3THGA

Crystal structure of the creosote rubisco activase c-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
PFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic resolution x-ray structure of the substrate recognition domain of higher plant ribulose-bisphosphate carboxylase/oxygenase (Rubisco) activase.
pubmed doi rcsb
source organism Larrea tridentata
molecule tags Protein binding
molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase 1, chlo
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3thgA00
4W5WA 3T15A 3THGA
chains in the Genus database with same CATH superfamily
1I94M 1V34A 3TQSA 4KODA 4M9XA 2KHHA 2YFQA 2HWJA 4M9SA 1R6BX 4K0KM 1L2BA 1QAQA 4LJAA 4G6ZA 4GRIA 3MMPA 4DR3M 2RKOA 2KRKA 3IECA 5EJCA 2L7IA 1HNXM 1WGLA 2F4VM 1UM8A 1Q3CA 5IWAM 3SARA 3IG5A 4PDIA 4AKGA 4DBGB 3GLIE 1GABA 1R2ZA 1N75A 3GPUA 4YY3M 4WW0A 5IT9S 4LFAM 2Y21A 1G8PA 4IBCA 3TPZA 2DVWB 3M0EA 2EUCA 3J81S 3GO8A 1XXHB 2DAGA 1XC8A 2C9CA 2D7HA 2WSEF 3SYKA 4X66M 1ZAEA 4NOOB 1L1TA 2EKKA 3K9OA 4RF1A 2EKFA 1WR1B 1QYRA 4X65M 1PJSA 1G4AE 5FTNA 3GQ4A 2X49A 4EIWA 1G41A 2JWSA 3B7NA 1T3TA 1VEKA 5L8RF 4YHHM 1IBLM 1QDRA 2BJWA 4AZFA 4CISA 1NSFA 4KHPM 4M9ZA 2W82A 2APLA 2L4FA 2R44A 3AOEC 3I4VA 4QHTA 1PJQA 3TWMA 1PJTA 2CFOA 2LVPC 3UK6A 4CGYB 2M60A 4AG6A 4DR1M 3U6LA 1G3IA 4LRSA 4IBDA 3PNVA 2DHRA 1N34M 2KW0A 4P17A 4DR6M 3THGA 2YQZA 2B3TA 2VIIA 4DR5M 3U60A 1DGBA 3HZJA 3J80S 4KO8A 2DAIA 1W5TA 1HQCA 3HJSA 3U6PA 1Y8GA 2DWNA 4HLQA 4IBEA 1IXSA 2H1RA 2KZUA 3UGJA 3B7ZA 3AJIB 1D0LA 2Y20A 5C1BA 3H4MA 4DUYM 5KPZA 2A5YB 4PCZA 1SG9A 5H37D 3U6QA 2UUBM 3D8BA 1NNJA 3B7QA 3ZH9B 4AKHA 4B3RM 3WHKA 1HT2E 3WHLA 3QWLA 1OTRA 5DYIA 3U6MA 1JR3E 1DGGA 3R9XB 2BWEA 2LXEA 1VQ1A 3KSJA 2I7NA 3E21A 2LBCA 4MGIE 4PDGA 3E46A 3H4JA 3SAUA 4LJ8A 3CGWA 2XF3A 4G4RA 2C5RA 2DZNB 1DGHA 1L1ZA 4JI7M 2UXDM 1Z5AA 5FTMA 2R65A 5JI2E 2HCBA 3ILKA 3K1JA 3IHPA 4ANRA 4QOZC 3HKPA 1ORYB 3L26A 1PRBA 1EE8A 4DV6M 2Y0QA 4TUWA 3SATA 3M6AA 5KO3A 4CIZA 3KOYE 3UZUA 3ZCBB 1KFVA 2KRUA 2CP8A 1ZMVA 3NWLA 3GPXA 2UXCM 3GRRA 3GPYA 2G5GX 1IY0A 2D7EA 2ERCA 3KW6A 5EQTA 3DFZA 1G59A 1TH3A 2QENA 2K0BX 2ZM6M 1E94E 2LNHC 2ZTDA 3RFWA 2HKJA 3B9PA 3FYCA 3I01M 2Z8YM 3PXGA 5C18A 4AW4A 4MGHA 2XH9A 4FW9A 4JI3M 5F3WA 4OVZB 3SASA 1QVRA 4JI0M 3UJNA 1MJGM 1D0KA 3E9SA 4JI6M 3GRUA 3GPPA 1DGFA 1OIZA 1XXHA 5JI3E 4BB9A 3MHVC 3E4RA 3TE6A 3KFUG 2C99A 2MJ5B 4AI6A 2ZTCA 4PD2A 2M5ZA 1NJFA 3TWKA 2KDLA 3SHGB 1C1KA 1PGYA 2XFSA 4MGZE 3VK8A 4GMQA 1ZV1A 5GKNA 1I4WA 3KXEC 2CHVA 4FCTA 3W0LB 3U61A 1VDLA 1XXHE 1N36M 1XNRM 4NSRA 4B3MM 4LF4M 3U61B 2FE8A 2J5YA 3JR4A 4AKIA 3FTDA 1HQYE 5EXSA 1LTMA 3KDSE 2L7HA 1IM2A 3W67A 1E9SA 1SXJA 2WSFF 1Q02A 4PT5A 3SAVA 3HJQA 2LVAA 2XEPA 1T6OA 3LCVB 2R45A 3GLFA 3U60B 3FE3A 3A46A 3BBZA 4P16A 2GNOA 4WURA 2OO9A 5ITXA 3VKHA 3V76A 4RNAA 3ZQJA 3VFDA 2MGWA 3C3DA 3HU2A 2YR0A 3L25A 4M0DA 3T38A 3FRIA 3GLIB 3HHZA 2FH0A 2RGHA 4G4NA 4IBIA 1QZMA 2LVQD 3U5ZA 3W0FA 1YLAA 3W68A 2X4AA 1FJGM 2QZ4A 3U6DA 2CV2A 2JY6B 2BWBA 4DUZM 4LF7M 4IBFA 4FWGA 2Z4RA 1QAMA 4NC6A 4JYAM 4GHAA 2EO2A 4LFBM 4L15A 1IBKM 3HHYA 3FRHA 4F1IA 4GHLA 5FTKA 1QDTA 4MH0E 4NL4H 3HHWA 2DZOB 5EP2A 4MB7A 1QZEA 1GKIA 3FUXA 4FD2A 4LGMA 4IBKA 4OU7A 3FUVA 3HU3A 4IBGA 2VQFM 3CF6E 4DR4M 2HHHM 1NVMA 1W5SA 4QOSA 2I7PA 1TH2A 4FWDA 5FSWA 3LMMA 1Q3BA 5LMUM 3J7AS 1P3QQ 1MX0A 2RRUA 2KA6B 4GITA 4XBOA 2P5TA 2EJSA 1IXSB 1J7KA 1WGNA 2JXNA 3EIHA 2UXBM 3HU1A 1R4GA 5E26A 2HAKA 3SMSA 1PJIA 5IZ7D 1IFYA 5EP3A 1LV7A 2JY7A 2DAKA 4JI1M 1GL7A 2MROB 1IN5A 2KEBA 1TR8A 1DO0A 2K9DA 4B08A 3JAMS 1SXJD 1QQWA 4QNMA 3VDUA 2CE7A 