2W82A

The structure of arda
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
163
structure length
163
Chain Sequence
DMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF18
publication title Extensive DNA Mimicry by the Arda Anti-Restriction Protein and its Role in the Spread of Antibiotic Resistance.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Replication inhibitor
total genus 39
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07275 ArdA Antirestriction protein (ArdA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.560 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2w82A02
1.10.10.1190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w82A03
3.10.20.480 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w82A01
2W82A
chains in the Genus database with same CATH superfamily
3RNGC 2CV0A 1FEHA 4JI4M 1TWCJ 1R2ZA 3HHMA 2WTEA 1WR1B 3L17A 2EZLA 3PV1A 1HNWM 2FCNA 1TQIA 3I56I 2HJ1A 3ERMA 3Q2AC 5C4XJ 4A12A 2JZYA 3UR3C 3AMZA 2W57A 3JTHA 2EILH 1Q1OA 2GBYA 3U61B 5FSWA 3EUKL 1ZP0B 5DUIA 2GXAA 2IBDA 3FUTA 2BB6A 1P92A 3HK0A 1J0RA 2YVCA 1YN5A 2INCC 3CJTB 4B43A 1TTYA 2BY1A 3F6VA 1YX3A 2VQFM 5HNHA 4F1IA 2CRGA 2D3BA 3CCVI 2FOKA 5EG0A 2H8WA 2K8BA 3SFZA 4JK1X 3REOA 3MZYA 5CHFA 1DU6A 1DPUA 4MACA 1XG1A 4NQWB 5DYGA 3RI4A 2WS3B 2O25A 3CTWB 4E7KA 1QT9A 1QZYA 1ZW7A 4AKGA 2DZNB 1TYGB 5H2FC 1TNSA 1KLGD 2XZFA 4KIKB 1QZMA 3W68A 3PQJA 1FYMA 4YTPB 4XRSA 4P17A 4BKTA 4DUZM 2CHVA 4G11A 5E6PA 4AOFA 1Z7UA 4CZCA 2RGOA 2PKOA 4D5FA 4I0AA 4LLGF 2QSHX 1C78A 3PNYA 4XLCA 1GLNA 1OCCH 2E35A 4WWCA 1DDNA 4BBNC 4OU7A 1O3SA 2RPQA 1F1ZA 4DYRA 3WE3A 4G4NA 2AHQA 2HFHA 2V1XA 2IGNA 1ZDXA 1GVNA 3NJTA 3CP2A 1XLPA 3K69A 5TRDA 4XR6A 1VDVA 5EE3A 1XSDA 5M3FJ 1DV0A 3LAPA 3CD6I 2OJED 2PMVA 3G71I 4ZTFA 3QAHA 2XC7A 1WJDA 2LREA 3I71A 3AU4A 3IUOA 3KETA 5LMUM 1S29A 1O3RA 3J80K 2M7BA 1SD7A 3BINA 2F5FA 5K1YA 4OVVA 2OV7A 2LVOC 3OWEB 1R4NI 2CQ7A 3CUQA 4D80A 3E5XA 3O8GA 3LSKA 2M0AA 4W5WA 3GZNI 2MD0A 1C1KA 2O0YA 4G3OA 2WXKA 2JVGA 3E6BA 2PW9A 2KMAA 4AJWA 1K78B 3Q8CA 1NNUC 3PZ8A 2LUEA 4DHZE 3CDHA 2I8DA 3IT4B 1GJTA 5BOXA 4ARIA 1Z67A 4XRSG 3GLIE 4N4NB 4O3MA 1I4XA 3DHHC 3APDA 1W7PD 1DGBA 2CJNA 3J81S 2DT5A 2YNMD 4P6VF 2CKHB 3MKWB 1D1BA 3BLYA 2JA2A 1QF6A 4ABZA 2DQLA 1T0QC 2DI3A 4DBQA 1UWMA 2R6FA 4AYBN 1BN5A 1X1PA 5HNFA 3SHFA 4L5IA 5BNGA 1X3WB 3J2PB 3HOWJ 4M6XA 3GP1A 1JHFA 3LVWA 3TPZA 3V3XA 3AXCA 1QQIA 5GMVA 1TZ1A 2N4FA 2VZKD 3FIWA 4IRGA 3KUCB 1L2BA 1XWIA 4R71A 2OQGA 2NTSA 4NJ6A 1IXCA 2IP2A 4IRHA 4YFKF 3DXJF 5L83A 4R79A 2JZZA 1P7IA 1I6XA 3ZW3A 2Q5WD 1R6BX 1MDMB 1XHBA 1D5VA 4B47A 2JY7A 3Q3OC 4BHPA 1ZELA 3AOEA 4B1RA 4LG0A 1I4QA 1QZZA 5FROA 1DO2A 2RC4A 3HOVJ 4WW0A 1EU3A 2K9QA 1E32A 1S8NA 3HRSA 3ABUA 2KDMA 4OIQF 5H6RA 1K51A 3MP9A 3GTMJ 5IOIA 1DGFA 3FISA 2GAUA 4KT5C 2Z0EB 3B9JA 1P7EA 3W67A 2Y0MA 1BIBA 4IHXA 2KO3A 3HM5A 3M1CA 3ZKJC 3MCZA 2NVTJ 3SR6A 1YRNA 2RGHA 2CWBA 2EIJH 4XQFA 4N58A 2N1WA 1EF5A 2KDIA 1PGBA 3KXEC 3FZVA 1D5ZC 4YRVA 3Q6BA 2V9VA 3MKLA 4JPSA 2WXLA 4W9HA 3W0FA 1U0JA 3KZZA 3SEZA 2H1KA 3KLSX 1UM8A 1IRZA 2CJOA 2MJ5B 2JT1A 3NBIA 3U6LA 3X23A 3DLLF 2H1RA 1WH5A 4LCDE 3QHTA 2K4BA 2E1NA 1SXJA 2HJ8A 4V2GA 3W2VA 2CQNA 1MBHA 1U9NA 3TO7A 4FCTA 4EJOA 2UUCM 1F1HA 4E70A 1LE8A 2KKOA 1MD0A 1KZHA 1RUOA 5EGOB 1I1GA 3BTIA 3F8NA 2DQRA 2YUSA 2MG4A 4XX5A 2IJ0A 4OZAA 3VDZA 3P9CA 2VQLA 1F43A 1NY6A 3S2DJ 3IHPA 3O8HA 1GG3A 1P0RA 1XQQA 1W5SA 2L01A 3E6MA 3FYDA 2N9EB 3PQKA 1VDLA 1BI2A 5DDGA 2ZXHA 2LJIA 4PS8A 2KIQA 4QHTA 2TRTA 3A4RA 2UWMA 2Z33A 3WU2C 2AQEA 3M8JA 4XKCA 1V5GA 4M3EA 3RQIA 5E18F 2Y75A 5A2QS 4LJOB 4PCQA 1IFYA 3N97A 3Q0UA 2E5ZA 1JI8A 1N77A 3WANA 5LEJA 1FM0D 1R7JA 3FILB 2Z59B 5ITQA 1WJCA 5DUKA 1W1WE 4A3IJ 3L7WA 3PL8A 3P4PB 1EH8A 1W4MA 2LVOA 4HAMA 2VIXA 4UVBA 4EGZA 4GMQA 1Y6IA 5LEKA 2IA1A 1STEA 4KN4X 3A1QA 4KT6A 4K7UA 4PJNA 5AUIA 5IY5H 3ZNZB 4DK5A 1EF1A 2ZTCA 2K4JA 2YLMA 2MFZA 4JV5M 1N6ZA 2O2VB 1IGDA 2CU1A 3NBXX 4DZPA 2KRUA 2IS6A 2M4KA 1VFCA 8CATA 3HSRA 4CYEA 1M1EB 2FBHA 4MSMB 4GEWA 4XIDA 2JN6A 1E94E 3MJ5A 2IGOA 4MEXF 3D5LA 1E2XA 4HEOA 2FUG1 1JXSA 1V97A 1WGKA 4K3BA 1LEAA 2HQRA 1F0ZA 2GB1A 5BMZA 2IA2A 3B02A 3SJMA 3W5UB 3ZMUA 2D1HA 3V62A 1G41A 3RCZA 2R5YA 2WADA 3ZCOA 2WU5B 2QENA 3GCMA 3A9KB 2KHMA 2CW8A 5FR6A 5E6JA 3KE2A 4RCOA 2LH9A 2QYOA 4OAZA 4KZCA 2W85A 2RRUA 3R8FA 3S2WA 4OZCA 3G1MA 5EEGA 3VDUA 3FXQA 2LD9A 1ETWA 4GRIA 4NSRA 3T1BA 1CF7A 3K1NA 3OL4A 2ZCWA 5IA7A 2ZVNA 3WU0A 4L5EA 5JH5C 5E3NA 4IBEA 2LZ6A 5E1WA 1E5WA 2BE5F 4KITB 5G55A 2XRNA 3TGNA 3PTFC 4AIHA 1WJNA 1U3EM 1A5RA 4MGIE 2EH3A 4XE0A 2EZKA 1VEJA 2R7SA 1K4TA 1BW5A 1LFUP 5DNYA 1S6LA 2O01F 3L1PA 3LW5F 4AI6A 4AM3A 3WIMA 1XGOA 1L7YA 3L2CA 3OJ4B 4TMAB 3U6MA 2ZPNA 3WTVC 4K0KM 2F4MB 1DU0A 2L7IA 5D6JB 1J7AA 2EELA 5JHBA 4P5OA 3MHSD 3AL0C 5ED4A 2ZBKB 4RM3A 5F3WA 2LWXA 2JA7J 3OYCA 3H4MA 1T6BX 4LGYA 2KQSA 4JOMA 2Y31A 3OWTA 4U7BA 1VD2A 5BYRA 3GBGA 4YXDB 1NV9A 4HSTA 2ZXWH 5D5XB 1ZMWA 3W2AA 2ZMEA 5EZGA 2X0LA 4YTMB 4UUTA 3LFUA 1I4WA 5FFXA 5L8RF 2JRHA 2CQKA 3KP3A 3QCAA 3TO6A 2XEPA 4OOIA 3IXSA 1E17A 2HTJA 3QOPA 5BO4B 4WCGA 2QIEB 1O3QA 4B44A 5FKMA 2GBKA 4M0DA 4LLGM 2KRCA 4M74A 4RGTA 