2W82A

The structure of arda
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
163
structure length
163
Chain Sequence
DMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF18
publication title Extensive DNA Mimicry by the Arda Anti-Restriction Protein and its Role in the Spread of Antibiotic Resistance.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Replication inhibitor
total genus 39
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07275 ArdA Antirestriction protein (ArdA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.560 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2w82A02
1.10.10.1190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w82A03
3.10.20.480 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w82A01
2W82A
chains in the Genus database with same CATH superfamily
4GYGA 4V2GA 4DQOC 4XORA 3VDXA 4YL8A 3NWLA 4IRIA 1TJEA 2H88B 2KMMA 2RPQA 2DA5A 2RMMA 1GNUA 1XXHE 4CXFA 5J3LA 3AEBB 2O3FA 4ZRQA 4BHCA 4HDUA 1WKMA 1BC7C 1UG2A 3ISPA 1JW9D 4DWFA 1YJ1A 3BYTB 3S1RJ 3KP7A 1U5TB 2L00B 4BE0A 3BVMA 2BT6A 1Q39A 1WJNA 3SZTA 3OIPA 3ZMDA 1W7PA 3K6GA 1MJGM 1IAWA 2VOOA 5KHOA 1O3SA 3DTKA 4M0DA 1D1CA 3H92A 2AWTA 1OAOC 1QNTA 2LJ5A 1ZG1A 4EE2A 5HG2A 3MJWA 1NDDA 3I01M 4UVCA 3ZUNA 2M8EA 2VT2A 5IYBJ 3TEXA 3AE3B 3AN1A 2QM3A 2JY7A 2OPFA 1WI0A 5FK9C 2XB5A 3FF5A 4WW0A 4AYBN 1WRDB 4D7MA 3LJ3A 2EIJH 1FZPB 1T6OA 4MFEA 3I71A 5FKKA 1TWHJ 4RM2A 1GL7A 1P9DU 1OYIA 4ZRPA 2AO9A 2ELJA 4B3AA 4CCMA 3RKWA 2IVMA 4J00A 1FIQA 3KSJA 5BOXA 5DTDA 4M72A 3CC7I 3ZTDA 1YX5A 3BR3A 4LNIA 3E6CC 2HHHM 2Y9ZA 4M9XA 3GLIA 5F6FA 1DO2A 3S2HJ 3IBEA 2BV6A 1Z7LA 2RREA 1G4DA 3U9GA 3M3JA 4ZHOA 2UYZB 1QAQA 1IQPA 2LY2A 1H4RA 1SIFA 1R22A 1L4ZB 1TS5A 5E6JA 5JFRA 3DU6A 4NDLA 3PO2J 2DZMA 3EHVA 3HHYA 1NVID 3A0BC 4LLGF 2EMSA 1PDXA 4PFOA 2ZXHA 1NNUC 3FUWA 1UZXB 2KQSA 3J7YJ 2A3SA 2XKPA 5DNYA 2Y3AA 4B08A 2R5ZA 1ZK8A 1TT5B 1IBXB 1OCTC 5GTHC 1PYWD 3GLXA 2AQFA 1L4DB 2X1DA 1BIAA 4PSWA 2C96A 1JWAD 4A69C 3JRCA 5IO9A 3LCVB 4F8CB 3G3ZA 3NQOA 2BYFA 5EP4A 3QYFA 3ZQLA 2Z33A 2INNE 2QMTA 2Z4RA 2COBA 2BB6A 2V1CA 3VEPA 4WJPA 2K5CA 1WXSA 4HW0A 1FD6A 2JZ0A 5C4XJ 3SZPA 2E1MC 1HQCA 5EXSA 2NOGA 5L3BA 1FMWA 3EUHA 4PFPA 2RVCA 3WU0A 4LD5A 4RGNA 2X1CA 2E60A 1UM8A 3E6DA 4EZLA 3S1NJ 1TQPA 3PNYA 2RQPA 2HKJA 3J81Z 4M8MA 5JR3A 1C4CA 4ENJA 1F2RI 2BOLA 1Z3YA 4NL4H 2R93J 4W9DA 4II3B 2R4JA 5BMZA 3WANA 2C5RA 3PLVA 3E7LA 2DDAA 2GOMA 3DPLC 3BR2A 1ZTRA 1XGSA 1W0TA 2E5NA 3HOSA 2YEPF 1V2YA 1B6AA 1IG7A 1Q1OA 2V3NA 4FLHA 5FLXK 3U1DA 5FKNA 2OD5A 2D3BA 3ZR8X 5KPTA 4A5MA 5HOOA 4FX4A 1TH4A 1AKHB 3M63B 4X64M 4GITA 1IJWC 5LNK1 5A2QK 2C98A 4GIPA 2KLGA 3GWZA 2M0CA 3NY5A 1KM7A 3ZO5B 1J2XA 1ZARA 3E0JB 3MTNB 1AN8A 5DCMB 1WE7A 2EKEC 4FXCA 1FMAD 1AIPC 2KZUA 4IRHA 2HYFA 4XN3A 2XF3A 2HDCA 1TL8A 3NVVA 2M8GX 2DTZA 3AJIB 2KKCA 4AVZA 5LMUM 3J7AY 1S6LA 3KP1E 2X6YA 2PLPA 2HU9A 1MHHE 5C23A 2D3CA 5ERIA 2LXEA 2X8AA 2QSFX 2VODA 3RNAC 2I10A 1W36D 4R79A 1GC6A 3F9KA 1ZMVA 1FIAA 3S3MA 1FSEA 4WQMA 2ZJ2A 2B76B 5J2RA 3HRTA 3QODA 3A33B 4FJYA 1KOTA 1SD5A 4QWQA 2LBFA 3NARA 2UXBM 2H1LA 3TEWA 3FXKA 1L6UA 3KZYA 1G3SA 3I3TB 2DHYA 1OCOH 3KOYE 2GLOA 1VZ0A 2G45B 3IHUA 3NWTA 5FTMA 1E32A 1UBQA 3FXJA 1V5GA 2D7GA 2H6BA 1IN6A 2K22A 2IY0B 3PHXB 1GB4A 1QZEA 3N1ZC 3HOYJ 3V61A 2EUCA 2NPTB 2I2YA 2QJLA 2GXGA 3ERED 4E3CA 5KO3A 4ZYSA 3I4YA 1ESFA 1HXYD 1TBXA 1OCZH 1WCMJ 2LVNC 4EEWA 1Q1HA 1R7RA 3O65B 2FIFA 4AUQC 1DU6A 1FBSA 2KRCA 1GVJA 3JR9A 1ET9A 4FJVB 2KP6A 3KS4A 5HS9A 4B8XA 1KZHA 1YYVA 1YG2A 1FXIA 3C18A 4LF7M 4RBOA 1Q10A 3EUHC 3W6JB 3AE2B 2GZWA 3WTVC 3LOCA 1G3TA 4UB6C 2M2EA 1NI3A 4KUMA 4EJTA 1QZMA 2LY9A 4BY1J 2X38A 2P5TA 2XFTA 2OJED 4AKHA 2XSDC 3VAWA 4ETSA 4LK0M 2KNVA 2VIIA 3KZZA 3LMMA 3R4KA 4FD2A 3FC4A 3TEDA 1SE3A 2W1OA 3H9GA 4LCBA 1VQ4I 4C80A 1L1TA 4ENNA 3RTRA 1BW5A 5TR5A 4OIPF 3MCZA 2VKDA 2OUMA 3UZUA 1N5WA 4A3DJ 4FCVA 3FM3A 3CCUI 2AQ1B 1EE8A 1L1ZA 4LNOA 1NVMA 1QA6A 1R7SA 2PFBA 2WWYA 3PLUA 5F1JA 1ZXIA 4KX6B 4XDCA 2IYDB 1QAOA 1XLOA 2W4SA 2LBCA 1D5VA 2DDBA 1L6VA 1DGWY 4N9IA 2CHQA 3VB2A 3NS1A 1WMHA 1RUOA 2MROB 3FISA 1ZN2A 4C2TA 2WXLA 4B44A 5CVIA 3GVAA 2GA2A 1IN7A 1LGRA 2E1NA 1D2NA 1A31A 2PEAA 2K4BA 2YLMA 2MP2B 2KFDA 2E6XA 5DPSA 1B72A 1FJLA 4A3BJ 2YX7A 3D32A 1G6JA 1MKMA 1T0YA 1P7FA 3RYTA 1H0MA 2CW0F 1IY2A 1BR2A 2G9HD 4HA8A 1TIFA 1XN7A 3Q3FA 2XC7A 1FBQA 4A0ZA 2VJJA 2DCEA 5E79C 3P9CA 4BS9A 1GAQB 2W57A 2NRAC 2KZGA 1R4MI 5L95C 3GP1A 1MMDA 3CP2A 2VLAA 1XCBA 1R1VA 1D4BA 1X4OA 3TMOA 1JB0F 3QWZB 3U6OA 1LE8B 4I6NB 3T3NA 3PT2B 1QO0D 1SGHA 2B63J 3RNBC 2OC6A 4TSSA 5D3IB 1R00A 3IH3A 4ESBA 1WJFA 3FTCA 3UGBB 1OTRB 2G1EA 3HGIA 3EA6A 2Z59B 2MBQA 4DZJA 1XMAA 3JTGA 4LJ6A 4EJUA 5D6JB 1LDDA 2LGXA 4QLCU 4B3XA 1QQRA 4B1RA 4ZTJA 1BBYA 3BG6A 2WU2B 4KT5C 2E34A 2FQ4A 2D07B 3BIID 5C4JJ 1VR9A 4IG7B 3E1SA 2PI0A 4XLNF 4M0WA 2EV0A 2EZIA 2REXA 4JPSA 2ZZPB 3NZ3A 2GBYA 4GDLB 3JR4A 3BZDB 2NTSA 4HDVA 3IUOA 4I76A 9ANTA 2ZFWA 3B89A 4YWGG 4HWIB 2NR2A 2XZUA 4RAYA 1E6EB 1KQ9A 5C44J 1GT0C 1E3OC 1JKQC 1R36A 1UD7A 4BKSD 1OFIA 1ZKGA 1LFDA 2M9HA 1QOFA 3B73A 4M3EA 2ZNVB 3C8YA 2WY7Q 5TRDA 3U2RA 4DV5M 2P5LC 2BJWA 5F0CA 3CJQB 3DEEA 1EA3A 