4B7FA 2V6ZM 4L6V6 1Z6TA 4L78A 3GQ3A 5EP1A 3I4YA 3VDPA 2YNMD 1R2YA 1ZQ9A 4IJEA 4BLCA 1NNUC 3SMPA 1NY5A 1E32A 4LF9M 2WZJA 2L6OA 2DAMA 4Z6YA 2OQ4A 2JZ0A 4GC5A 4A3VB 3FTEA 2C98A 4HEOA 2K47A 3GLHB 4HL4A 1NV8A 3J7BA 5EP4A 5ITYA 4DR2M 2N35A 4RF0A 4LJ9A 3SFZA 5FTLA 4IBJA 2HL7A 4B3TM 4LF5M 2O25A 1JQJC 1Z5CA 2Y0TA 4LRTA 5EXXA 3L28A 2XFTA 1EFUB 1KSFX 2ZANA 2R4EA 3RGPA 4DV4M 1UFZA 4B3SM 2OOAA 1HNWM 2DI0A 1VEGA 2J7OA 3D8LA 3GRVA 1OIPA 2LVOC 4GKKM 1MN3A 3KP1E 2LVNC 5DFLA 1V92A 3JR5A 4FCVA 4X64M 4OX9M 4OVZA 1TTEA 3LVVA 2CWBA 2Z7JA 4LY6A 4IIWA 4NRVA 2QQ8A 1QUTA 1WXQA 2O01F 3HY5A 3GLFB 1SXJC 4QHSA 2CRUA 3QAUA 4I8OA 2VDBB 3KS4A 3KSXA 3GLGE 2DENA 1IN8A 1JR3D 3GRYA 1G71A 4RKUF 4D82A 1AIPC 4LJ4A 3UMMA 3M7GA 2F5OA 2ZAOA 3LQRA 4JI5M 3SBJA 4REZA 3SC3A 1GL6A 2KXEA 3GLIA 3CF2A 2J7NA 3FUWA 2JUJA 3GQ5A 1IQPA 2ZBKB 3L2AA 2F5QA 3VK7A 2GQFA 1HJPA 1QANA 2QSFX 3CF0A 3FTCA 1XMQM 3FTFA 4DR7M 3A45A 2KNZA 3HWSA 2XGNA 1DO2A 2DWZB 2VF8A 3KP0E 4W5WA 1OJLA 1BVSA 4LZZA 2DNAA 4IJFA 4I4LA 4IBBA 2DWMA 2FNAA 2E5LM 4JI4M 4MM3B 2V1UA 4AG5A 2JNHA 2D7GA 3J2PB 3SAWA 4QNRA 7CATA 2XZUA 3FD9A 2CHGA 3C58A 4I81A 2LHCA 1E9RA 1EIJA 2XSZA 3TL4X 3B74A 2DAEA 1OAOC 2Q2EB 2QBYB 1NHGC 3T1HM 1YUBA 2DZLA 4KT0F 4B7GA 4LJ5A 5LMNM 4L16A 4Z8XA 1YSYA 2QPAA 3C3EA 3K9PA 4G3OA 2Z4SA 1PM5A 2CUZA 1J5EM 3KOXE 1JB0F 2JY8A 2JA2A 4XK8F 4UN2B 2QCUA 2LTUA 3QYBA 1NJGA 4WP2A 2JY5A 1T43A 3U5ZB 2FOIC 5ITXE 1OQYA 3HHXA 1R7RA 5FTJA 3DOAA 4ZPXA 1NO1A 3FKEA 1DV0A 1VG5A 3LQQA 3LCUA 1OFIA 3DA1A 3LVWA 1AUAA 4KLNA 2CHQA 3AOEA 3AFHA 4CHTB 5A2QS 3J27B 4G4OA 4DV7M 1HR0M 2V1CA 2R4JA 4FCWA 1H6UA 3HJ8A 4Q7JA 4B7HA 3OTOM 3F92A 1IN4A 3MJ5A 5BR8M 2K6BA 2QNJA 1KYIA 3I51A 4FVMA 4JV5M 2KNVA 1OFHA 1ZMUA 5KPTA 2CV1A 4DV5M 1TF0B 4DV0M 4Y28F 3AOGA 1QAOA 4GIPA 2XZFA 1N32M 2R0IA 1OKSA 3GLHA 1N77A 2R46A 2BJVA 2MR9A 1SXJE 2DHYA 1F4IA 3L27A 5KQ8A 1K82A 1Z59A 4NSOB 3BOSA 2L4EA 2L2DA 1IY1A 1XMOM 2CV0A 1JR3A 4F2LA 1K3WA 3T15A 3AV0A 2QP9X 1X37A 5BPVA 3BXWA 3I04M 3K92A 3LW5F 2XSZD 4GH9A 4DV1M 3QYEA 2C9OA 1L2DA 1VEJA 4CJ6A 1HT1E 3GLHE 1K3XA 1WHCA 2DKLA 1SXJB 3K2LA 3RGSA 1ZMWA 2R62A 1XB2B 1CUKA 1GJSA 4G4QA 4R71A 4GEWA 2L09A 1IY2A 1A5TA 2G3QA 3NBXX 3SHFA 5DNYA 4L4UA 1IXZA 4D80A 5EXPA 2UU9M 2LWXA 4JN6A 4LZJA 1Z5BA 4L8RC 3A42A 1D0MA 3Q8GA 2MH8A 1S3SA 3C9PA 4ITQA 3KOZE 4MGKE 4DV2M 3PNYA 2LHGA 1QUSA 3KOWE 2RGOA 1C7YA 3EIEA 5ITTA 2DXIA 3PVSA 1GJTA 3U6OA 2BNKA 1OAIA 3U6CA 1IBMM 2JZ1A 3R8FA 1XWIA 4FWHA 5FLXS 1IN7A 1L8QA 1TDZA 1R5LA 3IG8A 3VKGA 5ITUA 3A98B 2LH0A 3Q8XA 1WJ7A 1PJJA 1TDHA 4XGIA 3FUTA 2X8AA 5ITRA 3U6EA 2O5RA 3T6PA 1XNQM 4LJ7A 3VLFB 2VF7A 3L29A 1TH4A 1D2NA 4NXNM 4DV3M 2JP7A 2NQ8C 3B89A 2OPFA 3TWLA 3KVWA 2XLJA 3FYDA 4LJ6A 1J09A 3SYLA 3HX3A 4D81A 2C96A 2OOBA 1IXRC 2KNAA 3HGIA 5KPRA 4X62M 4NXMM 2FFJA 3T1YM 2R6FA 2FS1A 2G8LA 4LCBA 2UUAM 4R7GA 3NBIA 5KQDA 1GO5A 2F5NA 1GLNA 1Q39A 1VDDA 5ITQA 1XHBA 2F5SA 3GLGB 5E6JA 4MGYE 3U6SA 4OW0A 3RE8A 3AL0C 3GLGA 4II7A 1NV9A 1N33M 2DWLA 3KS8A 5IREB 1GVNA 1RU3A 1TGUA 3GLFE 5EXTA 8CATA 4NRWA 3PFIA 1HNZM 4LGYA 1NY6A 4JXJA 2VQEM 4LG2A 2EA0A 2UUCM 4GKJM 1NHWC 4M0WA 3DZDA 1V33A 2AHMA 2ZAMA 4JI8M 4LF8M 2QHOB 1DGHB 4AQYM 2F5PA 2H5XA 4GC9A 5DYGA 3MK6A 4JI2M 1N78A 1WIVA 3FUUA 1YE9A 4LFCM 4R3DA 3GP1A 2QBYA 2WSCF 4S12A 4BBAA 3K8ZA 1IN6A 1L2CA 1FNNA 3ZC7B 2CEAA 4LF6M 3CTWB 4I5SA 2R18A 2Z3XA 1MU5A 2KZSA 3AKZA
chains in the Genus database with same CATH topology