4XWTA 3DU5A 1V8CA 1O7FA 2XKOA 2HTME 4FXCA 1V86A 2MP2A 4DV0M 2NOJB 4RS8A 2XGCA 2OUMA 3I01M 1E8YA 5H20A 4DXGA 1JUPA 4HNUA 2W24A 3VB2A 2JPHA 1NVMA 2F5OA 3ABVB 4ITKA 3C58A 4P1BC 1FMWA 5ITXE 4XDDA 4IUMB 3FKYA 1A5TA 3GRYA 1J75A 2KX0A 1JWBD 1QKZA 3BZ6A 2EFQA 2L2OA 4Y3OA 2XB0X 3J81K 1YHQI 3CF5F 1V49A 4F52A 1I5ZA 1YX5B 2IT0A 2XGDA 2V4LA 2ZO4A 4G7OF 1KYIA 1T3QA 3CTAA 5KQ8A 3BC8A 2R4GA 2KEBA 3QYBA 2JNHA 4J6IA 4LF5M 2IZVB 1ETOA 3BT9A 5D8KB 1OFHA 3BDDA 1K53A 2P81A 3BR2A 2MSED 5E3OA 3K9OB 2J53A 2VZKB 1OAOC 3ZO5B 5LBQA 3A01B 2QSFX 2L4AA 3VUYA 4TSSA 3HU3A 5AZFA 2L9SA 3VR8B 1ULYA 2KAJA 1USTA 2BHYA 3KLNA 2RD0A 4ZRJA 4A3VB 3K92A 1AKHB 2E71A 3NG0A 3ZRGA 1Z0XA 2AXTC 1WF9A 3Q8EA 4KDLB 4PDIA 2BW2A 2KLGA 4WURA 4RGSA 4G94A 4FCYA 1SANA 3MMPA 3GLGE 3AB5A 2EFNA 2CU7A 1DGRM 3I3TB 2DZJA 1VJKA 1KQ8A 2HGCA 2AQ3B 3AE4B 2EO2A 2KIFA 3FBNB 4I09A 2QMTA 1YD8U 2VJ5A 4KV2A 2KMUA 5HODA 3F92A 2BVLA 4IHTA 4CZZA 2KYWA 2MJEA 1D4BA 1JWSD 2FBKA 3B2FA 1XC5A 4MEMA 4KDPA 2QKLB 1MFWA 2INPE 3I58A 3U6PA 2AHMA 5E17F 3CCUI 2J0KA 3KP6A 4W9IA 1ZGJA 4OIOF 5F64A 1WFXA 4HEA1 1SMTA 1FZPB 2D2WA 1D5XC 1YTYA 2WGSA 3E3VA 1S72I 2XEWA 2A61A 1IV8A 2MYSA 2L4MA 1WSPA 4E7JA 1ZR2A 3W6KB 3VTUA 3RYTA 2MH9A 1EIJA 2MD5A 3RNFC 2HTHA 3SU8X 1T56A 2NRAC 3IBEA 4W9GA 3ZMDA 4J01A 5DM6F 2FSWA 2KQ7A 5CVJA 4LTUA 2FFJA 3E46A 2GZWA 3C3EA 2GMIC 4YL8A 1FC3A 1WKMA 4G0NB 3HVDA 1WXVA 5J4YA 1T2KA 4P96A 1FWZA 4OW0A 2PPHA 4LK0F 2XNAC 1SVMA 4LITA 1O7LA 2DA1A 4I0BA 1H89C 4LB6B 4PCZA 2XBBC 3ZC7B 2M3AA 2V79A 3UQAA 2QBYB 3RPQA 1D3ZA 5ILVA 2HQNA 4GGQA 1E3PA 5FR3A 2JY8A 4HKQA 1NEKB 4XMYA 2LGXA 5ITUA 1LQ1A 4XKBA 1HCRA 3JR4A 3U4EG 2WXQA 3JRGA 5M5XJ 1FYKA 2M0CA 1TKYA 2FJ1A 1MHXA 1ZGWA 3LSPA 3Q8GA 1MJAA 2Y9YA 1PDXA 2DU9A 4XN3A 1ZV1A 1OCTC 2GXBA 3I4PA 4A3MJ 3L00A 3DDCB 3U2RA 3SEQA 3ISPA 1UBIA 1SJED 1G8PA 1U5TB 3JSVA 1JT0A 2QZ8A 2PVOD 4G4QA 1OLTA 3WTWC 2DAOA 5IYCJ 4D9JA 2Q2EB 3LOCA 4M01A 1FMAD 2W00A 3MVPA 3GTQJ 1XSVA 2KN4A 3RIRA 1SGHA 2Z5UA 3LDZE 4C7YA 4IBFA 3LYYA 2BKRB 2ZXJA 3HHHA 4I81A 3LA3A 2CH0A 1S3SA 2DMNA 4HDOA 3DPUA 1OKSA 2P8TA 2RSUA 3LCVB 2A3SA 2TSSA 3UI3A 3NOBA 4Y4RA 3U6DA 2XDVA 1R36A 3MFKA 4BJTA 5TGTA 5GTIC 4JX4A 1ESFA 4ENKA 3BK2A 4FHTA 2WV1A 2R5ZA 2O6VD 2D7EA 3QIJA 4GXOA 1KJTA 4F2LA 3WTUC 2A5YB 1ZUD2 3MTNB 3U5ZA 4KNYA 4B0MA 3HIFA 2MROB 2ZSIB 2GOWA 2CHQA 3L25A 2MC4A 1WR1A 4XSXF 2WB1A 3GLXA 1B9NA 5CX3A 1FEXA 2KNVA 2FNAA 2NBWB 4W9CA 4RAFA 3CLQA 3GEZA 1D5YA 2JXNA 3ONSA 5E3LA 4RGNA 5EP1A 1AARA 3U61A 3VYRB 3NWTA 3Q3JA 1OCOH 3FDYA 4LJ7A 1PJSA 2ZPYA 3I5UA 3HC7A 1LVAA 4F8CB 3K2AA 2QM3A 3U8ZA 1WXMA 4CCJA 5C3EJ 3G1LA 1R1UA 4YFXF 2FOWA 4KX6B 4LJ4A 3S14J 4OIRF 1B8IB 1R00A 4NXNM 4ANXA 1LDJA 1S3SG 1P4XA 4US9A 4NQWA 4EIWA 4U0WA 4MNUA 2Q0OA 3RZDJ 3UNGC 1O3TA 3BPVA 3GS2A 1E8XA 3VTVA 5L3FA 3OYDA 4BBRJ 4HL4A 5K7HA 4ENNA 4E7IA 3K8ZA 3CSTA 4LDTD 4IBGA 1XLQA 1RNLA 1NHGC 4KIKA 2ZJDA 1R4NB 4DOZA 4D81A 4A3JJ 3BIID 2X48A 2XLJA 2BYVE 1CJEA 1R4MI 3GZNB 1BR2A 1TS2A 1HSJA 3KP1E 4I01A 2R0IA 2TCTA 3ZNGC 1BJAA 4JI3M 3ESWB 2DPUA 3LMMA 1MMDA 1R22A 1LM8B 4PS7A 4TKNA 1V3FA 4AVPA 2LJ5A 3FKJA 3S8PA 1WGGA 4DV7M 1Z59A 2AYOB 1BIAA 4ITQA 4NC7A 1FNUA 3HU1A 2OEDA 1NG6A 3B74A 3S3MA 1TTNA 1YN3A 2DI0A 6PAXA 2FS1A 5CTRC 2NVYJ 3ZH9B 3N9YC 1POGA 2OPTA 5IYDJ 2WXOA 5TJJA 2XAGA 4LF9M 3GVAA 5I4DA 2VQCA 1WH3A 1YN4A 3ZNID 3QQAA 4A3OA 3CLOA 3QRFF 3V8LA 3AE8B 3DHIC 2VQEM 2WDRB 5KVRA 3PLVA 3FX3A 2HOTA 2XIGA 1C4AA 1HW1A 3CF6E 3ERED 1N25A 2KIUA 1WWTA 4GHLA 3JAMZ 1QOBA 1TKEA 2CWEA 1DOIA 2JY5A 1JKQC 4I98B 2HZDA 1QUSA 1VZ7A 4DQOC 1OEYJ 1ZAOA 4BUPA 2ADUA 3FD9A 5KAIC 4LLNA 4NDLA 2GIVA 4A6DA 1K78A 2L6OA 4M8NA 4XICA 1QHHD 4NAMA 4Z6YA 2LKSA 1WY8A 3K4MA 3RNBC 4IOIE 3PNVA 4GDKB 1P7FA 2XGEA 2HPIA 2RAEA 2G9HD 3PPAA 1L1TA 2J5OA 2DAJA 1OCPA 3UINB 2DAIA 3TE6A 3M1EA 3SHQA 1YS7A 1ENHA 1X19A 4LFAM 2GWRA 3BYTB 4LJPB 1HXDA 2HDCA 3T3NA 3A02A 2CSOA 5BQTA 1IO2A 3RT3B 2APLA 4E7SA 1IM2A 3U60B 2P5VA 4N9IA 2PTLA 4ZRIA 3OIQA 1V55H 2PJPA 1MN3A 3M63B 3V7CA 1I42A 3BG9A 3FE3A 5KNLA 1YSYA 2CJJA 2KTRB 1WJ7A 2MBHA 2V0GA 3C2HA 2DNFA 4IDIA 4JX5A 1ROEA 3LSMA 5L3CA 2K3PA 1GNUA 3BG3A 3QQ8B 1HKQA 1MDMA 4CDGA 1H4RA 3BY4B 2FE3A 4B0EA 3U7DA 3FMQA 2MGWA 3KQ4A 4RB0A 4QNRA 2ZJPF 2MH8A 2V6CA 4AQ7A 2HQAA 1L4ZB 2W48A 4G7ZF 3AEDB 1N61A 2MC3A 1Q0WB 3GQ5A 1I27A 4DDGD 4MB7A 3NZSA 2G3QB 3TQSA 4CCNA 1GUAB 4FE7A 4WK8F 4F1SA 1KRHA 4DR4M 2DA2A 5FK9C 3HJ8A 1DP7P 1MBGA 4M3DA 3HRMA 3VSLA 5C44J 1X1CA 4AKHA 5FTKA 5BPVA 5B5EC 3Q8BA 2XHKA 1FD6A 5KHOA 5EXPA 3D1NI 5CHVC 1FBSA 5J3LA 2JSCA 3MHVC 4QWQA 4E7HA 4QLCU 3DKXA 4RM9A 1JGGA 4Y7NJ 3DWLE 3GRVA 3AEBB 3WTZA 1WI9A 1IF1A 2X6WA 4GXBA 3R6SA 4FE4A 1GXPA 4CA0A 1TH4A 2JMWA 3KZIC 4L15A 5KPRA 1E3OC 4G50A 2K6DB 2LVSA 1Z77A 1XGNA 4NJCA 2I10A 5AIPA 3DLAA 2PEXA 3AV8A 1A31A 2PI0A 2VOPA 4X6AJ 3SATA 2R2QA 3SQNA 2H1LA 3E9SA 3I54A 3QPLA 4ESBA 4KSLC 4BQAA 2G8LA 2Z8LA 3T8TA 1P3QQ 1DOXA 2WXJA 1VDDA 5IT9K 5EGOA 1G8XA 1QANA 4RGRA 2MGQA 5EG0B 5IP9J 2EB7A 4ZYEA 2JRIB 2FMLA 3EUHC 1PJRA 4FQGA 3TIXA 2XF7A 1NDDA 5EE9A 3L2UA 4EJUA 2UWQA 3P7NA 4B3TM 2MA3A 4XSZF 1I35A 4FCVA 2MBQA 3SDLC 3GZ6A 4D7NA 4PGGA 1QAQA 2N7EA 2HL7A 3NHEB 4LK0M 2D3GA 1ETQA 4LJAA 2HYGD 2R93J 