2DZNB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 17
structure length 57
sequence length 57
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dznB00
1UM8A 2CHQA 1NJGA 3HU2A 3SYLA 3VFDA 3VLFB 1R6BX 1SXJD 2QENA 4LY6A 3GLGA 1JR3D 4QHSA 3PVSA 5EXSA 5FTNA 1DO0A 3BOSA 2QBYA 2DZNB 3DZDA 4L15A 1NY6A 1OFHA 1SXJB 4FCVA 4A3VB 5EP4A 2XSZD 5EP3A 5EP1A 3AJIB 3M0EA 1NY5A 5FTKA 1C1KA 2DWZB 2ZANA 3GLIA 1W5TA 1OFIA 2VIIA 3HU3A 2BJWA 2CHVA 3CF0A 1IN5A 1QVRA 3M6AA 4QNMA 3GLFA 1HQYE 4LJ8A 3ZH9B 4LJ7A 2R62A 4ZPXA 1IN6A 1S3SA 4FD2A 3R8FA 1IN4A 1R7RA 5EQTA 1LV7A 3GLHA 4LGMA 4QHTA 2CHGA 3D8BA 5DYIA 1IXSB 2C99A 1X37A 1IY1A 1XWIA 3PFIA 3WHLA 5C18A 5C1BA 1IN7A 2Z4SA 2QPAA 1KYIA 4FWHA 1XXHA 4FWDA 1SXJE 4FW9A 4I81A 5EP2A 4L4UA 1G4AE 5FTMA 5JI2E 2ZAOA 4FWGA 3HU1A 4L16A 3WHKA 1HQCA 3KW6A 3K1JA 4LJ4A 4WW0A 1IY2A 4GITA 1W5SA 4EIWA 2C98A 1QZMA 3GLGB 3B9PA 2HCBA 4LRTA 3UK6A 5FTLA 2QBYB 4D82A 2X8AA 4KLNA 3U5ZB 2ZAMA 1J7KA 1IN8A 4LJAA 1SXJA 2DHRA 4LZZA 2Z4RA 4QNRA 3U60B 4JN6A 2FNAA 2R65A 3KDSE 4LJ6A 2DZOB 3EIHA 1IQPA 4LCBA 3GLIB 1HT2E 2RKOA 2KRKA 1IXRC 2V6ZM 3GLFB 4QOSA 5FTJA 1NVMA 1KSFX 2C96A 1G3IA 5JI3E 4KODA 3CF2A 4LJ5A 2CEAA 1D2NA 1E32A 1E94E 1G41A 1NSFA 1SXJC 2CE7A 1NJFA 4LRSA 4FCTA 4KO8A 2V1UA 3HWSA 3GLHB 1IXZA 3MHVC 4D80A 2DVWB 5EXXA 3SYKA 4Z8XA 1JQJC 1OJLA 1FNNA 2XSZA 3H4MA 3SC3A 4I4LA 4D81A 1XXHB 3EIEA 2BJVA 2C9OA 4FCWA 1HT1E 3U61B 4LJ9A 1IY0A 1DO2A 5DYGA 1IM2A 1L8QA 1JR3A 3PXGA 2C9CA 2QP9X 5EXTA 5EXPA 2QZ4A
chains in the Genus database with same CATH superfamily
1N78A 3HU2A 4K0KM 2XEPA 4DV0M 1SXJD 2B3TA 2R0IA 3FKEA 5EJCA 4YHHM 4QHSA 4XBOA 2K6BA 3GRUA 1V33A 1WGNA 5FTNA 1TR8A 2DI0A 4DR5M 1GLNA 3VK7A 1NY6A 1WHCA 3IHPA 5IREB 1OFHA 1SXJB 1R2ZA 3TL4X 2M60A 3IECA 3AL0C 2FH0A 2XSZD 2R18A 4II7A 2I7PA 2ZANA 3B74A 4MGKE 2CFOA 1I4WA 4JI3M 4MM3B 2DHYA 2MROB 2BJWA 4G4NA 1IN5A 1QVRA 1PGYA 2EJSA 3FE3A 3GLFA 4DR2M 1HQYE 3I4YA 4LJ8A 3C9PA 4LJ7A 3ZH9B 3L2AA 3F92A 5DNYA 4LFCM 2KRUA 1IN6A 3A98B 4NRWA 3TE6A 2FFJA 2O5RA 2L7HA 1TH4A 2WSFF 2L7IA 4FD2A 2HHHM 3GLHA 2GQFA 4LGMA 2DAKA 3U6EA 4NXMM 5E26A 3E46A 3C3DA 2KNVA 3SMSA 1XWIA 4B08A 1D0LA 4DR3M 3UZUA 3LMMA 3U6CA 1Q3CA 5KPZA 4FWHA 4DV5M 1IBLM 1XXHA 4G3OA 1K3XA 4FWDA 2J7NA 4OX9M 2OO9A 5EP2A 5FTMA 2R45A 2KNAA 4MH0E 4L6V6 5JI2E 1ZAEA 3W0FA 3HHWA 5IT9S 1TDHA 1EFUB 2QHOB 3LVWA 4MGIE 3WHKA 1QAQA 1QQWA 2KZUA 1QUTA 3CTWB 4GITA 1W5SA 4OW0A 4LF9M 2LH0A 3HHZA 2F4VM 1QZMA 2V1CA 2YNMD 1PJJA 2HCBA 2F5QA 2FS1A 3UK6A 1I94M 1L2CA 3HGIA 4G4QA 3U5ZB 1R4GA 2LVAA 3SAVA 1R2YA 4XGIA 4R71A 2QQ8A 4WP2A 4M0DA 4DR7M 1BVSA 3GPXA 3A42A 3GLIE 3KDSE 2DZOB 3SATA 3J7BA 4LCBA 3HHYA 4AG5A 1HT2E 2KRKA 2KXEA 2GNOA 1IXRC 3QYEA 4QOSA 5FTJA 2VQEM 2C96A 1G3IA 5JI3E 4NXNM 3SMPA 4PCZA 2F5OA 1Z5AA 1VEKA 4RNAA 3GQ5A 3GP1A 4DV2M 2LBCA 3UMMA 3HWSA 4CISA 3HKPA 3MHVC 1QAMA 2N35A 2DVWB 3LVVA 4LF5M 1PJTA 1JQJC 2QNJA 2LVNC 1FNNA 1R5LA 4AG6A 5ITRA 2UXCM 2DAGA 3H4MA 4G4RA 1T6OA 1WGLA 3KXEC 1QDTA 3HJ8A 1YSYA 4PD2A 4G4OA 3U6PA 2DAMA 1HT1E 3TWKA 1GJTA 4F2LA 4BBAA 2G5GX 1ZQ9A 2KHHA 1DO2A 3FYCA 4IJFA 4MGHA 2O01F 1WIVA 5F3WA 3PXGA 2XF3A 3BOSA 1OIZA 2ZTCA 1C7YA 1YLAA 4LG2A 3ZC7B 2Y0QA 3LCUA 1OAIA 4LF7M 1MU5A 2QENA 3QWLA 2HL7A 1HNZM 3VDPA 3PVSA 2VDBB 3KFUG 3DA1A 3KP1E 3DZDA 3H4JA 2LWXA 4DR6M 2VQFM 4FVMA 3FTEA 2D7EA 4A3VB 5EP4A 4DV1M 1XHBA 4AZFA 3SAUA 2LNHC 2MGWA 5EP3A 3U60A 3GPPA 5FTKA 1NHGC 4JYAM 4B3SM 3GLIA 1W5TA 3KS8A 4GHLA 4QNMA 3FUTA 1IBMM 1YUBA 4CGYB 4W5WA 4RKUF 5IWAM 2MH8A 4IBFA 4JI0M 4X64M 1G59A 3T38A 4JI2M 1DV0A 1S3SA 2JWSA 2L4EA 3GRRA 1NNUC 2UXBM 4GH9A 1LV7A 3FRIA 5EQTA 3I04M 2KZSA 5DYIA 4DBGB 3UGJA 2C99A 2F5PA 1PM5A 2K0BX 5C18A 1CUKA 1TGUA 4GMQA 1IN7A 5ITTA 4OU7A 1J5EM 3LW5F 2QPAA 4L8RC 3FTCA 5FSWA 2F5SA 4M9ZA 1PJSA 4REZA 1G4AE 3U61A 2EKKA 1OKSA 3HZJA 2E5LM 4DUZM 3LQQA 3J27B 3HU1A 3W0LB 2VF8A 2YFQA 3IG5A 4BLCA 1RU3A 3TQSA 2R4EA 2K47A 1PRBA 2O25A 2XGNA 1XNRM 1HJPA 1NNJA 1QYRA 3MMPA 1IFYA 1GJSA 3V76A 1SG9A 