2DZNB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 57
sequence length 57
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dznB00
1G4AE 2QBYA 2QPAA 3HU3A 3M0EA 1KYIA 2ZANA 4LRSA 1R6BX 3GLHA 1UM8A 5DYGA 1OFIA 3HU1A 3K1JA 1XXHB 2X8AA 4WW0A 4LGMA 2CHQA 1OFHA 4FCTA 2KRKA 1NVMA 2CE7A 1NY6A 1QZMA 1SXJE 2CHGA 1R7RA 3HWSA 3M6AA 5EXPA 1IY2A 4QNMA 3CF2A 3KW6A 3GLFA 1NY5A 1JR3A 2HCBA 3U5ZB 1G3IA 1IQPA 2DWZB 3PVSA 1HT1E 1SXJD 4KO8A 4KODA 5FTKA 3KDSE 5FTJA 2ZAMA 4FWDA 2QZ4A 1S3SA 1OJLA 1XXHA 2CEAA 1NJGA 2C9CA 3DZDA 1HQCA 3SYKA 2C99A 4GITA 3R8FA 5EP3A 1JR3D 2RKOA 1E94E 2V6ZM 1NJFA 4FCWA 1SXJC 4I4LA 3WHKA 3BOSA 2V1UA 1C1KA 3EIEA 3AJIB 5EXSA 2Z4RA 4LJ6A 2CHVA 4LY6A 1LV7A 1QVRA 1HT2E 2DZNB 3EIHA 1D2NA 1E32A 3HU2A 1IXRC 3PFIA 1IN7A 5EXTA 3CF0A 4I81A 3PXGA 5FTMA 1IY0A 3U61B 2QENA 4D82A 4L15A 1IN5A 4LRTA 1IXSB 4FCVA 1IXZA 1X37A 5EQTA 4LJ9A 2Z4SA 4KLNA 4D81A 1IN4A 4Z8XA 1DO0A 1L8QA 2VIIA 2QBYB 2XSZA 1SXJB 2R65A 2C96A 5FTLA 1FNNA 2DHRA 3GLGB 1DO2A 5C18A 3UK6A 4LJ7A 3SYLA 1IM2A 2DVWB 2ZAOA 1G41A 1IN6A 4LJAA 4QNRA 4ZPXA 5C1BA 4LJ5A 2QP9X 4EIWA 4LZZA 3VLFB 3GLIB 1NSFA 2BJWA 2XSZD 1W5SA 2DZOB 2BJVA 4QHSA 4D80A 3WHLA 4FWGA 5JI3E 5EP2A 1SXJA 4JN6A 4QOSA 4LCBA 1XWIA 1KSFX 3ZH9B 5FTNA 3VFDA 3GLGA 3U60B 4FWHA 2C9OA 5DYIA 1IN8A 1IY1A 1JQJC 4LJ8A 5EP4A 4FW9A 5EXXA 3H4MA 4L4UA 2C98A 4A3VB 3GLIA 3GLHB 2R62A 3B9PA 1W5TA 2FNAA 3D8BA 3SC3A 3MHVC 4LJ4A 1J7KA 5EP1A 4FD2A 4L16A 1HQYE 3GLFB 4QHTA 5JI2E
chains in the Genus database with same CATH superfamily
2O01F 2CRUA 2QHOB 2DAMA 3HU3A 2Y0QA 4I8OA 1L2DA 3RGPA 3AOEA 4GIPA 4YHHM 3W0LB 1R6BX 3MK6A 2UXBM 1WXQA 1XXHB 4B3TM 1HJPA 2KNVA 4WW0A 1OFHA 2JXNA 5IZ7D 1NY6A 1XMOM 5H37D 5EXPA 1IY2A 4GC9A 1NHGC 4NRVA 4LGYA 3U6CA 4AI6A 2V1CA 3K92A 1DGBA 1ZAEA 2J7NA 4LFBM 1JR3A 4DR6M 1ZV1A 1F4IA 1TGUA 3TE6A 2CP8A 2DWZB 2DKLA 4BLCA 4DV2M 1Z5AA 1L1TA 2DWNA 1OQYA 4CJ6A 3FRHA 2VQFM 2BNKA 4KODA 2UUCM 2X4AA 4X62M 3SMSA 4ITQA 2CFOA 2KRUA 3HJQA 1S3SA 1OJLA 2I7PA 1OIPA 2C9CA 1G8PA 5F3WA 1XNRM 4AG5A 2C99A 1AIPC 4DBGB 5EP3A 1JR3D 1DGGA 3LCVB 3PNVA 3L26A 4DV5M 1SXJC 3Q8GA 2K6BA 4NSOB 3L25A 4DV3M 3KS8A 4KT0F 3A45A 1LV7A 3U6MA 2M5ZA 3L27A 1R5LA 1WJ7A 2DZNB 2WZJA 3Q8XA 4HEOA 2EA0A 1D2NA 1EIJA 5ITTA 2UXCM 2JA2A 4G3OA 1IXRC 3PFIA 3FTFA 3SHGB 4MM3B 3KP0E 4LF7M 4NSRA 2LNHC 4IIWA 4MGHA 1L2BA 3AL0C 3C9PA 4GHLA 3KOZE 2DZLA 2HL7A 3HJ8A 3J2PB 1CUKA 5ITXA 4D82A 4F2LA 4LRTA 2DWMA 3GPYA 4CIZA 3GPXA 2XEPA 4JI4M 1OTRA 2R18A 1X37A 5EQTA 4LJ9A 2APLA 3MMPA 1G59A 5ITXE 2Z3XA 4Z8XA 2JUJA 3CTWB 3TPZA 1R4GA 2YFQA 3IG5A 2VIIA 5E26A 3AOEC 2MJ5B 3FUTA 1I94M 1SXJB 2R65A 3C58A 3HHZA 3I4YA 3A42A 5FTLA 4NRWA 1XNQM 3GLGB 4RF0A 1R2ZA 2FOIC 2JWSA 1GVNA 4II7A 3T6PA 3FRIA 1G41A 3ILKA 4QNRA 3M7GA 5C1BA 4LZZA 3NBIA 1OAIA 3K2LA 5KPTA 1DV0A 2CV0A 4M9XA 1W5SA 1UFZA 2DZOB 2R6FA 1Z6TA 4NXNM 5ITYA 2N35A 1VEKA 1MX0A 4K0KM 2ZBKB 4DUZM 2JY6B 1TH4A 2LVAA 1DGHB 5LMUM 1KSFX 1ORYB 2Y21A 1TH3A 1PM5A 5DYIA 3I01M 4LJ8A 3UGJA 2RRUA 5ITQA 4HL4A 4L4UA 2C98A 4JYAM 4AKGA 2HHHM 2WSFF 1GL7A 2Q2EB 3LVVA 3GLIA 2FE8A 2LWXA 1OKSA 3C3DA 2JZ0A 3QYBA 2XH9A 1TR8A 1TDZA 4LJ4A 2LTUA 1PRBA 4P17A 4AQYM 3BBZA 3GLIE 2R0IA 1N32M 2R45A 4MH0E 3JR5A 4GH9A 2EKFA 5IWAM 1VDDA 2R4EA 3HKPA 2O5RA 4L6V6 1VQ1A 4GMQA 1IBKM 3HHXA 1YSYA 3I4VA 1G4AE 1K3WA 2LBCA 1TTEA 1NV8A 3ZQJA 4R71A 3DOAA 1KYIA 1TF0B 4LRSA 4L78A 1A5TA 4DR5M 2FFJA 4REZA 4R3DA 3K1JA 3KXEC 3CGWA 4LGMA 3VDPA 4LF5M 1SXJE 1IBLM 2CHGA 1YLAA 2OO9A 3GLGE 1XC8A 1DGFA 3KW6A 3GQ4A 1NY5A 3U6OA 1VDLA 4X65M 1G3IA 2UU9M 3RFWA 1IQPA 5E6JA 1NO1A 1HT1E 1SXJD 4NOOB 4KO8A 3THGA 2ZM6M 2D7GA 2F5NA 3TQSA 4G4OA 4NXMM 4LFAM 5FTKA 1DGHA 3HJSA 2ZAMA 2XGNA 3B7NA 3HHWA 2CEAA 1NJGA 2FS1A 2Z8YM 3NWLA 1D0KA 2CUZA 3SYKA 4XGIA 1Q02A 1WR1B 2RKOA 2OPFA 1NJFA 3KVWA 1Q3CA 4FCWA 4WURA 3U6DA 3U5ZA 3HX3A 2H1RA 3C3EA 2V1UA 1N78A 1C1KA 1GLNA 2MH8A 3EIEA 2CHVA 4LY6A 4DR7M 4OVZB 2VF8A 2R46A 2DXIA 2L4FA 4B08A 1WHCA 3W0FA 4DR2M 4IBFA 1XB2B 