1N36M

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n36M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n36M02
2VQFM 4DR7M 4DV7M 1R2ZA 3TWLA 4G4RA 4DV2M 1Q39A 1IBMM 1L2DA 4DV0M 3SBJA 5ITQA 3GP1A 4K0KM 4DR2M 5IT9S 3J80S 4NXMM 2ZBKB 3GPUA 2XZUA 1EE8A 4NRWA 3U6DA 3U6SA 5LMUM 4ITQA 1K82A 4LFCM 2F5PA 2EA0A 4DV5M 4DR5M 4LF5M 1HNWM 3VK8A 4DV4M 5FLXS 1TDZA 4DUYM 1N36M 3U6LA 3J81S 5ITYA 1K3XA 3TWKA 1KFVA 3JR4A 4JYAM 2OQ4A 4JI4M 1XNRM 1IBKM 3JAMS 4AQYM 4YHHM 1XNQM 4DR1M 3U6OA 2E5LM 4JI5M 4YY3M 4G4OA 3U6EA 3A42A 4KHPM 4DR4M 4PD2A 1PM5A 1TDHA 4X64M 2ZM6M 3VK7A 5LMNM 3DOAA 4X66M 1N33M 3U6PA 3SASA 4PDIA 1L1TA 1N34M 3SATA 4G4QA 4LF4M 4JI8M 1L1ZA 1J5EM 4MB7A 1IBLM 3GPXA 2UUBM 2UUCM 1NNJA 4JI7M 1XC8A 1K3WA 2XZFA 1Z5CA 3GO8A 4B3MM 4CISA 1Z5BA 5ITUA 1Q3BA 4X65M 1I94M 1L2CA 4NXNM 5ITXA 3SARA 1Z5AA 4JV5M 4X62M 4GKJM 3T1YM 3C58A 1PJIA 4B3TM 4B3RM 4LF6M 2UXCM 3W0FA 4LFAM 1XMOM 1HNXM 2F5OA 2VQEM 4PDGA 4G4NA 4LF9M 1PJJA 2UU9M 4JI6M 5IWAM 3SAWA 3JR5A 4DV6M 3SAVA 4NRVA 1MX0A 2F5QA 4B3SM 2HKJA 4JI2M 3J7AS 4DV3M 3TWMA 2OPFA 5A2QS 4DR6M 1MU5A 4DV1M 3T1HM 3GQ3A 4JI1M 4JI3M 3GPPA 3GPYA 4GKKM 1L2BA 4DR3M 3SAUA 4PCZA 4LF8M 4DUZM 2UUAM 5ITTA 4LFBM 2HHHM 2UXBM 2UXDM 1HR0M 3GQ4A 4JI0M 5ITXE 4LF7M 1Q3CA 5ITRA 1Z59A 2F4VM 3U6MA 1HNZM 3OTOM 3U6QA 3U6CA 3GQ5A 2Q2EB 5BR8M 1XMQM 2F5SA 3A46A 1N32M 1R2YA 1FJGM 4OX9M 3A45A 2F5NA
chains in the Genus database with same CATH superfamily
3C3EA 1OKSA 1G41A 3LQQA 1SXJE 2LVNC 4G4RA 2QPAA 2W82A 3L28A 3Q8GA 1JB0F 5GKNA 2L7IA 4DV2M 3SBJA 2QBYB 1VEJA 2EJSA 3KS8A 3HHWA 4REZA 1V34A 1OFHA 2LVOC 2XZUA 1EE8A 1QUTA 3HHXA 4CHTB 4MGYE 3IG8A 2FE8A 3GRVA 3HHZA 2F5PA 4DV5M 3L25A 2L09A 2DAIA 1UFZA 4LJ4A 1NHGC 2MR9A 1W5TA 1KSFX 3K92A 3I51A 2BWBA 4KODA 4AG6A 5FLXS 3BOSA 3QAUA 2H5XA 5EJCA 1KFVA 1V33A 2XSZA 2O01F 1DGHB 1XNRM 2CV1A 3JAMS 1QUSA 4YHHM 1NY5A 3ZCBB 2DWMA 1DV0A 3B7NA 2M5ZA 3CGWA 2KA6B 3AOGA 4MGHA 3KSJA 4AKIA 1G8PA 1TDHA 4X64M 3VK7A 1MJGM 4IJFA 3KOWE 3DOAA 4WURA 3MHVC 2ZAOA 4XBOA 1HT2E 4FW9A 3HKPA 2Z7JA 3U5ZB 4PDIA 2CV2A 1N34M 1YUBA 2HCBA 3SATA 4LF4M 1ZMWA 4JI8M 2CWBA 2QZ4A 2ZTCA 3PNYA 3FUXA 1XC8A 1K3WA 4JI7M 2V6ZM 4M0DA 5IREB 5L8RF 4OW0A 3FE3A 1Q3BA 4NXNM 1QDTA 1Z5AA 3SMPA 3AV0A 1D0LA 2Z4RA 1YSYA 3THGA 2C9OA 2B3TA 5KPZA 2XZFA 4GHAA 1OTRA 2K47A 2ZAMA 3KVWA 2N35A 4LF6M 2DWNA 3KXEC 3ILKA 1QDRA 3FUUA 5JI2E 4G4NA 4NSRA 3HU1A 2L6OA 4JI6M 5BPVA 3SAWA 1HQYE 2K0BX 5F3WA 1G3IA 1L8QA 1Z6TA 2VDBB 3TPZA 2HL7A 3NBIA 3SYLA 1MX0A 3KSXA 3NBXX 2KNAA 2HKJA 4B3SM 1ORYB 3FKEA 2LNHC 2L4EA 4DV3M 2LH0A 5DFLA 1XXHB 3Q8XA 1E32A 3GLGB 2CV0A 4GIPA 4DR6M 3GLHA 4DV1M 4M9XA 1G71A 4JI3M 4I5SA 4IBDA 1GJTA 3GPPA 4P17A 3GPYA 1F4IA 2LWXA 4DR3M 1ZQ9A 3L26A 5DYGA 4QHSA 2UXDM 1E9SA 2Y21A 4JI0M 3M6AA 2CE7A 4LF7M 4D82A 4NL4H 2DZOB 3CF6E 1Q02A 1Z59A 3VLFB 3PXGA 4IBJA 3IHPA 4R7GA 2YNMD 3SC3A 4IBEA 5KPRA 1DGBA 2YR0A 5EXXA 3U6QA 3E46A 2D7GA 1YLAA 2JXNA 1TGUA 3FUWA 1XMQM 1SXJA 4IIWA 3ZC7B 3FUTA 1FJGM 3A45A 4DV7M 1R2ZA 2DZNB 2ZANA 3HJQA 4L16A 1Q39A 3HZJA 2BNKA 2Z3XA 3GLIB 4MGKE 4PT5A 3KFUG 3FRIA 5ITQA 3GP1A 5C1BA 4DR2M 2C9CA 3J80S 2LBCA 1XWIA 2ZBKB 5EP3A 3HJSA 3GLFE 1IN8A 2A5YB 2KHHA 3RFWA 3VDUA 4B7FA 3GPUA 2KEBA 5KQDA 3U6DA 3M7GA 1HQCA 1A5TA 3UK6A 1DO2A 2R6FA 3KW6A 1QZEA 4DR5M 1R7RA 4CGYB 3EIEA 5FTLA 2LXEA 3T6PA 3VK8A 1TF0B 2DHRA 3J2PB 2FH0A 2G8LA 3KOZE 4QHTA 5KQ8A 4DUYM 1N36M 3HU2A 1K3XA 1MN3A 3HWSA 3AFHA 1UM8A 2EUCA 2OQ4A 4JYAM 3LMMA 1E9RA 3H4MA 1NHWC 1NJFA 5EP2A 4LG2A 1WIVA 4GITA 4IBKA 4G4OA 3PNVA 3VFDA 1TH3A 3KOXE 1PJTA 5EP4A 4PD2A 1IN4A 2DHYA 3B9PA 3L2AA 1D2NA 1GL7A 2XSZD 5LMNM 4IBBA 2Z4SA 2DAKA 3CF0A 1ZV1A 1H6UA 2L4FA 4HLQA 3UZUA 3LVVA 3SASA 1VQ1A 4LGMA 2HAKA 2OO9A 1QAMA 1IN6A 1L1ZA 4IBIA 1AIPC 1SXJC 2J5YA 5FTMA 4GC9A 4CISA 1IY0A 1Z5BA 5ITUA 3KOYE 1L2CA 1JR3A 4MGIE 4LY6A 1OFIA 2O25A 3HU3A 3T1YM 3AKZA 1PJIA 2XFTA 1NV9A 2DAEA 2Y20A 2UXCM 1XMOM 1HNXM 3DA1A 2F5OA 2D7EA 4NOOB 5C18A 