3B9PA 2F5NA 3SAWA 1HNXM 4JI8M 1TTEA 3L27A 2W82A 3GPUA 2QBYB 4LF4M 4LF8M 4AKGA 3BXWA 4KLNA 4NL4H 2ZAMA 1WJ7A 2JY8A 2Q2EB 4LJAA 4DR1M 3KOZE 1SXJA 4LZZA 1XC8A 3K2LA 1P3QQ 3AFHA 2CV2A 4M0WA 4KHPM 1D0KA 3L26A 3I51A 3GO8A 1DGGA 5LMUM 3EIHA 1IQPA 4I5SA 1WXQA 2RKOA 3J2PB 1G8PA 4QOZC 3THGA 2XFTA 2I7NA 3GLFB 3FTFA 2MR9A 7CATA 5IZ7D 4G6ZA 5KPRA 3KSXA 1T43A 4KODA 2FOIC 2CEAA 1NSFA 1E32A 2CE7A 2EO2A 2DZLA 2R44A 3B7QA 2L6OA 3HJSA 4LRSA 1L2BA 2Z7JA 2V1UA 1Z6TA 1IXZA 1TH2A 4R7GA 3AOGA 2JNHA 4IBIA 2JY6B 3SYKA 3JR5A 4JV5M 2HKJA 1ZMVA 4LFBM 1OJLA 1VG5A 2ERCA 5ITXE 5E6JA 2XSZA 2L4FA 1N77A 3SC3A 4D81A 2H1RA 1OTRA 4KT0F 4NSOB 4AI6A 1NHWC 1V34A 2JA2A 2WSCF 2C9OA 4FCWA 3SBJA 1YE9A 2EKFA 2JP7A 2DWLA 4B7FA 4GIPA 1JR3A 4S12A 3RE8A 4Z8XA 2XZFA 1L1ZA 2YQZA 3E9SA 1E9RA 1UM8A 2CHQA 1G71A 1NJGA 3FTDA 3SYLA 3VFDA 2AHMA 3J7AS 1QZEA 3VLFB 4TUWA 1XMQM 3GLGA 1JR3D 1N33M 1DGFA 5EXSA 3A45A 1DO0A 3E21A 4BB9A 4IBJA 4RF1A 2DZNB 3FUWA 3K9PA 3KOXE 4L15A 3U5ZA 1EE8A 4NSRA 3SHGB 5KO3A 3NWLA 3SFZA 4JI1M 1EIJA 3GQ3A 3I01M 3HHXA 3M0EA 3L29A 4B7GA 2DWZB 3K8ZA 2ZTDA 4AKHA 1OFIA 4IIWA 3HU3A 2CHVA 2D7HA 4MGZE 5ITXA 3M6AA 1DGHB 4DUYM 2CV0A 1Q39A 2OOBA 5LMNM 3TPZA 2HWJA 2CV1A 2P5TA 2EUCA 3TWMA 1IN4A 1R7RA 3RGSA 1JR3E 4PT5A 2CHGA 4GHAA 3D8BA 1IXSB 3DOAA 1DGBA 1IY1A 3WHLA 5C1BA 4CHTB 1GVNA 3U6SA 1GABA 4OVZA 4MB7A 3FD9A 3U6OA 1FJGM 1L1TA 3E4RA 2M5ZA 3NBXX 4DV7M 4FW9A 2CRUA 3MK6A 3FUXA 3FUUA 4PDGA 2CUZA 4FWGA 3QAUA 4L16A 2XFSA 3KW6A 3K1JA 2CP8A 3K92A 3VKHA 4EIWA 1KFVA 1T3TA 2Y21A 2C98A 4GRIA 3LQRA 2R4JA 2Z8YM 5FTLA 2RRUA 3NBIA 2X8AA 4IBGA 3VDUA 4P16A 3T1HM 1IN8A 3A46A 4IBDA 4L78A 3VK8A 1N75A 1QUSA 1NV8A 1OAOC 2R65A 2DNAA 4LJ6A 2ZBKB 3AOEC 5EXTA 2G3QA 2WSEF 3IG8A 3CGWA 1Q3BA 2V6ZM 4DV6M 2XLJA 1VQ1A 1ZMWA 3I4VA 1LTMA 1GKIA 4DV4M 3HJQA 4R3DA 5KQ8A 3OTOM 3CF2A 2R46A 3HX3A 1D2NA 1G41A 3UJNA 3R9XB 1NJFA 4P17A 1TDZA 3FYDA 3GLHB 2UU9M 4B3RM 3KP0E 4AQYM 4D80A 2LTUA 5EXXA 5ITQA 2JUJA 2CWBA 1Q02A 4LF6M 1MX0A 1WR1B 4NC6A 2Y0TA 4JI5M 2C5RA 1XXHB 3AOEA 3FRHA 3T6PA 3EIEA 3FUVA 3U61B 4LJ9A 5ITYA 3JR4A 3CF6E 1IY0A 5ITUA 4XK8F 2EA0A 1L8QA 5FLXS 4Y28F 1N32M 2MJ5B 2C9CA 2FE8A 1JB0F 4CJ6A 1NO1A 5EXPA 4HEOA 1GO5A 1N36M 3GPYA 3C58A 3W67A 2UUCM 4IBBA 1R6BX 2LXEA 3KVWA 1H6UA 4LY6A 2LVPC 3SASA 1HNWM 1OQYA 2LVQD 2L2DA 2DWNA 4WURA 1PJIA 4HLQA 2QBYA 1TF0B 4IJEA 1QAOA 3GRYA 3PNVA 1VEGA 2BWBA 4FCVA 1VDLA 2A5YB 1AUAA 3JAMS 4I8OA 2BWEA 5EP1A 3AJIB 4ITQA 1NY5A 4NRVA 1C1KA 3L28A 4UN2B 3U6QA 2BNKA 5BPVA 2DENA 4AKIA 2RGHA 2UUBM 2VIIA 4GEWA 3CF0A 2OOAA 3KS4A 5GKNA 3SHFA 4M9SA 4AW4A 1Z59A 2K9DA 1TH3A 2R62A 2RGOA 4ZPXA 2KDLA 4LFAM 5A2QS 4MGYE 3U6DA 3KOYE 2XH9A 2LHCA 1PJQA 2HAKA 1HR0M 2OPFA 3L25A 3R8FA 1IBKM 1UFZA 4JI7M 1Z5BA 3RGPA 4NOOB 4B7HA 4DV3M 4QHTA 1NV9A 2J7OA 3PNYA 2XZUA 2DWMA 3B7ZA 1X37A 2WZJA 3MJ5A 3PFIA 3GQ4A 3GLFE 3RFWA 2YR0A 1XNQM 2LVOC 2Z4SA 5BR8M 4IBCA 3KSJA 1KYIA 4IBEA 4LGYA 4X66M 4ANRA 3KOWE 1SXJE 4I81A 2Y20A 1V92A 4L4UA 2KA6B 4CIZA 2ZAOA 1D0MA 3TWLA 4HL4A 3ILKA 1HQCA 4LJ4A 4WW0A 1IY2A 2D7GA 4F1IA 4JI6M 3VKGA 1J09A 3D8LA 1N34M 3W68A 2G8LA 2OQ4A 1XMOM 3GLGB 4M9XA 2UXDM 4YY3M 2X4AA 4DR4M 8CATA 2KNZA 4LRTA 2KEBA 4D82A 2JZ1A 3HY5A 5KQDA 1J7KA 4JI4M 4RF0A 2DHRA 4QNRA 2Z4RA 1OIPA 4Z6YA 2ZM6M 1F4IA 4X62M 1MJGM 2JXNA 2VF7A 3U60B 4JN6A 1K3WA 1AIPC 1QANA 1VEJA 2DAIA 2FNAA 3DFZA 3U6MA 1XB2B 3C3EA 2JZ0A 3QYBA 5L8RF 3GLIB 3U6LA 3Q8GA 5DFLA 3T1YM 2QSFX 1E9SA 3K9OA 1DGHA 3AKZA 3J80S 1NVMA 2JY5A 1Y8GA 1KSFX 4Q7JA 4B3TM 4GKKM 1GL7A 1VDDA 2X49A 3BBZA 4LJ5A 3ZCBB 1MN3A 1E94E 1GL6A 1QDRA 1SXJC 1ZMUA 2L09A 2DAEA 4GC9A 2R6FA 4FCTA 3AV0A 4KO8A 1Z5CA 2KW0A 3LCVB 3T15A 3SARA 1K82A 2H5XA 2DKLA 5KPTA 4PDIA 1IXSA 2JY7A 3GRVA 1ZV1A 4IBKA 1XXHE 4LZJA 4OVZB 3ZQJA 4I4LA 1L2DA 2APLA 2Z3XA 2UUAM 2NQ8C 3B7NA 3J81S 2BJVA 2DXIA 1ORYB 3Q8XA 4B3MM 2LHGA 4JXJA 4GKJM 2J5YA 2QCUA 5DYGA 1IM2A 5H37D 3GLHE 4X65M 4GC5A 3B89A 2QP9X 1A5TA 3GLGE 3M7GA 2QZ4A
chains in the Genus database with same CATH topology
