3THGA

Crystal structure of the creosote rubisco activase c-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'PFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase 1, chlo
molecule tags Protein binding
source organism Larrea tridentata
publication title Atomic resolution x-ray structure of the substrate recognition domain of higher plant ribulose-bisphosphate carboxylase/oxygenase (Rubisco) activase.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3thgA00
4W5WA 3THGA 3T15A
chains in the Genus database with same CATH superfamily
1QAMA 1WXQA 1AUAA 5E6JA 3K9OA 3ZC7B 1C1KA 3HX3A 4IBJA 4GHAA 2ZAMA 3U5ZA 2LVQD 2L4EA 2JY6B 5FSWA 1S3SA 2KDLA 4PDIA 2L4FA 4FCWA 3HJQA 3U6DA 1N77A 4JI2M 3DOAA 5F3WA 2Z7JA 1IN5A 3A42A 1K3WA 3KOWE 1Z6TA 1NV8A 1NV9A 3KVWA 3M0EA 4LF5M 2ZBKB 2FOIC 2O25A 3C58A 1IBKM 4G4NA 3W67A 2QSFX 3Q8XA 2Z3XA 2H5XA 4GH9A 4GIPA 4LY6A 4OVZA 5ITXE 3HKPA 1NHWC 3I4VA 4RNAA 4CISA 3FYCA 1N34M 1T43A 1DGBA 1G41A 1JR3E 2H1RA 2VQEM 1IN6A 1SXJA 3LMMA 2NQ8C 1QAOA 4YHHM 4IBDA 4MGZE 3SHGB 3W0FA 1SXJB 2R65A 3GPUA 4AKIA 3PVSA 3NBIA 4R71A 3WHKA 4GMQA 3FRIA 4MGIE 1PRBA 5LMUM 5KPRA 2R18A 3AKZA 3SASA 2CV1A 4F1IA 2DZOB 3L2AA 4EIWA 1NNUC 5KQ8A 3LCUA 1OFIA 5FTNA 2MH8A 4F2LA 4JI0M 2DNAA 3U61A 1PJTA 2UUBM 3KXEC 3L28A 3E21A 2P5TA 1XWIA 3B7QA 1E32A 4IBGA 3RGSA 3VLFB 5IZ7D 5IWAM 3FYDA 4MGKE 4QNMA 1QAQA 2HKJA 4M9ZA 1TF0B 3SAWA 3C9PA 1GL7A 1FJGM 3NWLA 2EUCA 1MJGM 2R4EA 4LGMA 3TPZA 4I81A 2WZJA 3AOEC 3SATA 4LF8M 3CF0A 1V92A 4IIWA 2FFJA 2XZFA 3HU3A 3GQ4A 1A5TA 1SXJC 3JR5A 2XSZD 2I7NA 3I04M 3U6SA 1PJQA 1Y8GA 2UXCM 1GKIA 2K9DA 3THGA 5EXTA 2VF7A 2KNAA 2R45A 3IG8A 5EP2A 4GEWA 2C5RA 3U5ZB 1RU3A 5KPZA 1ZMVA 3HHXA 1DGHB 3SAVA 1X37A 4X62M 3E4RA 5ITRA 4YY3M 2AHMA 2JY7A 3HZJA 3L29A 1NJFA 1ZAEA 2M5ZA 3F92A 3K92A 4LG2A 3R9XB 1CUKA 