3FUVA 2JA2A 4IBFA 1PJJA 3AL0C 4FD2A 2EKFA 2VF7A 2D7HA 2XEPA 1TTEA 3FYCA 4BLCA 5FSWA 3UGJA 1S3SA 4GC5A 1IXZA 2Z8YM 2AHMA 4LJ9A 2OPFA 1HJPA 1OJLA 1GL6A 1R5LA 2XFSA 2R4EA 2JY7A 1VDDA 1PGYA 1VG5A 3HGIA 3TL4X 3LCUA 3W68A 4JI1M 5EP1A 3U5ZA 1QYRA 3GRRA 1WXQA 1CUKA 3LVWA 5EXTA 4GKKM 1L2BA 2DWLA 3TWMA 4XK8F 3LCVB 4LF8M 4DUZM 2UUAM 3GO8A 4Z6YA 2UXBM 2HHHM 1D0KA 2KW0A 1JR3E 5IZ7D 5E26A 2CHQA 2EKKA 4D80A 1NO1A 4JN6A 4II7A 2BJWA 3PVSA 1HNZM 4JXJA 1D0MA 4FCWA 4M0WA 2Q2EB 3AOEA 1DGGA 4Q7JA 4UN2B 1N32M 1NY6A 3NWLA 2K6BA 1R2YA 1ZMUA 4GHLA 3T38A 4OX9M 3SMSA 2F5NA 2VQFM 4FWHA 4DR7M 3WHKA 1PRBA 1G59A 3MJ5A 1J7KA 2LVQD 1KYIA 4OVZA 3QYEA 3C9PA 3GLFA 4K0KM 2R46A 5EXSA 4FWGA 1SXJD 2MROB 4HEOA 3I04M 5IT9S 1HT1E 4G3OA 4I8OA 1XXHA 2KNZA 5H37D 3GLGA 4NXMM 1J09A 2I7NA 4R3DA 4L78A 3UJNA 1P3QQ 2GNOA 4NRWA 2WSCF 3GLHB 1IXSA 1XHBA 2NQ8C 4WW0A 3VKHA 5LMUM 2BJVA 1K82A 2KZUA 3H4JA 4LF5M 1DO0A 4GMQA 1VEKA 4QOSA 2RGOA 3LW5F 2CP8A 1QAOA 2JNHA 2QENA 4MGZE 2LHCA 3U6LA 2XF3A 2DI0A 4MH0E 3TWKA 4AG5A 2KRKA 3JR4A 4AI6A 2OOBA 2Y0TA 2JUJA 2YQZA 3B7ZA 3SHFA 4D81A 3FTFA 2APLA 3C3DA 2QCUA 4AQYM 1N77A 2E5LM 4IBGA 4KLNA 3U6OA 4B7HA 4JI5M 4YY3M 4L6V6 4FVMA 1SXJB 1PM5A 1IQPA 3J7BA 3K1JA 4IJEA 2ZM6M 1GABA 1N75A 2DWZB 3KS4A 2X49A 3U60A 4X66M 5EQTA 1N33M 4KT0F 4MM3B 2H1RA 1XXHE 1JQJC 1DGFA 3E9SA 3GLGE 2CEAA 4HL4A 3F92A 2J7NA 3L27A 2KDLA 2MH8A 3GPXA 4A3VB 2XLJA 2UUBM 2X8AA 1NNJA 1FNNA 1IN7A 1QQWA 1EFUB 2G3QA 1TR8A 2WSFF 1E94E 4LRTA 4QNRA 3PFIA 2KRUA 3TE6A 4CJ6A 4OU7A 1T3TA 2JWSA 1I94M 3J27B 2DAGA 4F2LA 4ZPXA 4X62M 3K2LA 2R18A 5JI3E 1IFYA 3KDSE 3U61A 4GEWA 5FTJA 3W0FA 4LFAM 1GLNA 4RNAA 2DENA 2ERCA 2LVAA 4PDGA 4RKUF 3R8FA 5IWAM 1V92A 1OIZA 1QZMA 2CHVA 1OAOC 2C98A 1IM2A 3JR5A 3V76A 3SAVA 2QBYA 1GO5A 4NRVA 2RRUA 4AKHA 1TH4A 4L4UA 4JI2M 2OOAA 4P16A 4I4LA 5DNYA 3L29A 3GLIE 1T43A 4LJ6A 3CF2A 2GQFA 4LJ8A 3GQ3A 2CUZA 3T1HM 1WGLA 2KZSA 2DNAA 2R44A 4AZFA 2VF8A 1QANA 2MGWA 3D8LA 4RF1A 4PCZA 2XGNA 2C99A 3KP0E 2KXEA 4LFBM 1HR0M 3GQ4A 3I4VA 3FD9A 2DVWB 3QWLA 2JY6B 1DGHA 1AUAA 2LVPC 3IECA 3U6MA 3D8BA 1GVNA 4NSOB 4XGIA 2EO2A 3U6CA 2M60A 3GQ5A 4B08A 3SHGB 1VEGA 3CTWB 3MK6A 2JP7A 4FCVA 5BR8M 2C5RA 2G5GX 1EIJA 2QNJA 2O5RA 4B3TM 2DXIA 3B89A 1VDLA 4L15A 3TWLA 2WSEF 4GRIA 1IBMM 1IXRC 1L2DA 4DV0M 5KPTA 4LJ7A 3KP1E 1RU3A 2LTUA 1LTMA 1Y8GA 2XH9A 2V1CA 4LJ5A 2BWEA 3RE8A 4DBGB 3WHLA 3U6SA 3SYKA 3W0LB 2RGHA 4CIZA 4ITQA 4LFCM 2EA0A 4IBCA 1HNWM 4DV4M 4LGYA 2KNVA 4FWDA 1NV8A 2FNAA 1TDZA 2R4JA 2QSFX 3J81S 1QAQA 1ZAEA 1R4GA 3FRHA 3GRUA 5ITYA 4LCBA 2WZJA 3B7QA 3FTCA 3I01M 1OIPA 3T15A 4JI4M 2C96A 1T6OA 2R45A 2I7PA 3LQRA 3M0EA 1IBKM 2JZ1A 1XNQM 4DR1M 3U6EA 3AJIB 3A42A 4Z8XA 4DR4M 2L7HA 4M9SA 4KHPM 4QOZC 1WJ7A 4TUWA 2LHGA 2R65A 4I81A 3R9XB 2DKLA 1C7YA 3HX3A 1WHCA 3HY5A 5DYIA 4Y28F 4BBAA 1IN5A 3U6PA 4AW4A 2DZLA 1BVSA 1XB2B 4OVZB 3VKGA 3HJ8A 1W5SA 1GJSA 4LZJA 2CFOA 2QQ8A 2YFQA 3ZQJA 3GLFB 3K9PA 2HWJA 1L1TA 4QNMA 2CRUA 2DAMA 3K8ZA 4G4QA 5KO3A 2FOIC 4MB7A 1J5EM 1IBLM 3QYBA 1WGNA 1X37A 4LRSA 2UUCM 1R6BX 2K9DA 4RF0A 1Z5CA 4B3MM 1NSFA 1IXSB 1LV7A 4X65M 3BBZA 1OAIA 5FTNA 4R71A 2FS1A 5ITXA 3A98B 3SARA 2V1UA 4JV5M 3W67A 4GKJM 1ZMVA 3C58A 4B3RM 3BXWA 3ZH9B 7CATA 3K9OA 3DFZA 2VQEM 3EIHA 5FTKA 1PJSA 4G6ZA 4BB9A 4LF9M 2X4AA 3RGSA 2UU9M 2ZTDA 2CHGA 2R62A 3MMPA 4ANRA 4DV6M 4M9ZA 5E6JA 3GLIA 4EIWA 2JZ0A 1OQYA 1NNUC 2QP9X 2RKOA 3GRYA 2F5QA 3J7AS 3I4YA 1PJQA 2JY5A 4F1IA 3AOEC 5A2QS 1G4AE 3E4RA 1YE9A 3RGPA 1WR1B 3TQSA 1MU5A 3U60B 5EXPA 4LJAA 2L2DA 4AKGA 1SG9A 1NVMA 4B7GA 3E21A 1C1KA 1IY1A 2Y0QA 3FTEA 1N78A 4KO8A 2VIIA 3GLHE 3FTDA 3B74A 3SFZA 3SAUA 2FFJA 4WP2A 5ITTA 1NJGA 8CATA 5ITXE 3HHYA 4L8RC 1Q3CA 5ITRA 1I4WA 2JY8A 3UMMA 1IY2A 2F4VM 1JR3D 3OTOM 4S12A 4FCTA 2QHOB 3FYDA 3IG5A 1QVRA 1TH2A 2R0IA 3DZDA 2MJ5B 4W5WA 2F5SA 4GH9A 3A46A 2J7OA 4LZZA 3U61B 4NC6A 2P5TA 1GKIA 3VDPA
chains in the Genus database with same CATH topology