1N78A 3HU2A 4K0KM 2XEPA 4DV0M 1SXJD 3FKEA 5EJCA 4YHHM 4QHSA 4XBOA 5FTNA 3GRUA 4DR5M 3VK7A 1GLNA 1NY6A 5IREB 1OFHA 1SXJB 1R2ZA 3TL4X 2M60A 3AL0C 2XSZD 2R18A 4II7A 2I7PA 2ZANA 4MGKE 2CFOA 1I4WA 4JI3M 4MM3B 2BJWA 4G4NA 1IN5A 1QVRA 3GLFA 4DR2M 1HQYE 3I4YA 4LJ8A 3ZH9B 4LJ7A 3L2AA 5DNYA 4LFCM 2KRUA 1IN6A 3A98B 4NRWA 3TE6A 2FFJA 2O5RA 2L7HA 1TH4A 4FD2A 2L7IA 2HHHM 3GLHA 4LGMA 3U6EA 4NXMM 5E26A 3SMSA 1XWIA 4B08A 4DR3M 3UZUA 3LMMA 3U6CA 1Q3CA 5KPZA 4FWHA 4DV5M 1IBLM 1XXHA 1K3XA 4FWDA 2J7NA 4OX9M 5EP2A 5FTMA 2R45A 4MH0E 5JI2E 1ZAEA 3W0FA 3HHWA 5IT9S 1TDHA 3LVWA 4MGIE 3WHKA 1QAQA 1QQWA 2KZUA 3CTWB 4GITA 1W5SA 4OW0A 4LF9M 2LH0A 3HHZA 2F4VM 1QZMA 2V1CA 2YNMD 1PJJA 2HCBA 2F5QA 3UK6A 1I94M 1L2CA 3HGIA 4G4QA 3U5ZB 3SAVA 1R2YA 4XGIA 4M0DA 4DR7M 3GPXA 3A42A 3KDSE 2DZOB 3SATA 3J7BA 4LCBA 3HHYA 4AG5A 1HT2E 2KRKA 2KXEA 1IXRC 4QOSA 5FTJA 2VQEM 2C96A 1G3IA 5JI3E 4NXNM 3SMPA 4PCZA 2F5OA 1Z5AA 4RNAA 3GQ5A 3GP1A 4DV2M 3UMMA 3HWSA 3HKPA 3MHVC 1QAMA 4LF5M 2DVWB 3LVVA 1JQJC 1FNNA 4AG6A 2UXCM 5ITRA 3H4MA 4G4RA 3KXEC 3HJ8A 1YSYA 4PD2A 4G4OA 3U6PA 1HT1E 3TWKA 4BBAA 2G5GX 1ZQ9A 4MGHA 1DO2A 3FYCA 4IJFA 5F3WA 3PXGA 2XF3A 3BOSA 4LG2A 3ZC7B 2Y0QA 4LF7M 1MU5A 2QENA 3QWLA 2HL7A 1HNZM 3VDPA 3PVSA 3KFUG 3DA1A 3KP1E 3DZDA 2LWXA 4DR6M 2VQFM 4FVMA 3FTEA 2D7EA 4A3VB 5EP4A 4DV1M 1XHBA 4AZFA 3SAUA 2LNHC 5EP3A 3U60A 3GPPA 5FTKA 1NHGC 4JYAM 4B3SM 3GLIA 1W5TA 3KS8A 4GHLA 4QNMA 3FUTA 1IBMM 1YUBA 4CGYB 4W5WA 5IWAM 4IBFA 4X64M 4JI0M 1G59A 3T38A 4JI2M 1S3SA 3GRRA 1NNUC 2UXBM 4GH9A 1LV7A 5EQTA 2KZSA 5DYIA 3UGJA 2C99A 2F5PA 1PM5A 5C18A 1TGUA 5ITTA 4GMQA 1IN7A 4OU7A 1J5EM 2QPAA 4L8RC 3FTCA 5FSWA 2F5SA 4M9ZA 4REZA 1G4AE 3U61A 2E5LM 4DUZM 3LQQA 3J27B 3HU1A 3W0LB 2YFQA 3IG5A 4BLCA 3TQSA 2R4EA 2K47A 1XNRM 2XGNA 1NNJA 1QYRA 2F5NA 3B9PA 4JI8M 3SAWA 1HNXM 3L27A 2W82A 3GPUA 2QBYB 4LF4M 4LF8M 4AKGA 4KLNA 4NL4H 2ZAMA 2Q2EB 4DR1M 4LJAA 1XC8A 3KOZE 1SXJA 4LZZA 3K2LA 3AFHA 2CV2A 4M0WA 4KHPM 3L26A 3I51A 3GO8A 1DGGA 5LMUM 3EIHA 1IQPA 4I5SA 1WXQA 2RKOA 3J2PB 1G8PA 4QOZC 3THGA 2XFTA 2I7NA 3GLFB 3FTFA 7CATA 5IZ7D 4G6ZA 5KPRA 3KSXA 4KODA 2FOIC 2CEAA 1NSFA 1E32A 2CE7A 2EO2A 3HJSA 4LRSA 2L6OA 1L2BA 2Z7JA 2V1UA 1Z6TA 1IXZA 1TH2A 4R7GA 3AOGA 4IBIA 3SYKA 3JR5A 4JV5M 2HKJA 4LFBM 1OJLA 5ITXE 2ERCA 5E6JA 2XSZA 1N77A 3SC3A 4D81A 2H1RA 4NSOB 4AI6A 1NHWC 2JA2A 2C9OA 4FCWA 3SBJA 1YE9A 2DWLA 4B7FA 4GIPA 1JR3A 4S12A 3RE8A 4Z8XA 2XZFA 1L1ZA 2YQZA 3FTDA 1E9RA 1UM8A 2CHQA 3E9SA 1NJGA 3SYLA 3VFDA 2AHMA 3J7AS 3VLFB 4TUWA 1XMQM 3GLGA 1JR3D 1N33M 1DGFA 5EXSA 3A45A 1DO0A 4BB9A 4IBJA 4RF1A 2DZNB 3FUWA 3KOXE 4L15A 3U5ZA 1EE8A 4NSRA 3SHGB 5KO3A 3NWLA 3SFZA 4JI1M 3GQ3A 3HHXA 3M0EA 3L29A 4B7GA 2DWZB 3K8ZA 4AKHA 1OFIA 4IIWA 3HU3A 2CHVA 2D7HA 4MGZE 5ITXA 3M6AA 1DGHB 4DUYM 2CV0A 1Q39A 5LMNM 3TPZA 2CV1A 2P5TA 2EUCA 3TWMA 1IN4A 1R7RA 3RGSA 4PT5A 2CHGA 4GHAA 3D8BA 1IXSB 3DOAA 1DGBA 1IY1A 3WHLA 5C1BA 4CHTB 1GVNA 3U6SA 4OVZA 4MB7A 3FD9A 3U6OA 1FJGM 1L1TA 3E4RA 2M5ZA 4DV7M 4FW9A 3MK6A 3FUXA 3FUUA 4PDGA 2CUZA 4FWGA 3QAUA 4L16A 2XFSA 3KW6A 3K1JA 3K92A 3VKHA 4EIWA 1KFVA 1T3TA 2Y21A 2C98A 4GRIA 3LQRA 2R4JA 5FTLA 3NBIA 2X8AA 4IBGA 3VDUA 4P16A 3T1HM 1IN8A 3A46A 4IBDA 4L78A 3VK8A 1N75A 2R65A 4LJ6A 2ZBKB 3AOEC 3IG8A 1Q3BA 2V6ZM 4DV6M 2XLJA 3I4VA 1GKIA 4DV4M 3HJQA 4R3DA 5KQ8A 3OTOM 3CF2A 2R46A 1D2NA 1G41A 3UJNA 3R9XB 1NJFA 1TDZA 3FYDA 3GLHB 2UU9M 4B3RM 3KP0E 4AQYM 4D80A 5EXXA 5ITQA 4LF6M 1MX0A 2Y0TA 4JI5M 2C5RA 1XXHB 3AOEA 3EIEA 3FUVA 3U61B 4LJ9A 5ITYA 3JR4A 3CF6E 1IY0A 5ITUA 2EA0A 1L8QA 5FLXS 1N32M 2C9CA 2FE8A 5EXPA 1N36M 3GPYA 3C58A 2UUCM 4IBBA 1R6BX 2LXEA 3KVWA 1H6UA 4LY6A 3SASA 1HNWM 2DWNA 4WURA 1PJIA 4HLQA 2QBYA 4IJEA 1QAOA 3GRYA 3PNVA 4FCVA 2A5YB 3JAMS 4I8OA 5EP1A 3AJIB 4ITQA 1NY5A 4NRVA 1C1KA 3L28A 3U6QA 2BNKA 5BPVA 4AKIA 2RGHA 2UUBM 2VIIA 3CF0A 3KS4A 5GKNA 3SHFA 4M9SA 4AW4A 1Z59A 1TH3A 2R62A 2RGOA 4ZPXA 4LFAM 5A2QS 4MGYE 3U6DA 3KOYE 2XH9A 1HR0M 2OPFA 3L25A 