2W82A

The structure of arda
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
163
structure length
163
Chain Sequence
DMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication inhibitor
molecule keywords ORF18
publication title Extensive DNA Mimicry by the Arda Anti-Restriction Protein and its Role in the Spread of Antibiotic Resistance.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 39
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07275 ArdA Antirestriction protein (ArdA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.560 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2w82A02
1.10.10.1190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w82A03
3.10.20.480 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w82A01
2W82A
chains in the Genus database with same CATH superfamily
3W5UB 5JI2E 2MH2A 2E6XA 2ERCA 3LNQA 2M3AA 2HVQA 2JRMA 2UU9M 4ANXA 3HIZA 2W54A 2LGXA 3WAMA 1TWGJ 3KSXA 1FTTA 3IG8A 3G73A 1Q02A 1MHXA 1T0FA 2LXCA 2WV1A 3T8MA 4AW4A 4RM2A 4RMNA 2Z2SB 2KRFA 4RMAA 2L9RA 1D3YA 4UDUC 3RQ4A 1MW7A 1HXYD 3DP7A 1V5OA 2LBCA 2R5YA 2DX5B 4FJZA 3FZVA 3TOAA 4FCWA 5B66C 2DA3A 3TW6A 4Q4ZF 2GNOA 1FXTB 1FEXA 1UFMA 3ZMZA 5F0FA 2EMSA 2DDBA 2M34A 2WU5B 4XLCA 1ITYA 5BO4B 3PV1A 2K39A 3ILKA 4QOZC 3KEQA 3SD5A 3VQIA 5DPWA 3JSVA 4PYZA 4YFNF 3HUGB 1FO4A 3LSPA 1BW5A 2LHDA 4OVVA 1VJKA 3KLOA 2LK2A 2CYYA 1LUJB 4DGWB 1EH8A 4EKUA 2IS1A 2YR2A 3I57A 1K3WA 2MLGA 2ZNYA 1V81A 4L15A 2VBYA 3FBNB 1D0YA 1B72B 4PJLA 2HZTA 4OWRB 3I56I 4Q2JA 3W0FA 3CD6I 5HLIA 3SBJA 2I7NA 2IA2A 2JA8J 2L5QA 4X1EA 2JNHA 2LBFB 1KJTA 2LR8A 4GXOA 2RKHA 3TEWA 4A5MA 1BBYA 2E1CA 2KDOA 2RDPA 2KDIA 4AIDA 3PRMB 1R4MI 1FWZA 2BW3B 5J3LA 1ZXIA 2E19A 3B9PA 4YEJA 1VQKI 2DT5A 1A6QA 4F92B 1ACCA 1MG4A 5HLHA 1O57A 3KIOA 2EKEC 1OYYA 4CISA 3HHHA 1YQBA 2DBBA 3F72A 2DENA 4PDKA 4KISA 5L3FA 2V6CA 3RKWA 4B43A 1DPRA 5FO5A 3R9XB 2KJBA 3I9V2 1FYKA 4PJJA 4QPQA 1KYWA 2ZMEA 3X2QH 4IBCA 3FDYA 4EATA 3W6VA 2KRCA 1HKTA 3WCQA 3Q0WA 1T5XD 2ZNZA 4XN3A 1Y39A 1TLHB 1YJWI 1NG6A 4WQMA 3JRBA 3BJAA 1ONVA 3ZTDA 3ZLZA 3CCEI 2XGNA 1UMQA 1K83J 4ZRIA 1IUYA 1GVNA 3CTWB 3AE4B 2KISA 2WV0A 5B1AH 5ITTA 5EXSA 2MCNB 2FCNA 4U7BA 2GB1A 1XF5L 1Q5WB 4CICA 1TL8A 1JB0F 1ZK8A 1R4MB 2L00B 3E9SA 3U60A 4BGDA 4M00A 3R2IA 1IO2A 3OYEA 3V60A 4HOBA 4WWMA 2XB5A 3RIRA 2OO9A 3KYDB 2M8SA 3HTUA 2D11A 2MD5A 3FKEA 2EZHA 1C0WA 3QWZB 2QBYA 5J1UA 3C3DA 4FISA 2K9NA 4CO7A 2E2JJ 3DWMA 1P3QU 2MBBB 1C7YA 2FCQA 2E1OA 1G41A 1L6UA 3M95A 2ZANA 2VBWA 2WXIA 4TUUA 2QZ8A 3V7SA 4KX6B 2BBCA 4I6PA 2YLMA 1WMHA 2VJ5A 3EQLF 2XFSA 1JXSA 4CHUA 2VKVA 3HOSA 2IO1B 5FFXA 3GOEA 2G5GX 4IQJA 2GLOA 1TKYA 4G9YA 4DV6M 1H9GA 2XASA 4R71A 3I59B 3ZP5A 2XIGA 1OGWA 5F6FA 2BW2A 4KDIC 4HJKA 5CPRB 4NQWA 2F5NA 5LMUM 1KLUD 4XWWA 2VOPA 4OINF 3CC7I 2X1CA 3FYDA 4M8NA 4DW6A 2KD0A 3BPVA 3I53A 1UZXB 3S16J 1YJ9I 1VZ0A 2VQHA 1DO2A 2Q2EB 1WM3A 3NZSA 2IT0A 1LEAA 1R4GA 4AYBA 3CCUI 4FVMA 4XM3A 2DLLA 5EZGA 5JHBA 5J4VA 5B1BH 3FISA 2MW5A 2W84A 2A6EF 3RNEC 3OIPA 3LSRA 5IAAC 2DBYA 3DBSA 4E7HA 1DOXA 3KSJA 4OOIA 2QA4I 1X3WB 3SFDB 2E5LM 2CFXA 1VCBA 1WJCA 3C8YA 4ZHPA 2V9VA 1LFDA 4CJ6A 2XB0X 2BT6A 4LJ5A 2RC4A 4LK0F 1ZHFA 2EQRA 3VK8A 4LJAA 3BYYB 1YYVA 2PJPA 1LNWA 2TRTA 3CJRB 1K51A 1P4WA 1HQYE 3DQVC 3WANA 3RYPA 2UV1A 1ZUD2 3ZYYX 2D10A 2DZIA 2REXA 3KW6A 1ZH5A 1WRDB 3KYCB 3QP6A 3QAHA 2BJVA 1BIAA 2RDHA 2JZPA 4EJVA 2OTLI 1T56A 5BYSA 4I7HA 5C1ZA 3K7AJ 2R4EA 3N1XC 1WJBA 1UELB 4IRIA 5LXHA 3TMPB 4BVUC 4A3EJ 1FD6A 4KMFA 4BHPA 2C7HA 3I4PA 3ML9A 1ETKA 5D6EA 3VAWA 4BUPA 2V26A 4BKGA 5JHUA 2LVSA 2HU9A 5HG2A 3RFWA 3ZCOA 1A70A 1G71A 1AIPC 1R7SA 4LJ7A 2LLKA 4U88A 1Y1VJ 4IKFA 2MROB 4I4LA 2ZVNA 4RAGA 5CQEA 2DYOA 2LNBA 2MWSB 1VQLI 2ONQA 3UR3C 1CQTA 1HT2E 3KFWX 3AAFA 3BG6A 2RDBC 2L7RA 2BQQA 5DYGA 1TQIA 2OPFA 1S6LA 3B6CA 4A3IJ 1ZLKA 1XB2B 4RKUF 3CF2A 2CU1A 3BTJA 2VPLA 1MNEA 3SZPA 1SANA 2R7TA 1YW9A 3D5RC 4LG0B 2WB1N 4LGYA 3VYTB 2JY6B 3VTWA 1GXPA 3A4RA 4WWCA 4LRSA 4RBOA 1ZP0B 4NAWA 3GZ6A 3FBIB 3DWGC 1H88C 4WAAA 1C3TA 4IKGA 3BCBA 4JX6A 3KLSX 1C76A 1ZG1A 2LZ6A 2KW0A 2VE9A 2KWVB 3KS8A 3VTUA 4ESBA 4C7YA 1BN5A 3I04M 1J9IA 5E20A 2B76B 1UF0A 4OW0A 3M1EA 2E2HJ 1GABA 2LRWA 1D1BA 2P7VB 1HC8A 2QSHX 3FF5A 2MLBA 2CW8A 3E7LA 4LJ8A 3K0LA 2CS4A 3U61A 4DBQA 3OAWA 2GOWA 4GXBA 4ZC3A 1HT1E 1G2HA 3L27A 2N7EA 1X1MA 3ECHA 2INPE 2KJ6A 4ZHOA 1B9NA 3I71A 3HOXJ 2CUFA 2HDEA 1TTNA 1TH3A 2O7OA 5JXVA 1H89C 1IXRC 2PJHA 3DCGA 4B3SM 1IY0A 4B08A 3G4SI 3CSFA 3GLGB 1NYQA 1FNVA 2DA1A 1MFWA 3HOTA 3DHGC 2VONA 1FT9A 4AUXA 1SD4A 2ZNVC 3SMSA 3HHYA 4CZZA 3SATA 1C4AA 4U0WA 2UUCM 5EDSA 1PJQA 4K2EA 4ANVA 4GKKM 3GFMA 4L0ZB 3AE2B 3CDLA 1LFUP 3LSKA 2XPUA 3O8HA 4UVAA 1WF9A 2DZOB 3VXWA 2VJJA 4PGHA 2NYXA 4GDKA 2KZGA 4B7FA 1IRGA 3CUOA 3GTOJ 2R93J 3HC7A 5IYCJ 2P5VA 3WALA 4IBBA 3HHGA 3AN1A 4FE7A 4WXHA 3H7PB 2R0IA 1F9JA 1P9DU 4X62M 2K4BA 1GDTA 1Y0NA 3VSLA 3VRAB 4XL9A 2V4IB 5IYDJ 3M8FA 3IH4A 3PT2B 2BTEA 3ZPLA 3CMAI 4YSZB 5EP4A 2JPHA 2K8BA 5JZEB 2R7FA 4MTEA 5GPCA 1LXDA 1QGPA 4XK4A 1VI0A 1BOBA 3IBEA 1QPMA 2KLOA 3GP7A 1BA5A 2M30A 3A4SC 1BJAA 3CDHA 3OR2C 4BHCA 3KH0A 3AOEA 1N34M 4KODA 1ERDA 2F2EA 3A01B 4KVGB 