1G41A 3LQQA 1SXJE 4G4RA 2QPAA 2W82A 3L28A 5GKNA 4DV2M 2L7IA 3SBJA 2QBYB 3KS8A 3HHWA 4REZA 1OFHA 2XZUA 1EE8A 3HHXA 4CHTB 4MGYE 3IG8A 2FE8A 3GRVA 3HHZA 2F5PA 4DV5M 3L25A 2L09A 4LJ4A 1NHGC 1W5TA 1KSFX 3K92A 3I51A 4KODA 4AG6A 5FLXS 3BOSA 3QAUA 5EJCA 1KFVA 2XSZA 1DGHB 1XNRM 2CV1A 3JAMS 4YHHM 1NY5A 3ZCBB 2DWMA 2M5ZA 2KA6B 3AOGA 4MGHA 3KSJA 4AKIA 1G8PA 1TDHA 4X64M 3VK7A 4IJFA 3KOWE 3DOAA 4WURA 3MHVC 2ZAOA 4XBOA 1HT2E 4FW9A 3HKPA 2Z7JA 3U5ZB 4PDIA 2CV2A 1N34M 1YUBA 2HCBA 3SATA 4LF4M 4JI8M 2QZ4A 3PNYA 3FUXA 1XC8A 1K3WA 4JI7M 2V6ZM 4M0DA 5IREB 4OW0A 1Q3BA 4NXNM 3SMPA 1Z5AA 3AV0A 3THGA 2Z4RA 1YSYA 2C9OA 4GHAA 5KPZA 2K47A 2ZAMA 3KVWA 4LF6M 2DWNA 3KXEC 3ILKA 3FUUA 5JI2E 4G4NA 4NSRA 3HU1A 2L6OA 4JI6M 5BPVA 3SAWA 1HQYE 5F3WA 1G3IA 1L8QA 1Z6TA 3TPZA 2HL7A 3NBIA 3SYLA 1MX0A 3KSXA 4B3SM 2HKJA 1ORYB 3FKEA 2LNHC 4DV3M 2LH0A 1XXHB 3Q8XA 1E32A 3GLGB 2CV0A 4GIPA 4DR6M 3GLHA 4DV1M 4M9XA 4JI3M 4I5SA 4IBDA 3GPPA 3GPYA 2LWXA 4DR3M 1ZQ9A 3L26A 5DYGA 4QHSA 2UXDM 1E9SA 2Y21A 4JI0M 3M6AA 2CE7A 4LF7M 4D82A 4NL4H 2DZOB 3CF6E 1Z59A 3VLFB 3PXGA 4IBJA 4R7GA 2YNMD 3SC3A 4IBEA 5KPRA 1DGBA 2YR0A 5EXXA 3U6QA 2D7GA 1TGUA 3FUWA 1XMQM 1SXJA 4IIWA 3ZC7B 3FUTA 1FJGM 3A45A 4DV7M 1R2ZA 2DZNB 2ZANA 3HJQA 4L16A 1Q39A 2Z3XA 2BNKA 3GLIB 4MGKE 4PT5A 3KFUG 5ITQA 3GP1A 5C1BA 4DR2M 2C9CA 3J80S 1XWIA 2ZBKB 5EP3A 3HJSA 1IN8A 2A5YB 3VDUA 3RFWA 4B7FA 3GPUA 2KEBA 5KQDA 3U6DA 3M7GA 1HQCA 3UK6A 1DO2A 3KW6A 4DR5M 1R7RA 4CGYB 3EIEA 5FTLA 2LXEA 3VK8A 2DHRA 3J2PB 2G8LA 3KOZE 4QHTA 5KQ8A 4DUYM 1N36M 3HU2A 1K3XA 3HWSA 3AFHA 1UM8A 2EUCA 2OQ4A 4JYAM 3LMMA 1E9RA 3H4MA 1NHWC 1NJFA 5EP2A 4LG2A 4GITA 4IBKA 4G4OA 3PNVA 3VFDA 1TH3A 3KOXE 5EP4A 4PD2A 1IN4A 3B9PA 3L2AA 1D2NA 1GL7A 2XSZD 5LMNM 4IBBA 2Z4SA 3CF0A 1H6UA 4HLQA 3UZUA 3LVVA 3SASA 4LGMA 1QAMA 1IN6A 1L1ZA 4IBIA 1SXJC 5FTMA 4GC9A 4CISA 1IY0A 1Z5BA 5ITUA 3KOYE 1L2CA 1JR3A 4MGIE 4LY6A 1OFIA 3HU3A 3T1YM 1PJIA 3AKZA 2XFTA 2Y20A 2UXCM 1XMOM 1HNXM 3DA1A 2F5OA 2D7EA 4NOOB 5C18A 3FUVA 2JA2A 4IBFA 1PJJA 3AL0C 4FD2A 2D7HA 2XEPA 3FYCA 4BLCA 5FSWA 3UGJA 1S3SA 4GC5A 1IXZA 2OPFA 2AHMA 4LJ9A 3TWMA 1OJLA 1GL6A 2XFSA 2R4EA 3TL4X 1VDDA 3HGIA 4JI1M 5EP1A 3U5ZA 1QYRA 3GRRA 1WXQA 3LVWA 5EXTA 4GKKM 1L2BA 2DWLA 4LF8M 4DUZM 2UUAM 4Z6YA 2UXBM 2HHHM 2KW0A 5IZ7D 5E26A 2CHQA 4D80A 4JN6A 4II7A 2BJWA 3PVSA 1HNZM 4JXJA 4FCWA 4M0WA 2Q2EB 3AOEA 1DGGA 1N32M 1NY6A 3NWLA 1R2YA 4GHLA 3T38A 4OX9M 3SMSA 2F5NA 2VQFM 4FWHA 4DR7M 3WHKA 1G59A 3MJ5A 1J7KA 1KYIA 4OVZA 3GLFA 4K0KM 2R46A 5EXSA 4FWGA 1SXJD 5IT9S 1HT1E 4I8OA 1XXHA 5H37D 3GLGA 4NXMM 1J09A 2I7NA 4R3DA 4L78A 3UJNA 4NRWA 3GLHB 1XHBA 4WW0A 2NQ8C 3VKHA 5LMUM 2BJVA 1K82A 2KZUA 4LF5M 1DO0A 4GMQA 4QOSA 2RGOA 1QAOA 2QENA 4MGZE 3U6LA 2XF3A 4MH0E 3TWKA 4AG5A 2KRKA 3JR4A 4AI6A 2Y0TA 2YQZA 3SHFA 4D81A 3FTFA 4AQYM 2QCUA 1N77A 2E5LM 4IBGA 4KLNA 3U6OA 4B7HA 4JI5M 4YY3M 4FVMA 1SXJB 1PM5A 1IQPA 3J7BA 3K1JA 4IJEA 2ZM6M 1N75A 2DWZB 3KS4A 2X49A 3U60A 4X66M 5EQTA 1N33M 4MM3B 2H1RA 3E9SA 1JQJC 1DGFA 2CEAA 4HL4A 2J7NA 3L27A 3GPXA 4A3VB 2XLJA 2UUBM 2X8AA 1NNJA 1QQWA 1FNNA 1IN7A 4LRTA 3GO8A 2XZFA 1N78A 1E94E 3TE6A 4QNRA 3PFIA 2KRUA 4OU7A 1T3TA 1I94M 3J27B 4ZPXA 4X62M 3K2LA 2R18A 5JI3E 3KDSE 3U61A 5FTJA 3W0FA 4LFAM 1GLNA 4RNAA 2ERCA 4PDGA 3R8FA 5IWAM 3JR5A 1QZMA 2CHVA 2C98A 1IM2A 3SAVA 2QBYA 4NRVA 4AKHA 1TH4A 4L4UA 4JI2M 4P16A 4I4LA 5DNYA 3L29A 4LJ6A 3CF2A 4LJ8A 3GQ3A 3T1HM 2CUZA 2KZSA 4AZFA 1QANA 3D8LA 4RF1A 4PCZA 2XGNA 2C99A 3KP0E 2KXEA 4LFBM 1HR0M 3GQ4A 3I4VA 3FD9A 2DVWB 3QWLA 1DGHA 3U6MA 3D8BA 1GVNA 4NSOB 4XGIA 2EO2A 3U6CA 2M60A 3GQ5A 4B08A 3SHGB 3CTWB 3MK6A 4FCVA 5BR8M 2C5RA 2G5GX 2O5RA 4B3TM 2DXIA 4L15A 3TWLA 4GRIA 1IBMM 1IXRC 1L2DA 4DV0M 5KPTA 4LJ7A 3KP1E 2XH9A 2V1CA 4LJ5A 3RE8A 3WHLA 3U6SA 3SYKA 3W0LB 2RGHA 4ITQA 4LFCM 2EA0A 4IBCA 1HNWM 4DV4M 4LGYA 4FWDA 2FNAA 1TDZA 2R4JA 3J81S 1QAQA 1ZAEA 3GRUA 5ITYA 4LCBA 3FTCA 3T15A 4JI4M 2C96A 2R45A 3LQRA 2I7PA 3M0EA 1IBKM 1XNQM 4DR1M 3U6EA 3AJIB 3A42A 