3HU2A 1IN7A 3FKEA 3GPPA 8CATA 2CV2A 4L8RC 4I81A 1EFUB 4BB9A 4LF9M 1JR3E 2QENA 1HNWM 4OX9M 1IXSB 5KPRA 4OW0A 4JI3M 4B7HA 1H6UA 2YR0A 1BVSA 4MGZE 2YNMD 2F5OA 4KLNA 2KNZA 1IN4A 4D81A 2LXEA 3AV0A 1PJJA 1DO0A 2LH0A 3SFZA 2QBYB 4XBOA 1VEJA 2QSFX 4DV4M 2DENA 3J80S 1GABA 1PJIA 1FNNA 2XZFA 3KSJA 3J81S 2LVNC 3SBJA 3UK6A 1Z5BA 4LJ7A 3RGSA 3SMPA 4JI2M 4R7GA 4NL4H 3U6LA 4ZPXA 4EIWA 3GLIB 1NNUC 3T38A 3U6SA 4G6ZA 2BJVA 5DFLA 4CISA 3VDUA 1V33A 4XK8F 4FWGA 2KDLA 5EP2A 2FH0A 3KOXE 5ITRA 4QOSA 3L29A 2ZTDA 4LCBA 2L4EA 3KOYE 4X64M 3T1YM 3VFDA 1WGNA 3U60B 3T15A 3FYCA 4OVZA 4ANRA 4BBAA 3A98B 1GJTA 4FW9A 3FE3A 3GQ5A 2J7OA 3B9PA 3PNYA 4JI0M 1K82A 3SC3A 2P5TA 3MHVC 4IBBA 4DV6M 4DV0M 1J7KA 1Q39A 1QAQA 2KA6B 1IXSA 2OQ4A 2XZUA 4FD2A 3KOWE 1ZMUA 4I5SA 1Z59A 1Y8GA 3ZC7B 2F5PA 5KQDA 2VDBB 4MB7A 4MGKE 4UN2B 5IT9S 2JZ1A 3L28A 2QBYA 1L2CA 1L1ZA 2L09A 3T1HM 3M0EA 3VK8A 4RNAA 3L2AA 2ZANA 3GLHA 1UM8A 1OFIA 4DV1M 3SAUA 1N34M 3IG8A 2A5YB 4GKJM 1MN3A 2X8AA 4TUWA 2DAGA 1NVMA 2CE7A 1QZMA 4RKUF 3FYDA 3GLHE 4IJFA 3UZUA 1ZMVA 4QNMA 1EE8A 3J7BA 3GLFA 2HCBA 3U5ZB 3E21A 3DA1A 4IBEA 1J09A 3SATA 4GEWA 2HKJA 3GLFE 3FUWA 1T3TA 4LZJA 3GRYA 1QUTA 3FUXA 3B74A 3FTCA 5FTJA 3GQ3A 3JR4A 3U60A 4WP2A 2R4JA 3BXWA 1XHBA 2KZSA 3LVWA 1HQCA 4RF1A 1VEGA 2GQFA 3LQQA 3TWMA 1N36M 3CF6E 2V6ZM 2AHMA 3IHPA 2CV1A 4JI6M 3KFUG 4B7GA 2DI0A 3KS4A 3LQRA 2I7NA 3BOSA 4AKHA 4DUYM 3D8LA 3AJIB 1QAMA 1ZMWA 5EXSA 2Z4RA 2KXEA 3GRRA 4LJ6A 4W5WA 3FUUA 4OU7A 1MJGM 3RE8A 2F4VM 4LF4M 3EIHA 4PD2A 1E32A 5DNYA 2G5GX 5IREB 3FTEA 5EXTA 1GJSA 2JY7A 5A2QS 2KNAA 1QQWA 2MROB 1PGYA 3B7QA 4YY3M 1R2YA 1T6OA 1IY0A 2QQ8A 5BR8M 2MGWA 4L15A 4AW4A 1IN5A 2VF7A 4FCVA 2L2DA 2Z4SA 4G4QA 2W82A 2EUCA 3FUVA 3FTDA 4M9SA 4DV7M 2DWLA 2Y20A 1J5EM 2XSZA 2WSEF 2ERCA 2UUAM 1NNJA 2C96A 1PJQA 4AKIA 1V92A 2DHRA 2DNAA 7CATA 3U61A 4GHAA 3E46A 3JAMS 5C18A 1IM2A 2DVWB 2DAKA 4LJAA 1IN6A 1P3QQ 3K9PA 3U6QA 2XF3A 1NSFA 1QAOA 2XSZD 3IECA 4B7FA 3VKGA 4MGYE 1QYRA 2K9DA 3SAVA 1C7YA 3AFHA 3NBXX 1QDTA 3V76A 4D80A 5L8RF 1ZQ9A 2E5LM 3WHLA 1K3XA 3A46A 2GNOA 4B3MM 4JI7M 2RGOA 4JN6A 4MGIE 1XWIA 1VG5A 2BWBA 3E9SA 3ZH9B 3ZCBB 3J27B 1LTMA 1OIZA 2L7HA 4KHPM 3LCUA 4GRIA 3H4MA 5FSWA 4JI5M 4PCZA 1RU3A 4CHTB 4AZFA 4A3VB 2JY5A 3GLHB 5KO3A 2FNAA 3GRVA 2NQ8C 4S12A 4PDGA 2X49A 2DAIA 4NC6A 1T43A 1QUSA 3F92A 1HQYE 2O25A 1IFYA 5KQ8A 3GLFB 3HY5A 4B3SM 3HGIA 3GP1A 2D7HA 2R44A 4B3RM 2QPAA 1FJGM 2HWJA 2HAKA 5DYGA 4IBJA 3HU1A 2LVPC 2CHQA 4FCTA 4IBGA 2KRKA 2C5RA 1WGLA 4PT5A 3K9OA 1R7RA 2G3QA 3HWSA 3M6AA 4JI8M 3CF2A 1Q3BA 3W67A 4G4RA 2XLJA 1PJSA 2G8LA 2YQZA 1SG9A 2B3TA 3PVSA 2DHYA 2K0BX 3I51A 4Q7JA 1GL6A 5KPZA 4JV5M 1N75A 3LW5F 3KDSE 4FWDA 2CWBA 2QZ4A 4LFCM 1QZEA 1XXHA 2XFTA 3TL4X 1TH2A 1HR0M 3DZDA 2KW0A 2M60A 5LMNM 4DR4M 3SARA 2EO2A 4GITA 3R8FA 3AKZA 4G4NA 1NV9A 1E94E 1XXHE 3VK7A 2QCUA 2LHGA 1E9SA 4GC5A 4I4LA 3WHKA 4QOZC 1I4WA 2QNJA 1GO5A 4IJEA 2K47A 4IBKA 3K8ZA 2KZUA 2LHCA 1QVRA 1HT2E 3KP1E 4M0DA 1XMQM 4M0WA 2D7EA 2WSCF 3OTOM 1TDHA 1HNZM 1MU5A 2Y0TA 3CF0A 3PXGA 5FTMA 1PJTA 4Y28F 4LF8M 3QWLA 2L7IA 4AG6A 3U61B 3R9XB 3VKHA 4P16A 3UMMA 2XFSA 3FD9A 3KSXA 4IBIA 3U6PA 1KFVA 2EKKA 1IXZA 3TWLA 2JP7A 2Z7JA 3U6EA 3SASA 3W68A 3B7ZA 4DR1M 1L8QA 1Z5CA 2KEBA 3MJ5A 4DR3M 2UUBM 1OAOC 4JXJA 2VQEM 3H4JA 3J7AS 2F5QA 4JI1M 1QDRA 3HHYA 1G71A 2MR9A 2KHHA 1QANA 3GRUA 3HZJA 3LMMA 1DO2A 2JNHA 5BPVA 3SYLA 3GO8A 5EJCA 2ZAOA 4M9ZA 3AOGA 2BWEA 3SHFA 4LJ5A 1NHWC 2QP9X 3VLFB 1AUAA 2RGHA 5GKNA 2BJWA 3E4RA 4F1IA 2OOBA 4QHSA 1WIVA 1JB0F 2LVOC 2LVQD 4CGYB 2L6OA 5JI3E 5ITUA 3GPUA 5FLXS 1V34A 3SAWA 1GKIA 1SXJA 3I04M 2UXDM 2H5XA 5FTNA 2ZTCA 3GLGA 3B89A 2F5SA 3DFZA 4X66M 1HNXM 1N33M 1D0MA 2J5YA 2C9OA 4FWHA 4Z6YA 1IN8A 1IY1A 1JQJC 5EP4A 4IBCA 5EXXA 4GKKM 1D0LA 2JY8A 2OOAA 4LF6M 1E9RA 2R62A 3QYEA 3TWKA 1W5TA 4HLQA 2DAEA 3D8BA 4LG2A 3UJNA 5EP1A 4PDIA 1YE9A 4FVMA 3QAUA 4L16A 1IBMM 2EJSA 1N77A 1YUBA 4QHTA 5JI2E 4IBDA
chains in the Genus database with same CATH topology