3TGNA 2FCSA 1X1PA 3RNAC 3N20C 3R0AA 3ROUA 2XF5A 2CH0A 2XSJC 1E90A 4G8XA 1N6ZA 3WGIA 3CDIA 4A3CJ 4EIWA 1RM6C 1GAQB 1ZG3A 1T39A 1KU2A 1EO6A 1NHWC 3U9GA 1VQ8I 2AXLA 1GL7A 3U1DA 5ILVA 1SFEA 1QHGA 2Y5PA 4FJYA 4IJAA 2D07B 1JKQC 5ICGA 4I6NB 2M0MA 1Z3XA 2DMNA 1WWXA 1IN4A 4DV7M 3OYBA 3U6SA 1E3PA 2J7QB 1WI3A 1FYMA 1XT9B 3J7ZI 1HW1A 2R5ZA 1WJUA 2M19A 4GIPA 2WZJA 1E8XA 2VBXA 1ET6A 4JX4A 2QJLA 4II3B 3O8GA 3HG9A 4F52A 4XK8F 1R23A 2QCUA 1YN5A 5KAFC 1K53A 3RI4A 3OTOM 4BQOA 1B8IB 3ONSA 2PX9A 2WA0A 3U6DA 4AOFA 5FKAC 3A9KB 1OCZH 3SZGA 1YUBA 1T38A 4DZJA 1W1WE 3EECA 2ICWG 2VZKD 4WXDA 1QOAA 3ETRA 2N7JA 1GHCA 3IAM1 4L2YA 2CV0A 1R6RA 3WG9A 4LF7M 3DCFA 3GPXA 1V8CA 3RQIA 2GQQA 2XDVA 1NK2P 1HTOA 4BS9A 2L4FA 1DUXC 2ZPNA 2KQSA 1Z5SB 1XXHE 1T2KA 1WH7A 3K92A 3MD2A 3VUWA 1IXSB 4DYQA 3CJTB 1E3OC 2Z59B 2N7DA 4M71A 2XRNA 3AJIB 1V80A 3DKXA 3E4RA 4KKIA 3KEYA 3JAMZ 2OZ6A 3GLHE 3V6CB 4C80A 3ZQLA 4I8OA 4ANWA 2YPRA 4W9DA 4BKTA 1DGRM 3GLLA 1E32A 3ZIMA 3ZN1A 4HK2A 1HBXG 2CRGA 4AZFA 5HDNA 5ILUA 1VR9A 4ARIA 4XGAB 2N9EB 4NJ7A 4AG5A 4XNFA 2JT4B 5D6JB 2PMZN 1UAAA 1DGHA 2MSYA 4M0WB 1AKHA 2BVCA 2Z4SA 4WJOA 1D4BA 2IS2A 4FT8A 3L2CA 2PG4A 2K9LA 3UIOB 3IFWB 4Y13A 1K52A 2PPHA 5HVQC 1U4AA 1JUSA 3BROA 3NZUA 3Q2AC 5DM7F 2OJWA 1V1PA 4AWJA 2G3QA 3HVZA 5LRSA 4ITQA 4MT5A 3ZQHA 4RLFA 4KITB 4Y33A 1OKRA 2WXQA 1WGRA 2EV6A 4JL9A 3ABTA 2E1MB 2KEBA 3UGBB 3KP1E 3CCQI 1YMHE 2KRHA 5F04A 1UBIA 2W1OA 1MD0A 4Y52J 5GP9A 1Q39A 2MABA 2XRLA 2I7PA 3S93A 2HE7A 5EZHA 4RGTA 1UBQA 3DPUA 2OC6A 3KUZA 2XGXA 1B9RA 3N1YC 4IJEA 1IY1A 1OCRH 4G4NA 3G1MA 3S3NA 4FXCA 4L0YB 3AEFB 4BE2A 3ELKA 2V6ZM 2M4NA 4C30A 2R18A 4RAFA 3MFKA 3LVWA 1TW3A 1IV6A 3ZQ7A 3A2KA 1L3LA 3MHSD 3D5LA 2L0TA 3GZNI 4IRHA 1W7PB 5DCNA 2KRUA 1V6EA 2I2YA 3GRYA 3F8CA 2QGUA 1R1VA 3VSKA 3AMZA 3ECIA 4M74A 1R5ID 4BLCA 3HHMA 4YFXF 4GGQA 4AJYB 1R58A 1PM5A 4GN1A 2UXBM 3MKZA 2UU7A 1YQ4B 4HRSA 5D5UB 3MEXA 4BQQA 4Z6YA 2JUGA 1PP8F 5KK1A 3RGPA 3HB9A 5FB2A 1ZXHA 1PQSA 3K2ZA 4O5VA 1L1ZA 1W36C 1N62A 3N3KB 1Q3BA 2E7XA 2HS5A 2LXAA 2HR3A 3WE2A 2RV8A 5GTHC 4Q47A 1YX3A 3VDPA 3OR1C 3ZNZB 1TNTA 2O03A 3LDZE 2WWZA 2V1XA 3SASA 2HQRA 2D3AA 3MMPA 4BBRJ 4XMYA 4OVZB 4ZYNA 2HTHA 1FOWA 2FJ1A 3I9V1 1CJEA 3KQ4A 1YNTE 1HSTA 3RNBC 3GB1A 2E1NA 2KP6A 3GZNB 2BJWA 1ACIA 3K70C 3U7ZA 5C44J 2LFBA 3U6QA 1TNSA 1PJJA 1TDHA 3OYIA 2DO7A 4B0MA 1REPC 4G7HF 4XLEA 2GAUA 2EIKH 2VKDA 2NR2A 2KT0A 3BR3A 4ARCA 1SE4A 3QIJA 3F9KA 3FRIA 1X19A 3OIQA 4A6QA 3I55I 1HNZM 3F21A 3EDPA 2EA2A 2EFPA 1SGHA 2D3GA 2AEHA 5ITQA 3I4MJ 3PUBA 1GPXA 1GVJA 1OFFA 3FK7A 3IH2A 2JRIB 4BXFA 2EV0A 2BOLA 1GJZA 5AEKB 4XQFA 1K79A 2N35A 1F5TA 3ABUA 4UB6C 5ITUA 3CWIA 1S3SA 1TZOA 2M1MA 2UUZA 4NNJA 2MC4A 4RH6A 2OQ4A 1KZHA 3SC3A 4Q48A 1RKTA 2EPFA 4GMQA 3B2FA 2ZEQA 3ALBA 4C4VB 2AL6A 1SIJA 1TWFJ 4D2KA 2O6GE 4G3XB 1SXJC 1V97A 2DWZB 3CCVI 2MA9B 2G0EA 4KGRA 3PZ7A 3H3UA 2APLA 3FRHA 2KX3A 4DV4M 4RF1A 1ZGUB 2DXIA 1S29A 2E60A 5AIQA 1Q1OA 2QIEB 3PLVA 2HOEA 2MJDA 3HOUJ 2DZKA 2F5QA 1WXQA 2RDGA 4YTMB 2N9PC 2L54A 3TSSA 3KYLA 3LSHA 1ZRCA 3RULA 1FP2A 3KP7A 4L8RC 1UUPA 5HNFA 1D1CA 5FRMA 1D5XC 3MJ5A 2NS0A 4CSWA 4LIVA 2EINH 1ZG5A 2WC2A 3VYUB 5T8IA 1FMWA 3CCYA 4MSMB 4A20A 1F43A 2LJIA 4M3DA 2PMUA 1GC7A 5E18F 1WI0A 2QQBA 5K5RA 2L7FP 1W4MA 4JQFA 3QOPA 1MVKA 2WSFF 3KOWE 4B3RM 1X4PA 1BI2A 1E8YA 2EMTA 1LKXA 3JSVB 1VQ5I 2UUBM 1WVRA 2DJIA 3PZ8A 2IJLA 1KYZA 1OFCX 5AONA 1MZBA 4XR6A 4PFOA 5D7GA 3AEBB 3DWLE 5TR5A 1KQ8A 3FUTA 1HNXM 1XEEA 2CHQA 4WP2A 4Y17A 5JI6A 3HBLA 4JI2M 3GPPA 4XLNF 3R60A 4NBQA 1I5ZA 3WHCA 2KIMA 2EJRA 1G8XA 3HGYA 4JWUC 2JJ7A 4XLPF 3H5AA 2BZTA 3HXLA 4I09A 2PIAA 3QAQA 2DA4A 1RESA 1X2MA 1FFVA 4MFDA 1JALA 1PJSA 4XLFA 3RCZA 3VPRA 1S8NA 1HDDC 3WGGA 1JKRC 2O01F 4IHXA 3F8NA 1TZ1A 4X66M 3MK6A 1WQ2A 2KJRA 3KP5A 1ET9A 2W25A 3NUHB 3HUGA 5KCMA 2LD9A 4ASWC 1P7IA 2LNHC 1RLFA 4QHSA 1NTCA 3ONQA 1WR6E 5J1YA 1IUFA 3OYNA 3VDZA 3AE1B 3L2WA 2M8EA 3A0HC 1DGFA 1FFUA 3GPYA 1XNRM 3MN2A 4GGGA 1B72A 1WIVA 1N63A 1IN7A 2W82A 2E2IJ 3T15A 1YHQI 2MFZA 3EUKL 4MO7A 3L13A 3S8PA 3OYMA 4UHTA 1HNWM 2LBFA 1XXHA 2RGFA 5HDGA 5HLGA 1FOYA 1N32M 2UUAM 1E17A 3IXSA 4HPLB 5JI3E 2LH0A 2X6XA 2O25A 3R61A 5FD5A 2BW3A 5JLWA 1FIAA 1A35A 3S2AA 4IL6C 1HW5A 1R1UA 3GLHA 4KIFA 4NQLB 3RMKC 2EUCA 1D0ZA 4NRVA 1I1GA 1SF0A 2GBKA 3QQAA 2C5RA 2YSRA 4LD5A 2CP8A 1YJ1A 2QBYB 5L3BA 2RGOA 1F1HA 2RGVA 4A3BJ 1SMTA 4DQOC 1DGWY 1NV8A 2DWMA 4LJ9A 1NI2A 1H8CA 4AKGA 2DAKA 1E2XA 5I4DA 2J52A 4BQNA 1D0LA 3O6BB 4HV6A 3WU1B 2GBNA 2L2OA 4W9EA 4G4QA 2K9MA 3DLLF 1BT0A 3K70D 4KLNA 3M63B 4AI6A 2D1VA 2EBIA 3DPDA 1OTRB 1D0XA 2JY5A 1MGTA 2X6OA 3HIFA 3W9CB 3WTTC 2Z8YM 4S04A 2X8AA 3K9OB 5M5XJ 3MWMA 2LHEA 2R7VA 1R49A 2MD0A 3GTPJ 3Q8EA 1J75A 2LY2A 4HNVA 3W1YA 3FYCA 2WADA 2WY7Q 2EKIA 2R7WA 1QKZA 4J00A 1IPGA 2BEOA 2L02A 1E7PB 1EKEA 1C1KA 4ZYEA 1PGBA 3L08A 1EWYC 3RPUA 4HW0A 3CP8A 5KNLA 2VDBB 2FBIA 2ETHA 2OCCH 1CQVA 1DGGA 1K61A 2H89B 2L05A 2MLKA 5LNK1 3JW4A 4L18B 1B9MA 3GFIA 2L7HA 4KDPA 2GBJA 4US9A 3QPTA 3GWZA 1AYFA 4FWGA 1ZGAA 4CIZA 1P7EA 2I1JA 2IO0B 4ZYSA 1UGMA 3BXWA 1XHBA 4ANJA 3OSFA 1YW7A 4PCQA 3K2AA 3T0YA 3I59A 4IUMB 2W48A 4QHTA 4XX5A 1ZW7A 3BOQA 4U0YA 2WDVB 1R5HA 1U3EM 2AQEA 4IM0A 