2W82A

The structure of arda
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
163
structure length
163
Chain Sequence
DMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extensive DNA Mimicry by the Arda Anti-Restriction Protein and its Role in the Spread of Antibiotic Resistance.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Replication inhibitor
molecule keywords ORF18
total genus 39
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07275 ArdA Antirestriction protein (ArdA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.560 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2w82A02
1.10.10.1190 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2w82A03
3.10.20.480 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w82A01
2W82A
chains in the Genus database with same CATH superfamily
2B7EA 5C2TB 1PUFB 1FIAA 1RFKA 3BINA 2MH8A 3AEEB 1JHFA 1ZN2A 3Q8BA 3WGHA 3C3EA 1XMKA 2XK5B 3BYYB 2BV6A 4FLHA 3R9XB 4GITA 1JQ4A 2QSFX 4LNOA 4HEA2 3E1SA 3MZYA 1NHWC 2BW2A 2F5OA 2QSHX 1E0ZA 4LIUA 1LDKB 5C44J 4ZDVA 1HJPA 3QQ8B 1KJTA 3RNFC 3RT3B 2LR8A 3WTUC 4IBFA 2FSWA 1WGHA 2D11A 5D5WB 2JXNA 1V81A 1X1CA 4X0GA 4BE0A 5FB2A 4E6KG 2RD0A 1UWXA 4F91B 3KOYE 2DFIA 1SFEA 2DPUA 2Y31A 2VIIA 2KJBA 4K81A 5AZHA 1EO6A 1K82A 1B4AA 1DGFA 3I59B 5FGMA 1B1BA 3BC8A 3W2AA 2GA1A 5CVUA 3ZQHA 2Y20A 2G9HD 2JWTA 4XE0A 2I2YA 3U4EG 2WA0A 3PXGA 2NVUI 3E5XA 3Q8CA 3LXFA 4BKSD 5F0FA 2Y75A 2L9VA 4TSSA 3KEYA 4W9EA 4ZZLA 3A9JA 1ZAEA 1YSYA 4UY8I 4M6VA 4BHPA 4P1WA 4A3FJ 3ZJVA 5H6RA 3EIHA 4XMYA 4MDKE 1WH5A 2D10A 3JTHA 1J5EM 2JF5A 1FSEA 3T8TA 1V97A 2GXAA 3G4SI 2W84A 3C58A 3QC8B 5H8YE 5D4RA 4IBDA 2R7DA 2VASA 2ECCA 3AEGB 3RZOJ 1FYMA 1MSEC 4NQKE 1KOTA 2M4GA 3ZMUA 2DVWB 3ZQGA 4ZTJA 2ISYA 4N6EB 3HTUA 4UN2B 1NI2A 1TS2A 3TQNA 4NDLA 3U6OA 1WKMA 3A1YA 1DU0A 4CHKA 3QOPA 1TDHA 1B72A 1X1DA 4KV2A 1SVLA 2GIVA 1MNDA 2RQPA 4L2YA 2NS7A 4M73A 4LD5A 3BIID 3V05A 4BXUA 2D5VA 3VTVA 4LDTB 1WR1B 3RE8A 3CP2A 2KTFA 4LITA 4NB5A 2KD0A 3NZ3A 4QLCU 4LG2A 4WJNA 1JWAD 2VF8A 1WR6E 5JHAA 3U6PA 1BIBA 4URKA 3U30A 2VRRB 4GYGA 1F9NA 3HDDA 4OIRF 5CHWA 2R7TA 1J7BA 4X57B 2LTPA 3K92A 3GP1A 3O8HA 2HYJA 1EH6A 1OTRB 4YT0B 3EHVA 4G4RA 3Q8FA 2BE5F 1T38A 4AUQC 1NNUC 2IZVB 1OLTA 1XCQL 2L3ZA 2B3TA 1UZXB 1MJAA 4L9NA 1ZRCA 3ECIA 2F4MB 2EILH 3A02A 1FT9A 4A0ZA 4HDUA 4A3GJ 1ACIA 1ZR4A 3S2HJ 3AOGA 2M60A 1UELB 3C2GA 1Z77A 3KYLA 4GOCA 4I76A 3CO7C 1KU3A 4PYZA 1IPGA 2A05A 2MSYA 1WM3A 3ZP5A 1NH3A 4PDIA 4CCMA 2CWBA 2VQGA 4LJ5A 5FKAC 2L2DA 5D6JB 2KC2A 1YOVB 2HVQA 3D5LA 5LHHA 3RMKC 2NQ8C 4AQ7A 3OYJA 2R62A 4MGHA 2RVCA 1WFYA 4NAMA 2IP2A 3DBLB 1JROA 3M8JA 5GTIC 1X2MA 5LXIB 5E1WA 4GRIA 5ERIA 1RYJA 4IBIA 4CJ6A 1ZELA 2KANA 3ECHA 4GDFA 2CUEA 2LJ5A 3LYYA 1YFHA 1X3ZB 1IDYA 1OYYA 2LASA 2DJIA 4JV5M 2HYGD 5F1JA 2IPKD 2Y21A 1V4RA 2VOPA 1ZK8A 3FKIJ 5HI1A 2O7OA 2UXBM 1SXJD 3SFIA 3HKZA 2EIJH 3EETA 3AOEA 3K8ZA 3GLGB 5CX3A 1FFUA 3S32A 1KQ0A 3LSHA 1K8RB 1IQPA 2LXEA 4G4OA 4OW0A 1R6RA 5LMUM 1HW5A 1QNTA 1SXJE 2INCC 1BJAA 4CZCA 2DENB 3IRRA 1YQBA 1GDTA 1EWCA 3L2WA 3BDDA 4Y4RA 2RV8A 3ABUA 2JNHA 1B6AA 4A8XC 4EM1A 3AU5A 1ZXIA 2M0XA 3SAUA 2PX9A 2C7HA 3BTLA 2J0MA 3DLAA 4FTHA 2WB1A 3AJIB 2VT3A 1G3TA 5K5QA 5DPTA 3IH4A 2SAKA 2AQ1B 1YD8U 2DAGA 5HLIA 3LAPA 2JXXA 1YYVA 5IKCM 2CP8A 4CISA 1P4XA 2R0QC 2B3AA 1YX6B 5GXGB 2KMUA 3HVDA 2N0SB 3WU0A 2KRCA 4NAWA 3B6AA 2VBZA 1V5GA 2V4JC 4XX5A 3BK2A 1WH7A 3J7AY 1DGRM 1C7YA 5DPRA 3P4PB 2P8TA 1ZPSA 3DPUA 2EINH 3QJZA 5IZ7D 4L5EA 1CK1A 3RPUD 2KX3A 2LVOA 3V8KA 4BBRJ 4DUYM 3T3OA 2ZSIB 1IAWA 3CUQC 2LVSA 3E6DA 3OS2A 1UWMA 2BS2B 3KW5B 4A3CJ 3VODA 5TSSA 4LJ8A 1XCBA 5F6FA 4AYBN 4XWWA 2VONA 2MC4A 1NEKB 3GTJJ 3U5ZB 1DGWY 4FWHA 3C7JA 4FCWA 2DKLA 2CUJA 2JPBA 2HXIA 3F8CA 3CTAA 3BPVA 1ZG3A 2EPFA 1E32A 3NHEB 3E56A 4KHPM 5ITXE 3FHNA 2LHGA 1MH4A 2QHOA 5FR3A 3F8NA 2NTTA 3CCJI 2NMQA 1YRNB 1R00A 3VTWA 3I64A 1T0SC 4JWUC 3L13A 5EP3A 4O1NA 2GLOA 1NTCA 1P3QQ 2HEOA 3E7LA 2KIUA 1JWSD 3CDHA 1FTZA 3U7DA 2JZPA 5C4XJ 1FMWA 3EDPA 1XCVA 4KISA 1VQNI 2A68F 1E9MA 2STWA 4G9YA 3BTIA 2D7EA 2NPTA 2C5RA 1FCLA 2FA5A 4ZYHA 3GZ6A 2OD5A 4BNCA 4GEWA 2R45A 1YJ9I 3DWLE 3H9JA 5LLIA 5BNGA 1QOFA 4LDTD 2VJ4A 3NZSA 1XMQM 1G41A 2MW8A 3ISPA 2ZPYA 3X0WA 2K9SA 2K6QA 2L09A 2E5LM 3DBRB 1I39A 1A36A 3T6PA 5HS9A 2AYOB 4B43A 3UK6A 3VTUA 1CZPA 3WAOA 3IG8A 4OMZA 1T39A 2ZJDA 5HG2A 2BB5A 2E35A 2XSZD 1EH8A 3H4MA 3PREA 3WA0A 3CCUI 4PCZA 5K7ZA 3NVYA 2OO9A 4RGRA 5FLMJ 3AKZA 2XSDC 4HV6A 4K7WA 2EIKH 1GUAB 3OIPA 3MFGA 5KPRA 3LA7A 1W0TA 4IWPA 4C3HJ 2DA6A 1OIPA 1ZHFA 3GTLJ 1VQ9I 4HQMA 2OCCH 1C76A 4DR6M 4LY6A 1PDNC 2X6OA 2O61A 1U3EM 3U1DA 3T5XA 1SE4A 4I6ZA 4KZCA 2LRWA 3A01A 5GAGJ 2IGMA 1I4XA 1V34A 1YJNI 1EU4A 4XONA 4DR1M 4AIDA 4RGNA 4DYQA 3T3NA 4IJEA 4UXNA 1W7PA 4UV9A 2ZTCA 4P6VF 1N25A 4RAGA 4PS7A 2ZCBA 1EF5A 2PIAA 3BR5A 3RNEC 2V9KA 4OVUA 4ZHPA 3JTGA 4W5WA 2F4VM 2RDHA 2MBOA 5E1ZB 2JY6B 2HU9A 1TQIA 3BTCA 2APLA 1ETYA 3OIQA 1DP3A 1Q0WB 3KS8A 3TO6A 3P42A 5FKKA 2VQLA 4FCTA 2L0TA 1AUAA 2J0KA 2RDBC 2PTLA 2JY7A 4DV3M 4M74A 3VYUB 3H5NA 1TBXA 3DBRI 4REZA 5FTMA 1POGA 4EE2A 2FNAA 2MJ5B 2DI3A 3WIMA 4YELA 5CTRC 3K4JA 3H6NA 1HNXM 3HRSA 2OQ4A 4CIZA 