1N36M

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 14
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1n36M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1n36M02
4LF4M 3U6DA 5ITYA 3SATA 4LFBM 5BR8M 4DR5M 4DV1M 3C58A 1XC8A 1IBKM 3OTOM 1HNZM 1Q3BA 1EE8A 5LMUM 3JR5A 4DR1M 1IBLM 5FLXS 2UUAM 3A42A 3JR4A 4GKJM 3GQ3A 2VQEM 1L2BA 3SASA 4LF7M 4NRWA 3GPYA 4DR2M 2OQ4A 3DOAA 4CISA 1XMQM 4DUYM 4DV0M 3U6CA 4JI7M 1TDHA 1TDZA 4JYAM 2HKJA 4DR7M 3T1YM 4X62M 4LFAM 3SBJA 1R2ZA 1FJGM 4PD2A 3GPPA 4LF5M 1Q39A 4NRVA 4NXMM 1Q3CA 2XZFA 2E5LM 1L2CA 3GO8A 5ITRA 1XNQM 3VK8A 1MX0A 4JI6M 4DV7M 2F4VM 3GQ4A 5ITXA 3SAWA 4PCZA 4DR3M 2F5NA 1HNXM 4DR6M 4PDGA 4LF9M 3T1HM 5LMNM 5ITUA 3U6EA 3JAMS 2F5OA 1N32M 5ITTA 3U6OA 4MB7A 1Z5BA 1J5EM 4GKKM 4K0KM 2VQFM 2XZUA 2F5SA 3U6LA 1I94M 1IBMM 4X64M 2UXDM 1PJJA 4YY3M 3A46A 4X66M 3A45A 4B3RM 1N33M 4LFCM 4DV2M 4JV5M 4G4OA 1NNJA 1HR0M 3GQ5A 5IWAM 2UUBM 1XMOM 1PM5A 4JI4M 4JI0M 4B3MM 3GP1A 4DV4M 4DV5M 1K3WA 3U6PA 2UXCM 1HNWM 4B3SM 2UXBM 1L1ZA 4X65M 4G4NA 1L2DA 4LF6M 1L1TA 2HHHM 4JI5M 1PJIA 4G4QA 3TWKA 1K3XA 4NXNM 4AQYM 3TWLA 1Z5AA 1KFVA 4YHHM 5ITQA 5IT9S 3W0FA 3GPXA 4LF8M 4OX9M 4DR4M 2ZBKB 2F5PA 2Q2EB 1N36M 1K82A 2F5QA 4JI8M 1MU5A 3VK7A 4PDIA 3TWMA 4JI3M 1R2YA 1XNRM 1Z5CA 3U6SA 3U6QA 3J7AS 2EA0A 1N34M 3J81S 3SAVA 3SARA 2ZM6M 3U6MA 4JI1M 4JI2M 4KHPM 3J80S 4DV3M 2UUCM 2UU9M 2OPFA 4DUZM 4B3TM 5ITXE 5A2QS 4DV6M 1Z59A 3GPUA 4G4RA 3SAUA 4ITQA
chains in the Genus database with same CATH superfamily
1OIZA 3U6DA 5ITYA 2FS1A 2C9OA 5FTLA 4ZPXA 1XC8A 1G3IA 3OTOM 1OTRA 4FD2A 3KOZE 1Q3BA 1EE8A 3UGJA 3HGIA 3NBXX 3GLIB 2FE8A 3RFWA 2KW0A 4R71A 4UN2B 3JR4A 1QUTA 4GKJM 3GQ3A 1L2BA 2CV1A 4LGYA 1HJPA 1HQYE 2R4JA 4JXJA 2GQFA 1NHGC 3FUXA 5H37D 2CE7A 1NVMA 3U5ZB 1OAOC 3B7ZA 3CF0A 3KFUG 4NSOB 3LMMA 4DUYM 3J2PB 1NV8A 3KP0E 1TDHA 2H1RA 4LJ5A 4JI7M 5FTNA 4FW9A 4OVZA 4X62M 2JWSA 4MGHA 4ANRA 4IBIA 1IQPA 1IN4A 2KHHA 4RNAA 2QBYB 4L15A 3SMSA 3QYBA 5IREB 4RF1A 3GPPA 2DWMA 1Q39A 1QAQA 2LVAA 1TTEA 4NXMM 3E21A 3J27B 2B3TA 2RKOA 3LW5F 2XZFA 4L78A 2E5LM 5DYGA 3A98B 1PJSA 2GNOA 2X8AA 4LY6A 3GLIA 2LVNC 4M0DA 3SAWA 2JUJA 2KNAA 4DR3M 1R4GA 2CP8A 4NOOB 1HNXM 3C9PA 3DZDA 5GKNA 1XXHB 2DAKA 5LMNM 3T1HM 4LF9M 5ITUA 2J7OA 3AOEC 3TPZA 4GHLA 4FCVA 4GKKM 3HHZA 4K0KM 2EKFA 2XZUA 2EO2A 2UXDM 4I8OA 1PJJA 3ILKA 1R5LA 5EXSA 3A46A 1TH4A 2L09A 4IBGA 1IN6A 1IFYA 3T6PA 1GLNA 2R65A 2Z4RA 3B74A 4Y28F 4P16A 4BLCA 4G4OA 4CJ6A 2XEPA 2JY5A 2ZTCA 4P17A 5IWAM 2QP9X 1XMOM 4W5WA 4Z8XA 3GP1A 1C7YA 3DA1A 4GHAA 2DWZB 2HWJA 1GJTA 2D7HA 2Z3XA 3HY5A 3K9PA 1D0MA 4LRTA 4FWGA 4G4NA 1L2DA 1OFHA 1XXHA 3K2LA 1PJIA 4G4QA 3TWKA 1K3XA 1IXZA 3CF6E 2ZAOA 4MGIE 4AQYM 1TR8A 2EUCA 3FUTA 2YFQA 3AFHA 1TGUA 4D80A 4OX9M 2JXNA 2K9DA 2ZBKB 3KP1E 2Q2EB 3D8BA 2N35A 1N36M 4FCWA 1K82A 3FUUA 2J5YA 1QANA 2JY6B 1NJFA 3HJQA 4I81A 4M9SA 3FD9A 4REZA 2CV0A 4B7HA 1P3QQ 2BWBA 4GH9A 1G59A 2V1UA 3FUWA 4F1IA 3U6SA 4MGKE 2R45A 1TH2A 2EA0A 4L6V6 3KOWE 1DGBA 1N34M 3FTCA 2DKLA 4JI1M 4KHPM 1S3SA 1NY6A 1T6OA 4XK8F 4S12A 4DUZM 2ERCA 2YQZA 3KSJA 5ITXE 4RF0A 5A2QS 1UFZA 1NNUC 3RGPA 1WHCA 3LCVB 1H6UA 2FOIC 1QDTA 4LJ6A 2QBYA 1XB2B 4Z6YA 1JR3A 4LF4M 4LFBM 1ZMUA 3W0LB 4NSRA 1D0LA 4LJ4A 3HU3A 2L4FA 4R7GA 1IBKM 2JNHA 3ZH9B 3THGA 2OOBA 2Z4SA 4B7FA 1D0KA 3FE3A 2L4EA 1OAIA 3UJNA 2UUAM 2X49A 2DWNA 4CGYB 2LNHC 2VQEM 1SXJE 4LF7M 4NRWA 5KO3A 1G4AE 2I7PA 2KRUA 2WSEF 3KW6A 3KDSE 2JY7A 3PXGA 4AZFA 3H4MA 1NV9A 3M0EA 3I4VA 2DHYA 3NBIA 1XMQM 1GJSA 4IBCA 3GLHE 3K1JA 3C3DA 1TDZA 4JYAM 2HKJA 1NJGA 5JI2E 4DR7M 1QAOA 2L2DA 2R46A 5L8RF 3PVSA 3VKGA 7CATA 1FNNA 1EIJA 4BB9A 2QQ8A 1IN7A 1G41A 3DFZA 3FRHA 4NRVA 2QHOB 3CTWB 1PGYA 4GRIA 4TUWA 3GO8A 2FNAA 1Z6TA 3F92A 1MX0A 3LQQA 2F4VM 3GQ4A 2OOAA 2P5TA 2EJSA 5C18A 2DZLA 3K8ZA 3JAMS 3L29A 5EQTA 2F5OA 1E9RA 2CRUA 3VDUA 8CATA 4LG2A 3U5ZA 3GLGB 3HX3A 1QZMA 1QZEA 3Q8GA 3HHYA 4AG6A 1IBMM 4QNRA 1XWIA 3A45A 1GKIA 1IY0A 3I04M 4M0WA 4B3RM 