4I8OA 3HU3A 2Y0QA 1L2DA 3RGPA 3AOEA 4GIPA 4YHHM 3W0LB 1R6BX 3MK6A 2UXBM 1WXQA 1XXHB 4B3TM 4WW0A 1OFHA 5IZ7D 1NY6A 1XMOM 5H37D 5EXPA 1IY2A 4GC9A 1NHGC 4NRVA 4LGYA 3U6CA 4AI6A 2V1CA 3K92A 1DGBA 1ZAEA 2J7NA 4LFBM 1JR3A 4DR6M 1TGUA 3TE6A 2DWZB 4BLCA 4DV2M 1Z5AA 1L1TA 2DWNA 2VQFM 2BNKA 4KODA 2UUCM 2X4AA 4X62M 3SMSA 4ITQA 2CFOA 2KRUA 3HJQA 1S3SA 1OJLA 2I7PA 2C9CA 1G8PA 5F3WA 1XNRM 4AG5A 2C99A 5EP3A 1JR3D 1DGGA 3PNVA 3L26A 4DV5M 1SXJC 4NSOB 3L25A 4DV3M 3KS8A 3A45A 1LV7A 3U6MA 2M5ZA 3L27A 2DZNB 3Q8XA 2EA0A 1D2NA 5ITTA 2UXCM 2JA2A 3FTFA 1IXRC 3PFIA 3SHGB 4MM3B 3KP0E 4LF7M 4NSRA 2LNHC 4IIWA 4MGHA 1L2BA 3AL0C 4GHLA 3KOZE 2HL7A 3HJ8A 3J2PB 4D82A 5ITXA 2DWMA 4LRTA 3GPYA 3GPXA 4JI4M 2XEPA 2R18A 1X37A 5EQTA 4LJ9A 1G59A 5ITXE 2Z3XA 4Z8XA 3TPZA 3CTWB 2YFQA 3IG5A 2VIIA 5E26A 3AOEC 3FUTA 1I94M 1SXJB 2R65A 3C58A 3HHZA 3I4YA 3A42A 5FTLA 4NRWA 1XNQM 3GLGB 4RF0A 1R2ZA 2FOIC 1GVNA 4II7A 1G41A 3ILKA 4QNRA 3M7GA 5C1BA 4LZZA 3NBIA 5KPTA 3K2LA 2CV0A 4M9XA 1W5SA 2DZOB 1Z6TA 4NXNM 5ITYA 1MX0A 4K0KM 2ZBKB 4DUZM 1TH4A 1DGHB 5LMUM 1KSFX 1ORYB 2Y21A 1TH3A 1PM5A 5DYIA 4LJ8A 3UGJA 5ITQA 4HL4A 4L4UA 2C98A 4JYAM 4AKGA 2HHHM 1GL7A 2Q2EB 3LVVA 3GLIA 2FE8A 2LWXA 2XH9A 1TDZA 4LJ4A 4AQYM 1N32M 2R45A 4MH0E 3JR5A 4GH9A 5IWAM 1VDDA 2R4EA 3HKPA 2O5RA 4GMQA 1IBKM 3HHXA 1YSYA 3I4VA 1G4AE 1K3WA 3DOAA 1KYIA 4LRSA 4L78A 4DR5M 2FFJA 4REZA 4R3DA 3K1JA 3KXEC 3VDPA 4LGMA 4LF5M 1SXJE 1IBLM 2CHGA 1XC8A 1DGFA 3KW6A 3GQ4A 1NY5A 3U6OA 4X65M 1G3IA 3RFWA 1IQPA 5E6JA 1HT1E 1SXJD 4NOOB 4KO8A 3THGA 2ZM6M 2D7GA 2F5NA 3TQSA 4G4OA 4NXMM 4LFAM 5FTKA 1DGHA 3HJSA 2ZAMA 2XGNA 3HHWA 2CEAA 1NJGA 3NWLA 2CUZA 3SYKA 4XGIA 2RKOA 2OPFA 1NJFA 3KVWA 1Q3CA 4FCWA 4WURA 3U6DA 3U5ZA 2H1RA 2V1UA 1N78A 1C1KA 1GLNA 3EIEA 2CHVA 4LY6A 4DR7M 4OVZB 2R46A 2DXIA 4B08A 3W0FA 4DR2M 4IBFA 3HU2A 1IN7A 3FKEA 3GPPA 8CATA 2CV2A 4L8RC 4I81A 4BB9A 4LF9M 2QENA 1HNWM 4OX9M 1IXSB 5KPRA 4OW0A 4JI3M 4B7HA 1H6UA 2YR0A 4MGZE 2YNMD 2F5OA 4KLNA 4D81A 1IN4A 2LXEA 3AV0A 1PJJA 1DO0A 2LH0A 3SFZA 2QBYB 4XBOA 4DV4M 3J80S 1PJIA 1FNNA 2XZFA 3KSJA 3J81S 3SBJA 3UK6A 1Z5BA 4LJ7A 3RGSA 3SMPA 4JI2M 4R7GA 4NL4H 3U6LA 4ZPXA 4EIWA 3GLIB 1NNUC 3T38A 3U6SA 4G6ZA 2BJVA 4CISA 3VDUA 4FWGA 5EP2A 3KOXE 5ITRA 4QOSA 3L29A 4LCBA 3KOYE 4X64M 3T1YM 3VFDA 3U60B 3T15A 3FYCA 4OVZA 4BBAA 3A98B 4FW9A 3GQ5A 2J7OA 3B9PA 3PNYA 4JI0M 1K82A 3SC3A 2P5TA 3MHVC 4IBBA 4DV6M 4DV0M 1J7KA 1Q39A 1QAQA 2KA6B 2OQ4A 2XZUA 4FD2A 3KOWE 4I5SA 1Z59A 3ZC7B 2F5PA 5KQDA 4MB7A 4MGKE 5IT9S 3L28A 2QBYA 1L2CA 1L1ZA 2L09A 3T1HM 3M0EA 3VK8A 4RNAA 3L2AA 2ZANA 3GLHA 1UM8A 1OFIA 4DV1M 3SAUA 1N34M 3IG8A 2A5YB 4GKJM 4TUWA 2X8AA 1NVMA 2CE7A 1QZMA 3FYDA 4IJFA 3UZUA 4QNMA 1EE8A 3J7BA 3GLFA 2HCBA 3U5ZB 3DA1A 4IBEA 1J09A 3SATA 2HKJA 3FUWA 1T3TA 4LZJA 3GRYA 3FUXA 5FTJA 3FTCA 3GQ3A 3JR4A 3U60A 2R4JA 1XHBA 2KZSA 3LVWA 1HQCA 4RF1A 2CV1A 1N36M 3LQQA 3TWMA 4JI6M 3CF6E 2V6ZM 2AHMA 3KFUG 4B7GA 3KS4A 3LQRA 2I7NA 3BOSA 4AKHA 4DUYM 3D8LA 3AJIB 1QAMA 5EXSA 2UU9M 2Z4RA 2KXEA 3GRRA 4LJ6A 4W5WA 3FUUA 4OU7A 3RE8A 2F4VM 4LF4M 3EIHA 4PD2A 1E32A 5DNYA 2G5GX 5IREB 3FTEA 5EXTA 5A2QS 1QQWA 4YY3M 1R2YA 1IY0A 5BR8M 4L15A 4AW4A 1IN5A 4FCVA 2Z4SA 4G4QA 2W82A 2EUCA 3FUVA 3FTDA 4M9SA 4DV7M 2DWLA 2Y20A 1J5EM 2XSZA 2ERCA 2UUAM 1NNJA 2C96A 4AKIA 2DHRA 7CATA 3U61A 4GHAA 3JAMS 5C18A 1IM2A 2DVWB 4LJAA 1IN6A 3U6QA 2XF3A 1NSFA 1QAOA 2XSZD 4B7FA 3VKGA 4MGYE 1QYRA 3SAVA 3AFHA 4D80A 2E5LM 1ZQ9A 3WHLA 1K3XA 3A46A 4B3MM 4JI7M 2RGOA 4JN6A 4MGIE 1XWIA 3ZH9B 3E9SA 3ZCBB 3J27B 2L7HA 4KHPM 4GRIA 3H4MA 5FSWA 4JI5M 4PCZA 4CHTB 4AZFA 4A3VB 3GLHB 5KO3A 2FNAA 3GRVA 2NQ8C 4S12A 4PDGA 2X49A 1HQYE 5KQ8A 3GLFB 4B3SM 3HGIA 3GP1A 2D7HA 4B3RM 2QPAA 1FJGM 5DYGA 4IBJA 3HU1A 2CHQA 4FCTA 4IBGA 2KRKA 2C5RA 4PT5A 1R7RA 3HWSA 3M6AA 4JI8M 3CF2A 1Q3BA 4G4RA 2XLJA 2G8LA 2YQZA 5KPZA 3PVSA 3I51A 1GL6A 4JV5M 1N75A 3KDSE 4FWDA 2QZ4A 4LFCM 1XXHA 2XFTA 3TL4X 1TH2A 1HR0M 3DZDA 2KW0A 2M60A 5LMNM 4DR4M 3SARA 2EO2A 