2V3SA 4NY0A 2LGDA 2VF8A 2WC2A 4PS3A 2UUAM 4CO7A 3RYRA 3GOEA 5CQGA 2NS7A 5J1UA 5H6QA 3IRRA 3QK0A 3Q9SA 3MP9A 4KA4A 1LEBA 3I59A 4ICUA 5EEGA 1IPGA 1VDVA 3F8CA 2R61A 2G7HA 3JCUC 1I4QA 4W9JA 1J19A 3OV8A 2NQ8C 5BQTA 2L0FA 1K3XA 5TSSA 3TSSA 4PS8A 2RRUA 2D3AA 3H5NA 1SEBD 1XEEA 2J53A 4HEOA 2L32A 3GTGJ 1NYQA 4LJPB 3J81K 1T8IA 1D0KA 3QA8A 4IUMB 4FCTA 1NI2A 3LSJA 1DO0A 5H20A 3K4NA 3VWBA 3SDLC 1PUEE 4WWNA 4BBNC 4TQ1A 3AEGB 3KEOA 3AV8A 1T43A 3KSXA 2VKHA 5LD2C 2R65A 1SMTA 3L25A 3AU5A 3W68A 4NOOB 2MBBB 1UHMA 5K7FA 2DA7A 3KP3A 2J4XA 2LGYA 2M1BA 1ZDVA 4QOSA 1CK1A 1TT0A 1P4WA 1FYLA 5J1RA 5LEJA 4EATA 2PN6A 1NSFA 4M9SA 2E5LM 1G59A 4FHJA 2CG4A 1RKWA 4PDGA 4YTPB 2ICIA 3GUDA 3K8ZA 3TWKA 2ZJQF 1I4GA 1L0XB 4GKKM 5DD8A 3F6VA 4UN2B 2FOWA 2KTFA 2CW7A 4EJOA 1ET6A 3L00A 3L2CA 4I8OA 2HJ1A 3EETA 3EDPA 2J0MA 2HDEA 1XCTL 1MU5A 5IWAM 4IM2A 2INDC 2JNHA 2L7RA 2W25A 2XKOA 3J9CA 3GLFE 2ZW0A 4MTDA 1MJDA 1FPYA 3JAMS 3CC2I 3TL4X 3PREA 3PSIA 5HKHA 5LRSA 2OHFA 3FMQA 3VQIA 1K82A 1X1AA 2JMWA 2X51A 2UWMA 3AG2H 2E2IJ 4AIHA 1IFYA 2Y0SA 1HTQA 4E7KA 2ZAOA 2MRPA 4Y15A 2V4JC 2MH9A 1I4WA 4JWUC 4ACFA 4PYZA 5DPWA 1XS9A 2F5OA 1FOYA 1GG3A 4A3PA 2W7NA 3PSEB 4HX8A 1RR7A 3IVFA 1SVOA 1HW1A 2LWPA 3RQIA 2MEKA 3GO5A 3OWTA 4LG0A 4U7DA 2YU9J 2O0YA 1FWZA 4I81A 3I5UA 3NUHB 3DKWA 1N61A 4A3JJ 4LG2A 2D1HA 2Q2EB 2K85A 3OYGA 1K8RB 2PIAA 2O6GE 3M9AA 3A1QA 4NNJB 1ETKA 2IO2B 5D5VB 2V1DA 3M0EA 3ZMZA 3P63A 4RB2C 1E3HA 2LG4A 3P5JA 4CJ6A 4II3A 3ZCBB 1PGAA 4WURA 3SDBA 3PVLA 1J09A 4Q48A 1P6RA 3T8MA 2KXEA 1AW7A 3OR1C 2DKLA 3F21A 2VPRA 3HM6X 4KIKA 1A35A 4LZJA 2R7VA 5ITYA 4IXAA 4HEA1 1ZMUA 5EDSA 4L4UA 3CDLA 4DV7M 3MWMA 4ZYAA 5D2MB 2KISA 2MJEA 1ETWA 2KJCA 4HLYA 4DV3M 3GLHE 4CSWA 2XEPA 1MI0A 3JRFA 2NAZA 1NG6A 5FJ8J 3H3UA 4I4LA 3R8FA 3WU2C 2QILA 2LR8A 3MKZA 1IGNA 2WXOA 1YLAA 3MJ5A 1GL6A 2M0XA 2LHEA 4NJCA 2G7UA 5BR8M 3OYNA 4XLAA 1O3QA 4B4CA 4EKUA 2QZ4A 2L6OA 4YFKF 3LXFA 3H7PA 2Z16A 2KWUB 2K4JA 2X0LA 4GC9A 4KODA 2MD5A 4A0XA 3EUB2 5HFYA 3K70D 1QDTA 1QF6A 1TDZA 2L0KA 3PQJA 2FCMA 5F0FA 3FYDA 2BKFA 3A02A 3E46A 1WXAA 2P5VA 4XR6A 5B1BH 1LM8B 3U6EA 1RESA 5K5RA 4ENMA 1XCQL 1IGCA 4V2FA 3C7JA 1V8CA 2CFXA 4RB0A 3RFZB 1F9JA 3SAWA 3DPTA 3DP7A 1YE9A 3DXJF 5ITXE 1GHCA 1XC8A 3VSKA 1WGDA 2P81A 1I6HJ 2FMYA 2IP2A 2L4EA 2RD0A 1NYRA 3ELKA 2XH9A 3GLGE 4XKBA 4W9EA 1UWMA 3SBJA 4O3MA 1H8CA 1VRAB 5H92C 1SD4A 3PUBA 1OKSA 3J2PB 3T15A 3CQZJ 3GTLJ 1ZP0B 4AUXA 4GMQA 5AUIA 1P9QC 1BJZA 5IP4D 4IKFA 1T56A 2Y5BB 2O6VA 3BY4B 4G11A 2NPTA 4C56C 4BKTA 2CV1A 4P1BC 1YTYA 2C99A 4ASNA 1WGYA 1WX8A 1U78A 2FS1A 2ETHA 3RJPA 3TQNA 3B0AA 2N35A 5EXTA 3GMEA 3GE8C 4OX9M 5BNGA 1EU4A 1IM2A 3H9QA 3ZP5A 2WQYB 2JY6A 4XOPA 3WCQA 2FRHA 4PDKA 2ZMEA 4GDKB 2KJBA 4PGHA 2G4SA 3UIOB 3S1QJ 1SXJB 2ON8A 3GB1A 2BHYA 1PYVA 5GPCA 1ZAEA 3J80S 1YNTE 4HROA 2VBZA 2K27A 1E9SA 1C1KA 1JRUA 4A3VB 4Y3OA 1Z6RA 3AE1B 3U60B 3HHGA 4EZJA 5EEAA 3ZPLA 2MFZA 1T08B 5AZGA 1A5TA 2A6TA 3SYTA 4K81A 1DGHB 1J7KA 2Y0TA 3ABVB 2L4AA 4LGMA 1YLFA 3TW7A 4NUBA 3W1SA 2F5SA 2XGNA 4TMAB 4HQEA 3QOEA 5C1BA 2FCSA 3FBIB 1SIJA 3CJNA 4PZJA 2FCQA 2LNBA 1K61A 2LTUA 4KSKC 1H89C 2JRIB 1QHHD 2BW3B 5J4VA 4WIPA 3GP7A 3QHTA 2CP8A 1J59A 2XEWA 2ZBKB 2LD5A 1LFBA 4LOCA 4M3FA 3Q0VA 3TWLA 1AWCA 2XGDA 2A6HF 3R2IA 1FC3A 1LVKA 2LI5A 2DZNB 1WE6A 4LRTA 1MBHA 3MZHA 3LDZE 1S29A 2KVRA 2M4NA 1ZGUB 2M4GA 5E8GA 4Q47A 3AEFB 2HXIA 4M74A 2XSZD 4OZBA 5GP9A 2YUSA 3NVWA 1FPQA 2MP2A 4JX6A 1WJUA 3S32A 1I4XA 1WGGA 3C9PA 4CH7A 1VQPI 1XLQA 3GLIE 1IXSB 1WJCA 5EZGA 3KP0E 1K78A 4B3MM 4E7JA 2L4FA 3FM5A 3CCRI 4CISA 3WHCA 3LA7A 1IW7F 2H09A 2GBMA 4UUVA 3BK1A 4O6JA 2BQQA 1GV2A 2JRHA 3GZNB 4CYCA 3BPXA 4K3CA 4A5NA 5M3FJ 4HLEA 3JYUA 1J7AA 2EMTA 4FX0A 4X65M 3Q3JA 4XGIA 5D5UB 3TWMA 3W2VA 3RPUD 3RKQA 1LE8A 1VQ8I 2X6WA 3R66C 1K53A 5HS8A 3VHTC 1LJ9A 2E7XA 1WGXA 2MD0A 4OZCA 4MGKE 2H6CA 3ZXSA 3F6OA 4YIRX 2IS6A 1OTRA 2GBJA 1JALA 2PJPA 1FM0D 4YIIA 2ZXJA 3A46A 2QC8A 3ZXRA 1TR8A 1VQ6I 4B95A 1Y56A 2ZNYA 1FJGM 3JW0X 2DAJA 2GAUA 1IRGA 3KQ4A 5BMIA 1X2MA 1L2NA 3Q3OC 3N1XC 4NRWA 3K9PB 3KX2A 4NXNM 2L52A 2I8DA 2CWEA 4IC7B 1TKGA 2AQ3B 4NSOB 3C2BA 2QZ8A 3KUDB 3KLOA 1U3EM 1UF0A 5HI1A 2HEOA 4A3GJ 3TIXA 4ITVA 2HGCA 2DN0A 3C2HA 2KFJA 4F55A 2ZMEC 1CJEA 2ESHA 2HDDA 2GI9A 5LXIB 2KJRA 3BG9A 2XPUA 5EXPA 4G7HF 4KT0F 3FKYA 3B6AA 4L1BA 2LKSA 4MB7A 1YS6A 1I39A 1J8CA 3GRVA 3R7QA 2WHIA 5CPRB 1QVUA 3R6SA 5F0HA 1BI3A 2XGCA 4ZDVA 4A3CJ 2YS9A 2DNFA 2XRNA 3QU6A 2IGNA 1GKIA 4WXDA 2FF4A 3BXWA 4MEXF 3UJNA 2ASQA 1YS7A 4LLLA 4JQWC 4GXBA 2V6ZM 4IW0A 4YHHM 3V3XA 5HVQC 2PEXA 3ZCOA 3W1SC 3ML8A 2LGIA 1WY8A 2MBFA 5KPZA 2OBPA 4CHUA 1FSHA 3ZKJC 3U52E 3CCSI 1XLPA 5D4RA 3MAJA 3DBRB 5IP9J 2SAKA 2GBNA 3NVZA 3ECIA 2DAEA 5DYIA 4X57B 1T39A 1G8XA 1N25A 1NH3A 3SD5A 1WJDA 3M95A 2ZSHB 3L2WA 2KT0A 3D8LA 1G4AE 2VONA 1EM7A 2DWMA 3GEZA 4UUSB 4CCKA 4OIOF 4IRGA 3U7ZA 4IBDA 2J52A 2YVCA 4NQWB 1T6BX 2OEDA 3N30A 4RGUA 4E7ZA 3ZJUA 2MABA 3LSKA 2FQ3A 5LGTA 5ICFA 1JKPC 4BGDA 3P4PB 1V55H 3IT6B 4A9AA 4L6V6 1TGUA 4DQ2A 1Y1VJ 3DWLE 3DCGA 4W97A 4HX7A 2KO3A 3HKZA 4DNCA 1J0RA 1DQUA 2AL3A 3H9DA 2K9NA 2KMAA 4L16A 4ZYDA 2QQ8A 4CYDA 3K92A 3FTDA 3ZQ7A 2C7NB 1MNMC 2K9XA 3IG3A 2K02A 3CCJI 4WK8F 