3THGA

Crystal structure of the creosote rubisco activase c-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
PFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase 1, chlo
publication title Atomic resolution x-ray structure of the substrate recognition domain of higher plant ribulose-bisphosphate carboxylase/oxygenase (Rubisco) activase.
pubmed doi rcsb
source organism Larrea tridentata
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3thgA00
4W5WA 3T15A 3THGA
chains in the Genus database with same CATH superfamily
4L4UA 3LCUA 4JV5M 2L2DA 5H37D 3SBJA 1XXHE 4DR2M 1XMQM 1T6OA 2JZ0A 3UMMA 2FFJA 1PM5A 1WGNA 4II7A 2UUCM 4FCWA 3VFDA 1AUAA 1IN8A 4IJFA 4AKIA 2VIIA 2DHRA 1R4GA 2R62A 2WSCF 3NWLA 2EKKA 3HJQA 2QCUA 2EJSA 3SYKA 1NJGA 3F92A 4GITA 4DUZM 2EUCA 3EIHA 1G59A 3B9PA 3WHKA 4LY6A 1YE9A 2XLJA 3FD9A 4JI4M 4L6V6 3IECA 2QBYB 3DOAA 3HHWA 1IN7A 1QAMA 2X49A 5FLXS 5IZ7D 2N35A 3T1HM 4W5WA 2HCBA 2KEBA 3E4RA 4S12A 4AZFA 3MJ5A 3PVSA 1TF0B 4IBIA 2J7OA 4LJ9A 5EJCA 4XGIA 5FSWA 3GQ3A 4GHAA 4R3DA 2CUZA 1QVRA 4RF1A 1UFZA 3W67A 5FTLA 2XF3A 3U61B 4Q7JA 3AL0C 2DZOB 4LFBM 4IBKA 2CHGA 5DYGA 3AFHA 4LF7M 2M60A 2DAIA 1JR3D 1Z59A 2Y0QA 1KYIA 2UUAM 1H6UA 3KOZE 3JR5A 3QYBA 1D0LA 3AOEC 2C98A 1IXSA 4IBGA 4CHTB 1GO5A 2DHYA 5EP3A 1QAOA 4FCTA 2ZAOA 1Z5CA 1X37A 1Z6TA 4AI6A 4DBGB 3SAVA 4LF6M 4GH9A 2YNMD 4CIZA 3U6CA 5FTNA 2R4JA 1J7KA 1SXJC 2CV1A 3GLHA 3THGA 2L7IA 2QENA 2OOAA 1ZMVA 1OAOC 3QWLA 3DA1A 4LGMA 4YY3M 5IWAM 1NHWC 4JI2M 2D7EA 1R2YA 2Q2EB 1C7YA 1DGHB 1NO1A 5C18A 3GLGB 4JN6A 3KXEC 4NL4H 2DI0A 5ITYA 3GP1A 1NNJA 3DZDA 1GVNA 2EKFA 4LZZA 1HR0M 3GLGA 4MB7A 3MK6A 4AG6A 3J81S 3ZC7B 3C9PA 2R4EA 1OIZA 1NHGC 2LVNC 3SHFA 4QHSA 1NSFA 2XFSA 1L1ZA 5ITQA 3L28A 4GMQA 4JI1M 1WJ7A 3GLIA 3M0EA 5IREB 4X66M 4XBOA 3FUVA 3W68A 2L7HA 4AW4A 1VQ1A 2LVOC 4IBFA 4DV3M 1IBMM 2LNHC 2R18A 1F4IA 1XXHA 1OAIA 3JAMS 3C3EA 5KQ8A 4FVMA 4TUWA 4FWGA 1L8QA 2LBCA 2O25A 2DWMA 1TH2A 3A45A 4LG2A 2L09A 2MJ5B 5BPVA 4HEOA 5IT9S 3VKHA 1XB2B 2AHMA 2D7GA 2V6ZM 4LJ8A 2KA6B 1XNRM 1NNUC 4LZJA 3HU1A 1WGLA 3K2LA 3J80S 3GRYA 4D81A 3B7ZA 1JQJC 2LHCA 3HY5A 1QUSA 2DNAA 2I7NA 3AV0A 3SATA 4IBEA 2K9DA 1L2DA 4IBBA 1VDLA 2V1CA 3L25A 1XC8A 1K3XA 2Z8YM 4DV1M 5FTMA 2F5PA 2UU9M 2R65A 5EXXA 4GIPA 1MJGM 4L8RC 2F5SA 3KSXA 1KSFX 4WP2A 4G4QA 3IG5A 1PJSA 2DVWB 4GHLA 1TR8A 1Q02A 2QNJA 4MGIE 2OO9A 5EP4A 4B7FA 3GLIE 2DXIA 3CF2A 3D8BA 4MGYE 4M9SA 4ZPXA 2KNZA 4X64M 3H4JA 3PXGA 3VLFB 2H1RA 4F2LA 5L8RF 4DR7M 1E9RA 3BBZA 4LF5M 4G4OA 2BWEA 1IN6A 1Q39A 3GPXA 3GQ4A 3GO8A 2KNAA 3FTCA 2L6OA 4KT0F 4JI6M 1G71A 2KZSA 4IBCA 2C5RA 2FOIC 2I7PA 3HU3A 5JI3E 4WW0A 3RGSA 2Z3XA 3GLFE 2H5XA 3W0FA 1R5LA 4HL4A 4DR1M 2ZAMA 1S3SA 2F4VM 1AIPC 2JY5A 5ITUA 1IXZA 4JI7M 1NVMA 5BR8M 2Y21A 2KDLA 1IXRC 1G4AE 5EXTA 1R2ZA 4LF9M 1SXJA 4P17A 3KP1E 2R44A 3TWKA 5KO3A 2C9OA 3C3DA 4AKHA 2HAKA 4LJ5A 4M9ZA 3AJIB 3HJSA 2VQFM 4DR4M 2VQEM 2VF8A 4R7GA 2R0IA 2NQ8C 2DZLA 2FNAA 1NV8A 4PD2A 4NXNM 2KHHA 3KFUG 2CP8A 1ZAEA 1W5TA 1OTRA 3FKEA 3PNYA 4OVZA 5JI2E 4LFCM 4REZA 3UZUA 3HKPA 4GC9A 4LGYA 1XHBA 3L27A 2DENA 4X65M 1VEJA 3HGIA 3SAWA 1QUTA 1TDZA 1MU5A 3QYEA 2KXEA 3LMMA 2E5LM 2F5OA 2XSZA 2JA2A 1IXSB 1IY2A 3U6QA 1ZMUA 4PCZA 5KQDA 2K6BA 3A42A 3HHZA 4PDGA 5C1BA 5KPRA 2C9CA 3LW5F 4MH0E 2UXBM 4FCVA 4JYAM 5ITXE 2FE8A 2CFOA 3TPZA 2F5QA 1GJTA 2OOBA 3HHXA 3HZJA 2D7HA 1QAQA 3U6OA 3GLHB 4RNAA 4OX9M 2KRKA 3K9OA 4Y28F 4B3MM 1QDRA 3BXWA 2LXEA 5EXPA 4KODA 1VEKA 3WHLA 2HWJA 4QHTA 2MROB 1HNZM 3FUTA 1SXJE 4XK8F 4B3RM 1NV9A 1QZMA 4B08A 2OQ4A 3Q8GA 3W0LB 2J7NA 2ZANA 2QHOB 3E21A 3VDUA 3VK8A 3HX3A 