4Z8XA 4DR4M 2L7HA 4M9SA 4KHPM 4QOZC 4TUWA 2R65A 4I81A 3R9XB 5DYIA 4BBAA 1IN5A 3U6PA 4AW4A 4OVZB 3VKGA 3HJ8A 1W5SA 4LZJA 2CFOA 2YFQA 3GLFB 1L1TA 4QNMA 3K8ZA 4G4QA 5KO3A 2FOIC 4MB7A 1J5EM 1IBLM 4LRSA 1X37A 2UUCM 1R6BX 4RF0A 1Z5CA 4B3MM 1NSFA 1IXSB 1LV7A 4X65M 5FTNA 5ITXA 3A98B 3SARA 2V1UA 4JV5M 4GKJM 3C58A 4B3RM 3ZH9B 7CATA 3DFZA 2VQEM 3EIHA 5FTKA 4G6ZA 4BB9A 4LF9M 2X4AA 3RGSA 2UU9M 2CHGA 2R62A 4DV6M 4M9ZA 5E6JA 3GLIA 4EIWA 2QP9X 1NNUC 2RKOA 3GRYA 2F5QA 3J7AS 3I4YA 3AOEC 5A2QS 1G4AE 3E4RA 1YE9A 3RGPA 3TQSA 1MU5A 3U60B 5EXPA 4LJAA 4AKGA 1NVMA 4B7GA 1C1KA 1IY1A 2Y0QA 3FTEA 4KO8A 2VIIA 3SFZA 3FTDA 3SAUA 2FFJA 5ITTA 1NJGA 8CATA 5ITXE 3HHYA 4L8RC 1Q3CA 5ITRA 1I4WA 3UMMA 1IY2A 2F4VM 1JR3D 3OTOM 4S12A 4FCTA 3FYDA 3IG5A 1QVRA 1TH2A 3DZDA 4W5WA 2F5SA 4GH9A 3A46A 2J7OA 4LZZA 3U61B 2P5TA 1GKIA 3VDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF M;  4DR7 M;  4DV7 M;  1R2Z A;  3TWL A;  4G4R A;  4DV2 M;  1Q39 A;  1IBM M;  1L2D A;  4DV0 M;  3SBJ A;  5ITQ A;  3GP1 A;  4K0K M;  4DR2 M;  5IT9 S;  3J80 S;  4NXM M;  2ZBK B;  3GPU A;  2XZU A;  1EE8 A;  4NRW A;  3U6D A;  3U6S A;  5LMU M;  4ITQ A;  1K82 A;  4LFC M;  2F5P A;  2EA0 A;  4DV5 M;  4DR5 M;  4LF5 M;  1HNW M;  3VK8 A;  4DV4 M;  5FLX S;  1TDZ A;  4DUY M;  1N36 M;  3U6L A;  3J81 S;  5ITY A;  1K3X A;  3TWK A;  1KFV A;  3JR4 A;  4JYA M;  2OQ4 A;  4JI4 M;  1XNR M;  1IBK M;  3JAM S;  4AQY M;  4YHH M;  1XNQ M;  4DR1 M;  3U6O A;  2E5L M;  4JI5 M;  4YY3 M;  4G4O A;  3U6E A;  3A42 A;  4KHP M;  4DR4 M;  4PD2 A;  1PM5 A;  1TDH A;  4X64 M;  2ZM6 M;  3VK7 A;  5LMN M;  3DOA A;  4X66 M;  1N33 M;  3U6P A;  3SAS A;  4PDI A;  1L1T A;  1N34 M;  3SAT A;  4G4Q A;  4LF4 M;  4JI8 M;  1L1Z A;  1J5E M;  4MB7 A;  1IBL M;  3GPX A;  2UUB M;  2UUC M;  1NNJ A;  4JI7 M;  1XC8 A;  1K3W A;  2XZF A;  1Z5C A;  3GO8 A;  4B3M M;  4CIS A;  1Z5B A;  5ITU A;  1Q3B A;  4X65 M;  1I94 M;  1L2C A;  4NXN M;  5ITX A;  3SAR A;  1Z5A A;  4JV5 M;  4X62 M;  4GKJ M;  3T1Y M;  3C58 A;  1PJI A;  4B3T M;  4B3R M;  4LF6 M;  2UXC M;  3W0F A;  4LFA M;  1XMO M;  1HNX M;  2F5O A;  2VQE M;  4PDG A;  4G4N A;  4LF9 M;  1PJJ A;  2UU9 M;  4JI6 M;  5IWA M;  3SAW A;  3JR5 A;  4DV6 M;  3SAV A;  4NRV A;  1MX0 A;  2F5Q A;  4B3S M;  2HKJ A;  4JI2 M;  3J7A S;  4DV3 M;  3TWM A;  2OPF A;  5A2Q S;  4DR6 M;  1MU5 A;  4DV1 M;  3T1H M;  3GQ3 A;  4JI1 M;  4JI3 M;  3GPP A;  3GPY A;  4GKK M;  1L2B A;  4DR3 M;  3SAU A;  4PCZ A;  4LF8 M;  4DUZ M;  2UUA M;  5ITT A;  4LFB M;  2HHH M;  2UXB M;  2UXD M;  1HR0 M;  3GQ4 A;  4JI0 M;  5ITX E;  4LF7 M;  1Q3C A;  5ITR A;  1Z59 A;  2F4V M;  3U6M A;  1HNZ M;  3OTO M;  3U6Q A;  3U6C A;  3GQ5 A;  2Q2E B;  5BR8 M;  1XMQ M;  2F5S A;  3A46 A;  1N32 M;  1R2Y A;  1FJG M;  4OX9 M;  3A45 A;  2F5N A; 
#chains in the Genus database with same CATH topology
 3C3E A;  1OKS A;  1G41 A;  3LQQ A;  1SXJ E;  2LVN C;  4G4R A;  2QPA A;  2W82 A;  3L28 A;  3Q8G A;  1JB0 F;  5GKN A;  2L7I A;  4DV2 M;  3SBJ A;  2QBY B;  1VEJ A;  2EJS A;  3KS8 A;  3HHW A;  4REZ A;  1V34 A;  1OFH A;  2LVO C;  2XZU A;  1EE8 A;  1QUT A;  3HHX A;  4CHT B;  4MGY E;  3IG8 A;  2FE8 A;  3GRV A;  3HHZ A;  2F5P A;  4DV5 M;  3L25 A;  2L09 A;  2DAI A;  1UFZ A;  4LJ4 A;  1NHG C;  2MR9 A;  1W5T A;  1KSF X;  3K92 A;  3I51 A;  2BWB A;  4KOD A;  4AG6 A;  5FLX S;  3BOS A;  3QAU A;  2H5X A;  5EJC A;  1KFV A;  1V33 A;  2XSZ A;  2O01 F;  1DGH B;  1XNR M;  2CV1 A;  3JAM S;  1QUS A;  4YHH M;  1NY5 A;  3ZCB B;  2DWM A;  1DV0 A;  3B7N A;  2M5Z A;  3CGW A;  2KA6 B;  3AOG A;  4MGH A;  3KSJ A;  4AKI A;  1G8P A;  1TDH A;  4X64 M;  3VK7 A;  1MJG M;  4IJF A;  3KOW E;  3DOA A;  4WUR A;  3MHV C;  2ZAO A;  4XBO A;  1HT2 E;  4FW9 A;  3HKP A;  2Z7J A;  3U5Z B;  4PDI A;  2CV2 A;  1N34 M;  1YUB A;  2HCB A;  3SAT A;  4LF4 M;  1ZMW A;  4JI8 M;  2CWB A;  2QZ4 A;  2ZTC A;  3PNY A;  3FUX A;  1XC8 A;  1K3W A;  4JI7 M;  2V6Z M;  