3R8FA 1IBKM 4JI7M 1Z5BA 3RGPA 4NOOB 4B7HA 4DV3M 4QHTA 2J7OA 3PNYA 2XZUA 2DWMA 1X37A 3GQ4A 3MJ5A 3PFIA 3RFWA 2YR0A 1XNQM 2Z4SA 5BR8M 4IBCA 3KSJA 1KYIA 4IBEA 4LGYA 4X66M 3KOWE 1SXJE 4I81A 2Y20A 4L4UA 2KA6B 2ZAOA 3TWLA 4HL4A 3ILKA 1HQCA 4LJ4A 4WW0A 1IY2A 2D7GA 4JI6M 3VKGA 1J09A 3D8LA 1N34M 2OQ4A 2G8LA 1XMOM 3GLGB 4M9XA 2UXDM 4YY3M 2X4AA 4DR4M 8CATA 4LRTA 2KEBA 4D82A 5KQDA 4JI4M 1J7KA 4RF0A 2DHRA 4QNRA 2Z4RA 4Z6YA 2ZM6M 4X62M 3U60B 4JN6A 1K3WA 1QANA 2FNAA 3DFZA 3U6MA 3U6LA 3GLIB 3T1YM 1E9SA 1DGHA 3AKZA 3J80S 1NVMA 1KSFX 4B3TM 4GKKM 1GL7A 1VDDA 2X49A 4LJ5A 3ZCBB 1E94E 1GL6A 1SXJC 2L09A 4GC9A 4FCTA 3AV0A 4KO8A 1Z5CA 2KW0A 3SARA 3T15A 1K82A 5KPTA 4PDIA 3GRVA 4IBKA 4LZJA 4OVZB 4I4LA 1L2DA 2Z3XA 2UUAM 2NQ8C 3J81S 2BJVA 2DXIA 1ORYB 3Q8XA 4B3MM 4JXJA 4GKJM 2QCUA 5DYGA 1IM2A 5H37D 4X65M 4GC5A 2QP9X 5EXTA 4CISA 3M7GA 2QZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UM8 A;  2CHQ A;  1NJG A;  3HU2 A;  3SYL A;  3VFD A;  3VLF B;  1R6B X;  1SXJ D;  2QEN A;  4LY6 A;  3GLG A;  1JR3 D;  4QHS A;  3PVS A;  5EXS A;  5FTN A;  1DO0 A;  3BOS A;  2QBY A;  2DZN B;  3DZD A;  4L15 A;  1NY6 A;  1OFH A;  1SXJ B;  4FCV A;  4A3V B;  5EP4 A;  2XSZ D;  5EP3 A;  5EP1 A;  3AJI B;  3M0E A;  1NY5 A;  5FTK A;  1C1K A;  2DWZ B;  2ZAN A;  3GLI A;  1W5T A;  1OFI A;  2VII A;  3HU3 A;  2BJW A;  2CHV A;  3CF0 A;  1IN5 A;  1QVR A;  3M6A A;  4QNM A;  3GLF A;  1HQY E;  4LJ8 A;  3ZH9 B;  4LJ7 A;  2R62 A;  4ZPX A;  1IN6 A;  1S3S A;  4FD2 A;  3R8F A;  1IN4 A;  1R7R A;  5EQT A;  1LV7 A;  3GLH A;  4LGM A;  4QHT A;  2CHG A;  3D8B A;  5DYI A;  1IXS B;  2C99 A;  1X37 A;  1IY1 A;  1XWI A;  3PFI A;  3WHL A;  5C18 A;  5C1B A;  1IN7 A;  2Z4S A;  2QPA A;  1KYI A;  4FWH A;  1XXH A;  4FWD A;  1SXJ E;  4FW9 A;  4I81 A;  5EP2 A;  4L4U A;  1G4A E;  5FTM A;  5JI2 E;  2ZAO A;  4FWG A;  3HU1 A;  4L16 A;  3WHK A;  1HQC A;  3KW6 A;  3K1J A;  4LJ4 A;  4WW0 A;  1IY2 A;  4GIT A;  1W5S A;  4EIW A;  2C98 A;  1QZM A;  3GLG B;  3B9P A;  2HCB A;  4LRT A;  3UK6 A;  5FTL A;  2QBY B;  4D82 A;  2X8A A;  4KLN A;  3U5Z B;  2ZAM A;  1J7K A;  1IN8 A;  4LJA A;  1SXJ A;  2DHR A;  4LZZ A;  2Z4R A;  4QNR A;  3U60 B;  4JN6 A;  2FNA A;  2R65 A;  3KDS E;  4LJ6 A;  2DZO B;  3EIH A;  1IQP A;  4LCB A;  3GLI B;  1HT2 E;  2RKO A;  2KRK A;  1IXR C;  2V6Z M;  3GLF B;  4QOS A;  5FTJ A;  1NVM A;  1KSF X;  2C96 A;  1G3I A;  5JI3 E;  4KOD A;  3CF2 A;  4LJ5 A;  2CEA A;  1D2N A;  1E32 A;  1E94 E;  1G41 A;  1NSF A;  1SXJ C;  2CE7 A;  1NJF A;  4LRS A;  4FCT A;  4KO8 A;  2V1U A;  3HWS A;  3GLH B;  1IXZ A;  3MHV C;  4D80 A;  2DVW B;  5EXX A;  3SYK A;  4Z8X A;  1JQJ C;  1OJL A;  1FNN A;  2XSZ A;  3H4M A;  3SC3 A;  4I4L A;  4D81 A;  1XXH B;  3EIE A;  2BJV A;  2C9O A;  4FCW A;  1HT1 E;  3U61 B;  4LJ9 A;  1IY0 A;  1DO2 A;  5DYG A;  1IM2 A;  1L8Q A;  1JR3 A;  3PXG A;  2C9C A;  2QP9 X;  5EXT A;  5EXP A;  2QZ4 A; 
#chains in the Genus database with same CATH topology
 1N78 A;  3HU2 A;  4K0K M;  2XEP A;  4DV0 M;  1SXJ D;  2B3T A;  2R0I A;  3FKE A;  5EJC A;  4YHH M;  4QHS A;  4XBO A;  2K6B A;  3GRU A;  1V33 A;  1WGN A;  5FTN A;  1TR8 A;  2DI0 A;  4DR5 M;  1GLN A;  3VK7 A;  1NY6 A;  1WHC A;  3IHP A;  5IRE B;  1OFH A;  1SXJ B;  1R2Z A;  3TL4 X;  2M60 A;  3IEC A;  3AL0 C;  2FH0 A;  2XSZ D;  2R18 A;  4II7 A;  2I7P A;  2ZAN A;  3B74 A;  4MGK E;  2CFO A;  1I4W A;  4JI3 M;  4MM3 B;  2DHY A;  2MRO B;  2BJW A;  4G4N A;  1IN5 A;  1QVR A;  1PGY A;  2EJS A;  3FE3 A;  3GLF A;  4DR2 M;  1HQY E;  3I4Y A;  4LJ8 A;  3C9P A;  4LJ7 A;  3ZH9 B;  3L2A A;  3F92 A;  5DNY A;  4LFC M;  2KRU A;  1IN6 A;  3A98 B;  4NRW A;  3TE6 A;  2FFJ A;  2O5R A;  2L7H A;  1TH4 A;  2WSF F;  2L7I A;  4FD2 A;  2HHH M;  3GLH A;  2GQF A;  4LGM A;  2DAK A;  3U6E A;  4NXM M;  5E26 A;  3E46 A;  3C3D A;  2KNV A;  3SMS A;  1XWI A;  4B08 A;  1D0L A;  4DR3 M;  3UZU A;  3LMM A;  3U6C A;  1Q3C A;  5KPZ A;  4FWH A;  4DV5 M;  1IBL