2VOPA 1Z0XA 4RDUA 2KQRA 3AOGA 2DO7A 3A4CA 2OCEA 3BC8A 2A6EF 1A04A 2O8XA 3CMYA 2V4IB 2RKOA 1SFEA 1IDYA 1BUIC 4EGYA 4HLQA 1ZE3D 4XK8F 3RGSA 1G3IA 4FN2A 3GZ6A 4OZAA 4EVIA 5J17A 2BY0A 5JH5C 1FY7A 2GNOA 4JP0A 4OIQF 1X1DA 1SJED 2CS4A 3MMPA 4K0KM 3BQYA 3TP0A 2BYVE 2HVSA 5HHDG 2ZO4A 1JROA 1WPKA 2IO0B 2RGFA 1D0ZA 3KP6A 3MVPA 4UY8I 1YW9A 4R71A 4RFBA 4I98B 1LPQA 4G50A 1MDMB 3AG1H 3WTUC 1KU9A 5BYRA 2HKOA 4I99C 1FT9A 1MG8A 3WG9A 5E3NA 4MJSB 2WWZA 4LDTB 1W36C 1B9NA 1SANA 3J80Z 1L0YB 4BFRA 4HAMA 1DGFA 4UNOA 3IECA 2DZKA 2LHDA 2WDTB 3MKLA 4B09A 4DV2M 3HOXJ 3FKEA 4KV2A 1E9MA 3OTOM 2ADUA 5H6RA 1F9NA 2Q2EA 2KIUA 3A01B 3GF2A 4AKGA 3IT4B 1C4AA 3L54A 4F93B 1RNLA 2E1MB 2KXJA 1OGWA 1Y8RC 1WJAA 1FIPA 2WV1A 4OAZA 4YY3M 3ZGKA 4HNVA 2HQRA 3FK6A 4JLCA 1QLBB 3L28A 2HJ8A 3FD9A 2HQ5A 3K1NA 3DWMA 3RPQA 4WAFA 3CCVI 4QHTA 2IGKA 2R4GA 3L26A 1AA7A 2DAMA 2F4MB 1IXRC 2WXQA 3CCYA 1UAAA 4A6QA 2JZPA 1LDKB 2JZ1A 3ECHA 1HEZE 1WX9A 2H94A 3N97A 2INCC 4AD9A 2PKOA 1ZGAA 4JE3B 1R6RA 4KISA 4JOMA 2TSSA 2ZNZA 2IS4A 4BEHB 2IXSA 4MGYE 2NVUI 1S8NA 2SEBD 4G0NB 3M1EA 2O03A 2MJ3A 2QGUA 1BR1A 3NWSA 1LDJA 3ZDMC 4DHJB 2EFWA 1CZPA 1G6NA 2YQZA 3WA0A 5GPAA 4MLOA 3B2FA 3O2PE 4US8A 2E5ZA 2UZKA 1UHWA 2X1EA 2M8SA 3X0WA 4RS8A 1C3TA 5BPIA 2HAKA 3A9KA 1VDDA 2XAFA 3I9V1 2DFHA 4ANUA 4CCOA 1TWGJ 1OISA 2QQAA 4B3SM 1W7PB 1IRFA 1GXQA 5ICGA 2ZCCA 2YSRA 2KIFA 2JXNA 3IAM2 2CMPA 1SE2A 1F4IA 3BY6A 2Y9YA 1T0QC 3ZQQA 3DHIC 4DR7M 2CYYA 1MSFC 2LHGA 2KDMA 1HKQA 2MBOA 4WQOB 5CKTA 1KGSA 2VRRB 4W9CA 2IGGA 2F5CA 2DU9A 1PP7U 2W82A 4UV9A 2LMDA 3DKYA 3B2GA 5IT9S 4JI6M 1E3PA 1ZG3A 3KYCB 4RGSA 3FHNA 2JUOA 4OWRB 1MJ9A 2M5ZA 4MNUA 3A03A 1G71A 3VKGA 1A36A 1U9OA 1EWCA 5TISC 2H27A 3P4SB 4HK2A 3AG4H 3OSGA 1W5CC 2P6SA 1E9RA 1IBLM 2R7RA 4E71A 2G5GX 1KLGD 1V54H 5IT3A 1YX5B 3T1YM 2DFIA 4IJEA 2K39A 3GLIB 4JYAM 4OU7A 4CDGA 1YJWI 1VQMI 3LQQA 1Z3XA 1FRDA 3MMYB 1Z77A 3R7RA 4LMYA 4XLEA 3CMAI 2E1OA 1TS2A 4KICA 4MTEA 1E7VA 1UNSA 2W24A 5JI2E 4C30A 3EIHA 2XIGA 5L3EA 1KFVA 1RLFA 1FP1D 4R3DA 4HSRA 3Q69A 1BM9A 4GDKA 2ECCA 4WWPA 2L7ZA 1TH3A 1YQAA 1T38A 3FUVA 2K3FA 1T33A 2HQNA 4W5WA 2V9KA 3WAPA 2Z4SA 3FXLA 1FCLA 2IW5A 2ZW1A 1I50J 4IBFA 4XSZF 3OIOA 3JAMK 2K9SA 2JVCA 2DLBA 1ZELA 1XT9B 2QKMB 4LJ7A 2HWJA 3GPPA 2E2HJ 1V3FA 2PJRB 3GYHX 2F5FA 2DXIA 2R92J 6PAXA 4AKIA 2EK5A 3T8RA 4FHTA 5IOIA 5JHUA 3L0WB 2OU2A 3OYLA 4NC7A 3OYDA 4PD2A 1V33A 3VK7A 2IA1A 1R58A 2KX3A 3P9KA 4MACA 2WAEA 5B66C 4P96A 3GTKJ 2MQJA 4J6IA 4ICVA 2ISYA 1C76A 1UJ8A 1QZYA 1BL0A 3O8HA 2CKHB 3DPUA 5EE3A 2ZBKA 2BGCA 2RDPA 2G9WA 1I3AA 4US9A 2EELA 5DCFA 4DBGB 2P4WA 1V92A 4MH0E 5CHFA 5HLHA 3EFCA 3HM3A 4IOCF 1PDNC 4JYKA 4U0YA 1W1WE 4E7IA 4E7HA 3CO7C 1AUAA 3F0CA 4AJWA 2UXDM 1I4PA 2Y20A 1KONA 3BZ6A 2OF7A 3I56I 1PM5A 5EE1A 4RM8A 3W1YA 2ZM6M 2BXZA 2X6OA 1BN5A 1KTKA 1MIJA 1KLVA 4K7WA 4PCZA 3E56A 4C2MJ 3L2VA 5FRMA 2KDZA 1IXSA 3N9YC 1BI1A 4G6TB 4QSHA 1SMYF 2STWA 3LW5F 2MGWA 2KEBA 2WTEA 1U8RA 1T6SA 4HNTA 2A5UA 2L83A 4G9YA 2KDOA 3Q8AA 4NBQA 4CHTB 1YW8A 3KPHA 4HF0A 3N32A 3G1LA 1PGBA 1FNNA 1UCRA 5AIQA 4LF6M 2HQAA 2R7ZJ 4LRSA 2JZZA 3V76A 2LDUA 1X58A 2M34A 2JT1A 3VDPA 1EF4A 3PZDA 1MMSA 1E2XA 4W9IA 2E1CA 2AQ2B 3AE9B 2MC3A 1YD8U 2CHGA 1CQTA 3F8FA 3DDCB 2VL8A 4NC6A 3BINA 3V62A 2DFFA 2KD0A 1PVEA 2L2OA 4B6WA 1A5RA 1SXTA 5FR6A 1WZ3A 5ICEA 2XAUA 5F27A 3TQSA 2DI3A 3G4SI 1C0WA 1WZ2A 1BXTA 3K69A 5HNFA 2JYEA 3LVVA 1DUXC 1C7YA 3E5XA 3U6LA 2KYWA 3K9PA 1JUPA 3Q2AC 5EXXA 2OCCH 4OIRF 3U6DA 3DBHB 4WAAA 3WHKA 1DP3A 1WX7A 2XUBA 3KLNA 4BVUC 1ZR4A 1ULYA 4USAA 1JTXA 4RGMA 1V34A 3NRZA 4BH9A 2CR5A 4IHYA 1ACIA 1SD6A 4IBJA 3DQVA 2L4MA 4FA6A 4IOAF 1Q0WB 1U9NA 2KPMA 2E3TA 4JGHB 4BJ5C 1V97A 1J75A 5KHQA 3E6BA 3R8BA 1W5SA 2ME0A 1Z5BA 1HE8A 4PGGA 2ZCBA 1IBKM 4AZFA 3G71I 5J18A 1WWXA 2DTRA 3UQAA 2XF7A 2BWFA 2OZ6A 3REOA 4Z2YA 1NV8A 1MJBA 4PK1A 2HCBA 4KMUX 4I5SA 5HDKA 2VI6A 3K10A 3J80K 4FJZA 4B7HA 3IH2A 2IPKD 2R4EA 4HOBA 3GCMA 5EJCA 3UI3A 3QYBA 1IUYA 1XPXA 2K8BA 2VZKB 2BZTA 3G73A 2JWTA 1L2BA 1YN4A 4XBOA 4OAYA 1UUPA 3V7CA 4HKZE 4W9FA 4OINF 3I0TA 1P98A 3K4JA 1P7IA 2FU4A 1UH6A 3WHBA 4IF4A 1RC9A 4IIWA 2DENB 3V6CB 4NJ7A 1MNEA 1JRPA 3C0RB 2D45A 1E10A 4NQWA 3V60A 3HK0A 3HRUA 3QYEA 2V4LA 3V8JA 2UUBM 1NY6A 3HYIA 5EZHA 3UQBA 4AG6A 3PHWB 1ORYB 5D5WB 4ZDOA 4MQVA 4UV8A 2B3AA 1SE4A 1Y39A 3L2UA 2NNNA 2GIZA 3Q5FA 2J0JA 5IT9Z 2KTRB 1J0GA 2OOAA 3FIWA 2R7FA 3RZOJ 4HNUA 3NG0A 2JSVX 3SYKA 4NXMM 1VZ7A 4P9FA 1JHHA 3DBLB 2KVZA 1WMHB 2F6CA 2AS5F 3KYDB 1QANA 3L2RA 5FROA 3JRGA 1DV0A 1PFDA 3U61B 4M6VA 4KT6A 1VEKA 1TY0A 2DQLA 3PTFC 4J3OD 3ZNID 2JA2A 4HF1A 4AYBA 2QCZA 2W84A 2BTEA 1TS4A 1B72B 1IN5A 2L01A 3CP8A 2LVQD 4KMFA 2X6XA 2QBYA 3Q6BA 3PNVA 3V4GA 2WU5B 3RNEC 2TDXA 1E8XA 5C3EJ 4ESFA 4XICA 2KIMA 2J5PA 2KIQA 4GXOA 4HF2A 2M1MA 2L7FP 3A2KA 4RAFA 3QWLA 3HTSB 1D0YA 1YMHE 1MDMA 2NXNB 4C3IJ 1IGDA 3K1PA 3K70C 2KA6B 3I4PA 4F92B 1VG5A 3K4KA 2PW9A 2O5RA 3RUIB 4WWMA 3W5VB 1HDDC 4XKVA 1E8YA 4JIOU 2HVQA 2LVOC 4RGRA 3RZDJ 2QWWA 4MJSA 3M4OJ 3FTEA 3QAHA 3FHZA 1E7PB 2X4AA 2Y5PA 4UXNA 2R45A 2VDBB 4BQAA 2MBHA 2WXNA 2Y48A 4LLGM 3RPUA 3SJMA 2JF5A 1GUUA 1H88C 1X1BA 1GO5A 3LAPA 3HGGA 2ACZB 2JXXA 3U21A 2MHJA 3A01A 2DYBA 