2W82A

The structure of arda
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
163
structure length
163
Chain Sequence
b'DMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF18
publication title Extensive DNA Mimicry by the Arda Anti-Restriction Protein and its Role in the Spread of Antibiotic Resistance.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Replication inhibitor
total genus 39
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07275 ArdA Antirestriction protein (ArdA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.560 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2w82A02
1.10.10.1190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w82A03
3.10.20.480 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w82A01
2W82A
chains in the Genus database with same CATH superfamily
2QBYA 2E34A 2WZJA 1J5EM 5TSSA 1JRUA 1TQMA 2EZKA 2PJRB 5GTHC 5TR5A 2CG4A 5E17F 3ENEA 3KOYE 4EEWA 2K4JA 2X4HA 2DZMA 4A8XC 2J7NA 1GXPA 1JW9D 1Z5CA 2HKJA 3B7NA 2FCQA 1NY5A 3GO8A 1OQRA 5HLHA 3IVFA 4LDTB 1S3SG 1XEEA 3GTLJ 4XGAB 3GEZA 3WHBA 3W0LB 3FKJA 5ICEA 2ZBKB 4BDYA 5TGTA 4X64M 1XX5A 2HVQA 5CLSA 1IPGA 1ETXA 3P1MA 1JKPC 4LG2A 1TBXA 2MJEA 3MHSD 4F55A 1GVJA 1LKXA 3DXJF 1E17A 3C3DA 4PS3A 3L28A 4KLNA 3W1SC 1F4IA 2DAMA 5L3DA 2WXOA 5DYGA 2KRUA 2IEKA 3JSPA 5AIPA 3P42A 2KMCA 4ZDLA 1E0EA 4Y52J 1WGDA 2Z1DA 4LFBM 4XLNF 3E21A 4ANWA 2WY8Q 3K0LA 4MACA 3OYDA 3S14J 4UY8I 4IRHA 2L54A 2L9SA 2QF7A 1A04A 2NPTB 5E6PA 4L9JA 2CQQA 1PYVA 4A0YA 1C4PA 1Q5WB 5HODA 3ZMSA 2CMPA 2UUZA 3APCA 1Q1OA 1B72B 4B09A 2R7FA 1D5ZC 2GBMA 4WH4A 1E3HA 1T0FC 5CTRC 3FBIB 3CLQA 4D7NA 4YFKF 1OCOH 2WXPA 3WU0A 5KHQA 2DAEA 1JT0A 3WTUC 1AU7A 4M9SA 4XN0A 1F77A 1XG1A 3LAJA 3MKWB 5J1RA 4GKJM 1F5TA 2ZTDA 4IF4A 3U8ZA 3MVPA 1S5LC 2QGUA 1NJGA 2JN6A 2LKPA 1QZMA 4WF2A 1OEYJ 4LG3A 1KU7A 3NVYA 2YX7A 2LMDA 2KMUA 3FDYA 4DOZA 3PNVA 4MSMB 2DXIA 1HR0M 3K2AA 3P9KA 3OWTA 3ZQ4A 4Z6YA 2LTUA 5J6XA 2PE6B 2DODA 3PHWB 1J59A 1Z5SB 2XGDA 4P9UA 2D7GA 2OTLI 5FLVA 3CC4I 3WHCA 3B7QA 4PYUA 2OA4A 1NSFA 2FSWA 1JE8A 2R7VA 2BS2B 4G50A 1D6EC 4RDUA 3RYRA 4JL9A 3D8BA 3I4PA 1J09A 3APDA 1YQBA 3J7AO 2M4KA 2IA2A 1JR3D 2UXCM 3Q8AA 1WH3A 2PVOD 3RZOJ 3VR9B 5CX3A 4RAFA 3PV1A 1F9JA 2CRGA 2X51A 1YQ3B 1ZXIA 1A6QA 4GDKA 2N9KA 4KISA 2L83A 3BOSA 3PVSA 4ZHPA 5DV5A 2KX3A 4DNCA 2J5YA 1V4RA 4RCOA 3VRBB 1VQLI 3F8BA 3GTMJ 2CQ7A 2LY1A 1JMLA 1VTNC 3AV0A 3FRIA 3CMMA 2XSJC 5IYDJ 1WFYA 5A2QK 1LM8B 5D6EA 3L00A 3OYKA 5HDGA 2KZSA 4E4HA 4KFCA 5G5HA 5B1AH 2O8KA 1PJTA 2DYMA 3TQNA 4S12A 2LF8A 1DGRM 1MIJA 3JRAA 3DA1A 5EEGA 2XKOA 1IXSA 2A68F 2IVMA 4LK0F 1BUIC 1JUSA 4Y33A 3A45A 1SG9A 3FUVA 4P5OA 3I53A 3F8CA 4JI0M 3Q3SA 3FHNA 2DHYA 3IAS1 1P98A 2E1NA 3K1NA 3ZLZA 2R7XA 4M6YA 4HBLA 2WXMA 5JHBA 3O6BB 3KEOA 3PPAA 2PVGC 2NBVB 1PJSA 1LDDA 3O13A 2E2IJ 1A70A 5DD4A 4A5NA 2JRHA 1H9TA 3TOBA 2CQXA 5EEAA 1HTOA 2N0SB 1N61A 1QDRA 1L2NA 1Y8RC 3VDXA 3AEFB 4N6EB 4A3GJ 5E8GA 4Z8XA 2XZUA 1JQJC 3H9QA 4KN7X 1YN3A 1L1ZA 1W4MA 3W2VA 3DBRB 2VONA 2EPFA 3G1LA 1FC3A 2MH2A 1C78A 4HOBA 3HC7A 3RCOA 4LCDE 1BIAA 1K3XA 3DV8A 1T6SA 2KDFB 2QM3A 1HEZE 2KN5A 2QQ8A 2L7ZA 1FJGM 3OTOM 1KFYB 1ZLJA 2K85A 1YJJA 3GLLA 3O2PE 4X6AJ 3B9PA 3HRUA 4E7JA 2R45A 3I04M 4EMSA 1W7PD 4XWWA 3OAWA 1JHHA 3J7AS 3HGYA 3H35A 1JB0F 1E94E 4JI5M 4RMNA 3Q69A 4ZRKA 3K1PA 5ICGA 1G6NA 4HDUA 1YYVA 2CQKA 2ZVOA 4OIQF 4AC0A 1BVSA 3EUAA 5IP6A 4P9FA 1F9NA 2HKOA 4YHHM 5IP7J 2ZW1A 3I4VA 1GO5A 2HFHA 4DW6A 2RDHA 2KACA 2Y21A 2FOWA 1J7CA 2BW2A 4DUYM 4I6LB 1VDLA 4IBIA 2KIMA 2M2EA 4G9YA 4M3BA 3MAJA 4HJGE 1K6OA 1P7EA 4OW0A 3ZQ7A 1ENFA 3L4PA 1XWIA 5D7GA 1WSUA 1HKTA 3DLAA 5HNFA 1R4GA 5J4YA 2BBYA 2BJVA 2VQLA 3GPXA 2JRTA 4L1BA 4CUGA 1A36A 4KKJA 2RGFA 1K50A 2KLGA 3WALA 2Y30A 5F6FA 1D0LA 2G4SA 5F1JA 3SHFA 2CYYA 2K3FA 2HVSA 3RMKC 4WIPA 2W57A 4BVUC 3PT2B 4NRWA 1MBFA 2WXHA 3SFIA 1R4MI 3MKYB 4OMZA 3K4LA 1K6YA 3O3KA 3ZR8X 4D7MA 2H1LA 1HNXM 3PFYA 2FS1A 3RT3B 2KT7A 2CWEA 2E19A 2F4OB 2QSGX 1EUVB 1E8ZA 3OYAA 3PUBA 1WJBA 3MMPA 3IRRA 2N1WA 2Y5BB 2ZMEA 1EV7A 2DT5A 1R22A 3U6PA 1WZ2A 1N36M 1FNWA 3K4MA 3CC7I 2FUG1 4A3FJ 1TNSA 4A6QA 4HNTA 2BWEA 2XHKA 2CFOA 2GLSA 1MMSA 2IT0A 2ON8A 3CSFA 3VXWA 4JP0A 4XLPF 3F6OA 3DWLE 2OCCH 3VDPA 1QVRA 4AJYB 1N33M 2X9DA 4RMAA 1EE8A 2LUEA 4OMYA 1Q3BA 1T0QC 3FMRA 1V5EA 4E71A 3QCAA 2N7DA 5JFRA 1NVID 2BHYA 1JWMD 4LTUA 1FMAD 4B3SM 2BHZA 1R5GA 1XNRM 2NQ8C 1GV5A 2XB0X 3KSJA 3HSRA 5KK1A 3OS0A 4A3VB 3LA2A 2MSED 3DPLC 3U61B 1G8PA 2I7PA 1RLFA 2F5DA 1KZHA 1FWZA 3GLFB 3TEDA 2VUMJ 2AQEA 2APLA 1J7BA 2HOSA 1U5TB 1ZXHA 3I3LA 1IC8A 3W6VA 4FX4A 1Q39A 4XDDA 4OVZB 3IC7A 3HKZA 4N58A 4CJ6A 2KJBA 3MJWA 5D2MB 4UVCA 1X4PA 1V54H 2LHGA 1IW7F 2ZNZA 2B3TA 3HOYJ 1HXYD 1A5RA 4GYIA 2D3GA 3IXSA 4KIBA 4DXAB 2BYFA 5C2TB 2F4VM 3S1QJ 2DMNA 4DR3M 4EQQA 1DGBA 3FXKA 1A5TA 5HS8A 1U0JA 3IV5A 1WIAA 1TWCJ 3OOPA 3OSGA 2IO0B 3V7RA 1D0ZA 2E5ZA 1E0ZA 1NO1A 3ML8A 4HW0A 1OQYA 1U5TC 2X1DA 5DDGA 2NMQA 2IRFG 1OYIA 3CCEI 5CVRA 4K81A 2N1VA 4LNFA 1IGNA 1I3QJ 2HOEA 2LK2A 4XGIA 4DWFA 2IGNA 3FTEA 4M00A 3HB9A 4AD9A 4WWNA 1CQVA 5GADJ 3TL4X 3W6JB 1BJAA 3F92A 2AQ2B 3ERED 2WXQA 1FBQA 2NVXJ 4QHSA 1WRJA 3CCJI 2XKPA 3RZDJ 