2XAFA 4XK8F 1KQ8A 4WWCA 2JTVA 2YU9J 4IHWA 3QPHA 3GTQJ 1HSTA 2PMUA 1NV9A 1HZ5A 3R60A 2V1XA 3F23A 2V6CA 3C8YA 2C6YA 1CQVA 2ELJA 1YX5A 1B9RA 1T3QA 4HQEA 1VDVA 3RIRA 1D5MC 1MNMC 2O6VB 2NVQJ 3ZUNA 3VR9B 5E3LA 3IL2A 3MHSD 2LREA 5LHIA 3VUXA 5JHUA 2AL6A 3IRQA 1QVRA 4HNTA 1CQTA 3ML9A 4KMFA 1QHGA 1BR2A 1QILA 1X19A 1VQ4I 1S72I 2E3TA 4HW0A 3D0SA 3APDA 4FADA 1WJUA 2KK8A 2EZKA 3FWEA 4YY3M 4GMVA 1FTTA 3CC7I 2JVCA 2XK5A 2WAQA 3UQAA 1IN5A 2LTUA 5FRNA 3LA3A 1N75A 3MKLA 3DHGC 3L4PA 5LGTA 4ZOHC 1DPRA 5E3NA 2R7VA 5JLXA 2OBPA 2O9LA 1EU3A 5A2QK 1Q39A 4II3A 1UHWA 3S1MJ 4IUMB 1GV5A 2PI0A 3EA6A 1Z21A 4LF8M 1MJBA 3ZMZA 5DM7F 3P63A 1N33M 1FOKA 3WANA 2KZRA 4HVBA 1WZ3A 3BP8A 1Q10A 3KP5A 3IHUA 3TOBA 3CCSI 3BBZA 2CWEA 1R9TJ 2IVMA 4KKJA 3L9FA 2KN4A 4JX6A 4MTDA 2GNOA 3HYIA 3BJ6A 2PE9A 4QTRA 1TY2A 3P9KA 3Q0UA 5J47A 1TF0B 4IBGA 4BS9A 3NJTA 3WTVC 4B7GA 4BXFA 2VN2A 4UB8C 1TS4A 2LP0A 1Q3CA 2LWXA 3ZNZB 2IA1A 1QPMA 1HR0M 2WB1N 5ILVA 2W85A 2GOXB 3V8JA 3KP2A 4H4KC 2I38A 3IHPC 3TBLD 1X4OA 2AEHA 3JW0X 3PRMB 5IAAC 2OC6A 1HT2E 2JJ7A 1Y1VJ 3OIOA 4WK8F 5EQTA 2KRUA 4RKUF 4XGAB 3ZNID 3BPXA 4JBAA 4DW6A 1P92A 4AQYM 2UV1A 2XUBA 1V2YA 2QNJA 2IPQX 1MBGA 2JA7J 1C4CA 4NC6A 5E3OA 3TMPB 1R7RA 4FASD 4EZKA 4A3BJ 1H4RA 3BG7A 1R6BX 5EP1A 3K7AJ 1BW5A 3VLFB 5B3SH 2RGFA 4AVZA 2MBFA 1K79A 2GXBA 2CE7A 3F8MA 5F27A 1L1ZA 2MW5A 1L0OC 3MZ8A 3JRGA 1K61A 2COMA 1FEXA 2MEKA 3KYCD 3PLUA 2BWFA 5JH5C 2ZJ2A 5L95C 4FWDA 4MFEA 1YQ4B 2VH2A 1F1ZA 2WDTB 1ETVA 2F5DA 2RPQA 5J4VA 4RB0A 3PFIA 4NXNM 4XKBA 3V7RA 4AG6A 2UUZA 4Q7JA 4RGTA 2CJNA 1S8NA 3FXQA 4BJ5C 3ZQ7A 5MPOA 2WXIA 2BYVE 3T1HM 1MSFC 1KRHA 1D8JA 1QA6A 1T95A 4C2TA 3FXRA 1R5GA 2RPVA 4KA4A 3BLYA 1OKRA 3VQIA 2O03A 5B5EC 4JWSC 2DWMA 2DLBA 3PZ7A 3SBJA 5E18F 3Q3JA 1H6UA 2P4WA 4ARCA 5HKHA 2A5UA 5DUIA 4GSWA 4BOZB 3F22A 4NNJB 2JY6A 3WHKA 3W1SC 1YN5A 4YIFA 4GHLA 1C1YB 3LSGA 2AO9A 2R44A 2H6BA 5ITXA 1WF9A 1XGOA 3HB9A 4IZZA 3IUOA 4D7NA 1U5TB 4WQOB 1LQ1A 4QOZC 4NJCA 1GO5A 4HF2A 1XDSA 5DD4A 4PZJA 1K4TA 4A5NA 3ABKH 3RYPA 4ZHOA 2A6TA 5FLXZ 1U4AA 1YN3A 5J1UA 4II2B 2VH1A 1I1GA 2LHDA 1F4KA 3S8PA 2ICIA 4M9XA 5FKNA 1LB2A 2K22A 1X1PA 3JAMK 3G1MA 3GLHA 2ZFUA 1PUEE 4L6V6 2RREA 5AONA 3K70D 5FK9C 2KJRA 1X3UA 2VXDA 3K6GA 3KFUG 1UNSA 3AE7B 2IGOA 4IC7B 2RR9A 3HKPA 4N0BA 1B59A 4HWIB 1BL0A 3AI5A 3NAUA 5FSWA 2LKPA 1WI3A 2RRUA 3JSVA 3ECOA 1HE8A 3PL8A 5E8GA 5KHQA 3VDXA 3UQBA 3K0LA 3IVFA 4NL4H 4RB3C 3ZW3A 2STTA 2KP6A 1JWMD 4X1EA 1K4SA 2HOSA 3BZCA 3AMZA 1EA3A 3KIOA 3TEYA 1BN5A 2VJ5A 2B9SA 2DBYA 3U6DA 1R49A 3GBGA 2BKRB 2CQKA 1TW2A 1KYZA 2L0KA 1PJSA 3IFWB 2OOBA 3IECA 1Z6RA 1ERDA 2CW0F 3WODF 4W9GA 2JZZA 1FYLA 3L27A 2L00B 3JYUA 1QO0D 3ZVVA 1AWDA 2D1HA 2QM3A 1OTRA 5FFZA 4GDKA 2Z7JA 2XF3A 4I81A 1EJ9A 4KT6A 1BVSA 2LKSA 3VR8B 2INDC 3QU6A 4W9FA 1Z7UA 1F52A 2RGHA 1VQ6I 2IW5A 5KQ8A 2HTSA 1J7CA 3H5AA 3AFHA 1V3FA 1PJTA 3DTKA 3MC0B 2AQFA 1SVMA 5BPDA 2LBFA 4A3EJ 4HJKA 4B0EA 2IA2A 1C4PA 2DT6A 4HROA 1QU3A 2FCMA 2RKOA 4GDLB 2HL7A 1SAUA 4L8RC 3LVVA 3K9PA 4IKFA 3ABMH 4M0WB 2KLCA 1WZ2A 3HRTA 3KYDD 4LJPB 1XMAA 2LFIA 3ZGKA 2MHJA 5E6JA 3EGRA 4DV1M 1VQLI 1C4AA 3DA1A 4A5MA 2DA3A 3SJMA 3DEWA 2XV4S 4HLQA 5BYQA 4B3TM 4KT0F 4HNVA 3CDLA 3G3ZA 3TDZC 3APFA 4IJAA 1MX0A 4L16A 4DIQA 2O01F 5D5XB 3V6CB 3AE6B 2K8HA 5GP9A 3NUHB 4QWQA 3RPFC 1RNLA 4PJMA 4HKQA 2FMLA 1I42A 3BQZA 3SZGA 1XN7A 2X1CA 2X38A 4C56C 4A3IJ 2LBCA 1WGLA 2ZCCA 3RKQA 1KLUD 1SXJB 1GXQA 3JREA 4AP4C 3VPRA 4A90A 4ANVA 1MJ9A 4RM2A 2FCSA 1HSJA 4GGGA 3VOEA 4M9ZA 2M4KA 4ZRQA 4S05A 1WGGA 2Z9OA 2CHWA 2WAFA 4XLFA 3FM5A 5E79C 2Z2SB 2F5NA 4GHAA 4LB6B 2FBKA 4ASNA 3OG5A 3I5UA 3UJNA 3UMMA 2RQQA 4M3DA 1XX5A 3G6EI 3L2VA 3WALA 1FRDA 4JQWC 5IT9S 3FKEA 1XMOM 2M0MA 2DTZA 2XAHA 1P98A 3ASOH 2VJIA 1T6OA 1STZA 3HM3A 2LUEA 2RN7A 3H8HA 4S0RA 1I4PA 5LRSA 2ESNA 4W1UA 3FK7A 2WXHA 4ETSA 1JR3A 2EBIA 3T1YM 4O6JA 2IGDA 2QJLA 3E46A 4MM3B 3W5UB 5BO4B 1JWUD 4JPSA 4IHTA 4XQFA 5K7FA 3A2KA 2FNPA 2V7FA 1WFXA 4ZRKA 2XHKA 2N9PC 5FTNA 4W9DA 1DGHA 1WYWB 3DLLF 1VI0A 3CCLI 1T56A 2HDCA 3F9KA 3R7RA 1J09A 2L4MA 2LGIA 4D82A 3X23A 2XBBC 4IIWA 4AS1A 2X6YA 4NNJA 4XIDA 1X2NA 3CF6E 3AOEC 2QENA 2WSFF 2XSJC 4QIWN 5GAEJ 2V1DA 4WURA 1J9IA 4RMNA 2LI5A 4JI7M 5HFYA 1DQUA 3PGEA 1WGRA 1V33A 1YITI 1B1ZA 4LF5M 1TZLA 4PSXA 3ZMSA 1ET6A 2WXLA 4HLXA 4QOSA 4I4LA 3K4NA 5F04A 2EB7A 1I4QA 2OQGA 2Z3XA 1WGNA 1T98A 3P5JA 1OMIA 1FBQA 4AUXA 1JJ6C 2MH7A 5IP6A 4DR4M 3BY4B 3FHZA 5L8RF 2DAKA 3IXSA 4DK5A 4RDUA 4IW0A 1VQ5I 1XGMA 2LUMA 1Z5AA 2EELA 3VVWB 5JI2E 1QVUA 3N1ZC 2A69F 1WGKA 3RZFA 4C80A 4ZYSA 4B3XA 3VH3B 3ERED 2XFTA 3MJWA 2JMWA 5LEJA 2M8GX 4MEXF 4BQAA 1PGXA 1QOBA 1TS3A 3L09A 3JW4A 4CCJA 1MDMB 1ESFA 3FTCA 2J42A 3M95A 1KYIA 3FD9A 4N9HA 2DX5B 6PAXA 4P1CC 3H7PB 2KQRA 1XXHA 2RKHA 3ZGZA 4MJSB 3CUQA 3E6MA 5IO9A 4F1IA 1X1MA 2X6WA 2KZSA 3Q3OC 3H0GJ 4DBRA 3S2WA 1GJSA 3AG1H 2YNMD 3KOWE 1IRFA 1V5EA 4GCVA 1JE8A 1NBFC 4A3OA 3OWEB 1UBIA 4G8XA 1IG7A 1RR7A 2DCEA 3TL4X 2E60A 3NVZA 3TL5A 2C60A 2DQLA 1WPKA 1B8IA 3KUCB 3HIFA 2HWJA 3NWSA 2M8EA 2NAZA 1RUOA 3K9OB 2FUHB 3M8FA 1CMXB 4W9CA 2ZCWA 4PS8A 2IS6A 1P7FA 1SXTA 3VWBA 3PQJA 2JXTA 3OYHA 3DXJF 1W0UA 5GPCA 3CIRB 4F93B 2R7RA 4LF4M 2TSSA 1RI7A 