4ZYNA 5LGUA 3AE7B 2QPAA 4Y17A 1VLBA 2Y2ZA 2CQQA 3DCFA 3DZDA 1ZMWA 3Q8CA 2XNAC 2ZFUA 3HJSA 2X48A 3TBIA 1AARA 1Z67A 3SHGB 1R6BX 4PJMA 1V5EA 2DAOA 2V9PA 2L1AA 3DFZA 1BC8C 1YUBA 1XC5A 3LSMA 3K7AJ 3MN2A 3NS8A 2IO3B 3PZ7A 4E74A 4S0HB 4G94A 1V1PA 1SD7A 2WLBA 2L7MP 4EGZA 4W9HA 1EH8A 3HSFA 2KLOA 1T3QA 2LRDA 2VQGA 2DZLA 4KIBA 4M3BA 1GPXA 4I6LB 4BEHA 3BK2A 3N05A 1TS3A 2JZ3B 2AHMA 1S72I 4XRSA 3WGHA 2PMUA 4DBQA 2QCUA 2I7PA 1WGRA 3NEUA 4HRIA 3VTWA 1YJJA 2DAFA 1QKZA 4XDDA 3RNFC 3HUIA 1WJBA 4IEJA 3N3KB 1VQKI 3OYIA 2B0LA 3PPAA 4L5EA 4LZZA 3LSTA 3I59B 1C1YB 3EIEA 2EO2A 1H9TA 2LVPC 4XNFA 3A0HC 2ZXIA 2IGMA 2W54A 3ZQIA 3OYFA 3VDUA 4BLCA 4GU2A 1L0VB 2G3QA 3HOZJ 2R3SA 3RCOA 1R4NB 1C4PA 2M56B 4R1HA 1JR3A 4HXDA 1XO3A 2C7HA 3HX3A 2EIKH 2GWRA 5FGMA 3OYEA 3MHVC 1ETQA 3PZ8A 2RGOA 1MGTA 3RN9C 2R46A 1N33M 1ZKHA 2WGSA 2M17A 2X4HA 4YIFA 2GOXB 4IM3A 1REPC 2DBYA 1X3WB 2H8WA 4JI1M 1S7EA 3MKWB 3B7ZA 1D5XC 3M7GA 3GXOA 4ZJZA 1FRRA 3LFUA 3PGEA 2DW4A 2XPWA 2HOEA 1EU3A 1HA8A 1GVNA 2J5OA 1J5YA 4M00A 1WSUA 2MA3A 4RMNA 3R3MA 1YIWA 3L16A 3DTIA 5L3GA 2JA6J 2LKPA 4B9KA 2NOJB 4LJ9A 5ITRA 3A42A 2KDEB 2ZB9A 1CMXB 2R7SA 3KIOA 4E6KG 2QSGX 2IY1B 4KN7X 5DV5A 3BCBA 1VEGA 2JT4B 3OYHA 2NTTA 3S16J 4L5JA 3FXRA 4FCWA 2DZJA 2UXNA 1WGNA 4RKUF 3GX4X 1RYJA 1V86A 4ZRIA 3ZOBA 2VN2A 3IKTA 1Y1WJ 2OJRA 4LCDE 5CVVA 1DGGA 4NQLB 2LF7A 3DFGA 1IV8A 3RI7C 3VFZA 4BL0B 1STZA 4DR2M 4NSRA 3DBSA 4E7LA 4D82A 3B6CA 3M07A 1W5TA 2HD5B 2PJRA 2MWSB 2M7AA 4M8NA 5ITUA 1X19A 3C1DA 4GSWA 2UWQA 4II2B 3RT3B 3DVNV 2YR2A 4XRFA 4YT0B 3ZTCA 1POGA 4KDIC 3JRDA 3RZFA 3RDIA 1PJSA 3VDZA 2LRUA 2VB6A 4LG0B 3RSNA 1MH4A 4XOTA 3JRIA 4RM3A 3RQ4A 2KNBA 2IZVB 3UKGA 2L05A 3HHMA 3S3NA 3A1QB 2BWEA 4XLFA 2NVQJ 2DAGA 3MD2A 1SG9A 1SSNA 4KLNA 3IAS2 2CH0A 4XKWA 2MBEA 1FXTB 4P1WA 3ZQCA 1WWTA 3RZWC 3LAJA 4MM3A 3HIFA 4B0MA 2LH9A 3LSGA 3VUXA 3T8TA 4DBGA 3TEYA 1VZ6A 4FQGA 2STTA 5LLQA 4IHWA 5ILVA 1UELA 2XLJA 1IC8A 1W4MA 1I42A 3VFKA 2AX5A 4KIKB 4YFNF 2JP7A 3S2WA 3SFZA 4ESJA 4BXFA 4M6YA 3Q3MC 3WTSC 5EF6A 3NZUA 4AIDA 2GXAA 4G6ZA 3BJAA 1X1CA 4DV6M 2VQEM 1H6UA 2CHZA 3RPFC 1TLHB 1B9MA 1R71A 5B3SH 3W0FA 3V42A 2JX5A 5IKCM 2LK2A 3I4MJ 3V7RA 4ARIA 4LJ5A 2J7QB 4CHKA 4C7YA 5E3LA 1LNWA 3AECB 1N78A 1S3SA 3OMYA 5K7ZA 4BUPA 4A3EJ 4CZZA 2MR9A 3HJEA 2DYMA 4J01A 1YI2I 3H7PB 1L8QA 4LK1F 3P4RB 3AEDB 1AU7A 4KITB 4JV5M 5HLGA 2MLKA 1LUJB 3PSFA 3APDA 2JUJA 3H5RA 4GC5A 2ZPNA 1YX6B 4WJOA 3PJRA 2DWNA 1JQJC 2EFPA 3F3XA 3ABLH 1SC7A 3OYBA 2JQRB 2RDGA 2RDHA 4EUTA 2AHQA 3HU1A 4LJAA 1OR7C 5KK1A 2VKVA 1OQYA 5IN7A 3H3ZA 1DOXA 1B59A 1BVSA 3TL5A 1CQVA 4D1QA 3Q9VA 2MLBA 1IUFA 4I02A 5IT9K 2L7IA 4AP4C 1Z05A 1NEKB 4G4QA 5EGOA 2FJ1A 1JI8A 3PRZA 4W9KA 4O1NA 2LNHC 2N9KA 1SFUA 2GBKA 3UINB 4DYQA 1Q3BA 4Z6YA 5M5YJ 2D5VA 1HC8A 1FOKA 1GC7A 2V26A 2IO1B 2F5EA 4F1IA 3AM9A 5JXVA 3JREA 3PO3J 2LF8A 1NJGA 2A5WA 3HJQA 4DR4M 2O6VB 1UWXA 4GGQA 3DWGC 3ZW3A 2K25A 4KVGB 3AOEA 3HHXA 1N5XA 3IHPA 1WXVA 3G2BA 4C7ZA 1ZH5A 5KCMA 3B74A 2BXYA 5LBQA 1ZV1A 3S1MJ 1H8AC 2JK3A 4PSXA 1XF5L 2K6DB 1YX3A 4HRSA 4D81A 2N9XA 5L83A 2JY6B 4FWGA 3VLFB 2ZPYA 2ZMEB 1GJZA 4N59A 4B3RM 1FXAA 2A69F 5BS6A 1XXGA 5F04A 4DBRA 2HR3A 3W5UB 4BQOA 3V6EB 5JVGF 1OQRA 3RD2A 2EZLA 2WXGA 5GADJ 2EB7A 1I4RA 3EYYA 2DA3A 4A3KJ 1B9RA 1HNWM 1PUFA 3I5JC 2Z1DA 3TMPB 1C77A 4BE1A 3L2AA 2KAJA 2WY8Q 3WG7H 2RR9A 3BOQA 2JA5J 1RAXA 2RPVA 3K1MA 3U8ZA 3I53A 2K1FA 2K6QA 3C3DA 2CQXA 2RKHA 5FLVA 2K7LA 3T0YA 3F22A 2B9SA 2E71A 1M1EB 3LSRA 2DFEA 3E5UA 1YIOA 3FKJA 1LEAA 3IAM1 1RRBA 2IJ0A 4I6ZA 3CCQI 2G0EA 2DENA 5FRNA 4XMYA 2H1KA 1KA8A 4D7NA 1BOAA 4BKXA 2IGDA 3IC7A 2Z0DB 3AKZA 4DV0M 3BR0A 2GMIC 3RFWA 2P6TA 3PNTA 3ZQJA 2CHWA 3BPVA 3RULA 2ZTDA 3ZIMA 4NZLB 2DMPA 3SMSA 5ICCA 3DBLI 4LNKA 1YQ3B 4BE2A 2KTRA 2DZIA 5AZFA 4CZCA 3ZGZA 4D80A 5IP7J 1SFXA 1Z59A 2K6BA 3D1NI 2F4VM 2VJIA 1WIVA 2VIXA 3BG7A 2DA6A 4KNYA 3E9SA 4NAMA 3U61A 1TNTA 4ANWA 3CTAA 1XD3B 3A9JA 2LVSA 2JWZA 4GHAA 4Y7NJ 5FD5A 2WXMA 2QHOA 1NTCA 3VSLA 2MH7A 4ZYHA 4KHPM 4LGYA 2UV1A 4KIGA 4M73A 1K78B 3CMMB 3B7NA 3GO8A 3BR6A 2BVCA 3OL3A 2RN7A 2K8HA 4LF5M 2PBIA 2RDBC 4CYCB 3I9V2 2VJ4A 5ILUA 1V5FA 2R7UA 3T3OA 5H2FC 5FTJA 1Y0NA 1VQLI 2L9VA 3CUQB 3D0SA 3U1KA 3QCAA 3ZQGA 4G6DA 2KX0A 1MBFA 1TYGB 4JI5M 1KQ8A 1PP8F 1S9HA 5IOYA 2PMZA 3WALA 3FKIJ 4AWXB 4P55A 4RCOA 1SXJE 3J7AS 2ZKZA 3UR3C 2L3ZA 2VH1A 3GRYA 2ECBA 3FWEA 2ZTCA 4IJAA 1LQBA 2LH0A 3PFYA 2N7DA 2Z3YA 3HXLA 3HOUJ 1HLVA 3GLFA 3K9OB 4F91B 4RM9A 1GV5A 5D8LB 4BAYA 2LD9A 3URYA 2C9WB 5D94A 4XN0A 4LB6B 2HWVA 2FE8A 4X1EA 2NS5A 3AOEC 1FNWA 3IHPC 1NY5A 1FP2A 2LYCA 1IRXA 3LVWA 1Y8RB 1ORKA 4KYWA 3T1BA 4S04A 5LGNA 3WODF 5JHBA 2K47A 4M02A 4OVUA 2IBDA 3L29A 2ZJPF 3AXCA 4BAXA 3RKXA 4XM3A 2BS2B 4B47A 4DR3M 1UMQA 3BROA 4MSQB 3U5ZA 3VTVA 3VYTB 3OYAA 3AB5A 1YRNA 3EC8A 4GEWA 2KRFA 1KYZA 5DPTA 3F8NA 2KHHA 4LGWA 1B1ZA 2JRTA 5T8IA 1XX5A 4ZRKA 2I5UA 3WIMA 2BWES 1ZREA 1YQ4B 3SR6A 4IOIE 2HDWA 2OTJI 1QBJA 4OMYA 3L7WA 2D2QA 3VRAB 3OOPA 2FA5A 2I1KA 3F92A 2JN6A 4D2KA 1GXPA 2LXAA 5ITQA 2CUZA 5E20A 3ZH9B 5E3MA 2WNMA 2VUMJ 1DGRM 5FSWA 2QLZA 3DV8A 3C3WA 2UXXA 1GVDA 2QVOA 2R18A 3COAC 2FMLA 1UB9A 4DIQA 5LHIA 3GLHA 4URKA 3DVNU 2WSFF 5KQDA 1K4TA 4IWPA 