3THGA

Crystal structure of the creosote rubisco activase c-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
PFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase 1, chlo
publication title Atomic resolution x-ray structure of the substrate recognition domain of higher plant ribulose-bisphosphate carboxylase/oxygenase (Rubisco) activase.
pubmed doi rcsb
source organism Larrea tridentata
molecule tags Protein binding
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3thgA00
3THGA 3T15A 4W5WA
chains in the Genus database with same CATH superfamily
1XMOM 3LQRA 4MGKE 1N34M 2DXIA 4LJ4A 1OKSA 2YNMD 2KNZA 1D2NA 5EXXA 4K0KM 2JXNA 2LXEA 2RKOA 2LNHC 2R4JA 3HZJA 2VF7A 4X65M 3M6AA 3VKHA 1OIZA 2Y20A 3J7BA 1H6UA 3HU2A 3TPZA 4M0WA 3C3DA 4LRSA 1TH3A 2FNAA 3TQSA 3VDUA 4B3RM 4GH9A 1TTEA 2VF8A 3DOAA 3FKEA 3HHWA 4AKIA 4IJEA 4JI2M 1QAQA 5KQDA 4IBJA 1IN5A 1T43A 2Z3XA 4B3SM 1T3TA 1JR3E 3GLHB 4AQYM 3LW5F 4JXJA 4DV0M 4MGIE 1VDDA 1OTRA 4FW9A 3U60B 3KFUG 1L1TA 1DGHA 1ZAEA 3CF0A 4R3DA 3SATA 2KRKA 3FRHA 4DUZM 3NWLA 1OFIA 1Z6TA 4G6ZA 1XXHB 4MGYE 3FD9A 3CF6E 2M60A 4G4NA 4M9SA 1IXZA 5ITYA 1G4AE 1KYIA 1MN3A 2CHVA 2MGWA 3DFZA 1K3XA 3KS8A 4IBGA 4GRIA 4PD2A 1R4GA 4IJFA 1Q02A 3R8FA 1NV8A 1YSYA 1MX0A 2O01F 4NC6A 3OTOM 5BPVA 4DR7M 1YUBA 2C96A 4GHLA 2WZJA 3U6QA 1R5LA 2L4FA 5A2QS 4LGMA 1LV7A 4M9XA 4G4OA 5FTLA 1HQCA 4MH0E 4DR3M 3SAUA 2DI0A 3LVWA 4FWHA 4I81A 3GPXA 2LVNC 4FD2A 4FWGA 2J7OA 2R62A 1K3WA 3FTFA 4D80A 1E9SA 4L6V6 1X37A 4OW0A 5DNYA 1TR8A 2J7NA 3SC3A 1GJSA 2YFQA 1ZMUA 4Z8XA 2DENA 4GIPA 1XNRM 2Y0QA 4X66M 1GO5A 4AI6A 1NNUC 5C18A 3J80S 1XWIA 2QHOB 1MJGM 2R46A 2OPFA 2CHGA 3GPUA 2I7NA 2KA6B 4G4RA 3SFZA 1PM5A 1W5TA 1R2YA 3VDPA 2B3TA 1JR3A 4L78A 2R4EA 4MM3B 4RF1A 2O25A 3W68A 2DAGA 5FLXS 2KZUA 1ORYB 3UK6A 7CATA 4LJ9A 1SXJC 1VEKA 2JZ1A 3GP1A 5GKNA 4D82A 3FUTA 4NXNM 3LCVB 5H37D 2EO2A 1NVMA 3I4VA 2LBCA 2DAMA 3J27B 2EKFA 4F1IA 2DAEA 3GLIE 3VK8A 4LF6M 2P5TA 2KEBA 1E32A 4CGYB 4I4LA 2DVWB 4XBOA 1VEJA 3MJ5A 2Y21A 1N36M 4GITA 3V76A 5ITQA 3U5ZA 2LH0A 3GPYA 1N32M 2EJSA 1D0KA 3E9SA 5KPZA 2OQ4A 3AJIB 1ZV1A 1QUTA 1FJGM 3I51A 4AW4A 3PNYA 3KXEC 4M0DA 3RE8A 2YQZA 2UUAM 3K1JA 1HNWM 4L15A 1RU3A 3HU1A 4RKUF 3AKZA 5LMUM 3K8ZA 3U6EA 3K9OA 1NJGA 1QQWA 4ANRA 2L4EA 5EXPA 4JYAM 3AOGA 3SMPA 4BBAA 4LFBM 2QENA 2EA0A 4NOOB 4B7GA 1OFHA 5KQ8A 4W5WA 1Q3CA 2V1CA 4PCZA 1XHBA 3E46A 2MR9A 1NV9A 4LJ7A 2CP8A 2DZNB 5FSWA 1QDTA 2DNAA 3E4RA 2JNHA 1Z5BA 2DWNA 1HQYE 2BWEA 1EE8A 1IY2A 1OAOC 2FS1A 2LVAA 5F3WA 1Y8GA 3LQQA 2WSEF 3W0FA 2KNVA 2QP9X 4IBDA 4WW0A 3K9PA 1N75A 5E6JA 2ZAMA 2OOBA 2JZ0A 4XK8F 3U6DA 2I7PA 2L7HA 3F92A 2KRUA 2VQFM 2A5YB 1DGBA 2UU9M 3SYLA 4FCTA 2EKKA 4PDIA 3GLFA 1CUKA 4GC5A 2K0BX 1R2ZA 5ITTA 3PNVA 4G4QA 3GLIA 3FUXA 3Q8GA 4X62M 1OAIA 1HJPA 1PJSA 1WHCA 1N78A 3U6PA 1XXHE 2VIIA 5IWAM 2MROB 3TE6A 4EIWA 3VLFB 1GL6A 4DV1M 1IFYA 1D0MA 1OIPA 3U6MA 1EIJA 5FTJA 2DWLA 2Z8YM 2V1UA 2RGOA 3SHGB 3U6SA 4LRTA 1SXJD 5L8RF 1A5TA 1PGYA 3UZUA 3T1YM 2XZUA 2CV0A 2QQ8A 2CRUA 1GJTA 4XGIA 2F5PA 4NXMM 2LHGA 1PJIA 5BR8M 1GABA 4JI7M 2MJ5B 3KOWE 1SXJB 2LWXA 1JB0F 3ZCBB 2QBYB 4LY6A 3B74A 4LCBA 3K92A 5ITUA 4AKHA 2GQFA 3T15A 1AIPC 2HWJA 4ITQA 2BJVA 3T6PA 3L28A 2X49A 4LGYA 1L1ZA 1FNNA 4AZFA 4D81A 3PXGA 1V34A 2R44A 1QYRA 2L7IA 4DV2M 4HL4A 2AHMA 2K9DA 2JP7A 1DO2A 1J5EM 2JY8A 2G5GX 1SG9A 4DR5M 3A45A 2ZTDA 1NY6A 3FYDA 1V92A 3K2LA 1NHGC 2LVQD 1QVRA 1YE9A 3AOEC 3U61B 1HNXM 4LJ8A 3FYCA 2KXEA 2MH8A 5EP4A 3CF2A 2KDLA 3GLHA 3HU3A 3L27A 4CISA 3SMSA 3SAVA 2X8AA 3CGWA 3CTWB 4P16A 3EIHA 1VDLA 3U60A 2D7EA 1IQPA 4UN2B 2R6FA 3H4MA 