1N33M 4PT5A 3HHWA 4B7GA 4LJ9A 1F4IA 1JR3D 1VEJA 4LFCM 1N77A 1QVRA 5EXXA 2BJVA 3MHVC 2L7IA 2UUBM 2XLJA 3U61B 3R8FA 4MGZE 5DYIA 4JI0M 1IXSB 2I7NA 4QNMA 5E6JA 1DGHA 2QSFX 1UM8A 3KS8A 3QYEA 2G8LA 1VEGA 1L8QA 4LGMA 4B3SM 4X65M 4LF6M 2QENA 1Q02A 2Y0QA 4JI5M 4LRSA 3UK6A 2Y0TA 3TL4X 3E4RA 2KNZA 3B9PA 3PNVA 4FCTA 3SHGB 4OU7A 2G3QA 3AKZA 3W67A 5ITQA 1E9SA 3L25A 2R62A 3W0FA 2YNMD 4FVMA 1TF0B 4LF8M 4FWDA 4XGIA 3GLIE 1QYRA 2F5PA 4JI8M 2OO9A 2R18A 2F5QA 3VK7A 3GRRA 2JA2A 4PDIA 2V6ZM 1ZMWA 4QHTA 3VLFB 4DBGB 2LH0A 1OIPA 2APLA 1Z5CA 5FTMA 1KFVA 3U6QA 2DAGA 3U61A 2CUZA 1QDRA 2C96A 1DGHB 3U6MA 4FWHA 4OW0A 3T38A 4DV3M 1IN8A 1SXJB 4IJFA 2UU9M 2L7HA 2R0IA 1YLAA 2BNKA 1Z59A 3UMMA 4G4RA 1KYIA 4ITQA 1W5SA 2ZAMA 3KSXA 1GO5A 4G6ZA 3BXWA 3TQSA 2J7NA 2XF3A 4DR5M 4DV1M 3SMPA 4LZZA 5FSWA 1V92A 3C58A 4AKGA 3AJIB 1BVSA 2D7GA 3BOSA 3PNYA 4LJ7A 2C9CA 1GL6A 2LVPC 5JI3E 3GLFB 1IM2A 3JR5A 2KXEA 1NSFA 5KQDA 3L26A 3SASA 1G8PA 3GPYA 3NWLA 4DR2M 2DAMA 2VF8A 2OQ4A 1IN5A 2R44A 2FH0A 4QOZC 3WHLA 4CISA 3GLGA 4LJAA 1DV0A 1SXJA 2O01F 1QUSA 2EKKA 2LHGA 2G5GX 3KVWA 1VG5A 3L28A 2ZANA 1HT1E 3SYLA 3T1YM 1T43A 4LFAM 3SBJA 1R2ZA 3GLGE 4PD2A 3L2AA 2LTUA 1J09A 2JY8A 1YUBA 4LF5M 2K0BX 2LXEA 3SFZA 1T3TA 4KT0F 2JZ0A 1J7KA 2XSZD 5EP1A 3L27A 3GLFA 4JI6M 3H4JA 4IBBA 1DGFA 4DV7M 3HJ8A 3U60A 1VDDA 2KEBA 4PCZA 2F5NA 3HZJA 4WW0A 4D81A 2C98A 3FTDA 4IJEA 2LHCA 3E46A 3U6EA 1ZMVA 3BBZA 5ITTA 2XSZA 4MB7A 3QWLA 2KRKA 1GL7A 2VQFM 2MGWA 4II7A 2XGNA 5KQ8A 1OJLA 2F5SA 1MN3A 4X64M 2L6OA 3IECA 4BBAA 1I4WA 1ZV1A 4HLQA 1WJ7A 1D2NA 1OKSA 3HWSA 4NL4H 3AV0A 3E9SA 2QCUA 4DV2M 1SXJC 4G3OA 1NNJA 2JP7A 2DVWB 2CHQA 3ZC7B 4Q7JA 1PJQA 2M5ZA 3UZUA 3HU1A 1IY1A 1ORYB 3QAUA 4R3DA 4L4UA 2DZOB 1PM5A 4B3MM 4HEOA 4JI4M 3MMPA 3FRIA 1PJTA 3LCUA 2UXCM 3GLHA 2KZUA 4MH0E 2RRUA 1HNWM 2WSFF 2UXBM 1L1ZA 4IBKA 1WGLA 3C3EA 2MR9A 1L1TA 1VDLA 3FKEA 4L16A 4D82A 3FTFA 4NXNM 2WSCF 2RGOA 4AI6A 2CV2A 4HL4A 3TWLA 1Z5AA 5C1BA 4MM3B 3M6AA 5IT9S 5EJCA 4EIWA 3R9XB 2BJWA 2DAIA 2QNJA 4IBFA 3ZQJA 2FFJA 3GRYA 1LTMA 1W5TA 4QOSA 3TWMA 4JI3M 3I51A 4NC6A 2K6BA 2MH8A 3HHXA 3J7AS 5KPRA 4GMQA 2BWEA 3RGSA 1E32A 1VEKA 4IBEA 3J81S 3SARA 1OFIA 3W68A 1VQ1A 2KA6B 3GLHB 4GITA 2DWLA 4JI2M 2UUCM 4MGYE 3VKHA 1IXRC 3SHFA 3KS4A 4B3TM 2QZ4A 3EIEA 4OVZB 3KOYE 5BPVA 2LBCA 1NHWC 2R4EA 2DZNB 3CF2A 2DHRA 4AKIA 5IZ7D 3SATA 2MROB 2NQ8C 5BR8M 3LQRA 1OQYA 1N75A 2XH9A 1C1KA 2K47A 1HNZM 5FTKA 5KPZA 3HKPA 5LMUM 2DENA 3B7NA 1JR3E 4I4LA 1IY2A 4DR1M 1IBLM 5FLXS 2VIIA 3A42A 2CFOA 2Z7JA 2KZSA 2MJ5B 3LVVA 3VFDA 1GVNA 1RU3A 3IHPA 5KPTA 2Y20A 4JN6A 1ZQ9A 3DOAA 2XFTA 1HQCA 2VDBB 4WURA 4CHTB 2Y21A 1DGGA 1Y8GA 2VF7A 4DV0M 3U6CA 1AIPC 3AL0C 4I5SA 2O5RA 4IBDA 3B89A 2CEAA 4AKHA 3KOXE 1FJGM 1QAMA 2DXIA 4M9XA 2DNAA 4GEWA 4RKUF 2X4AA 2DI0A 2LVQD 2A5YB 2LVOC 4LZJA 1V34A 1DO0A 2Z8YM 1Q3CA 2WZJA 2YR0A 3FUVA 1XHBA 2CHGA 1IXSA 3GRUA 3V76A 1A5TA 1HT2E 2ZTDA 3GRVA 3IG8A 3KXEC 4AG5A 5ITRA 1L2CA 1XNQM 3VK8A 2M60A 2V1CA 4IBJA 1EFUB 5EXTA 1E94E 5ITXA 3VDPA 2HAKA 4KODA 4DR6M 3EIHA 3HJSA 5EP3A 4PDGA 4AW4A 4GC5A 2C5RA 1N32M 1N78A 2HCBA 3U6OA 1Z5BA 1J5EM 2O25A 3U6LA 1R7RA 1NY5A 1SXJD 3HU2A 4M9ZA 3AOGA 1I94M 1G71A 2H5XA 3T15A 4YY3M 1AUAA 4X66M 3D8LA 1YE9A 1JB0F 3B7QA 4JV5M 3CGWA 1GABA 1HR0M 1YSYA 2W82A 3TE6A 3GQ5A 4B08A 3MK6A 4DV4M 4DV5M 1K3WA 2AHMA 1XXHE 2C99A 1PRBA 2KNVA 3LVWA 4KLNA 3SC3A 4XBOA 3U6PA 1WR1B 3U60B 2HL7A 1SG9A 2KDLA 4LJ8A 5DNYA 4LCBA 1QQWA 1NO1A 1V33A 2JZ1A 5EP2A 2HHHM 4GC9A 4KO8A 4GIPA 4IIWA 3PFIA 5F3WA 3M7GA 4QHSA 2CWBA 3I01M 2R6FA 2DAEA 3K92A 2XFSA 3Q8XA 4CIZA 4YHHM 2LWXA 3FTEA 3J7BA 3GPXA 4WP2A 1WGNA 5EXPA 3GLFE 4DR4M 1JQJC 1TH3A 1X37A 1R6BX 1DO2A 2RGHA 1MU5A 3K9OA 4F2LA 5E26A 3AOEA 1LV7A 3FYCA 1R2YA 1XNRM 4L8RC 5DFLA 3IG5A 1WXQA 5FTJA 5EP4A 4A3VB 1WIVA 3I4YA 3FYDA 3SAVA 2ZM6M 2CHVA 3J80S 2OPFA 1CUKA 3WHKA 2D7EA 3MJ5A 4DV6M 3RE8A 3GPUA 3SYKA 3SAUA 1MJGM 2QPAA 1KSFX 1ZAEA 3ZCBB
chains in the Genus database with same CATH topology