M;  1XXH A;  4G3O A;  1K3X A;  4FWD A;  2J7N A;  4OX9 M;  2OO9 A;  5EP2 A;  5FTM A;  2R45 A;  2KNA A;  4MH0 E;  4L6V 6;  5JI2 E;  1ZAE A;  3W0F A;  3HHW A;  5IT9 S;  1TDH A;  1EFU B;  2QHO B;  3LVW A;  4MGI E;  3WHK A;  1QAQ A;  1QQW A;  2KZU A;  1QUT A;  3CTW B;  4GIT A;  1W5S A;  4OW0 A;  4LF9 M;  2LH0 A;  3HHZ A;  2F4V M;  1QZM A;  2V1C A;  2YNM D;  1PJJ A;  2HCB A;  2F5Q A;  2FS1 A;  3UK6 A;  1I94 M;  1L2C A;  3HGI A;  4G4Q A;  3U5Z B;  1R4G A;  2LVA A;  3SAV A;  1R2Y A;  4XGI A;  4R71 A;  2QQ8 A;  4WP2 A;  4M0D A;  4DR7 M;  1BVS A;  3GPX A;  3A42 A;  3GLI E;  3KDS E;  2DZO B;  3SAT A;  3J7B A;  4LCB A;  3HHY A;  4AG5 A;  1HT2 E;  2KRK A;  2KXE A;  2GNO A;  1IXR C;  3QYE A;  4QOS A;  5FTJ A;  2VQE M;  2C96 A;  1G3I A;  5JI3 E;  4NXN M;  3SMP A;  4PCZ A;  2F5O A;  1Z5A A;  1VEK A;  4RNA A;  3GQ5 A;  3GP1 A;  4DV2 M;  2LBC A;  3UMM A;  3HWS A;  4CIS A;  3HKP A;  3MHV C;  1QAM A;  2N35 A;  2DVW B;  3LVV A;  4LF5 M;  1PJT A;  1JQJ C;  2QNJ A;  2LVN C;  1FNN A;  1R5L A;  4AG6 A;  5ITR A;  2UXC M;  2DAG A;  3H4M A;  4G4R A;  1T6O A;  1WGL A;  3KXE C;  1QDT A;  3HJ8 A;  1YSY A;  4PD2 A;  4G4O A;  3U6P A;  2DAM A;  1HT1 E;  3TWK A;  1GJT A;  4F2L A;  4BBA A;  2G5G X;  1ZQ9 A;  2KHH A;  1DO2 A;  3FYC A;  4IJF A;  4MGH A;  2O01 F;  1WIV A;  5F3W A;  3PXG A;  2XF3 A;  3BOS A;  1OIZ A;  2ZTC A;  1C7Y A;  1YLA A;  4LG2 A;  3ZC7 B;  2Y0Q A;  3LCU A;  1OAI A;  4LF7 M;  1MU5 A;  2QEN A;  3QWL A;  2HL7 A;  1HNZ M;  3VDP A;  3PVS A;  2VDB B;  3KFU G;  3DA1 A;  3KP1 E;  3DZD A;  3H4J A;  2LWX A;  4DR6 M;  2VQF M;  4FVM A;  3FTE A;  2D7E A;  4A3V B;  5EP4 A;  4DV1 M;  1XHB A;  4AZF A;  3SAU A;  2LNH C;  2MGW A;  5EP3 A;  3U60 A;  3GPP A;  5FTK A;  1NHG C;  4JYA M;  4B3S M;  3GLI A;  1W5T A;  3KS8 A;  4GHL A;  4QNM A;  3FUT A;  1IBM M;  1YUB A;  4CGY B;  4W5W A;  4RKU F;  5IWA M;  2MH8 A;  4IBF A;  4JI0 M;  4X64 M;  1G59 A;  3T38 A;  4JI2 M;  1DV0 A;  1S3S A;  2JWS A;  2L4E A;  3GRR A;  1NNU C;  2UXB M;  4GH9 A;  1LV7 A;  3FRI A;  5EQT A;  3I04 M;  2KZS A;  5DYI A;  4DBG B;  3UGJ A;  2C99 A;  2F5P A;  1PM5 A;  2K0B X;  5C18 A;  1CUK A;  1TGU A;  4GMQ A;  1IN7 A;  5ITT A;  4OU7 A;  1J5E M;  3LW5 F;  2QPA A;  4L8R C;  3FTC A;  5FSW A;  2F5S A;  4M9Z A;  1PJS A;  4REZ A;  1G4A E;  3U61 A;  2EKK A;  1OKS A;  3HZJ A;  2E5L M;  4DUZ M;  3LQQ A;  3J27 B;  3HU1 A;  3W0L B;  2VF8 A;  2YFQ A;  3IG5 A;  4BLC A;  1RU3 A;  3TQS A;  2R4E A;  2K47 A;  1PRB A;  2O25 A;  2XGN A;  1XNR M;  1HJP A;  1NNJ A;  1QYR A;  3MMP A;  1IFY A;  1GJS A;  3V76 A;  1SG9 A;  3B9P A;  2F5N A;  3SAW A;  1HNX M;  4JI8 M;  1TTE A;  3L27 A;  2W82 A;  3GPU A;  2QBY B;  4LF4 M;  4LF8 M;  4AKG A;  3BXW A;  4KLN A;  4NL4 H;  2ZAM A;  1WJ7 A;  2JY8 A;  2Q2E B;  4LJA A;  4DR1 M;  3KOZ E;  1SXJ A;  4LZZ A;  1XC8 A;  3K2L A;  1P3Q Q;  3AFH A;  2CV2 A;  4M0W A;  4KHP M;  1D0K A;  3L26 A;  3I51 A;  3GO8 A;  1DGG A;  5LMU M;  3EIH A;  1IQP A;  4I5S A;  1WXQ A;  2RKO A;  3J2P B;  1G8P A;  4QOZ C;  3THG A;  2XFT A;  2I7N A;  3GLF B;  3FTF A;  2MR9 A;  7CAT A;  5IZ7 D;  4G6Z A;  5KPR A;  3KSX A;  1T43 A;  4KOD A;  2FOI C;  2CEA A;  1NSF A;  1E32 A;  2CE7 A;  2EO2 A;  2DZL A;  2R44 A;  3B7Q A;  2L6O A;  3HJS A;  4LRS A;  1L2B A;  2Z7J A;  2V1U A;  1Z6T A;  1IXZ A;  1TH2 A;  4R7G A;  3AOG A;  2JNH A;  4IBI A;  2JY6 B;  3SYK A;  3JR5 A;  4JV5 M;  2HKJ A;  1ZMV A;  4LFB M;  1OJL A;  1VG5 A;  2ERC A;  5ITX E;  5E6J A;  2XSZ A;  2L4F A;  1N77 A;  3SC3 A;  4D81 A;  2H1R A;  1OTR A;  4KT0 F;  4NSO B;  4AI6 A;  1NHW C;  1V34 A;  2JA2 A;  2WSC F;  2C9O A;  4FCW A;  3SBJ A;  1YE9 A;  2EKF A;  2JP7 A;  2DWL A;  4B7F A;  4GIP A;  1JR3 A;  4S12 A;  3RE8 A;  4Z8X A;  2XZF A;  1L1Z A;  2YQZ A;  3E9S A;  1E9R A;  1UM8 A;  2CHQ A;  1G71 A;  1NJG A;  3FTD A;  3SYL A;  3VFD A;  2AHM A;  3J7A S;  1QZE A;  3VLF B;  4TUW A;  1XMQ M;  3GLG A;  1JR3 D;  