1L2CA 1DO2A 1HQYE 1I4WA 3UGJA 5EQTA 3GRUA 1R7RA 1QQWA 1IQPA 4L15A 3GLIB 4LJ4A 4LCBA 3TE6A 1XWIA 2UUBM 1LV7A 3DFZA 4L78A 2BNKA 4NSOB 2BJVA 2C99A 3VKGA 2KZUA 3ILKA 2O01F 4M9XA 3ZH9B 1XXHB 2HKJA 2Z4SA 4LRSA 4Z6YA 3FE3A 1MN3A 2DZNB 2XEPA 4CISA 3VDPA 2UXDM 1EE8A 4IBJA 2R46A 1E9SA 4KLNA 3U6LA 3U6MA 1N75A 2C96A 3I51A 5EXSA 3A46A 3U60A 3I04M 3GQ5A 1L2BA 1D0KA 8CATA 3KDSE 2DWZB 2QQ8A 2CWBA 2YR0A 1QZEA 2JP7A 3UJNA 2CHQA 4P16A 4GKJM 4B3TM 3KVWA 1R6BX 3GLFA 3KP0E 1IY0A 3SC3A 4DR5M 3IG8A 2CV2A 2DAEA 2EO2A 3M7GA 2XZUA 1Z5BA 2FH0A 1CUKA 1TTEA 4JI3M 4CGYB 2CV0A 1XMOM 1T43A 4JXJA 1RU3A 3TQSA 3FYDA 1YUBA 4I81A 3U6EA 1DV0A 3LVWA 3C58A 7CATA 1L1TA 4DR3M 1OJLA 3FTEA 3U5ZA 2MR9A 4I4LA 2K0BX 2Z4RA 3FYCA 2ZTCA 3UK6A 3U6PA 2BJWA 1NY6A 1Y8GA 2J5YA 4DV5M 4G3OA 4BB9A 2RRUA 4D80A 4G6ZA 4IBDA 4IIWA 3GRVA 3TWMA 3K92A 3L2AA 2R6FA 1DO0A 1OIPA 1DGGA 2DAGA 3MMPA 4WURA 2XGNA 3B74A 1TDHA 2LVQD 2JNHA 5DFLA 2L4EA 3HHYA 5DNYA 3T6PA 3PFIA 1IBKM 5ITRA 1TGUA 1HT1E 1WIVA 1OKSA 1GKIA 3CTWB 3AOEA 5ITXA 3LQQA 1G8PA 2DAKA 3ZCBB 4ANRA 3GPYA 3KSJA 3RE8A 2QP9X 2DWLA 1TH4A 1I94M 3A98B 1SXJB 4AG5A 1PGYA 1QYRA 1TH3A 1ZQ9A 2CE7A 3FRHA 4AQYM 1K82A 1IBLM 1NJFA 2G8LA 2GNOA 3SMSA 2O5RA 4MM3B 4DV4M 3NBXX 4QOZC 3GRRA 3HWSA 4K0KM 1YLAA 3E46A 3J7BA 1EIJA 1XNQM 4BLCA 1WR1B 4NOOB 2ZM6M 3SFZA 2JY6B 1WXQA 4PT5A 4DV0M 4MGZE 4OVZB 3QAUA 5ITTA 1N32M 2JXNA 3B89A 3KW6A 1JR3E 4KHPM 4LJAA 3ZQJA 1GL6A 2QSFX 2Y20A 3SAUA 4RKUF 3TWLA 3T1YM 3LQRA 3JR4A 1MX0A 3CGWA 3FUXA 2DKLA 1D2NA 1Q3BA 3Q8XA 4NRVA 1HJPA 3FUWA 3EIEA 2CRUA 4G4NA 4B7GA 1OQYA 4LF8M 3CF0A 5E26A 4M0WA 1ORYB 2VDBB 3I4VA 4AKGA 4FWDA 4DV2M 2JWSA 3E9SA 2GQFA 4B7HA 2R45A 1IFYA 1D0MA 4JI8M 2OPFA 2Z7JA 1N34M 2QBYA 1N77A 1OFHA 4FWHA 4EIWA 3CF6E 2XFTA 1PJQA 3RGPA 3T15A 1DGBA 5GKNA 1ZV1A 3U6DA 1J5EM 4HLQA 3AOGA 1PJIA 3SASA 3J7AS 2M5ZA 3HU2A 1HT2E 1VEGA 2KNVA 2MGWA 4IJEA 4L16A 2V1UA 4GEWA 2YFQA 2WZJA 3RFWA 3GPUA 2LH0A 2LTUA 3U61A 1VDDA 4I5SA 3PNVA 5DYIA 4QOSA 1HQCA 1PJTA 3H4MA 4LJ7A 4D82A 1VG5A 2W82A 1G3IA 4R71A 4MGHA 2RGOA 4GRIA 1Z5AA 5A2QS 2LVPC 3KS8A 3K9PA 2JUJA 3MHVC 3SMPA 4F1IA 2XZFA 1V34A 4NRWA 2EA0A 4PDIA 4QNRA 2ERCA 3B7NA 1J09A 4BBAA 1DGFA 1GL7A 1V33A 1HNXM 1W5SA 3FTDA 4G4RA 4B3SM 3J2PB 3LCVB 3FTFA 2X8AA 1QDTA 2LHGA 4X62M 2RGHA 4CJ6A 2DWNA 3U60B 1UM8A 3GPPA 1BVSA 1EFUB 3D8LA 1WHCA 4NC6A 1OFIA 3SHGB 3OTOM 4NSRA 3SARA 1DGHA 1QANA 3GLFB 1K3WA 1IM2A 2VF7A 4RF0A 3KOYE 1E94E 1PRBA 1FNNA 2YQZA 1SXJD 1GLNA 2ZBKB 2UXCM 4FW9A 3BOSA 1PJJA 3K1JA 2Y0TA 1GABA 2ZTDA 3L26A 2QZ4A 4ITQA 1A5TA 3K8ZA 1JB0F 2BWBA 2KRUA 2RKOA 2CHVA 3HJ8A 2WSEF 3V76A 4M0DA 3M6AA 1N33M 4QNMA 3U5ZB 1LTMA 4LFAM 2G5GX 4Z8XA 1V92A 5FTJA 2X4AA 3KS4A 1IY1A 4A3VB 2K47A 2L4FA 2DAMA 2APLA 2FS1A 3FUUA 4KO8A 1NY5A 4OU7A 3U6SA 2KW0A 2XH9A 4I8OA 1KFVA 5KPZA 1IN4A 4DR6M 2CEAA 1E32A 1JR3A 4DUYM 2XSZD 4LJ6A 2HL7A 2MH8A 3I4YA 5EP1A 5FTKA 3T38A 4YHHM 1GJSA 1SG9A 3R8FA 1YSYA 2P5TA 4JI5M 4JI0M 3GLHE 4NXMM 2F5NA 2LWXA 2QPAA 3IHPA 4MGKE 5EP2A 4DV6M 3KOXE 3B7QA 4UN2B 3I01M 4DV7M 1G41A 3VK7A 2B3TA 4GKKM 2JZ1A 4FD2A 2WSFF 3LVVA 5KPTA 3KOWE 5F3WA 1FJGM 2HHHM 5LMNM 3FRIA 2JY8A 3GLGE 4LF4M 3NBIA 2JY7A 3L29A 1Q3CA 4OW0A 1HNWM 4GC5A 1IN5A 1C1KA 1P3QQ 4LRTA 1ZMWA 5E6JA 3J27B 3TL4X 3R9XB 1N78A 3AKZA 3SYLA 2A5YB 1T3TA 2G3QA 1N36M 2LVAA 5LMUM
chains in the Genus database with same CATH topology