1I94M 3TQSA 4KODA 4M9XA 2YFQA 4M9SA 1R6BX 4K0KM 1L2BA 1QAQA 4LJAA 4G6ZA 4GRIA 4DR3M 2RKOA 2KRKA 5EJCA 2L7IA 1HNXM 2F4VM 1UM8A 1Q3CA 5IWAM 3SARA 3IG5A 4PDIA 4AKGA 1R2ZA 1N75A 3GPUA 4YY3M 4WW0A 5IT9S 4LFAM 2Y21A 1G8PA 4IBCA 3TPZA 2DVWB 3M0EA 2EUCA 3J81S 3GO8A 1XXHB 1XC8A 2C9CA 2D7HA 3SYKA 4X66M 1ZAEA 4NOOB 1L1TA 4RF1A 1QYRA 4X65M 1G4AE 5FTNA 3GQ4A 2X49A 4EIWA 1G41A 1T3TA 4CISA 4YHHM 1IBLM 4AZFA 2BJWA 1NSFA 4KHPM 4M9ZA 2W82A 3I4VA 3AOEC 4QHTA 3TWMA 2CFOA 3UK6A 4CGYB 2M60A 4AG6A 4DR1M 3U6LA 1G3IA 4LRSA 4IBDA 3PNVA 2DHRA 1N34M 2KW0A 4DR6M 3THGA 2YQZA 2VIIA 4DR5M 3U60A 1DGBA 3J80S 4KO8A 1W5TA 1HQCA 3HJSA 3U6PA 2DWNA 4HLQA 4IBEA 2H1RA 2KZUA 3UGJA 3AJIB 2Y20A 5C1BA 3H4MA 4DUYM 5KPZA 2A5YB 4PCZA 5H37D 3U6QA 2UUBM 3D8BA 1NNJA 3ZH9B 4AKHA 4B3RM 3WHKA 1HT2E 3WHLA 3QWLA 5DYIA 3U6MA 1DGGA 3R9XB 4MGIE 2LXEA 3KSJA 2I7NA 4PDGA 3SAUA 4LJ8A 2C5RA 2XF3A 4G4RA 2DZNB 1DGHA 1L1ZA 4JI7M 2UXDM 1Z5AA 5FTMA 2R65A 5JI2E 2HCBA 3ILKA 3K1JA 4QOZC 3HKPA 1ORYB 3L26A 1EE8A 4DV6M 2Y0QA 4TUWA 3SATA 3M6AA 5KO3A 3KOYE 3UZUA 3ZCBB 1KFVA 2KRUA 3NWLA 3GPXA 2UXCM 3GRRA 3GPYA 2G5GX 1IY0A 2D7EA 2ERCA 3KW6A 5EQTA 3DFZA 1G59A 1TH3A 2QENA 2ZM6M 1E94E 2LNHC 3RFWA 2HKJA 3B9PA 3FYCA 3PXGA 5C18A 4AW4A 4MGHA 2XH9A 4FW9A 4JI3M 5F3WA 4OVZB 3SASA 1QVRA 4JI0M 3UJNA 3E9SA 4JI6M 3GRUA 3GPPA 1DGFA 1XXHA 5JI3E 4BB9A 3MHVC 3E4RA 3TE6A 3KFUG 2C99A 4AI6A 4PD2A 2M5ZA 1NJFA 3TWKA 3SHGB 1C1KA 2XFSA 4MGZE 3VK8A 4GMQA 5GKNA 1I4WA 3KXEC 2CHVA 4FCTA 3W0LB 3U61A 1XNRM 1N36M 4NSRA 4B3MM 4LF4M 3U61B 2FE8A 3JR4A 4AKIA 3FTDA 1HQYE 5EXSA 3KDSE 2L7HA 1IM2A 1E9SA 1SXJA 4PT5A 3SAVA 3HJQA 2XEPA 2R45A 3GLFA 3U60B 3A46A 4P16A 4WURA 5ITXA 3VKHA 4RNAA 3VFDA 3HU2A 2YR0A 3L25A 4M0DA 3T38A 3GLIB 3HHZA 2RGHA 4G4NA 4IBIA 1QZMA 3U5ZA 3W0FA 2X4AA 1FJGM 2QZ4A 3U6DA 2CV2A 4DUZM 4LF7M 4IBFA 4FWGA 2Z4RA 1QAMA 4JYAM 4LFBM 2EO2A 4L15A 1IBKM 3HHYA 4GHLA 5FTKA 4MH0E 4NL4H 3HHWA 2DZOB 5EP2A 4MB7A 3FUXA 1GKIA 4FD2A 4LGMA 4OU7A 4IBKA 4GHAA 3FUVA 3HU3A 4IBGA 2VQFM 3CF6E 4DR4M 2HHHM 1NVMA 1W5SA 4QOSA 2I7PA 1TH2A 4FWDA 5FSWA 3LMMA 1Q3BA 5LMUM 3J7AS 1MX0A 2KA6B 4GITA 4XBOA 2P5TA 1IXSB 1J7KA 3EIHA 2UXBM 3HU1A 5E26A 3SMSA 1PJIA 5IZ7D 5EP3A 1LV7A 4JI1M 1GL7A 1IN5A 2KEBA 1DO0A 4B08A 3JAMS 1SXJD 1QQWA 4QNMA 3VDUA 2CE7A 4B7FA 2V6ZM 4L78A 1Z6TA 3GQ3A 5EP1A 3I4YA 3VDPA 2YNMD 1R2YA 1ZQ9A 4IJEA 4BLCA 1NNUC 3SMPA 1NY5A 1E32A 4LF9M 2L6OA 4Z6YA 2OQ4A 4GC5A 4A3VB 3FTEA 2C98A 2K47A 3GLHB 4HL4A 3J7BA 5EP4A 5ITYA 4DR2M 4RF0A 4LJ9A 3SFZA 5FTLA 4IBJA 2HL7A 4B3TM 4LF5M 1JQJC 1Z5CA 2Y0TA 4LRTA 5EXXA 3L28A 2XFTA 1KSFX 2ZANA 2R4EA 3RGPA 4DV4M 4B3SM 1HNWM 2J7OA 3D8LA 3GRVA 4GKKM 3KP1E 3JR5A 4FCVA 4X64M 4OX9M 4OVZA 3LVVA 2Z7JA 4LY6A 4IIWA 4NRVA 1WXQA 3GLFB 1SXJC 4QHSA 3QAUA 4I8OA 3KS4A 3KSXA 1IN8A 1JR3D 3GRYA 4D82A 4LJ4A 3UMMA 2F5OA 3M7GA 4JI5M 2ZAOA 3LQRA 3SBJA 4REZA 3SC3A 1GL6A 2KXEA 3GLIA 3CF2A 2J7NA 3FUWA 3GQ5A 1IQPA 2ZBKB 3L2AA 2F5QA 3VK7A 3CF0A 1QANA 3FTCA 1XMQM 3FTFA 4DR7M 3A45A 3HWSA 2XGNA 1DO2A 2DWZB 3KP0E 4W5WA 1OJLA 4LZZA 2E5LM 4IJFA 4I4LA 4IBBA 2DWMA 2FNAA 4JI4M 4MM3B 2V1UA 4AG5A 2D7GA 3J2PB 3SAWA 4QNRA 7CATA 2XZUA 3FD9A 2CHGA 3C58A 4I81A 1E9RA 2XSZA 3TL4X 2QBYB 2Q2EB 1NHGC 3T1HM 1YUBA 4B7GA 4LJ5A 5LMNM 4L16A 4Z8XA 1YSYA 2QPAA 2Z4SA 1PM5A 2CUZA 1J5EM 3KOXE 2JA2A 2QCUA 1NJGA 3U5ZB 2FOIC 5ITXE 3HHXA 1R7RA 5FTJA 3DOAA 4ZPXA 3FKEA 3LQQA 1OFIA 3DA1A 3LVWA 4KLNA 4CHTB 2CHQA 3AOEA 3AFHA 5A2QS 4G4OA 3J27B 4DV7M 1HR0M 2V1CA 2R4JA 4FCWA 1H6UA 3HJ8A 4B7HA 3OTOM 1IN4A 3MJ5A 5BR8M 3I51A 1KYIA 4JV5M 4FVMA 1OFHA 5KPTA 2CV1A 4DV5M 4DV0M 3AOGA 1QAOA 4GIPA 2XZFA 1N32M 3GLHA 1N77A 2R46A 2BJVA 1SXJE 3L27A 5KQ8A 1K82A 1Z59A 4NSOB 3BOSA 1XMOM 1IY1A 2CV0A 1JR3A 1K3WA 3T15A 3AV0A 2QP9X 1X37A 5BPVA 3K92A 4GH9A 2XSZD 4DV1M 2C9OA 1L2DA 1HT1E 