3ZQ4A 4CYCA 3GEZA 4MACA 1FIQA 3HGGA 5FKOA 4LJZF 4F7ZA 5F0CA 2O6VB 1I42A 2LEKA 4NOOB 3FTFA 3RFZB 1J5EM 4QNMA 4LF9M 1YX6B 1C79A 1T0RC 3V61A 5FR3A 4RGUA 2UWMA 2Q2EA 4HL4A 2Q5WD 2XF3A 3LQRA 5IOYA 5D8KB 3GLXA 2OJED 5FTLA 1IFYA 1TIFA 4GHLA 2FFJA 4G11A 2RVCA 2HHHM 3KP6A 1CUKA 2YR0A 3A98B 2JZYA 3C2GA 1ZREA 2ZW0A 4WWNA 4DBGB 4HCPB 2FUG2 1ISNA 2DT6A 1G8PA 2C60A 4HX4A 4NXMM 3HRUA 2DWLA 3G1LA 5LLIA 3JW0X 3VTVA 4G6DA 2GLSA 3BP8A 1IW7F 1XSXA 4N9F4 3REOA 1QO0D 3ZRCA 4IRGA 1ETQA 2BWFA 3IUOA 4FQGA 4MTDA 4QLCU 4DYRA 1Z5AA 2KT7A 1PFDA 4R7GA 1NDDA 1OEYA 3E46A 5E3MA 2EO2A 2Y2ZA 1F2RC 2Z3XA 2OUMA 1LJ9A 2ZAMA 4OX9M 3FIWA 1MHHE 3SZTA 1T43A 3LXFA 1UELA 3BZ6A 2BF8B 3NRZA 4YL8A 2DZJA 3W6JB 1EWCA 2F5PA 1RR8C 1TBXA 3L7WA 4P7IA 1BR1A 3QCAA 3L26A 4GB9A 1YW8A 1NY5A 1Z7UA 1VDLA 4D7NA 1V4RA 1ZRDA 4LITA 4OMZA 1EUVB 1WH3A 1P6RA 4XICA 4XN0A 1EM7A 2M0XA 2MH7A 2V9KA 1UCRA 3JAMK 3NEUA 3QQ8B 1OFIA 3K4MA 4NUBA 2KL4A 1ZMUA 4JYKA 5KVRA 2GOXB 1M4VA 2HZDA 5E8IA 2R44A 3L2AA 2VQGA 2UXDM 3K4JA 2HYJA 5K1YA 4DDID 2NS7A 2RN7A 5JHAA 3KP2A 2KTFA 2KN4A 2DZNB 5TRDA 3MKLA 4RGSA 2N8GA 3SMPA 5G5GA 1MMGA 4HX8A 2DDAA 1FRDA 4J6IA 1PJTA 3U4EG 2B0LA 3Q5FA 5DUKA 4RCOA 1SE3A 4LG0A 1L4ZB 3BG3A 2MHJA 2KMAA 2HEOA 5BS6A 2JY6A 4Y7NJ 4A55A 1B59A 1Z67A 5JVGF 2FEZA 3K1MA 3KVFB 3Q3FA 2EB7A 4B4CA 1FYLA 3N32A 3E5QA 4I01A 3AEAB 2ZSHB 1WX8A 4ITVA 1KOTA 2BY3A 2V3PA 2ISYA 3OYGA 2XNAC 5LMNM 2DFEA 3IT6B 5KPTA 1APLC 2Y20A 1Z77A 5EE0A 3MKWB 4LB5A 2LF7A 3TOBA 2L83A 4GDKB 4CXFA 2MYSA 1JWAD 4AIKA 1GUAB 2EILH 3UNGC 3TJPA 3DU6A 2MBQA 4JXJA 5DCMB 4ZYGA 1DGJA 3GO8A 3SAUA 1Z05A 4IBGA 1G3YA 3TEXA 2HL7A 4DJAA 1GT0C 2X49A 5EEGA 1KSFX 3N9YC 3E5XA 4NB5A 3SDGA 1MMSA 3CIRB 1NY6A 2VZKB 4PK4A 2PJRB 3CQZJ 2A69F 2DU9A 5LEJA 5DYIA 2KFDA 5K5QA 2KJHB 3GLGA 1SE2A 2VJIA 4DR2M 5AUIA 4GMVA 1TGUA 2H27A 3L25A 3ZR8X 4P9UA 3U2SC 3IT4B 4EGZA 2LVOC 2KRKA 4RM3A 4A0XA 2JP7A 4Z2YA 1HZ5A 1BM9A 3I64A 3HU1A 5IY5H 3T5XA 4UNOA 4EOYA 1Z1DA 4HEOA 3TDUC 2K0BX 1UG2A 2M45A 2KACA 1PDXA 5ITYA 2WXOA 5FSWA 4BY1J 1D2NA 4PZJA 1LE8A 2GBMA 2FIDA 3FKYA 2FH0A 1XTAA 4HKZE 2MG4A 4CCJA 2DHZA 2X1DA 4M3FA 2P5KA 4MEMA 4ZTFA 1OQYA 2R7RA 2LUMA 1L0YB 1SVMA 3TQSA 3ZMTA 2D1HA 3HHWA 5A2QS 1IRXA 3E3VA 3DKWA 1G4DA 4EJTA 5AZFA 1T0YA 1MMDA 2ZCBA 2YU9J 3S1MJ 4FETA 2BY0A 2EFOA 4YELA 4XRSG 4L6V6 4LNNA 4RB2C 4RLQA 4A0YA 4Y3OA 2JZ3B 3M1CA 1YI2I 2GIZA 2XVCA 4OZAA 1MBJA 2UXNA 1L0OC 2XZFA 1IBXB 4L1BA 1QU3A 3LA7A 1Y8QB 2HQ5A 3A01A 4NL4H 3JR5A 5IO9A 3K4NA 3K8ZA 4HROA 3LAPA 3IKTA 4HZFA 3R4KA 1ETVA 2KK8A 3QJZA 5IT9Z 1GKIA 2TCTA 1RKWA 2P6SA 1F36A 1I3AA 3JRAA 4DZPA 1A6IA 1V5EA 1VTNC 2DMQA 2F5OA 3DXJF 1SVLA 2BBYA 3CZ6A 5IN7A 2R7DA 2ZNVB 2DPUA 5BMZA 4FBJB 4D0PA 4HJGE 3HJSA 2BXZA 4NC6A 1UHWA 2Y75A 4LGMA 2DOFA 2KAJA 4DV5M 3VH3B 2C7MB 4K0KM 3BIID 2J5YA 5EP2A 3GE3C 3VHTC 2ZKZA 3ZN0A 4II3A 1HW2A 2Z5UA 2Z0EB 2XFTA 3BR1A 2IO2B 3BTLA 2Y48A 2RMMA 3W2DA 3DA1A 3FM3A 1FPYA 2AL3A 3I4NJ 3VVWB 2XF7A 3IAS2 3IVFA 5HS8A 1B8IA 3H4JA 3AG4H 3W2VA 1ZE3D 2JQRB 3OG5A 3TEDA 3L9FA 1IC8A 4HNUA 1B1ZA 4TUWA 3GYHX 3UKGA 4PK1A 2K9QA 3MAJA 4JOMA 3HRSA 1OAOC 1AKHB 3FK6A 1ZARA 4G6ZA 3RJPA 3KCCA 4W5WA 1LTMA 4PSXA 1R2YA 1OR7A 1X3UA 3U2RA 4EJWA 1Z59A 3NVWA 2N9KA 5IT9S 3OWTA 2M56B 2H94A 4A3VB 3VDUA 5JVTA 4N0BA 1WE6A 1IXSA 4TV7A 1SFOJ 3EYIA 2FOIC 4QPOA 3P4SB 2FS1A 3MZ8A 2J5PA 1LO5D 2LVQA 4G50A 2K0PA 3DV8A 4FW9A 3M7GA 1FPQA 2Z7JA 4EJUA 3Q3MC 3MVPA 5DCFA 4REZA 4PD2A 5FTNA 1MJAA 3O2PE 2CJOA 3BR5A 3HM6X 4KV2A 4DXAB 3GTKJ 4G7ZF 5BMIA 1JRUA 1HTQA 1MBKA 3MJWA 5GAGJ 2C9OA 2VC0A 5D5WB 1FIPA 2JA2A 1L0XB 3CCSI 2E5NA 4M0WA 1VFCA 3EUHC 4PJMA 3HKZN 3TKYA 2WNMA 1FNNA 2VXDA 2LVPA 3K4CA 4A3GJ 2HGCA 5FLXK 1BC8C 1D5MC 4KZ0A 1S5LC 3H5NA 1EU4A 3OV8A 3L54A 2ZAOA 4IOCF 4ACFA 3WHLA 4P9FA 1ZGJA 5FFZA 3DBLI 3K4BA 3TP3A 3H9QA 3RKQA 4P96A 2QCOA 3UJNA 2V1YA 4QNRA 3X0WA 4R79A 3QPHA 2V3SA 2VQCA 2ACJA 2B9SA 1JHHA 2QVOA 1BI3A 1S7EA 5DM6F 1P2FA 4B0EA 3P9KA 4KN4X 4ANRA 3E6BA 4JWSC 1JMLA 4A5NA 2ZW1A 1D5ZC 2E5ZA 2Z9OA 4GSWA 2M4GA 4GDFA 4D82A 4UUTA 2XEWA 2Z8LA 4E71A 5CVJA 4M3BA 1LB2A 3WHBA 4BKSA 1DP3A 1A36A 3RYTA 1OCPA 1F1ZA 1XCTL 2W55A 4L5EA 3ZRFA 3TUOA 3VYRB 2MBHA 4ASNA 2DYSH 2G1EA 2K9SA 2ZCWA 1YD8U 3RPQA 4AKHA 1XMKA 1NO1A 1W7PA 2LVQD 1MNMC 3J81Z 1ZGWA 5TGTA 2K5CA 3QP5A 3KOXE 2DJNA 5DS9A 4FADA 4BHBA 1V2YA 4E7SA 2AHQA 4L5JA 3DPTA 2F5EA 4LF6M 5J8FA 2X1EA 4BFRA 2W24A 5FLVA 2FXAA 1YS7A 1E6EB 3AH7A 4DV3M 3VFZA 1Z2MA 3BVZA 4I99C 1Z7LA 1YQ3B 3WGHA 3CLQA 4OAYA 4NDLA 1PGXA 4HXDA 3ECOA 1ZR4A 5EDNA 2QM3A 4NC8A 4IG7B 3ZTCA 2WDQB 1KH0A 3H92A 2G7UA 2Y0SN 1QQWA 1SG9A 4RGMA 4XZ4A 3S2HJ 1ZDXA 2C98A 2ZTDA 4MJSA 3I63C 3BINA 2DTRA 3RNCC 3M3JA 3ZMUA 3HU3A 5EEAA 2KDFB 2LVAA 4OVZA 3ERED 4M9SA 2WB1A 1D3ZA 3K1PA 1KF6B 4A3FJ 1Z5CA 4A12A 2M7BA 2ID6A 4PJNA 4XYCA 4A9AA 4M9ZA 2FRHA 3OYDA 1SIFA 3F8BA 3GRVA 4WW0A 1NI3A 4MGKE 4E70A 4LG3A 1IXCA 3KUDB 4B3MM 3HTSB 2HDCA 2BV6A 2D5GA 3HOZJ 3MTNB 1JKOC 3BJ6A 2GXAA 3OWEB 3U6LA 5IP4D 4E7ZA 3RNFC 1JWSD 4YTPB 3L2RA 3RCOA 4GH9A 1S1QB 1NENB 1YX5A 3FILB 3PSFA 5B5EC 4KIKB 3NHEB 2I10A 4S0HB 1TBEA 3VUXA 5KHOA 3HOYJ 5F64A 1VG5A 5KHQA 2ZZPB 3K9TA 2OJRA 5ITXE 4A69C 3QA8A 2BWES 5HKHA 2V4LA 3B02A 2AXTC 