2DZNB

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
57
structure length
57
Chain Sequence
MSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Structural basis for the recognition between the regulatory particles Nas6 and Rpt3 of the yeast 26S proteasome
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 17
structure length 57
sequence length 57
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2006-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dznB00
4KODA 4FCWA 2Z4SA 4L4UA 1IN5A 4QOSA 5DYGA 1G41A 1NJFA 2C96A 3SYKA 1C1KA 3MHVC 2VIIA 3SYLA 1OFIA 1IN4A 3GLHA 4I4LA 1QVRA 2QPAA 3H4MA 4FWDA 1S3SA 4LJ4A 1JR3D 1NSFA 2BJWA 1KSFX 1DO0A 2CEAA 4FCTA 1SXJB 3KDSE 1SXJC 3EIHA 4LZZA 4LRSA 5EQTA 5FTJA 1NY6A 1QZMA 3U5ZB 1SXJE 4LJ7A 5EP1A 3VLFB 1UM8A 1IY2A 1IXZA 3K1JA 4FCVA 5EXPA 3R8FA 4ZPXA 4D80A 2C98A 1NVMA 3WHLA 2V1UA 4KO8A 2DZNB 2Z4RA 3D8BA 3HWSA 5EXTA 4A3VB 4LCBA 4D82A 1L8QA 4FD2A 4I81A 2BJVA 4WW0A 1E32A 1HT1E 1X37A 1JQJC 1OJLA 2DHRA 2CHVA 1FNNA 3PVSA 1XWIA 4FWGA 2ZAOA 2C9CA 1D2NA 1W5SA 3AJIB 2ZANA 2HCBA 3M0EA 3ZH9B 3BOSA 4LJ5A 5EP3A 2XSZD 4LJ6A 1R6BX 4Z8XA 1NY5A 4LJ8A 1SXJA 5FTKA 2DZOB 1NJGA 5FTMA 3GLIB 4L15A 2CHGA 5FTNA 1IQPA 4JN6A 2KRKA 4QNMA 1DO2A 2ZAMA 5DYIA 3GLIA 4EIWA 3PFIA 3EIEA 2QP9X 1IN7A 2QENA 4LY6A 1G3IA 3CF0A 1IM2A 5EXXA 3CF2A 4GITA 3PXGA 4QNRA 3WHKA 2CHQA 4QHTA 5C1BA 1E94E 3HU3A 4LJ9A 1IN8A 1JR3A 2RKOA 1IY0A 2QBYB 3GLGB 3SC3A 3GLFB 2FNAA 5EXSA 2CE7A 5EP2A 3GLFA 1XXHB 3GLGA 3KW6A 3U61B 1J7KA 1SXJD 3HU2A 1XXHA 4FWHA 3UK6A 1IN6A 4LGMA 4LRTA 5JI2E 3M6AA 2DWZB 4FW9A 3VFDA 1IY1A 2DVWB 3DZDA 2V6ZM 3GLHB 1G4AE 1OFHA 2C9OA 3HU1A 4L16A 3U60B 3B9PA 2C99A 1IXRC 4D81A 4QHSA 1IXSB 2X8AA 1LV7A 1KYIA 5EP4A 5JI3E 1W5TA 2R62A 1R7RA 2QZ4A 2R65A 2XSZA 5C18A 2QBYA 4LJAA 1HT2E 1HQCA 5FTLA 4KLNA 1HQYE
chains in the Genus database with same CATH superfamily
1PJTA 3ZCBB 2OO9A 4IBKA 1FJGM 4QOSA 3FTDA 4KT0F 3U6EA 2OQ4A 3B7QA 1C1KA 3MHVC 4I8OA 1WXQA 3TWMA 2MROB 3SYLA 1OFIA 3A46A 5ITUA 2V1CA 3HJ8A 4XK8F 2JY6B 3TWKA 3MJ5A 1NO1A 1TF0B 2BNKA 1GO5A 4F1IA 4FWDA 4LJ4A 5L8RF 1NSFA 1E9RA 2BJWA 2CP8A 2R6FA 2CEAA 2D7HA 4Q7JA 2DZLA 4LGYA 1SXJB 3RGPA 4JI3M 2E5LM 2RRUA 2DENA 4ITQA 4JI8M 1QDRA 3U5ZB 3GRRA 1SXJE 2XFSA 3VLFB 4L8RC 3FUVA 3AL0C 3K1JA 1IXZA 1YSYA 5EXPA 3U6DA 3I04M 4B3RM 3U5ZA 1PJQA 3K92A 4KO8A 2Z4RA 1Y8GA 4A3VB 2VQEM 4JYAM 3VK7A 1Q3BA 4AG5A 2DWMA 1NV9A 3F92A 1XMOM 2DI0A 1OJLA 5IZ7D 3MK6A 1C7YA 2CHVA 2O25A 2ZAOA 2KW0A 3A42A 1W5SA 5GKNA 4NXNM 3K8ZA 4XBOA 3BOSA 1T43A 4LJ5A 3ZC7B 4JV5M 3GLFE 3KXEC 4LJ8A 5KQDA 2DZOB 2MGWA 4DV4M 4L15A 4QOZC 5FTNA 1IQPA 1XXHE 5KO3A 4X62M 1DGGA 1IFYA 1L1ZA 4P16A 5ITXA 4G4OA 2WZJA 2DAEA 2Z7JA 1HNZM 2RGOA 4R71A 4B7FA 1G3IA 1GVNA 3CF0A 3KSJA 2JXNA 5EXXA 2QCUA 2LVPC 3B74A 2F5PA 1DGHB 4QNRA 1OIZA 2XZFA 4LFCM 1EE8A 3C9PA 3HU3A 4DV2M 1IN8A 2RKOA 1IY0A 4X64M 4OX9M 3QAUA 3SAWA 2F5OA 2DNAA 3AKZA 3SC3A 1AIPC 1WIVA 3HZJA 5EXSA 4HEOA 1XHBA 1XC8A 2JP7A 2DAKA 2OPFA 3U61B 1TH3A 2CUZA 1ZMVA 3FTFA 4LF8M 2DHYA 1TR8A 1VDLA 2GQFA 2JY8A 1YE9A 3HU2A 1TH4A 3GPXA 5BR8M 4DR4M 1Z5BA 2LVAA 4FWHA 3UK6A 3NBXX 2HHHM 3T6PA 4LRTA 3T38A 2G5GX 3QYEA 4G3OA 4IBCA 3DZDA 2V6ZM 3TE6A 1G4AE 2VF8A 3HU1A 4IJEA 4LZJA 4R7GA 2XLJA 3R9XB 1F4IA 1GL7A 2C99A 2LTUA 2P5TA 3KOWE 4D81A 4OVZB 2ERCA 3SHFA 4P17A 2LVOC 2XH9A 4UN2B 2JUJA 2EA0A 1I94M 3KFUG 4GC9A 3BBZA 5KPTA 2M60A 4LF6M 1R2ZA 1LV7A 3FYDA 4G4QA 1TDHA 5EP4A 5IT9S 1W5TA 4GRIA 4FVMA 1XNRM 4IBDA 5C18A 7CATA 4LJAA 2FOIC 4B08A 1R4GA 2YFQA 1N32M 2DWNA 5FTLA 1LTMA 4CHTB 4KODA 4GHAA 4DUYM 2D7EA 1D0KA 4JI1M 1G41A 1N78A 3L29A 2LVNC 3JR4A 4M0DA 4MB7A 2VIIA 2F5NA 2XFTA 4IBIA 3AOEA 4LFAM 4CJ6A 4G4NA 3Q8GA 2KNZA 5H37D 1Q39A 1KSFX 4FCTA 2KNAA 1Z5CA 4W5WA 3E4RA 1PRBA 2R4JA 1OKSA 3EIHA 1HR0M 4JI4M 1IXSA 1WGNA 5EQTA 3SMPA 4AZFA 4DR2M 2K6BA 1PGYA 3ILKA 4REZA 2J7OA 3T1HM 2MR9A 2R18A 2Y21A 4JI5M 4LJ7A 1G71A 1NHGC 2FE8A 4FCVA 3R8FA 5ITYA 4TUWA 2LBCA 4XGIA 2C98A 3MMPA 1MJGM 3J7AS 5EXTA 1IBKM 3HWSA 