3QYBA 2LHGA 3KS8A 3B74A 3W68A 4DUYM 2D7HA 5C1BA 4LFBM 5H37D 1GL6A 2WSFF 3T15A 1HNXM 3DFZA 3AV0A 1LTMA 2ZAOA 5ITUA 2JXNA 2FNAA 3GRVA 4I4LA 2OQ4A 3U6CA 1MX0A 1VEJA 4R7GA 2MJ5B 3GPPA 2QBYB 1OTRA 2R46A 1XC8A 4LZJA 1XHBA 5EP3A 4L78A 3HY5A 2K6BA 2JP7A 3QAUA 3A46A 1PJJA 3I51A 3SHFA 4GITA 3C3DA 3LW5F 4S12A 2XSZA 3L26A 2KNVA 1T6OA 4I5SA 1VEGA 2R0IA 3HU2A 4DR7M 2F5PA 5KPTA 1OIZA 5GKNA 3FUTA 1Q3CA 4QOZC 2YFQA 2OO9A 2DHYA 5DYIA 2HHHM 4LJ5A 4WURA 2F4VM 2XEPA 3GRYA 1UFZA 1EFUB 3K2LA 4DBGB 3GLFE 1HJPA 8CATA 1IN4A 1IY2A 4KO8A 1XXHA 2VF8A 2C98A 1VG5A 1ZMUA 4HEOA 3T1HM 4PCZA 4GKKM 3OTOM 2KRKA 4D80A 2A5YB 3UK6A 5C18A 3L25A 2UU9M 2BWEA 1WIVA 2Y21A 1D0LA 3U6EA 3H4MA 1TDZA 5FTLA 4DV7M 1SXJD 3L27A 4L6V6 4NRWA 2CUZA 3SYLA 4B7HA 1TTEA 3GLFB 1C7YA 4LGYA 3B89A 3HJSA 4WW0A 5EJCA 5EXPA 5FLXS 3J81S 1LV7A 1AIPC 4Y28F 3PXGA 2JY5A 3CTWB 2QPAA 1K3XA 3SMPA 2HL7A 4UN2B 4DR5M 1HT2E 3J7BA 4LJ6A 1XNQM 4L4UA 3BXWA 4IBCA 4KHPM 1G71A 2JUJA 3GLIB 4AZFA 3MMPA 2DENA 1QDRA 2K0BX 2HWJA 2V6ZM 3U6QA 3FRHA 2LTUA 2LVAA 2Y20A 3HWSA 5DFLA 4B3MM 3ILKA 3MK6A 2ZM6M 1EIJA 2BJVA 4FWHA 1N32M 4JI6M 1G4AE 2O01F 4DV6M 2OOAA 1SG9A 3SAUA 3B9PA 5L8RF 1MU5A 2DWNA 2LVNC 4OX9M 4LF6M 3B7NA 1N36M 1R4GA 2J7OA 4FWDA 1GJSA 3KOYE 4X66M 1KYIA 3HHYA 4KODA 4A3VB 2OOBA 4KT0F 4RF0A 2WSCF 3LQRA 1VEKA 1Z5BA 3KOXE 4IBIA 4QHTA 3GLGE 4JI5M 2DWMA 3GLGB 4G4QA 2QZ4A 3UGJA 3UMMA 2JY8A 4FVMA 1JR3D 1L1TA 2Y0QA 4Z6YA 5DYGA 1N75A 1OJLA 3KFUG 2EKFA 1XMQM 3TE6A 2QHOB 2G8LA 4L8RC 1TDHA 4B3RM 2QENA 2CHGA 2LVPC 3C3EA 1G8PA 2MROB 4FD2A 2L09A 2DWLA 2DI0A 1N78A 2DAIA 2C99A 2R62A 5E26A 4DV1M 2I7PA 3T38A 1PGYA 2CV0A 1ZV1A 3Q8GA 2UXBM 3ZCBB 4JI8M 2FE8A 4D81A 1E9SA 2DHRA 4BB9A 2X8AA 2C9OA 2D7EA 5FTJA 2K47A 2J7NA 2DKLA 5BPVA 4P17A 3GLGA 2X4AA 3ZH9B 2L7IA 1HNZM 2LWXA 4NRVA 3FKEA 4FCVA 4Z8XA 4K0KM 3SMSA 