2VQEM 1IBMM 1GKIA 5IT9S 4FVMA 2JUJA 2Z7JA 3PFIA 3T38A 4JN6A 1DGGA 1XXHA 2ZTCA 1G41A 1OJLA 1OQYA 2BWBA 2XF3A 1HT2E 4PDGA 2QCUA 3QYBA 4OVZB 3B7ZA 1C1KA 3J7AS 3GLGB 4MGHA 3Q8XA 4RNAA 2FOIC 2CEAA 1I94M 4RF0A 2FE8A 2DAIA 1BVSA 1IXRC 4QHTA 1WGLA 3J81S 3GLFE 3HHZA 1VEGA 4GC9A 4LFCM 2XSZD 3KW6A 2C9CA 2LHCA 4B7HA 1IXSB 3HWSA 1TF0B 4DUYM 5KPTA 1ZMVA 4IIWA 2H5XA 2Y0TA 1IY0A 5EXTA 1Z5CA 3KS4A 1LTMA 2L09A 4NRVA 4S12A 1WXQA 2XGNA 3HY5A 2HAKA 3GO8A 2K47A 5IREB 2N35A 5EP2A 3KOXE 5JI3E 3RGPA 4IBBA 2XZFA 4DR4M 2V6ZM 4AG5A 2R45A 2XH9A 1J09A 3AV0A 3HJ8A 1PJQA 2O5RA 4X64M 3TWMA 4LJAA 4HEOA 3GPPA 3HX3A 4NRWA 1VG5A 3C3EA 1TDZA 1E94E 2WSFF 3ZC7B 3GRUA 1ZQ9A 5IZ7D 3U6OA 4I8OA 3SBJA 3KOZE 3FUWA 1L2BA 4Z6YA 2F5QA 1DV0A 4LJ5A 2EUCA 4B3MM 2DAKA 3LMMA 4IBIA 1WIVA 2D7GA 3B7QA 3FTDA 3FUVA 3TL4X 1IBKM 4F2LA 2UXDM 4LZZA 4CJ6A 2RGHA 3KDSE 2L6OA 2CHQA 4FCWA 3GRVA 1K82A 1F4IA 1NNJA 4BB9A 1L2CA 3I01M 1VQ1A 3IG8A 3SARA 2W82A 3AFHA 2UUBM 3B7NA 4LF8M 3RFWA 2CV2A 3GRYA 5EP3A 3IHPA 2DHRA 3LVVA 1G59A 3UJNA 2APLA 4R71A 2JY6B 2NQ8C 3L2AA 2K6BA 4REZA 1G3IA 4WP2A 3ILKA 3U6CA 5JI2E 1L8QA 2R0IA 3H4JA 4GKKM 1G71A 4G3OA 3GQ4A 3GLHE 1UM8A 3A42A 4IBCA 5DFLA 5KPRA 3QYEA 1ZMWA 4CHTB 4GMQA 1DGHB 2YR0A 3QAUA 3KOYE 1L2DA 3ZH9B 2ERCA 3UGJA 2OO9A 4QOSA 1Z5AA 4M9ZA 3ZQJA 3I04M 3J2PB 5ITXE 3JR5A 2XLJA 4DV5M 1NHWC 4JI6M 2Z4RA 3SASA 3VKGA 3MK6A 2XFTA 4LFAM 1PRBA 1SXJE 1NJFA 1QDRA 5ITRA 4LG2A 4YHHM 4NSRA 1XNQM 2M5ZA 2CE7A 2LTUA 2ZBKB 3GRRA 4IBKA 2ZANA 4DV4M 2HKJA 3B9PA 2QZ4A 2F5NA 3LCUA 1NY5A 4MB7A 2R18A 3QWLA 2JA2A 1QUSA 1IN4A 4IBFA 4QNRA 4WURA 1R7RA 3THGA 3BBZA 2DKLA 3GQ3A 1E9RA 3FUUA 4LF9M 3A98B 1I4WA 2ZM6M 2JY7A 3FRIA 2HCBA 1S3SA 4KO8A 1EFUB 2J5YA 2L2DA 1C7YA 2UUCM 2DZLA 1WR1B 4L4UA 3AL0C 1WJ7A 2CV1A 1Q3BA 3IECA 2H1RA 4JI1M 1HR0M 5E26A 1T6OA 1PJJA 3W0LB 2CUZA 4FCVA 4DV3M 1JR3D 4NL4H 1KFVA 4JI0M 4QHSA 1XMQM 3AOEA 3T1HM 1DO0A 1IY1A 2UXCM 1N33M 5DYIA 1D0LA 1QANA 4LZJA 2R65A 4FWDA 3A46A 2QPAA 4LJ6A 3HJQA 3GQ5A 1XB2B 2XFSA 2KW0A 3C9PA 4KODA 5FTKA 3FE3A 4JI8M 3L26A 1NO1A 5EQTA 4KHPM 4QNMA 5EXSA 2KHHA 3GLGE 2LVOC 2C99A 2OOAA 1PJTA 3IG5A 2UXBM 1KSFX 2DHYA 2BJWA 1JQJC 1YLAA 2FFJA 2E5LM 3I4YA 1IM2A 4DR2M 5ITXA 3NBIA 2G3QA 3FTCA 3JR4A 2Z4SA 5FTMA 5EJCA 3U5ZB 1TDHA 4II7A 2KNAA 4B7FA 1SXJA 4NSOB 1QZEA 4R7GA 4DV7M 2QBYA 3HHYA 2G8LA 2DZOB 4ZPXA 2CFOA 1IN6A 2F4VM 3DZDA 2WSCF 4QOZC 3HJSA 5LMNM 4MGZE 3L25A 1IBLM 3KP0E 4DV6M 3SYKA 1Z59A 2RRUA 4JI3M 4AG6A 2F5OA 2C98A 1GLNA 3HHXA 4LF5M 1G8PA 4KT0F 4B08A 3C58A 2QNJA 3TWLA 3HGIA 4CIZA 4JI5M 3JAMS 1DGFA 5C1BA 3M7GA 3BXWA 3W67A 3L29A 2DWMA 3U61A 2FH0A 3MMPA 3UMMA 1TH4A 1IN8A 4DBGB 1HNZM 3DA1A 4Q7JA 1Q39A 3NBXX 2KZSA 2JWSA 3SHFA 4LF7M 1AUAA 2C9OA 4OX9M 3D8BA 3WHLA 4B3TM 2BNKA 4L16A 4PT5A 3EIEA 4GKJM 4IBEA 1XC8A 5EP1A 2X4AA 2CWBA 2HL7A 4DR6M 4DR1M 3VK7A 2Q2EB 3KSXA 4A3VB 1NSFA 4JV5M 2DWZB 4AKGA 3SAWA 3M0EA 4OVZA 1QZMA 3GLGA 3GLFB 3KSJA 1MU5A 2GNOA 3GLIB 3KVWA 1TH2A 3MHVC 1TGUA 4OU7A 4KLNA 5FTNA 2F5SA 2JY5A 1IN7A 2LVPC 3D8LA 1WGNA 1IXSA 2XEPA 4P17A 3R9XB 1W5SA 2ZAOA 4GEWA 1V33A 4HLQA 3TWKA 1P3QQ 1QAOA 3FTEA 4GHAA 3U6LA 5KO3A 2XSZA 2D7HA 1HT1E 1UFZA 3B89A 4I5SA 4L8RC 2QSFX 1GL7A 3HKPA 3KP1E 3BOSA 4BLCA 1R6BX 1N77A 4YY3M 2HHHM 2VDBB 3WHKA 3PVSA 3VFDA 3RGSA 1QAMA 4Y28F 4JI4M 4TUWA 1J7KA 1GVNA 2C5RA 5DYGA 4LF4M 8CATA 3E21A
chains in the Genus database with same CATH topology