1K3XA 1SXJB 3K2LA 3RGSA 2R62A 4G4QA 2L09A 1IY2A 3SHFA 5DNYA 4L4UA 1IXZA 4D80A 5EXPA 2UU9M 2LWXA 4JN6A 4LZJA 1Z5BA 4L8RC 3A42A 1S3SA 4ITQA 3KOZE 4MGKE 4DV2M 3PNYA 3KOWE 2RGOA 3EIEA 5ITTA 2DXIA 3PVSA 3U6OA 2BNKA 3U6CA 1IBMM 3R8FA 1XWIA 4FWHA 5FLXS 1IN7A 1L8QA 1TDZA 3IG8A 3VKGA 5ITUA 3A98B 2LH0A 3Q8XA 1PJJA 1TDHA 4XGIA 3FUTA 2X8AA 5ITRA 3U6EA 2O5RA 1XNQM 4LJ7A 3VLFB 3L29A 1TH4A 1D2NA 4NXNM 4DV3M 2NQ8C 2OPFA 3TWLA 3KVWA 2XLJA 3FYDA 4LJ6A 1J09A 3SYLA 4D81A 2C96A 1IXRC 3HGIA 5KPRA 4X62M 4NXMM 2FFJA 3T1YM 2G8LA 4LCBA 2UUAM 4R7GA 3NBIA 5KQDA 2F5NA 1GLNA 1Q39A 1VDDA 5ITQA 1XHBA 2F5SA 3GLGB 5E6JA 4MGYE 3U6SA 4OW0A 3RE8A 3AL0C 3GLGA 4II7A 1N33M 2DWLA 3KS8A 5IREB 1GVNA 1TGUA 5EXTA 8CATA 4NRWA 3PFIA 1HNZM 4LGYA 1NY6A 4JXJA 2VQEM 4LG2A 2EA0A 2UUCM 4GKJM 1NHWC 4M0WA 3DZDA 2AHMA 4JI8M 2ZAMA 4LF8M 1DGHB 4AQYM 2F5PA 4GC9A 5DYGA 3MK6A 4JI2M 1N78A 3FUUA 1YE9A 4LFCM 4R3DA 3GP1A 2QBYA 4S12A 4BBAA 3K8ZA 1IN6A 1L2CA 1FNNA 3ZC7B 2CEAA 4LF6M 3CTWB 4I5SA 2R18A 2Z3XA 1MU5A 2KZSA 3AKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5W A;  3T15 A;  3THG A; 
#chains in the Genus database with same CATH topology
 1I94 M;  1V34 A;  3TQS A;  4KOD A;  4M9X A;  2KHH A;  2YFQ A;  2HWJ A;  4M9S A;  1R6B X;  4K0K M;  1L2B A;  1QAQ A;  4LJA A;  4G6Z A;  4GRI A;  3MMP A;  4DR3 M;  2RKO A;  2KRK A;  3IEC A;  5EJC A;  2L7I A;  1HNX M;  1WGL A;  2F4V M;  1UM8 A;  1Q3C A;  5IWA M;  3SAR A;  3IG5 A;  4PDI A;  4AKG A;  4DBG B;  3GLI E;  1GAB A;  1R2Z A;  1N75 A;  3GPU A;  4YY3 M;  4WW0 A;  5IT9 S;  4LFA M;  2Y21 A;  1G8P A;  4IBC A;  3TPZ A;  2DVW B;  3M0E A;  2EUC A;  3J81 S;  3GO8 A;  1XXH B;  2DAG A;  1XC8 A;  2C9C A;  2D7H A;  2WSE F;  3SYK A;  4X66 M;  1ZAE A;  4NOO B;  1L1T A;  2EKK A;  3K9O A;  4RF1 A;  2EKF A;  1WR1 B;  1QYR A;  4X65 M;  1PJS A;  1G4A E;  5FTN A;  3GQ4 A;  2X49 A;  4EIW A;  1G41 A;  2JWS A;  3B7N A;  1T3T A;  1VEK A;  5L8R F;  4YHH M;  1IBL M;  1QDR A;  2BJW A;  4AZF A;  4CIS A;  1NSF A;  4KHP M;  4M9Z A;  2W82 A;  2APL A;  2L4F A;  2R44 A;  3AOE C;  3I4V A;  4QHT A;  1PJQ A;  3TWM A;  1PJT A;  2CFO A;  2LVP C;  3UK6 A;  4CGY B;  2M60 A;  4AG6 A;  4DR1 M;  3U6L A;  1G3I A;  4LRS A;  4IBD A;  3PNV A;  2DHR A;  1N34 M;  2KW0 A;  4P17 A;  4DR6 M;  3THG A;  2YQZ A;  2B3T A;  2VII A;  4DR5 M;  3U60 A;  1DGB A;  3HZJ A;  3J80 S;  4KO8 A;  2DAI A;  1W5T A;  1HQC A;  3HJS A;  3U6P A;  1Y8G A;  2DWN A;  4HLQ A;  4IBE A;  1IXS A;  2H1R A;  2KZU A;  3UGJ A;  3B7Z A;  3AJI B;  1D0L A;  2Y20 A;  5C1B A;  3H4M A;  4DUY M;  5KPZ A;  2A5Y B;  4PCZ A;  1SG9 A;  5H37 D;  3U6Q A;  2UUB M;  3D8B A;  1NNJ A;  3B7Q A;  3ZH9 B;  4AKH A;  4B3R M;  3WHK A;  1HT2 E;  3WHL A;  3QWL A;  1OTR A;  5DYI A;  3U6M A;  1JR3 E;  1DGG A;  3R9X B;  2BWE A;  2LXE A;  1VQ1 A;  3KSJ A;  2I7N A;  3E21 A;  2LBC A;  4MGI E;  4PDG A;  3E46 A;  3H4J A;  3SAU A;  4LJ8 A;  3CGW A;  2XF3 A;  4G4R A;  2C5R A;  2DZN B;  1DGH A;  1L1Z A;  4JI7 M;  2UXD M;  1Z5A A;  5FTM A;  2R65 A;  5JI2 E;  2HCB A;  3ILK A;  3K1J A;  3IHP A;  4ANR A;  4QOZ C;  3HKP A;  1ORY B;  3L26 A;  1PRB A;  1EE8 A;  4DV6 M;  2Y0Q A;  4TUW A;  3SAT A;  3M6A A;  5KO3 A;  4CIZ A;  3KOY E;  3UZU A;  3ZCB B;  1KFV A;  2KRU A;  2CP8 A;  1ZMV A;  3NWL A;  3GPX A;  2UXC M;  3GRR A;  3GPY A;  2G5G X;  1IY0 A;  2D7E A;  2ERC A;  3KW6 A;  5EQT A;  3DFZ A;  1G59 A;  1TH3 A;  2QEN A;  2K0B X;  2ZM6 M;  1E94 E;  2LNH C;  2ZTD A;  3RFW A;  2HKJ A;  3B9P A;  3FYC A;  3I01 M;  2Z8Y M;  3PXG A;  5C18 A;  4AW4 A;  4MGH A;  2XH9 A;  4FW9 A;  