2W82A

The structure of arda
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
163
structure length
163
Chain Sequence
DMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extensive DNA Mimicry by the Arda Anti-Restriction Protein and its Role in the Spread of Antibiotic Resistance.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Replication inhibitor
molecule keywords ORF18
total genus 39
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07275 ArdA Antirestriction protein (ArdA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.560 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2w82A02
1.10.10.1190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w82A03
3.10.20.480 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w82A01
2W82A
chains in the Genus database with same CATH superfamily
2NNNA 4ZYHA 1K83J 3HTUA 2DZIA 1TS2A 2JT1A 3C3EA 2FBIA 2LMCA 3GVAA 3S1QJ 3J7YJ 4XKCA 2MSED 1TQIA 2KANA 2PTLA 1WKMA 1IP9A 1XEEA 3D8LA 4EZKA 2AYOB 5H20A 2RSUA 5DTDA 2J5YA 4XK4A 4RMNA 2V1UA 4GITA 3Q6BA 4P1WA 1X2MA 2XPVA 5JZEB 2C9CA 4HX8A 2BTEA 5KK1A 1D5MC 4HA8A 2DDAA 1TKYA 3VTVA 1ON1A 1JTYA 1X1CA 2Z99A 2INDC 1YS6A 2YSRA 2HYFA 2O6VD 2VPLA 3FX3A 1XMAA 4GKKM 5EQTA 2QM3A 5CLSA 4PJ0C 2ZNYA 3KEOA 4GB9A 4CA0A 1FLIA 3FWEA 3GPYA 2JWSA 4CZZA 2ZVNA 4HNTA 3SARA 1F2RI 3K7AJ 2K3FA 3JR9A 4KMFA 1IM2A 3SMSA 2ZW1A 3HU2A 4QWQA 1O7LA 4OAZA 2REXA 2DMQA 3OIPA 4REZA 3K4NA 4N59A 1LPQA 3B9PA 1J7KA 1YD8U 1LQBA 3WANA 1N5XA 2IW5A 2E3TA 5D3IB 2ID6A 2KOXA 1EUVB 1JQ4A 1N75A 4ZPXA 2OTLI 1Y0NA 4FJVB 4FCVA 5ITTA 1VEKA 3BR2A 3K2AA 3AE1B 1S3SA 4AIJA 1V6EA 2L52A 3G2BA 2E1MB 1HTOA 1F36A 3IC7A 4G7ZF 4OWRB 5FB2A 2ESNA 1JGGA 3L28A 1T8IA 3O6BB 3AH7A 2DAIA 4LFBM 1VZ8A 1XSDA 1DU0A 2BPSA 3JYUA 1TWFJ 1WGXA 2DWLA 3M62B 3V05A 3LSRA 3PQJA 3HHHA 2F5OA 2R65A 1KYIA 1TC3C 2DMPA 4KN7X 3JRDA 1E2XA 4IBJA 1E8ZA 1WPKA 2K3PA 2GM4A 2YEPF 4LJ7A 1GJTA 1IC8A 5IO9A 2ZAOA 4Y13A 2PFBA 1UBIA 2QUFA 4LGMA 4HWIB 5F08A 2WX1A 5TSSA 1FIAA 4JX6A 2JTVA 1AHDP 2GOMA 4LGWA 4GHAA 1U5TA 5BMGA 4EVIA 4IDIA 4I6PA 2EV6A 3WGHA 1W36D 4W5WA 4YY3M 1IN6A 3ONSA 1Q3BA 4LFCM 3LWFA 2OPTA 4W9HA 3D8BA 2ONQA 1WIAA 5F1RA 3EUHA 2FU4A 2LHGA 1TH4A 3W2DA 4G3OA 2RGVA 1C77A 2W54A 2XASA 2NVXJ 1IY2A 5EF6A 5F6FA 2LBCA 1MMSA 4M0WB 4HJKA 3ZOBA 3P2BA 4G50A 4M9ZA 1HE8A 3UF8A 1ZAOA 4WXCA 1X19A 1LKXA 2QQ9A 3Q0VA 4XRSG 4GFBA 3DHHC 2ECCA 3RPFC 2BBYA 4M01A 2NR2A 2V1YA 1XF5L 3SASA 3FTFA 3WTSC 2A69F 3L1PA 3U6CA 1NJFA 3TOBA 2IVMA 1W4MA 4X65M 2VOOA 3HSFA 3JTGA 4U7DA 5J2RA 3AE2B 1R4NB 3KUZA 3FXLA 1K51A 2KNAA 1REPC 3RI4A 2ASQA 1X3ZB 1OAOC 3LCVB 4D7NA 2TSSA 3D5SC 3FDYA 4II2B 4XZ4A 3A46A 4NRVA 1STEA 3HK0A 1SD5A 1T08B 1YO5C 3S8PA 2CUEA 1P4WA 3IWZA 2V79A 2Z0DB 2KT0A 1YQ3B 3H35A 4QNMA 1W7PB 2RR9A 4KYWA 4CDGA 4J01A 4JYKA 3CCEI 2KZSA 3EETA 4DDGD 1ZW7A 2LVSA 1NSFA 2K6QA 4JI2M 5L3EA 4IHYA 4DR6M 3MWMA 3VHTC 1YUBA 2F4IA 3T0YA 1XCTL 1SVLA 1WSUA 2CHQA 3QP5A 3HY5A 1ZUD2 1OCOH 1UWXA 3F23A 2XV4S 1ON2A 3GPPA 4AIDA 3JW0X 2WB1A 2B0LA 5DPSA 1EU3A 1OR7C 2OJED 4TKNA 2MHJA 2PEXA 1HCRA 2XZFA 5EE9A 1GC6A 2G45B 2K9MA 1SVMA 1ETWA 2Z0EB 2VH2A 2E60A 4II7A 2X4HA 4KIGA 5M3FJ 3R61A 1LM8B 2K40A 3UNGC 3B2FA 3K1MA 2CHWA 3GBGA 4P7IA 2EFPA 4L78A 2HEOA 1FNVA 2Y31A 4W1UA 3Q8XA 5TGTA 2QKMB 4TV3A 4EJOA 3LXFA 1L1ZA 1VQ4I 4O3MA 1MH4A 2DAGA 4DIQA 3UR3C 2UXNA 5DD8A 3WTVC 2XRLA 1KQ0A 2ZTCA 3R7QA 5AONA 4CYCA 2KLGA 3EIHA 1XMOM 4RF0A 1Y1WJ 1YX5A 2PE9A 2XSJC 1Q3CA 2HKJA 2V9HA 1AOYA 4XLAA 3HUIA 4JN6A 1Q39A 2LKXA 3ZW3A 2LVQD 3GZ5A 4CHKA 2QBYB 3KUDB 5F04A 3LA7A 2LFBA 1L4DB 3U2RA 1ZRFA 4EM2A 3GLHE 2C96A 5HDGA 1GAQB 4HVBA 1H0MA 3VEPA 2AQ2B 2I1JA 3Q2AC 1OTRA 1VQ9I 1IBMM 4JXJA 1ETOA 2JSCA 3HOVJ 2EQRA 3Q3MC 2FEZA 4KLNA 4CYDA 1N6ZA 4K3BA 1UFMA 4IRIA 2PG4A 5EJCA 4HSTA 1KOTA 3SEBA 1MBFA 4XICA 1WE7A 3QX1A 4JI8M 3TEWA 3NWSA 2QQBA 1SFEA 3SATA 1D8KA 4HDQA 3MP9A 2R0QC 4GDKA 1JUSA 3T8TA 1XCVA 3V3XA 2WX0A 3K70D 2FQ3A 2VBWA 1P9DU 1OJLA 3IH2A 4DW6A 1V3FA 2DAEA 2JRMA 3OYCA 2BVLA 4US9A 4NXMM 2CYYA 4K7WA 2E34A 4XSZF 4GOCA 2W1OA 1WRIA 2KD0A 2KDZA 3NVVA 4LJOB 4JX4A 1YX5B 4D0PA 4ENMA 1YIWA 1FEHA 4KICA 4AI6A 2GOXB 3J7AS 2KWCA 3C0RB 3LDZE 1SIJA 3FM5A 1U9OA 3KXEC 2IO2B 3P4SB 4UY8I 2F5SA 2RGFA 4IHSA 1Y8RB 2INPE 2FBKA 4ARCA 1PDNC 2JVGA 3GTLJ 4ZHPA 2CFXA 3HJQA 3DVGY 1MMDA 4RFBA 5H6QA 1XXHA 2HD5B 1PGYA 2KVZA 3APDA 3LSHA 2MA9B 3DF8A 2WWZA 1SB3C 1WM2A 2K0BX 5B1BH 4ESBA 2PEAA 1M94A 5E3OA 3S3NA 2XGEA 3GLFA 2L0FA 1GG3A 3FUUA 3E6DA 4ENKA 2XIGA 1FJLA 4I8OA 2BEOA 3QK0A 1Q1OA 1QANA 2O61A 4J6IA 5J17A 2BF8B 4RGXA 3KS4A 1OIZA 4PJNA 1GNUA 1TY0A 5FRMA 4BUPA 1ZQ9A 4HKZE 1K82A 1E17A 4KX6B 1P6RA 3CO7C 2V26A 1OFIA 3ZYYX 3CMAI 2LJ5A 3ZDMC 2B3AA 5LEKA 4CHUA 3PNYA 1OFCX 5IREB 1QLBB 3KYCB 1KU7A 2XLJA 2R18A 2CWEA 2INNE 3GEZA 5CHFA 3JRIA 1WSPA 1P2FA 3NY5A 4B3SM 3FD9A 4MLOA 3W1YA 2EKIA 2DA7A 4QNRA 2LNBA 3WTWC 1AU7A 3SDGA 3DVNU 1VLBA 1QPMA 2KL4A 3P5JA 3S14J 4DOZA 2PW9A 3GPUA 2WQYB 4ENNA 3GTOJ 1SD6A 2DENA 1NVMA 1VD2A 3M07A 5J1UA 4AYBA 2BXZA 4I5SA 1UAAA 1TH2A 3FKJA 2J52A 3QODA 3TL4X 1G8PA 1DGWY 4CCOA 2IPKD 1EJ9A 2LASA 1IF1A 3S15J 4TUUA 2Q1ZB 3OYIA 2R7SA 4NC7A 1MNEA 2KRHA 4B08A 4DXGA 