4P9UA 4G8XA 5D4SA 4D1QA 5FKKA 4YIIA 1GB1A 3BWUD 4GU2A 2VDBB 2R7FA 4JP0A 5D6FA 4GDLB 3TWKA 1P9QC 5GADJ 1TQMA 3GE3C 2W7NA 1GV2A 4QOSA 1VQNI 3Q69A 5FLXS 3UIOB 2KZSA 1T08B 2CU3A 4CO7A 2ZTDA 3FILA 2JPBA 5E6OA 3ZQHA 4XNFA 5IZ7D 4WIPA 3AE2B 1H9GA 1Q10A 1XEEA 1IGNA 2CW7A 4C9YA 1UELB 2A5WA 4HXDA 4AD9A 1HF0A 2LVPA 5M5WJ 1UHMA 2ME0A 3TSSA 1OAIA 2DTZA 4DW6A 2K25A 2ZCCA 3FXOA 1F9NA 4D5CA 4C4VB 2O6VB 5FTLA 3ULQB 2K5CA 1JGSA 2PQ8A 4LZJA 1AN8A 5F04A 2O2VA 4UN2B 3DEEA 2MLBA 2V6ZM 1UMQA 4B7FA 2L76A 4WJNA 5DCNA 3MC0B 3CCSI 5IP4D 4Y33A 3OY9A 2Y5CA 1TIFA 2K8HA 3CMYA 1TTEA 3H5NA 2L9RA 3IC7A 2E36A 3FKIJ 2M56B 4Y17A 4S12A 3JVZX 2R7RA 1ZAEA 3LSRA 3ZVVA 1IUYA 2F5NA 3DOWA 2R4EA 4QOZC 4FISA 1RAXA 2Y0SA 1L0XB 2OQ4A 2JSVX 3IG5A 5GXGB 3A9KA 1BUIC 1R49A 1XS9A 1SE4A 3FK7A 3DVGX 2WXIA 5GP9A 2M1MA 2HXIA 2MSYA 3RNCC 4IZZA 1ZG5A 4GOCA 3EFUA 3VK8A 3HUGB 2A68F 2O5RA 1YLAA 2BWBA 1E7UA 1PM5A 4O1NA 2YX4A 1SXTA 4BXFA 5H37D 1EJ9A 3F8FA 1ZRFA 1DO0A 5IN7A 1B72B 5M3MJ 3L4PA 3VXWA 5HS9A 2XK5B 3J7YJ 4IRIA 2PE6B 4KISA 1U8BA 5LLQA 3JR9A 2JSPA 4LDTB 4PJ0C 2F4IA 4REZA 1VEGA 2G7HA 3FHZA 2Y48A 1A35A 3VFZA 3E6DA 5ITTA 4A69C 1D8JA 1TDZA 2JTVA 2L00B 3R4KA 2CFOA 2XAJA 2ZBKA 5E20A 4NAWB 1ONVA 3GO5A 2L4FA 2FUG2 3IG8A 2B9SA 4G6ZA 4A9AA 2ZAMA 3CC7I 3SZGA 2ZJRF 2CHXA 4NJ7A 1BOBA 1UB9A 4M9SA 1SIJA 1LVKA 4WWOA 2P0WA 2BKFA 1WJFA 4RB1A 4TQ0A 2WXMA 5B1BH 2LMCA 4DR6M 4QPOA 4ZYAA 2ELKA 5KCMA 4G3XB 1BOAA 2AQFA 3BQYA 1W0TA 1RRJA 1ZK8A 2XASA 5DS9A 3N32A 3KW6A 3GX4X 4PJLA 2QP9X 3QK0A 1LFBA 1Y56A 2M8GX 3C18A 2G4DB 3TMOA 4QAYA 1XNQM 2XGNA 1RUNA 3I53A 3AAFA 2OJWA 4YSXB 2Y3AA 4MIMA 5TR5A 2R45A 1YG2A 4UVAA 1NTCA 3G2BA 2ELHA 4BQOA 4L9JA 2G45B 3NWLA 2FEZA 4JXJA 2K9SA 2VRRB 3TMPB 2E3TA 1WIVA 4HQMA 3RZOJ 3OSFA 2N0SB 1ETXA 2WAFA 4U0VA 2F2EA 1V92A 1OQYA 5JI2E 4BHCA 2FX0A 1FIQA 1KLUD 1ETKA 1YX5A 4L18B 1B1ZA 1FNVA 4A3LJ 3MJWA 4BKXA 1FIAA 4V2FA 4ZRQA 4K81A 3DKYA 3VYSB 3HRTA 2ZVOA 2X1EA 3VK7A 2KC1A 3HEFA 2I7PA 4LZZA 4DV2M 3APCA 3WODF 2K22A 2V1UA 4GCVA 3GPUA 2WXGA 4KLNA 2WXHA 2DNAA 2OZ6A 3ZMTA 1OYYA 3UGBB 3K9OA 4O5VA 1VQ5I 2KNBA 4II3B 4DBGB 2MBBB 5LHIA 3S1QJ 3BJAA 1SXJE 3A01A 2CQQA 2BYTA 3VWBA 4P55A 3DV8A 2A05A 1AKHA 2L32A 4C2MJ 1TJEA 4I7HA 3ZJTA 4ZDLA 5GAEJ 1HDDC 5D5VB 3MZ8A 1IN8A 3LQQA 3J7BA 1SE9A 4DV6M 4B3MM 1NH3A 2HKJA 2CUZA 1T0FC 3DEUA 3AE1B 3JRBA 3HOYJ 2JXXA 3EUB2 2DBBA 4F92B 2STTA 3PZ7A 3M95A 1XTAA 1N36M 2W9NA 1C9FA 4KIBA 3HWSA 3U6OA 1GB4A 1GXQA 1WJUA 4MTEA 4XZ4A 4Z8XA 1ZLKA 2QNJA 2ZJQF 4XC2A 1Z5BA 4RBOA 4EEWA 4EMSA 3HM6X 2LRUA 2WHIA 4XYCA 4S17A 2P6SA 2WSCF 2DA3A 1UJ8A 2M87A 1KU7A 1VQ7I 1G3YA 3QWLA 1K3WA 2V9KA 1MIJA 2O6GE 2JUOA 2QCZA 3E21A 2EMSA 2KJ6A 4JX1C 5IPAA 1FSEA 2X85A 1HA5A 3GMEA 2KT7A 3AE6B 3W2DA 3VSKA 4MFDA 3IAM1 3TL5A 1MX0A 4JN6A 2DZMA 4L2YA 3C3DA 1IW7F 3OR1C 1AOYA 4WP2A 3IFWB 1U4AA 3X0WA 4GLSC 3P42A 3GLFB 2BGFA 2WWZA 4KFCA 3QOEA 3JYUA 3V42A 3DCGA 5ITYA 1N63A 3KUDB 2LD5A 3AE9B 5FRNA 4A93J 1WI3A 2QBYA 4KIGA 3U6EA 1Y8QB 1QQWA 4Q47A 1KGSA 1UG0A 3UKGA 2E2JJ 2ZEQA 3V61A 2C7MB 1NJFA 5HLGA 3OYNA 4HW0A 2MA9B 2ZC2A 1FOYA 3T15A 3T38A 3WG9A 3E4RA 3GTOJ 5CQEA 1XC8A 1GV5A 2PN6A 4WXHA 5K5RA 1FXAA 4PDGA 1U5TA 1B4AA 1NK2P 5AONA 1YW7A 3LWFA 1JW9D 3H7SA 4HEA2 4HWIB 3GLFE 2Q2EA 3I63C 1CQVA 3O2PE 2KMMA 1G3WA 3M7GA 1MH4A 3U9GA 2E5NA 1I6HJ 3D8BA 4LRTA 5D2MB 2CHWA 3KIOA 2W54A 4AZFA 1R6RA 3MMYB 4JQWC 4RA2A 1JROA 4CCKA 4L16A 5KPTA 4NOOB 2YU3A 2H27A 2VKEA 2WAQA 2FQ3A 1QRYA 1Z3XA 4II7A 2BW3B 2M0MA 4GC5A 2KWDA 2DZLA 4GYGA 1HT1E 3K6GA 1WRDB 3RNEC 5L3GA 3PT2B 3E56A 2D3CA 1TW3A 3EA6A 1ETYA 2BVCA 5FFZA 2F5CA 3WHLA 1JUSA 1TZLA 2F5EA 1HC8A 4B6WA 4PS3A 3URYA 2BPSA 5GKNA 3U1KA 3UQBA 3J7AO 3OOUA 1LNWA 2KPMA 1ZHFA 4EM2A 1PQSA 2PMUA 1YJIA 4DJAA 1REPC 3HU2A 1ACCA 1NHAA 2XF5A 3J80S 3ZXRA 2NS0A 4JYAM 2LH0A 1R4MB 2R4JA 2IJLA 4DHJD 3I4VA 2B0LA 4P1WA 4YSZB 3NQOA 2OU2A 4ANRA 3GW2A 3T0YA 2F5VA 4B3AA 4GGGA 2XF3A 3FM5A 3E1SA 4E4HA 2BBYA 2ZW0A 1WRJA 2VE8A 1F9JA 2KOXA 2P5LC 2LHCA 1Q3BA 1STZA 2BQQA 4FJYA 2CEAA 3BR5A 1I7HA 1L4DB 4MGZE 4ESJA 1HQYE 1XXHB 2GBNA 1T0FA 1B8IA 4JBAA 1BA5A 1FPQA 2LLKA 2DDAA 3HKZA 1ET9A 2KC2A 2IAIA 4OVZB 2R0QC 1GUUA 4FJVB 3F8CA 1L1ZA 2KNZA 3NWSA 5LGNA 2VKDA 2GIZA 2MEKA 3U6SA 5DEQA 4JL9A 1PJQA 1HXYD 1S3JA 2DWLA 1IN6A 4C00A 4HDUA 4IM2A 1JHHA 3EIHA 1Y0NA 3ZOBA 3VHTC 4XOTA 1G3TA 3MN2A 4XLEA 4UHTA 1VZ8A 5HG2A 3EGRA 3QPTA 5HLHA 2JWZA 1FBQA 1P1AA 1LFDA 2NVUI 5LLIA 4WXCA 2LASA 2EQRA 3COAC 2OOBB 5LGTA 3FWEA 4MGKE 1VQ8I 2IO0B 1IGCA 3CMAI 4DIQA 1SD5A 3HSEA 2CW0F 3QP6A 1OCRH 2JWSA 5IOZA 3S16J 3W5VB 2L7HA 3T9LA 2E2HJ 2CUFA 3BR3A 3OG5A 1SC7A 2C7HA 3U6CA 5KHDA 5KQDA 1RWSA 2ZW1A 4DWFA 3R2IA 5BMIA 3HB9A 1L6VA 4E74A 4LNOA 3EPZA 2DOAA 3GZ5A 4XLNF 3NY5A 3TW6A 4EOYA 2Y0QA 1C76A 3SZPA 1OQRA 3H7PB 2LVQD 2UYZB 2WBMA 4MGHA 3CIRB 4DDID 2L54A 5D4RA 4E3CA 3L09A 3QPHA 1I50J 4PGHA 4EQQA 4AKIA 3ZYYX 5ILUA 4IF4A 2HYFA 3JRAA 4FA6A 2CHZA 3UGJA 2LF8A 1WXAA 1BC7C 1P2FA 3PFYA 1E0ZA 3VFKA 1SAXA 3LSTA 3V7SA 1R5GA 3OAWA 3RYRA 3CMMB 3CQZJ 1F2RI 2NCNA 3ZQ7A 1GOZA 2M34A 3Q3MC 4MELA 4BB9A 4GDKA 3JREA 4ZH4F 2DZOB 4BJ5C 1Z6RA 1DGWY 2DN0A 1GAQB 2J0JA 5TISC 1Z21A 1YNTE 2QA4I 1VQ1A 3SAWA 4JI0M 4HX7A 