3THGA

Crystal structure of the creosote rubisco activase c-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
PFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic resolution x-ray structure of the substrate recognition domain of higher plant ribulose-bisphosphate carboxylase/oxygenase (Rubisco) activase.
pubmed doi rcsb
source organism Larrea tridentata
molecule tags Protein binding
molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase 1, chlo
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3thgA00
3T15A 4W5WA 3THGA
chains in the Genus database with same CATH superfamily
3CF6E 3J7BA 3ZH9B 2DZOB 3U6DA 3AKZA 3T1YM 3GQ3A 2CFOA 5KQDA 4LGYA 3BBZA 3FTFA 3FUTA 1Z5CA 3GQ5A 1DGHB 5ITUA 2G3QA 1MN3A 5FTNA 3HHYA 1DV0A 3U6CA 2JY6B 2CV1A 2XEPA 4NOOB 1J09A 3I01M 4REZA 4JI6M 1AUAA 4XK8F 2JY5A 4L4UA 5DNYA 1ZMVA 1N78A 1NJFA 1G3IA 2Y0TA 3NBIA 2LXEA 1IQPA 2KEBA 1HT2E 3K1JA 3KXEC 5EXXA 3HHWA 1D2NA 3JR4A 3ZCBB 1Z6TA 2OO9A 1VQ1A 3B7QA 2XF3A 1IBKM 2EKFA 7CATA 4D80A 1H6UA 3AOEA 1IN4A 3KP1E 1I4WA 2CUZA 1NHWC 2VQFM 4UN2B 2EA0A 3VDPA 3SHGB 4G4RA 1UM8A 1L1ZA 3U6OA 2KNAA 3AJIB 5H37D 4XBOA 1IN5A 2L09A 3KDSE 2HAKA 4GMQA 3Q8XA 4KODA 2LBCA 4II7A 4CHTB 4IBBA 5A2QS 3EIEA 4FD2A 2JY8A 3DZDA 3W68A 1IXSA 4DUZM 4AI6A 1V34A 3OTOM 3SYKA 3E4RA 1GJTA 4X66M 2Z8YM 2QNJA 1C7YA 3GRYA 3K8ZA 4OU7A 3L28A 1NV8A 5IREB 4P17A 4JI5M 4LG2A 3J7AS 3D8LA 1E94E 4X65M 3U6LA 4X64M 1ZMUA 1IN8A 1EE8A 2FFJA 2LVNC 2ZTDA 3NBXX 3FRIA 4LJ7A 4NC6A 2DAEA 3GLHA 1G59A 1TGUA 2XGNA 1J7KA 1Y8GA 2QSFX 3KVWA 2HWJA 2WSEF 3AOGA 1VG5A 3B74A 3PVSA 2BWBA 2L7HA 4LF7M 2F4VM 4QOSA 4FCTA 1P3QQ 3QYBA 2FS1A 3E46A 4EIWA 5LMNM 1TH4A 4M9XA 2J7NA 2GQFA 1E9RA 2XSZD 3DOAA 3SATA 4I8OA 4QOZC 2JXNA 2R6FA 3MJ5A 2CV2A 3AL0C 3MMPA 3B7NA 4FVMA 1Q39A 2Z4SA 3V76A 2O01F 2Z3XA 5FLXS 2MH8A 3KS8A 1MJGM 1OQYA 3GRUA 1WJ7A 4FWGA 3SYLA 3C58A 4IBFA 1GKIA 5EXTA 3IECA 5ITTA 2C98A 4GC5A 2OQ4A 3L2AA 2LVPC 3ZQJA 1XHBA 1IN7A 5E6JA 1XNRM 4LRTA 1IXZA 3GLFE 3GLGB 4TUWA 3GLGE 3GLFB 3SAUA 3K9OA 1OIPA 3VKHA 1L8QA 2WSFF 3C3EA 4BLCA 4NRVA 4LJ6A 2CE7A 3R9XB 4IBKA 2R0IA 4DR4M 4LGMA 1N75A 2JZ0A 4PD2A 1VDLA 1C1KA 2LVOC 4JXJA 4BBAA 2XZFA 5KO3A 4DR3M 3HY5A 3FE3A 2OOAA 1YLAA 3FTCA 1DGHA 1OKSA 3W67A 3A45A 3LW5F 5JI2E 1G41A 2ZANA 2UU9M 3IHPA 1D0LA 2F5SA 2R46A 2RGHA 4LJ8A 4RF0A 1YE9A 4ANRA 4OVZA 2WZJA 3HU1A 4GEWA 4PDGA 4WW0A 3A46A 2AHMA 2FOIC 3AFHA 3FUUA 3LCVB 2DXIA 1OAOC 5EP1A 1PJJA 1T6OA 2CEAA 2K47A 4F1IA 4KT0F 3UMMA 1N34M 1I94M 2VF8A 3TL4X 2I7PA 1JR3D 3KOYE 8CATA 4KLNA 2XLJA 1HNZM 1WXQA 3GPXA 1NY5A 2R44A 1NV9A 1N77A 3FUWA 4LY6A 3BXWA 4IBIA 1N33M 1WGLA 2XH9A 3AV0A 4D82A 2DI0A 2A5YB 2L4EA 4HLQA 3J27B 4M9ZA 4RF1A 4WP2A 3SBJA 3LQRA 4X62M 1XC8A 1T43A 3HGIA 1R5LA 3DFZA 2OPFA 2BJVA 4MGKE 2M60A 1QZEA 4DV2M 4LJ9A 3U6PA 3U60B 5ITXE 5DYGA 1K3WA 3VKGA 4L8RC 3B9PA 2KW0A 2UUCM 3HU2A 3T15A 1KFVA 2F5OA 3HKPA 3HJSA 4LCBA 4JI0M 1XNQM 1QDTA 3FTEA 2Q2EB 1OFHA 4MGIE 2OOBA 4DV3M 4ZPXA 3FRHA 4MH0E 2FE8A 2DENA 4DV6M 1X37A 1SXJA 1D0KA 3LQQA 1QZMA 3GLHE 3SMSA 3GLIB 5C18A 3U6EA 4AW4A 1XXHA 3HWSA 2X49A 5FTKA 3GO8A 1ZAEA 1NHGC 3GQ4A 3VK8A 1L2CA 4L15A 2G8LA 4G4QA 2JWSA 3Q8GA 4S12A 2KRUA 2XFSA 3SHFA 1RU3A 4GH9A 4JN6A 5EQTA 4G3OA 3E9SA 1WGNA 5FTLA 1PGYA 3FKEA 1ZQ9A 1K82A 1BVSA 5DFLA 2UXDM 3QYEA 3VK7A 4L78A 4Z6YA 2XZUA 1IY2A 3H4MA 5EJCA 2J7OA 3TWKA 2BNKA 2L7IA 5KPRA 1G8PA 5F3WA 2ZAMA 2YR0A 3FYCA 1MU5A 3L25A 1OAIA 2EKKA 1GLNA 1K3XA 2KHHA 5EP3A 5BPVA 3CGWA 2KDLA 4L16A 2K0BX 5JI3E 1Q02A 2DWLA 1N32M 4XGIA 1HT1E 1W5SA 2B3TA 5EP2A 1T3TA 5EXSA 5L8RF 3J81S 4DUYM 4G4NA 4DR1M 4NXNM 