1SD5A 2KZUA 2HDWA 1W7PD 4IPAA 3T1BA 1OISA 2FD5A 4FLHA 2M2EA 4PT5A 3PFIA 3FUWA 1JGSA 2EA0A 2DWQA 1I4WA 4LIUA 1UHMA 4XKVA 2FOKA 2BWBA 1U6GA 2M5WA 1OQRA 3JVZX 1TP4A 2CHWA 2HQAA 3FKIJ 5EE3A 3JTGA 3O13A 1SE9A 1RR7A 3W1SA 1EFUB 1DPUA 2A6TA 4U87A 3DDCB 2YQZA 3COAC 2ELKA 5J4YA 2V4JC 4OU0A 1WZ0A 3J7BA 5CHVC 2FNJB 1RU3A 3SEZA 5IREB 2KNBA 3QYFA 1RWSA 2K9DA 1SJED 3HGIA 2BKRB 3NWSA 2NCNA 1TT0A 5FD6A 3DEUA 2L52A 2CWBA 4IX7A 2KDMA 5AZHA 1P98A 4HG2A 3KP0E 3L09A 3VH4B 3WTZA 2KLCA 3BG5A 1K6OA 1ZPSA 3BG7A 4BZAA 3VOEA 1HDPA 1MU5A 3C58A 4HA8A 3CF6E 5EF6A 3LCVB 1T0QC 4MHGA 1N77A 1SVOA 4AWXB 2MP2A 4BBAA 3BCAA 2EWNA 2D45A 3S2DJ 2B63J 3JTHA 2MSED 3R3MA 1WYWB 9ANTA 3T6PA 4KA4A 2KIFA 4HNTA 2O5RA 3OYFA 2EIMH 1IGDA 1N61A 2OTJI 2F4OB 4ITKA 2VB6A 1WIAA 3CF5F 3CLOA 2V3NA 2G4DB 3KPHA 1ENHA 3UMMA 2AYOB 1ESFA 5E6OA 3TEZA 2EZLA 5G55A 3S1QJ 3C0RB 4UV8A 1YN4A 3OJ4B 4YFKF 3SYLA 4ESJA 1XXHB 1BUIC 4LZJA 1QVRA 2CU7A 3FMQA 4BJTA 3ERMA 2LF8A 3W68A 5IKCM 5D3IB 1SXJB 2JZ1A 4DR1M 3CTAA 1S3JA 2ZBKA 5J47A 3DEEA 2YUSA 3GLHB 2H88B 2CQNA 2WXLA 3OS0A 3PLUA 2QILA 2HNHA 1GV2A 1N33M 5EXPA 4S17A 1KM7A 2BGCA 1CGPA 3BDDA 1VQ1A 4JI4M 2GI9A 2EFQA 2LY1A 3T1YM 2KXEA 1HZ6A 2ID3A 2HQNA 2J0MA 5HNHA 1U8BA 3HRTA 1C77A 1IN6A 3OOUA 1NEKB 3B73A 1FP1D 2DMPA 3DVGX 3OYKA 1AWDA 4GYIA 2DMTA 5L95C 4LCBA 2DHRA 1AW7A 2R7OA 3GQ3A 1FLIA 1I39A 3ZCBB 1VQ6I 1KU9A 4GRIA 2OOBB 4XLAA 2QHOA 2WAQN 2KTRB 3V76A 1FOKA 4HLEA 2M5ZA 4BOZB 1GL6A 4HLQA 4C3HJ 3GLIE 2IO3B 4FCYA 5HS7A 3RSNA 2CHZA 3GUDA 1J0RA 2HFHA 1VQMI 1JI8A 1XCVA 4NXNM 5AZGA 2WYQA 3SEBA 2LKPA 2BY2A 5F1JA 3MP9A 2KC2A 2UZKA 1IQPA 3HUIA 2X51A 1ZQ3P 5JFRA 1XSVA 4MLOA 3CO6C 1DYQA 2D3BA 3K2LA 2JZZA 3M8JA 3AE9B 4FX4A 1QVTA 1I94M 5E6JA 2FMYA 2F5SA 1FRRA 4JI1M 4A8XC 1J7BA 4JLCA 3J9CA 1T8IA 4Y15A 1H0MA 1R22A 2ZFWA 1ZKHA 3B6AA 3WG7H 2CEAA 4KJZA 2PMZA 5LHGA 1YRNA 2DK5A 4II7A 1YTYA 4PFPA 2ESNA 1VF9A 4US8A 4LFAM 3KE2A 1NVMA 2WXNA 3IHPC 4G3OA 2WXMA 1WJNA 1WHUA 2IY0B 2JY7A 2WS3B 1OTRA 1OEYJ 4OHJA 4D5FA 3SR6A 3ZMSA 1MBFA 4CZCA 3K9OA 3FUXA 2M1BA 3LJ3A 4P6VF 4CYCB 5E8GA 3JRFA 1UH6A 1ETWA 1UM8A 5EGOB 4S05A 2AQ2B 3GF2A 4HDQA 3QRFF 2BPSA 4IWQA 1JUPA 4XDDA 2OV7A 2QF7A 2NXNB 3TEYA 3F6VA 4K7UA 3WTUC 2R4GA 1DO0A 2L2DA 4GHAA 3KUCB 4BB9A 2BYVE 3E6MA 2VQLA 3IG3A 4J3OD 4DIQA 4IBEA 3V62A 3Q3SA 4B3XA 4B09A 3O3KA 2KDBA 1V92A 1TS4A 2UWQA 3L2VA 1P1AA 1WXAA 5LRRA 1UJ8A 1WJ4A 5J8CA 5BMGA 5ICFA 5GPAA 4HCNB 3AV0A 1VQ9I 1HLVA 5IZ7D 2K8HA 3BTIA 3J80K 3HPHA 2CQKA 1VQNI 2IJ0A 2LGIA 3ZQGA 2HKOA 4D7MA 4WWOA 1ZN2A 2VQFM 2AQ1B 1XB4A 2KMUA 4BE1A 3U6OA 3PL8A 2MBOA 4MEXF 4OVUA 3TP0A 3TW7A 2L32A 4FCTA 2O6VA 3B7ZA 1G6NA 1BR2A 2C99A 4XKCA 1T98A 1ZAEA 2M87A 2DA5A 2MGQA 2X6YA 4BBNF 2RRUA 2GXGA 2NTSA 4HYEA 1D0MA 1OKSA 2O9LA 2OZUA 1F52A 5D4SA 4RAZA 3U52E 1Q1HA 3ZMVA 4QSHA 4AG6A 1TKGA 3ASNH 5BPDA 3ZC7B 4I98B 4DBGA 3JSOA 2UXXA 1K82A 1V1OA 1Z0XA 1NVID 4ZJZA 3V7RA 1RETA 2XZUA 3ZKJC 2INCC 3J2PB 2P7CB 2I1KA 4LGWA 4W9CA 4WF2A 3PS6A 3FTDA 1KU3A 1XS9A 4XLHA 4PS8A 4ZZDA 3ZQJA 1EE8A 4O3MA 3TE6A 1E8ZA 1HCRA 4XKBA 2YX4A 3A9JB 2G9HD 3UI3A 2JU6X 2KHWB 2B7EA 3F8FA 4CQNA 1WFXA 3NBIA 3PSIA 1X58A 1STZA 2J53A 1JHFA 3WU0A 1TTYA 1WGLA 1XNQM 3I3TB 3CCMI 4LFBM 3URYA 2VRRB 4R8HA 3PIPF 3IAS1 3AI5A 3U6EA 5E3OA 2YX7A 2VKHA 3LVVA 2OQRA 1C78A 1U5TC 1YOVB 2BKFA 1J8CA 3HU2A 5HI1A 1MX0A 3M07A 5DPTA 2LC2A 3DU5A 5CVIA 3FE3A 4JI7M 4W9JA 2V1DA 3VKGA 3TO9A 4XOPA 1WCMJ 4JBAA 4LCDE 3APDA 2JMWA 4JGHB 5KPZA 2Y5CA 4S12A 2LH9A 4RM9A 3DBRI 1I4PA 3WTSC 3PJRA 1F2RI 2CQQA 3BK2A 1S72I 1CZPA 2AX5A 5GXGB 3TO7A 3S32A 2PLPA 1TDZA 1U2WA 2O6VD 3NZ3A 4FHJA 3E5UA 3QU3A 3CUQC 2ZPYA 1TH4A 2VASA 3SARA 3S1NJ 1G3SA 1GO5A 4DHJD 1IDYA 3BWGA 5HHDG 3DF8A 2XH9A 2ZO4A 2R7QA 4B9KA 3UGJA 3HHZA 1V3FA 2JY8A 2ME0A 3SEQA 5L83A 4KT6A 2AS5F 1QZMA 4WAFA 3ZXVA 4LB6B 1N60A 1TS5A 2K8CA 4IW0A 1E9MA 7CATA 2H6CA 3NAUA 4P1BC 1G3WA 1V33A 4A6DA 3S1RJ 5D94A 3NARA 1P3QQ 3ABKH 1WZ3A 1WRJA 2KFKB 1XG1A 3CJQB 4PDGA 3W67A 2KO3A 1LE8B 3EUAA 2DVWB 1JJ8C 2WDRB 3DQVA 1I7HA 5IT3A 1Y0UA 5GTIC 5E6NA 3Q9VA 3RZWC 1O7FA 4KICA 2Y21A 3H3ZA 4NPNA 2CE7A 1HEZE 4B6WA 3DBRB 5DCMA 1Y8RC 4GYGA 1F4KA 1U9OA 2VUMJ 2KFJA 3V7CA 2O0YA 2RD0A 1I4HA 2Z1DA 1ZOYB 2PJRA 2JVCA 4L9TA 1IGCA 4JN6A 4UVCA 1P7FA 3NVYA 4LDTB 4M73A 1UHSA 2Y3AA 1DGBA 2L4AA 1R2ZA 4C56C 1QNTA 4BY7J 1X3ZB 2NBWB 1NNJA 2MA3A 2FUHB 2F48A 1SEBD 2HJ8A 2PEAA 1T33A 2DK8A 4A2UA 2LGSA 5ITRA 5LD2C 4IEJA 1MH4A 3Q3NC 1XXGA 1P4XA 2E34A 3P1MA 5ICCA 2WTEA 4IBKA 1H4RA 4M0DA 5CVUA 2DAFA 5IOIA 2W9NA 2Y31A 1ULYA 4HF0A 5EG0B 2WXHA 3EC8A 2HVRA 1R1TA 1OLTA 2JWTA 2X9DA 2L0FA 1IG7A 3ZQCA 1T3TA 3LSJA 4WK8F 3MQ0A 4OZCA 3ZOBA 3E21A 3D8LA 2WXRA 3V6EB 3Q8GA 4GOCA 1L7YA 3BG9A 3LQQA 1D0KA 3PVLA 3FAHA 1JTYA 1USSA 3DFGA 4ZDVA 1QPIA 3NOBA 1FJLA 1MPEA 2V1CA 1XDUA 2X8XX 3JRIA 1L2NA 4BXXJ 2NTTA 4AS1A 5LFAA 3QPLA 4IHYA 3HYIA 1RUOA 4GIVA 2NRAC 1KYIA 3NJTA 5D4RA 1TH2A 4E4HA 2YFQA 1XCQL 1EF4A 1T0FC 3IKVA 1SXTA 2VBZA 3HRMA 4OIRF 4II2B 1IBXA 1FXAA 4GC5A 5GADJ 3VWBA 4ZDLA 1VD2A 2DZMA 1K3XA 1MSFC 3K9PB 2M17A 3H4MA 2ZJPF 2OHFA 2R3SA 2KZVA 2WXPA 4M8MA 2DPDA 3AFHA 2NQ8C 4QWQA 1E9SA 3OYCA 3C2HA 3M4OJ 2DWNA 3WU2C 3K4KA 4F2LA 4BOSC 2JQ7A 