2CU7A 1WFXA 2D7EA 2FIDA 4IQ4A 4KZCA 4F2LA 4MGHA 3OOUA 2VC0A 2CV2A 3T1HM 2XK5A 2FNAA 5F08A 1VQ1A 3SARA 1IZ1A 4U0WA 1WR1B 5DD4A 2IGHA 4L9JA 4EEFG 2Z9OA 4DV1M 4LFAM 2EH3A 1MHXA 1PJRA 4TKNA 1RM6C 1P0RA 2ZVOA 2L02A 2M19A 1TTYA 1YFHA 3DOAA 3MEXA 3GPXA 2XPVA 3KEQA 3I3LA 3K9TA 4HPMB 4BOSC 1APLC 4HJKA 4HDQA 5HLIA 1GUAB 4L5IA 1WGLA 1L2CA 2CSOA 3RE8A 1HXDA 3I04M 4BACA 3PM1A 1N60A 2JVGA 3CMEI 3NRVA 1VD2A 4YELA 1N62A 2QP9X 2V9HA 2P0WA 1EKEA 1XTAA 2D5GA 1R4MB 3RKYA 1ZHFA 2DYOA 5F3WA 2DA2A 1T0FA 1X3UA 2QDFA 3VUYA 1YHQI 1DPRA 5GXGB 1FLIA 3GQ5A 1O57A 2OZUA 1UG0A 3PQKA 3L9FA 4FE4A 1DOIA 1BW6A 3HG9A 1I1GA 5F64A 4MEYF 4MIMA 2CS3A 4BBRJ 3AV0A 3K4LA 2BYEA 3I51A 2BS4B 2MCNB 3OY9A 2EKKA 1HR0M 4L23A 2ID6A 1WYGA 2O25A 4B0EA 2ERCA 1SAXA 3KP5A 1GJSA 5G5HA 4II2A 1H9GA 4A3MJ 1VQ7I 3PVSA 4GO1A 2P7CB 2LC2A 1K6OA 3GFIA 1XB4A 3K4CA 2Z5UA 1F1ZA 2DMQA 3EUAA 4DXAB 3W9CB 2NVYJ 1VEJA 2ZCWA 2JSCA 1E8ZA 2JA8J 2BJVA 3T38A 2F5NA 3LFKA 1T0SC 3TKYA 2LSOA 3JR5A 2FBIA 2VPLA 1D6EC 4JBAA 4L15A 3PO0A 2FUG2 3IWZA 3SATA 4FHKA 1LTMA 1LO5D 2LHCA 3OAWA 4DXFA 3TCAA 3C19A 3KOWE 1XQQA 3MFGA 5AZHA 4BDYA 2YU3A 3SZGA 2PX9A 3BR1A 1Z91A 2WXHA 1G41A 1B8IA 1WM3A 1JUSA 2MW5A 3M62B 4IWOA 2XASA 4XIDA 1FYMA 4RGTA 4S17A 2KDIA 4ZC3A 2KDFB 3HY5A 5LHHA 4DR5M 4KZ0A 1ZUD2 1YO5C 1UFMA 3ETRA 4IBIA 1BT0A 4LF9M 3BZCA 1DP7P 4XQFA 2JWUA 3I55I 1N32M 4IHSA 3RGPA 5EG0A 4ZTFA 2QSHX 1XGNA 5E3OA 3A9KB 2RNJA 2Q8KA 4TQ0A 3G1MA 1WSPA 3KOXE 3AG3H 4DHZB 4DYRA 3CJRB 3UMMA 1Y6IA 3HKPA 3BZKA 4MELA 1TWAJ 2O01F 4I6PA 1VQ9I 1Y8GA 2WAQN 3KW6A 2O6VD 3ROUA 4RB1A 4XYCA 2V1YA 3CGWA 2WB1N 1R7JA 3QQAA 2MJDA 3DOWA 3VYSB 3HRSA 4JX4A 3MK6A 2XV4S 4WXCA 2XGEA 1D8JA 2J7NA 3HPHA 5F1RA 1KFYB 3QIJA 1OFFA 4L8RC 2J5YA 1I5ZA 2VKEA 3QOPA 1YW7A 2C9OA 4WF2A 4GMVA 2LP0A 3FRIA 1ZDXA 2WXJA 5D8KB 1NG7A 3L1PA 2VF7A 2DYSH 5BPDA 1WIAA 3HOWJ 5EE9A 4FISA 3ML6A 2JPHA 4H2AA 2PMVA 2DLLA 3ZQ4A 2Y21A 1RKTA 4GFBA 2CHXA 4F7ZA 4ABZA 4AQYM 2N0SB 3BDDA 1STEA 5KAIC 4XRSG 2ZSIB 2FSWA 1JHFA 3ILKA 1QHGA 4AM3A 3ZYYX 1A70A 4EFOA 3KH0A 2GB1A 3D5LA 1T0FC 1KYWA 2DOFA 2K9QA 1S7OA 1P4AA 4P9UA 2XF5A 2ELHA 3Q0WA 3BBZA 1TW2A 3QU3A 1NHGC 1D0MA 1IXZA 2ZJDA 1DOYA 3R60A 1VJKA 1D0XA 3B1LX 1D5MC 4AI6A 2BY3A 3AEEB 4BBAA 5D6FA 1K79A 5HODA 3L08A 2H1RA 1K6YA 4CYEA 4UVAA 1YITI 1JKRC 2K9DA 2KK8A 1YOVB 2MH8A 3SEBA 1QDRA 1C79A 1I27A 4DUYM 2KWVB 3LNQA 4IHXA 4OHJA 4HVBA 4X66M 1X1MA 2L54A 2N7JA 1I6XA 2R0QC 2LGSA 2ACJA 4KGRA 3IL2A 2DWQA 5C18A 2B3TA 3SC3A 2BVMA 3SMPA 3VR9B 3A4SC 1VQ5I 3ZQFA 4Q4ZF 4U0VA 4HLXA 1IY0A 5AIPA 3HVZA 2AYOB 3CLQA 1SEUA 5GAHJ 4CA0A 1K83J 2DMTA 3G1OA 1L0OC 4XLHA 2C7MB 1MSEC 1JR3E 2OQGA 1HBXG 2DWLA 2IBIB 2JXTA 3P42A 4NQKE 3O3KA 4OMZA 4KN4X 2ISZA 2W3RA 4XBFA 1YQBA 2K3UA 3TJPA 2W3SA 1WRJA 2ZJRF 5EYRA 1FNUA 3BP8A 4Y13A 1P3QU 3SAVA 2FNPA 1TY2A 2EA0A 1K52A 3V7SA 1QT9A 2XFSA 3AL0C 3ZMVA 3KETA 4IBCA 2HOAA 1D3YA 3JW4A 2DT5A 4H4KC 5AUKA 1MBJA 4YRVA 4FULA 3LQRA 3BT9A 4XGAB 3ZC7B 3HVDA 1TQMA 4IX7A 2NYXA 5HNHA 3MZYA 2ELKA 4QTRA 5C3JB 2CGPA 2E35A 1XLNA 2A5YB 3KZIC 1ONVA 3CMMA 3S15J 1N34M 1OMIA 3QPSA 1DGBA 1G2HA 2G4DB 1YJNI 4R8HA 4NC8A 3N20C 2M3AA 2Y69H 1Z6TA 4N58A 3ZNGC 1X3ZB 2V7FA 4G8XA 1L5PA 3PL8A 3FMRA 4EOYA 3H5AA 1F4KA 2VQFM 5HDNA 1IRZA 3VRBB 4RNAA 3CUQA 4ANVA 1TZOA 3DHGC 3HUGA 1E0EA 1MH3A 2HS5A 5IYDJ 1FNVA 1JXSA 4DW6A 2HI3A 2JA7J 5CHVC 2R6FA 4KFCA 1IN4A 1SAUA 2K3PA 2M0AA 1WI3A 1ZQ9A 1BI2A 4Y4RA 3APFA 2OOBB 1WH7A 1N77A 4KSLC 2Y31A 3BVGA 1MZBA 4M3DA 1ZYRF 2FNJB 4XRMA 3K9OA 2NNYA 2WA0A 3WHLA 2DWZB 3HTUA 4UHTA 4Y33A 4OU0A 5FKOA 2KWCA 4B3TM 2VE9A 2WV0A 2F4IA 3ASOH 3R0JA 4E70A 3CTWB 2TCTA 3J7AO 2FAZA 3IAS1 4BQQA 5E1XA 2BE5F 1XNQM 4REZA 4PUSA 2WXFA 2BKRB 5J47A 1HQRD 3T9LA 1D5YA 3P9IA 3J7ZI 1QYRA 5FD6A 5K5OA 2V3PA 3Q0UA 3BVZA 1ENFA 1QRYA 2ZANA 1R2YA 5M5WJ 2NCNA 5EDNA 5C1ZA 2JPCA 4BXUA 5IP6A 5E6OA 4JI3M 3TBLD 1TTEA 2VXDA 2R7TA 3BG3A 1MFWA 2EQRA 3ZMSA 2R7DA 2DZOB 2C5LC 2LVAA 4HCNB 1S3SG 2D10A 1MVKA 1I4HA 2JUGA 4J19A 2ONQA 2Q0OA 2BBYA 1NHWC 4RGXA 3TDUC 1MBKA 1P7JA 3RNGC 1G8PA 3H0GJ 2LFIA 1JT0A 3I63C 3T5XA 3PFIA 2F5QA 1FMVA 3GFJA 2IA2A 4FCYA 4XE0A 1VTNC 1PJIA 2KRUA 2QQ9A 1RUNA 4GGGA 1F2RC 1GLNA 2IA0A 4EJVA 3GS2A 1T5XD 1LFPA 1HT2E 4NAWB 1TTNA 3W2WA 3SXYA 4C9YA 3A45A 3OWEB 4HX4A 4L9TA 4IO9F 4BJ6C 5K1YA 4DGWB 3W2DA 2X85A 3KWVA 1WJ5A 1HKSA 1WXQA 5EP2A 1IV6A 1XXHB 1HZ6A 3FK7A 4C2UA 3EGRA 3CDIA 3IFWB 1ETXA 3B08A 2GXBA 4A3IJ 2PVOD 2V1UA 1R49A 3ZN0A 2R62A 3PIPF 1WR1A 2UUZA 2HYJA 1VZ8A 2KDLA 5KNLA 4XLCA 2ESNA 1TGZB 3ML9A 3FUUA 3Q8EA 3KVFB 4BHBA 3Q14C 3FILB 4IDIA 3ABKH 2Q5WD 4TV3A 2LMCA 4LJZF 1B1BA 4AQ7A 1EWYC 3O13A 4AIKA 2QEXI 2VQLA 3ZMTA 5E17F 3HGYA 3ASNH 1XDSA 3CF5F 1Y0UA 3EECA 4HG2A 3S8PA 2YFQA 4OW0A 2PE6B 2M7BA 3DHHC 3O6BB 4P6VF 3F72A 4ON0A 4WP2A 1HZ5A 3HRDD 4DOZA 2UUCM 4G12A 5D4SA 3BTIA 4RAGA 1ZLKA 1TNSA 1KH0A 2IGOA 2QBYB 3VYUB 3LSPA 3CUQC 1SBBB 5M5XJ 4LJ8A 3N4MA 1HTOA 1XSDA 1QZZA 3GTJJ 4KJZA 1WI9A 1XHBA 4QOZC 2EBIA 4A3LJ 2CU1A 3DLAA 1MD0A 1TQIA 2A68F 4L9VA 4R7GA 5E18F 2DA1A 1E90A 4S0RA 1MMGA 5IAAC 1RPWA 2K86A 5FFXA 1WGKA 1DU0A 2KQ4X 4RMAA 3DU5A 5IPAA 4RF0A 2Z8YM 1HKTA 4MQ9F 3OJ3A 5FTLA 4KKIA 4BB9A 5BO4B 2OO9A 4CCJA 4FETA 