4HRIA 2ZSIB 4YHHM 3GP7A 4B4CA 4A3MJ 2BYVE 1PGBA 3W2VA 5C4XJ 1DP3A 1BI3A 1IGDA 3ZMSA 1K4SA 5KQ8A 1HKQA 2V4LA 3L17A 2M56B 1R4MB 4NAMA 5FRNA 2Z8LA 3G3ZA 1DU6A 3FXMA 1L2DA 1HR0M 5JH5C 2C6YA 3D1NI 4BXFA 1IPGA 4CQNA 5IOYA 1FWZA 3FTDA 4KGSA 2MC3A 2IP2A 2YR2A 4IBKA 1R22A 1ET9A 4WH4A 1L8QA 4HV6A 3I71A 4DQ2A 2R2OA 3IXSA 2DOAA 2IY1B 3BPVA 4BEHA 1Q5WB 3J81K 3S3MA 2KRUA 3IKTA 2HZDA 1TL8A 1KGSA 2STTA 3AE8B 2GAUA 3JRBA 1WJCA 4PCZA 1R7RA 3RYPA 2R7VA 5FLXZ 4G94A 5HVQC 3RFWA 1F9NA 2DZLA 3QP6A 2GWRA 4G11A 3HGIA 4KT6A 3S2WA 3TEYA 4HPMB 1D4BA 4IBIA 1J0RA 2KDEB 3W2WA 3CSFA 3F72A 1C1KA 1BMLC 3M3JA 4Z8XA 1JWMD 3SFIA 1WGRA 4N4NB 4EE2A 4F52A 3BOQA 3V7CA 3PT2B 2DDBA 2OOBB 2HTHA 4I99C 3VR8B 1S6LA 1I4PA 3U61A 1YE9A 3L7WA 2X6YA 1FXIA 5CHVC 2VKDA 1RLFA 5DNYA 2FCSA 3C2BA 5FROA 2PE6B 4A9AA 3OOUA 2M17A 1AA7A 5LGNA 3AAFA 1SMYF 3TPZA 3JRCA 1EF1A 4DV5M 3H3UA 2XGCA 2E2HJ 3IHPC 1ZRDA 1Z5CA 3KW6A 4ITVA 1QOBA 1D3ZA 3WCQA 2KKOA 3BYYB 3R3MA 1MJ9A 3U6DA 2JT4B 1C79A 3ZCOA 4BEHB 1JRUA 4S0HB 1S7AA 4EQQA 1WX9A 1XCQL 3VTWA 3KEQA 3RFZB 1TNSA 4XLNF 4AJWA 2CS3A 2MR9A 5IP4D 2L6OA 1MN3A 2KRKA 1ORYB 4CO7A 3L2CA 3KYDD 4WAFA 3G6EI 4IWQA 3V8KA 1XHBA 4NZLB 2KLCA 3RKXA 2CUJA 3B73A 1HC8A 3P42A 1RI7A 2WU2B 3LSIA 4CCJA 4YEJA 5D5XB 2LDUA 4HF1A 2Y3AA 4EV0A 4FCTA 1Q10A 4G4QA 3L2WA 3K4MA 3IAM2 3ABUA 2K9XA 4BL0B 2PMUA 1KH0A 3JSOA 3GFIA 4C2TA 3DLLF 2WXGA 2CHGA 3CLOA 2DI0A 5E1XA 5J40A 3RNGC 4EM0B 1X4PA 2WY7Q 3NHEB 4G9YA 1J9IA 2F6CA 3E6CC 5FK9C 1OFFA 2EZKA 5AIQA 3IG3A 2KWDA 3PXGA 4BVUC 2LVPC 1GLNA 3L08A 2KDIA 2QYOA 4DHZB 4D81A 4LCDE 4DV1M 7CATA 4HSRA 2JUCA 3AE7B 3IT6B 3ABMH 1W5CC 4UUSA 2D10A 3B7NA 1L7YA 2HYGD 2LXCA 3HC7A 1N5WA 1NY5A 1V5OA 5L8RF 1WGDA 4JQWC 1UELB 4RAGA 4YFXF 2NS8A 1OQRA 2R4JA 3M4OJ 5LGUA 3OL3A 4BXUA 2FCNA 4HW0A 4FX4A 1T43A 2M30A 2H8RA 4XX5A 2HKOA 2N8GA 2ZNVC 2EZIA 5EP4A 5F0CA 1WYWB 1FT9A 2NBWB 5ICCA 3PRPB 3PFYA 1H8AC 3A4CA 2CJJA 2KNVA 1USSA 1DGFA 2B7EA 2LUEA 4BAXA 3RKYA 3DTEA 4Q4ZF 1XTAA 4WWPA 5EEHA 4EATA 1J59A 1QO0D 2UXCM 2W82A 5E8IA 3JR4A 3I4MJ 2KTRB 1YJNI 3TL5A 5EXXA 4ZTJA 4HX7A 1D5YA 3FYCA 1NTCA 4IXAA 4ESJA 4P9UA 1I39A 2R93J 2NVTJ 3BIID 4C4VA 2I7PA 5KHQA 3FRIA 4F92B 1F9JA 4BNCA 4KZ0A 3MFGA 1JKOC 4YG2F 1Z91A 4Y33A 2WDRB 4BKXA 2BW3A 3BY4B 1MJAA 3J7BA 1XMXA 1AWCA 2MBFA 4RB1A 1JB0F 2JPBA 4CGYB 1JRPA 2LKSA 3GE3C 1IXZA 1XMQM 1S29A 4XLPF 5BYRA 2QZ4A 3CDHA 5E6NA 4WAAA 3J9CA 4J3OD 1R5ID 3BZDB 3BG3A 1DOYA 2JSPA 2HYJA 1VFCA 2WDTB 3L54A 1IBLM 3GLFE 3QQAA 1L6VA 4CXFA 5KVRA 3WG7H 1FRDA 4IHTA 1LVAA 4LLGF 1VI0A 4WP2A 2OQRA 2J42A 3N1ZC 2PVGC 4IF4A 2EUCA 1U5TB 4XN3A 3TGNA 3S2AA 3TSSA 4AS1A 3WG9A 3NARA 3TCAA 2KC1A 5AZGA 4DZJA 1F43A 3N20C 4KN4X 4B7GA 2EKKA 1UHSA 3J7AY 2JY7A 2BY2A 2DK8A 2WDQB 4WWCA 1TW2A 1Z5BA 5EYRA 2HE7A 3W2AA 2KYWA 3TMOA 4GC5A 4FLHA 2KDLA 4LNOA 2LRWA 3NJTA 2MH2A 3RT3B 2R7WA 1R7SA 1H9TA 4UHTA 4JI3M 1SE2A 3MZYA 3KP6A 3ZMZA 2KJHB 4Q7JA 2RN7A 4C3JJ 3OYHA 3S17J 2D3CA 2Y5CA 2LGSA 4KIKB 5T8IA 3HB9A 2L9SA 3I59A 3I59B 1ZP0B 4HLEA 4N6EB 1ESFA 4IOCF 1STZA 5CQGA 2K4BA 1FBQA 1PUTA 3G71I 4LITA 2J0KA 3WTTC 3A9KB 1WMHA 1G71A 4K81A 3ABKH 3GPXA 2O03A 4RGMA 3K2ZA 1YS7A 2L00B 1MBGA 2NOGA 2RKHA 3LNQA 5HLHA 3H9DA 1W7PA 1B1ZA 3IRRA 3KOWE 2SAKA 2KZRA 2GBJA 4FHJA 3GO8A 5J1YA 1Z21A 4NSOB 3GLHA 1HQRD 2KC2A 1I35A 1JWAD 2LGDA 3A42A 1MG8A 4DV2M 3RE8A 1VG5A 3I9V1 3TEDA 3CC7I 3EPZA 5C4JJ 4HF0A 3QPTA 2ZCCA 3SU8X 3KOXE 2MFZA 3VTUA 3C1DA 2ZMEC 4PK1A 4PZJA 4A3GJ 3WAPA 3H4JA 3MC0B 3NVZA 2XGXA 4NAWB 2L7KA 2F5NA 2OU2A 4FWDA 1LTMA 3AXCA 3GLGA 3LCUA 1C9FA 2ZNVB 2YU9J 3HEFA 3GW2A 3B0AA 4E70A 2V9VA 4L18B 2ZO4A 4OIPF 2ZJRF 4L16A 2H5XA 2EA0A 4BOSC 3TJPA 3FE3A 1J75A 1G2HA 1QOAA 4UV9A 1Y56A 2G4DB 2NTTA 2WXMA 2LKPA 4W9DA 3V7SA 4JX5A 2DT7B 3GB1A 1U3EM 2VL8A 1YQBA 1FCCC 3TKYA 1NG7A 1TBXA 2AEHA 1PP7U 1WHUA 3VUYA 1F52A 2GXAA 4ETSA 4BKSA 2IXSA 3DFZA 5K5QA 3GFMA 1OGWA 3LOCA 1CMXB 3R8FA 4KNYA 1QOGA 4A3FJ 1ZXHA 4E7SA 1VQKI 1POGA 1G6NA 4AVZA 3SBJA 2W57A 2WV1A 3DV8A 5D7GA 1B72A 1GUUA 2HAKA 2CW0F 2FXAA 4IBGA 3EUB2 4A3EJ 4BE1A 3PVLA 4MACA 1RRJA 4M73A 3H1UA 3PRZA 3WAMA 3V61A 2L83A 1C78A 2EZHA 1HSTA 2PI0A 2DQLA 1FEXA 2GRIA 1XD7A 2E1MC 5F3WA 1BOBA 3A45A 2N9XA 2XPUA 4WQMA 3LFKA 3PQKA 3U6PA 1R49A 4G7HF 3HOSA 3X23A 1IYFA 2NOJB 2KX3A 5K7HA 2W85A 3I3TB 2CU7A 2KMUA 2ZEQA 2EKFA 2LGXA 2LBFA 5FKOA 2A05A 4OIOF 3PL8A 4BJTA 4N0BA 4OX9M 2K39A 3ZJUA 4W9GA 1E9MA 2DYSH 2M0MA 2OO9A 2BHZA 2AL3A 4AG6A 2DXIA 2Y48A 4ANXA 3H5AA 3U21A 4KHPM 3CCUI 4RF1A 3R7RA 2WBMA 4B47A 3HG9A 2GZWA 3U5ZA 3MFKA 4LJ4A 3AV8A 1ZGWA 2JA2A 3NWLA 2MH9A 2V4JC 2DAFA 4CCNA 1V33A 3ZC7B 2LY2A 1JHFA 5ITRA 4LLNA 3RZDJ 4F8CB 1XDUA 2BJWA 2NBUA 3H9GA 3PNTA 2Q8KA 5IP6A 1I94M 2K9LA 3C2GA 4WJNA 2JRHA 1WGNA 1WCMJ 4Y15A 3HWSA 1GL6A 3KEYA 5JHFA 2FOWA 3HJSA 2XEWA 2H94A 4G0NB 4GDLB 1NV9A 1NBFC 3GO5A 2G0EA 1XXGA 3K8ZA 3W6VA 1T98A 4PDKA 1OEYJ 4IQ4A 1FMAD 2XRNA 3QOPA 5IT9S 1L2BA 2DA4A 3V8JA 4WJPA 1D0LA 1LDKB 2CV2A 1UG2A 2IGOA 5JHBA 5ITXA 1XDSA 1DGGA 4JLCA 3ONQA 1VZ7A 2VXDA 3GE8C 2C9WB 2CFOA 3E7LA 1TTEA 3PTFC 3UJNA 3M7GA 2EMSA 1X1BA 1E32A 1OYYA 4LOCA 3EIEA 4HPLB 4XQFA 1H88C 1ROEA 2H89B 2MP2A 3Q5FA 2VKVA 2F48A 2APLA 1QZMA 2Z9OA 2IA0A 