2Y48A 1X3ZB 3V8KA 4UB6C 5G55A 4YELA 1R1VA 1D5XC 1G3SA 1HDPA 2KJ6A 3NRZA 4DQOC 1ZLKA 3NVVA 1BL0A 5ITXE 2WP9B 2DHZA 1WM2A 3FXRA 3U52E 1V81A 1C79A 2FUHB 2L2OA 2KLCA 3ZQJA 1HSTA 3CF6E 3AM9A 2LKSA 3LSIA 2F5EA 2LI5A 1BR4A 5FKNA 2EIMH 1P4WA 2IS2A 4TUWA 1YJWI 1XGNA 2CU3A 4A93J 1ZARA 4D9JA 2BPSA 1HTQA 3LL7A 3ZRCA 4L0ZB 4ICVA 3PSEB 5F08A 4ZYEA 2BWBA 1QRYA 2P7CB 1BMLC 3AV8A 3VH4B 2NNYA 3EYYA 4HEA1 4RAYA 5BYSA 4B3TM 4M0DA 2LFBA 2LFIA 1DU6A 5ITXA 2EA4A 1WKMA 3B9JA 3QU3A 2MBOA 2DMPA 4MFEA 1PJQA 2BXZA 3H8HA 4NC8A 1WGGA 1MJ9A 2HWJA 4IVNA 1FFUA 1S9HA 1TQIA 2XVCA 4FHKA 4MHGA 1ZRFA 3QYFA 5EG0A 1F2RC 2ZCCA 4EOYA 4US9A 4WAAA 1T0YA 1ZV1A 2EQRA 1STZA 1YJ1A 4RM8A 5EP4A 3KOWE 4WXHA 3VOEA 3FWEA 1MBEA 2MX2A 3H5AA 4IQ4A 5BQTA 2HU9A 3P9IA 2FRHA 4X0GA 1GL7A 4BS9A 1I7HA 3HJ8A 4A0ZA 2E7XA 4G7OF 3VQIA 4U7DA 1FIQA 2KNVA 4HLEA 2K8BA 4L5EA 4AVPA 2R2OA 1F1ZA 1CMXB 4ASWC 3LFUA 3CCSI 3G1MA 4KGSA 4N4OB 2VDBB 1IG7A 2BXYA 2XAUA 4N0BA 3DKXA 4P17A 2KANA 1WJFA 4BACA 2L7IA 3EA6A 3A02A 2QVOA 4GLSC 4CZCA 4B9KA 3RGPA 2KFKA 2P5KA 3WTTC 3BZCA 4XKWA 2K25A 2INCC 4B95A 2ZKZA 3TSSA 1J8CA 3HRDD 1WGXA 3J7BA 5EGOB 4DHJD 4B08A 1WMHA 3M95A 2M56B 5LFAA 4KT0F 4P1WA 3T8MA 2KZUA 1DDNA 3T1HM 1PUFA 1ROEA 3ETRA 1WGKA 2DAJA 3BR2A 2E6XA 2LVQA 3WCQA 1JGSA 4ITQA 2XGXA 4N9HA 4GSWA 2ZXJA 3E6BA 1P9QC 4ESBA 4E3CA 4HL4A 4OIOF 1OJLA 4XRSG 2FNAA 5JI6A 1ZKHA 2ZPNA 1D2NA 3E46A 3W3CA 4I76A 3PQKA 5IOIA 2MFZA 4UUSA 2BE5F 3Q3JA 2PW9A 3CF5F 1IBXA 5LNK1 1LTMA 4MEXF 1UHWA 3HHMA 2M0AA 4A6DA 1L2DA 2BB6A 1HCRA 1WGRA 2AXTC 1E8WA 1JKOC 4NY0A 5J17A 3OYBA 3VTVA 4UN2B 1UELB 5J40A 4CYCA 3NHEB 2QPAA 2WU5B 5H37D 2DA2A 5L3CA 3OMYA 3K2ZA 4FWGA 5F3WA 2J0MA 3IL2A 2QLZA 2FOIC 2PFBA 2N9XA 1LNWA 3VSLA 1MG4A 1I27A 2DA3A 3VAWA 2JQ7A 2EO2A 2WSFF 1QANA 2EZLA 3ZN0A 1YIOA 5D8KB 5DPSA 3JRGA 5F0CA 3B2FA 4JI6M 4Q5SF 3VRAB 3U6QA 4IBCA 1WX7A 3V42A 2LDUA 3GPPA 1S3JA 4YXDB 1FPQA 3M1EA 4KZCA 1QOAA 1X1DA 2JVHA 4XSZF 2N7EA 2EV5A 1W36C 1MNEA 2DAFA 2JMWA 4KO8A 3SYLA 1MI0A 2VKEA 4IIWA 2HQ5A 1O4XA 3GLHE 1QOBA 1JWUD 2EIKH 3QJZA 4OWRB 3SEZA 1SMTA 1TKYA 3GS2A 1BOBA 1EKEA 1TZ1A 2OJRA 2V4LA 3ZVVA 3I51A 3A03A 1KA8A 3I71A 3S93A 4OVVA 4DR2M 2XRLA 4B43A 4M0WA 4BJTA 3A01A 2MSYA 3Q8EA 5EE9A 3U5ZA 3UQAA 4GOCA 1A6IA 1QQIA 3F0CA 3ZCBB 3IH3A 3RI4A 4ANXA 1A35A 2KWCA 3R61A 2H94A 4J3OD 2R4JA 3G3ZA 2TCTA 1IBMM 2H1KA 2JXXA 3ZC7B 3PSIA 3GLHA 3WTXC 3JR4A 2JZ1A 5CVIA 1XHBA 1L0VB 2M19A 2Y0SA 1D0XA 1MSFC 1IBLM 4IM0A 3TMPB 3ULQB 3JSVA 4JOMA 2CW7A 2H09A 1RFKA 3DHIC 3W6KB 1MG8A 1N5WA 1E2XA 1K4TA 2HPIA 4YTPB 2CHQA 5HG2A 2O0YA 2O8XA 3BZ6A 2EJSA 1SD5A 3VDUA 2DPUA 4C80A 3AG2H 2LXEA 1E9SA 1B1ZA 2W25A 5K7HA 4OX9M 4FA6A 5FD6A 3FYCA 2C9CA 2VKDA 3LCUA 4IHVA 3PLUA 3RYTA 2DWLA 2JY6A 2IP2A 3GO5A 4C3IJ 4MELA 4NQWB 1T98A 4MEYF 1GB1A 4ZYSA 3OYIA 1EWYC 2V1DA 1AW7A 2V7FA 2DZKA 3BY6A 4HNVA 4MB7A 2BY3A 3WTYC 1Z5BA 2LH9A 1VQNI 3NS1A 3M8EA 2VE8A 3AE8B 4HPMB 4IEJA 3APFA 3RPUA 2UXXA 3A1QB 2DTRA 1HZ5A 4HG2A 5FTNA 2Q1ZB 3R7QA 1XSVA 1Z59A 4MGYE 4B0EA 4W9HA 2K9DA 1PUTA 5E3MA 5J3LA 1XGOA 5ILVA 2BF8B 2X8XX 2GZWA 3C3EA 2MCNB 4GU2A 4GHLA 1IDZA 1MBKA 2EELA 1R2YA 3ZOBA 3NBIA 2MD5A 4A3EJ 4GIVA 2RKHA 2KFKB 3HM5A 2G0EA 2MD0A 4RGSA 1ZRDA 4XNFA 1SFOJ 1N34M 1SF0A 2DLBA 1ZAOA 2O6VA 3VYUB 1HQYE 2JZ3B 1XB2B 3AG4H 3BYTB 2YLMA 4JN6A 1VD2A 3KLOA 3P5JA 3IP4B 2VQEM 2ASQA 3GRVA 3L2VA 4RM3A 2IBIB 3JRDA 8CATA 4RAZA 1LV7A 1W5TA 1T2KA 4I4LA 1HSJA 1TT0A 3SEQA 3GRUA 1QNTA 4PJLA 1YITI 3DVGY 2CW8A 2Q2EA 1AYFA 3SU8X 2IA1A 5J18A 2LASA 1O7LA 3SXYA 1X37A 3AECB 2P81A 3QPTA 4LRTA 3PZDA 4AUQC 4II2B 1V3FA 2WXGA 4XN3A 2YU3A 4LJ5A 3SATA 3A42A 4BE1A 1HKQA 3B02A 3OIOA 2VIIA 2XF7A 3WE3A 2MLBA 3LVWA 2EKKA 2L4AA 3CESA 1V80A 2E5NA 2V9KA 3S2HJ 1IXCA 1X3WB 4MSQB 4MGKE 3AE2B 4M9ZA 1VJKA 5D3IB 3S3OA 4HCPB 3L1PA 2I5UA 3FAHA 5FTKA 4X66M 5E6NA 2L76A 2CJJA 4JX5A 1JWSD 1M1EB 3HJSA 1IN6A 2VE9A 2V0GA 3H0DA 3L2CA 3ZMZA 3PGEA 1FRDA 1STEA 1MH3A 5DCMA 1KYZA 5FKMA 1TYGB 4LJ4A 3BJOA 4ETSA 2WB1A 3FK7A 3TDUC 3W9CB 3HUIA 1IV6A 2VJ5A 2STTA 3GP7A 4DHZB 4U7BA 4W9GA 3EHVA 3ZN1A 1HA5A 3HIZA 1QZZA 4RS8A 1U9OA 2M3AA 3FMQA 4PDKA 4GXOA 2V4JC 2LXAA 4KDLB 1FXIA 3V05A 4BOSC 1VR9A 3OYCA 5JLWA 3PTFC 2DZLA 1QF6A 3MZ8A 4G11A 2Z4SA 1J2XA 1S7OA 1QUSA 2KC1A 4II3A 1SFXA 3PLVA 1KLVA 1RU3A 2D5VA 2Y3AA 1UF0A 3A01B 1K83J 4QWQA 2EKIA 4Y17A 2RPQA 1I6HJ 1UHMA 3A46A 1R4NI 4TMAB 4F1IA 4G8XA 2JNHA 3V6EB 4FETA 3DLLF 4GEWA 2PMUA 3V62A 3I0TA 3HHYA 3ABLH 2B0LA 5EEHA 3S17J 2LGIA 2D10A 1X2NA 2BS4B 2C99A 2DTZA 2FQ4A 4WWOA 1VI0A 4W9JA 1FCCC 4S04A 1UB9A 1XPXA 3OYGA 2K9MA 4LFUA 3R3MA 2DNFA 2JY6B 3ECIA 1SXJB 3N1YC 4AIJA 3D5SC 2ONQA 3BOQA 2BVLA 4P16A 2EFOA 2VBYA 2LVQD 5EP1A 1MH4A 1TWGJ 3QOEA 4ZDPA 2JY8A 2JZ0A 4KKIA 1C0WA 4D0PA 3MK6A 1MMAA 4MQVA 3TGNA 1BA5A 1E7UA 2DOAA 1T43A 4RFBA 5FKLA 2DI3A 3AE1B 3CMYA 2LXCA 1WJDA 4RGUA 5J1YA 5IP9J 1IAWA 2FX0A 3GLGE 4R7GA 4IHTA 2XB5A 2R61A 1FMVA 2KKCA 1YX5A 3PZ8A 1MW7A 2IGDA 4V2FA 3WTVC 2MLKA 1HE8A 2PKOA 4M6XA 2NXNB 2DAOA 3S2DJ 5DD8A 4HEA2 3H0GJ 5DYIA 3J7AY 3DPUA 2W84A 1GT0C 2I7NA 2V3SA 1AWDA 2WY7Q 2RKOA 3AKZA 2Z3YA 1SAUA 4LNIA 1CF7B 2CUFA 4NAMA 3ZIMA 3LSGA 3WHLA 4EV0A 1OGWA 5E3NA 5LHIA 3DOAA 4IWOA 