4JI3 M;  5F3W A;  4OVZ B;  3SAS A;  1QVR A;  4JI0 M;  3UJN A;  1MJG M;  1D0K A;  3E9S A;  4JI6 M;  3GRU A;  3GPP A;  1DGF A;  1OIZ A;  1XXH A;  5JI3 E;  4BB9 A;  3MHV C;  3E4R A;  3TE6 A;  3KFU G;  2C99 A;  2MJ5 B;  4AI6 A;  2ZTC A;  4PD2 A;  2M5Z A;  1NJF A;  3TWK A;  2KDL A;  3SHG B;  1C1K A;  1PGY A;  2XFS A;  4MGZ E;  3VK8 A;  4GMQ A;  1ZV1 A;  5GKN A;  1I4W A;  3KXE C;  2CHV A;  4FCT A;  3W0L B;  3U61 A;  1VDL A;  1XXH E;  1N36 M;  1XNR M;  4NSR A;  4B3M M;  4LF4 M;  3U61 B;  2FE8 A;  2J5Y A;  3JR4 A;  4AKI A;  3FTD A;  1HQY E;  5EXS A;  1LTM A;  3KDS E;  2L7H A;  1IM2 A;  3W67 A;  1E9S A;  1SXJ A;  2WSF F;  1Q02 A;  4PT5 A;  3SAV A;  3HJQ A;  2LVA A;  2XEP A;  1T6O A;  3LCV B;  2R45 A;  3GLF A;  3U60 B;  3FE3 A;  3A46 A;  3BBZ A;  4P16 A;  2GNO A;  4WUR A;  2OO9 A;  5ITX A;  3VKH A;  3V76 A;  4RNA A;  3ZQJ A;  3VFD A;  2MGW A;  3C3D A;  3HU2 A;  2YR0 A;  3L25 A;  4M0D A;  3T38 A;  3FRI A;  3GLI B;  3HHZ A;  2FH0 A;  2RGH A;  4G4N A;  4IBI A;  1QZM A;  2LVQ D;  3U5Z A;  3W0F A;  1YLA A;  3W68 A;  2X4A A;  1FJG M;  2QZ4 A;  3U6D A;  2CV2 A;  2JY6 B;  2BWB A;  4DUZ M;  4LF7 M;  4IBF A;  4FWG A;  2Z4R A;  1QAM A;  4NC6 A;  4JYA M;  4GHA A;  2EO2 A;  4LFB M;  4L15 A;  1IBK M;  3HHY A;  3FRH A;  4F1I A;  4GHL A;  5FTK A;  1QDT A;  4MH0 E;  4NL4 H;  3HHW A;  2DZO B;  5EP2 A;  4MB7 A;  1QZE A;  1GKI A;  3FUX A;  4FD2 A;  4LGM A;  4IBK A;  4OU7 A;  3FUV A;  3HU3 A;  4IBG A;  2VQF M;  3CF6 E;  4DR4 M;  2HHH M;  1NVM A;  1W5S A;  4QOS A;  2I7P A;  1TH2 A;  4FWD A;  5FSW A;  3LMM A;  1Q3B A;  5LMU M;  3J7A S;  1P3Q Q;  1MX0 A;  2RRU A;  2KA6 B;  4GIT A;  4XBO A;  2P5T A;  2EJS A;  1IXS B;  1J7K A;  1WGN A;  2JXN A;  3EIH A;  2UXB M;  3HU1 A;  1R4G A;  5E26 A;  2HAK A;  3SMS A;  1PJI A;  5IZ7 D;  1IFY A;  5EP3 A;  1LV7 A;  2JY7 A;  2DAK A;  4JI1 M;  1GL7 A;  2MRO B;  1IN5 A;  2KEB A;  1TR8 A;  1DO0 A;  2K9D A;  4B08 A;  3JAM S;  1SXJ D;  1QQW A;  4QNM A;  3VDU A;  2CE7 A;  4B7F A;  2V6Z M;  4L6V 6;  1Z6T A;  4L78 A;  3GQ3 A;  5EP1 A;  3I4Y A;  3VDP A;  2YNM D;  1R2Y A;  1ZQ9 A;  4IJE A;  4BLC A;  1NNU C;  3SMP A;  1NY5 A;  1E32 A;  4LF9 M;  2WZJ A;  2L6O A;  2DAM A;  4Z6Y A;  2OQ4 A;  2JZ0 A;  4GC5 A;  4A3V B;  3FTE A;  2C98 A;  4HEO A;  2K47 A;  3GLH B;  4HL4 A;  1NV8 A;  3J7B A;  5EP4 A;  5ITY A;  4DR2 M;  2N35 A;  4RF0 A;  4LJ9 A;  3SFZ A;  5FTL A;  4IBJ A;  2HL7 A;  4B3T M;  4LF5 M;  2O25 A;  1JQJ C;  1Z5C A;  2Y0T A;  4LRT A;  5EXX A;  3L28 A;  2XFT A;  1EFU B;  1KSF X;  2ZAN A;  2R4E A;  3RGP A;  4DV4 M;  1UFZ A;  4B3S M;  2OOA A;  1HNW M;  2DI0 A;  1VEG A;  2J7O A;  3D8L A;  3GRV A;  1OIP A;  2LVO C;  4GKK M;  1MN3 A;  3KP1 E;  2LVN C;  5DFL A;  1V92 A;  3JR5 A;  4FCV A;  4X64 M;  4OX9 M;  4OVZ A;  1TTE A;  3LVV A;  2CWB A;  2Z7J A;  4LY6 A;  4IIW A;  4NRV A;  2QQ8 A;  1QUT A;  1WXQ A;  2O01 F;  3HY5 A;  3GLF B;  1SXJ C;  4QHS A;  2CRU A;  3QAU A;  4I8O A;  2VDB B;  3KS4 A;  3KSX A;  3GLG E;  2DEN A;  1IN8 A;  1JR3 D;  3GRY A;  1G71 A;  4RKU F;  4D82 A;  1AIP C;  4LJ4 A;  3UMM A;  3M7G A;  2F5O A;  2ZAO A;  3LQR A;  4JI5 M;  3SBJ A;  4REZ A;  3SC3 A;  1GL6 A;  2KXE A;  3GLI A;  3CF2 A;  2J7N A;  3FUW A;  2JUJ A;  3GQ5 A;  1IQP A;  2ZBK B;  3L2A A;  2F5Q A;  3VK7 A;  2GQF A;  1HJP A;  1QAN A;  2QSF X;  3CF0 A;  3FTC A;  1XMQ M;  3FTF A;  4DR7 M;  3A45 A;  2KNZ A;  3HWS A;  2XGN A;  1DO2 A;  2DWZ B;  2VF8 A;  3KP0 E;  4W5W A;  1OJL A;  1BVS A;  4LZZ A;  2DNA A;  4IJF A;  4I4L A;  4IBB A;  2DWM A;  2FNA A;  2E5L M;  4JI4 M;  4MM3 