5BS6A 3BG9A 3AB5A 4LJPB 5KCMA 1LE8A 1J2XA 3RSNA 1TWAJ 4JE3B 3GXOA 2NPTA 2RC4A 4EIWA 5LLQA 2W84A 3SYLA 3DHIC 1ZGJA 1ZK8A 1WGLA 2F2EA 3S1NJ 2N1VA 3K4CA 4ZZLA 4C00A 1IXSA 5M5WJ 1G4DA 1R6BX 3GRYA 3QPLA 4XLCA 3VYUB 1R1TA 2MLGA 2DPUA 4GDKB 4IM0A 2CQQA 2QGUA 2I1KA 2DNAA 2Y0SA 3LA2A 2MW5A 3E0JB 1NNUC 3Q8GA 2W3SA 5DYGA 2R7FA 1KLUD 2FRHA 3HHWA 3T3NA 3HJEA 3I4VA 4AIHA 2KZUA 3F92A 3K1PA 2VKEA 4L8RC 1CQVA 3A2KA 3SYKA 1TY2A 4MTEA 1I5ZA 3VRAB 1WJNA 3H3ZA 2WXJA 2XK5A 1PUFA 3KZZA 2MLBA 2K86A 5DYIA 2F4VM 3CCVI 2NVUB 3AMZA 3HHZA 3CMMA 3OYNA 3EQLF 1FXAA 4IBEA 5IT9Z 3BZCA 3GRVA 4LZZA 1E10A 5GADJ 3WE3A 4DYQA 2IPQX 5F0HA 4NUBA 1GABA 3CC2I 4K1RB 2Z16A 4ZRIA 5DCMA 3K9PB 2FE8A 2ZXIA 3SFZA 1ZG3A 3NBIA 1L0VB 3BVGA 5IP9J 1IW7F 4LJ9A 1Z6TA 5C23A 2LD9A 2KZGA 2DT5A 4EFOA 2WA0A 1YN3A 3RKWA 3K2LA 4MGIE 2I2YA 1G3TA 2KRFA 3CESA 2O3FA 3J81Z 2ZXHA 1FY7A 1X1MA 3JW4A 5E8GA 2PLYA 2XGDA 4A3PA 2F4MB 2QWWA 2DODA 2Y2ZA 1LFPA 1IY0A 4XR6A 4A20A 3ZQGA 2GIZA 2DVWB 4L4UA 1E3OC 3KWVA 1S3JA 3WA0A 1W1WE 4B09A 2N9PC 3HL2A 4CO8A 4ANVA 4LG0B 4GRIA 4JQFA 4DUZM 2WXLA 4IC7B 1MX0A 1FIQA 5L95C 4MH0E 3CQZJ 2XHKA 1J7CA 3SYTA 2M34A 1Y8GA 3S2DJ 2LTUA 3QA8A 1WYGA 4HJGE 3RGPA 4AP4C 2A68F 1YJ1A 2O2VA 3MCZA 4M71A 3O3KA 4GXOA 1E94E 1VQ6I 2FCMA 2CR5A 2LVNC 2HCBA 1ETXA 2FOIC 5E3NA 2Y0QA 3I63C 2DENB 4F3QA 3VFZA 1XWIA 2BZTA 4FWGA 4AJYB 4IZZA 5ED4A 2IBIB 2QSFX 5IA7A 2VQLA 3LFUA 2PMHA 1E3PA 2M4GA 4BS9A 1ISNA 4IPAA 4M8NA 4RAFA 1JJ8C 4IBDA 3RPQA 3U7ZA 2NCNA 2ZJ2A 3CJNA 3A02A 5TR5A 1V80A 3PLUA 4RKUF 2PX9A 3BR1A 2RDHA 2Q2EA 1KF6B 5C18A 2N7EA 4I81A 1S3SG 2QC8A 5C3EJ 1C4AA 3TUOA 2KISA 1K8RB 1XLQA 3VWBA 3KP7A 3AG4H 3ZQIA 4OVZA 3HHMA 2LUMA 3RZFA 4U0WA 1V9JA 4FW9A 2V1CA 2CU1A 4NL4H 4CCLA 2JVCA 2VC0A 1MMAA 2D7EA 4BLCA 2W24A 2O6VA 4I09A 4DGWB 4KFCA 5E6JA 3MKYB 2BXYA 3A03A 1EFUB 5F64A 2M7BA 1FNUA 2KIUA 4S05A 1ZR4A 3KYDB 5HLIA 1OEYA 1WJ4A 1MBKA 2V6CA 4ZYAA 2UYZB 5C1ZA 2KDBA 1XCBA 1QILA 1XNRM 1DPRA 3VKGA 3CF2A 4G6DA 4CIZA 5D94A 3AEDB 3NZUA 1HKTA 2Y75A 2IRFG 1V5FA 3Q14C 4EMSA 2X4AA 2OQGA 2WHIA 2DLBA 4MQ9F 4L2YA 1QRYA 3ML6A 1QBJA 4RNAA 3MC9A 4S12A 1WI3A 1X3UA 3NZSA 4OINF 2N9KA 2GLOA 3VSKA 4LD5A 1FP2A 2DOFA 4Q48A 1NHWC 4BB9A 2GBRA 1FZPB 3U8ZA 3LW5F 4XWWA 3H4MA 1V2YA 1H8CA 1VDLA 4JI0M 2L4FA 2V1NA 4GCVA 3BDDA 2MGQA 2P6TA 2K8HA 2L76A 3BJOA 3BROA 3V6EB 3CP2A 5FKLA 2XSZA 5HG2A 1T0RC 4FBJB 2KVRA 3DTKA 3C2HA 5E17F 2MBEA 2DZNB 2FOKA 4PGHA 4CH7A 5KAFC 1IG7A 2R7XA 3I5UA 2MGWA 4QOSA 2BT6A 5AUIA 2ZPYA 5BMIA 3IG5A 1TQPA 1V8CA 4P1BC 4A6EA 3A9JA 5GAGJ 5D6EA 4CUGA 5EXPA 4U7BA 2HOTA 1W5SA 1HA8A 4ASWC 3RYTA 3DFGA 2Z2SB 4W9FA 1QHHD 4A3CJ 1MDMB 2FNJB 1L0OC 4YTPB 2K4JA 3SQNA 4EJVA 3FM3A 3FUWA 4ICVA 1P3QU 1XMKA 3SMPA 5FD6A 1EIJA 1YW8A 4HROA 3F8FA 4B95A 2A5YB 3TBLD 2P7CB 3UK6A 1L2CA 1ETQA 2ME6A 4RGTA 4E74A 4BBNC 2L8JA 3IAS2 2BW2A 4L5IA 2MRPA 1MMNA 1U78A 3IAM1 1YIJI 1C7YA 3MEXA 3O65B 4XN0A 2JZ3B 1MHHE 3U9GA 2PLPA 1XNQM 5LMNM 4A2UA 5K5OA 1TKGA 2M8SA 1UF0A 2LGYA 2ZZPB 1MNMC 1LQ1A 2YX4A 1TIFA 4LG2A 3EECA 4ZTFA 4OMZA 3ZNHB 4OOIA 4CZCA 4FQGA 3H7SA 2QSGX 4X0GA 2E71A 1D0MA 1UZXB 1E7PB 1WI0A 2LVPA 1E7VA 1QYRA 1TBEA 1TR8A 4FISA 4IJAA 4IJFA 4TSSA 1LXDA 4BKSD 2MROB 2MP2B 5GMVA 3L10B 3KLSX 3RQ4A 1T5XD 1PRBA 4FA6A 2I38A 3KP2A 2Z59B 1SXJE 1WJ6A 2KHWB 3RDIA 2IO1B 4P16A 5IKCM 2JJ7A 5IT3A 2Z7JA 3EGRA 1HDPA 3ZNID 5BYSA 3L2AA 4DHJD 1OMIA 4KODA 4F2LA 3KH0A 1SFOJ 4PYUA 2GLSA 1PJQA 2D7GA 2XROA 3VODA 5JI2E 3KE2A 2ZBKA 3V76A 3K4BA 1P7EA 2R5YB 4IX7A 2DZMA 4MGKE 1TTYA 2DA5A 1IBXA 2V7FA 1P7FA 5IWAM 1QVTA 3NVWA 5AIPA 3LSGA 1CF7B 2FNPA 5HDKA 4MGZE 5JHUA 1L6UA 2I8DA 2DK5A 5M3MJ 2VODA 1GVJA 2KFJA 5A2QK 3ZH9B 2FMLA 4OIRF 4PJJA 2E36A 3GLHB 3AEGB 3K9OA 4PJLA 2AHQA 2P5LC 1K6YA 2XK5B 3ZJTA 4RB0A 1PYWD 2E5NA 2K9NA 1U4AA 1O57A 4NY0A 3DWMA 4C80A 3A9KA 1FP1D 1MNDA 3VLFB 2N35A 1ETKA 4ZOHC 5BR8M 4WIPA 3OYFA 2G3QA 3GS2A 5IYDJ 4YSYB 2DZKA 1BJAA 1R9TJ 2ME0A 2IY0B 1QUSA 1DPUA 2QZ8A 1ZXIA 2OUMA 3UZUA 1ZLKA 2WXPA 4IQJA 1SD7A 4RM2A 3HZJA 3CTWB 4PDGA 2DNFA 3FXUA 4LIUA 3BWUD 2HDEA 3ML9A 1A31A 1TDZA 1YX3A 4S04A 2LHCA 4HDVA 4A6QA 1T0SC 3ROUA 2JRTA 4GHLA 1ORKA 5EP3A 5CKTA 3DLAA 1WI9A 2RRUA 2AQFA 4HG2A 4G6QA 4HDOA 1NDDA 2HTSA 3RD2A 1JW9D 4AUXA 1UGJA 4BKTA 1YIOA 2E35A 1WJEA 3KOYE 2R7UA 1FRRA 1HEZE 2XH9A 1I3QJ 2EFQA 2XNAC 2G9HD 4AVPA 4WCGA 2E1CA 4XDDA 2D3GA 1NI2A 2M87A 3DZDA 1TGZB 1MJBA 4L5JA 3IKVA 1IN4A 4US8A 2QCUA 1YW7A 1E7UA 2ISYA 2W00A 2JZPA 1GVNA 3HRTA 5JI6A 3TQNA 2DWQA 1JQJC 2JMWA 1ZMWA 2KJBA 1HNXM 3ZQQA 2PN6A 3J2PB 3M8JA 2Q5WD 1YI2I 5FLMJ 3W1SA 2CW8A 4PD2A 5JXVA 3I57A 1GXQA 2VQEM 5K7ZA 3RPUD 3PO2J 4WW0A 2BBCA 3EUHC 4KDLB 1Z9CA 4AKIA 3Q0UA 1MFWA 4PS8A 5IOZA 3VDZA 4DR3M 4RM8A 3EUKL 2Z4RA 2WYQA 5EXSA 3KIOA 2HDCA 4UB8C 4ABZA 4QHSA 5K7FA 3N1XC 1D1BA 3W3CA 1DUXC 2KT7A 2V9PA 1XSXA 3HOZJ 3GLXA 4AG5A 4HCNB 2XFSA 1P7JA 4E7LA 3FKIJ 5JLXA 1AIPC 1NV8A 1GKIA 3FTEA 3GLLA 4C7ZA 3ZGZA 5GTIC 2ZTDA 5BOXA 1F4KA 3JREA 3W5UB 1ZG5A 2DJIA 1X2NA 3J7ZI 3V7RA 1MSFC 2O5RA 4XMYA 4M74A 1T0FC 2J53A 1Z67A 3PUBA 5J4VA 2QSDA 4FJYA 2CKHB 4HNUA 3L9FA 1RAXA 1YMHE 4B3RM 3GUDA 3Q8CA 5CHWA 1R5LA 2M7AA 2Z1DA 2RAEA 2M8GX 1J7BA 5CYVA 1DV0A 2HGCA 2G9WA 2IBDA 4X6AJ 