1N36M

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n36M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n36M02
1Q3BA 3T1HM 3GPPA 4ITQA 5ITQA 3U6DA 2ZM6M 1K3XA 4DR4M 1L2DA 1XMQM 4LF7M 1XMOM 3GQ4A 3T1YM 5ITXA 2HHHM 4DR3M 4PCZA 4NXNM 4DUZM 4MB7A 2F5SA 1Q39A 4JI1M 1Q3CA 2OPFA 4DV1M 1KFVA 5ITYA 2F5QA 3TWLA 4LF9M 3A45A 3GQ5A 4DV3M 3U6CA 4NRVA 3SAWA 4DV6M 1N34M 4AQYM 1L1ZA 4JI2M 4LF8M 3DOAA 3C58A 1NNJA 1N32M 1EE8A 2UUAM 3U6SA 3U6EA 1HR0M 2Q2EB 3U6LA 2UU9M 2E5LM 1I94M 1MU5A 4KHPM 3J80S 3VK8A 1IBKM 2OQ4A 3GPYA 2ZBKB 3J81S 5BR8M 2VQEM 1Z59A 4PD2A 3TWKA 4X62M 4DV4M 4DV7M 4G4RA 3SBJA 4YHHM 1HNZM 3W0FA 4X66M 5ITXE 4LF5M 4JI0M 3U6PA 1PJIA 3U6OA 2UUBM 3OTOM 1XNRM 3GPUA 2UXBM 1XC8A 3SAUA 1MX0A 3JR4A 1PJJA 5ITRA 4YY3M 1TDZA 4DR2M 4PDIA 4B3RM 4DV5M 3SASA 3JR5A 1L2CA 2UXDM 1N33M 4B3SM 4K0KM 4DR5M 1K82A 2UXCM 1Z5AA 2F5PA 4G4OA 4JYAM 3GPXA 1IBLM 4OX9M 4NXMM 3JAMS 5A2QS 3U6QA 3J7AS 4DR7M 4X64M 3A42A 5LMNM 4LFAM 1K3WA 4G4QA 4G4NA 3VK7A 1PM5A 2EA0A 1XNQM 4DUYM 4PDGA 5ITUA 5IT9S 2XZUA 2F4VM 4NRWA 2UUCM 2XZFA 5LMUM 4CISA 4B3TM 2F5NA 1IBMM 1L1TA 4JI8M 4DR1M 1HNXM 1R2YA 1HNWM 1R2ZA 3GQ3A 4GKKM 1Z5CA 4LFCM 4LFBM 2F5OA 4X65M 3GO8A 4B3MM 5IWAM 5ITTA 3SAVA 4JI6M 3GP1A 5FLXS 4JI3M 4GKJM 1Z5BA 4JI5M 2HKJA 4DR6M 4DV0M 3SARA 4DV2M 1FJGM 1N36M 4JI7M 1L2BA 2VQFM 4JI4M 1TDHA 1J5EM 4LF6M 3TWMA 4JV5M 3A46A 4LF4M 3U6MA 3SATA
chains in the Genus database with same CATH superfamily
2X4AA 4Y28F 3K9PA 2HWJA 1SXJE 2K47A 2EUCA 4AKGA 5JI2E 1QAMA 3U5ZA 5EP4A 1K3XA 4FVMA 2LVQD 3PXGA 1L2DA 2Z4RA 4DR4M 2D7HA 1ZV1A 2QPAA 5DYGA 1QZEA 2WSFF 4PCZA 3GRUA 1WJ7A 3VLFB 2EO2A 3GLHB 4LRTA 2DAMA 2H1RA 4WP2A 3A98B 2CE7A 3GQ5A 3HY5A 1QDTA 3MJ5A 3FKEA 1TTEA 1JR3E 4M0WA 4JI2M 3QYBA 1R6BX 2K6BA 1IY0A 3C58A 1S3SA 2P5TA 1EE8A 3I4YA 3IG8A 2CFOA 3U6SA 2LWXA 3U6EA 1HR0M 2Q2EB 3ILKA 4LJ6A 1TH2A 3FTFA 5EXTA 3LVWA 3GLFB 3GLIA 3VK8A 2X49A 4ANRA 4R7GA 2OQ4A 2ZAOA 2L6OA 4LG2A 4DV4M 2R62A 4AKHA 2C98A 2L2DA 3W0FA 3I4VA 3SMPA 3U6OA 3M0EA 1XNRM 1PJSA 1EIJA 1ZAEA 1MX0A 4I8OA 4YY3M 3DFZA 1IN5A 1ZMUA 4GEWA 4OVZB 1TGUA 3FTDA 2DHRA 3HU2A 5GKNA 4PDIA 4DR2M 4DV5M 4L8RC 4D80A 1DGBA 1GLNA 1QAOA 4K0KM 1F4IA 3WHKA 2DVWB 2YNMD 2JY5A 4LGYA 1OIPA 1T43A 1LTMA 1R4GA 1X37A 3K2LA 4HEOA 3VDPA 2YFQA 1TR8A 1UFZA 3AV0A 3LQQA 4OX9M 4NXMM 5A2QS 1WIVA 2LBCA 3LMMA 2KXEA 3B89A 3L27A 1ZMVA 4ZPXA 1SXJD 2MR9A 3W67A 4A3VB 3FUWA 4GMQA 3FUTA 1PM5A 4MH0E 2C9OA 1CUKA 2DWNA 3MHVC 1IN4A 4IBCA 4LJ8A 3GLHA 2CRUA 3QYEA 2F4VM 2L7HA 4IBIA 1IFYA 2MGWA 2LVNC 3QWLA 5LMUM 2F5NA 3LCUA 4MGYE 2HAKA 3LCVB 2R0IA 1HNXM 1HNWM 4WURA 1NO1A 1PJQA 1YSYA 4KLNA 1HT2E 1PRBA 2Y21A 3J27B 3KOXE 5EP1A 5KPTA 4B3MM 2XGNA 2NQ8C 5E6JA 1QANA 5IWAM 4BBAA 1OTRA 2DZNB 4GC9A 4L78A 3GLFA 3VKHA 4LJ7A 4JI5M 4DR6M 3AOEA 1VDLA 2QSFX 2O01F 1XHBA 3SARA 4RKUF 4MGKE 1OKSA 1N36M 4M9SA 1L2BA 2L7IA 2FE8A 1FNNA 2CEAA 5EXXA 1GABA 3A46A 2JY8A 1TH3A 1IN8A 1T3TA 3R9XB 1J7KA 3SATA 4GH9A 3VFDA 4OVZA 1VEGA 3IG5A 4LRSA 3GPPA 4KO8A 1Q02A 2KNVA 3U6DA 1QQWA 2ZM6M 7CATA 1J09A 4RF0A 4QHTA 5ITXA 3BOSA 2HHHM 5KQ8A 4DR3M 1MN3A 4FCTA 2KRKA 1V92A 2OPFA 3FUUA 3SHGB 3TL4X 2LHGA 3HJSA 1E9RA 2LH0A 3B7QA 2DI0A 2XF3A 2QQ8A 4IJEA 3A45A 3MMPA 2Z3XA 2CV2A 2DWLA 3SAWA 3NWLA 1R5LA 2R18A 3AOGA 3LVVA 4UN2B 3UJNA 3DA1A 3FTEA 3DOAA 4QHSA 1NNJA 1N32M 1VDDA 3AKZA 1QVRA 1NNUC 2KNZA 1OFHA 2UUAM 4GHAA 3K8ZA 5EQTA 3SHFA 3PNYA 3U6LA 3B7ZA 2LVPC 2LXEA 3KDSE 3T38A 2UU9M 1MU5A 4BB9A 2CP8A 2I7PA 1IBKM 1QUTA 2ZBKB 5BPVA 3J81S 2DWZB 4PD2A 4X62M 4G4RA 3GLIE 1HNZM 2C5RA 2BWBA 2R44A 4JI0M 2MJ5B 5EP2A 1ORYB 3FYCA 3GPUA 2DENA 2ZAMA 1LV7A 3HHZA 4CIZA 3M6AA 1D0LA 4R71A 5EXSA 3FRIA 4CJ6A 3CGWA 1PJJA 2KA6B 5ITRA 3EIHA 2OO9A 2XFTA 3SASA 3VDUA 1HT1E 4DBGB 4QOZC 1XWIA 1K82A 2ZTDA 1OFIA 2FOIC 2UXCM 1XXHB 2F5PA 2L09A 2J5YA 3M7GA 1G71A 1IXZA 2L4EA 2KZUA 3KP1E 2CUZA 5H37D 3C3DA 1IBLM 2R45A 4LJAA 4FW9A 4LZZA 3U6QA 4DR7M 4FCWA 1ZQ9A 4IJFA 1BVSA 3C3EA 4G4QA 