1N36M

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n36M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n36M02
3A45A 1Z5AA 5LMNM 4DV4M 1Z59A 3A46A 4LF5M 4DR7M 1XMQM 3T1HM 2F5OA 5A2QS 4B3TM 4DR4M 3TWMA 1N36M 1J5EM 3U6PA 1L1TA 4DUYM 4JI6M 4JI2M 5ITRA 1L2CA 3SAVA 1IBMM 1KFVA 1R2ZA 4JI1M 2VQEM 1N34M 1L1ZA 3U6MA 3TWLA 2VQFM 2F5PA 2ZBKB 5FLXS 3U6DA 1HR0M 5ITXE 1L2BA 4G4RA 1R2YA 3SATA 2F4VM 5ITXA 3GPUA 4DV2M 2EA0A 4LF7M 5ITTA 2XZFA 2UUBM 4NXMM 2UUAM 1HNWM 1PJIA 1XMOM 4JI0M 1IBLM 4NXNM 4JI5M 3C58A 3U6CA 4DR5M 3SASA 4LF8M 4PCZA 2HHHM 1NNJA 1Z5CA 5LMUM 1MU5A 4JYAM 4AQYM 3DOAA 3SAWA 1XC8A 3GP1A 4DR3M 1Z5BA 2E5LM 4GKKM 4LFBM 4LFAM 3VK7A 3GPPA 3GQ4A 4DV5M 4DUZM 3GPYA 1TDZA 4PDIA 1TDHA 4PDGA 3J80S 4YY3M 1HNZM 2F5QA 1MX0A 4LF4M 2ZM6M 4X64M 3JR4A 4MB7A 4YHHM 1Q3BA 4ITQA 4PD2A 1I94M 5IT9S 4DV0M 4B3SM 5ITUA 2UXDM 4G4NA 2OPFA 3U6LA 4JV5M 3U6QA 4JI3M 1K3WA 5IWAM 4X66M 4DV3M 3U6OA 4KHPM 1XNQM 1XNRM 4OX9M 3A42A 3JR5A 4JI7M 4NRWA 1PJJA 5ITYA 3GQ5A 5BR8M 4NRVA 4DR6M 1FJGM 4DV7M 2UXBM 4CISA 1IBKM 4G4QA 3J81S 1EE8A 1Q39A 3OTOM 3GO8A 3JAMS 4X65M 2Q2EB 4JI8M 3SARA 4B3RM 3GPXA 1K82A 3SAUA 4G4OA 3TWKA 3W0FA 2XZUA 2UU9M 4LF9M 4B3MM 1L2DA 1HNXM 3GQ3A 2OQ4A 4DR2M 1PM5A 2HKJA 4K0KM 3J7AS 4LFCM 4DV6M 4LF6M 3SBJA 1K3XA 1Q3CA 2UUCM 2F5SA 2UXCM 3U6EA 4X62M 4DV1M 2F5NA 1N33M 5ITQA 4GKJM 4DR1M 1N32M 3T1YM 3U6SA 3VK8A 4JI4M
chains in the Genus database with same CATH superfamily
3A45A 4ANRA 4FD2A 3TL4X 2L7HA 4LF5M 2L4EA 3HHYA 4NC6A 3T1HM 4Q7JA 1QANA 1V92A 2XSZA 1GL6A 3T38A 1VEJA 7CATA 3B89A 1QVRA 1ZMUA 2CV1A 3C3EA 4B7FA 1OJLA 2Y21A 1QAOA 3W68A 3U61A 3HY5A 3GLHB 1TGUA 3FUVA 3D8LA 1DO2A 2QP9X 1N78A 1LV7A 2VQEM 1IFYA 5KPTA 2ZANA 2F5PA 1IXSB 2ZBKB 3KVWA 2L4FA 2F4VM 3QWLA 1D0LA 1SXJD 5ITXA 3MK6A 4LJ8A 3GPUA 3FUXA 4XBOA 1G71A 1Z6TA 2LHGA 3SC3A 4DV2M 1HT1E 3GRUA 2XZFA 2CV0A 1EFUB 3SYKA 1W5SA 2KRKA 4DR1M 1QUTA 2KNZA 1HNWM 2Y0TA 1QDTA 2OO9A 3IECA 4Y28F 4JI5M 3M0EA 1DO0A 4OW0A 4CHTB 1YSYA 1XXHE 3GRRA 3VFDA 2HHHM 2DVWB 4AQYM 3T15A 3R8FA 2JUJA 3HJSA 4DR3M 1OKSA 4IBKA 4F2LA 4M9SA 2CEAA 3HHWA 2JZ1A 1DGBA 2KNAA 4LFBM 1XXHA 1SXJE 1T3TA 2I7NA 2CE7A 2L2DA 1WR1B 4DUZM 1TDZA 3SYLA 4PDIA 1E32A 4PT5A 1YE9A 3L26A 2W82A 3K92A 2MR9A 4LF4M 2O5RA 4X64M 4AW4A 5E26A 1D0KA 3GLGA 3FKEA 2M60A 1PJSA 2HWJA 1RU3A 5IT9S 1QDRA 4B7HA 5ITUA 3CGWA 1S3SA 2MROB 1NVMA 2FOIC 3MMPA 3GLGE 2BJVA 4CGYB 1K3WA 4X66M 2P5TA 5FTJA 5FSWA 1XNRM 4XGIA 3RFWA 2JY8A 4IBDA 3JR5A 2V1CA 3EIEA 1WXQA 4MGKE 3R9XB 1WJ7A 2C99A 3BOSA 4II7A 3FRHA 3L27A 2H5XA 3Q8XA 4NSRA 5DNYA 2G8LA 5KPZA 3U5ZA 1GJSA 1Q39A 3AOEC 4KO8A 3D8BA 2Q2EB 4B3RM 3GPXA 1R7RA 2O25A 1WGLA 1ZV1A 2DZNB 3QYEA 2ZAOA 4GEWA 2K6BA 4KLNA 2LTUA 3GLHE 1NHGC 3LQQA 4KT0F 5IREB 3FUWA 1TR8A 3AV0A 2XFSA 1L2DA 1HNXM 1IY1A 2DWNA 4LJ6A 3FTEA 3HHXA 3ZC7B 5JI3E 2DAMA 3SBJA 1K3XA 2LVQD 2X4AA 2UUCM 4WURA 3NBIA 3RGPA 2C9OA 4B08A 1TH4A 2C96A 4M9XA 4MGYE 2OOBA 1N33M 1TH3A 1QQWA 2LHCA 4L4UA 3T1YM 2QCUA 5EP1A 1PRBA 1Z5AA 4DV4M 3K1JA 3C3DA 2LVAA 4BBAA 1XMQM 2Y0QA 2F5OA 4B3TM 2HAKA 4DR4M 1E9SA 1QAQA 1N36M 1XWIA 4KODA 4LGMA 2DZOB 5EP3A 4DUYM 3FTCA 3FTDA 1OAOC 3UK6A 1HT2E 1XXHB 2QNJA 4LCBA 3KOYE 1BVSA 1HQCA 3SAVA 2O01F 3HJ8A 1IBMM 2KXEA 2G3QA 2DWLA 5FTMA 2MGWA 1KFVA 1E9RA 1R2ZA 3IG5A 1OAIA 2J7NA 3SHFA 3V76A 4BB9A 3TWLA 3U6MA 1N34M 1XB2B 1L1ZA 1NHWC 2CRUA 1IXSA 3U6DA 5EJCA 1HR0M 3TE6A 5ITXE 4G4RA 3L29A 1VG5A 4Z6YA 3WHLA 2FH0A 1TTEA 3PVSA 2EA0A 5ITTA 3LQRA 2WSFF 1AUAA 5DYIA 3AOEA 1EIJA 4NXMM 3GLFB 4GITA 3U60B 3C9PA 3KOZE 4OVZA 1GVNA 2JY6B 1N75A 4A3VB 4M0WA 2EKFA 5C1BA 4D81A 3C58A 2NQ8C 2KDLA 2VF8A 3SASA 5EXXA 2KW0A 3B7QA 3SHGB 3H4MA 1NNJA 1GKIA 1Z5CA 2C5RA 2Z4RA 2XLJA 4R3DA 4EIWA 2D7EA 2BNKA 4GKKM 2LNHC 1SXJA 3A98B 3KDSE 4LFAM 2L7IA 3KFUG 4F1IA 4M9ZA 4LJ4A 2G5GX 1UFZA 4CJ6A 2DENA 1TDHA 4UN2B 3GLHA 4ZPXA 3ZH9B 2XF3A 4LY6A 1DGHA 2RGOA 2YNMD 3DA1A 4RF0A 3CTWB 1N77A 2LBCA 4M0DA 2F5QA 4AKIA 2GNOA 2LVPC 