TA 1G8PA 4LY6A 2QNJA 3BBZA 1OQYA 4QHTA 1Q02A 1IQPA 3QWLA 2QCUA 4R7GA 5LMNM 5BPVA 3PVSA 4GRIA 1HJPA 3Q8XA 4GC5A 1QANA 4M0WA 4M9XA 5FTKA 3ZC7B 1IN6A 1VEGA 1MU5A 2D7GA 4JI4M 1ZMUA 2R44A 4FW9A 4LF5M 4DBGB 2OOAA 4AZFA 3U6QA 5DNYA 5ITUA 4OVZA 2F5QA 2CHGA 1WIVA 1K3XA 1RU3A 3KFUG 2KHHA 4KLNA 2YR0A 4I5SA 2CFOA 3R8FA 3E46A 2YFQA 1UFZA 5ITRA 4MM3B 2LWXA 4LJAA 1Z59A 2JNHA 4MH0E 4DR4M 4CHTB 2Y20A 4D82A 1SG9A 3HU2A 3LCVB 1OFIA 2XFSA 2QP9X 3HKPA 4IBFA 3SFZA 4BB9A 5E6JA 2XSZD 4R3DA 4GC9A 4NSOB 3SAUA 2LVOC 3FUVA 1VDLA 2HHHM 1YUBA 1NHGC 4CISA 1H6UA 3VLFB 3M0EA 3SAWA 3KSXA 1OIPA 3HX3A 4AG6A 4L15A 2QBYB 1EFUB 3HJ8A 2DWZB 2DAMA 4GMQA 4G4QA 1JQJC 2R4JA 3KP1E 4LCBA 2CEAA 2J5YA 1VDDA 2HCBA 4JI3M 3SYLA 3VK8A 3K9PA 3PXGA 1QUSA 4AI6A 3KOXE 4IJFA 1V34A 1GJSA 2R45A 3VDUA 1J7KA 1IBMM 2L4EA 2CRUA 2XLJA 1IXSB 3B7NA 1J5EM 1TTEA 4NXMM 3U6EA 2R62A 5DYIA 1IY1A 2I7NA 2JP7A 3QYEA 2AHMA 4RF0A 4B7HA 2DZOB 4JN6A 4JXJA 4R71A 2JY7A 3HU3A 3D8BA 1XMOM 5KQDA 4DR2M 1HQYE 3B9PA 3PFIA 3K9OA 5FTNA 4HLQA 4DV7M 1Y8GA 2Z3XA 4DR5M 3LMMA 3VFDA 1XHBA 2C5RA 2Z4RA 3BXWA 3VDPA 2J7NA 1JR3D 3HZJA 4L78A 3U5ZB 1KSFX 1VQ1A 2LBCA 1OFHA 4X64M 3ZCBB 1IXZA 5ITQA 3GLFE 1K82A 4AKIA 1LTMA 2EO2A 4QOZC 2ZTCA 2QHOB 4FWHA 4JI1M 1PJSA 3KS4A 1G3IA 2ZTDA 3WHLA 1P3QQ 2CP8A 4B3RM 2KEBA 3KDSE 3EIHA 3MHVC 3I4VA 4LJ8A 5IZ7D 4LFCM 2UXDM 1L1ZA 1PJTA 1Z5BA 2XGNA 2Z4SA 3E21A 3NWLA 2K6BA 3AFHA 2QENA 2V1CA 4F1IA 4S12A 4LF4M 2V6ZM 2GNOA 4FWGA 3L26A 1QYRA 2MROB 2VF7A 3I01M 4HL4A 3TL4X 1IY2A 1QAOA 3SMPA 4KHPM 4DR7M 5H37D 4DV3M 1QVRA 1G41A 2JXNA 2UU9M 4LJ9A 3LQQA 3CGWA 3GLGB 3SATA 3DA1A 3FKEA 5KPZA 3KXEC 2XZFA 3KP0E 2EJSA 1TH3A 2Y0QA 1G59A 2FS1A 3W67A 1L2BA 3FTFA 1TGUA 2DWMA 4AQYM 2VQFM 3U6OA 2DZNB 2WSFF 1D0KA 1NNUC 4JI6M 2APLA 3GQ4A 1WGNA 4NSRA 4QOSA 2VF8A 2GQFA 2WZJA 4DUZM 1Z6TA 4IBCA 4LJ7A 2FE8A 1TH2A 4RKUF 3K8ZA 2MH8A 1R6BX 2ZM6M 3FUWA 1L2DA 5ITXE 1NNJA 2F5OA 3R9XB 2F4VM 4L4UA 4WURA 5EP3A 1Z5CA 1L8QA 2MR9A 2N35A 2LVQD 4CGYB 1G4AE 1SXJE 2BWBA 4AG5A 5F3WA 1YE9A 2QQ8A 4LF7M 1D2NA 1OTRA 2M60A 4LF9M 3UZUA 1I4WA 1KFVA 2Z7JA 4L6V6 3RGSA 4WW0A 3IHPA 2C9OA 2I7PA 4LRSA 2H1RA 1XC8A 1XWIA 5DFLA 1A5TA 5GKNA 3U60B 4M0DA 1EIJA 4AW4A 4JI2M 1GL6A 5EXXA 3SAVA 1OIZA 1IXSA 2CUZA 4FCVA 4CIZA 3L27A 4FD2A 4IBEA 1AUAA 3B89A 3SHFA 2RRUA 1JB0F 4JV5M 1E9SA 3MJ5A 1PGYA 1VEJA 3CTWB 4X62M 3U6PA 2R4EA 1TDZA 2YQZA 3FE3A 2KNVA 2MGWA 3J27B 3C3DA 1Q3CA 3AJIB 3ILKA 3M6AA 2CWBA 2XF3A 4XK8F 4IBKA 5EXPA 3KSJA 3AL0C 1TF0B 5LMUM 1GLNA 2LVAA 1BVSA 4XBOA 1NVMA 3DOAA 4PCZA 2JY6B 2OOBA 1V92A 4IBDA 5ITTA 1NV9A 3AOEA 3T1YM 3U5ZA 1XMQM 1LV7A 1V33A 3AOGA 1GKIA 1WR1B 5FLXS 3GP1A 4LF6M 4DR1M 3I4YA 3VKHA 4LGYA 3U61A 4LJ4A 3KVWA 2F5SA 4LG2A 3IG5A 1IBKM 2DAEA 1NJFA 1PRBA 4PT5A 2RGHA 1JR3A 1ZAEA 1Q3BA 4GHAA 5IREB 1NV8A 1PM5A 5FTJA 1TR8A 4BLCA 4PDIA 3OTOM 4DV1M 4LFAM 1MJGM 4D80A
chains in the Genus database with same CATH topology