4D5FA 4V19K 3RJPA 3K9PA 4I2OA 1I4GA 1XTAA 4HK2A 1R7SA 4FJYA 3GLGA 4OHJA 3G71I 4Q48A 1L2BA 4F91B 2GBYA 1WI9A 4M3DA 2KISA 4DBGA 1MX0A 1D3ZA 1NV8A 1U4AA 2DENA 3OL3A 2K0PA 4CO7A 5E3OA 3KIOA 3H5NA 1ZR4A 1EWCA 3M63B 2VIXA 4IJAA 2PIAA 2O6GE 3RKXA 1C3TA 1DO2A 2LMCA 4A69C 5KHDA 2I2YA 2FAZA 3Q8FA 3ZH9B 2YEPF 4NXMM 3TW7A 2KTRA 2HJ1A 1GVDA 4A20A 1WIVA 1G6JA 1T95A 1ODDA 3OIQA 4B3RM 2MBFA 4ABZA 5AIQA 4JLCA 4PDGA 1MKMA 5HS9A 5ICCA 4L23A 2BW3A 4C7ZA 3MP9A 1F43A 2ZSHB 2R5YB 1SE3A 3UGBB 2KK8A 5DCFA 4MH0E 1XS9A 4EJWA 4XRMA 3COAC 4EM2A 4AW4A 4FT8A 4WP2A 3VB2A 4B1RA 1ET6A 2M9HA 4L4UA 4AIHA 1V6EA 1HT1E 3GX4X 3H3ZA 3RN9C 1BIBA 3Q3NC 2YFQA 3BG5A 4DDID 1WJ7A 2Y31A 4PSWA 5GP9A 4YTMB 1IP9A 2VBXA 2KN4A 3TE6A 5LGNA 3ILKA 1GUUA 1G2HA 2Z0DB 2KDZA 4XOTA 1V5TA 2EB7A 4HDVA 2KWVB 2GBNA 1HOMA 3RYPA 3KZIC 1JKRC 1VZ0A 3I59A 3H7SA 3AG3H 2VL8A 1G3YA 4IO9F 5DUIA 3GUDA 3REOA 1WYWB 1UWMA 1LO5D 5JI3E 3RPUD 2GA1A 1WZ0A 3ZKJC 1ETQA 4BXUA 1EH8A 1E9RA 2RGHA 2UU7A 2M4NA 1I4QA 3HJQA 2KZVA 3HEFA 4RNAA 1Y39A 1F36A 4ASNA 3RQ4A 4UUVA 3BWGA 1K78A 3KWLA 2PMZN 2NVQJ 5ITYA 2E60A 2CU7A 2AL3A 2L6OA 1VZ6A 1V1OA 1XGMA 2XGNA 1ZDVA 1XLNA 4BQOA 2ACJA 4QNMA 4ANRA 1IDYA 1SE9A 3VODA 2EV6A 1MNDA 3G1OA 4LZJA 2O6VD 3DU6A 4AP4C 1MJDA 4O6JA 2X6XA 1VQ7I 3RE8A 2HTJA 2XIGA 1FOWA 2ZAMA 1P4AA 2FJ1A 2VXZA 2LRWA 4MFDA 3KH0A 1YRNA 3H6NA 4KT6A 2WDQB 4GDLA 2GMIC 4JXJA 4OAYA 4WQOB 5EXSA 2LWPA 2K22A 2VZKB 2WS3B 3ERMA 5FLXS 4KT5C 1QT9A 4A3KJ 4DJAA 1NNJA 4DBQA 3RDIA 1HZ6A 2X1CA 2O5RA 2R4GA 2Z33A 3KWVA 3V3XA 1ZRCA 1ZE3D 1VQ9I 2XK5B 2BNKA 5DUKA 2DJIA 1QLBB 1IM2A 3K9OB 5H6RA 1WH5A 5H20A 4YRVA 2Z8LA 2K3PA 1K53A 1V34A 3A1YA 4BYYA 4C4VA 2WC2A 4AG6A 2K3UA 3A0BC 3N20C 2HNHA 4PCZA 1ITYA 3GRRA 1XO3A 2Q8KA 4PJNA 1XD3B 2HPMA 2O03A 2IGGA 2V1UA 4A6EA 1V86A 1BXTA 2AHMA 3U9GA 1JKQC 4YT0B 2WXLA 4PJJA 2MA9B 4DBGB 1MMNA 2XNAC 2B63J 2EILH 1WGYA 1BC7C 2UXNA 2WXJA 4P1CC 3RNEC 3B7ZA 3GTPJ 2CJNA 2XFTA 2LH0A 2VC0A 4UXNA 1R5LA 2NTTA 4JK1X 3FILA 4ACFA 5G5GA 2QQ9A 1TWFJ 4CIZA 4LF5M 1FFVA 3HU1A 3ABUA 4MT5A 4XORA 1VQPI 3RNBC 4FCTA 1YD8U 1FBSA 2DWMA 4HWIB 1HLVA 2NS8A 4C56C 3QP5A 4YTNB 3KUDB 4XK8F 3W1YA 4HZFA 4CQNA 3IBEA 1HKSA 4N4NB 3V7SA 2VRRB 3GTKJ 3SMSA 3GFJA 4B8XA 5D3DA 3EETA 4BU2A 4S17A 3L26A 4S05A 4CH7A 4FWHA 2QUFA 3OJ4B 3FZVA 1FOYA 5D8LB 2EFQA 1QZEA 4OZBA 1A31A 1Z5AA 2OJED 3CO7C 2VH2A 2PJHA 1GNUA 1WQ2A 2IY1B 2KWDA 2BYTA 1XD7A 3I54A 3SASA 2HCBA 3WIMA 3TOAA 3B2GA 1R6RA 2P5LC 5LHGA 3JYUA 2Z4RA 3U4EG 4B6WA 4GGGA 3T38A 5CHVC 2W55A 2L7FP 4XLAA 4XR6A 3T9LA 1YW8A 4D82A 3AB5A 3EUHC 2ZFUA 4NB5A 4A3CJ 3A98B 1RPWA 2K8CA 1UHSA 3E9SA 1DUXC 3TUOA 4MTDA 3Q8CA 1RZ4A 1SVLA 3F72A 5AZHA 1FP2A 2HDDA 1R5ID 1WF9A 4OOIA 2IO2B 1UZCA 2M30A 3QRFF 2XASA 1D0MA 3KFUG 2NYXA 2WV1A 1YQ4B 1KGSA 2LRDA 1UJ8A 2WGSA 1NI2A 3TMOA 1XCTL 2WWYA 3E5UA 1YLAA 2UU9M 3GTQJ 3SD5A 1LEAA 3L7WA 4B7HA 4HV5A 5JVGF 4YL8A 1Z2MA 4YIFA 2NVUI 2ZC2A 1JUPA 1Z6TA 2OZ6A 3OYEA 3HU3A 3CUQA 1YJ9I 2LF7A 1FIAA 4PJ0C 2QKLB 1I4XA 1VQ5I 4FJZA 1SXJE 1KF6B 4TUUA 4BBSJ 2M7AA 3C7JA 1WXSA 4C2TA 4HDQA 1NG6A 3P2BA 4EFOA 1NH3A 3CCRI 2L7RA 4KA4A 1TS5A 1V49A 4NL4H 4NDLA 2VODA 4CHUA 3I5UA 4Y15A 3HVDA 2O01F 2DN0A 1EF5A 4Y4RA 4L8RC 1E7PB 2XBBC 3TO6A 1AHDP 3JRCA 3LB8C 1TS3A 1QVTA 2KRFA 3K69A 2OZUA 3HHXA 5IOZA 4KIGA 3FX3A 3CDIA 4YIRX 5KPTA 1WPKA 1D8JA 3TO7A 1UFMA 2VQHA 1ETKA 1YUBA 1D1CA 5CHWA 1MBHA 1OIZA 1REPC 2FCNA 4DYQA 2IS4A 1HBXG 4IUMB 3CF2A 1DOYA 4BBAA 4FTHA 1FYMA 5CHFA 3FRHA 2R7UA 3I4YA 1H6UA 3FTCA 4KHPM 5GMVA 1HQCA 4F8CB 1UG0A 3MN2A 2INPE 2VASA 5HHDG 1IF1A 2CP8A 2DAIA 3PNTA 3MHZA 5IT9Z 1DV0A 4H4KC 5GKNA 1EIJA 2NOJB 3KP5A 2ZW0A 2JY5A 4LB6B 4NRVA 2P4WA 2BWES 3W0FA 5FFXA 4NPNA 1XXGA 2JA2A 2P6SA 1WY8A 5C1BA 1YMHE 5HVQC 5LEKA 4GCVA 3PS6A 1LFUP 2C5RA 2G1EA 4N59A 5J1UA 3BG3A 2DPDA 4DV1M 3GP1A 3PM1A 3JAMK 3CMAI 2AX5A 4ENKA 4AYBA 1KYIA 2A5YB 1MMDA 1TS2A 2K02A 5B66C 2L52A 4CZZA 1BN5A 4EZJA 2CHVA 2NOGA 5IT9S 3NARA 1G8XA 4XMYA 3QPSA 2LVNC 1ULYA 1B8IB 3OYFA 4P7IA 2BYVE 5IREB 3TEXA 2V9VA 4RGOS 1BW5A 1Z7UA 3DQVC 2KAJA 4AQYM 3U1KA 2D2QA 1N78A 2GLOA 4JI4M 1B9RA 2L4FA 1TTEA 2NS5A 3H4MA 3A4RA 5DPTA 5CQEA 2MJ5B 2ID6A 3PRPB 3U6CA 3KYCB 2J53A 3ZQIA 3MFGA 2FE3A 2CS3A 3BR5A 2D3AA 3GMEA 2CUEA 2XFSA 1QAMA 2K5PA 1SMYF 2KQRA 5ITQA 2DA1A 5BMZA 2ACZB 1V5OA 4MJSA 4TQ0A 2BGFA 5GAEJ 4DR7M 3DFZA 4IDIA 2AXLA 4CCLA 2XUBA 3L29A 3OR1C 1NK3P 4UUTA 4BBNF 1RETA 3RKWA 3ZNID 1FM0D 2RGOA 4HCNB 1WI0A 2RPVA 1JALA 1P3QQ 2AO9A 2RQPA 5FRNA 2OOAA 4IHXA 1MHHE 4IRIA 2LTPA 1V97A 3DVGX 2DOFA 4I7HA 4EZKA 4R79A 3S1RJ 3H4JA 1JWAD 2LBFB 5JR3A 3PVLA 1R2ZA 3AN1A 2BY1A 2GOMA 1PGXA 5TJJA 1PUEE 2K6QA 3OR2C 2LGDA 2M8GX 1FEXA 3LSJA 3AOEA 1BI1A 2KVRA 2ME6A 2ZAOA 4B44A 4Y13A 1KH0A 2P6TA 4KIKA 2KQSA 1Q1HA 2YR2A 1FYKA 2ELJA 3A33B 1FNNA 1HW1A 3ZRGA 4L16A 3V4GA 4A9AA 2M0XA 1WE7A 3RQIA 2DX5B 5D6FA 4DYCA 3HOVJ 2F5CA 3J81Z 2JTVA 2JZYA 2KWUB 4IG7B 1DGHA 4LGWA 2STWA 3PO2J 3SAVA 3IHPA 1GABA 3NZUA 2G9WA 2EK5A 3LSPA 3BR1A 3SYKA 5D94A 3QAUA 1I50J 1XB4A 4L5IA 1KU2A 2C5LC 3QARA 1Q02A 3CO6C 1BI3A 4LMYA 2QDFA 3U6DA 3VLFB 2WAFA 4DXGA 3H5RA 2MR9A 4EVIA 1T33A 1LE8B 1XN7A 4KVGB 1AN8A 3E4RA 2ZO4A 1OR7A 2K9QA 2ZPYA 1F0ZA 2A3SA 4IBFA 