1L1TA 1OTRA 4IBEA 1QDTA 1K3WA 4FD2A 4I81A 4WW0A 2KA6B 1E32A 2JY5A 2KHHA 1JQJC 2G8LA 3RE8A 3OTOM 4DV3M 3CTWB 1T6OA 4FWGA 1FNNA 1XWIA 3KOYE 3C3EA 2FS1A 1MX0A 3HJQA 2H1RA 1PM5A 2J5YA 1PJJA 3FTEA 1D2NA 3AJIB 2ZANA 2AHMA 3M0EA 4PT5A 2R0IA 2XSZD 4Z8XA 2UXDM 3I4VA 3KVWA 1Z59A 1SXJA 2R4EA 2CWBA 4DR6M 2DXIA 2CHGA 3SAVA 2KRKA 3SBJA 2ZAMA 4RKUF 4M9XA 1HJPA 3CGWA 3PFIA 4LY6A 3DFZA 3FUUA 3AV0A 1NV8A 4GKKM 4GITA 3PXGA 1WJ7A 3I01M 2CHQA 3WHKA 1L2CA 4GEWA 3VDUA 1XMQM 4LJ9A 2UXBM 3M7GA 1Q02A 3GLFB 2I7PA 2CE7A 2UUCM 1ZV1A 3HHWA 2ZTCA 3FKEA 2KRUA 4GMQA 2QQ8A 3LCUA 5E26A 3GLFA 1XXHB 2XGNA 4Y28F 1GJTA 4DR7M 4NOOB 4CIZA 4NL4H 1XXHA 3A98B 1N77A 4LF5M 5E6JA 2KNVA 4LGMA 2YNMD 1ZQ9A 3L2AA 4AQYM 4GKJM 4S12A 3M6AA 3J80S 2WSCF 2APLA 2HL7A 2DWZB 3QWLA 4FW9A 2L4EA 4B7GA 3GLHB 3AOEC 2DKLA 2JNHA 3FUXA 3HY5A 4R3DA 3GLHE 2K9DA 2I7NA 2JY7A 4QHSA 3U6LA 1V92A 1DGHA 2M5ZA 4II7A 5JI3E 1L2BA 2F4VM 1YLAA 3FRHA 1QUTA 1R7RA 2QZ4A 2R62A 2XSZA 3FUTA 4HLQA 1XB2B 4JXJA 4OW0A 5FSWA 2NQ8C 2KZSA 1ZMWA 2KZUA 1HQCA 3IG5A 1JB0F 4CGYB 3GP1A 4KLNA 3DA1A 4CISA 3THGA 4FCWA 4AG6A 3U61A 3FRIA 3I51A 3K2LA 3NWLA 2FH0A 1WGLA 4X65M 3KSXA 3HHYA 4L4UA 1IN5A 3C58A 2UU9M 2VF7A 2HAKA 2K0BX 1KFVA 3HGIA 4B3TM 3SYKA 4HL4A 2CV1A 2H5XA 4NRVA 4GHLA 3U6SA 2L09A 4NRWA 4DV7M 3SAUA 1GLNA 1TDZA 4M9SA 2DAGA 1TH2A 2KEBA 2QPAA 3H4MA 1S3SA 3KOZE 3AOGA 4ANRA 2JA2A 4OVZA 4DBGB 1OAIA 1ZAEA 4IBFA 2Z3XA 2UUBM 3KDSE 1SXJC 2X49A 5IREB 4PDGA 2UXCM 4LRSA 5FTJA 1NY6A 5DFLA 5BPVA 1SG9A 3U6MA 5EP1A 1UM8A 3U6OA 1IY2A 3GPUA 5LMNM 1QANA 3RFWA 4ZPXA 4RF1A 4D80A 1NVMA 4MGHA 1G8PA 3WHLA 4BB9A 3GLIE 2DZNB 2LHGA 3D8BA 2WSFF 4MGIE 1IBLM 4JI6M 1L2DA 4LCBA 2WSEF 4D82A 3W68A 5KPZA 2C5RA 2XZUA 3IHPA 2BJVA 3CF6E 4WP2A 1PJSA 2CV0A 4IIWA 2EKFA 1D0MA 1JR3E 2OOAA 3PVSA 3LMMA 3SATA 1N33M 2MH8A 4AW4A 4JI7M 1Z6TA 1VG5A 2HCBA 2KDLA 3ZH9B 4DR1M 2D7GA 2LHCA 4LJ6A 4M0WA 3GLGE 4MH0E 5FTKA 1MU5A 4DV1M 3E21A 1WR1B 4YY3M 4G6ZA 3GRUA 3IECA 4QNMA 1BVSA 3GPPA 4MGYE 3FD9A 2G3QA 4X66M 3C3DA 2QP9X 3SFZA 1IN7A 2QENA 1I4WA 2F5SA 4Z6YA 2LVQD 2YQZA 1TTEA 1IM2A 3T15A 2QHOB 3JR5A 2A5YB 3K9PA 3LVVA 4MGKE 3W0FA 4BBAA 4LF7M 2LH0A 3W0LB 3UJNA 1E94E 3GRVA 4NC6A 2QBYB 1DGFA 2Y0QA 2L7IA 5F3WA 1HNXM 3TWLA 1VDDA 3HKPA 3PNVA 3J27B 1OQYA 2L4FA 3TPZA 1GJSA 5EP2A 1IBMM 2XF3A 3KW6A 2K47A 2LNHC 1E9SA 1CUKA 2Z8YM 4NSOB 3VK8A 3FE3A 1IN6A 4LF4M 3UGJA 4DUZM 4I5SA 5JI2E 2HKJA 3HX3A 4IBBA 1QQWA 3UZUA 3SASA 3VFDA 2VQFM 2DVWB 2LWXA 1OFHA 4L16A 3QYBA 4PCZA 3LQQA 3TQSA 5FLXS 1IXRC 3TL4X 3W67A 3VKHA 3UMMA 1V34A 2JWSA 3U6QA 4DR3M 4L6V6 4DV5M 3BXWA 3IG8A 2O5RA 3FUWA 1EFUB 1K82A 4KHPM 2ZBKB 1V33A 1N34M 1XNQM 4LFBM 1QZEA 4JI2M 2L2DA 3GRYA 2Z4SA 1N36M 3ZQJA 1P3QQ 5DYGA 2B3TA 3KS4A 1J09A 1NJFA 2C96A 1GL6A 1WHCA 1DGBA 5IWAM 3B89A 4M9ZA 1IN4A 1NHWC 3D8LA 1A5TA 1QAQA 2EUCA 3GLHA 4I4LA 1QVRA 2MJ5B 3HHXA 1AUAA 2RGHA 3KP1E 5KPRA 3E9SA 1JR3D 5ITQA 1DO0A 3JAMS 2DAMA 4AKGA 3Q8XA 1R5LA 4NXMM 4LZZA 2BWEA 2CRUA 2Y0TA 2L7HA 2EKKA 2OOBA 3L26A 2JZ0A 4AKHA 1QZMA 4IBGA 2QNJA 4L78A 3HHZA 4B3MM 1YUBA 4GC5A 1NNJA 4YHHM 4NSRA 3SARA 3GPYA 3H4JA 4AI6A 5ITXE 2FFJA 2L6OA 3GQ5A 2V1UA 3I4YA 3KP0E 1ZMUA 1DV0A 1L8QA 2QSFX 4WURA 2N35A 1HT1E 1VEKA 2HWJA 1X37A 1NNUC 2DHRA 2Y20A 4MGZE 4F2LA 1H6UA 1MN3A 2C9CA 2R44A 1K3XA 3KS8A 2UUAM 2YR0A 5EP3A 1QYRA 1R6BX 2GNOA 2J7NA 1NY5A 4DV6M 1Z5AA 3K9OA 1NJGA 5FTMA 3NBIA 2CFOA 3GLIB 5LMUM 3V76A 1GKIA 4JN6A 4MM3B 5DYIA 1DO2A 3B7ZA 1PJIA 2KXEA 4IJFA 3J81S 4EIWA 3GLIA 3B7NA 2EO2A 3EIEA 1D0LA 3J2PB 2DWLA 2JZ1A 3RGSA 2ZM6M 3A45A 1VQ1A 2F5QA 4DR5M 2R46A 3CF2A 3LQRA 2EJSA 4AKIA 1QAOA 4QHTA 1QAMA 2BWBA 5C1BA 3SHGB 1G59A 3L25A 1JR3A 3FTCA 3U6PA 3U6CA 1ORYB 2X4AA 4RNAA 3GLGB 1OAOC 2FNAA 5A2QS 4DV0M 4B7HA 3GLGA 2W82A 1T3TA 4PD2A 1J7KA 2XEPA 5ITRA 1SXJD 2ZTDA 3AFHA 3GQ4A 1VEJA 2CV2A 4GH9A 3FYCA 1R2YA 3VKGA 3DOAA 1OIPA 3GQ3A 4K0KM 1QUSA 4OU7A 5EJCA 4PDIA 1GABA 1IY1A 2VDBB 1VEGA 1Q3CA 2C9OA 2R45A 3U60B 3T1YM 3B9PA 4IBJA 1HNWM 1TGUA 3E46A 1N75A 4G4RA 3VDPA 4B3SM 3U60A 3HJSA 3L28A 5ITTA 2DAIA 3J7BA 3PNYA 3GO8A 4BLCA 1IXSB 1RU3A 2X8AA 1KYIA 2O01F 4LF9M 8CATA 1UFZA 3LW5F 1J5EM 4GIPA 2R65A 4LG2A 2QBYA 3LVWA 3L27A 1HT2E 3KOXE 5KQ8A 5DNYA 4RF0A 3LCVB 2LXEA 1EIJA 2Q2EB 3SMSA 4JI0M 1HQYE