4LZJA 3RE8A 3ZC7B 3CTWB 3HJ8A 2RRUA 1Q3BA 1Z59A 1OFIA 3TQSA 2V1CA 1XMOM 4LF9M 4IJEA 2R4EA 1N36M 4LF6M 2LNHC 2X8AA 2JUJA 2QENA 2YFQA 4QHSA 1TH3A 4GKKM 3PNYA 3HX3A 1YUBA 1TTEA 2LTUA 3B89A 4AKHA 4JI1M 5E26A 2HCBA 1ORYB 3T6PA 4DV0M 4FCVA 4GITA 4LF5M 3U6SA 4JI4M 1A5TA 4IBDA 3KSXA 3KOZE 1IBMM 1QANA 3I51A 2NQ8C 2JY7A 2R45A 4LZZA 4JI3M 1S3SA 1W5TA 3A42A 3UK6A 1YSYA 3C3DA 3KSJA 3J80S 4OVZB 1R4GA 1IY0A 4IBGA 3BOSA 5FTJA 2C9CA 4BB9A 3RFWA 1R2ZA 2KNVA 1IBLM 1KYIA 1PRBA 4B7GA 2KXEA 4LF4M 5EP4A 4M9SA 3KP0E 5KPTA 1CUKA 2Y0QA 5FSWA 4AKGA 1JR3E 3GRVA 3KOXE 4F2LA 4R71A 2YQZA 1NY6A 5FTMA 1Z5AA 3F92A 2Y21A 4FWHA 3WHLA 1TR8A 2DAGA 3D8BA 3QWLA 4GHAA 3L26A 1NSFA 2DZLA 2X4AA 4K0KM 1GO5A 2EO2A 4WURA 3I4VA 2MGWA 1HNWM 1GABA 3L29A 4DV7M 4PDIA 3M6AA 4MGYE 4JI2M 4GIPA 4QHTA 3RGSA 3GRRA 4B3SM 1IXSB 2YNMD 1XMQM 4NRWA 5ITQA 4M0WA 2UUAM 1IM2A 3MK6A 4LJ4A 2K6BA 3SMPA 1VDDA 5C1BA 2LWXA 2UUBM 2QP9X 2QZ4A 1WHCA 2C9OA 2N35A 2E5LM 2LHGA 4QNRA 1E9SA 4AG6A 1GL7A 2M5ZA 2QHOB 3K92A 4FCWA 4MGZE 2CWBA 3GLGA 2C5RA 2V6ZM 4NSOB 4GHLA 4GRIA 4IJFA 2DVWB 3KW6A 4B7FA 4Q7JA 3GPUA 1DGBA 2VDBB 4D81A 2CP8A 3TWMA 2DWNA 2QBYA 2MR9A 2L4FA 4CJ6A 4LJ5A 2ZAOA 2D7EA 1AIPC 4KO8A 3RGPA 3A98B 4YHHM 1TDHA 3CF2A 4JI7M 3B7ZA 3NWLA 4CISA 3KS4A 3HZJA 2DHYA 3THGA 1NNJA 2RKOA 1EIJA 2CRUA 3KFUG 4R3DA 3DA1A 4OX9M 1NVMA 1L2DA 3C9PA 3K2LA 5BR8M 1R2YA 5ITRA 3JAMS 2V1UA 3M7GA 1XB2B 3PXGA 3T38A 3UJNA 3U5ZA 2F5QA 3PFIA 1F4IA 4Z8XA 2EJSA 1XWIA 4HEOA 1EFUB 4I4LA 4P16A 1QUTA 4MB7A 1ZMWA 1IXRC 1VEJA 1G4AE 3LVWA 1PM5A 4W5WA 4CIZA 5GKNA 2R62A 2QCUA 4RKUF 1HNXM 2DZNB 1OJLA 1QAMA 3EIHA 3L27A 5KPZA 3SC3A 3HJQA 3PNVA 4JV5M 5IT9S 4I5SA 1DGGA 2MJ5B 3UZUA 3U6MA 2W82A 3U60A 4IBCA 5ITXA 1IY1A 1DO0A 3SAWA 1E32A 4GKJM 1NNUC 1WR1B 1V92A 3SFZA 4B08A 1LV7A 2EUCA 1TF0B 1IFYA 3FYDA 4FWDA 2ZTCA 3HHZA 3J2PB 2L2DA 4IBJA 3VDUA 4KHPM 1SXJD 4FW9A 3GLIE 1PJIA 2HL7A 1TDZA 3U61A 3K9PA 4AG5A 2DWMA 2VF7A 3ILKA 2BWEA 1XXHB 2R18A 2I7NA 1HQYE 1R7RA 2KZUA 3E21A 3GLFA 1GJSA 2F5NA 4B3RM 3W0FA 3FUXA 4IIWA 1ZV1A 1L1TA 1Q3CA 3MHVC 2DWZB 2WSCF 3SAVA 1LTMA 5ITYA 1QAOA 1OTRA 2LHCA 2J5YA 3FD9A 4AZFA 4G4OA 2DAIA 4NL4H 5KQ8A 1Z5BA 2ERCA 4DV5M 1FNNA 3AOEC 4MM3B 4NSRA 2C99A 5IWAM 1FJGM 3HU3A 1GVNA 2KA6B 2LVAA 1V33A 2R65A 2KRKA 3I4YA 3LVVA 3SASA 2RGOA 1D0MA 3U5ZB 1VEKA 1L2BA 4LFAM 1PJTA 1PJQA 3GLIA 4LF8M 2D7GA 3KOWE 5IZ7D 4DR7M 2DNAA 4Y28F 3TE6A 2R4JA 2CV0A 3WHKA 4G6ZA 1QUSA 4B7HA 2P5TA 4DR5M 2Y20A 2Z4RA 1HQCA 3M0EA 2ZBKB 2CHGA 1QDRA 4RNAA 3GP1A 2LH0A 2XSZA 4A3VB 2DAKA 2JNHA 4LFBM 2XFTA 2QBYB 4AKIA 4R7GA 1HJPA 2ZM6M 2UXCM 1UFZA 4IBEA 2LVQD 2JP7A 2BJWA 2Z7JA 4JI8M 2UXBM 3U6QA 2CHVA 2DAMA 4PT5A 4PCZA 1HR0M 3FUVA 1GL6A 3SARA 4ITQA 1NJGA 2KNZA 3UGJA 1PJSA 1QYRA 1R6BX 2APLA 2K9DA 2DHRA 3LCUA 3LMMA 4QNMA 4YY3M 1WIVA 3JR5A 3TPZA 1DGFA 2MROB 3GPYA 2F5PA 2VIIA 3R8FA 1XXHE 4I81A 2O25A 4B3MM 1TH2A 2FH0A 3QAUA 2KZSA 1OIZA 4JYAM 4L6V6 1JR3A 1JQJC 2O5RA 1VEGA 1DO2A 2C96A 2JA2A 1NO1A 2G5GX 4DBGB 4LFCM 1QQWA 4HL4A 3H4JA 3VLFB 3GPPA 1SXJC 4GC9A 4MGHA 2CHQA 1JB0F 2DKLA 2HKJA 3VFDA 2D7HA 5LMUM 4DV4M 5DYIA 4NXMM 1SG9A 2H5XA 4LJAA 1IN6A 5EXPA 3W0LB 1QVRA 3TWLA 1MX0A 3I04M 3IG8A 2GNOA 2HHHM 4B3TM 2FNAA 3FTDA 4DV1M 2QPAA 1G71A 4DR6M 2L6OA 2JZ1A 3IG5A 3CF0A 1KSFX 1SXJB 4AQYM 3HHXA 1SXJE 4M0DA 2H1RA 4OW0A 3T1HM 4LRSA 4CGYB 4DR2M 3U61B 3GLHB 1J5EM 1QAQA 2VQEM 2QQ8A
chains in the Genus database with same CATH topology