4G4RA 5KQ8A 1W5TA 1L2CA 4MGIE 4A3VB 4LF8M 1HNWM 4I8OA 2JA2A 4P16A 1SXJC 1YSYA 1UM8A 4OVZB 2DWLA 5C1BA 1ORYB 3LVWA 4I4LA 2Q2EB 3J80S 5BR8M 3FTEA 3FUXA 3J81S 4LJ6A 3D8LA 2R65A 3T1HM 3GRYA 2J7OA 1TH4A 3GLGA 3LVVA 4GHLA 1GL7A 3W0LB 4NRWA 3T15A 4K0KM 1W5SA 3PNYA 3TE6A 3FUTA 2HKJA 4FCTA 3GLFB 2P5TA 3GLIB 3K2LA 2F5PA 1HNXM 3SHGB 2RKOA 1R7RA 5KPRA 3GLHB 4OX9M 2FOIC 1DGFA 1QQWA 4G4NA 4GKJM 2EUCA 4B3TM 1HNZM 3M7GA 1OJLA 3JR5A 1PJJA 5C18A 1IY0A 1QZMA 1IBLM 4DV2M 4DV6M 2DHRA 3GRRA 4MGHA 3SC3A 1NSFA 3GPPA 3HHXA 1HT1E 2V1UA 1XXHB 3KOWE 1EE8A 3AKZA 1Q39A 1N75A 1R2YA 3HHYA 3SBJA 2UUAM 5KO3A 3NBIA 4OW0A 1N33M 2R46A 3HWSA 2CV1A 4ITQA 1E32A 2OQ4A 2A5YB 3AV0A 4LZJA 3FD9A 3TWLA 1NHWC 1Z5AA 4L8RC 1DO0A 1QAMA 1DO2A 4NOOB 1NJGA 3J7AS 1I94M 3GPYA 3FYDA 4ZPXA 3U60A 4G6ZA 3SARA 3KS8A 1KYIA 3GQ3A 5EP2A 4TUWA 4DV4M 4BBAA 1WXQA 3U6CA 5EQTA 3W0FA 3JR4A 1SXJD 1DGHB 2KW0A 1N77A 2QPAA 4AKHA 4X66M 3T38A 3IG8A 4LZZA 2ZBKB 4B7FA 4JYAM 4B3MM 3HGIA 2QBYA 4FVMA 3ZH9B 3E4RA 1XNRM 2Y21A 1NY5A 3E9SA 1SXJB 2EA0A 4IBGA 2XSZA 4MB7A 3I51A 5KPTA 3A98B 2L7IA 3VKGA 3HU1A 4NL4H 3J2PB 2ZANA 1E9RA 5EXTA 3DFZA 4YHHM 4MGZE 3FYCA 3CF2A 3L29A 2KZSA 5FTLA 1DGBA 4PD2A 2XZUA 4QNRA 4DV0M 3L2AA 4MGYE 5FSWA 3UK6A 1MX0A 3QAUA 2O5RA 3KW6A 5EJCA 2BNKA 2L7HA 5FTMA 3TPZA 1XNQM 4LGMA 2E5LM 4IBIA 2VIIA 3A46A 2G5GX 2M5ZA 4IBJA 3UJNA 4M9SA 1S3SA 3K1JA 2X49A 3H4MA 1T3TA 3TWKA 3UMMA 2R18A 2X4AA 3FUUA 3U6LA 1R2ZA 1HQCA 1X37A 2KRUA 3L25A 3GRVA 3LQRA 4NXNM 2FNAA 1HR0M 4FCWA 4B08A 4G4OA 3UGJA 3GLFA 1QAQA 2G8LA 3GLIA 1N34M 3A45A 2XH9A 4NRVA 3U6DA 4II7A 4Z6YA 3GLHA 3HJSA 3TWMA 2CHVA 2CHQA 4MGKE 4YY3M 4L16A 3J7BA 2F5NA 2UUCM 2UXBM 2DWNA 3MK6A 1IN8A 2KA6B 7CATA 1IN7A 2BJWA 3TQSA 2LNHC 1XXHA 4GIPA 2D7HA 2RGOA 4LRTA 3PNVA 1FNNA 1C1KA 1GVNA 4KO8A 4W5WA 5A2QS 3JAMS 3U6MA 4AKGA 2LXEA 4X65M 3CF6E 1J09A 3GPUA 1FJGM 2KXEA 3KOYE 3CF0A 4M9ZA 4PDGA 2C98A 2XFTA 3FTDA 2NQ8C 4JI0M 3RE8A 3BOSA 2ERCA 1IM2A 4B7GA 4KODA 5E26A 2HL7A 3KOZE 2KRKA 3FTCA 4JI5M 2L09A 4IIWA 4REZA 3U6SA 3L28A 3SYKA 3U61B 1PJIA 5JI3E 2BJVA 4DUYM 2KZUA 3SASA 3GQ5A 3HJQA 4IBBA 4DR6M 1DGHA 1N36M 4B3SM 8CATA 1TDHA 2UUBM 4GH9A 4OU7A 3RFWA 3RGPA 5ITXA 3WHKA 2ZAOA 3THGA 2DVWB 2CE7A 2ZAMA 1ZQ9A 5IWAM 4EIWA 1N78A 2C9CA 1SXJA 2CV0A 4DR3M 1IN5A 4QNMA 4JI8M 4LFBM 4XGIA 4GITA 2C99A 2W82A 1IXRC 2K47A 3A42A 2C96A 3SMSA 1DGGA 1L1TA 1N32M 1HT2E 2DXIA 4RNAA 3HHWA 5ITYA 4IJEA 3GRUA 1NY6A 4GKKM 2VQEM 4LJ5A 4FWDA 5EXSA 3VK7A 2D7EA 4Z8XA 4DV5M 5IT9S 4I81A 2CV2A 2OPFA 2X8AA 2UXCM 5EP1A 4JI7M 2YNMD 2LH0A 4QHSA 2QZ4A 3C58A 2FFJA 2L6OA 4RF1A 3K92A 5DYGA 3AOEC 3EIEA 5JI2E 1K3WA 4D81A 3GO8A 3HHZA 1E94E 5EP4A 3DZDA 2XEPA 1IN4A 3GPXA 2Y0TA 1G8PA 4LY6A 4QHTA 1IQPA 3QWLA 2QCUA 4R7GA 5LMNM 5BPVA 3PVSA 4GRIA 3Q8XA 4GC5A 4DR2M 1QANA 4M0WA 4M9XA 5FTKA 3ZC7B 1IN6A 1MU5A 2D7GA 4JI4M 4LF5M 4FW9A 3U6QA 4AZFA 5DNYA 5ITUA 4OVZA 2F5QA 2CHGA 1K3XA 3KFUG 4KLNA 2YR0A 4I5SA 2CFOA 3R8FA 2YFQA 5ITRA 4MM3B 2LWXA 4LJAA 1Z59A 4MH0E 4DR4M 4CHTB 2Y20A 4D82A 3HU2A 4BB9A 1OFIA 2XFSA 2QP9X 3HKPA 4IBFA 3SFZA 5E6JA 2XSZD 4R3DA 4GC9A 4NSOB 3SAUA 3FUVA 2HHHM 1YUBA 1NHGC 4CISA 1H6UA 3VLFB 3M0EA 3SAWA 3KSXA 2QBYB 4AG6A 4L15A 3HJ8A 2DWZB 4GMQA 4G4QA 1JQJC 2R4JA 3KP1E 4LCBA 2CEAA 1VDDA 2HCBA 4JI3M 3SYLA 3VK8A 3PXGA 4AI6A 3KOXE 4IJFA 2R45A 3VDUA 1J7KA 1IBMM 2XLJA 1IXSB 1J5EM 4NXMM 3U6EA 2R62A 5DYIA 1IY1A 2I7NA 4RF0A 2AHMA 4B7HA 2DZOB 4JN6A 4JXJA 1XMOM 3HU3A 3D8BA 5KQDA 1HQYE 3B9PA 3PFIA 5FTNA 4HLQA 4DV7M 2Z3XA 4DR5M 3LMMA 3VFDA 1XHBA 2C5RA 2Z4RA 3VDPA 2J7NA 1JR3D 4L78A 3U5ZB 1KSFX 1OFHA 4X64M 3ZCBB 1IXZA 5ITQA 4AKIA 1K82A 2EO2A 4QOZC 4FWHA 4JI1M 3KS4A 1G3IA 3WHLA 4B3RM 2KEBA 3KDSE 3EIHA 3MHVC 3I4VA 4LJ8A 5IZ7D 4LFCM 2UXDM 1L1ZA 1Z5BA 2XGNA 2Z4SA 3NWLA 3AFHA 2QENA 