2O2VB 4BBNC 2J4XA 3F9KA 5TRDA 4NNJA 4LLLA 3D8LA 5E8IA 2LSOA 2UXDM 3V61A 3UZUA 2H1RA 3H7PA 4JV5M 3Q14C 1I6XA 2IXSA 4G12A 2B76B 3E5QA 3ZW3A 3A4CA 2NCNA 2BBCA 2AS5F 2VKVA 3KPHA 1RKTA 1QZYA 4M02A 2HZDA 4KX6B 3WAOA 2ZB9A 5HI1A 2MP2A 3LCVB 2KXEA 1GHCA 3PO0A 3V60A 2G8LA 1MZBA 3KYCD 3OV8A 4LJ9A 3S16J 2COBA 3L2WA 2WAEA 4A3PA 3ZJUA 2HDCA 4HX7A 1OCPA 3HSFA 3G2BA 4A3JJ 2KRHA 3BK2A 4GFBA 4CHTB 4HF0A 1ETVA 3FHZA 1BR1A 3KFWX 4W1UA 2JUOA 5HDKA 3M3YJ 3A0HC 4ZRIA 4B4CA 4D81A 1P2FA 2V1NA 3DU5A 3HRMA 2R3SA 3GZNI 4E7HA 2JUCA 3MTNB 4OIRF 2A05A 1DPRA 1ZAEA 4XICA 1MU5A 2PI0A 1NYQA 3GE3C 3IFWB 3WG9A 2WX0A 3SZTA 2A07F 1X1PA 2R7OA 4HPLB 1S3SA 2W82A 4PSXA 2XDVA 3J80S 3KZZA 4QLCU 4FASD 2GBJA 4ZC3A 1Q0WB 4JX6A 4TSSA 2LVAA 3HHHA 1XCQL 2R65A 4IRGA 2K40A 2MEKA 2NBUA 1OEYA 1GJTA 3BG9A 1OLTA 5ERIA 3ZCOA 4W9LA 4RLFA 4AIKA 1KOTA 1UGJA 3U6MA 2XC7A 1CK1A 2HWVA 3J9CA 3GXOA 4MJSB 2J7OA 4E7IA 2UWMA 2WAQA 1TLHB 5BPDA 1SANA 4IBGA 1USSA 1SB3C 4K1RB 4BXXJ 2GXBA 1FJLA 5FSWA 2HYGD 3RIRA 2GBRA 2FCMA 1YW9A 3NQOA 4FE4A 3ZMUA 2KNZA 1BBYA 1YJIA 3ABTA 4IOAF 3R2IA 4A90A 1IUYA 3L2QA 3K10A 5C3EJ 2L0KA 1JWBD 1E3PA 2HJ8A 5FTLA 2VQCA 5ITRA 4LGYA 5KAFC 3KLNA 1LEBA 5AUIA 5FKKA 1V1PB 2JZZA 1L5PA 3RFZB 1N75A 1NVMA 4ENJA 1HT2E 2F5PA 2G5GX 1RESA 3B74A 3MHVC 4WJPA 1FP1D 2HQNA 4ESFA 4KIKB 2Z99A 3IWFA 1S7AA 2NNNA 4A0XA 1SEBD 4PUSA 2FA5A 3GFLA 1W7PB 3VH3B 2PE9A 1EH7A 4MH8A 3I58A 1YIWA 1C1KA 3OYNA 5HOOA 5EQTA 3GLIB 4LB5A 2L05A 2NVYJ 2ZXHA 4ARIA 2JSVX 2IBDA 2A6TA 1BI2A 3SZPA 3X23A 2TRTA 5AZFA 3K2LA 2DAGA 2FCSA 1XXHB 2DZIA 4MGZE 4B7GA 4QOZC 4M8NA 3FM5A 2QHOB 3HM3A 4LF6M 2UUBM 1LQBA 1WXQA 3URYA 2LVOA 3A9KA 4NJ6A 1P0RA 1OTRB 2BY0A 2RREA 4PGHA 5CJ9A 4DYRA 2KRCA 2OU2A 2ISZA 4XL9A 5BOXA 1RIOH 2L9VA 1FNUA 2WV0A 4XYCA 3E97A 5EE1A 4BEHA 2KX0A 2V6EA 3I3TB 4PDIA 4KODA 2CU1A 3K9TA 2ZVNA 4FN2A 2LHCA 3I56I 4DR5M 3FISA 3QOPA 4IOCF 4PJMA 2R6FA 2PN6A 3A9JB 4NNJB 1VEJA 2GIZA 1UAAA 2R5ZB 1L7YA 3IHPC 3DTIA 4X1EA 2PMVA 2UYZB 2KEBA 4WCGA 1GVNA 1XLPA 4MLOA 3U21A 2W3SA 4J00A 1TGUA 2DA6A 3P4PB 5LD2C 3Q6BA 1SJHD 2KRKA 2MGQA 2ETHA 2DLLA 1LUJB 5BYQA 3WHKA 3WTSC 2V79A 1L4ZB 3K92A 3JRFA 1XLQA 1VQ1A 2G3QB 2MP2B 3T1BA 1FPYA 1NTCA 5KNLA 2IDYA 1U6GA 2ZFWA 2GQFA 3OG5A 3ZQCA 3O65B 4MNUA 1SE2A 1CZPA 5IN7A 2C60A 1SIJA 2ICIA 3IAM2 3FIWA 2H6CA 4AWXB 1Y8RB 2QCUA 3HIFA 1AKHB 4I01A 5LHHA 2UV1A 3BBZA 2DVWB 2JWZA 4G0NB 1G3IA 3GPYA 1N77A 4BH9A 5JXVA 4IQJA 4XDCA 2QBYB 2DYRH 2EUCA 4NQKE 2JJ7A 3KZYA 4JGHB 2ZNYA 1JTXA 3JW4A 2KD0A 2XF3A 1R7RA 3HGIA 3BTCA 4KITB 2BB5A 2LWXA 3IECA 4FCYA 2RN7A 2ZCWA 3R9XB 1UG2A 4A3BJ 3RTRA 5FTJA 1HW2A 1VEKA 2J7QB 1EF4A 1SJED 2K4BA 1JQ4A 1PJRA 1Z0XA 2QNJA 5HFYA 3LSRA 4FBJB 4CCJA 1TWHJ 2Y2ZA 3VK8A 3KX2A 3GQ5A 3BPVA 3ALBA 3FXUA 3OYJA 4PK4A 1NYRA 2DJNA 3LNQA 4K7WA 1OMIA 4BHBA 2Z7JA 2UWQA 2Z3XA 4WW0A 2PBIA 4DXFA 3IKVA 4IZZA 1MMGA 4M71A 4E7KA 5CQGA 7CATA 1IRZA 3KP3A 3RKQA 3NZ3A 1QQRA 2OBPA 4HRIA 2O25A 1OKRA 4ICUA 5H8YE 3W2WA 1I4HA 4C7YA 3SBJA 5E1ZB 1S8NA 2L8JA 4MIMA 4AWJA 3U6EA 3KP4A 3HRTA 2MBEA 1OCCH 2AL6A 2UUAM 2NAZA 3GE8C 3FUXA 3MC8A 2V9PA 1HDDC 2WHIA 4EUTA 2C96A 2KA6B 5GPAA 3BCAA 4HLYA 1FYLA 1IN5A 2N9PC 2R7ZJ 1LQ1A 2ME0A 4AG5A 2ZM6M 2IGHA 1WHCA 5JLXA 2OQ4A 2M1MA 2IGOA 1QILA 3RNGC 2CS4A 2KDOA 5MPOA 3HGGA 1NEKB 2DT6A 3CTWB 2Y0TA 4BJ6C 2JXNA 3KS4A 3BVGA 1W5SA 4LJPB 2LG4A 5A2QZ 5CVJA 4A3MJ 3AL0B 2MRPA 3ZMDA 1KSFX 3BJAA 1T0RC 1ZP0B 2EFNA 4IC7B 1TDHA 3FKYA 1GB4A 2EFPA 4ZRJA 4BAYA 2JYEA 1FOXA 4HEOA 3GVAA 2QJLA 1DYQA 2ECCA 1YIJI 1N63A 2FBKA 3QWZB 4AS1A 5HS7A 1WSPA 2D3BA 1ACIA 1ZYRF 4ANJA 3UIPB 1XT9B 4MTEA 5EDSA 3SQNA 5DM7F 5FRMA 1MPEA 2V26A 4OAZA 2W1OA 1MDMA 2A5UA 3VWBA 5BO4B 5FKAC 1PGBA 2QZ4A 4NOOB 5F64A 4EE2A 3LYYA 3IH2A 5A2QS 3AL0C 4HKQA 4KZ0A 4WX9A 3TEYA 1F4KA 1GOZA 1K4SA 1XSXA 4QOSA 3M8FA 1J7AA 1USTA 1AA7A 4BEHB 5KQDA 3AEGB 2L7HA 3B6AA 2XRNA 2Z8YM 5FB2A 1VF9A 2DYOA 3AE4B 4GDKB 5KHOA 3L2UA 3FKIJ 4NZLB 3KYLA 3FBNB 4UHTA 3QA8A 5KQ8A 4EJOA 2PJPA 1OAOC 3GQ3A 1JGGA 4KYWA 4QNRA 5FFZA 2OD5A 2JP7A 5KPZA 1TTYA 4LK1F 1GC6A 1FIPA 3Q3MC 1YX3A 2MJ3A 2NR2A 2ZNVB 4BHCA 1G71A 2KT0A 3ML9A 3CMMB 1FSEA 1RI7A 4GC9A 3HXLA 3FYDA 4D2KA 3ECHA 5DM6F 3UJNA 4WWMA 1TWAJ 3PHXB 4QHTA 2DFEA 4EATA 2M4GA 3V8JA 2MC4A 2P5TA 2W00A 3IHUA 1SVOA 3CCMI 2XPUA 4XRFA 1IXSB 1OYYA 3I9V2 1HC8A 4FJVB 2E1CA 3HOWJ 2ZJQF 2O3FA 3WE2A 3A2KA 4RLQA 1LVAA 4BAXA 2VLAA 2K9NA 1I39A 5FLMJ 3U60A 2ZNVC 1YFHA 1R5HA 4EZLA 1O3RA 2OTJI 4UB8C 3VYRB 4D5CA 2DA5A 3F8FA 2HTHA 3DZDA 4DHJB 1QKZA 1T08B 1CQTA 3HL2A 3IG5A 3CP8A 1XLOA 3DBSA 4HSRA 4RAGA 5B3SH 2LD5A 1SE4A 5B1BH 3W1SA 1I4RA 1E8YA 3HUGA 2IW5A 3BT9A 4LCBA 2R4EA 1HQRD 3H9GA 3ABMH 2PJRA 3BG6A 2GQQA 2KZRA 2D3CA 1ONVA 2MC3A 2H8RA 5C18A 3ZYYX 2WQYB 3OYLA 1BW6A 4RKUF 3BQYA 3V76A 2XSZA 1S7EA 1EM7A 4REZA 3L17A 3JR5A 1C77A 2CR5A 3GF2A 4DV6M 3CZ6A 4LNKA 2ZSIB 1TS4A 2HS5A 4FXCA 3DVNU 3N97A 3S2AA 4BB9A 1E90A 4ZTJA 4M3FA 3C3WA 4FULA 3RZFA 4FCVA 4LF4M 3P4QB 2XEPA 3N9YC 1J0GA 1T0FA 2MH9A 2IYDB 1OQQA 2IO3B 1Z1DA 1TR8A 4G4QA 3Q8XA 4W9KA 4IBEA 3KDSE 2V6CA 2HL7A 2HI3A 3QPLA 1H8AC 2XAFA 2AEHA 2LR8A 3RPFC 3K1MA 2R93J 3WTWC 3ZTCA 2IPQX 1T6BX 2RD0A 2VN2A 1CJEA 2NPTA 1M4VA 3Q8BA 4MEMA 