4M0D A;  5IRE B;  5L8R F;  4OW0 A;  3FE3 A;  1Q3B A;  4NXN M;  1QDT A;  1Z5A A;  3SMP A;  3AV0 A;  1D0L A;  2Z4R A;  1YSY A;  3THG A;  2C9O A;  2B3T A;  5KPZ A;  2XZF A;  4GHA A;  1OTR A;  2K47 A;  2ZAM A;  3KVW A;  2N35 A;  4LF6 M;  2DWN A;  3KXE C;  3ILK A;  1QDR A;  3FUU A;  5JI2 E;  4G4N A;  4NSR A;  3HU1 A;  2L6O A;  4JI6 M;  5BPV A;  3SAW A;  1HQY E;  2K0B X;  5F3W A;  1G3I A;  1L8Q A;  1Z6T A;  2VDB B;  3TPZ A;  2HL7 A;  3NBI A;  3SYL A;  1MX0 A;  3KSX A;  3NBX X;  2KNA A;  2HKJ A;  4B3S M;  1ORY B;  3FKE A;  2LNH C;  2L4E A;  4DV3 M;  2LH0 A;  5DFL A;  1XXH B;  3Q8X A;  1E32 A;  3GLG B;  2CV0 A;  4GIP A;  4DR6 M;  3GLH A;  4DV1 M;  4M9X A;  1G71 A;  4JI3 M;  4I5S A;  4IBD A;  1GJT A;  3GPP A;  4P17 A;  3GPY A;  1F4I A;  2LWX A;  4DR3 M;  1ZQ9 A;  3L26 A;  5DYG A;  4QHS A;  2UXD M;  1E9S A;  2Y21 A;  4JI0 M;  3M6A A;  2CE7 A;  4LF7 M;  4D82 A;  4NL4 H;  2DZO B;  3CF6 E;  1Q02 A;  1Z59 A;  3VLF B;  3PXG A;  4IBJ A;  3IHP A;  4R7G A;  2YNM D;  3SC3 A;  4IBE A;  5KPR A;  1DGB A;  2YR0 A;  5EXX A;  3U6Q A;  3E46 A;  2D7G A;  1YLA A;  2JXN A;  1TGU A;  3FUW A;  1XMQ M;  1SXJ A;  4IIW A;  3ZC7 B;  3FUT A;  1FJG M;  3A45 A;  4DV7 M;  1R2Z A;  2DZN B;  2ZAN A;  3HJQ A;  4L16 A;  1Q39 A;  3HZJ A;  2BNK A;  2Z3X A;  3GLI B;  4MGK E;  4PT5 A;  3KFU G;  3FRI A;  5ITQ A;  3GP1 A;  5C1B A;  4DR2 M;  2C9C A;  3J80 S;  2LBC A;  1XWI A;  2ZBK B;  5EP3 A;  3HJS A;  3GLF E;  1IN8 A;  2A5Y B;  2KHH A;  3RFW A;  3VDU A;  4B7F A;  3GPU A;  2KEB A;  5KQD A;  3U6D A;  3M7G A;  1HQC A;  1A5T A;  3UK6 A;  1DO2 A;  2R6F A;  3KW6 A;  1QZE A;  4DR5 M;  1R7R A;  4CGY B;  3EIE A;  5FTL A;  2LXE A;  3T6P A;  3VK8 A;  1TF0 B;  2DHR A;  3J2P B;  2FH0 A;  2G8L A;  3KOZ E;  4QHT A;  5KQ8 A;  4DUY M;  1N36 M;  3HU2 A;  1K3X A;  1MN3 A;  3HWS A;  3AFH A;  1UM8 A;  2EUC A;  2OQ4 A;  4JYA M;  3LMM A;  1E9R A;  3H4M A;  1NHW C;  1NJF A;  5EP2 A;  4LG2 A;  1WIV A;  4GIT A;  4IBK A;  4G4O A;  3PNV A;  3VFD A;  1TH3 A;  3KOX E;  1PJT A;  5EP4 A;  4PD2 A;  1IN4 A;  2DHY A;  3B9P A;  3L2A A;  1D2N A;  1GL7 A;  2XSZ D;  5LMN M;  4IBB A;  2Z4S A;  2DAK A;  3CF0 A;  1ZV1 A;  1H6U A;  2L4F A;  4HLQ A;  3UZU A;  3LVV A;  3SAS A;  1VQ1 A;  4LGM A;  2HAK A;  2OO9 A;  1QAM A;  1IN6 A;  1L1Z A;  4IBI A;  1AIP C;  1SXJ C;  2J5Y A;  5FTM A;  4GC9 A;  4CIS A;  1IY0 A;  1Z5B A;  5ITU A;  3KOY E;  1L2C A;  1JR3 A;  4MGI E;  4LY6 A;  1OFI A;  2O25 A;  3HU3 A;  3T1Y M;  3AKZ A;  1PJI A;  2XFT A;  1NV9 A;  2DAE A;  2Y20 A;  2UXC M;  1XMO M;  1HNX M;  3DA1 A;  2F5O A;  2D7E A;  4NOO B;  5C18 A;  3FUV A;  2JA2 A;  4IBF A;  1PJJ A;  3AL0 C;  4FD2 A;  2EKF A;  2VF7 A;  2D7H A;  2XEP A;  1TTE A;  3FYC A;  4BLC A;  5FSW A;  3UGJ A;  1S3S A;  4GC5 A;  1IXZ A;  2Z8Y M;  2AHM A;  4LJ9 A;  2OPF A;  1HJP A;  1OJL A;  1GL6 A;  1R5L A;  2XFS A;  2R4E A;  2JY7 A;  1VDD A;  1PGY A;  1VG5 A;  3HGI A;  3TL4 X;  3LCU A;  3W68 A;  4JI1 M;  5EP1 A;  3U5Z A;  1QYR A;  3GRR A;  1WXQ A;  1CUK A;  3LVW A;  5EXT A;  4GKK M;  1L2B A;  2DWL A;  3TWM A;  4XK8 F;  3LCV B;  4LF8 M;  4DUZ M;  2UUA M;  3GO8 A;  4Z6Y A;  2UXB M;  2HHH M;  1D0K A;  2KW0 A;  1JR3 E;  5IZ7 D;  5E26 A;  2CHQ A;  2EKK A;  4D80 A;  1NO1 A;  4JN6 A;  4II7 A;  2BJW A;  3PVS A;  1HNZ M;  4JXJ A;  1D0M A;  4FCW A;  4M0W A;  2Q2E B;  3AOE A;  1DGG A;  4Q7J A;  4UN2 B;  1N32 M;  1NY6 A;  3NWL A;  2K6B A;  1R2Y A;  1ZMU A;  4GHL A;  3T38 A;  4OX9 M;  3SMS A;  2F5N A;  2VQF M;  4FWH A;  4DR7 M;  3WHK A;  1PRB A;  1G59 A;  3MJ5 A;  1J7K A;  2LVQ D;  1KYI A;  4OVZ A;  3QYE A;  3C9P A;  3GLF A;  4K0K M;  2R46 A;  5EXS A;  4FWG A;  1SXJ D;  2MRO B;  4HEO A;  3I04 M;  5IT9 S;  1HT1 E;  4G3O A;  4I8O A;  1XXH A;  2KNZ A;  5H37 D;  3GLG A;  4NXM M;  1J09 A;  2I7N A;  4R3D A;  4L78 A;  3UJN A;  1P3Q Q;  2GNO A;  4NRW A;  2WSC F;  3GLH B;  1IXS A;  1XHB A;  2NQ8 C;  