4GITA 3R8FA 3AKZA 4G4NA 1E94E 3VK7A 2QCUA 1E9SA 4GC5A 4I4LA 3WHKA 4QOZC 1I4WA 4IJEA 2K47A 4IBKA 3K8ZA 2KZUA 1QVRA 1HT2E 3KP1E 4M0DA 1XMQM 4M0WA 2D7EA 3OTOM 1TDHA 1HNZM 1MU5A 2Y0TA 3CF0A 3PXGA 5FTMA 4LF8M 3QWLA 2L7IA 4AG6A 3U61B 3R9XB 3VKHA 4P16A 3UMMA 2XFSA 3FD9A 3KSXA 4IBIA 3U6PA 1KFVA 1IXZA 3TWLA 2Z7JA 3U6EA 3SASA 4DR1M 1L8QA 1Z5CA 2KEBA 3MJ5A 4DR3M 2UUBM 4JXJA 3J7AS 2VQEM 2F5QA 4JI1M 3HHYA 3LMMA 1QANA 3GRUA 1DO2A 5BPVA 3SYLA 3GO8A 5EJCA 2ZAOA 4M9ZA 3AOGA 3SHFA 4LJ5A 1NHWC 2QP9X 3VLFB 2RGHA 5GKNA 2BJWA 3E4RA 4QHSA 4CGYB 2L6OA 5JI3E 5ITUA 3GPUA 5FLXS 3SAWA 1GKIA 1SXJA 2UXDM 5FTNA 3GLGA 2F5SA 3DFZA 4X66M 1HNXM 1N33M 4FWHA 2C9OA 4Z6YA 1IN8A 1IY1A 1JQJC 5EP4A 4IBCA 5EXXA 4GKKM 4LF6M 1E9RA 2R62A 3TWKA 1W5TA 4HLQA 3D8BA 4LG2A 3UJNA 5EP1A 4PDIA 1YE9A 4FVMA 3QAUA 4L16A 1IBMM 1N77A 1YUBA 4QHTA 5JI2E 4IBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4A E;  2QBY A;  2QPA A;  3HU3 A;  3M0E A;  1KYI A;  2ZAN A;  4LRS A;  1R6B X;  3GLH A;  1UM8 A;  5DYG A;  1OFI A;  3HU1 A;  3K1J A;  1XXH B;  2X8A A;  4WW0 A;  4LGM A;  2CHQ A;  1OFH A;  4FCT A;  2KRK A;  1NVM A;  2CE7 A;  1NY6 A;  1QZM A;  1SXJ E;  2CHG A;  1R7R A;  3HWS A;  3M6A A;  5EXP A;  1IY2 A;  4QNM A;  3CF2 A;  3KW6 A;  3GLF A;  1NY5 A;  1JR3 A;  2HCB A;  3U5Z B;  1G3I A;  1IQP A;  2DWZ B;  3PVS A;  1HT1 E;  1SXJ D;  4KO8 A;  4KOD A;  5FTK A;  3KDS E;  5FTJ A;  2ZAM A;  4FWD A;  2QZ4 A;  1S3S A;  1OJL A;  1XXH A;  2CEA A;  1NJG A;  2C9C A;  3DZD A;  1HQC A;  3SYK A;  2C99 A;  4GIT A;  3R8F A;  5EP3 A;  1JR3 D;  2RKO A;  1E94 E;  2V6Z M;  1NJF A;  4FCW A;  1SXJ C;  4I4L A;  3WHK A;  3BOS A;  2V1U A;  1C1K A;  3EIE A;  3AJI B;  5EXS A;  2Z4R A;  4LJ6 A;  2CHV A;  4LY6 A;  1LV7 A;  1QVR A;  1HT2 E;  2DZN B;  3EIH A;  1D2N A;  1E32 A;  3HU2 A;  1IXR C;  3PFI A;  1IN7 A;  5EXT A;  3CF0 A;  4I81 A;  3PXG A;  5FTM A;  1IY0 A;  3U61 B;  2QEN A;  4D82 A;  4L15 A;  1IN5 A;  4LRT A;  1IXS B;  4FCV A;  1IXZ A;  1X37 A;  5EQT A;  4LJ9 A;  2Z4S A;  4KLN A;  4D81 A;  1IN4 A;  4Z8X A;  1DO0 A;  1L8Q A;  2VII A;  2QBY B;  2XSZ A;  1SXJ B;  2R65 A;  2C96 A;  5FTL A;  1FNN A;  2DHR A;  3GLG B;  1DO2 A;  5C18 A;  3UK6 A;  4LJ7 A;  3SYL A;  1IM2 A;  2DVW B;  2ZAO A;  1G41 A;  1IN6 A;  4LJA A;  4QNR A;  4ZPX A;  5C1B A;  4LJ5 A;  2QP9 X;  4EIW A;  4LZZ A;  3VLF B;  3GLI B;  1NSF A;  2BJW A;  2XSZ D;  1W5S A;  2DZO B;  2BJV A;  4QHS A;  4D80 A;  3WHL A;  4FWG A;  5JI3 E;  5EP2 A;  1SXJ A;  4JN6 A;  4QOS A;  4LCB A;  1XWI A;  1KSF X;  3ZH9 B;  5FTN A;  3VFD A;  3GLG A;  3U60 B;  4FWH A;  2C9O A;  5DYI A;  1IN8 A;  1IY1 A;  1JQJ C;  4LJ8 A;  5EP4 A;  4FW9 A;  5EXX A;  3H4M A;  4L4U A;  2C98 A;  4A3V B;  3GLI A;  3GLH B;  2R62 A;  3B9P A;  1W5T A;  2FNA A;  3D8B A;  3SC3 A;  3MHV C;  4LJ4 A;  1J7K A;  5EP1 A;  4FD2 A;  4L16 A;  1HQY E;  3GLF B;  4QHT A;  5JI2 E; 
#chains in the Genus database with same CATH topology
 2O01 F;  2CRU A;  2QHO B;  2DAM A;  3HU3 A;  2Y0Q A;  4I8O A;  1L2D A;  3RGP A;  3AOE A;  4GIP A;  4YHH M;  3W0L B;  1R6B X;  3MK6 A;  2UXB M;  1WXQ A;  1XXH B;  4B3T M;  1HJP A;  2KNV A;  4WW0 A;  1OFH A;  2JXN A;  5IZ7 D;  1NY6 A;  1XMO M;  5H37 D;  5EXP A;  1IY2 A;  4GC9 A;  1NHG C;  4NRV A;  4LGY A;  3U6C A;  4AI6 A;  2V1C A;  3K92 A;  1DGB A;  1ZAE A;  2J7N A;  4LFB M;  1JR3 A;  4DR6 M;  1ZV1 A;  1F4I A;  1TGU A;  3TE6 A;  2CP8 A;  2DWZ B;  2DKL A;  4BLC A;  4DV2 M;  1Z5A A;  1L1T A;  2DWN A;  1OQY A;  4CJ6 A;  3FRH A;  2VQF M;  2BNK A;  4KOD A;  2UUC M;  2X4A A;  4X62 M;  3SMS A;  4ITQ A;  2CFO A;  2KRU A;  3HJQ A;  1S3S A;  1OJL A;  2I7P A;  1OIP A;  2C9C A;  1G8P A;  5F3W A;  1XNR M;  4AG5 A;  2C99 A;  1AIP C;  4DBG B;  5EP3 A;  1JR3 D;  1DGG A;  3LCV B;  3PNV A;  3L26 A;  4DV5 M;  1SXJ C;  3Q8G A;  2K6B A;  4NSO B;  3L25 A;  4DV3 M;  3KS8 A;  4KT0 F;  3A45 A;  1LV7 A;  3U6M A;  2M5Z A;  3L27 A;  1R5L A;  1WJ7 