4L4UA 4JV5M 5H37D 3SBJA 1XMQM 4DR2M 3UMMA 2FFJA 1PM5A 4II7A 2UUCM 4FCWA 3VFDA 1IN8A 4IJFA 4AKIA 2VIIA 2DHRA 2R62A 3NWLA 3HJQA 2QCUA 3SYKA 1NJGA 4GITA 4DUZM 2EUCA 3EIHA 1G59A 3B9PA 3WHKA 4LY6A 1YE9A 2XLJA 3FD9A 4JI4M 2QBYB 3DOAA 3HHWA 1IN7A 1QAMA 2X49A 5FLXS 5IZ7D 3T1HM 4W5WA 2HCBA 2KEBA 3E4RA 4S12A 4AZFA 3MJ5A 3PVSA 4IBIA 2J7OA 4LJ9A 5EJCA 4XGIA 5FSWA 3GQ3A 4GHAA 4R3DA 2CUZA 1QVRA 4RF1A 5FTLA 3U61B 3AL0C 2XF3A 4LFBM 2DZOB 4IBKA 2CHGA 5DYGA 3AFHA 4LF7M 2M60A 1JR3D 1Z59A 2Y0QA 1KYIA 2UUAM 1H6UA 3KOZE 3JR5A 3AOEC 2C98A 4IBGA 4CHTB 5EP3A 1QAOA 4FCTA 2ZAOA 1Z5CA 1X37A 1Z6TA 4AI6A 3SAVA 4LF6M 4GH9A 2YNMD 3U6CA 5FTNA 2R4JA 1J7KA 1SXJC 2CV1A 3GLHA 3THGA 2L7IA 2QENA 3QWLA 5IWAM 3DA1A 4LGMA 4YY3M 4JI2M 1NHWC 2D7EA 1R2YA 2Q2EB 1DGHB 5C18A 3GLGB 4JN6A 3KXEC 4NL4H 5ITYA 3GP1A 1NNJA 3DZDA 1GVNA 4LZZA 1HR0M 3GLGA 4MB7A 3MK6A 4AG6A 3J81S 3ZC7B 2R4EA 1NHGC 3SHFA 1L1ZA 4QHSA 1NSFA 2XFSA 5ITQA 3L28A 4GMQA 4JI1M 3GLIA 3M0EA 5IREB 4X66M 4XBOA 3FUVA 2L7HA 4AW4A 4IBFA 4DV3M 1IBMM 2LNHC 2R18A 1XXHA 3JAMS 5KQ8A 4FVMA 4TUWA 4FWGA 1L8QA 2DWMA 1TH2A 3A45A 4LG2A 2L09A 5BPVA 5IT9S 3VKHA 2V6ZM 2AHMA 2D7GA 4LJ8A 2KA6B 1XNRM 1NNUC 4LZJA 3HU1A 3K2LA 3J80S 3GRYA 4D81A 1JQJC 3SATA 2I7NA 3AV0A 4IBEA 1L2DA 4IBBA 2V1CA 3L25A 1XC8A 1K3XA 4DV1M 5FTMA 2F5PA 2UU9M 2R65A 5EXXA 4GIPA 4L8RC 2F5SA 3KSXA 1KSFX 4G4QA 3IG5A 2DVWB 4GHLA 4MGIE 5EP4A 4B7FA 2DXIA 3CF2A 3D8BA 4MGYE 4M9SA 4ZPXA 4X64M 3PXGA 3VLFB 2H1RA 4DR7M 1E9RA 4LF5M 4G4OA 1IN6A 1Q39A 3GPXA 3GQ4A 3GO8A 3FTCA 2L6OA 4JI6M 2KZSA 4IBCA 2C5RA 2FOIC 2I7PA 3HU3A 5JI3E 4WW0A 3RGSA 2Z3XA 3W0FA 2F4VM 4HL4A 4DR1M 2ZAMA 1S3SA 5ITUA 4JI7M 1IXZA 1NVMA 5BR8M 2Y21A 1IXRC 1G4AE 5EXTA 1R2ZA 4LF9M 1SXJA 3KP1E 3TWKA 5KO3A 2C9OA 4AKHA 4LJ5A 4M9ZA 3AJIB 3HJSA 2VQFM 4DR4M 2VQEM 4R7GA 2NQ8C 2FNAA 4PD2A 4NXNM 3KFUG 5JI2E 1ZAEA 1W5TA 3FKEA 3PNYA 4OVZA 4LFCM 4REZA 3UZUA 3HKPA 4GC9A 4LGYA 1XHBA 3L27A 4X65M 3HGIA 3SAWA 1TDZA 1MU5A 2KXEA 3LMMA 2E5LM 2F5OA 2XSZA 2JA2A 1IXSB 1IY2A 3U6QA 4PCZA 5KQDA 3A42A 3HHZA 4PDGA 5C1BA 5KPRA 2C9CA 4MH0E 2UXBM 4FCVA 4JYAM 5ITXE 2FE8A 2CFOA 3TPZA 2F5QA 3HHXA 3U6OA 2D7HA 1QAQA 3GLHB 4RNAA 4OX9M 2KRKA 4B3MM 5EXPA 2LXEA 4KODA 3WHLA 4QHTA 1HNZM 3FUTA 1SXJE 4B3RM 1QZMA 4B08A 2OQ4A 3W0LB 2J7NA 2ZANA 3VDUA 3VK8A 1L2CA 1DO2A 1HQYE 1I4WA 3UGJA 5EQTA 3GRUA 1R7RA 1IQPA 1QQWA 4L15A 3GLIB 4LJ4A 4LCBA 3TE6A 1XWIA 2UUBM 1LV7A 3DFZA 4L78A 2BNKA 4NSOB 2BJVA 2C99A 3VKGA 2KZUA 3ILKA 4M9XA 3ZH9B 1XXHB 2HKJA 2Z4SA 4LRSA 4Z6YA 2DZNB 2XEPA 4CISA 3VDPA 2UXDM 1EE8A 4IBJA 2R46A 1E9SA 4KLNA 3U6LA 3U6MA 1N75A 2C96A 3I51A 5EXSA 3A46A 3U60A 3GQ5A 1L2BA 8CATA 3KDSE 2DWZB 2YR0A 3UJNA 2CHQA 4P16A 4GKJM 4B3TM 3KVWA 1R6BX 3GLFA 3KP0E 1IY0A 3SC3A 4DR5M 3IG8A 2CV2A 2EO2A 3M7GA 2XZUA 1Z5BA 4CGYB 2CV0A 4JI3M 1XMOM 4JXJA 3TQSA 3FYDA 1YUBA 4I81A 3U6EA 3LVWA 3C58A 7CATA 1L1TA 4DR3M 1OJLA 3FTEA 3U5ZA 4I4LA 3FYCA 2Z4RA 3UK6A 3U6PA 2BJWA 1NY6A 4DV5M 4BB9A 4D80A 4G6ZA 4IBDA 4IIWA 3GRVA 3TWMA 3K92A 3L2AA 1DO0A 1DGGA 4WURA 2XGNA 1TDHA 3HHYA 5DNYA 3PFIA 1IBKM 5ITRA 1TGUA 1HT1E 1GKIA 3CTWB 3AOEA 5ITXA 3LQQA 1G8PA 3ZCBB 3GPYA 3KSJA 3RE8A 2QP9X 2DWLA 1TH4A 1I94M 3A98B 1SXJB 4AG5A 1QYRA 1K82A 1TH3A 1ZQ9A 2CE7A 4AQYM 1IBLM 1NJFA 2G8LA 3SMSA 2O5RA 4MM3B 4DV4M 4QOZC 3GRRA 3HWSA 4K0KM 3J7BA 1XNQM 4BLCA 4NOOB 2ZM6M 3SFZA 4PT5A 1WXQA 4DV0M 4MGZE 4OVZB 3QAUA 5ITTA 1N32M 3KW6A 4KHPM 4LJAA 1GL6A 2Y20A 3SAUA 3T1YM 3TWLA 3LQRA 3JR4A 1MX0A 3FUXA 1D2NA 1Q3BA 3Q8XA 4NRVA 3FUWA 3EIEA 4G4NA 4B7GA 4LF8M 3CF0A 5E26A 4M0WA 1ORYB 4AKGA 3I4VA 4FWDA 4DV2M 3E9SA 4B7HA 2R45A 4JI8M 2OPFA 2Z7JA 1N34M 2QBYA 1N77A 1OFHA 4FWHA 4EIWA 3CF6E 2XFTA 3RGPA 3T15A 1J5EM 1DGBA 5GKNA 3U6DA 4HLQA 3AOGA 1PJIA 3SASA 3J7AS 2M5ZA 3HU2A 1HT2E 4IJEA 4L16A 2V1UA 2YFQA 3RFWA 3GPUA 2LH0A 3U61A 1VDDA 4I5SA 3PNVA 5DYIA 4QOSA 