chains in the Genus database with same CATH topology
3ZCBB 4IBKA 1FJGM 4QOSA 3FTDA 3U6EA 2OQ4A 1C1KA 3MHVC 4I8OA 1WXQA 3TWMA 3SYLA 1OFIA 3A46A 5ITUA 2V1CA 3HJ8A 3TWKA 3MJ5A 2BNKA 4FWDA 4LJ4A 1NSFA 1E9RA 2BJWA 2CEAA 2D7HA 3RGPA 4LGYA 1SXJB 4JI3M 2E5LM 4ITQA 4JI8M 3U5ZB 3GRRA 1SXJE 2XFSA 3VLFB 4L8RC 3FUVA 3AL0C 3K1JA 1IXZA 1YSYA 5EXPA 3U6DA 4B3RM 3U5ZA 3K92A 4KO8A 2Z4RA 2VQEM 4A3VB 4JYAM 3VK7A 1Q3BA 4AG5A 2DWMA 1XMOM 5IZ7D 1OJLA 3MK6A 2CHVA 2ZAOA 2KW0A 3A42A 1W5SA 5GKNA 4NXNM 3K8ZA 4XBOA 3BOSA 4LJ5A 3ZC7B 4JV5M 3KXEC 4LJ8A 5KQDA 2DZOB 4DV4M 4L15A 4QOZC 5FTNA 1IQPA 5KO3A 4X62M 1DGGA 1L1ZA 4P16A 5ITXA 4G4OA 1HNZM 2Z7JA 2RGOA 4B7FA 1G3IA 1GVNA 3CF0A 3KSJA 5EXXA 2QCUA 2F5PA 1DGHB 4QNRA 2XZFA 4LFCM 1EE8A 3HU3A 1IN8A 2RKOA 1IY0A 4X64M 4OX9M 3QAUA 3SAWA 2F5OA 3AKZA 3SC3A 5EXSA 1XC8A 1XHBA 2OPFA 3U61B 1TH3A 2CUZA 3FTFA 4LF8M 3GPXA 1YE9A 3HU2A 1TH4A 4DR4M 5BR8M 1Z5BA 4FWHA 3UK6A 2HHHM 4LRTA 3T38A 2G5GX 4IBCA 3DZDA 2V6ZM 3TE6A 1G4AE 4IJEA 3HU1A 4LZJA 2XLJA 4R7GA 3R9XB 1GL7A 2C99A 3KOWE 2P5TA 4D81A 4OVZB 2ERCA 3SHFA 2XH9A 2EA0A 1I94M 3KFUG 4GC9A 5KPTA 2M60A 4LF6M 1R2ZA 1LV7A 3FYDA 4G4QA 1TDHA 5EP4A 5IT9S 1W5TA 4GRIA 4FVMA 1XNRM 4IBDA 5C18A 7CATA 4LJAA 2FOIC 4B08A 2YFQA 1N32M 2DWNA 5FTLA 4CHTB 4KODA 4GHAA 4DUYM 2D7EA 4JI1M 1G41A 1N78A 3L29A 3JR4A 4M0DA 4MB7A 2VIIA 2F5NA 2XFTA 4IBIA 3AOEA 4LFAM 4G4NA 5H37D 1Q39A 1KSFX 4FCTA 4W5WA 1Z5CA 3E4RA 2R4JA 3EIHA 1HR0M 4JI4M 5EQTA 4AZFA 3SMPA 4DR2M 3ILKA 4REZA 3T1HM 2J7OA 4JI5M 2Y21A 2R18A 4LJ7A 1NHGC 2FE8A 4FCVA 3R8FA 5ITYA 4TUWA 4XGIA 2C98A 3J7AS 5EXTA 1IBKM 3HWSA 1L1TA 4IBEA 1K3WA 4FD2A 4I81A 4WW0A 2KA6B 1E32A 3OTOM 1JQJC 2G8LA 3RE8A 4DV3M 3CTWB 4FWGA 1FNNA 1XWIA 3KOYE 3HJQA 1MX0A 1PM5A 2H1RA 1PJJA 3FTEA 1D2NA 3AJIB 2ZANA 2AHMA 3M0EA 4PT5A 2XSZD 4Z8XA 2UXDM 3I4VA 3KVWA 1Z59A 1SXJA 2R4EA 4DR6M 2DXIA 2CHGA 3SAVA 2KRKA 3SBJA 2ZAMA 4M9XA 3PFIA 4LY6A 3DFZA 3FUUA 3AV0A 4GKKM 4GITA 3PXGA 3WHKA 2CHQA 1L2CA 3VDUA 1XMQM 4LJ9A 2UXBM 3M7GA 3GLFB 2I7PA 2CE7A 2UUCM 3HHWA 3FKEA 2KRUA 4GMQA 5E26A 3GLFA 1XXHB 2XGNA 4DR7M 4NOOB 4NL4H 1XXHA 3A98B 1N77A 4LF5M 5E6JA 4LGMA 2YNMD 1ZQ9A 3L2AA 4AQYM 4GKJM 4S12A 3M6AA 3J80S 2HL7A 2DWZB 3QWLA 4FW9A 4B7GA 3GLHB 3AOEC 3FUXA 4R3DA 2I7NA 4QHSA 3U6LA 1DGHA 2M5ZA 4II7A 5JI3E 1L2BA 2F4VM 2R62A 1R7RA 2QZ4A 2XSZA 3FUTA 4HLQA 4JXJA 4OW0A 5FSWA 2NQ8C 2KZSA 2KZUA 3IG5A 1HQCA 4CGYB 3GP1A 4KLNA 3DA1A 4CISA 3THGA 4FCWA 4AG6A 3U61A 4DV2M 3I51A 3K2LA 3NWLA 4X65M 3KSXA 3HHYA 4L4UA 1IN5A 3C58A 2UU9M 4B3TM 1KFVA 3HGIA 3SYKA 4HL4A 2CV1A 4NRVA 4GHLA 3U6SA 2L09A 4NRWA 4DV7M 3SAUA 1GLNA 1TDZA 4M9SA 1TH2A 2KEBA 2QPAA 3H4MA 1S3SA 3KOZE 3AOGA 2JA2A 4OVZA 1ZAEA 4IBFA 2Z3XA 2UUBM 3KDSE 1SXJC 2X49A 5IREB 4PDGA 2UXCM 4LRSA 5FTJA 1NY6A 5BPVA 3U6MA 5EP1A 1UM8A 3U6OA 1IY2A 3GPUA 5LMNM 1QANA 3RFWA 4ZPXA 4RF1A 4D80A 1NVMA 4MGHA 1G8PA 3WHLA 4BB9A 2DZNB 4MGIE 3D8BA 4JI6M 1IBLM 1L2DA 4LCBA 4D82A 5KPZA 2C5RA 2XZUA 2BJVA 3CF6E 2CV0A 4IIWA 3PVSA 3SATA 3LMMA 1N33M 4AW4A 4JI7M 1Z6TA 2HCBA 3ZH9B 4DR1M 2D7GA 4LJ6A 4M0WA 4MH0E 5FTKA 1MU5A 4DV1M 4YY3M 4G6ZA 3GRUA 4QNMA 3GPPA 4MGYE 3FD9A 4X66M 2QP9X 3SFZA 1IN7A 2QENA 1I4WA 2F5SA 4Z6YA 2YQZA 3T15A 1IM2A 3JR5A 2A5YB 3LVVA 4MGKE 3W0FA 4BBAA 4LF7M 2LH0A 3W0LB 3UJNA 1E94E 3GRVA 2QBYB 1DGFA 2Y0QA 2L7IA 5F3WA 1HNXM 3TWLA 1VDDA 3HKPA 3PNVA 3J27B 3TPZA 5EP2A 1IBMM 2XF3A 3KW6A 2K47A 2LNHC 1E9SA 4NSOB 3VK8A 1IN6A 4LF4M 3UGJA 4DUZM 4I5SA 5JI2E 2HKJA 4IBBA 1QQWA 3UZUA 3SASA 3VFDA 2VQFM 2DVWB 2LWXA 1OFHA 4L16A 4PCZA 3LQQA 3TQSA 5FLXS 1IXRC 3TL4X 3VKHA 3UMMA 3U6QA 4DR3M 4DV5M 3IG8A 2O5RA 3FUWA 4KHPM 1K82A 2ZBKB 1N34M 1XNQM 4LFBM 4JI2M 3GRYA 2Z4SA 1N36M 5DYGA 3KS4A 1J09A 1NJFA 2C96A 1GL6A 1DGBA 5IWAM 4M9ZA 1IN4A 1NHWC 3D8LA 1QAQA 2EUCA 3GLHA 4I4LA 1QVRA 3KP1E 