2ZAMA 2ZTCA 4MB7A 2ERCA 3L2AA 4YHHM 8CATA 1Q3BA 2JXNA 5FTLA 4ITQA 2VF7A 2EJSA 3KXEC 1QUSA 2DI0A 4PD2A 5L8RF 4DV0M 5BPVA 1J7KA 2XSZD 1JR3E 4JN6A 4G4NA 2OPFA 4AZFA 2DZLA 3U6LA 1V33A 2QPAA 4JI3M 2LVNC 4DV3M 1XNQM 3KW6A 2C98A 3DZDA 4NRWA 3BXWA 2HL7A 1MJGM 2B3TA 3GQ5A 4NRVA 4DV7M 1WIVA 3CF2A 3KOWE 4L78A 1D2NA 2QHOB 1EE8A 1LTMA 4IBGA 3J81S 4IBFA 3MHVC 1D0MA 3GO8A 3JAMS 5C18A 1DV0A 1GL7A 2M5ZA 2DNAA 4FW9A 3TWKA 2QENA 2UU9M 1GO5A 1JR3A 4IBIA 4NSOB 3M6AA 4D80A 5KO3A 1JR3D 4R71A 2A5YB 3GQ3A 3I4VA 4DR2M 1G8PA 3Q8GA 3HJQA 1YUBA 4K0KM 2DAKA 1IY0A 3LMMA 3GLIA 4IJFA 4HLQA 1A5TA 2X8AA 4RNAA 3PNYA 4GHAA 3L25A 4R7GA 2JY7A 1J09A 3UZUA 3KOXE 4GC5A 1NJFA 2F5NA 4QNRA 5EP2A 1N32M 3U6SA 4FWGA 3EIHA 5LMNM 4LG2A 1Z59A 2LXEA 1DGGA 4IJEA 1J5EM 4I81A 3UJNA 1VDLA 4MGZE 3U6PA 4JI2M 3VLFB 5ITRA 3I04M 4FCWA 4HEOA 4QOZC 1T6OA 3NWLA 2R65A 2V6ZM 1IN5A 5JI2E 3E21A 4JI1M 1DGFA 4IIWA 1HJPA 2DAIA 3E46A 1ZQ9A 1OIPA 2K0BX 5FLXS 4D82A 3L28A 2DWZB 3SATA 3HU2A 1X37A 1G4AE 5EXPA 2Z4SA 1JQJC 4G6ZA 4G3OA 2APLA 1L8QA 2R44A 2JWSA 4L15A 1NJGA 1V34A 5FTKA 3VDUA 2R0IA 5F3WA 4RKUF 4CIZA 5EQTA 4LRSA 1WGNA 1E94E 1PJIA 3FUTA 4JI0M 1IBLM 4NXNM 1TF0B 1ZMVA 3ILKA 3U6CA 4FVMA 5EP4A 4L8RC 1OFHA 2CV2A 4LF8M 4PCZA 1XHBA 4LZZA 3UMMA 1F4IA 3SFZA 2KNVA 2N35A 3GLFE 1IM2A 4TUWA 1MU5A 2FNAA 2QQ8A 1QZEA 3I51A 2KHHA 1C7YA 4B7GA 3GP1A 1AIPC 1Z5BA 3B74A 5EXSA 4GRIA 2MH8A 3CF6E 2K47A 2OOAA 2J7OA 3VK7A 5KQ8A 4DBGB 1IXRC 1IY2A 2KZUA 3GPPA 1VEKA 2JNHA 3GLIE 4I5SA 4DV5M 3KP0E 3U61B 3HX3A 1G3IA 4REZA 1Q02A 4PDGA 3J80S 3BBZA 2CP8A 1IN6A 3FTFA 1QZMA 4FWDA 1IN8A 2WSEF 2LVOC 3F92A 3LVWA 2QBYB 3VKGA 3J2PB 2UXDM 2R4JA 3RGSA 3GRVA 4LZJA 2AHMA 5FTNA 4JV5M 2Y20A 1NV8A 1VDDA 2MJ5B 5IWAM 3KS4A 1NV9A 2VDBB 3FRIA 3U6OA 4KHPM 4IBBA 3KS8A 5IZ7D 1SXJB 2QSFX 2QZ4A 3AJIB 3WHKA 1ORYB 1Y8GA 2C9CA 2EUCA 4JI7M 1YLAA 1NSFA 5BR8M 4DR6M 2Z8YM 1GLNA 1OQYA 1PJTA 1TH2A 2CUZA 2XEPA 4CISA 3B7NA 5EXTA 3SMPA 4AKGA 4G4QA 4P16A 3U5ZB 4MM3B 2KEBA 3AFHA 3GRYA 1R4GA 4X65M 4OU7A 4JI8M 1NNUC 3K9OA 3NBXX 1IXZA 4LGYA 3UGJA 4G4OA 4QNMA 3W0FA 2WZJA 2XZUA 4LF9M 4L6V6 1NY6A 5H37D 4B3MM 4AKHA 1KSFX 2DKLA 2DHRA 3E9SA 2OQ4A 2JA2A 3K2LA 3W67A 3J7AS 4LJ9A 4LF6M 1CUKA 2YFQA 4MGIE 4IBCA 1IQPA 1Q3CA 3TPZA 3KP1E 1IN7A 1C1KA 3LVVA 5E6JA 2L09A 2UXCM 1ZMWA 4X62M 4DV1M 2UUBM 2X49A 3DFZA 1VQ1A 3VK8A 4I8OA 4FWHA 2DAGA 2CWBA 2KRUA 3A46A 4LJ7A 3W0LB 4DR7M 4WP2A 4JXJA 1OIZA 5A2QS 2VIIA 4LRTA 3THGA 3GLFA 3TWMA 3ZQJA 1G59A 3IHPA 2J5YA 1L1TA 1T43A 4JI6M 3VKHA 4IBJA 2D7GA 2KZSA 1MN3A 1I4WA 1L2CA 2CHQA 2XH9A 3QYBA 2H1RA 2BWEA 3AOGA 3KSJA 3B9PA 4GMQA 1W5TA 3GLIB 3J27B 2K9DA 3ZCBB 2VQFM 3HU1A 4LJ5A 4WW0A 3J7BA 3I01M 1L2BA 1R2YA 1OFIA 2JZ0A 2KA6B 3FUUA 3KSXA 2DWMA 4FCTA 2HCBA 4LF7M 3PNVA 3QAUA 3HKPA 3PXGA 4OVZB 4Z8XA 2UUAM 3AL0C 4MH0E 2RKOA 3LCVB 3PFIA 4FCVA 1XMOM 2R18A 4QHSA 3IG8A 5GKNA 2ZTDA 4DR5M 3H4JA 2YQZA 4RF1A 3SMSA 1QAMA 2V1UA 3T6PA 5LMUM 3LCUA 3VDPA 3LW5F 4JYAM 3HWSA 3DOAA 4XK8F 4P17A 3SAWA 3CF0A 2R62A 1XC8A 2E5LM 2FS1A 1SG9A 5DFLA 2RRUA 3K8ZA 4GIPA 3MJ5A 1ZAEA 5DYGA 3FYDA 3GQ4A 3FE3A 3GPYA 4AI6A 4HL4A 3B7ZA 1KYIA 1P3QQ 1DGHB 4YY3M 1HNZM 2DXIA 3HHZA 1MX0A 4QOSA 2ZM6M 3FD9A 3JR4A 3GLGB 4AG6A 2CHGA 2R4EA 2D7HA 2EO2A 2FFJA 3FYCA 4AG5A 4BLCA 3HU3A 2Z3XA 1NY5A 2R6FA 2EKKA 2L6OA 4LJAA 1I94M 2QBYA 4B3SM 2I7PA 5KQDA 4IBEA 1OTRA 3I4YA 2JY5A 2YR0A 2R46A 3U6QA 2Z7JA 4NOOB 2DHYA 3U60A 1H6UA 2DAEA 4OX9M 3A42A 2RGHA 4L16A 2CFOA 1PJJA 4GH9A 5ITYA 5KPRA 1FJGM 1QYRA 1SXJC 2FE8A 2UXBM 2R45A 4GHLA 1IBKM 2WSCF 1FNNA 2CHVA 3OTOM 3M7GA 2BJWA 2GQFA 4I4LA 3SARA 2JP7A 4W5WA 2BWBA 1UM8A 4GC9A 3SAUA 1K82A 1IN4A 1GJTA 2XGNA 3TQSA 1VEGA 3K9PA 2LWXA 3RE8A 1PM5A 1WHCA 2HKJA 4LFCM 4DV6M 4MGHA 4S12A 2XFTA 1NO1A 2F5SA 3AKZA 1HQYE 1PJQA 3HGIA 1R5LA 3U6EA 1JB0F 3HZJA 4NL4H 1GABA 2LH0A 1G41A 1R6BX 5ITQA 4GKJM 3E4RA 4QHTA 1PGYA 4JI4M
chains in the Genus database with same CATH topology