1XMOM 3LQRA 4MGKE 1N34M 2DXIA 4LJ4A 2YNMD 1D2NA 5EXXA 4K0KM 2LXEA 2RKOA 2LNHC 2R4JA 4X65M 3VKHA 3M6AA 2Y20A 3J7BA 1H6UA 3HU2A 3TPZA 4M0WA 4LRSA 1TH3A 2FNAA 3TQSA 3VDUA 4B3RM 4GH9A 3FKEA 3DOAA 3HHWA 4AKIA 4IJEA 4JI2M 1QAQA 5KQDA 4IBJA 1IN5A 2Z3XA 4B3SM 1T3TA 3GLHB 4AQYM 4JXJA 4DV0M 4MGIE 1VDDA 4FW9A 3U60B 3KFUG 1L1TA 1DGHA 1ZAEA 3CF0A 4R3DA 3SATA 2KRKA 4DUZM 3NWLA 1OFIA 1Z6TA 4G6ZA 1XXHB 4MGYE 3FD9A 3CF6E 2M60A 4G4NA 4M9SA 1IXZA 5ITYA 1G4AE 1KYIA 2CHVA 3DFZA 1K3XA 3KS8A 4IBGA 4GRIA 4PD2A 4IJFA 3R8FA 1YSYA 3OTOM 1MX0A 5BPVA 4DR7M 1YUBA 2C96A 4GHLA 3U6QA 5A2QS 4LGMA 1LV7A 4M9XA 4G4OA 5FTLA 1HQCA 4MH0E 4DR3M 3SAUA 3LVWA 4FWHA 4I81A 3GPXA 4FD2A 4FWGA 2J7OA 2R62A 1K3WA 3FTFA 4D80A 1E9SA 1X37A 4OW0A 5DNYA 2J7NA 3SC3A 2YFQA 4Z8XA 4GIPA 1XNRM 2Y0QA 4X66M 4AI6A 1NNUC 5C18A 3J80S 1XWIA 2R46A 2OPFA 2CHGA 3GPUA 2I7NA 2KA6B 4G4RA 3SFZA 1PM5A 1W5TA 1R2YA 3VDPA 1JR3A 4L78A 2R4EA 4MM3B 4RF1A 5FLXS 2KZUA 1ORYB 3UK6A 7CATA 4LJ9A 1SXJC 3GP1A 5GKNA 4D82A 3FUTA 4NXNM 5H37D 2EO2A 1NVMA 3I4VA 3J27B 3VK8A 4LF6M 2P5TA 2KEBA 1E32A 4CGYB 4I4LA 2DVWB 4XBOA 3MJ5A 2Y21A 1N36M 4GITA 5ITQA 3U5ZA 2LH0A 3GPYA 1N32M 3E9SA 5KPZA 2OQ4A 3AJIB 1FJGM 3I51A 4AW4A 3PNYA 3KXEC 4M0DA 3RE8A 2YQZA 2UUAM 3K1JA 1HNWM 4L15A 3HU1A 3AKZA 5LMUM 3K8ZA 3U6EA 1NJGA 1QQWA 5EXPA 4JYAM 3AOGA 3SMPA 4BBAA 4LFBM 2QENA 2EA0A 4NOOB 4B7GA 1OFHA 5KQ8A 4W5WA 1Q3CA 2V1CA 4PCZA 1XHBA 4LJ7A 2DZNB 5FSWA 3E4RA 1Z5BA 2DWNA 1HQYE 1EE8A 1IY2A 5F3WA 3LQQA 3W0FA 2QP9X 4IBDA 4WW0A 1N75A 5E6JA 2ZAMA 3U6DA 2I7PA 2L7HA 2KRUA 2VQFM 2A5YB 1DGBA 2UU9M 3SYLA 4FCTA 4PDIA 3GLFA 4GC5A 1R2ZA 5ITTA 3PNVA 4G4QA 3GLIA 3FUXA 4X62M 1N78A 3U6PA 2VIIA 5IWAM 3TE6A 4EIWA 3VLFB 1GL6A 4DV1M 3U6MA 5FTJA 2DWLA 2V1UA 2RGOA 3SHGB 3U6SA 4LRTA 1SXJD 3T1YM 2CV0A 2XZUA 3UZUA 4LF7M 4NXMM 4XGIA 2F5PA 1PJIA 5BR8M 4JI7M 3KOWE 1SXJB 2LWXA 3ZCBB 2QBYB 4LY6A 5ITUA 4LCBA 3K92A 4AKHA 3T15A 4ITQA 2BJVA 1L1ZA 3L28A 2X49A 4LGYA 1FNNA 4AZFA 4D81A 3PXGA 1QYRA 2L7IA 4DV2M 4HL4A 2AHMA 1DO2A 1J5EM 2G5GX 4DR5M 3A45A 1NY6A 3FYDA 3K2LA 1NHGC 1QVRA 1YE9A 3AOEC 3U61B 1HNXM 4LJ8A 3FYCA 2KXEA 5EP4A 3CF2A 3HU3A 3GLHA 3L27A 4CISA 3SMSA 3SAVA 2X8AA 4P16A 3CTWB 3EIHA 3U60A 2D7EA 1IQPA 2VQEM 3H4MA 1IBMM 5IT9S 1GKIA 4FVMA 2Z7JA 3PFIA 3T38A 4JN6A 1DGGA 1XXHA 1G41A 1OJLA 2XF3A 1HT2E 4PDGA 2QCUA 4OVZB 1C1KA 3J7AS 3GLGB 4MGHA 3Q8XA 4RNAA 2FOIC 2CEAA 1I94M 4RF0A 2FE8A 1IXRC 4QHTA 3J81S 3HHZA 4GC9A 4LFCM 2XSZD 3KW6A 2C9CA 4B7HA 1IXSB 3HWSA 4DUYM 5KPTA 4IIWA 2Y0TA 1IY0A 5EXTA 1Z5CA 3KS4A 2L09A 4NRVA 4S12A 1WXQA 2XGNA 3GO8A 2K47A 5IREB 5EP2A 3KOXE 5JI3E 3RGPA 4IBBA 2XZFA 4DR4M 2V6ZM 4AG5A 2R45A 2XH9A 1J09A 3AV0A 3HJ8A 4X64M 2O5RA 3TWMA 4LJAA 3GPPA 4NRWA 1TDZA 1E94E 3ZC7B 3GRUA 1ZQ9A 5IZ7D 3U6OA 4I8OA 3SBJA 3KOZE 3FUWA 1L2BA 4Z6YA 2F5QA 4LJ5A 2EUCA 4B3MM 3LMMA 4IBIA 2D7GA 3FTDA 3TL4X 3FUVA 1IBKM 2UXDM 4LZZA 2RGHA 3KDSE 2L6OA 2CHQA 4FCWA 3GRVA 1K82A 1NNJA 4BB9A 1L2CA 3IG8A 3SARA 2W82A 3AFHA 2UUBM 4LF8M 3RFWA 2CV2A 3GRYA 5EP3A 3LVVA 2DHRA 1G59A 3UJNA 2NQ8C 3L2AA 4REZA 1G3IA 3ILKA 3U6CA 5JI2E 1L8QA 4GKKM 3GQ4A 1UM8A 3A42A 4IBCA 5KPRA 4CHTB 4GMQA 1DGHB 2YR0A 3QAUA 3KOYE 1L2DA 3ZH9B 2ERCA 3UGJA 4QOSA 1Z5AA 4M9ZA 3J2PB 5ITXE 3JR5A 2XLJA 4DV5M 1NHWC 4JI6M 2Z4RA 3SASA 3VKGA 3MK6A 2XFTA 4LFAM 1SXJE 5ITRA 1NJFA 4LG2A 4YHHM 4NSRA 1XNQM 2M5ZA 2CE7A 2ZBKB 3GRRA 4IBKA 2ZANA 4DV4M 2HKJA 3B9PA 2QZ4A 2F5NA 1NY5A 4MB7A 2R18A 3QWLA 2JA2A 1IN4A 4IBFA 4QNRA 4WURA 1R7RA 3THGA 3GQ3A 1E9RA 3FUUA 4LF9M 3A98B 1I4WA 2ZM6M 2HCBA 1S3SA 4KO8A 2UUCM 4L4UA 3AL0C 2CV1A 1Q3BA 2H1RA 4JI1M 1HR0M 5E26A 1PJJA 3W0LB 2CUZA 4FCVA 4DV3M 1JR3D 4NL4H 1KFVA 4JI0M 4QHSA 1XMQM 3AOEA 3T1HM 1DO0A 1IY1A 2UXCM 1N33M 5DYIA 1QANA 4LZJA 2R65A 4FWDA 3A46A 2QPAA 4LJ6A 3HJQA 3GQ5A 2XFSA 2KW0A 4KODA 5FTKA 4JI8M 3L26A 