1N33 M;  1DGF A;  5EXS A;  3A45 A;  1DO0 A;  3E21 A;  4BB9 A;  4IBJ A;  4RF1 A;  2DZN B;  3FUW A;  3K9P A;  3KOX E;  4L15 A;  3U5Z A;  1EE8 A;  4NSR A;  3SHG B;  5KO3 A;  3NWL A;  3SFZ A;  4JI1 M;  1EIJ A;  3GQ3 A;  3I01 M;  3HHX A;  3M0E A;  3L29 A;  4B7G A;  2DWZ B;  3K8Z A;  2ZTD A;  4AKH A;  1OFI A;  4IIW A;  3HU3 A;  2CHV A;  2D7H A;  4MGZ E;  5ITX A;  3M6A A;  1DGH B;  4DUY M;  2CV0 A;  1Q39 A;  2OOB A;  5LMN M;  3TPZ A;  2HWJ A;  2CV1 A;  2P5T A;  2EUC A;  3TWM A;  1IN4 A;  1R7R A;  3RGS A;  1JR3 E;  4PT5 A;  2CHG A;  4GHA A;  3D8B A;  1IXS B;  3DOA A;  1DGB A;  1IY1 A;  3WHL A;  5C1B A;  4CHT B;  1GVN A;  3U6S A;  1GAB A;  4OVZ A;  4MB7 A;  3FD9 A;  3U6O A;  1FJG M;  1L1T A;  3E4R A;  2M5Z A;  3NBX X;  4DV7 M;  4FW9 A;  2CRU A;  3MK6 A;  3FUX A;  3FUU A;  4PDG A;  2CUZ A;  4FWG A;  3QAU A;  4L16 A;  2XFS A;  3KW6 A;  3K1J A;  2CP8 A;  3K92 A;  3VKH A;  4EIW A;  1KFV A;  1T3T A;  2Y21 A;  2C98 A;  4GRI A;  3LQR A;  2R4J A;  2Z8Y M;  5FTL A;  2RRU A;  3NBI A;  2X8A A;  4IBG A;  3VDU A;  4P16 A;  3T1H M;  1IN8 A;  3A46 A;  4IBD A;  4L78 A;  3VK8 A;  1N75 A;  1QUS A;  1NV8 A;  1OAO C;  2R65 A;  2DNA A;  4LJ6 A;  2ZBK B;  3AOE C;  5EXT A;  2G3Q A;  2WSE F;  3IG8 A;  3CGW A;  1Q3B A;  2V6Z M;  4DV6 M;  2XLJ A;  1VQ1 A;  1ZMW A;  3I4V A;  1LTM A;  1GKI A;  4DV4 M;  3HJQ A;  4R3D A;  5KQ8 A;  3OTO M;  3CF2 A;  2R46 A;  3HX3 A;  1D2N A;  1G41 A;  3UJN A;  3R9X B;  1NJF A;  4P17 A;  1TDZ A;  3FYD A;  3GLH B;  2UU9 M;  4B3R M;  3KP0 E;  4AQY M;  4D80 A;  2LTU A;  5EXX A;  5ITQ A;  2JUJ A;  2CWB A;  1Q02 A;  4LF6 M;  1MX0 A;  1WR1 B;  4NC6 A;  2Y0T A;  4JI5 M;  2C5R A;  1XXH B;  3AOE A;  3FRH A;  3T6P A;  3EIE A;  3FUV A;  3U61 B;  4LJ9 A;  5ITY A;  3JR4 A;  3CF6 E;  1IY0 A;  5ITU A;  4XK8 F;  2EA0 A;  1L8Q A;  5FLX S;  4Y28 F;  1N32 M;  2MJ5 B;  2C9C A;  2FE8 A;  1JB0 F;  4CJ6 A;  1NO1 A;  5EXP A;  4HEO A;  1GO5 A;  1N36 M;  3GPY A;  3C58 A;  3W67 A;  2UUC M;  4IBB A;  1R6B X;  2LXE A;  3KVW A;  1H6U A;  4LY6 A;  2LVP C;  3SAS A;  1HNW M;  1OQY A;  2LVQ D;  2L2D A;  2DWN A;  4WUR A;  1PJI A;  4HLQ A;  2QBY A;  1TF0 B;  4IJE A;  1QAO A;  3GRY A;  3PNV A;  1VEG A;  2BWB A;  4FCV A;  1VDL A;  2A5Y B;  1AUA A;  3JAM S;  4I8O A;  2BWE A;  5EP1 A;  3AJI B;  4ITQ A;  1NY5 A;  4NRV A;  1C1K A;  3L28 A;  4UN2 B;  3U6Q A;  2BNK A;  5BPV A;  2DEN A;  4AKI A;  2RGH A;  2UUB M;  2VII A;  4GEW A;  3CF0 A;  2OOA A;  3KS4 A;  5GKN A;  3SHF A;  4M9S A;  4AW4 A;  1Z59 A;  2K9D A;  1TH3 A;  2R62 A;  2RGO A;  4ZPX A;  2KDL A;  4LFA M;  5A2Q S;  4MGY E;  3U6D A;  3KOY E;  2XH9 A;  2LHC A;  1PJQ A;  2HAK A;  1HR0 M;  2OPF A;  3L25 A;  3R8F A;  1IBK M;  1UFZ A;  4JI7 M;  1Z5B A;  3RGP A;  4NOO B;  4B7H A;  4DV3 M;  4QHT A;  1NV9 A;  2J7O A;  3PNY A;  2XZU A;  2DWM A;  3B7Z A;  1X37 A;  2WZJ A;  3MJ5 A;  3PFI A;  3GQ4 A;  3GLF E;  3RFW A;  2YR0 A;  1XNQ M;  2LVO C;  2Z4S A;  5BR8 M;  4IBC A;  3KSJ A;  1KYI A;  4IBE A;  4LGY A;  4X66 M;  4ANR A;  3KOW E;  1SXJ E;  4I81 A;  2Y20 A;  1V92 A;  4L4U A;  2KA6 B;  4CIZ A;  2ZAO A;  1D0M A;  3TWL A;  4HL4 A;  3ILK A;  1HQC A;  4LJ4 A;  4WW0 A;  1IY2 A;  2D7G A;  4F1I A;  4JI6 M;  3VKG A;  1J09 A;  3D8L A;  1N34 M;  3W68 A;  2G8L A;  2OQ4 A;  1XMO M;  3GLG B;  4M9X A;  2UXD M;  4YY3 M;  2X4A A;  4DR4 M;  8CAT A;  2KNZ A;  4LRT A;  2KEB A;  4D82 A;  2JZ1 A;  3HY5 A;  5KQD A;  1J7K A;  4JI4 M;  4RF0 A;  2DHR A;  4QNR A;  2Z4R A;  1OIP A;  4Z6Y A;  2ZM6 M;  1F4I A;  4X62 M;  1MJG M;  2JXN A;  2VF7 A;  3U60 B;  4JN6 A;  1K3W A;  1AIP C;  1QAN A;  1VEJ A;  2DAI A;  2FNA A;  3DFZ A;  3U6M A;  1XB2 B;  3C3E A;  2JZ0 A;  3QYB A;  5L8R F;  3GLI B;  3U6L A;  3Q8G A;  5DFL A;  3T1Y M;  2QSF X;  1E9S A;  3K9O A;  1DGH A;  3AKZ A;  3J80 S;  1NVM A;  2JY5 A;  1Y8G A;  1KSF X;  4Q7J A;  4B3T M;  4GKK M;  1GL7 A;  1VDD A;  2X49 A;  3BBZ A;  4LJ5 A;  3ZCB B;  1MN3 A;  1E94 E;  1GL6 A;  1QDR A;  1SXJ C;  1ZMU A;  2L09 A;  2DAE A;  4GC9 A;  2R6F A;  4FCT A;  3AV0 A;  4KO8 A;  1Z5C A;  2KW0 A;  3LCV B;  3T15 A;  3SAR A;  1K82 A;  2H5X A;  2DKL A;  5KPT A;  4PDI A;  1IXS A;  2JY7 A;  3GRV A;  1ZV1 A;  4IBK A;  1XXH E;  4LZJ A;  4OVZ B;  3ZQJ A;  4I4L A;  1L2D A;  2APL A;  2Z3X A;  2UUA M;  2NQ8 C;  3B7N A;  3J81 S;  2BJV A;  2DXI A;  1ORY B;  3Q8X A;  4B3M M;  2LHG A;  4JXJ A;  4GKJ M;  2J5Y A;  2QCU A;  5DYG A;  1IM2 A;  5H37 D;  3GLH E;  4X65 M;  4GC5 A;  3B89 A;  2QP9 X;  1A5T A;  3GLG E;  3M7G A;  2QZ4 A; 