3A45A 4FD2A 3TL4X 2L7HA 4LF5M 3HHYA 3T1HM 1QANA 2XSZA 1GL6A 3T38A 7CATA 1QVRA 2CV1A 4B7FA 1OJLA 2Y21A 1QAOA 3U61A 3GLHB 1TGUA 3FUVA 3D8LA 1DO2A 2QP9X 1N78A 1LV7A 2VQEM 5KPTA 2ZANA 2F5PA 1IXSB 2ZBKB 3KVWA 2F4VM 3QWLA 1SXJD 5ITXA 3GPUA 3MK6A 4LJ8A 3FUXA 4XBOA 1Z6TA 3SC3A 4DV2M 1HT1E 3GRUA 2XZFA 2CV0A 3SYKA 1W5SA 2KRKA 4DR1M 1HNWM 2Y0TA 4JI5M 3M0EA 1DO0A 4OW0A 4CHTB 1YSYA 3GRRA 3VFDA 2HHHM 2DVWB 4AQYM 3T15A 3R8FA 3HJSA 4DR3M 4IBKA 4M9SA 2CEAA 3HHWA 1DGBA 4LFBM 1XXHA 1SXJE 1T3TA 2I7NA 2CE7A 4DUZM 1TDZA 3SYLA 4PDIA 1E32A 4PT5A 1YE9A 3L26A 2W82A 3K92A 4LF4M 2O5RA 4X64M 4AW4A 5E26A 3GLGA 3FKEA 2M60A 5IT9S 4B7HA 5ITUA 1S3SA 1NVMA 2FOIC 2BJVA 4CGYB 1K3WA 4X66M 2P5TA 5FTJA 5FSWA 1XNRM 4XGIA 3RFWA 4IBDA 3JR5A 2V1CA 3EIEA 1WXQA 4MGKE 3R9XB 2C99A 3BOSA 4II7A 3L27A 3Q8XA 4NSRA 5DNYA 2G8LA 5KPZA 3U5ZA 1Q39A 3AOEC 4KO8A 3D8BA 2Q2EB 4B3RM 3GPXA 1R7RA 2DZNB 4KLNA 2ZAOA 3LQQA 1NHGC 5IREB 3FUWA 3AV0A 2XFSA 1L2DA 1HNXM 1IY1A 2DWNA 4LJ6A 3FTEA 3HHXA 3ZC7B 5JI3E 3SBJA 1K3XA 2X4AA 2UUCM 4WURA 3NBIA 3RGPA 2C9OA 4B08A 1TH4A 2C96A 4M9XA 4MGYE 1N33M 1TH3A 1QQWA 4L4UA 3T1YM 2QCUA 5EP1A 1Z5AA 4DV4M 3K1JA 4BBAA 1XMQM 2F5OA 2Y0QA 4B3TM 4DR4M 1E9SA 1QAQA 1N36M 1XWIA 4KODA 4LGMA 2DZOB 5EP3A 4DUYM 3FTCA 3FTDA 3UK6A 1HT2E 1XXHB 4LCBA 3KOYE 1HQCA 3SAVA 3HJ8A 1IBMM 2KXEA 2DWLA 5FTMA 1KFVA 1E9RA 1R2ZA 3IG5A 2J7NA 3SHFA 1N34M 4BB9A 3U6MA 3TWLA 1L1ZA 2V1UA 1NHWC 3U6DA 1HR0M 5EJCA 3TE6A 5ITXE 4G4RA 3L29A 4Z6YA 3WHLA 3PVSA 2EA0A 5ITTA 3LQRA 5DYIA 3AOEA 4NXMM 3GLFB 4GITA 3U60B 3KOZE 4OVZA 1GVNA 1N75A 4A3VB 4M0WA 5C1BA 4D81A 3C58A 2NQ8C 3SASA 5EXXA 2KW0A 3SHGB 3H4MA 1NNJA 1GKIA 1Z5CA 2C5RA 2Z4RA 2XLJA 4R3DA 4EIWA 2D7EA 2BNKA 4GKKM 2LNHC 1SXJA 3A98B 3KDSE 4LFAM 2L7IA 3KFUG 4M9ZA 4LJ4A 2G5GX 4ZPXA 1TDHA 3ZH9B 3GLHA 2XF3A 4LY6A 1DGHA 2RGOA 2YNMD 3DA1A 4RF0A 3CTWB 1N77A 4M0DA 2F5QA 4AKIA 2ZAMA 4MB7A 2ERCA 3L2AA 4YHHM 8CATA 1Q3BA 5FTLA 4ITQA 3KXEC 4PD2A 4DV0M 5BPVA 1J7KA 2XSZD 4JN6A 4G4NA 2OPFA 4AZFA 3U6LA 2QPAA 4JI3M 4DV3M 1XNQM 3KW6A 2C98A 3DZDA 4NRWA 2HL7A 3GQ5A 4NRVA 4DV7M 3CF2A 3KOWE 4L78A 1D2NA 3J81S 1EE8A 4IBGA 4IBFA 3MHVC 3GO8A 3JAMS 5C18A 1GL7A 2M5ZA 4FW9A 3TWKA 2QENA 2UU9M 1JR3A 4IBIA 4NSOB 3M6AA 4D80A 5KO3A 1JR3D 2A5YB 3GQ3A 3I4VA 4DR2M 1G8PA 3HJQA 1YUBA 4K0KM 1IY0A 3LMMA 3GLIA 4IJFA 4HLQA 4RNAA 2X8AA 3PNYA 4GHAA 3L25A 4R7GA 1J09A 3UZUA 3KOXE 4GC5A 1NJFA 2F5NA 4QNRA 5EP2A 1N32M 3U6SA 4FWGA 3EIHA 5LMNM 4LG2A 1Z59A 2LXEA 1DGGA 4IJEA 1J5EM 4I81A 3UJNA 3U6PA 4MGZE 4JI2M 3VLFB 5ITRA 4FCWA 4QOZC 3NWLA 2R65A 2V6ZM 1IN5A 5JI2E 4JI1M 1DGFA 4IIWA 1ZQ9A 5FLXS 4D82A 3L28A 2DWZB 3SATA 3HU2A 1X37A 1G4AE 5EXPA 2Z4SA 1JQJC 4G6ZA 1L8QA 4L15A 1NJGA 5FTKA 3VDUA 5F3WA 5EQTA 4LRSA 1PJIA 1E94E 3FUTA 4JI0M 1IBLM 4NXNM 3ILKA 3U6CA 4FVMA 5EP4A 4L8RC 1OFHA 2CV2A 4LF8M 4PCZA 1XHBA 4LZZA 3UMMA 3SFZA 1IM2A 4TUWA 1MU5A 2FNAA 3I51A 4B7GA 3GP1A 1Z5BA 5EXSA 4GRIA 3CF6E 2K47A 2J7OA 3VK7A 5KQ8A 1IXRC 1IY2A 2KZUA 3GPPA 4DV5M 3U61B 4I5SA 3KP0E 1G3IA 4REZA 4PDGA 3J80S 1IN6A 3FTFA 1QZMA 4FWDA 1IN8A 3LVWA 2QBYB 3VKGA 3J2PB 2UXDM 2R4JA 3RGSA 3GRVA 4LZJA 2AHMA 5FTNA 4JV5M 2Y20A 1VDDA 5IWAM 3KS4A 3U6OA 4KHPM 4IBBA 3KS8A 5IZ7D 1SXJB 2QZ4A 3AJIB 3WHKA 1ORYB 2C9CA 2EUCA 4JI7M 1NSFA 5BR8M 4DR6M 1GLNA 1TH2A 2CUZA 2XEPA 4CISA 5EXTA 3SMPA 4AKGA 4G4QA 4P16A 3U5ZB 4MM3B 2KEBA 3AFHA 3GRYA 4X65M 4OU7A 4JI8M 1NNUC 3UGJA 1IXZA 4LGYA 4G4OA 4QNMA 3W0FA 2XZUA 4LF9M 1NY6A 5H37D 4B3MM 4AKHA 1KSFX 3E9SA 2DHRA 2OQ4A 2JA2A 3K2LA 3J7AS 4LJ9A 4LF6M 2YFQA 4MGIE 4IBCA 1IQPA 1Q3CA 3TPZA 3KP1E 1IN7A 1C1KA 3LVVA 5E6JA 2L09A 2UXCM 4X62M 4DV1M 2UUBM 3DFZA 2X49A 3VK8A 4I8OA 4FWHA 2KRUA 3A46A 4LJ7A 3W0LB 4DR7M 4JXJA 5A2QS 3GLFA 2VIIA 4LRTA 3THGA 3TWMA 1G59A 1L1TA 4JI6M 3VKHA 4IBJA 2D7GA 2KZSA 1I4WA 1L2CA 2CHQA 2XH9A 2H1RA 3AOGA 3KSJA 3B9PA 4GMQA 1W5TA 3GLIB 3J27B 3ZCBB 2VQFM 3HU1A 4LJ5A 4WW0A 3J7BA 1L2BA 1R2YA 1OFIA 2KA6B 3FUUA 3KSXA 2DWMA 4FCTA 2HCBA 4LF7M 3PNVA 3QAUA 3HKPA 3PXGA 