1HQCA 3H4MA 4LJ7A 4D82A 2W82A 1G3IA 4MGHA 2RGOA 4GRIA 1Z5AA 5A2QS 3KS8A 3MHVC 3SMPA 4NRWA 2XZFA 2EA0A 4PDIA 4QNRA 2ERCA 1J09A 4BBAA 1DGFA 1GL7A 1HNXM 1W5SA 3FTDA 4G4RA 4B3SM 3J2PB 3FTFA 2X8AA 4X62M 2RGHA 2DWNA 3U60B 1UM8A 3GPPA 3D8LA 1OFIA 3SHGB 3OTOM 4NSRA 3SARA 1DGHA 1QANA 3GLFB 1K3WA 1IM2A 4RF0A 3KOYE 1E94E 1FNNA 2YQZA 1SXJD 1GLNA 2ZBKB 2UXCM 4FW9A 3BOSA 1PJJA 3K1JA 2Y0TA 3L26A 2QZ4A 4ITQA 3K8ZA 2KRUA 2RKOA 2CHVA 3HJ8A 4M0DA 3M6AA 1N33M 4QNMA 3U5ZB 4LFAM 2G5GX 4Z8XA 5FTJA 2X4AA 3KS4A 1IY1A 4A3VB 2K47A 4KO8A 3FUUA 4OU7A 1NY5A 3U6SA 2KW0A 2XH9A 4I8OA 1KFVA 5KPZA 1IN4A 4DR6M 2CEAA 1E32A 1JR3A 4DUYM 2XSZD 4LJ6A 2HL7A 5EP1A 3I4YA 5FTKA 4YHHM 3T38A 3R8FA 1YSYA 2P5TA 4JI5M 4JI0M 4NXMM 2F5NA 2LWXA 2QPAA 4MGKE 5EP2A 4DV6M 3KOXE 3VK7A 4DV7M 1G41A 4GKKM 4FD2A 3LVVA 5KPTA 3KOWE 5F3WA 1FJGM 2HHHM 5LMNM 4LF4M 3NBIA 3L29A 1Q3CA 4OW0A 1HNWM 4GC5A 1IN5A 1C1KA 4LRTA 5E6JA 3TL4X 3J27B 3R9XB 1N78A 3AKZA 3SYLA 2A5YB 1T3TA 1N36M 5LMUM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5W A;  3T15 A;  3THG A; 
#chains in the Genus database with same CATH topology
 4L4U A;  3LCU A;  4JV5 M;  2L2D A;  5H37 D;  3SBJ A;  1XXH E;  4DR2 M;  1XMQ M;  1T6O A;  2JZ0 A;  3UMM A;  2FFJ A;  1PM5 A;  1WGN A;  4II7 A;  2UUC M;  4FCW A;  3VFD A;  1AUA A;  1IN8 A;  4IJF A;  4AKI A;  2VII A;  2DHR A;  1R4G A;  2R62 A;  2WSC F;  3NWL A;  2EKK A;  3HJQ A;  2QCU A;  2EJS A;  3SYK A;  1NJG A;  3F92 A;  4GIT A;  4DUZ M;  2EUC A;  3EIH A;  1G59 A;  3B9P A;  3WHK A;  4LY6 A;  1YE9 A;  2XLJ A;  3FD9 A;  4JI4 M;  4L6V 6;  3IEC A;  2QBY B;  3DOA A;  3HHW A;  1IN7 A;  1QAM A;  2X49 A;  5FLX S;  5IZ7 D;  2N35 A;  3T1H M;  4W5W A;  2HCB A;  2KEB A;  3E4R A;  4S12 A;  4AZF A;  3MJ5 A;  3PVS A;  1TF0 B;  4IBI A;  2J7O A;  4LJ9 A;  5EJC A;  4XGI A;  5FSW A;  3GQ3 A;  4GHA A;  4R3D A;  2CUZ A;  1QVR A;  4RF1 A;  1UFZ A;  3W67 A;  5FTL A;  2XF3 A;  3U61 B;  4Q7J A;  3AL0 C;  2DZO B;  4LFB M;  4IBK A;  2CHG A;  5DYG A;  3AFH A;  4LF7 M;  2M60 A;  2DAI A;  1JR3 D;  1Z59 A;  2Y0Q A;  1KYI A;  2UUA M;  1H6U A;  3KOZ E;  3JR5 A;  3QYB A;  1D0L A;  3AOE C;  2C98 A;  1IXS A;  4IBG A;  4CHT B;  1GO5 A;  2DHY A;  5EP3 A;  1QAO A;  4FCT A;  2ZAO A;  1Z5C A;  1X37 A;  1Z6T A;  4AI6 A;  4DBG B;  3SAV A;  4LF6 M;  4GH9 A;  2YNM D;  4CIZ A;  3U6C A;  5FTN A;  2R4J A;  1J7K A;  1SXJ C;  2CV1 A;  3GLH A;  3THG A;  2L7I A;  2QEN A;  2OOA A;  1ZMV A;  1OAO C;  3QWL A;  3DA1 A;  4LGM A;  4YY3 M;  5IWA M;  1NHW C;  4JI2 M;  2D7E A;  1R2Y A;  2Q2E B;  1C7Y A;  1DGH B;  1NO1 A;  5C18 A;  3GLG B;  4JN6 A;  3KXE C;  4NL4 H;  2DI0 A;  5ITY A;  3GP1 A;  1NNJ A;  3DZD A;  1GVN A;  2EKF A;  4LZZ A;  1HR0 M;  3GLG A;  4MB7 A;  3MK6 A;  4AG6 A;  3J81 S;  3ZC7 B;  3C9P A;  2R4E A;  1OIZ A;  1NHG C;  2LVN C;  3SHF A;  4QHS A;  1NSF A;  2XFS A;  1L1Z A;  5ITQ A;  3L28 A;  4GMQ A;  4JI1 M;  1WJ7 A;  3GLI A;  3M0E A;  5IRE B;  4X66 M;  4XBO A;  3FUV A;  3W68 A;  2L7H A;  4AW4 A;  1VQ1 A;  2LVO C;  4IBF A;  4DV3 M;  1IBM M;  2LNH C;  2R18 A;  1F4I A;  1XXH A;  1OAI A;  3JAM S;  3C3E A;  5KQ8 A;  4FVM A;  4TUW A;  4FWG A;  1L8Q A;  2LBC A;  2O25 A;  2DWM A;  1TH2 A;  3A45 A;  4LG2 A;  2L09 A;  2MJ5 B;  5BPV A;  4HEO A;  5IT9 S;  3VKH A;  1XB2 B;  2AHM A;  2D7G A;  2V6Z M;  4LJ8 A;  2KA6 B;  1XNR M;  1NNU C;  4LZJ A;  3HU1 A;  1WGL A;  3K2L A;  3J80 S;  3GRY A;  4D81 A;  3B7Z A;  1JQJ C;  2LHC A;  3HY5 A;  1QUS A;  2DNA A;  2I7N A;  3AV0 A;  3SAT A;  4IBE A;  2K9D A;  1L2D A;  4IBB A;  1VDL A;  2V1C A;  3L25 