5EQTA 4KHPM 4QNMA 5EXSA 2C99A 3IG5A 2UXBM 1KSFX 2BJWA 1JQJC 2FFJA 2E5LM 3I4YA 1IM2A 4DR2M 5ITXA 3NBIA 3FTCA 3JR4A 2Z4SA 5FTMA 5EJCA 3U5ZB 1TDHA 4II7A 4B7FA 1SXJA 4NSOB 4R7GA 4DV7M 2QBYA 3HHYA 2G8LA 2DZOB 4ZPXA 2CFOA 1IN6A 2F4VM 3DZDA 4QOZC 3HJSA 5LMNM 4MGZE 3L25A 1IBLM 3KP0E 4DV6M 3SYKA 1Z59A 4JI3M 4AG6A 2F5OA 2C98A 1GLNA 3HHXA 4LF5M 1G8PA 4B08A 3C58A 3TWLA 3HGIA 4JI5M 3JAMS 1DGFA 5C1BA 3M7GA 3L29A 2DWMA 3U61A 3UMMA 1TH4A 1IN8A 1HNZM 3DA1A 1Q39A 2KZSA 3SHFA 4OX9M 2C9OA 3D8BA 3WHLA 4B3TM 2BNKA 4L16A 4PT5A 3EIEA 4GKJM 4IBEA 1XC8A 5EP1A 2X4AA 2HL7A 4DR6M 4DR1M 3VK7A 2Q2EB 3KSXA 4A3VB 1NSFA 4JV5M 2DWZB 4AKGA 3SAWA 3M0EA 4OVZA 1QZMA 3GLGA 3GLFB 3KSJA 1MU5A 3GLIB 3KVWA 1TH2A 3MHVC 1TGUA 4OU7A 4KLNA 5FTNA 2F5SA 1IN7A 3D8LA 2XEPA 3R9XB 1W5SA 2ZAOA 4HLQA 3TWKA 3FTEA 1QAOA 4GHAA 3U6LA 5KO3A 2XSZA 2D7HA 1HT1E 4I5SA 4L8RC 3KP1E 3HKPA 1GL7A 4BLCA 3BOSA 1N77A 1R6BX 2HHHM 4YY3M 3WHKA 3PVSA 3VFDA 3RGSA 1QAMA 4JI4M 4TUWA 1J7KA 1GVNA 2C5RA 5DYGA 4LF4M 8CATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THG A;  3T15 A;  4W5W A; 
#chains in the Genus database with same CATH topology
 1XMO M;  3LQR A;  4MGK E;  1N34 M;  2DXI A;  4LJ4 A;  1OKS A;  2YNM D;  2KNZ A;  1D2N A;  5EXX A;  4K0K M;  2JXN A;  2LXE A;  2RKO A;  2LNH C;  2R4J A;  3HZJ A;  2VF7 A;  4X65 M;  3M6A A;  3VKH A;  1OIZ A;  2Y20 A;  3J7B A;  1H6U A;  3HU2 A;  3TPZ A;  4M0W A;  3C3D A;  4LRS A;  1TH3 A;  2FNA A;  3TQS A;  3VDU A;  4B3R M;  4GH9 A;  1TTE A;  2VF8 A;  3DOA A;  3FKE A;  3HHW A;  4AKI A;  4IJE A;  4JI2 M;  1QAQ A;  5KQD A;  4IBJ A;  1IN5 A;  1T43 A;  2Z3X A;  4B3S M;  1T3T A;  1JR3 E;  3GLH B;  4AQY M;  3LW5 F;  4JXJ A;  4DV0 M;  4MGI E;  1VDD A;  1OTR A;  4FW9 A;  3U60 B;  3KFU G;  1L1T A;  1DGH A;  1ZAE A;  3CF0 A;  4R3D A;  3SAT A;  2KRK A;  3FRH A;  4DUZ M;  3NWL A;  1OFI A;  1Z6T A;  4G6Z A;  1XXH B;  4MGY E;  3FD9 A;  3CF6 E;  2M60 A;  4G4N A;  4M9S A;  1IXZ A;  5ITY A;  1G4A E;  1KYI A;  1MN3 A;  2CHV A;  2MGW A;  3DFZ A;  1K3X A;  3KS8 A;  4IBG A;  4GRI A;  4PD2 A;  1R4G A;  4IJF A;  1Q02 A;  3R8F A;  1NV8 A;  1YSY A;  1MX0 A;  2O01 F;  4NC6 A;  3OTO M;  5BPV A;  4DR7 M;  1YUB A;  2C96 A;  4GHL A;  2WZJ A;  3U6Q A;  1R5L A;  2L4F A;  5A2Q S;  4LGM A;  1LV7 A;  4M9X A;  4G4O A;  5FTL A;  1HQC A;  4MH0 E;  4DR3 M;  3SAU A;  2DI0 A;  3LVW A;  4FWH A;  4I81 A;  3GPX A;  2LVN C;  4FD2 A;  4FWG A;  2J7O A;  2R62 A;  1K3W A;  3FTF A;  4D80 A;  1E9S A;  4L6V 6;  1X37 A;  4OW0 A;  5DNY A;  1TR8 A;  2J7N A;  3SC3 A;  1GJS A;  2YFQ A;  1ZMU A;  4Z8X A;  2DEN A;  4GIP A;  1XNR M;  2Y0Q A;  4X66 M;  1GO5 A;  4AI6 A;  1NNU C;  5C18 A;  3J80 S;  1XWI A;  2QHO B;  1MJG M;  2R46 A;  2OPF A;  2CHG A;  3GPU A;  2I7N A;  2KA6 B;  4G4R A;  3SFZ A;  1PM5 A;  1W5T A;  1R2Y A;  3VDP A;  2B3T A;  1JR3 A;  4L78 A;  2R4E A;  4MM3 B;  4RF1 A;  2O25 A;  3W68 A;  2DAG A;  5FLX S;  2KZU A;  1ORY B;  3UK6 A;  7CAT A;  4LJ9 A;  1SXJ C;  1VEK A;  2JZ1 A;  3GP1 A;  5GKN A;  4D82 A;  3FUT A;  4NXN M;  3LCV B;  5H37 D;  2EO2 A;  1NVM A;  3I4V A;  2LBC A;  2DAM A;  3J27 B;  2EKF A;  4F1I A;  2DAE A;  3GLI E;  3VK8 A;  4LF6 M;  2P5T A;  2KEB A;  1E32 A;  4CGY B;  4I4L A;  2DVW B;  4XBO A;  1VEJ A;  3MJ5 A;  2Y21 A;  1N36 M;  4GIT A;  3V76 A;  5ITQ A;  3U5Z A;  2LH0 A;  3GPY A;  1N32 M;  2EJS A;  1D0K A;  3E9S A;  5KPZ A;  2OQ4 A;  3AJI B;  1ZV1 A;  1QUT A;  1FJG M;  3I51 A;  4AW4 A;  3PNY A;  3KXE C;  4M0D A;  3RE8 A;  2YQZ A;  2UUA M;  3K1J A;  1HNW M;  4L15 A;  1RU3 A;  3HU1 A;  4RKU F;  3AKZ A;  5LMU M;  3K8Z A;  3U6E A;  3K9O A;  1NJG A;  1QQW A;  4ANR A;  2L4E A;  5EXP A;  4JYA M;  3AOG A;  3SMP A;  4BBA A;  4LFB M;  2QEN A;  2EA0 A;  4NOO B;  4B7G A;  1OFH A;  5KQ8 A;  4W5W A;  1Q3C A;  2V1C A;  4PCZ A;  1XHB A;  3E46 A;  2MR9 A;  1NV9 A;  4LJ7 A;  2CP8 A;  2DZN B;  5FSW A;  1QDT A;  2DNA A;  3E4R A;  2JNH A;  1Z5B A;  2DWN A;  1HQY E;  2BWE A;  1EE8 A;  1IY2 A;  1OAO C;  2FS1 A;  2LVA A;  5F3W A;  1Y8G A;  3LQQ A;  2WSE F;  3W0F A;  2KNV A;  2QP9 X;  4IBD A;  4WW0 A;  3K9P A;  1N75 A;  5E6J A;  2ZAM A;  2OOB A;  2JZ0 A;  4XK8 F;  3U6D A;  2I7P A;  2L7H A;  3F92 A;  2KRU A;  2VQF M;  2A5Y B;  1DGB A;  2UU9 M;  3SYL A;  4FCT A;  2EKK A;  4PDI A;  3GLF A;  1CUK A;  4GC5 A;  2K0B X;  1R2Z A;  5ITT A;  3PNV A;  4G4Q A;  3GLI A;  3FUX A;  3Q8G A;  4X62 M;  1OAI A;  1HJP A;  1PJS A;  1WHC A;  1N78 A;  3U6P A;  1XXH E;  2VII A;  5IWA M;  2MRO B;  3TE6 A;  4EIW A;  3VLF B;  1GL6 A;  4DV1 M;  1IFY A;  1D0M A;  1OIP A;  3U6M A;  1EIJ A;  5FTJ A;  2DWL A;  2Z8Y M;  2V1U A;  2RGO A;  3SHG B;  3U6S A;  4LRT A;  1SXJ D;  5L8R F;  1A5T A;  1PGY A;  3UZU A;  3T1Y M;  2XZU A;  2CV0 A;  2QQ8 A;  2CRU A;  1GJT A;  4XGI A;  2F5P A;  4NXM M;  2LHG A;  1PJI A;  5BR8 M;  1GAB A;  4JI7 M;  2MJ5 B;  3KOW E;  1SXJ B;  2LWX A;  1JB0 F;  3ZCB B;  2QBY B;  4LY6 A;  3B74 A;  4LCB A;  3K92 A;  5ITU A;  4AKH A;  2GQF A;  3T15 A;  1AIP C;  2HWJ A;  4ITQ A;  2BJV A;  3T6P A;  3L28 A;  2X49 A;  4LGY A;  1L1Z A;  1FNN A;  4AZF A;  4D81 A;  3PXG A;  1V34 A;  2R44 A;  1QYR A;  2L7I A;  4DV2 M;  4HL4 A;  2AHM A;  2K9D A;  2JP7 A;  1DO2 A;  1J5E M;  2JY8 A;  2G5G X;  1SG9 A;  4DR5 M;  3A45 A;  2ZTD A;  1NY6 A;  3FYD A;  1V92 A;  3K2L A;  1NHG C;  2LVQ D;  1QVR A;  1YE9 A;  3AOE C;  3U61 B;  1HNX M;  4LJ8 A;  3FYC A;  2KXE A;  2MH8 A;  5EP4 A;  3CF2 A;  2KDL A;  3GLH A;  3HU3 A;  3L27 A;  4CIS A;  3SMS A;  3SAV A;  2X8A A;  3CGW A;  3CTW B;  4P16 A;  3EIH A;  1VDL A;  3U60 A;  2D7E A;  1IQP A;  4UN2 B;  2R6F A;  3H4M A;  2VQE M;  1IBM M;  1GKI A;  5IT9 S;  4FVM A;  2JUJ A;  2Z7J A;  3PFI A;  3T38 A;  4JN6 A;  1DGG A;  1XXH A;  2ZTC A;  1G41 A;  1OJL A;  1OQY A;  2BWB A;  2XF3 A;  1HT2 E;  4PDG A;  2QCU A;  3QYB A;  4OVZ B;  3B7Z A;  1C1K A;  3J7A S;  3GLG B;  4MGH A;  3Q8X A;  4RNA A;  2FOI C;  2CEA A;  1I94 M;  4RF0 A;  2FE8 A;  2DAI A;  1BVS A;  1IXR C;  4QHT A;  1WGL A;  3J81 S;  3GLF E;  3HHZ A;  1VEG A;  4GC9 A;  4LFC M;  2XSZ D;  3KW6 A;  2C9C A;  2LHC A;  4B7H A;  1IXS B;  3HWS A;  1TF0 B;  4DUY M;  5KPT A;  1ZMV A;  4IIW A;  2H5X A;  2Y0T A;  1IY0 A;  5EXT A;  1Z5C A;  3KS4 A;  1LTM A;  2L09 A;  4NRV A;  4S12 A;  1WXQ A;  2XGN A;  3HY5 A;  2HAK A;  3GO8 A;  2K47 A;  5IRE B;  2N35 A;  5EP2 A;  3KOX E;  5JI3 E;  3RGP A;  4IBB A;  2XZF A;  4DR4 M;  2V6Z M;  4AG5 A;  2R45 A;  2XH9 A;  1J09 A;  3AV0 A;  3HJ8 A;  1PJQ A;  2O5R A;  4X64 M;  3TWM A;  4LJA A;  4HEO A;  3GPP A;  3HX3 A;  4NRW A;  1VG5 A;  3C3E A;  1TDZ A;  1E94 E;  2WSF F;  3ZC7 B;  3GRU A;  1ZQ9 A;  5IZ7 D;  3U6O A;  4I8O A;  3SBJ A;  3KOZ E;  3FUW A;  1L2B A;  4Z6Y A;  2F5Q A;  1DV0 A;  4LJ5 A;  2EUC A;  4B3M M;  2DAK A;  3LMM A;  4IBI A;  1WIV A;  2D7G A;  3B7Q A;  3FTD A;  3FUV A;  3TL4 X;  1IBK M;  4F2L A;  2UXD M;  4LZZ A;  4CJ6 A;  2RGH A;  3KDS E;  2L6O A;  2CHQ A;  4FCW A;  3GRV A;  1K82 A;  1F4I A;  1NNJ A;  4BB9 A;  1L2C A;  3I01 M;  1VQ1 A;  3IG8 A;  3SAR A;  2W82 A;  3AFH A;  2UUB M;  3B7N A;  4LF8 M;  3RFW A;  2CV2 A;  3GRY A;  5EP3 A;  3IHP A;  2DHR A;  3LVV A;  1G59 A;  