1N36M

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n36M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n36M02
1XMQM 2UXBM 3VK8A 3GQ4A 3GQ3A 4X62M 4DUYM 4CISA 1Q3BA 4JI7M 3OTOM 5IT9S 5ITQA 4B3SM 4JI3M 1TDHA 4G4RA 4LF6M 1KFVA 3J80S 2UUBM 4G4QA 4PDIA 2UXDM 1L2BA 4JI6M 2ZBKB 2UXCM 2VQEM 3SAUA 3C58A 1K82A 1Q3CA 2OQ4A 1HR0M 1HNWM 3T1YM 4DV0M 3A46A 4DV2M 5A2QS 5FLXS 4B3TM 4DR6M 3A45A 4PDGA 1Z59A 4NRWA 1L1ZA 3TWMA 4LF4M 4JYAM 3SAWA 3U6CA 4X66M 2UU9M 4AQYM 1NNJA 1Q39A 4DR3M 4LF9M 4LF7M 3JR4A 2XZUA 1Z5AA 4G4NA 3U6QA 1N33M 3GP1A 2VQFM 1IBMM 1Z5CA 3GPXA 3JR5A 4LFBM 4DV7M 4GKKM 1K3WA 1J5EM 3U6MA 2XZFA 2ZM6M 4LFCM 4JI8M 5ITTA 3J81S 4DR7M 4JI5M 1XMOM 2EA0A 2UUAM 4DR5M 4NXNM 1L2CA 1PM5A 2HKJA 3VK7A 2F4VM 3GPUA 5ITUA 1XC8A 1XNQM 1IBKM 1L2DA 3JAMS 4K0KM 1HNXM 1I94M 1XNRM 4MB7A 4NRVA 3T1HM 4LF8M 1IBLM 4JI2M 1MU5A 3U6EA 3SAVA 2F5QA 4DV3M 1PJIA 5LMNM 3U6SA 1R2ZA 4GKJM 1K3XA 4B3RM 3GPYA 4DV1M 3GQ5A 2HHHM 4LFAM 4JI4M 5ITXE 1R2YA 1N34M 4X64M 5ITRA 4DR2M 2UUCM 4YHHM 2E5LM 2F5NA 4YY3M 4JI1M 3GO8A 2F5SA 1HNZM 4LF5M 1PJJA 4B3MM 4ITQA 4DV5M 3J7AS 3TWKA 4DR4M 1L1TA 3U6PA 1N36M 5LMUM 3U6LA 3TWLA 4OX9M 3U6DA 2F5PA 3SARA 3W0FA 4X65M 1Z5BA 4DV4M 1EE8A 4KHPM 2F5OA 4NXMM 5BR8M 4DR1M 4JV5M 4G4OA 1N32M 3U6OA 2OPFA 4PCZA 4DUZM 3GPPA 3SBJA 3SATA 1FJGM 1MX0A 3SASA 2Q2EB 3DOAA 4JI0M 4PD2A 4DV6M 5ITXA 5ITYA 5IWAM 1TDZA 3A42A
chains in the Genus database with same CATH superfamily
1PJQA 3I04M 2RGHA 3HU3A 4AG6A 3AOEC 3KDSE 1G8PA 2LHCA 4X62M 2HAKA 4L78A 2P5TA 3GQ3A 3KP0E 4LRSA 3D8LA 2ZTDA 4QNMA 3OTOM 3L28A 1JQJC 3SFZA 5ITQA 1IY0A 2KW0A 2LNHC 2OOBA 1QAMA 2DWNA 2DAEA 4LF6M 4P17A 2YQZA 2FE8A 4R71A 3J80S 1TH3A 2CHGA 4G4QA 2JA2A 4OVZA 1XXHA 2UXDM 2QSFX 3DFZA 1L2BA 2O01F 2DAIA 2VQEM 3LQQA 1HT2E 2N35A 2QP9X 4M9XA 3PXGA 4AKGA 1R6BX 2R4EA 1HNWM 3HGIA 1SXJA 5KPZA 2JY5A 1KYIA 3T6PA 5A2QS 3C3DA 2Z3XA 2O25A 4B3TM 4AZFA 1Z59A 2OO9A 3QWLA 4JYAM 3VLFB 2I7NA 1DO0A 1H6UA 1D0MA 2XH9A 3KSXA 1D0LA 2L09A 5FTNA 5IZ7D 1SXJC 2X8AA 4LJ5A 4LF9M 3HWSA 4MGZE 2Z4RA 2JNHA 1Z5AA 2KDLA 4FCTA 4G4NA 1N33M 1W5SA 4GHAA 2Z7JA 3HJQA 1D2NA 3K9OA 2JWSA 5EP4A 2XZFA 4GIPA 2ZM6M 4JI8M 4D81A 4WURA 2V1UA 3MMPA 2JZ0A 3PFIA 3KW6A 1GL6A 2HCBA 2BWBA 1OFIA 1WHCA 5E6JA 3VK7A 5DYIA 4MH0E 1DO2A 4CJ6A 5KO3A 3UMMA 5ITUA 2FNAA 2BWEA 2MH8A 1ZMVA 3A98B 2C98A 4IBJA 4B08A 2DZNB 3F92A 1QAOA 1XNRM 1OAIA 2HL7A 1OKSA 4JXJA 1IXSB 1IN6A 1J7KA 1ZAEA 1PJSA 2EUCA 3UZUA 5EXTA 1PJIA 5LMNM 2C9OA 4GITA 4L15A 4GKJM 3FUTA 4AI6A 1K3XA 4B3RM 4M0DA 4G6ZA 4IIWA 4FCVA 4R3DA 4HLQA 1R2YA 3CF2A 2EKKA 3W67A 5ITRA 5EP3A 4GHLA 3Q8GA 4JI1M 1UFZA 1IXZA 1OFHA 2L6OA 3LVVA 2KNZA 1LTMA 1AIPC 2K0BX 3MK6A 2LVAA 2X49A 1NY5A 4QOZC 3KOZE 2Y0TA 1VG5A 4B3MM 2DAMA 4ITQA 1TF0B 1NV9A 3KP1E 2CUZA 3LW5F 1QDTA 4OU7A 1IY2A 2L7HA 1KSFX 2BJWA 2XSZA 3GLIB 3RE8A 3SARA 3HHZA 1A5TA 3IG5A 1QAQA 1WGLA 4DR1M 4JV5M 3HHWA 1NJFA 1TH4A 4GMQA 3HHYA 2OPFA 3R8FA 2R0IA 3E21A 1MX0A 2MROB 2Q2EB 4JI0M 3ZQJA 4NSRA 5ITXA 2YNMD 2XF3A 4PT5A 5KPRA 1T6OA 1XMQM 3FUWA 2UXBM 3SC3A 4WP2A 4QNRA 1G3IA 4L6V6 3SYKA 7CATA 3GQ4A 1OIZA 4QOSA 3M6AA 4KT0F 5IT9S 3VKHA 2DAKA 3K9PA 4D80A 2B3TA 1TDHA 2H5XA 2RGOA 1ZMUA 1VDDA 2V6ZM 1G4AE 2XFSA 3QYBA 1Y8GA 3ZC7B 4PDIA 1QUTA 3L29A 3U61A 1DGHB 1WIVA 2ZBKB 5KQ8A 3AOEA 1N77A 4LGYA 4JI6M 2UXCM 1V92A 2DWZB 3C58A 4CHTB 1G41A 4FD2A 1IQPA 1Q3CA 2M5ZA 3FUVA 4LG2A 2MGWA 1HR0M 4MGHA 3KS8A 1NO1A 3K92A 1OQYA 4M9SA 1HJPA 5E26A 3T1YM 2H1RA 1QYRA 2K9DA 3A46A 5F3WA 4Z6YA 4XGIA 3I4VA 4DR6M 1V34A 2CV2A 1L1ZA 4D82A 1E9SA 2NQ8C 2JUJA 2KZUA 2R46A 5JI2E 2MR9A 2Y20A 3HKPA 3PNYA 3V76A 4BLCA 3U6CA 3B7QA 2DWMA 4AQYM 3U60B 3FYDA 1Q39A 1NNJA 1QUSA 2DZLA 4GH9A 3GLGB 2QPAA 2XFTA 3GP1A 2LHGA 1F4IA 4MM3B 2QCUA 2DZOB 3LMMA 3TL4X 1OIPA 3GPXA 3GLFB 4GKKM 4P16A 4UN2B 1J5EM 2R4JA 4FWGA 3U6MA 3GLHE 2JXNA 2DHYA 5ITTA 5L8RF 4DR7M 4KO8A 1DGHA 1XMOM 4G3OA 4HEOA 4Y28F 2Z4SA 3CGWA 1L2CA 1G59A 2W82A 2F4VM 2CWBA 1L2DA 