A;  1XC8 A;  1K3X A;  2Z8Y M;  4DV1 M;  5FTM A;  2F5P A;  2UU9 M;  2R65 A;  5EXX A;  4GIP A;  1MJG M;  4L8R C;  2F5S A;  3KSX A;  1KSF X;  4WP2 A;  4G4Q A;  3IG5 A;  1PJS A;  2DVW B;  4GHL A;  1TR8 A;  1Q02 A;  2QNJ A;  4MGI E;  2OO9 A;  5EP4 A;  4B7F A;  3GLI E;  2DXI A;  3CF2 A;  3D8B A;  4MGY E;  4M9S A;  4ZPX A;  2KNZ A;  4X64 M;  3H4J A;  3PXG A;  3VLF B;  2H1R A;  4F2L A;  5L8R F;  4DR7 M;  1E9R A;  3BBZ A;  4LF5 M;  4G4O A;  2BWE A;  1IN6 A;  1Q39 A;  3GPX A;  3GQ4 A;  3GO8 A;  2KNA A;  3FTC A;  2L6O A;  4KT0 F;  4JI6 M;  1G71 A;  2KZS A;  4IBC A;  2C5R A;  2FOI C;  2I7P A;  3HU3 A;  5JI3 E;  4WW0 A;  3RGS A;  2Z3X A;  3GLF E;  2H5X A;  3W0F A;  1R5L A;  4HL4 A;  4DR1 M;  2ZAM A;  1S3S A;  2F4V M;  1AIP C;  2JY5 A;  5ITU A;  1IXZ A;  4JI7 M;  1NVM A;  5BR8 M;  2Y21 A;  2KDL A;  1IXR C;  1G4A E;  5EXT A;  1R2Z A;  4LF9 M;  1SXJ A;  4P17 A;  3KP1 E;  2R44 A;  3TWK A;  5KO3 A;  2C9O A;  3C3D A;  4AKH A;  2HAK A;  4LJ5 A;  4M9Z A;  3AJI B;  3HJS A;  2VQF M;  4DR4 M;  2VQE M;  2VF8 A;  4R7G A;  2R0I A;  2NQ8 C;  2DZL A;  2FNA A;  1NV8 A;  4PD2 A;  4NXN M;  2KHH A;  3KFU G;  2CP8 A;  1ZAE A;  1W5T A;  1OTR A;  3FKE A;  3PNY A;  4OVZ A;  5JI2 E;  4LFC M;  4REZ A;  3UZU A;  3HKP A;  4GC9 A;  4LGY A;  1XHB A;  3L27 A;  2DEN A;  4X65 M;  1VEJ A;  3HGI A;  3SAW A;  1QUT A;  1TDZ A;  1MU5 A;  3QYE A;  2KXE A;  3LMM A;  2E5L M;  2F5O A;  2XSZ A;  2JA2 A;  1IXS B;  1IY2 A;  3U6Q A;  1ZMU A;  4PCZ A;  5KQD A;  2K6B A;  3A42 A;  3HHZ A;  4PDG A;  5C1B A;  5KPR A;  2C9C A;  3LW5 F;  4MH0 E;  2UXB M;  4FCV A;  4JYA M;  5ITX E;  2FE8 A;  2CFO A;  3TPZ A;  2F5Q A;  1GJT A;  2OOB A;  3HHX A;  3HZJ A;  2D7H A;  1QAQ A;  3U6O A;  3GLH B;  4RNA A;  4OX9 M;  2KRK A;  3K9O A;  4Y28 F;  4B3M M;  1QDR A;  3BXW A;  2LXE A;  5EXP A;  4KOD A;  1VEK A;  3WHL A;  2HWJ A;  4QHT A;  2MRO B;  1HNZ M;  3FUT A;  1SXJ E;  4XK8 F;  4B3R M;  1NV9 A;  1QZM A;  4B08 A;  2OQ4 A;  3Q8G A;  3W0L B;  2J7N A;  2ZAN A;  2QHO B;  3E21 A;  3VDU A;  3VK8 A;  3HX3 A;  1L2C A;  1DO2 A;  1HQY E;  1I4W A;  3UGJ A;  5EQT A;  3GRU A;  1R7R A;  1QQW A;  1IQP A;  4L15 A;  3GLI B;  4LJ4 A;  4LCB A;  3TE6 A;  1XWI A;  2UUB M;  1LV7 A;  3DFZ A;  4L78 A;  2BNK A;  4NSO B;  2BJV A;  2C99 A;  3VKG A;  2KZU A;  3ILK A;  2O01 F;  4M9X A;  3ZH9 B;  1XXH B;  2HKJ A;  2Z4S A;  4LRS A;  4Z6Y A;  3FE3 A;  1MN3 A;  2DZN B;  2XEP A;  4CIS A;  3VDP A;  2UXD M;  1EE8 A;  4IBJ A;  2R46 A;  1E9S A;  4KLN A;  3U6L A;  3U6M A;  1N75 A;  2C96 A;  3I51 A;  5EXS A;  3A46 A;  3U60 A;  3I04 M;  3GQ5 A;  1L2B A;  1D0K A;  8CAT A;  3KDS E;  2DWZ B;  2QQ8 A;  2CWB A;  2YR0 A;  1QZE A;  2JP7 A;  3UJN A;  2CHQ A;  4P16 A;  4GKJ M;  4B3T M;  3KVW A;  1R6B X;  3GLF A;  3KP0 E;  1IY0 A;  3SC3 A;  4DR5 M;  3IG8 A;  2CV2 A;  2DAE A;  2EO2 A;  3M7G A;  2XZU A;  1Z5B A;  2FH0 A;  1CUK A;  1TTE A;  4JI3 M;  4CGY B;  2CV0 A;  1XMO M;  1T43 A;  4JXJ A;  1RU3 A;  3TQS A;  3FYD A;  1YUB A;  4I81 A;  3U6E A;  1DV0 A;  3LVW A;  3C58 A;  7CAT A;  1L1T A;  4DR3 M;  1OJL A;  3FTE A;  3U5Z A;  2MR9 A;  4I4L A;  2K0B X;  2Z4R A;  3FYC A;  2ZTC A;  3UK6 A;  3U6P A;  2BJW A;  1NY6 A;  1Y8G A;  2J5Y A;  4DV5 M;  4G3O A;  4BB9 A;  2RRU A;  4D80 A;  4G6Z A;  4IBD A;  4IIW A;  3GRV A;  3TWM A;  3K92 A;  3L2A A;  2R6F A;  1DO0 A;  1OIP A;  1DGG A;  2DAG A;  3MMP A;  4WUR A;  2XGN A;  3B74 A;  1TDH A;  2LVQ D;  2JNH A;  5DFL A;  2L4E A;  3HHY A;  5DNY A;  3T6P A;  3PFI A;  1IBK M;  5ITR A;  1TGU A;  1HT1 E;  1WIV A;  1OKS A;  1GKI