4OVZB 4Z8XA 2UUAM 3AL0C 4MH0E 2RKOA 3PFIA 4FCVA 1XMOM 2R18A 4QHSA 3IG8A 5GKNA 4DR5M 2YQZA 4RF1A 3SMSA 1QAMA 4JYAM 5LMUM 3VDPA 3HWSA 3DOAA 3SAWA 3CF0A 2R62A 1XC8A 2E5LM 3K8ZA 4GIPA 3MJ5A 1ZAEA 5DYGA 3FYDA 3GQ4A 4AI6A 3GPYA 4HL4A 1KYIA 1DGHB 4YY3M 1HNZM 2DXIA 3HHZA 1MX0A 4QOSA 2ZM6M 3FD9A 3JR4A 3GLGB 4AG6A 2CHGA 2R4EA 2D7HA 2EO2A 2FFJA 3FYCA 4AG5A 4BLCA 3HU3A 2Z3XA 1NY5A 4LJAA 2L6OA 1I94M 2QBYA 4B3SM 2I7PA 5KQDA 4IBEA 3I4YA 2YR0A 2R46A 3U6QA 2Z7JA 4NOOB 3U60A 1H6UA 4OX9M 3A42A 2RGHA 4L16A 2CFOA 1PJJA 4GH9A 5ITYA 5KPRA 1FJGM 1QYRA 1SXJC 2FE8A 2UXBM 2R45A 4GHLA 1IBKM 1FNNA 2CHVA 3OTOM 3M7GA 2BJWA 4I4LA 3SARA 4W5WA 1K82A 3SAUA 1UM8A 4GC9A 1IN4A 2XGNA 3TQSA 3RE8A 2LWXA 1PM5A 2HKJA 4LFCM 4DV6M 4MGHA 4S12A 2XFTA 2F5SA 3AKZA 1HQYE 3HGIA 3U6EA 4NL4H 2LH0A 1G41A 1R6BX 5ITQA 4GKJM 3E4RA 4QHTA 4JI4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A45 A;  1Z5A A;  5LMN M;  4DV4 M;  1Z59 A;  3A46 A;  4LF5 M;  4DR7 M;  1XMQ M;  3T1H M;  2F5O A;  5A2Q S;  4B3T M;  4DR4 M;  3TWM A;  1N36 M;  1J5E M;  3U6P A;  1L1T A;  4DUY M;  4JI6 M;  4JI2 M;  5ITR A;  1L2C A;  3SAV A;  1IBM M;  1KFV A;  1R2Z A;  4JI1 M;  2VQE M;  1N34 M;  1L1Z A;  3U6M A;  3TWL A;  2VQF M;  2F5P A;  2ZBK B;  5FLX S;  3U6D A;  1HR0 M;  5ITX E;  1L2B A;  4G4R A;  1R2Y A;  3SAT A;  2F4V M;  5ITX A;  3GPU A;  4DV2 M;  2EA0 A;  4LF7 M;  5ITT A;  2XZF A;  2UUB M;  4NXM M;  2UUA M;  1HNW M;  1PJI A;  1XMO M;  4JI0 M;  1IBL M;  4NXN M;  4JI5 M;  3C58 A;  3U6C A;  4DR5 M;  3SAS A;  4LF8 M;  4PCZ A;  2HHH M;  1NNJ A;  1Z5C A;  5LMU M;  1MU5 A;  4JYA M;  4AQY M;  3DOA A;  3SAW A;  1XC8 A;  3GP1 A;  4DR3 M;  1Z5B A;  2E5L M;  4GKK M;  4LFB M;  4LFA M;  3VK7 A;  3GPP A;  3GQ4 A;  4DV5 M;  4DUZ M;  3GPY A;  1TDZ A;  4PDI A;  1TDH A;  4PDG A;  3J80 S;  4YY3 M;  1HNZ M;  2F5Q A;  1MX0 A;  4LF4 M;  2ZM6 M;  4X64 M;  3JR4 A;  4MB7 A;  4YHH M;  1Q3B A;  4ITQ A;  4PD2 A;  1I94 M;  5IT9 S;  4DV0 M;  4B3S M;  5ITU A;  2UXD M;  4G4N A;  2OPF A;  3U6L A;  4JV5 M;  3U6Q A;  4JI3 M;  1K3W A;  5IWA M;  4X66 M;  4DV3 M;  3U6O A;  4KHP M;  1XNQ M;  1XNR M;  4OX9 M;  3A42 A;  3JR5 A;  4JI7 M;  4NRW A;  1PJJ A;  5ITY A;  3GQ5 A;  5BR8 M;  4NRV A;  4DR6 M;  1FJG M;  4DV7 M;  2UXB M;  4CIS A;  1IBK M;  4G4Q A;  3J81 S;  1EE8 A;  1Q39 A;  3OTO M;  3GO8 A;  3JAM S;  4X65 M;  2Q2E B;  4JI8 M;  3SAR A;  4B3R M;  3GPX A;  1K82 A;  3SAU A;  4G4O A;  3TWK A;  3W0F A;  2XZU A;  2UU9 M;  4LF9 M;  4B3M M;  1L2D A;  1HNX M;  3GQ3 A;  2OQ4 A;  4DR2 M;  1PM5 A;  2HKJ A;  4K0K M;  3J7A S;  4LFC M;  4DV6 M;  4LF6 M;  3SBJ A;  1K3X A;  1Q3C A;  2UUC M;  2F5S A;  2UXC M;  3U6E A;  4X62 M;  4DV1 M;  2F5N A;  1N33 M;  5ITQ A;  4GKJ M;  4DR1 M;  1N32 M;  3T1Y M;  3U6S A;  3VK8 A;  4JI4 M; 
#chains in the Genus database with same CATH topology
 3A45 A;  4ANR A;  4FD2 A;  3TL4 X;  2L7H A;  4LF5 M;  2L4E A;  3HHY A;  4NC6 A;  3T1H M;  4Q7J A;  1QAN A;  1V92 A;  2XSZ A;  1GL6 A;  3T38 A;  1VEJ A;  7CAT A;  3B89 A;  1QVR A;  1ZMU A;  2CV1 A;  3C3E A;  4B7F A;  1OJL A;  2Y21 A;  1QAO A;  3W68 A;  3U61 A;  3HY5 A;  3GLH B;  1TGU A;  3FUV A;  3D8L A;  1DO2 A;  2QP9 X;  1N78 A;  1LV7 A;  2VQE M;  1IFY A;  5KPT A;  2ZAN A;  2F5P A;  1IXS B;  2ZBK B;  3KVW A;  2L4F A;  2F4V M;  3QWL A;  1D0L A;  1SXJ D;  5ITX A;  3MK6 A;  4LJ8 A;  3GPU A;  3FUX A;  4XBO A;  1G71 A;  1Z6T A;  2LHG A;  3SC3 A;  4DV2 M;  1HT1 E;  3GRU A;  2XZF A;  2CV0 A;  1EFU B;  3SYK A;  1W5S A;  2KRK A;  4DR1 M;  1QUT A;  2KNZ A;  1HNW M;  2Y0T A;  1QDT A;  2OO9 A;  3IEC A;  4Y28 F;  4JI5 M;  3M0E A;  1DO0 A;  4OW0 A;  4CHT B;  1YSY A;  1XXH E;  3GRR A;  3VFD A;  2HHH M;  2DVW B;  4AQY M;  3T15 A;  3R8F A;  2JUJ A;  3HJS A;  4DR3 M;  1OKS A;  4IBK A;  4F2L A;  4M9S A;  2CEA A;  3HHW A;  2JZ1 A;  1DGB A;  2KNA A;  4LFB M;  1XXH A;  1SXJ E;  1T3T A;  2I7N A;  2CE7 A;  2L2D A;  1WR1 