3UJN A;  2APL A;  4R71 A;  2JY6 B;  2NQ8 C;  3L2A A;  2K6B A;  4REZ A;  1G3I A;  4WP2 A;  3ILK A;  3U6C A;  5JI2 E;  1L8Q A;  2R0I A;  3H4J A;  4GKK M;  1G71 A;  4G3O A;  3GQ4 A;  3GLH E;  1UM8 A;  3A42 A;  4IBC A;  5DFL A;  5KPR A;  3QYE A;  1ZMW A;  4CHT B;  4GMQ A;  1DGH B;  2YR0 A;  3QAU A;  3KOY E;  1L2D A;  3ZH9 B;  2ERC A;  3UGJ A;  2OO9 A;  4QOS A;  1Z5A A;  4M9Z A;  3ZQJ A;  3I04 M;  3J2P B;  5ITX E;  3JR5 A;  2XLJ A;  4DV5 M;  1NHW C;  4JI6 M;  2Z4R A;  3SAS A;  3VKG A;  3MK6 A;  2XFT A;  4LFA M;  1PRB A;  1SXJ E;  1NJF A;  1QDR A;  5ITR A;  4LG2 A;  4YHH M;  4NSR A;  1XNQ M;  2M5Z A;  2CE7 A;  2LTU A;  2ZBK B;  3GRR A;  4IBK A;  2ZAN A;  4DV4 M;  2HKJ A;  3B9P A;  2QZ4 A;  2F5N A;  3LCU A;  1NY5 A;  4MB7 A;  2R18 A;  3QWL A;  2JA2 A;  1QUS A;  1IN4 A;  4IBF A;  4QNR A;  4WUR A;  1R7R A;  3THG A;  3BBZ A;  2DKL A;  3GQ3 A;  1E9R A;  3FUU A;  4LF9 M;  3A98 B;  1I4W A;  2ZM6 M;  2JY7 A;  3FRI A;  2HCB A;  1S3S A;  4KO8 A;  1EFU B;  2J5Y A;  2L2D A;  1C7Y A;  2UUC M;  2DZL A;  1WR1 B;  4L4U A;  3AL0 C;  1WJ7 A;  2CV1 A;  1Q3B A;  3IEC A;  2H1R A;  4JI1 M;  1HR0 M;  5E26 A;  1T6O A;  1PJJ A;  3W0L B;  2CUZ A;  4FCV A;  4DV3 M;  1JR3 D;  4NL4 H;  1KFV A;  4JI0 M;  4QHS A;  1XMQ M;  3AOE A;  3T1H M;  1DO0 A;  1IY1 A;  2UXC M;  1N33 M;  5DYI A;  1D0L A;  1QAN A;  4LZJ A;  2R65 A;  4FWD A;  3A46 A;  2QPA A;  4LJ6 A;  3HJQ A;  3GQ5 A;  1XB2 B;  2XFS A;  2KW0 A;  3C9P A;  4KOD A;  5FTK A;  3FE3 A;  4JI8 M;  3L26 A;  1NO1 A;  5EQT A;  4KHP M;  4QNM A;  5EXS A;  2KHH A;  3GLG E;  2LVO C;  2C99 A;  2OOA A;  1PJT A;  3IG5 A;  2UXB M;  1KSF X;  2DHY A;  2BJW A;  1JQJ C;  1YLA A;  2FFJ A;  2E5L M;  3I4Y A;  1IM2 A;  4DR2 M;  5ITX A;  3NBI A;  2G3Q A;  3FTC A;  3JR4 A;  2Z4S A;  5FTM A;  5EJC A;  3U5Z B;  1TDH A;  4II7 A;  2KNA A;  4B7F A;  1SXJ A;  4NSO B;  1QZE A;  4R7G A;  4DV7 M;  2QBY A;  3HHY A;  2G8L A;  2DZO B;  4ZPX A;  2CFO A;  1IN6 A;  2F4V M;  3DZD A;  2WSC F;  4QOZ C;  3HJS A;  5LMN M;  4MGZ E;  3L25 A;  1IBL M;  3KP0 E;  4DV6 M;  3SYK A;  1Z59 A;  2RRU A;  4JI3 M;  4AG6 A;  2F5O A;  2C98 A;  1GLN A;  3HHX A;  4LF5 M;  1G8P A;  4KT0 F;  4B08 A;  3C58 A;  2QNJ A;  3TWL A;  3HGI A;  4CIZ A;  4JI5 M;  3JAM S;  1DGF A;  5C1B A;  3M7G A;  3BXW A;  3W67 A;  3L29 A;  2DWM A;  3U61 A;  2FH0 A;  3MMP A;  3UMM A;  1TH4 A;  1IN8 A;  4DBG B;  1HNZ M;  3DA1 A;  4Q7J A;  1Q39 A;  3NBX X;  2KZS A;  2JWS A;  3SHF A;  4LF7 M;  1AUA A;  2C9O A;  4OX9 M;  3D8B A;  3WHL A;  4B3T M;  2BNK A;  4L16 A;  4PT5 A;  3EIE A;  4GKJ M;  4IBE A;  1XC8 A;  5EP1 A;  2X4A A;  2CWB A;  2HL7 A;  4DR6 M;  4DR1 M;  3VK7 A;  2Q2E B;  3KSX A;  4A3V B;  1NSF A;  4JV5 M;  2DWZ B;  4AKG A;  3SAW A;  3M0E A;  4OVZ A;  1QZM A;  3GLG A;  3GLF B;  3KSJ A;  1MU5 A;  2GNO A;  3GLI B;  3KVW A;  1TH2 A;  3MHV C;  1TGU A;  4OU7 A;  4KLN A;  5FTN A;  2F5S A;  2JY5 A;  1IN7 A;  2LVP C;  3D8L A;  1WGN A;  1IXS A;  2XEP A;  4P17 A;  3R9X B;  1W5S A;  2ZAO A;  4GEW A;  1V33 A;  4HLQ A;  3TWK A;  1P3Q Q;  1QAO A;  3FTE A;  4GHA A;  3U6L A;  5KO3 A;  2XSZ A;  2D7H A;  1HT1 E;  1UFZ A;  3B89 A;  4I5S A;  4L8R C;  2QSF X;  1GL7 A;  3HKP A;  3KP1 E;  3BOS A;  4BLC A;  1R6B X;  1N77 A;  4YY3 M;  2HHH M;  2VDB B;  3WHK A;  3PVS A;  3VFD A;  3RGS A;  1QAM A;  4Y28 F;  4JI4 M;  4TUW A;  1J7K A;  1GVN A;  2C5R A;  5DYG A;  4LF4 M;  8CAT A;  3E21 A; 
#chains in the Genus database with same CATH homology