1O3RA 4MELA 2L9NA 4ICUA 3C2HA 2F5SA 2ZXHA 4J00A 4AJYB 2KDIA 2ZXWH 2FX0A 1MPEA 3UKGA 4S0HB 1SFUA 1OFIA 2XGCA 3SD5A 4IG7B 1Y0NA 4LRTA 4IXAA 4JX4A 3VKHA 3ZDMC 2YX7A 2JVHA 4HYEA 3FAHA 3DFGA 3QAHA 4ANJA 4Z8XA 1J59A 2C96A 4RGUA 3L2RA 2KDZA 4LG0B 1U8BA 4XOTA 1T3TA 4NJ6A 3A4SC 4B4CA 3A45A 5LMNM 1FJGM 2V1NA 4AIHA 1ZGUB 3M8EA 3AE3B 2PBIA 3DBSA 1RZ4A 2AQ3B 1U78A 4FJYA 5C23A 4GH9A 2DAIA 2ZBKB 2UUCM 1N60A 2XPUA 4I09A 2E5ZA 1HW2A 3DDCB 4PCQA 1D1CA 3GYHX 3CUQB 2WBMA 2BVLA 3DTEA 3BROA 3VDZA 3HU2A 2LY9A 2DAMA 5EDNA 1WXMA 1N32M 4ZTFA 3G1OA 2HOAA 1E5WA 3U6CA 1OGWA 4D0PA 3CSTA 4GDKB 3RI4A 1LFDA 1L5PA 5J8CA 2L76A 5LXHA 3QP6A 3HRMA 1SD6A 1SF0A 1ZGAA 4JI5M 4DGWB 4II3B 5GMVA 1P7EA 2KTRB 4C30A 2C7NB 1WJBA 4CA0A 3J7ZI 2R7ZJ 2M8SA 3PPAA 1LV7A 4W9KA 2KQ7A 1BR4A 3F6VA 1XSDA 2XZFA 5L3DA 3TCAA 1Q02A 4FCYA 1XC8A 1HKTA 1PJQA 4KYWA 3ZCBB 2OV7A 4CSWA 1HF0A 5GKNA 2XZUA 1E0EA 1O3SA 1TTNA 1PDXA 5EXXA 4PSWA 1ZDVA 5HNHA 3JRBA 2HDDA 5K5RA 2EFNA 3W0LB 2XSZA 1DDNA 2H1LA 4RAYA 2M56B 4W97A 3T8MA 5GPAA 2OAZA 2F5FA 1S3SA 1BI3A 4BDZA 2DHZA 4FBJB 2KNBA 1FMAD 2MP2B 2M1BA 1R23A 2DMPA 1KSFX 2AX5A 4BUPA 1RKWA 5EP2A 1NJGA 2WSEF 2N4FA 2VQHA 1DGHB 2ZXIA 5IWAM 2ZW0A 1QZEA 1MVKA 4M3EA 3KW6A 4U0VA 2M5WA 1H88C 1QVTA 1I94M 3HOUJ 3OJ3A 1E3HA 1SAXA 5IOIA 3DOWA 1IO2A 4LCBA 3E4RA 3B7ZA 4L78A 1GJZA 3N97A 1YG2A 1BA5A 3F21A 1UGMA 2N9EB 3HY5A 2KMCA 3I4NJ 4XSZF 1SEUA 1ZUD2 3GFMA 4EKUA 3RQIA 3A42A 2C98A 2K4JA 3AULA 2R65A 2KQ4X 4XL9A 2L7RA 4GXOA 1OQQA 2ELHA 3GPXA 3GLFA 1FNNA 2JUJA 2ZZPB 2KDLA 7CATA 2ICWG 3KLNA 2CHGA 4JX1C 4G6ZA 1XD7A 2ZMEA 4IWQA 1YIOA 5L3BA 2L05A 3H9DA 1Y8RB 2HTJA 1LKXA 2QZ4A 1KF6B 3Q3MC 1R1VA 4FHTA 3HL2A 1ZR2A 3ZNHB 1PUFA 1GAQB 1PGBA 3FM3A 3VUWA 1L6UA 3V61A 2OJRA 3GRVA 2O8XA 5HNFA 1TKYA 1XSXA 2ID6A 2WXMA 4KIGA 4RM9A 1A6IA 2BXYA 2FOWA 2V3NA 2QKMB 1GB4A 1YHQI 3DEUA 5BMHA 1WI0A 1WVRA 5B66C 2P5VA 2WS3B 1I6XA 2LZ6A 3S1QJ 1ZE3D 1UJ8A 4BXXJ 3FILA 1EKEA 2BTEA 1WJ7A 2R93J 4IDIA 2DODA 4KJZA 1UUPA 4BAYA 2V1CA 2ESHA 1SSNA 4JYKA 4OWRB 4ITKA 3ML6A 1H89C 1J75A 1QLBB 4N4OB 2WY7Q 5C1BA 2W54A 1YLFA 2KKCA 5TGTA 4C2MJ 3RNAC 4BKTA 4DUZM 3L10B 1K53A 1NY6A 2JZYA 1F43A 4CHUA 2E71A 2E34A 3BVZA 3KE2A 5E3MA 5J1RA 3UNGC 4JGHB 1DU6A 3MVPA 4FT8A 1I3AA 1MMDA 3SFDB 2EKKA 2QVOA 1XTAA 5ITYA 4XDCA 3J80Z 4A2UA 4ZRJA 4L5JA 1OCOH 4I7HA 1VQPI 4DV0M 3X2QH 2NVYJ 2JPCA 3Q8XA 4M3BA 3NS1A 1JB0F 1JI8A 1DO2A 3MC8A 1P1AA 2KAJA 2DA5A 5H92C 5G2NA 3OYNA 3PJRA 3IH3A 3CJNA 4B3AA 5IT9Z 2OZUA 1XXHB 1BMLC 3R8FA 2BJVA 2WXNA 4NJ7A 1L2NA 2VBYA 1E9SA 2HQ5A 2E1MC 2E2HJ 4LIVA 4IX7A 4AKHA 3I58A 1KZHA 1IV8A 1K7AA 2VQCA 4FJVB 3DWMA 4IOAF 4D2KA 2D3BA 4JX5A 2LRUA 1FSHA 4FWGA 2MBEA 2CHXA 1V5OA 2IAIA 3HXLA 3V7CA 4ENKA 1OISA 2OF7A 2L4EA 2KDEB 4AG5A 3M4OJ 3JR4A 3BR2A 5AIQA 1SJED 3B7QA 4JI8M 1MJGM 4IBEA 3EC8A 2P6TA 3E6BA 4KLNA 2YS9A 1JTXA 1I7HA 3VFKA 4F55A 1N77A 5EYRA 4AZFA 2FU4A 1J19A 4RGMA 4BYYA 2G1EA 2PE6B 2BY2A 2FQ4A 2ERCA 4ON0A 1VRAB 1O7LA 1Y6IA 3MC9A 1UHSA 1GJTA 2WY8Q 2BB6A 1VQOI 1D0MA 3KP3A 3W68A 1F77A 1XXHE 1ACCA 3HJ8A 2LLKA 3HGGA 3FKJA 5TRDA 2KA6B 3ASNH 2BWEA 2HQAA 1IM2A 2FIFA 2ZBKA 2DMNA 4LG0A 4KZ0A 1AIPC 2W82A 4B3RM 2YVCA 3GLHB 2R7WA 3OYCA 2WP9B 1DO0A 3GEZA 9ANTA 4C9YA 2K3FA 3IC7A 2K9NA 4JP0A 2QILA 4L18B 3SDBA 2GBYA 3FYCA 4DDID 3GLXA 3NVVA 4CO7A 4I5SA 2IGKA 2ZXJA 3H1UA 4BJTA 2DMUA 3N3KB 2ID3A 2PN6A 3BT9A 3J81S 1ZMVA 4MH8A 1ZMWA 4B3MM 4C00A 2CHZA 2R0IA 3MFKA 4BOSC 4DXGA 3VDUA 4EJVA 3ZYYX 1V1PA 5F0HA 4WF2A 5E17F 4OOIA 5KAIC 5EEHA 2V4IB 4D9JA 3ETRA 4XLNF 4P1BC 3W6JB 4X6AJ 1KQ9A 2FCNA 1AYFA 1UCRA 3AE5B 5DYGA 3OYDA 4TV3A 1X58A 2XB5A 1ZG5A 4WJQA 2M19A 3RNCC 3TW6A 1JRUA 1YN4A 2XLJA 3K10A 3B2GA 1ZV1A 2YR0A 5HHDG 4RM8A 5DCFA 1W36C 3GLIE 2KQSA 4WX9A 1ET9A 1TTEA 2P0WA 1VQ1A 2V1UA 5IN7A 4HF0A 1AN8A 3LVWA 4NQLB 3CLQA 1FXTB 2H89B 3TEXA 1PJRA 3TEZA 4EFOA 4UUVA 2CV2A 5FO5A 2GBKA 4AI6A 2LH9A 1R4NB 5ITRA 4MSQB 3LNQA 2XAGA 2IRFG 4V2GA 4UV8A 1J5YA 3H0DA 4LK0M 4ZDLA 3TDUC 4BLCA 5IT9K 3GPUA 1ZGWA 3VRBB 4YRVA 2DFHA 5DDGA 3CCRI 1MI0A 1JCKB 3C0RB 4P5OA 2Q5WD 2AL3A 4DV5M 1UD7A 4BE2A 3WGIA 1E8ZA 4K3CA 3KP4A 3ZQLA 2KVRA 4XZ4A 4QPOA 3OYFA 2G8LA 1UELA 3L08A 3CMEI 2VB6A 2QBYA 2XPVA 1S1QB 4RF1A 3GS2A 1VQMI 1T5XD 4NUBA 4B8XA 4HAMA 5DD8A 4ZYDA 3BCAA 4PJJA 1NNJA 3DKWA 2KACA 4WWOA 1IF1A 4X66M 3R2IA 2I7PA 1NENB 2LY2A 4E3CA 3HSRA 4PGHA 1XG1A 1L7YA 5TISC 1I35A 2MD5A 4OU0A 5FKLA 1RWSA 2VKDA 2UYZB 3HUIA 5F64A 4HEA1 3GRUA 2EUCA 1AARA 1PQSA 3AL0C 1HEZE 5DNYA 4IF4A 1IUYA 3W6KB 3ZR8X 2DZNB 2PVOD 5EZGA 5KNLA 2KVZA 3FUXA 3KOXE 1IGDA 4LF9M 3NBXX 1WH3A 3C9PA 3N4MA 2DZKA 1W7PB 2EA0A 2PLYA 3BWGA 5E26A 2EV5A 4WP2A 1R58A 3ONQA 4NC8A 5CVRA 4Y13A 3ZIMA 1FXIA 4A55A 1MNEA 3GZ5A 3B6CA 4B08A 4KKIA 1WHUA 5BYSA 2EZHA 2E1CA 1FOYA 5D8KB 4AIJA 2LVPA 3F3XA 3MKWB 1KFYB 1G59A 3L2AA 1K50A 2CG4A 2NNYA 5FTKA 3C2BA 3EUHC 3ZQQA 1Y56A 3DTIA 5HLGA 2PMVA 1IN7A 2YFQA 4CZZA 1D3ZA 3IWFA 2G7UA 4GC9A 2K1FA 3DVGX 1ZAOA 2VODA 1ZLKA 2M0AA 1EWYC 3GFJA 4MIMA 3SDLC 2TDXA 3ULQB 5LEKA 2KFDA 1O3TA 1G6NA 2VIXA 2H27A 3RYRA 1DGBA 1L3LA 2OOBB 1D0XA 1YNTE 3WAMA 3J81Z 5AZFA 2M17A 1D0LA 2A4ZA 2DWQA 4WQMA 1PM5A 2RNJA 2G3QB 3MMPA 2VQEM 2F6CA 5IYBJ 2O2VA 2FIDA 1N63A 