5I4DA 2PQ8A 4U0VA 3KETA 3OY9A 1MIJA 2VI6A 2WWYA 2DA3A 3ZN0A 3HPHA 1IN5A 3KP5A 4BZAA 3H3VK 4RGOS 2WXRA 2XKOA 3VKHA 4I0AA 5DYMA 2DYBA 1WGKA 1PUFB 3A0HC 4XYCA 1V92A 2L54A 1WM3A 3H9JA 3PSIA 2KPMA 4N9IA 1ZV1A 4YELA 2LWPA 4MQVA 4ZDOA 3BC8A 5LGTA 1LDDA 2D1HA 2QBYA 4EGYA 3NAUA 2ZXJA 3AFHA 1YFHA 3PZ8A 5ITXE 2K9QA 2AQEA 4ZZDA 2WGSA 3RNBC 4YSXB 2IGMA 1RZ4A 3J80S 1AUAA 4AOFA 3SAVA 3HUGB 3GF2A 1FM0D 1Y8RC 3VQIA 2WAQA 4KVGB 1JKPC 4I6LB 4MO7A 1WXAA 1I4GA 2A07F 4IHVA 3HRUA 3T5XA 2FBWB 5DUKA 3OYEA 3IT4B 4JI4M 1WE6A 4P5OA 3KP0E 3MD2A 3GLIE 2EMTA 4UVCA 3TOAA 2QF7A 2V3PA 2UUBM 2YUSA 3CMEI 1QQWA 3TO7A 3PO3J 2YEPB 3SFEB 1R36A 2ETHA 3M6AA 4NXNM 1LDJA 1R7JA 3CUOA 2K47A 4UXNA 1K6OA 1VDDA 3HU1A 4G4NA 4R8HA 3MKZA 4XE0A 4L23A 2HOSA 5M5YJ 2A5WA 1LV7A 1HT2E 3OL4A 3U6SA 1M1EB 1JT6A 4ON0A 4I02A 1V34A 3VOEA 4LJ6A 3HOXJ 3H0GJ 1L5PA 3OS0A 4W9CA 4PJMA 1DGJA 3VH4B 4QOZC 4A93J 1UD7A 3N97A 1PFDA 3PSEB 3AE5B 4FVMA 1EM7A 3IBEA 1BI2A 3MKLA 2XEPA 2VE9A 4ANWA 3K6GA 3KW5B 3FKYA 1WH7A 2KN4A 1VEJA 2F5DA 4LJ5A 4GMQA 5D8KB 3GTJJ 1RUOA 4ACFA 3BTJA 3NS8A 2HU9A 3OLMD 2H6CA 3WIMA 1QT9A 3U5ZB 3SZGA 2J0MA 3RNAC 5BPVA 2DMNA 3RNCC 2HJ1A 3SC3A 2KWUB 4W9JA 3ZP5A 2OOBA 1VQ8I 3BVZA 4QIWN 2E6XA 1W36C 1HKSA 1FOXA 1S9HA 1SEBD 1S5LC 4HLYA 5JFRA 1WJFA 1T0FA 4NJ6A 2UWQA 2AXTC 1WGGA 2LMDA 3R0JA 1MZBA 2M9HA 2IGGA 1OCRH 2L0TA 3ELKA 3W5VB 1G41A 3U1KA 4XBFA 3SEQA 1HZ5A 4A8XC 3QARA 2M4NA 4WJQA 4LNIA 1F2RC 1RU3A 1EU4A 1O3RA 4LDTB 2JY6A 1FSEA 4Q47A 2N4FA 1TNTA 4ANRA 5L3CA 4BBNF 2MBBB 1GUAB 3L4PA 3TW7A 2L0KA 3OYAA 1UELA 4RM9A 4OU0A 5FJ8J 5HOOA 4H2AA 2WP9B 4JI7M 2IYDB 2K5CA 3Q8FA 4L15A 4LB5A 3GCMA 2WXNA 3ASNH 4GEWA 5FKMA 4DR5M 5FTKA 4MNUA 2CE7A 2M8EA 4DYRA 2NAZA 2O6VB 4ZRPA 2VPRA 2LLKA 3K92A 3THGA 2QMTA 2V3SA 1JKQC 3LSTA 2QQAA 2VJ5A 5FSWA 4LNNA 1B9RA 5JHAA 3FIWA 3GTQJ 4X62M 2IT0A 4PFOA 2A3SA 2OBPA 1LGRA 2V6ZM 5DD4A 2TRTA 1ZELA 3ABTA 3F3XA 4EJUA 2FJ1A 2Z3YA 2KK8A 2G7UA 1IXCA 2LYCA 3PUFA 1H6UA 2VXZA 3HYIA 2QQ8A 2CS4A 1TJEA 5A2QS 1Z7UA 3H92A 5FD5A 2AWTA 4NDLA 3OYJA 4C56C 1YJIA 2FH0A 3ECOA 2IS6A 1ZMVA 2RGOA 2WTEA 2V1DA 1P92A 3A0BC 5F27A 3S32A 2Y30A 4KKIA 3MZ8A 2H88B 1DGHA 1PYVA 5C3JB 1GJZA 1R1UA 3HKZN 1JWBD 2M60A 4LF7M 4M00A 2QNJA 4XNFA 1TDHA 4G3XB 3RN9C 2LVOC 1X3WB 2DAOA 3JR5A 5CVUA 2CRUA 2A6TA 2NXNB 3NG0A 4DR2M 4HEOA 1Z7LA 5LMUM 3P4RB 1YITI 4CYCB 3QWZB 1VRAB 4XBOA 3VYTB 4EEWA 1MPEA 5BNGA 3N4MA 2JA6J 1KYZA 3DBLB 3QYEA 2QCOA 4RLQA 5KNLA 3P9CA 2BKRB 3BQYA 1NK3P 3JRHA 1J7AA 3PRMB 1WY8A 5LEJA 1ETYA 1G3WA 4I98B 1KLGD 2VJJA 4BY1J 1FTZA 3TW6A 2V3NA 2HDDA 2VT3A 4HQMA 3ASOH 2DTRA 2MQJA 4IBBA 2LSOA 3K9PA 2LVQA 3MHVC 3ZQ4A 4C4VB 5FTJA 5IOIA 1JUPA 4NB5A 1I3AA 5EE0A 3U61B 2L4EA 1UFZA 2FE3A 1TKEA 3HKZA 1EV7A 4BBRJ 1C76A 2CQ7A 1TS5A 3NZ3A 3MJ5A 2HFHA 3EHVA 2JUJA 1VQ7I 2JX5A 1P4XA 3GLFB 2VKHA 2DA1A 1LNWA 4FHKA 2B76B 1BI1A 3ESWB 2R7DA 3IVFA 2WAFA 1N32M 1YNTE 1ZQ3P 2M0XA 1QDRA 1E0ZA 1VZ6A 4R7GA 4J00A 1FBSA 2L05A 2A4ZA 4AWJA 4BFRA 1K50A 1WQ2A 1FO4A 2GBYA 2X0LA 3GLIB 2VBZA 2VJIA 3KLOA 4W97A 3MMYB 3JRAA 3CUQC 2RREA 2K27A 5D6JB 3HVDA 3PSFA 1TYGB 1OYWA 2XBBC 3ERMA 5L3BA 4ZRQA 2RNGA 3Q3FA 4UUVA 4IL6C 2LVAA 1B72B 1TZLA 1TLHB 2Q2EB 5EDNA 4I6ZA 1HBXG 4HL4A 5LFAA 4FULA 1LO5D 1V81A 5IT9K 3FYDA 3F8BA 2RPQA 2LFIA 1OISA 1JJ6C 1FNWA 2B63J 1C1YB 2AHMA 1XB4A 3M0EA 5E3LA 4U88A 1G3IA 2FIFA 1T3TA 4NBQA 3W6KB 3FXKA 5GTHC 1HQCA 2K7LA 4HKQA 2OPFA 4ICUA 1HF0A 1K3WA 4Q2JA 3ZMVA 2WXOA 1Z2MA 1OCZH 3EDPA 4XM3A 1BL0A 2GOWA 3K4JA 3SHFA 1NJGA 1SE3A 4D82A 3DKWA 3A4RA 3MHSD 2HWJA 3AKZA 5E6OA 2J0JA 4G12A 2VZKD 4ZYGA 3WGIA 3A9JB 1QZEA 2OAZA 1I42A 5JR3A 1T33A 4WWNA 1BUIC 1EH8A 4KKJA 3CMYA 3M8FA 2X6WA 4EGZA 3UQBA 1N63A 1DYQA 2CHZA 2YPRA 1K52A 2LI5A 1ZH5A 2VASA 3ZR8X 5LXIB 4ZJZA 1K4TA 3ZDTA 1VEGA 4KMUX 3AJIB 2PPHA 3L26A 5DS9A 4MELA 4D5FA 3W68A 2TCTA 2EB7A 2BY1A 3IH3A 1SFKA 4GGGA 4XGIA 3QU3A 3TO9A 2EK5A 3N1YC 4GKJM 1HQYE 4ZC3A 1NO1A 2W7NA 2C7MB 5LHIA 1YN4A 1UBQA 1TT5B 3DU5A 4JWSC 2MJDA 4RMAA 2DW4A 2MD0A 3BR5A 1FIPA 1F5TA 2OJWA 3ZQCA 2BE5F 1V4RA 2EIMH 2IZVB 3P7NA 4NNJA 2VONA 2M0AA 1Q1VA 2DLLA 2GBNA 4UN2B 2X8XX 4DV4M 3I64A 1GC7A 4B0EA 1W0UA 1UWMA 2BNKA 4BAYA 1H89C 4HLXA 1ZLJA 3NEUA 2DBYA 4Y17A 3VPRA 1V49A 1KU9A 3B89A 2LEKA 2GB1A 1DP7P 1P4AA 2QHOA 1E6EB 3W6JB 1TWCJ 4IM2A 3FC4A 3KDSE 4HNVA 4C7YA 2LF8A 5DPWA 4JBAA 1NEKB 2XAJA 3HGGA 4D7MA 1FBUA 1BC7C 3RNEC 1E9RA 5CQEA 3DOWA 4AQYM 2L9NA 4RGUA 1E3HA 3BXWA 3RCZA 3LMMA 1VR9A 4U87A 1TW3A 3H6NA 2XGNA 3B9JA 2M5ZA 1IV6A 2DX5B 5KO3A 4ZYDA 2HNHA 3GZNI 4FXCA 2RDBC 4C3IJ 1JWUD 2IGDA 1W0TA 4BDZA 2BKFA 3IECA 2WXHA 2V0GA 2YLMA 4JGHB 5EDSA 1N62A 1FOWA 4WX9A 1TS4A 4YFKF 3IRQA 2LZ6A 3K70C 4D5CA 5EE1A 2VOPA 2YNMD 1D1CA 2NS7A 3KP1E 2HQAA 2ZMEB 3BR6A 3K4KA 4C3HJ 3UGBB 2JA5J 3A33B 2HZTA 1D6EC 5HS7A 4KZCA 2QKLB 2E5ZA 1FCLA 3M9AA 2C5RA 5TISC 3SHQA 2ACZB 2EELA 3SZTA 3PZDA 1WX7A 5DFLA 1T38A 3OYKA 3JSVB 3HU3A 1OKRA 1V54H 4E7IA 2Y9ZA 3IHUA 2MYSA 2JXTA 5EZHA 1VQPI 2F5CA 4M6XA 3GX4X 2L2DA 4YT0B 2JK3A 2BWES 1K7AA 1ODDA 2G1EA 2HXIA 1WJUA 2MWSB 1YJJA 4RBOA 5GKNA 3JSPA 2EFNA 4GYGA 4YIIA 4OVUA 5D5UB 3LQRA 1VQ5I 3B7QA 2DFHA 2O7OA 3IL2A 1SE9A 2EA2A 4V2FA 2L09A 1FXTB 4G6ZA 5LRSA 1E8XA 