4WW0 A;  3VKH A;  5LMU M;  2BJV A;  1K82 A;  2KZU A;  3H4J A;  4LF5 M;  1DO0 A;  4GMQ A;  1VEK A;  4QOS A;  2RGO A;  3LW5 F;  2CP8 A;  1QAO A;  2JNH A;  2QEN A;  4MGZ E;  2LHC A;  3U6L A;  2XF3 A;  2DI0 A;  4MH0 E;  3TWK A;  4AG5 A;  2KRK A;  3JR4 A;  4AI6 A;  2OOB A;  2Y0T A;  2JUJ A;  2YQZ A;  3B7Z A;  3SHF A;  4D81 A;  3FTF A;  2APL A;  3C3D A;  2QCU A;  4AQY M;  1N77 A;  2E5L M;  4IBG A;  4KLN A;  3U6O A;  4B7H A;  4JI5 M;  4YY3 M;  4L6V 6;  4FVM A;  1SXJ B;  1PM5 A;  1IQP A;  3J7B A;  3K1J A;  4IJE A;  2ZM6 M;  1GAB A;  1N75 A;  2DWZ B;  3KS4 A;  2X49 A;  3U60 A;  4X66 M;  5EQT A;  1N33 M;  4KT0 F;  4MM3 B;  2H1R A;  1XXH E;  1JQJ C;  1DGF A;  3E9S A;  3GLG E;  2CEA A;  4HL4 A;  3F92 A;  2J7N A;  3L27 A;  2KDL A;  2MH8 A;  3GPX A;  4A3V B;  2XLJ A;  2UUB M;  2X8A A;  1NNJ A;  1FNN A;  1IN7 A;  1QQW A;  1EFU B;  2G3Q A;  1TR8 A;  2WSF F;  1E94 E;  4LRT A;  4QNR A;  3PFI A;  2KRU A;  3TE6 A;  4CJ6 A;  4OU7 A;  1T3T A;  2JWS A;  1I94 M;  3J27 B;  2DAG A;  4F2L A;  4ZPX A;  4X62 M;  3K2L A;  2R18 A;  5JI3 E;  1IFY A;  3KDS E;  3U61 A;  4GEW A;  5FTJ A;  3W0F A;  4LFA M;  1GLN A;  4RNA A;  2DEN A;  2ERC A;  2LVA A;  4PDG A;  4RKU F;  3R8F A;  5IWA M;  1V92 A;  1OIZ A;  1QZM A;  2CHV A;  1OAO C;  2C98 A;  1IM2 A;  3JR5 A;  3V76 A;  3SAV A;  2QBY A;  1GO5 A;  4NRV A;  2RRU A;  4AKH A;  1TH4 A;  4L4U A;  4JI2 M;  2OOA A;  4P16 A;  4I4L A;  5DNY A;  3L29 A;  3GLI E;  1T43 A;  4LJ6 A;  3CF2 A;  2GQF A;  4LJ8 A;  3GQ3 A;  2CUZ A;  3T1H M;  1WGL A;  2KZS A;  2DNA A;  2R44 A;  4AZF A;  2VF8 A;  1QAN A;  2MGW A;  3D8L A;  4RF1 A;  4PCZ A;  2XGN A;  2C99 A;  3KP0 E;  2KXE A;  4LFB M;  1HR0 M;  3GQ4 A;  3I4V A;  3FD9 A;  2DVW B;  3QWL A;  2JY6 B;  1DGH A;  1AUA A;  2LVP C;  3IEC A;  3U6M A;  3D8B A;  1GVN A;  4NSO B;  4XGI A;  2EO2 A;  3U6C A;  2M60 A;  3GQ5 A;  4B08 A;  3SHG B;  1VEG A;  3CTW B;  3MK6 A;  2JP7 A;  4FCV A;  5BR8 M;  2C5R A;  2G5G X;  1EIJ A;  2QNJ A;  2O5R A;  4B3T M;  2DXI A;  3B89 A;  1VDL A;  4L15 A;  3TWL A;  2WSE F;  4GRI A;  1IBM M;  1IXR C;  1L2D A;  4DV0 M;  5KPT A;  4LJ7 A;  3KP1 E;  1RU3 A;  2LTU A;  1LTM A;  1Y8G A;  2XH9 A;  2V1C A;  4LJ5 A;  2BWE A;  3RE8 A;  4DBG B;  3WHL A;  3U6S A;  3SYK A;  3W0L B;  2RGH A;  4CIZ A;  4ITQ A;  4LFC M;  2EA0 A;  4IBC A;  1HNW M;  4DV4 M;  4LGY A;  2KNV A;  4FWD A;  1NV8 A;  2FNA A;  1TDZ A;  2R4J A;  2QSF X;  3J81 S;  1QAQ A;  1ZAE A;  1R4G A;  3FRH A;  3GRU A;  5ITY A;  4LCB A;  2WZJ A;  3B7Q A;  3FTC A;  3I01 M;  1OIP A;  3T15 A;  4JI4 M;  2C96 A;  1T6O A;  2R45 A;  2I7P A;  3LQR A;  3M0E A;  1IBK M;  2JZ1 A;  1XNQ M;  4DR1 M;  3U6E A;  3AJI B;  3A42 A;  4Z8X A;  4DR4 M;  2L7H A;  4M9S A;  4KHP M;  4QOZ C;  1WJ7 A;  4TUW A;  2LHG A;  2R65 A;  4I81 A;  3R9X B;  2DKL A;  1C7Y A;  3HX3 A;  1WHC A;  3HY5 A;  5DYI A;  4Y28 F;  4BBA A;  1IN5 A;  3U6P A;  4AW4 A;  2DZL A;  1BVS A;  1XB2 B;  4OVZ B;  3VKG A;  3HJ8 A;  1W5S A;  1GJS A;  4LZJ A;  2CFO A;  2QQ8 A;  2YFQ A;  3ZQJ A;  3GLF B;  3K9P A;  2HWJ A;  1L1T A;  4QNM A;  2CRU A;  2DAM A;  3K8Z A;  4G4Q A;  5KO3 A;  2FOI C;  4MB7 A;  1J5E M;  1IBL M;  3QYB A;  1WGN A;  1X37 A;  4LRS A;  2UUC M;  1R6B X;  2K9D A;  4RF0 A;  1Z5C A;  4B3M M;  1NSF A;  1IXS B;  1LV7 A;  4X65 M;  3BBZ A;  1OAI A;  5FTN A;  4R71 A;  2FS1 A;  5ITX A;  3A98 B;  3SAR A;  2V1U A;  4JV5 M;  3W67 A;  4GKJ M;  1ZMV A;  3C58 A;  4B3R M;  3BXW A;  3ZH9 B;  7CAT A;  3K9O A;  3DFZ A;  2VQE M;  3EIH A;  5FTK A;  1PJS A;  4G6Z A;  4BB9 A;  4LF9 M;  2X4A A;  3RGS A;  2UU9 M;  2ZTD A;  2CHG A;  2R62 A;  3MMP A;  4ANR A;  4DV6 M;  4M9Z A;  5E6J A;  3GLI A;  4EIW A;  2JZ0 A;  1OQY A;  1NNU C;  2QP9 X;  2RKO A;  3GRY A;  2F5Q A;  3J7A S;  3I4Y A;  1PJQ A;  2JY5 A;  4F1I A;  3AOE C;  5A2Q S;  1G4A E;  3E4R A;  1YE9 A;  3RGP A;  1WR1 B;  3TQS A;  1MU5 A;  3U60 B;  5EXP A;  4LJA A;  2L2D A;  4AKG A;  1SG9 A;  1NVM A;  4B7G A;  3E21 A;  1C1K A;  1IY1 A;  2Y0Q A;  3FTE A;  1N78 A;  4KO8 A;  2VII A;  3GLH E;  3FTD A;  3B74 A;  3SFZ A;  3SAU A;  2FFJ A;  4WP2 A;  5ITT A;  1NJG A;  8CAT A;  5ITX E;  3HHY A;  4L8R C;  1Q3C A;  5ITR A;  1I4W A;  2JY8 A;  3UMM A;  1IY2 A;  2F4V M;  1JR3 D;  3OTO M;  4S12 A;  4FCT A;  2QHO B;  3FYD A;  3IG5 A;  1QVR A;  1TH2 A;  2R0I A;  3DZD A;  2MJ5 B;  4W5W A;  2F5S A;  4GH9 A;  3A46 A;  2J7O A;  4LZZ A;  3U61 B;  4NC6 A;  2P5T A;  1GKI A;  3VDP A; 