A;  2DZN B;  2WZJ A;  3Q8X A;  4HEO A;  2EA0 A;  1D2N A;  1EIJ A;  5ITT A;  2UXC M;  2JA2 A;  4G3O A;  1IXR C;  3PFI A;  3FTF A;  3SHG B;  4MM3 B;  3KP0 E;  4LF7 M;  4NSR A;  2LNH C;  4IIW A;  4MGH A;  1L2B A;  3AL0 C;  3C9P A;  4GHL A;  3KOZ E;  2DZL A;  2HL7 A;  3HJ8 A;  3J2P B;  1CUK A;  5ITX A;  4D82 A;  4F2L A;  4LRT A;  2DWM A;  3GPY A;  4CIZ A;  3GPX A;  2XEP A;  4JI4 M;  1OTR A;  2R18 A;  1X37 A;  5EQT A;  4LJ9 A;  2APL A;  3MMP A;  1G59 A;  5ITX E;  2Z3X A;  4Z8X A;  2JUJ A;  3CTW B;  3TPZ A;  1R4G A;  2YFQ A;  3IG5 A;  2VII A;  5E26 A;  3AOE C;  2MJ5 B;  3FUT A;  1I94 M;  1SXJ B;  2R65 A;  3C58 A;  3HHZ A;  3I4Y A;  3A42 A;  5FTL A;  4NRW A;  1XNQ M;  3GLG B;  4RF0 A;  1R2Z A;  2FOI C;  2JWS A;  1GVN A;  4II7 A;  3T6P A;  3FRI A;  1G41 A;  3ILK A;  4QNR A;  3M7G A;  5C1B A;  4LZZ A;  3NBI A;  1OAI A;  3K2L A;  5KPT A;  1DV0 A;  2CV0 A;  4M9X A;  1W5S A;  1UFZ A;  2DZO B;  2R6F A;  1Z6T A;  4NXN M;  5ITY A;  2N35 A;  1VEK A;  1MX0 A;  4K0K M;  2ZBK B;  4DUZ M;  2JY6 B;  1TH4 A;  2LVA A;  1DGH B;  5LMU M;  1KSF X;  1ORY B;  2Y21 A;  1TH3 A;  1PM5 A;  5DYI A;  3I01 M;  4LJ8 A;  3UGJ A;  2RRU A;  5ITQ A;  4HL4 A;  4L4U A;  2C98 A;  4JYA M;  4AKG A;  2HHH M;  2WSF F;  1GL7 A;  2Q2E B;  3LVV A;  3GLI A;  2FE8 A;  2LWX A;  1OKS A;  3C3D A;  2JZ0 A;  3QYB A;  2XH9 A;  1TR8 A;  1TDZ A;  4LJ4 A;  2LTU A;  1PRB A;  4P17 A;  4AQY M;  3BBZ A;  3GLI E;  2R0I A;  1N32 M;  2R45 A;  4MH0 E;  3JR5 A;  4GH9 A;  2EKF A;  5IWA M;  1VDD A;  2R4E A;  3HKP A;  2O5R A;  4L6V 6;  1VQ1 A;  4GMQ A;  1IBK M;  3HHX A;  1YSY A;  3I4V A;  1G4A E;  1K3W A;  2LBC A;  1TTE A;  1NV8 A;  3ZQJ A;  4R71 A;  3DOA A;  1KYI A;  1TF0 B;  4LRS A;  4L78 A;  1A5T A;  4DR5 M;  2FFJ A;  4REZ A;  4R3D A;  3K1J A;  3KXE C;  3CGW A;  4LGM A;  3VDP A;  4LF5 M;  1SXJ E;  1IBL M;  2CHG A;  1YLA A;  2OO9 A;  3GLG E;  1XC8 A;  1DGF A;  3KW6 A;  3GQ4 A;  1NY5 A;  3U6O A;  1VDL A;  4X65 M;  1G3I A;  2UU9 M;  3RFW A;  1IQP A;  5E6J A;  1NO1 A;  1HT1 E;  1SXJ D;  4NOO B;  4KO8 A;  3THG A;  2ZM6 M;  2D7G A;  2F5N A;  3TQS A;  4G4O A;  4NXM M;  4LFA M;  5FTK A;  1DGH A;  3HJS A;  2ZAM A;  2XGN A;  3B7N A;  3HHW A;  2CEA A;  1NJG A;  2FS1 A;  2Z8Y M;  3NWL A;  1D0K A;  2CUZ A;  3SYK A;  4XGI A;  1Q02 A;  1WR1 B;  2RKO A;  2OPF A;  1NJF A;  3KVW A;  1Q3C A;  4FCW A;  4WUR A;  3U6D A;  3U5Z A;  3HX3 A;  2H1R A;  3C3E A;  2V1U A;  1N78 A;  1C1K A;  1GLN A;  2MH8 A;  3EIE A;  2CHV A;  4LY6 A;  4DR7 M;  4OVZ B;  2VF8 A;  2R46 A;  2DXI A;  2L4F A;  4B08 A;  1WHC A;  3W0F A;  4DR2 M;  4IBF A;  1XB2 B;  3HU2 A;  1IN7 A;  3FKE A;  3GPP A;  8CAT A;  2CV2 A;  4L8R C;  4I81 A;  1EFU B;  4BB9 A;  4LF9 M;  1JR3 E;  2QEN A;  1HNW M;  4OX9 M;  1IXS B;  5KPR A;  4OW0 A;  4JI3 M;  4B7H A;  1H6U A;  2YR0 A;  1BVS A;  4MGZ E;  2YNM D;  2F5O A;  4KLN A;  2KNZ A;  1IN4 A;  4D81 A;  2LXE A;  3AV0 A;  1PJJ A;  1DO0 A;  2LH0 A;  3SFZ A;  2QBY B;  4XBO A;  1VEJ A;  2QSF X;  4DV4 M;  2DEN A;  3J80 S;  1GAB A;  1PJI A;  1FNN A;  2XZF A;  3KSJ A;  3J81 S;  2LVN C;  3SBJ A;  3UK6 A;  1Z5B A;  4LJ7 A;  3RGS A;  3SMP A;  4JI2 M;  4R7G A;  4NL4 H;  3U6L A;  4ZPX A;  4EIW A;  3GLI B;  1NNU C;  3T38 A;  3U6S A;  4G6Z A;  2BJV A;  5DFL A;  4CIS A;  3VDU A;  1V33 A;  4XK8 F;  4FWG A;  2KDL A;  5EP2 A;  2FH0 A;  3KOX E;  5ITR A;  4QOS A;  3L29 A;  2ZTD A;  4LCB A;  2L4E A;  3KOY E;  4X64 M;  3T1Y M;  3VFD A;  1WGN A;  3U60 B;  3T15 A;  3FYC A;  4OVZ A;  4ANR A;  4BBA A;  3A98 B;  1GJT A;  4FW9 A;  3FE3 A;  3GQ5 A;  2J7O A;  3B9P A;  3PNY A;  4JI0 M;  1K82 A;  3SC3 A;  2P5T A;  3MHV C;  4IBB A;  4DV6 M;  4DV0 M;  1J7K A;  1Q39 A;  1QAQ A;  2KA6 B;  1IXS A;  2OQ4 A;  2XZU A;  4FD2 A;  3KOW E;  1ZMU A;  4I5S A;  1Z59 A;  1Y8G A;  3ZC7 B;  2F5P A;  5KQD A;  2VDB B;  4MB7 A;  4MGK E;  4UN2 B;  5IT9 S;  2JZ1 A;  3L28 A;  2QBY A;  1L2C A;  1L1Z A;  2L09 A;  