3U6DA 5ITYA 2C9OA 5FTLA 4ZPXA 1XC8A 1G3IA 3OTOM 4FD2A 3KOZE 1Q3BA 1EE8A 3UGJA 3HGIA 3GLIB 2FE8A 3RFWA 2KW0A 3JR4A 4GKJM 3GQ3A 1L2BA 2CV1A 4LGYA 1HQYE 2R4JA 4JXJA 1NHGC 3FUXA 5H37D 2CE7A 1NVMA 3U5ZB 3KFUG 3CF0A 4NSOB 3LMMA 4DUYM 3J2PB 3KP0E 4LJ5A 1TDHA 2H1RA 4JI7M 5FTNA 4FW9A 4OVZA 4X62M 4MGHA 4IBIA 1IQPA 1IN4A 4RNAA 2QBYB 4L15A 3SMSA 5IREB 4RF1A 3GPPA 2DWMA 1Q39A 1QAQA 4NXMM 3J27B 2RKOA 2XZFA 4L78A 2E5LM 5DYGA 3A98B 2X8AA 4LY6A 3GLIA 4M0DA 3SAWA 4DR3M 4NOOB 1HNXM 3DZDA 5GKNA 1XXHB 3T1HM 5LMNM 4LF9M 5ITUA 2J7OA 3AOEC 3TPZA 4GHLA 4FCVA 4GKKM 3HHZA 4K0KM 2XZUA 2EO2A 2UXDM 4I8OA 1PJJA 3ILKA 5EXSA 3A46A 1TH4A 2L09A 4IBGA 1IN6A 1GLNA 2R65A 2Z4RA 4P16A 4BLCA 4G4OA 2XEPA 5IWAM 2QP9X 1XMOM 4W5WA 4Z8XA 3GP1A 3DA1A 4GHAA 2DWZB 2D7HA 2Z3XA 4LRTA 4FWGA 4G4NA 1L2DA 1OFHA 1XXHA 3K2LA 1PJIA 4G4QA 3TWKA 1K3XA 1IXZA 3CF6E 2ZAOA 4MGIE 4AQYM 2EUCA 3FUTA 2YFQA 3AFHA 1TGUA 4D80A 4OX9M 2ZBKB 3KP1E 2Q2EB 3D8BA 1N36M 1K82A 4FCWA 3FUUA 1QANA 1NJFA 3HJQA 4I81A 4M9SA 3FD9A 4REZA 2CV0A 4B7HA 4GH9A 1G59A 2V1UA 3FUWA 3U6SA 4MGKE 2R45A 1TH2A 2EA0A 3KOWE 1DGBA 1N34M 3FTCA 4JI1M 4KHPM 1S3SA 1NY6A 4S12A 4DUZM 2ERCA 2YQZA 3KSJA 5ITXE 4RF0A 5A2QS 1NNUC 3RGPA 1H6UA 2FOIC 4LJ6A 2QBYA 4Z6YA 1JR3A 4LF4M 4LFBM 3W0LB 4NSRA 4LJ4A 3HU3A 1IBKM 4R7GA 3ZH9B 3THGA 2Z4SA 4B7FA 2UUAM 3UJNA 2X49A 2DWNA 4CGYB 2LNHC 2VQEM 1SXJE 4LF7M 4NRWA 5KO3A 1G4AE 2I7PA 2KRUA 3KW6A 3KDSE 3PXGA 4AZFA 3H4MA 3M0EA 3I4VA 3NBIA 1XMQM 4IBCA 3K1JA 1TDZA 4JYAM 2HKJA 1NJGA 5JI2E 4DR7M 1QAOA 2R46A 3PVSA 3VKGA 7CATA 1FNNA 4BB9A 1IN7A 1G41A 3DFZA 4NRVA 3CTWB 4GRIA 4TUWA 3GO8A 2FNAA 1Z6TA 1MX0A 3LQQA 2F4VM 3GQ4A 2P5TA 5C18A 3K8ZA 3JAMS 3L29A 5EQTA 2F5OA 1E9RA 8CATA 3VDUA 4LG2A 3U5ZA 3GLGB 1QZMA 3HHYA 4AG6A 1IBMM 4QNRA 1XWIA 3A45A 1GKIA 1IY0A 4M0WA 4B3RM 1N33M 4PT5A 3HHWA 4B7GA 4LJ9A 1JR3D 4LFCM 1N77A 1QVRA 5EXXA 2BJVA 3MHVC 2L7IA 2UUBM 2XLJA 3U61B 3R8FA 4MGZE 5DYIA 4JI0M 1IXSB 2I7NA 4QNMA 5E6JA 1DGHA 1UM8A 3KS8A 2G8LA 1L8QA 4LGMA 4B3SM 4X65M 4LF6M 2QENA 2Y0QA 4JI5M 4LRSA 3UK6A 2Y0TA 3TL4X 3E4RA 3B9PA 3PNVA 4FCTA 3SHGB 4OU7A 3AKZA 5ITQA 1E9SA 3L25A 2R62A 3W0FA 2YNMD 4FVMA 4LF8M 4FWDA 4XGIA 1QYRA 2F5PA 4JI8M 2F5QA 2R18A 3VK7A 3GRRA 2JA2A 4PDIA 2V6ZM 4QHTA 3VLFB 2LH0A 5FTMA 1Z5CA 3U6QA 3U61A 2CUZA 2C96A 1DGHB 3U6MA 4FWHA 4OW0A 3T38A 4DV3M 1IN8A 1SXJB 4IJFA 2UU9M 2L7HA 2BNKA 3UMMA 1Z59A 4G4RA 1KYIA 4ITQA 1W5SA 2ZAMA 3KSXA 4G6ZA 3TQSA 2J7NA 2XF3A 4DR5M 4DV1M 3SMPA 4LZZA 5FSWA 3C58A 4AKGA 3AJIB 2D7GA 4LJ7A 3BOSA 3PNYA 2C9CA 1GL6A 5JI3E 3GLFB 1IM2A 3JR5A 2KXEA 1NSFA 5KQDA 3L26A 3SASA 1G8PA 3GPYA 3NWLA 4DR2M 2OQ4A 1IN5A 4QOZC 3WHLA 4CISA 3GLGA 4LJAA 1SXJA 3KVWA 2G5GX 3L28A 2ZANA 1HT1E 3SYLA 3T1YM 4LFAM 3SBJA 1R2ZA 4PD2A 3L2AA 1J09A 1YUBA 4LF5M 2LXEA 3SFZA 1T3TA 1J7KA 2XSZD 5EP1A 3L27A 3GLFA 4JI6M 4IBBA 4DV7M 1DGFA 3U60A 3HJ8A 1VDDA 2KEBA 4PCZA 2F5NA 4WW0A 4D81A 2C98A 3FTDA 4IJEA 3U6EA 5ITTA 2XSZA 4MB7A 3QWLA 2KRKA 1GL7A 2VQFM 4II7A 5KQ8A 2XGNA 2F5SA 1OJLA 4X64M 2L6OA 4BBAA 1I4WA 4HLQA 1D2NA 3HWSA 4NL4H 3AV0A 3E9SA 2QCUA 4DV2M 1SXJC 1NNJA 3ZC7B 2DVWB 2CHQA 2M5ZA 3UZUA 3HU1A 1IY1A 1ORYB 3QAUA 4R3DA 4L4UA 2DZOB 1PM5A 4B3MM 4JI4M 2UXCM 3GLHA 2KZUA 4MH0E 1HNWM 2UXBM 1L1ZA 4IBKA 1L1TA 3FKEA 4L16A 4D82A 3FTFA 4NXNM 2RGOA 4AI6A 2CV2A 4HL4A 3TWLA 1Z5AA 5C1BA 4MM3B 3M6AA 5IT9S 5EJCA 4EIWA 3R9XB 2BJWA 4IBFA 2FFJA 3GRYA 1W5TA 4QOSA 3TWMA 4JI3M 3I51A 3HHXA 3J7AS 5KPRA 4GMQA 3RGSA 1E32A 4IBEA 3J81S 3SARA 1OFIA 2KA6B 3GLHB 4GITA 2DWLA 4JI2M 2UUCM 4MGYE 3VKHA 1IXRC 3SHFA 3KS4A 4B3TM 2QZ4A 3EIEA 4OVZB 3KOYE 5BPVA 1NHWC 2R4EA 2DZNB 3CF2A 2DHRA 4AKIA 5IZ7D 3SATA 2NQ8C 5BR8M 3LQRA 1N75A 2XH9A 1C1KA 2K47A 1HNZM 5FTKA 5KPZA 3HKPA 5LMUM 4I4LA 1IY2A 4DR1M 1IBLM 5FLXS 2VIIA 3A42A 2CFOA 2Z7JA 2KZSA 3LVVA 3VFDA 1GVNA 5KPTA 2Y20A 4JN6A 1ZQ9A 3DOAA 2XFTA 1HQCA 4WURA 4CHTB 2Y21A 1DGGA 4DV0M 3U6CA 3AL0C 4I5SA 2O5RA 4IBDA 2CEAA 4AKHA 3KOXE 1FJGM 1QAMA 