3VPRA 5JLWA 4G4OA 4DYCA 3R9XB 2M45A 4JL9A 2QENA 1KQ0A 1HW5A 3VFDA 4PDIA 3GQ4A 1VFCA 2KANA 2DI0A 2XHKA 4LIUA 4G4NA 1TWCJ 2IS1A 4LK0F 2EJSA 2DK5A 3W0LB 1ETVA 3CF6E 2RGHA 4XWWA 2O2VB 5CVRA 1PQSA 3CSTA 2WS3B 1Q5WB 3ALBA 4L0ZB 1R1TA 2M4KA 1V1PB 2H89B 1IBMM 4U7BA 3MC0B 1CF7B 2IPQX 5D3DA 2MC4A 1ON1A 1P2FA 1KRHA 4WX9A 1BA5A 1U5TA 3V05A 3R2TA 3HHHA 3K1JA 2CO5A 4X6AJ 3RIRA 4BKSA 4P5OA 2HE7A 1QQWA 1XMOM 2N8GA 3V8KA 2EV5A 2HVRA 2CW8A 3RCZA 3HOTA 2QA4I 1LVAA 2EZHA 2LLKA 3U6PA 2DK8A 5JZEB 3HB9A 3GRUA 2L5QA 4DK5A 1D3ZA 1KJTA 2CHVA 4ZYEA 3KVWA 1ZRFA 1S1QB 1XG1A 1MPEA 2XGXA 3PS6A 2H5XA 4JK1X 1C78A 1TP4A 2BPSA 1D5ZC 4L0YB 4HYEA 1XMKA 1KU3A 4XWTA 2EA2A 1QPIA 4ZHPA 2LY1A 3QAUA 1JJ6C 1KU2A 2G3QB 3QP5A 2L7KA 4IPAA 2KC1A 2DVWB 3GBGA 1SB3C 1Z5AA 1DDNA 2IAIA 5ITTA 3AI5A 3I58A 2HZTA 5LEKA 4X0GA 2GA1A 1WH5A 1R2ZA 2N4FA 1YJ9I 4TUWA 3OYMA 3MQ0A 3A98B 2N7EA 4YEJA 4IHTA 1R4GA 1T98A 3DF8A 5KPRA 4B48A 5K5QA 4Q5SF 4HV5A 4K7UA 1DYQA 1Q3CA 2XF6A 2XAGA 2PMZN 4NJ6A 1NO1A 5FR3A 4JN6A 2N1WA 2HTME 4M71A 1JKOC 5BPVA 5FLMJ 4U87A 5KHDA 3GLLA 3P7NA 4KO8A 4BDZA 1SXJD 3QARA 4W1UA 2BVLA 4Y52J 2LREA 2L0TA 2FH0A 2K9MA 3VODA 3ZXVA 1IBXA 4BU2A 2R7XA 1J5EM 2GRIA 4IKGA 1ETOA 1PUTA 2V0GA 1XNRM 3IG8A 2KHMA 4F52A 3BTJA 5AEKB 3VYRB 3W67A 5JI6A 3VOEA 3KCCA 4G7ZF 3Q3NC 1WJEA 3DA1A 1G3YA 2HTHA 3BR5A 3CD6I 1U2WA 3LYYA 4DXGA 3KLSX 4S12A 4HQMA 3SASA 1Z21A 4A2UA 1HOMA 3U7DA 4JI0M 3Q8FA 2A07F 2X49A 3FXOA 3UGJA 1UBIA 1RR8C 3N1YC 3CWIA 2BHZA 1A6IA 4NRVA 3S93A 3SAUA 1DGJA 3H0DA 1NHAA 3B02A 5MPOA 1I35A 1ERDA 3Q3SA 2MG4A 4LIVA 3ECOA 1F5TA 1OYYA 1NK2P 3BWUD 2WX1A 3AH7A 2YPRA 1Z7UA 1Q1VA 2JRMA 2CQ7A 4I2OA 2M0MA 2DYRH 4DUZM 1NJFA 2MSED 3TO6A 1NK3P 2P8TA 3L13A 3HL2A 4EZKA 2I7NA 3CLOA 1RWSA 3P2BA 3CIRB 2PE9A 4EMSA 4HJGE 2LXCA 4A3FJ 3QPHA 4ITKA 4GYIA 2DX5B 4KIFA 5IA7A 4LJ4A 1AKHA 5ILSA 3ZRCA 2KRHA 4MM3B 4IVNA 5E8IA 1HDPA 4QPOA 4ENKA 1OAIA 2KNZA 3PXGA 5FKMA 3ZVVA 3J7BA 3S17J 3E4RA 2EILH 1QQIA 1K51A 1U5TC 2UU7A 1YJIA 1N75A 3E5QA 1BR4A 2MYSA 2HNHA 1U0JA 2F48A 4NHJA 1UELB 4ZPXA 2NVUB 1HA5A 3H1UA 4RAZA 2BBCA 3RI4A 3HWSA 3X23A 2V1NA 3C3EA 5J8FA 3C2GA 3OR2C 5DCMA 4BBSJ 2J42A 3TGNA 2LUMA 5H8YE 3HRMA 3GTMJ 2KZSA 4W9GA 4FADA 3QPTA 4CUGA 4AS1A 1X37A 4XSXF 7CATA 3MHSD 3NOBA 4GIVA 3AU4A 4HPQA 2J7OA 4QNMA 3FXMA 1I1SA 3B9PA 3M6AA 3JVZX 1JMLA 3CF0A 3K2ZA 3GZNI 2KJ6A 2X9DA 3SU8X 2KACA 2JZYA 2DOAA 2E2JJ 3ZMUA 2UXCM 1I3QJ 4B7FA 3OG5A 4ZZLA 4BXXJ 1W0UA 2FUHB 3BCAA 2G8LA 3QQ8B 4DV4M 3GE3C 3D5SC 3Q8BA 3U4EG 2KLCA 3DPDA 3KP4A 4YTMB 3KUZA 3FTFA 4EV0A 1HNXM 2KWDA 2ZEQA 2DAKA 4P1CC 3W6VA 1A6QA 2KMCA 2JY8A 4ZDLA 5GAEJ 1WYWB 1VDLA 3MC9A 4ZH4F 4KDLB 4ANRA 2IDYA 1E7UA 4DR6M 3ABMH 4MFDA 3CC4I 4BHPA 3WE3A 1LQ1A 1N6ZA 5ED4A 3TO9A 3TP3A 2BF8B 3IWFA 5G2NA 3GQ3A 2OOBA 4E4HA 1JWBD 3BYYB 2DHRA 4WWOA 2LVOA 2EV6A 1HSJA 2Y0SN 1EH7A 5FO5A 1K3WA 4N9F4 1FTTA 2N9PC 4A3OA 2GOWA 2F5VA 4M01A 3VK8A 2INPE 5EGOB 4ZRJA 4AVPA 1FOXA 2Z8LA 1JUMA 3GPYA 1LKXA 2KJHB 4LFBM 3PUFA 5LFAA 1U8BA 1F0ZA 4L78A 5L8RF 1XD7A 2FUG1 1T3TA 2OTLI 4FE7A 2Z7JA 4MHGA 2A05A 2HFHA 1ZXHA 5IOZA 3AE4B 1ETYA 3HPGA 1EUVB 4YTNB 4IHVA 1BJAA 2VQCA 2WSEF 3H9JA 1E5WA 4IBEA 2IEKA 2R7WA 5DEQA 4P16A 4QAYA 2AEHA 5C2TB 1IYFA 1HNZM 2R5YB 3EQLF 3NBXX 1BI0A 2XZFA 4TUUA 2Z2SB 3T6PA 4HSTA 4C4VB 4N0BA 2LASA 1YN5A 3HM5A 3FMSA 3AE6B 2KT7A 1XDUA 2DMUA 2KN5A 2P5KA 2C60A 2M30A 4AC0A 4YFXF 1WJ4A 3CO6C 4B7GA 3WTWC 4M3GA 3EYIA 1NV9A 3ONQA 3FUTA 4G4RA 3WTZA 2QEJC 3IP4B 1HCRA 3NBIA 2NMQA 4HV6A 4LLNA 2LZ6A 2P7VB 1JCKB 5DM7F 4GOCA 3WAOA 1PUFB 2NBUA 3PIOF 2MX2A 3DBRI 4ITQA 3AULA 3U6CA 2O61A 2DJNA 4BYYA 1IXCA 4KKJA 2M60A 4CCNA 1MBEA 4NAWA 2EFQA 1R5ID 5FFZA 3QJZA 3KWLA 1LB2A 2NS8A 1J7CA 1WRIA 1OFHA 1QOAA 4UB8C 2LVPA 1LFUP 4QNRA 3JRBA 2MH2A 1AYFA 2CUFA 1XXHA 1N36M 2VH2A 4MGZE 5JHFA 2V6EA 2CEAA 3I57A 2XROA 3K2LA 4HPLB 1IN8A 3PRMB 4HPPA 4GKJM 1SVLA 1U4AA 5LMNM 2EWNA 3UIPB 2BGFA 2WXPA 2D3GA 1GABA 4UVBA 4Z8XA 4BJTA 5H37D 1DPUA 1ITYA 2CJNA 4A6DA 1F52A 3CSFA 1E8WA 4GB9A 3FILA 4C00A 4AW4A 1K7AA 1XWIA 4DR1M 4WH4A 2FBHA 5LLIA 3GZ5A 2DT6A 5DUKA 3RNCC 1N63A 1EF1A 3QP6A 1V81A 1Z5SB 2DAIA 2JQ7A 2FEZA 1R23A 2VBXA 1OCRH 3ONSA 1WF9A 2XBBC 1FEHA 2MJ5B 3HSEA 1RI7A 3A9JB 2FD5A 2MGQA 3C58A 5EQTA 3P4QB 5HS7A 4LDTD 2KZVA 5E6PA 2QHOB 3ENEA 3CDHA 5EEHA 1ZG5A 3ERMA 4G3OA 1S5LC 1JTYA 5CHWA 1CUKA 2EFNA 5IYCJ 2XSZA 3GTPJ 1F36A 3FXUA 3BTLA 2L2DA 3JAMZ 3HEFA 1JWUD 1ZRDA 5GMVA 1JWSD 3OSFA 3HC7A 2RGVA 4CGZA 4AOFA 1A5JA 4MEMA 4ZDPA 3S3OA 4FWDA 2VJ5A 2L7HA 3KS8A 5J6XA 2R2QA 5HDGA 2CRUA 1PRBA 1ZLJA 2OA4A 3AMZA 3HJ8A 2PQ8A 3ULQB 4YG2F 3A4RA 4GDLA 2GQFA 3TOBA 4JX5A 1V9JA 5L3DA 1MG4A 3L2QA 5CVUA 1ROEA 2LJIA 2EIMH 2OQ4A 1MJAA 2Q1ZB 5K7HA 4HL4A 3I4VA 3JSOA 4EM2A 2EFOA 2Y0MA 3EFUA 5KQ8A 3GRRA 2F2EA 1IY1A 1V5OA 3DEWA 5BYQA 1V80A 4GH9A 4A55A 5IY5H 1RRJA 3OS1A 3GLFB 4A8XC 2KOXA 4M6XA 4M9ZA 3KW5B 2WSCF 4DHJD 4FW9A 2HZDA 4MH8A 1V5TA 3IRQA 3AE5B 1GDTA 3ZNZB 1VNDA 4IJFA 1P92A 3AEAB 1AWDA 1XGMA 3AFHA 3LWFA 2VBYA 1ZGWA 3WU1B 4KDPA 2VXZA 2O2VA 2KNAA 4YSXB 4D0PA 1EF5A 5FKAC 3SEZA 1RIOH 2KFKB 3LA2A 4LG3A 2MW8A 5D5XB 1GB1A 4K1RB 1W7PD 1CF7A 3IG5A 4K3BA 4Q7JA 3L10B 3M1CA 4LF4M 1TZLA 4LFCM 2DBBA 3VXWA 