3I4YA 5EE1A 4CGYB 1HT1E 3Q14C 1FPQA 2J5YA 3TPZA 2HD5B 5JXVA 1IRZA 3DU5A 2BS3B 1L0VB 4GIVA 1QGPA 1SXJA 3UI3A 3K9PB 1PP7U 3K4KA 3KUDB 3FUWA 2QQ8A 4G7HF 4LLNA 4KIKA 2WADA 4BU2A 3TOAA 1A70A 5IYCJ 1GVJA 2D5GA 2X0LA 1BI2A 2KNZA 2DFEA 2FBHA 1L2DA 2DA2A 1QF6A 1WX7A 1OYWA 3SQNA 4KIKB 2G45B 1RESA 2BWES 4CHTB 2N35A 3PO3J 5CJ9A 4JN6A 4OINF 2W48A 2JA6J 4EM0B 4A3KJ 1FIPA 3ZLZA 5FTLA 1FLIA 1N61A 4KGSA 1K3XA 5JI6A 5BMGA 4L4UA 4G50A 2IGGA 3G71I 3J7AS 4RAFA 2XROA 2MP2A 2EMTA 1UFZA 1ORKA 3H7PA 2OOAA 4O3MA 2Z99A 4FA6A 1G3WA 2LD5A 2IJLA 4WXCA 3FTDA 2DWNA 1LQBA 4E7LA 3A1QA 3ABVB 2FF4A 2KDFB 3M07A 1ZH5A 2R7UA 2Y5BB 2EKFA 4EVIA 3HPGA 3HJEA 4EQQA 3AE8B 2C9WB 3BG5A 1XF5L 5H37D 2LYCA 4XOPA 2J7OA 2DA7A 1GL6A 3F72A 3B2FA 1QQRA 5JHFA 2I8DA 5CHVC 3GLHE 1FM0D 3CMYA 1RLFA 1WJ4A 3MKYB 1V86A 2N9KA 3I71A 2L6OA 1FCCC 4DZJA 3FXJA 1XHBA 4YL8A 3A0HC 3BG3A 1SD7A 4HPPA 4MH0E 3S1RJ 2TRTA 1GV2A 1YX3A 1ZREA 2RGVA 4MGZE 4YFNF 2KXJA 1OCCH 1BW6A 4S04A 1ZG1A 4LTUA 5LLQA 3L26A 2CV0A 4MSMB 2OPTA 3HHHA 1N34M 2FOIC 2BW3A 1JGGA 3IG3A 4FJZA 4IO9F 3FUVA 3ZQIA 3WCQA 1ZP0B 2ME0A 3CP8A 3H4JA 2WXJA 1ON1A 3DEEA 4TQ1A 3NY5A 3P9IA 2BY1A 5IPAA 2LHCA 2ZANA 2V3SA 1H9GA 1X1BA 1SMYF 2GXGA 3D32A 3GXOA 4XKWA 2YEPB 3U9GA 1OQRA 3KP7A 1WJNA 3A33B 2JY5A 2M9HA 3U7ZA 4HX8A 2G4DB 3AV0A 5EJCA 4R7GA 3LA2A 3DWGC 3AU4A 2J5PA 3OOPA 3U52E 2WXGA 2KNVA 2XDVA 3PSFA 3JRAA 3LWFA 3DVNU 3S3NA 4GN1A 2ZNVC 3GZNB 5K5OA 1MN3A 4D80A 2CJJA 1FJLA 2G5GX 2KWVB 4HCPB 3JVZX 4AOFA 1V92A 3VDPA 3MQ0A 4A6QA 2NOGA 1G2HA 1X37A 3NS8A 2MLKA 2Z3YA 4RB2C 3V8LA 1P0RA 3GTPJ 1TGZB 2K9MA 3D8LA 1YJJA 1IXSA 1TZOA 4WWPA 2L9RA 3ZC7B 1IBKM 4I01A 3VH4B 1D1BA 4R3DA 1E17A 1I6HJ 2ISZA 3HRDD 3RNBC 3FF5A 3T8RA 2CHVA 4FX0A 1YLAA 2EA4A 1T43A 1FNUA 2BW3B 4EGZA 4LG3A 3V3XA 4HDVA 5ED4A 3ZN1A 4ZC3A 1UZCA 1SFXA 2ELKA 2ZW1A 2DK5A 5G55A 1OCRH 4GMQA 3BYTB 2K5PA 4YTMB 1GB1A 1P7JA 5FD6A 5IOZA 1XLNA 1I4RA 1T0RC 4OU7A 2HOTA 3BK1A 1QUSA 1YW8A 1UBQA 5JVGF 4C3IJ 1LEAA 3HOSA 3HOXJ 5AUIA 2JZ1A 3GE3C 1HBXG 4HL4A 3DV8A 1MH3A 3V4GA 3FX3A 1OFFA 1J7KA 3HX3A 1IV6A 3QIJA 4IPAA 3DHHC 1WXQA 2Z8LA 2O6VA 2KW0A 4EMSA 2R5ZB 4HPQA 2DLLA 2ZVNA 5AIPA 3LFUA 1L4DB 5FLXS 5GTHC 1FP1D 1Z9CA 4IRHA 4F8CB 5DCNA 3H5RA 3CJRB 1JUPA 4CGZA 4N9F4 3WTWC 4XBFA 4LMYA 2C9OA 2I1KA 3BVMA 1C78A 1LEBA 1SB3C 1IBXB 2R7OA 5HS7A 5KK1A 3ZMTA 2D2QA 2A3SA 1BT0A 2LGSA 4HZFA 4E74A 2NYXA 3ILKA 3EUB2 5A2QZ 1IW7F 1Q1HA 1WGDA 3I3LA 5CVIA 2BYTA 1RKTA 1K6YA 1Z7LA 3MHZA 5D2MB 2QF7A 3FXUA 4HV5A 1K51A 3VYSB 3D5RC 1VF9A 4YSXB 1LGRA 3ZQJA 1XWIA 1TIFA 3A01B 3R2TA 4LK1F 4PT5A 4D81A 2P5TA 1BIAA 1SG9A 2X6XA 1UG0A 3PZ8A 4B0MA 2MGWA 2K7LA 1LDJA 4A3LJ 3ZO5B 4B44A 2GA2A 1KM7A 2J7QB 3TWLA 1YE9A 3VAWA 2E36A 3N32A 3ZRGA 1R5HA 4EV0A 2CSOA 2KIQA 3GX4X 5L3GA 2HQNA 4NQWA 3IAM1 3FZVA 1IBXA 1C9FA 3HHYA 4IQ4A 4BQNA 2IGHA 2WAEA 2RC4A 2HAKA 1VR9A 1A6QA 1ZYRF 4EZJA 4P7IA 1VCBA 1TH4A 3ZQ4A 1OCTC 1Z5CA 4LZZA 3LW5F 2OPFA 3RFWA 3PUBA 5C4JJ 2CYYA 2DW4A 3QK0A 2QSGX 2X85A 2AQEA 1D5XC 3FRIA 1A35A 4M72A 4NZLB 1OEYA 4XSXF 5IOYA 2L7ZA 3MP9A 3R4KA 4KDIC 2A5WA 2HVSA 1I4WA 5JR3A 5LBQA 5DUKA 3ERMA 4IQJA 2NS0A 3RULA 3DCFA 2O3FA 1PYWD 2K27A 4V19K 2LVOC 1R5LA 1E7PB 2K8BA 4QHTA 2WHIA 3RGSA 4GU2A 3BOSA 4MEMA 4UVBA 2K3PA 1HLVA 4XRSA 2NVXJ 2FRHA 1XO3A 2M7AA 1KONA 3BY6A 4I6NB 4M3GA 1N5XA 4JI2M 1ZRFA 3A9KB 2LH0A 4KODA 5ICCA 5J2RA 1LUJB 3OAWA 1F5TA 5T8IA 2HHHM 4IOCF 1XCTL 2KC1A 2BS4B 4F92B 4GKJM 4LZJA 3QU3A 3KCCA 3VEPA 4KSLC 1YW7A 2JPHA 3QAQA 3K2ZA 3A4CA 3IH2A 3VYRB 2WSCF 4Q48A 2UWMA 5DPWA 2Q1ZB 4PJ0C 3I4VA 3QAUA 4LFCM 4U7DA 4JOMA 4WIPA 3V6EB 3S16J 5JI3E 5AUKA 2OA4A 3RPUA 1FFVA 3W1YA 3PNYA 1AA7A 2L01A 3KP1E 3RKWA 1A5RA 1SVOA 4NY0A 2KXEA 4V2FA 2IBDA 4DBGA 2DOEA 2O0YA 4ZYAA 4GKKM 3PLVA 4BKGA 1IN6A 4MB7A 2M5ZA 4X65M 5H6QA 3TSSA 4NSRA 1HC8A 2QHOB 1E8WA 2KDBA 3VK7A 3I59A 2QZ8A 3M3YJ 2KOXA 4IBJA 3GLLA 4M02A 2K6BA 3Q3NC 3OYMA 3BJAA 1OKSA 4P9UA 3K1NA 1QOGA 3A9KA 2L7MP 1Y8QB 1ZLJA 4BHBA 4B6WA 2IO1B 2CFOA 1I3QJ 1T0FA 1PJIA 3M3JA 1WJFA 4G11A 1YI2I 3N20C 3WHBA 2OCEA 4DOZA 1G3IA 4A3VB 3DU6A 2MJ3A 1D3YA 4PGGA 4U87A 3PHWB 3I4MJ 4ZRPA 5ITTA 1LE8A 4E7JA 2HJ1A 1NDDA 3GTGJ 4LCDE 2KWCA 5H2FC 3K9TA 2M4NA 2EKIA 2MQJA 4Y3OA 5A2QS 2JVGA 2IS2A 1JRPA 1WJCA 1JQJC 1ZQ3P 2ZEQA 3BXWA 2XKPA 2VBXA 3NQOA 3Q2AC 3I5JC 4N4NB 2IXSA 3Q0WA 2WWYA 1YO5C 2JSPA 4JI3M 4B09A 4OVZB 1WCMJ 3PTFC 3W67A 1R1TA 2HKXA 3PQKA 4XRSG 2EZLA 4C2UA 3BR6A 3KZZA 5E8IA 3RKYA 3GLFB 1TYGB 3GO8A 2QEJC 1BC8C 3K4CA 1SBBB 1SFOJ 3SMPA 3QRFF 3BTJA 2JA2A 1LVAA 1DOIA 1RM6C 2KMMA 3NVWA 5E1XA 4AW4A 3IKTA 4BH9A 3HBLA 1C1KA 3ZXRA 3OYIA 4Q5SF 1WSPA 2WC2A 1WE6A 3R3MA 3H1CA 2P5LC 2VC1A 3EYYA 2YSRA 3DBHB 4PK4A 1QAOA 1YMHE 2PW9A 3FDYA 1Z2MA 2JT4B 3N1XC 1C79A 3M63B 3M7GA 1NSFA 5D3IB 4CDGA 2O6VD 1E94E 1R71A 2JRMA 3H35A 1XLOA 1P3QU 3ZRFA 1YQAA 4CCLA 1WJDA 3KWLA 5I4DA 3MAJA 3KXEC 3A03A 1GUUA 4N9IA 3TKYA 1YJWI 3IV5A 3HOWJ 2NBWB 1WX9A 3ZMVA 3JRHA 4KGTA 3U2SC 4L0ZB 5HLTA 2JUGA 1FBUA 3THGA 4EOYA 1JMLA 2GAUA 1SE9A 2LWPA 3AXCA 1RC9A 1KU2A 4JK1X 1TT5B 3SEQA 2GIZA 1PUTA 3U61B 2R4JA 1GHCA 2H1KA 4O5VA 1ETOA 3CMMA 4ANXA 3R61A 5E20A 5IP7J 2Z4RA 4OIOF 1XLQA 2GM4A 1HOMA 4LFBM 2HR3A 2QQAA 3J7YJ 4A6EA 