2V1CA 4S12A 4LF4M 2V6ZM 4FWGA 3L26A 1QYRA 3TL4X 4HL4A 1IY2A 1QAOA 3SMPA 4KHPM 4DR7M 5H37D 4DV3M 1QVRA 1G41A 2UU9M 4LJ9A 3LQQA 3GLGB 3SATA 3DA1A 3FKEA 5KPZA 3KXEC 2XZFA 3KP0E 1TH3A 2Y0QA 1G59A 1L2BA 3FTFA 1TGUA 2DWMA 4AQYM 2VQFM 3U6OA 2DZNB 1NNUC 4JI6M 3GQ4A 4NSRA 4QOSA 4DUZM 1Z6TA 4IBCA 4LJ7A 2FE8A 1TH2A 3K8ZA 2ZM6M 1R6BX 3FUWA 1L2DA 5ITXE 1NNJA 2F5OA 3R9XB 2F4VM 4L4UA 4WURA 5EP3A 1Z5CA 1L8QA 4CGYB 1G4AE 1SXJE 4AG5A 5F3WA 1YE9A 4LF7M 1D2NA 2M60A 4LF9M 3UZUA 1I4WA 1KFVA 2Z7JA 3RGSA 4WW0A 2C9OA 2I7PA 4LRSA 2H1RA 1XC8A 1XWIA 5GKNA 3U60B 4M0DA 4AW4A 4JI2M 1GL6A 5EXXA 3SAVA 2CUZA 4FCVA 3L27A 4FD2A 4IBEA 3SHFA 4JV5M 1E9SA 3MJ5A 3CTWB 4X62M 3U6PA 2R4EA 1TDZA 2YQZA 3J27B 1Q3CA 3AJIB 3ILKA 3M6AA 2XF3A 4IBKA 5EXPA 3KSJA 3AL0C 5LMUM 1GLNA 4XBOA 1NVMA 3DOAA 4PCZA 4IBDA 5ITTA 3AOEA 3T1YM 3U5ZA 1XMQM 1LV7A 3AOGA 5FLXS 1GKIA 3GP1A 4LF6M 4DR1M 3I4YA 3VKHA 4LGYA 3U61A 4LJ4A 3KVWA 2F5SA 4LG2A 3IG5A 1IBKM 1NJFA 4PT5A 2RGHA 1JR3A 1ZAEA 1Q3BA 4GHAA 5IREB 1PM5A 5FTJA 4BLCA 4PDIA 3OTOM 4DV1M 4LFAM 4D80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KW6 A;  1W5T A;  5FTM A;  4A3V B;  2Z4S A;  4LGM A;  1SXJ C;  2QEN A;  1UM8 A;  2VII A;  5DYG A;  5C1B A;  1S3S A;  3EIE A;  2V6Z M;  3K1J A;  4I4L A;  4FWG A;  4D81 A;  5JI2 E;  3H4M A;  1E94 E;  4LJ6 A;  5EP4 A;  3DZD A;  2R65 A;  1IY2 A;  1IN4 A;  1HQC A;  1X37 A;  1QVR A;  1G41 A;  4LY6 A;  4QHT A;  4LJ9 A;  2FNA A;  3GLG A;  4FCW A;  3GLG B;  1W5S A;  1IQP A;  3GLF A;  4FCT A;  3GLI A;  3GLF B;  3PVS A;  3GLI B;  3GLH A;  5FTK A;  1IN6 A;  1R7R A;  2DZN B;  2CHV A;  2CHQ A;  2RKO A;  3GLH B;  4FW9 A;  4L16 A;  1OJL A;  2CHG A;  4QOS A;  1IN8 A;  5C18 A;  1IY0 A;  4LJ7 A;  1QZM A;  4KLN A;  1IN7 A;  2BJW A;  2DHR A;  3SC3 A;  3R8F A;  1NSF A;  1XXH A;  1R6B X;  1HT1 E;  4LJA A;  2V1U A;  1XXH B;  4LRT A;  1FNN A;  1C1K A;  4KO8 A;  4L4U A;  4D82 A;  5EP3 A;  3HU2 A;  4D80 A;  1L8Q A;  1OFI A;  2QP9 X;  3HWS A;  1G4A E;  1SXJ E;  2XSZ D;  3CF0 A;  1E32 A;  1D2N A;  2C98 A;  3VLF B;  3M0E A;  1DO0 A;  4WW0 A;  2C9O A;  3BOS A;  2QBY B;  4L15 A;  1DO2 A;  1IM2 A;  4KOD A;  1NJG A;  4LRS A;  2DWZ B;  4ZPX A;  1JQJ C;  4LCB A;  2KRK A;  2CEA A;  1XWI A;  2HCB A;  3SYL A;  3U60 B;  1KYI A;  3SYK A;  5EP2 A;  3PXG A;  3U61 B;  5JI3 E;  2BJV A;  5EXX A;  4FCV A;  1J7K A;  4FD2 A;  5EQT A;  1IXS B;  2R62 A;  5DYI A;  1IY1 A;  1SXJ D;  2QPA A;  2DZO B;  4JN6 A;  3HU3 A;  3D8B A;  1HQY E;  4LZZ A;  3WHK A;  3B9P A;  3PFI A;  2ZAO A;  3AJI B;  3M6A A;  2DVW B;  5FTN A;  2CE7 A;  2ZAM A;  5EXP A;  4EIW A;  2QBY A;  3ZH9 B;  2C9C A;  1SXJ A;  1NVM A;  3VFD A;  1IN5 A;  1NY5 A;  2Z4R A;  4QNM A;  1SXJ B;  1LV7 A;  1JR3 D;  2XSZ A;  4GIT A;  2C99 A;  3U5Z B;  1IXR C;  1KSF X;  2C96 A;  1OFH A;  4LJ4 A;  1IXZ A;  3HU1 A;  1HT2 E;  2ZAN A;  1NY6 A;  5EXT A;  1NJF A;  4LJ5 A;  4FWD A;  5EXS A;  1JR3 A;  4FWH A;  3CF2 A;  4Z8X A;  5FTJ A;  1G3I A;  3WHL A;  5FTL A;  4I81 A;  4QNR A;  2X8A A;  5EP1 A;  3KDS E;  3EIH A;  2QZ4 A;  3MHV C;  4LJ8 A;  4QHS A;  3UK6 A; 
#chains in the Genus database with same CATH topology