2KRKA 3U5ZB 1MN3A 4BKGA 8CATA 1YSYA 2OAZA 1MW7A 2RQQA 1YRNB 1JR3D 1RZ4A 4LNNA 3V8LA 1FYKA 2JVHA 4YSZB 2QQBA 3OLMD 1QOGA 2GIVA 1HSTA 4LY6A 2VBWA 2JUCA 1M94A 2JU6X 5DDGA 3KUCB 2L9RA 4I09A 1OPCA 2LFBA 3KYCD 4X62M 4AIJA 4JWSC 3H3VK 2QSDA 3CZ6A 2WAFA 3HIZA 1O7LA 3OYKA 1QGPA 4EM1A 4N4OB 3K0LA 1FFUA 3BJ6A 2EJRA 5FTNA 2WXIA 3B7QA 2R2OA 4PS7A 3DVGY 5AONA 3KE2A 2BW2A 4ZYGA 2EZKA 4IBBA 3ZDTA 2FX0A 3NVYA 3QC8B 1L2DA 3GLHB 2GLSA 2CWBA 4XONA 2YNMD 3VKHA 3ESWB 1BIBA 2W9NA 1TWFJ 3E6MA 3FXQA 2LKXA 1OIPA 2H8RA 3GTOJ 3FYCA 2RV8A 2VE8A 3QPLA 2K8CA 3HU3A 3QRFF 2I1JA 4LTUA 4XX5A 4C3JJ 1D0LA 3D8BA 2XK5B 3BWGA 1WFYA 1OR7A 3FE3A 2V6CA 4EJWA 2RC4A 3MHZA 3Q8XA 1USSA 2LWXA 2VT3A 2FXAA 1U6GA 3OYCA 1UZCA 1WH3A 3UNGC 2IJLA 3H36A 2ZXWH 2V1XA 4A90A 2JSPA 5D7GA 4FTHA 5JI3E 2Z3XA 3GFLA 1MNDA 3TDZC 2NBVB 1SJHD 5DUIA 3VUWA 1OKRA 3TE6A 4CGYB 3OIQA 2GBRA 1QILA 5J40A 2WX0A 4XC2A 3ZJVA 1HJPA 3H7SA 5DM6F 1QVTA 4MT5A 1TBEA 1BMLC 3A1YA 1L3LA 1XB2B 4EIWA 1JE8A 4L18B 3FX3A 1GJTA 3SDGA 4QHSA 2ID3A 2K5PA 3GLGB 1QPMA 2O9LA 3NHEB 2DPDA 2V79A 1HF0A 1VCBA 3I64A 5I4DA 3AE8B 1FOWA 1O7FA 3RYPA 1O4XA 5B1AH 2HPMA 3WTTC 1UHSA 4O5VA 1L7YA 4NNJA 1ZR2A 4JI4M 4GCVA 1QAMA 3U6SA 2L9SA 3F8BA 3JSVB 1M4VA 4OVZB 5CVJA 2D7HA 4N4NB 2ZNVC 4XZ4A 4Y28F 2TRTA 3KOZE 1ZPSA 2J0KA 2WDQB 2KL4A 3OL4A 5D6EA 4NPNA 2W55A 2O8KA 2DT7B 3SFIA 5FLXS 4XLPF 5JLXA 2COMA 3ZN1A 3APCA 5LRRA 1WQ2A 3LCUA 3E3VA 2DJIA 2MSYA 1JGGA 1T2KA 5DPRA 2WDRB 4G7OF 2XAQA 3THGA 1XMXA 5A2QS 3M8FA 1IP9A 4LB5A 1USTA 3VH3B 2GM4A 5JHAA 1QUSA 3LSIA 1KU7A 4ANJA 2F4OB 2WXRA 4B43A 2A61A 2L09A 2NVXJ 4MDKE 2MA9B 3KYLA 1Z1DA 1OJLA 4D5FA 5GAGJ 1XMQM 2WYQA 1T95A 1B8IB 3KDSE 4ANXA 1S3JA 1Z9CA 1CGPA 4DJAA 2HOTA 3HKZN 4TV7A 1FCCC 2K40A 3VR8B 4PK4A 3AL0B 3O8GA 2EPFA 4WJNA 2RSUA 2R0IA 3JRAA 2WP9B 1OLTA 5DYMA 5CJ9A 4IZZA 2WZJA 2PVGC 1WM2A 2X8XX 3GFMA 3FZVA 3BQZA 1E94E 2BB5A 1PJQA 2QYOA 3DVGX 2RNGA 4HDOA 2JY5A 1X1PA 2V9VA 1P3QQ 1BOBA 4RLQA 3H8HA 2PJHA 1Z5CA 3W6KB 5DS9A 3BTCA 3W2AA 5CQEA 5CX3A 4CICA 5LXHA 1QU3A 5EG0B 3M8JA 1VF9A 4JXJA 3U30A 2F5PA 2DQRA 4JQFA 3S2DJ 3KFUG 2VASA 2YR0A 4KGSA 2KHWB 3CF2A 4F1SA 3M8EA 1OEYA 4L9NA 5CLSA 3KP2A 2E19A 1WJ7A 4YSYB 4DZPA 4XK4A 2R7QA 4E7SA 4H0EA 1MX0A 3DTEA 3CCMI 4HCPB 3UK6A 2KN4A 3HOVJ 3SYLA 4JI7M 5BMGA 4HKQA 3ZQHA 3H6NA 3G6EI 2MLGA 1UGJA 2Z99A 1OQQA 5CYVA 2DMNA 4PJNA 1X2NA 4MGIE 1LV7A 3GW2A 3HHZA 5EP1A 1V49A 3DBHI 4LF8M 2ZC2A 2KKOA 3DEUA 4F3QA 3Q8GA 3NZSA 1OIZA 1OFCX 1EJ9A 2JJ7A 3RMKC 3I54A 3H4JA 3WTYC 1XSVA 1OCCH 5LHGA 4FASD 3FRHA 2R5ZB 3NAUA 2KMUA 4LJOB 2PLYA 1Q02A 2RAEA 1VQOI 3H1CA 5L3CA 4GDFA 5E6NA 1SXJA 2KQ7A 3VVWB 1LXDA 1AOYA 3K2AA 1T0RC 2VZKD 2FBWB 2QF7A 1ON2A 1XSXA 2WDVB 5J4YA 2R5YA 1EIJA 5E1ZB 4I0AA 2M87A 2HOSA 4JX1C 5BMHA 1TDHA 3U60A 4WCGA 4C4VA 1FFVA 2L76A 2EA4A 1KSFX 2FBKA 4V19K 1RU3A 3EPZA 2Z0EB 1DGHA 1EO6A 3GPUA 1P4XA 5DYGA 3DLLF 1IF1A 1VI0A 2KW0A 4A20A 3ZRGA 2NVTJ 3FDYA 4WJQA 2OPTA 4CCLA 2NBWB 4AG5A 2K0BX 2QIEB 5DCNA 2WADA 3LA3A 1JQ4A 1F77A 5IREB 4BBNF 1QVRA 2KDBA 4RF1A 1E0ZA 4K2EA 3L27A 2Y30A 2DNAA 1C9FA 2Y5CA 3ZJTA 4P17A 1ODDA 3X2QH 2CRGA 2BS3B 2BW3A 1D8KA 3HDDA 5EE0A 4BOZB 1O3RA 5FB2A 4RB3C 3KYDD 5KVRA 4C3HJ 2BWBA 5FKLA 2LOOA 4RLFA 2HYGD 2VC1A 4BY7J 2AL6A 4DHZE 1D1AA 4CIZA 2I38A 3HHWA 3OS2A 2CQKA 5L3FA 4K7SA 4W9LA 2PG4A 2XVCA 5CTRC 2BY2A 2FCNA 2DPUA 2CFOA 1R5HA 5G5GA 3TOAA 2KZRA 1E17A 5E26A 2AXTC 3DKXA 2N9LA 2OJWA 4U88A 2XSJC 2BY1A 5IZ7D 3ABTA 1MBGA 4BQNA 4FT8A 1NENB 3TO7A 4D9JA 2IT0A 4AWJA 4G6QA 2LTPA 3OJ4B 3TEZA 1FBUA 1SFOJ 3OS0A 2XAJA 1ZAOA 2CUEA 3CCLI 1ENHA 2LUEA 4DDID 3SFEB 3PRPB 2WXKA 4WXHA 1R5LA 1JJ8C 4S05A 3H35A 4IBKA 1IO2A 1WVRA 4XL9A 5GTIC 4G3XB 2DODA 1WHCA 4IM0A 2PPHA 2DA4A 4UDUC 2CQNA 2YEPB 3I4NJ 2ICWG 1FX7A 2W00A 1OCPA 3WGGA 1ZRCA 1NBFC 3L09A 3L17A 4MO7A 3HU2A 3FAHA 4D5CA 3H4MA 2WBMA 3JRHA 2N1VA 1JT6A 2IRFG 2OQRA 2JPBA 1ACCA 1XGOA 2GQQA 4N6EB 3VH4B 2LEKA 2JYTA 3MKYB 3ZRFA 5JVTA 1D1BA 1Y8QB 3FBNB 2LBFB 3CUOA 1X4PA 3K4BA 4BNCA 1KYIA 3HUGB 1ISNA 1QUTA 2Y0QA 4CO8A 1PGYA 3D5RC 2JWSA 3CCEI 1I7HA 1O3TA 4AJYB 1J7BA 3M3YJ 4L2YA 2DHZA 2CJJA 4LFUA 4PJLA 1RFAA 4IBGA 1YIJI 3KFWX 2L3DA 2W48A 4JI2M 1KF6B 1WGHA 1WR6E 1F43A 2CJOA 4JI8M 1EH6A 1K50A 5J8CA 2XDVA 4II7A 3WE2A 2QKLB 3SHFA 5TGTA 1JWMD 2BEOA 3BOSA 4Q2JA 4I7HA 3WTXC 4I01A 1SXJC 3IV5A 4RH6A 1EFUB 3KXEC 4MGRA 2CU3A 5FLXZ 4RGOS 4CQNA 3U6QA 5M3MJ 2AXLA 2L9NA 4EM0B 4EQQA 1S7AA 1FEXA 1YN3A 1TF0B 2D1VA 4GN1A 2KFKA 3WAMA 1TKYA 1SF0A 4I0BA 2M5WA 3LB8C 5HLTA 4NB5A 5A2QZ 3FUXA 1RETA 1VQNI 4ASWC 3S14J 3W3CA 3MFKA 4QIWN 2R7OA 2HXOA 1V6EA 4GLSC 1PJJA 4PT5A 4DDGD 2FOIC 2L8JA 2DOEA 1R1UA 1R9TJ 4GHLA 2PTLA 4OVVA 3SHQA 3IKVA 1SFKA 3SQNA 1G3WA 1ZW7A 4UUTA 1QOBA 3J81S 3QX1A 3CJTB 2XB0X 2D2WA 3F8MA 3KEYA 2K0PA 2FOKA 2EKFA 1JGSA 1PJTA 4IL6C 3J27B 2E7WA 2FFJA 2OV7A 4HBLA 4UUSA 2YX4A 4IWQA 2CV0A 1XCVA 4PCQA 1R5GA 2HKXA 3CESA 1HW2A 1V1OA 3SFDB 5DFLA 1WZ0A 4GRIA 1R4NI 2F5DA 1TW3A 3L4PA 4FVMA 3GTQJ 4YXDB 4IQJA 3EUKL 1WHUA 2JTVA 3VTUA 1NNJA 1SVMA 1IUEA 5BYSA 2UU9M 2W85A 2A4ZA 1TH2A 1KLUD 2N9EB 4HEA2 2APLA 4ZOHC 3JSPA 1MMNA 3UF8A 2Y75A 3IH4A 3K4MA 1EV7A 2R44A 2HTSA 2XN9C 1TKEA 4KGTA 4FBJB 3BG5A 2C6YA 