4BB9A 4QHTA 1HNXM 3EIHA 3GRYA 4S12A 3GRVA 2QQ8A 1I94M 2XLJA 4LJ9A 3ZH9B 1XXHE 4NRVA 3LQRA 2D7EA 1AUAA 1JR3D 3HZJA 1MU5A 3U6EA 4B7HA 2R18A 4TUWA 3LCVB 4NSOB 3QAUA 3U60A 4GEWA 1SXJE 3FUUA 3GPYA 3GQ5A 2JY8A 3DZDA 3GLGA 4DV1M 2R6FA 2HHHM 2QBYB 4LJ4A 4DR2M 4AKIA 3GLFA 1Q02A 4YY3M 3FTFA 3VDPA 4FWHA 4L4UA 3GO8A 2F5SA 3KFUG 1PJTA 4IBIA 1IN7A 2VDBB 1EIJA 3B7ZA 1NJGA 3GRUA 1D0KA 1TTEA 2CHVA 3FKEA 4B7GA 4DR4M 1L1TA 2AHMA 3FRHA 3U6PA 2MJ5B 5LMUM 2RRUA 4IJFA 1ZMWA 4KODA 4X65M 2L7IA 4DV4M 4OW0A 4I8OA 1QZEA 3FTEA 2C99A 2RKOA 5DFLA 2CEAA 4G4OA 2VIIA 2J5YA 2K47A 4MGKE 1N75A 3J2PB 4LY6A 3T38A 1IN4A 3TE6A 3WHKA 2BNKA 3M7GA 4PD2A 4LZZA 5ITYA 5IWAM 2XZUA 3UGJA 1TDZA 4CGYB 1QVRA 5EP2A 3VK8A 2DAGA 2DENA 5FTLA 2LVOC 1Q3BA 4I4LA 4I5SA 2LWXA 3Q8XA 3RGPA 2DWLA 1GO5A 4LJAA 2WSFF 2JP7A 2LH0A 4JI3M 5EXSA 3E46A 4IBKA 1R5LA 1E94E 1OJLA 2FH0A 1KFVA 2QZ4A 1YSYA 3L27A 2KXEA 2G8LA 2WZJA 4Q7JA 2CV0A 2CV1A 3ILKA 2GNOA 1T43A 4RF1A 4Z8XA 3SAUA 1JR3A 1IXSA 1C1KA 4HL4A 1GABA 4WW0A 1UM8A 4IJEA 2DHRA 4IBBA 3GRRA 1LV7A 1OTRA 4DV2M 2VF7A 3SHFA 2ERCA 2WSEF 4GRIA 4PDGA 2G3QA 4XK8F 4NRWA 1VEGA 2DXIA 3DA1A 3EIEA 3CF6E 1VDLA 2EJSA 2ZAMA 1X37A 2X4AA 5DYGA 1C7YA 4W5WA 2EO2A 3NBIA 4IBGA 4A3VB 4LCBA 4DR3M 1ZV1A 3L25A 2UUBM 2KHHA 1IN5A 3FE3A 4DBGB 1QQWA 2FOIC 3FD9A 1Z5CA 3JR5A 1TR8A 3GLHB 1GJTA 2JY6B 2V1CA 3J7BA 4DV7M 3H4MA 4LFCM 3GLIA 5EP1A 2XEPA 1PGYA 4JI5M 2Y0QA 2UUAM 4IBEA 3AOGA 4DR5M 4GC5A 5BPVA 4REZA 4NXNM 2HKJA 4R7GA 1Z6TA 2GQFA 3GPUA 1XWIA 1XC8A 1QDRA 1IFYA 3PNVA 1IY1A 4IBDA 4K0KM 3VKGA 2YR0A 1JB0F 3CF0A 1XXHB 4OVZB 2LXEA 3AKZA 2L2DA 3T1HM 1MJGM 1NHGC 3HJ8A 2R44A 4IBFA 3RFWA 1NY6A 4EIWA 3BBZA 1IBLM 4LF8M 3SAVA 2F5QA 1GVNA 2BJVA 4DV3M 2Z8YM 1E9RA 3H4JA 2DI0A 1IXRC 3FRIA 4JI4M 2C5RA 1WR1B 3L2AA 4RF0A 3FTDA 4LFAM 2XGNA 3VFDA 3J27B 3K1JA 4X64M 5GKNA 2E5LM 3IECA 2F5NA 3I51A 1W5TA 3B89A 2KNAA 2R45A 2LTUA 3T15A 4ANRA 3SHGB 3VDUA 4LF5M 1G71A 2R65A 1GKIA 1V33A 3SYLA 4F1IA 4L8RC 1N36M 1TH2A 3THGA 3U5ZB 2L4FA 3TWLA 3U6LA 2CHQA 5EJCA 3U6DA 4LRTA 2ZANA 2CP8A 3L26A 2D7GA 1NSFA 1VEKA 4OX9M 5EXXA 2CFOA 1EE8A 3HU2A 2F5OA 4NXMM 2VF8A 1WXQA 5BR8M 2LBCA 2JY7A 4RNAA 3SBJA 3GPPA 3E4RA 1FJGM 2LVQD 3DOAA 3HHXA 3IHPA 3TQSA 3E9SA 3A42A 5KPTA 3KOWE 2APLA 5H37D 2M60A 2LVPC 2DKLA 2R62A 4ZPXA 2XSZD 1N78A 4DUYM 4CISA 5EQTA 5C18A 2C96A 3HU1A 3K2LA 2Y21A 4JI7M 4B7FA 2OOAA 2DNAA 3UJNA 1DGGA 4B3SM 4II7A 3HY5A 4CIZA 2C9CA 4XBOA 4G4RA 1QZMA 1S3SA 1YUBA 1FNNA 2KNVA 3QYEA 2ZTCA 4M9ZA 2O5RA 3GLGE 3IG8A 4LJ7A 3C3EA 5FTMA 1OAOC 2QHOB 2J7NA 3AFHA 3UK6A 3GLFE 3U5ZA 3R9XB 3TPZA 1K82A 2KZSA 4L16A 4NL4H 4QHSA 1R4GA 2K6BA 2OQ4A 1NNUC 1R7RA 3KOXE 2DVWB 4DV0M 3K8ZA 4FCWA 3FYCA 3NWLA 5FLXS 3W68A 3SMSA 2QBYA 3A45A 5DNYA 4AG5A 3ZCBB 3TWMA 4FVMA 4LF4M 3SAWA 2WSCF 1EFUB 4BBAA 3MJ5A 1CUKA 3AV0A 4X66M 2UU9M 3LCUA 4LF7M 4M0WA 3JR4A 8CATA 1J09A 3U6QA 2VQFM 1IBMM 1DGBA 4LFBM 2YFQA 4IBCA 1K3WA 5IREB 4GC9A 3SMPA 2FFJA 3PVSA 4FW9A 2QENA 4JN6A 5FSWA 3J81S 4LJ6A 1VQ1A 2EA0A 1WGNA 1XB2B 1VEJA 3BXWA 3RGSA 1PM5A 2L4EA 4MGIE 4F2LA 1ZQ9A 2FS1A 1IBKM 1XNQM 3JAMS 3BOSA 5FTKA 3KS4A 3MHVC 4RKUF 3HX3A 5C1BA 4AKHA 1RU3A 2JZ1A 2CE7A 1GLNA 3KSJA 3M0EA 1MN3A 1YLAA 3U61B 5JI3E 4MB7A 4AW4A 2A5YB 3LVWA 1TGUA 1QANA 2ZAOA 3I4YA 4JI2M 1BVSA 2KRKA 1JR3E 3KOYE 1GL7A 2J7OA 1R2ZA 1YE9A 3U6SA 1HT1E 1SXJD 4I81A 3B74A 4LGMA 3HJSA 1PRBA 1I4WA 2D7HA 3KVWA 5ITXE 1HQCA 1N34M 2UUCM 4YHHM 1DGFA 2LVNC 1DV0A 1XHBA 4FWDA 4LZJA 2KEBA 1NHWC 1NV8A 2EKFA 4NC6A 1HNZM 3CTWB 3I01M 4NOOB 3NBXX 2G5GX 2HWJA 3C9PA 1PJJA 4MGYE 1WJ7A 4DV5M 3J7AS 3TWKA 1E32A 3B7NA 1SG9A 1P3QQ 2F5PA 1ORYB 3AJIB 3W0FA 2KRUA 1Z5BA 1L8QA 3FTCA 3KXEC 3GLIE 4LJ8A 4KLNA 1NVMA 4KHPM 5KQDA 2QNJA 5EXPA 1IM2A 1SXJB 3W0LB 3AL0C 1N32M 2KA6B 3FUXA 4PCZA 4DUZM 3U6OA 3SATA 1HQYE 5FTJA 1T3TA 1IN8A 3D8BA 4DV6M 3SASA 3GLHA 3WHLA 1GJSA 3B9PA 2I7PA 2CRUA
chains in the Genus database with same CATH topology