1S72I 1TQPA 3BC8A 5JHAA 1NJFA 1B72A 4K7SA 5HNHA 1D0KA 2N9LA 3HZJA 2X0LA 4IM3A 3FXJA 1RFAA 2ESNA 4ZYAA 2KQ7A 4FHJA 2JA6J 2X8AA 4V2GA 4LIUA 2DT7B 3TWKA 2ICWG 5GAHJ 2COMA 4DV4M 3MC9A 4AVZA 2I8DA 1YN5A 1ZPSA 2PEAA 1OFHA 1B9NA 2GI9A 2K1FA 5LBQA 4HSTA 4F92B 1RR7A 1TY0A 4I0BA 1NY6A 5KVRA 3KYDD 1JJ6C 4I6NB 3PREA 1DGFA 2E35A 2W9NA 2ZMEB 3E1SA 4LFAM 4LZZA 1E32A 3MJ5A 4ON0A 2XH9A 2XGCA 2KO3A 3D5LA 3QHTA 4LJ7A 1P7FA 1FEHA 1CUKA 1PFDA 2LZ6A 3HKZN 3OYHA 3ZNHB 2AQFA 2X1EA 4BQAA 3BYYB 4XLFA 2V6ZM 1JUMA 2CE7A 3KSXA 2KYWA 1LPQA 4WJOA 3EGRA 3EUB2 1HJPA 3ZXSA 3I4MJ 4EGZA 4JPSA 1QGPA 3KP6A 3E6MA 3CMEI 4XLHA 5C3JB 3R4KA 2L09A 3KUCB 5ILUA 4KV2A 1L0OC 5LXHA 4C00A 1IN4A 1WM3A 3Q2AC 2RNGA 5LMNM 1K3WA 2ZMEC 3U6OA 2C9WB 2ESHA 3L27A 5IOYA 4I99C 2XAQA 3WGHA 4NBQA 1RUOA 1ETYA 3J2PB 5D5XB 4UNOA 4I81A 1UGMA 3D0SA 1Z6RA 2R18A 4HLXA 4DK5A 2Q5WD 1AUAA 2BWFA 4RGMA 2MA3A 4XRSA 1QPIA 3VUWA 5J8CA 5ITTA 3J7ZI 1LVKA 1PJIA 3CQZJ 3FK6A 1X1MA 3EECA 3THGA 1DU0A 3F6VA 3DVNV 5M3MJ 3VKGA 3P7NA 2ADUA 1WJEA 1JROA 1MHXA 4GN1A 3EQLF 3CTAA 1WXAA 4PD2A 4EM0B 5JI2E 3M4OJ 2M60A 1WR1A 1WJAA 1SIFA 1J7KA 3LMMA 5CYVA 3C9PA 1QO0D 4OU7A 1LXDA 3F8MA 2N35A 3TCAA 2KIFA 2F4IA 1WJ6A 1XSDA 4QAYA 2M1BA 1SFKA 2F6CA 3ZJTA 4AU7A 1SFEA 2DMUA 2MH8A 4WWCA 5LLIA 3HUGB 3C2GA 4GHAA 2TSSA 2BEOA 1VQMI 3RNCC 3P4SB 3KXEC 4L5JA 1R6BX 2L4EA 2WXIA 2NRAC 1AWCA 3KEQA 5TISC 4LLGM 3BK1A 5H92C 2ZZPB 3OYMA 5G2NA 2LNBA 5AUKA 1L8QA 3WU2C 3OIPA 2C98A 3N32A 3LXFA 4ENMA 4L18B 2G7HA 1T5XD 3NJTA 5GXGB 5EP3A 1GLNA 3WGIA 2M5WA 2RC4A 1R58A 3ZDTA 2OOBA 4RBOA 5DNYA 2M5ZA 2BQQA 1JRPA 2FBIA 5IO9A 3UK6A 1QU3A 2VB6A 3IAS2 1KRHA 1MJGM 1G3TA 2DDBA 1YG2A 1PM5A 1TNTA 3RPQA 1ZK8A 1ETWA 5KO3A 1SSNA 4JI1M 1WHUA 3DFGA 2JU6X 4A3LJ 2HR3A 3QP6A 4GXBA 3B1LX 1O3TA 3TP0A 2O9LA 2LGSA 3CD6I 4KSKC 5LMUM 3M6AA 4S0RA 2B3AA 3KS8A 3UKGA 4G4NA 2HDEA 3ZQFA 2JA8J 3DBLI 4AIDA 1IBKM 3HPGA 3HHZA 4W9IA 2CH0A 5EG0B 1YX6B 2NVUB 2ISYA 3HHGA 1LFBA 2DK5A 3Q9VA 1SXTA 1V5FA 1FT9A 1NDDA 2QSHX 1FSHA 4ANVA 4M6VA 3TW6A 3VVWB 3BR3A 2W24A 1ZTRA 4ZDOA 1K79A 1EU3A 5J4VA 3CSTA 4AQ7A 3LSMA 3JW0X 3WODF 1GAQB 4PT5A 5DFLA 1TIFA 1E5WA 3BXWA 2MHJA 4HROA 2KDEB 4NHJA 1ZGUB 2GRIA 1WE6A 5FD5A 1SGHA 5CVUA 2F2EA 1DQUA 2O61A 4YIIA 2EA0A 3LA7A 4EM1A 2DA4A 2DZJA 1OCRH 1V92A 1C7YA 3FE3A 1UD7A 2QP9X 4R1HA 3ZNZB 4KMUX 2IS1A 2M34A 3PJRA 2OQGA 2Z0EB 3HOXJ 2F4MB 2B7EA 3FUWA 5LRSA 3GOEA 4LY6A 2WADA 4BL0B 2E2JJ 2D5GA 2W85A 4LJZF 3MQ0A 4EGYA 2Y0QA 3CCLI 1OKSA 4YWGG 1H89C 1WMHB 2VPLA 3BPXA 3GLFE 2DI0A 3AU4A 3SHGB 1PUFB 4W9FA 4I98B 3T8TA 1ZW7A 3S32A 1IRFA 3QAHA 3FKEA 2JA5J 3BR6A 1IUFA 4TV7A 5ILSA 2KW0A 5FTMA 5E6OA 3T5XA 1GKIA 5BNGA 4GMVA 4WQMA 1QA6A 3R0JA 4LDTD 4UUSB 4WJNA 2FIFA 1KU3A 3CWIA 2P7VB 1VZ7A 1IBXB 2XSZD 4AKIA 1PP7U 3U61A 3TL5A 2KFJA 4NJ7A 3KVWA 2K5CA 2VKHA 4CA0A 1R1TA 3GLFA 1AIPC 4PS8A 3D32A 3RFWA 3VTWA 1U5TA 3T3NA 4JWSC 2W4SA 2FU4A 3M62B 1G4AE 4OVZA 4CYCB 2LKXA 2KJHB 2FUG2 4KICA 4DV7M 4U0WA 2MROB 4AZFA 1WR1B 1IZ1A 3EPZA 1SFUA 2IGKA 4G3OA 2R7RA 2HKXA 1CGPA 1JT6A 1TC3C 1D0YA 3AXCA 4IJFA 1YHQI 4KDIC 1W1WE 3CJNA 1ACCA 3CCVI 3BTLA 4ITVA 1WZ3A 3CCYA 2FNPA 2OV7A 1P4XA 1Z21A 2L0FA 5F0FA 1V55H 2VC1A 2OEDA 1TDZA 4LFCM 4RM2A 2H6BA 2V3PA 3SDLC 4DGWB 3MEXA 3DWGC 3KUZA 3DTEA 4BY7J 4JQWC 2Y0SN 4CYDA 4YFNF 1QYRA 4ZZDA 2EMSA 4I09A 2Y5PA 4JWUC 3LVVA 4NSOB 4XK4A 2KOXA 2UZKA 1ERDA 1V8CA 1U3EM 1KLUD 2QQBA 3TP3A 3BVMA 5L3FA 4HXDA 5J8FA 5KPRA 4M0WB 1VDDA 3GBGA 2C9OA 2K6DB 4ZZLA 2OOBB 2AHQA 3U5ZB 3JR9A 2M7BA 4G6DA 2F5NA 4IM2A 3GLHB 4HA8A 1AARA 3E6DA 4WK8F 4QSHA 3BLYA 4LJOB 1PDXA 1C4AA 5BMIA 3JSVB 2CW0F 3E0JB 3W67A 3MC0B 2WWZA 5LLQA 2K27A 3RCZA 1I42A 1KQ0A 3ZQGA 2N8GA 1Y8QB 4W97A 3AEBB 4J19A 2SAKA 3O8GA 2DFIA 2J0JA 2PG4A 3MCZA 4PS7A 2KMMA 5E3LA 3MD2A 1E8XA 4MM3A 1ZKGA 2C6YA 3NWSA 4Q4ZF 4AM3A 3VHTC 3R2TA 1QDTA 4DUZM 1FZPB 4IBJA 4QPQA 1XMOM 1IRGA 4I6PA 1ZOYB 2V1CA 2JWSA 2LOOA 2HQRA 1WJNA 4FISA 3FM3A 2QC8A 2EZHA 4RF1A 5M3FJ 4JQFA 4NAWA 3OWEB 4DR6M 2DAKA 1MJAA 3M7GA 1QPMA 2DFHA 5JVTA 4I6ZA 3LOCA 4NSRA 4Q7JA 2NS7A 4WXDA 4QPOA 1UMQA 2FFJA 4YSYB 2DZNB 3NUHB 2WNMA 5E1XA 2DBBA 2H89B 2WDTB 2JY7A 3WAPA 2K9LA 1VFCA 1WH7A 4GB9A 4MDKE 3DKYA 2DOEA 1WJUA 2W54A 1H8CA 3ZDMC 2FNJB 4ARCA 4W9EA 3JTGA 1P7JA 5C4XJ 1AOYA 3S15J 4LLGF 2BJWA 3AEAB 4CXFA 3KE2A 1UBQA 1I4PA 4LNNA 2L7KA 4BLCA 4C2UA 1TZLA 1QOFA 5E6JA 1ZH5A 2O6VB 3K6GA 4A5MA 1SBBB 3B73A 3NZSA 1IY0A 2KDMA 3PZ7A 4MGRA 1XMXA 4XIDA 4B47A 2BKRB 4PZJA 1SVMA 4DR1M 3SR6A 3EFUA 3HTUA 4RGXA 4UDUC 1E6EB 2WX1A 1PGYA 1LDKB 4LJAA 1D1AA 4BHPA 1MJBA 3L9FA 2Q2EB 3QAQA 2Z59B 1G3WA 4W5WA 3X2QH 4BBRJ 5EGOA 1T6OA 2QEXI 4MO7A 3M8JA 2MH7A 4ITKA 1UFZA 2BOLA 3AI5A 4H0EA 2WB1N 1WR6E 3EFCA 4J01A 1IJWC 2JUGA 4ZOHC 4H2AA 3VUXA 4G7ZF 3L16A 4NQLB 3RUIB 1DOXA 4UV9A 2K39A 4P1BC 2RDBC 4ZH4F 2M8EA 3ZQHA 4ZHOA 4IX7A 4HLQA 2K0BX 4CICA 1WJCA 1FY7A 3U7DA 1XGSA 2L9RA 3FMSA 1FTZA 4XKVA 3IT4B 3CDLA 3BVZA 3GZNB 1Y6IA 3L25A 3TBIA 4GDFA 2VQGA 4I8OA 3BP8A 2OC6A 5DCMB 4E7SA 2L01A 2RSUA 1F52A 4GIPA 3LJ3A 2X49A 5EF6A 3KOZE 5IY5H 5BPIA 4ZYDA 2JSCA 3HTSB 1UELA 1FMWA 2VOPA 1KJTA 4WURA 4U0YA 2YPRA 1KFVA 1TTNA 1XC5A 4NUBA 3V6CB 3M3JA 3HK0A 1MNMC 4FQGA 2INNE 2NVTJ 