 1XMO M;  3LQR A;  4MGK E;  1N34 M;  2DXI A;  4LJ4 A;  2YNM D;  1D2N A;  5EXX A;  4K0K M;  2LXE A;  2RKO A;  2LNH C;  2R4J A;  4X65 M;  3VKH A;  3M6A A;  2Y20 A;  3J7B A;  1H6U A;  3HU2 A;  3TPZ A;  4M0W A;  4LRS A;  1TH3 A;  2FNA A;  3TQS A;  3VDU A;  4B3R M;  4GH9 A;  3FKE A;  3DOA A;  3HHW A;  4AKI A;  4IJE A;  4JI2 M;  1QAQ A;  5KQD A;  4IBJ A;  1IN5 A;  2Z3X A;  4B3S M;  1T3T A;  3GLH B;  4AQY M;  4JXJ A;  4DV0 M;  4MGI E;  1VDD A;  4FW9 A;  3U60 B;  3KFU G;  1L1T A;  1DGH A;  1ZAE A;  3CF0 A;  4R3D A;  3SAT A;  2KRK A;  4DUZ M;  3NWL A;  1OFI A;  1Z6T A;  4G6Z A;  1XXH B;  4MGY E;  3FD9 A;  3CF6 E;  2M60 A;  4G4N A;  4M9S A;  1IXZ A;  5ITY A;  1G4A E;  1KYI A;  2CHV A;  3DFZ A;  1K3X A;  3KS8 A;  4IBG A;  4GRI A;  4PD2 A;  4IJF A;  3R8F A;  1YSY A;  3OTO M;  1MX0 A;  5BPV A;  4DR7 M;  1YUB A;  2C96 A;  4GHL A;  3U6Q A;  5A2Q S;  4LGM A;  1LV7 A;  4M9X A;  4G4O A;  5FTL A;  1HQC A;  4MH0 E;  4DR3 M;  3SAU A;  3LVW A;  4FWH A;  4I81 A;  3GPX A;  4FD2 A;  4FWG A;  2J7O A;  2R62 A;  1K3W A;  3FTF A;  4D80 A;  1E9S A;  1X37 A;  4OW0 A;  5DNY A;  2J7N A;  3SC3 A;  2YFQ A;  4Z8X A;  4GIP A;  1XNR M;  2Y0Q A;  4X66 M;  4AI6 A;  1NNU C;  5C18 A;  3J80 S;  1XWI A;  2R46 A;  2OPF A;  2CHG A;  3GPU A;  2I7N A;  2KA6 B;  4G4R A;  3SFZ A;  1PM5 A;  1W5T A;  1R2Y A;  3VDP A;  1JR3 A;  4L78 A;  2R4E A;  4MM3 B;  4RF1 A;  5FLX S;  2KZU A;  1ORY B;  3UK6 A;  7CAT A;  4LJ9 A;  1SXJ C;  3GP1 A;  5GKN A;  4D82 A;  3FUT A;  4NXN M;  5H37 D;  2EO2 A;  1NVM A;  3I4V A;  3J27 B;  3VK8 A;  4LF6 M;  2P5T A;  2KEB A;  1E32 A;  4CGY B;  4I4L A;  2DVW B;  4XBO A;  3MJ5 A;  2Y21 A;  1N36 M;  4GIT A;  5ITQ A;  3U5Z A;  2LH0 A;  3GPY A;  1N32 M;  3E9S A;  5KPZ A;  2OQ4 A;  3AJI B;  1FJG M;  3I51 A;  4AW4 A;  3PNY A;  3KXE C;  4M0D A;  3RE8 A;  2YQZ A;  2UUA M;  3K1J A;  1HNW M;  4L15 A;  3HU1 A;  3AKZ A;  5LMU M;  3K8Z A;  3U6E A;  1NJG A;  1QQW A;  5EXP A;  4JYA M;  3AOG A;  3SMP A;  4BBA A;  4LFB M;  2QEN A;  2EA0 A;  4NOO B;  4B7G A;  1OFH A;  5KQ8 A;  4W5W A;  1Q3C A;  2V1C A;  4PCZ A;  1XHB A;  4LJ7 A;  2DZN B;  5FSW A;  3E4R A;  1Z5B A;  2DWN A;  1HQY E;  1EE8 A;  1IY2 A;  5F3W A;  3LQQ A;  3W0F A;  2QP9 X;  4IBD A;  4WW0 A;  1N75 A;  5E6J A;  2ZAM A;  3U6D A;  2I7P A;  2L7H A;  2KRU A;  2VQF M;  2A5Y B;  1DGB A;  2UU9 M;  3SYL A;  4FCT A;  4PDI A;  3GLF A;  4GC5 A;  1R2Z A;  5ITT A;  3PNV A;  4G4Q A;  3GLI A;  3FUX A;  4X62 M;  1N78 A;  3U6P A;  2VII A;  5IWA M;  3TE6 A;  4EIW A;  3VLF B;  1GL6 A;  4DV1 M;  3U6M A;  5FTJ A;  2DWL A;  2V1U A;  2RGO A;  3SHG B;  3U6S A;  4LRT A;  1SXJ D;  3T1Y M;  2CV0 A;  2XZU A;  3UZU A;  4LF7 M;  4NXM M;  4XGI A;  2F5P A;  1PJI A;  5BR8 M;  4JI7 M;  3KOW E;  1SXJ B;  2LWX A;  3ZCB B;  2QBY B;  4LY6 A;  5ITU A;  4LCB A;  3K92 A;  4AKH A;  3T15 A;  4ITQ A;  2BJV A;  1L1Z A;  3L28 A;  2X49 A;  4LGY A;  1FNN A;  4AZF A;  4D81 A;  3PXG A;  1QYR A;  2L7I A;  4DV2 M;  4HL4 A;  2AHM A;  1DO2 A;  1J5E M;  2G5G X;  4DR5 M;  3A45 A;  1NY6 A;  3FYD A;  3K2L A;  1NHG C;  1QVR A;  1YE9 A;  3AOE C;  3U61 B;  1HNX M;  4LJ8 A;  3FYC A;  2KXE A;  5EP4 A;  3CF2 A;  3HU3 A;  3GLH A;  3L27 A;  4CIS A;  3SMS A;  3SAV A;  2X8A A;  4P16 A;  3CTW B;  3EIH A;  3U60 A;  2D7E A;  1IQP A;  2VQE M;  3H4M A;  1IBM M;  5IT9 S;  1GKI A;  4FVM A;  2Z7J A;  3PFI A;  3T38 A;  4JN6 A;  1DGG A;  1XXH A;  1G41 A;  1OJL A;  2XF3 A;  1HT2 E;  4PDG A;  2QCU A;  4OVZ B;  1C1K A;  3J7A S;  3GLG B;  4MGH A;  3Q8X A;  4RNA A;  2FOI C;  2CEA A;  1I94 M;  4RF0 A;  2FE8 A;  1IXR C;  4QHT A;  3J81 S;  3HHZ A;  4GC9 A;  4LFC M;  2XSZ D;  3KW6 