3T1H M;  3M0E A;  3VK8 A;  4RNA A;  3L2A A;  2ZAN A;  3GLH A;  1UM8 A;  1OFI A;  4DV1 M;  3SAU A;  1N34 M;  3IG8 A;  2A5Y B;  4GKJ M;  1MN3 A;  2X8A A;  4TUW A;  2DAG A;  1NVM A;  2CE7 A;  1QZM A;  4RKU F;  3FYD A;  3GLH E;  4IJF A;  3UZU A;  1ZMV A;  4QNM A;  1EE8 A;  3J7B A;  3GLF A;  2HCB A;  3U5Z B;  3E21 A;  3DA1 A;  4IBE A;  1J09 A;  3SAT A;  4GEW A;  2HKJ A;  3GLF E;  3FUW A;  1T3T A;  4LZJ A;  3GRY A;  1QUT A;  3FUX A;  3B74 A;  3FTC A;  5FTJ A;  3GQ3 A;  3JR4 A;  3U60 A;  4WP2 A;  2R4J A;  3BXW A;  1XHB A;  2KZS A;  3LVW A;  1HQC A;  4RF1 A;  1VEG A;  2GQF A;  3LQQ A;  3TWM A;  1N36 M;  3CF6 E;  2V6Z M;  2AHM A;  3IHP A;  2CV1 A;  4JI6 M;  3KFU G;  4B7G A;  2DI0 A;  3KS4 A;  3LQR A;  2I7N A;  3BOS A;  4AKH A;  4DUY M;  3D8L A;  3AJI B;  1QAM A;  1ZMW A;  5EXS A;  2Z4R A;  2KXE A;  3GRR A;  4LJ6 A;  4W5W A;  3FUU A;  4OU7 A;  1MJG M;  3RE8 A;  2F4V M;  4LF4 M;  3EIH A;  4PD2 A;  1E32 A;  5DNY A;  2G5G X;  5IRE B;  3FTE A;  5EXT A;  1GJS A;  2JY7 A;  5A2Q S;  2KNA A;  1QQW A;  2MRO B;  1PGY A;  3B7Q A;  4YY3 M;  1R2Y A;  1T6O A;  1IY0 A;  2QQ8 A;  5BR8 M;  2MGW A;  4L15 A;  4AW4 A;  1IN5 A;  2VF7 A;  4FCV A;  2L2D A;  2Z4S A;  4G4Q A;  2W82 A;  2EUC A;  3FUV A;  3FTD A;  4M9S A;  4DV7 M;  2DWL A;  2Y20 A;  1J5E M;  2XSZ A;  2WSE F;  2ERC A;  2UUA M;  1NNJ A;  2C96 A;  1PJQ A;  4AKI A;  1V92 A;  2DHR A;  2DNA A;  7CAT A;  3U61 A;  4GHA A;  3E46 A;  3JAM S;  5C18 A;  1IM2 A;  2DVW B;  2DAK A;  4LJA A;  1IN6 A;  1P3Q Q;  3K9P A;  3U6Q A;  2XF3 A;  1NSF A;  1QAO A;  2XSZ D;  3IEC A;  4B7F A;  3VKG A;  4MGY E;  1QYR A;  2K9D A;  3SAV A;  1C7Y A;  3AFH A;  3NBX X;  1QDT A;  3V76 A;  4D80 A;  5L8R F;  1ZQ9 A;  2E5L M;  3WHL A;  1K3X A;  3A46 A;  2GNO A;  4B3M M;  4JI7 M;  2RGO A;  4JN6 A;  4MGI E;  1XWI A;  1VG5 A;  2BWB A;  3E9S A;  3ZH9 B;  3ZCB B;  3J27 B;  1LTM A;  1OIZ A;  2L7H A;  4KHP M;  3LCU A;  4GRI A;  3H4M A;  5FSW A;  4JI5 M;  4PCZ A;  1RU3 A;  4CHT B;  4AZF A;  4A3V B;  2JY5 A;  3GLH B;  5KO3 A;  2FNA A;  3GRV A;  2NQ8 C;  4S12 A;  4PDG A;  2X49 A;  2DAI A;  4NC6 A;  1T43 A;  1QUS A;  3F92 A;  1HQY E;  2O25 A;  1IFY A;  5KQ8 A;  3GLF B;  3HY5 A;  4B3S M;  3HGI A;  3GP1 A;  2D7H A;  2R44 A;  4B3R M;  2QPA A;  1FJG M;  2HWJ A;  2HAK A;  5DYG A;  4IBJ A;  3HU1 A;  2LVP C;  2CHQ A;  4FCT A;  4IBG A;  2KRK A;  2C5R A;  1WGL A;  4PT5 A;  3K9O A;  1R7R A;  2G3Q A;  3HWS A;  3M6A A;  4JI8 M;  3CF2 A;  1Q3B A;  3W67 A;  4G4R A;  2XLJ A;  1PJS A;  2G8L A;  2YQZ A;  1SG9 A;  2B3T A;  3PVS A;  2DHY A;  2K0B X;  3I51 A;  4Q7J A;  1GL6 A;  5KPZ A;  4JV5 M;  1N75 A;  3LW5 F;  3KDS E;  4FWD A;  2CWB A;  2QZ4 A;  4LFC M;  1QZE A;  1XXH A;  2XFT A;  3TL4 X;  1TH2 A;  1HR0 M;  3DZD A;  2KW0 A;  2M60 A;  5LMN M;  4DR4 M;  3SAR A;  2EO2 A;  4GIT A;  3R8F A;  3AKZ A;  4G4N A;  1NV9 A;  1E94 E;  1XXH E;  3VK7 A;  2QCU A;  2LHG A;  1E9S A;  4GC5 A;  4I4L A;  3WHK A;  4QOZ C;  1I4W A;  2QNJ A;  1GO5 A;  4IJE A;  2K47 A;  4IBK A;  3K8Z A;  2KZU A;  2LHC A;  1QVR A;  1HT2 E;  3KP1 E;  4M0D A;  1XMQ M;  4M0W A;  2D7E A;  2WSC F;  3OTO M;  1TDH A;  1HNZ M;  1MU5 A;  2Y0T A;  3CF0 A;  3PXG A;  5FTM A;  1PJT A;  4Y28 F;  4LF8 M;  3QWL A;  2L7I A;  4AG6 A;  3U61 B;  3R9X B;  3VKH A;  4P16 A;  3UMM A;  2XFS A;  3FD9 A;  3KSX A;  4IBI A;  3U6P A;  1KFV A;  2EKK A;  1IXZ A;  3TWL A;  2JP7 A;  2Z7J A;  3U6E A;  3SAS A;  3W68 A;  3B7Z A;  4DR1 M;  1L8Q A;  1Z5C A;  2KEB A;  3MJ5 A;  4DR3 M;  2UUB M;  1OAO C;  4JXJ A;  2VQE M;  3H4J A;  3J7A S;  2F5Q A;  4JI1 M;  1QDR A;  3HHY A;  1G71 A;  2MR9 A;  2KHH A;  1QAN A;  3GRU A;  3HZJ A;  3LMM A;  1DO2 A;  2JNH A;  5BPV A;  3SYL A;  3GO8 A;  5EJC A;  2ZAO A;  4M9Z A;  3AOG A;  2BWE A;  3SHF A;  4LJ5 A;  1NHW C;  2QP9 X;  3VLF B;  1AUA A;  2RGH A;  5GKN A;  2BJW A;  3E4R A;  4F1I A;  2OOB A;  4QHS A;  1WIV A;  1JB0 F;  2LVO C;  2LVQ D;  4CGY B;  2L6O A;  5JI3 E;  5ITU A;  3GPU A;  5FLX S;  1V34 A;  3SAW A;  1GKI A;  1SXJ A;  3I04 M;  2UXD M;  2H5X A;  5FTN A;  2ZTC A;  3GLG A;  3B89 A;  2F5S A;  3DFZ A;  4X66 M;  1HNX M;  1N33 M;  1D0M A;  2J5Y A;  2C9O A;  4FWH A;  4Z6Y A;  1IN8 A;  1IY1 A;  1JQJ C;  5EP4 A;  4IBC A;  5EXX A;  4GKK M;  1D0L A;  2JY8 A;  2OOA A;  4LF6 M;  1E9R A;  2R62 A;  3QYE A;  3TWK A;  1W5T A;  4HLQ A;  2DAE A;  3D8B A;  4LG2 A;  3UJN A;  5EP1 A;  4PDI A;  1YE9 A;  4FVM A;  3QAU A;  4L16 A;  1IBM M;  2EJS A;  1N77 A;  1YUB A;  4QHT A;  5JI2 E;  4IBD A; 