4ZDVA 4PFOA 1UNSA 1YW7A 1P9DU 1UBIA 2LP0A 2IO1B 2DU9A 2J5PA 3WTZA 1GPXA 3S1NJ 4FW9A 3R7RA 2XPVA 4IPAA 4B3MM 3QYBA 2CV0A 3U7ZA 4II3B 4L15A 2PEXA 3FXOA 2YEPB 5L8RF 3B0AA 1I94M 4NJCA 3PNYA 4ANUA 2Y75A 2YR0A 3NBXX 3CCQI 1ON1A 2LYCA 1FLIA 2ZANA 3AJIB 1FRRA 1YO5C 4MGHA 1Z77A 2BT6A 3LSHA 4HF1A 1UH6A 3T0YA 1ISNA 2N9EB 1MBGA 5EP2A 2KNAA 3DEEA 1E3OC 3N30A 4B48A 1DP3A 4BKGA 4HAMA 1WXVA 5IKCM 2Y0MA 3HYIA 2X6OA 2EV0A 4TV3A 2Q0OA 4IXAA 2VJJA 3CLOA 1O3QA 2J5OA 4XWTA 3ZQQA 2DWZB 3VUYA 5FLXZ 1VDVA 4LOCA 1Z9CA 1Y8GA 2HOAA 2X48A 2DWQA 3DBHI 3AE9B 2E1OA 1L6VA 4GKKM 3OS2A 3H3UA 5FGMA 4JIOU 2CQNA 5EZGA 1NI3A 3AE7B 2A69F 5JHUA 4MM3B 2A5WA 3AG1H 5B5EC 2OPFA 1WX9A 1G4DA 3G73A 2GOWA 3N05A 5LXIB 2JWUA 2LJIA 4B3XA 3EIEA 5E20A 1FXTB 3K4JA 1VQ8I 2ZJ2A 2E3TA 3SHQA 3E6CC 2E5LM 2FIDA 2MBQA 4NAWB 4JYKA 4F93B 2WSCF 3F3XA 3GQ4A 3FUUA 5D5UB 2NTSA 3LDZE 1IUEA 3RULA 1IFYA 5D6JB 3BZKA 4NQWA 2BZTA 2YSRA 1J19A 1OFIA 1PRBA 3CIRB 3W5UB 1GUAB 3ABKH 1TW3A 4KJZA 1VQ6I 3OJ3A 3DKWA 3NWTA 2XF6A 5E26A 3DOWA 2D07B 3FTFA 3LQQA 2X6YA 4A3IJ 4GRIA 4RA2A 5EE0A 2M87A 1YX5B 2KTFA 2H27A 3A1QA 2CHWA 3BZDB 5C23A 1ORYB 4XBOA 1ZQ9A 1R1UA 3B6CA 3HOSA 1P7IA 3WG7H 4LIVA 3KVFB 3D5RC 5BR8M 2WA0A 4C3HJ 2XLJA 1YQAA 1T39A 2K8HA 5L3GA 1EFUB 4U88A 3MKLA 1FCLA 4M01A 4G7HF 1O57A 2OO9A 1QVUA 2XAJA 1MSEC 2LEKA 2C7NB 3K9PB 2PMHA 1R49A 4QTRA 3MFKA 3PRMB 1NV9A 3T8RA 1U2WA 3GLGB 3OS1A 4GITA 3TDZC 5J2RA 2XGEA 3ZJVA 1D5VA 4IBDA 2A6HF 4EJTA 2EKEC 1TY2A 5E79C 3DPDA 1OISA 2MW5A 3SEBA 2YNMD 2DK8A 3PIPF 4RB2C 3KW6A 3DP7A 2D45A 2XEWA 1V33A 2DENB 4XM3A 4LF8M 2O7OA 1WCMJ 2JT1A 2LVPA 1IGCA 2Y69H 4NC6A 1R71A 2KNBA 2JVGA 3W2DA 2ZJPF 2HDWA 2FQ3A 5DPRA 2EWNA 3TQSA 2DW4A 1OCTC 2L2DA 3BTIA 2R7TA 2UXBM 5LGUA 4EKUA 4IL6C 4TQ1A 2M0CA 1Z3YA 3R0AA 5EZHA 4CCOA 1T38A 1MN3A 2WYQA 1FNVA 3IUOA 4IBBA 2I1KA 4E7ZA 3GZ5A 3SMPA 4II2A 2KDLA 2XF5A 3SARA 1B9MA 4BQQA 2KTRB 3HVZA 2DMTA 3M07A 4G6TB 3SFEB 1IQPA 2VBWA 3FF5A 2HYFA 4ZRQA 2BW3B 4DHZE 3ZGKA 3BQZA 2KHWB 3TEZA 4BY1J 2RMMA 2RGVA 4G4RA 3DPTA 1PVEA 4HPPA 1Z7LA 3CP2A 4GC5A 2HOTA 1U78A 2BYEA 4HQMA 2XAHA 1K61A 2F5QA 3SJMA 3S8PA 5H2FC 1Y56A 2FMLA 4G6QA 4AI6A 3WA0A 1DO0A 2RDPA 2L3DA 2R44A 2BGCA 1GDTA 1H88C 4BNCA 1KU9A 2VT3A 3OLMD 3J7YJ 3UR3C 4JI7M 5FROA 2R7SA 2HQAA 1BM9A 4HX4A 4PK1A 2PQ8A 4S0HB 1IGDA 4RB0A 2RRUA 3J27B 3LSTA 5AZGA 4IHWA 1Y1VJ 2V4IB 1QHHD 4FWDA 1HW5A 3I59B 3Q5FA 1M94A 2VI6A 4XBFA 4DZJA 4D80A 1E7VA 3QIJA 2F5FA 5DYMA 4XSXF 4HF2A 1YS6A 5GAGJ 3UINB 2CEAA 2R62A 5I4DA 3BY4B 3T3OA 4URKA 4YSXB 1Y1WJ 3QX1A 1RR8C 2F5VA 1L2CA 1ZN2A 4HPQA 2LRUA 1IV8A 4IHSA 2LGYA 3U6LA 3UIOB 2LUMA 4M3EA 2LHEA 3V8LA 1EA3A 4KIFA 4E74A 1VNDA 9ANTA 4G4OA 4GO1A 1K78B 1U8RA 3TEWA 2A4ZA 3C0RB 4XE0A 1BR2A 3E5XA 2KVZA 1WVRA 3VR8B 2KHMA 1GG3A 2FBWB 2KQ4X 3L13A 1VLBA 4RH6A 1WWTA 2BS3B 3SZGA 5IAAC 3U30A 2KZGA 4JI3M 2LJ5A 1APLC 2LVSA 4K2EA 4XX5A 4U87A 1QHGA 3R8BA 2JZPA 2FOKA 3MZYA 1YRNB 3ZUNA 2WBMA 1R4MB 4GDLB 1WGLA 3WU1B 2MJDA 3GW2A 1WRIA 5CPRB 3R60A 5D5VB 1SXJA 4TKNA 3JVZX 4WJQA 1D3YA 2OF7A 5F0HA 1K8RB 4ZYNA 2X38A 3IWZA 2CHZA 4EIWA 2R0IA 4LG0A 4OINF 2C7MB 2JT4B 2XN9C 3AAFA 3AE6B 3WANA 4Q47A 3JRHA 4Z2YA 1YNTE 2K7LA 3GRYA 3BWUD 1L6UA 5IPAA 4USAA 3AE3B 3JTHA 3PFIA 3PXGA 5IYBJ 1Z05A 1XCVA 6PAXA 3ZNGC 2IJ0A 3K70C 3HOUJ 1X1AA 1UM8A 2MW8A 1F1HA 1SEUA 3FXLA 3KP1E 2HYJA 3JRBA 1FD6A 3EUKL 4C4VB 3QK0A 2MABA 3GFIA 3H92A 4RGRA 4UV8A 1ZELA 2HZTA 1P92A 3E56A 2XPWA 3L54A 3G4SI 4PGGA 1W36D 2CUJA 5FR6A 4L9TA 1L1TA 1FO4A 3H1CA 2HHHM 4DDGD 2EA2A 2LD9A 2ELKA 5CKTA 3RI7C 1CF7A 5L3EA 3ASNH 4YG2F 2KJCA 3R8FA 2OCEA 1D1BA 4ZYHA 1WJ5A 2D7EA 2BV6A 3NEUA 3PO3J 2PPHA 3AFHA 3ECOA 2DBYA 3NAUA 3HOZJ 3Q3OC 1P3QU 1JI8A 3FILB 5E18F 2I38A 2H5XA 2CUZA 4G3XB 2I10A 3QODA 3AOGA 1X1CA 5JHFA 3K7AJ 3AEEB 1WWXA 4M73A 3UQBA 1GV2A 1T0SC 2KDIA 1I5ZA 3I64A 3ZGZA 1EO6A 2KIQA 1B59A 2KPMA 4HJKA 3M0EA 2R7DA 1R36A 1VRAB 2VXDA 5ITUA 2FXAA 4BKXA 2LVPC 2JWTA 4YSZB 4DV5M 2KKOA 3HY5A 3KETA 3DBRI 2FH0A 2G4DB 2AQ3B 2RQQA 4GMQA 1N60A 1NENB 1Z67A 3ZP5A 2GNOA 1ZG5A 3FXMA 3KQ4A 1TP4A 3MZHA 2E7WA 2YUSA 4P96A 4CISA 2XSDC 2BTEA 2CWBA 2X4AA 2R5YA 4HV6A 3RNAC 3Q9SA 2WLBA 2JX5A 3CJQB 4R71A 3S2WA 2GA2A 2E2HJ 5IYCJ 4HQEA 3LAPA 4FD2A 2W48A 4M74A 2EZIA 1ETOA 3HWSA 1I3AA 3K70D 1ZGWA 3NS8A 2K6BA 4O3MA 2GIVA 1PQSA 1WGNA 3QQ8B 5FKOA 2RR9A 1LJ9A 2KDBA 4X65M 3BROA 5M5XJ 3DHHC 4IW0A 4OU0A 3KP7A 2B9SA 1B6AA 4BE2A 1PYWD 1VQOI 4BGDA 1IYFA 2EJRA 3SAWA 2L3ZA 2AWTA 3CUQB 2VH1A 3P63A 2QA4I 4X62M 1FOKA 3CC2I 2FD5A 3LSKA 2JUJA 4G6ZA 1TBEA 3I5JC 1P1AA 5EE3A 3AE5B 2Y9YA 5J47A 3HDDA 5IWAM 3GFMA 4ZPXA 4HDOA 2DWNA 1NHAA 1YE9A 2JPCA 2QCOA 3NOBA 4DR4M 3I57A 1KQ9A 1EU4A 4B3AA 2QCZA 1YJNI 4X57B 3U2RA 3SC3A 2YX4A 2RV8A 1EJ9A 1H9GA 4I0AA 5FO5A 2QILA 1D5YA 4J6IA 4ENNA 4LF9M 4E7LA 3JAMZ 1L0XB 4RB1A 1HXDA 4LD5A 2Z9OA 3OSFA 3CUQC 3HOTA 3VYSB 2R92J 2WTEA 2OPTA 2JQRB 1UCRA 2L7MP 1ZREA 3PQJA 1O3SA 4DZPA 2DYBA 2QSDA 4LG0B 3I4NJ 3NY5A 2PLYA 3IG8A 5IA7A 3JREA 1QAOA 2JXTA 3SAUA 3K8ZA 1LGRA 1I1GA 2IGMA 2JF5A 4F52A 2D2WA 2PMZA 3CJRB 4KN4X 2ZCBA 2CV1A 3PIOF 3ZXRA 5DTDA 4DBRA 4CHKA 3JAMS 4AYBN 4BOZB 2EINH 4C2MJ 2WXKA 2W3RA 1C4CA 2CFXA 2L4MA 5L83A 1YI2I 1SXJC 3HM6X 