2UUBM 2Z8YM 2E60A 3U60A 1T98A 2LF7A 4IL6C 4NSOB 2XN9C 1PJIA 2MCNB 2HQ5A 2GBJA 4XLPF 2KTRA 1UHSA 4OWRB 4W9FA 1YJ9I 3UMMA 1WGYA 1XD7A 3FC4A 2KACA 3WTSC 4EE2A 3AJIB 1OEYA 2LBFB 2SEBD 2GM4A 3EFCA 4JI6M 1YW9A 2DFEA 4BBAA 3NS1A 5CLSA 2X4AA 5BR8M 3F72A 1UHWA 2I1JA 2EIKH 4LNNA 3LXFA 2MJDA 4MEYF 2DZKA 2KXEA 1I4HA 1Q39A 4X66M 5HLTA 4GFBA 3HJSA 4WF2A 2G3QA 5LHHA 4HOBA 3ZQIA 4C2TA 2AL6A 2N7DA 5K5QA 2LRWA 5IOYA 1J5EM 1M4VA 2DKLA 1WM2A 4A90A 2LY2A 4JE3B 4B3RM 2E6XA 4IWOA 5DTDA 1AHDP 1FCLA 2DWNA 1J8CA 1U8RA 4AWJA 3B6AA 2L9VA 4MLOA 2VJ4A 4CQNA 4C2UA 4H0EA 3I04M 2BOLA 3RUIB 1IRGA 1EWCA 1QYRA 4KVGB 4IBBA 3HL2A 1JKOC 2D5VA 1WJEA 4XK4A 1N60A 2LC2A 3BROA 2QCOA 1YIOA 3DU6A 5EXSA 1W0UA 3PRZA 4A6EA 4XDCA 5EYRA 2KW0A 4RAZA 3HVZA 4LD5A 2BXZA 2R7XA 2OOAA 3FTCA 4HKZE 4G7HF 2FIFA 4NXMM 1XNRM 3BVMA 1QOFA 3LJ3A 2M45A 3KZYA 3DCFA 2IRFG 2Z4SA 1PP7U 2LWPA 2B76B 2EKEC 3VLFB 4FHJA 1K52A 1C79A 3RKXA 4WH4A 3WCQA 4HF1A 3ETRA 3KOZE 1Y8GA 3MC9A 2PJRB 1ZG3A 1VTNC 3P63A 1VF9A 1GC6A 3PSFA 3RGPA 3LL7A 3PSEB 2D7GA 1F4KA 3N4MA 1SFXA 3U30A 2INDC 2PMZA 2YU9J 2DA5A 3PUFA 2DPDA 4GDLA 2CGPA 3K9TA 4G6DA 2ESHA 2ZJ2A 1HDPA 4PJMA 1BL0A 1H0MA 2VC1A 4Z2YA 2QEJC 2EZIA 2MR9A 1OR7C 3QPSA 2EBIA 2JZ0A 1WGRA 1GABA 3H9QA 3HKZN 2LFIA 2IS1A 1UELA 5IWAM 2QQAA 1WSUA 2MABA 3RKQA 2E7XA 3AECB 2QHOB 1NNJA 1GHCA 1A6QA 4PJJA 2NAZA 4KZ0A 3AEAB 2FRHA 2OTLI 2DX5B 2PVGC 2E1OA 2Z16A 2PLYA 4LFUA 4L1BA 2WXPA 4C4VA 3HRUA 2O6VA 2IO2B 1WVRA 3CESA 3VKGA 5E8GA 4NZLB 1X1DA 1WHCA 1TBEA 3SC3A 4IVNA 4CYCB 3AN1A 1T5XD 3GPYA 3ENEA 2BHZA 2VQHA 2DOFA 2QC8A 3A33B 3ZQ4A 1RKWA 3HJEA 2BT6A 3ABLH 1VQ9I 3HGIA 4S0RA 2W3RA 3M6AA 2N1VA 4DHJB 2V1NA 4M8MA 4KSKC 2A6HF 1HNXM 2MQJA 1GVJA 1RI7A 3LFKA 2BS3B 5E1ZB 4MHGA 1NVID 1H88C 2KIMA 3MAJA 4FBJB 1MGTA 3FMRA 1O4XA 2FUHB 1R4GA 2WV0A 1M94A 3AULA 3SEBA 3LSJA 2LXEA 3QARA 1IXZA 2XPWA 2BNKA 3HUGA 1R7RA 2XZUA 1OFFA 3U52E 1TT0A 2KZRA 2IYDB 3VYTB 5E6NA 1A04A 2VODA 3KFWX 3AI5A 3BTJA 2XSDC 1X1MA 2JJ7A 2V1DA 2FH0A 3TEWA 2LK2A 4IJEA 2QQ8A 3L2VA 4M02A 1B72A 3SZTA 3VQIA 4BZAA 4GITA 3IRRA 3EIEA 1ZMUA 2NBUA 3H6NA 4NHJA 2VE9A 2XK5A 2VI6A 1IY1A 1RRBA 5J1RA 3L0WB 3Q8AA 4BFRA 3T1HM 4OAYA 1PJJA 3CCMI 1FNNA 4GIPA 5JXVA 1ON2A 4I99C 5CQGA 1G6JA 3NVVA 2O03A 1UF0A 1BVSA 1UG2A 4PD2A 2ECBA 2FAZA 3CCEI 1AYFA 3E97A 2KDEB 4NAWA 1EO6A 2YSRA 4BXXJ 2WY8Q 1WMHB 3ZDTA 5HFYA 1K6YA 2Z7JA 4LFCM 2OCEA 2N8GA 2XAUA 1WX8A 2H09A 2F6CA 1SD4A 4KYWA 5FRMA 5IAAC 4A5NA 5AZHA 1XCVA 4EM1A 4J3OD 3DEWA 5FLVA 3MC8A 1TBXA 4N4OB 2DXIA 2CR5A 2LTPA 2GI9A 5D94A 2XAHA 2BWEA 3P5JA 1ON1A 3THGA 2ZNYA 1X58A 2KDFB 5C2TB 4YY3M 3A45A 2YS9A 4HLXA 2FE8A 4ZYGA 3PZDA 4UUVA 1LO5D 4MGYE 3T5XA 1MMGA 2H5XA 1CUKA 4YEJA 3AU5A 4A5MA 4F3QA 2KANA 2KFKB 3CCYA 2LHDA 2LMDA 2IGHA 1N5WA 1ITYA 3H92A 4EJWA 4IKGA 3H35A 4E7LA 2CFXA 3GLHB 2E1CA 3ML8A 1Z9CA 5E79C 2RQQA 4BU2A 2HPMA 2HTSA 1IXSB 2KZGA 2VBXA 1LDDA 3CCJI 4A2UA 2IVMA 2BB5A 3TOAA 5AZGA 4GDFA 1I4RA 4N9HA 4KGSA 2NQ8C 2LP0A 4JI8M 5C1ZA 3PVSA 3FK6A 3HOTA 1JR3A 2GQQA 4FASD 4JIOU 1KQ0A 3QYFA 2RPVA 1IUEA 3CJNA 4FT8A 3KP2A 3BOSA 4K7SA 5CVUA 1FTZA 4WJOA 1PUEE 1F5TA 1OR7A 2OF7A 2DYOA 1QNTA 3FBIB 4B08A 3B0AA 2COMA 1FTTA 1T95A 4A20A 4Q7JA 4R8HA 2RDPA 4A0YA 4II3A 4DBGA 1YFHA 4EVIA 3Q14C 1LV7A 2DODA 1PVEA 4RGXA 1OYWA 1BJZA 2UV1A 1D1AA 2KFDA 2BS4B 2DHYA 1IV6A 5IP7J 3DPTA 4QTRA 4JI2M 4L8RC 3S1MJ 3ZQCA 2WY7Q 1MW7A 3ZGZA 4TV7A 3VRAB 2YR0A 2Y0TA 3NVZA 2K40A 2P5TA 3DBLI 1SE2A 1FBUA 1XMAA 3F8BA 2Z4RA 2ISZA 2L0TA 2Z0DB 3E7LA 4ZYHA 2EWNA 2V6EA 2G4SA 4LB5A 2NS7A 4UB6C 4B09A 2KZUA 4RAYA 2PBIA 3DZDA 2XGXA 1VZ6A 3L2QA 1HNZM 2M2EA 1FRDA 3F23A 5F0FA 4BDYA 2L7RA 3PXGA 3L27A 3KEOA 1WHUA 1T0YA 1R5LA 3I9V2 4YELA 3KLOA 2NVQJ 2DDBA 1WRIA 2M9HA 4M3GA 3EDPA 5E26A 3SMPA 3T1YM 3TDZC 2M4NA 5GAHJ 2KFJA 3M8FA 4HNVA 4L0ZB 4DR5M 3HPHA 2ICIA 1Y1VJ 1ZARA 4LJ6A 2JYEA 1AUAA 2UZKA 2PJHA 2F4VM 3TEDA 2JUGA 3KP4A 3PSIA 3GLFA 3HOSA 2R2OA 3FXKA 3DQVC 4UV9A 3AEFB 2PFBA 1L6UA 2RN7A 1VQKI 2XV4S 4RF0A 2BBCA 1ZKHA 1P7JA 3BG5A 2BVMA 4ZDPA 3H3UA 4AJYB 1EE8A 3TJPA 1WGNA 4IM0A 4OU0A 4HNTA 3ZLZA 3WTXC 4N0BA 5FD5A 1MJ9A 4KICA 1PUFB 2G9WA 4E7ZA 1TY2A 2EZHA 1BR4A 2DTRA 3KPHA 2YR2A 1N33M 2GLSA 3S2HJ 2K1FA 3P4SB 4HA8A 3VRBB 1Q5WB 5EF6A 1JQ4A 1WE6A 1DGJA 3DTEA 2QUFA 1FRRA 5EE0A 3AFHA 1UH6A 4FCWA 1D8KA 3X2QH 1X2MA 1V9JA 2ESNA 4ZZDA 4RM2A 2ISYA 4P16A 4RMAA 2PE9A 1RU3A 4CH7A 4BXUA 3L54A 2HEOA 4M6YA 1S7EA 4BY1J 2WAEA 3DBSA 4XBOA 1GJZA 2XSJC 1MG8A 2NVXJ 2M7AA 4LNKA 3AE3B 1ORKA 5EQTA 1EFUB 1SEUA 2LNBA 2JF5A 3R0AA 2ECCA 2I5UA 2ZFWA 4CISA 2BW3A 1PFDA 4BDZA 1KSFX 2XPVA 4B48A 1RPWA 5F0CA 3J81Z 2WSEF 3N1ZC 3OYAA 5C18A 3FKEA 5ICFA 1PYWD 1OISA 4RNAA 3WALA 4KKIA 1R2YA 1QOAA 3K70D 2BTEA 1C4CA 4ZHOA 4WWPA 3OYMA 2DHRA 2VBZA 1MSEC 4K3CA 4DV5M 1Q1HA 3RFZB 3J9CA 2XH9A 2V1CA 3FUUA 1ORYB 3WG7H 4EJTA 2L9NA 5E8IA 3PM1A 1JB0F 3HHYA 3ZRCA 1IN4A 2OBPA 3HXLA 1CZPA 2DWQA 3CC4I 2BS2B 2YFQA 1VQPI 4NRWA 5CPRB 2ACZB 4EATA 2LHEA 4LIUA 4ENJA 3ASNH 3JRHA 1MNDA 3DWGC 4HCNB 4HLYA 1RETA 4Y15A 4HPMB 2NVUB 1ZR4A 1U6GA 3CDIA 1G4DA 3TEYA 4BY7J 1S9HA 2XB5A 5EP2A 2LEKA 3RDIA 1QVRA 1UBQA 1VQOI 1WGHA 4DXAB 1LEBA 1GPXA 2UU9M 1F77A 1HW5A 1G4AE 3P4QB 2LGDA 2NBVB 