1OAIA 3DTIA 1LDDA 2BB6A 1TWCJ 2XGCA 3EUB2 3CO7C 4NRWA 4QIWN 4JI8M 2K9XA 4MM3B 2WXFA 1RFAA 2IZVB 2MGWA 3GQ5A 4LNKA 4CHKA 1K50A 3ZGKA 5LLQA 5IYBJ 3KX2A 4YSYB 4U0VA 2JSPA 2ISZA 1SXJE 1ZR2A 4XOTA 1P0RA 2LVNC 1HKQA 4X57B 1RZ4A 3T3NA 4AC0A 3U5ZB 4M01A 2ZXWH 3UQBA 3ZGZA 3SJMA 1MMNA 5CKTA 3ZJVA 4ZYDA 1F0ZA 1HKSA 1E7VA 4HBLA 2LASA 2EV5A 3JRHA 2LHGA 2G45B 3B89A 2K85A 4HF1A 2DOEA 1MKMA 1G4AE 3NS8A 4NY0A 2IS6A 5BR8M 1ETYA 1A5TA 4GKJM 4TQ0A 1XPXA 4OIQF 4QTRA 1UFZA 1Y8GA 4ZRQA 4MIMA 2OU2A 2F4IA 3QODA 4MELA 1D5VA 3W2WA 1N25A 3PREA 4IOIE 2ZMEC 4MGRA 4PGGA 4JI6M 3BBZA 4IWPA 1XN7A 2F5VA 3E6DA 3HRDD 2FBHA 4LRTA 2DW4A 1A5RA 5DNYA 2H5XA 3GTJJ 3FXOA 3M6AA 3X23A 3PTFC 2QSFX 1FNWA 1PGAA 4Y4RA 5BPVA 1TTEA 4KDLB 1SD6A 5LGNA 4WQOB 2BYFA 2GA1A 2IBDA 2QDFA 2HAKA 4A3JJ 2QCZA 4ICVA 2N9LA 2WDTB 2EH3A 2KVZA 5E6PA 3R6SA 3KWVA 2IRFG 4O1NA 4DUZM 1R4NI 3HSRA 3VFDA 2QSGX 3AU4A 5DV5A 1Q3CA 1E0EA 2JX5A 4IDIA 1QRYA 4ZRKA 3FXMA 2XGEA 3OSGA 4J19A 4XBOA 4OMYA 4DR7M 4YHHM 2JWSA 2MJEA 1SFXA 2FE3A 3BC8A 2V1NA 4M6YA 2QC8A 2EIJH 4YXDB 1FCCC 4DBRA 3PNVA 3VFKA 3I58A 2JUJA 3NG0A 3I51A 2TSSA 1WKMA 2X38A 3AU5A 3LOCA 1KTKA 1RI7A 4PUSA 2DQLA 2GZWA 4NQKE 5F0HA 3C9PA 1AHDP 1IF1A 2K1FA 2BWEA 1X1BA 2SEBD 3LCUA 4HDVA 1VQ4I 1D6EC 3HX3A 4NAMA 1TW2A 1NJFA 3HDDA 1MBEA 1YN3A 3PFYA 2KWUB 2KZRA 1KQ0A 1IRZA 3M0EA 2EFNA 5FJ8J 3Q14C 4WWPA 4MFEA 4J01A 4G6QA 3HZJA 1YO5C 3DHIC 5ED4A 1R4NB 1ENFA 2WU2B 5LGUA 4MJSB 1A5JA 3MMYB 2HVSA 2CFOA 4ESFA 3GLFE 1AUAA 2XSZD 1GG3A 3KOYE 4OAZA 3MC9A 1VDDA 5FROA 3PIOF 4LY6A 2ZM6M 1XGNA 1JJ6C 4ENMA 2K4JA 1ZTRA 3F0CA 1R5GA 3CC2I 3IRQA 4KT0F 1PUEE 2LP0A 4HQEA 1D1AA 2N0SB 5EXXA 3HOVJ 2Q8KA 4PS3A 1YFHA 3VRBB 1WGHA 1BW6A 4AD9A 2ZVOA 3SDBA 1AA7A 2YU3A 2HWJA 4BEHB 3GTLJ 2G8LA 4DV1M 4R1HA 3PO3J 2L7MP 1D8JA 1XCBA 2L9SA 3S3MA 3ZMDA 1TGZB 3T1HM 5L3GA 1YX5B 2WX1A 1F4IA 3U7DA 1E3HA 2NOJB 3IV5A 3LSMA 3KLNA 5L3CA 4DV2M 4RB1A 4I6ZA 4A3MJ 2M9HA 1P92A 3SU8X 4WURA 1HQRD 4HEA2 1T3QA 3RDIA 4FE4A 2TDXA 3E1SA 2LSOA 4EMSA 1K8RB 1H8AC 3CSTA 2P81A 5HS9A 1FM0D 3HHXA 2KDZA 1JCKB 5DYMA 2IGDA 2XAHA 2FU4A 5FK9C 1XLOA 2CJJA 1NYRA 2GA2A 2R62A 1V55H 1DP7P 1UNSA 4P1WA 2BHYA 2IXSA 4MGHA 2RGHA 2MRPA 1R7JA 1E10A 5F1RA 2CUEA 1FBSA 3PNYA 1VEKA 4CO8A 4L9NA 1W0UA 4LMYA 4U7DA 3DTKA 3PQKA 3DLAA 3GQ4A 3FILA 1MBGA 4X0GA 2L7ZA 4KIKA 2EKKA 3FMSA 3C19A 3R66C 2XAUA 4DYCA 1ON2A 3CC4I 2DQRA 3Q3OC 2CJNA 2RQQA 1WR1B 4E7KA 5H6RA 3J7AS 5FKMA 1Y6IA 1QOBA 2NPTA 1EIJA 4NC7A 3MHVC 3DKYA 5H2FC 4K7WA 3A1QB 5CTRC 4X6AJ 2MP2B 2INNE 1N75A 2ASQA 2WXGA 3NRVA 4M3EA 1Q0WB 2Y9YA 2K6DB 3FHNA 5CLSA 5D2MB 1W5SA 2PFBA 2CV1A 3JREA 2NVTJ 2OEDA 2XAQA 2KOXA 2R7XA 4F93B 2XKOA 4EZJA 2F5CA 2CQXA 2FBWB 1LPQA 4LLGF 1JT6A 4W9FA 4QAYA 1W5CC 4N9HA 4ZTJA 4AUQC 5J18A 2HXOA 4KGTA 3GW2A 5D5XB 1BVSA 4ANUA 4W9GA 3PNTA 2Z99A 2HTSA 1M94A 2FX0A 3ABMH 1KLVA 4LNIA 2R65A 3LW5F 2KN5A 1VLBA 2BS4B 2WP9B 3H9JA 1FXIA 2L01A 4XONA 1LQBA 3P2BA 3AKZA 4NJ6A 1RAXA 2JF5A 4MNUA 1CF7B 2J5OA 4CCOA 3KVWA 3SAWA 1WPKA 4D5CA 1T6SA 4GC9A 1ZAOA 2K3PA 5D3DA 1WYGA 2EZKA 3PGEA 2VF8A 1YIOA 3JR4A 1WGDA 5EEHA 4URKA 1KFVA 4KUMA 4H2AA 2IGGA 2NVYJ 2K3FA 1XC8A 2ZC2A 1HJPA 2F6CA 3VR8B 5TSSA 1XX5A 2ZBKB 3WHKA 3W6KB 4K7SA 4HSTA 1EF1A 4XWTA 1V5GA 4B3TM 4A3PA 2VC1A 1GB4A 1C1YB 3R2TA 3FUUA 3SFEB 3BY6A 1BC7C 2KC1A 4IZZA 3G6EI 2WHIA 4CCLA 2JSCA 3RNGC 4BQAA 2WX0A 4ZYAA 4IC7B 1S7AA 1MMAA 1WJ6A 2LUEA 2A3SA 2HOSA 2CV2A 3HKPA 1WXVA 1TYGB 2WSCF 1L4DB 2Z3YA 4FASD 5DPRA 2HTME 2DCEA 1HE8A 4NZLB 2QQAA 2CW7A 3RT3B 2WAFA 1DDNA 3GO5A 3AL0C 1O4XA 2R2QA 1WJEA 4D9JA 1ODDA 2XAGA 3LA3A 2XC7A 3J7AO 5C2TB 4TMAB 2QHOB 3BVGA 3VODA 1SXJA 4NJCA 3ZH9B 3J7YJ 5BQTA 3RZDJ 3V05A 5TJJA 1IJWC 3BZCA 4HLYA 1I1SA 2BY1A 2EZIA 4HSRA 3DVGY 3F8MA 2L3DA 2E35A 2IAIA 1W36D 3APFA 1HA5A 2Z0DB 1ETOA 2WGSA 1JWMD 3LL7A 3AE7B 1K6YA 3PO0A 2R4JA 5E3NA 1I50J 1LFBA 1Z9CA 3AOEC 2DKLA 1MI0A 4DOZA 2JA7J 4KSLC 3IL2A 3ZXRA 4IHWA 1PYVA 2KVRA 3U6PA 4HLXA 1PUFA 1TF0B 4YWGG 3RZFA 1S3SG 3APCA 3T38A 1OQQA 1J7KA 2OA4A 3DOWA 4GDLB 5CYVA 4C00A 2RNGA 1RRJA 2A5YB 3JCUC 1LVAA 1YRNB 4M02A 3K6GA 2D2QA 1L2BA 3VR9B 3N4MA 4USAA 3OYLA 2LKXA 4DR3M 2PEXA 4EUTA 1SAXA 3M9AA 2XROA 4DUYM 2OOBA 3A45A 2WY8Q 3H1CA 2KTRA 4JPSA 1FBQA 4W9HA 2ZFUA 1POGA 2JVGA 2AO9A 4HPMB 1ORYB 3NY5A 2QEXI 5M3FJ 4AQYM 1HA8A 4D1QA 2N4FA 5J6XA 1PYWD 1WXSA 2X4AA 4L16A 3DPLC 4BXUA 4TSSA 4TQ1A 5GMVA 2COMA 1XD7A 3BQZA 5E1XA 3Q9SA 1WM2A 3IH3A 1TJEA 2VIXA 4YIRX 2R45A 2KDLA 3SAVA 4HPQA 1I4RA 4HDOA 5E79C 4P5OA 1TR8A 1FEHA 1DU0A 1DQUA 2PBIA 1MSEC 4ZOHC 1VQ7I 1SMYF 1N36M 4N4OB 1CK1A 1VZ6A 3HKZA 3GRUA 1JE8A 1B1BA 3I3LA 1SXJD 3VDXA 4UB8C 2KZSA 1VQPI 5E17F 2BXYA 2ON8A 3ZJTA 2L6OA 5DD4A 4IVNA 2V7FA 3LAJA 2GOMA 2NOGA 4BACA 4ZDOA 3B7QA 2STWA 3AG3H 1WI9A 2ZXIA 1XGOA 2HWVA 3KW5B 3GS2A 5J2RA 2ZCCA 4KZCA 5FR6A 2GBRA 4XRFA 2O8KA 2I38A 2JRHA 5EGOA 3EFUA 3C7JA 1YQAA 2GRIA 1R5LA 1YIWA 1YG2A 2V79A 4GCVA 3QYBA 2MBFA 5TISC 4DHJB 3P63A 2QP9X 2JYTA 1VZ8A 4RS8A 2OBPA 1EH6A 3I01M 2LOOA 5BMHA 2IW5A 1HQCA 4GEWA 4XKWA 2LGYA 3DHHC 5KPRA 4DQ2A 4IBDA 5HDKA 1WX7A 3GLFA 2J4XA 2KQ7A 1IN8A 2KLGA 3N97A 1L2DA 3BY4B 1IBKM 1WSPA 1TY0A 3DBHI 2Z16A 4HV5A 2L1AA 1Z21A 1YJNI 5ICEA 4IHTA 