2RGHA 3HU3A 4AG6A 3AOEC 3KDSE 1G8PA 3GQ3A 4X62M 4L78A 2P5TA 3KP0E 4LRSA 3D8LA 4QNMA 3OTOM 3L28A 1JQJC 3SFZA 5ITQA 1IY0A 2KW0A 2LNHC 1QAMA 2DWNA 4LF6M 2YQZA 2FE8A 3J80S 1TH3A 2CHGA 4G4QA 2JA2A 4OVZA 1XXHA 2UXDM 3DFZA 1L2BA 2VQEM 3LQQA 1HT2E 2QP9X 4M9XA 3PXGA 4AKGA 1R6BX 2R4EA 1HNWM 3HGIA 1SXJA 5KPZA 1KYIA 5A2QS 2Z3XA 4B3TM 4AZFA 1Z59A 3QWLA 4JYAM 3VLFB 2I7NA 1DO0A 1H6UA 2XH9A 3KSXA 5FTNA 2L09A 5IZ7D 1SXJC 2X8AA 4LJ5A 4LF9M 3HWSA 4MGZE 2Z4RA 1Z5AA 4G4NA 4FCTA 1N33M 1W5SA 4GHAA 2Z7JA 3HJQA 1D2NA 5EP4A 2XZFA 4GIPA 2ZM6M 4JI8M 4D81A 4WURA 2V1UA 3PFIA 3KW6A 1GL6A 2HCBA 1OFIA 5E6JA 3VK7A 5DYIA 4MH0E 1DO2A 5KO3A 3UMMA 5ITUA 2FNAA 3A98B 2C98A 4IBJA 4B08A 2DZNB 1QAOA 1XNRM 2HL7A 4JXJA 1IXSB 1IN6A 1J7KA 1ZAEA 2EUCA 3UZUA 5EXTA 1PJIA 5LMNM 2C9OA 4GITA 4L15A 4GKJM 3FUTA 4AI6A 1K3XA 4B3RM 4M0DA 4G6ZA 4IIWA 4FCVA 4R3DA 4HLQA 1R2YA 3CF2A 5ITRA 5EP3A 4GHLA 4JI1M 1IXZA 1OFHA 2L6OA 3LVVA 3MK6A 2X49A 4QOZC 1NY5A 3KOZE 2Y0TA 4B3MM 4ITQA 3KP1E 2CUZA 4OU7A 1IY2A 2L7HA 1KSFX 2BJWA 2XSZA 3GLIB 3RE8A 3SARA 3HHZA 3IG5A 1QAQA 4DR1M 4JV5M 3HHWA 1NJFA 1TH4A 4GMQA 3HHYA 2OPFA 3R8FA 1MX0A 2Q2EB 4JI0M 4NSRA 5ITXA 2YNMD 2XF3A 4PT5A 5KPRA 1XMQM 3FUWA 2UXBM 3SC3A 4QNRA 1G3IA 3GQ4A 3SYKA 7CATA 4QOSA 3M6AA 5IT9S 3VKHA 4D80A 1TDHA 2RGOA 1VDDA 2V6ZM 1G4AE 2XFSA 3ZC7B 4PDIA 3L29A 3U61A 1DGHB 2ZBKB 5KQ8A 1N77A 3AOEA 4JI6M 4LGYA 2UXCM 3C58A 2DWZB 4CHTB 1G41A 4FD2A 1IQPA 1Q3CA 2M5ZA 3FUVA 4LG2A 1HR0M 4MGHA 3KS8A 4M9SA 3K92A 5E26A 3T1YM 2H1RA 1QYRA 3A46A 5F3WA 4Z6YA 4XGIA 3I4VA 4DR6M 2CV2A 1L1ZA 4D82A 1E9SA 2NQ8C 2R46A 2KZUA 5JI2E 2Y20A 3PNYA 3HKPA 4BLCA 3U6CA 2DWMA 4AQYM 3U60B 3FYDA 1Q39A 1NNJA 3GLGB 4GH9A 2QPAA 2XFTA 3GP1A 4MM3B 2QCUA 2DZOB 3LMMA 3TL4X 3GPXA 3GLFB 4GKKM 4P16A 1J5EM 2R4JA 4FWGA 3U6MA 5ITTA 4DR7M 4KO8A 1DGHA 1XMOM 2Z4SA 1L2CA 1G59A 2W82A 2F4VM 1L2DA 4BB9A 4QHTA 1HNXM 3EIHA 3GRYA 4S12A 3GRVA 1I94M 2XLJA 4LJ9A 3ZH9B 4NRVA 3LQRA 2D7EA 1JR3D 1MU5A 3U6EA 4B7HA 2R18A 4TUWA 4NSOB 3QAUA 3U60A 1SXJE 3FUUA 3GPYA 3GQ5A 3GLGA 3DZDA 4DV1M 2HHHM 2QBYB 4LJ4A 4DR2M 4AKIA 3GLFA 4YY3M 3FTFA 3VDPA 4FWHA 4L4UA 3GO8A 2F5SA 3KFUG 4IBIA 1IN7A 1NJGA 3GRUA 2CHVA 3FKEA 4B7GA 4DR4M 1L1TA 2AHMA 3U6PA 5LMUM 4IJFA 4KODA 4X65M 2L7IA 4DV4M 4OW0A 4I8OA 3FTEA 2C99A 2RKOA 4G4OA 2CEAA 2VIIA 4MGKE 2K47A 1N75A 3J2PB 4LY6A 3T38A 1IN4A 3TE6A 3WHKA 2BNKA 3M7GA 4PD2A 4LZZA 5ITYA 5IWAM 2XZUA 3UGJA 1TDZA 4CGYB 1QVRA 5EP2A 3VK8A 5FTLA 1Q3BA 4I4LA 4I5SA 2LWXA 3Q8XA 3RGPA 2DWLA 4LJAA 2LH0A 4JI3M 5EXSA 4IBKA 1KFVA 1E94E 1OJLA 2UUBM 3L27A 1YSYA 2QZ4A 2KXEA 2G8LA 2CV0A 2CV1A 3ILKA 3SAUA 4RF1A 4Z8XA 1JR3A 1C1KA 4HL4A 4WW0A 1UM8A 4IJEA 2DHRA 4IBBA 3GRRA 1LV7A 4DV2M 3SHFA 2ERCA 4GRIA 4PDGA 4NRWA 2DXIA 3DA1A 3EIEA 3CF6E 2ZAMA 1X37A 2X4AA 5DYGA 4W5WA 2EO2A 3NBIA 4IBGA 4A3VB 4LCBA 4DR3M 3L25A 1IN5A 1QQWA 2FOIC 3FD9A 1Z5CA 3JR5A 3GLHB 4DV7M 2V1CA 3J7BA 3H4MA 4LFCM 3GLIA 5EP1A 2XEPA 4JI5M 2Y0QA 2UUAM 4IBEA 3AOGA 4DR5M 4GC5A 5BPVA 4REZA 4NXNM 2HKJA 4R7GA 1Z6TA 3GPUA 1XWIA 1XC8A 3PNVA 1IY1A 4IBDA 4K0KM 3VKGA 2YR0A 3CF0A 1XXHB 4OVZB 2LXEA 3AKZA 3T1HM 3HJ8A 1NHGC 4IBFA 3RFWA 1NY6A 4EIWA 4LF8M 1IBLM 3SAVA 2F5QA 1GVNA 2BJVA 4DV3M 1E9RA 1IXRC 4JI4M 2C5RA 4RF0A 3L2AA 4LFAM 3FTDA 2XGNA 3VFDA 3J27B 3K1JA 4X64M 5GKNA 2E5LM 2F5NA 3I51A 1W5TA 2R45A 3T15A 3SHGB 3VDUA 4LF5M 2R65A 1GKIA 3SYLA 4L8RC 1N36M 1TH2A 3THGA 3U5ZB 3U6LA 3TWLA 2CHQA 5EJCA 3U6DA 4LRTA 2ZANA 4OX9M 3L26A 2D7GA 1NSFA 5EXXA 2CFOA 1EE8A 3HU2A 2F5OA 4NXMM 1WXQA 5BR8M 4RNAA 3SBJA 3GPPA 3E4RA 1FJGM 3DOAA 3HHXA 3TQSA 3E9SA 3A42A 5KPTA 3KOWE 5H37D 2M60A 4ZPXA 2R62A 2XSZD 1N78A 4DUYM 4CISA 5EQTA 5C18A 2C96A 3HU1A 3K2LA 2Y21A 4JI7M 4B7FA 3UJNA 1DGGA 4B3SM 4II7A 2C9CA 4XBOA 4G4RA 1QZMA 1S3SA 1YUBA 1FNNA 4M9ZA 2O5RA 3IG8A 4LJ7A 5FTMA 3U5ZA 3AFHA 2J7NA 3R9XB 3UK6A 3TPZA 1K82A 2KZSA 4L16A 4NL4H 4QHSA 2OQ4A 1NNUC 1R7RA 3KOXE 2DVWB 4DV0M 3K8ZA 4FCWA 3FYCA 3NWLA 5FLXS 3SMSA 2QBYA 3A45A 5DNYA 4AG5A 3ZCBB 3TWMA 4FVMA 