3CF6E 3J7BA 3ZH9B 2DZOB 3U6DA 3AKZA 3T1YM 3GQ3A 2CFOA 5KQDA 4LGYA 3FTFA 3FUTA 1Z5CA 3GQ5A 1DGHB 5ITUA 5FTNA 3HHYA 3U6CA 2CV1A 2XEPA 4NOOB 1J09A 4REZA 4JI6M 4L4UA 5DNYA 1N78A 1NJFA 1G3IA 3NBIA 2Y0TA 2LXEA 1IQPA 2KEBA 1HT2E 3K1JA 3KXEC 5EXXA 3HHWA 1D2NA 3JR4A 3ZCBB 1Z6TA 2XF3A 1IBKM 7CATA 4D80A 1H6UA 3AOEA 1IN4A 3KP1E 1I4WA 2CUZA 1NHWC 2VQFM 2EA0A 3VDPA 3SHGB 4G4RA 1UM8A 1L1ZA 3U6OA 3AJIB 5H37D 4XBOA 1IN5A 2L09A 3KDSE 4GMQA 3Q8XA 4KODA 4CHTB 4II7A 4IBBA 5A2QS 3EIEA 4FD2A 3DZDA 4DUZM 4AI6A 3OTOM 3SYKA 3E4RA 4X66M 4JI5M 3GRYA 3K8ZA 4OU7A 3L28A 5IREB 4LG2A 3J7AS 3D8LA 1E94E 4X65M 3U6LA 4X64M 1IN8A 1EE8A 2FFJA 4LJ7A 3GLHA 1G59A 1TGUA 2XGNA 1J7KA 3KVWA 3AOGA 2F4VM 3PVSA 2L7HA 4LF7M 4QOSA 4FCTA 4EIWA 5LMNM 1TH4A 4M9XA 2J7NA 3SATA 1E9RA 2XSZD 3DOAA 4QOZC 4I8OA 3MJ5A 2CV2A 3AL0C 4FVMA 1Q39A 2Z4SA 2Z3XA 3KS8A 3GRUA 4FWGA 3SYLA 3C58A 4IBFA 1GKIA 5EXTA 5ITTA 2C98A 4GC5A 2OQ4A 3L2AA 1XHBA 1IN7A 5E6JA 1XNRM 4LRTA 1IXZA 3GLGB 4TUWA 3GLFB 3SAUA 3VKHA 1L8QA 4BLCA 4NRVA 4LJ6A 2CE7A 3R9XB 4IBKA 4DR4M 4LGMA 1N75A 4PD2A 4JXJA 1C1KA 4BBAA 2XZFA 5KO3A 4DR3M 3FTCA 1DGHA 3A45A 5JI2E 1G41A 2ZANA 2UU9M 2F5SA 2R46A 2RGHA 4LJ8A 4RF0A 1YE9A 4OVZA 3A46A 3HU1A 4PDGA 4WW0A 2AHMA 2FOIC 3AFHA 3FUUA 2DXIA 5EP1A 1PJJA 2CEAA 2K47A 3UMMA 1I94M 3TL4X 2I7PA 1JR3D 3KOYE 8CATA 4KLNA 2XLJA 1HNZM 1WXQA 3GPXA 1NY5A 1N77A 3FUWA 4LY6A 4IBIA 1N33M 2XH9A 3AV0A 4D82A 4RF1A 2A5YB 4HLQA 4M9ZA 3J27B 3SBJA 1N34M 3LQRA 4X62M 1XC8A 3HGIA 3DFZA 2OPFA 3U6PA 2BJVA 4MGKE 2M60A 3U60B 4DV2M 4LJ9A 5ITXE 5DYGA 1K3WA 3VKGA 4L8RC 3B9PA 2KW0A 2UUCM 3HU2A 3T15A 1KFVA 2F5OA 3HKPA 3HJSA 4LCBA 4JI0M 1XNQM 3FTEA 2Q2EB 1OFHA 4MGIE 4DV3M 4ZPXA 4MH0E 2FE8A 4DV6M 1X37A 1SXJA 3LQQA 1QZMA 3SMSA 3GLIB 3U6EA 5C18A 4AW4A 1XXHA 3HWSA 2X49A 5FTKA 3GO8A 1ZAEA 1NHGC 3GQ4A 3VK8A 1L2CA 4L15A 2G8LA 4G4QA 4S12A 2KRUA 2XFSA 3SHFA 4GH9A 4JN6A 5EQTA 3E9SA 5FTLA 3FKEA 1ZQ9A 1K82A 2UXDM 3VK7A 4L78A 4Z6YA 2XZUA 1IY2A 3H4MA 5EJCA 2J7OA 3TWKA 2BNKA 2L7IA 5KPRA 1G8PA 5F3WA 2ZAMA 2YR0A 3FYCA 1MU5A 3L25A 1GLNA 1K3XA 5EP3A 5BPVA 4L16A 5JI3E 1N32M 2DWLA 4XGIA 1HT1E 1W5SA 5EP2A 1T3TA 5EXSA 3J81S 4DUYM 4G4NA 4DR1M 4NXNM 4LZJA 3RE8A 3ZC7B 3CTWB 3HJ8A 1Q3BA 1Z59A 1OFIA 3TQSA 2V1CA 1XMOM 4LF9M 4IJEA 2R4EA 1N36M 4LF6M 2LNHC 2X8AA 2QENA 4QHSA 2YFQA 4GKKM 1TH3A 3PNYA 1YUBA 4AKHA 4JI1M 5E26A 2HCBA 1ORYB 4DV0M 4FCVA 4GITA 4LF5M 3U6SA 4JI4M 4IBDA 3KSXA 3KOZE 1IBMM 1QANA 3I51A 2NQ8C 4LZZA 2R45A 4JI3M 3UK6A 1S3SA 1W5TA 3A42A 5FLXS 1YSYA 3KSJA 3J80S 4OVZB 1IY0A 4IBGA 3BOSA 5FTJA 2C9CA 4BB9A 3RFWA 1R2ZA 1IBLM 4NXMM 1KYIA 4B7GA 2KXEA 4LF4M 5EP4A 4M9SA 3KP0E 5KPTA 4AKGA 2Y0QA 5FSWA 3GRVA 3KOXE 2YQZA 1NY6A 5FTMA 1Z5AA 2Y21A 4FWHA 3WHLA 3D8BA 3QWLA 4GHAA 3L26A 1NSFA 2X4AA 4K0KM 2EO2A 4WURA 3I4VA 1HNWM 3L29A 4DV7M 4PDIA 3M6AA 4MGYE 4JI2M 4GIPA 4QHTA 3RGSA 3GRRA 4B3SM 1IXSB 2YNMD 1XMQM 4NRWA 5ITQA 4M0WA 2UUAM 1IM2A 3MK6A 4LJ4A 3SMPA 1VDDA 5C1BA 2LWXA 2UUBM 2QP9X 2QZ4A 2C9OA 2E5LM 4QNRA 1E9SA 4AG6A 1GL7A 2M5ZA 4FCWA 4MGZE 3GLGA 2C5RA 2V6ZM 4NSOB 4GHLA 4GRIA 4IJFA 2DVWB 3KW6A 4B7FA 3GPUA 1DGBA 2DWNA 4D81A 2QBYA 3TWMA 4LJ5A 2ZAOA 2D7EA 4KO8A 3RGPA 3A98B 4YHHM 1TDHA 3CF2A 4JI7M 3NWLA 4CISA 3KS4A 1NNJA 3THGA 2RKOA 3KFUG 4R3DA 3DA1A 4OX9M 1NVMA 1L2DA 3K2LA 5BR8M 1R2YA 5ITRA 3JAMS 2V1UA 3M7GA 3PXGA 3T38A 3UJNA 3U5ZA 2F5QA 3PFIA 4Z8XA 1XWIA 4I4LA 4P16A 4MB7A 1IXRC 3LVWA 1G4AE 1PM5A 4W5WA 5GKNA 2R62A 2QCUA 1HNXM 2DZNB 1OJLA 1QAMA 3EIHA 3L27A 5KPZA 3SC3A 3HJQA 3PNVA 4JV5M 5IT9S 4I5SA 1DGGA 3UZUA 3U6MA 2W82A 3U60A 4IBCA 5ITXA 1IY1A 1DO0A 3SAWA 1E32A 4GKJM 1NNUC 3SFZA 4B08A 1LV7A 2EUCA 3FYDA 4FWDA 3HHZA 3J2PB 4IBJA 3VDUA 4KHPM 1SXJD 4FW9A 1PJIA 2HL7A 1TDZA 3U61A 4AG5A 2DWMA 3ILKA 1XXHB 2R18A 2I7NA 1HQYE 1R7RA 2KZUA 3GLFA 2F5NA 