1ZOYB 4RA2A 1UGMA 2NS0A 4PJ0C 3E21A 1V4RA 4LNFA 2HPIA 3TPZA 3BLYA 1K4SA 2PMHA 2QCOA 4OOIA 4PJJA 3MC8A 3HBLA 2CUJA 2QNJA 2EINH 2WAQA 1Z2MA 3P1MA 1GOZA 4WWCA 2WB1A 2QUFA 1OEYJ 3PV1A 2ZAMA 2BYTA 4LITA 1F1HA 1I94M 3NJTA 4A12A 1J9IA 5E1WA 1OYWA 3HZJA 3TW6A 4ARCA 5GKNA 5ITXA 2CE7A 3AAFA 2E36A 3IXSA 5FTKA 3U6MA 3F23A 4FWHA 1UFZA 2BNKA 4A6EA 1TC3C 5J1YA 3GLGA 2EKIA 2KC2A 3R0AA 4QPQA 3S2AA 1TZ1A 1SE9A 1ZGJA 2ME6A 3R61A 2LVQA 3U2SC 1FO4A 4A93J 5TJJA 4XKCA 2AQEA 1HT1E 4PYUA 2FE3A 2D11A 3E97A 3BJOA 1WJ6A 3OYJA 2XRLA 4ZZDA 2O7OA 3TUOA 5B5EC 1PGXA 3ZNHB 4M0WB 2HL7A 3MZ8A 4BZAA 5EP3A 1ZQ3P 3HSRA 3ABUA 3JSVA 1MMAA 4OVZA 2VQHA 4P7IA 3JTHA 3ZLZA 1WXMA 3SEQA 3B9JA 2K9LA 2LRWA 4AU7A 4A0YA 2B7EA 2XAHA 2C9CA 2IS2A 1IDZA 3DQVC 1RFKA 2ZVNA 5KAFC 1P1AA 1P7EA 3WGIA 1AHDP 1FTZA 4HZFA 4N9HA 3LSHA 3QAQA 5G55A 3LL7A 2HTJA 4MSMB 1HQYE 1B4AA
chains in the Genus database with same CATH topology
1C77A 4BE1A 3L2AA 2KAJA 2WY8Q 2IGNA 4DQOC 1GKIA 3HL2A 4XORA 2RPVA 3VDXA 3NWLA 2I7NA 1RWSA 1TJEA 2H88B 3UJNA 2KMMA 3CIRB 4HJGE 2RMMA 2V6ZM 3AEBB 4YHHM 4ITKA 4ZRQA 3V3XA 3FKJA 5HVQC 3IAM1 3ZCOA 4LJ4A 2IJ0A 2LGIA 2KRHA 4MM3B 5FRNA 1JW9D 5KPZA 4XMYA 4QPOA 3U52E 3PXGA 2IGDA 1XLPA 3J7BA 3E4RA 3BYTB 3AKZA 2SAKA 4DV0M 1K51A 3NVZA 1YJIA 4BE0A 1N75A 5DYIA 3BVMA 1BR4A 3RFWA 1G8XA 2MYSA 2BT6A 1WJDA 2HNHA 1Q39A 1U0JA 3OIPA 3PNTA 2ZSHB 1UELB 4ZPXA 1HA5A 3L2WA 3D8LA 1G4AE 2BBCA 3K6GA 1EM7A 3HWSA 2DWMA 4CCKA 2V1NA 4NZLB 3U7ZA 3DTKA 3C2GA 4M0DA 3OR2C 3SMSA 4IBDA 2J52A 2J42A 1D1CA 1YQ3B 2LUMA 5H8YE 4BE2A 4NQWB 1T6BX 2OEDA 2KZSA 4EE2A 4CUGA 4CZCA 5HG2A 4AS1A 3ZGZA 1X37A 4D80A 4E7ZA 3ZJUA 7CATA 2MABA 3LSKA 4HPQA 1Z59A 2J7OA 3TEXA 3AE3B 4QNMA 4BGDA 3AN1A 3P4PB 3B9PA 2F4VM 2VJIA 3IT6B 4A9AA 2VIXA 3BG7A 2OPFA 5FK9C 3M6AA 1TGUA 1JMLA 4WW0A 3CF0A 3DWLE 3E9SA 4NAMA 3U61A 3HKZA 2KACA 1DQUA 2DOAA 4GHAA 2UXCM 4B7FA 4L16A 2WXMA 3VSLA 4RM2A 3K92A 3FTDA 3BCAA 1GL7A 2MH7A 2G8LA 2K9XA 4ZRPA 4KHPM 4DV4M 4LGYA 2UV1A 3D5SC 3Q8BA 3U4EG 2ELJA 4YTMB 4CCMA 3FTFA 2KQRA 1HNXM 2KWDA 4J00A 3AOGA 1FIQA 3KSJA 3GO8A 3A4CA 3BC8A 3OL3A 1YX5A 2V4IB 2HHHM 2RKOA 4M9XA 3GLIA 4LF5M 1BUIC 4HLQA 1ZE3D 1DO2A 4ZDLA 3RGSA 1G3IA 3I9V2 2VJ4A 4OZAA 1Z7LA 2RREA 1V5FA 2IDYA 2R7UA 3T3OA 4DR6M 4ZHOA 1QAQA 1IQPA 2LY2A 5FTJA 1X1DA 1SJED 1L4ZB 1TS5A 5E6JA 3DU6A 4K0KM 3GQ3A 3HHYA 1NVID 2HVSA 5HHDG 4E4HA 1JROA 1JWBD 1TYGB 4JI5M 3BYYB 2DHRA 1PDXA 4PFOA 2ZXHA 1NNUC 3FUWA 1S9HA 1D0ZA 2PMZA 1K3WA 4RFBA 5DNYA 1SXJE 4RCOA 3J7AS 2Y3AA 3UR3C 2F5VA 3GRYA 4B08A 5BYRA 1IBXB 3VK8A 2INPE 1PYWD 2LH0A 2Z8LA 3PFYA 3GPYA 2AQFA 1LKXA 1L4DB 4LFBM 5LFAA 2X1DA 3HXLA 1F0ZA 4PSWA 4L78A 2C96A 1W36C 1JWAD 1L0YB 2FUG1 1T3TA 3GLFA 1DGFA 4F91B 2LHDA 2Z7JA 5EP4A 3QYFA 1ZXHA 3URYA 4DV2M 2INNE 3FKEA 2QMTA 3AE4B 2Z4RA 2BB6A 4XN0A 3HPGA 2V1CA 2FE8A 4YTNB 1E9MA 2VQCA 3AOEC 2K5CA 3OTOM 1FNWA 3H9JA 4AKGA 4IBEA 1FD6A 3IT4B 2R7WA 1NY5A 2E1MC 1C4AA 4F93B 2E1MB 1HQCA 4P16A 2LYCA 5EXSA 1IRXA 3LVWA 5C2TB 1FMWA 1HNZM 1WJAA 4PFPA 2XZFA 2Z2SB 4OAZA 4YY3M 4HSTA 2K47A 3ZGKA 1YN5A 1QLBB 3L28A 3AE6B 3L29A 3FD9A 4RGNA 2X1CA 3DWMA 2E60A 1UM8A 4WAFA 4QHTA 4XM3A 2BS2B 4B7GA 2IGKA 2R4GA 4B47A 3PNYA 3L26A 4DR3M 1AA7A 2HKJA 3ONQA 3FUTA 1IXRC 4G4RA 3U5ZA 2WXQA 3VYTB 3OYAA 1UAAA 3AB5A 4A6QA 2QEJC 1C4CA 2JZPA 1LDKB 1F2RI 3IP4B 2BOLA 3NBIA 2NMQA 1B1ZA 1Z3YA 4NL4H 1HEZE 5T8IA 1JCKB 2R4JA 2C5RA 1YQ4B 3SR6A 4IOIE 2PKOA 4JE3B 1R6RA 4KISA 4ITQA 2GOMA 2HDWA 3U6CA 3DPLC 4JOMA 2TSSA 3VRAB 2IS4A 4BEHB 2IXSA 4MGYE 4KKJA 4D2KA 2M60A 4CCNA 2SEBD 5ITQA 2E5NA 3HOSA 2YEPF 2MJ3A 2V3NA 3KWLA 2CUZA 1BR1A 1J7CA 1WRIA 3NWSA 1OFHA 1QOAA 3ZH9B 2WNMA 3ZR8X 4QNRA 5KPTA 1CZPA 5HOOA 1TH4A 2YQZA 5FSWA 1DGRM 1XXHA 1AYFA 1N36M 4MLOA 4MGZE 5JHFA 2V6EA 3B2FA 2CEAA 3I57A 4US8A 2E5ZA 3K2LA 2X1EA 1IN8A 2R18A 4X64M 4GITA 4GKJM 5LNK1 5LMNM 4DIQA 2C98A 1VDDA 4GIPA 3I9V1 3GLHA 4CCOA 2WXPA 4BJTA 4Z8XA 5H37D 5KQDA 2CJNA 4B3SM 1WFXA 3E0JB 2D7EA 1AN8A 3FILA 4IQ4A 4AW4A 4FXCA 4MGHA 1XWIA 3OOUA 1FMAD 3IAM2 2CMPA 4DR1M 4WH4A 2KZUA 1SE2A 4XN3A 2CV2A 3T1HM 3ZQQA 2XF3A 2DT6A 4DR7M 1N63A 3NVVA 2FNAA 2KDMA 3SARA 3AJIB 2IGHA 4AVZA 5LMUM 5CKTA 3J7AY 3KP1E 2X6YA 4DV1M 2IGGA 2PLPA 4LFAM 2HU9A 2W82A 1MHHE 3DKYA 1FEHA 3B2GA 5IT9S 4JI6M 1MHXA 2LXEA 1PJRA 3C58A 2X8AA 5EQTA 3FHNA 3P4QB 4OWRB 1RM6C 2KZVA 1W36D 4R79A 2M19A 2M5ZA 3DOAA 3F9KA 3GPXA 3VKGA 3S3MA 3I3LA 1EWCA 2XSZA 3P4SB 4WQMA 2B76B 3QODA 1E9RA 1IBLM 2R7RA 1L2CA 3RE8A 2LBFA 2G5GX 4BACA 1KLGD 2UXBM 1JWUD 3T1YM 1N60A 2JVGA 3TEWA 4IJEA 1JWSD 3GLIB 4JYAM 4OU7A 1L6UA 3HC7A 4YELA 3LQQA 1N62A 1Z3XA 2QP9X 3KOYE 2P0WA 1VZ0A 1FRDA 2D5GA 3MMYB 3NWTA 4ZDPA 3S3OA 4FWDA 2VJ5A 5FTMA 4XLEA 1E32A 2L7HA 2DYOA 5F3WA 3KS8A 1V5GA 2D7GA 1TS2A 1IN6A 2K22A 1GB4A 3AMZA 5GXGB 3HJ8A 1UNSA 2EUCA 5JI2E 4C30A 3EIHA 3GQ5A 1KFVA 2I2YA 1UG0A 3L2QA 1DOIA 1ROEA 2LJIA 3HG9A 4R3DA 2OQ4A 4HSRA 2Q1ZB 3Q69A 4HL4A 3I4VA 2QJLA 2CS3A 3AV0A 3K4LA 5KO3A 4ZYSA 3I4YA 1ESFA 1HXYD 3I51A 1TH3A 2BS4B 3FUVA 3OY9A 5KQ8A 1HR0M 4L23A 1WYGA 3GRRA 1R7RA 1IY1A 4W5WA 2V9KA 4B0EA 2ERCA 5BYQA 5G5HA 4II2A 2Z4SA 4GH9A 1FCLA 4A55A 2ZW1A 2KRCA 3OS1A 4IBFA 3GLFB 1ET9A 4A8XC 3PVSA 2DLBA 1ZELA