4LF4M 3SAWA 4BBAA 3MJ5A 3AV0A 4X66M 2UU9M 4LF7M 4M0WA 3JR4A 8CATA 1J09A 3U6QA 2VQFM 1IBMM 1DGBA 4LFBM 2YFQA 4IBCA 1K3WA 5IREB 4GC9A 3SMPA 2FFJA 3PVSA 4FW9A 2QENA 4JN6A 5FSWA 3J81S 4LJ6A 2EA0A 3RGSA 1PM5A 4MGIE 1ZQ9A 1XNQM 1IBKM 3JAMS 3BOSA 5FTKA 3KS4A 3MHVC 5C1BA 4AKHA 2CE7A 1GLNA 3KSJA 3M0EA 3U61B 5JI3E 4MB7A 4AW4A 2A5YB 3LVWA 1TGUA 1QANA 2ZAOA 3I4YA 4JI2M 2KRKA 3KOYE 1GL7A 2J7OA 1R2ZA 1YE9A 3U6SA 1HT1E 1SXJD 4I81A 4LGMA 3HJSA 1I4WA 2D7HA 3KVWA 5ITXE 1HQCA 1N34M 2UUCM 4YHHM 1DGFA 1XHBA 4FWDA 4LZJA 2KEBA 1NHWC 1HNZM 3CTWB 4NOOB 2G5GX 1PJJA 4MGYE 4DV5M 3J7AS 3TWKA 1E32A 2F5PA 1ORYB 3AJIB 3W0FA 2KRUA 1Z5BA 1L8QA 3FTCA 3KXEC 4LJ8A 4KLNA 1NVMA 4KHPM 5KQDA 5EXPA 1IM2A 1SXJB 3W0LB 3AL0C 1N32M 2KA6B 3FUXA 4PCZA 4DUZM 3U6OA 3SATA 1HQYE 5FTJA 1T3TA 1IN8A 3D8BA 4DV6M 3SASA 3GLHA 3WHLA 3B9PA 2I7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ M;  2UXB M;  3VK8 A;  3GQ4 A;  3GQ3 A;  4X62 M;  4DUY M;  4CIS A;  1Q3B A;  4JI7 M;  3OTO M;  5IT9 S;  5ITQ A;  4B3S M;  4JI3 M;  1TDH A;  4G4R A;  4LF6 M;  1KFV A;  3J80 S;  2UUB M;  4G4Q A;  4PDI A;  2UXD M;  1L2B A;  4JI6 M;  2ZBK B;  2UXC M;  2VQE M;  3SAU A;  3C58 A;  1K82 A;  1Q3C A;  2OQ4 A;  1HR0 M;  1HNW M;  3T1Y M;  4DV0 M;  3A46 A;  4DV2 M;  5A2Q S;  5FLX S;  4B3T M;  4DR6 M;  3A45 A;  4PDG A;  1Z59 A;  4NRW A;  1L1Z A;  3TWM A;  4LF4 M;  4JYA M;  3SAW A;  3U6C A;  4X66 M;  2UU9 M;  4AQY M;  1NNJ A;  1Q39 A;  4DR3 M;  4LF9 M;  4LF7 M;  3JR4 A;  2XZU A;  1Z5A A;  4G4N A;  3U6Q A;  1N33 M;  3GP1 A;  2VQF M;  1IBM M;  1Z5C A;  3GPX A;  3JR5 A;  4LFB M;  4DV7 M;  4GKK M;  1K3W A;  1J5E M;  3U6M A;  2XZF A;  2ZM6 M;  4LFC M;  4JI8 M;  5ITT A;  3J81 S;  4DR7 M;  4JI5 M;  1XMO M;  2EA0 A;  2UUA M;  4DR5 M;  4NXN M;  1L2C A;  1PM5 A;  2HKJ A;  3VK7 A;  2F4V M;  3GPU A;  5ITU A;  1XC8 A;  1XNQ M;  1IBK M;  1L2D A;  3JAM S;  4K0K M;  1HNX M;  1I94 M;  1XNR M;  4MB7 A;  4NRV A;  3T1H M;  4LF8 M;  1IBL M;  4JI2 M;  1MU5 A;  3U6E A;  3SAV A;  2F5Q A;  4DV3 M;  1PJI A;  5LMN M;  3U6S A;  1R2Z A;  4GKJ M;  1K3X A;  4B3R M;  3GPY A;  4DV1 M;  3GQ5 A;  2HHH M;  4LFA M;  4JI4 M;  5ITX E;  1R2Y A;  1N34 M;  4X64 M;  5ITR A;  4DR2 M;  2UUC M;  4YHH M;  2E5L M;  2F5N A;  4YY3 M;  4JI1 M;  3GO8 A;  2F5S A;  1HNZ M;  4LF5 M;  1PJJ A;  4B3M M;  4ITQ A;  4DV5 M;  3J7A S;  3TWK A;  4DR4 M;  1L1T A;  3U6P A;  1N36 M;  5LMU M;  3U6L A;  3TWL A;  4OX9 M;  3U6D A;  2F5P A;  3SAR A;  3W0F A;  4X65 M;  1Z5B A;  4DV4 M;  1EE8 A;  4KHP M;  2F5O A;  4NXM M;  5BR8 M;  4DR1 M;  4JV5 M;  4G4O A;  1N32 M;  3U6O A;  2OPF A;  4PCZ A;  4DUZ M;  3GPP A;  3SBJ A;  3SAT A;  1FJG M;  1MX0 A;  3SAS A;  2Q2E B;  3DOA A;  4JI0 M;  4PD2 A;  4DV6 M;  5ITX A;  5ITY A;  5IWA M;  1TDZ A;  3A42 A; 
#chains in the Genus database with same CATH topology
 1PJQ A;  3I04 M;  2RGH A;  3HU3 A;  4AG6 A;  3AOE C;  3KDS E;  1G8P A;  2LHC A;  4X62 M;  2HAK A;  4L78 A;  2P5T A;  3GQ3 A;  3KP0 E;  4LRS A;  3D8L A;  2ZTD A;  4QNM A;  3OTO M;  3L28 A;  1JQJ C;  3SFZ A;  5ITQ A;  1IY0 A;  2KW0 A;  2LNH C;  2OOB A;  1QAM A;  2DWN A;  2DAE A;  4LF6 M;  4P17 A;  2YQZ A;  2FE8 A;  4R71 A;  3J80 S;  1TH3 A;  2CHG A;  4G4Q A;  2JA2 A;  4OVZ A;  1XXH A;  2UXD M;  2QSF X;  3DFZ A;  1L2B A;  2O01 F;  2DAI A;  2VQE M;  3LQQ A;  1HT2 E;  2N35 A;  2QP9 X;  4M9X A;  3PXG A;  4AKG A;  1R6B X;  2R4E A;  1HNW M;  3HGI A;  1SXJ A;  5KPZ A;  2JY5 A;  1KYI A;  3T6P A;  5A2Q S;  3C3D A;  2Z3X A;  2O25 A;  4B3T M;  4AZF A;  1Z59 A;  2OO9 A;  3QWL A;  4JYA M;  3VLF B;  2I7N A;  1DO0 A;  1H6U A;  1D0M A;  2XH9 A;  3KSX A;  1D0L A;  2L09 A;  5FTN A;  5IZ7 D;  1SXJ C;  2X8A A;  4LJ5 A;  4LF9 M;  3HWS A;  4MGZ E;  2Z4R A;  2JNH A;  1Z5A A;  2KDL A;  4FCT A;  4G4N A;  1N33 M;  1W5S A;  4GHA A;  2Z7J A;  3HJQ A;  1D2N A;  3K9O A;  2JWS A;  5EP4 A;  2XZF A;  4GIP A;  2ZM6 M;  4JI8 M;  4D81 A;  