4CGYB 2FBKA 1J5YA 1QZEA 2IS4A 4YRVA 2NVQJ 5D5VB 1P7JA 4A0ZA 2BS2B 4GO1A 3TWMA 2JZ0A 1ON1A 4KMUX 3NWTA 4ABZA 1MBHA 2KKCA 4HPPA 2R7UA 4WJQA 3WAPA 3U1KA 2L7IA 4PCZA 1H9TA 1IRFA 2RPQA 5J17A 1YE9A 3B2GA 1LM8B 1OYIA 2DLBA 2CKHB 2EFWA 1VEGA 1L6VA 3L1PA 4LLGM 1BIBA 2XK5B 4HDUA 4UN2B 5EE1A 4UUVA 3ESWB 3UZUA 4AP4C 5LGTA 3AE8B 5CQGA 3KZZA 3OYAA 1MJBA 4EZKA 1EV7A 1EF5A 1WSUA 4IQ4A 1OMIA 3BTCA 2IY1B 2HKJA 1JT0A 4K81A 2IPKD 3BZDB 3ZRGA 2Y0SA 4B95A 2RSUA 4Z8XA 1WJAA 4FULA 3PXGA 4DNCA 3OS2A 1WE7A 2M0CA 1FY7A 4IM2A 5CVRA 4AU7A 4FD2A 2YNMD 3DBHB 1WGKA 2LGDA 2CQ7A 2PLYA 3D8BA 2WWYA 3ZNHB 3A9JA 4MH0E 5EYRA 3RYRA 1OCOH 5LHHA 1K7AA 2R46A 1NK3P 3TO6A 5DTDA 3E6CC 2AQ3B 3QX1A 2NAZA 3J27B 4LK1F 3CCRI 1PP7U 3AOGA 3Q0UA 2H8WA 1XMQM 2O2VB 4E7JA 2H1LA 3FWEA 2LREA 1QAOA 1YS6A 4EGYA 4LK0M 3V8LA 1XO3A 2D3CA 4NSRA 2H1KA 1V5TA 2JWZA 3OJ3A 2L3ZA 2PMVA 3I54A 1QAMA 4LF5M 2CUJA 4GFBA 3RGSA 5HFYA 2F4VM 1RIOH 1JW9D 4CCNA 2XAFA 3A0BC 5IA7A 2XAJA 2YEPF 5A2QZ 4K1RB 1OIZA 2QZ4A 3HSEA 1J59A 2LI5A 1JQJC 4LOCA 3HPGA 4TV3A 1LDKB 2O61A 2W3SA 3JR9A 1A31A 2KIUA 4L9JA 1XGMA 3HJ8A 1ETXA 1BOAA 3ZXSA 1J09A 1V86A 3P7NA 1IBLM 2XV4S 4YG2F 1FX7A 4L5IA 3KP3A 2R0QC 3DOAA 3MKYB 1PJIA 2MJ3A 2RAEA 1O3QA 2FQ3A 1R71A 2K02A 2AWTA 1X1AA 2DMUA 3KXEC 4KO8A 1L8QA 3HM5A 4BDYA 2K6QA 3BWUD 3C3WA 1QYRA 4GU2A 1HOMA 3AE6B 3NVVA 1QUSA 1GVDA 4KT5C 1N5XA 3LMMA 2C7NB 3LSIA 3OL4A 1IXZA 3C3EA 3KFUG 4V19K 2KFKA 4TKNA 4B7HA 2ELJA 3CMMB 3BR6A 2IBIB 4KKJA 3EIHA 2ICIA 4WCGA 4C2MJ 4AQ7A 1W5TA 3VLFB 3WAOA 3M3YJ 1WXMA 5GAHJ 3O65B 3K10A 4EFOA 4L4UA 1WX9A 5KQDA 2QLZA 4JE3B 1MG8A 5KHDA 1SBBB 2LMCA 1MH3A 4B47A 2COBA 1RNLA 2J7NA 1NH3A 1AOYA 2BE5F 5FTMA 2I8DA 4XIDA 4CYDA 1T0SC 4YSXB 2CG4A 2B3TA 4CA0A 1X4OA 3L00A 4AYBN 4E7IA 1U5TB 3ABVB 4A6EA 3GVAA 4WX9A 1Q10A 1U78A 5C23A 4RB3C 1KFYB 2G7HA 2VKEA 1WHCA 1TT5B 3JAMS 2MEKA 4RGNA 4KGSA 5KQ8A 1BR4A 3CMYA 1GJTA 4HF2A 4OZBA 1I4XA 2DNAA 3GTGJ 4S0RA 1PGYA 1PJRA 3F3XA 5H37D 3NBXX 3BJOA 3R7QA 1WGGA 2J7OA 3B0AA 3GLIB 1SC7A 2CRUA 3F6OA 5EG0A 2DAJA 1B4AA 4BBSJ 3CUQB 3QAUA 3L2QA 3SXYA 2IA1A 3C2BA 1QF6A 4V2FA 2NS8A 2ZXHA 1JWBD 5E1ZB 4G0NB 2BB5A 3R8BA 4C2UA 2JVHA 4HWIB 2QMTA 3KWLA 3CMEI 5BYQA 2NNNA 2E3TA 2PW9A 2NBUA 2ELHA 4MSQB 3I5JC 2ZB9A 3QARA 3RPFC 1GXQA 4KIBA 1V54H 4LLNA 3GTQJ 2JUOA 2JYEA 1OFHA 3H9GA 3KDSE 1LVKA 1WGYA 4AVZA 1QQIA 2JSVX 2W7NA 2MJ5B 4PJ0C 4D81A 5CVVA 1JRPA 2N1VA 3AULA 1IYFA 3SYTA 2K27A 1SAUA 4XORA 3D0SA 4P1CC 4A3LJ 2H6BA 4II2A 1Y8RB 1GV5A 1LV7A 2OQGA 4ENNA 2QEJC 1NV9A 3K9PA 2Z33A 1X1DA 4AM3A 4HEA1 3GFLA 4KFCA 3CP2A 4HQMA 2PVOD 2WAQA 2IEKA 2VE8A 4RA2A 2VPRA 3P9CA 1M1EB 2MH8A 1JROA 5K5OA 2GWRA 2VOOA 5C3JB 2R2OA 4UUSA 2DZLA 4CH7A 4LDTD 3KETA 2VJ4A 3H1UA 4IOAF 2LVOA 4M6VA 2W57A 4MM3A 3NWLA 1I27A 3WTXC 3GCMA 1P4AA 1LDJA 4W9IA 2KIQA 2CHVA 4BJ5C 1S7OA 2DA7A 3M62B 2FE8A 2LRDA 2NVXJ 1BJZA 1PVEA 1OYWA 2KWDA 4RDUA 2GQFA 2XPVA 1QUTA 1ORKA 2KHHA 1NBFC 3BK1A 1XLQA 1Z91A 3MFGA 2LTUA 2ZJDA 3U5ZA 2IGHA 5LHIA 3AEGB 4WJPA 2ZJ2A 3H0GJ 3T8RA 2F5DA 2BNKA 4Q7JA 3F23A 3VUYA 4RB0A 2MR9A 1X2NA 1D5YA 1ZV1A 2J42A 4DK5A 2WQYB 5AUKA 4LF4M 2GIVA 2PTLA 3GFJA 3BR2A 5BOXA 3P9IA 2DFIA 3FUVA 1GOZA 2JA6J 1VRAB 1MDMA 3GRRA 2YEPB 3BLYA 2WBMA 5DEQA 2M4KA 4FN2A 3A4CA 3BPXA 3FMRA 4ZRJA 3QYEA 3TL4X 3H6NA 4ENKA 2ZSIB 4AIHA 4FHTA 2B3AA 3SDLC 1TS3A 3V42A 3H0DA 1QHHD 2XSDC 4QOSA 3DFZA 3EA6A 1AWCA 1I4QA 3SFIA 2XLJA 2R5YB 4IHVA 4XDCA 1QANA 4B7GA 4A93J 4E7LA 2NNYA 5K7ZA 5J1RA 2XBBC 5K7FA 3FX3A 2M60A 1F9NA 4F1SA 4YTNB 4RAYA 1YLAA 1K78A 1T08B 3B7NA 4B1RA 2VH1A 3RKYA 1ZYRF 2DNFA 2JPCA 2Y5BB 4IWOA 4CCKA 2R7SA 5G5HA 2K47A 1RYJA 1VQOI 2W3RA 5JLXA 2Q0OA 1UD7A 1WJ5A 2CS3A 1J2XA 1MJDA 3ZNID 2P4WA 2KYWA 4KNYA 1ZMWA 2P5LC 2QNJA 1DU6A 2HTJA 2BS3B 3B1LX 1LQ1A 5L3DA 3W5VB 2QKMB 4IF4A 3GLGE 3QU6A 4IHSA 4B8XA 4DR6M 3L0WB 4A3OA 2Y69H 2V9HA 5C3EJ 5FLXZ 2OOAA 4DV0M 1YJIA 5H8YE 4BJ6C 3RZOJ 2EELA 4E3CA 4NSOB 1JWUD 2ECCA 1J7AA 3DBLB 4DXFA 2HJ1A 4M6XA 4XBFA 1R9TJ 5IPAA 2Y30A 2KMCA 4MDKE 5ILSA 3L10B 4EZLA 3E56A 2I5UA 2C6YA 2GXBA 2QQ9A 1MN3A 4I0AA 4BDZA 3ASOH 1YSYA 3K1JA 1T95A 2ME6A 2LG4A 5EXTA 2FSWA 4RM8A 2V0GA 3B9JA 3N30A 3SQNA 3VB2A 2DENB 3FXJA 1XLNA 3P42A 4N4NB 1LFPA 1G3IA 2K40A 2FCMA 4LJPB 3MC0B 1C4CA 2ZMEB 5CJ9A 1BI0A 4D80A 5EQTA 4XRMA 3HJQA 4WXCA 1L1TA 4MGYE 1L0VB 5DPSA 4I6LB 4H4KC 5B3SH 1PRBA 3HM3A 2STTA 4LNFA 4I2OA 3TL5A 4FHKA 3IG5A 2XPWA 2VXZA 2C9WB 3A46A 4BU2A 1EU3A 2VI6A 4LFUA 2YVCA 1E5WA 2L7KA 3L4PA 2R92J 4OIPF 2EJSA 3B74A 4BEHA 2CSOA 3U60B 3L2UA 3FC4A 1I35A 2FIFA 1FSHA 4K3CA 3EUHA 4BH9A 5FLXS 2RQPA 1GJSA 3ZO5B 1XSDA 3W2AA 3SHFA 4JYAM 2RKOA 5H6QA 2CR5A 5ERIA 3N1ZC 2N1WA 4JX5A 1YLFA 1QZZA 3CF0A 4XSZF 5FLMJ 1AU7A 4N59A 3QOEA 2L76A 2DI3A 2C96A 1ROEA 2LKSA 2R7ZJ 3S3OA 1IGNA 2JWUA 1BL0A 3NS1A 1IY2A 2NPTB 4DR4M 3IC7A 1O3TA 2CGPA 3AE5B 1WMHB 3AECB 2L8JA 4N58A 4RNAA 2NMQA 4FWDA 4JK1X 3OMYA 3CCJI 3G3ZA 2W85A 3IWZA 1XGSA 3TBLD 3DZDA 2JT1A 2JXTA 4NQWB 3TMOA 2LFIA 1WJ7A 4E74A 4ENJA 3JRDA 2W4SA 4L78A 2DHYA 2JA5J 2J0JA 2KJCA 2IGKA 1BMLC 2WXJA 3AXCA 2Y0MA 1BI1A 1C9FA 2K25A 4BAXA 3P5JA 1G59A 2E7WA 3OL3A 3S17J 1GLNA 2H1RA 3DVNV 4P17A 3IP4B 1ZELA 2FOWA 1E8WA 1FTZA 3LB8C 3JRCA 