2DXIA 4M9XA 2X4AA 4LZJA 2A5YB 1DO0A 1Q3CA 2YR0A 3FUVA 1XHBA 2CHGA 3GRUA 1HT2E 1L2CA 3GRVA 3IG8A 3KXEC 4AG5A 5ITRA 1XNQM 3VK8A 2M60A 2V1CA 4IBJA 5EXTA 3VDPA 1E94E 5ITXA 4KODA 4DR6M 3EIHA 3HJSA 5EP3A 4PDGA 4AW4A 4GC5A 2C5RA 1N32M 1N78A 2HCBA 3U6OA 1Z5BA 1J5EM 3U6LA 1R7RA 1NY5A 1SXJD 3HU2A 4M9ZA 3AOGA 1I94M 3T15A 4YY3M 4X66M 3D8LA 1YE9A 4JV5M 1HR0M 1YSYA 2W82A 3TE6A 3GQ5A 4B08A 3MK6A 4DV4M 4DV5M 1K3WA 2AHMA 2C99A 4KLNA 3LVWA 3SC3A 4XBOA 3U6PA 3U60B 2HL7A 4LJ8A 5DNYA 4LCBA 1QQWA 5EP2A 2HHHM 4GC9A 4KO8A 4GIPA 4IIWA 3PFIA 5F3WA 3M7GA 4QHSA 4YHHM 1KFVA 3K92A 3Q8XA 2XFSA 2LWXA 3FTEA 3J7BA 3GPXA 5EXPA 4DR4M 1JQJC 1TH3A 1X37A 1R6BX 1DO2A 2RGHA 1MU5A 5E26A 3AOEA 1LV7A 3FYCA 1R2YA 1XNRM 4L8RC 3IG5A 1WXQA 5FTJA 5EP4A 4A3VB 3I4YA 3FYDA 3SAVA 2ZM6M 2CHVA 3J80S 2OPFA 3WHKA 2D7EA 3MJ5A 4DV6M 3RE8A 3GPUA 3SYKA 3SAUA 2QPAA 1KSFX 1ZAEA 3ZCBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 M;  3U6D A;  5ITY A;  3SAT A;  4LFB M;  5BR8 M;  4DR5 M;  4DV1 M;  3C58 A;  1XC8 A;  1IBK M;  3OTO M;  1HNZ M;  1Q3B A;  1EE8 A;  5LMU M;  3JR5 A;  4DR1 M;  1IBL M;  5FLX S;  2UUA M;  3A42 A;  3JR4 A;  4GKJ M;  3GQ3 A;  2VQE M;  1L2B A;  3SAS A;  4LF7 M;  4NRW A;  3GPY A;  4DR2 M;  2OQ4 A;  3DOA A;  4CIS A;  1XMQ M;  4DUY M;  4DV0 M;  3U6C A;  4JI7 M;  1TDH A;  1TDZ A;  4JYA M;  2HKJ A;  4DR7 M;  3T1Y M;  4X62 M;  4LFA M;  3SBJ A;  1R2Z A;  1FJG M;  4PD2 A;  3GPP A;  4LF5 M;  1Q39 A;  4NRV A;  4NXM M;  1Q3C A;  2XZF A;  2E5L M;  1L2C A;  3GO8 A;  5ITR A;  1XNQ M;  3VK8 A;  1MX0 A;  4JI6 M;  4DV7 M;  2F4V M;  3GQ4 A;  5ITX A;  3SAW A;  4PCZ A;  4DR3 M;  2F5N A;  1HNX M;  4DR6 M;  4PDG A;  4LF9 M;  3T1H M;  5LMN M;  5ITU A;  3U6E A;  3JAM S;  2F5O A;  1N32 M;  5ITT A;  3U6O A;  4MB7 A;  1Z5B A;  1J5E M;  4GKK M;  4K0K M;  2VQF M;  2XZU A;  2F5S A;  3U6L A;  1I94 M;  1IBM M;  4X64 M;  2UXD M;  1PJJ A;  4YY3 M;  3A46 A;  4X66 M;  3A45 A;  4B3R M;  1N33 M;  4LFC M;  4DV2 M;  4JV5 M;  4G4O A;  1NNJ A;  1HR0 M;  3GQ5 A;  5IWA M;  2UUB M;  1XMO M;  1PM5 A;  4JI4 M;  4JI0 M;  4B3M M;  3GP1 A;  4DV4 M;  4DV5 M;  1K3W A;  3U6P A;  2UXC M;  1HNW M;  4B3S M;  2UXB M;  1L1Z A;  4X65 M;  4G4N A;  1L2D A;  4LF6 M;  1L1T A;  2HHH M;  4JI5 M;  1PJI A;  4G4Q A;  3TWK A;  1K3X A;  4NXN M;  4AQY M;  3TWL A;  1Z5A A;  1KFV A;  4YHH M;  5ITQ A;  5IT9 S;  3W0F A;  3GPX A;  4LF8 M;  4OX9 M;  4DR4 M;  2ZBK B;  2F5P A;  2Q2E B;  1N36 M;  1K82 A;  2F5Q A;  4JI8 M;  1MU5 A;  3VK7 A;  4PDI A;  3TWM A;  4JI3 M;  1R2Y A;  1XNR M;  1Z5C A;  3U6S A;  3U6Q A;  3J7A S;  2EA0 A;  1N34 M;  3J81 S;  3SAV A;  3SAR A;  2ZM6 M;  3U6M A;  4JI1 M;  4JI2 M;  4KHP M;  3J80 S;  4DV3 M;  2UUC M;  2UU9 M;  2OPF A;  4DUZ M;  4B3T M;  5ITX E;  5A2Q S;  4DV6 M;  1Z59 A;  3GPU A;  4G4R A;  3SAU A;  4ITQ A; 
#chains in the Genus database with same CATH topology
 1OIZ A;  3U6D A;  5ITY A;  2FS1 A;  2C9O A;  5FTL A;  4ZPX A;  1XC8 A;  1G3I A;  3OTO M;  1OTR A;  4FD2 A;  3KOZ E;  1Q3B A;  1EE8 A;  3UGJ A;  3HGI A;  3NBX X;  3GLI B;  2FE8 A;  3RFW A;  2KW0 A;  4R71 A;  4UN2 B;  3JR4 A;  1QUT A;  4GKJ M;  3GQ3 A;  1L2B A;  2CV1 A;  4LGY A;  1HJP A;  1HQY E;  2R4J A;  4JXJ A;  2GQF A;  1NHG C;  3FUX A;  5H37 D;  2CE7 A;  1NVM A;  3U5Z B;  1OAO C;  3B7Z A;  3CF0 A;  3KFU G;  4NSO B;  3LMM A;  4DUY M;  3J2P B;  1NV8 A;  3KP0 E;  1TDH A;  2H1R A;  4LJ5 A;  4JI7 M;  5FTN A;  4FW9 A;  4OVZ A;  4X62 M;  2JWS A;  4MGH A;  4ANR A;  4IBI A;  1IQP A;  1IN4 A;  2KHH A;  4RNA A;  2QBY B;  4L15 A;  3SMS A;  3QYB A;  5IRE B;  4RF1 A;  3GPP A;  2DWM A;  1Q39 A;  1QAQ A;  2LVA A;  1TTE A;  4NXM M;  3E21 A;  3J27 B;  2B3T A;  2RKO A;  3LW5 F;  2XZF A;  4L78 A;  2E5L M;  5DYG A;  3A98 B;  1PJS A;  2GNO A;  2X8A A;  4LY6 A;  3GLI A;  2LVN C;  4M0D A;  3SAW A;  2JUJ A;  2KNA A;  4DR3 M;  1R4G A;  2CP8 A;  4NOO B;  1HNX M;  3C9P A;  3DZD A;  5GKN A;  1XXH