#chains in the Genus database with same CATH homology
 4I8O A;  3HU3 A;  2Y0Q A;  1L2D A;  3RGP A;  3AOE A;  4GIP A;  4YHH M;  3W0L B;  1R6B X;  3MK6 A;  2UXB M;  1WXQ A;  1XXH B;  4B3T M;  4WW0 A;  1OFH A;  5IZ7 D;  1NY6 A;  1XMO M;  5H37 D;  5EXP A;  1IY2 A;  4GC9 A;  1NHG C;  4NRV A;  4LGY A;  3U6C A;  4AI6 A;  2V1C A;  3K92 A;  1DGB A;  1ZAE A;  2J7N A;  4LFB M;  1JR3 A;  4DR6 M;  1TGU A;  3TE6 A;  2DWZ B;  4BLC A;  4DV2 M;  1Z5A A;  1L1T A;  2DWN A;  2VQF M;  2BNK A;  4KOD A;  2UUC M;  2X4A A;  4X62 M;  3SMS A;  4ITQ A;  2CFO A;  2KRU A;  3HJQ A;  1S3S A;  1OJL A;  2I7P A;  2C9C A;  1G8P A;  5F3W A;  1XNR M;  4AG5 A;  2C99 A;  5EP3 A;  1JR3 D;  1DGG A;  3PNV A;  3L26 A;  4DV5 M;  1SXJ C;  4NSO B;  3L25 A;  4DV3 M;  3KS8 A;  3A45 A;  1LV7 A;  3U6M A;  2M5Z A;  3L27 A;  2DZN B;  3Q8X A;  2EA0 A;  1D2N A;  5ITT A;  2UXC M;  2JA2 A;  3FTF A;  1IXR C;  3PFI A;  3SHG B;  4MM3 B;  3KP0 E;  4LF7 M;  4NSR A;  2LNH C;  4IIW A;  4MGH A;  1L2B A;  3AL0 C;  4GHL A;  3KOZ E;  2HL7 A;  3HJ8 A;  3J2P B;  4D82 A;  5ITX A;  2DWM A;  4LRT A;  3GPY A;  3GPX A;  4JI4 M;  2XEP A;  2R18 A;  1X37 A;  5EQT A;  4LJ9 A;  1G59 A;  5ITX E;  2Z3X A;  4Z8X A;  3TPZ A;  3CTW B;  2YFQ A;  3IG5 A;  2VII A;  5E26 A;  3AOE C;  3FUT A;  1I94 M;  1SXJ B;  2R65 A;  3C58 A;  3HHZ A;  3I4Y A;  3A42 A;  5FTL A;  4NRW A;  1XNQ M;  3GLG B;  4RF0 A;  1R2Z A;  2FOI C;  1GVN A;  4II7 A;  1G41 A;  3ILK A;  4QNR A;  3M7G A;  5C1B A;  4LZZ A;  3NBI A;  5KPT A;  3K2L A;  2CV0 A;  4M9X A;  1W5S A;  2DZO B;  1Z6T A;  4NXN M;  5ITY A;  1MX0 A;  4K0K M;  2ZBK B;  4DUZ M;  1TH4 A;  1DGH B;  5LMU M;  1KSF X;  1ORY B;  2Y21 A;  1TH3 A;  1PM5 A;  5DYI A;  4LJ8 A;  3UGJ A;  5ITQ A;  4HL4 A;  4L4U A;  2C98 A;  4JYA M;  4AKG A;  2HHH M;  1GL7 A;  2Q2E B;  3LVV A;  3GLI A;  2FE8 A;  2LWX A;  2XH9 A;  1TDZ A;  4LJ4 A;  4AQY M;  1N32 M;  2R45 A;  4MH0 E;  3JR5 A;  4GH9 A;  5IWA M;  1VDD A;  2R4E A;  3HKP A;  2O5R A;  4GMQ A;  1IBK M;  3HHX A;  1YSY A;  3I4V A;  1G4A E;  1K3W A;  3DOA A;  1KYI A;  4LRS A;  4L78 A;  4DR5 M;  2FFJ A;  4REZ A;  4R3D A;  3K1J A;  3KXE C;  3VDP A;  4LGM A;  4LF5 M;  1SXJ E;  1IBL M;  2CHG A;  1XC8 A;  1DGF A;  3KW6 A;  3GQ4 A;  1NY5 A;  3U6O A;  4X65 M;  1G3I A;  3RFW A;  1IQP A;  5E6J A;  1HT1 E;  1SXJ D;  4NOO B;  4KO8 A;  3THG A;  2ZM6 M;  2D7G A;  2F5N A;  3TQS A;  4G4O A;  4NXM M;  4LFA M;  5FTK A;  1DGH A;  3HJS A;  2ZAM A;  2XGN A;  3HHW A;  2CEA A;  1NJG A;  3NWL A;  2CUZ A;  3SYK A;  4XGI A;  2RKO A;  2OPF A;  1NJF A;  3KVW A;  1Q3C A;  4FCW A;  4WUR A;  3U6D A;  3U5Z A;  2H1R A;  2V1U A;  1N78 A;  1C1K A;  1GLN A;  3EIE A;  2CHV A;  4LY6 A;  4DR7 M;  4OVZ B;  2R46 A;  2DXI A;  4B08 A;  3W0F A;  4DR2 M;  4IBF A;  3HU2 A;  1IN7 A;  3FKE A;  3GPP A;  8CAT A;  2CV2 A;  4L8R C;  4I81 A;  4BB9 A;  4LF9 M;  2QEN A;  1HNW M;  4OX9 M;  1IXS B;  5KPR A;  4OW0 A;  4JI3 M;  4B7H A;  1H6U A;  2YR0 A;  4MGZ E;  2YNM D;  2F5O A;  4KLN A;  4D81 A;  1IN4 A;  2LXE A;  3AV0 A;  1PJJ A;  1DO0 A;  2LH0 A;  3SFZ A;  2QBY B;  4XBO A;  4DV4 M;  3J80 S;  1PJI A;  1FNN A;  2XZF A;  3KSJ A;  3J81 S;  3SBJ A;  3UK6 A;  1Z5B A;  4LJ7 A;  3RGS A;  3SMP A;  4JI2 M;  4R7G A;  4NL4 H;  3U6L A;  4ZPX A;  4EIW A;  3GLI B;  1NNU C;  3T38 A;  3U6S A;  4G6Z A;  2BJV A;  4CIS A;  