3TQNA 3L28A 3E97A 1GC6A 1SSNA 1WR1A 4KN7X 2CHGA 2QUFA 1Z6RA 2XHKA 1Z6TA 2IP2A 4G7OF 2KNVA 4CUGA 3ULQB 5CHFA 4F55A 1ZQ9A 3A1QA 3ML8A 4BKXA 3EGRA 1SFKA 3S15J 3Q69A 1TQMA 1R36A 2JPBA 3OIOA 2FF4A 1SJHD 2GM4A 1I6HJ 1YIJI 1CMXB 4YIIA 4BNCA 2FUG1 4PS7A 3Q8XA 3UIPB 2QKLB 5F08A 5LXIB 1F77A 1IBMM 1S9HA 3PVSA 5EP1A 1TQPA 2A4ZA 2KDEB 4JI5M 1QOGA 1JQ4A 1E7UA 4X64M 2BHZA 2VH2A 5M3MJ 2AQFA 2OAZA 2M8GX 3A42A 3Q3JA 2G9WA 4P55A 5JHFA 4RGOS 2L0KA 4HRIA 4YT0B 1EJ9A 1CF7A 3PO2J 3HK0A 2CUZA 3D5SC 1O3RA 3A1YA 1VNDA 1E0ZA 4JQWC 3JSPA 4JIOU 2KKOA 3UF8A 4EEFG 1MJGM 1UWXA 3GP1A 4LTUA 3KZYA 4AIJA 4EEWA 3LA2A 3KP4A 3WTVC 1IUEA 3BT9A 4UVBA 3EYYA 1V49A 2DN0A 1IM2A 2IVMA 5DD8A 4EJOA 3IRRA 2UXCM 1XQQA 3UINB 5M5WJ 4DHZB 5E1WA 2MC3A 4XRSA 2OCEA 4IIWA 3G2BA 2LHCA 2LD5A 1RFKA 1WFYA 3PQJA 1ZRFA 1JUMA 1PUFB 4CGZA 4LNOA 1FOXA 5IP7J 4K3BA 3KYDD 1RUNA 3TPZA 2IA0A 4EM0B 2DYMA 2IGNA 2VT3A 3Q8FA 2A07F 2LWPA 2VT2A 3RTRA 3LFUA 3LWFA 1HXDA 4RGRA 5E26A 2CWEA 1OCCH 4F8CB 2Q1ZB 1QVUA 2P6TA 2XKPA 4G4RA 3RPUD 1HR0M 5C1BA 3RE8A 2JUCA 5FTKA 3VKHA 3FXUA 4NAWB 5EP3A 1Z3YA 1KGSA 5A2QK 4YY3M 4KIGA 1JGGA 1FSEA 2VN2A 2EA4A 5LBQA 4XGIA 3HVDA 3OS1A 1JR3E 5JH5C 1GNUA 2H09A 2NBVB 1W0TA 4CCMA 3H7SA 3QPSA 3EPZA 2DOAA 1WGNA 4C7ZA 2HYFA 5M5YJ 2BYEA 1D8KA 2JN6A 3ZDMC 5DFLA 1K4SA 3U61B 5G2NA 1FZPB 4EVIA 2GBYA 2GMIC 3KOZE 5FTJA 2K6BA 4PSWA 4UXNA 4GDLA 1T6OA 3OYHA 1KU7A 1FMAD 1MJ9A 2KHMA 1X1CA 3F92A 4I81A 2K5PA 4OU7A 3K4LA 4I5SA 4AJWA 4P16A 5H92C 1SEUA 2HKXA 4UY8I 2WLBA 2HOAA 4W97A 5IWAM 4LZZA 4FX0A 2HPIA 2DAEA 4BYYA 2WAEA 5BPIA 2PQ8A 3HL2A 4JI3M 4W1UA 1TWHJ 3R7RA 3SFZA 2XUBA 1Y56A 3JRGA 4C3IJ 5L8RF 3TWKA 1QBJA 3LYYA 2V9PA 2PI0A 5F27A 2LRUA 4MH8A 4WIPA 2YS9A 3TIXA 3KYCD 4BBNC 4I02A 3TBIA 3KS4A 4WH4A 1J19A 2WXKA 4EM2A 2LTPA 3AL0B 2R61A 1R00A 1KRHA 2ACZB 4M72A 2KXJA 4DXGA 2V1UA 3ZW3A 1FBUA 5BNGA 1NG7A 3U21A 5IOZA 2E36A 3GLFB 4ICUA 4LJOB 2X6WA 2PVGC 1B6AA 1OR7C 3MC8A 2HYGD 2C5LC 4ZRPA 3FKJA 4A3DJ 4KHPM 3AG1H 2A61A 5CX3A 3L29A 2P0WA 3VEPA 2DI0A 1U9NA 1TY2A 4FA6A 3AG2H 5K7HA 3RKXA 4FJVB 1XD3B 3MHZA 3QC8B 3PPAA 1DOYA 2K7LA 1H6UA 3FTEA 1A04A 1G3TA 3RD2A 3WA0A 5IT9K 4FWHA 2P5TA 4JI0M 1WJDA 4Q5SF 3U6MA 2QSDA 1QLBB 1UZCA 1V34A 3OOPA 3A02A 3THGA 3GPUA 2PMHA 1PUTA 3ISPA 4FTHA 4G6TB 1E9RA 3FXLA 2IGOA 1WJFA 1BXTA 1TZLA 1WGXA 3ZQQA 3P4PB 3Q0VA 2Y0TA 3DEWA 4Y28F 1HF0A 1KONA 4GITA 1SD7A 3G1OA 1UGJA 3AE3B 4X65M 2XGDA 3H7PA 5HODA 4XC2A 4BL0B 2VQEM 2P8TA 4DR5M 2QYOA 5CHWA 1RPWA 3IHUA 1Q1VA 1YITI 2DA6A 4MEYF 1VEJA 3FM5A 3I0TA 3S2WA 4G94A 2CU3A 3ABLH 2L4EA 4I0BA 2K3UA 4L23A 2R5ZB 3A33B 1I4GA 1DV0A 4RF0A 2XF6A 2LVPC 1XLPA 4AKIA 3EFCA 4WJNA 3PRZA 3HWSA 5GAEJ 3PUFA 2DFHA 2HDDA 2ZTCA 2KPMA 1XWIA 2DTZA 3FD9A 3J80Z 1WZ2A 3R8FA 2IPQX 4A90A 2EKFA 1V5FA 1SFUA 1OJLA 3NQOA 4DDGD 5FKLA 5LEKA 2BGFA 3ZVVA 2E1MC 2JRTA 2OF7A 1FJGM 3LSGA 3ZNGC 5EE9A 4MGIE 4CHTB 3BVMA 3GTMJ 3U30A 3N05A 2KWCA 3MCZA 5GKNA 2V6EA 2XK5A 3OY9A 2KNAA 3H9DA 3QWLA 4M3GA 5AIPA 3DVNU 4MQ9F 1Z5BA 5FGMA 4C3JJ 2LJ5A 3IHPA 5KO3A 4FCVA 2QENA 2A5WA 5ITXA 2QWWA 2FQ4A 4XSXF 4LF8M 1IN5A 1STEA 1K4TA 4DWFA 5HLTA 3CCLI 5DDGA 2J0KA 4M9XA 4IXAA 3Q8AA 1UWMA 1X37A 1N5WA 2AHMA 3H36A 3CGWA 3RI7C 1HSJA 4EQQA 1O7LA 3IECA 5F3WA 3I4YA 3T3OA 3K69A 3OLMD 3UK6A 3PSEB 4LG2A 1EA3A 3A9KA 1IZ1A 1FMVA 2ZJRF 4BE0A 2BVLA 3HJEA 2LDUA 3BYTB 2PE9A 1NNUC 2O2VA 4RFBA 3KEOA 2JK3A 3HEFA 4JV5M 2UYZB 2BYTA 1IV8A 1DGHB 3HSFA 1R7RA 5D8LB 2H8RA 5L3EA 1OIPA 4F91B 2LWXA 2G4SA 1KLGD 3J80S 3SHGB 5C18A 3TDZC 3FXRA 2A68F 4IBJA 2F5FA 1MNDA 4HAMA 4XE0A 3G71I 2Y9ZA 3AB5A 3A03A 1XMXA 3ZJUA 1J0GA 3BZKA 2DA2A 4V2GA 2IDYA 2RR9A 1RC9A 1V1PB 2G3QB 3NVZA 4IBIA 2O8XA 1QT9A 5C4JJ 4ON0A 3AM9A 3D32A 4ZYHA 1TC3C 3GE8C 1OCTC 2JTVA 5H20A 2F4MB 4G12A 2ZJQF 4PDIA 2M7AA 1AN8A 1P9QC 5IP9J 4W9KA 4W9LA 3ML6A 1FNUA 2SAKA 1XMOM 1U0JA 4ZZLA 4ZPXA 4MB7A 1USTA 2DYRH 4ETSA 4PYUA 3LFKA 1R6BX 2C9CA 3WTYC 3KZIC 4C2TA 2FNPA 3GXOA 2DT7B 2VL8A 1GB1A 4JP0A 3GX4X 3BR0A 3HY5A 3P4RB 4KSKC 2Y0QA 5C4XJ 5EJCA 4B48A 3J81K 1WRIA 5FKKA 1NHGC 2L9VA 3CMMA 2X4HA 2RPVA 2DAOA 3GMEA 3RN9C 1IP9A 2NVUI 3FXQA 1O3SA 3W0LB 4F1IA 5HOOA 3P4QB 2RNJA 1YJJA 5FKNA 2MBEA 4MGZE 4KYWA 2D7HA 3H8HA 3EHVA 2OPTA 2QQ8A 2A6HF 2ZXJA 4MQVA 2XEPA 3RUIB 1QOFA 2O3FA 2OD5A 3BOSA 3K1NA 3PRPB 2PE6B 2VODA 2LYCA 4HVBA 3FHZA 4LLLA 2IYDB 1U5TA 2CMPA 3D1NI 3FXKA 2K86A 1N78A 3T9LA 2HOTA 4N6EB 1WH5A 5KAIC 3W1SC 6PAXA 3H5RA 4YIFA 3MZYA 2X0LA 2XN9C 1XMAA 1ZKGA 1DOIA 2DYBA 3V4GA 4JX1C 3L17A 2FMLA 2Z4RA 2KQRA 2CW0F 4AVPA 3QHTA 3VYSB 1UB9A 1IAWA 1QILA 2D7GA 3F22A 1ZMVA 1E94E 1QDTA 3EIEA 3PM1A 1RRBA 1IDZA 2A5UA 1ZLJA 2IGMA 3ZDTA 4R3DA 2KA6B 3WTWC 2PN6A 2DAIA 5IP6A 1SB3C 2L09A 3GLIA 1VZ7A 4A3KJ 1JR3A 2DFFA 1QQRA 3BQYA 3ZUNA 2ECBA 2HPMA 1L5PA 3CUQA 2NVUB 4HKQA 1NSFA 1QAQA 3V8KA 2VIIA 1NHAA 2CHXA 1L2CA 2CO5A 2RREA 3AV8A 2DODA 5E3LA 3GZ5A 4UUSB 2HI3A 2VLAA 5BYRA 2DAMA 3CESA 3M8EA 1TWAJ 1JKPC 3Q8CA 3QK0A 1AARA 4L9VA 3ENEA 2N9XA 2MH9A 3TWLA 2D7EA 2A05A 3MZHA 1I3QJ 2MQJA 3V3XA 2HXIA 2QPAA 4IO9F 1WY8A 1UG0A 4C9YA 5J40A 2L4MA 3WE3A 3TCAA 4IJFA 1LEBA 1XC5A 8CATA 3GBGA 4IBFA 4ZH4F 4NHJA 3AEEB 2WSEF 3VK7A 2DAGA 3IWFA 2D2WA 3WIMA 3WODF 1C4PA 4LFCM 