 4G4R A;  5KQ8 A;  1QZE A;  1W5T A;  2LTU A;  4MGI E;  4A3V B;  1L2C A;  4LF8 M;  1HNW M;  4I8O A;  2JA2 A;  4P16 A;  1SXJ C;  1YSY A;  1UM8 A;  4OVZ B;  2DWL A;  5C1B A;  1ORY B;  3LVW A;  4I4L A;  2Q2E B;  3J80 S;  5BR8 M;  3FTE A;  4CJ6 A;  3FUX A;  3J81 S;  4LJ6 A;  3D8L A;  3FRI A;  2R65 A;  3T1H M;  1ZV1 A;  3GRY A;  2DZL A;  2JY5 A;  2J7O A;  2HWJ A;  1TH4 A;  2QSF X;  3GLG A;  3GLI E;  3LVV A;  4GHL A;  1GL7 A;  3W0L B;  1VEK A;  4NRW A;  1XB2 B;  3T15 A;  3GLH E;  1W5S A;  3PNY A;  3TE6 A;  4K0K M;  3FUT A;  1G71 A;  2HKJ A;  4FCT A;  3GLF B;  2P5T A;  3GLI B;  3K2L A;  2F5P A;  1HNX M;  3SHG B;  2RKO A;  1R7R A;  5KPR A;  3GLH B;  4OX9 M;  2FOI C;  1OKS A;  1DGF A;  1QQW A;  4G4N A;  4GKJ M;  2EUC A;  4B3T M;  1HNZ M;  3M7G A;  1XXH E;  1OJL A;  3JR5 A;  1PJJ A;  2R6F A;  3C3E A;  5C18 A;  1IY0 A;  1QZM A;  1IBL M;  4DV2 M;  4DV6 M;  2DHR A;  3GRR A;  4MGH A;  3SC3 A;  1NSF A;  3GPP A;  3HHX A;  1HT1 E;  1D0M A;  2V1U A;  1XXH B;  3KOW E;  1EE8 A;  3AKZ A;  1Q39 A;  1N75 A;  1R2Y A;  3HHY A;  3SBJ A;  2UUA M;  5KO3 A;  3NBI A;  4OW0 A;  1N33 M;  2R46 A;  3HWS A;  2CV1 A;  4ITQ A;  2JZ0 A;  1E32 A;  2OQ4 A;  2A5Y B;  3AV0 A;  2KDL A;  2VDB B;  4LZJ A;  1ZMV A;  3FD9 A;  3TWL A;  1OAI A;  1NHW C;  2H5X A;  1Z5A A;  4L8R C;  1DO0 A;  2LVN C;  1QAM A;  1DO2 A;  4NOO B;  1NJG A;  3J7A S;  1I94 M;  3GPY A;  3FYD A;  4ZPX A;  3U60 A;  4G6Z A;  3SAR A;  3KS8 A;  1KYI A;  3GQ3 A;  5EP2 A;  4TUW A;  3V76 A;  4DV4 M;  4BBA A;  1WXQ A;  2KNZ A;  3U6C A;  5EQT A;  3W0F A;  3JR4 A;  1SXJ D;  1DGH B;  2KW0 A;  1N77 A;  1ZMW A;  2QPA A;  4AKH A;  4X66 M;  3T38 A;  3IG8 A;  4LZZ A;  1WGL A;  3B7Z A;  2ZBK B;  4B7F A;  3MMP A;  4JYA M;  3Q8G A;  4B3M M;  2DEN A;  3HGI A;  2QBY A;  4FVM A;  3ZH9 B;  1IFY A;  3E4R A;  1XNR M;  2Y21 A;  1NY5 A;  3E9S A;  1SXJ B;  2EA0 A;  4IBG A;  2XSZ A;  3T6P A;  4MB7 A;  3I51 A;  5KPT A;  3A98 B;  2L7I A;  3VKG A;  1MN3 A;  3HY5 A;  3HU1 A;  2BWE A;  5L8R F;  4NL4 H;  3I04 M;  3J2P B;  2ZAN A;  1E9R A;  2DAG A;  5EXT A;  2DHY A;  2G3Q A;  3DFZ A;  4YHH M;  4MGZ E;  3FYC A;  3CF2 A;  3L29 A;  2KZS A;  1CUK A;  1DGB A;  1QDR A;  3IEC A;  4PD2 A;  5FTL A;  2MJ5 B;  3ZQJ A;  4QNR A;  2XZU A;  2EKF A;  4DV0 M;  3L2A A;  4MGY E;  5FSW A;  3UK6 A;  1MX0 A;  3QAU A;  2O5R A;  4Y28 F;  3KW6 A;  5EJC A;  2BNK A;  1QDT A;  2L7H A;  5FTM A;  3TPZ A;  1XNQ M;  4LGM A;  2R0I A;  2E5L M;  4IBI A;  2VII A;  3A46 A;  2G5G X;  2M5Z A;  1NO1 A;  4IBJ A;  4M9S A;  3UJN A;  1S3S A;  3K1J A;  2X49 A;  4KT0 F;  3H4M A;  1T3T A;  3TWK A;  3UMM A;  1AIP C;  2R18 A;  2X4A A;  3FUU A;  3U6L A;  1R2Z A;  1HQC A;  1X37 A;  2KRU A;  3L25 A;  3GRV A;  3LQR A;  4NXN M;  2K9D A;  2FNA A;  1HR0 M;  4FCW A;  1GJT A;  4B08 A;  4G4O A;  3UGJ A;  3B7Q A;  3GLF A;  1QAQ A;  2G8L A;  3H4J A;  1PJQ A;  2KNA A;  4HEO A;  3GLI A;  3A45 A;  2WSC F;  2XH9 A;  4NRV A;  4ANR A;  4II7 A;  3U6D A;  1N34 M;  3NBX X;  4Z6Y A;  3GLH A;  3HJS A;  2FH0 A;  1T6O A;  3TWM A;  2CHV A;  2CHQ A;  2DI0 A;  4MGK E;  4YY3 M;  4L16 A;  3J7B A;  2F5N A;  2UUC M;  2UXB M;  2DWN A;  3MK6 A;  1C7Y A;  1IN8 A;  2KA6 B;  7CAT A;  1IN7 A;  1GO5 A;  2BJW A;  3TQS A;  2LNH C;  1XXH A;  3F92 A;  4GIP A;  2D7H A;  2RGO A;  4LRT A;  3PNV A;  1FNN A;  1C1K A;  1GVN A;  4KO8 A;  4W5W A;  5A2Q S;  3JAM S;  3U6M A;  4AKG A;  1WHC A;  1R4G A;  2LXE A;  4X65 M;  3CF6 E;  1J09 A;  3GPU A;  