4G4NA 3VK7A 2D7GA 5DNYA 4DUYM 2EJSA 3AFHA 1RU3A 2EKFA 2QCUA 3J7BA 3L29A 4EIWA 2RGHA 3HU1A 2JUJA 4FD2A 3E21A 1IY1A 4I4LA 1NHWC 2UUCM 2OOAA 3GRVA 2JY7A 2XSZA 3AOEC 1IBMM 4JI8M 4LJ5A 1TH4A 2M60A 1GVNA 4GKKM 1Z5CA 2W82A 1L8QA 1YLAA 5EP3A 2DXIA 4FWDA 2BNKA 3BXWA 2A5YB 4LFCM 2F5OA 4S12A 2KRUA 2RRUA 2DNAA 3AJIB 4IIWA 2EKKA 3SAVA 2K0BX 5FLXS 3W68A 3CF2A 1N78A 3GRYA 2HKJA 2C96A 3K9OA 3EIEA 2KNAA 4IBKA 5E26A 5KPRA 2D7EA 2FS1A 2MROB 3HZJA 1JR3A 1G59A 1WXQA 3UGJA 3HJQA 2ERCA 3C9PA 1WHCA 3FTCA 4AG6A 1OAIA 3SYLA 4LF4M 4M9ZA 4JV5M 3R8FA 4QNMA 3Q8GA 2I7NA 3TE6A 2LHCA 4LJ9A 3KFUG 1Y8GA 3L25A 1UM8A 1Q3BA 1N77A 3T1HM 3U60B 4XGIA 4ITQA 5ITQA 1XMQM 4MGZE 1XXHA 3GQ4A 2QNJA 4Z8XA 1E94E 4MB7A 4AI6A 2F5SA 1QYRA 4JI1M 3D8LA 1IQPA 2BJVA 3I01M 8CATA 4DV1M 2JZ1A 3B7NA 4CGYB 1QZMA 5ITYA 2BJWA 3FUXA 1IXSB 2DAIA 5L8RF 3RGPA 4LF9M 2JNHA 2L4FA 3FD9A 3FRHA 3U6CA 1OAOC 4DV6M 1DGHB 2RKOA 4Z6YA 1W5SA 3SFZA 2QHOB 1WGLA 2JY6B 3TQSA 4LF8M 3L28A 4AW4A 3HJ8A 3GLGE 1G8PA 1T6OA 3CF6E 1GL7A 2KHHA 2DZLA 2DAKA 3KOZE 1JQJC 3E46A 5FTLA 2E5LM 1I94M 4KHPM 3J80S 4NC6A 4AG5A 5BR8M 1Z59A 3T6PA 1SG9A 3TWKA 1Z6TA 3UK6A 2H5XA 4YHHM 2LNHC 2XH9A 4CHTB 1AUAA 4L6V6 1PJIA 2GNOA 1V33A 4BLCA 1DO2A 1IXRC 2UXBM 1GJSA 5IZ7D 2JWSA 3L26A 1SXJB 4G6ZA 3KOYE 3JR4A 3SAUA 1XC8A 3VKGA 1TDZA 3QAUA 1C7YA 1A5TA 3B9PA 3U61B 5DYIA 3JR5A 3KS4A 2WZJA 4JXJA 4KT0F 4B7HA 1HQYE 1L2CA 1N33M 2J7OA 3PVSA 4M0DA 1E32A 3V76A 3HWSA 3LQRA 4FCVA 2DAEA 4G4OA 3U60A 1G41A 1PJTA 4JYAM 4PT5A 1IM2A 2K9DA 3GPXA 2CHVA 1R7RA 2FFJA 2V1CA 3H4MA 3PFIA 4I81A 3ZH9B 4LCBA 4KODA 2C9CA 4D81A 4GRIA 5FTJA 2YR0A 3A42A 4G3OA 5LMNM 4LFAM 1K3WA 5FSWA 4XK8F 4XBOA 3SMSA 2EA0A 3HGIA 2XLJA 2DHYA 4IBEA 3DZDA 3HX3A 1IXSA 1NHGC 4NRWA 2XZFA 5F3WA 1NV9A 3HHWA 4GHLA 4LZJA 4NSOB 1L1TA 1DGHA 4B08A 4DR1M 4P17A 3H4JA 4RNAA 3GQ3A 2XEPA 1AIPC 2BWEA 3HKPA 3CTWB 2DKLA 2G8LA 1W5TA 4LFBM 2JP7A 3I04M 4X65M 3B74A 2CHQA 4Q7JA 2M5ZA 1NJFA 5ITTA 4TUWA 2KDLA 4LGMA 1WGNA 2G3QA 4M9XA 4REZA 3GP1A 1D0KA 4W5WA 1Z5BA 4FWHA 1E9SA 3J2PB 3W0LB 1IY2A 2C99A 2OOBA 1D0MA 1YE9A 1G3IA 1IN6A 3L2AA 5IREB 4DV2M 4F2LA 2N35A 3PNVA 4LJ4A 2LVOC 4OU7A 3KSXA 2WSCF 5EJCA 2VQFM 4JI4M 1TDHA 3UMMA 1VEJA 4I5SA 1J5EM 3TWMA 4MGHA 2VF8A 2R65A 1SXJA 1DV0A 3U6MA 4B3SM 2LVAA 3KVWA 2XFSA 3GLHE 3HHYA 1KSFX 1C1KA 4QOSA 4MGIE 1YUBA 3K1JA 3KXEC 2FH0A 4NSRA 4R3DA 2CHGA 1HJPA 4B7GA 3U61A 1EFUB 2RGOA 5KO3A 4JN6A 2CV0A 2VF7A 3UZUA 4LF7M 1XMOM 3T1YM 3E4RA 1DO0A 3HU3A 1MJGM 2QZ4A 4D82A 1QDRA 4NXNM 2YQZA 1NY5A 1XXHE 2HL7A 4HL4A 4DUZM 3ZC7B 1Q39A 1VEKA 1Q3CA 2X8AA 1NVMA 3FUVA 2G5GX 1KFVA 3GLFE 2F5QA 5C1BA 3TWLA 1G4AE 2KEBA 4LY6A 4DV3M 4F1IA 4GITA 1GJTA 4NRVA 2VDBB 4P16A 1N34M 4AQYM 1L1ZA 1QAQA 4IBDA 4MM3B 1N75A 2JXNA 4GIPA 3BBZA 4IBBA 2O5RA 5KQDA 2Z7JA 2QBYB 1H6UA 1NSFA 3ZQJA 2Y0QA 4RF1A 3THGA 1GL6A 3AL0C 2JZ0A 1HQCA 1OQYA 3ZCBB 3GPYA 3RGSA 2V6ZM 2R6FA 5JI3E 2VQEM 1JB0F 5EXPA 2HCBA 4DV7M 3TPZA 3KOWE 3E9SA 3SBJA 1GO5A 1WR1B 2XSZD 4X66M 5ITXE 4LF5M 3U6PA 4HLQA 1IN7A 2UUBM 3OTOM 4IBJA 3GLGB 1D2NA 3NBIA 2R46A 3K92A 5KPZA 2MH8A 3LW5F 1KYIA 4B3RM 4AKIA 1QUSA 2QENA 2QP9X 4NOOB 2DWMA 2DAGA 2JA2A 3U5ZB 2UXDM 1ZMWA 4DR5M 4II7A 1Z5AA 5FTNA 2AHMA 3CF0A 2ZANA 2LTUA 1JR3D 2CV1A 3SC3A 4L4UA 3JAMS 4QNRA 3J7AS 1I4WA 2Y20A 4FWGA 2R4EA 3D8BA 3FE3A 4X64M 1DGGA 2APLA 2B3TA 3HHXA 2J7NA 4NL4H 2V1UA 1DGFA 3I51A 4L16A 5DFLA 3RFWA 2Z4SA 1NV8A 2CWBA 1XNQM 2VIIA 4IBGA 4B7FA 4PDGA 5ITUA 5IT9S 2XZUA 2Y0TA 4IBFA 3FYDA 3NBXX 2Z8YM 4L15A 1PGYA 1GKIA 4CISA 1NY6A 3IECA 3SYKA 4B3TM 3KS8A 4OW0A 3T15A 1V34A 3KP0E 1R2YA 1R2ZA 3WHLA 2R4JA 2GQFA 4WW0A 3GLIB 3Q8XA 5C18A 2QBYA 1SXJC 3MK6A 3GO8A 3KW6A 2O25A 3IHPA 3KSJA 4AZFA 4JI6M 2DZOB 1VQ1A 4JI3M 4GKJM 1OJLA 3F92A 4DV0M 5FTKA 5FTMA 1NJGA 2KZSA 2KW0A 1XB2B 1FJGM 1VG5A 4JI7M 3GRRA 1OIZA 2FNAA 3RE8A 1P3QQ 4LF6M 2ZTCA 3GLGA 1TF0B 2WSEF 4GC5A
chains in the Genus database with same CATH topology