B;  4DUZ M;  1TDZ A;  3SYL A;  4PDI A;  1E32 A;  4PT5 A;  1YE9 A;  3L26 A;  2W82 A;  3K92 A;  2MR9 A;  4LF4 M;  2O5R A;  4X64 M;  4AW4 A;  5E26 A;  1D0K A;  3GLG A;  3FKE A;  2M60 A;  1PJS A;  2HWJ A;  1RU3 A;  5IT9 S;  1QDR A;  4B7H A;  5ITU A;  3CGW A;  1S3S A;  2MRO B;  1NVM A;  2FOI C;  3MMP A;  3GLG E;  2BJV A;  4CGY B;  1K3W A;  4X66 M;  2P5T A;  5FTJ A;  5FSW A;  1XNR M;  4XGI A;  3RFW A;  2JY8 A;  4IBD A;  3JR5 A;  2V1C A;  3EIE A;  1WXQ A;  4MGK E;  3R9X B;  1WJ7 A;  2C99 A;  3BOS A;  4II7 A;  3FRH A;  3L27 A;  2H5X A;  3Q8X A;  4NSR A;  5DNY A;  2G8L A;  5KPZ A;  3U5Z A;  1GJS A;  1Q39 A;  3AOE C;  4KO8 A;  3D8B A;  2Q2E B;  4B3R M;  3GPX A;  1R7R A;  2O25 A;  1WGL A;  1ZV1 A;  2DZN B;  3QYE A;  2ZAO A;  4GEW A;  2K6B A;  4KLN A;  2LTU A;  3GLH E;  1NHG C;  3LQQ A;  4KT0 F;  5IRE B;  3FUW A;  1TR8 A;  3AV0 A;  2XFS A;  1L2D A;  1HNX M;  1IY1 A;  2DWN A;  4LJ6 A;  3FTE A;  3HHX A;  3ZC7 B;  5JI3 E;  2DAM A;  3SBJ A;  1K3X A;  2LVQ D;  2X4A A;  2UUC M;  4WUR A;  3NBI A;  3RGP A;  2C9O A;  4B08 A;  1TH4 A;  2C96 A;  4M9X A;  4MGY E;  2OOB A;  1N33 M;  1TH3 A;  1QQW A;  2LHC A;  4L4U A;  3T1Y M;  2QCU A;  5EP1 A;  1PRB A;  1Z5A A;  4DV4 M;  3K1J A;  3C3D A;  2LVA A;  4BBA A;  1XMQ M;  2Y0Q A;  2F5O A;  4B3T M;  2HAK A;  4DR4 M;  1E9S A;  1QAQ A;  1N36 M;  1XWI A;  4KOD A;  4LGM A;  2DZO B;  5EP3 A;  4DUY M;  3FTC A;  3FTD A;  1OAO C;  3UK6 A;  1HT2 E;  1XXH B;  2QNJ A;  4LCB A;  3KOY E;  1BVS A;  1HQC A;  3SAV A;  2O01 F;  3HJ8 A;  1IBM M;  2KXE A;  2G3Q A;  2DWL A;  5FTM A;  2MGW A;  1KFV A;  1E9R A;  1R2Z A;  3IG5 A;  1OAI A;  2J7N A;  3SHF A;  3V76 A;  4BB9 A;  3TWL A;  3U6M A;  1N34 M;  1XB2 B;  1L1Z A;  1NHW C;  2CRU A;  1IXS A;  3U6D A;  5EJC A;  1HR0 M;  3TE6 A;  5ITX E;  4G4R A;  3L29 A;  1VG5 A;  4Z6Y A;  3WHL A;  2FH0 A;  1TTE A;  3PVS A;  2EA0 A;  5ITT A;  3LQR A;  2WSF F;  1AUA A;  5DYI A;  3AOE A;  1EIJ A;  4NXM M;  3GLF B;  4GIT A;  3U60 B;  3C9P A;  3KOZ E;  4OVZ A;  1GVN A;  2JY6 B;  1N75 A;  4A3V B;  4M0W A;  2EKF A;  5C1B A;  4D81 A;  3C58 A;  2NQ8 C;  2KDL A;  2VF8 A;  3SAS A;  5EXX A;  2KW0 A;  3B7Q A;  3SHG B;  3H4M A;  1NNJ A;  1GKI A;  1Z5C A;  2C5R A;  2Z4R A;  2XLJ A;  4R3D A;  4EIW A;  2D7E A;  2BNK A;  4GKK M;  2LNH C;  1SXJ A;  3A98 B;  3KDS E;  4LFA M;  2L7I A;  3KFU G;  4F1I A;  4M9Z A;  4LJ4 A;  2G5G X;  1UFZ A;  4CJ6 A;  2DEN A;  1TDH A;  4UN2 B;  3GLH A;  4ZPX A;  3ZH9 B;  2XF3 A;  4LY6 A;  1DGH A;  2RGO A;  2YNM D;  3DA1 A;  4RF0 A;  3CTW B;  1N77 A;  2LBC A;  4M0D A;  2F5Q A;  4AKI A;  2GNO A;  2LVP C;  2ZAM A;  2ZTC A;  4MB7 A;  2ERC A;  3L2A A;  4YHH M;  8CAT A;  1Q3B A;  2JXN A;  5FTL A;  4ITQ A;  2VF7 A;  2EJS A;  3KXE C;  1QUS A;  2DI0 A;  4PD2 A;  5L8R F;  4DV0 M;  5BPV A;  1J7K A;  2XSZ D;  1JR3 E;  4JN6 A;  4G4N A;  2OPF A;  4AZF A;  2DZL A;  3U6L A;  1V33 A;  2QPA A;  4JI3 M;  2LVN C;  4DV3 M;  1XNQ M;  3KW6 A;  2C98 A;  3DZD A;  4NRW A;  3BXW A;  2HL7 A;  1MJG M;  2B3T A;  3GQ5 A;  4NRV A;  4DV7 M;  1WIV A;  3CF2 A;  3KOW E;  4L78 A;  1D2N A;  2QHO B;  1EE8 A;  1LTM A;  4IBG A;  3J81 S;  4IBF A;  3MHV C;  1D0M A;  3GO8 A;  3JAM S;  5C18 A;  1DV0 A;  1GL7 A;  2M5Z A;  2DNA A;  4FW9 A;  3TWK A;  2QEN A;  2UU9 M;  1GO5 A;  1JR3 A;  4IBI A;  4NSO B;  3M6A A;  4D80 A;  5KO3 A;  1JR3 D;  4R71 A;  2A5Y B;  3GQ3 A;  3I4V A;  4DR2 M;  1G8P A;  3Q8G A;  3HJQ A;  1YUB A;  4K0K M;  2DAK A;  1IY0 A;  3LMM A;  3GLI A;  4IJF A;  4HLQ A;  1A5T A;  2X8A A;  4RNA A;  3PNY A;  4GHA A;  3L25 A;  4R7G A;  2JY7 A;  1J09 A;  3UZU A;  3KOX E;  4GC5 A;  1NJF A;  2F5N A;  4QNR A;  5EP2 A;  1N32 M;  3U6S A;  4FWG A;  3EIH A;  5LMN M;  4LG2 A;  1Z59 A;  2LXE A;  1DGG A;  4IJE A;  1J5E M;  4I81 A;  3UJN A;  1VDL A;  4MGZ E;  3U6P A;  4JI2 M;  3VLF B;  5ITR A;  3I04 M;  4FCW A;  4HEO A;  4QOZ C;  1T6O A;  3NWL A;  2R65 A;  2V6Z M;  1IN5 A;  5JI2 E;  3E21 A;  4JI1 M;  1DGF A;  4IIW A;  1HJP A;  2DAI A;  3E46 A;  1ZQ9 A;  1OIP A;  2K0B X;  5FLX S;  4D82 A;  3L28 A;  2DWZ B;  3SAT A;  3HU2 A;  1X37 A;  1G4A E;  5EXP A;  2Z4S A;  1JQJ C;  4G6Z A;  4G3O A;  2APL A;  1L8Q A;  2R44 A;  2JWS A;  4L15 A;  1NJG A;  1V34 A;  5FTK A;  3VDU A;  2R0I A;  5F3W A;  4RKU F;  4CIZ A;  5EQT A;  4LRS A;  1WGN A;  1E94 E;  1PJI A;  3FUT A;  4JI0 M;  1IBL M;  4NXN M;  1TF0 B;  1ZMV A;  3ILK A;  3U6C A;  4FVM A;  5EP4 A;  4L8R C;  1OFH A;  2CV2 A;  4LF8 M;  4PCZ A;  1XHB A;  4LZZ A;  3UMM A;  1F4I A;  3SFZ A;  2KNV A;  2N35 A;  3GLF E;  1IM2 A;  4TUW A;  1MU5 A;  2FNA A;  2QQ8 A;  1QZE A;  3I51 A;  2KHH A;  1C7Y A;  4B7G A;  3GP1 A;  1AIP C;  1Z5B A;  3B74 A;  5EXS A;  4GRI A;  2MH8 A;  3CF6 E;  2K47 A;  2OOA A;  2J7O A;  3VK7 A;  5KQ8 A;  4DBG B;  1IXR C;  1IY2 A;  2KZU A;  3GPP A;  1VEK A;  2JNH A;  3GLI E;  4I5S A;  4DV5 M;  3KP0 E;  3U61 B;  3HX3 A;  1G3I A;  4REZ A;  1Q02 A;  4PDG A;  3J80 S;  3BBZ A;  2CP8 A;  1IN6 A;  3FTF A;  1QZM A;  4FWD A;  1IN8 A;  2WSE F;  2LVO C;  3F92 A;  3LVW A;  2QBY B;  3VKG A;  3J2P B;  2UXD M;  2R4J A;  3RGS A;  3GRV A;  4LZJ A;  2AHM A;  5FTN A;  4JV5 M;  2Y20 A;  1NV8 A;  1VDD A;  2MJ5 B;  5IWA M;  3KS4 A;  1NV9 A;  2VDB B;  3FRI A;  3U6O A;  4KHP M;  4IBB A;  3KS8 A;  5IZ7 D;  1SXJ B;  2QSF X;  2QZ4 A;  3AJI B;  3WHK A;  1ORY B;  1Y8G A;  2C9C A;  2EUC A;  4JI7 M;  1YLA A;  1NSF A;  5BR8 M;  4DR6 M;  2Z8Y M;  1GLN A;  1OQY A;  1PJT A;  1TH2 A;  2CUZ A;  2XEP A;  4CIS A;  3B7N A;  5EXT A;  3SMP A;  4AKG A;  4G4Q A;  4P16 A;  3U5Z B;  4MM3 B;  2KEB A;  3AFH A;  3GRY A;  1R4G A;  4X65 M;  4OU7 A;  4JI8 M;  1NNU C;  3K9O A;  3NBX X;  1IXZ A;  4LGY A;  3UGJ A;  4G4O A;  4QNM A;  3W0F A;  2WZJ A;  2XZU A;  4LF9 M;  4L6V 6;  1NY6 A;  5H37 D;  4B3M M;  4AKH A;  1KSF X;  2DKL A;  2DHR A;  3E9S A;  2OQ4 A;  2JA2 A;  3K2L A;  3W67 A;  3J7A S;  4LJ9 A;  4LF6 M;  1CUK A;  2YFQ A;  4MGI E;  4IBC A;  1IQP A;  1Q3C A;  3TPZ A;  3KP1 E;  1IN7 A;  1C1K A;  3LVV A;  5E6J A;  2L09 A;  2UXC M;  1ZMW A;  4X62 M;  4DV1 M;  2UUB M;  2X49 A;  3DFZ A;  1VQ1 A;  3VK8 A;  4I8O A;  4FWH A;  2DAG A;  2CWB A;  2KRU A;  3A46 A;  4LJ7 A;  3W0L B;  4DR7 M;  4WP2 A;  4JXJ A;  1OIZ A;  5A2Q S;  2VII A;  4LRT A;  3THG A;  3GLF A;  3TWM A;  3ZQJ A;  1G59 A;  3IHP A;  2J5Y A;  1L1T A;  1T43 A;  4JI6 M;  3VKH A;  4IBJ A;  2D7G A;  2KZS A;  1MN3 A;  1I4W A;  1L2C A;  2CHQ A;  2XH9 A;  3QYB A;  2H1R A;  2BWE A;  3AOG A;  3KSJ A;  3B9P A;  4GMQ A;  1W5T A;  3GLI B;  3J27 B;  2K9D A;  3ZCB B;  2VQF M;  3HU1 A;  4LJ5 A;  4WW0 A;  3J7B A;  3I01 M;  1L2B A;  1R2Y A;  1OFI A;  2JZ0 A;  2KA6 B;  3FUU A;  3KSX A;  2DWM A;  4FCT A;  2HCB A;  4LF7 M;  3PNV A;  3QAU A;  3HKP A;  3PXG A;  4OVZ B;  4Z8X A;  2UUA M;  3AL0 C;  4MH0 E;  2RKO A;  3LCV B;  3PFI A;  4FCV A;  1XMO M;  2R18 A;  4QHS A;  3IG8 A;  5GKN A;  2ZTD A;  4DR5 M;  3H4J A;  2YQZ A;  4RF1 A;  3SMS A;  1QAM A;  2V1U A;  3T6P A;  5LMU M;  3LCU A;  3VDP A;  3LW5 F;  4JYA M;  3HWS A;  3DOA A;  4XK8 F;  4P17 A;  3SAW A;  3CF0 A;  2R62 A;  1XC8 A;  2E5L M;  2FS1 A;  1SG9 A;  5DFL A;  2RRU A;  3K8Z A;  4GIP A;  3MJ5 A;  1ZAE A;  5DYG A;  3FYD A;  3GQ4 A;  3FE3 A;  3GPY A;  4AI6 A;  4HL4 A;  3B7Z A;  1KYI A;  1P3Q Q;  1DGH B;  4YY3 M;  1HNZ M;  2DXI A;  3HHZ A;  1MX0 A;  4QOS A;  2ZM6 M;  3FD9 A;  3JR4 A;  3GLG B;  4AG6 A;  2CHG A;  2R4E A;  2D7H A;  2EO2 A;  2FFJ A;  3FYC A;  4AG5 A;  4BLC A;  3HU3 A;  2Z3X A;  1NY5 A;  2R6F A;  2EKK A;  2L6O A;  4LJA A;  1I94 M;  2QBY A;  4B3S M;  2I7P A;  5KQD A;  4IBE A;  1OTR A;  3I4Y A;  2JY5 A;  2YR0 A;  2R46 A;  3U6Q A;  2Z7J A;  4NOO B;  2DHY A;  3U60 A;  1H6U A;  2DAE A;  4OX9 M;  3A42 A;  2RGH A;  4L16 A;  2CFO A;  1PJJ A;  4GH9 A;  5ITY A;  5KPR A;  1FJG M;  1QYR A;  1SXJ C;  2FE8 A;  2UXB M;  2R45 A;  4GHL A;  1IBK M;  2WSC F;  1FNN A;  2CHV A;  3OTO M;  3M7G A;  2BJW A;  2GQF A;  4I4L A;  3SAR A;  2JP7 A;  4W5W A;  2BWB A;  1UM8 A;  4GC9 A;  3SAU A;  1K82 A;  1IN4 A;  1GJT A;  2XGN A;  3TQS A;  1VEG A;  3K9P A;  2LWX A;  3RE8 A;  1PM5 A;  1WHC A;  2HKJ A;  4LFC M;  4DV6 M;  4MGH A;  4S12 A;  2XFT A;  1NO1 A;  2F5S A;  3AKZ A;  1HQY E;  1PJQ A;  3HGI A;  1R5L A;  3U6E A;  1JB0 F;  3HZJ A;  4NL4 H;  1GAB A;  2LH0 A;  1G41 A;  1R6B X;  5ITQ A;  4GKJ M;  3E4R A;  4QHT A;  1PGY A;  4JI4 M; 