1U8RA 1LGRA 4LJ6A 2HCBA 2K22A 4NNJB 1TKEA 2X48A 3E0JB 5DUIA 3J7AY 2D5VA 2ADUA 3SYKA 3CJNA 4CDGA 3IAM2 3Q8BA 1KA8A 4DHZE 1JTXA 2KNZA 1EH7A 3B08A 4IM3A 2MW8A 2BVMA 3UQAA 4H0EA 1OPCA 2FNAA 1QA6A 1QZYA 1T6BX 1WWTA 4G4OA 2LY9A 4UV9A 3JYUA 1FCLA 1MDMB 4I76A 2KQ4X 2M0AA 1G6JA 4ZDPA 3T8TA 5D6FA 3AEDB 3EETA 1PDNC 5FRNA 3J81S 4B3AA 1XDSA 1MIJA 4BKSD 2KMMA 4B44A 3FTCA 3W3CA 4HX7A 4LJ4A 3PHXB 2KANA 3PHWB 2MX2A 2JXXA 2L9NA 3I4VA 2VF7A 4RGXA 2JXNA 2EK5A 2XSZA 3U6CA 1ZDVA 4EE2A 2FA5A 4EM1A 3OYJA 1I6XA 3DTEA 3LSTA 2X85A 2W00A 2HD5B 2NS5A 5MPOA 2LXEA 1GUUA 3HOWJ 1J7CA 3V8JA 1V9JA 4OIOF 1NJGA 1QDRA 4GLSC 3H3VK 3SHQA 3S14J 2ESHA 4EV0A 3I5UA 1JR3D 3PZDA 4BAYA 1TS2A 5JR3A 2INDC 4CYEA 3Q6BA 1FC3A 2R6FA 3C18A 3ZQIA 2KX0A 1K78B 2E71A 4C4VA 3H35A 1Y1WJ 1VDVA 3R0JA 3ZQFA 4F3QA 2PKOA 4N9IA 3U8ZA 2LMDA 1KQ9A 2FAZA 4E6KG 3L16A 4O6JA 3C1DA
chains in the Genus database with same CATH topology
3W5UB 5JI2E 1WFXA 2E6XA 4OZBA 1I4XA 2ERCA 3NBIA 3PSIA 3K70D 2M3AA 2HVQA 4KLNA 2J53A 2UU9M 4AI6A 2W54A 1PJRA 1XNQM 5H37D 4LFBM 3URYA 3KSXA 2J7OA 1D0XA 3GLIB 3IAS1 3U6EA 3IG8A 2VKHA 3LVVA 3W9CB 1C78A 3HU2A 5HI1A 1MHXA 3QAUA 2X8AA 3L2QA 4AW4A 2LHEA 1MX0A 2R7VA 4RM2A 1QF6A 4RMNA 2LC2A 2MD0A 2Z2SB 3Q8EA 2ZXHA 3DU5A 4UDUC 2LY2A 3RQ4A 1JWBD 1MW7A 3FYCA 4JI7M 2WADA 2WY7Q 2EKIA 1HXYD 2R7WA 1QKZA 3VKGA 2BB5A 4XOPA 3R8BA 4C2UA 2JVHA 2QMTA 3KWLA 4FCWA 4J00A 5BYQA 2E3TA 5KPZA 2PW9A 2Y5CA 4S12A 2LH9A 1I4PA 3RPFC 1E7PB 1C1KA 1PGBA 1EWYC 3PJRA 1F2RI 2JYEA 1OFHA 3BK2A 3CP8A 3H9GA 5KNLA 1CZPA 2AX5A 3KDSE 1LVKA 5GXGB 1CQVA 1DGGA 3S32A 4AVZA 2PLPA 2WU5B 4XLCA 1TDZA 2H89B 2JSVX 2W7NA 3ILKA 4QOZC 5LNK1 4D81A 2L7HA 1JRPA 3NZ3A 3VQIA 4US9A 3HUGB 1FO4A 1TH4A 2VASA 3SARA 1AYFA 2LHDA 3SYTA 1SAUA 4XORA 1VJKA 4FWGA 5HHDG 1P7EA 2XH9A 4DGWB 2R7QA 4ZYSA 4II2A 2IS1A 1XHBA 3UGJA 3HHZA 4ANJA 3I57A 1K3WA 1LV7A 4L15A 3FBNB 1D0YA 3SEQA 4KT6A 1QZMA 4WAFA 2QEJC 4QHTA 1X1DA 4HEA1 4PJLA 1N60A 1TS5A 3CP2A 2PVOD 2WAQA 4OWRB 1E9MA 4Q2JA 3W0FA 2WDVB 2AQEA 7CATA 3SBJA 2I7NA 3ZQ4A 4MACA 2L5QA 1FIQA 1JROA 2LBFB 5C3JB 3TEWA 2LEKA 4NOOB 3FTFA 3CJQB 3RFZB 4PDGA 1J5EM 4QNMA 4LF9M 2KDOA 1C79A 4CH7A 5FR3A 2UWMA 2VJ4A 4HL4A 3EUAA 2Q5WD 2DVWB 2XF3A 2WDRB 3LQRA 1I7HA 2BW3B 1ZXIA 5FTLA 4YEJA 3B9PA 3NWLA 2Y21A 4GHLA 2CE7A 1HEZE 2FFJA 4F92B 2HHHM 1ACCA 2CHVA 2YR0A 3A98B 4BJ5C 3C2GA 2FE8A 2LRDA 2ZW0A 2FUG2 4CISA 2DT6A 1G8PA 2KWDA 4KISA 1I4HA 4NXMM 2DWLA 4B43A 3BK1A 2Z1DA 1ZOYB 2PJRA 1XLQA 3R9XB 3I9V2 3MFGA 3U5ZA 4PJJA 2IGHA 1IGCA 4QPQA 4JN6A 3AEGB 1P7FA 4IBCA 3FDYA 3NVYA 4EATA 2Y3AA 1DGBA 2KRCA 3WCQA 2BNKA 1R2ZA 1T5XD 4C56C 2J42A 4XN3A 1NNJA 1NG6A 2WQYB 4WQMA 5AUKA 4LF4M 1SEBD 2PTLA 3IUOA 5ITRA 2XGNA 5LD2C 1Z5AA 1XXGA 3FUVA 1PFDA 1GVNA 1GOZA 3P1MA 1VRAB 3CTWB 4R7GA 3AE4B 3GRRA 2EO2A 1F2RC 2Z3XA 2YEPB 4IBKA 2OUMA 3BLYA 2WBMA 4M0DA 2ZAMA 5ITTA 5EXSA 4OX9M 1MHHE 4U7BA 2GB1A 2M4KA 1XF5L 3LXFA 2WXHA 3NRZA 1EWCA 2F5PA 2HVRA 1OLTA 3A4CA 3E9SA 3U60A 1BR1A 4BGDA 3QYEA 3TL4X 3R2IA 3OYEA 3L26A 2ZSIB 1NY5A 4WWMA 1T3TA 4OZCA 1TS3A 3V42A 4LITA 3H0DA 3D8LA 1QHHD 2WXRA 4QOSA 3DFZA 3EA6A 1I4QA 2XLJA 4XN0A 4XDCA 1QANA 4B7GA 1EM7A 3LQQA 3FKEA 2MH7A 3FAHA 2QBYA 4E7LA 2V9KA 1MPEA 2V1CA 2M60A 1OFIA 3K4MA 4NUBA 3DWMA 2KL4A 2GOXB 2NTTA 1G41A 1L6UA 4YTNB 4AS1A 1M4VA 5LFAA 2HZDA 3L2AA 2VQGA 2ZANA 2WXIA 2UXDM 1KYIA 3K4JA 4CCKA 1TH2A 2R7SA 4KX6B 5G5HA 2BBCA 2K47A 4E4HA 1RYJA 2VJ5A 2YFQA 1XCQL 1T0FC 2W3RA 1SXTA 2KN4A 2DZNB 2XFSA 1WJ5A 2CS3A 3HOSA 5G5GA 3SMPA 1MMGA 1FRDA 2G5GX 4IQJA 1TKYA 3U4EG 1IBXA 1FXAA 4GC5A 4DV6M 4RCOA 1SE3A 3VWBA 4ZDLA 1L4ZB 2BS3B 3W5VB 2QKMB 2BW2A 1K3XA 4A55A 5CPRB 2F5NA 3H4MA 5LMUM 2OHFA 1KLUD 4XWWA 2KZVA 2WXPA 4DR6M 2X1CA 3FYDA 3AFHA 2NQ8C 3AEAB 2ZSHB 4ITVA 4DV0M 1YJIA 5H8YE 2V3PA 3OYGA 1E9SA 4BJ6C 2EELA 3OYCA 2XNAC 3C2HA 5LMNM 4NSOB 1JWUD 1J7AA 3IT6B 5KPTA 2DWNA 4DXFA 3K4KA 1VZ0A 2Y20A 2VQHA 3DTIA 1DO2A 5EE0A 3MKWB 2Q2EB 2BB6A 3EUB2 2L83A 4NRWA 4GDKB 4JI8M 3E56A 2MYSA 1JWAD 2K9XA 4MM3B 4AYBA 2WXFA 3UNGC 4FVMA 3GQ5A 4BDZA 3DU6A 4JXJA 1YSYA 1K50A 3K1JA 1DGJA 4XM3A 3ZGKA 1T95A 3GO8A 3SAUA 2LG4A 5EXTA 4IBGA 3TEXA 2HL7A 2V0GA 3KX2A 4YSYB 4DJAA 3B9JA 2JSPA 2X49A 1KSFX 1SXJE 3OIPA 3N9YC 4XOTA 2DBYA 4E7HA 3CIRB 1XLNA 1NY6A 3P42A 1DOXA 3KSJA 2VZKB 3SFDB 4PK4A 2PJRB 3T3NA 2E5LM 4N4NB 3U5ZB 1LFPA 1G3IA 1WJCA 3C8YA 4ZHPA 3MC0B 1C4CA 2BT6A 5DYIA 4LJ5A 3ZGZA 3GLGA 1SE2A 1MMNA 5CKTA 3ZJVA 4D80A 2VJIA 3VK8A 5EQTA 4LJAA 1F0ZA 3BYYB 4DR2M 5AUIA 3HJQA 1TGUA 1L1TA 4MGYE 3L25A 1L0VB 3CJRB 3ZR8X 1K51A 3U2SC 3IT4B 1HQYE 3DQVC 2UV1A 1ZUD2 3ZYYX 3KW6A 2KRKA 4RM3A 4H4KC 1G4AE 1HZ5A 3HU1A 2BJVA 2IS6A 3IG5A 5BR8M 4GKJM 2VXZA 4TQ0A 3A46A 4BU2A 1EU3A 2RDHA 2JZPA 1PDXA 5BYSA 2KACA 5ITYA 2WXOA 5FSWA 2L7KA 1D2NA 4ZRQA 2R4EA 3L4PA 1WJBA 1UELB 2F4IA 3QODA 4BEHA 1FD6A 3W2WA 4HKZE 4CCJA 2X1DA 3U60B 3L2UA 3FC4A 4IOIE 4ZTFA 5FLXS 2R7RA 4JI6M 2LUMA 1L0YB 4BUPA 2V26A 3W2AA 3TQSA 3SHFA 4JYAM 2F5VA 2RKOA 3HRDD 3HHWA 5A2QS 2HU9A 1IRXA 5HG2A 4LRTA 3RFWA 5DNYA 3ZCOA 1A70A 1R7SA 4N59A 3CF0A 4LJ7A 3M6AA 3QOEA 4IKFA 1MMDA 1FNWA 4I4LA 4FETA 1PGAA 4Y4RA 5BPVA 2C96A 1ROEA 5CQEA 2DYOA 2ONQA 3UR3C 3S3OA 2JWUA 4YELA