2X4AA 1SXJE 2K47A 2EUCA 4AKGA 5JI2E 1QAMA 3U5ZA 5EP4A 1K3XA 4FVMA 3PXGA 4DR4M 1L2DA 2Z4RA 2D7HA 2QPAA 5DYGA 4PCZA 3GRUA 3VLFB 2EO2A 3GLHB 4LRTA 2H1RA 3A98B 2CE7A 3GQ5A 3MJ5A 3FKEA 4JI2M 4M0WA 1R6BX 3C58A 1IY0A 1S3SA 2P5TA 1EE8A 3I4YA 3IG8A 2CFOA 3U6SA 2LWXA 3U6EA 1HR0M 2Q2EB 3ILKA 4LJ6A 1TH2A 3FTFA 5EXTA 3LVWA 3GLFB 3GLIA 3VK8A 2X49A 4R7GA 2OQ4A 2ZAOA 2L6OA 4LG2A 4DV4M 2R62A 4AKHA 2C98A 3W0FA 3I4VA 3SMPA 3U6OA 3M0EA 1XNRM 1ZAEA 1MX0A 4I8OA 4YY3M 3DFZA 1IN5A 4OVZB 4DR2M 1TGUA 3FTDA 2DHRA 3HU2A 5GKNA 4PDIA 4DV5M 4L8RC 4D80A 1DGBA 1GLNA 1QAOA 4K0KM 3WHKA 2DVWB 2YNMD 4LGYA 1X37A 3K2LA 3VDPA 2YFQA 3AV0A 3LQQA 4OX9M 4NXMM 5A2QS 3LMMA 2KXEA 3L27A 4ZPXA 1SXJD 4A3VB 3FUWA 4GMQA 3FUTA 1PM5A 4MH0E 2C9OA 2DWNA 3MHVC 1IN4A 4IBCA 4LJ8A 3GLHA 2F4VM 2L7HA 4IBIA 5LMUM 3QWLA 2F5NA 4MGYE 1HNXM 1HNWM 4WURA 1YSYA 4KLNA 1HT2E 2Y21A 3J27B 3KOXE 5EP1A 5KPTA 4B3MM 2XGNA 2NQ8C 5E6JA 1QANA 5IWAM 4BBAA 2DZNB 4GC9A 4L78A 3GLFA 3VKHA 4LJ7A 4JI5M 4DR6M 3AOEA 3SARA 1XHBA 4MGKE 1N36M 4M9SA 1L2BA 2L7IA 2FE8A 1FNNA 2CEAA 5EXXA 3A46A 1TH3A 1IN8A 1T3TA 3R9XB 1J7KA 3SATA 4GH9A 3VFDA 4OVZA 3IG5A 4LRSA 3GPPA 4KO8A 3U6DA 1QQWA 2ZM6M 7CATA 1J09A 4RF0A 4QHTA 5ITXA 3BOSA 2HHHM 5KQ8A 4DR3M 4FCTA 2KRKA 2OPFA 3FUUA 3SHGB 3TL4X 3HJSA 1E9RA 2LH0A 2XF3A 4IJEA 3A45A 2Z3XA 2CV2A 2DWLA 3SAWA 3NWLA 2R18A 3AOGA 3LVVA 3UJNA 3FTEA 3DA1A 3DOAA 4QHSA 1NNJA 1N32M 1VDDA 3AKZA 1QVRA 1NNUC 2UUAM 1OFHA 4GHAA 3K8ZA 5EQTA 3SHFA 3PNYA 3U6LA 2LXEA 3KDSE 3T38A 2UU9M 1MU5A 4BB9A 2I7PA 1IBKM 2ZBKB 5BPVA 3J81S 2DWZB 4PD2A 4X62M 4G4RA 1HNZM 2C5RA 4JI0M 5EP2A 1ORYB 3FYCA 3GPUA 2ZAMA 3HHZA 1LV7A 3M6AA 5EXSA 1PJJA 2KA6B 5ITRA 3EIHA 2XFTA 3SASA 3VDUA 1HT1E 4QOZC 1XWIA 1K82A 1OFIA 2FOIC 2UXCM 1XXHB 2F5PA 2L09A 3M7GA 1IXZA 2KZUA 3KP1E 2CUZA 5H37D 1IBLM 2R45A 4LJAA 4FW9A 4LZZA 3U6QA 4DR7M 4FCWA 1ZQ9A 4IJFA 4G4QA 4G4NA 3VK7A 2D7GA 5DNYA 4DUYM 3AFHA 3L29A 2QCUA 3J7BA 4EIWA 2RGHA 3HU1A 4I4LA 4FD2A 1IY1A 1NHWC 2UUCM 3GRVA 3AOEC 2XSZA 1IBMM 4JI8M 4LJ5A 1TH4A 2M60A 1GVNA 4GKKM 1Z5CA 2W82A 1L8QA 5EP3A 2DXIA 4FWDA 2BNKA 4LFCM 2A5YB 2F5OA 4S12A 2KRUA 3AJIB 4IIWA 3SAVA 5FLXS 3CF2A 1N78A 3GRYA 2HKJA 2C96A 4IBKA 3EIEA 5E26A 5KPRA 2D7EA 1JR3A 1G59A 1WXQA 3UGJA 3HJQA 2ERCA 3FTCA 4AG6A 4JV5M 3SYLA 4LF4M 4M9ZA 3R8FA 4QNMA 2I7NA 3TE6A 4LJ9A 3KFUG 3L25A 1UM8A 1Q3BA 1N77A 3T1HM 3U60B 4XGIA 4ITQA 5ITQA 1XMQM 4MGZE 1XXHA 3GQ4A 4Z8XA 1E94E 4MB7A 4AI6A 2F5SA 1QYRA 4JI1M 3D8LA 1IQPA 2BJVA 8CATA 4DV1M 4CGYB 1QZMA 5ITYA 2BJWA 3FUXA 1IXSB 3RGPA 4LF9M 3FD9A 3U6CA 4DV6M 1DGHB 2RKOA 4Z6YA 1W5SA 3SFZA 3TQSA 4LF8M 3L28A 4AW4A 3HJ8A 1G8PA 3CF6E 1GL7A 3KOZE 1JQJC 5FTLA 2E5LM 1I94M 4KHPM 3J80S 4AG5A 5BR8M 1Z59A 3TWKA 1Z6TA 3UK6A 4YHHM 2LNHC 2XH9A 4CHTB 1PJIA 4BLCA 1DO2A 1IXRC 2UXBM 5IZ7D 3L26A 1SXJB 4G6ZA 3KOYE 3JR4A 3SAUA 1XC8A 3VKGA 1TDZA 3QAUA 3B9PA 3U61B 5DYIA 3JR5A 3KS4A 4B7HA 4JXJA 1L2CA 1N33M 1HQYE 2J7OA 3PVSA 4M0DA 1E32A 3HWSA 3LQRA 4FCVA 4G4OA 3U60A 1G41A 4JYAM 4PT5A 1IM2A 3GPXA 2CHVA 1R7RA 2FFJA 2V1CA 3H4MA 3PFIA 4I81A 3ZH9B 4LCBA 4KODA 2C9CA 4D81A 4GRIA 5FTJA 2YR0A 3A42A 5LMNM 4LFAM 1K3WA 5FSWA 4XBOA 3SMSA 2EA0A 3HGIA 2XLJA 4IBEA 3DZDA 1NHGC 4NRWA 2XZFA 5F3WA 3HHWA 4GHLA 4LZJA 4NSOB 1L1TA 1DGHA 4B08A 4DR1M 4RNAA 3GQ3A 2XEPA 3HKPA 3CTWB 2G8LA 1W5TA 4LFBM 4X65M 2CHQA 2M5ZA 1NJFA 5ITTA 4TUWA 4LGMA 3GP1A 4M9XA 4REZA 4W5WA 1Z5BA 4FWHA 1E9SA 3J2PB 3W0LB 1IY2A 2C99A 3L2AA 1YE9A 5IREB 1G3IA 1IN6A 4DV2M 3PNVA 4LJ4A 4OU7A 2VQFM 3KSXA 5EJCA 4JI4M 1TDHA 3UMMA 1J5EM 4I5SA 3TWMA 4MGHA 2R65A 1SXJA 3U6MA 4B3SM 3KVWA 2XFSA 3HHYA 1KSFX 1C1KA 4QOSA 4MGIE 1YUBA 3K1JA 3KXEC 4NSRA 4R3DA 4B7GA 2CHGA 3U61A 2RGOA 5KO3A 2CV0A 4JN6A 3UZUA 4LF7M 1XMOM 3T1YM 3E4RA 1DO0A 3HU3A 2QZ4A 4D82A 4NXNM 2YQZA 1NY5A 2HL7A 4HL4A 4DUZM 3ZC7B 1Q39A 1Q3CA 2X8AA 1NVMA 3FUVA 2G5GX 1KFVA 2F5QA 5C1BA 3TWLA 1G4AE 2KEBA 4LY6A 4DV3M 4GITA 4NRVA 4P16A 1N34M 4AQYM 1L1ZA 1QAQA 4IBDA 4MM3B 1N75A 4GIPA 4IBBA 2O5RA 5KQDA 2Z7JA 