1FJG M;  2KXE A;  3KOY E;  3CF0 A;  3QYB A;  4M9Z A;  1DV0 A;  2DNA A;  4PDG A;  2JZ1 A;  2K0B X;  2C98 A;  2XFT A;  3FTD A;  2JY8 A;  2NQ8 C;  4JI0 M;  3RE8 A;  3BOS A;  2ERC A;  1IM2 A;  4GEW A;  4KOD A;  5E26 A;  4B7G A;  2HL7 A;  3KOZ E;  2KRK A;  3FTC A;  1T43 A;  4JI5 M;  1JR3 E;  2L09 A;  4IIW A;  4REZ A;  4F2L A;  3L28 A;  3SYK A;  3U6S A;  3U61 B;  1PJI A;  5JI3 E;  2BJV A;  2O01 F;  2O25 A;  4Q7J A;  4DUY M;  2KZU A;  4P17 A;  4WP2 A;  3SAS A;  3GQ5 A;  3HJQ A;  4IBB A;  4DR6 M;  1DGH A;  1N36 M;  4B3S M;  3LW5 F;  8CAT A;  1TDH A;  2UUB M;  4GH9 A;  2WSE F;  1R5L A;  4OU7 A;  3RFW A;  3RGP A;  5ITX A;  2JUJ A;  3WHK A;  2B3T A;  1YLA A;  2ZAO A;  3THG A;  2DVW B;  2CE7 A;  4UN2 B;  2ZAM A;  1ZQ9 A;  5IWA M;  4EIW A;  4NC6 A;  2DAK A;  1N78 A;  2C9C A;  1SXJ A;  2L2D A;  2CV0 A;  4DR3 M;  2LVP C;  1IN5 A;  4QNM A;  3C9P A;  4JI8 M;  4LFB M;  3GLG E;  4XGI A;  4GIT A;  2C99 A;  2W82 A;  1IXR C;  2EKK A;  2K47 A;  2C96 A;  3A42 A;  3SMS A;  1GAB A;  1WJ7 A;  1DGG A;  1L1T A;  1N32 M;  1HT2 E;  2DXI A;  3FRH A;  3HHW A;  4RNA A;  5ITY A;  4IJE A;  3GRU A;  1NY6 A;  1OAO C;  4GKK M;  2VQE M;  2OO9 A;  4LJ5 A;  4FWD A;  5EXS A;  4G3O A;  2L4F A;  2HAK A;  3LCU A;  3VK7 A;  1F4I A;  1D0L A;  2D7E A;  4Z8X A;  4DV5 M;  5IT9 S;  4I81 A;  2JWS A;  2CV2 A;  2OPF A;  2X8A A;  2UXC M;  5EP1 A;  4JI7 M;  2YNM D;  2LH0 A;  4QHS A;  2QZ4 A;  2LHG A;  3C58 A;  2DKL A;  2FFJ A;  2L6O A;  4RF1 A;  2Z8Y M;  3K92 A;  1VG5 A;  3B74 A;  5DYG A;  2DAI A;  3AOE C;  3EIE A;  5JI2 E;  1K3W A;  4D81 A;  3GO8 A;  1QUT A;  1E94 E;  5EP4 A;  3HHZ A;  3DZD A;  2XEP A;  1IN4 A;  3W68 A;  3GPX A;  2LHC A;  2Y0T A;  1G8P A;  4LY6 A;  2QNJ A;  3BBZ A;  1OQY A;  4QHT A;  1Q02 A;  1IQP A;  3QWL A;  2QCU A;  4R7G A;  5LMN M;  5BPV A;  3PVS A;  4GRI A;  1HJP A;  3Q8X A;  4GC5 A;  1QAN A;  4M0W A;  4M9X A;  5FTK A;  3ZC7 B;  1IN6 A;  1VEG A;  1MU5 A;  2D7G A;  4JI4 M;  1ZMU A;  2R44 A;  4FW9 A;  4LF5 M;  4DBG B;  2OOA A;  4AZF A;  3U6Q A;  5DNY A;  5ITU A;  4OVZ A;  2F5Q A;  2CHG A;  1WIV A;  1K3X A;  1RU3 A;  3KFU G;  2KHH A;  4KLN A;  2YR0 A;  4I5S A;  2CFO A;  3R8F A;  3E46 A;  2YFQ A;  1UFZ A;  5ITR A;  4MM3 B;  2LWX A;  4LJA A;  1Z59 A;  2JNH A;  4MH0 E;  4DR4 M;  4CHT B;  2Y20 A;  4D82 A;  1SG9 A;  3HU2 A;  3LCV B;  1OFI A;  2XFS A;  2QP9 X;  3HKP A;  4IBF A;  3SFZ A;  4BB9 A;  5E6J A;  2XSZ D;  4R3D A;  4GC9 A;  4NSO B;  3SAU A;  2LVO C;  3FUV A;  1VDL A;  2HHH M;  1YUB A;  1NHG C;  4CIS A;  1H6U A;  3VLF B;  3M0E A;  3SAW A;  3KSX A;  1OIP A;  3HX3 A;  4AG6 A;  4L15 A;  2QBY B;  1EFU B;  3HJ8 A;  2DWZ B;  2DAM A;  4GMQ A;  4G4Q A;  1JQJ C;  2R4J A;  3KP1 E;  4LCB A;  2CEA A;  2J5Y A;  1VDD A;  2HCB A;  4JI3 M;  3SYL A;  3VK8 A;  3K9P A;  3PXG A;  1QUS A;  4AI6 A;  3KOX E;  4IJF A;  1V34 A;  1GJS A;  2R45 A;  3VDU A;  1J7K A;  1IBM M;  2L4E A;  2CRU A;  2XLJ A;  1IXS B;  3B7N A;  1J5E M;  1TTE A;  4NXM M;  3U6E A;  2R62 A;  5DYI A;  1IY1 A;  2I7N A;  2JP7 A;  3QYE A;  2AHM A;  4RF0 A;  4B7H A;  2DZO B;  4JN6 A;  4JXJ A;  4R71 A;  2JY7 A;  3HU3 A;  3D8B A;  1XMO M;  5KQD A;  4DR2 M;  1HQY E;  3B9P A;  3PFI A;  3K9O A;  5FTN A;  4HLQ A;  4DV7 M;  1Y8G A;  2Z3X A;  4DR5 M;  3LMM A;  3VFD A;  1XHB A;  2C5R