4WUR A;  2V1U A;  3MMP A;  2JZ0 A;  3PFI A;  3KW6 A;  1GL6 A;  2HCB A;  2BWB A;  1OFI A;  1WHC A;  5E6J A;  3VK7 A;  5DYI A;  4MH0 E;  1DO2 A;  4CJ6 A;  5KO3 A;  3UMM A;  5ITU A;  2FNA A;  2BWE A;  2MH8 A;  1ZMV A;  3A98 B;  2C98 A;  4IBJ A;  4B08 A;  2DZN B;  3F92 A;  1QAO A;  1XNR M;  1OAI A;  2HL7 A;  1OKS A;  4JXJ A;  1IXS B;  1IN6 A;  1J7K A;  1ZAE A;  1PJS A;  2EUC A;  3UZU A;  5EXT A;  1PJI A;  5LMN M;  2C9O A;  4GIT A;  4L15 A;  4GKJ M;  3FUT A;  4AI6 A;  1K3X A;  4B3R M;  4M0D A;  4G6Z A;  4IIW A;  4FCV A;  4R3D A;  4HLQ A;  1R2Y A;  3CF2 A;  2EKK A;  3W67 A;  5ITR A;  5EP3 A;  4GHL A;  3Q8G A;  4JI1 M;  1UFZ A;  1IXZ A;  1OFH A;  2L6O A;  3LVV A;  2KNZ A;  1LTM A;  1AIP C;  2K0B X;  3MK6 A;  2LVA A;  2X49 A;  1NY5 A;  4QOZ C;  3KOZ E;  2Y0T A;  1VG5 A;  4B3M M;  2DAM A;  4ITQ A;  1TF0 B;  1NV9 A;  3KP1 E;  2CUZ A;  3LW5 F;  1QDT A;  4OU7 A;  1IY2 A;  2L7H A;  1KSF X;  2BJW A;  2XSZ A;  3GLI B;  3RE8 A;  3SAR A;  3HHZ A;  1A5T A;  3IG5 A;  1QAQ A;  1WGL A;  4DR1 M;  4JV5 M;  3HHW A;  1NJF A;  1TH4 A;  4GMQ A;  3HHY A;  2OPF A;  3R8F A;  2R0I A;  3E21 A;  1MX0 A;  2MRO B;  2Q2E B;  4JI0 M;  3ZQJ A;  4NSR A;  5ITX A;  2YNM D;  2XF3 A;  4PT5 A;  5KPR A;  1T6O A;  1XMQ M;  3FUW A;  2UXB M;  3SC3 A;  4WP2 A;  4QNR A;  1G3I A;  4L6V 6;  3SYK A;  7CAT A;  3GQ4 A;  1OIZ A;  4QOS A;  3M6A A;  4KT0 F;  5IT9 S;  3VKH A;  2DAK A;  3K9P A;  4D80 A;  2B3T A;  1TDH A;  2H5X A;  2RGO A;  1ZMU A;  1VDD A;  2V6Z M;  1G4A E;  2XFS A;  3QYB A;  1Y8G A;  3ZC7 B;  4PDI A;  1QUT A;  3L29 A;  3U61 A;  1DGH B;  1WIV A;  2ZBK B;  5KQ8 A;  3AOE A;  1N77 A;  4LGY A;  4JI6 M;  2UXC M;  1V92 A;  2DWZ B;  3C58 A;  4CHT B;  1G41 A;  4FD2 A;  1IQP A;  1Q3C A;  2M5Z A;  3FUV A;  4LG2 A;  2MGW A;  1HR0 M;  4MGH A;  3KS8 A;  1NO1 A;  3K92 A;  1OQY A;  4M9S A;  1HJP A;  5E26 A;  3T1Y M;  2H1R A;  1QYR A;  2K9D A;  3A46 A;  5F3W A;  4Z6Y A;  4XGI A;  3I4V A;  4DR6 M;  1V34 A;  2CV2 A;  1L1Z A;  4D82 A;  1E9S A;  2NQ8 C;  2JUJ A;  2KZU A;  2R46 A;  5JI2 E;  2MR9 A;  2Y20 A;  3HKP A;  3PNY A;  3V76 A;  4BLC A;  3U6C A;  3B7Q A;  2DWM A;  4AQY M;  3U60 B;  3FYD A;  1Q39 A;  1NNJ A;  1QUS A;  2DZL A;  4GH9 A;  3GLG B;  2QPA A;  2XFT A;  3GP1 A;  2LHG A;  1F4I A;  4MM3 B;  2QCU A;  2DZO B;  3LMM A;  3TL4 X;  1OIP A;  3GPX A;  3GLF B;  4GKK M;  4P16 A;  4UN2 B;  1J5E M;  2R4J A;  4FWG A;  3U6M A;  3GLH E;  2JXN A;  2DHY A;  5ITT A;  5L8R F;  4DR7 M;  4KO8 A;  1DGH A;  1XMO M;  4G3O A;  4HEO A;  4Y28 F;  2Z4S A;  3CGW A;  1L2C A;  1G59 A;  2W82 A;  2F4V M;  2CWB A;  1L2D A;  4BB9 A;  4QHT A;  1HNX M;  3EIH A;  3GRY A;  4S12 A;  3GRV A;  2QQ8 A;  1I94 M;  2XLJ A;  4LJ9 A;  3ZH9 B;  1XXH E;  4NRV A;  3LQR A;  2D7E A;  1AUA A;  1JR3 D;  3HZJ A;  1MU5 A;  3U6E A;  4B7H A;  2R18 A;  4TUW A;  3LCV B;  4NSO B;  3QAU A;  3U60 A;  4GEW A;  1SXJ E;  3FUU A;  3GPY A;  3GQ5 A;  2JY8 A;  3DZD A;  3GLG A;  4DV1 M;  2R6F A;  2HHH M;  2QBY B;  4LJ4 A;  4DR2 M;  4AKI A;  3GLF A;  1Q02 A;  4YY3 M;  3FTF A;  3VDP A;  4FWH A;  4L4U A;  3GO8 A;  2F5S A;  3KFU G;  1PJT A;  4IBI A;  1IN7 A;  2VDB B;  1EIJ A;  3B7Z A;  1NJG A;  3GRU A;  1D0K A;  1TTE A;  2CHV A;  3FKE A;  4B7G A;  4DR4 M;  1L1T A;  2AHM A;  3FRH A;  3U6P A;  2MJ5 B;  5LMU M;  2RRU A;  4IJF A;  1ZMW A;  4KOD A;  4X65 M;  2L7I A;  4DV4 M;  4OW0 A;  4I8O A;  1QZE A;  3FTE A;  2C99 A;  2RKO A;  5DFL A;  2CEA A;  4G4O A;  2VII A;  2J5Y A;  2K47 A;  4MGK E;  1N75 A;  3J2P B;  4LY6 A;  3T38 A;  1IN4 A;  3TE6 A;  3WHK A;  2BNK A;  3M7G A;  4PD2 A;  4LZZ A;  5ITY A;  5IWA M;  2XZU A;  3UGJ A;  1TDZ A;  4CGY B;  1QVR A;  5EP2 A;  3VK8 A;  2DAG A;  2DEN A;  5FTL A;  2LVO C;  1Q3B A;  4I4L A;  4I5S A;  2LWX A;  3Q8X A;  3RGP A;  2DWL A;  1GO5 A;  4LJA A;  2WSF F;  2JP7 A;  2LH0 A;  4JI3 M;  5EXS A;  3E46 A;  4IBK A;  1R5L A;  1E94 E;  1OJL A;  