1Y0NA 2QWWA 4K7UA 1N25A 3OY9A 1HNWM 2QSFX 4HRSA 3GLXA 4IWQA 2KFDA 2XK5A 1IN8A 4AJWA 3VK7A 3K9OA 5ICFA 1MFWA 2D11A 1YN4A 1TZOA 2HGCA 4PYZA 4OIPF 3J80Z 5EDNA 3T1YM 1OYWA 4A55A 4IKGA 3RD2A 3QPHA 2LY2A 2K9SA 5C44J 1NHWC 5LGTA 5FLXK 4L9VA 2HAKA 4FLHA 2KLOA 1DPUA 1WRDB 1SC7A 3KP0E 3VPRA 1EH6A 2HD5B 1NHGC 5EXXA 5C1ZA 2ZXIA 3MMYB 4Y3OA 3T6PA 3BR0A 2KIUA 1RWSA 3GTOJ 1TKEA 3C8YA 3V7CA 2R46A 3NVZA 3BJ6A 2CRUA 1ZMUA 3BDDA 1X2MA 3VDZA 5K5OA 2HVRA 1FX7A 4L0YB 3ZPLA 2Z5UA 4BDZA 1DGGA 2KHHA 3R6SA 1I1SA 4EJUA 2NS0A 2YVCA 1NK2P 4I5SA 5IT3A 2R7QA 1DGJA 3UI3A 1UZXB 2OJWA 2DCEA 4OZCA 1D8KA 3E3VA 3GZ6A 5M5WJ 1HA8A 3KW5B 3HKPA 4FE7A 3IH4A 2N7JA 2D1HA 1W0UA 3TKYA 5AEKB 3GCMA 2DFFA 2OQRA 2XAGA 5BYRA 3ZO5B 5F1RA 5DEQA 1JTYA 3PL8A 1I4WA 4BE0A 3RZWC 3H9JA 2WSEF 2ID3A 3IT6B 3EUHA 1FTTA 2EH3A 2GB1A 1XCBA 1MBJA 2A61A 4C9YA 2SEBD 1E9MA 3H1UA 2ZJRF 3W2AA 3SDBA 4DV2M 4LJ6A 2H8WA 4HVBA 3PUFA 3P4RB 3HX3A 3B89A 3BINA 4AKHA 2DZOB 5BS6A 4P6VF 2JYTA 2W7NA 4C3JJ 3F23A 3FXQA 5T8IA 3BIID 2IS6A 3Q8GA 2HXIA 1DP7P 1PGAA 2EKFA 2H88B 2R0QC 1SD4A 4GH9A 1ZHFA 1Z91A 2RDGA 4HNUA 1SXJD 1IY2A 2DQRA 1F2RI 3D1NI 1X3UA 4RF0A 3VFZA 1VEGA 2FMYA 4L9NA 3FC4A 2WDRB 2ZXWH 5EJCA 3TPZA 2L0TA 4C30A 1TH3A 3AULA 3ONSA 4RGNA 1V5GA 4IBKA 1WX8A 1R23A 2MBBB 3DEWA 3KOXE 4E6KG 2KMAA 1BJZA 2V3NA 5KAIC 1D4BA 5M5YJ 3CCUI 3C1DA 1T3QA 4JI2M 2JPHA 1XDSA 4P55A 2HE7A 1YLFA 5JZEB 1ESFA 3WAMA 1DGHB 1U9NA 3DBLB 4F2LA 3SDGA 4MGIE 2M0MA 2G45B 3ABVB 2L02A 1TT5B 1ZGAA 2QKMB 4AKGA 4JYAM 1ZG1A 3AOEC 3NVWA 3L09A 1IN7A 1RRBA 1RUNA 3BCBA 2QIEB 4DIQA 2MG4A 2R7WA 2GAUA 2ZTCA 2P0WA 1ZR2A 4OVUA 3Q0WA 1DOIA 4BFRA 2P5VA 2GXAA 1ORKA 2K47A 1T56A 4M9XA 1GL6A 2L1AA 1YSYA 4D1QA 1SD6A 3ROUA 3M9AA 2MLGA 3RKYA 3CGWA 3VSKA 1J0RA 3ML6A 1TH2A 2FEZA 4I02A 3H7PB 1Z3XA 1UUPA 2LHDA 3ELKA 5KCMA 1KYWA 4IOIE 1RRJA 3HJEA 4ESJA 1TH4A 2LBCA 2LGXA 1OFFA 1RAXA 1C1YB 1VZ8A 1Q1VA 3TO9A 4LGMA 1YTYA 1OR7C 4Y28F 3R66C 1GXQA 2QZ8A 2X6WA 3EIHA 2Y9ZA 1XMKA 3HHWA 4CCKA 2MGWA 3QU6A 3VTUA 1X19A 1UWXA 2E1MB 1L3LA 1GJSA 3DF8A 3ZQLA 2KP6A 1BT0A 3DDCB 1IXZA 3HBLA 3Q0UA 4BUPA 3SFZA 3TIXA 1PDNC 2JVCA 2PTLA 4BKSA 1SD7A 3MKZA 3GWZA 5DS9A 3ESWB 5D4SA 1RNLA 1A5JA 4ZJZA 1NNUC 2QYOA 2VPRA 2R2QA 1ZQ3P 3SYTA 2YS9A 4XKBA 3DQVA 4UVAA 3L2AA 1ZMWA 3GTGJ 4XLEA 2X85A 2CGPA 1X58A 2M45A 2WAQN 2BKFA 3VFKA 3CJTB 3LA3A 3B08A 2E1MC 4XOPA 4FCWA 3DCFA 5IZ7D 1WI3A 2K9XA 5D5WB 1BC8C 1MD0A 2VT2A 1OAIA 4LITA 3IKTA 3VKHA 3U6SA 4BQNA 5ED4A 1XMQM 1B8IA 3AU5A 2M17A 4DV0M 4JBAA 4B0MA 4F1SA 3ONQA 2UUCM 4KGTA 1JCKB 1S1QB 2RAEA 5K7FA 1IY1A 4XQFA 4YEJA 4EEFG 3Q0VA 2YQZA 2CSOA 2MQJA 3IG3A 2JSPA 3EDPA 2F5OA 3UMMA 5K7ZA 2JK3A 3QQAA 4GGQA 4EJVA 5F04A 1BOAA 3VFDA 3L2RA 3RSNA 2F48A 4UVBA 4HX8A 1ET9A 3ASOH 1V9JA 1QBJA 4M72A 4R3DA 5IT9K 4LF7M 5LEJA 3DHGC 2VBZA 3UNGC 2WU2B 4Y7NJ 3GYHX 1WGHA 2V9HA 4M3GA 5HDNA 3HU2A 4M8MA 4ZTFA 4IKFA 1ZMVA 5DPWA 1D5MC 2G7UA 1KM7A 1N32M 5HLTA 4L2YA 3T15A 2ERCA 1R4NB 1B4AA 3N4MA 1MVKA 3VEPA 4XKCA 2KXJA 2VJ4A 1MGTA 2XV4S 3N1ZC 4XLCA 2IAIA 3TWLA 2GWRA 2EMTA 2LBFA 1QAQA 2LLKA 3UGJA 2VZKD 3GPUA 3HSEA 2HTME 3DCGA 5GPCA 4HKZE 4RGTA 2WXNA 4KNYA 2TDXA 2E71A 1E10A 4WWPA 3PRZA 4FHTA 3HPHA 2VOOA 4JE3B 1K52A 2CO5A 3GTJJ 5E1WA 2GXGA 4CCMA 5EYRA 5K5RA 2QMTA 2REXA 2VF8A 1JJ8C 1TKGA 4CYEA 1QUTA 1FXAA 4W9DA 2EBIA 4DV3M 1GJZA 2OHFA 4K3CA 2V1XA 3A9KB 1XMAA 4FVMA 1XDUA 1XF5L 4BKTA 3U1DA 4F7ZA 1OPCA 1ENHA 3UF8A 2LREA 1WFXA 5K5QA 1W0TA 1ZDXA 1VQ4I 4F3QA 3IAM1 2BVMA 3K4KA 5BMHA 5JH5C 2DA7A 4KDPA 3I63C 3H3VK 4R8HA 1SAXA 3TJPA 3P9CA 1TGZB 1RYJA 4LNOA 2CV2A 5K1YA 3FD9A 2JA7J 3C2HA 3K1JA 1ZGJA 2GBKA 1LE8A 1G41A 1V2YA 2LVOC 4CCNA 2QQAA 3NWLA 4MQ9F 3C19A 2D7HA 1NBFC 2O2VA 2XROA 5FR3A 2IJLA 2ELHA 2KJRA 3A4SC 3S3MA 4LRSA 4ZYGA 2ECBA 1Q10A 1N5XA 3KYDB 3W5VB 4LJ8A 1JR3E 3E7LA 1K51A 1PJJA 3L0WB 4II7A 1DGWY 2HXOA 3TBLD 2YU9J 3ZXVA 2HTSA 3KEYA 1BI0A 5GTIC 1QOGA 2JRIB 4B7FA 4ZRPA 1P6RA 1TL8A 3LW5F 3S1MJ 3LFKA 4NC7A 3LQRA 4CGYB 2Z16A 1N6ZA 1S6LA 4FX0A 3J81K 4BXFA 4O1NA 1N62A 2JPBA 5C4JJ 1R7JA 3I01M 4FADA 3KLSX 3KP2A 1POGA 2L00B 1JR3A 2LY9A 1IO2A 1LFPA 2WXRA 2DMQA 1C9FA 4CO8A 3C2BA 2RNJA 5HLGA 3IRQA 1K7AA 2L32A 2VJIA 3BTJA 4U0VA 1O7FA 4E70A 3H9DA 2AYOB 3OL4A 1J75A 5IP4D 4OZAA 1W5CC 2XZFA 1J5YA 2LC2A 3Q3FA 2J0KA 2A6EF 3AEDB 4A3OA 2ZBKA 3KCCA 4DQ2A 3CF0A 4YFXF 3CUOA 2F5SA 1ZG3A 3SFDB 2Y20A 3JCUC 4O5VA 1G59A 4L6V6 3S3NA 4XONA 1WJ4A 1K82A 3M1CA 2LNHC 2D1VA 3QYEA 1VG5A 4JI8M 2DO7A 3EYIA 2CHGA 2FE8A 3ZMTA 1IXRC 3LWFA 1KLGD 3X0WA 2K86A 4KGRA 4QIWN 1KONA 2P8TA 2L5QA 4G94A 3DEUA 1YOVB 1ZUD2 2VF7A 3F21A 2KC2A 3GB1A 1WYGA 1FBUA 3QC8B 2NBWB 2ZEQA 3L08A 2DQLA 1HNZM 3QWLA 5AONA 4HYEA 5D4RA 3EC8A 5HKHA 1I35A 3J80K 3FTDA 1RC9A 1OFCX 2JRMA 1L0YB 2FF4A 3NRVA 1T3TA 3RGSA 1T8IA 1YS7A 4KSLC 5EXPA 4JX1C 3PSFA 3JRIA 2CJOA 2V1YA 1TF0B 1JHFA 2OAZA 4PCQA 3HG9A 1QQWA 3GLIE 2QEJC 2J52A 4Q2JA 2PLPA 2QENA 2L9NA 4IWPA 3DWMA 1XC8A 2WDVB 1VQKI 1V1PA 2I1JA 4KMFA 1XXHE 2C7HA 3ZTDA 4LK0M 3F8NA 3DBHB 5LRRA 1Y0UA 2MWSB 3WGGA 4IHYA 3K4CA 4W9CA 4WXCA 3U2SC 4PFPA 1L4DB 4BJ5C 3OOUA 1W7PA 4CSWA 1MDMB 4A12A 4L78A 3F22A 1R9TJ 2VQFM 2M8SA 2DDAA 5L95C 3GLIA 3G6EI 3MWMA 4AUXA 1X1BA 2KL4A 