2QBYB 1H6UA 1NSFA 2Y0QA 4RF1A 3THGA 1GL6A 3AL0C 1HQCA 3ZCBB 3GPYA 3RGSA 2V6ZM 5JI3E 2VQEM 4DV7M 5EXPA 2HCBA 3TPZA 3KOWE 3E9SA 3SBJA 2XSZD 4X66M 5ITXE 4LF5M 3U6PA 4HLQA 1IN7A 2UUBM 3OTOM 4IBJA 3GLGB 1D2NA 3NBIA 2R46A 3K92A 5KPZA 1KYIA 4B3RM 4AKIA 2QENA 2QP9X 4NOOB 2DWMA 2UXDM 2JA2A 3U5ZB 4DR5M 4II7A 1Z5AA 5FTNA 2AHMA 3CF0A 2ZANA 1JR3D 2CV1A 3SC3A 4L4UA 3JAMS 4QNRA 3J7AS 1I4WA 2Y20A 4FWGA 2R4EA 3D8BA 4X64M 1DGGA 3HHXA 2J7NA 4NL4H 2V1UA 1DGFA 3I51A 4L16A 3RFWA 2Z4SA 1XNQM 2VIIA 4IBGA 4B7FA 4PDGA 5ITUA 5IT9S 2XZUA 2Y0TA 4IBFA 3FYDA 4L15A 1GKIA 4CISA 1NY6A 3SYKA 4B3TM 3KS8A 4OW0A 3T15A 3KP0E 1R2YA 1R2ZA 3WHLA 2R4JA 4WW0A 3GLIB 3Q8XA 5C18A 2QBYA 1SXJC 3MK6A 3GO8A 3KW6A 3KSJA 4AZFA 4JI6M 2DZOB 4JI3M 4GKJM 1OJLA 4DV0M 5FTKA 5FTMA 1NJGA 2KZSA 2KW0A 1FJGM 4JI7M 3GRRA 2FNAA 3RE8A 4LF6M 3GLGA 4GC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3B A;  3T1H M;  3GPP A;  4ITQ A;  5ITQ A;  3U6D A;  2ZM6 M;  1K3X A;  4DR4 M;  1L2D A;  1XMQ M;  4LF7 M;  1XMO M;  3GQ4 A;  3T1Y M;  5ITX A;  2HHH M;  4DR3 M;  4PCZ A;  4NXN M;  4DUZ M;  4MB7 A;  2F5S A;  1Q39 A;  4JI1 M;  1Q3C A;  2OPF A;  4DV1 M;  1KFV A;  5ITY A;  2F5Q A;  3TWL A;  4LF9 M;  3A45 A;  3GQ5 A;  4DV3 M;  3U6C A;  4NRV A;  3SAW A;  4DV6 M;  1N34 M;  4AQY M;  1L1Z A;  4JI2 M;  4LF8 M;  3DOA A;  3C58 A;  1NNJ A;  1N32 M;  1EE8 A;  2UUA M;  3U6S A;  3U6E A;  1HR0 M;  2Q2E B;  3U6L A;  2UU9 M;  2E5L M;  1I94 M;  1MU5 A;  4KHP M;  3J80 S;  3VK8 A;  1IBK M;  2OQ4 A;  3GPY A;  2ZBK B;  3J81 S;  5BR8 M;  2VQE M;  1Z59 A;  4PD2 A;  3TWK A;  4X62 M;  4DV4 M;  4DV7 M;  4G4R A;  3SBJ A;  4YHH M;  1HNZ M;  3W0F A;  4X66 M;  5ITX E;  4LF5 M;  4JI0 M;  3U6P A;  1PJI A;  3U6O A;  2UUB M;  3OTO M;  1XNR M;  3GPU A;  2UXB M;  1XC8 A;  3SAU A;  1MX0 A;  3JR4 A;  1PJJ A;  5ITR A;  4YY3 M;  1TDZ A;  4DR2 M;  4PDI A;  4B3R M;  4DV5 M;  3SAS A;  3JR5 A;  1L2C A;  2UXD M;  1N33 M;  4B3S M;  4K0K M;  4DR5 M;  1K82 A;  2UXC M;  1Z5A A;  2F5P A;  4G4O A;  4JYA M;  3GPX A;  1IBL M;  4OX9 M;  4NXM M;  3JAM S;  5A2Q S;  3U6Q A;  3J7A S;  4DR7 M;  4X64 M;  3A42 A;  5LMN M;  4LFA M;  1K3W A;  4G4Q A;  4G4N A;  3VK7 A;  1PM5 A;  2EA0 A;  1XNQ M;  4DUY M;  4PDG A;  5ITU A;  5IT9 S;  2XZU A;  2F4V M;  4NRW A;  2UUC M;  2XZF A;  5LMU M;  4CIS A;  4B3T M;  2F5N A;  1IBM M;  1L1T A;  4JI8 M;  4DR1 M;  1HNX M;  1R2Y A;  1HNW M;  1R2Z A;  3GQ3 A;  4GKK M;  1Z5C A;  4LFC M;  4LFB M;  2F5O A;  4X65 M;  3GO8 A;  4B3M M;  5IWA M;  5ITT A;  3SAV A;  4JI6 M;  3GP1 A;  5FLX S;  4JI3 M;  4GKJ M;  1Z5B A;  4JI5 M;  2HKJ A;  4DR6 M;  4DV0 M;  3SAR A;  4DV2 M;  1FJG M;  1N36 M;  4JI7 M;  1L2B A;  2VQF M;  4JI4 M;  1TDH A;  1J5E M;  4LF6 M;  3TWM A;  4JV5 M;  3A46 A;  4LF4 M;  3U6M A;  3SAT A; 
#chains in the Genus database with same CATH topology
 2X4A A;  4Y28 F;  3K9P A;  2HWJ A;  1SXJ E;  2K47 A;  2EUC A;  4AKG A;  5JI2 E;  1QAM A;  3U5Z A;  5EP4 A;  1K3X A;  4FVM A;  2LVQ D;  3PXG A;  1L2D A;  2Z4R A;  4DR4 M;  2D7H A;  1ZV1 A;  2QPA A;  5DYG A;  1QZE A;  2WSF F;  4PCZ A;  3GRU A;  1WJ7 A;  3VLF B;  2EO2 A;  3GLH B;  4LRT A;  2DAM A;  2H1R A;  4WP2 A;  3A98 B;  2CE7 A;  3GQ5 A;  3HY5 A;  1QDT A;  3MJ5 A;  3FKE A;  1TTE A;  1JR3 E;  4M0W A;  4JI2 M;  3QYB A;  1R6B X;  2K6B A;  1IY0 A;  3C58 A;  1S3S A;  2P5T A;  1EE8 A;  3I4Y A;  3IG8 A;  2CFO A;  3U6S A;  2LWX A;  3U6E A;  1HR0 M;  2Q2E B;  3ILK A;  4LJ6 A;  1TH2 A;  3FTF A;  5EXT A;  3LVW A;  3GLF B;  3GLI A;  3VK8 A;  2X49 A;  4ANR A;  4R7G A;  2OQ4 A;  2ZAO A;  2L6O A;  4LG2 A;  4DV4 M;  2R62 A;  4AKH A;  2C98 A;  2L2D A;  3W0F A;  3I4V A;  3SMP A;  3U6O A;  3M0E A;  1XNR M;  1PJS A;  1EIJ A;  1ZAE A;  1MX0 A;  4I8O A;  4YY3 M;  3DFZ A;  1IN5 A;  1ZMU A;  4GEW A;  4OVZ B;  1TGU A;  3FTD A;  2DHR A;  3HU2 A;  5GKN A;  4PDI A;  4DR2 M;  4DV5 M;  4L8R C;  4D80 A;  1DGB A;  1GLN A;  1QAO A;  