2FH0 A;  1KFV A;  2QZ4 A;  1YSY A;  3L27 A;  2KXE A;  2G8L A;  2WZJ A;  4Q7J A;  2CV0 A;  2CV1 A;  3ILK A;  2GNO A;  1T43 A;  4RF1 A;  4Z8X A;  3SAU A;  1JR3 A;  1IXS A;  1C1K A;  4HL4 A;  1GAB A;  4WW0 A;  1UM8 A;  4IJE A;  2DHR A;  4IBB A;  3GRR A;  1LV7 A;  1OTR A;  4DV2 M;  2VF7 A;  3SHF A;  2ERC A;  2WSE F;  4GRI A;  4PDG A;  2G3Q A;  4XK8 F;  4NRW A;  1VEG A;  2DXI A;  3DA1 A;  3EIE A;  3CF6 E;  1VDL A;  2EJS A;  2ZAM A;  1X37 A;  2X4A A;  5DYG A;  1C7Y A;  4W5W A;  2EO2 A;  3NBI A;  4IBG A;  4A3V B;  4LCB A;  4DR3 M;  1ZV1 A;  3L25 A;  2UUB M;  2KHH A;  1IN5 A;  3FE3 A;  4DBG B;  1QQW A;  2FOI C;  3FD9 A;  1Z5C A;  3JR5 A;  1TR8 A;  3GLH B;  1GJT A;  2JY6 B;  2V1C A;  3J7B A;  4DV7 M;  3H4M A;  4LFC M;  3GLI A;  5EP1 A;  2XEP A;  1PGY A;  4JI5 M;  2Y0Q A;  2UUA M;  4IBE A;  3AOG A;  4DR5 M;  4GC5 A;  5BPV A;  4REZ A;  4NXN M;  2HKJ A;  4R7G A;  1Z6T A;  2GQF A;  3GPU A;  1XWI A;  1XC8 A;  1QDR A;  1IFY A;  3PNV A;  1IY1 A;  4IBD A;  4K0K M;  3VKG A;  2YR0 A;  1JB0 F;  3CF0 A;  1XXH B;  4OVZ B;  2LXE A;  3AKZ A;  2L2D A;  3T1H M;  1MJG M;  1NHG C;  3HJ8 A;  2R44 A;  4IBF A;  3RFW A;  1NY6 A;  4EIW A;  3BBZ A;  1IBL M;  4LF8 M;  3SAV A;  2F5Q A;  1GVN A;  2BJV A;  4DV3 M;  2Z8Y M;  1E9R A;  3H4J A;  2DI0 A;  1IXR C;  3FRI A;  4JI4 M;  2C5R A;  1WR1 B;  3L2A A;  4RF0 A;  3FTD A;  4LFA M;  2XGN A;  3VFD A;  3J27 B;  3K1J A;  4X64 M;  5GKN A;  2E5L M;  3IEC A;  2F5N A;  3I51 A;  1W5T A;  3B89 A;  2KNA A;  2R45 A;  2LTU A;  3T15 A;  4ANR A;  3SHG B;  3VDU A;  4LF5 M;  1G71 A;  2R65 A;  1GKI A;  1V33 A;  3SYL A;  4F1I A;  4L8R C;  1N36 M;  1TH2 A;  3THG A;  3U5Z B;  2L4F A;  3TWL A;  3U6L A;  2CHQ A;  5EJC A;  3U6D A;  4LRT A;  2ZAN A;  2CP8 A;  3L26 A;  2D7G A;  1NSF A;  1VEK A;  4OX9 M;  5EXX A;  2CFO A;  1EE8 A;  3HU2 A;  2F5O A;  4NXM M;  2VF8 A;  1WXQ A;  5BR8 M;  2LBC A;  2JY7 A;  4RNA A;  3SBJ A;  3GPP A;  3E4R A;  1FJG M;  2LVQ D;  3DOA A;  3HHX A;  3IHP A;  3TQS A;  3E9S A;  3A42 A;  5KPT A;  3KOW E;  2APL A;  5H37 D;  2M60 A;  2LVP C;  2DKL A;  2R62 A;  4ZPX A;  2XSZ D;  1N78 A;  4DUY M;  4CIS A;  5EQT A;  5C18 A;  2C96 A;  3HU1 A;  3K2L A;  2Y21 A;  4JI7 M;  4B7F A;  2OOA A;  2DNA A;  3UJN A;  1DGG A;  4B3S M;  4II7 A;  3HY5 A;  4CIZ A;  2C9C A;  4XBO A;  4G4R A;  1QZM A;  1S3S A;  1YUB A;  1FNN A;  2KNV A;  3QYE A;  2ZTC A;  4M9Z A;  2O5R A;  3GLG E;  3IG8 A;  4LJ7 A;  3C3E A;  5FTM A;  1OAO C;  2QHO B;  2J7N A;  3AFH A;  3UK6 A;  3GLF E;  3U5Z A;  3R9X B;  3TPZ A;  1K82 A;  2KZS A;  4L16 A;  4NL4 H;  4QHS A;  1R4G A;  2K6B A;  2OQ4 A;  1NNU C;  1R7R A;  3KOX E;  2DVW B;  4DV0 M;  3K8Z A;  4FCW A;  3FYC A;  3NWL A;  5FLX S;  3W68 A;  3SMS A;  2QBY A;  3A45 A;  5DNY A;  4AG5 A;  3ZCB B;  3TWM A;  4FVM A;  4LF4 M;  3SAW A;  2WSC F;  1EFU B;  4BBA A;  3MJ5 A;  1CUK A;  3AV0 A;  4X66 M;  2UU9 M;  3LCU A;  4LF7 M;  4M0W A;  3JR4 A;  8CAT A;  1J09 A;  3U6Q A;  2VQF M;  1IBM M;  1DGB A;  4LFB M;  2YFQ A;  4IBC A;  1K3W A;  5IRE B;  4GC9 A;  3SMP A;  2FFJ A;  3PVS A;  4FW9 A;  2QEN A;  4JN6 A;  5FSW A;  3J81 S;  4LJ6 A;  1VQ1 A;  2EA0 A;  1WGN A;  1XB2 B;  1VEJ A;  3BXW A;  3RGS A;  1PM5 A;  2L4E A;  4MGI E;  4F2L A;  1ZQ9 A;  2FS1 A;  1IBK M;  1XNQ M;  3JAM S;  3BOS A;  5FTK A;  3KS4 A;  3MHV C;  4RKU F;  3HX3 A;  5C1B A;  4AKH A;  1RU3 A;  2JZ1 A;  2CE7 A;  1GLN A;  3KSJ A;  3M0E A;  1MN3 A;  1YLA A;  3U61 B;  5JI3 E;  4MB7 A;  4AW4 A;  2A5Y B;  3LVW A;  1TGU A;  1QAN A;  2ZAO A;  3I4Y A;  4JI2 M;  1BVS A;  2KRK A;  1JR3 E;  3KOY E;  1GL7 A;  2J7O A;  1R2Z A;  1YE9 A;  3U6S A;  1HT1 E;  1SXJ D;  4I81 A;  3B74 A;  4LGM A;  3HJS A;  1PRB A;  1I4W A;  2D7H A;  3KVW A;  5ITX E;  1HQC A;  1N34 M;  2UUC M;  4YHH M;  1DGF A;  2LVN C;  1DV0 A;  1XHB A;  4FWD A;  4LZJ A;  2KEB A;  1NHW C;  1NV8 A;  2EKF A;  4NC6 A;  1HNZ M;  3CTW B;  3I01 M;  4NOO B;  3NBX X;  2G5G X;  2HWJ A;  3C9P A;  1PJJ A;  4MGY E;  1WJ7 A;  4DV5 M;  3J7A S;  3TWK A;  1E32 A;  3B7N A;  1SG9 A;  1P3Q Q;  2F5P A;  1ORY B;  3AJI B;  3W0F A;  2KRU A;  1Z5B A;  1L8Q A;  3FTC A;  3KXE C;  3GLI E;  4LJ8 A;  4KLN A;  1NVM A;  4KHP M;  5KQD A;  2QNJ A;  5EXP A;  1IM2 A;  1SXJ B;  3W0L B;  3AL0 C;  1N32 M;  2KA6 B;  3FUX A;  4PCZ A;  4DUZ M;  3U6O A;  3SAT A;  1HQY E;  5FTJ A;  1T3T A;  1IN8 A;  3D8B A;  4DV6 M;  3SAS A;  3GLH A;  3WHL A;  1GJS A;  3B9P A;  2I7P A;  2CRU A; 