2VZKB 3L1PA 4MEYF 4BKXA 4G7ZF 4G7OF 2XGXA 2LVNC 3PVLA 1MHHE 3K1MA 3P4SB 1PP8F 3BVGA 5LNK1 5DFLA 4Y15A 3SYLA 4XLCA 1ZKGA 3QWLA 4NQWB 1VG5A 3QYEA 1LM8B 1ZKHA 2JWZA 1V9JA 3CLOA 2HNHA 3VKGA 2X8AA 2MX2A 3R66C 2NXNB 5EG0A 2EFOA 1Z59A 3N30A 1ODDA 3AEAB 3H92A 1FNVA 2HZTA 4P96A 4M9SA 2F48A 1OFCX 3H3ZA 3UR3C 4J19A 4HJGE 1D0KA 2PKOA 1S6LA 1QKZA 4M71A 4XBOA 2QEXI 2EJRA 1A31A 3ZJTA 3MHVC 2LHEA 5C18A 2IDYA 2WTEA 2DWLA 2MWSB 4IHVA 2BBCA 3DVGY 1BC7C 1IGNA 4OZBA 4A3MJ 3FK6A 4L1BA 5BOXA 1GG3A 4B47A 2Y30A 2NNNA 2W9NA 4D1QA 2KWUB 3SASA 3AAFA 5ICFA 1BUIC 2IO2B 4M00A 4UUTA 3K4MA 3AE2B 4HPMB 4ZH4F 4X64M 2HZDA 3B08A 1JT6A 3TGNA 4G6DA 1NV8A 2EV6A 2A5YB 2HPMA 3I56I 5HDKA 5GAHJ 2EH3A 3I57A 2XIGA 1OFHA 3V76A 1S5LC 3CESA 2OQRA 3I01M 3FC4A 4E70A 4IM0A 1NO1A 1S3SG 3U6EA 3PFYA 4AKGA 2PJRB 1ZMUA 3UGJA 1XC5A 4OMYA 1MMGA 2DK8A 2BOLA 1R7SA 2QP9X 3ZPLA 1ROEA 2R6FA 4BBSJ 1TDZA 1JT0A 2WXOA 4H0EA 4KMUX 4ACFA 4I6PA 1Z1DA 3SHFA 2KLOA 4KT5C 1K3WA 3NARA 1YX5B 2QA4I 1SXJC 1HCRA 3UIPB 1IY1A 1TGUA 3QP5A 4FE7A 2XASA 4HCNB 3E5QA 2KJCA 3F6OA 2K6DB 1WRJA 3J80K 2Y9YA 2Y2ZA 2YPRA 3WTTC 3EECA 3OV8A 1H9TA 3E21A 1SJHD 2JWSA 3CZ6A 3COAC 5J17A 1VD2A 2M2EA 3NBIA 4DR5M 3OTOM 3QPTA 2D7HA 1IN4A 4L5IA 3QPSA 4XDDA 3TE6A 1VNDA 2MROB 2ONQA 3U1KA 1IY0A 2UUAM 3PM1A 5D6EA 3ZH9B 3R0AA 3ZOBA 3CDIA 4RF0A 2WXKA 4AM3A 3KLOA 4JLCA 3VRAB 3KZYA 2SEBD 3U60B 4FISA 2O25A 3HHZA 2HOEA 2BXZA 1TH3A 3DQVC 4C7YA 1E3PA 3HSEA 4II2A 1FC3A 4IJFA 1TWCJ 3P4QB 2R61A 4NPNA 3O2PE 4I8OA 5KO3A 1XGNA 1UB9A 3RTRA 3EYIA 2KIFA 2MC3A 3BCBA 1LFBA 3MCZA 2NVUB 3JSVB 4FULA 3E97A 4QSHA 4M6XA 2XRNA 2DXIA 2IO3B 1K78B 3UGBB 2WXQA 3NG0A 3T38A 5EF6A 4XK4A 4LNFA 1ETWA 2MG4A 2ZB9A 3HOZJ 4J3OD 2IGNA 1EE8A 1JGSA 3OL3A 4G4QA 2WDQB 4G6TB 1TJEA 4RGXA 4WAFA 3EIEA 1TWGJ 2L4AA 3DKYA 4ABZA 1FPYA 4UNOA 5CLSA 4BHCA 5DCMA 5M5WJ 3G2BA 1OR7A 3JCUC 4YG2F 1D2NA 3ONSA 3QQAA 4K0KM 4M6YA 3IBEA 3ZCOA 4DR2M 1IRXA 4CUGA 2HCBA 1U6GA 4G6QA 5DM6F 4XN0A 1TT0A 5C3EJ 2DYMA 2DMTA 2D45A 2G3QA 4KUMA 2PEAA 4K3BA 2EWNA 4LFUA 1L2BA 3OYLA 3SHGB 1MIJA 5KQDA 4DXAB 3I9V2 1H0MA 1LFUP 4L23A 1G3YA 4BFRA 1WGYA 4RGSA 3K70C 5F1RA 2NS8A 4WWMA 2YU3A 2QCOA 1J7AA 4RH6A 4JI1M 1S29A 1ORYB 4JI0M 2DA1A 1V8CA 1V49A 1FBSA 4NOOB 2XAUA 2WZJA 3HHXA 3C18A 4LGYA 3WAPA 1IJWC 2XAQA 1GVNA 3LQQA 3HG9A 1UMQA 2Z0DB 2DDBA 2YEPF 4DZPA 3LDZE 1S7AA 2WV0A 1HNZM 4UUSB 3LSIA 4CYCB 1T2KA 3CQZJ 5L3FA 1JKOC 1X4PA 2QYOA 3CJTB 2NVTJ 3M0EA 2WX0A 3CCEI 4MGIE 3P4RB 1MBJA 2L9SA 4KN7X 1UF0A 2R3SA 1UFMA 1C3TA 3S3MA 2GBNA 4J6IA 4ZYNA 2VE9A 4I99C 2N9XA 3N05A 3B89A 4TUUA 3NWLA 1KFVA 3HPHA 1R7JA 2CQ7A 4IVNA 1PYVA 3HUGB 3WU2C 2COBA 1DGJA 1F4IA 4RBOA 5FRMA 5LFAA 3RD2A 1I1SA 3BR3A 3JRIA 3D8BA 3K2LA 4FD2A 4HNUA 1TH2A 1W4MA 2AWTA 1OAOC 4KFCA 2JK3A 2KPMA 4LNNA 5D8LB 2KX0A 2R5YB 2LNHC 3WE2A 3B7NA 2CFXA 3RCOA 2W25A 1MJDA 5K7HA 3VHTC 4XYCA 3RZDJ 1YW9A 3FXMA 3CF0A 1ETKA 3ROUA 3S17J 2CU7A 2YX4A 2LFBA 3U6MA 4R8HA 3O13A 5CVVA 2L7IA 3HHGA 3OWTA 2MD0A 4XR6A 2K0PA 1MHXA 2IEKA 4DQOC 4RA2A 1ONVA 4U7BA 1Y0UA 3ABTA 2V6EA 3A4RA 3IKVA 4A6DA 2LMDA 2LY1A 2QQ9A 2MJDA 3RFZB 1M1EB 4IHSA 2PFBA 5JFRA 4GDLA 1FOWA 2KRFA 3WHCA 2VKEA 3R8BA 2VOOA 4RGOS 2X1EA 4IKGA 1QQWA 3L54A 3RJPA 1V6EA 3HEFA 4RLQA 4HA8A 1CUKA 5CPRB 2MBHA 2N7EA 3O65B 3JR9A 2BYFA 1SD4A 3I4PA 4K1RB 3CF2A 3GQ4A 2F5EA 2DWZB 1BBYA 3TMOA 2Z8YM 2EV0A 4F3QA 1ZOYB 4L9TA 2KTRA 3I0TA 2LG4A 3Q9VA 1GNUA 4U88A 2N9LA 3APCA 1S7OA 4YSYB 1YJ1A 2ZFWA 4N59A 5D5VB 1TTYA 2JP7A 2EJSA 2DBBA 2LXCA 4F1SA 3GZNI 2CJOA 3QPLA 1TNSA 2HE7A 1LE8B 1P4WA 1OJLA 2ZNYA 1HZ6A 1YQ3B 2CQNA 2XPWA 3PRZA 2P5KA 5FTJA 5G5HA 5CQEA 5IT3A 1IZ1A 2MBBB 3NEUA 3HKZN 4E7SA 3S14J 3C19A 4OHJA 2XAJA 3LSPA 3MD2A 2K3UA 3DKXA 2QDFA 1A5TA 1TWFJ 1FD6A 2BJWA 1W7PD 2K86A 3KETA 3S2AA 5HS8A 1N5WA 2DZMA 1JJ8C 3TWKA 3DZDA 4MQVA 2WNMA 2A6HF 2GQQA 2HFHA 3Q8GA 3FE3A 4IL6C 2PJHA 1BOAA 1ULYA 4XICA 3CCYA 4PUSA 3HU1A 1ENFA 1WIAA 4XLPF 2K9LA 1ETQA 3AG2H 1QAQA 2LMCA 2DFFA 3HRUA 1TQMA 4EUTA 1V5FA 4US8A 4WH4A 3KWVA 2AQ2B 1FEHA 3DBHI 2IYDB 2JUCA 2V0GA 4NRVA 1MD0A 2VT2A 2F4IA 3FILB 1NG7A 1ITYA 2KMAA 4ZYEA 4HX4A 2CQXA 4B7FA 1SEBD 2HYFA 2QWWA 2XGNA 1F0ZA 2Z16A 1Q3BA 5CQGA 2F5VA 5D6FA 5F3WA 1Z5BA 2NTSA 3H3UA 2GRIA 3VYTB 3JRCA 2EKEC 1PGAA 2EQRA 3EPZA 4AU7A 3OR2C 3BR0A 4G3XB 2EMSA 2D3AA 3KYDB 2HKOA 3TEWA 2DHRA 4E7ZA 4CYEA 2CO5A 2EFQA 1G8PA 2H6CA 1HNWM 4XM3A 3SYTA 3QWZB 3BJOA 4ANRA 4CICA 2DAEA 1I50J 2VKHA 2D7GA 4KITB 2BT6A 2MR9A 2ZMEB 3I04M 2FMYA 1KYWA 3FYDA 1TW3A 3GF2A 3JSPA 1FYKA 2EZIA 3HTSB 1RR8C 1SIJA 5ICEA 1PJJA 3CCVI 2LNBA 3OYAA 5AZGA 5D3DA 2XEPA 2IT0A 3AEDB 1IFYA 2DYOA 2B63J 1L4ZB 1XXGA 2LVPC 2E7XA 3U61A 3GLFE 2JX5A 4ESBA 1E2XA 3GFIA 3HGIA 3FBNB 1WE7A 3LAJA 1D0ZA 2ZO4A 4PFPA 3JAMS 3W3CA 2X4AA 1VDDA 4M8NA 3M62B 3AE9B 4JQFA 1BXTA 2INNE 1DPUA 1MFWA 3SZPA 1AKHA 2M1MA 1WWTA 1VEKA 2Y3AA 4KIBA 1MBFA 3UF8A 4R71A 2OJED 3MKZA 2CUZA 3CWIA 5H20A 3EFCA 3A46A 2O8KA 2R2OA 3W2WA 1J2XA 4K2EA 3ZQFA 2RMMA 2L02A 3FXOA 3OL4A 3T15A 2ZAOA 4MNUA 2PJPA 3Q6BA 5EXPA 1IGCA 1HXYD 2PVGC 2G9WA 3LSTA 4TMAB 2BGFA 2DZLA 4Q47A 1KLGD 1MGTA 1TKGA 1V1OA 3K9OA 1QUTA 4A12A 2J7NA 1IP9A 1WXSA 4P17A 4LJZF 3BZKA 1P4AA 3AE4B 3WU1B 2KT0A 