1D0MA 2MR9A 4B3TM 2ZTDA 1IXRC 4MH0E 3GLHA 1NJGA 1R7RA 4JXJA 3VKHA 4M9XA 3JAMS 5ITTA 4R3DA 3BOSA 4PT5A 5LMNM 1W5TA 5EP4A 5ITXA 4HL4A 2L7HA 4NOOB 4TUWA 5FTKA 2R4JA 5DNYA 3K8ZA 2FH0A 4M9SA 3D8BA 2EA0A 2CFOA 3VK8A 2QP9X 2F5QA 3B7ZA 1ZQ9A 4B7GA 2KZSA 3GQ3A 1F4IA 3U60A 3LVWA 1GLNA 3E46A 2GNOA 4AKGA 1TGUA 2Y0TA 3KOZE 2EKKA 2R44A 2XH9A 4OW0A 5EXSA 4BLCA 3UJNA 4P16A 1K82A 4ZPXA 1G3IA 4NC6A 2RGOA 3SARA 1NHGC 2BNKA 2KXEA 2KZUA 4XBOA 4CGYB 2DAGA 1J7KA 2F5NA 1J09A 2QCUA 1WGNA 3FTFA 4LRSA 4CHTB 1XXHB 1PM5A 5KO3A 2DZNB 2DAEA 3K9PA 1OFHA 1P3QQ 5EXXA 3WHLA 2ZTCA 3FTEA 3RE8A 1D0KA 2CHQA 3HHZA 3HU1A 3FUXA 1L2DA 1IFYA 5EQTA 5JI2E 1Z5CA 4W5WA 3J2PB 2Z8YM 4JYAM 3SC3A 3KDSE 1V34A 1HQCA 2JZ0A 3FUUA 4NSOB 4QNRA 2WSEF 1OQYA 3AOEA 1YSYA 3HHWA 3SYKA 1IXSB 4G4RA 3VDPA 3FE3A 2KA6B 4G3OA 1DGGA 3W0LB 3CF2A 3PNVA 1WGLA 1KFVA 2C9CA 1TH4A 3FUVA 1DV0A 4M0WA 1GO5A 3J80S 4LRTA 4DUZM 3I4YA 4WP2A 2M60A 1UM8A 1Q39A 4FWGA 4DV3M 2LH0A 2BWBA 1JB0F 3V76A 4ANRA 3DA1A 2Z4SA 5FTMA 3R8FA 3MHVC 3VDUA 3CGWA 3GRUA 3M6AA 1YE9A 1ORYB 5EP1A 2D7GA 2LNHC 3FUWA 2W82A 3IG5A 3MJ5A 2ERCA 2JWSA 1GVNA 5ITQA 3GQ5A 1V33A 1EE8A 2CP8A 4XK8F 4DR2M 4JV5M 2OPFA 1PJIA 2MGWA 3E9SA 1DGHA 3T1YM 2F5OA 2JZ1A 1R2ZA 3EIHA 4IJFA 3GRRA 4L16A 4X64M 4DV0M 3A45A 2DWZB 1WR1B 2LBCA 3TL4X 1OAOC 1DGFA 3QWLA 3GPYA 2VQFM 3K1JA 2VIIA 4MGHA 2V1CA 1VDLA 4CIZA 1JQJC 1NSFA 2DZLA 2XFTA 4FW9A 1Z5AA 2DVWB 4LF7M 2HAKA 2LXEA 2EJSA 3U6LA 2RGHA 2KHHA 4JI1M 3KS4A 2QQ8A 1IBLM 1WJ7A 4G6ZA 5BR8M 2XF3A 1HT1E 3H4JA 2ZANA 1W5SA 2HCBA 1QUTA 3HGIA 3KP1E 4LFAM 1NY5A 3RGPA 1HR0M 4IBEA 3VK7A 4DV5M 1E94E 2XLJA 2F5SA 1IBMM 1YUBA 3GLIE 1DO0A 1OAIA 4G4OA 1HQYE 1XXHE 1Z59A 3FTDA 4BBAA 4MM3B 4LFCM 2J5YA 3U61B 2KNZA 1QDTA 1R6BX 1QVRA 1TH2A 1QZEA 4LCBA 3SFZA 2UUCM 3CF6E 4GKJM 1QQWA 4NL4H 2KRUA 4B3SM 1L2CA 3A98B 2VDBB 