3HHXA 5KPRA 2RGHA 3E9SA 1JR3D 5ITQA 1DO0A 3JAMS 4AKGA 3Q8XA 4NXMM 4LZZA 2Y0TA 3L26A 2L7HA 4AKHA 1QZMA 4IBGA 4L78A 3HHZA 4B3MM 1YUBA 4GC5A 1NNJA 4YHHM 4NSRA 3SARA 3GPYA 4AI6A 5ITXE 2FFJA 2L6OA 3GQ5A 2V1UA 3I4YA 3KP0E 1L8QA 4WURA 1HT1E 1X37A 1NNUC 2DHRA 2Y20A 4MGZE 1H6UA 2C9CA 1K3XA 3KS8A 2UUAM 2YR0A 5EP3A 1QYRA 1R6BX 2J7NA 1NY5A 4DV6M 1Z5AA 1NJGA 5FTMA 3NBIA 2CFOA 3GLIB 5LMUM 1GKIA 4JN6A 4MM3B 5DYIA 1DO2A 1PJIA 2KXEA 4IJFA 3J81S 4EIWA 3GLIA 2EO2A 3EIEA 3J2PB 2DWLA 3RGSA 2ZM6M 3A45A 2F5QA 4DR5M 2R46A 3CF2A 3LQRA 4AKIA 1QAOA 4QHTA 1QAMA 5C1BA 3L25A 3SHGB 1G59A 1JR3A 3FTCA 3U6PA 3U6CA 1ORYB 2X4AA 4RNAA 3GLGB 2FNAA 5A2QS 4DV0M 4B7HA 3GLGA 2W82A 1T3TA 4PD2A 1J7KA 2XEPA 5ITRA 1SXJD 3AFHA 3GQ4A 2CV2A 4GH9A 3FYCA 1R2YA 3VKGA 3DOAA 3GQ3A 4K0KM 4OU7A 5EJCA 4PDIA 1IY1A 2C9OA 1Q3CA 2R45A 3U60B 3T1YM 3B9PA 4IBJA 1HNWM 1TGUA 1N75A 4G4RA 3VDPA 4B3SM 3U60A 3HJSA 3L28A 5ITTA 3J7BA 3PNYA 3GO8A 4BLCA 1IXSB 2X8AA 1KYIA 4LF9M 8CATA 1J5EM 4GIPA 2R65A 4LG2A 2QBYA 3LVWA 3L27A 1HT2E 3KOXE 5KQ8A 5DNYA 4RF0A 2LXEA 2Q2EB 3SMSA 4JI0M 1HQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOD A;  4FCW A;  2Z4S A;  4L4U A;  1IN5 A;  4QOS A;  5DYG A;  1G41 A;  1NJF A;  2C96 A;  3SYK A;  1C1K A;  3MHV C;  2VII A;  3SYL A;  1OFI A;  1IN4 A;  3GLH A;  4I4L A;  1QVR A;  2QPA A;  3H4M A;  4FWD A;  1S3S A;  4LJ4 A;  1JR3 D;  1NSF A;  2BJW A;  1KSF X;  1DO0 A;  2CEA A;  4FCT A;  1SXJ B;  3KDS E;  1SXJ C;  3EIH A;  4LZZ A;  4LRS A;  5EQT A;  5FTJ A;  1NY6 A;  1QZM A;  3U5Z B;  1SXJ E;  4LJ7 A;  5EP1 A;  3VLF B;  1UM8 A;  1IY2 A;  1IXZ A;  3K1J A;  4FCV A;  5EXP A;  3R8F A;  4ZPX A;  4D80 A;  2C98 A;  1NVM A;  3WHL A;  2V1U A;  4KO8 A;  2DZN B;  2Z4R A;  3D8B A;  3HWS A;  5EXT A;  4A3V B;  4LCB A;  4D82 A;  1L8Q A;  4FD2 A;  4I81 A;  2BJV A;  4WW0 A;  1E32 A;  1HT1 E;  1X37 A;  1JQJ C;  1OJL A;  2DHR A;  2CHV A;  1FNN A;  3PVS A;  1XWI A;  4FWG A;  2ZAO A;  2C9C A;  1D2N A;  1W5S A;  3AJI B;  2ZAN A;  2HCB A;  3M0E A;  3ZH9 B;  3BOS A;  4LJ5 A;  5EP3 A;  2XSZ D;  4LJ6 A;  1R6B X;  4Z8X A;  1NY5 A;  4LJ8 A;  1SXJ A;  5FTK A;  2DZO B;  1NJG A;  5FTM A;  3GLI B;  4L15 A;  2CHG A;  5FTN A;  1IQP A;  4JN6 A;  2KRK A;  4QNM A;  1DO2 A;  2ZAM A;  5DYI A;  3GLI A;  4EIW A;  3PFI A;  3EIE A;  2QP9 X;  1IN7 A;  2QEN A;  4LY6 A;  1G3I A;  3CF0 A;  1IM2 A;  5EXX A;  3CF2 A;  4GIT A;  3PXG A;  4QNR A;  3WHK A;  2CHQ A;  4QHT A;  5C1B A;  1E94 E;  3HU3 A;  4LJ9 A;  1IN8 A;  1JR3 A;  2RKO A;  1IY0 A;  2QBY B;  3GLG B;  3SC3 A;  3GLF B;  2FNA A;  5EXS A;  2CE7 A;  5EP2 A;  3GLF A;  1XXH B;  3GLG A;  3KW6 A;  3U61 B;  1J7K A;  1SXJ D;  3HU2 A;  1XXH A;  4FWH A;  3UK6 A;  1IN6 A;  4LGM A;  4LRT A;  5JI2 E;  3M6A A;  2DWZ B;  4FW9 A;  3VFD A;  1IY1 A;  2DVW B;  3DZD A;  2V6Z M;  3GLH B;  1G4A E;  1OFH A;  2C9O A;  3HU1 A;  4L16 A;  3U60 B;  3B9P A;  2C99 A;  1IXR C;  4D81 A;  4QHS A;  1IXS B;  2X8A A;  1LV7 A;  1KYI A;  5EP4 A;  5JI3 E;  1W5T A;  2R62 A;  1R7R A;  2QZ4 A;  2R65 A;  2XSZ A;  5C18 A;  2QBY A;  4LJA A;  1HT2 E;  1HQC A;  5FTL A;  4KLN A;  1HQY E; 
#chains in the Genus database with same CATH topology
 1PJT A;  3ZCB B;  2OO9 A;  4IBK A;  1FJG M;  4QOS A;  3FTD A;  4KT0 F;  3U6E A;  2OQ4 A;  3B7Q A;  1C1K A;  3MHV C;  4I8O A;  1WXQ A;  3TWM A;  2MRO B;  3SYL A;  1OFI A;  3A46 A;  5ITU A;  2V1C A;  3HJ8 A;  4XK8 F;  2JY6 B;  3TWK A;  3MJ5 A;  1NO1 A;  1TF0 B;  2BNK A;  1GO5 A;  4F1I A;  4FWD A;  4LJ4 A;  5L8R F;  1NSF A;  1E9R A;  2BJW A;  2CP8 A;  2R6F A;  2CEA A;  2D7H A;  4Q7J A;  2DZL A;  4LGY A;  1SXJ B;  3RGP A;  4JI3 M;  2E5L M;  2RRU A;  2DEN A;  4ITQ A;  4JI8 M;  1QDR A;  3U5Z B;  3GRR A;  1SXJ E;  2XFS A;  3VLF B;  4L8R C;  3FUV A;  3AL0 C;  3K1J A;  1IXZ A;  1YSY A;  5EXP A;  3U6D A;  3I04 M;  4B3R M;  3U5Z A;  1PJQ A;  3K92 A;  4KO8 A;  2Z4R A;  1Y8G A;  4A3V B;  2VQE M;  4JYA M;  3VK7 A;  1Q3B A;  4AG5 A;  2DWM A;  1NV9 A;  3F92 A;  1XMO