3HK0A 2IO0B 1IBMM 3I63C 1K83J 4QNRA 1Z05A 3OYEA 2FFJA 2KISA 2E2JJ 1P9DU 3PVSA 3ML8A 3O6BB 3VFZA 3A0BC 2XN9C 2JRHA 1HDDC 2I10A 4EEFG 1H8AC 3KUZA 2QMTA 3IAM2 1TR8A 2KZVA 1RETA 1TKEA 1WMHA 1R5ID 4ZRIA 3DCGA 2KYWA 4RM3A 1QYRA 5EE9A 3HHWA 3PSEB 3SFEB 1QDTA 1IXRC 3KDSE 5B1AH 4WWNA 4AYBA 4I2OA 5E6NA 2X9DA 2KDMA 2PJRA 1W1WE 2L32A 1RU3A 3BOQA 4MLOA 1F1HA 2QC8A 3HZJA 2VQFM 2VF7A 2KJHB 3SEZA 3PRPB 2FUG2 4PD2A 3AV8A 5CHFA 1MBHA 5IYDJ 4E4HA 3TBIA 4ITVA 2FQ3A 3LCVB 3GWZA 2XH9A 1ZW7A 3J2PB 1WMHB 3F8BA 4AWXB 2F5PA 4LGMA 2UU7A 3HVZA 4IRIA 3F8FA 3AECB 2CGPA 4FETA 3GLIB 4BBNF 3FUTA 5KHDA 2QLZA 1W5TA 2IY0B 2R92J 2V3PA 4PYUA 1QDRA 1QQIA 3GVAA 2RGOA 3T1BA 2X8XX 5FR6A 4Y7NJ 3VUYA 2DT7B 2KFKB 2MA3A 2HXOA 2VKVA 1JKPC 1LNWA 3RPQA 4ZPXA 1A5JA 3SARA 3L16A 2WX1A 4XWTA 4LJ6A 3PIOF 2CUFA 3CUOA 4KDLB 3QOEA 2K9XA 3DHIC 2WWZA 1K52A 2FXAA 1L0XB 2ON8A 5CYVA 3U21A 3Q69A 5C1ZA 5M5YJ 5BR8M 4USAA 3BWUD 1OQYA 2UU9M 1LJ9A 1ISNA 1APLC 4QPQA 4KX6B 1QOAA 3U6LA 2J5OA 1YIJI 4C7ZA 4WAAA 3GW2A 2E2IJ 1WM2A 5EP4A 4TKNA 3RKXA 1TS5A 3BZDB 3B9PA 4LF7M 4BEHA 4XRMA 4RB1A 1UM8A 3K69A 3B1LX 1XS9A 2GZWA 4HKZE 4TV7A 2IA0A 2QQBA 2MH2A 5FKMA 4RMAA 4GB9A 4KVGB 3RUIB 2N7JA 5M3FJ 1HQRD 1VDLA 4DXFA 4OVZA 4CCKA 3NRVA 2I5UA 2K8CA 4XLEA 1FWZA 3KS4A 2B0LA 2G7HA 2FD5A 1F9JA 1J0RA 2J0JA 3J7BA 1K6OA 2FAZA 2FJ1A 2V6ZM 3QX1A 3I53A 2IJ0A 2BF8B 3HJSA 1YS6A 1E3OC 4HRSA 3U8ZA 3REOA 5IREB 1EFUB 4DV4M 4M3FA 4CYDA 2R2QA 5BMZA 1D1AA 2E5NA 2L5QA 2NRAC 4JXJA 2BVMA 3L00A 4BJ6C 3P2BA 3IHPA 4A93J 3HOTA 4DJAA 3FIWA 1SMTA 5FROA 2F2EA 3S15J 3CSFA 2DAOA 3J81K 3MZHA 2VUMJ 2IY1B 4ARIA 2JU6X 1WJ5A 2M0CA 2XRLA 5BYRA 3HHMA 1U2WA 2W24A 5ITUA 2K02A 1JR3D 2XEWA 3KX2A 5DCMB 4DQ2A 3PV1A 2WDRB 1WZ0A 4IHXA 1GC6A 1RUNA 3L7WA 1F2RC 3TQSA 2H94A 2C9CA 2GI9A 4RFBA 3PS6A 5J4YA 5M5XJ 3KVWA 1OCPA 3MN2A 3OYGA 5ITQA 2GMIC 2KHMA 3EUAA 1FIQA 4PDKA 2D2WA 2JZ0A 1R36A 2ZKZA 3A9JB 4AIKA 1H8CA 4G4NA 5ILUA 4LJ7A 2XB0X 5EGOB 5G5GA 4M0DA 4B48A 3K1JA 2FE3A 4W9HA 2VBWA 3KLSX 3R6SA 3GOEA 1XB2B 3HUGA 5D7GA 1W36D 1SANA 2R7FA 4I0BA 4ZJZA 3HU3A 2H8RA 1B72B 2KN5A 4QHSA 3SATA 3SHQA 2Y5CA 2QUFA 1RRBA 3QYBA 2W3RA 1OCZH 2E19A 1RPWA 4FX4A 1GOZA 3L25A 2C7MB 4EM2A 3EFUA 5EGOA 2Q2EA 3B02A 1NI3A 1ZQ9A 2Y9ZA 4Q4ZF 1MKMA 3ZDTA 2HQRA 2MABA 2WXPA 4UUSA 4R79A 2ZPNA 4A0YA 1Z3YA 2GQFA 4MGYE 2DOAA 3RNGC 2CW8A 3K4BA 3P7NA 1FX7A 1CF7A 5FKOA 2QGUA 1MU5A 1TY0A 4D5CA 4JIOU 2JA5J 2MGQA 1RAXA 2R7SA 2DZJA 3UINB 2AHMA 1XEEA 2PMHA 2BHZA 3JR5A 1MDMA 3AL0B 1WXVA 2WAQN 4G12A 3I51A 1I4GA 1MBEA 1LXDA 4OZAA 1MG8A 1J0GA 1EF4A 2UXXA 2WXFA 4LK0F 5EG0B 2L8JA 3I3TB 4P16A 3NRZA 5LGNA 4C3JJ 2ZAMA 4HLYA 2RDPA 4IRGA 1WSUA 1ZARA 4G0NB 2P7VB 1E6EB 4BBAA 3DBLI 4ENNA 1REPC 4NBQA 2R4EA 3ZRCA 2VDBB 4P9FA 1HDPA 4DV7M 3P1MA 1VZ0A 4HG2A 4ESFA 1E7UA 2CS3A 2FS1A 3HOYJ 3OLMD 1DOYA 2HJ8A 4B3SM 2R5ZA 3W1SA 2EFWA 2HS5A 3KSJA 4IEJA 5BQTA 1JXSA 4IOIE 2HPIA 4LJAA 2JUOA 1P9QC 2DA4A 3RDIA 3Q0VA 1USTA 1IXCA 4CCNA 4R1HA 2E1NA 3Q8AA 2HDWA 2UZKA 1W5SA 2I7NA 2BPSA 1T0FC 2X51A 2K5CA 4DHJB 3GLGA 4GYIA 4BVUC 3LOCA 1V5TA 1Y8GA 3FKYA 1VQKI 4EGYA 3H36A 1D6EC 1OIZA 4DV6M 2BWBA 2BGCA 2R7XA 4FN2A 1U8RA 2XGEA 3PT2B 3H3VK 4OIPF 1OR7C 3OYKA 2LKXA 3GTKJ 4YHHM 3QODA 4GLSC 3Q5FA 3ZMDA 3ZTCA 3KEQA 3AE1B 1L0YB 1IBLM 3C3WA 3PO0A 4BB9A 2W57A 3QCAA 4CH7A 1VEGA 2LXAA 1Q5WB 1L8QA 2VZKD 2K0BX 1UH6A 2FCQA 1D4BA 4HBLA 3S3OA 1WJEA 3U5ZA 2JN6A 4J01A 5LRRA 1HTOA 2MA9B 4NXMM 2GBJA 2N7DA 3FUUA 2O6GE 4WXDA 3DVNV 2H5XA 3R0JA 2VC0A 2D07B 4II7A 2X4HA 1JUMA 2MYSA 3CJQB 2DJNA 2XF6A 5E6PA 1EM7A 2EFPA 2N1WA 3DPDA 3I55I 3W6VA 5KPZA 3WG9A 1E7VA 4MACA 2B76B 3FISA 2FH0A 4OX9M 2ZNVB 1TWAJ 5JVTA 1TBEA 3ESWB 2WYQA 4DBQA 5IP9J 1DOXA 2L7HA 3KEOA 3HJQA 2HWVA 3IT4B 2KRKA 2DZIA 3F0CA 4KNYA 4NC7A 2XGDA 4XLAA 3N1YC 2KO3A 2P7CB 2BQQA 1PGYA 1EIJA 2L1AA 1L2CA 2K39A 2LSOA 3ZJUA 1IDZA 2FE8A 1HKSA 2JSVX 1G6JA 4JL9A 1U9OA 3AB5A 5EE3A 1BJZA 3IAS2 3JRDA 2ZJQF 1P2FA 1RRJA 1XGSA 3TEDA 1R2YA 5BMIA 3GCMA 4LLGM 2Y5PA 2K40A 2CMPA 2JZ3B 2M30A 5K1YA 3ABLH 2C99A 1P7IA 2KHHA 5GADJ 2PPHA 4MQ9F 2K9DA 2DNFA 3TUOA 1O57A 3T0YA 2LF7A 1VZ7A 1SE3A 3CGWA 1TLHB 5ILSA 1YRNA 2H88B 1DUXC 5DYMA 4XORA 2HGCA 1NHAA 1JW9D 3G73A 1HQCA 1D0YA 4XKVA 5DS9A 4A69C 2DYSH 2KJ6A 1WX8A 1WJAA 2ADUA 3CO6C 3KP0E 3M6AA 1VJKA 2EK5A 2OHFA 1OEYJ 4RNAA 2LF8A 3TW7A 2Y48A 1EF1A 4P55A 1IXZA 3GFLA 3KP6A 4GGQA 3CCQI 1I4HA 2J52A 2M45A 1MMAA 5CVJA 1ZRDA 2GBMA 1QANA 2GLSA 3U6SA 5L3EA 4AJWA 4C4VA 1QT9A 2AS5F 4EZLA 2KWDA 4LNIA 2KNAA 1L1TA 2VPLA 4EJUA 4LB5A 4LRSA 1X1AA 3OOUA 2KFJA 2CHQA 5J1YA 2CRUA 3EUKL 2Z4SA 4RS8A 4LJOB 3VSKA 3B0AA 3U2RA 1PVEA 3SZTA 1AU7A 5J40A 2ZC2A 4HEOA 3BZ6A 3H9QA 4MJSA 2C5LC 3BQYA 2NBUA 1NHGC 4KO8A 1E8YA 1N62A 1Y1WJ 2LRDA 1IRGA 4PDGA 2JYTA 2AXTC 1IYFA 4CCOA 2VPRA 4BKSA 2QPAA 2LBFB 2VLAA 2ACJA 4IBBA 3JAMZ 1WQ2A 2CRGA 4GXBA 4DR3M 5EZHA 1YJIA 3CMMB 1NVMA 2D3GA 4FVMA 1QHHD 1XQQA 2K47A 3HM5A 1FZPB 4EIWA 1G3SA 2O2VB 1ZXHA 2MCNB 3Q8EA 4ANUA 2L83A 4FCVA 2LOOA 4TQ0A 1ENHA 4PK1A 1DGGA 1NK3P 2DMQA 4YXDB 2DYBA 3ZXVA 2M34A 4FW9A 3ZKJC 3TO7A 2QCZA 3N9YC 4LNKA 1U9NA 2BBYA 5FLXK 3GPPA 3HC7A 3A98B 1E8XA 3FXKA 4LOCA 4E7IA 4TUWA 1D5VA 3F92A 2O5RA 2UXCM 2R46A 5EEGA 