A;  2Z4R A;  3BXW A;  3VDP A;  2J7N A;  1JR3 D;  3HZJ A;  4L78 A;  3U5Z B;  1KSF X;  1VQ1 A;  2LBC A;  1OFH A;  4X64 M;  3ZCB B;  1IXZ A;  5ITQ A;  3GLF E;  1K82 A;  4AKI A;  1LTM A;  2EO2 A;  4QOZ C;  2ZTC A;  2QHO B;  4FWH A;  4JI1 M;  1PJS A;  3KS4 A;  1G3I A;  2ZTD A;  3WHL A;  1P3Q Q;  2CP8 A;  4B3R M;  2KEB A;  3KDS E;  3EIH A;  3MHV C;  3I4V A;  4LJ8 A;  5IZ7 D;  4LFC M;  2UXD M;  1L1Z A;  1PJT A;  1Z5B A;  2XGN A;  2Z4S A;  3E21 A;  3NWL A;  2K6B A;  3AFH A;  2QEN A;  2V1C A;  4F1I A;  4S12 A;  4LF4 M;  2V6Z M;  2GNO A;  4FWG A;  3L26 A;  1QYR A;  2MRO B;  2VF7 A;  3I01 M;  4HL4 A;  3TL4 X;  1IY2 A;  1QAO A;  3SMP A;  4KHP M;  4DR7 M;  5H37 D;  4DV3 M;  1QVR A;  1G41 A;  2JXN A;  2UU9 M;  4LJ9 A;  3LQQ A;  3CGW A;  3GLG B;  3SAT A;  3DA1 A;  3FKE A;  5KPZ A;  3KXE C;  2XZF A;  3KP0 E;  2EJS A;  1TH3 A;  2Y0Q A;  1G59 A;  2FS1 A;  3W67 A;  1L2B A;  3FTF A;  1TGU A;  2DWM A;  4AQY M;  2VQF M;  3U6O A;  2DZN B;  2WSF F;  1D0K A;  1NNU C;  4JI6 M;  2APL A;  3GQ4 A;  1WGN A;  4NSR A;  4QOS A;  2VF8 A;  2GQF A;  2WZJ A;  4DUZ M;  1Z6T A;  4IBC A;  4LJ7 A;  2FE8 A;  1TH2 A;  4RKU F;  3K8Z A;  2MH8 A;  1R6B X;  2ZM6 M;  3FUW A;  1L2D A;  5ITX E;  1NNJ A;  2F5O A;  3R9X B;  2F4V M;  4L4U A;  4WUR A;  5EP3 A;  1Z5C A;  1L8Q A;  2MR9 A;  2N35 A;  2LVQ D;  4CGY B;  1G4A E;  1SXJ E;  2BWB A;  4AG5 A;  5F3W A;  1YE9 A;  2QQ8 A;  4LF7 M;  1D2N A;  1OTR A;  2M60 A;  4LF9 M;  3UZU A;  1I4W A;  1KFV A;  2Z7J A;  4L6V 6;  3RGS A;  4WW0 A;  3IHP A;  2C9O A;  2I7P A;  4LRS A;  2H1R A;  1XC8 A;  1XWI A;  5DFL A;  1A5T A;  5GKN A;  3U60 B;  4M0D A;  1EIJ A;  4AW4 A;  4JI2 M;  1GL6 A;  5EXX A;  3SAV A;  1OIZ A;  1IXS A;  2CUZ A;  4FCV A;  4CIZ A;  3L27 A;  4FD2 A;  4IBE A;  1AUA A;  3B89 A;  3SHF A;  2RRU A;  1JB0 F;  4JV5 M;  1E9S A;  3MJ5 A;  1PGY A;  1VEJ A;  3CTW B;  4X62 M;  3U6P A;  2R4E A;  1TDZ A;  2YQZ A;  3FE3 A;  2KNV A;  2MGW A;  3J27 B;  3C3D A;  1Q3C A;  3AJI B;  3ILK A;  3M6A A;  2CWB A;  2XF3 A;  4XK8 F;  4IBK A;  5EXP A;  3KSJ A;  3AL0 C;  1TF0 B;  5LMU M;  1GLN A;  2LVA A;  1BVS A;  4XBO A;  1NVM A;  3DOA A;  4PCZ A;  2JY6 B;  2OOB A;  1V92 A;  4IBD A;  5ITT A;  1NV9 A;  3AOE A;  3T1Y M;  3U5Z A;  1XMQ M;  1LV7 A;  1V33 A;  3AOG A;  1GKI A;  1WR1 B;  5FLX S;  3GP1 A;  4LF6 M;  4DR1 M;  3I4Y A;  3VKH A;  4LGY A;  3U61 A;  4LJ4 A;  3KVW A;  2F5S A;  4LG2 A;  3IG5 A;  1IBK M;  2DAE A;  1NJF A;  1PRB A;  4PT5 A;  2RGH A;  1JR3 A;  1ZAE A;  1Q3B A;  4GHA A;  5IRE B;  1NV8 A;  1PM5 A;  5FTJ A;  1TR8 A;  4BLC A;  4PDI A;  3OTO M;  4DV1 M;  4LFA M;  1MJG M;  4D80 A; 
#chains in the Genus database with same CATH homology
 4G4R A;  5KQ8 A;  1W5T A;  1L2C A;  4MGI E;  4A3V B;  4LF8 M;  1HNW M;  4I8O A;  2JA2 A;  4P16 A;  1SXJ C;  1YSY A;  1UM8 A;  4OVZ B;  2DWL A;  5C1B A;  1ORY B;  3LVW A;  4I4L A;  2Q2E B;  3J80 S;  5BR8 M;  3FTE A;  3FUX A;  3J81 S;  4LJ6 A;  3D8L A;  2R65 A;  3T1H M;  3GRY A;  2J7O A;  1TH4 A;  3GLG A;  3LVV A;  4GHL A;  1GL7 A;  3W0L B;  4NRW A;  3T15 A;  4K0K M;  1W5S A;  3PNY A;  3TE6 A;  3FUT A;  2HKJ A;  4FCT A;  3GLF B;  2P5T A;  3GLI B;  3K2L A;  2F5P A;  1HNX M;  3SHG B;  2RKO A;  1R7R A;  5KPR A;  3GLH B;  4OX9 M;  2FOI C;  1DGF A;  1QQW A;  4G4N A;  4GKJ M;  