M;  2DI0 A;  1OJL A;  5IZ7 D;  3MK6 A;  1C7Y A;  2CHV A;  2O25 A;  2ZAO A;  2KW0 A;  3A42 A;  1W5S A;  5GKN A;  4NXN M;  3K8Z A;  4XBO A;  3BOS A;  1T43 A;  4LJ5 A;  3ZC7 B;  4JV5 M;  3GLF E;  3KXE C;  4LJ8 A;  5KQD A;  2DZO B;  2MGW A;  4DV4 M;  4L15 A;  4QOZ C;  5FTN A;  1IQP A;  1XXH E;  5KO3 A;  4X62 M;  1DGG A;  1IFY A;  1L1Z A;  4P16 A;  5ITX A;  4G4O A;  2WZJ A;  2DAE A;  2Z7J A;  1HNZ M;  2RGO A;  4R71 A;  4B7F A;  1G3I A;  1GVN A;  3CF0 A;  3KSJ A;  2JXN A;  5EXX A;  2QCU A;  2LVP C;  3B74 A;  2F5P A;  1DGH B;  4QNR A;  1OIZ A;  2XZF A;  4LFC M;  1EE8 A;  3C9P A;  3HU3 A;  4DV2 M;  1IN8 A;  2RKO A;  1IY0 A;  4X64 M;  4OX9 M;  3QAU A;  3SAW A;  2F5O A;  2DNA A;  3AKZ A;  3SC3 A;  1AIP C;  1WIV A;  3HZJ A;  5EXS A;  4HEO A;  1XHB A;  1XC8 A;  2JP7 A;  2DAK A;  2OPF A;  3U61 B;  1TH3 A;  2CUZ A;  1ZMV A;  3FTF A;  4LF8 M;  2DHY A;  1TR8 A;  1VDL A;  2GQF A;  2JY8 A;  1YE9 A;  3HU2 A;  1TH4 A;  3GPX A;  5BR8 M;  4DR4 M;  1Z5B A;  2LVA A;  4FWH A;  3UK6 A;  3NBX X;  2HHH M;  3T6P A;  4LRT A;  3T38 A;  2G5G X;  3QYE A;  4G3O A;  4IBC A;  3DZD A;  2V6Z M;  3TE6 A;  1G4A E;  2VF8 A;  3HU1 A;  4IJE A;  4LZJ A;  4R7G A;  2XLJ A;  3R9X B;  1F4I A;  1GL7 A;  2C99 A;  2LTU A;  2P5T A;  3KOW E;  4D81 A;  4OVZ B;  2ERC A;  3SHF A;  4P17 A;  2LVO C;  2XH9 A;  4UN2 B;  2JUJ A;  2EA0 A;  1I94 M;  3KFU G;  4GC9 A;  3BBZ A;  5KPT A;  2M60 A;  4LF6 M;  1R2Z A;  1LV7 A;  3FYD A;  4G4Q A;  1TDH A;  5EP4 A;  5IT9 S;  1W5T A;  4GRI A;  4FVM A;  1XNR M;  4IBD A;  5C18 A;  7CAT A;  4LJA A;  2FOI C;  4B08 A;  1R4G A;  2YFQ A;  1N32 M;  2DWN A;  5FTL A;  1LTM A;  4CHT B;  4KOD A;  4GHA A;  4DUY M;  2D7E A;  1D0K A;  4JI1 M;  1G41 A;  1N78 A;  3L29 A;  2LVN C;  3JR4 A;  4M0D A;  4MB7 A;  2VII A;  2F5N A;  2XFT A;  4IBI A;  3AOE A;  4LFA M;  4CJ6 A;  4G4N A;  3Q8G A;  2KNZ A;  5H37 D;  1Q39 A;  1KSF X;  4FCT A;  2KNA A;  1Z5C A;  4W5W A;  3E4R A;  1PRB A;  2R4J A;  1OKS A;  3EIH A;  1HR0 M;  4JI4 M;  1IXS A;  1WGN A;  5EQT A;  3SMP A;  4AZF A;  4DR2 M;  2K6B A;  1PGY A;  3ILK A;  4REZ A;  2J7O A;  3T1H M;  2MR9 A;  2R18 A;  2Y21 A;  4JI5 M;  4LJ7 A;  1G71 A;  1NHG C;  2FE8 A;  4FCV A;  3R8F A;  5ITY A;  4TUW A;  2LBC A;  4XGI A;  2C98 A;  3MMP A;  1MJG M;  3J7A S;  5EXT A;  1IBK M;  3HWS A;  1L1T A;  1OTR A;  4IBE A;  1QDT A;  1K3W A;  4FD2 A;  4I81 A;  4WW0 A;  2KA6 B;  1E32 A;  2JY5 A;  2KHH A;  1JQJ C;  2G8L A;  3RE8 A;  3OTO M;  4DV3 M;  3CTW B;  1T6O A;  4FWG A;  1FNN A;  1XWI A;  3KOY E;  3C3E A;  2FS1 A;  1MX0 A;  3HJQ A;  2H1R A;  1PM5 A;  2J5Y A;  1PJJ A;  3FTE A;  1D2N A;  3AJI B;  2ZAN A;  2AHM A;  3M0E A;  4PT5 A;  2R0I A;  2XSZ D;  4Z8X A;  2UXD M;  3I4V A;  3KVW A;  1Z59 A;  1SXJ A;  2R4E A;  2CWB A;  4DR6 M;  2DXI A;  2CHG A;  3SAV A;  2KRK A;  3SBJ A;  2ZAM A;  4RKU F;  4M9X A;  1HJP A;  3CGW A;  3PFI A;  4LY6 A;  3DFZ A;  3FUU A;  3AV0 A;  1NV8 A;  4GKK M;  4GIT A;  3PXG A;  1WJ7 A;  3I01 M;  2CHQ A;  3WHK A;  1L2C A;  4GEW A;  3VDU A;  1XMQ M;  4LJ9 A;  2UXB M;  3M7G A;  1Q02 A;  3GLF B;  2I7P A;  2CE7 A;  2UUC M;  1ZV1 A;  3HHW A;  2ZTC A;  3FKE A;  2KRU A;  4GMQ A;  2QQ8 A;  3LCU A;  5E26 A;  3GLF A;  1XXH B;  2XGN A;  4Y28 F;  1GJT A;  4DR7 M;  4NOO B;  4CIZ A;  4NL4 H;  1XXH A;  3A98 B;  1N77 A;  4LF5 M;  5E6J A;  2KNV A;  4LGM A;  2YNM D;  1ZQ9 A;  3L2A A;  4AQY M;  4GKJ M;  4S12 A;  3M6A A;  3J80 S;  2WSC F;  2APL A;  2HL7 A;  2DWZ B;  3QWL A;  4FW9 A;  2L4E A;  4B7G A;  3GLH B;  3AOE C;  2DKL A;  2JNH A;  3FUX A;  3HY5 A;  4R3D A;  3GLH E;  2K9D A;  2I7N A;  2JY7 A;  4QHS A;  3U6L A;  1V92 A;  1DGH A;  2M5Z A;  4II7 A;  5JI3 E;  1L2B A;  2F4V M;  1YLA A;  3FRH A;  1QUT A;  1R7R A;  2QZ4 A;  2R62 A;  2XSZ A;  3FUT A;  4HLQ A;  1XB2 B;  4JXJ A;  4OW0 A;  5FSW A;  2NQ8 C;  2KZS A;  1ZMW A;  2KZU A;  1HQC A;  3IG5 A;  1JB0 F;  4CGY B;  3GP1 A;  4KLN A;  3DA1 A;  4CIS A;  3THG A;  4FCW A;  4AG6 A;  3U61 