#chains in the Genus database with same CATH homology
 3A45 A;  4FD2 A;  3TL4 X;  2L7H A;  4LF5 M;  3HHY A;  3T1H M;  1QAN A;  2XSZ A;  1GL6 A;  3T38 A;  7CAT A;  1QVR A;  2CV1 A;  4B7F A;  1OJL A;  2Y21 A;  1QAO A;  3U61 A;  3GLH B;  1TGU A;  3FUV A;  3D8L A;  1DO2 A;  2QP9 X;  1N78 A;  1LV7 A;  2VQE M;  5KPT A;  2ZAN A;  2F5P A;  1IXS B;  2ZBK B;  3KVW A;  2F4V M;  3QWL A;  1SXJ D;  5ITX A;  3GPU A;  3MK6 A;  4LJ8 A;  3FUX A;  4XBO A;  1Z6T A;  3SC3 A;  4DV2 M;  1HT1 E;  3GRU A;  2XZF A;  2CV0 A;  3SYK A;  1W5S A;  2KRK A;  4DR1 M;  1HNW M;  2Y0T A;  4JI5 M;  3M0E A;  1DO0 A;  4OW0 A;  4CHT B;  1YSY A;  3GRR A;  3VFD A;  2HHH M;  2DVW B;  4AQY M;  3T15 A;  3R8F A;  3HJS A;  4DR3 M;  4IBK A;  4M9S A;  2CEA A;  3HHW A;  1DGB A;  4LFB M;  1XXH A;  1SXJ E;  1T3T A;  2I7N A;  2CE7 A;  4DUZ M;  1TDZ A;  3SYL A;  4PDI A;  1E32 A;  4PT5 A;  1YE9 A;  3L26 A;  2W82 A;  3K92 A;  4LF4 M;  2O5R A;  4X64 M;  4AW4 A;  5E26 A;  3GLG A;  3FKE A;  2M60 A;  5IT9 S;  4B7H A;  5ITU A;  1S3S A;  1NVM A;  2FOI C;  2BJV A;  4CGY B;  1K3W A;  4X66 M;  2P5T A;  5FTJ A;  5FSW A;  1XNR M;  4XGI A;  3RFW A;  4IBD A;  3JR5 A;  2V1C A;  3EIE A;  1WXQ A;  4MGK E;  3R9X B;  2C99 A;  3BOS A;  4II7 A;  3L27 A;  3Q8X A;  4NSR A;  5DNY A;  2G8L A;  5KPZ A;  3U5Z A;  1Q39 A;  3AOE C;  4KO8 A;  3D8B A;  2Q2E B;  4B3R M;  3GPX A;  1R7R A;  2DZN B;  4KLN A;  2ZAO A;  3LQQ A;  1NHG C;  5IRE B;  3FUW A;  3AV0 A;  2XFS A;  1L2D A;  1HNX M;  1IY1 A;  2DWN A;  4LJ6 A;  3FTE A;  3HHX A;  3ZC7 B;  5JI3 E;  3SBJ A;  1K3X A;  2X4A A;  2UUC M;  4WUR A;  3NBI A;  3RGP A;  2C9O A;  4B08 A;  1TH4 A;  2C96 A;  4M9X A;  4MGY E;  1N33 M;  1TH3 A;  1QQW A;  4L4U A;  3T1Y M;  2QCU A;  5EP1 A;  1Z5A A;  4DV4 M;  3K1J A;  4BBA A;  1XMQ M;  2F5O A;  2Y0Q A;  4B3T M;  4DR4 M;  1E9S A;  1QAQ A;  1N36 M;  1XWI A;  4KOD A;  4LGM A;  2DZO B;  5EP3 A;  4DUY M;  3FTC A;  3FTD A;  3UK6 A;  1HT2 E;  1XXH B;  4LCB A;  3KOY E;  1HQC A;  3SAV A;  3HJ8 A;  1IBM M;  2KXE A;  2DWL A;  5FTM A;  1KFV A;  1E9R A;  1R2Z A;  3IG5 A;  2J7N A;  3SHF A;  1N34 M;  4BB9 A;  3U6M A;  3TWL A;  1L1Z A;  2V1U A;  1NHW C;  3U6D A;  1HR0 M;  5EJC A;  3TE6 A;  5ITX E;  4G4R A;  3L29 A;  4Z6Y A;  3WHL A;  3PVS A;  2EA0 A;  5ITT A;  3LQR A;  5DYI A;  3AOE A;  4NXM M;  3GLF B;  4GIT A;  3U60 B;  3KOZ E;  4OVZ A;  1GVN A;  1N75 A;  4A3V B;  4M0W A;  5C1B A;  4D81 A;  3C58 A;  2NQ8 C;  3SAS A;  5EXX A;  2KW0 A;  3SHG B;  3H4M A;  1NNJ A;  1GKI A;  1Z5C A;  2C5R A;  2Z4R A;  2XLJ A;  4R3D A;  4EIW A;  2D7E A;  2BNK A;  4GKK M;  2LNH C;  1SXJ A;  3A98 B;  3KDS E;  4LFA M;  2L7I A;  3KFU G;  4M9Z A;  4LJ4 A;  2G5G X;  4ZPX A;  1TDH A;  3ZH9 B;  3GLH A;  2XF3 A;  4LY6 A;  1DGH A;  2RGO A;  2YNM D;  3DA1 A;  4RF0 A;  3CTW B;  1N77 A;  4M0D A;  2F5Q A;  4AKI A;  2ZAM A;  4MB7 A;  2ERC A;  3L2A A;  4YHH M;  8CAT A;  1Q3B A;  5FTL A;  4ITQ A;  3KXE C;  4PD2 A;  4DV0 M;  5BPV A;  1J7K A;  2XSZ D;  4JN6 A;  4G4N A;  2OPF A;  4AZF A;  3U6L A;  2QPA A;  4JI3 M;  4DV3 M;  1XNQ M;  3KW6 A;  2C98 A;  3DZD A;  4NRW A;  2HL7 A;  3GQ5 A;  4NRV A;  4DV7 M;  3CF2 A;  3KOW E;  4L78 A;  1D2N A;  3J81 S;  1EE8 A;  4IBG A;  4IBF A;  3MHV C;  3GO8 A;  3JAM S;  5C18 A;  1GL7 A;  2M5Z A;  4FW9 A;  3TWK A;  2QEN A;  2UU9 M;  1JR3 A;  4IBI A;  4NSO B;  3M6A A;  4D80 