3Q3NC 3F9KA 1MI0A 3I3LA 3HRSA 4TV7A 3RJPA 5HODA 2JF5A 4JOMA 5D4SA 2JU6X 4L6V6 5LRRA 2DYRH 1T3QA 4NAWA 4A0XA 1KLVA 2DYOA 2OOAA 2LH9A 1B6AA 3C3WA 4PGGA 1I50J 3BT9A 3FMSA 3G4SI 4IO9F 5B5EC 3Q3JA 1BR2A 4C2UA 2XSZD 4KIFA 3FXOA 2WXQA 5F0FA 2HDWA 4JL9A 1I1GA 1QAMA 4C2MJ 2DZJA 1NK2P 3DQVC 4BQOA 5IN7A 2W3RA 4KIBA 4NOOB 1PVEA 1YOVB 1JXSA 2HTME 3U6OA 5B66C 3FK7A 2VQHA 1UMQA 2MBQA 4HLQA 1G6JA 4DBRA 2WAEA 2LD5A 3DPDA 4KUMA 2FFJA 5GAEJ 2UUCM 3LQQA 2LH0A 3BY6A 4KIKA 3B2GA 3MVPA 2YVCA 4N4OB 2LHDA 1BW6A 2KFDA 2K22A 1NY6A 1FOYA 4MH8A 2OTJI 2TDXA 1IV8A 4AKGA 3KVFB 4MFDA 3BINA 4KGTA 2J7NA 1FC3A 1RFAA 1FPQA 1T6BX 1JALA 1AARA 4NHJA 4M3GA 4RDUA 2RQQA 1PJSA 3HGYA 2C5LC 2M1MA 3ABVB 2XF3A 1OR7A 2H6BA 1EKEA 2C98A 2IA1A 1WZ0A 4LMYA 1LE8B 1KQ8A 3MKWB 2HKXA 2EH3A 2KDMA 4AD9A 4GC9A 1LFBA 4IOAF 1KJTA 1U0JA 3PO0A 4U0YA 4F93B 4OZBA 4M0WA 2ZFWA 4RAYA 4GN1A 4XLHA 5F1JA 3TMPB 1BR4A 2L5QA 4M0DA 4BYYA 2XDVA 1A6IA 2EKEC 3OOPA 3Q0WA 5B3SH 1UG0A 5FLXS 1JKRC 1YG2A 4UB6C 4XIDA 2E2IJ 3V42A 2JYEA 1YW9A 5HS9A 3QHTA 5ITQA 1VQNI 2PMZA 5KQDA 2KQRA 2L9RA 3M3YJ 3UINB 2GQQA 1PJRA 1T2KA 1BC8C 3OR2C 2XUBA 1KONA 3KQ4A 3AOEA 1NHAA 2ZNZA 1KFYB 1ZARA 2N0SB 2VQFM 2WY8Q 5CJ9A 1FJGM 5EZGA 3ZVVA 4WF2A 3C19A 4FT8A 1IUYA 3WU2C 3E5QA 1AYFA 3ZRFA 2CWBA 4GMVA 2J5PA 1K3XA 1UGMA 4UDUC 4FD2A 4IKFA 2JXXA 4XGAB 4HK2A 3GOEA 1JROA 4F7ZA 3QIJA 1T6OA 1QNTA 1V5TA 4B1RA 1MSEC 4A3OA 5H2FC 1SFUA 3R9XB 1A36A 3W0FA 2DJNA 1ZDVA 4L0ZB 4P96A 1BT0A 5CVIA 2F5PA 3KSJA 3RZOJ 4NSRA 9ANTA 4B6WA 3A01B 3BG6A 1HJPA 2JQ7A 3E6BA 2P6SA 3DBHB 3L09A 2GA2A 2MBHA 2QLZA 1P9QC 2RVCA 2BS2B 4K3CA 3SXYA 1MMGA 4KSLC 5JVTA 3WTUC 4LDTD 2D7HA 3HHYA 1OIPA 5H37D 5L3GA 3TWLA 1FD6A 2BB5A 4LLLA 3SDBA 2JYTA 4RGNA 3MMPA 3WHCA 1XQQA 2K0PA 3KX2A 3PGEA 2L32A 1D5VA 5AZFA 2CG4A 2FNAA 2X48A 1SANA 1KQ9A 2R6FA 1WXSA 1ITYA 2KFKB 3ZPLA 1S1QB 3ZQHA 3U7DA 4ZDVA 1XSVA 4ZYEA 5IPAA 3BR3A 3JAMK 3L2VA 1SFXA 1RFKA 1L4ZB 1JR3A 2J7OA 5ILUA 4NC6A 1O3QA 4IWOA 2O8KA 4II2A 2VZKB 5DPRA 3K0LA 3GRRA 1IJWC 1NHGC 2LY1A 3ZCBB 4L1BA 2MLKA 4I2OA 4H0EA 3AOGA 1BIBA 4L9JA 2IO3B 1HNZM 5FFXA 3LAJA 1JCKB 2KACA 2QEXI 1ZR2A 5CPRB 2OF7A 1QZZA 5EGOA 2A6EF 2UXDM 3H5RA 2LG4A 5JVGF 2GBKA 3FTCA 3CIRB 5CVVA 2L7ZA 4AUQC 3T6PA 3S93A 3AECB 1CGPA 2XFTA 3QPHA 3CCYA 1DOXA 3RTRA 3TO6A 5EEAA 1OCPA 3HSEA 5ICGA 3CD6I 4HCPB 3PS6A 4CISA 3Q3SA 2L7RA 4I6NB 3ZTDA 1RRBA 3CCMI 4MEXF 3APCA 2J5OA 3TWKA 2UWMA 2DI3A 1IBKM 2JQRB 2E7XA 2BW3B 4GSWA 1NYRA 3C3DA 2R62A 2XAHA 3AEBB 3BTIA 2VF7A 3E97A 3O13A 3DU6A 1TT0A 3QAHA 3I54A 5HKHA 2DKLA 2FUG2 3AEFB 1BIAA 3D5LA 2EWNA 4XDCA 1O3SA 5IZ7D 1PJTA 2WZJA 4BE0A 1EWCA 1TZ1A 5LHHA 4KV2A 2F5VA 1XG1A 3BCBA 3UI3A 3DBHI 3WTYC 1HXYD 4A5MA 2R44A 2Y5PA 4YL8A 3FXQA 2BS4B 4W9KA 5GPCA 2X6XA 3NRVA 2CV0A 2ZXWH 5K5RA 4XKWA 3AOEC 1I6HJ 3HTSB 3SAWA 3ZKJC 3FILA 5G2NA 1RM6C 4YXDB 2K3UA 4RH6A 3IHPA 1O7FA 2H09A 1AKHA 1S72I 1WJDA 3IH4A 1OYIA 2JPHA 2EJRA 2KDFB 4DBQA 1ZKHA 4M9XA 4F91B 5FLVA 4CSWA 2ECBA 3S2HJ 3U6QA 1T0QC 4PK4A 3M63B 4OVVA 2R4EA 3OWTA 2O25A 2D1VA 2BV6A 2CH0A 1CK1A 2D45A 2CJOA 4UNOA 5EXTA 2LP0A 2DHYA 4MJSA 2HXOA 2PBIA 1FTTA 1B9NA 4NJ7A 3LA3A 1XLOA 3QJZA 1WIVA 1HNWM 2M2EA 2ZCBA 1SG9A 4XKBA 1OPCA 3E5XA 4JWUC 1I4XA 3CSTA 3CCJI 2D2WA 3V4GA 3CP8A 1JE8A 1BM9A 3VFDA 5EG0B 4A3DJ 1AWDA 1Z3XA 3F8CA 3P9KA 5BPIA 4MGYE 3NOBA 3AEAB 2JUOA 1NNJA 2WB1N 4NNJB 2KNZA 1J19A 3E56A 5IP7J 1JTXA 1ZAEA 4JYAM 3F6VA 4L0YB 1XPXA 2OZ6A 5E20A 4Y7NJ 3ZMTA 2CO5A 1NH3A 1SXJC 2R5YA 3HOWJ 2XAGA 3HM6X 1ZGAA 4MB7A 2PJRA 3FKEA 4FTHA 4P55A 3VXWA 3I4YA 1NYQA 5FR3A 3TEZA 1C3TA 1QUTA 1AKHB 4JPSA 4DNCA 2WV0A 3JSVA 4LTUA 2WU5B 5IAAC 3Q8AA 5FKKA 1Z6RA 1OAIA 5K1YA 1BI0A 3CJTB 2DBBA 4LF8M 3FXRA 2L2OA 1XGOA 3AULA 5C44J 4B7FA 4IG7B 5D2MB 3DVGX 1FFUA 3PFIA 1F0ZA 2L4MA 1HLVA 2V1XA 4DWFA 4LG3A 3AU4A 1L1TA 4QHTA 3EYIA 3VR9B 2GXGA 1LUJB 5C2TB 3CDLA 1ZHFA 2JWTA 3WHKA 3DVNV 3U4EG 1MBHA 3VUWA 1D8JA 2Z33A 5GPAA 2K02A 3GQ5A 2MD5A 2W9NA 1SSNA 1TH3A 1IGCA 3MK6A 3GTMJ 1C0WA 2QENA 4IM3A 1BOAA 2HI3A 2KMCA 3V6CB 5E3MA 4LJAA 5LD2C 2R7ZJ 4LZJA 4W9EA 1XC8A 3I53A 4GLSC 2BY0A 2OCCH 4D2KA 4XOPA 2D2QA 5HLGA 3N30A 3ZMUA 2WS3B 3CCQI 4O1NA 4I0BA 1ZGUB 1NI3A 1WWXA 1VQLI 2KMMA 2V6EA 3Q8BA 3FBIB 2NPTB 4AIKA 4DR7M 4C30A 2CUZA 3OMYA 2RPVA 1N61A 4P17A 2XAUA 3MZHA 2K9DA 4D1QA 4BKGA 2YR0A 1USTA 1GOZA 2QJLA 4R79A 1E90A 1SMTA 3RQIA 4HDUA 4XRFA 1D5XC 4JI1M 4PSWA 4AZFA 1SVOA 2VT2A 3OIQA 1GV5A 2EV0A 2C9OA 1ZG1A 3DBSA 3CUQB 8CATA 1BW5A 2X49A 5E1ZB 2ICWG 3CLQA 3I56I 4G8XA 3AV0A 5EP2A 2QHOB 3P4QB 4GYIA 2W25A 3TDZC 4M8MA 5D3DA 4LF5M 4PCQA 3R6SA 1LEBA 4RCOA 1FYLA 5J3LA 2F5FA 3HX3A 3EYYA 4IHXA 3S3OA 3BQZA 2JWZA 2EIKH 3SD5A 3CJQB 2O8XA 1Z59A 2OEDA 3FMRA 1HW5A 3I51A 2EINH 4P9FA 2YU3A 2LRUA 4N58A 2AS5F 1D3YA 2GIVA 2KDOA 1R2YA 1WXQA 3CF0A 4N9F4 3IWFA 2R0IA 2ZAMA 3JTHA 3BCAA 3G73A 3F6OA 2K1FA 2VQGA 2ON8A 1NG6A 4LJZF 3D0SA 4JI6M 3AG2H 3LSPA 1I6XA 2FUG1 1IUFA 1JI8A 2ELHA 1TQMA 1DO2A 1A70A 5G55A 4F1IA 1I4QA 5CVRA 2WXIA 3C7JA 2FCQA 2IJ0A 4BQQA 4OIQF 1SAXA 2INCC 2EZLA 1GXPA 4QTRA 1QU3A 1VF9A 3CMMB 1YJ9I 1YQAA 3PZ7A 2DAMA 4UUSB 1GL7A 3BR0A 3QYBA 3B74A 5HI1A 1E8WA 1J5EM 2H8WA 1WZ2A 2QA4I 3E1SA 4JX1C 2Z8YM 5E18F 