#chains in the Genus database with same CATH homology
 1N78 A;  3HU2 A;  4K0K M;  2XEP A;  4DV0 M;  1SXJ D;  3FKE A;  5EJC A;  4YHH M;  4QHS A;  4XBO A;  5FTN A;  3GRU A;  4DR5 M;  3VK7 A;  1GLN A;  1NY6 A;  5IRE B;  1OFH A;  1SXJ B;  1R2Z A;  3TL4 X;  2M60 A;  3AL0 C;  2XSZ D;  2R18 A;  4II7 A;  2I7P A;  2ZAN A;  4MGK E;  2CFO A;  1I4W A;  4JI3 M;  4MM3 B;  2BJW A;  4G4N A;  1IN5 A;  1QVR A;  3GLF A;  4DR2 M;  1HQY E;  3I4Y A;  4LJ8 A;  3ZH9 B;  4LJ7 A;  3L2A A;  5DNY A;  4LFC M;  2KRU A;  1IN6 A;  3A98 B;  4NRW A;  3TE6 A;  2FFJ A;  2O5R A;  2L7H A;  1TH4 A;  4FD2 A;  2L7I A;  2HHH M;  3GLH A;  4LGM A;  3U6E A;  4NXM M;  5E26 A;  3SMS A;  1XWI A;  4B08 A;  4DR3 M;  3UZU A;  3LMM A;  3U6C A;  1Q3C A;  5KPZ A;  4FWH A;  4DV5 M;  1IBL M;  1XXH A;  1K3X A;  4FWD A;  2J7N A;  4OX9 M;  5EP2 A;  5FTM A;  2R45 A;  4MH0 E;  5JI2 E;  1ZAE A;  3W0F A;  3HHW A;  5IT9 S;  1TDH A;  3LVW A;  4MGI E;  3WHK A;  1QAQ A;  1QQW A;  2KZU A;  3CTW B;  4GIT A;  1W5S A;  4OW0 A;  4LF9 M;  2LH0 A;  3HHZ A;  2F4V M;  1QZM A;  2V1C A;  2YNM D;  1PJJ A;  2HCB A;  2F5Q A;  3UK6 A;  1I94 M;  1L2C A;  3HGI A;  4G4Q A;  3U5Z B;  3SAV A;  1R2Y A;  4XGI A;  4M0D A;  4DR7 M;  3GPX A;  3A42 A;  3KDS E;  2DZO B;  3SAT A;  3J7B A;  4LCB A;  3HHY A;  4AG5 A;  1HT2 E;  2KRK A;  2KXE A;  1IXR C;  4QOS A;  5FTJ A;  2VQE M;  2C96 A;  1G3I A;  5JI3 E;  4NXN M;  3SMP A;  4PCZ A;  2F5O A;  1Z5A A;  4RNA A;  3GQ5 A;  3GP1 A;  4DV2 M;  3UMM A;  3HWS A;  3HKP A;  3MHV C;  1QAM A;  4LF5 M;  2DVW B;  3LVV A;  1JQJ C;  1FNN A;  4AG6 A;  2UXC M;  5ITR A;  3H4M A;  4G4R A;  3KXE C;  3HJ8 A;  1YSY A;  4PD2 A;  4G4O A;  3U6P A;  1HT1 E;  3TWK A;  4BBA A;  2G5G X;  1ZQ9 A;  4MGH A;  1DO2 A;  3FYC A;  4IJF A;  5F3W A;  3PXG A;  2XF3 A;  3BOS A;  4LG2 A;  3ZC7 B;  2Y0Q A;  4LF7 M;  1MU5 A;  2QEN A;  3QWL A;  2HL7 A;  1HNZ M;  3VDP A;  3PVS A;  3KFU G;  3DA1 A;  3KP1 E;  3DZD A;  2LWX A;  4DR6 M;  2VQF M;  4FVM A;  3FTE A;  2D7E A;  4A3V B;  5EP4 A;  4DV1 M;  1XHB A;  4AZF A;  3SAU A;  2LNH C;  5EP3 A;  3U60 A;  3GPP A;  5FTK A;  1NHG C;  4JYA M;  4B3S M;  3GLI A;  1W5T A;  3KS8 A;  4GHL A;  4QNM A;  3FUT A;  1IBM M;  1YUB A;  4CGY B;  4W5W A;  5IWA M;  4IBF A;  4X64 M;  4JI0 M;  1G59 A;  3T38 A;  4JI2 M;  1S3S A;  3GRR A;  1NNU C;  2UXB M;  4GH9 A;  1LV7 A;  5EQT A;  2KZS A;  5DYI A;  3UGJ A;  2C99 A;  2F5P A;  1PM5 A;  5C18 A;  1TGU A;  5ITT A;  4GMQ A;  1IN7 A;  4OU7 A;  1J5E M;  2QPA A;  4L8R C;  3FTC A;  5FSW A;  2F5S A;  4M9Z A;  4REZ A;  1G4A E;  3U61 A;  2E5L M;  4DUZ M;  3LQQ A;  3J27 B;  3HU1 A;  3W0L B;  2YFQ A;  3IG5 A;  4BLC A;  3TQS A;  2R4E A;  2K47 A;  1XNR M;  2XGN A;  1NNJ A;  1QYR A;  2F5N A;  3B9P A;  4JI8 M;  3SAW A;  1HNX M;  3L27 A;  2W82 A;  3GPU A;  2QBY B;  4LF4 M;  4LF8 M;  4AKG A;  4KLN A;  4NL4 H;  2ZAM A;  2Q2E B;  4DR1 M;  4LJA A;  1XC8 A;  3KOZ E;  1SXJ A;  4LZZ A;  3K2L A;  3AFH A;  2CV2 A;  4M0W A;  4KHP M;  3L26 A;  3I51 A;  3GO8 A;  1DGG A;  5LMU M;  3EIH A;  1IQP A;  4I5S A;  1WXQ A;  2RKO A;  3J2P B;  1G8P A;  4QOZ C;  3THG A;  2XFT A;  2I7N A;  3GLF B;  3FTF A;  7CAT A;  5IZ7 D;  4G6Z A;  5KPR A;  3KSX A;  4KOD A;  2FOI C;  2CEA A;  1NSF A;  1E32 A;  2CE7 A;  2EO2 A;  3HJS A;  4LRS A;  2L6O A;  1L2B A;  2Z7J A;  2V1U A;  1Z6T A;  1IXZ A;  