2EUC A;  4B3T M;  1HNZ M;  3M7G A;  1OJL A;  3JR5 A;  1PJJ A;  5C18 A;  1IY0 A;  1QZM A;  1IBL M;  4DV2 M;  4DV6 M;  2DHR A;  3GRR A;  4MGH A;  3SC3 A;  1NSF A;  3GPP A;  3HHX A;  1HT1 E;  2V1U A;  1XXH B;  3KOW E;  1EE8 A;  3AKZ A;  1Q39 A;  1N75 A;  1R2Y A;  3HHY A;  3SBJ A;  2UUA M;  5KO3 A;  3NBI A;  4OW0 A;  1N33 M;  2R46 A;  3HWS A;  2CV1 A;  4ITQ A;  1E32 A;  2OQ4 A;  2A5Y B;  3AV0 A;  4LZJ A;  3FD9 A;  3TWL A;  1NHW C;  1Z5A A;  4L8R C;  1DO0 A;  1QAM A;  1DO2 A;  4NOO B;  1NJG A;  3J7A S;  1I94 M;  3GPY A;  3FYD A;  4ZPX A;  3U60 A;  4G6Z A;  3SAR A;  3KS8 A;  1KYI A;  3GQ3 A;  5EP2 A;  4TUW A;  4DV4 M;  4BBA A;  1WXQ A;  3U6C A;  5EQT A;  3W0F A;  3JR4 A;  1SXJ D;  1DGH B;  2KW0 A;  1N77 A;  2QPA A;  4AKH A;  4X66 M;  3T38 A;  3IG8 A;  4LZZ A;  2ZBK B;  4B7F A;  4JYA M;  4B3M M;  3HGI A;  2QBY A;  4FVM A;  3ZH9 B;  3E4R A;  1XNR M;  2Y21 A;  1NY5 A;  3E9S A;  1SXJ B;  2EA0 A;  4IBG A;  2XSZ A;  4MB7 A;  3I51 A;  5KPT A;  3A98 B;  2L7I A;  3VKG A;  3HU1 A;  4NL4 H;  3J2P B;  2ZAN A;  1E9R A;  5EXT A;  3DFZ A;  4YHH M;  4MGZ E;  3FYC A;  3CF2 A;  3L29 A;  2KZS A;  5FTL A;  1DGB A;  4PD2 A;  2XZU A;  4QNR A;  4DV0 M;  3L2A A;  4MGY E;  5FSW A;  3UK6 A;  1MX0 A;  3QAU A;  2O5R A;  3KW6 A;  5EJC A;  2BNK A;  2L7H A;  5FTM A;  3TPZ A;  1XNQ M;  4LGM A;  2E5L M;  4IBI A;  2VII A;  3A46 A;  2G5G X;  2M5Z A;  4IBJ A;  3UJN A;  4M9S A;  1S3S A;  3K1J A;  2X49 A;  3H4M A;  1T3T A;  3TWK A;  3UMM A;  2R18 A;  2X4A A;  3FUU A;  3U6L A;  1R2Z A;  1HQC A;  1X37 A;  2KRU A;  3L25 A;  3GRV A;  3LQR A;  4NXN M;  2FNA A;  1HR0 M;  4FCW A;  4B08 A;  4G4O A;  3UGJ A;  3GLF A;  1QAQ A;  2G8L A;  3GLI A;  1N34 M;  3A45 A;  2XH9 A;  4NRV A;  3U6D A;  4II7 A;  4Z6Y A;  3GLH A;  3HJS A;  3TWM A;  2CHV A;  2CHQ A;  4MGK E;  4YY3 M;  4L16 A;  3J7B A;  2F5N A;  2UUC M;  2UXB M;  2DWN A;  3MK6 A;  1IN8 A;  2KA6 B;  7CAT A;  1IN7 A;  2BJW A;  3TQS A;  2LNH C;  1XXH A;  4GIP A;  2D7H A;  2RGO A;  4LRT A;  3PNV A;  1FNN A;  1C1K A;  1GVN A;  4KO8 A;  4W5W A;  5A2Q S;  3JAM S;  3U6M A;  4AKG A;  2LXE A;  4X65 M;  3CF6 E;  1J09 A;  3GPU A;  1FJG M;  2KXE A;  3KOY E;  3CF0 A;  4M9Z A;  4PDG A;  2C98 A;  2XFT A;  3FTD A;  2NQ8 C;  4JI0 M;  3RE8 A;  3BOS A;  2ERC A;  1IM2 A;  4B7G A;  4KOD A;  5E26 A;  2HL7 A;  3KOZ E;  2KRK A;  3FTC A;  4JI5 M;  2L09 A;  4IIW A;  4REZ A;  3U6S A;  3L28 A;  3SYK A;  3U61 B;  1PJI A;  5JI3 E;  2BJV A;  4DUY M;  2KZU A;  3SAS A;  3GQ5 A;  3HJQ A;  4IBB A;  4DR6 M;  1DGH A;  1N36 M;  4B3S M;  8CAT A;  1TDH A;  2UUB M;  4GH9 A;  4OU7 A;  3RFW A;  3RGP A;  5ITX A;  3WHK A;  2ZAO A;  3THG A;  2DVW B;  2CE7 A;  2ZAM A;  1ZQ9 A;  5IWA M;  4EIW A;  1N78 A;  2C9C A;  1SXJ A;  2CV0 A;  4DR3 M;  1IN5 A;  4QNM A;  4JI8 M;  4LFB M;  4XGI A;  4GIT A;  2C99 A;  2W82 A;  1IXR C;  2K47 A;  3A42 A;  2C96 A;  3SMS A;  1DGG A;  1L1T A;  1N32 M;  1HT2 E;  2DXI A;  4RNA A;  3HHW A;  5ITY A;  4IJE A;  3GRU A;  1NY6 A;  4GKK M;  2VQE M;  4LJ5 A;  4FWD A;  5EXS A;  3VK7 A;  2D7E A;  4Z8X A;  4DV5 M;  5IT9 S;  4I81 A;  2CV2 A;  2OPF A;  2X8A A;  2UXC M;  5EP1 A;  4JI7 M;  2YNM D;  2LH0 A;  4QHS A;  2QZ4 A;  3C58 A;  2FFJ A;  2L6O A;  4RF1 A;  3K92 A;  5DYG A;  3AOE C;  3EIE A;  5JI2 E;  1K3W A;  4D81 A;  