A;  3FRI A;  3I51 A;  3K2L A;  3NWL A;  2FH0 A;  1WGL A;  4X65 M;  3KSX A;  3HHY A;  4L4U A;  1IN5 A;  3C58 A;  2UU9 M;  2VF7 A;  2HAK A;  2K0B X;  1KFV A;  3HGI A;  4B3T M;  3SYK A;  4HL4 A;  2CV1 A;  2H5X A;  4NRV A;  4GHL A;  3U6S A;  2L09 A;  4NRW A;  4DV7 M;  3SAU A;  1GLN A;  1TDZ A;  4M9S A;  2DAG A;  1TH2 A;  2KEB A;  2QPA A;  3H4M A;  1S3S A;  3KOZ E;  3AOG A;  4ANR A;  2JA2 A;  4OVZ A;  4DBG B;  1OAI A;  1ZAE A;  4IBF A;  2Z3X A;  2UUB M;  3KDS E;  1SXJ C;  2X49 A;  5IRE B;  4PDG A;  2UXC M;  4LRS A;  5FTJ A;  1NY6 A;  5DFL A;  5BPV A;  1SG9 A;  3U6M A;  5EP1 A;  1UM8 A;  3U6O A;  1IY2 A;  3GPU A;  5LMN M;  1QAN A;  3RFW A;  4ZPX A;  4RF1 A;  4D80 A;  1NVM A;  4MGH A;  1G8P A;  3WHL A;  4BB9 A;  3GLI E;  2DZN B;  2LHG A;  3D8B A;  2WSF F;  4MGI E;  1IBL M;  4JI6 M;  1L2D A;  4LCB A;  2WSE F;  4D82 A;  3W68 A;  5KPZ A;  2C5R A;  2XZU A;  3IHP A;  2BJV A;  3CF6 E;  4WP2 A;  1PJS A;  2CV0 A;  4IIW A;  2EKF A;  1D0M A;  1JR3 E;  2OOA A;  3PVS A;  3LMM A;  3SAT A;  1N33 M;  2MH8 A;  4AW4 A;  4JI7 M;  1Z6T A;  1VG5 A;  2HCB A;  2KDL A;  3ZH9 B;  4DR1 M;  2D7G A;  2LHC A;  4LJ6 A;  4M0W A;  3GLG E;  4MH0 E;  5FTK A;  1MU5 A;  4DV1 M;  3E21 A;  1WR1 B;  4YY3 M;  4G6Z A;  3GRU A;  3IEC A;  4QNM A;  1BVS A;  3GPP A;  4MGY E;  3FD9 A;  2G3Q A;  4X66 M;  3C3D A;  2QP9 X;  3SFZ A;  1IN7 A;  2QEN A;  1I4W A;  2F5S A;  4Z6Y A;  2LVQ D;  2YQZ A;  1TTE A;  1IM2 A;  3T15 A;  2QHO B;  3JR5 A;  2A5Y B;  3K9P A;  3LVV A;  4MGK E;  3W0F A;  4BBA A;  4LF7 M;  2LH0 A;  3W0L B;  3UJN A;  1E94 E;  3GRV A;  4NC6 A;  2QBY B;  1DGF A;  2Y0Q A;  2L7I A;  5F3W A;  1HNX M;  3TWL A;  1VDD A;  3HKP A;  3PNV A;  3J27 B;  1OQY A;  2L4F A;  3TPZ A;  1GJS A;  5EP2 A;  1IBM M;  2XF3 A;  3KW6 A;  2K47 A;  2LNH C;  1E9S A;  1CUK A;  2Z8Y M;  4NSO B;  3VK8 A;  3FE3 A;  1IN6 A;  4LF4 M;  3UGJ A;  4DUZ M;  4I5S A;  5JI2 E;  2HKJ A;  3HX3 A;  4IBB A;  1QQW A;  3UZU A;  3SAS A;  3VFD A;  2VQF M;  2DVW B;  2LWX A;  1OFH A;  4L16 A;  3QYB A;  4PCZ A;  3LQQ A;  3TQS A;  5FLX S;  1IXR C;  3TL4 X;  3W67 A;  3VKH A;  3UMM A;  1V34 A;  2JWS A;  3U6Q A;  4DR3 M;  4L6V 6;  4DV5 M;  3BXW A;  3IG8 A;  2O5R A;  3FUW A;  1EFU B;  1K82 A;  4KHP M;  2ZBK B;  1V33 A;  1N34 M;  1XNQ M;  4LFB M;  1QZE A;  4JI2 M;  2L2D A;  3GRY A;  2Z4S A;  1N36 M;  3ZQJ A;  1P3Q Q;  5DYG A;  2B3T A;  3KS4 A;  1J09 A;  1NJF A;  2C96 A;  1GL6 A;  1WHC A;  1DGB A;  5IWA M;  3B89 A;  4M9Z A;  1IN4 A;  1NHW C;  3D8L A;  1A5T A;  1QAQ A;  2EUC A;  3GLH A;  4I4L A;  1QVR A;  2MJ5 B;  3HHX A;  1AUA A;  2RGH A;  3KP1 E;  5KPR A;  3E9S A;  1JR3 D;  5ITQ A;  1DO0 A;  3JAM S;  2DAM A;  4AKG A;  3Q8X A;  1R5L A;  4NXM M;  4LZZ A;  2BWE A;  2CRU A;  2Y0T A;  2L7H A;  2EKK A;  2OOB A;  3L26 A;  2JZ0 A;  4AKH A;  1QZM A;  4IBG A;  2QNJ A;  4L78 A;  3HHZ A;  4B3M M;  1YUB A;  4GC5 A;  1NNJ A;  4YHH M;  4NSR A;  3SAR A;  3GPY A;  3H4J A;  4AI6 A;  5ITX E;  2FFJ A;  2L6O A;  3GQ5 A;  2V1U A;  3I4Y A;  3KP0 E;  1ZMU A;  1DV0 A;  1L8Q A;  2QSF X;  4WUR A;  2N35 A;  1HT1 E;  1VEK A;  2HWJ A;  1X37 A;  1NNU C;  2DHR A;  2Y20 A;  4MGZ E;  4F2L A;  1H6U A;  1MN3 A;  2C9C A;  2R44 A;  1K3X A;  3KS8 A;  2UUA M;  2YR0 A;  5EP3 A;  1QYR A;  1R6B X;  2GNO A;  2J7N A;  1NY5 A;  4DV6 M;  1Z5A A;  3K9O A;  1NJG A;  5FTM A;  3NBI A;  2CFO A;  3GLI B;  5LMU M;  3V76 A;  1GKI A;  4JN6 A;  4MM3 B;  5DYI A;  1DO2 A;  3B7Z A;  1PJI A;  2KXE A;  4IJF A;  3J81 S;  4EIW A;  3GLI A;  3B7N A;  2EO2 A;  3EIE A;  1D0L A;  3J2P B;  2DWL A;  2JZ1 A;  3RGS A;  2ZM6 M;  3A45 A;  1VQ1 A;  2F5Q A;  4DR5 M;  2R46 A;  3CF2 A;  3LQR A;  2EJS A;  4AKI A;  1QAO A;  4QHT A;  1QAM A;  2BWB A;  5C1B A;  3SHG B;  1G59 A;  3L25 A;  1JR3 A;  3FTC A;  3U6P A;  3U6C A;  1ORY B;  2X4A A;  4RNA A;  3GLG B;  1OAO C;  2FNA A;  5A2Q S;  4DV0 M;  4B7H A;  3GLG A;  2W82 A;  1T3T A;  4PD2 A;  1J7K A;  2XEP A;  5ITR A;  1SXJ D;  2ZTD A;  3AFH