B;  2DAK A;  5LMN M;  3T1H M;  4LF9 M;  5ITU A;  2J7O A;  3AOE C;  3TPZ A;  4GHL A;  4FCV A;  4GKK M;  3HHZ A;  4K0K M;  2EKF A;  2XZU A;  2EO2 A;  2UXD M;  4I8O A;  1PJJ A;  3ILK A;  1R5L A;  5EXS A;  3A46 A;  1TH4 A;  2L09 A;  4IBG A;  1IN6 A;  1IFY A;  3T6P A;  1GLN A;  2R65 A;  2Z4R A;  3B74 A;  4Y28 F;  4P16 A;  4BLC A;  4G4O A;  4CJ6 A;  2XEP A;  2JY5 A;  2ZTC A;  4P17 A;  5IWA M;  2QP9 X;  1XMO M;  4W5W A;  4Z8X A;  3GP1 A;  1C7Y A;  3DA1 A;  4GHA A;  2DWZ B;  2HWJ A;  1GJT A;  2D7H A;  2Z3X A;  3HY5 A;  3K9P A;  1D0M A;  4LRT A;  4FWG A;  4G4N A;  1L2D A;  1OFH A;  1XXH A;  3K2L A;  1PJI A;  4G4Q A;  3TWK A;  1K3X A;  1IXZ A;  3CF6 E;  2ZAO A;  4MGI E;  4AQY M;  1TR8 A;  2EUC A;  3FUT A;  2YFQ A;  3AFH A;  1TGU A;  4D80 A;  4OX9 M;  2JXN A;  2K9D A;  2ZBK B;  3KP1 E;  2Q2E B;  3D8B A;  2N35 A;  1N36 M;  4FCW A;  1K82 A;  3FUU A;  2J5Y A;  1QAN A;  2JY6 B;  1NJF A;  3HJQ A;  4I81 A;  4M9S A;  3FD9 A;  4REZ A;  2CV0 A;  4B7H A;  1P3Q Q;  2BWB A;  4GH9 A;  1G59 A;  2V1U A;  3FUW A;  4F1I A;  3U6S A;  4MGK E;  2R45 A;  1TH2 A;  2EA0 A;  4L6V 6;  3KOW E;  1DGB A;  1N34 M;  3FTC A;  2DKL A;  4JI1 M;  4KHP M;  1S3S A;  1NY6 A;  1T6O A;  4XK8 F;  4S12 A;  4DUZ M;  2ERC A;  2YQZ A;  3KSJ A;  5ITX E;  4RF0 A;  5A2Q S;  1UFZ A;  1NNU C;  3RGP A;  1WHC A;  3LCV B;  1H6U A;  2FOI C;  1QDT A;  4LJ6 A;  2QBY A;  1XB2 B;  4Z6Y A;  1JR3 A;  4LF4 M;  4LFB M;  1ZMU A;  3W0L B;  4NSR A;  1D0L A;  4LJ4 A;  3HU3 A;  2L4F A;  4R7G A;  1IBK M;  2JNH A;  3ZH9 B;  3THG A;  2OOB A;  2Z4S A;  4B7F A;  1D0K A;  3FE3 A;  2L4E A;  1OAI A;  3UJN A;  2UUA M;  2X49 A;  2DWN A;  4CGY B;  2LNH C;  2VQE M;  1SXJ E;  4LF7 M;  4NRW A;  5KO3 A;  1G4A E;  2I7P A;  2KRU A;  2WSE F;  3KW6 A;  3KDS E;  2JY7 A;  3PXG A;  4AZF A;  3H4M A;  1NV9 A;  3M0E A;  3I4V A;  2DHY A;  3NBI A;  1XMQ M;  1GJS A;  4IBC A;  3GLH E;  3K1J A;  3C3D A;  1TDZ A;  4JYA M;  2HKJ A;  1NJG A;  5JI2 E;  4DR7 M;  1QAO A;  2L2D A;  2R46 A;  5L8R F;  3PVS A;  3VKG A;  7CAT A;  1FNN A;  1EIJ A;  4BB9 A;  2QQ8 A;  1IN7 A;  1G41 A;  3DFZ A;  3FRH A;  4NRV A;  2QHO B;  3CTW B;  1PGY A;  4GRI A;  4TUW A;  3GO8 A;  2FNA A;  1Z6T A;  3F92 A;  1MX0 A;  3LQQ A;  2F4V M;  3GQ4 A;  2OOA A;  2P5T A;  2EJS A;  5C18 A;  2DZL A;  3K8Z A;  3JAM S;  3L29 A;  5EQT A;  2F5O A;  1E9R A;  2CRU A;  3VDU A;  8CAT A;  4LG2 A;  3U5Z A;  3GLG B;  3HX3 A;  1QZM A;  1QZE A;  3Q8G A;  3HHY A;  4AG6 A;  1IBM M;  4QNR A;  1XWI A;  3A45 A;  1GKI A;  1IY0 A;  3I04 M;  4M0W A;  4B3R M;  1N33 M;  4PT5 A;  3HHW A;  4B7G A;  4LJ9 A;  1F4I A;  1JR3 D;  1VEJ A;  4LFC M;  1N77 A;  1QVR A;  5EXX A;  2BJV A;  3MHV C;  2L7I A;  2UUB M;  2XLJ A;  3U61 B;  3R8F A;  4MGZ E;  5DYI A;  4JI0 M;  1IXS B;  2I7N A;  4QNM A;  5E6J A;  1DGH A;  2QSF X;  1UM8 A;  3KS8 A;  3QYE A;  2G8L A;  1VEG A;  1L8Q A;  4LGM A;  4B3S M;  4X65 M;  4LF6 M;  2QEN A;  1Q02 A;  2Y0Q A;  4JI5 M;  4LRS A;  3UK6 A;  2Y0T A;  3TL4 X;  3E4R A;  2KNZ A;  3B9P A;  3PNV A;  4FCT A;  3SHG B;  4OU7 A;  2G3Q A;  3AKZ A;  3W67 A;  5ITQ A;  1E9S A;  3L25 A;  2R62 A;  3W0F A;  2YNM D;  4FVM A;  1TF0 B;  4LF8 M;  4FWD A;  4XGI A;  3GLI E;  1QYR A;  2F5P A;  4JI8 M;  2OO9 A;  2R18 A;  2F5Q A;  3VK7 A;  3GRR A;  2JA2 A;  4PDI A;  2V6Z M;  1ZMW A;  4QHT A;  3VLF B;  4DBG B;  2LH0 A;  1OIP A;  2APL A;  1Z5C A;  5FTM A;  1KFV A;  3U6Q A;  2DAG A;  3U61 A;  2CUZ A;  1QDR A;  2C96 A;  1DGH B;  3U6M A;  4FWH A;  4OW0 A;  3T38 A;  4DV3 M;  1IN8 A;  1SXJ B;  4IJF A;  2UU9 M;  2L7H A;  2R0I A;  1YLA A;  2BNK A;  1Z59 A;  3UMM A;  4G4R A;  1KYI A;  4ITQ A;  1W5S A;  2ZAM A;  3KSX A;  1GO5 A;  4G6Z A;  3BXW A;  3TQS A;  2J7N A;  2XF3 A;  4DR5 M;  4DV1 M;  3SMP A;  4LZZ A;  5FSW A;  1V92 A;  3C58 A;  4AKG A;  3AJI B;  1BVS A;  2D7G A;  3BOS A;  3PNY A;  4LJ7 A;  2C9C A;  1GL6 A;  2LVP C;  5JI3 E;  3GLF B;  1IM2 