3VDU A;  4FWG A;  5EP2 A;  3KOX E;  5ITR A;  4QOS A;  3L29 A;  4LCB A;  3KOY E;  4X64 M;  3T1Y M;  3VFD A;  3U60 B;  3T15 A;  3FYC A;  4OVZ A;  4BBA A;  3A98 B;  4FW9 A;  3GQ5 A;  2J7O A;  3B9P A;  3PNY A;  4JI0 M;  1K82 A;  3SC3 A;  2P5T A;  3MHV C;  4IBB A;  4DV6 M;  4DV0 M;  1J7K A;  1Q39 A;  1QAQ A;  2KA6 B;  2OQ4 A;  2XZU A;  4FD2 A;  3KOW E;  4I5S A;  1Z59 A;  3ZC7 B;  2F5P A;  5KQD A;  4MB7 A;  4MGK E;  5IT9 S;  3L28 A;  2QBY A;  1L2C A;  1L1Z A;  2L09 A;  3T1H M;  3M0E A;  3VK8 A;  4RNA A;  3L2A A;  2ZAN A;  3GLH A;  1UM8 A;  1OFI A;  4DV1 M;  3SAU A;  1N34 M;  3IG8 A;  2A5Y B;  4GKJ M;  4TUW A;  2X8A A;  1NVM A;  2CE7 A;  1QZM A;  3FYD A;  4IJF A;  3UZU A;  4QNM A;  1EE8 A;  3J7B A;  3GLF A;  2HCB A;  3U5Z B;  3DA1 A;  4IBE A;  1J09 A;  3SAT A;  2HKJ A;  3FUW A;  1T3T A;  4LZJ A;  3GRY A;  3FUX A;  5FTJ A;  3FTC A;  3GQ3 A;  3JR4 A;  3U60 A;  2R4J A;  1XHB A;  2KZS A;  3LVW A;  1HQC A;  4RF1 A;  2CV1 A;  1N36 M;  3LQQ A;  3TWM A;  4JI6 M;  3CF6 E;  2V6Z M;  2AHM A;  3KFU G;  4B7G A;  3KS4 A;  3LQR A;  2I7N A;  3BOS A;  4AKH A;  4DUY M;  3D8L A;  3AJI B;  1QAM A;  5EXS A;  2UU9 M;  2Z4R A;  2KXE A;  3GRR A;  4LJ6 A;  4W5W A;  3FUU A;  4OU7 A;  3RE8 A;  2F4V M;  4LF4 M;  3EIH A;  4PD2 A;  1E32 A;  5DNY A;  2G5G X;  5IRE B;  3FTE A;  5EXT A;  5A2Q S;  1QQW A;  4YY3 M;  1R2Y A;  1IY0 A;  5BR8 M;  4L15 A;  4AW4 A;  1IN5 A;  4FCV A;  2Z4S A;  4G4Q A;  2W82 A;  2EUC A;  3FUV A;  3FTD A;  4M9S A;  4DV7 M;  2DWL A;  2Y20 A;  1J5E M;  2XSZ A;  2ERC A;  2UUA M;  1NNJ A;  2C96 A;  4AKI A;  2DHR A;  7CAT A;  3U61 A;  4GHA A;  3JAM S;  5C18 A;  1IM2 A;  2DVW B;  4LJA A;  1IN6 A;  3U6Q A;  2XF3 A;  1NSF A;  1QAO A;  2XSZ D;  4B7F A;  3VKG A;  4MGY E;  1QYR A;  3SAV A;  3AFH A;  4D80 A;  2E5L M;  1ZQ9 A;  3WHL A;  1K3X A;  3A46 A;  4B3M M;  4JI7 M;  2RGO A;  4JN6 A;  4MGI E;  1XWI A;  3ZH9 B;  3E9S A;  3ZCB B;  3J27 B;  2L7H A;  4KHP M;  4GRI A;  3H4M A;  5FSW A;  4JI5 M;  4PCZ A;  4CHT B;  4AZF A;  4A3V B;  3GLH B;  5KO3 A;  2FNA A;  3GRV A;  2NQ8 C;  4S12 A;  4PDG A;  2X49 A;  1HQY E;  5KQ8 A;  3GLF B;  4B3S M;  3HGI A;  3GP1 A;  2D7H A;  4B3R M;  2QPA A;  1FJG M;  5DYG A;  4IBJ A;  3HU1 A;  2CHQ A;  4FCT A;  4IBG A;  2KRK A;  2C5R A;  4PT5 A;  1R7R A;  3HWS A;  3M6A A;  4JI8 M;  3CF2 A;  1Q3B A;  4G4R A;  2XLJ A;  2G8L A;  2YQZ A;  5KPZ A;  3PVS A;  3I51 A;  1GL6 A;  4JV5 M;  1N75 A;  3KDS E;  4FWD A;  2QZ4 A;  4LFC M;  1XXH A;  2XFT A;  3TL4 X;  1TH2 A;  1HR0 M;  3DZD A;  2KW0 A;  2M60 A;  5LMN M;  4DR4 M;  3SAR A;  2EO2 A;  4GIT A;  3R8F A;  3AKZ A;  4G4N A;  1E94 E;  3VK7 A;  2QCU A;  1E9S A;  4GC5 A;  4I4L A;  3WHK A;  4QOZ C;  1I4W A;  4IJE A;  2K47 A;  4IBK A;  3K8Z A;  2KZU A;  1QVR A;  1HT2 E;  3KP1 E;  4M0D A;  1XMQ M;  4M0W A;  2D7E A;  3OTO M;  1TDH A;  1HNZ M;  1MU5 A;  2Y0T A;  3CF0 A;  3PXG A;  5FTM A;  4LF8 M;  3QWL A;  2L7I A;  4AG6 A;  3U61 B;  3R9X B;  3VKH A;  4P16 A;  3UMM A;  2XFS A;  3FD9 A;  3KSX A;  4IBI A;  3U6P A;  1KFV A;  1IXZ A;  3TWL A;  2Z7J A;  3U6E A;  3SAS A;  4DR1 M;  1L8Q A;  1Z5C A;  2KEB A;  3MJ5 A;  4DR3 M;  2UUB M;  4JXJ A;  3J7A S;  2VQE M;  2F5Q A;  4JI1 M;  3HHY A;  3LMM A;  1QAN A;  3GRU A;  1DO2 A;  5BPV A;  3SYL A;  3GO8 A;  5EJC A;  2ZAO A;  4M9Z A;  3AOG A;  3SHF A;  4LJ5 A;  1NHW C;  2QP9 X;  3VLF B;  2RGH A;  5GKN A;  2BJW A;  3E4R A;  4QHS A;  4CGY B;  2L6O A;  5JI3 E;  5ITU A;  3GPU A;  5FLX S;  3SAW A;  1GKI A;  1SXJ A;  2UXD M;  5FTN A;  3GLG A;  2F5S A;  3DFZ A;  4X66 M;  1HNX M;  1N33 M;  4FWH A;  2C9O A;  4Z6Y A;  1IN8 A;  1IY1 A;  1JQJ C;  5EP4 A;  4IBC A;  5EXX A;  4GKK M;  4LF6 M;  1E9R A;  2R62 A;  3TWK A;  1W5T A;  4HLQ A;  3D8B A;  4LG2 A;  3UJN A;  5EP1 A;  4PDI A;  1YE9 A;  4FVM A;  3QAU A;  4L16 A;  1IBM M;  1N77 A;  1YUB A;  4QHT A;  5JI2 E;  4IBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...