4HOBA 5LD2C 3CC2I 2XF7A 5F08A 3E5UA 1MW7A 2Q0OA 5KAFC 1E90A 1Z5SB 2LGDA 4NRWA 2XVCA 2ZVOA 3OS1A 3ALBA 4XN3A 4IM3A 3VSLA 2L52A 4PJNA 2WU5B 3WTXC 2L54A 1BOBA 3P9CA 3DOAA 1T0QC 3LSRA 1DV0A 2ZNZA 1RIOH 4WW0A 4MT5A 1U5TA 1DYQA 3RI7C 2E6XA 2LC2A 1GVDA 4DWFA 3W9CB 4BEHB 4IHYA 2GB1A 3EQLF 4EJTA 5E6OA 2DNAA 3AM9A 1FMVA 1SD5A 3HSFA 4Q2JA 1WWXA 2KZUA 4Y33A 3SAVA 4PJLA 1TZ1A 1XT9B 2V26A 1PRBA 2F5CA 2IS1A 2P6SA 2E7WA 5FJ8J 3WHLA 1NJFA 5HLHA 2CQQA 1KU9A 3O3KA 4G3OA 5L3CA 2EA2A 2V9VA 2HVRA 2Y0TA 3SYKA 1N36M 3FTEA 2R4GA 1HKQA 1WY8A 4GC5A 3DF8A 5D4SA 2HTHA 2WLBA 4ITQA 1Z91A 4S17A 4NAWB 2F5QA 4DNCA 1WIVA 4DYRA 2FUG1 1BI0A 4JE3B 1A04A 4M01A 4AVPA 4BGDA 1GL7A 1KGSA 2UXDM 4B7HA 4WJPA 2JY8A 3GMEA 1WRIA 3WGGA 2DU9A 2PMZA 3J80S 1JALA 1GT0C 3TP3A 3PSIA 2KL4A 2QIEB 1AWCA 4LLGF 1X3WB 1GABA 2EO2A 3SU8X 4L9JA 1Z0XA 3URYA 3K4LA 1R4MI 4QAYA 1T8IA 4MFDA 1LPQA 2AHQA 3L0WB 1S7EA 2OU2A 3HGYA 2OUMA 3TWMA 1WYGA 1FOXA 2P81A 4A3JJ 2YQZA 2REXA 2DENA 4CQNA 2Y0SN 2CU3A 2L3DA 2A6EF 3OMYA 5J3LA 5IA7A 1EH7A 3MJ5A 4UVCA 2BKFA 2KIMA 3QARA 4EATA 4IWOA 2F4OB 1FP2A 2NCNA 2QSDA 3GQ3A 1O7FA 3PO2J 2MSED 4KDPA 4KICA 1TNTA 4OAZA 1BM9A 3AN1A 2R7QA 2CW7A 3IP4B 3L2UA 3L28A 1OYIA 4KSKC 2QKLB 2CEAA 5D5UB 1VQ7I 1IC8A 1R2ZA 4RCOA 2V9PA 4F2LA 2OZ6A 2PQ8A 2KKOA 3E0JB 2BEOA 1R4GA 3BG9A 3S1NJ 3RYTA 3GLIA 2MBQA 1C0WA 1CGPA 3K2AA 3HM6X 2L2OA 1HXDA 1XB4A 2JQRB 4W9LA 2ME6A 2L0FA 1TQPA 1UHMA 4ICVA 3M1CA 3AG4H 4DDGD 4AC0A 3AEFB 2J53A 1XMXA 4HK2A 1FNWA 3CTWB 2W3SA 1XLPA 4FXCA 1FY7A 2BNKA 1I27A 3BR1A 5HODA 1MG4A 3SFZA 1MMSA 1HA8A 2PG4A 1U5TC 3I54A 2LD9A 3SMSA 3RN9C 1VEJA 3WTZA 2A61A 3KOZE 1QAMA 1QRYA 2YUSA 1XD3B 2Y0QA 1JHHA 3DFZA 2DYRH 3G1LA 4DHJD 2ZSHB 3OSGA 1R4NI 2N1VA 1BI1A 2LVQD 1VLBA 2UXNA 1XNRM 4HXDA 3L29A 1BR1A 1YS7A 1ZTRA 1NYQA 1XDUA 1IN8A 5FFXA 2KDOA 4L15A 3C3DA 4X62M 4CYCA 4BACA 4CXFA 1LTMA 2Z33A 1QZZA 3SC3A 3L17A 1JTYA 3W2DA 4YEJA 1ON2A 4LJ9A 2JWUA 1JWBD 4A3PA 1R4MB 1MZBA 4ZYGA 4ENJA 2PLPA 5TR5A 2LDUA 2GWRA 3V42A 4CO8A 1SGHA 2JSCA 1G8XA 4AKIA 2FBWB 4EJOA 3M1EA 3E9SA 4XC2A 2K9QA 1JKRC 2Q8KA 1HA5A 2V4LA 2OJWA 2MLGA 2L7KA 2Z5UA 2R5YA 1AW7A 1F2RI 2D1VA 3UZUA 1GC7A 2XFSA 2NPTB 2VI6A 3FRHA 3RCZA 3S93A 2MFZA 4UDUC 4NSOB 2ECBA 2FBIA 3LJ3A 2HDEA 3CD6I 5EXSA 5KVRA 3MK6A 2GOWA 3QHTA 1R1UA 1NY5A 3KFWX 4DR7M 3E6CC 2DI0A 4XKCA 4S12A 3HWSA 1Z67A 4L9VA 3K1PA 1CJEA 3B9JA 3H9GA 3CC4I 2WU2B 3VB2A 3HIZA 3FMQA 4DYCA 2Z59B 1NK2P 1O3QA 2HI3A 2DO7A 1Y39A 3PNVA 4IBKA 4I98B 5L83A 2YLMA 2FEZA 1NG6A 5KCMA 2X48A 5TJJA 5HOOA 5ICGA 4F7ZA 5IP4D 1Q1OA 3Q9SA 1S3JA 2NBVB 1M4VA 1T08B 1HQYE 3KPHA 4OVVA 3FMRA 3JRFA 3WTYC 2DOFA 1T0YA 3CMAI 3GO5A 3R7QA 1AKHB 2JT1A 2H8WA 1VTNC 2ACZB 4US9A 1UG2A 4PFOA 4LJ4A 4EEWA 3Q3SA 1LVKA 4Z6YA 1WI9A 1V80A 2MLBA 2CKHB 2Y69H 5HDGA 2ZJPF 1FO4A 1UAAA 2VJJA 3FBIB 2BY3A 2W00A 4BL0B 1STEA 5HVQC 1WRDB 2DAFA 3MMYB 2KT7A 1LDDA 2LGYA 2GOMA 1NYRA 2Y0SA 2ZM6M 1B9NA 4W9IA 4XNFA 3DPTA 1IUFA 3GUDA 4ZDPA 1XPXA 1I5ZA 1KA8A 1SC7A 3ZNGC 4NHJA 1RFAA 4AWJA 2N8GA 4KN4X 2KEBA 2CR5A 1ZGJA 2D3CA 3LFKA 1SIFA 1TC3C 1XNQM 4K7UA 5BS6A 3WG7H 2L4FA 2WXRA 1CF7B 1KH0A 5DEQA 2V1YA 4UVAA 1KLVA 3SXYA 1V54H 1YUBA 4F52A 2X1DA 2EIMH 4WXHA 3DQVA 1V55H 3LSJA 4A9AA 1OPCA 3M9AA 1D8KA 2BZTA 4BAXA 3PHXB 1UGJA 1SE2A 3U60A 1TP4A 4MHGA 3KVFB 3Q3FA 3QYFA 2M7BA 2RNGA 4Y28F 3WE3A 2CV1A 1V1PB 1D5ZC 2FNJB 4DBGB 3L2QA 2UWQA 4Y17A 2GBRA 1P6RA 1TWHJ 2IS4A 4ASWC 4HX7A 2OTLI 1WJ6A 3VK8A 2VXZA 4ENMA 1JKQC 1T6BX 3TO9A 2XC7A 4MM3A 4A20A 4ESJA 4Z2YA 3RGPA 1R22A 4ZZDA 1JUSA 3LSMA 4DV2M 2KZGA 4MGRA 3KYCB 1Z6TA 3MTNB 1XSVA 2G4SA 4BY7J 4H2AA 3PNTA 3TIXA 4I02A 3I9V1 3DP7A 1VZ8A 5JZEB 5J6XA 3PIPF 4JYAM 1E10A 2ZTDA 2K25A 3VFDA 2PMZN 2V79A 2QBYB 2V9HA 2UUBM 4ZDOA 5JHBA 4BQOA 3GB1A 1WR1A 3B74A 3J27B 1QBJA 1USSA 2NOJB 3IWZA 3MEXA 3JSOA 5EXTA 1L6VA 3AH7A 4GFBA 1MBKA 5EEAA 5FLVA 2WQYB 3LSKA 4YFKF 2MRPA 4UB6C 4A3DJ 4N58A 4LF6M 5C3JB 3NOBA 2QCUA 1O4XA 2RSUA 3SR6A 4E71A 3J7AO 1KTKA 2NS5A 2JA8J 4YTPB 2LJIA 4I0AA 3BG6A 4WJOA 4E7KA 2VL8A 4D5FA 1GXPA 1SFKA 4IM2A 1M94A 5LHGA 3KQ4A 1JR3E 2W55A 2H1RA 2JRTA 2KLGA 3GTMJ 3LMMA 5IY5H 2CS4A 5J8FA 5M3MJ 1OAIA 4YIRX 5DTDA 2Q2EB 2E1OA 3QA8A 4HSRA 2W7NA 5BPVA 2HKJA 3OY9A 2ZMEC 3CCMI 2X49A 3AEBB 3GPYA 4BQQA 3SAWA 2BHYA 3OYBA 4MTEA 2L7FP 2RDGA 4UHTA 2DDAA 4KGRA 3LCUA 4HRIA 4HPLB 4C4VB 3ENEA 1HTQA 1G4AE 3PZDA 1IXSB 2PEXA 1AHDP 3RQ4A 1G4DA 1GLNA 1LFPA 3NWTA 2W4SA 2I1JA 3H7SA 4YFXF 4AD9A 4HLEA 1G71A 4EJWA 4YSZB 4Y52J 4BE1A 2DZOB 2OEDA 5B1BH 1B8IB 3RSNA 2OTJI 4HSTA 1K78A 2JQ7A 1QZMA 2MJEA 1QZYA 1DP7P 2NR2A 4XGIA 4G94A 3NZUA 2CH0A 3KSXA 3L2CA 1T6SA 1Q1VA 4WCGA 4XLHA 3OJ4B 2INPE 1WXAA 3UIOB 4LLLA 2R18A 3B73A 5CKTA 2A07F 4FE4A 3GP7A 1KU7A 3E3VA 1WHCA 1VZ6A 1VQ8I 3GQ5A 4M0WA 1ZDXA 3HOVJ 2DPDA 3W2VA 1N6ZA 3ZN0A 2WDVB 4K7SA 3D1NI 3LQRA 4YWGG 3OS0A 4YTNB 5DPSA 2LGXA 1N78A 3W5VB 1Z3XA 3T9LA 2DHYA 3IAS1 4OIQF 1ETXA 2LVAA 4FHKA 4DHZB 4M8MA 2Z0EB 5FD5A 3C1DA 3GRRA 1Y8RC 3GE8C 2VE8A 4GO1A 3D5SC 3KH0A 2DT5A 4BDYA 3LB8C 2DAJA 2XKOA 4LFAM 2BVCA 2M3AA 5J18A 2KRHA 1S9HA 1FRRA 2WV1A 2E1MB 2HTME 4HF1A 3GTOJ 8CATA 4I6LB 3SDGA 5KPTA 1VFCA 3CF5F 1J8CA 1PFDA 4W9JA 5F0CA 2YR2A 1IY2A 3SEBA 4LGWA 