1WWTA 1WRJA 3GZNB 3A1QB 2CHXA 3N32A 4HYEA 1L3LA 3GRUA 3AM9A 3B7ZA 3U30A 1ENFA 2ZSHB 2VRRB 3JAMZ 4Y4RA 2FUHB 2MBOA 2PJRB 2MC4A 3HXLA 2OHFA 2UV1A 3ZTCA 1LVKA 2CEAA 4DDID 1IUEA 3H1CA 3U1DA 1WR1A 3BPXA 4RB3C 5IY5H 2HQNA 2B9SA 1IN7A 2STWA 4LFUA 4GH9A 2MA3A 1E0EA 3ETRA 2KJ6A 2L01A 4EJWA 2IS1A 3CGWA 4BBAA 3LSKA 3CZ6A 1PDXA 2BVCA 2A61A 3G1OA 2P8TA 2NS5A 2XC7A 2RV8A 4RS8A 1WJ5A 3Q69A 2HWVA 2XZUA 1HSJA 2WXKA 2CW7A 3VK8A 3FMQA 4XWTA 3ZRCA 1QVUA 1MDMA 2A6HF 2O9LA 2YS9A 3RKQA 4O6JA 4B48A 3IP4B 5ICFA 1PQSA 2COMA 4FCYA 2JY6B 1LFUP 3K9OB 4B3TM 2UU9M 4WK8F 2LY9A 4OZCA 2L1AA 4NQWA 5ERIA 3WU1B 3BZ6A 3I01M 1KM7A 4BJ5C 4HQEA 3GTGJ 3OYBA 2MH8A 4Z6YA 3A01A 2AO9A 3EUAA 1N25A 3K10A 3REOA 2JZZA 3L2RA 2FMYA 3F21A 3B02A 4M02A 3FBNB 4GDLA 2D07B 1AN8A 1CUKA 1LEAA 1JMLA 1XLPA 2R7QA 1OCCH 3F8MA 3PJRA 1EF4A 1K79A 2BOLA 1SAUA 1Y6IA 3RI7C 1T6SA 1T56A 2K9SA 2M5WA 2DA6A 1CF7A 3AE6B 1X58A 2NS0A 2CQKA 3KFWX 2LF7A 1FSHA 1R71A 3VK7A 4IW0A 2KEBA 4LIVA 1IRXA 4L5EA 2DHRA 3T1BA 1SJHD 2Y5BB 2KHHA 2DWMA 2D3AA 4OZAA 3ML8A 4WWOA 3JRFA 3GFLA 2BYEA 2RD0A 2DN0A 2HVSA 3OS2A 1BVSA 4IBCA 3FK6A 3H9QA 2LWXA 1RESA 2MEKA 3DBRB 4DV6M 2OV7A 1MJDA 1J0GA 2A5UA 1V1PB 1MG4A 3P9IA 3PNVA 3QPSA 4DZPA 5KHOA 2OC6A 2SEBD 1ULYA 4BBSJ 2JN6A 1EF5A 2QDFA 4BOZB 2X38A 2FF4A 2HS5A 2XKPA 5DCNA 4Y28F 3ULQB 3RULA 2W4SA 3L0WB 1XLNA 2JY5A 4ZDPA 1YYVA 2GMIC 1Y1VJ 2EO2A 5CVJA 2HVQA 2M45A 4CGZA 4FE7A 3TDUC 5AZHA 4AM3A 2CMPA 5H8YE 3TP3A 1FYKA 4LK0F 1WR1B 1RPWA 4M6VA 4GIVA 5AEKB 1WGYA 2JZ0A 2LJIA 1X1AA 3Q3OC 3J7AO 1B59A 5E79C 1YJWI 1ZTRA 1NENB 2ZANA 2KIMA 1MJGM 5EG0A 3R60A 4B3XA 5G5HA 2KNBA 4PSXA 2K25A 1BXTA 3E5UA 1M4VA 2IDYA 3WE2A 2ELJA 2ZCWA 4L9VA 1IQPA 4MT5A 1DOIA 1XGSA 2JPCA 1TGUA 2E7WA 2W48A 1OKSA 4OAYA 5BPDA 1ZREA 2UXXA 4K7UA 5EEGA 4C9YA 4M6YA 3ZLZA 5FO5A 3L16A 3I5JC 2YQZA 3S1RJ 1IRGA 2PMVA 2AL6A 1V55H 3LVWA 2ZW0A 4YRVA 3HIFA 4YIFA 1VQ1A 3EFUA 1C4PA 1YSYA 1D2NA 1SXJA 1R00A 4CHTB 2P7VB 4B8XA 4DHJB 3BBZA 2GI9A 2D11A 1WGHA 4MEMA 4DR4M 3EFCA 1J8CA 5J8FA 4WXDA 3DEWA 4BXXJ 1E9SA 3PV1A 1XD3B 3ZMDA 3GTKJ 3ALBA 3H36A 4TQ1A 2OJRA 2Y69H 3W0LB 4XRSA 3DBRI 3T1YM 1Q0WB 1BBYA 3MN2A 1SXJB 2P81A 1IRZA 4IJEA 1ACIA 2HPIA 1IBXB 1C4CA 3WTXC 1JR3E 1VQMI 4E3CA 4HX4A 2PJPA 1XC5A 3L13A 4XSXF 2VIXA 4ARIA 2ESHA 3HBLA 5L83A 1IO2A 1HXDA 1VCBA 3COAC 2EPFA 2HR3A 2OZUA 1PGAA 3AG3H 1WJ7A 1N78A 1R2ZA 2DFFA 3BTCA 1X1PA 2MX2A 3BYTB 2Y0MA 4FX0A 3J80K 5KPZA 1SGHA 4G4RA 3ZXVA 2KJRA 3U2SC 1GB4A 2KHMA 4PUSA 3QQ8B 2IA2A 1GV2A 1XO3A 2QVOA 4FADA 3O2PE 1FFVA 5EGOB 3OAWA 4A5NA 1ETVA 1K78A 1APLC 2DOEA 5E6PA 3SDLC 2CRGA 2NNYA 2R7TA 4Y52J 4FWHA 3WGGA 2JRIB 1R1VA 2X1EA 2N9LA 2WXFA 2VBXA 3AEEB 3QRFF 3S16J 2MSYA 2XF6A 1KZHA 2G4SA 1O3TA 5E1WA 2DCEA 4HBLA 2NVQJ 5DEQA 3QCAA 1N34M 3OTOM 2WADA 2ERCA 2E19A 2NMQA 4A0YA 2QILA 1B1BA 4ANJA 4IVNA 4R71A 4X64M 4G6TB 2DWNA 4KA4A 4BH9A 2H1RA 1A04A 3BOSA 1CQTA 2RNJA 3BK2A 4IHWA 1GO5A 1KTKA 4CYEA 3HM3A 1N77A 5H6RA 4E7HA 4MEYF 3NWTA 3AI5A 1T95A 4GDFA 4K0KM 3T3OA 1Z05A 3ZQFA 1FMWA 2HL7A 3DEEA 3SR6A 1XS9A 1KSFX 1L0XB 2RDGA 2FS1A 4NQKE 3LAPA 5C1BA 2BWBA 4MGHA 4BY7J 4D9JA 4OU7A 2CU3A 2WNMA 3F0CA 3MC8A 1V97A 1KA8A 1OTRB 4F55A 4EM1A 4HPPA 2MG4A 4LLGM 3NRZA 4L9TA 2XAQA 4I7HA 3G1LA 2MCNB 3MAJA 4L9NA 3H8HA 2Z4SA 3Q8EA 1ET6A 2Y0SN 1S7EA 2L02A 2HPMA 4E6KG 5BMHA 2VIIA 4JI5M 2D3BA 3T9LA 1K61A 3VUXA 4IBFA 2KQ7A 3RPUA 4EOYA 2R46A 2FBHA 1RYJA 4LFAM 2VH1A 2KP6A 2DTZA 1E8YA 2X8AA 2O6GE 3H5NA 2AQ3B 2DAKA 3RZWC 3K4LA 2M3AA 4QAYA 3VAWA 1LB2A 1PGXA 2EFWA 4PS7A 2CJNA 3BTLA 4KT0F 1RR8C 4RGRA 1W7PD 2JA7J 3U6EA 3OIOA 3ILKA 4ITQA 1FX7A 4E4HA 1ZDXA 1CZPA 1Z0XA 2XSDC 3OJ4B 2ZJQF 1UHMA 4HAMA 2HTJA 4BJ6C 3OYGA 2PVOD 3KZYA 2Z3XA 3NQOA 1YX6B 4DK5A 2C7HA 1WMHB 2LGIA 4ZRKA 4FETA 4B43A 2JZYA 4M3DA 2CSOA 1VTNC 4KDIC 3C58A 4KT5C 1SC7A 2JY8A 1TZOA 1DDNA 5BQTA 4MFEA 1YRNA 2IO0B 3D32A 3KFUG 2VB6A 1P1AA 2MH7A 1A5TA 1ZN2A 1Z5SB 3FUVA 2IAIA 5HDNA 3ZRGA 2UUAM 3T38A 3AL0C 5IYCJ 1OLTA 2E1OA 1OCTC 3I4NJ 3AE9B 5D8LB 1MKMA 4LK1F 4HOBA 1D0XA 4X66M 3CTAA 3KOZE 3DA1A 1WHCA 4V2GA 4NQLB 4AC0A 1I7HA 4IWPA 2I5UA 3ISPA 2R3SA 2VC1A 2MJEA 3ZO5B 3BK1A 2H1KA 3W9CB 1KYWA 3ZUNA 3FRHA 1QZYA 2HOAA 3TIXA 4KISA 2ZB9A 2K6BA 3H7PA 3HRDD 1PP8F 2ACJA 1QF6A 3BJ6A 2KAJA 4XKVA 3WAOA 4KSKC 2WLBA 1WJBA 3C8YA 1XX5A 3I55I 1RIOH 5FTMA 3VSLA 2QEJC 5FKNA 1GDTA 2ZKZA 1MVKA 1JHHA 1RKWA 3X2QH 3L2QA 5E26A 5B1AH 2DFIA 1QA6A 2VUMJ 2CQXA 4UVAA 3ZQLA 3B6AA 4M3BA 5A2QZ 2KIFA 1OQYA 1IN8A 3VYSB 1HT1E 2EFOA 3DXJF 4A6DA 1I27A 3O8HA 1UZCA 1MH3A 4XK8F 5GAHJ 3ENEA 1F4IA 3QWLA 3HKPA 1MW7A 1WFYA 1T39A 2IJLA 1PUEE 4FE4A 4FASD 2CP8A 1TF0B 1YRNB 3R2IA 3M1CA 1JWSD 3DKXA 4QPQA 2X1DA 4MM3A 2XF5A 2D5GA 4PDIA 4E7KA 6PAXA 2ICIA 3WODF 1G59A 4W9LA 1SEUA 2HQ5A 1GT0C 2DMUA 4LCBA 5DUIA 2NQ8C 2LXEA 4UVBA 4DQOC 2JNHA 2RQPA 3I58A 3CF6E 4A55A 2XVCA 4YTMB 4BGDA 3KS8A 1U2WA 3OV8A 4PFPA 2ELKA 4DV7M 4GO1A 1LJ9A 4LF6M 1G3SA 4CICA 2JZ1A 2G8LA 5DCMB 3X0WA 1WX8A 2FD5A 3G1MA 4M72A 4W9IA 2FIDA 3L00A 5LLIA 5D5WB 1OQQA 3GQ4A 4ZHOA 2HQRA 1EA3A 1UB9A 1EH7A 2AXLA 3DPTA 1D0ZA 2DQRA 1QAOA 2N7DA 4ESFA 2KQSA 2VBYA 1P0RA 4I4LA 2KLOA 1UHWA 1IGNA 3GLGE 5J8CA 3J27B 3MTNB 5J1RA 3L25A 3I04M 3LVVA 