3GO8 A;  3HHZ A;  1E94 E;  5EP4 A;  3DZD A;  2XEP A;  1IN4 A;  3GPX A;  2Y0T A;  1G8P A;  4LY6 A;  4QHT A;  1IQP A;  3QWL A;  2QCU A;  4R7G A;  5LMN M;  5BPV A;  3PVS A;  4GRI A;  3Q8X A;  4GC5 A;  4DR2 M;  1QAN A;  4M0W A;  4M9X A;  5FTK A;  3ZC7 B;  1IN6 A;  1MU5 A;  2D7G A;  4JI4 M;  4LF5 M;  4FW9 A;  3U6Q A;  4AZF A;  5DNY A;  5ITU A;  4OVZ A;  2F5Q A;  2CHG A;  1K3X A;  3KFU G;  4KLN A;  2YR0 A;  4I5S A;  2CFO A;  3R8F A;  2YFQ A;  5ITR A;  4MM3 B;  2LWX A;  4LJA A;  1Z59 A;  4MH0 E;  4DR4 M;  4CHT B;  2Y20 A;  4D82 A;  3HU2 A;  4BB9 A;  1OFI A;  2XFS A;  2QP9 X;  3HKP A;  4IBF A;  3SFZ A;  5E6J A;  2XSZ D;  4R3D A;  4GC9 A;  4NSO B;  3SAU A;  3FUV A;  2HHH M;  1YUB A;  1NHG C;  4CIS A;  1H6U A;  3VLF B;  3M0E A;  3SAW A;  3KSX A;  2QBY B;  4AG6 A;  4L15 A;  3HJ8 A;  2DWZ B;  4GMQ A;  4G4Q A;  1JQJ C;  2R4J A;  3KP1 E;  4LCB A;  2CEA A;  1VDD A;  2HCB A;  4JI3 M;  3SYL A;  3VK8 A;  3PXG A;  4AI6 A;  3KOX E;  4IJF A;  2R45 A;  3VDU A;  1J7K A;  1IBM M;  2XLJ A;  1IXS B;  1J5E M;  4NXM M;  3U6E A;  2R62 A;  5DYI A;  1IY1 A;  2I7N A;  4RF0 A;  2AHM A;  4B7H A;  2DZO B;  4JN6 A;  4JXJ A;  1XMO M;  3HU3 A;  3D8B A;  5KQD A;  1HQY E;  3B9P A;  3PFI A;  5FTN A;  4HLQ A;  4DV7 M;  2Z3X A;  4DR5 M;  3LMM A;  3VFD A;  1XHB A;  2C5R A;  2Z4R A;  3VDP A;  2J7N A;  1JR3 D;  4L78 A;  3U5Z B;  1KSF X;  1OFH A;  4X64 M;  3ZCB B;  1IXZ A;  5ITQ A;  4AKI A;  1K82 A;  2EO2 A;  4QOZ C;  4FWH A;  4JI1 M;  3KS4 A;  1G3I A;  3WHL A;  4B3R M;  2KEB A;  3KDS E;  3EIH A;  3MHV C;  3I4V A;  4LJ8 A;  5IZ7 D;  4LFC M;  2UXD M;  1L1Z A;  1Z5B A;  2XGN A;  2Z4S A;  3NWL A;  3AFH A;  2QEN A;  2V1C A;  4S12 A;  4LF4 M;  2V6Z M;  4FWG A;  3L26 A;  1QYR A;  3TL4 X;  4HL4 A;  1IY2 A;  1QAO A;  3SMP A;  4KHP M;  4DR7 M;  5H37 D;  4DV3 M;  1QVR A;  1G41 A;  2UU9 M;  4LJ9 A;  3LQQ A;  3GLG B;  3SAT A;  3DA1 A;  3FKE A;  5KPZ A;  3KXE C;  2XZF A;  3KP0 E;  1TH3 A;  2Y0Q A;  1G59 A;  1L2B A;  3FTF A;  1TGU A;  2DWM A;  4AQY M;  2VQF M;  3U6O A;  2DZN B;  1NNU C;  4JI6 M;  3GQ4 A;  4NSR A;  4QOS A;  4DUZ M;  1Z6T A;  4IBC A;  4LJ7 A;  2FE8 A;  1TH2 A;  3K8Z A;  2ZM6 M;  1R6B X;  3FUW A;  1L2D A;  5ITX E;  1NNJ A;  2F5O A;  3R9X B;  2F4V M;  4L4U A;  4WUR A;  5EP3 A;  1Z5C A;  1L8Q A;  4CGY B;  1G4A E;  1SXJ E;  4AG5 A;  5F3W A;  1YE9 A;  4LF7 M;  1D2N A;  2M60 A;  4LF9 M;  3UZU A;  1I4W A;  1KFV A;  2Z7J A;  3RGS A;  4WW0 A;  2C9O A;  2I7P A;  4LRS A;  2H1R A;  1XC8 A;  1XWI A;  5GKN A;  3U60 B;  4M0D A;  4AW4 A;  4JI2 M;  1GL6 A;  5EXX A;  3SAV A;  2CUZ A;  4FCV A;  3L27 A;  4FD2 A;  4IBE A;  3SHF A;  4JV5 M;  1E9S A;  3MJ5 A;  3CTW B;  4X62 M;  3U6P A;  2R4E A;  1TDZ A;  2YQZ A;  3J27 B;  1Q3C A;  3AJI B;  3ILK A;  3M6A A;  2XF3 A;  4IBK A;  5EXP A;  3KSJ A;  3AL0 C;  5LMU M;  1GLN A;  4XBO A;  1NVM A;  3DOA A;  4PCZ A;  4IBD A;  5ITT A;  3AOE A;  3T1Y M;  3U5Z A;  1XMQ M;  1LV7 A;  3AOG A;  5FLX S;  1GKI A;  3GP1 A;  4LF6 M;  4DR1 M;  3I4Y A;  3VKH A;  4LGY A;  3U61 A;  4LJ4 A;  3KVW A;  2F5S A;  4LG2 A;  3IG5 A;  1IBK M;  1NJF A;  4PT5 A;  2RGH A;  1JR3 A;  1ZAE A;  1Q3B A;  4GHA A;  5IRE B;  1PM5 A;  5FTJ A;  4BLC A;  4PDI A;  3OTO M;  4DV1 M;  4LFA M;  4D80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...