A;  3JR5 A;  2KXE A;  1NSF A;  5KQD A;  3L26 A;  3SAS A;  1G8P A;  3GPY A;  3NWL A;  4DR2 M;  2DAM A;  2VF8 A;  2OQ4 A;  1IN5 A;  2R44 A;  2FH0 A;  4QOZ C;  3WHL A;  4CIS A;  3GLG A;  4LJA A;  1DV0 A;  1SXJ A;  2O01 F;  1QUS A;  2EKK A;  2LHG A;  2G5G X;  3KVW A;  1VG5 A;  3L28 A;  2ZAN A;  1HT1 E;  3SYL A;  3T1Y M;  1T43 A;  4LFA M;  3SBJ A;  1R2Z A;  3GLG E;  4PD2 A;  3L2A A;  2LTU A;  1J09 A;  2JY8 A;  1YUB A;  4LF5 M;  2K0B X;  2LXE A;  3SFZ A;  1T3T A;  4KT0 F;  2JZ0 A;  1J7K A;  2XSZ D;  5EP1 A;  3L27 A;  3GLF A;  4JI6 M;  3H4J A;  4IBB A;  1DGF A;  4DV7 M;  3HJ8 A;  3U60 A;  1VDD A;  2KEB A;  4PCZ A;  2F5N A;  3HZJ A;  4WW0 A;  4D81 A;  2C98 A;  3FTD A;  4IJE A;  2LHC A;  3E46 A;  3U6E A;  1ZMV A;  3BBZ A;  5ITT A;  2XSZ A;  4MB7 A;  3QWL A;  2KRK A;  1GL7 A;  2VQF M;  2MGW A;  4II7 A;  2XGN A;  5KQ8 A;  1OJL A;  2F5S A;  1MN3 A;  4X64 M;  2L6O A;  3IEC A;  4BBA A;  1I4W A;  1ZV1 A;  4HLQ A;  1WJ7 A;  1D2N A;  1OKS A;  3HWS A;  4NL4 H;  3AV0 A;  3E9S A;  2QCU A;  4DV2 M;  1SXJ C;  4G3O A;  1NNJ A;  2JP7 A;  2DVW B;  2CHQ A;  3ZC7 B;  4Q7J A;  1PJQ A;  2M5Z A;  3UZU A;  3HU1 A;  1IY1 A;  1ORY B;  3QAU A;  4R3D A;  4L4U A;  2DZO B;  1PM5 A;  4B3M M;  4HEO A;  4JI4 M;  3MMP A;  3FRI A;  1PJT A;  3LCU A;  2UXC M;  3GLH A;  2KZU A;  4MH0 E;  2RRU A;  1HNW M;  2WSF F;  2UXB M;  1L1Z A;  4IBK A;  1WGL A;  3C3E A;  2MR9 A;  1L1T A;  1VDL A;  3FKE A;  4L16 A;  4D82 A;  3FTF A;  4NXN M;  2WSC F;  2RGO A;  4AI6 A;  2CV2 A;  4HL4 A;  3TWL A;  1Z5A A;  5C1B A;  4MM3 B;  3M6A A;  5IT9 S;  5EJC A;  4EIW A;  3R9X B;  2BJW A;  2DAI A;  2QNJ A;  4IBF A;  3ZQJ A;  2FFJ A;  3GRY A;  1LTM A;  1W5T A;  4QOS A;  3TWM A;  4JI3 M;  3I51 A;  4NC6 A;  2K6B A;  2MH8 A;  3HHX A;  3J7A S;  5KPR A;  4GMQ A;  2BWE A;  3RGS A;  1E32 A;  1VEK A;  4IBE A;  3J81 S;  3SAR A;  1OFI A;  3W68 A;  1VQ1 A;  2KA6 B;  3GLH B;  4GIT A;  2DWL A;  4JI2 M;  2UUC M;  4MGY E;  3VKH A;  1IXR C;  3SHF A;  3KS4 A;  4B3T M;  2QZ4 A;  3EIE A;  4OVZ B;  3KOY E;  5BPV A;  2LBC A;  1NHW C;  2R4E A;  2DZN B;  3CF2 A;  2DHR A;  4AKI A;  5IZ7 D;  3SAT A;  2MRO B;  2NQ8 C;  5BR8 M;  3LQR A;  1OQY A;  1N75 A;  2XH9 A;  1C1K A;  2K47 A;  1HNZ M;  5FTK A;  5KPZ A;  3HKP A;  5LMU M;  2DEN A;  3B7N A;  1JR3 E;  4I4L A;  1IY2 A;  4DR1 M;  1IBL M;  5FLX S;  2VII A;  3A42 A;  2CFO A;  2Z7J A;  2KZS A;  2MJ5 B;  3LVV A;  3VFD A;  1GVN A;  1RU3 A;  3IHP A;  5KPT A;  2Y20 A;  4JN6 A;  1ZQ9 A;  3DOA A;  2XFT A;  1HQC A;  2VDB B;  4WUR A;  4CHT B;  2Y21 A;  1DGG A;  1Y8G A;  2VF7 A;  4DV0 M;  3U6C A;  1AIP C;  3AL0 C;  4I5S A;  2O5R A;  4IBD A;  3B89 A;  2CEA A;  4AKH A;  3KOX E;  1FJG M;  1QAM A;  2DXI A;  4M9X A;  2DNA A;  4GEW A;  4RKU F;  2X4A A;  2DI0 A;  2LVQ D;  2A5Y B;  2LVO C;  4LZJ A;  1V34 A;  1DO0 A;  2Z8Y M;  1Q3C A;  2WZJ A;  2YR0 A;  3FUV A;  1XHB A;  2CHG A;  1IXS A;  3GRU A;  3V76 A;  1A5T A;  1HT2 E;  2ZTD A;  3GRV A;  3IG8 A;  3KXE C;  4AG5 A;  5ITR A;  1L2C A;  1XNQ M;  3VK8 A;  2M60 A;  2V1C A;  4IBJ A;  1EFU B;  5EXT A;  1E94 E;  5ITX A;  3VDP A;  2HAK A;  4KOD A;  4DR6 M;  3EIH A;  3HJS A;  5EP3 A;  4PDG A;  4AW4 A;  4GC5 A;  2C5R A;  1N32 M;  1N78 A;  2HCB A;  3U6O A;  1Z5B A;  1J5E M;  2O25 A;  3U6L A;  1R7R A;  1NY5 A;  1SXJ D;  3HU2 A;  4M9Z A;  3AOG A;  1I94 M;  1G71 A;  2H5X A;  3T15 A;  4YY3 M;  1AUA A;  4X66 M;  3D8L A;  1YE9 A;  1JB0 F;  3B7Q A;  4JV5 M;  3CGW A;  1GAB A;  1HR0 M;  1YSY A;  2W82 A;  3TE6 A;  3GQ5 A;  4B08 A;  3MK6 A;  4DV4 M;  4DV5 M;  1K3W A;  2AHM A;  1XXH E;  2C99 A;  1PRB A;  2KNV A;  3LVW A;  4KLN A;  3SC3 A;  4XBO A;  3U6P A;  1WR1 B;  3U60 B;  2HL7 A;  1SG9 A;  2KDL A;  4LJ8 A;  5DNY A;  4LCB A;  1QQW A;  1NO1 A;  1V33 A;  2JZ1 A;  5EP2 A;  2HHH M;  4GC9 A;  4KO8 A;  4GIP A;  4IIW A;  3PFI A;  5F3W A;  3M7G A;  4QHS A;  2CWB A;  3I01 M;  2R6F A;  2DAE A;  3K92 A;  2XFS A;  3Q8X A;  4CIZ A;  4YHH M;  2LWX A;  3FTE A;  3J7B A;  3GPX A;  4WP2 A;  1WGN A;  5EXP A;  3GLF E;  4DR4 M;  1JQJ C;  1TH3 A;  1X37 A;  1R6B X;  1DO2 A;  2RGH A;  1MU5 A;  3K9O A;  4F2L A;  5E26 A;  3AOE A;  1LV7 A;  3FYC A;  1R2Y A;  1XNR M;  4L8R C;  5DFL A;  3IG5 A;  1WXQ A;  5FTJ A;  5EP4 A;  4A3V B;  1WIV A;  3I4Y A;  3FYD A;  3SAV A;  2ZM6 M;  2CHV A;  3J80 S;  2OPF A;  1CUK A;  3WHK A;  2D7E A;  3MJ5 A;  4DV6 M;  3RE8 A;  3GPU A;  3SYK A;  3SAU A;  1MJG M;  2QPA A;  1KSF X;  1ZAE A;  3ZCB B; 