#chains in the Genus database with same CATH homology
 2RGH A;  3HU3 A;  4AG6 A;  3AOE C;  3KDS E;  1G8P A;  3GQ3 A;  4X62 M;  4L78 A;  2P5T A;  3KP0 E;  4LRS A;  3D8L A;  4QNM A;  3OTO M;  3L28 A;  1JQJ C;  3SFZ A;  5ITQ A;  1IY0 A;  2KW0 A;  2LNH C;  1QAM A;  2DWN A;  4LF6 M;  2YQZ A;  2FE8 A;  3J80 S;  1TH3 A;  2CHG A;  4G4Q A;  2JA2 A;  4OVZ A;  1XXH A;  2UXD M;  3DFZ A;  1L2B A;  2VQE M;  3LQQ A;  1HT2 E;  2QP9 X;  4M9X A;  3PXG A;  4AKG A;  1R6B X;  2R4E A;  1HNW M;  3HGI A;  1SXJ A;  5KPZ A;  1KYI A;  5A2Q S;  2Z3X A;  4B3T M;  4AZF A;  1Z59 A;  3QWL A;  4JYA M;  3VLF B;  2I7N A;  1DO0 A;  1H6U A;  2XH9 A;  3KSX A;  5FTN A;  2L09 A;  5IZ7 D;  1SXJ C;  2X8A A;  4LJ5 A;  4LF9 M;  3HWS A;  4MGZ E;  2Z4R A;  1Z5A A;  4G4N A;  4FCT A;  1N33 M;  1W5S A;  4GHA A;  2Z7J A;  3HJQ A;  1D2N A;  5EP4 A;  2XZF A;  4GIP A;  2ZM6 M;  4JI8 M;  4D81 A;  4WUR A;  2V1U A;  3PFI A;  3KW6 A;  1GL6 A;  2HCB A;  1OFI A;  5E6J A;  3VK7 A;  5DYI A;  4MH0 E;  1DO2 A;  5KO3 A;  3UMM A;  5ITU A;  2FNA A;  3A98 B;  2C98 A;  4IBJ A;  4B08 A;  2DZN B;  1QAO A;  1XNR M;  2HL7 A;  4JXJ A;  1IXS B;  1IN6 A;  1J7K A;  1ZAE A;  2EUC A;  3UZU A;  5EXT A;  1PJI A;  5LMN M;  2C9O A;  4GIT A;  4L15 A;  4GKJ M;  3FUT A;  4AI6 A;  1K3X A;  4B3R M;  4M0D A;  4G6Z A;  4IIW A;  4FCV A;  4R3D A;  4HLQ A;  1R2Y A;  3CF2 A;  5ITR A;  5EP3 A;  4GHL A;  4JI1 M;  1IXZ A;  1OFH A;  2L6O A;  3LVV A;  3MK6 A;  2X49 A;  4QOZ C;  1NY5 A;  3KOZ E;  2Y0T A;  4B3M M;  4ITQ A;  3KP1 E;  2CUZ A;  4OU7 A;  1IY2 A;  2L7H A;  1KSF X;  2BJW A;  2XSZ A;  3GLI B;  3RE8 A;  3SAR A;  3HHZ A;  3IG5 A;  1QAQ A;  4DR1 M;  4JV5 M;  3HHW A;  1NJF A;  1TH4 A;  4GMQ A;  3HHY A;  2OPF A;  3R8F A;  1MX0 A;  2Q2E B;  4JI0 M;  4NSR A;  5ITX A;  2YNM D;  2XF3 A;  4PT5 A;  5KPR A;  1XMQ M;  3FUW A;  2UXB M;  3SC3 A;  4QNR A;  1G3I A;  3GQ4 A;  3SYK A;  7CAT A;  4QOS A;  3M6A A;  5IT9 S;  3VKH A;  4D80 A;  1TDH A;  2RGO A;  1VDD A;  2V6Z M;  1G4A E;  2XFS A;  3ZC7 B;  4PDI A;  3L29 A;  3U61 A;  1DGH B;  2ZBK B;  5KQ8 A;  1N77 A;  3AOE A;  4JI6 M;  4LGY A;  2UXC M;  3C58 A;  2DWZ B;  4CHT B;  1G41 A;  4FD2 A;  1IQP A;  1Q3C A;  2M5Z A;  3FUV A;  4LG2 A;  1HR0 M;  4MGH A;  3KS8 A;  4M9S A;  3K92 A;  5E26 A;  3T1Y M;  2H1R A;  1QYR A;  3A46 A;  5F3W A;  4Z6Y A;  4XGI A;  3I4V A;  4DR6 M;  2CV2 A;  1L1Z A;  4D82 A;  1E9S A;  2NQ8 C;  2R46 A;  2KZU A;  5JI2 E;  2Y20 A;  3PNY A;  3HKP A;  4BLC A;  3U6C A;  2DWM A;  4AQY M;  3U60 B;  3FYD A;  1Q39 A;  1NNJ A;  3GLG B;  4GH9 A;  2QPA A;  2XFT A;  3GP1 A;  4MM3 B;  2QCU A;  2DZO B;  3LMM A;  3TL4 X;  3GPX A;  3GLF B;  4GKK M;  4P16 A;  1J5E M;  2R4J A;  4FWG A;  3U6M A;  5ITT A;  4DR7 M;  4KO8 A;  1DGH A;  1XMO M;  2Z4S A;  1L2C A;  1G59 A;  2W82 A;  2F4V M;  1L2D A;  4BB9 A;  4QHT A;  1HNX M;  3EIH A;  3GRY A;  4S12 A;  3GRV A;  1I94 M;  2XLJ A;  4LJ9 A;  3ZH9 B;  4NRV A;  3LQR A;  2D7E A;  1JR3 D;  1MU5 A;  3U6E A;  4B7H A;  2R18 A;  4TUW A;  4NSO B;  3QAU A;  3U60 A;  1SXJ E;  3FUU A;  3GPY A;  3GQ5 A;  3GLG A;  3DZD A;  4DV1 M;  2HHH M;  2QBY B;  4LJ4 A;  4DR2 M;  4AKI A;  3GLF A;  4YY3 M;  3FTF A;  3VDP A;  4FWH A;  4L4U A;  3GO8 A;  2F5S A;  3KFU G;  4IBI A;  1IN7 A;  1NJG A;  3GRU A;  2CHV A;  3FKE A;  4B7G A;  4DR4 M;  1L1T A;  2AHM A;  3U6P A;  5LMU M;  4IJF A;  4KOD