4B3RM 3W0FA 3FUXA 4IIWA 1L1TA 1Q3CA 3MHVC 2DWZB 3SAVA 5ITYA 1QAOA 3FD9A 4AZFA 4G4OA 4NL4H 5KQ8A 1Z5BA 2ERCA 4DV5M 1FNNA 3AOEC 4MM3B 4NSRA 2C99A 5IWAM 1FJGM 3HU3A 1GVNA 2KA6B 3LVVA 3SASA 2R65A 2KRKA 3I4YA 2RGOA 3U5ZB 1L2BA 4LFAM 3GLIA 4LF8M 2D7GA 3KOWE 5IZ7D 4DR7M 3TE6A 2R4JA 2CV0A 3WHKA 4G6ZA 4B7HA 2P5TA 4DR5M 2Y20A 2Z4RA 1HQCA 3M0EA 2ZBKB 2CHGA 4RNAA 3GP1A 2LH0A 2XSZA 4A3VB 4LFBM 2XFTA 2QBYB 4AKIA 4R7GA 2ZM6M 2UXCM 4IBEA 2BJWA 2Z7JA 4JI8M 2UXBM 3U6QA 2CHVA 4PT5A 4PCZA 1HR0M 3SARA 3FUVA 1GL6A 4ITQA 1NJGA 3UGJA 1QYRA 1R6BX 2DHRA 4QNMA 3LMMA 4YY3M 3JR5A 3TPZA 1DGFA 3GPYA 2F5PA 2VIIA 3R8FA 4I81A 4B3MM 1TH2A 3QAUA 2KZSA 4JYAM 1JR3A 1JQJC 2O5RA 1DO2A 2C96A 2JA2A 2G5GX 4LFCM 1QQWA 4HL4A 3VLFB 3GPPA 1SXJC 4GC9A 4MGHA 2CHQA 2HKJA 3VFDA 5LMUM 4DV4M 2D7HA 5DYIA 4LJAA 5EXPA 1IN6A 3W0LB 1QVRA 3TWLA 1MX0A 3IG8A 2HHHM 4B3TM 2FNAA 3FTDA 4DV1M 2QPAA 4DR6M 2L6OA 3IG5A 3CF0A 1KSFX 1SXJB 4AQYM 3HHXA 1SXJE 4M0DA 2H1RA 4OW0A 3T1HM 4LRSA 4CGYB 4DR2M 3U61B 3GLHB 1J5EM 1QAQA 2VQEM 3K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T15 A;  4W5W A;  3THG A; 
#chains in the Genus database with same CATH topology
 3CF6 E;  3J7B A;  3ZH9 B;  2DZO B;  3U6D A;  3AKZ A;  3T1Y M;  3GQ3 A;  2CFO A;  5KQD A;  4LGY A;  3BBZ A;  3FTF A;  3FUT A;  1Z5C A;  3GQ5 A;  1DGH B;  5ITU A;  2G3Q A;  1MN3 A;  5FTN A;  3HHY A;  1DV0 A;  3U6C A;  2JY6 B;  2CV1 A;  2XEP A;  4NOO B;  1J09 A;  3I01 M;  4REZ A;  4JI6 M;  1AUA A;  4XK8 F;  2JY5 A;  4L4U A;  5DNY A;  1ZMV A;  1N78 A;  1NJF A;  1G3I A;  2Y0T A;  3NBI A;  2LXE A;  1IQP A;  2KEB A;  1HT2 E;  3K1J A;  3KXE C;  5EXX A;  3HHW A;  1D2N A;  3JR4 A;  3ZCB B;  1Z6T A;  2OO9 A;  1VQ1 A;  3B7Q A;  2XF3 A;  1IBK M;  2EKF A;  7CAT A;  4D80 A;  1H6U A;  3AOE A;  1IN4 A;  3KP1 E;  1I4W A;  2CUZ A;  1NHW C;  2VQF M;  4UN2 B;  2EA0 A;  3VDP A;  3SHG B;  4G4R A;  1UM8 A;  1L1Z A;  3U6O A;  2KNA A;  3AJI B;  5H37 D;  4XBO A;  1IN5 A;  2L09 A;  3KDS E;  2HAK A;  4GMQ A;  3Q8X A;  4KOD A;  2LBC A;  4II7 A;  4CHT B;  4IBB A;  5A2Q S;  3EIE A;  4FD2 A;  2JY8 A;  3DZD A;  3W68 A;  1IXS A;  4DUZ M;  4AI6 A;  1V34 A;  3OTO M;  3SYK A;  3E4R A;  1GJT A;  4X66 M;  2Z8Y M;  2QNJ A;  1C7Y A;  3GRY A;  3K8Z A;  4OU7 A;  3L28 A;  1NV8 A;  5IRE B;  4P17 A;  4JI5 M;  4LG2 A;  3J7A S;  3D8L A;  1E94 E;  4X65 M;  3U6L A;  4X64 M;  1ZMU A;  1IN8 A;  1EE8 A;  2FFJ A;  2LVN C;  2ZTD A;  3NBX X;  3FRI A;  4LJ7 A;  4NC6 A;  2DAE A;  3GLH A;  1G59 A;  1TGU A;  2XGN A;  1J7K A;  1Y8G A;  2QSF X;  3KVW A;  2HWJ A;  2WSE F;  3AOG A;  1VG5 A;  3B74 A;  3PVS A;  2BWB A;  2L7H A;  4LF7 M;  2F4V M;  4QOS A;  4FCT A;  1P3Q Q;  3QYB A;  2FS1 A;  3E46 A;  4EIW A;  5LMN M;  1TH4 A;  4M9X A;  2J7N A;  2GQF A;  1E9R A;  2XSZ D;  3DOA A;  3SAT A;  4I8O A;  4QOZ C;  2JXN A;  2R6F A;  3MJ5 A;  2CV2 A;  3AL0 C;  3MMP A;  3B7N A;  4FVM A;  1Q39 A;  2Z4S A;  3V76 A;  2O01 F;  2Z3X A;  5FLX S;  2MH8 A;  3KS8 A;  1MJG M;  1OQY A;  3GRU A;  1WJ7 A;  4FWG A;  3SYL A;  3C58 A;  4IBF A;  1GKI A;  5EXT A;  3IEC A;  5ITT A;  2C98 A;  4GC5 A;  2OQ4 A;  3L2A A;  2LVP C;  3ZQJ A;  1XHB A;  1IN7 A;  5E6J A;  1XNR M;  4LRT A;  1IXZ A;  3GLF E;  3GLG B;  4TUW A;  3GLG E;  3GLF B;  3SAU A;  3K9O A;  1OIP A;  3VKH A;  1L8Q A;  2WSF F;  3C3E A;  4BLC A;  4NRV A;  4LJ6 A;  2CE7 A;  3R9X B;  4IBK A;  2R0I A;  4DR4 M;  4LGM A;  1N75 A;  2JZ0 A;  4PD2 A;  1VDL A;  1C1K A;  2LVO C;  4JXJ A;  4BBA A;  2XZF A;  5KO3 A;  4DR3 M;  3HY5 A;  3FE3 A;  2OOA A;  1YLA A;  3FTC A;  1DGH A;  1OKS A;  3W67 A;  