3GO8A 4NXMM 5IT9S 3QYEA 3FTCA 3VKGA 1MN3A 4LJAA 4GC9A 1L2BA 4IBKA 4ITQA 4LZZA 4JI4M 1HNWM 4CJ6A 4IBFA 2UXDM 1XB2B 4LJ8A 1IY0A 1XNRM 1H6UA 1N33M 1IXSA 3UZUA 2RRUA 1KSFX 2G3QA 4OU7A 3GLFA 3T6PA 2XGNA 1E9RA 1QYRA 3ZQJA 1NNJA 1J5EM 5JI3E 1TH3A 1NO1A 4PDGA 3LQQA 2L6OA 5A2QS 1IN8A 1DO2A 2QNJA 4AKHA 1L1ZA 4I8OA 4RF1A 1OIPA 3DZDA 4LJ7A 3GLIA 4OVZB 1L8QA 4JI3M 1YLAA 3IHPA 4JI7M 3J7AS 4DR4M 1GJTA 2LHCA 3LCVB 4B7FA 4Q7JA 1PJSA 2UUAM 4GHLA 1IM2A 4KLNA 3KP0E 3KSXA 2CWBA 1IQPA 5IREB 4DV2M 2LVOC 3J27B 4NXNM 1I4WA 1QUSA 3LVVA 2GQFA 3NBXX 4DV4M 2RKOA 2YQZA 3AFHA 2B3TA 2O5RA 3GP1A 4L15A 1VQ1A 3AOGA 4AG5A 4LF4M 2Z4RA 3U6PA 3EIEA 3U60B 1R2YA 4IJEA 1ZMWA 2DXIA 4LF9M 4PD2A 3HJ8A 2EO2A 4AQYM 2CE7A 3RFWA 2QBYA 4DR6M 3U6MA 1I94M 3U6OA 3IECA 4M0DA 4DR1M 3TWLA 1SXJE 4II7A 4JN6A 4RKUF 3TQSA 4DR3M 1G59A 2JNHA 2APLA 1OKSA 2BJWA 2CHVA 2XFSA 3PFIA 4B08A 1XMOM 2YNMD 4MGYE 2V1UA 3M7GA 4NSRA 4LJ4A 4AI6A 3JR4A 2L2DA 4FCTA 1VDDA 2R6FA 2KW0A 1FNNA 2CRUA 4HLQA 1Q3BA 1TR8A 2CEAA 2DAKA 3FD9A 4D82A 7CATA 5KQDA 2XZUA 2E5LM 3GLHB 4QOSA 2X49A 3KSJA 1NY6A 2YR0A 2JA2A 3KW6A 4AG6A 1WHCA 3AL0C 3SBJA 2DAMA 4GC5A 2FS1A 2Q2EB 4QHSA 1QANA 1D2NA 3GPXA 3AJIB 1QZMA 3PNYA 4XGIA 3TWKA 1T3TA 2G5GX 2CV2A 5ITYA 3D8LA 3GLHE 1IN7A 3TWMA 1Q02A 2N35A 4MB7A 4REZA 3VFDA 1BVSA 1GABA 4LJ9A 4AW4A 1NVMA 3I01M 1IXZA 4IBBA 3BBZA 1JR3A 2C96A 1R5LA 2KEBA 4X65M 1IY1A 4GRIA
chains in the Genus database with same CATH topology
1QAMA 1WXQA 5E6JA 3ZC7B 1C1KA 4IBJA 4GHAA 2ZAMA 3U5ZA 5FSWA 1S3SA 4PDIA 3U6DA 4FCWA 1N77A 3HJQA 4JI2M 3DOAA 5F3WA 2Z7JA 1IN5A 3A42A 1K3WA 3KOWE 1Z6TA 3KVWA 3M0EA 4LF5M 2ZBKB 2FOIC 3C58A 1IBKM 4G4NA 3Q8XA 2Z3XA 4GH9A 4GIPA 4LY6A 4OVZA 5ITXE 3HKPA 1NHWC 3I4VA 4RNAA 4CISA 3FYCA 1N34M 1DGBA 1G41A 2H1RA 2VQEM 1IN6A 1SXJA 3LMMA 2NQ8C 1QAOA 4YHHM 4IBDA 4MGZE 