#chains in the Genus database with same CATH homology
 1G41 A;  3LQQ A;  1SXJ E;  4G4R A;  2QPA A;  2W82 A;  3L28 A;  5GKN A;  4DV2 M;  2L7I A;  3SBJ A;  2QBY B;  3KS8 A;  3HHW A;  4REZ A;  1OFH A;  2XZU A;  1EE8 A;  3HHX A;  4CHT B;  4MGY E;  3IG8 A;  2FE8 A;  3GRV A;  3HHZ A;  2F5P A;  4DV5 M;  3L25 A;  2L09 A;  4LJ4 A;  1NHG C;  1W5T A;  1KSF X;  3K92 A;  3I51 A;  4KOD A;  4AG6 A;  5FLX S;  3BOS A;  3QAU A;  5EJC A;  1KFV A;  2XSZ A;  1DGH B;  1XNR M;  2CV1 A;  3JAM S;  4YHH M;  1NY5 A;  3ZCB B;  2DWM A;  2M5Z A;  2KA6 B;  3AOG A;  4MGH A;  3KSJ A;  4AKI A;  1G8P A;  1TDH A;  4X64 M;  3VK7 A;  4IJF A;  3KOW E;  3DOA A;  4WUR A;  3MHV C;  2ZAO A;  4XBO A;  1HT2 E;  4FW9 A;  3HKP A;  2Z7J A;  3U5Z B;  4PDI A;  2CV2 A;  1N34 M;  1YUB A;  2HCB A;  3SAT A;  4LF4 M;  4JI8 M;  2QZ4 A;  3PNY A;  3FUX A;  1XC8 A;  1K3W A;  4JI7 M;  2V6Z M;  4M0D A;  5IRE B;  4OW0 A;  1Q3B A;  4NXN M;  3SMP A;  1Z5A A;  3AV0 A;  3THG A;  2Z4R A;  1YSY A;  2C9O A;  4GHA A;  5KPZ A;  2K47 A;  2ZAM A;  3KVW A;  4LF6 M;  2DWN A;  3KXE C;  3ILK A;  3FUU A;  5JI2 E;  4G4N A;  4NSR A;  3HU1 A;  2L6O A;  4JI6 M;  5BPV A;  3SAW A;  1HQY E;  5F3W A;  1G3I A;  1L8Q A;  1Z6T A;  3TPZ A;  2HL7 A;  3NBI A;  3SYL A;  1MX0 A;  3KSX A;  4B3S M;  2HKJ A;  1ORY B;  3FKE A;  2LNH C;  4DV3 M;  2LH0 A;  1XXH B;  3Q8X A;  1E32 A;  3GLG B;  2CV0 A;  4GIP A;  4DR6 M;  3GLH A;  4DV1 M;  4M9X A;  4JI3 M;  4I5S A;  4IBD A;  3GPP A;  3GPY A;  2LWX A;  4DR3 M;  1ZQ9 A;  3L26 A;  5DYG A;  4QHS A;  2UXD M;  1E9S A;  2Y21 A;  4JI0 M;  3M6A A;  2CE7 A;  4LF7 M;  4D82 A;  4NL4 H;  2DZO B;  3CF6 E;  1Z59 A;  3VLF B;  3PXG A;  4IBJ A;  4R7G A;  2YNM D;  3SC3 A;  4IBE A;  5KPR A;  1DGB A;  2YR0 A;  5EXX A;  3U6Q A;  2D7G A;  1TGU A;  3FUW A;  1XMQ M;  1SXJ A;  4IIW A;  3ZC7 B;  3FUT A;  1FJG M;  3A45 A;  4DV7 M;  1R2Z A;  2DZN B;  2ZAN A;  3HJQ A;  4L16 A;  1Q39 A;  2Z3X A;  2BNK A;  3GLI B;  4MGK E;  4PT5 A;  3KFU G;  5ITQ A;  3GP1 A;  5C1B A;  4DR2 M;  2C9C A;  3J80 S;  1XWI A;  2ZBK B;  5EP3 A;  3HJS A;  1IN8 A;  2A5Y B;  3VDU A;  3RFW A;  4B7F A;  3GPU A;  2KEB A;  5KQD A;  3U6D A;  3M7G A;  1HQC A;  3UK6 A;  1DO2 A;  3KW6 A;  4DR5 M;  1R7R A;  4CGY B;  3EIE A;  5FTL A;  2LXE A;  3VK8 A;  2DHR A;  3J2P B;  2G8L A;  3KOZ E;  4QHT A;  5KQ8 A;  4DUY M;  1N36 M;  3HU2 A;  1K3X A;  3HWS A;  3AFH A;  1UM8 A;  2EUC A;  2OQ4 A;  4JYA M;  3LMM A;  1E9R A;  3H4M A;  1NHW C;  1NJF A;  5EP2 A;  4LG2 A;  4GIT A;  4IBK A;  4G4O A;  3PNV A;  3VFD A;  1TH3 A;  3KOX E;  5EP4 A;  4PD2 A;  1IN4 A;  3B9P A;  3L2A A;  1D2N A;  1GL7 A;  2XSZ D;  5LMN M;  4IBB A;  2Z4S A;  3CF0 A;  1H6U A;  4HLQ A;  3UZU A;  3LVV A;  3SAS A;  4LGM A;  1QAM A;  1IN6 A;  1L1Z A;  4IBI A;  1SXJ C;  5FTM A;  4GC9 A;  4CIS A;  1IY0 A;  1Z5B A;  5ITU A;  3KOY E;  1L2C A;  1JR3 A;  4MGI E;  4LY6 A;  1OFI A;  3HU3 A;  3T1Y M;  1PJI A;  3AKZ A;  2XFT A;  2Y20 A;  2UXC M;  1XMO M;  1HNX M;  3DA1 A;  2F5O A;  2D7E A;  4NOO B;  5C18 A;  3FUV A;  2JA2 A;  4IBF A;  1PJJ A;  3AL0 C;  4FD2 A;  2D7H A;  2XEP A;  3FYC A;  4BLC A;  5FSW A;  3UGJ A;  1S3S A;  4GC5 A;  1IXZ A;  2OPF A;  2AHM A;  4LJ9 A;  3TWM A;  1OJL A;  1GL6 A;  2XFS A;  2R4E A;  3TL4 X;  1VDD A;  3HGI A;  4JI1 M;  5EP1 A;  3U5Z A;  1QYR A;  3GRR A;  1WXQ A;  3LVW A;  5EXT A;  4GKK M;  1L2B