A;  5KO3 A;  1JR3 D;  2A5Y B;  3GQ3 A;  3I4V A;  4DR2 M;  1G8P A;  3HJQ A;  1YUB A;  4K0K M;  1IY0 A;  3LMM A;  3GLI A;  4IJF A;  4HLQ A;  4RNA A;  2X8A A;  3PNY A;  4GHA A;  3L25 A;  4R7G A;  1J09 A;  3UZU A;  3KOX E;  4GC5 A;  1NJF A;  2F5N A;  4QNR A;  5EP2 A;  1N32 M;  3U6S A;  4FWG A;  3EIH A;  5LMN M;  4LG2 A;  1Z59 A;  2LXE A;  1DGG A;  4IJE A;  1J5E M;  4I81 A;  3UJN A;  3U6P A;  4MGZ E;  4JI2 M;  3VLF B;  5ITR A;  4FCW A;  4QOZ C;  3NWL A;  2R65 A;  2V6Z M;  1IN5 A;  5JI2 E;  4JI1 M;  1DGF A;  4IIW A;  1ZQ9 A;  5FLX S;  4D82 A;  3L28 A;  2DWZ B;  3SAT A;  3HU2 A;  1X37 A;  1G4A E;  5EXP A;  2Z4S A;  1JQJ C;  4G6Z A;  1L8Q A;  4L15 A;  1NJG A;  5FTK A;  3VDU A;  5F3W A;  5EQT A;  4LRS A;  1PJI A;  1E94 E;  3FUT A;  4JI0 M;  1IBL M;  4NXN M;  3ILK A;  3U6C A;  4FVM A;  5EP4 A;  4L8R C;  1OFH A;  2CV2 A;  4LF8 M;  4PCZ A;  1XHB A;  4LZZ A;  3UMM A;  3SFZ A;  1IM2 A;  4TUW A;  1MU5 A;  2FNA A;  3I51 A;  4B7G A;  3GP1 A;  1Z5B A;  5EXS A;  4GRI A;  3CF6 E;  2K47 A;  2J7O A;  3VK7 A;  5KQ8 A;  1IXR C;  1IY2 A;  2KZU A;  3GPP A;  4DV5 M;  3U61 B;  4I5S A;  3KP0 E;  1G3I A;  4REZ A;  4PDG A;  3J80 S;  1IN6 A;  3FTF A;  1QZM A;  4FWD A;  1IN8 A;  3LVW A;  2QBY B;  3VKG A;  3J2P B;  2UXD M;  2R4J A;  3RGS A;  3GRV A;  4LZJ A;  2AHM A;  5FTN A;  4JV5 M;  2Y20 A;  1VDD A;  5IWA M;  3KS4 A;  3U6O A;  4KHP M;  4IBB A;  3KS8 A;  5IZ7 D;  1SXJ B;  2QZ4 A;  3AJI B;  3WHK A;  1ORY B;  2C9C A;  2EUC A;  4JI7 M;  1NSF A;  5BR8 M;  4DR6 M;  1GLN A;  1TH2 A;  2CUZ A;  2XEP A;  4CIS A;  5EXT A;  3SMP A;  4AKG A;  4G4Q A;  4P16 A;  3U5Z B;  4MM3 B;  2KEB A;  3AFH A;  3GRY A;  4X65 M;  4OU7 A;  4JI8 M;  1NNU C;  3UGJ A;  1IXZ A;  4LGY A;  4G4O A;  4QNM A;  3W0F A;  2XZU A;  4LF9 M;  1NY6 A;  5H37 D;  4B3M M;  4AKH A;  1KSF X;  3E9S A;  2DHR A;  2OQ4 A;  2JA2 A;  3K2L A;  3J7A S;  4LJ9 A;  4LF6 M;  2YFQ A;  4MGI E;  4IBC A;  1IQP A;  1Q3C A;  3TPZ A;  3KP1 E;  1IN7 A;  1C1K A;  3LVV A;  5E6J A;  2L09 A;  2UXC M;  4X62 M;  4DV1 M;  2UUB M;  3DFZ A;  2X49 A;  3VK8 A;  4I8O A;  4FWH A;  2KRU A;  3A46 A;  4LJ7 A;  3W0L B;  4DR7 M;  4JXJ A;  5A2Q S;  3GLF A;  2VII A;  4LRT A;  3THG A;  3TWM A;  1G59 A;  1L1T A;  4JI6 M;  3VKH A;  4IBJ A;  2D7G A;  2KZS A;  1I4W A;  1L2C A;  2CHQ A;  2XH9 A;  2H1R A;  3AOG A;  3KSJ A;  3B9P A;  4GMQ A;  1W5T A;  3GLI B;  3J27 B;  3ZCB B;  2VQF M;  3HU1 A;  4LJ5 A;  4WW0 A;  3J7B A;  1L2B A;  1R2Y A;  1OFI A;  2KA6 B;  3FUU A;  3KSX A;  2DWM A;  4FCT A;  2HCB A;  4LF7 M;  3PNV A;  3QAU A;  3HKP A;  3PXG A;  4OVZ B;  4Z8X A;  2UUA M;  3AL0 C;  4MH0 E;  2RKO A;  3PFI A;  4FCV A;  1XMO M;  2R18 A;  4QHS A;  3IG8 A;  5GKN A;  4DR5 M;  2YQZ A;  4RF1 A;  3SMS A;  1QAM A;  4JYA M;  5LMU M;  3VDP A;  3HWS A;  3DOA A;  3SAW A;  3CF0 A;  2R62 A;  1XC8 A;  2E5L M;  3K8Z A;  4GIP A;  3MJ5 A;  1ZAE A;  5DYG A;  3FYD A;  3GQ4 A;  4AI6 A;  3GPY A;  4HL4 A;  1KYI A;  1DGH B;  4YY3 M;  1HNZ M;  2DXI A;  3HHZ A;  1MX0 A;  4QOS A;  2ZM6 M;  3FD9 A;  3JR4 A;  3GLG B;  4AG6 A;  2CHG A;  2R4E A;  2D7H A;  2EO2 A;  2FFJ A;  3FYC A;  4AG5 A;  4BLC A;  3HU3 A;  2Z3X A;  1NY5 A;  4LJA A;  2L6O A;  1I94 M;  2QBY A;  4B3S M;  2I7P A;  5KQD A;  4IBE A;  3I4Y A;  2YR0 A;  2R46 A;  3U6Q A;  2Z7J A;  4NOO B;  3U60 A;  1H6U A;  4OX9 M;  3A42 A;  2RGH A;  4L16 A;  2CFO A;  1PJJ A;  4GH9 A;  5ITY A;  5KPR A;  1FJG M;  1QYR A;  1SXJ C;  2FE8 A;  2UXB M;  2R45 A;  4GHL A;  1IBK M;  1FNN A;  2CHV A;  3OTO M;  3M7G A;  2BJW A;  4I4L A;  3SAR A;  4W5W A;  1K82 A;  3SAU A;  1UM8 A;  4GC9 A;  1IN4 A;  2XGN A;  3TQS A;  3RE8 A;  2LWX A;  1PM5 A;  2HKJ A;  4LFC M;  4DV6 M;  4MGH A;  4S12 A;  2XFT A;  2F5S A;  3AKZ A;  1HQY E;  3HGI A;  3U6E A;  4NL4 H;  2LH0 A;  1G41 A;  1R6B X;  5ITQ A;  4GKJ M;  3E4R A;  4QHT A;  4JI4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...