3A45 A;  3LW5 F;  5JI2 E;  1G41 A;  2ZAN A;  2UU9 M;  3IHP A;  1D0L A;  2F5S A;  2R46 A;  2RGH A;  4LJ8 A;  4RF0 A;  1YE9 A;  4ANR A;  4OVZ A;  2WZJ A;  3HU1 A;  4GEW A;  4PDG A;  4WW0 A;  3A46 A;  2AHM A;  2FOI C;  3AFH A;  3FUU A;  3LCV B;  2DXI A;  1OAO C;  5EP1 A;  1PJJ A;  1T6O A;  2CEA A;  2K47 A;  4F1I A;  4KT0 F;  3UMM A;  1N34 M;  1I94 M;  2VF8 A;  3TL4 X;  2I7P A;  1JR3 D;  3KOY E;  8CAT A;  4KLN A;  2XLJ A;  1HNZ M;  1WXQ A;  3GPX A;  1NY5 A;  2R44 A;  1NV9 A;  1N77 A;  3FUW A;  4LY6 A;  3BXW A;  4IBI A;  1N33 M;  1WGL A;  2XH9 A;  3AV0 A;  4D82 A;  2DI0 A;  2A5Y B;  2L4E A;  4HLQ A;  3J27 B;  4M9Z A;  4RF1 A;  4WP2 A;  3SBJ A;  3LQR A;  4X62 M;  1XC8 A;  1T43 A;  3HGI A;  1R5L A;  3DFZ A;  2OPF A;  2BJV A;  4MGK E;  2M60 A;  1QZE A;  4DV2 M;  4LJ9 A;  3U6P A;  3U60 B;  5ITX E;  5DYG A;  1K3W A;  3VKG A;  4L8R C;  3B9P A;  2KW0 A;  2UUC M;  3HU2 A;  3T15 A;  1KFV A;  2F5O A;  3HKP A;  3HJS A;  4LCB A;  4JI0 M;  1XNQ M;  1QDT A;  3FTE A;  2Q2E B;  1OFH A;  4MGI E;  2OOB A;  4DV3 M;  4ZPX A;  3FRH A;  4MH0 E;  2FE8 A;  2DEN A;  4DV6 M;  1X37 A;  1SXJ A;  1D0K A;  3LQQ A;  1QZM A;  3GLH E;  3SMS A;  3GLI B;  5C18 A;  3U6E A;  4AW4 A;  1XXH A;  3HWS A;  2X49 A;  5FTK A;  3GO8 A;  1ZAE A;  1NHG C;  3GQ4 A;  3VK8 A;  1L2C A;  4L15 A;  2G8L A;  4G4Q A;  2JWS A;  3Q8G A;  4S12 A;  2KRU A;  2XFS A;  3SHF A;  1RU3 A;  4GH9 A;  4JN6 A;  5EQT A;  4G3O A;  3E9S A;  1WGN A;  5FTL A;  1PGY A;  3FKE A;  1ZQ9 A;  1K82 A;  1BVS A;  5DFL A;  2UXD M;  3QYE A;  3VK7 A;  4L78 A;  4Z6Y A;  2XZU A;  1IY2 A;  3H4M A;  5EJC A;  2J7O A;  3TWK A;  2BNK A;  2L7I A;  5KPR A;  1G8P A;  5F3W A;  2ZAM A;  2YR0 A;  3FYC A;  1MU5 A;  3L25 A;  1OAI A;  2EKK A;  1GLN A;  1K3X A;  2KHH A;  5EP3 A;  5BPV A;  3CGW A;  2KDL A;  4L16 A;  2K0B X;  5JI3 E;  1Q02 A;  2DWL A;  1N32 M;  4XGI A;  1HT1 E;  1W5S A;  2B3T A;  5EP2 A;  1T3T A;  5EXS A;  5L8R F;  3J81 S;  4DUY M;  4G4N A;  4DR1 M;  4NXN M;  4LZJ A;  3RE8 A;  3ZC7 B;  3CTW B;  3HJ8 A;  2RRU A;  1Q3B A;  1Z59 A;  1OFI A;  3TQS A;  2V1C A;  1XMO M;  4LF9 M;  4IJE A;  2R4E A;  1N36 M;  4LF6 M;  2LNH C;  2X8A A;  2JUJ A;  2QEN A;  2YFQ A;  4QHS A;  1TH3 A;  4GKK M;  3PNY A;  3HX3 A;  1YUB A;  1TTE A;  2LTU A;  3B89 A;  4AKH A;  4JI1 M;  5E26 A;  2HCB A;  1ORY B;  3T6P A;  4DV0 M;  4FCV A;  4GIT A;  4LF5 M;  3U6S A;  4JI4 M;  1A5T A;  4IBD A;  3KSX A;  3KOZ E;  1IBM M;  1QAN A;  3I51 A;  2NQ8 C;  2JY7 A;  2R45 A;  4LZZ A;  4JI3 M;  1S3S A;  1W5T A;  3A42 A;  3UK6 A;  1YSY A;  3C3D A;  3KSJ A;  3J80 S;  4OVZ B;  1R4G A;  1IY0 A;  4IBG A;  3BOS A;  5FTJ A;  2C9C A;  4BB9 A;  3RFW A;  1R2Z A;  2KNV A;  1IBL M;  1KYI A;  1PRB A;  4B7G A;  2KXE A;  4LF4 M;  5EP4 A;  4M9S A;  3KP0 E;  5KPT A;  1CUK A;  2Y0Q A;  5FSW A;  4AKG A;  1JR3 E;  3GRV A;  3KOX E;  4F2L A;  4R71 A;  2YQZ A;  1NY6 A;  5FTM A;  1Z5A A;  3F92 A;  2Y21 A;  4FWH A;  3WHL A;  1TR8 A;  2DAG A;  3D8B A;  3QWL A;  4GHA A;  3L26 A;  1NSF A;  2DZL A;  2X4A A;  4K0K M;  1GO5 A;  2EO2 A;  4WUR A;  3I4V A;  2MGW A;  1HNW M;  1GAB A;  3L29 A;  4DV7 M;  4PDI A;  3M6A A;  4MGY E;  4JI2 M;  4GIP A;  4QHT A;  3RGS A;  3GRR A;  4B3S M;  1IXS B;  2YNM D;  1XMQ M;  4NRW A;  5ITQ A;  4M0W A;  2UUA M;  1IM2 A;  3MK6 A;  4LJ4 A;  2K6B A;  3SMP A;  1VDD A;  5C1B A;  2LWX A;  2UUB M;  2QP9 X;  2QZ4 A;  1WHC A;  2C9O A;  2N35 A;  2E5L M;  2LHG A;  4QNR A;  1E9S A;  4AG6 A;  1GL7 A;  2M5Z A;  2QHO B;  3K92 A;  4FCW A;  4MGZ E;  2CWB A;  3GLG A;  2C5R A;  2V6Z M;  4NSO