4E71A 4AP4C 4L78A 3SARA 3M0EA 3K4BA 2RR9A 1SFEA 2DOEA 2OPFA 3VVWB 4ON0A 4HLEA 1RM6C 2VB6A 3NVWA 5KPZA 2DENB 3NRZA 1EKEA 1XXHA 4CUGA 3W2WA 3ZJVA 5DYMA 3BPXA 4IHVA 4A55A 4HYEA 4OVZA 1TZOA 1OJLA 4GO1A 1XGSA 4BOSC 3ELKA 5J4VA 3VR9B 2K9MA 4XGIA 4BJ6C 2R3SA 2M5ZA 1JMLA 1JALA 1WX9A 2BF8B 3RFWA 1IRXA 2DVWB 4AYBA 5LXHA 4II2B 4MH8A 4GMVA 2RNGA 1K6OA 1SE3A 1SB3C 1J5YA 3MEXA 2MJ3A 3QA8A 1UWXA 3NEUA 5LD2C 4IHYA 2D11A 1X1BA 1JUMA 3BP8A 3GTLJ 1RR7A 3M3JA 1P9DU 1KH0A 3H9DA 3IWZA 2OOBA 3SMSA 3KYDD 2AEHA 4RDUA 1QDRA 3BXWA 2JPCA 1CQTA 1QDTA 5FD6A 2D10A 3ROUA 1A5JA 1Y0UA 3SYKA 3N20C 5DCFA 1WXQA 3FF5A 1D6EC 3V8JA 4DGWB 3CUQC 3CF2A 5C23A 2DMPA 4FLHA 2VASA 5FTJA 2HAKA 3T6PA 5H6QA 2K3UA 3DQVA 4KDIC 4NC8A 5EXTA 3CO7C 4LG2A 3A9JB 4IO9F 4LJ5A 2JUJA 3R7RA 1YJNI 3HGYA 3HJQA 1WJ6A 1V4RA 1XD3B 1T43A 4F93B 2IPKD 3OS2A 2F5DA 1C3TA 3GTPJ 2ICWG 3H7PA 4LCBA 3DTIA 1WQ2A 4PYUA 2P5KA 5A2QZ 5DPWA 2DMQA 4J00A 1OFCX 1LFPA 3HPGA 2L3DA 1KU9A 1VRAB 3ZRFA 4DV1M 5BYSA 3KOWE 5GAGJ 1TLHB 1V81A 3FTFA 3WU1B 2LY1A 3WAPA 1YUBA 2DJNA 3QU3A 2GBRA 3IHUA 4XM3A 5J18A 1NK3P 1SEBD 3BYYB 4XORA 4NRVA 3CMMA 1YMHE 2Y21A 1XCBA 5C1BA 2EA4A 2M17A 2D1VA 1QGPA 3HDDA 1BI3A 1LJ9A 4BBNF 1FIPA 2XF6A 4BGDA 2ZFUA 2LFBA 2BZTA 2KL4A 2HDWA 5IT9S 2KRFA 4RAGA 2DK8A 3DBHI 1FY7A 2ID6A 4RMNA 2NPTB 1Z91A 3O13A 2F5PA 4P7IA 2KLCA 2KKCA 3AOEC 1VLBA 3U2SC 1VG5A 4NNJB 4RM8A 2CHGA 3ML9A 2XSZD 4B4CA 2W4SA 2BYEA 1ZH5A 3M3YJ 1IBXB 3BQZA 3MZHA 3QU6A 1P98A 4DV3M 1ACIA 4CSWA 2K85A 2LBFA 1IXRC 2K6QA 2VT2A 2I7NA 2LG4A 1P3QU 2LSOA 1SFUA 1OIPA 4KMUX 1K7AA 1XB4A 1TS3A 1FOXA 1XX5A 2VKVA 4NY0A 3WE2A 2COBA 1QVTA 4FX4A 2RREA 1KOTA 4DV4M 2CG4A 5MPOA 4K7WA 2NXNB 1ZDVA 2OJRA 3GTKJ 2LNHC 1QPMA 4CYDA 1Z2MA 1SXJC 4OHJA 2EKFA 1S5LC 2V4JC 1B9RA 3ECOA 3G1OA 1IG7A 1SJHD 5L3EA 3TWMA 4IBKA 5L3BA 1Z5CA 1V1PB 2OO9A 4L9TA 5ICCA 2VXZA 3ZR8X 3TCAA 4I6NB 5K7ZA 4HCPB 3SXYA 4MM3B 5FTMA 4CIZA 2LBCA 1ZGAA 2IGGA 3E5QA 3MHZA 1P4WA 3LSGA 4A0XA 1MBFA 1ETVA 4CCMA 2HOSA 2ZNVB 2RDBC 4LG3A 2BY3A 2VBYA 5D5WB 3GOEA 2VPLA 2DJIA 2L7ZA 3IHPC 3HRDD 3PO3J 5AEKB 3EYYA 4HK2A 2AL3A 1D3YA 4CCOA 5FB2A 2D5GA 4LJZF 2CO5A 2LGIA 4XN0A 1YQBA 4NL4H 3RN9C 5DD8A 1L2NA 2ZAOA 3KCCA 4DHZB 1R23A 4ZDVA 3OSGA 4BKGA 3L29A 3H1CA 4QPQA 4MJSB 1C0WA 2JX5A 2R18A 3GLIB 5JZEB 2PJRA 3KOXE 2O61A 4L5JA 2NMQA 3MKYB 3A46A 3GFJA 1BI1A 2QILA 3C9PA 2K27A 2B3AA 1MMNA 1MBEA 5G5HA 2JY6B 2AXLA 4BYYA 3W3CA 4XBFA 2V7FA 1WYGA 1L3LA 4N59A 5HI1A 3Q3SA 1WI0A 3K4KA 2E1MC 1TGUA 1GVDA 4AUXA 2RDHA 4ETSA 4AW4A 4FADA 2H89B 1PRBA 1G71A 4IIWA 2P7CB 3RSNA 2BV6A 2GOMA 2M8SA 1KYZA 5J8FA 4FJZA 1IP9A 4HX4A 1MKMA 3KYCD 1KA8A 3M62B 4MT5A 1CGPA 5K7FA 5T8IA 3E0JB 4X0GA 2QHOA 3FAHA 5K5OA 1HEZE 4C80A 1HE8A 3PNTA 1ZQ3P 3ZGKA 2RGFA 3RJPA 4URKA 3BVGA 2BWES 1K4SA 2WSFF 4U7DA 2REXA 3C7JA 1ENFA 2AWTA 4R1HA 3RULA 2EIMH 4NBQA 1PYVA 3SYLA 3OIPA 2QKMB 4CYCA 5G5GA 3PRMB 2KRKA 3B08A 1EM7A 3ZMSA 2VBWA 1HKSA 2ZCBA 4M9XA 1HZ5A 3Q8XA 3N05A 3OYJA 2UXBM 3ZN1A 3A2KA 4PK1A 1K3XA 3IAS1 4ZTJA 2LVNC 4S0HB 4L9VA 1BI0A 3ZUNA 4XONA 4ANUA 1V6EA 3M07A 3VYUB 2W25A 1WGXA 3KFUG 3LVVA 1KF6B 5AUKA 2DAKA 2QEXI 2IA0A 2LRDA 5GPCA 1TW2A 3GB1A 1JR3D 2Q8KA 5DD4A 4TV3A 3H5AA 2CRUA 3H5RA 5DCMB 5DPRA 2JYTA 4DYQA 2CS3A 1YITI 1FXIA 4LF7M 5F6FA 1VCBA 4OZBA 1B9MA 3AEGB 3GFMA 3D8LA 1LTMA 4ZYNA 2IXSA 2F48A 1MVKA 4X1EA 3L2RA 4ASWC 2DT6A 2ZM6M 3H36A 1D0KA 3ZN0A 1WWXA 2KDOA 2VQGA 1J09A 4S04A 4TUWA 2IGDA 2I1KA 3PJRA 1KM7A 1KTKA 5DYIA 1W5CC 2ERCA 4WWNA 2O8KA 1RLFA 1D2NA 2FIDA 2JVHA 1CK1A 1SFKA 2ZMEC 4TUUA 2J7NA 1PGYA 4Q48A 1TF0B 5FJ8J 5KHQA 5ITRA 2K7LA 4BAXA 3KS4A 4ZPXA 1WMHA 2HVRA 2W82A 3KYDB 1VI0A 1HOMA 5B3SH 7CATA 4PZJA 3BJ6A 3KWLA 1K83J 3OYKA 1L0YB 3PO0A 1IY2A 3KVFB 1YIJI 2IGKA 4WAAA 1TWGJ 3OMYA 2C5RA 3W9CB 3W0LB 3QC8B 2N9KA 5ILSA 1JKRC 1IZ1A 1RC9A 3GYHX 2BY2A 4L6V6 3W6JB 2H94A 5IT9Z 1QBJA 4QNMA 3H0GJ 3Q9SA 2PG4A 3CCRI 1GO5A 2G7UA 2KHWB 3B2GA 2CUEA 1XSXA 2VJJA 1NI2A 1N32M 1BM9A 3BTLA 4ZDOA 1LQBA 4XL9A 4JI7M 5EEHA 2ZB9A 2M4GA 2KFKA 4HF0A 4C56C 2LVQA 3APFA 2KNAA 4XOPA 2HXOA 4UB8C 5JHFA 2EA0A 5HVQC 3ZMZA 2IO3B 3PGEA 2X38A 3GRUA 3GLHA 1K50A 2OC6A 4HLQA 3P9IA 4M72A 4EUTA 3CWIA 3A03A 3NRVA 1GJSA 1IXSA 4LIVA 2DAMA 9ANTA 4A3DJ 2H6BA 3GE8C 3DWMA 2R7VA 4G9YA 2ASQA 1L5PA 1ZE3D 4IC7B 3CSFA 3DP7A 3PHWB 1ZG1A 1OGWA 2IW5A 3DBLB 4V19K 2W3SA 2MBOA 1Z1DA 2XKPA 3K10A 1YQ3B 1X37A 1H9TA 2HWVA 3H3VK 2DMTA 4D82A 1AU7A 4IWQA 2WB1N 4M3BA 1V5OA 1H6UA 3F8MA 2I38A 3QAQA 5EE1A 5CVIA 1VZ0A 1XLOA 2R7WA 3IRQA 3VPRA 2ZANA 3EQLF 1UCRA 4KJZA 1QVUA 4OMYA 1UZCA 4GHAA 1V2YA 2ME6A 1MSFC 3HHXA 2X51A 1HQCA 2YX7A 2R61A 4RLFA 2JRMA 1TC3C 2C99A 4BE1A 1RKTA 3I5JC 4LRSA 4Y13A 5L3DA 3DHGC 1ZN2A 1ZREA 1X4PA 3R8BA 3C2GA 4IEJA 3K2LA 5EEAA 1IN5A 2HNHA 2L0FA 2A07F 3A0BC 4E6KG 4C30A 1OYIA 4I6ZA 3CF0A 4GSWA 4YFNF 4HVBA 2VIIA 2L0KA 3F21A 1RIOH 3I4MJ 3CGWA 2DZIA 3PUBA 3TP0A 4HQEA 1SG9A 2CUJA 2L05A 2XAQA 4FX0A 1HZ6A 4UUSB 2YEPF 5J8CA 5HDKA 3OYHA 3U1DA 1UZXB 2HKOA 1QPIA 1HTQA 1FP1D 2LXAA 1YI2I 1TQPA 2VH2A 4RGUA 3HHWA 4EFOA 1MH3A 3K9PB 1PJTA 2FNJB 3WTTC 2KWUB 2N9XA 5ICGA 2AO9A 4GKKM 4W9DA 3FUVA 2RV8A 4P1CC 3V60A 3F6OA 3I55I 1D5MC 3UF8A 1D1CA 3TKYA 1F2RC 2L7FP 