A;  3CTW B;  3AOE A;  5ITX A;  3LQQ A;  1G8P A;  2DAK A;  3ZCB B;  4ANR A;  3GPY A;  3KSJ A;  3RE8 A;  2QP9 X;  2DWL A;  1TH4 A;  1I94 M;  3A98 B;  1SXJ B;  4AG5 A;  1PGY A;  1QYR A;  1TH3 A;  1ZQ9 A;  2CE7 A;  3FRH A;  4AQY M;  1K82 A;  1IBL M;  1NJF A;  2G8L A;  2GNO A;  3SMS A;  2O5R A;  4MM3 B;  4DV4 M;  3NBX X;  4QOZ C;  3GRR A;  3HWS A;  4K0K M;  1YLA A;  3E46 A;  3J7B A;  1EIJ A;  1XNQ M;  4BLC A;  1WR1 B;  4NOO B;  2ZM6 M;  3SFZ A;  2JY6 B;  1WXQ A;  4PT5 A;  4DV0 M;  4MGZ E;  4OVZ B;  3QAU A;  5ITT A;  1N32 M;  2JXN A;  3B89 A;  3KW6 A;  1JR3 E;  4KHP M;  4LJA A;  3ZQJ A;  1GL6 A;  2QSF X;  2Y20 A;  3SAU A;  4RKU F;  3TWL A;  3T1Y M;  3LQR A;  3JR4 A;  1MX0 A;  3CGW A;  3FUX A;  2DKL A;  1D2N A;  1Q3B A;  3Q8X A;  4NRV A;  1HJP A;  3FUW A;  3EIE A;  2CRU A;  4G4N A;  4B7G A;  1OQY A;  4LF8 M;  3CF0 A;  5E26 A;  4M0W A;  1ORY B;  2VDB B;  3I4V A;  4AKG A;  4FWD A;  4DV2 M;  2JWS A;  3E9S A;  2GQF A;  4B7H A;  2R45 A;  1IFY A;  1D0M A;  4JI8 M;  2OPF A;  2Z7J A;  1N34 M;  2QBY A;  1N77 A;  1OFH A;  4FWH A;  4EIW A;  3CF6 E;  2XFT A;  1PJQ A;  3RGP A;  3T15 A;  1DGB A;  5GKN A;  1ZV1 A;  3U6D A;  1J5E M;  4HLQ A;  3AOG A;  1PJI A;  3SAS A;  3J7A S;  2M5Z A;  3HU2 A;  1HT2 E;  1VEG A;  2KNV A;  2MGW A;  4IJE A;  4L16 A;  2V1U A;  4GEW A;  2YFQ A;  2WZJ A;  3RFW A;  3GPU A;  2LH0 A;  2LTU A;  3U61 A;  1VDD A;  4I5S A;  3PNV A;  5DYI A;  4QOS A;  1HQC A;  1PJT A;  3H4M A;  4LJ7 A;  4D82 A;  1VG5 A;  2W82 A;  1G3I A;  4R71 A;  4MGH A;  2RGO A;  4GRI A;  1Z5A A;  5A2Q S;  2LVP C;  3KS8 A;  3K9P A;  2JUJ A;  3MHV C;  3SMP A;  4F1I A;  2XZF A;  1V34 A;  4NRW A;  2EA0 A;  4PDI A;  4QNR A;  2ERC A;  3B7N A;  1J09 A;  4BBA A;  1DGF A;  1GL7 A;  1V33 A;  1HNX M;  1W5S A;  3FTD A;  4G4R A;  4B3S M;  3J2P B;  3LCV B;  3FTF A;  2X8A A;  1QDT A;  2LHG A;  4X62 M;  2RGH A;  4CJ6 A;  2DWN A;  3U60 B;  1UM8 A;  3GPP A;  1BVS A;  1EFU B;  3D8L A;  1WHC A;  4NC6 A;  1OFI A;  3SHG B;  3OTO M;  4NSR A;  3SAR A;  1DGH A;  1QAN A;  3GLF B;  1K3W A;  1IM2 A;  2VF7 A;  4RF0 A;  3KOY E;  1E94 E;  1PRB A;  1FNN A;  2YQZ A;  1SXJ D;  1GLN A;  2ZBK B;  2UXC M;  4FW9 A;  3BOS A;  1PJJ A;  3K1J A;  2Y0T A;  1GAB A;  2ZTD A;  3L26 A;  2QZ4 A;  4ITQ A;  1A5T A;  3K8Z A;  1JB0 F;  2BWB A;  2KRU A;  2RKO A;  2CHV A;  3HJ8 A;  2WSE F;  3V76 A;  4M0D A;  3M6A A;  1N33 M;  4QNM A;  3U5Z B;  1LTM A;  4LFA M;  2G5G X;  4Z8X A;  1V92 A;  5FTJ A;  2X4A A;  3KS4 A;  1IY1 A;  4A3V B;  2K47 A;  2L4F A;  2DAM A;  2APL A;  2FS1 A;  3FUU A;  4KO8 A;  1NY5 A;  4OU7 A;  3U6S A;  2KW0 A;  2XH9 A;  4I8O A;  1KFV A;  5KPZ A;  1IN4 A;  4DR6 M;  2CEA A;  1E32 A;  1JR3 A;  4DUY M;  2XSZ D;  4LJ6 A;  2HL7 A;  2MH8 A;  3I4Y A;  5EP1 A;  5FTK A;  3T38 A;  4YHH M;  1GJS A;  1SG9 A;  3R8F A;  1YSY A;  2P5T A;  4JI5 M;  4JI0 M;  3GLH E;  4NXM M;  2F5N A;  2LWX A;  2QPA A;  3IHP A;  4MGK E;  5EP2 A;  4DV6 M;  3KOX E;  3B7Q A;  4UN2 B;  3I01 M;  4DV7 M;  1G41 A;  3VK7 A;  2B3T A;  4GKK M;  2JZ1 A;  4FD2 A;  2WSF F;  3LVV A;  5KPT A;  3KOW E;  5F3W A;  1FJG M;  2HHH M;  5LMN M;  3FRI A;  2JY8 A;  3GLG E;  4LF4 M;  3NBI A;  2JY7 A;  3L29 A;  1Q3C A;  4OW0 A;  1HNW M;  4GC5 A;  1IN5 A;  1C1K A;  1P3Q Q;  4LRT A;  1ZMW A;  5E6J A;  3J27 B;  3TL4 X;  3R9X B;  1N78 A;  3AKZ A;  3SYL A;  2A5Y B;  1T3T A;  2G3Q A;  1N36 M;  2LVA A;  5LMU M; 
#chains in the Genus database with same CATH homology