#chains in the Genus database with same CATH homology
 3U6D A;  5ITY A;  2C9O A;  5FTL A;  4ZPX A;  1XC8 A;  1G3I A;  3OTO M;  4FD2 A;  3KOZ E;  1Q3B A;  1EE8 A;  3UGJ A;  3HGI A;  3GLI B;  2FE8 A;  3RFW A;  2KW0 A;  3JR4 A;  4GKJ M;  3GQ3 A;  1L2B A;  2CV1 A;  4LGY A;  1HQY E;  2R4J A;  4JXJ A;  1NHG C;  3FUX A;  5H37 D;  2CE7 A;  1NVM A;  3U5Z B;  3KFU G;  3CF0 A;  4NSO B;  3LMM A;  4DUY M;  3J2P B;  3KP0 E;  4LJ5 A;  1TDH A;  2H1R A;  4JI7 M;  5FTN A;  4FW9 A;  4OVZ A;  4X62 M;  4MGH A;  4IBI A;  1IQP A;  1IN4 A;  4RNA A;  2QBY B;  4L15 A;  3SMS A;  5IRE B;  4RF1 A;  3GPP A;  2DWM A;  1Q39 A;  1QAQ A;  4NXM M;  3J27 B;  2RKO A;  2XZF A;  4L78 A;  2E5L M;  5DYG A;  3A98 B;  2X8A A;  4LY6 A;  3GLI A;  4M0D A;  3SAW A;  4DR3 M;  4NOO B;  1HNX M;  3DZD A;  5GKN A;  1XXH B;  3T1H M;  5LMN M;  4LF9 M;  5ITU A;  2J7O A;  3AOE C;  3TPZ A;  4GHL A;  4FCV A;  4GKK M;  3HHZ A;  4K0K M;  2XZU A;  2EO2 A;  2UXD M;  4I8O A;  1PJJ A;  3ILK A;  5EXS A;  3A46 A;  1TH4 A;  2L09 A;  4IBG A;  1IN6 A;  1GLN A;  2R65 A;  2Z4R A;  4P16 A;  4BLC A;  4G4O A;  2XEP A;  5IWA M;  2QP9 X;  1XMO M;  4W5W A;  4Z8X A;  3GP1 A;  3DA1 A;  4GHA A;  2DWZ B;  2D7H A;  2Z3X A;  4LRT A;  4FWG A;  4G4N A;  1L2D A;  1OFH A;  1XXH A;  3K2L A;  1PJI A;  4G4Q A;  3TWK A;  1K3X A;  1IXZ A;  3CF6 E;  2ZAO A;  4MGI E;  4AQY M;  2EUC A;  3FUT A;  2YFQ A;  3AFH A;  1TGU A;  4D80 A;  4OX9 M;  2ZBK B;  3KP1 E;  2Q2E B;  3D8B A;  1N36 M;  1K82 A;  4FCW A;  3FUU A;  1QAN A;  1NJF A;  3HJQ A;  4I81 A;  4M9S A;  3FD9 A;  4REZ A;  2CV0 A;  4B7H A;  4GH9 A;  1G59 A;  2V1U A;  3FUW A;  3U6S A;  4MGK E;  2R45 A;  1TH2 A;  2EA0 A;  3KOW E;  1DGB A;  1N34 M;  3FTC A;  4JI1 M;  4KHP M;  1S3S A;  1NY6 A;  4S12 A;  4DUZ M;  2ERC A;  2YQZ A;  3KSJ A;  5ITX E;  4RF0 A;  5A2Q S;  1NNU C;  3RGP A;  1H6U A;  2FOI C;  4LJ6 A;  2QBY A;  4Z6Y A;  1JR3 A;  4LF4 M;  4LFB M;  3W0L B;  4NSR A;  4LJ4 A;  3HU3 A;  1IBK M;  4R7G A;  3ZH9 B;  3THG A;  2Z4S A;  4B7F A;  2UUA M;  3UJN A;  2X49 A;  2DWN A;  4CGY B;  2LNH C;  2VQE M;  1SXJ E;  4LF7 M;  4NRW A;  5KO3 A;  1G4A E;  2I7P A;  2KRU A;  3KW6 A;  3KDS E;  3PXG A;  4AZF A;  3H4M A;  3M0E A;  3I4V A;  3NBI A;  1XMQ M;  4IBC A;  3K1J A;  1TDZ A;  4JYA M;  2HKJ A;  1NJG A;  5JI2 E;  4DR7 M;  1QAO A;  2R46 A;  3PVS A;  3VKG A;  7CAT A;  1FNN A;  4BB9 A;  1IN7 A;  1G41 A;  3DFZ A;  4NRV A;  3CTW B;  4GRI A;  4TUW A;  3GO8 A;  2FNA A;  1Z6T A;  1MX0 A;  3LQQ A;  2F4V M;  3GQ4 A;  2P5T A;  5C18 A;  3K8Z A;  3JAM S;  3L29 A;  5EQT A;  2F5O A;  1E9R A;  8CAT A;  3VDU A;  4LG2 A;  3U5Z A;  3GLG B;  1QZM A;  3HHY A;  4AG6 A;  1IBM M;  4QNR A;  1XWI A;  3A45 A;  1GKI A;  1IY0 A;  4M0W A;  4B3R M;  1N33 M;  4PT5 A;  3HHW A;  4B7G A;  4LJ9 A;  1JR3 D;  4LFC M;  1N77 A;  1QVR A;  5EXX A;  2BJV A;  3MHV C;  2L7I A;  2UUB M;  2XLJ A;  3U61 B;  3R8F A;  4MGZ E;  5DYI A;  4JI0 M;  1IXS B;  2I7N A;  4QNM A;  5E6J A;  1DGH A;  1UM8 A;  3KS8 A;  2G8L A;  1L8Q A;  4LGM A;  4B3S M;  4X65 M;  4LF6 M;  2QEN A;  2Y0Q A;  4JI5 M;  4LRS A;  3UK6 A;  2Y0T A;  3TL4 X;  3E4R A;  3B9P A;  3PNV A;  4FCT A;  3SHG B;  4OU7 A;  3AKZ A;  5ITQ A;  1E9S A;  3L25 A;  2R62 A;  3W0F A;  2YNM D;  4FVM A;  4LF8 M;  4FWD A;  4XGI A;  1QYR A;  2F5P A;  4JI8 M;  2F5Q A;  2R18 A;  3VK7 A;  3GRR A;  2JA2 A;  