2NNYA 5LMNM 1DUXC 1MJGM 2L4EA 3I64A 5BPDA 4FWDA 3IH2A 3BK1A 3D5RC 2C6YA 1KONA 5EDNA 4IX7A 4BACA 1MBKA 2MX2A 3ONQA 5J2RA 2DYSH 2ZSHB 3O3KA 3QODA 3U6QA 1YLFA 2UXNA 3K0LA 2Y5PA 4NC6A 3LSIA 3SFIA 3FYCA 2IBIB 3TP3A 2FBWB 1W36C 1E90A 2N7JA 2STWA 3P9KA 2LOOA 2EFWA 1ERDA 2E7WA 4AUQC 4IHWA 3QP5A 2WP9B 1PUFA 1KYWA 2XROA 2M19A 2HR3A 3BZCA 1V5FA 3R0JA 1R1TA 3OS0A 1TP4A 5J47A 2VONA 1KQ9A 4AG6A 2KRHA 3NAUA 3JRIA 2V9PA 3HTUA 1TR8A 3RCOA 4QHSA 3OYEA 1C7YA 1VR9A 3P1MA 1H8AC 2EKIA 4FN2A 5LHGA 1YW8A 1BT0A 3I59B 2X1CA 1HBXG 1ET6A 1LDKB 3FXJA 3BZKA 5JHUA 4M6VA 1TWFJ 3GXOA 3WHKA 2PMHA 1XN7A 2KQ4X 3KSXA 2Z99A 3OIOA 3G73A 3KX2A 4KKJA 3EYIA 4JX6A 3UZUA 4BEHB 1PP8F 2FCSA 1MPEA 2LGYA 2WLBA 1S7OA 3GLGB 3KYCB 4BH9A 1WH7A 3BG6A 1XMQM 4HPPA 3FTDA 4D0PA 1W7PB 3T8RA 4IJFA 3KWVA 2ONQA 4AIDA 2JT4B 3KOYE 4YT0B 5DPSA 1SF0A 1JRPA 1NYQA 3LCUA 4BBSJ 5DM7F 1FYLA 3V76A 4MDKE 2DBYA 2QSGX 4MTDA 1MMSA 1AW7A 2GBMA 2XVCA 2J52A 4RGOS 5TSSA 1PGAA 2K3FA 2RKOA 3EECA 2DYBA 1KLVA 4CJ6A 1F36A 3D32A 4LFBM 3CCLI 2RDGA 2WXNA 3A42A 1ZGUB 2Q1ZB 4D7MA 4D2KA 3EUHA 1RFAA 1IC8A 3L26A 1NSFA 3IP4B 4BKSA 3JAMS 3HOXJ 4ZYDA 4RH6A 4PT5A 4KHPM 3V7RA 3RD2A 1EH7A 1HKTA 4ZRKA 4ANVA 1D0ZA 4I8OA 5J6XA 2HS5A 3TUOA 2JQ7A 3RQ4A 1KFYB 4F91B 3CDLA 1VQ6I 1QAOA 2JA6J 4HDQA 1YQ4B 2M60A 4DXFA 2HOAA 2C9CA 1E0EA 1V33A 1NJGA 1FOKA 5EP3A 4ANJA 1QUTA 3BWGA 3OYBA 4HF2A 1UFMA 1A6IA 1T38A 5BYQA 2DENA 4YG2F 2R46A 2ZNVC 1C77A 2H6CA 3MK6A 3CO6C 1DYQA 3S15J 4IXAA 1WXSA 2CMPA 2NOGA 1D0YA 3GTGJ 5EDSA 1XMOM 1OTRB 4DR3M 2HVSA 1I4PA 3B7ZA 2N35A 1L2DA 1ZKGA 4US8A 3V6CB 2FCQA 4IBDA 3BR1A 4ZRPA 4II2A 1K8RB 2CE7A 3AE5B 2Y30A 4L4UA 4WX9A 3B7NA 5J17A 1D0LA 4MH0E 4W97A 3KEYA 4A3KJ 5CYVA 1FCCC 1JR3E 3VFDA 2V3SA 1JTYA 3R9XB 2M5WA 3J27B 1J0GA 2L09A 2R7UA 4M0WB 4FVMA 4CHTB 5J1UA 2JA8J 2OCCH 2LR8A 1D0XA 1Z3YA 3RZFA 2MRPA 2EJSA 3DTKA 1E8ZA 1NHWC 3RI7C 3F3XA 2R7DA 1N62A 5JVGF 4IW0A 2A6TA 4ZOHC 4RLQA 2DK5A 3A9JA 2HVQA 2ID3A 3DBHB 1MBJA 4M00A 1DGHB 1O57A 3DFGA 3K4LA 5DPTA 2DA6A 3PRPB 1IBLM 5A2QK 4A3GJ 1MZBA 2J7OA 2Y5BB 3AH7A 3WGGA 3VDXA 2WDQB 3FXUA 4O6JA 3AV0A 4EZKA 2R7TA 4GC9A 3GFIA 4XRFA 3IKTA 2X1DA 2V9HA 1LKXA 3CUOA 2TDXA 2K0PA 2EV5A 1TH3A 3HKPA 1SFOJ 3HX3A 2JK3A 5FGMA 5FLXZ 3K70C 4HPQA 3BZDB 4PYZA 4IOCF 3HIZA 4JWSC 2CV1A 3OR2C 4FULA 1JT6A 5GTHC 3ZPLA 5C4JJ 4FWHA 1WFYA 1IDYA 1VQ4I 2L7MP 3GRRA 4WAFA 4JI1M 4MSQB 3L28A 1Y8RB 3G3ZA 4G12A 5AIQA 1YJ1A 3RE8A 2GXGA 1IBMM 1WPKA 2M1BA 3FRIA 5HHDG 2J4XA 2C96A 4LLLA 5F1RA 2VUMJ 2HE7A 3ZMVA 4I5SA 3RPUA 3GUDA 4FETA 4AVZA 2NS5A 3L10B 3ZQQA 2X6OA 3HZJA 1B59A 2OZUA 2QGUA 1ZTRA 1VQLI 3OV8A 1C1YB 2CQXA 4ICUA 2NPTA 2C9OA 4W9LA 2VPRA 1VNDA 4IM3A 2W1OA 3C2BA 4BAYA 4NNJA 2LI5A 2Y0SN 3PREA 5E3MA 1R5HA 1MMAA 1KU2A 3HG9A 4JGHB 1IBXA 3I57A 2KX3A 1PUTA 3F0CA 3KS8A 5F1JA 2JA5J 2WDVB 3V6EB 3NZUA 3KW5B 2WX0A 1YE9A 1OCZH 1JTXA 5LRRA 3PVLA 3GFLA 3R3MA 4YWGG 3W1SC 3CZ6A 1EUVB 3M8EA 3HM3A 1E9MA 1XGMA 2M30A 1GL6A 4ZJZA 1NBFC 5CVRA 1J9IA 3L16A 3TO9A 5FLMJ 3Q5FA 1YS6A 4W9EA 3M4OJ 4RB2C 3DPDA 2KD0A 2JVCA 2KP6A 1G3IA 1F4IA 3KDSE 4OMZA 2KVRA 2X6XA 1K79A 1FJGM 5D3DA 3ZCBB 2EPFA 3DBRI 4XGAB 2B7EA 1I1SA 3OLMD 4IWPA 3DA1A 1YQAA 3LNQA 2QCUA 2HU9A 3SDGA 1DQUA 1DOYA 4UVCA 3K7AJ 4IBIA 2EFOA 4B3SM 2JZPA 1WJBA 1T39A 1WCMJ 2L7KA 1V1PA 4TQ1A 2BY0A 3ZIMA 5BMHA 2D7HA 2DAFA 3VUWA 5CJ9A 4MM3A 2ZZPB 1I94M 2CP8A 3DFZA 5ICEA 3H9GA 3IWFA 2MW5A 4KGRA 3BCAA 4NUBA 5IKCM 1JWUD 1RZ4A 1GKIA 1R58A 4P9FA 3RZWC 1J19A 2DLBA 2N9LA 2GOXB 4IQ4A 1OFIA 4IJAA 5IT3A 3RNAC 1OMIA 3GQ4A 3CMEI 3TDUC 3VAWA 1R71A 3HOUJ 2MLGA 4Q4ZF 4DR1M 3HTSB 1LGRA 2DAGA 4CHUA 4GKJM 4L9NA 1YIWA 4NPNA 1G3SA 5F27A 2GLOA 4MJSA 2EK5A 2QF7A 1U2WA 3GLIA 3NZ3A 1IJWC 1U9OA 4LGMA 2ACJA 3UK6A 3LQRA 3AG1H 5HKHA 4XLHA 4N9F4 3H1UA 2KLOA 2VH1A 4QSHA 2BJVA 2KJRA 3TL4X 2CV2A 3SBJA 2RVCA 1RR8C 2JY6A 3EETA 3WHCA 2LVPC 4U0YA 2WZJA 4XKVA 1Q1VA 4LK1F 3OYIA 2R92J 3OS1A 1TY0A 2DYMA 1N34M 3KVWA 2LGSA 3QWZB 3BY6A 3ABTA 3AM9A 5IP6A 1QA6A 1SXJD 1JKPC 3HUIA 1MG4A 5C3JB 3ZQLA 3MFGA 2P4WA 4A3BJ 1XXGA 2CYYA 3KP5A 1CMXB 1ZYRF 3RKYA 4JQFA 1K82A 1T33A 2Z2SB 4DR2M 1R1VA 3BCBA 4MQVA 5H92C 1XXHE 3SAUA 3HOZJ 3GPXA 4FTHA 1L8QA 2WU2B 3CJQB 1ZMVA 1UD7A 4UV8A 1NV8A 1QOGA 3OTOM 1HR0M 1QHGA 2HOEA 2M8EA 4I2OA 1J7KA 4GYIA 4WXDA 4ENMA 2HHHM 2P7VB 2K0BX 2IS2A 1JJ8C 4C3JJ 2QQ9A 2BWFA 1JWAD 2PIAA 2QLZA 3F9KA 2O7OA 2KT0A 3S2AA 1E10A 1N75A 3C8YA 3JAMK 2EV6A 1FJLA 4BE0A 3HY5A 2UUZA 4R7GA 5JR3A 1JJ6C 4X65M 2AQ2B 4L0YB 4S05A 3BOQA 1EU4A 1SBBB 4MFEA 2WX1A 2J5YA 3PIPF 3OL3A 3KP0E 5E1XA 3EHVA 4RGMA 3Q0VA 4F55A 3R66C 4LOCA 1ZRDA 4EZLA 1X4OA 2VF8A 4A3CJ 4B3XA 3E6CC 2GNOA 4W9KA 2VOOA 2QPAA 4HX8A 2KISA 2WC2A 1Z5SB 5EJCA 4UNOA 1Z05A 2D45A 4A3EJ 3HSFA 2QSDA 2R7QA 4KA4A 2DO7A 2OTJI 3V05A 4F7ZA 1E6EB 2KWCA 5FKOA 4RKUF 2YQZA 4G6QA 5DCMA 1MNMC 2FA5A 3H0DA 2K6BA 4LJ9A 3W1SA 1WJ4A 2K9NA 3GP7A 3N1XC 2AS5F 4AQYM 3DVNU 3OOPA 2Y69H 4KGTA 3A4CA 1IUFA 5BPIA 2QQBA 4CO8A 3Q3FA 4ARCA 1N5XA 2KJHB 4JWUC 2MBFA 2DWZB 5J40A 3AG4H 2HKXA 4IOAF 1XCTL 1B1BA 2RMMA 2DMUA 4PFPA 1IDZA 3RKWA 3NARA 4Q5SF 1Y39A 1XO3A 4W9JA 3PHXB 1QQRA 2K9XA 2DYRH 1V80A 3C19A 3I4NJ 5ERIA 2RQPA 1BMLC 3EC8A 3HYIA 2ZNZA 2WA0A 3KUZA 