3SHGB 3W0FA 1SXJB 2R65A 3GPUA 4AKIA 3PVSA 3NBIA 3WHKA 4GMQA 4MGIE 5LMUM 5KPRA 2R18A 3AKZA 3SASA 2CV1A 2DZOB 3L2AA 4EIWA 1NNUC 5KQ8A 1OFIA 5FTNA 4JI0M 3U61A 2UUBM 3KXEC 3L28A 2P5TA 1XWIA 4IBGA 1E32A 3RGSA 3VLFB 5IZ7D 5IWAM 3FYDA 4MGKE 4QNMA 1QAQA 2HKJA 4M9ZA 3SAWA 1GL7A 1FJGM 3NWLA 2EUCA 2R4EA 4LGMA 3TPZA 4I81A 3AOEC 3SATA 4LF8M 3CF0A 4IIWA 2FFJA 2XZFA 3HU3A 3GQ4A 1SXJC 3JR5A 2XSZD 2I7NA 3U6SA 2UXCM 1GKIA 3THGA 5EXTA 2R45A 3IG8A 5EP2A 2C5RA 3U5ZB 5KPZA 3HHXA 1DGHB 3SAVA 1X37A 4X62M 3E4RA 5ITRA 4YY3M 2AHMA 3L29A 1NJFA 1ZAEA 2M5ZA 3K92A 4LG2A 3R9XB 3KS8A 4DUYM 2D7HA 5C1BA 4LFBM 5H37D 1GL6A 3T15A 1HNXM 3DFZA 3AV0A 2ZAOA 5ITUA 2FNAA 3GRVA 4I4LA 2OQ4A 3U6CA 1MX0A 4R7GA 3GPPA 2QBYB 2R46A 1XC8A 4LZJA 1XHBA 5EP3A 4L78A 3QAUA 3A46A 1PJJA 3I51A 3SHFA 4GITA 4S12A 2XSZA 3L26A 4I5SA 3HU2A 4DR7M 2F5PA 5KPTA 5GKNA 3FUTA 1Q3CA 4QOZC 2YFQA 5DYIA 2HHHM 4LJ5A 4WURA 2F4VM 2XEPA 3GRYA 3K2LA 8CATA 1IN4A 1IY2A 4KO8A 1XXHA 2C98A 3T1HM 4PCZA 4GKKM 3OTOM 2KRKA 4D80A 2A5YB 3UK6A 5C18A 3L25A 2UU9M 1TDZA 2Y21A 3U6EA 3H4MA 5FTLA 4DV7M 1SXJD 3L27A 4NRWA 2CUZA 3SYLA 4B7HA 3GLFB 4LGYA 5EJCA 3HJSA 4WW0A 5EXPA 4B3SM 5FLXS 3J81S 1LV7A 3PXGA 1K3XA 3CTWB 2QPAA 3SMPA 2HL7A 4DR5M 1HT2E 3J7BA 4LJ6A 1XNQM 4L4UA 4IBCA 4KHPM 3GLIB 4AZFA 2V6ZM 3U6QA 2Y20A 3HWSA 4B3MM 3ILKA 3MK6A 2ZM6M 2BJVA 4FWHA 1N32M 4JI6M 1G4AE 4DV6M 3SAUA 3B9PA 1MU5A 2DWNA 4OX9M 4LF6M 1N36M 2J7OA 4FWDA 3KOYE 4X66M 1KYIA 3HHYA 4KODA 4A3VB 4RF0A 3LQRA 4IBIA 1Z5BA 4QHTA 3KOXE 4JI5M 2DWMA 3GLGB 4G4QA 2QZ4A 3UGJA 3UMMA 4FVMA 1JR3D 1L1TA 2Y0QA 4Z6YA 5DYGA 1N75A 1OJLA 3KFUG 1XMQM 3TE6A 2G8LA 4L8RC 1TDHA 4B3RM 2QENA 2CHGA 4FD2A 1G8PA 2DWLA 2L09A 1N78A 2C99A 2R62A 5E26A 4DV1M 2I7PA 3T38A 2CV0A 2UXBM 3ZCBB 4JI8M 2FE8A 4D81A 1E9SA 2DHRA 4BB9A 2X8AA 2C9OA 2D7EA 5FTJA 2K47A 2J7NA 5BPVA 