A;  3GQ4 A;  1VEJ A;  2CV2 A;  4GH9 A;  3FYC A;  1R2Y A;  3VKG A;  3DOA A;  1OIP A;  3GQ3 A;  4K0K M;  1QUS A;  4OU7 A;  5EJC A;  4PDI A;  1GAB A;  1IY1 A;  2VDB B;  1VEG A;  1Q3C A;  2C9O A;  2R45 A;  3U60 B;  3T1Y M;  3B9P A;  4IBJ A;  1HNW M;  1TGU A;  3E46 A;  1N75 A;  4G4R A;  3VDP A;  4B3S M;  3U60 A;  3HJS A;  3L28 A;  5ITT A;  2DAI A;  3J7B A;  3PNY A;  3GO8 A;  4BLC A;  1IXS B;  1RU3 A;  2X8A A;  1KYI A;  2O01 F;  4LF9 M;  8CAT A;  1UFZ A;  3LW5 F;  1J5E M;  4GIP A;  2R65 A;  4LG2 A;  2QBY A;  3LVW A;  3L27 A;  1HT2 E;  3KOX E;  5KQ8 A;  5DNY A;  4RF0 A;  3LCV B;  2LXE A;  1EIJ A;  2Q2E B;  3SMS A;  4JI0 M;  1HQY E; 
#chains in the Genus database with same CATH homology
 3ZCB B;  4IBK A;  1FJG M;  4QOS A;  3FTD A;  3U6E A;  2OQ4 A;  1C1K A;  3MHV C;  4I8O A;  1WXQ A;  3TWM A;  3SYL A;  1OFI A;  3A46 A;  5ITU A;  2V1C A;  3HJ8 A;  3TWK A;  3MJ5 A;  2BNK A;  4FWD A;  4LJ4 A;  1NSF A;  1E9R A;  2BJW A;  2CEA A;  2D7H A;  3RGP A;  4LGY A;  1SXJ B;  4JI3 M;  2E5L M;  4ITQ A;  4JI8 M;  3U5Z B;  3GRR A;  1SXJ E;  2XFS A;  3VLF B;  4L8R C;  3FUV A;  3AL0 C;  3K1J A;  1IXZ A;  1YSY A;  5EXP A;  3U6D A;  4B3R M;  3U5Z A;  3K92 A;  4KO8 A;  2Z4R A;  2VQE M;  4A3V B;  4JYA M;  3VK7 A;  1Q3B A;  4AG5 A;  2DWM A;  1XMO M;  5IZ7 D;  1OJL A;  3MK6 A;  2CHV A;  2ZAO A;  2KW0 A;  3A42 A;  1W5S A;  5GKN A;  4NXN M;  3K8Z A;  4XBO A;  3BOS A;  4LJ5 A;  3ZC7 B;  4JV5 M;  3KXE C;  4LJ8 A;  5KQD A;  2DZO B;  4DV4 M;  4L15 A;  4QOZ C;  5FTN A;  1IQP A;  5KO3 A;  4X62 M;  1DGG A;  1L1Z A;  4P16 A;  5ITX A;  4G4O A;  1HNZ M;  2Z7J A;  2RGO A;  4B7F A;  1G3I A;  1GVN A;  3CF0 A;  3KSJ A;  5EXX A;  2QCU A;  2F5P A;  1DGH B;  4QNR A;  2XZF A;  4LFC M;  1EE8 A;  3HU3 A;  1IN8 A;  2RKO A;  1IY0 A;  4X64 M;  4OX9 M;  3QAU A;  3SAW A;  2F5O A;  3AKZ A;  3SC3 A;  5EXS A;  1XC8 A;  1XHB A;  2OPF A;  3U61 B;  1TH3 A;  2CUZ A;  3FTF A;  4LF8 M;  3GPX A;  1YE9 A;  3HU2 A;  1TH4 A;  4DR4 M;  5BR8 M;  1Z5B A;  4FWH A;  3UK6 A;  2HHH M;  4LRT A;  3T38 A;  2G5G X;  4IBC A;  3DZD A;  2V6Z M;  3TE6 A;  1G4A E;  4IJE A;  3HU1 A;  4LZJ A;  2XLJ A;  4R7G A;  3R9X B;  1GL7 A;  2C99 A;  3KOW E;  2P5T A;  4D81 A;  4OVZ B;  2ERC A;  3SHF A;  2XH9 A;  2EA0 A;  1I94 M;  3KFU G;  4GC9 A;  5KPT A;  2M60 A;  4LF6 M;  1R2Z A;  1LV7 A;  3FYD A;  4G4Q A;  1TDH A;  5EP4 A;  5IT9 S;  1W5T A;  4GRI A;  4FVM A;  1XNR M;  4IBD A;  5C18 A;  7CAT A;  4LJA A;  2FOI C;  4B08 A;  2YFQ A;  1N32 M;  2DWN A;  5FTL A;  4CHT B;  4KOD A;  4GHA A;  4DUY M;  2D7E A;  4JI1 M;  1G41 A;  1N78 A;  3L29 A;  3JR4 A;  4M0D A;  4MB7 A;  2VII A;  2F5N A;  2XFT A;  4IBI A;  3AOE A;  4LFA M;  4G4N A;  5H37 D;  1Q39 A;  1KSF X;  4FCT A;  4W5W A;  1Z5C A;  3E4R A;  2R4J A;  3EIH A;  1HR0 M;  4JI4 M;  5EQT A;  4AZF A;  3SMP A;  4DR2 M;  3ILK A;  4REZ A;  3T1H M;  2J7O A;  4JI5 M;  2Y21 A;  2R18 A;  4LJ7 A;  1NHG C;  2FE8 A;  4FCV A;  3R8F A;  5ITY A;  4TUW A;  4XGI A;  2C98 A;  3J7A S;  5EXT A;  1IBK M;  3HWS A;  1L1T A;  4IBE A;  1K3W A;  4FD2 A;  4I81 A;  4WW0 A;  2KA6 B;  1E32 A;  3OTO M;  1JQJ C;  2G8L A;  3RE8 A;  4DV3 M;  3CTW B;  4FWG A;  1FNN A;  1XWI A;  3KOY E;  3HJQ A;  1MX0 A;  1PM5 A;  2H1R A;  1PJJ A;  3FTE A;  1D2N A;  3AJI B;  2ZAN A;  2AHM A;  3M0E A;  4PT5 A;  2XSZ D;  4Z8X A;  2UXD M;  3I4V A;  3KVW A;  1Z59 A;  1SXJ A;  2R4E A;  4DR6 M;  2DXI A;  2CHG A;  3SAV A;  2KRK A;  3SBJ A;  2ZAM A;  4M9X A;  3PFI A;  4LY6 A;  3DFZ A;  3FUU A;  3AV0 A;  4GKK M;  4GIT A;  3PXG A;  3WHK A;  2CHQ A;  1L2C A;  3VDU A;  1XMQ M;  4LJ9 A;  2UXB M;  3M7G A;  3GLF B;  2I7P A;  2CE7 A;  2UUC M;  3HHW A;  3FKE A;  2KRU A;  4GMQ A;  5E26 A;  3GLF A;  1XXH B;  2XGN A;  4DR7 M;  4NOO B;  4NL4 H;  1XXH A;  3A98 B;  1N77 A;  4LF5 M;  5E6J A;  4LGM A;  2YNM D;  1ZQ9 A;  3L2A A;  4AQY M;  4GKJ M;  4S12 A;  3M6A A;  3J80 S;  2HL7 A;  2DWZ B;  3QWL A;  4FW9 A;  4B7G A;  3GLH B;  3AOE C;  3FUX