1UM8A 1MGTA 1ERDA 1ENHA 4ANUA 2ZC2A 4FHTA 3C9PA 2WSFF 3RCOA 3E3VA 4B7HA 2GBMA 2FSWA 3ZNGC 1TS3A 4N9HA 2OCEA 3J81S 3UQAA 1IXSB 3JAMS 4A3JJ 1TWHJ 4ZDLA 1I4RA 2P5KA 3N05A 1IFYA 2G5GX 3ZXRA 1RR7A 4DBGA 2C7NB 4LJ8A 1F1ZA 3FHNA 1BN5A 4KGRA 3I9V2 1MU5A 4B44A 1WFXA 3T8MA 4RB2C 4HXDA 3RMKC 1DO0A 3RIRA 2GNOA 3CWIA 3MJWA 3KYCD 5KHDA 4A90A 3JCUC 1U8RA 1ZMUA 1T0YA 2ZPNA 3ECIA 3VFKA 4HRSA 2R5ZA 3MHZA 1Z77A 2K5PA 4EKUA 4G7OF 4MIMA 4F1SA 2I7NA 3OR1C 4YIRX 3UMMA 3GMEA 4P1CC 3DP7A 2LC2A 2O2VB 4O5VA 4XONA 1X4OA 1WR6E 4EZJA 3A1YA 1ZPSA 4Z2YA 4HEA1 1MBJA 1U5TC 3I4PA 4XLEA 2DWZB 3RYRA 2QP9X 4DBGB 3LYYA 3U60A 2COBA 2G3QB 3APFA 1A5JA 4BHCA 3K1JA 2L7FP 3AE3B 2X9DA 4A12A 3HUGA 2KXJA 3OSFA 1Y39A 1BJZA 1G3YA 3KVWA 2P0WA 2FQ4A 4J19A 3M95A 3UKGA 1FYMA 2NBVB 2V4IB 1W5TA 4R1HA 3V8LA 3HOTA 3WTZA 3TE6A 3NUHB 2IEKA 3FF5A 4AKHA 3DWLE 3QOEA 2LREA 3K69A 2NTSA 5FTNA 5DM7F 2HOEA 5J4YA 3TWMA 4OMYA 5FFZA 4TUWA 2RKOA 2R7OA 4RLFA 2KXEA 2N1WA 1X37A 3AN1A 4S17A 3C18A 3A98B 2ZM6M 2WAQN 3FISA 2BQQA 1R5HA 3FUXA 4TQ0A 3GLIA 3B6CA 2F4OB 3KP4A 2UUZA 3VDUA 1IZ1A 1B8IB 3KUCB 2DHZA 1HDDC 5EP1A 2BHYA 4NC8A 3Q9VA 1Y8QB 3FAHA 3QU6A 2Y21A 3GFJA 4RAZA 2MW8A 2DZOB 3IFWB 3DBLI 4PYZA 5LNK1 2DO7A 2UXBM 3NS1A 4MTDA 3U6LA 5GXGB 1KRHA 2RGHA 3ZGKA 4A3KJ 2J4XA 1V1OA 2I10A 4ZYNA 3VVWB 4LK0M 5EE3A 3WU0A 1ZE3D 4DV0M 2AQ1B 3KYLA 3RUIB 2JUGA 3GTPJ 4LF4M 5DPTA 4NQWB 4Q5SF 5ITUA 4MM3B 1JGSA 3GWZA 5FGMA 3QAQA 4H4KC 1ZRCA 4TMAB 2ZJPF 2G7HA 1Z1DA 3BP8A 5KPTA 1S7OA 4UUTA 5FR6A 4YFNF 2NRAC 2VQCA 3DWGC 3AG1H 1V86A 2R7RA 2J7QB 2GQFA 3LSJA 1ZYRF 1MD0A 2BB6A 5BYQA 2KA6B 3ZIMA 4A69C 2P4WA 3GYHX 4EEFG 1EH6A 3BLYA 1UNSA 5M5XJ 2VDBB 4IUMB 1HA5A 3H7PB 3LB8C 2BGFA 2C99A 2YX7A 5J6XA 1SD4A 3TQSA 3PPAA 2NVUI 1I4HA 3OWEB 2GXBA 2LXAA 3B08A 2IS2A 1DGRM 3M1EA 4DV3M 1MHXA 4MSQB 1QOFA 3SJMA 3DKYA 1HW1A 4GU2A 2L7IA 1GHCA 4I76A 2L4AA 1HW2A 2LHEA 3FUTA 3ZXSA 2BYFA 3PREA 3FZVA 1SBBB 4RM3A 2L7HA 1RC9A 1R4GA 4BHPA 4HPQA 4LY6A 3HOUJ 3EC8A 2QSHX 2LTPA 4RA2A 3F22A 2HVRA 4OHJA 1L2NA 1U6GA 4KITB 2JSVX 3BJAA 2BJVA 2IS4A 3GQ3A 4NPNA 3T1HM 4MDKE 4KO8A 4UV8A 2L3DA 1JT0A 3NVYA 5JI3E 3V62A 5HFYA 4K7SA 4LNKA 2X1CA 4GGQA 2M19A 4ZRJA 4USAA 1N60A 2JA8J 2KMAA 3BG7A 4WQOB 2L3ZA 1CJEA 3E6MA 2M4KA 5HNHA 3PVSA 1B9MA 4LNFA 4E7ZA 2O0YA 4P6VF 2IGNA 1BA5A 3HJ8A 5BO4B 5G5GA 2BS3B 3O8GA 4ITKA 1SXTA 1KFVA 1P98A 1D1AA 4ZH4F 1QQRA 3Q9SA 5HHDG 3AL0B 1VDVA 4LRSA 1VZ0A 4BQAA 1XGNA 4IOIE 4B9KA 3ERED 2RMMA 4KDPA 2FX0A 3QYFA 1R4NI 2E1NA 2FA5A 5ITYA 3PM1A 2R92J 4GIPA 1QHGA 3KCCA 5TRDA 4EUTA 1XXHB 3IAS1 3ECHA 2KTRA 1QGPA 1GVDA 4DJAA 2X6OA 3HPGA 1MBEA 2JWUA 2DYMA 2C60A 1X1DA 2LRDA 3PHXB 1QQIA 2LBFB 4DXFA 1PJJA 3N9YC 2ISZA 2MJ3A 1RNLA 3UIOB 3R4KA 2VF8A 1UUPA 2K6DB 2E2JJ 1HTQA 4OW0A 2IGHA 3DCGA 4LRTA 1SE4A 2CV1A 5DM6F 1EE8A 4D80A 2ZJDA 1Z3YA 2CQNA 3D5RC 2N9EB 1K53A 5FTLA 2XB5A 3U6MA 3M8EA 1QAQA 1E5WA 1R5GA 5H92C 3SEZA 4BE2A 2KX0A 3HHXA 2DAJA 4A3BJ 5J18A 3U52E 2KO3A 4R3DA 1WH5A 2R61A 2XPWA 2DFEA 3R0AA 2HHHM 3DTIA 3JRGA 3DPUA 1O4XA 1ZKGA 1U9NA 3I0TA 2HJ8A 4M9SA 1QDTA 4IRGA 4M3FA 5BMZA 4QLCU 5CX3A 3ABLH 3CDIA 1Z5AA 1QVRA 2BGCA 2VJ4A 4CJ6A 4I01A 2WC2A 3DEUA 5JLWA 1R58A 2QCZA 2EJSA 4BHBA 5LBQA 1RKTA 4AW4A 4E7JA 2BVMA 2CUFA 3CCRI 3DHGC 4B3AA 5GP9A 2QPAA 2JVHA 2P5VA 1D5ZC 2NYXA 3VB2A 3OG5A 5DCFA 2WSEF 4IKGA 2KTFA 4BU2A 4AYBN 3HIZA 2R5ZB 4NRWA 3BG5A 2XN9C 4XRMA 1UH6A 1H9GA 3N3KB 3LL7A 4X57B 4HF2A 3B1LX 4RGSA 3GLGB 5MPOA 1A35A 3GZ6A 2E5LM 4JV5M 1K78B 2KRCA 1TTNA 4GXBA 1NVID 2KJCA 1IY1A 4URKA 3OSGA 1SXJD 4WURA 4FN2A 2WSCF 5CTRC 2EA4A 1TWGJ 4MHGA 5FKAC 2X85A 1EO6A 1P3QQ 3DPLC 3P4PB 1DQUA 3EA6A 2KZVA 4LG0A 5FLXK 1GPXA 4MSMB 3J80Z 1N36M 1D0KA 4XLFA 2Y20A 2M1BA 4LGYA 3WHBA 2ADUA 1L0YB 4A3IJ 4MJSB 1FOKA 1GJSA 4YSZB 2KQ4X 4WWMA 4LF9M 3CCLI 5LXHA 2DT6A 4DYCA 1A6QA 1N33M 1U8BA 4KJZA 4PT5A 3PLVA 4IRHA 4V19K 3KPHA 1XB2B 5D6FA 3T8RA 1BR1A 4AWXB 5TJJA 2VN2A 3ZN1A 2AX5A 1VNDA 4QPOA 3L2UA 4K2EA 4A3LJ 5AUKA 3UIPB 2CHVA 5ILVA 2LK2A 1OFHA 3U60B 1G4AE 3QAUA 1WRDB 3ZJVA 5DDGA 2BY3A 3FILB 5L3DA 1DGBA 3CCSI 5HS8A 1R23A 1IAWA 3IUOA 4ZYSA 2EIJH 1IDYA 1J5YA 1A5RA 1WJAA 2ZMEA 4XORA 1S8NA 1IXRC 3E21A 2OQ4A 2W55A 1F77A 4XL9A 5LHGA 3CO6C 3R66C 4DUYM 1V5EA 3QC8B 1DGHB 3TP0A 4LB6B 3URYA 1WXVA 3VYRB 1PJIA 2VLAA 2DMTA 2L7MP 3SZPA 1RWSA 2BYTA 2OD5A 4FCWA 1FPYA 3ZQ7A 3HSRA 4WXHA 1YLAA 1YQ4B 1UJ8A 1FNNA 1XT9B 5ILSA 1HOMA 2K8CA 3UGJA 3PIPF 2KWVB 4OVZB 4PS3A 4MGRA 3P1MA 3W67A 2DPDA 2H27A 3K9TA 1YN5A 2VE8A 2EV5A 2F5QA 2UU7A 3SFDB 3L29A 3CF5F 2L9VA 4JK1X 3OYDA 4E71A 2ZFUA 2RDPA 2K8BA 3CC4I 1Q1HA 1Y0UA 3P63A 1SIFA 2GA1A 1LFDA 4IEJA 4XOTA 3H0DA 4X1EA 1I4WA 4A3VB 4A0ZA 3ZNZB 1EWYC 4XC2A 4B0MA 4S0RA 4CCKA 2LR8A 1IRFA 3DOAA 2JXNA 4ASNA 5ICEA 3VH3B 3PIOF 2M0CA 4AQ7A 1XN7A 3BVMA 1Q02A 2H1LA 2EILH 3K1NA 3VDPA 3HHGA 3FXJA 1YHQI 1V1PA 3CJRB 2EBIA 1YTYA 2PMZN 2R45A 2MABA 3FHZA 3E46A 3DDCB 1WVRA 3LSMA 5IYBJ 2FAZA 2K85A 4YWGG 4HZFA 4AU7A 4DR1M 2LOOA 3S1MJ 2R4GA 5D4RA 3BWGA 3SAUA 1FMVA 4M3EA 1ACCA 4NJCA 2Q0OA 3W1SC 2B3TA 4B3MM 2PKOA 1ONVA 1R4MI 3KSXA 2DA2A 5KAIC 5KPRA 3VDXA 3AU5A 1JUMA 1V5GA 1P7IA 1G8XA 4Y3OA 1VQOI 1WZ3A 2LVOA 3OYMA 4IIWA 4JP0A 1XGMA 5J47A 2DU9A 