3GLGA 1HNZM 2X4AA 3ZH9B 2L7IA 2LWXA 4NRVA 3FKEA 4FCVA 4Z8XA 4K0KM 3SMSA 4B3TM 1IXRC 4MH0E 3GLHA 1NJGA 1R7RA 4JXJA 3VKHA 4M9XA 3JAMS 5ITTA 4R3DA 3BOSA 4PT5A 5LMNM 1W5TA 5EP4A 5ITXA 4HL4A 2L7HA 4NOOB 4TUWA 5FTKA 2R4JA 5DNYA 3K8ZA 4M9SA 3D8BA 2EA0A 2CFOA 3VK8A 2QP9X 2F5QA 1ZQ9A 4B7GA 2KZSA 3GQ3A 3U60A 3LVWA 1GLNA 4AKGA 1TGUA 2Y0TA 3KOZE 2XH9A 4OW0A 5EXSA 4BLCA 3UJNA 4P16A 1K82A 4ZPXA 1G3IA 2RGOA 3SARA 1NHGC 2BNKA 2KXEA 2KZUA 4XBOA 4CGYB 2F5NA 1J7KA 1J09A 2QCUA 3FTFA 4LRSA 4CHTB 1XXHB 1PM5A 5KO3A 2DZNB 5EXXA 3WHLA 1OFHA 3FTEA 3RE8A 2CHQA 3HHZA 3HU1A 3FUXA 1L2DA 5EQTA 5JI2E 1Z5CA 4W5WA 3J2PB 4JYAM 3SC3A 3KDSE 1HQCA 3FUUA 4NSOB 4QNRA 3AOEA 3HHWA 1YSYA 3SYKA 1IXSB 4G4RA 3VDPA 2KA6B 3W0LB 1DGGA 3CF2A 3PNVA 1KFVA 2C9CA 1TH4A 3FUVA 4M0WA 3J80S 4LRTA 4DUZM 3I4YA 2M60A 1UM8A 1Q39A 4FWGA 4DV3M 2LH0A 3DA1A 2Z4SA 5FTMA 3R8FA 3MHVC 3VDUA 3M6AA 3GRUA 1YE9A 1ORYB 5EP1A 2D7GA 2LNHC 3FUWA 2W82A 3IG5A 3MJ5A 2ERCA 1GVNA 5ITQA 3GQ5A 1EE8A 4DR2M 4JV5M 2OPFA 1PJIA 3E9SA 1DGHA 3T1YM 2F5OA 1R2ZA 3EIHA 4IJFA 3GRRA 4L16A 4X64M 4DV0M 3A45A 2DWZB 3TL4X 1DGFA 3QWLA 3GPYA 2VQFM 3K1JA 2VIIA 4MGHA 2V1CA 1JQJC 1NSFA 2XFTA 4FW9A 1Z5AA 2DVWB 4LF7M 2LXEA 3U6LA 2RGHA 4JI1M 3KS4A 1IBLM 4G6ZA 5BR8M 2XF3A 1HT1E 2ZANA 1W5SA 2HCBA 4LFAM 3HGIA 3KP1E 1NY5A 3RGPA 1HR0M 4IBEA 3VK7A 4DV5M 1E94E 2XLJA 2F5SA 1IBMM 1YUBA 1DO0A 4G4OA 1HQYE 1Z59A 3FTDA 4BBAA 4MM3B 4LFCM 3U61B 4LCBA 1QVRA 1R6BX 1TH2A 2UUCM 4GKJM 3SFZA 3CF6E 1QQWA 4NL4H 2KRUA 1L2CA 3A98B 3GO8A 4NXMM 5IT9S 3FTCA 3VKGA 1L2BA 4LJAA 4GC9A 4IBKA 4ITQA 4LZZA 4JI4M 1HNWM 4IBFA 2UXDM 4LJ8A 1IY0A 1XNRM 1H6UA 1N33M 3UZUA 1KSFX 4OU7A 3GLFA 2XGNA 1E9RA 1QYRA 1J5EM 1NNJA 5JI3E 1TH3A 4PDGA 3LQQA 2L6OA 5A2QS 1IN8A 1DO2A 4AKHA 1L1ZA 4I8OA 4RF1A 3DZDA 4LJ7A 3GLIA 4OVZB 1L8QA 4JI3M 4JI7M 3J7AS 4DR4M 4B7FA 