A;  4X65 M;  2L7I A;  4DV4 M;  4OW0 A;  4I8O A;  3FTE A;  2C99 A;  2RKO A;  4G4O A;  2CEA A;  2VII A;  4MGK E;  2K47 A;  1N75 A;  3J2P B;  4LY6 A;  3T38 A;  1IN4 A;  3TE6 A;  3WHK A;  2BNK A;  3M7G A;  4PD2 A;  4LZZ A;  5ITY A;  5IWA M;  2XZU A;  3UGJ A;  1TDZ A;  4CGY B;  1QVR A;  5EP2 A;  3VK8 A;  5FTL A;  1Q3B A;  4I4L A;  4I5S A;  2LWX A;  3Q8X A;  3RGP A;  2DWL A;  4LJA A;  2LH0 A;  4JI3 M;  5EXS A;  4IBK A;  1KFV A;  1E94 E;  1OJL A;  2UUB M;  3L27 A;  1YSY A;  2QZ4 A;  2KXE A;  2G8L A;  2CV0 A;  2CV1 A;  3ILK A;  3SAU A;  4RF1 A;  4Z8X A;  1JR3 A;  1C1K A;  4HL4 A;  4WW0 A;  1UM8 A;  4IJE A;  2DHR A;  4IBB A;  3GRR A;  1LV7 A;  4DV2 M;  3SHF A;  2ERC A;  4GRI A;  4PDG A;  4NRW A;  2DXI A;  3DA1 A;  3EIE A;  3CF6 E;  2ZAM A;  1X37 A;  2X4A A;  5DYG A;  4W5W A;  2EO2 A;  3NBI A;  4IBG A;  4A3V B;  4LCB A;  4DR3 M;  3L25 A;  1IN5 A;  1QQW A;  2FOI C;  3FD9 A;  1Z5C A;  3JR5 A;  3GLH B;  4DV7 M;  2V1C A;  3J7B A;  3H4M A;  4LFC M;  3GLI A;  5EP1 A;  2XEP A;  4JI5 M;  2Y0Q A;  2UUA M;  4IBE A;  3AOG A;  4DR5 M;  4GC5 A;  5BPV A;  4REZ A;  4NXN M;  2HKJ A;  4R7G A;  1Z6T A;  3GPU A;  1XWI A;  1XC8 A;  3PNV A;  1IY1 A;  4IBD A;  4K0K M;  3VKG A;  2YR0 A;  3CF0 A;  1XXH B;  4OVZ B;  2LXE A;  3AKZ A;  3T1H M;  3HJ8 A;  1NHG C;  4IBF A;  3RFW A;  1NY6 A;  4EIW A;  4LF8 M;  1IBL M;  3SAV A;  2F5Q A;  1GVN A;  2BJV A;  4DV3 M;  1E9R A;  1IXR C;  4JI4 M;  2C5R A;  4RF0 A;  3L2A A;  4LFA M;  3FTD A;  2XGN A;  3VFD A;  3J27 B;  3K1J A;  4X64 M;  5GKN A;  2E5L M;  2F5N A;  3I51 A;  1W5T A;  2R45 A;  3T15 A;  3SHG B;  3VDU A;  4LF5 M;  2R65 A;  1GKI A;  3SYL A;  4L8R C;  1N36 M;  1TH2 A;  3THG A;  3U5Z B;  3U6L A;  3TWL A;  2CHQ A;  5EJC A;  3U6D A;  4LRT A;  2ZAN A;  4OX9 M;  3L26 A;  2D7G A;  1NSF A;  5EXX A;  2CFO A;  1EE8 A;  3HU2 A;  2F5O A;  4NXM M;  1WXQ A;  5BR8 M;  4RNA A;  3SBJ A;  3GPP A;  3E4R A;  1FJG M;  3DOA A;  3HHX A;  3TQS A;  3E9S A;  3A42 A;  5KPT A;  3KOW E;  5H37 D;  2M60 A;  4ZPX A;  2R62 A;  2XSZ D;  1N78 A;  4DUY M;  4CIS A;  5EQT A;  5C18 A;  2C96 A;  3HU1 A;  3K2L A;  2Y21 A;  4JI7 M;  4B7F A;  3UJN A;  1DGG A;  4B3S M;  4II7 A;  2C9C A;  4XBO A;  4G4R A;  1QZM A;  1S3S A;  1YUB A;  1FNN A;  4M9Z A;  2O5R A;  3IG8 A;  4LJ7 A;  5FTM A;  3U5Z A;  3AFH A;  2J7N A;  3R9X B;  3UK6 A;  3TPZ A;  1K82 A;  2KZS A;  4L16 A;  4NL4 H;  4QHS A;  2OQ4 A;  1NNU C;  1R7R A;  3KOX E;  2DVW B;  4DV0 M;  3K8Z A;  4FCW A;  3FYC A;  3NWL A;  5FLX S;  3SMS A;  2QBY A;  3A45 A;  5DNY A;  4AG5 A;  3ZCB B;  3TWM A;  4FVM A;  4LF4 M;  3SAW A;  4BBA A;  3MJ5 A;  3AV0 A;  4X66 M;  2UU9 M;  4LF7 M;  4M0W A;  3JR4 A;  8CAT A;  1J09 A;  3U6Q A;  2VQF M;  1IBM M;  1DGB A;  4LFB M;  2YFQ A;  4IBC A;  1K3W A;  5IRE B;  4GC9 A;  3SMP A;  2FFJ A;  3PVS A;  4FW9 A;  2QEN A;  4JN6 A;  5FSW A;  3J81 S;  4LJ6 A;  2EA0 A;  3RGS A;  1PM5 A;  4MGI E;  1ZQ9 A;  1XNQ M;  1IBK M;  3JAM S;  3BOS A;  5FTK A;  3KS4 A;  3MHV C;  5C1B A;  4AKH A;  2CE7 A;  1GLN A;  3KSJ A;  3M0E A;  3U61 B;  5JI3 E;  4MB7 A;  4AW4 A;  2A5Y B;  3LVW A;  1TGU A;  1QAN A;  2ZAO A;  3I4Y A;  4JI2 M;  2KRK A;  3KOY E;  1GL7 A;  2J7O A;  1R2Z A;  1YE9 A;  3U6S A;  1HT1 E;  1SXJ D;  4I81 A;  4LGM A;  3HJS A;  1I4W A;  2D7H A;  3KVW A;  5ITX E;  1HQC A;  1N34 M;  2UUC M;  4YHH M;  1DGF A;  1XHB A;  4FWD A;  4LZJ A;  2KEB A;  1NHW C;  1HNZ M;  3CTW B;  4NOO B;  2G5G X;  1PJJ A;  4MGY E;  4DV5 M;  3J7A S;  3TWK A;  1E32 A;  2F5P A;  1ORY B;  3AJI B;  3W0F A;  2KRU A;  1Z5B A;  1L8Q A;  3FTC A;  3KXE C;  4LJ8 A;  4KLN A;  1NVM A;  4KHP M;  5KQD A;  5EXP A;  1IM2 A;  1SXJ B;  3W0L B;  3AL0 C;  1N32 M;  2KA6 B;  3FUX A;  4PCZ A;  4DUZ M;  3U6O A;  3SAT A;  1HQY E;  5FTJ A;  1T3T A;  1IN8 A;  3D8B A;  4DV6 M;  3SAS A;  3GLH A;  3WHL A;  3B9P A;  2I7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...