B;  4GHL A;  4GRI A;  4IJF A;  2DVW B;  3KW6 A;  4B7F A;  4Q7J A;  3GPU A;  1DGB A;  2VDB B;  4D81 A;  2CP8 A;  3TWM A;  2DWN A;  2QBY A;  2MR9 A;  2L4F A;  4CJ6 A;  4LJ5 A;  2ZAO A;  2D7E A;  1AIP C;  4KO8 A;  3RGP A;  3A98 B;  4YHH M;  1TDH A;  3CF2 A;  4JI7 M;  3B7Z A;  3NWL A;  4CIS A;  3KS4 A;  3HZJ A;  2DHY A;  3THG A;  1NNJ A;  2RKO A;  1EIJ A;  2CRU A;  3KFU G;  4R3D A;  3DA1 A;  4OX9 M;  1NVM A;  1L2D A;  3C9P A;  3K2L A;  5BR8 M;  1R2Y A;  5ITR A;  3JAM S;  2V1U A;  3M7G A;  1XB2 B;  3PXG A;  3T38 A;  3UJN A;  3U5Z A;  2F5Q A;  3PFI A;  1F4I A;  4Z8X A;  2EJS A;  1XWI A;  4HEO A;  1EFU B;  4I4L A;  4P16 A;  1QUT A;  4MB7 A;  1ZMW A;  1IXR C;  1VEJ A;  1G4A E;  3LVW A;  1PM5 A;  4W5W A;  4CIZ A;  5GKN A;  2R62 A;  2QCU A;  4RKU F;  1HNX M;  2DZN B;  1OJL A;  1QAM A;  3EIH A;  3L27 A;  5KPZ A;  3SC3 A;  3HJQ A;  3PNV A;  4JV5 M;  5IT9 S;  4I5S A;  1DGG A;  2MJ5 B;  3UZU A;  3U6M A;  2W82 A;  3U60 A;  4IBC A;  5ITX A;  1IY1 A;  1DO0 A;  3SAW A;  1E32 A;  4GKJ M;  1NNU C;  1WR1 B;  1V92 A;  3SFZ A;  4B08 A;  1LV7 A;  2EUC A;  1TF0 B;  1IFY A;  3FYD A;  4FWD A;  2ZTC A;  3HHZ A;  3J2P B;  2L2D A;  4IBJ A;  3VDU A;  4KHP M;  1SXJ D;  4FW9 A;  3GLI E;  1PJI A;  2HL7 A;  1TDZ A;  3U61 A;  3K9P A;  4AG5 A;  2DWM A;  2VF7 A;  3ILK A;  2BWE A;  1XXH B;  2R18 A;  2I7N A;  1HQY E;  1R7R A;  2KZU A;  3E21 A;  3GLF A;  1GJS A;  2F5N A;  4B3R M;  3W0F A;  3FUX A;  4IIW A;  1ZV1 A;  1L1T A;  1Q3C A;  3MHV C;  2DWZ B;  2WSC F;  3SAV A;  1LTM A;  5ITY A;  1QAO A;  1OTR A;  2LHC A;  2J5Y A;  3FD9 A;  4AZF A;  4G4O A;  2DAI A;  4NL4 H;  5KQ8 A;  1Z5B A;  2ERC A;  4DV5 M;  1FNN A;  3AOE C;  4MM3 B;  4NSR A;  2C99 A;  5IWA M;  1FJG M;  3HU3 A;  1GVN A;  2KA6 B;  2LVA A;  1V33 A;  2R65 A;  2KRK A;  3I4Y A;  3LVV A;  3SAS A;  2RGO A;  1D0M A;  3U5Z B;  1VEK A;  1L2B A;  4LFA M;  1PJT A;  1PJQ A;  3GLI A;  4LF8 M;  2D7G A;  3KOW E;  5IZ7 D;  4DR7 M;  2DNA A;  4Y28 F;  3TE6 A;  2R4J A;  2CV0 A;  3WHK A;  4G6Z A;  1QUS A;  4B7H A;  2P5T A;  4DR5 M;  2Y20 A;  2Z4R A;  1HQC A;  3M0E A;  2ZBK B;  2CHG A;  1QDR A;  4RNA A;  3GP1 A;  2LH0 A;  2XSZ A;  4A3V B;  2DAK A;  2JNH A;  4LFB M;  2XFT A;  2QBY B;  4AKI A;  4R7G A;  1HJP A;  2ZM6 M;  2UXC M;  1UFZ A;  4IBE A;  2LVQ D;  2JP7 A;  2BJW A;  2Z7J A;  4JI8 M;  2UXB M;  3U6Q A;  2CHV A;  2DAM A;  4PT5 A;  4PCZ A;  1HR0 M;  3FUV A;  1GL6 A;  3SAR A;  4ITQ A;  1NJG A;  2KNZ A;  3UGJ A;  1PJS A;  1QYR A;  1R6B X;  2APL A;  2K9D A;  2DHR A;  3LCU A;  3LMM A;  4QNM A;  4YY3 M;  1WIV A;  3JR5 A;  3TPZ A;  1DGF A;  2MRO B;  3GPY A;  2F5P A;  2VII A;  3R8F A;  1XXH E;  4I81 A;  2O25 A;  4B3M M;  1TH2 A;  2FH0 A;  3QAU A;  2KZS A;  1OIZ A;  4JYA M;  4L6V 6;  1JR3 A;  1JQJ C;  2O5R A;  1VEG A;  1DO2 A;  2C96 A;  2JA2 A;  1NO1 A;  2G5G X;  4DBG B;  4LFC M;  1QQW A;  4HL4 A;  3H4J A;  3VLF B;  3GPP A;  1SXJ C;  4GC9 A;  4MGH A;  2CHQ A;  1JB0 F;  2DKL A;  2HKJ A;  3VFD A;  2D7H A;  5LMU M;  4DV4 M;  5DYI A;  4NXM M;  1SG9 A;  2H5X A;  4LJA A;  1IN6 A;  5EXP A;  3W0L B;  1QVR A;  3TWL A;  1MX0 A;  3I04 M;  3IG8 A;  2GNO A;  2HHH M;  4B3T M;  2FNA A;  3FTD A;  4DV1 M;  2QPA A;  1G71 A;  4DR6 M;  2L6O A;  2JZ1 A;  3IG5 A;  3CF0 A;  1KSF X;  1SXJ B;  4AQY M;  3HHX A;  1SXJ E;  4M0D A;  2H1R A;  4OW0 A;  3T1H M;  4LRS A;  4CGY B;  4DR2 M;  3U61 B;  3GLH B;  1J5E M;  1QAQ A;  2VQE M;  2QQ8 A; 
#chains in the Genus database with same CATH homology