4R3DA 1TDHA 4W1UA 1FFUA 3IL2A 4M73A 1V5TA 1BXTA 3IAS2 4B7GA 2W84A 1TGZB 4Q2JA 4DYCA 5LNK1 1APLC 5KK1A 4NQKE 3TEXA 3R61A 2LDUA 4BQNA 1QLBB 1WIAA 1Q3CA 1B6AA 2DHZA 2XUBA 2IPQX 1V34A 1L0OC 3T8MA 4XLAA 2G1EA 1EF4A 2OAZA 1VQMI 3V4GA 4H2AA 3KH0A 3AG2H 3Q8FA 3P4RB 4AG5A 1SD6A 3BVZA 3I4YA 1J2XA 2CS4A 3NVYA 1BR1A 2IEKA 2WAQN 2EV0A 3TOBA 3U7ZA 3GO8A 2LVAA 2BGCA 3L9FA 1TWAJ 4MQ9F 4IKFA 2KDLA 1DP3A 3DVGY 3J7ZI 4AS1A 4ICVA 4DUYM 3AEEB 1XMXA 2QJLA 4LY6A 5D7GA 1IBKM 1QO0D 3UIPB 1E9RA 3ECIA 1TL8A 3GLLA 3FHNA 3LA2A 3ZXSA 2D07B 4ITVA 1WJ5A 1J7BA 1HA8A 3KSJA 2K86A 1XPXA 2MH7A 4KIFA 2L2DA 3AG3H 4LNFA 3FXLA 2JXTA 2EMTA 3H3ZA 5HDNA 1YJWI 2DFIA 4EKUA 4JI5M 3GWZA 4X57B 4GIVA 2R7ZJ 2RNJA 2XFSA 4DNCA 5JLWA 4K1RB 2XSZA 4WJQA 4MGRA 3B1LX 5JHAA 3MKZA 4YTNB 4M71A 3F22A 2DA7A 3KEQA 4A6QA 2K9LA 3CUQB 3CCQI 3J80Z 1XF5L 3G4SI 1LPQA 2F4OB 4J19A 2EUCA 3VEPA 4PK4A 4EV0A 4G4OA 4B95A 3DVNV 3V8KA 1MHHE 4K2EA 2K02A 4LGWA 1WGLA 2DAEA 4LJ8A 1TKGA 1E7PB 2AQ1B 1S7AA 3NS8A 1IAWA 1BW6A 2FF4A 3HHGA 5JI6A 4G4RA 1Z6TA 4UUSA 4IQJA 2BXYA 2QWWA 1OQQA 1J7CA 5EP4A 3AKZA 2DFHA 1GDTA 1JQJC 3RMKC 2WXRA 2BYFA 5D8LB 1WE7A 3SFEB 2OD5A 3AE7B 4H4KC 5M5YJ 1EH6A 1TNTA 3VODA 2KDZA 2KHHA 1WZ3A 3CC2I 3TBLD 3ZNHB 3K9PA 1XDSA 1XT9B 2IDYA 3H4JA 4I6PA 2VL8A 2C5LC 1V5EA 4U88A 3M9AA 2MHJA 2C9WB 2GA1A 5DV5A 4KMFA 4Y28F 2L52A 2FNPA 4MO7A 1C4PA 2AX5A 3A1YA 2KK8A 1HJPA 4BKSD 4FW9A 1JRUA 2X8AA 2X9DA 4EEFG 2E19A 3RTRA 2KN5A 4PSXA 1UFZA 2NS8A 2X4HA 1XMKA 3KYLA 4LG0B 1R5ID 3ASOH 5L95C 2C98A 5F0HA 1NY5A 1AIPC 3PS6A 4OX9M 2QVOA 5JLXA 5ITXA 3A0HC 4USAA 3ZQFA 2L1AA 4LNIA 3T3OA 1U5TC 4KN7X 1WX7A 4HBLA 3LB8C 3BG7A 3JSPA 5HDGA 4CXFA 1A70A 2V3NA 2X8XX 4RF1A 3LA7A 2EKKA 2VF7A 1JWMD 4HRIA 3SFDB 2K9DA 4ZYSA 1RYJA 5LXIB 2VXDA 1R7SA 1EWYC 2WNMA 2QZ4A 5KO3A 1YRNB 2XAFA 4I6LB 3G6EI 5D3IB 2Z3XA 3TEZA 4RB3C 4GN1A 2O3FA 2ELJA 4PFOA 4EZJA 2V4IB 3I59A 4GH9A 3JW0X 1KFVA 1F52A 1Y8RC 5J1YA 3VOEA 1FPYA 4LMYA 4PSWA 5FTNA 3WAOA 2MH2A 5EXXA 3N30A 1SXJB 1LXDA 4UXNA 1UAAA 3O6BB 1G2HA 4BOZB 2A69F 2K5PA 1NENB 2IY0B 2ETHA 4HG2A 3IKVA 2PLPA 4LF6M 4BEHA 3JSOA 4Y52J 1FOWA 1LE8B 1IY0A 1K61A 3GLGA 2Z1DA 1MJBA 3MQ0A 4BHBA 1I39A 3SDBA 2KXJA 1WZ2A 2FQ4A 5FKNA 1W7PA 3C0RB 2L5QA 4C3HJ 3TQNA 2UXCM 3I9V1 3K2ZA 1G59A 2K8CA 1USSA 2KTFA 1YYVA 2R7OA 3D5SC 4XK8F 2RKHA 3OYLA 4I4LA 1TS5A 1W36D 2L3ZA 4WQMA 4NB5A 1RESA 2XRLA 3ZQJA 4GB9A 1FP2A 1WJAA 3W6VA 2EJRA 3SYTA 5HS8A 3BTCA 2GQFA 1XLNA 5CHWA 3PLUA 1VEKA 1GC7A 4B9KA 4ZHPA 2L83A 1FT9A 1FMVA 4IBJA 3PO2J 4HZFA 2H8RA 3B73A 4ZZLA 4EJVA 2HWJA 2DCEA 1R9TJ 2M0XA 2VLAA 3SHGB 3BR6A 5D5UB 3C1DA 1AWCA 1W5TA 3LAJA 3R60A 3FXRA 4BQQA 1QU3A 3FXMA 1X3UA 2BEOA 4UDUC 4WWMA 4XKWA 3OJ3A 1SIFA 3A1QB 3FM3A 4BVUC 3OYGA 3WGIA 2QDFA 2IS4A 3MD2A 2L02A 1TH2A 5FO5A 2E1MB 1I4GA 3ZP5A 2WDTB 1ZOYB 1ZPSA 3RPUD 4HJKA 3K4NA 2VKHA 4HV5A 2UXXA 1SSNA 1DPRA 4KT0F 1GL7A 4AU7A 1P4AA 1BC8C 1L0VB 3GLHE 1HT2E 4YIRX 2OQRA 1OTRA 3SD5A 3FTEA 2DW4A 4C7ZA 1T6SA 4KODA 5HS7A 3JRFA 1TWHJ 1Z5AA 1WM3A 2R65A 1HTOA 2KWVB 2D2QA 3IG3A 2JRTA 1UNSA 3QJZA 1FX7A 3IH3A 3FRHA 3TWLA 2JU6X 4DBRA 1X1AA 4N6EB 3BJOA 4ANWA 5BMGA 4QIWN 2R5YB 3B9PA 2LXCA 3RPFC 2DLLA 4HROA 1HLVA 3VDPA 1G6NA 2D3AA 3N3KB 3JRDA 2LUMA 3S93A 3TW7A 2K39A 4M0WA 4U87A 2KJCA 4HRSA 3VKHA 2DA4A 2I2YA 1E3HA 1NI3A 3Q0WA 2X6YA 2FD5A 1CF7B 2PMZN 1FFVA 1WGDA 3R7QA 3ZQGA 1ZXHA 3WTYC 2V3PA 1MJDA 4ZC3A 2KQRA 4BS9A 3K1PA 1SVOA 4HDVA 2JWUA 2FOIC 4C3IJ 1DGHA 3I51A 2NTTA 1OPCA 1YJJA 2VN2A 4XWWA 3S32A 1ZRCA 3RGSA 3GQ3A 2DFFA 2EA2A 1PDNC 2OA4A 2FU4A 3VH4B 2FCMA 3JR5A 1NG7A 3S1NJ 1J59A 3VH3B 5G2NA 1E7VA 5FLXK 3IVFA 2YPRA 1AWDA 3ILKA 4PUSA 2ZKZA 2LY9A 2X49A 3BR0A 3B89A 2HCBA 3N1YC 1OIZA 5IO9A 2FBIA 4A0ZA 3OYFA 3IH4A 1A36A 4M3FA 4IPAA 1T8IA 2LKPA 4LF4M 2J7QB 2MBEA 4CGYB 4IHSA 2LKXA 4A8XC 3ZTDA 1X3ZB 1T0RC 1OKRA 3ABMH 2HDDA 5CVVA 4DZJA 2INNE 1XDUA 1YOVB 2FMYA 2JP7A 2ZMEB 1KU3A 1ISNA 3UJNA 1FNWA 4YSYB 1UGMA 3WA0A 3DBRB 5JI3E 1TS4A 3B7QA 3L08A 2UUAM 3JRCA 3O65B 1IRFA 2FXAA 4AC0A 3J7AS 3W1YA 3CJRB 4DQ2A 3GF2A 3GPPA 2MP2B 3S3NA 3S17J 4KO8A 5LGUA 5DFLA 4IG7B 1ZQ9A 3IV5A 3JTGA 3R2TA 3HHZA 4M9ZA 1E8WA 2MWSB 3I3LA 2PEAA 3DPLC 2DT7B 2KVZA 2WXFA 4FWGA 2VC0A 4HSRA 3LSHA 2XPUA 5FKAC 3IAM2 4I76A 1ZLJA 3S3OA 3ZDMC 3C3WA 5GPAA 2B63J 5JVTA 2HDEA 5LFAA 4A3PA 3IT6B 3E5UA 4CHKA 5B66C 4BNCA 3H8HA 4CGZA 1FXTB 2EINH 2LHGA 3KP7A 1IYFA 5F08A 1SVLA 2A6EF 3ALBA 3WHBA 1Z7LA 1U78A 1UUPA 2ON8A 2BJWA 4BL0B 2K47A 2UXDM 1V54H 3GTJJ 1DGGA 1HSTA 2Y20A 2V1YA 1EA3A 3D0SA 2L8JA 4DR7M 2EFPA 2IGMA 4L23A 3JW4A 2KZVA 3FUWA 5EZHA 4XLFA 4AIKA 2O9LA 2GRIA 1NYRA 3CP8A 1UGJA 1GT0C 3DKWA 1X2NA 2GA2A 2Z9OA 2J5PA 2V26A 2KA6B 4X62M 3Q9VA 2N9PC 1XCQL 4WJPA 3TBIA 1LUJB 2DWMA 2E5LM 2J42A 4X64M 4OIPF 4JYKA 2G0EA 3SAVA 1Q02A 1YX6B 4BLCA 5BS6A 2C7NB 1MNEA 4RFBA 1HQRD 3QAUA 2W55A 2NYXA 1SAUA 3HGGA 3ML6A 2KDBA 1H8CA 1QZEA 2JZ1A 2JQRB 3K4CA 1QILA 3NUHB 3K1MA 2C60A 2F5SA 3H9JA 3HBLA 5HOOA 3P2BA 2F5QA 3U21A 3DF8A 4IBCA 3L2WA 4YIFA 2E2IJ 2MLKA 1WYWB 3JCUC 4PDKA 3FMSA 1FO4A 1RFKA 1WR6E 1AA7A 5H8YE 4B7HA 1MU5A 1NO1A 1I3AA 1TT5B 2R44A 2VJIA 2B3TA 1T3TA 2VT3A 3PFIA 5D6EA 4G6TB 5LRSA 2WQYB 2JWTA 1FSHA 2HI3A 2Z3YA 