A;  4R3D A;  2I7N A;  4QHS A;  3U6L A;  1DGH A;  2M5Z A;  4II7 A;  5JI3 E;  1L2B A;  2F4V M;  2R62 A;  1R7R A;  2QZ4 A;  2XSZ A;  3FUT A;  4HLQ A;  4JXJ A;  4OW0 A;  5FSW A;  2NQ8 C;  2KZS A;  2KZU A;  3IG5 A;  1HQC A;  4CGY B;  3GP1 A;  4KLN A;  3DA1 A;  4CIS A;  3THG A;  4FCW A;  4AG6 A;  3U61 A;  4DV2 M;  3I51 A;  3K2L A;  3NWL A;  4X65 M;  3KSX A;  3HHY A;  4L4U A;  1IN5 A;  3C58 A;  2UU9 M;  4B3T M;  1KFV A;  3HGI A;  3SYK A;  4HL4 A;  2CV1 A;  4NRV A;  4GHL A;  3U6S A;  2L09 A;  4NRW A;  4DV7 M;  3SAU A;  1GLN A;  1TDZ A;  4M9S A;  1TH2 A;  2KEB A;  2QPA A;  3H4M A;  1S3S A;  3KOZ E;  3AOG A;  2JA2 A;  4OVZ A;  1ZAE A;  4IBF A;  2Z3X A;  2UUB M;  3KDS E;  1SXJ C;  2X49 A;  5IRE B;  4PDG A;  2UXC M;  4LRS A;  5FTJ A;  1NY6 A;  5BPV A;  3U6M A;  5EP1 A;  1UM8 A;  3U6O A;  1IY2 A;  3GPU A;  5LMN M;  1QAN A;  3RFW A;  4ZPX A;  4RF1 A;  4D80 A;  1NVM A;  4MGH A;  1G8P A;  3WHL A;  4BB9 A;  2DZN B;  4MGI E;  3D8B A;  4JI6 M;  1IBL M;  1L2D A;  4LCB A;  4D82 A;  5KPZ A;  2C5R A;  2XZU A;  2BJV A;  3CF6 E;  2CV0 A;  4IIW A;  3PVS A;  3SAT A;  3LMM A;  1N33 M;  4AW4 A;  4JI7 M;  1Z6T A;  2HCB A;  3ZH9 B;  4DR1 M;  2D7G A;  4LJ6 A;  4M0W A;  4MH0 E;  5FTK A;  1MU5 A;  4DV1 M;  4YY3 M;  4G6Z A;  3GRU A;  4QNM A;  3GPP A;  4MGY E;  3FD9 A;  4X66 M;  2QP9 X;  3SFZ A;  1IN7 A;  2QEN A;  1I4W A;  2F5S A;  4Z6Y A;  2YQZ A;  3T15 A;  1IM2 A;  3JR5 A;  2A5Y B;  3LVV A;  4MGK E;  3W0F A;  4BBA A;  4LF7 M;  2LH0 A;  3W0L B;  3UJN A;  1E94 E;  3GRV A;  2QBY B;  1DGF A;  2Y0Q A;  2L7I A;  5F3W A;  1HNX M;  3TWL A;  1VDD A;  3HKP A;  3PNV A;  3J27 B;  3TPZ A;  5EP2 A;  1IBM M;  2XF3 A;  3KW6 A;  2K47 A;  2LNH C;  1E9S A;  4NSO B;  3VK8 A;  1IN6 A;  4LF4 M;  3UGJ A;  4DUZ M;  4I5S A;  5JI2 E;  2HKJ A;  4IBB A;  1QQW A;  3UZU A;  3SAS A;  3VFD A;  2VQF M;  2DVW B;  2LWX A;  1OFH A;  4L16 A;  4PCZ A;  3LQQ A;  3TQS A;  5FLX S;  1IXR C;  3TL4 X;  3VKH A;  3UMM A;  3U6Q A;  4DR3 M;  4DV5 M;  3IG8 A;  2O5R A;  3FUW A;  4KHP M;  1K82 A;  2ZBK B;  1N34 M;  1XNQ M;  4LFB M;  4JI2 M;  3GRY A;  2Z4S A;  1N36 M;  5DYG A;  3KS4 A;  1J09 A;  1NJF A;  2C96 A;  1GL6 A;  1DGB A;  5IWA M;  4M9Z A;  1IN4 A;  1NHW C;  3D8L A;  1QAQ A;  2EUC A;  3GLH A;  4I4L A;  1QVR A;  3KP1 E;  3HHX A;  5KPR A;  2RGH A;  3E9S A;  1JR3 D;  5ITQ A;  1DO0 A;  3JAM S;  4AKG A;  3Q8X A;  4NXM M;  4LZZ A;  2Y0T A;  3L26 A;  2L7H A;  4AKH A;  1QZM A;  4IBG A;  4L78 A;  3HHZ A;  4B3M M;  1YUB A;  4GC5 A;  1NNJ A;  4YHH M;  4NSR A;  3SAR A;  3GPY A;  4AI6 A;  5ITX E;  2FFJ A;  2L6O A;  3GQ5 A;  2V1U A;  3I4Y A;  3KP0 E;  1L8Q A;  4WUR A;  1HT1 E;  1X37 A;  1NNU C;  2DHR A;  2Y20 A;  4MGZ E;  1H6U A;  2C9C A;  1K3X A;  3KS8 A;  2UUA M;  2YR0 A;  5EP3 A;  1QYR A;  1R6B X;  2J7N A;  1NY5 A;  4DV6 M;  1Z5A A;  1NJG A;  5FTM A;  3NBI A;  2CFO A;  3GLI B;  5LMU M;  1GKI A;  4JN6 A;  4MM3 B;  5DYI A;  1DO2 A;  1PJI A;  2KXE A;  4IJF A;  3J81 S;  4EIW A;  3GLI A;  2EO2 A;  3EIE A;  3J2P B;  2DWL A;  3RGS A;  2ZM6 M;  3A45 A;  2F5Q A;  4DR5 M;  2R46 A;  3CF2 A;  3LQR A;  4AKI A;  1QAO A;  4QHT A;  1QAM A;  5C1B A;  3L25 A;  3SHG B;  1G59 A;  1JR3 A;  3FTC A;  3U6P A;  3U6C A;  1ORY B;  2X4A A;  4RNA A;  3GLG B;  2FNA A;  5A2Q S;  4DV0 M;  4B7H A;  3GLG A;  2W82 A;  1T3T A;  4PD2 A;  1J7K A;  2XEP A;  5ITR A;  1SXJ D;  3AFH A;  3GQ4 A;  2CV2 A;  4GH9 A;  3FYC A;  1R2Y A;  3VKG A;  3DOA A;  3GQ3 A;  4K0K M;  4OU7 A;  5EJC A;  4PDI A;  1IY1 A;  2C9O A;  1Q3C A;  2R45 A;  3U60 B;  3T1Y M;  3B9P A;  4IBJ A;  1HNW M;  1TGU A;  1N75 A;  4G4R A;  3VDP A;  4B3S M;  3U60 A;  3HJS A;  3L28 A;  5ITT A;  3J7B A;  3PNY A;  3GO8 A;  4BLC A;  1IXS B;  2X8A A;  1KYI A;  4LF9 M;  8CAT A;  1J5E M;  4GIP A;  2R65 A;  4LG2 A;  2QBY A;  3LVW A;  3L27 A;  1HT2 E;  3KOX E;  5KQ8 A;  5DNY A;  4RF0 A;  2LXE A;  2Q2E B;  3SMS A;  4JI0 M;  1HQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...