 4L4U A;  4JV5 M;  5H37 D;  3SBJ A;  1XMQ M;  4DR2 M;  3UMM A;  2FFJ A;  1PM5 A;  4II7 A;  2UUC M;  4FCW A;  3VFD A;  1IN8 A;  4IJF A;  4AKI A;  2VII A;  2DHR A;  2R62 A;  3NWL A;  3HJQ A;  2QCU A;  3SYK A;  1NJG A;  4GIT A;  4DUZ M;  2EUC A;  3EIH A;  1G59 A;  3B9P A;  3WHK A;  4LY6 A;  1YE9 A;  2XLJ A;  3FD9 A;  4JI4 M;  2QBY B;  3DOA A;  3HHW A;  1IN7 A;  1QAM A;  2X49 A;  5FLX S;  5IZ7 D;  3T1H M;  4W5W A;  2HCB A;  2KEB A;  3E4R A;  4S12 A;  4AZF A;  3MJ5 A;  3PVS A;  4IBI A;  2J7O A;  4LJ9 A;  5EJC A;  4XGI A;  5FSW A;  3GQ3 A;  4GHA A;  4R3D A;  2CUZ A;  1QVR A;  4RF1 A;  5FTL A;  3U61 B;  3AL0 C;  2XF3 A;  4LFB M;  2DZO B;  4IBK A;  2CHG A;  5DYG A;  3AFH A;  4LF7 M;  2M60 A;  1JR3 D;  1Z59 A;  2Y0Q A;  1KYI A;  2UUA M;  1H6U A;  3KOZ E;  3JR5 A;  3AOE C;  2C98 A;  4IBG A;  4CHT B;  5EP3 A;  1QAO A;  4FCT A;  2ZAO A;  1Z5C A;  1X37 A;  1Z6T A;  4AI6 A;  3SAV A;  4LF6 M;  4GH9 A;  2YNM D;  3U6C A;  5FTN A;  2R4J A;  1J7K A;  1SXJ C;  2CV1 A;  3GLH A;  3THG A;  2L7I A;  2QEN A;  3QWL A;  5IWA M;  3DA1 A;  4LGM A;  4YY3 M;  4JI2 M;  1NHW C;  2D7E A;  1R2Y A;  2Q2E B;  1DGH B;  5C18 A;  3GLG B;  4JN6 A;  3KXE C;  4NL4 H;  5ITY A;  3GP1 A;  1NNJ A;  3DZD A;  1GVN A;  4LZZ A;  1HR0 M;  3GLG A;  4MB7 A;  3MK6 A;  4AG6 A;  3J81 S;  3ZC7 B;  2R4E A;  1NHG C;  3SHF A;  1L1Z A;  4QHS A;  1NSF A;  2XFS A;  5ITQ A;  3L28 A;  4GMQ A;  4JI1 M;  3GLI A;  3M0E A;  5IRE B;  4X66 M;  4XBO A;  3FUV A;  2L7H A;  4AW4 A;  4IBF A;  4DV3 M;  1IBM M;  2LNH C;  2R18 A;  1XXH A;  3JAM S;  5KQ8 A;  4FVM A;  4TUW A;  4FWG A;  1L8Q A;  2DWM A;  1TH2 A;  3A45 A;  4LG2 A;  2L09 A;  5BPV A;  5IT9 S;  3VKH A;  2V6Z M;  2AHM A;  2D7G A;  4LJ8 A;  2KA6 B;  1XNR M;  1NNU C;  4LZJ A;  3HU1 A;  3K2L A;  3J80 S;  3GRY A;  4D81 A;  1JQJ C;  3SAT A;  2I7N A;  3AV0 A;  4IBE A;  1L2D A;  4IBB A;  2V1C A;  3L25 A;  1XC8 A;  1K3X A;  4DV1 M;  5FTM A;  2F5P A;  2UU9 M;  2R65 A;  5EXX A;  4GIP A;  4L8R C;  2F5S A;  3KSX A;  1KSF X;  4G4Q A;  3IG5 A;  2DVW B;  4GHL A;  4MGI E;  5EP4 A;  4B7F A;  2DXI A;  3CF2 A;  3D8B A;  4MGY E;  4M9S A;  4ZPX A;  4X64 M;  3PXG A;  3VLF B;  2H1R A;  4DR7 M;  1E9R A;  4LF5 M;  4G4O A;  1IN6 A;  1Q39 A;  3GPX A;  3GQ4 A;  3GO8 A;  3FTC A;  2L6O A;  4JI6 M;  2KZS A;  4IBC A;  2C5R A;  2FOI C;  2I7P A;  3HU3 A;  5JI3 E;  4WW0 A;  3RGS A;  2Z3X A;  3W0F A;  2F4V M;  4HL4 A;  4DR1 M;  2ZAM A;  1S3S A;  5ITU A;  4JI7 M;  1IXZ A;  1NVM A;  5BR8 M;  2Y21 A;  1IXR C;  1G4A E;  5EXT A;  1R2Z A;  4LF9 M;  1SXJ A;  3KP1 E;  3TWK A;  5KO3 A;  2C9O A;  4AKH A;  4LJ5 A;  4M9Z A;  3AJI B;  3HJS A;  2VQF M;  4DR4 M;  2VQE M;  4R7G A;  2NQ8 C;  2FNA A;  4PD2 A;  4NXN M;  3KFU G;  5JI2 E;  1ZAE A;  1W5T A;  3FKE A;  3PNY A;  4OVZ A;  4LFC M;  4REZ A;  3UZU A;  3HKP A;  4GC9 A;  4LGY A;  1XHB A;  3L27 A;  4X65 M;  3HGI A;  3SAW A;  1TDZ A;  1MU5 A;  2KXE A;  3LMM A;  2E5L M;  2F5O A;  2XSZ A;  2JA2 A;  1IXS B;  1IY2 A;  3U6Q A;  4PCZ A;  5KQD A;  3A42 A;  3HHZ A;  4PDG A;  5C1B A;  5KPR A;  2C9C A;  4MH0 E;  2UXB M;  4FCV A;  4JYA M;  5ITX E;  2FE8 A;  2CFO A;  3TPZ A;  2F5Q A;  3HHX A;  3U6O A;  2D7H A;  1QAQ A;  3GLH B;  4RNA A;  4OX9 M;  2KRK A;  4B3M M;  5EXP A;  2LXE A;  4KOD A;  3WHL A;  4QHT A;  1HNZ M;  3FUT A;  1SXJ E;  4B3R M;  1QZM A;  4B08 A;  2OQ4 A;  3W0L B;  2J7N A;  2ZAN A;  3VDU A;  3VK8 A;  1L2C A;  1DO2 A;  1HQY E;  1I4W A;  3UGJ A;  5EQT A;  3GRU A;  1R7R A;  1IQP A;  1QQW A;  4L15 A;  3GLI B;  4LJ4 A;  4LCB A;  3TE6 A;  1XWI A;  2UUB M;  1LV7 A;  3DFZ A;  4L78 A;  2BNK A;  4NSO B;  2BJV A;  2C99 A;  3VKG A;  2KZU A;  