3FUXA 2NR2A 4HV6A 4ACFA 3ZJUA 4OINF 3WAMA 4UY8I 3VUXA 2MW8A 2LYCA 4YHHM 1IPGA 1EV7A 4XRMA 2A5UA 3K4JA 4AIJA 4EGYA 2JUCA 2WWYA 4ESFA 2A4ZA 1ZXIA 1T6OA 3K1JA 4LF8M 1FLIA 4JLCA 2RGVA 1LB2A 1L2CA 1E9SA 4CCLA 3WGHA 1Y1WJ 3ECHA 1JCKB 3AL0B 3A4SC 2P6TA 1P6RA 1V1OA 4FHKA 2G5GX 2E34A 4HPLB 3EUAA 1JE8A 3DOAA 4BE2A 4NQLB 1ODDA 2PX9A 3A98B 1HW2A 2O8XA 5KAFC 4HJGE 1T0SC 3JSVB 3ZTCA 3QYEA 1S1QB 4ASNA 3I0TA 2Y9ZA 4I02A 1MI0A 2SAKA 4WQOB 3B6CA 2R62A 3MWMA 4B8XA 1IQPA 2Y2ZA 3ABKH 3RYPA 5HLIA 3PIOF 3QX1A 2IO1B 3BBZA 2HD5B 1D0MA 2NNNA 4FD2A 3AOGA 5B1AH 2LTUA 2HYJA 5FKLA 2OHFA 4A3FJ 2HZTA 4EM0B 2IY1B 2ZXIA 1N78A 5CKTA 5IREB 3SASA 3L2AA 3S1RJ 1SMYF 5JFRA 3J7AY 1IN7A 1BBYA 3ZXVA 5IYBJ 1I3QJ 4CICA 4OVUA 3VTWA 2KJBA 3Q3NC 2XFTA 1YO5C 4KUMA 1WZ0A 1PGXA 2WYQA 4AWXB 2J0MA 3IECA 2KMCA 2R5ZB 2YEPB 1XB2B 2JZ3B 1QAMA 2H88B 2UU7A 3L13A 3U5ZB
chains in the Genus database with same CATH topology
3VRAB 2K0PA 2CV0A 2YR0A 1FEHA 4JI4M 2Y0TA 1TH3A 3HKPA 3EUHC 1PJRA 3NVZA 1R2ZA 2P5TA 1SE2A 2XF7A 3K70C 2Z4RA 4HPQA 1HNWM 3BZDB 3L2UA 5EE9A 4JWSC 4B3TM 2CV1A 3OR2C 4FCVA 2V6EA 4FWHA 1QAQA 2HL7A 4LK0M 2KZUA 3GRRA 4WAFA 3DZDA 4LJAA 4JI1M 3UR3C 3AMZA 3L28A 4D1QA 1VZ6A 3L2QA 1GB1A 3BWUD 1HNZM 3U61B 1FRDA 5FSWA 3EUKL 1ZP0B 4BDYA 3RE8A 1IBMM 3PXGA 3L27A 4GDLB 3FUTA 3TWKA 2BB6A 1P9QC 5HHDG 2J4XA 2C96A 3I9V2 4YELA 2W7NA 4I5SA 4FETA 4AVZA 1YN5A 4QOSA 3ZQQA 1WRIA 3Q69A 4B43A 5FLXS 5E26A 2KZSA 2CU3A 3SMPA 1YX3A 2VQFM 5HNHA 3T1YM 2C9OA 3FILA 4XNFA 2W1OA 5IZ7D 4WIPA 3SFZA 4DR5M 3HPHA 2ICIA 3AE2B 4NNJA 4LJ6A 1Q10A 2JYEA 1XEEA 2CW7A 4C9YA 1UELB 2A5WA 1MMAA 2F4VM 4MACA 2JUGA 3PSIA 3HG9A 4NQWB 5DYGA 1IBXA 3GLFA 3HOSA 3I57A 3DQVC 2WS3B 3TSSA 3AEFB 1L6UA 1PUTA 3KS8A 3CTWB 2WDVB 4RF0A 2BBCA 4E7KA 4ZDPA 2BVMA 1EE8A 1QT9A 1YE9A 4AKGA 5FTLA 4HNTA 2DZNB 1TYGB 4YWGG 2K5CA 1KLGD 3CZ6A 4LZJA 1AN8A 2XZFA 1E9MA 1QZMA 3DEEA 1GL6A 2V6ZM 4E7ZA 4ZJZA 1TY2A 4YTPB 1BR4A 4B7FA 1N33M 3MC0B 4Y33A 3P4SB 4DUZM 3OY9A 2Y5CA 3VRBB 2CHVA 1JQ4A 1DGJA 3DTEA 2KP6A 4CZCA 2RGOA 1FRRA 5EE0A 1G3IA 3AFHA 3H5NA 2PKOA 4FCWA 1C78A 3PNYA 3KDSE 4XLCA 1GLNA 2X6XA 1FJGM 5D3DA 3ZCBB 2M56B 4RM2A 4P16A 4OU7A 4CH7A 4S12A 3DA1A 2R7RA 1ZAEA 4G4NA 2QCUA 2F5NA 2HU9A 2R4EA 4QOZC 2IGNA 1ZDXA 1DQUA 1GVNA 1DOYA 2Y0SA 3CP2A 1XLPA 1L0XB 2WAEA 4IBIA 4XR6A 4B3SM 2OQ4A 1VDVA 1WJBA 2JSVX 2JZPA 5EE3A 3IG5A 5GXGB 4XBOA 1BUIC 2L7KA 1V1PA 2XSJC 1SE4A 4TQ1A 2WXIA 2M7AA 5BMHA 2D7HA 2PMVA 4ZTFA 4IZZA 3AE3B 2XC7A 1WJDA 3VK8A 3HUGB 2LREA 2O5RA 1I94M 3IUOA 3DFZA 3H9GA 5LMUM 4KGRA 5EQTA 1PM5A 3BCAA 4NUBA 4O1NA 2M7BA 1SXTA 1JWUD 4CISA 2BW3A 1GKIA 4BXFA 5H37D 2OV7A 1PFDA 4BDZA 1KSFX 3OWEB 1DO0A 4B48A 2DLBA 2N9LA 3OYAA 2GOXB 5C18A 4IQ4A 1OFIA 4D80A 3LSKA 2M0AA 3L4PA 3FKEA 4W5WA 1PYWD 4RNAA 2MD0A 1R2YA 4KKIA 3GQ4A 4KISA 1C1KA 1QOAA 3K70D 2JSPA 2BTEA 1C4CA 4ZHOA 2WXKA 2JVGA 2PW9A 4DR1M 3OYMA 2F4IA 2DHRA 4REZA 3Q8CA 1NNUC 4GKJM 4DV5M 3PZ8A 5ITTA 3RFZB 3J9CA 2XH9A 2V1CA 3FUUA 1ORYB 2I8DA 3IT4B 1TDZA 2L9NA 2CFOA 4ARIA 3HHYA 4NAWB 3GLIA 3NZ3A 1IN4A 4N4NB 3HXLA 1CZPA 1I4XA 4LGMA 2DWQA 1DGBA 2CJNA 2BS2B 3UK6A 2YFQA 3J81S 2YNMD 4P6VF 3LQRA 4NRWA 2FUG2 4XLHA 1D1BA 3MKWB 3BLYA 2JA2A 5CPRB 1QF6A 2ACZB 3IG8A 4EATA 4DBQA 1UWMA 2LHEA 4LIUA 4G6ZA 4A9AA 2ZAMA 1MNDA 2KLOA 2BJVA 3DWGC 3SZGA 3TL4X 5HNFA 3SHFA 2CV2A 3SBJA 1BOBA 4M9SA 3J2PB 1SIJA 1LVKA 3GP1A 3LVWA 3TPZA 3TEYA 2P0WA 1WJFA 4XKVA 3OYIA 1S9HA 3V3XA 3OS1A 1TY0A 4TQ0A 2DYMA 5EP2A 1N34M 3KVWA 2WXMA 2LEKA 1QVRA 2LMCA 3AM9A 4QPOA 4DR6M 4ZYAA 2VZKD 1SXJD 3HUIA 1L2BA 1GPXA 1XWIA 2UU9M 5C3JB 1F77A 1G4AE 2NTSA 3MFGA 3P4QB 5KCMA 1XXGA 4L78A 3SARA 3M0EA 3K4BA 4JQFA 1K82A 2OPFA 2Z2SB 2AQFA 4R79A 4DR2M 1RM6C 2VB6A 3NVWA 5KPZA 2Q5WD 1R6BX 3KW6A 3BCBA 3NRZA 5H92C 1XXHA 1XHBA 4PJLA 2QP9X 4CUGA 3SAUA 3W2WA 3GPXA 1Y56A 1L8QA 2WU2B 3ZJVA 4B47A 3CJQB 1QOGA 3OTOM 3TMOA 1XNQM 2XGNA 1ZELA 1HR0M 3AOEA 1QHGA 4A55A 4YSXB 4OVZA 1TZOA 2Y3AA 1OJLA 1I4QA 1J7KA 2HHHM 5FROA 1DO2A 2R45A 2IS2A 3VR9B 3G2BA 2K9MA 4WW0A 1EU3A 4BQOA 4XGIA 3NWLA 1E32A 4JXJA 4BJ6C 1JWAD 2PIAA 2M5ZA 1JMLA 2E3TA 2KDMA 3F9KA 1K51A 3MP9A 1JALA 2N0SB 3RFWA 1IRXA 2DVWB 4AYBA 1E10A 2WAFA 1N75A 4MH8A 1DGFA 2RNGA 3C8YA 1SE3A 5JI2E 3B9JA 4BE0A 1P7EA 1SB3C 1FIQA 1KLUD 2MJ3A 1YX5A 1UWXA 5LD2C 2UUZA 1B1ZA 1X1BA 4R7GA 3M1CA 1FNVA 4X65M 2AQ2B 3SR6A 1KH0A 1EU4A 2RGHA 1SBBB 4XQFA 4ZRQA 4N58A 3DKYA 3VYSB 2X1EA 3OL3A 3KP0E 3SMSA 3VK7A 1PGBA 3KXEC 4F55A 2I7PA 4RGMA 4LZZA 4DV2M 1D5ZC 2K22A 4YRVA 1X4OA 2V1UA 3GPUA 4JPSA 2WXLA 2WXGA 3W0FA 4B3XA 4KLNA 2WXHA 1U0JA 3SEZA 2QPAA 3KLSX 3SYKA 1UM8A 1WXQA 2CJOA 1D6EC 5EJCA 4DGWB 3NBIA 3U6LA 2H1RA 3CF2A 1SXJA 1SXJE 2VASA 5FTJA 2K3UA 2BYTA 4NC8A 5EXTA 3VWBA 2QSDA 4LG2A 3W2VA 2R7QA 4LJ5A 3V05A 1E6EB 2YQZA 4FCTA 3HJQA 2L32A 2UUCM 1TJEA 3H0DA 3ZJTA 4ZDLA 4F93B 4LJ9A 3W1SA 2IPKD 1IN8A 3OS2A 3LQQA 3J7BA 3GP7A 4AQYM 4DV6M 4B3MM 2HKJA 2CUZA 4LCBA 1T0FC 3DTIA 3AE1B 4KGTA 3A4CA 3EUB2 4J00A 4F92B 1LFPA 4ARCA 3PZ7A 1N5XA 2IJ0A 4JWUC 4OZAA 1N36M 2DWZB 1C9FA 3HPGA 3HWSA 3U6OA 1GB4A 1VRAB 4DV1M 5BYSA 3KOWE 2VQLA 1XCTL 1NY6A 2RMMA 3FTFA 4PFPA 4Z8XA 2LY1A 1YUBA 1W5SA 4XM3A 1Z5BA 3FYDA 1XO3A 1SEBD 3BYYB