A;  2DWL A;  4LF8 M;  4DUZ M;  2UUA M;  4Z6Y A;  2UXB M;  2HHH M;  2KW0 A;  5IZ7 D;  5E26 A;  2CHQ A;  4D80 A;  4JN6 A;  4II7 A;  2BJW A;  3PVS A;  1HNZ M;  4JXJ A;  4FCW A;  4M0W A;  2Q2E B;  3AOE A;  1DGG A;  1N32 M;  1NY6 A;  3NWL A;  1R2Y A;  4GHL A;  3T38 A;  4OX9 M;  3SMS A;  2F5N A;  2VQF M;  4FWH A;  4DR7 M;  3WHK A;  1G59 A;  3MJ5 A;  1J7K A;  1KYI A;  4OVZ A;  3GLF A;  4K0K M;  2R46 A;  5EXS A;  4FWG A;  1SXJ D;  5IT9 S;  1HT1 E;  4I8O A;  1XXH A;  5H37 D;  3GLG A;  4NXM M;  1J09 A;  2I7N A;  4R3D A;  4L78 A;  3UJN A;  4NRW A;  3GLH B;  1XHB A;  4WW0 A;  2NQ8 C;  3VKH A;  5LMU M;  2BJV A;  1K82 A;  2KZU A;  4LF5 M;  1DO0 A;  4GMQ A;  4QOS A;  2RGO A;  1QAO A;  2QEN A;  4MGZ E;  3U6L A;  2XF3 A;  4MH0 E;  3TWK A;  4AG5 A;  2KRK A;  3JR4 A;  4AI6 A;  2Y0T A;  2YQZ A;  3SHF A;  4D81 A;  3FTF A;  4AQY M;  2QCU A;  1N77 A;  2E5L M;  4IBG A;  4KLN A;  3U6O A;  4B7H A;  4JI5 M;  4YY3 M;  4FVM A;  1SXJ B;  1PM5 A;  1IQP A;  3J7B A;  3K1J A;  4IJE A;  2ZM6 M;  1N75 A;  2DWZ B;  3KS4 A;  2X49 A;  3U60 A;  4X66 M;  5EQT A;  1N33 M;  4MM3 B;  2H1R A;  3E9S A;  1JQJ C;  1DGF A;  2CEA A;  4HL4 A;  2J7N A;  3L27 A;  3GPX A;  4A3V B;  2XLJ A;  2UUB M;  2X8A A;  1NNJ A;  1QQW A;  1FNN A;  1IN7 A;  4LRT A;  3GO8 A;  2XZF A;  1N78 A;  1E94 E;  3TE6 A;  4QNR A;  3PFI A;  2KRU A;  4OU7 A;  1T3T A;  1I94 M;  3J27 B;  4ZPX A;  4X62 M;  3K2L A;  2R18 A;  5JI3 E;  3KDS E;  3U61 A;  5FTJ A;  3W0F A;  4LFA M;  1GLN A;  4RNA A;  2ERC A;  4PDG A;  3R8F A;  5IWA M;  3JR5 A;  1QZM A;  2CHV A;  2C98 A;  1IM2 A;  3SAV A;  2QBY A;  4NRV A;  4AKH A;  1TH4 A;  4L4U A;  4JI2 M;  4P16 A;  4I4L A;  5DNY A;  3L29 A;  4LJ6 A;  3CF2 A;  4LJ8 A;  3GQ3 A;  3T1H M;  2CUZ A;  2KZS A;  4AZF A;  1QAN A;  3D8L A;  4RF1 A;  4PCZ A;  2XGN A;  2C99 A;  3KP0 E;  2KXE A;  4LFB M;  1HR0 M;  3GQ4 A;  3I4V A;  3FD9 A;  2DVW B;  3QWL A;  1DGH A;  3U6M A;  3D8B A;  1GVN A;  4NSO B;  4XGI A;  2EO2 A;  3U6C A;  2M60 A;  3GQ5 A;  4B08 A;  3SHG B;  3CTW B;  3MK6 A;  4FCV A;  5BR8 M;  2C5R A;  2G5G X;  2O5R A;  4B3T M;  2DXI A;  4L15 A;  3TWL A;  4GRI A;  1IBM M;  1IXR C;  1L2D A;  4DV0 M;  5KPT A;  4LJ7 A;  3KP1 E;  2XH9 A;  2V1C A;  4LJ5 A;  3RE8 A;  3WHL A;  3U6S A;  3SYK A;  3W0L B;  2RGH A;  4ITQ A;  4LFC M;  2EA0 A;  4IBC A;  1HNW M;  4DV4 M;  4LGY A;  4FWD A;  2FNA A;  1TDZ A;  2R4J A;  3J81 S;  1QAQ A;  1ZAE A;  3GRU A;  5ITY A;  4LCB A;  3FTC A;  3T15 A;  4JI4 M;  2C96 A;  2R45 A;  3LQR A;  2I7P A;  3M0E A;  1IBK M;  1XNQ M;  4DR1 M;  3U6E A;  3AJI B;  3A42 A;  4Z8X A;  4DR4 M;  2L7H A;  4M9S A;  4KHP M;  4QOZ C;  4TUW A;  2R65 A;  4I81 A;  3R9X B;  5DYI A;  4BBA A;  1IN5 A;  3U6P A;  4AW4 A;  4OVZ B;  3VKG A;  3HJ8 A;  1W5S A;  4LZJ A;  2CFO A;  2YFQ A;  3GLF B;  1L1T A;  4QNM A;  3K8Z A;  4G4Q A;  5KO3 A;  2FOI C;  4MB7 A;  1J5E M;  1IBL M;  4LRS A;  1X37 A;  2UUC M;  1R6B X;  4RF0 A;  1Z5C A;  4B3M M;  1NSF A;  1IXS B;  1LV7 A;  4X65 M;  5FTN A;  5ITX A;  3A98 B;  3SAR A;  2V1U A;  4JV5 M;  4GKJ M;  3C58 A;  4B3R M;  3ZH9 B;  7CAT A;  3DFZ A;  2VQE M;  3EIH A;  5FTK A;  4G6Z A;  4BB9 A;  4LF9 M;  2X4A A;  3RGS A;  2UU9 M;  2CHG A;  2R62 A;  4DV6 M;  4M9Z A;  5E6J A;  3GLI A;  4EIW A;  2QP9 X;  1NNU C;  2RKO A;  3GRY A;  2F5Q A;  3J7A S;  3I4Y A;  3AOE C;  5A2Q S;  1G4A E;  3E4R A;  1YE9 A;  3RGP A;  3TQS A;  1MU5 A;  3U60 B;  5EXP A;  4LJA A;  4AKG A;  1NVM A;  4B7G A;  1C1K A;  1IY1 A;  2Y0Q A;  3FTE A;  4KO8 A;  2VII A;  3SFZ A;  3FTD A;  3SAU A;  2FFJ A;  5ITT A;  1NJG A;  8CAT A;  5ITX E;  3HHY A;  4L8R C;  1Q3C A;  5ITR A;  1I4W A;  3UMM A;  1IY2 A;  2F4V M;  1JR3 D;  3OTO M;  4S12 A;  4FCT A;  3FYD A;  3IG5 A;  1QVR A;  1TH2 A;  3DZD A;  4W5W A;  2F5S A;  4GH9 A;  3A46 A;  2J7O A;  4LZZ A;  3U61 B;  2P5T A;  1GKI A;  3VDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...