4K0K M;  1F4I A;  3WHK A;  2DVW B;  2YNM D;  2JY5 A;  4LGY A;  1OIP A;  1T43 A;  1LTM A;  1R4G A;  1X37 A;  3K2L A;  4HEO A;  3VDP A;  2YFQ A;  1TR8 A;  1UFZ A;  3AV0 A;  3LQQ A;  4OX9 M;  4NXM M;  5A2Q S;  1WIV A;  2LBC A;  3LMM A;  2KXE A;  3B89 A;  3L27 A;  1ZMV A;  4ZPX A;  1SXJ D;  2MR9 A;  3W67 A;  4A3V B;  3FUW A;  4GMQ A;  3FUT A;  1PM5 A;  4MH0 E;  2C9O A;  1CUK A;  2DWN A;  3MHV C;  1IN4 A;  4IBC A;  4LJ8 A;  3GLH A;  2CRU A;  3QYE A;  2F4V M;  2L7H A;  4IBI A;  1IFY A;  2MGW A;  2LVN C;  3QWL A;  5LMU M;  2F5N A;  3LCU A;  4MGY E;  2HAK A;  3LCV B;  2R0I A;  1HNX M;  1HNW M;  4WUR A;  1NO1 A;  1PJQ A;  1YSY A;  4KLN A;  1HT2 E;  1PRB A;  2Y21 A;  3J27 B;  3KOX E;  5EP1 A;  5KPT A;  4B3M M;  2XGN A;  2NQ8 C;  5E6J A;  1QAN A;  5IWA M;  4BBA A;  1OTR A;  2DZN B;  4GC9 A;  4L78 A;  3GLF A;  3VKH A;  4LJ7 A;  4JI5 M;  4DR6 M;  3AOE A;  1VDL A;  2QSF X;  2O01 F;  1XHB A;  3SAR A;  4RKU F;  4MGK E;  1OKS A;  1N36 M;  4M9S A;  1L2B A;  2L7I A;  2FE8 A;  1FNN A;  2CEA A;  5EXX A;  1GAB A;  3A46 A;  2JY8 A;  1TH3 A;  1IN8 A;  1T3T A;  3R9X B;  1J7K A;  3SAT A;  4GH9 A;  3VFD A;  4OVZ A;  1VEG A;  3IG5 A;  4LRS A;  3GPP A;  4KO8 A;  1Q02 A;  2KNV A;  3U6D A;  1QQW A;  2ZM6 M;  7CAT A;  1J09 A;  4RF0 A;  4QHT A;  5ITX A;  3BOS A;  2HHH M;  5KQ8 A;  4DR3 M;  1MN3 A;  4FCT A;  2KRK A;  1V92 A;  2OPF A;  3FUU A;  3SHG B;  3TL4 X;  2LHG A;  3HJS A;  1E9R A;  2LH0 A;  3B7Q A;  2DI0 A;  2XF3 A;  2QQ8 A;  4IJE A;  3A45 A;  3MMP A;  2Z3X A;  2CV2 A;  2DWL A;  3SAW A;  3NWL A;  1R5L A;  2R18 A;  3AOG A;  3LVV A;  4UN2 B;  3UJN A;  3DA1 A;  3FTE A;  3DOA A;  4QHS A;  1NNJ A;  1N32 M;  1VDD A;  3AKZ A;  1QVR A;  1NNU C;  2KNZ A;  1OFH A;  2UUA M;  4GHA A;  3K8Z A;  5EQT A;  3SHF A;  3PNY A;  3U6L A;  3B7Z A;  2LVP C;  2LXE A;  3KDS E;  3T38 A;  2UU9 M;  1MU5 A;  4BB9 A;  2CP8 A;  2I7P A;  1IBK M;  1QUT A;  2ZBK B;  5BPV A;  3J81 S;  2DWZ B;  4PD2 A;  4X62 M;  4G4R A;  3GLI E;  1HNZ M;  2C5R A;  2BWB A;  2R44 A;  4JI0 M;  2MJ5 B;  5EP2 A;  1ORY B;  3FYC A;  3GPU A;  2DEN A;  2ZAM A;  1LV7 A;  3HHZ A;  4CIZ A;  3M6A A;  1D0L A;  4R71 A;  5EXS A;  3FRI A;  4CJ6 A;  3CGW A;  1PJJ A;  2KA6 B;  5ITR A;  3EIH A;  2OO9 A;  2XFT A;  3SAS A;  3VDU A;  1HT1 E;  4DBG B;  4QOZ C;  1XWI A;  1K82 A;  2ZTD A;  1OFI A;  2FOI C;  2UXC M;  1XXH B;  2F5P A;  2L09 A;  2J5Y A;  3M7G A;  1G71 A;  1IXZ A;  2L4E A;  2KZU A;  3KP1 E;  2CUZ A;  5H37 D;  3C3D A;  1IBL M;  2R45 A;  4LJA A;  4FW9 A;  4LZZ A;  3U6Q A;  4DR7 M;  4FCW A;  1ZQ9 A;  4IJF A;  1BVS A;  3C3E A;  4G4Q A;  4G4N A;  3VK7 A;  2D7G A;  5DNY A;  4DUY M;  2EJS A;  3AFH A;  1RU3 A;  2EKF A;  2QCU A;  3J7B A;  3L29 A;  4EIW A;  2RGH A;  3HU1 A;  2JUJ A;  4FD2 A;  3E21 A;  1IY1 A;  4I4L A;  1NHW C;  2UUC M;  2OOA A;  3GRV A;  2JY7 A;  2XSZ A;  3AOE C;  1IBM M;  4JI8 M;  4LJ5 A;  1TH4 A;  2M60 A;  1GVN A;  4GKK M;  1Z5C A;  2W82 A;  1L8Q A;  1YLA A;  5EP3 A;  2DXI A;  4FWD A;  2BNK A;  3BXW A;  2A5Y B;  4LFC M;  2F5O A;  4S12 A;  2KRU A;  2RRU A;  2DNA A;  3AJI B;  4IIW A;  2EKK A;  3SAV A;  2K0B X;  5FLX S;  3W68 A;  3CF2 A;  1N78 A;  3GRY A;  2HKJ A;  2C96 A;  3K9O A;  3EIE A;  2KNA A;  4IBK A;  5E26 A;  5KPR A;  2D7E A;  2FS1 A;  2MRO B;  3HZJ A;  1JR3 A;  1G59 A;  1WXQ A;  3UGJ A;  3HJQ A;  2ERC A;  3C9P A;  1WHC A;  3FTC A;  4AG6 A;  1OAI A;  3SYL A;  4LF4 M;  4M9Z A;  4JV5 M;  3R8F A;  4QNM A;  3Q8G A;  2I7N A;  3TE6 A;  2LHC A;  4LJ9 A;  3KFU G;  1Y8G A;  3L25 A;  1UM8 A;  1Q3B A;  1N77 A;  3T1H M;  3U60 B;  4XGI A;  4ITQ A;  5ITQ A;  1XMQ M;  4MGZ E;  1XXH A;  3GQ4 A;  2QNJ A;  4Z8X A;  1E94 E;  4MB7 A;  4AI6 A;  2F5S A;  1QYR A;  4JI1 M;  3D8L A;  1IQP A;  2BJV A;  3I01 M;  8CAT A;  4DV1 M;  2JZ1 A;  3B7N A;  4CGY B;  1QZM A;  5ITY A;  2BJW A;  3FUX A;  1IXS B;  2DAI A;  5L8R F;  3RGP A;  4LF9 M;  2JNH A;  