3N1XC 4N9F4 5FK9C 1XXHA 2PX9A 3DTKA 1XQQA 2WXFA 4IJEA 1Q3CA 3I9V1 2Z2SB 4XC2A 2QHOA 1H0MA 1R00A 4BKSD 4RM9A 2MYSA 2E36A 3L10B 3W68A 5L3BA 4LLNA 1C76A 2EIJH 1OTRA 1RM6C 2DNAA 4A2UA 1EF1A 2OUMA 2RVCA 3K4BA 2FBHA 4XZ4A 3TWMA 5BMGA 3N3KB 5DCNA 2IA0A 5F27A 3ZMVA 2CHXA 3AMZA 2HEOA 1LDJA 5BPVA 4JX4A 3ZRFA 1LB2A 4N9IA 2MBHA 3C58A 1J9IA 2GOXB 2BY2A 3JSOA 3J81S 3A9JA 4WAFA 3ISPA 2IY0B 4US8A 2DKLA 4RB3C 2R5ZA 4YY3M 1TW2A 5FJ8J 2GM4A 1GC7A 3NG0A 1OIPA 5CVVA 3HRSA 1XNQM 3H36A 1H4RA 3RNFC 1IRXA 5EXTA 1X4OA 4A3DJ 4K3BA 4K0KM 2CKHB 1LFDA 2DYSH 3AH7A 5H6QA 2G3QA 4BZAA 2DHRA 1WXMA 2J42A 1OCZH 2Y5CA 2EFWA 3K4NA 4CGZA 3VYTB 1KQ8A 3U60B 4GYGA 2G9HD 3BG7A 1JXSA 3FUTA 1ON2A 4CDGA 1HF0A 2IPKD 1PP8F 3CDHA 1RKWA 2IZVB 3I55I 1B1BA 1AKHA 2N4FA 4AOFA 1NG7A 1TJEA 4NXNM 3C18A 1KTKA 1S29A 1U8BA 2AQ1B 2ZJDA 3O8HA 4KUMA 2BVCA 5HLIA 2INDC 1VCBA
chains in the Genus database with same CATH topology
2V4IB 1QHHD 2PKOA 2QBYA 1ZP0B 4FWDA 1TDHA 1J5EM 1GB4A 4HEA2 3J7AY 5DYIA 5TSSA 3DPUA 2I7NA 1AWDA 2JYEA 2WY7Q 2PJRB 4D80A 2RKOA 2QJLA 1DYQA 3KOYE 3AKZA 1SAUA 4NAMA 1N63A 4A8XC 2J7NA 4AS1A 1JW9D 1Z5CA 2HKJA 3LSGA 3WHLA 1NY5A 1WSPA 3GO8A 2CEAA 4ANJA 1OQRA 2R62A 5I4DA 3T3OA 1XEEA 3DOAA 5FRMA 3W0LB 3FKJA 2V26A 2ZBKB 4OAZA 1MPEA 4BDYA 5TGTA 4YSXB 2F5VA 2W1OA 1L2CA 1I4GA 4HPQA 4X64M 2HVQA 3VWBA 5FKAC 1PGBA 3U6LA 3P1MA 1R7SA 2QZ4A 4NOOB 4EE2A 3LYYA 3GLGA 4OHJA 2LUMA 2LHEA 4LG2A 5A2QS 3AL0C 1EA3A 1L2BA 2MJEA 4F91B 4HKQA 4F55A 1LKXA 3TEYA 3L28A 4KLNA 4G4OA 1GOZA 1MX0A 4QOSA 3TEWA 1J7AA 1AA7A 4BEHB 5KQDA 2WXOA 5DYGA 3AEGB 2KRUA 2L7HA 3OL3A 2K0PA 4XE0A 1BR2A 3P42A 3H5NA 3VR8B 2KHMA 2FBWB 1EWCA 4ZDLA 1E0EA 2KQ4X 1VLBA 4RH6A 2DYOA 3AE4B 2VIXA 2PIAA 4GDKB 1WWTA 2BS3B 3SZGA 3L2UA 4NZLB 3KYLA 3FBNB 2Z1DA 4LFBM 1DO2A 2LMCA 5KQ8A 5KHDA 3GQ3A 2WY8Q 4JI3M 4QNRA 4U87A 4MACA 2I2YA 3Q8FA 1QHGA 3ZH9B 3R8BA 5KPZA 2YEPF 2JZPA 3OYDA 4NXMM 1YX3A 2MJ3A 2L9SA 2WBMA 4GDLB 4GC9A 1T95A 2MJDA 3OIQA 4B3RM 3HXLA 3FYDA 4D2KA 1WRIA 5CPRB 3UJNA 4PDGA 4WWMA 1PYVA 1SXJA 1C4PA 4QHTA 4EATA 2M4GA 4L23A 2MC4A 2P5TA 2W00A 2BW3A 2CMPA 2UUZA 4C7ZA 2X38A 3MP9A 4EIWA 2ZSHB 1D5ZC 1SE3A 4WH4A 1T0FC 4MH0E 1IXSB 2XN9C 3I9V2 3FBIB 3AE6B 1YNTE 4AW4A 3GRYA 3BWUD 1L6UA 4USAA 3AE3B 3A2KA 4RLQA 1ET6A 3PFIA 3PXGA 4L4UA 2WXPA 1HT1E 2VLAA 2YFQA 3U60A 2IJ0A 3K70C 4PSWA 4YTMB 4M9SA 1X1AA 1UM8A 4XN0A 1F77A 3MKWB 4GKJM 2KN4A 3KP1E 3TE6A 3ILKA 3VYRB 1FD6A 1NJGA 3EUKL 1QZMA 4LG3A 3DZDA 2MABA 4XOTA 1QKZA 3HL2A 3IG5A 3CP8A 3NVYA 1XLOA 4HSRA 1ZELA 1SE4A 3W1SA 1I4RA 3E56A 2KMUA 1VZ0A 3FDYA 4DOZA 3PNVA 1W36D 2CUJA 2VL8A 2DXIA 1HR0M 1L1TA 1FO4A 2HHHM 4LCBA 2R4EA 1HQRD 3H9GA 3OWTA 1UWMA 2PJRA 5CKTA 3BG6A 1LO5D 4Z6YA 3ZQ4A 5JI3E 3RPUD 3R8FA 5C18A 2D7GA 1D1BA 3ZYYX 1WJ5A 1E9RA 2WQYB 2RGHA 3OYLA 2D7EA 1I4QA 3HJQA 2XSZA 1NSFA 2KZVA 4RNAA 2R7VA 2BS2B 1EM7A 1D6EC 4REZA 3AFHA 2DBYA 3D8BA 3JR5A 1C77A 3RQ4A 1J09A 1JI8A 3FILB 4DV6M 2I38A 2M4KA 2CUZA 3CZ6A 1JR3D 2UXCM 2ZSIB 1TS4A 3KWLA 5ITYA 2E60A 3Q8AA 4FXCA 2PVOD 3QODA 2L6OA 1VZ6A 3VR9B 1V1OA 2XGNA 3AOGA 1ZDVA 1XLNA 4BQOA 1X1CA 4BB9A 5JHFA 4ZTJA 2X51A 3AEEB 4QNMA 4FCVA 1YQ3B 1ZXIA 4LF4M 1MNDA 3P4QB 2XEPA 4LZJA 3N9YC 3DU6A 2N9KA 1OQQA 3ZGZA 4KISA 2L83A 3BOSA 3PVSA 4ZHPA 2X6XA 4G4QA 3Q8XA 2KPMA 3RE8A 3M0EA 4IBEA 2ZAMA 3KDSE 1VRAB 2HL7A 2VXDA 5ITUA 4RCOA 3VRBB 3RPFC 4YSZB 2VXZA 2LY1A 1JMLA 1T6BX 3AV0A 4DV5M 3CMMA 2XSJC 4KT6A 2WDQB 1CJEA 2AQ3B 2RQQA 4JXJA 4OAYA 1M4VA 4GMQA 1N60A 3OYKA 1NENB 5EXSA 3Q8BA 2K22A 2VZKB 3KQ4A 2WS3B 2KZSA 5FLXS 4E4HA 5G5HA 3BC8A 4CISA 2DYMA 2BTEA 1NJFA 4S12A 1QT9A 2X4AA 1DGRM 5HNHA 4DJAA 1NNJA 2N9LA 3DA1A 4DBQA 2WLBA 2JX5A 3CJQB 4ZYAA 1HZ6A 2X1CA 2O5RA 2R4GA 1BUIC 2X8AA 4FD2A 4LIUA 4Y33A 3A45A 2DT7B 3KWVA 3V3XA 3HWSA 3FUVA 1ZE3D 3TWKA 4P5OA 4JI0M 2BNKA 3K70D 3FHNA 2DJIA 4DV4M 1QLBB 1IM2A 4AVZA 3IAS1 2I8DA 2R7XA 4YRVA 2Z8LA 1YN5A 1ZPSA 2WXMA 2K3PA 1K53A 3A1YA 2PVGC 1OFHA 4AG6A 4X65M 2K3UA 3O13A 1A70A 2GI9A 2HNHA 4HSTA 4F92B 4PCZA 1TY0A 1NY6A 3GRRA 1XO3A 1DGFA 2N0SB 4PJNA 1N61A 2HPMA 4N6EB 3VDXA 3AEFB 4BE2A 4Z8XA 2XZUA 1PYWD 1JQJC 2IGGA 3H9QA 2V1UA 4BGDA 1YN3A 1L1ZA 1BXTA 2AHMA 3E1SA 3SAWA 3W2VA 4YT0B 4LFAM 4LZZA 1E32A 2WXLA 3MJ5A 4PJJA 1MMNA 2XH9A 2XNAC 1C78A 3D5LA 3P63A 4LJ7A 1P7FA 2WXJA 1FEHA 3HC7A 4X62M 3RCOA 3LSKA 1K3XA 4G6ZA 1PFDA 5EE3A 2CJNA 2XFTA 3AE5B 3OYHA 2LH0A 1HEZE 5IWAM 2AQFA 2X1EA 4ZPXA 3BYYB 2DWNA 4XLFA 1YE9A 1FJGM 2V6ZM 2CE7A 3KSXA 3EGRA 3EUB2 3OTOM 1KFYB 2NTTA 3ZXSA 4DR4M 3FILA 3I57A 1YJJA 3B9PA 1EU4A 5G5GA 4E7JA 4JPSA 2R45A 4LF5M 1FFVA 3HU1A 4XWWA 3SC3A 4XLHA 4MT5A 5C3JB 2L09A 4XORA 1IN4A 2QILA 3J7AS 3H35A 2RNGA 5LMNM 4FCTA 1K3WA 3U6OA 4LF9M 4E7LA 1E94E 2DWMA 3L27A 4JI5M 4RMNA 4C56C 3Q69A 1L0XB 4YTNB 3HOTA 3J2PB 4I81A 3VYSB 4CQNA 4N4NB 2JQRB 2R18A 3SMSA 3EUAA 2Q5WD 5D3DA 4YHHM 2ZW1A 4RGMA 3I4VA 4BU2A 3L26A 5ITTA 4CH7A 2QSDA 4FWHA 2RDHA 2KACA 2Y21A 1LVKA 3IG8A 1J7CA 1PJIA 2BW2A 4DUYM 1QAOA 2JXTA 4IBIA 3SAUA 3K8ZA 3THGA 4OZBA 4HJGE 1Z5AA 1P7EA 4OW0A 1ENFA 2IGMA 4F52A 3L4PA 3VKGA 1XWIA 2PMZA 5D7GA 2KWDA 2BYTA 3CJRB 1WJEA 1JROA 3DLAA 5HNFA 3SASA 1MHXA 2CV1A 2HCBA 3B2GA 1R6RA 4PD2A 5JI2E 2Z4RA 2BJVA