2UUAM 4GHLA 1IM2A 4KLNA 3KP0E 3KSXA 1IQPA 5IREB 4DV2M 3J27B 4NXNM 1I4WA 3LVVA 4DV4M 2RKOA 2YQZA 3AFHA 2O5RA 3GP1A 4L15A 3AOGA 4AG5A 4LF4M 2Z4RA 3U6PA 3EIEA 3U60B 1R2YA 4IJEA 2DXIA 4LF9M 4PD2A 3HJ8A 2EO2A 4AQYM 2CE7A 3RFWA 2QBYA 4DR6M 3U6MA 1I94M 3U6OA 4M0DA 4DR1M 3TWLA 1SXJE 4II7A 4JN6A 3TQSA 4DR3M 1G59A 2BJWA 2CHVA 4B08A 2XFSA 3PFIA 1XMOM 2YNMD 4MGYE 2V1UA 3M7GA 4NSRA 4LJ4A 4AI6A 3JR4A 4FCTA 1VDDA 4HLQA 2KW0A 1FNNA 4D82A 1Q3BA 2CEAA 3FD9A 5KQDA 2XZUA 2E5LM 7CATA 3GLHB 4QOSA 2X49A 3KSJA 1NY6A 2YR0A 2JA2A 3KW6A 4AG6A 3AL0C 3SBJA 4QHSA 4GC5A 2Q2EB 1QANA 1D2NA 3GPXA 3AJIB 1QZMA 3PNYA 4XGIA 3TWKA 1T3TA 2G5GX 2CV2A 5ITYA 3D8LA 1IN7A 3TWMA 4REZA 4MB7A 3VFDA 4LJ9A 4AW4A 1NVMA 1IXZA 4IBBA 1JR3A 2C96A 2KEBA 4X65M 1IY1A 4GRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5W A;  3THG A;  3T15 A; 
#chains in the Genus database with same CATH topology
 1QAM A;  1WXQ A;  1AUA A;  5E6J A;  3K9O A;  3ZC7 B;  1C1K A;  3HX3 A;  4IBJ A;  4GHA A;  2ZAM A;  3U5Z A;  2LVQ D;  2L4E A;  2JY6 B;  5FSW A;  1S3S A;  2KDL A;  4PDI A;  2L4F A;  4FCW A;  3HJQ A;  3U6D A;  1N77 A;  4JI2 M;  3DOA A;  5F3W A;  2Z7J A;  1IN5 A;  3A42 A;  1K3W A;  3KOW E;  1Z6T A;  1NV8 A;  1NV9 A;  3KVW A;  3M0E A;  4LF5 M;  2ZBK B;  2FOI C;  2O25 A;  3C58 A;  1IBK M;  4G4N A;  3W67 A;  2QSF X;  3Q8X A;  2Z3X A;  2H5X A;  4GH9 A;  4GIP A;  4LY6 A;  4OVZ A;  5ITX E;  3HKP A;  1NHW C;  3I4V A;  4RNA A;  4CIS A;  3FYC A;  1N34 M;  1T43 A;  1DGB A;  1G41 A;  1JR3 E;  2H1R A;  2VQE M;  1IN6 A;  1SXJ A;  3LMM A;  2NQ8 C;  1QAO A;  4YHH M;  4IBD A;  4MGZ E;  3SHG B;  3W0F A;  1SXJ B;  2R65 A;  3GPU A;  4AKI A;  3PVS A;  3NBI A;  4R71 A;  3WHK A;  4GMQ A;  3FRI A;  4MGI E;  1PRB A;  5LMU M;  5KPR A;  2R18 A;  3AKZ A;  3SAS A;  2CV1 A;  4F1I A;  2DZO B;  