5HNFA 3HOYJ 1HZ6A 4II3B 2ID3A 1H4RA 3IV5A 3HRMA 2OA4A 4DXAB 1WXMA 3A4SC 1IDZA 1B8IA 3KP3A 3DQVA 3RGSA 3WALA 1VJKA 1QKZA 2KN5A 1KU2A 2KFKA 4HEA2 3OYLA 2IGKA 2XAFA 2LNHC 4ENJA 3VRBB 4QSHA 3R2TA 3E4RA 2D5VA 4CCMA 1RETA 2ZBKB 2KKCA 1YLFA 5L3FA 2Z5UA 3BZKA 5DV5A 3CUQA 2KIQA 4BDYA 1WF9A 2BWFA 4BACA 3V60A 1SJED 3T15A 2UZKA 2YFQA 3MQ0A 4EJTA 3KZIC 2P5TA 4G4OA 3ZQJA 2Y9YA 3F8NA 4DHZE 2WDVB 1GB1A 3OJ3A 3HM5A 3AE4B 2ZVOA 3WHLA 2NVYJ 2XF7A 4BQNA 1KU3A 4II3A 2F5EA 1D0YA 3L27A 3R8BA 3OS1A 3PHWB 2Y0TA 5HLTA 2V9KA 1WH3A 2CGPA 3KWLA 2JP7A 3E9SA 4JIOU 1F1HA 1J09A 2X51A 3HDDA 1JR3D 1SF0A 1UCRA 1PM5A 3A1QA 1B4AA 2BWEA 1QPIA 2PJHA 1AW7A 1RUNA 3HVZA 3GP1A 3KLNA 1TP4A 4HV5A 1R6RA 2PIAA 3IG8A 2R2QA 3RNFC 2N7JA 3JVZX 4FJZA 5D5VB 1I1SA 4WJOA 1XXHE 4YTNB 3TBIA 3NBXX 2O01F 2KW0A 2XB0X 3DCFA 3LJ3A 2QIEB 3TEXA 4EZLA 1ZOYB 3SHGB 2MJ5B
chains in the Genus database with same CATH topology
4XM3A 3K4JA 3SHFA 1SXJB 1NJGA 4IJEA 1SE3A 4D82A 2HPIA 1TS2A 1IBXB 1C4CA 3AKZA 3HWSA 1GL6A 3KEYA 5JHFA 2VZKD 2LMCA 3HJSA 2VIXA 4XKCA 4ARIA 4GDLB 1BUIC 2PTLA 1XXGA 4KKJA 2X6WA 1PGAA 1XEEA 3D8LA 3K8ZA 1N63A 1DYQA 1N78A 1R2ZA 1K52A 4IQ4A 1FMAD 4RMNA 3BYTB 2V1UA 5KPZA 5IT9S 1L2BA 2VASA 4G4RA 4GITA 1LDKB 3ZR8X 4P1WA 3U2SC 1GB4A 4ZJZA 2CV2A 2C9CA 2IGOA 2KHMA 5ITXA 2BTEA 1DGGA 3ONQA 1D5MC 4PUSA 3AJIB 1VZ7A 3L26A 2VXDA 1TKYA 2CFOA 1XO3A 1SFKA 4XGIA 3UJNA 1X1CA 3M7GA 1X1BA 1E32A 1FFVA 4GKJM 1HQYE 4ZC3A 3EIEA 2VPLA 2W7NA 4XQFA 1ROEA 4GKKM 2H89B 5EQTA 2R7TA 1YN4A 4FWHA 4CA0A 1QZMA 2X1EA 3DU5A 3GPYA 2N9LA 2WXFA 4JWSC 2MJDA 3AEEB 4HNTA 3AB5A 3SARA 2XF6A 2MD0A 1F2RI 5KCMA 3RSNA 2DCEA 4JE3B 1IM2A 3SMSA 1N34M 2ZW1A 3OTOM 2WADA 3HU2A 4EIWA 4NNJA 4OAZA 2M0AA 2ERCA 4DV4M 2NMQA 3SYLA 2QILA 3OIPA 4ANJA 4REZA 4B0EA 3K4NA 3K4CA 4X64M 4G6TB 1UWMA 4N59A 2BNKA 2DWNA 3B9PA 1R6BX 1J7KA 3GRYA 4XLCA 3VYUB 2H1RA 4GDKB 2DBYA 3BOSA 1N5XA 3BK2A 2Y0SA 3E0JB 2E3TA 1NNUC 2LEKA 1KTKA 5D3IB 2W3SA 5DYGA 2GB1A 1KLUD 1N77A 3HHWA 3T3NA 4E7HA 1E6EB 1JQ4A 1N75A 4ZPXA 3I4VA 2KZUA 4FCVA 5ITTA 4L8RC 3NWTA 1CQVA 1T95A 3A2KA 3AE1B 1S3SA 2L52A 3SYKA 4K0KM 3FC4A 1TY2A 3G2BA 3T3OA 2E1MB 1FMWA 3KDSE 3VRAB 2HL7A 4C7YA 3DEEA 3SR6A 1KSFX 4OWRB 2WXJA 1NEKB 1L0XB 2RDGA 5DYIA 2F4VM 3L28A 5C1BA 3AH7A 4MGHA 4D9JA 4OU7A 2CU3A 3AMZA 1E9RA 5CQEA 2WNMA 1V97A 4LFBM 4F55A 1VZ8A 4AQYM 3HHZA 3CMMA 3OYNA 2L9NA 1FXAA 4IBEA 3GRVA 2DWLA 3V05A 4LZZA 1E10A 3LMMA 2F5OA 1VR9A 4LLGM 3NRZA 2R65A 4U87A 1KYIA 4NUBA 3H8HA 2Z4SA 2XGNA 3Q8EA 3B9JA 2Z16A 1ET6A 2M5ZA 5KO3A 4IBJA 2HNHA 2HPMA 2K3PA 4FXCA 4E6KG 5BMHA 2VIIA 1JWUD 2IGDA 2FE8A 4JI5M 2YEPF 2ZXIA 3SFZA 4BDZA 4LJ7A 4IBFA 3NBIA 2WXHA 2V0GA 2ZAOA 1L0VB 1N62A 2R46A 4LGMA 1RYJA 4LFAM 3BVGA 2KP6A 5TSSA 4LJ9A 1Z6TA 1TS4A 2GOMA 2X8AA 3K70C 3H5NA 2AQ3B 2WA0A 4GHAA 5EE1A 1YN3A 5BMGA 2YNMD 3K2LA 1D1CA 2M3AA 3KP1E 4MGIE 2HQAA 3K4LA 4IDIA 2I2YA 3K4KA 1W36D 4W5WA 3CESA 1PGXA 4YY3M 1IN6A 1D6EC 2CJNA 1Q3BA 4LFCM 2ZXHA 3D8BA 3U6EA 2ONQA 3ILKA 4ITQA 2QKLB 2E5ZA 1FCLA 4E4HA 1TH4A 1ZDXA 2C5RA 3W2DA 1CZPA 1LFPA 1C77A 2W54A 1IY0A 4XR6A 2ACZB 2EELA 2DVWB 4L4UA 4BJ6C 3OYGA 1IY2A 2PVOD 3KWVA 2Z3XA 3OYKA 3HU3A 4M9ZA 4E7IA 2LGIA 3HL2A 2MYSA 2JXTA 4FETA 1X19A 4B43A 1LKXA 4GRIA 4JQFA 4DUZM 2WXLA 1MX0A 1FIQA 3RPFC 3C58A 4MH0E 4YT0B 1XF5L 1J7CA 3SASA 3SYTA 1TZOA 3FTFA 1WYGA 4HJGE 3RGPA 3KFUG 2VB6A 2MH7A 3U6CA 1NJFA 2G1EA 3FUVA 1YJJA 4X65M 5GKNA 1E94E 3AE2B 2HCBA 3ZRGA 3LQRA 2FOIC 2Y0QA 4F3QA 1K51A 2UUAM 1XWIA 3T38A 3AL0C 2L09A 4G6ZA 1OLTA 4FWGA 4IZZA 2TSSA 3F9KA 3D5SC 3FDYA 3I3LA 1MI0A 3AE9B 3A46A 2VQLA 3LFUA 4NRVA 4JOMA 1STEA 2JU6X 1D0XA 4X66M 3KOZE 2M4GA 3DA1A 3S8PA 4BS9A 1T3QA 2DYOA 1I7HA 2LH9A 1YQ3B 4IBDA 3H35A 4QNMA 3U7ZA 4J01A 2MJEA 3BK1A 2KZSA 1BR2A 4C2UA 2XSZD 2RDHA 3W9CB 2WXQA 2HDWA 1KF6B 5C18A 1NSFA 1QAMA 4JI2M 4KISA 4I81A 3TUOA 1C4AA 3DQVC 3HRDD 4DR6M 1XLQA 4BQOA 3VWBA 1YUBA 2F4IA 4OVZA 2W3RA 1QF6A 2KAJA 1XCTL 4XKVA 2CHQA 2LUMA 4NOOB 2HTME 2WLBA 1WJBA 1ZUD2 3C8YA 1UWXA 4FW9A 3GPPA 3U6OA 2V1CA 2VQHA 2WB1A 5FTMA 3VSLA 2QEJC 1EU3A 4HLQA 4NL4H 1OR7C 4DBRA 2WAEA 4CCLA 1MVKA 2FFJA 2XZFA 5EE9A 2UUCM 1MMAA 3L2QA 3LQQA 2LH0A 2K9MA 5E26A 3B2GA 2D7EA 4BLCA 2E60A 4II7A 4N4OB 2LHDA 3UNGC 3B2FA 2K22A 1NY6A 4MH8A 4DGWB 5E6JA 3GBGA 4AKGA 3MKYB 4L78A 1IN8A 3VYSB 1FNVA 1HT1E 3Q8XA 2M7BA 4KGTA 2J7NA 1FNUA 5TGTA 1T6BX 2QKMB 1JALA 3LXFA 1L1ZA 3QWLA 3HKPA 1MW7A 2RQQA 3ABVB 4DIQA 3UR3C 4ZYAA 2XF3A 4FASD 3R2IA 1QILA 1XNRM 2C98A 3M1CA 1JWSD 3DKXA 4QPQA 3EIHA 3VKGA 2X1DA 1XMOM 3CF2A 3MKWB 4RF0A 1YX5A 2XF5A 2D5GA 4PDIA 2XSJC 3AEDB 1Q3CA 2HKJA 4E7KA 1V5FA 2X4AA 2ICIA 2KDMA 4GC9A 1G59A 4XLAA 2DLBA 3HUIA 4JN6A 1Q39A 4L2YA 2QBYB 1L4DB 1U0JA 3PO0A 4F93B 4M0WA 4LCBA 4RNAA 4OZBA 4XLHA 2NQ8C 2LXEA 4S12A 2C96A 1GAQB 4DQOC 1BR4A 2N9KA 2AQ2B 2L5QA 4M0DA 3VSKA 1NHWC 3CF6E 4A55A 4YTMB 1IBMM 4BB9A 2XDVA 4JXJA 4BGDA 3KS8A 1UG0A 4XWWA 3H4MA 4PFPA 4JI0M 5FLXS 4DV7M 2V1NA 4LF6M 3V42A 4KLNA 2JYEA 5EJCA 5ITQA 3CP2A 4HSTA 2XSZA 5HG2A 2G8LA 2PMZA 3SEBA 3DTKA 5KQDA 2KQRA 3C2HA 4JI8M 2DZNB 4CH7A 3NWSA 3TEWA 3SATA 2R7XA 3MP9A 1OQQA 1PJRA 4QOSA 3GQ4A 4ZHOA 2BT6A 3OR2C 5AUIA 1EA3A 5BMIA 3V3XA 3IG5A 1KON