3ILK A;  4M9X A;  3ZH9 B;  1XXH B;  2HKJ A;  2Z4S A;  4LRS A;  4Z6Y A;  2DZN B;  2XEP A;  4CIS A;  3VDP A;  2UXD M;  1EE8 A;  4IBJ A;  2R46 A;  1E9S A;  4KLN A;  3U6L A;  3U6M A;  1N75 A;  2C96 A;  3I51 A;  5EXS A;  3A46 A;  3U60 A;  3GQ5 A;  1L2B A;  8CAT A;  3KDS E;  2DWZ B;  2YR0 A;  3UJN A;  2CHQ A;  4P16 A;  4GKJ M;  4B3T M;  3KVW A;  1R6B X;  3GLF A;  3KP0 E;  1IY0 A;  3SC3 A;  4DR5 M;  3IG8 A;  2CV2 A;  2EO2 A;  3M7G A;  2XZU A;  1Z5B A;  4CGY B;  2CV0 A;  4JI3 M;  1XMO M;  4JXJ A;  3TQS A;  3FYD A;  1YUB A;  4I81 A;  3U6E A;  3LVW A;  3C58 A;  7CAT A;  1L1T A;  4DR3 M;  1OJL A;  3FTE A;  3U5Z A;  4I4L A;  3FYC A;  2Z4R A;  3UK6 A;  3U6P A;  2BJW A;  1NY6 A;  4DV5 M;  4BB9 A;  4D80 A;  4G6Z A;  4IBD A;  4IIW A;  3GRV A;  3TWM A;  3K92 A;  3L2A A;  1DO0 A;  1DGG A;  4WUR A;  2XGN A;  1TDH A;  3HHY A;  5DNY A;  3PFI A;  1IBK M;  5ITR A;  1TGU A;  1HT1 E;  1GKI A;  3CTW B;  3AOE A;  5ITX A;  3LQQ A;  1G8P A;  3ZCB B;  3GPY A;  3KSJ A;  3RE8 A;  2QP9 X;  2DWL A;  1TH4 A;  1I94 M;  3A98 B;  1SXJ B;  4AG5 A;  1QYR A;  1K82 A;  1TH3 A;  1ZQ9 A;  2CE7 A;  4AQY M;  1IBL M;  1NJF A;  2G8L A;  3SMS A;  2O5R A;  4MM3 B;  4DV4 M;  4QOZ C;  3GRR A;  3HWS A;  4K0K M;  3J7B A;  1XNQ M;  4BLC A;  4NOO B;  2ZM6 M;  3SFZ A;  4PT5 A;  1WXQ A;  4DV0 M;  4MGZ E;  4OVZ B;  3QAU A;  5ITT A;  1N32 M;  3KW6 A;  4KHP M;  4LJA A;  1GL6 A;  2Y20 A;  3SAU A;  3T1Y M;  3TWL A;  3LQR A;  3JR4 A;  1MX0 A;  3FUX A;  1D2N A;  1Q3B A;  3Q8X A;  4NRV A;  3FUW A;  3EIE A;  4G4N A;  4B7G A;  4LF8 M;  3CF0 A;  5E26 A;  4M0W A;  1ORY B;  4AKG A;  3I4V A;  4FWD A;  4DV2 M;  3E9S A;  4B7H A;  2R45 A;  4JI8 M;  2OPF A;  2Z7J A;  1N34 M;  2QBY A;  1N77 A;  1OFH A;  4FWH A;  4EIW A;  3CF6 E;  2XFT A;  3RGP A;  3T15 A;  1J5E M;  1DGB A;  5GKN A;  3U6D A;  4HLQ A;  3AOG A;  1PJI A;  3SAS A;  3J7A S;  2M5Z A;  3HU2 A;  1HT2 E;  4IJE A;  4L16 A;  2V1U A;  2YFQ A;  3RFW A;  3GPU A;  2LH0 A;  3U61 A;  1VDD A;  4I5S A;  3PNV A;  5DYI A;  4QOS A;  1HQC A;  3H4M A;  4LJ7 A;  4D82 A;  2W82 A;  1G3I A;  4MGH A;  2RGO A;  4GRI A;  1Z5A A;  5A2Q S;  3KS8 A;  3MHV C;  3SMP A;  4NRW A;  2XZF A;  2EA0 A;  4PDI A;  4QNR A;  2ERC A;  1J09 A;  4BBA A;  1DGF A;  1GL7 A;  1HNX M;  1W5S A;  3FTD A;  4G4R A;  4B3S M;  3J2P B;  3FTF A;  2X8A A;  4X62 M;  2RGH A;  2DWN A;  3U60 B;  1UM8 A;  3GPP A;  3D8L A;  1OFI A;  3SHG B;  3OTO M;  4NSR A;  3SAR A;  1DGH A;  1QAN A;  3GLF B;  1K3W A;  1IM2 A;  4RF0 A;  3KOY E;  1E94 E;  1FNN A;  2YQZ A;  1SXJ D;  1GLN A;  2ZBK B;  2UXC M;  4FW9 A;  3BOS A;  1PJJ A;  3K1J A;  2Y0T A;  3L26 A;  2QZ4 A;  4ITQ A;  3K8Z A;  2KRU A;  2RKO A;  2CHV A;  3HJ8 A;  4M0D A;  3M6A A;  1N33 M;  4QNM A;  3U5Z B;  4LFA M;  2G5G X;  4Z8X A;  5FTJ A;  2X4A A;  3KS4 A;  1IY1 A;  4A3V B;  2K47 A;  4KO8 A;  3FUU A;  4OU7 A;  1NY5 A;  3U6S A;  2KW0 A;  2XH9 A;  4I8O A;  1KFV A;  5KPZ A;  1IN4 A;  4DR6 M;  2CEA A;  1E32 A;  1JR3 A;  4DUY M;  2XSZ D;  4LJ6 A;  2HL7 A;  5EP1 A;  3I4Y A;  5FTK A;  4YHH M;  3T38 A;  3R8F A;  1YSY A;  2P5T A;  4JI5 M;  4JI0 M;  4NXM M;  2F5N A;  2LWX A;  2QPA A;  4MGK E;  5EP2 A;  4DV6 M;  3KOX E;  3VK7 A;  4DV7 M;  1G41 A;  4GKK M;  4FD2 A;  3LVV A;  5KPT A;  3KOW E;  5F3W A;  1FJG M;  2HHH M;  5LMN M;  4LF4 M;  3NBI A;  3L29 A;  1Q3C A;  4OW0 A;  1HNW M;  4GC5 A;  1IN5 A;  1C1K A;  4LRT A;  5E6J A;  3TL4 X;  3J27 B;  3R9X B;  1N78 A;  3AKZ A;  3SYL A;  2A5Y B;  1T3T A;  1N36 M;  5LMU M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...