A;  2C9C A;  4B7H A;  1IXS B;  3HWS A;  4DUY M;  5KPT A;  4IIW A;  2Y0T A;  1IY0 A;  5EXT A;  1Z5C A;  3KS4 A;  2L09 A;  4NRV A;  4S12 A;  1WXQ A;  2XGN A;  3GO8 A;  2K47 A;  5IRE B;  5EP2 A;  3KOX E;  5JI3 E;  3RGP A;  4IBB A;  2XZF A;  4DR4 M;  2V6Z M;  4AG5 A;  2R45 A;  2XH9 A;  1J09 A;  3AV0 A;  3HJ8 A;  4X64 M;  2O5R A;  3TWM A;  4LJA A;  3GPP A;  4NRW A;  1TDZ A;  1E94 E;  3ZC7 B;  3GRU A;  1ZQ9 A;  5IZ7 D;  3U6O A;  4I8O A;  3SBJ A;  3KOZ E;  3FUW A;  1L2B A;  4Z6Y A;  2F5Q A;  4LJ5 A;  2EUC A;  4B3M M;  3LMM A;  4IBI A;  2D7G A;  3FTD A;  3TL4 X;  3FUV A;  1IBK M;  2UXD M;  4LZZ A;  2RGH A;  3KDS E;  2L6O A;  2CHQ A;  4FCW A;  3GRV A;  1K82 A;  1NNJ A;  4BB9 A;  1L2C A;  3IG8 A;  3SAR A;  2W82 A;  3AFH A;  2UUB M;  4LF8 M;  3RFW A;  2CV2 A;  3GRY A;  5EP3 A;  3LVV A;  2DHR A;  1G59 A;  3UJN A;  2NQ8 C;  3L2A A;  4REZ A;  1G3I A;  3ILK A;  3U6C A;  5JI2 E;  1L8Q A;  4GKK M;  3GQ4 A;  1UM8 A;  3A42 A;  4IBC A;  5KPR A;  4CHT B;  4GMQ A;  1DGH B;  2YR0 A;  3QAU A;  3KOY E;  1L2D A;  3ZH9 B;  2ERC A;  3UGJ A;  4QOS A;  1Z5A A;  4M9Z A;  3J2P B;  5ITX E;  3JR5 A;  2XLJ A;  4DV5 M;  1NHW C;  4JI6 M;  2Z4R A;  3SAS A;  3VKG A;  3MK6 A;  2XFT A;  4LFA M;  1SXJ E;  5ITR A;  1NJF A;  4LG2 A;  4YHH M;  4NSR A;  1XNQ M;  2M5Z A;  2CE7 A;  2ZBK B;  3GRR A;  4IBK A;  2ZAN A;  4DV4 M;  2HKJ A;  3B9P A;  2QZ4 A;  2F5N A;  1NY5 A;  4MB7 A;  2R18 A;  3QWL A;  2JA2 A;  1IN4 A;  4IBF A;  4QNR A;  4WUR A;  1R7R A;  3THG A;  3GQ3 A;  1E9R A;  3FUU A;  4LF9 M;  3A98 B;  1I4W A;  2ZM6 M;  2HCB A;  1S3S A;  4KO8 A;  2UUC M;  4L4U A;  3AL0 C;  2CV1 A;  1Q3B A;  2H1R A;  4JI1 M;  1HR0 M;  5E26 A;  1PJJ A;  3W0L B;  2CUZ A;  4FCV A;  4DV3 M;  1JR3 D;  4NL4 H;  1KFV A;  4JI0 M;  4QHS A;  1XMQ M;  3AOE A;  3T1H M;  1DO0 A;  1IY1 A;  2UXC M;  1N33 M;  5DYI A;  1QAN A;  4LZJ A;  2R65 A;  4FWD A;  3A46 A;  2QPA A;  4LJ6 A;  3HJQ A;  3GQ5 A;  2XFS A;  2KW0 A;  4KOD A;  5FTK A;  4JI8 M;  3L26 A;  5EQT A;  4KHP M;  4QNM A;  5EXS A;  2C99 A;  3IG5 A;  2UXB M;  1KSF X;  2BJW A;  1JQJ C;  2FFJ A;  2E5L M;  3I4Y A;  1IM2 A;  4DR2 M;  5ITX A;  3NBI A;  3FTC A;  3JR4 A;  2Z4S A;  5FTM A;  5EJC A;  3U5Z B;  1TDH A;  4II7 A;  4B7F A;  1SXJ A;  4NSO B;  4R7G A;  4DV7 M;  2QBY A;  3HHY A;  2G8L A;  2DZO B;  4ZPX A;  2CFO A;  1IN6 A;  2F4V M;  3DZD A;  4QOZ C;  3HJS A;  5LMN M;  4MGZ E;  3L25 A;  1IBL M;  3KP0 E;  4DV6 M;  3SYK A;  1Z59 A;  4JI3 M;  4AG6 A;  2F5O A;  2C98 A;  1GLN A;  3HHX A;  4LF5 M;  1G8P A;  4B08 A;  3C58 A;  3TWL A;  3HGI A;  4JI5 M;  3JAM S;  1DGF A;  5C1B A;  3M7G A;  3L29 A;  2DWM A;  3U61 A;  3UMM A;  1TH4 A;  1IN8 A;  1HNZ M;  3DA1 A;  1Q39 A;  2KZS A;  3SHF A;  4OX9 M;  2C9O A;  3D8B A;  3WHL A;  4B3T M;  2BNK A;  4L16 A;  4PT5 A;  3EIE A;  4GKJ M;  4IBE A;  1XC8 A;  5EP1 A;  2X4A A;  2HL7 A;  4DR6 M;  4DR1 M;  3VK7 A;  2Q2E B;  3KSX A;  4A3V B;  1NSF A;  4JV5 M;  2DWZ B;  4AKG A;  3SAW A;  3M0E A;  4OVZ A;  1QZM A;  3GLG A;  3GLF B;  3KSJ A;  1MU5 A;  3GLI B;  3KVW A;  1TH2 A;  3MHV C;  1TGU A;  4OU7 A;  4KLN A;  5FTN A;  2F5S A;  1IN7 A;  3D8L A;  2XEP A;  3R9X B;  1W5S A;  2ZAO A;  4HLQ A;  3TWK A;  3FTE A;  1QAO A;  4GHA A;  3U6L A;  5KO3 A;  2XSZ A;  2D7H A;  1HT1 E;  4I5S A;  4L8R C;  3KP1 E;  3HKP A;  1GL7 A;  4BLC A;  3BOS A;  1N77 A;  1R6B X;  2HHH M;  4YY3 M;  3WHK A;  3PVS A;  3VFD A;  3RGS A;  1QAM A;  4JI4 M;  4TUW A;  1J7K A;  1GVN A;  2C5R A;  5DYG A;  4LF4 M;  8CAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...