 3CF6 E;  3J7B A;  3ZH9 B;  2DZO B;  3U6D A;  3AKZ A;  3T1Y M;  3GQ3 A;  2CFO A;  5KQD A;  4LGY A;  3FTF A;  3FUT A;  1Z5C A;  3GQ5 A;  1DGH B;  5ITU A;  5FTN A;  3HHY A;  3U6C A;  2CV1 A;  2XEP A;  4NOO B;  1J09 A;  4REZ A;  4JI6 M;  4L4U A;  5DNY A;  1N78 A;  1NJF A;  1G3I A;  3NBI A;  2Y0T A;  2LXE A;  1IQP A;  2KEB A;  1HT2 E;  3K1J A;  3KXE C;  5EXX A;  3HHW A;  1D2N A;  3JR4 A;  3ZCB B;  1Z6T A;  2XF3 A;  1IBK M;  7CAT A;  4D80 A;  1H6U A;  3AOE A;  1IN4 A;  3KP1 E;  1I4W A;  2CUZ A;  1NHW C;  2VQF M;  2EA0 A;  3VDP A;  3SHG B;  4G4R A;  1UM8 A;  1L1Z A;  3U6O A;  3AJI B;  5H37 D;  4XBO A;  1IN5 A;  2L09 A;  3KDS E;  4GMQ A;  3Q8X A;  4KOD A;  4CHT B;  4II7 A;  4IBB A;  5A2Q S;  3EIE A;  4FD2 A;  3DZD A;  4DUZ M;  4AI6 A;  3OTO M;  3SYK A;  3E4R A;  4X66 M;  4JI5 M;  3GRY A;  3K8Z A;  4OU7 A;  3L28 A;  5IRE B;  4LG2 A;  3J7A S;  3D8L A;  1E94 E;  4X65 M;  3U6L A;  4X64 M;  1IN8 A;  1EE8 A;  2FFJ A;  4LJ7 A;  3GLH A;  1G59 A;  1TGU A;  2XGN A;  1J7K A;  3KVW A;  3AOG A;  2F4V M;  3PVS A;  2L7H A;  4LF7 M;  4QOS A;  4FCT A;  4EIW A;  5LMN M;  1TH4 A;  4M9X A;  2J7N A;  3SAT A;  1E9R A;  2XSZ D;  3DOA A;  4QOZ C;  4I8O A;  3MJ5 A;  2CV2 A;  3AL0 C;  4FVM A;  1Q39 A;  2Z4S A;  2Z3X A;  3KS8 A;  3GRU A;  4FWG A;  3SYL A;  3C58 A;  4IBF A;  1GKI A;  5EXT A;  5ITT A;  2C98 A;  4GC5 A;  2OQ4 A;  3L2A A;  1XHB A;  1IN7 A;  5E6J A;  1XNR M;  4LRT A;  1IXZ A;  3GLG B;  4TUW A;  3GLF B;  3SAU A;  3VKH A;  1L8Q A;  4BLC A;  4NRV A;  4LJ6 A;  2CE7 A;  3R9X B;  4IBK A;  4DR4 M;  4LGM A;  1N75 A;  4PD2 A;  4JXJ A;  1C1K A;  4BBA A;  2XZF A;  5KO3 A;  4DR3 M;  3FTC A;  1DGH A;  3A45 A;  5JI2 E;  1G41 A;  2ZAN A;  2UU9 M;  2F5S A;  2R46 A;  2RGH A;  4LJ8 A;  4RF0 A;  1YE9 A;  4OVZ A;  3A46 A;  3HU1 A;  4PDG A;  4WW0 A;  2AHM A;  2FOI C;  3AFH A;  3FUU A;  2DXI A;  5EP1 A;  1PJJ A;  2CEA A;  2K47 A;  3UMM A;  1I94 M;  3TL4 X;  2I7P A;  1JR3 D;  3KOY E;  8CAT A;  4KLN A;  2XLJ A;  1HNZ M;  1WXQ A;  3GPX A;  1NY5 A;  1N77 A;  3FUW A;  4LY6 A;  4IBI A;  1N33 M;  2XH9 A;  3AV0 A;  4D82 A;  4RF1 A;  2A5Y B;  4HLQ A;  4M9Z A;  3J27 B;  3SBJ A;  1N34 M;  3LQR A;  4X62 M;  1XC8 A;  3HGI A;  3DFZ A;  2OPF A;  3U6P A;  2BJV A;  4MGK E;  2M60 A;  3U60 B;  4DV2 M;  4LJ9 A;  5ITX E;  5DYG A;  1K3W A;  3VKG A;  4L8R C;  3B9P A;  2KW0 A;  2UUC M;  3HU2 A;  3T15 A;  1KFV A;  2F5O A;  3HKP A;  3HJS A;  4LCB A;  4JI0 M;  1XNQ M;  3FTE A;  2Q2E B;  1OFH A;  4MGI E;  4DV3 M;  4ZPX A;  4MH0 E;  2FE8 A;  4DV6 M;  1X37 A;  1SXJ A;  3LQQ A;  1QZM A;  3SMS A;  3GLI B;  3U6E A;  5C18 A;  4AW4 A;  1XXH A;  3HWS A;  2X49 A;  5FTK A;  3GO8 A;  1ZAE A;  1NHG C;  3GQ4 A;  3VK8 A;  1L2C A;  4L15 A;  2G8L A;  4G4Q A;  4S12 A;  2KRU A;  2XFS A;  3SHF A;  4GH9 A;  4JN6 A;  5EQT A;  3E9S A;  5FTL A;  3FKE A;  1ZQ9 A;  1K82 A;  2UXD M;  3VK7 A;  4L78 A;  4Z6Y A;  2XZU A;  1IY2 A;  3H4M A;  5EJC A;  2J7O A;  3TWK A;  2BNK A;  2L7I A;  5KPR A;  1G8P A;  5F3W A;  2ZAM A;  2YR0 A;  3FYC A;  1MU5 A;  3L25 A;  1GLN A;  1K3X A;  5EP3 A;  5BPV A;  4L16 A;  5JI3 E;  1N32 M;  2DWL A;  4XGI A;  1HT1 E;  1W5S A;  5EP2 A;  1T3T A;  5EXS A;  3J81 S;  4DUY M;  4G4N A;  4DR1 M;  4NXN M;  4LZJ A;  3RE8 A;  3ZC7 B;  3CTW B;  3HJ8 A;  1Q3B A;  1Z59 A;  1OFI A;  3TQS A;  2V1C A;  1XMO M;  4LF9 M;  4IJE A;  2R4E A;  1N36 M;  4LF6 M;  2LNH C;  2X8A A;  2QEN A;  4QHS A;  2YFQ A;  4GKK M;  1TH3 A;  3PNY A;  1YUB A;  4AKH A;  4JI1 M;  5E26 A;  2HCB A;  1ORY B;  4DV0 M;  4FCV A;  4GIT A;  4LF5 M;  3U6S A;  4JI4 M;  4IBD A;  3KSX A;  3KOZ E;  1IBM M;  1QAN A;  3I51 A;  2NQ8 