B;  2V1U A;  4AG5 A;  2JNH A;  2D7G A;  3J2P B;  3SAW A;  4QNR A;  7CAT A;  2XZU A;  3FD9 A;  2CHG A;  3C58 A;  4I81 A;  2LHC A;  1E9R A;  1EIJ A;  2XSZ A;  3TL4 X;  3B74 A;  2DAE A;  1OAO C;  2Q2E B;  2QBY B;  1NHG C;  3T1H M;  1YUB A;  2DZL A;  4KT0 F;  4B7G A;  4LJ5 A;  5LMN M;  4L16 A;  4Z8X A;  1YSY A;  2QPA A;  3C3E A;  3K9P A;  4G3O A;  2Z4S A;  1PM5 A;  2CUZ A;  1J5E M;  3KOX E;  1JB0 F;  2JY8 A;  2JA2 A;  4XK8 F;  4UN2 B;  2QCU A;  2LTU A;  3QYB A;  1NJG A;  4WP2 A;  2JY5 A;  1T43 A;  3U5Z B;  2FOI C;  5ITX E;  1OQY A;  3HHX A;  1R7R A;  5FTJ A;  3DOA A;  4ZPX A;  1NO1 A;  3FKE A;  1DV0 A;  1VG5 A;  3LQQ A;  3LCU A;  1OFI A;  3DA1 A;  3LVW A;  1AUA A;  4KLN A;  2CHQ A;  3AOE A;  3AFH A;  4CHT B;  5A2Q S;  3J27 B;  4G4O A;  4DV7 M;  1HR0 M;  2V1C A;  2R4J A;  4FCW A;  1H6U A;  3HJ8 A;  4Q7J A;  4B7H A;  3OTO M;  3F92 A;  1IN4 A;  3MJ5 A;  5BR8 M;  2K6B A;  2QNJ A;  1KYI A;  3I51 A;  4FVM A;  4JV5 M;  2KNV A;  1OFH A;  1ZMU A;  5KPT A;  2CV1 A;  4DV5 M;  1TF0 B;  4DV0 M;  4Y28 F;  3AOG A;  1QAO A;  4GIP A;  2XZF A;  1N32 M;  2R0I A;  1OKS A;  3GLH A;  1N77 A;  2R46 A;  2BJV A;  2MR9 A;  1SXJ E;  2DHY A;  1F4I A;  3L27 A;  5KQ8 A;  1K82 A;  1Z59 A;  4NSO B;  3BOS A;  2L4E A;  2L2D A;  1IY1 A;  1XMO M;  2CV0 A;  1JR3 A;  4F2L A;  1K3W A;  3T15 A;  3AV0 A;  2QP9 X;  1X37 A;  5BPV A;  3BXW A;  3I04 M;  3K92 A;  3LW5 F;  2XSZ D;  4GH9 A;  4DV1 M;  3QYE A;  2C9O A;  1L2D A;  1VEJ A;  4CJ6 A;  1HT1 E;  3GLH E;  1K3X A;  1WHC A;  2DKL A;  1SXJ B;  3K2L A;  3RGS A;  1ZMW A;  2R62 A;  1XB2 B;  1CUK A;  1GJS A;  4G4Q A;  4R71 A;  4GEW A;  2L09 A;  1IY2 A;  1A5T A;  2G3Q A;  3NBX X;  3SHF A;  5DNY A;  4L4U A;  1IXZ A;  4D80 A;  5EXP A;  2UU9 M;  2LWX A;  4JN6 A;  4LZJ A;  1Z5B A;  4L8R C;  3A42 A;  1D0M A;  3Q8G A;  2MH8 A;  1S3S A;  3C9P A;  4ITQ A;  3KOZ E;  4MGK E;  4DV2 M;  3PNY A;  2LHG A;  1QUS A;  3KOW E;  2RGO A;  1C7Y A;  3EIE A;  5ITT A;  2DXI A;  3PVS A;  1GJT A;  3U6O A;  2BNK A;  1OAI A;  3U6C A;  1IBM M;  2JZ1 A;  3R8F A;  1XWI A;  4FWH A;  5FLX S;  1IN7 A;  1L8Q A;  1TDZ A;  1R5L A;  3IG8 A;  3VKG A;  5ITU A;  3A98 B;  2LH0 A;  3Q8X A;  1WJ7 A;  1PJJ A;  1TDH A;  4XGI A;  3FUT A;  2X8A A;  5ITR A;  3U6E A;  2O5R A;  3T6P A;  1XNQ M;  4LJ7 A;  3VLF B;  2VF7 A;  3L29 A;  1TH4 A;  1D2N A;  4NXN M;  4DV3 M;  2JP7 A;  2NQ8 C;  3B89 A;  2OPF A;  3TWL A;  3KVW A;  2XLJ A;  3FYD A;  4LJ6 A;  1J09 A;  3SYL A;  3HX3 A;  4D81 A;  2C96 A;  2OOB A;  1IXR C;  2KNA A;  3HGI A;  5KPR A;  4X62 M;  4NXM M;  2FFJ A;  3T1Y M;  2R6F A;  2FS1 A;  2G8L A;  4LCB A;  2UUA M;  4R7G A;  3NBI A;  5KQD A;  1GO5 A;  2F5N A;  1GLN A;  1Q39 A;  1VDD A;  5ITQ A;  1XHB A;  2F5S A;  3GLG B;  5E6J A;  4MGY E;  3U6S A;  4OW0 A;  3RE8 A;  3AL0 C;  3GLG A;  4II7 A;  1NV9 A;  1N33 M;  2DWL A;  3KS8 A;  5IRE B;  1GVN A;  1RU3 A;  1TGU A;  3GLF E;  5EXT A;  8CAT A;  4NRW A;  3PFI A;  1HNZ M;  4LGY A;  1NY6 A;  4JXJ A;  2VQE M;  4LG2 A;  2EA0 A;  2UUC M;  4GKJ M;  1NHW C;  4M0W A;  3DZD A;  1V33 A;  2AHM A;  2ZAM A;  4JI8 M;  4LF8 M;  2QHO B;  1DGH B;  4AQY M;  2F5P A;  2H5X A;  4GC9 A;  5DYG A;  3MK6 A;  4JI2 M;  1N78 A;  1WIV A;  3FUU A;  1YE9 A;  4LFC M;  4R3D A;  3GP1 A;  2QBY A;  2WSC F;  4S12 A;  4BBA A;  3K8Z A;  1IN6 A;  1L2C A;  1FNN A;  3ZC7 B;  2CEA A;  4LF6 M;  3CTW B;  4I5S A;  2R18 A;  2Z3X A;  1MU5 A;  2KZS A;  3AKZ A; 
#chains in the Genus database with same CATH homology
 1I94 M;  3TQS A;  4KOD A;  4M9X A;  2YFQ A;  4M9S A;  1R6B X;  4K0K M;  1L2B A;  1QAQ A;  4LJA A;  4G6Z A;  4GRI A;  4DR3 M;  2RKO A;  2KRK A;  5EJC A;  2L7I A;  1HNX M;  2F4V M;  1UM8 A;  1Q3C A;  5IWA M;  3SAR A;  3IG5 A;  4PDI A;  4AKG A;  1R2Z A;  1N75 A;  3GPU A;  4YY3 M;  4WW0 A;  5IT9 S;  4LFA M;  2Y21 A;  1G8P A;  4IBC A;  3TPZ A;  2DVW B;  3M0E A;  2EUC A;  3J81 S;  3GO8 A;  1XXH B;  1XC8 A;  2C9C A;  2D7H A;  3SYK A;  4X66 M;  1ZAE A;  4NOO B;  1L1T A;  4RF1 A;  1QYR A;  4X65 M;  1G4A E;  5FTN A;  3GQ4 A;  2X49 A;  4EIW A;  1G41 A;  1T3T A;  4CIS A;  4YHH M;  1IBL M;  4AZF A;  2BJW A;  1NSF A;  4KHP M;  4M9Z A;  2W82 A;  3I4V A;  3AOE C;  4QHT A;  3TWM A;  2CFO A;  3UK6 A;  4CGY B;  2M60 A;  4AG6 A;  4DR1 M;  3U6L A;  1G3I A;  4LRS A;  4IBD A;  3PNV A;  2DHR A;  1N34 M;  2KW0 A;  4DR6 M;  3THG A;  2YQZ A;  2VII A;  4DR5 M;  3U60 A;  1DGB A;  3J80 S;  4KO8 A;  1W5T A;  1HQC A;  3HJS A;  3U6P A;  2DWN A;  4HLQ A;  4IBE A;  2H1R A;  2KZU A;  3UGJ A;  3AJI B;  2Y20 A;  5C1B A;  3H4M A;  4DUY M;  5KPZ A;  2A5Y B;  4PCZ A;  5H37 D;  3U6Q A;  2UUB M;  3D8B A;  1NNJ A;  3ZH9 B;  4AKH A;  4B3R M;  3WHK A;  1HT2 E;  3WHL A;  3QWL A;  5DYI A;  3U6M A;  1DGG A;  3R9X B;  4MGI E;  2LXE A;  3KSJ A;  2I7N A;  4PDG A;  3SAU A;  4LJ8 A;  2C5R A;  2XF3 A;  4G4R A;  2DZN B;  1DGH A;  1L1Z A;  4JI7 M;  2UXD M;  1Z5A A;  5FTM A;  2R65 A;  5JI2 E;  2HCB A;  3ILK A;  3K1J A;  4QOZ C;  3HKP A;  1ORY B;  3L26 A;  1EE8 A;  4DV6 M;  2Y0Q A;  4TUW A;  3SAT A;  3M6A A;  5KO3 A;  3KOY E;  3UZU A;  3ZCB B;  1KFV A;  2KRU A;  3NWL A;  3GPX A;  2UXC M;  3GRR A;  3GPY A;  2G5G X;  1IY0 A;  2D7E A;  2ERC A;  3KW6 A;  5EQT A;  3DFZ A;  1G59 A;  1TH3 A;  2QEN A;  2ZM6 M;  1E94 E;  2LNH C;  3RFW A;  2HKJ A;  3B9P A;  3FYC A;  3PXG A;  5C18 A;  4AW4 A;  4MGH A;  2XH9 A;  4FW9 A;  4JI3 M;  5F3W A;  4OVZ B;  3SAS A;  1QVR A;  4JI0 M;  3UJN A;  3E9S A;  4JI6 M;  3GRU A;  3GPP A;  1DGF A;  1XXH A;  5JI3 E;  4BB9 A;  3MHV C;  3E4R A;  3TE6 A;  3KFU G;  2C99 A;  4AI6 A;  4PD2 A;  2M5Z A;  1NJF A;  3TWK A;  3SHG B;  1C1K A;  2XFS A;  4MGZ E;  3VK8 A;  4GMQ A;  5GKN A;  1I4W A;  3KXE C;  2CHV A;  4FCT A;  3W0L B;  3U61 A;  1XNR M;  1N36 M;  4NSR A;  4B3M M;  4LF4 M;  3U61 B;  2FE8 A;  3JR4 A;  4AKI A;  3FTD A;  1HQY E;  5EXS A;  3KDS E;  2L7H A;  1IM2 A;  1E9S A;  1SXJ A;  4PT5 A;  3SAV A;  3HJQ A;  2XEP A;  2R45 A;  3GLF A;  3U60 B;  3A46 A;  4P16 A;  4WUR A;  5ITX A;  3VKH A;  4RNA A;  3VFD A;  3HU2 A;  2YR0 A;  3L25 A;  4M0D A;  3T38 A;  3GLI B;  3HHZ A;  2RGH A;  4G4N A;  4IBI A;  1QZM A;  3U5Z A;  3W0F A;  2X4A A;  1FJG M;  2QZ4 A;  3U6D A;  2CV2 A;  4DUZ M;  4LF7 M;  4IBF A;  4FWG A;  2Z4R A;  1QAM A;  4JYA M;  4LFB M;  2EO2 A;  4L15 A;  1IBK M;  3HHY A;  4GHL A;  5FTK A;  4MH0 E;  4NL4 H;  3HHW A;  2DZO B;  5EP2 A;  4MB7 A;  3FUX A;  1GKI A;  4FD2 A;  4LGM A;  4OU7 A;  4IBK A;  4GHA A;  3FUV A;  3HU3 A;  4IBG A;  2VQF M;  3CF6 E;  4DR4 M;  2HHH M;  1NVM A;  1W5S A;  4QOS A;  2I7P A;  1TH2 A;  4FWD A;  5FSW A;  3LMM A;  1Q3B A;  5LMU M;  3J7A S;  1MX0 A;  2KA6 B;  4GIT A;  4XBO A;  2P5T A;  1IXS B;  1J7K A;  3EIH A;  2UXB M;  3HU1 A;  5E26 A;  3SMS A;  1PJI A;  5IZ7 D;  5EP3 A;  1LV7 A;  4JI1 M;  1GL7 A;  1IN5 A;  2KEB A;  1DO0 A;  4B08 A;  3JAM S;  1SXJ D;  1QQW A;  4QNM A;  3VDU A;  2CE7 A;  4B7F A;  2V6Z M;  4L78 A;  1Z6T A;  3GQ3 A;  5EP1 A;  3I4Y A;  3VDP A;  2YNM D;  1R2Y A;  1ZQ9 A;  4IJE A;  4BLC A;  1NNU C;  3SMP A;  1NY5 A;  1E32 A;  4LF9 M;  2L6O A;  4Z6Y A;  2OQ4 A;  4GC5 A;  4A3V B;  3FTE A;  2C98 A;  2K47 A;  3GLH B;  