2L4F A;  3FD9 A;  3FRH A;  3U6C A;  1OAO C;  4DV6 M;  1DGH B;  2RKO A;  4Z6Y A;  1W5S A;  3SFZ A;  2QHO B;  1WGL A;  2JY6 B;  3TQS A;  4LF8 M;  3L28 A;  4AW4 A;  3HJ8 A;  3GLG E;  1G8P A;  1T6O A;  3CF6 E;  1GL7 A;  2KHH A;  2DZL A;  2DAK A;  3KOZ E;  1JQJ C;  3E46 A;  5FTL A;  2E5L M;  1I94 M;  4KHP M;  3J80 S;  4NC6 A;  4AG5 A;  5BR8 M;  1Z59 A;  3T6P A;  1SG9 A;  3TWK A;  1Z6T A;  3UK6 A;  2H5X A;  4YHH M;  2LNH C;  2XH9 A;  4CHT B;  1AUA A;  4L6V 6;  1PJI A;  2GNO A;  1V33 A;  4BLC A;  1DO2 A;  1IXR C;  2UXB M;  1GJS A;  5IZ7 D;  2JWS A;  3L26 A;  1SXJ B;  4G6Z A;  3KOY E;  3JR4 A;  3SAU A;  1XC8 A;  3VKG A;  1TDZ A;  3QAU A;  1C7Y A;  1A5T A;  3B9P A;  3U61 B;  5DYI A;  3JR5 A;  3KS4 A;  2WZJ A;  4JXJ A;  4KT0 F;  4B7H A;  1HQY E;  1L2C A;  1N33 M;  2J7O A;  3PVS A;  4M0D A;  1E32 A;  3V76 A;  3HWS A;  3LQR A;  4FCV A;  2DAE A;  4G4O A;  3U60 A;  1G41 A;  1PJT A;  4JYA M;  4PT5 A;  1IM2 A;  2K9D A;  3GPX A;  2CHV A;  1R7R A;  2FFJ A;  2V1C A;  3H4M A;  3PFI A;  4I81 A;  3ZH9 B;  4LCB A;  4KOD A;  2C9C A;  4D81 A;  4GRI A;  5FTJ A;  2YR0 A;  3A42 A;  4G3O A;  5LMN M;  4LFA M;  1K3W A;  5FSW A;  4XK8 F;  4XBO A;  3SMS A;  2EA0 A;  3HGI A;  2XLJ A;  2DHY A;  4IBE A;  3DZD A;  3HX3 A;  1IXS A;  1NHG C;  4NRW A;  2XZF A;  5F3W A;  1NV9 A;  3HHW A;  4GHL A;  4LZJ A;  4NSO B;  1L1T A;  1DGH A;  4B08 A;  4DR1 M;  4P17 A;  3H4J A;  4RNA A;  3GQ3 A;  2XEP A;  1AIP C;  2BWE A;  3HKP A;  3CTW B;  2DKL A;  2G8L A;  1W5T A;  4LFB M;  2JP7 A;  3I04 M;  4X65 M;  3B74 A;  2CHQ A;  4Q7J A;  2M5Z A;  1NJF A;  5ITT A;  4TUW A;  2KDL A;  4LGM A;  1WGN A;  2G3Q A;  4M9X A;  4REZ A;  3GP1 A;  1D0K A;  4W5W A;  1Z5B A;  4FWH A;  1E9S A;  3J2P B;  3W0L B;  1IY2 A;  2C99 A;  2OOB A;  1D0M A;  1YE9 A;  1G3I A;  1IN6 A;  3L2A A;  5IRE B;  4DV2 M;  4F2L A;  2N35 A;  3PNV A;  4LJ4 A;  2LVO C;  4OU7 A;  3KSX A;  2WSC F;  5EJC A;  2VQF M;  4JI4 M;  1TDH A;  3UMM A;  1VEJ A;  4I5S A;  1J5E M;  3TWM A;  4MGH A;  2VF8 A;  2R65 A;  1SXJ A;  1DV0 A;  3U6M A;  4B3S M;  2LVA A;  3KVW A;  2XFS A;  3GLH E;  3HHY A;  1KSF X;  1C1K A;  4QOS A;  4MGI E;  1YUB A;  3K1J A;  3KXE C;  2FH0 A;  4NSR A;  4R3D A;  2CHG A;  1HJP A;  4B7G A;  3U61 A;  1EFU B;  2RGO A;  5KO3 A;  4JN6 A;  2CV0 A;  2VF7 A;  3UZU A;  4LF7 M;  1XMO M;  3T1Y M;  3E4R A;  1DO0 A;  3HU3 A;  1MJG M;  2QZ4 A;  4D82 A;  1QDR A;  4NXN M;  2YQZ A;  1NY5 A;  1XXH E;  2HL7 A;  4HL4 A;  4DUZ M;  3ZC7 B;  1Q39 A;  1VEK A;  1Q3C A;  2X8A A;  1NVM A;  3FUV A;  2G5G X;  1KFV A;  3GLF E;  2F5Q A;  5C1B A;  3TWL A;  1G4A E;  2KEB A;  4LY6 A;  4DV3 M;  4F1I A;  4GIT A;  1GJT A;  4NRV A;  2VDB B;  4P16 A;  1N34 M;  4AQY M;  1L1Z A;  1QAQ A;  4IBD A;  4MM3 B;  1N75 A;  2JXN A;  4GIP A;  3BBZ A;  4IBB A;  2O5R A;  5KQD A;  2Z7J A;  2QBY B;  1H6U A;  1NSF A;  3ZQJ A;  2Y0Q A;  4RF1 A;  3THG A;  1GL6 A;  3AL0 C;  2JZ0 A;  1HQC A;  1OQY A;  3ZCB B;  3GPY A;  3RGS A;  2V6Z M;  2R6F A;  5JI3 E;  2VQE M;  1JB0 F;  5EXP A;  2HCB A;  4DV7 M;  3TPZ A;  3KOW E;  3E9S A;  3SBJ A;  1GO5 A;  1WR1 B;  2XSZ D;  4X66 M;  5ITX E;  4LF5 M;  3U6P A;  4HLQ A;  1IN7 A;  2UUB M;  3OTO M;  4IBJ A;  3GLG B;  1D2N A;  3NBI A;  2R46 A;  3K92 A;  5KPZ A;  2MH8 A;  3LW5 F;  1KYI A;  4B3R M;  4AKI A;  1QUS A;  2QEN A;  2QP9 X;  4NOO B;  2DWM A;  2DAG A;  2JA2 A;  3U5Z B;  2UXD M;  1ZMW A;  4DR5 M;  4II7 A;  1Z5A A;  5FTN A;  2AHM A;  3CF0 A;  2ZAN A;  2LTU A;  1JR3 D;  2CV1 A;  3SC3 A;  4L4U A;  3JAM S;  4QNR A;  3J7A S;  1I4W A;  2Y20 A;  4FWG A;  2R4E A;  3D8B A;  3FE3 A;  4X64 M;  1DGG A;  2APL A;  2B3T A;  3HHX A;  2J7N A;  4NL4 H;  2V1U A;  1DGF A;  3I51 A;  4L16 A;  5DFL A;  3RFW A;  2Z4S A;  1NV8 A;  2CWB A;  1XNQ M;  2VII A;  4IBG A;  4B7F A;  4PDG A;  5ITU A;  5IT9 S;  2XZU A;  2Y0T A;  4IBF A;  3FYD A;  3NBX X;  2Z8Y M;  4L15 A;  1PGY A;  1GKI A;  4CIS A;  1NY6 A;  3IEC A;  3SYK A;  4B3T M;  3KS8 A;  4OW0 A;  3T15 A;  1V34 A;  3KP0 E;  1R2Y A;  1R2Z A;  3WHL A;  2R4J A;  2GQF A;  4WW0 A;  3GLI B;  3Q8X A;  5C18 A;  2QBY A;  1SXJ C;  3MK6 A;  3GO8 A;  3KW6 A;  2O25 A;  3IHP A;  3KSJ A;  4AZF A;  4JI6 M;  2DZO B;  1VQ1 A;  4JI3 M;  4GKJ M;  1OJL A;  3F92 A;  4DV0 M;  5FTK A;  5FTM A;  1NJG A;  2KZS A;  2KW0 A;  1XB2 B;  1FJG M;  1VG5 A;  4JI7 M;  3GRR A;  1OIZ A;  2FNA A;  3RE8 A;  1P3Q Q;  4LF6 M;  2ZTC A;  3GLG A;  1TF0 B;  2WSE F;  4GC5 A; 