C;  4LZZ A;  2R45 A;  4JI3 M;  3UK6 A;  1S3S A;  1W5T A;  3A42 A;  5FLX S;  1YSY A;  3KSJ A;  3J80 S;  4OVZ B;  1IY0 A;  4IBG A;  3BOS A;  5FTJ A;  2C9C A;  4BB9 A;  3RFW A;  1R2Z A;  1IBL M;  4NXM M;  1KYI A;  4B7G A;  2KXE A;  4LF4 M;  5EP4 A;  4M9S A;  3KP0 E;  5KPT A;  4AKG A;  2Y0Q A;  5FSW A;  3GRV A;  3KOX E;  2YQZ A;  1NY6 A;  5FTM A;  1Z5A A;  2Y21 A;  4FWH A;  3WHL A;  3D8B A;  3QWL A;  4GHA A;  3L26 A;  1NSF A;  2X4A A;  4K0K M;  2EO2 A;  4WUR A;  3I4V A;  1HNW M;  3L29 A;  4DV7 M;  4PDI A;  3M6A A;  4MGY E;  4JI2 M;  4GIP A;  4QHT A;  3RGS A;  3GRR A;  4B3S M;  1IXS B;  2YNM D;  1XMQ M;  4NRW A;  5ITQ A;  4M0W A;  2UUA M;  1IM2 A;  3MK6 A;  4LJ4 A;  3SMP A;  1VDD A;  5C1B A;  2LWX A;  2UUB M;  2QP9 X;  2QZ4 A;  2C9O A;  2E5L M;  4QNR A;  1E9S A;  4AG6 A;  1GL7 A;  2M5Z A;  4FCW A;  4MGZ E;  3GLG A;  2C5R A;  2V6Z M;  4NSO B;  4GHL A;  4GRI A;  4IJF A;  2DVW B;  3KW6 A;  4B7F A;  3GPU A;  1DGB A;  2DWN A;  4D81 A;  2QBY A;  3TWM A;  4LJ5 A;  2ZAO A;  2D7E A;  4KO8 A;  3RGP A;  3A98 B;  4YHH M;  1TDH A;  3CF2 A;  4JI7 M;  3NWL A;  4CIS A;  3KS4 A;  1NNJ A;  3THG A;  2RKO A;  3KFU G;  4R3D A;  3DA1 A;  4OX9 M;  1NVM A;  1L2D A;  3K2L A;  5BR8 M;  1R2Y A;  5ITR A;  3JAM S;  2V1U A;  3M7G A;  3PXG A;  3T38 A;  3UJN A;  3U5Z A;  2F5Q A;  3PFI A;  4Z8X A;  1XWI A;  4I4L A;  4P16 A;  4MB7 A;  1IXR C;  3LVW A;  1G4A E;  1PM5 A;  4W5W A;  5GKN A;  2R62 A;  2QCU A;  1HNX M;  2DZN B;  1OJL A;  1QAM A;  3EIH A;  3L27 A;  5KPZ A;  3SC3 A;  3HJQ A;  3PNV A;  4JV5 M;  5IT9 S;  4I5S A;  1DGG A;  3UZU A;  3U6M A;  2W82 A;  3U60 A;  4IBC A;  5ITX A;  1IY1 A;  1DO0 A;  3SAW A;  1E32 A;  4GKJ M;  1NNU C;  3SFZ A;  4B08 A;  1LV7 A;  2EUC A;  3FYD A;  4FWD A;  3HHZ A;  3J2P B;  4IBJ A;  3VDU A;  4KHP M;  1SXJ D;  4FW9 A;  1PJI A;  2HL7 A;  1TDZ A;  3U61 A;  4AG5 A;  2DWM A;  3ILK A;  1XXH B;  2R18 A;  2I7N A;  1HQY E;  1R7R A;  2KZU A;  3GLF A;  2F5N A;  4B3R M;  3W0F A;  3FUX A;  4IIW A;  1L1T A;  1Q3C A;  3MHV C;  2DWZ B;  3SAV A;  5ITY A;  1QAO A;  3FD9 A;  4AZF A;  4G4O A;  4NL4 H;  5KQ8 A;  1Z5B A;  2ERC A;  4DV5 M;  1FNN A;  3AOE C;  4MM3 B;  4NSR A;  2C99 A;  5IWA M;  1FJG M;  3HU3 A;  1GVN A;  2KA6 B;  3LVV A;  3SAS A;  2R65 A;  2KRK A;  3I4Y A;  2RGO A;  3U5Z B;  1L2B A;  4LFA M;  3GLI A;  4LF8 M;  2D7G A;  3KOW E;  5IZ7 D;  4DR7 M;  3TE6 A;  2R4J A;  2CV0 A;  3WHK A;  4G6Z A;  4B7H A;  2P5T A;  4DR5 M;  2Y20 A;  2Z4R A;  1HQC A;  3M0E A;  2ZBK B;  2CHG A;  4RNA A;  3GP1 A;  2LH0 A;  2XSZ A;  4A3V B;  4LFB M;  2XFT A;  2QBY B;  4AKI A;  4R7G A;  2ZM6 M;  2UXC M;  4IBE A;  2BJW A;  2Z7J A;  4JI8 M;  2UXB M;  3U6Q A;  2CHV A;  4PT5 A;  4PCZ A;  1HR0 M;  3SAR A;  3FUV A;  1GL6 A;  4ITQ A;  1NJG A;  3UGJ A;  1QYR A;  1R6B X;  2DHR A;  4QNM A;  3LMM A;  4YY3 M;  3JR5 A;  3TPZ A;  1DGF A;  3GPY A;  2F5P A;  2VII A;  3R8F A;  4I81 A;  4B3M M;  1TH2 A;  3QAU A;  2KZS A;  4JYA M;  1JR3 A;  1JQJ C;  2O5R A;  1DO2 A;  2C96 A;  2JA2 A;  2G5G X;  4LFC M;  1QQW A;  4HL4 A;  3VLF B;  3GPP A;  1SXJ C;  4GC9 A;  4MGH A;  2CHQ A;  2HKJ A;  3VFD A;  5LMU M;  4DV4 M;  2D7H A;  5DYI A;  4LJA A;  5EXP A;  1IN6 A;  3W0L B;  1QVR A;  3TWL A;  1MX0 A;  3IG8 A;  2HHH M;  4B3T M;  2FNA A;  3FTD A;  4DV1 M;  2QPA A;  4DR6 M;  2L6O A;  3IG5 A;  3CF0 A;  1KSF X;  1SXJ B;  4AQY M;  3HHX A;  1SXJ E;  4M0D A;  2H1R A;  4OW0 A;  3T1H M;  4LRS A;  4CGY B;  4DR2 M;  3U61 B;  3GLH B;  1J5E M;  1QAQ A;  2VQE M;  3K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...