4HL4 A;  3J7B A;  5EP4 A;  5ITY A;  4DR2 M;  4RF0 A;  4LJ9 A;  3SFZ A;  5FTL A;  4IBJ A;  2HL7 A;  4B3T M;  4LF5 M;  1JQJ C;  1Z5C A;  2Y0T A;  4LRT A;  5EXX A;  3L28 A;  2XFT A;  1KSF X;  2ZAN A;  2R4E A;  3RGP A;  4DV4 M;  4B3S M;  1HNW M;  2J7O A;  3D8L A;  3GRV A;  4GKK M;  3KP1 E;  3JR5 A;  4FCV A;  4X64 M;  4OX9 M;  4OVZ A;  3LVV A;  2Z7J A;  4LY6 A;  4IIW A;  4NRV A;  1WXQ A;  3GLF B;  1SXJ C;  4QHS A;  3QAU A;  4I8O A;  3KS4 A;  3KSX A;  1IN8 A;  1JR3 D;  3GRY A;  4D82 A;  4LJ4 A;  3UMM A;  2F5O A;  3M7G A;  4JI5 M;  2ZAO A;  3LQR A;  3SBJ A;  4REZ A;  3SC3 A;  1GL6 A;  2KXE A;  3GLI A;  3CF2 A;  2J7N A;  3FUW A;  3GQ5 A;  1IQP A;  2ZBK B;  3L2A A;  2F5Q A;  3VK7 A;  3CF0 A;  1QAN A;  3FTC A;  1XMQ M;  3FTF A;  4DR7 M;  3A45 A;  3HWS A;  2XGN A;  1DO2 A;  2DWZ B;  3KP0 E;  4W5W A;  1OJL A;  4LZZ A;  2E5L M;  4IJF A;  4I4L A;  4IBB A;  2DWM A;  2FNA A;  4JI4 M;  4MM3 B;  2V1U A;  4AG5 A;  2D7G A;  3J2P B;  3SAW A;  4QNR A;  7CAT A;  2XZU A;  3FD9 A;  2CHG A;  3C58 A;  4I81 A;  1E9R A;  2XSZ A;  3TL4 X;  2QBY B;  2Q2E B;  1NHG C;  3T1H M;  1YUB A;  4B7G A;  4LJ5 A;  5LMN M;  4L16 A;  4Z8X A;  1YSY A;  2QPA A;  2Z4S A;  1PM5 A;  2CUZ A;  1J5E M;  3KOX E;  2JA2 A;  2QCU A;  1NJG A;  3U5Z B;  2FOI C;  5ITX E;  3HHX A;  1R7R A;  5FTJ A;  3DOA A;  4ZPX A;  3FKE A;  3LQQ A;  1OFI A;  3DA1 A;  3LVW A;  4KLN A;  4CHT B;  2CHQ A;  3AOE A;  3AFH A;  5A2Q S;  4G4O A;  3J27 B;  4DV7 M;  1HR0 M;  2V1C A;  2R4J A;  4FCW A;  1H6U A;  3HJ8 A;  4B7H A;  3OTO M;  1IN4 A;  3MJ5 A;  5BR8 M;  3I51 A;  1KYI A;  4JV5 M;  4FVM A;  1OFH A;  5KPT A;  2CV1 A;  4DV5 M;  4DV0 M;  3AOG A;  1QAO A;  4GIP A;  2XZF A;  1N32 M;  3GLH A;  1N77 A;  2R46 A;  2BJV A;  1SXJ E;  3L27 A;  5KQ8 A;  1K82 A;  1Z59 A;  4NSO B;  3BOS A;  1XMO M;  1IY1 A;  2CV0 A;  1JR3 A;  1K3W A;  3T15 A;  3AV0 A;  2QP9 X;  1X37 A;  5BPV A;  3K92 A;  4GH9 A;  2XSZ D;  4DV1 M;  2C9O A;  1L2D A;  1HT1 E;  1K3X A;  1SXJ B;  3K2L A;  3RGS A;  2R62 A;  4G4Q A;  2L09 A;  1IY2 A;  3SHF A;  5DNY A;  4L4U A;  1IXZ A;  4D80 A;  5EXP A;  2UU9 M;  2LWX A;  4JN6 A;  4LZJ A;  1Z5B A;  4L8R C;  3A42 A;  1S3S A;  4ITQ A;  3KOZ E;  4MGK E;  4DV2 M;  3PNY A;  3KOW E;  2RGO A;  3EIE A;  5ITT A;  2DXI A;  3PVS A;  3U6O A;  2BNK A;  3U6C A;  1IBM M;  3R8F A;  1XWI A;  4FWH A;  5FLX S;  1IN7 A;  1L8Q A;  1TDZ A;  3IG8 A;  3VKG A;  5ITU A;  3A98 B;  2LH0 A;  3Q8X A;  1PJJ A;  1TDH A;  4XGI A;  3FUT A;  2X8A A;  5ITR A;  3U6E A;  2O5R A;  1XNQ M;  4LJ7 A;  3VLF B;  3L29 A;  1TH4 A;  1D2N A;  4NXN M;  4DV3 M;  2NQ8 C;  2OPF A;  3TWL A;  3KVW A;  2XLJ A;  3FYD A;  4LJ6 A;  1J09 A;  3SYL A;  4D81 A;  2C96 A;  1IXR C;  3HGI A;  5KPR A;  4X62 M;  4NXM M;  2FFJ A;  3T1Y M;  2G8L A;  4LCB A;  2UUA M;  4R7G A;  3NBI A;  5KQD A;  2F5N A;  1GLN A;  1Q39 A;  1VDD A;  5ITQ A;  1XHB A;  2F5S A;  3GLG B;  5E6J A;  4MGY E;  3U6S A;  4OW0 A;  3RE8 A;  3AL0 C;  3GLG A;  4II7 A;  1N33 M;  2DWL A;  3KS8 A;  5IRE B;  1GVN A;  1TGU A;  5EXT A;  8CAT A;  4NRW A;  3PFI A;  1HNZ M;  4LGY A;  1NY6 A;  4JXJ A;  2VQE M;  4LG2 A;  2EA0 A;  2UUC M;  4GKJ M;  1NHW C;  4M0W A;  3DZD A;  2AHM A;  4JI8 M;  2ZAM A;  4LF8 M;  1DGH B;  4AQY M;  2F5P A;  4GC9 A;  5DYG A;  3MK6 A;  4JI2 M;  1N78 A;  3FUU A;  1YE9 A;  4LFC M;  4R3D A;  3GP1 A;  2QBY A;  4S12 A;  4BBA A;  3K8Z A;  1IN6 A;  1L2C A;  1FNN A;  3ZC7 B;  2CEA A;  4LF6 M;  3CTW B;  4I5S A;  2R18 A;  2Z3X A;  1MU5 A;  2KZS A;  3AKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...