#chains in the Genus database with same CATH homology
 2X4A A;  1SXJ E;  2K47 A;  2EUC A;  4AKG A;  5JI2 E;  1QAM A;  3U5Z A;  5EP4 A;  1K3X A;  4FVM A;  3PXG A;  4DR4 M;  1L2D A;  2Z4R A;  2D7H A;  2QPA A;  5DYG A;  4PCZ A;  3GRU A;  3VLF B;  2EO2 A;  3GLH B;  4LRT A;  2H1R A;  3A98 B;  2CE7 A;  3GQ5 A;  3MJ5 A;  3FKE A;  4JI2 M;  4M0W A;  1R6B X;  3C58 A;  1IY0 A;  1S3S A;  2P5T A;  1EE8 A;  3I4Y A;  3IG8 A;  2CFO A;  3U6S A;  2LWX A;  3U6E A;  1HR0 M;  2Q2E B;  3ILK A;  4LJ6 A;  1TH2 A;  3FTF A;  5EXT A;  3LVW A;  3GLF B;  3GLI A;  3VK8 A;  2X49 A;  4R7G A;  2OQ4 A;  2ZAO A;  2L6O A;  4LG2 A;  4DV4 M;  2R62 A;  4AKH A;  2C98 A;  3W0F A;  3I4V A;  3SMP A;  3U6O A;  3M0E A;  1XNR M;  1ZAE A;  1MX0 A;  4I8O A;  4YY3 M;  3DFZ A;  1IN5 A;  4OVZ B;  4DR2 M;  1TGU A;  3FTD A;  2DHR A;  3HU2 A;  5GKN A;  4PDI A;  4DV5 M;  4L8R C;  4D80 A;  1DGB A;  1GLN A;  1QAO A;  4K0K M;  3WHK A;  2DVW B;  2YNM D;  4LGY A;  1X37 A;  3K2L A;  3VDP A;  2YFQ A;  3AV0 A;  3LQQ A;  4OX9 M;  4NXM M;  5A2Q S;  3LMM A;  2KXE A;  3L27 A;  4ZPX A;  1SXJ D;  4A3V B;  3FUW A;  4GMQ A;  3FUT A;  1PM5 A;  4MH0 E;  2C9O A;  2DWN A;  3MHV C;  1IN4 A;  4IBC A;  4LJ8 A;  3GLH A;  2F4V M;  2L7H A;  4IBI A;  5LMU M;  3QWL A;  2F5N A;  4MGY E;  1HNX M;  1HNW M;  4WUR A;  1YSY A;  4KLN A;  1HT2 E;  2Y21 A;  3J27 B;  3KOX E;  5EP1 A;  5KPT A;  4B3M M;  2XGN A;  2NQ8 C;  5E6J A;  1QAN A;  5IWA M;  4BBA A;  2DZN B;  4GC9 A;  4L78 A;  3GLF A;  3VKH A;  4LJ7 A;  4JI5 M;  4DR6 M;  3AOE A;  3SAR A;  1XHB A;  4MGK E;  1N36 M;  4M9S A;  1L2B A;  2L7I A;  2FE8 A;  1FNN A;  2CEA A;  5EXX A;  3A46 A;  1TH3 A;  1IN8 A;  1T3T A;  3R9X B;  1J7K A;  3SAT A;  4GH9 A;  3VFD A;  4OVZ A;  3IG5 A;  4LRS A;  3GPP A;  4KO8 A;  3U6D A;  1QQW A;  2ZM6 M;  7CAT A;  1J09 A;  4RF0 A;  4QHT A;  5ITX A;  3BOS A;  2HHH M;  5KQ8 A;  4DR3 M;  4FCT A;  2KRK A;  2OPF A;  3FUU A;  3SHG B;  3TL4 X;  3HJS A;  1E9R A;  2LH0 A;  2XF3 A;  4IJE A;  3A45 A;  2Z3X A;  2CV2 A;  2DWL A;  3SAW A;  3NWL A;  2R18 A;  3AOG A;  3LVV A;  3UJN A;  3FTE A;  3DA1 A;  3DOA A;  4QHS A;  1NNJ A;  1N32 M;  1VDD A;  3AKZ A;  1QVR A;  1NNU C;  2UUA M;  1OFH A;  4GHA A;  3K8Z A;  5EQT A;  3SHF A;  3PNY A;  3U6L A;  2LXE A;  3KDS E;  3T38 A;  2UU9 M;  1MU5 A;  4BB9 A;  2I7P A;  1IBK M;  2ZBK B;  5BPV A;  3J81 S;  2DWZ B;  4PD2 A;  4X62 M;  4G4R A;  1HNZ M;  2C5R A;  4JI0 M;  5EP2 A;  1ORY B;  3FYC A;  3GPU A;  2ZAM A;  3HHZ A;  1LV7 A;  3M6A A;  5EXS A;  1PJJ A;  2KA6 B;  5ITR A;  3EIH A;  2XFT A;  3SAS A;  3VDU A;  1HT1 E;  4QOZ C;  1XWI A;  1K82 A;  1OFI A;  2FOI C;  2UXC M;  1XXH B;  2F5P A;  2L09 A;  3M7G A;  1IXZ A;  2KZU A;  3KP1 E;  2CUZ A;  5H37 D;  1IBL M;  2R45 A;  4LJA A;  4FW9 A;  4LZZ A;  3U6Q A;  4DR7 M;  4FCW A;  1ZQ9 A;  4IJF A;  4G4Q A;  4G4N A;  3VK7 A;  2D7G A;  5DNY A;  4DUY M;  3AFH A;  3L29 A;  2QCU A;  3J7B A;  4EIW A;  2RGH A;  3HU1 A;  4I4L A;  4FD2 A;  1IY1 A;  1NHW C;  2UUC M;  3GRV A;  3AOE C;  2XSZ A;  1IBM M;  4JI8 M;  4LJ5 A;  1TH4 A;  2M60 A;  1GVN A;  4GKK M;  1Z5C A;  2W82 A;  1L8Q A;  5EP3 A;  2DXI A;  4FWD A;  2BNK A;  4LFC M;  2A5Y B;  2F5O A;  4S12 A;  2KRU A;  3AJI B;  4IIW A;  3SAV A;  5FLX S;  3CF2 A;  1N78 A;  3GRY A;  2HKJ A;  2C96 A;  4IBK A;  3EIE A;  5E26 A;  5KPR A;  2D7E A;  1JR3 A;  1G59 A;  1WXQ A;  3UGJ A;  3HJQ A;  2ERC A;  3FTC A;  4AG6 A;  4JV5 M;  3SYL A;  4LF4 M;  4M9Z A;  3R8F A;  4QNM A;  2I7N A;  3TE6 A;  4LJ9 A;  3KFU G;  3L25 A;  1UM8 A;  1Q3B A;  1N77 A;  3T1H M;  3U60 B;  4XGI A;  4ITQ A;  5ITQ A;  1XMQ M;  4MGZ E;  1XXH A;  3GQ4 A;  4Z8X A;  1E94 E;  4MB7 A;  4AI6 A;  2F5S A;  1QYR A;  4JI1 M;  3D8L A;  1IQP A;  2BJV A;  8CAT A;  4DV1 M;  4CGY B;  1QZM A;  5ITY A;  2BJW A;  3FUX A;  1IXS B;  3RGP A;  4LF9 M;  3FD9 A;  3U6C A;  4DV6 M;  1DGH B;  2RKO A;  4Z6Y A;  1W5S A;  3SFZ A;  3TQS A;  4LF8 M;  3L28 A;  4AW4 A;  3HJ8 A;  1G8P A;  3CF6 E;  1GL7 A;  3KOZ E;  1JQJ C;  5FTL A;  2E5L M;  1I94 M;  4KHP M;  3J80 S;  4AG5 A;  5BR8 M;  1Z59 A;  3TWK A;  1Z6T A;  3UK6 A;  4YHH M;  2LNH C;  2XH9 A;  4CHT B;  1PJI A;  4BLC A;  1DO2 A;  1IXR C;  2UXB M;  5IZ7 D;  3L26 A;  1SXJ B;  4G6Z A;  3KOY E;  3JR4 A;  3SAU A;  1XC8 A;  3VKG A;  1TDZ A;  3QAU A;  3B9P A;  3U61 B;  5DYI A;  3JR5 A;  3KS4 A;  4B7H A;  4JXJ A;  1L2C A;  1N33 M;  1HQY E;  2J7O A;  3PVS A;  4M0D A;  1E32 A;  3HWS A;  3LQR A;  4FCV A;  4G4O A;  3U60 A;  1G41 A;  4JYA M;  4PT5 A;  1IM2 A;  3GPX A;  2CHV A;  1R7R A;  2FFJ A;  2V1C A;  3H4M A;  3PFI A;  4I81 A;  3ZH9 B;  4LCB A;  4KOD A;  2C9C A;  4D81 A;  4GRI A;  5FTJ A;  2YR0 A;  3A42 A;  5LMN M;  4LFA M;  1K3W A;  5FSW A;  4XBO A;  3SMS A;  2EA0 A;  3HGI A;  2XLJ A;  4IBE A;  3DZD A;  1NHG C;  4NRW A;  2XZF A;  5F3W A;  3HHW A;  4GHL A;  4LZJ A;  4NSO B;  1L1T A;  1DGH A;  4B08 A;  4DR1 M;  4RNA A;  3GQ3 A;  2XEP A;  3HKP A;  3CTW B;  2G8L A;  1W5T A;  4LFB M;  4X65 M;  2CHQ A;  2M5Z A;  1NJF A;  5ITT A;  4TUW A;  4LGM A;  3GP1 A;  4M9X A;  4REZ A;  4W5W A;  1Z5B A;  4FWH A;  1E9S A;  3J2P B;  3W0L B;  1IY2 A;  2C99 A;  3L2A A;  1YE9 A;  5IRE B;  1G3I A;  1IN6 A;  4DV2 M;  3PNV A;  4LJ4 A;  4OU7 A;  2VQF M;  3KSX A;  5EJC A;  4JI4 M;  1TDH A;  3UMM A;  1J5E M;  4I5S A;  3TWM A;  4MGH A;  2R65 A;  1SXJ A;  3U6M A;  4B3S M;  3KVW A;  2XFS A;  3HHY A;  1KSF X;  1C1K A;  4QOS A;  4MGI E;  1YUB A;  3K1J A;  3KXE C;  4NSR A;  4R3D A;  4B7G A;  2CHG A;  3U61 A;  2RGO A;  5KO3 A;  2CV0 A;  4JN6 A;  3UZU A;  4LF7 M;  1XMO M;  3T1Y M;  3E4R A;  1DO0 A;  3HU3 A;  2QZ4 A;  4D82 A;  4NXN M;  2YQZ A;  1NY5 A;  2HL7 A;  4HL4 A;  4DUZ M;  3ZC7 B;  1Q39 A;  1Q3C A;  2X8A A;  1NVM A;  3FUV A;  2G5G X;  1KFV A;  2F5Q A;  5C1B A;  3TWL A;  1G4A E;  2KEB A;  4LY6 A;  4DV3 M;  4GIT A;  4NRV A;  4P16 A;  1N34 M;  4AQY M;  1L1Z A;  1QAQ A;  4IBD A;  4MM3 B;  1N75 A;  4GIP A;  4IBB A;  2O5R A;  5KQD A;  2Z7J A;  2QBY B;  1H6U A;  1NSF A;  2Y0Q A;  4RF1 A;  3THG A;  1GL6 A;  3AL0 C;  1HQC A;  3ZCB B;  3GPY A;  3RGS A;  2V6Z M;  5JI3 E;  2VQE M;  4DV7 M;  5EXP A;  2HCB A;  3TPZ A;  3KOW E;  3E9S A;  3SBJ A;  2XSZ D;  4X66 M;  5ITX E;  4LF5 M;  3U6P A;  4HLQ A;  1IN7 A;  2UUB M;  3OTO M;  4IBJ A;  3GLG B;  1D2N A;  3NBI A;  2R46 A;  3K92 A;  5KPZ A;  1KYI A;  4B3R M;  4AKI A;  2QEN A;  2QP9 X;  4NOO B;  2DWM A;  2UXD M;  2JA2 A;  3U5Z B;  4DR5 M;  4II7 A;  1Z5A A;  5FTN A;  2AHM A;  3CF0 A;  2ZAN A;  1JR3 D;  2CV1 A;  3SC3 A;  4L4U A;  3JAM S;  4QNR A;  3J7A S;  1I4W A;  2Y20 A;  4FWG A;  2R4E A;  3D8B A;  4X64 M;  1DGG A;  3HHX A;  2J7N A;  4NL4 H;  2V1U A;  1DGF A;  3I51 A;  4L16 A;  3RFW A;  2Z4S A;  1XNQ M;  2VII A;  4IBG A;  4B7F A;  4PDG A;  5ITU A;  5IT9 S;  2XZU A;  2Y0T A;  4IBF A;  3FYD A;  4L15 A;  1GKI A;  4CIS A;  1NY6 A;  3SYK A;  4B3T M;  3KS8 A;  4OW0 A;  3T15 A;  3KP0 E;  1R2Y A;  1R2Z A;  3WHL A;  2R4J A;  4WW0 A;  3GLI B;  3Q8X A;  5C18 A;  2QBY A;  1SXJ C;  3MK6 A;  3GO8 A;  3KW6 A;  3KSJ A;  4AZF A;  4JI6 M;  2DZO B;  4JI3 M;  4GKJ M;  1OJL A;  4DV0 M;  5FTK A;  5FTM A;  1NJG A;  2KZS A;  2KW0 A;  1FJG M;  4JI7 M;  3GRR A;  2FNA A;  3RE8 A;  4LF6 M;  3GLG A;  4GC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...