2M87A 3FXLA 3GRYA 2DN0A 3AG3H 4MO7A 1E9RA 1FXAA 1B9MA 2K4BA 4D7MA 2LK2A 2RAEA 3O8GA 3VXWA 4OZCA 1D5YA 3IG5A 5D94A 1W5CC 2DQRA 3ZXSA 2XF5A 2TCTA 2MH9A 4RAZA 5BPIA 2IBIB 1GKIA 5EDSA 1T33A 5DV5A 3W0FA 1IUEA 2WGSA 3A1QB 2DTRA 2LEKA 4XRFA 4QNMA 3S2DJ 4GIPA 3PUFA 5HDNA 3OSFA 4A0XA 1GPXA 4HDQA 5KHOA 3ZTDA 2ASQA 4DHZE 4B95A 4KIFA 4ANWA 4BBNC 1QPIA 2FOKA 2H09A 4RLFA 3LL7A 2J4XA 4U0WA 4BZAA 1WGXA 2W1OA 3IT6B 4YIIA 4B1RA 1AOYA 4HDOA 4BY1J 2K85A 2JRIB 4FHJA 2ETHA 4B9KA 3KZIC 3EUHA 3TP0A 1U0JA 1HW1A 3V60A 2G0EA 5AEKB 2Z1DA 4FQGA 3MWMA 3U6QA 5LGUA 2CU1A 5EE0A 2XNAC 3RZWC 4OAYA 1YTYA 2LVQA 3FMSA 1LO5D 4L0YB 2AXLA 1C77A 1MMNA 3ZQCA 2ZJRF 4JI4M 5JLWA 2BYEA 4MGKE 1F36A 3J9CA 4U0YA 3V7SA 1TL8A 2Y0MA 2KHWB 5DYIA 4IBCA 3WTSC 4JI6M 3OR1C 1NVID 1EV7A 4PS3A 3V62A 2JYEA 2KFKA 3DPLC 1YIWA 3TJPA 3ELKA 3GLGE 2BY0A 4E7HA 3FTFA 1EUVB
chains in the Genus database with same CATH topology
5C2TB 1XXHA 1GOZA 3ZGZA 3L25A 3VYRB 1RFKA 2UWMA 3AEEB 2Q1ZB 3I4VA 3QAUA 4LFCM 2KZSA 2X6WA 4JOMA 3Q8BA 1NI3A 1ZQ9A 4WIPA 5JI3E 3BYYB 2MABA 2WXPA 5AUKA 4R79A 1FFVA 4DBRA 3PNYA 3R9XB 4GITA 1AA7A 1Z3YA 1JQ4A 4MGYE 2DOAA 3KP1E 4HEA2 3E1SA 2YNMD 3KOWE 1NHWC 2BW2A 2CW8A 2F5OA 1E0ZA 1V5EA 2KXEA 3K4BA 4LIUA 1LDKB 3OWEB 1MU5A 1TY0A 4ZYAA 4GKKM 2DCEA 3TL4X 2E60A 2R7SA 3NVZA 1IN6A 2AHMA 4MB7A 1XEEA 2M5ZA 4X65M 3TSSA 4NSRA 4IBFA 3NWSA 3JR5A 3AL0B 3VK7A 3I51A 1I4GA 4IBJA 4OZAA 1X1CA 4X0GA 4BE0A 3OYMA 2WXFA 4E6KG 2IS6A 1UWXA 4F91B 1P7FA 3KOYE 1QOGA 1SXTA 3VWBA 4P16A 2CFOA 3NRZA 2JXTA 2VIIA 2ZAMA 3OYHA 1PJIA 3CIRB 1K82A 1WJFA 1E6EB 4F93B 4BBAA 2R7RA 4LF4M 2TSSA 1DGFA 4DOZA 2R4EA 1G3IA 2L9NA 3BC8A 4A3VB 3DU6A 2MJ3A 3W2AA 3C2HA 2F5SA 2ZXHA 4U87A 4J00A 2Y20A 2G9HD 4DV7M 4XE0A 3P1MA 2I2YA 3U4EG 1VZ0A 4HG2A 2CS3A 2WA0A 4ZRPA 1MPEA 3PXGA 1DOYA 4B3SM 3Q8CA 3W1SA 3LXFA 1OFIA 5ITTA 3KSJA 4TSSA 3KEYA 4E7JA 4LRTA 4IOIE 2HPIA 4LJAA 3VKHA 1P9QC 1ZAEA 1YSYA 2JVHA 2EKIA 3FAHA 4Y3OA 4ANJA 4Z8XA 4P1WA 5A2QS 2C96A 3ZJVA 2JVGA 2IS2A 1JRPA 3L2RA 3EIHA 1WJCA 4XMYA 1JQJC 4CCNA 4XOTA 1T3TA 1J5EM 3Q8AA 3A45A 1V97A 4N4NB 2IXSA 3C58A 5LMNM 1FJGM 2HDWA 2V1NA 1W5SA 2I7NA 5H8YE 1T0FC 2X51A 4IBDA 2JSPA 4JI3M 2K5CA 2VASA 3AE3B 3AEGB 3GLGA 2AQ3B 4OVZB 2M4GA 4GH9A 2ZBKB 2UUCM 1N60A 2E5ZA 2DVWB 4ZTJA 4N6EB 1D1CA 2WBMA 1D6EC 2BVLA 3DTEA 4C2UA 4DV6M 2R7XA 1TS2A 3HU2A 3U6OA 3A1YA 1N32M 4ZTFA 1TDHA 3GLFB 1X1DA 1TYGB 1OR7C 3GO8A 3OYKA 3U6CA 4YHHM 2QEJC 4GDKB 3K4CA 1SBBB 3QODA 1L5PA 3SMPA 4GLSC 1MNDA 2JA2A 1DOIA 4L2YA 1RM6C 2KMMA 3NVWA 3BIID 3AE1B 3V05A 4AW4A 1IBLM 1L0YB 1SF0A 4JI5M 4DGWB 3PO0A 4BB9A 1C1KA 1P7EA 3OYIA 3RE8A 3CP2A 4C30A 4LITA 4CH7A 1WSPA 1WJBA 4CA0A 3NZ3A 1L8QA 2VZKD 1D4BA 1LV7A 3S3OA 1WJEA 4LG2A 3U5ZA 1JWAD 4PK4A 1BR4A 1QAOA 2XZFA 4J01A 1YMHE 2PW9A 4NXMM 3U6PA 3FUUA 3FDYA 1C79A 4II7A 3M7GA 1NSFA 2MYSA 1XC8A 2XF6A 3CJQB 5D3IB 1E94E 1EM7A 3H35A 2R7TA 1J7BA 1XLOA 3ZCBB 2OV7A 4CSWA 3K92A 5GKNA 5KPZA 2XZUA 4CCLA 1E0EA 1WJDA 3KWLA 4MACA 5I4DA 2B76B 3KXEC 1PDXA 3GP1A 5EXXA 4YT0B 4PSWA 1ZDVA 5HNHA 4G4RA 3Q8FA 4OX9M 1NNUC 3W0LB 2XSZA 4KGTA 2M56B 1OLTA 1XCQL 3U2SC 5HLTA 2JUGA 4DBQA 3THGA 1JMLA 1DOXA 1S3SA 2L7HA 3HJQA 4BDZA 3IT4B 2KRKA 3SEQA 1PUTA 3U61B 1FMAD 3AOGA 2M60A 4NC7A 1UELB 2R4JA 3C2GA 1KSFX 2AX5A 3KYLA 4BUPA 4XLAA 3CMMA 5EP2A 2Z4RA 1NJGA 2ZXIA 2VQHA 1DGHB 1L2CA 2L1AA 5IWAM 2ZW0A 1XLQA 3ZJUA 1MVKA 2FE8A 3KW6A 4LFBM 4PDIA 2JSVX 2VZKB 3AB5A 1I94M 4CCMA 5EE3A 2VQGA 4LJ5A 5FKAC 3IAS2 2HVQA 3D5LA 4LCBA 3E4RA 1MHHE 4L78A 3P4SB 2NQ8C 1R2YA 3BVGA 5BMIA 4AQ7A 3OYJA 4LLGM 5LNK1 2R62A 4MGHA 2Y5PA 1ZUD2 3SYLA 2CMPA 3A42A 4XLCA 3QWLA 4NQWB 4NAMA 2C98A 1JROA 3M8JA 3QYEA 2R65A 2C99A 2KQ4X 4XL9A 1OQQA 2HNHA 4GRIA 3GPXA 3GLFA 3VKGA 1RYJA 2X8AA 3TUOA 1FNNA 4IBIA 1ZELA 1VZ7A 7CATA 1Z59A 1SE3A 3LYYA 2DJIA 3AEAB 2H88B 2CHGA 1FNVA 4JV5M 4JX1C 2IPKD 4G6ZA 4XORA 4M9SA 2Y21A 1JW9D 5HI1A 2UXBM 1HQCA 1D0YA 1SXJD 4XKVA 3UR3C 3HKZA 1LKXA 3AOEA 2QZ4A 3K8ZA 3GLGB 1KF6B 1WJAA 4HJGE 1FFUA 3S32A 3KP0E 3M6AA 3HL2A 3LSHA 2PKOA 1IQPA 1VJKA 2LXEA 4G4OA 2OHFA 1QKZA 4OW0A 4RNAA 1R6RA 1GAQB 1PGBA 5LMUM 4XBOA 1IXZA 1L6UA 1SXJE 3ZJTA 3MHVC 2LHEA 4CZCA 3GRVA 5C18A 2IDYA 5HNFA 2DWLA 1TKYA 2WXMA 1I4HA 2BBCA 2J52A 1EWCA 3L2WA 4Y4RA 2V3NA 1MMAA 4OZBA 2QKMB 4L1BA 1GB4A 4A8XC 1QANA 1ZXIA 3U6SA 4B47A 3SAUA 5BMHA 1QT9A 2WS3B 3DLAA 2KWDA 4D1QA 1ZE3D 1L1TA 3FILA 2BTEA 2VPLA 2WB1A 4IDIA 3SASA 4LRSA 1X1AA 3AJIB 4KJZA 1BUIC 1UUPA 3OOUA 2V1CA 2CHQA 1SSNA 3K4MA 3AE2B 3EUKL 2SAKA 4OWRB 2AQ1B 4ITKA 1QLBB 4N4OB 4X64M 2WY7Q 2Z4SA 2HZDA 5C1BA 2W54A 3VSKA 5TGTA 2A5YB 2HPMA 4DUZM 1K53A 3H9QA 4CISA 3I57A 1NY6A 1OFHA 2KMUA 3HVDA 5GXGB 1NHGC 3CESA 2N0SB 4KO8A 2KRCA 1N62A 2LRDA 4PDGA 1V5GA 2V4JC 2JYTA 3BK2A 4CCOA 3FC4A 3BVZA 3J7AY 2VLAA 2QPAA 1DGRM 2LBFB 3U6EA 3PFYA 3P4PB 4IBBA 3UNGC 1ZPSA 4AKGA 3DPUA 2PJRB 4DR3M 3UGJA 5IZ7D 1MMGA 1CK1A 2BOLA 1R7SA 3RPUD 2QP9X 1YJIA 1MMDA 1ROEA 1NVMA 3SFDB 4DUYM 3T3OA 4FVMA 2ZSIB 5ITYA 4XDCA 1TDZA 2WXOA 1QHHD 3OS2A 2K47A 1UWMA 2BS2B 4DV0M 4EIWA 3Q8XA 5TSSA 4LJ8A 3NS1A 1JI8A 3SHFA 2KLOA 1DO2A 1K3WA 4XWWA 2KAJA 1ZXHA 1SXJC 3Q8EA 2L83A 2MC4A 4FCVA 1NEKB 1IY1A 5H92C 2LOOA 3U5ZB 1TGU