4PDI A;  2V6Z M;  4QHT A;  3VLF B;  2LH0 A;  5FTM A;  1Z5C A;  3U6Q A;  3U61 A;  2CUZ A;  2C96 A;  1DGH B;  3U6M A;  4FWH A;  4OW0 A;  3T38 A;  4DV3 M;  1IN8 A;  1SXJ B;  4IJF A;  2UU9 M;  2L7H A;  2BNK A;  3UMM A;  1Z59 A;  4G4R A;  1KYI A;  4ITQ A;  1W5S A;  2ZAM A;  3KSX A;  4G6Z A;  3TQS A;  2J7N A;  2XF3 A;  4DR5 M;  4DV1 M;  3SMP A;  4LZZ A;  5FSW A;  3C58 A;  4AKG A;  3AJI B;  2D7G A;  4LJ7 A;  3BOS A;  3PNY A;  2C9C A;  1GL6 A;  5JI3 E;  3GLF B;  1IM2 A;  3JR5 A;  2KXE A;  1NSF A;  5KQD A;  3L26 A;  3SAS A;  1G8P A;  3GPY A;  3NWL A;  4DR2 M;  2OQ4 A;  1IN5 A;  4QOZ C;  3WHL A;  4CIS A;  3GLG A;  4LJA A;  1SXJ A;  3KVW A;  2G5G X;  3L28 A;  2ZAN A;  1HT1 E;  3SYL A;  3T1Y M;  4LFA M;  3SBJ A;  1R2Z A;  4PD2 A;  3L2A A;  1J09 A;  1YUB A;  4LF5 M;  2LXE A;  3SFZ A;  1T3T A;  1J7K A;  2XSZ D;  5EP1 A;  3L27 A;  3GLF A;  4JI6 M;  4IBB A;  4DV7 M;  1DGF A;  3U60 A;  3HJ8 A;  1VDD A;  2KEB A;  4PCZ A;  2F5N A;  4WW0 A;  4D81 A;  2C98 A;  3FTD A;  4IJE A;  3U6E A;  5ITT A;  2XSZ A;  4MB7 A;  3QWL A;  2KRK A;  1GL7 A;  2VQF M;  4II7 A;  5KQ8 A;  2XGN A;  2F5S A;  1OJL A;  4X64 M;  2L6O A;  4BBA A;  1I4W A;  4HLQ A;  1D2N A;  3HWS A;  4NL4 H;  3AV0 A;  3E9S A;  2QCU A;  4DV2 M;  1SXJ C;  1NNJ A;  3ZC7 B;  2DVW B;  2CHQ A;  2M5Z A;  3UZU A;  3HU1 A;  1IY1 A;  1ORY B;  3QAU A;  4R3D A;  4L4U A;  2DZO B;  1PM5 A;  4B3M M;  4JI4 M;  2UXC M;  3GLH A;  2KZU A;  4MH0 E;  1HNW M;  2UXB M;  1L1Z A;  4IBK A;  1L1T A;  3FKE A;  4L16 A;  4D82 A;  3FTF A;  4NXN M;  2RGO A;  4AI6 A;  2CV2 A;  4HL4 A;  3TWL A;  1Z5A A;  5C1B A;  4MM3 B;  3M6A A;  5IT9 S;  5EJC A;  4EIW A;  3R9X B;  2BJW A;  4IBF A;  2FFJ A;  3GRY A;  1W5T A;  4QOS A;  3TWM A;  4JI3 M;  3I51 A;  3HHX A;  3J7A S;  5KPR A;  4GMQ A;  3RGS A;  1E32 A;  4IBE A;  3J81 S;  3SAR A;  1OFI A;  2KA6 B;  3GLH B;  4GIT A;  2DWL A;  4JI2 M;  2UUC M;  4MGY E;  3VKH A;  1IXR C;  3SHF A;  3KS4 A;  4B3T M;  2QZ4 A;  3EIE A;  4OVZ B;  3KOY E;  5BPV A;  1NHW C;  2R4E A;  2DZN B;  3CF2 A;  2DHR A;  4AKI A;  5IZ7 D;  3SAT A;  2NQ8 C;  5BR8 M;  3LQR A;  1N75 A;  2XH9 A;  1C1K A;  2K47 A;  1HNZ M;  5FTK A;  5KPZ A;  3HKP A;  5LMU M;  4I4L A;  1IY2 A;  4DR1 M;  1IBL M;  5FLX S;  2VII A;  3A42 A;  2CFO A;  2Z7J A;  2KZS A;  3LVV A;  3VFD A;  1GVN A;  5KPT A;  2Y20 A;  4JN6 A;  1ZQ9 A;  3DOA A;  2XFT A;  1HQC A;  4WUR A;  4CHT B;  2Y21 A;  1DGG A;  4DV0 M;  3U6C A;  3AL0 C;  4I5S A;  2O5R A;  4IBD A;  2CEA A;  4AKH A;  3KOX E;  1FJG M;  1QAM A;  2DXI A;  4M9X A;  2X4A A;  4LZJ A;  2A5Y B;  1DO0 A;  1Q3C A;  2YR0 A;  3FUV A;  1XHB A;  2CHG A;  3GRU A;  1HT2 E;  1L2C A;  3GRV A;  3IG8 A;  3KXE C;  4AG5 A;  5ITR A;  1XNQ M;  3VK8 A;  2M60 A;  2V1C A;  4IBJ A;  5EXT A;  3VDP A;  1E94 E;  5ITX A;  4KOD A;  4DR6 M;  3EIH A;  3HJS A;  5EP3 A;  4PDG A;  4AW4 A;  4GC5 A;  2C5R A;  1N32 M;  1N78 A;  2HCB A;  3U6O A;  1Z5B A;  1J5E M;  3U6L A;  1R7R A;  1NY5 A;  1SXJ D;  3HU2 A;  4M9Z A;  3AOG A;  1I94 M;  3T15 A;  4YY3 M;  4X66 M;  3D8L A;  1YE9 A;  4JV5 M;  1HR0 M;  1YSY A;  2W82 A;  3TE6 A;  3GQ5 A;  4B08 A;  3MK6 A;  4DV4 M;  4DV5 M;  1K3W A;  2AHM A;  2C99 A;  4KLN A;  3LVW A;  3SC3 A;  4XBO A;  3U6P A;  3U60 B;  2HL7 A;  4LJ8 A;  5DNY A;  4LCB A;  1QQW A;  5EP2 A;  2HHH M;  4GC9 A;  4KO8 A;  4GIP A;  4IIW A;  3PFI A;  5F3W A;  3M7G A;  4QHS A;  4YHH M;  1KFV A;  3K92 A;  3Q8X A;  2XFS A;  2LWX A;  3FTE A;  3J7B A;  3GPX A;  5EXP A;  4DR4 M;  1JQJ C;  1TH3 A;  1X37 A;  1R6B X;  1DO2 A;  2RGH A;  1MU5 A;  5E26 A;  3AOE A;  1LV7 A;  3FYC A;  1R2Y A;  1XNR M;  4L8R C;  3IG5 A;  1WXQ A;  5FTJ A;  5EP4 A;  4A3V B;  3I4Y A;  3FYD A;  3SAV A;  2ZM6 M;  2CHV A;  3J80 S;  2OPF A;  3WHK A;  2D7E A;  3MJ5 A;  4DV6 M;  3RE8 A;  3GPU A;  3SYK A;  3SAU A;  2QPA A;  1KSF X;  1ZAE A;  3ZCB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...