1TH2 A;  4R7G A;  3AOG A;  4IBI A;  3SYK A;  3JR5 A;  4JV5 M;  2HKJ A;  4LFB M;  1OJL A;  5ITX E;  2ERC A;  5E6J A;  2XSZ A;  1N77 A;  3SC3 A;  4D81 A;  2H1R A;  4NSO B;  4AI6 A;  1NHW C;  2JA2 A;  2C9O A;  4FCW A;  3SBJ A;  1YE9 A;  2DWL A;  4B7F A;  4GIP A;  1JR3 A;  4S12 A;  3RE8 A;  4Z8X A;  2XZF A;  1L1Z A;  2YQZ A;  3FTD A;  1E9R A;  1UM8 A;  2CHQ A;  3E9S A;  1NJG A;  3SYL A;  3VFD A;  2AHM A;  3J7A S;  3VLF B;  4TUW A;  1XMQ M;  3GLG A;  1JR3 D;  1N33 M;  1DGF A;  5EXS A;  3A45 A;  1DO0 A;  4BB9 A;  4IBJ A;  4RF1 A;  2DZN B;  3FUW A;  3KOX E;  4L15 A;  3U5Z A;  1EE8 A;  4NSR A;  3SHG B;  5KO3 A;  3NWL A;  3SFZ A;  4JI1 M;  3GQ3 A;  3HHX A;  3M0E A;  3L29 A;  4B7G A;  2DWZ B;  3K8Z A;  4AKH A;  1OFI A;  4IIW A;  3HU3 A;  2CHV A;  2D7H A;  4MGZ E;  5ITX A;  3M6A A;  1DGH B;  4DUY M;  2CV0 A;  1Q39 A;  5LMN M;  3TPZ A;  2CV1 A;  2P5T A;  2EUC A;  3TWM A;  1IN4 A;  1R7R A;  3RGS A;  4PT5 A;  2CHG A;  4GHA A;  3D8B A;  1IXS B;  3DOA A;  1DGB A;  1IY1 A;  3WHL A;  5C1B A;  4CHT B;  1GVN A;  3U6S A;  4OVZ A;  4MB7 A;  3FD9 A;  3U6O A;  1FJG M;  1L1T A;  3E4R A;  2M5Z A;  4DV7 M;  4FW9 A;  3MK6 A;  3FUX A;  3FUU A;  4PDG A;  2CUZ A;  4FWG A;  3QAU A;  4L16 A;  2XFS A;  3KW6 A;  3K1J A;  3K92 A;  3VKH A;  4EIW A;  1KFV A;  1T3T A;  2Y21 A;  2C98 A;  4GRI A;  3LQR A;  2R4J A;  5FTL A;  3NBI A;  2X8A A;  4IBG A;  3VDU A;  4P16 A;  3T1H M;  1IN8 A;  3A46 A;  4IBD A;  4L78 A;  3VK8 A;  1N75 A;  2R65 A;  4LJ6 A;  2ZBK B;  3AOE C;  3IG8 A;  1Q3B A;  2V6Z M;  4DV6 M;  2XLJ A;  3I4V A;  1GKI A;  4DV4 M;  3HJQ A;  4R3D A;  5KQ8 A;  3OTO M;  3CF2 A;  2R46 A;  1D2N A;  1G41 A;  3UJN A;  3R9X B;  1NJF A;  1TDZ A;  3FYD A;  3GLH B;  2UU9 M;  4B3R M;  3KP0 E;  4AQY M;  4D80 A;  5EXX A;  5ITQ A;  4LF6 M;  1MX0 A;  2Y0T A;  4JI5 M;  2C5R A;  1XXH B;  3AOE A;  3EIE A;  3FUV A;  3U61 B;  4LJ9 A;  5ITY A;  3JR4 A;  3CF6 E;  1IY0 A;  5ITU A;  2EA0 A;  1L8Q A;  5FLX S;  1N32 M;  2C9C A;  2FE8 A;  5EXP A;  1N36 M;  3GPY A;  3C58 A;  2UUC M;  4IBB A;  1R6B X;  2LXE A;  3KVW A;  1H6U A;  4LY6 A;  3SAS A;  1HNW M;  2DWN A;  4WUR A;  1PJI A;  4HLQ A;  2QBY A;  4IJE A;  1QAO A;  3GRY A;  3PNV A;  4FCV A;  2A5Y B;  3JAM S;  4I8O A;  5EP1 A;  3AJI B;  4ITQ A;  1NY5 A;  4NRV A;  1C1K A;  3L28 A;  3U6Q A;  2BNK A;  5BPV A;  4AKI A;  2RGH A;  2UUB M;  2VII A;  3CF0 A;  3KS4 A;  5GKN A;  3SHF A;  4M9S A;  4AW4 A;  1Z59 A;  1TH3 A;  2R62 A;  2RGO A;  4ZPX A;  4LFA M;  5A2Q S;  4MGY E;  3U6D A;  3KOY E;  2XH9 A;  1HR0 M;  2OPF A;  3L25 A;  3R8F A;  1IBK M;  4JI7 M;  1Z5B A;  3RGP A;  4NOO B;  4B7H A;  4DV3 M;  4QHT A;  2J7O A;  3PNY A;  2XZU A;  2DWM A;  1X37 A;  3GQ4 A;  3MJ5 A;  3PFI A;  3RFW A;  2YR0 A;  1XNQ M;  2Z4S A;  5BR8 M;  4IBC A;  3KSJ A;  1KYI A;  4IBE A;  4LGY A;  4X66 M;  3KOW E;  1SXJ E;  4I81 A;  2Y20 A;  4L4U A;  2KA6 B;  2ZAO A;  3TWL A;  4HL4 A;  3ILK A;  1HQC A;  4LJ4 A;  4WW0 A;  1IY2 A;  2D7G A;  4JI6 M;  3VKG A;  1J09 A;  3D8L A;  1N34 M;  2OQ4 A;  2G8L A;  1XMO M;  3GLG B;  4M9X A;  2UXD M;  4YY3 M;  2X4A A;  4DR4 M;  8CAT A;  4LRT A;  2KEB A;  4D82 A;  5KQD A;  4JI4 M;  1J7K A;  4RF0 A;  2DHR A;  4QNR A;  2Z4R A;  4Z6Y A;  2ZM6 M;  4X62 M;  3U60 B;  4JN6 A;  1K3W A;  1QAN A;  2FNA A;  3DFZ A;  3U6M A;  3U6L A;  3GLI B;  3T1Y M;  1E9S A;  1DGH A;  3AKZ A;  3J80 S;  1NVM A;  1KSF X;  4B3T M;  4GKK M;  1GL7 A;  1VDD A;  2X49 A;  4LJ5 A;  3ZCB B;  1E94 E;  1GL6 A;  1SXJ C;  2L09 A;  4GC9 A;  4FCT A;  3AV0 A;  4KO8 A;  1Z5C A;  2KW0 A;  3SAR A;  3T15 A;  1K82 A;  5KPT A;  4PDI A;  3GRV A;  4IBK A;  4LZJ A;  4OVZ B;  4I4L A;  1L2D A;  2Z3X A;  2UUA M;  2NQ8 C;  3J81 S;  2BJV A;  2DXI A;  1ORY B;  3Q8X A;  4B3M M;  4JXJ A;  4GKJ M;  2QCU A;  5DYG A;  1IM2 A;  5H37 D;  4X65 M;  4GC5 A;  2QP9 X;  5EXT A;  4CIS A;  3M7G A;  2QZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...