3L2A A;  4EIW A;  1NNU C;  5KQ8 A;  3LCU A;  1OFI A;  5FTN A;  2MH8 A;  4F2L A;  4JI0 M;  2DNA A;  3U61 A;  1PJT A;  2UUB M;  3KXE C;  3L28 A;  3E21 A;  2P5T A;  1XWI A;  3B7Q A;  1E32 A;  4IBG A;  3RGS A;  3VLF B;  5IZ7 D;  5IWA M;  3FYD A;  4MGK E;  4QNM A;  1QAQ A;  2HKJ A;  4M9Z A;  1TF0 B;  3SAW A;  3C9P A;  1GL7 A;  1FJG M;  3NWL A;  2EUC A;  1MJG M;  2R4E A;  4LGM A;  3TPZ A;  4I81 A;  2WZJ A;  3AOE C;  3SAT A;  4LF8 M;  3CF0 A;  1V92 A;  4IIW A;  2FFJ A;  2XZF A;  3HU3 A;  3GQ4 A;  1A5T A;  1SXJ C;  3JR5 A;  2XSZ D;  2I7N A;  3I04 M;  3U6S A;  1PJQ A;  1Y8G A;  2UXC M;  1GKI A;  2K9D A;  3THG A;  5EXT A;  2VF7 A;  2KNA A;  2R45 A;  3IG8 A;  5EP2 A;  4GEW A;  2C5R A;  3U5Z B;  1RU3 A;  5KPZ A;  1ZMV A;  3HHX A;  1DGH B;  3SAV A;  1X37 A;  4X62 M;  3E4R A;  5ITR A;  4YY3 M;  2AHM A;  2JY7 A;  3HZJ A;  3L29 A;  1NJF A;  1ZAE A;  2M5Z A;  3F92 A;  3K92 A;  4LG2 A;  3R9X B;  1CUK A;  3QYB A;  2LHG A;  3KS8 A;  3B74 A;  3W68 A;  4DUY M;  2D7H A;  5C1B A;  4LFB M;  5H37 D;  1GL6 A;  2WSF F;  3T15 A;  1HNX M;  3DFZ A;  3AV0 A;  1LTM A;  2ZAO A;  5ITU A;  2JXN A;  2FNA A;  3GRV A;  4I4L A;  2OQ4 A;  3U6C A;  1MX0 A;  1VEJ A;  4R7G A;  2MJ5 B;  3GPP A;  2QBY B;  1OTR A;  2R46 A;  1XC8 A;  4LZJ A;  1XHB A;  5EP3 A;  4L78 A;  3HY5 A;  2K6B A;  2JP7 A;  3QAU A;  3A46 A;  1PJJ A;  3I51 A;  3SHF A;  4GIT A;  3C3D A;  3LW5 F;  4S12 A;  2XSZ A;  3L26 A;  2KNV A;  1T6O A;  4I5S A;  1VEG A;  2R0I A;  3HU2 A;  4DR7 M;  2F5P A;  5KPT A;  1OIZ A;  5GKN A;  3FUT A;  1Q3C A;  4QOZ C;  2YFQ A;  2OO9 A;  2DHY A;  5DYI A;  2HHH M;  4LJ5 A;  4WUR A;  2F4V M;  2XEP A;  3GRY A;  1UFZ A;  1EFU B;  3K2L A;  4DBG B;  3GLF E;  1HJP A;  8CAT A;  1IN4 A;  1IY2 A;  4KO8 A;  1XXH A;  2VF8 A;  2C98 A;  1VG5 A;  1ZMU A;  4HEO A;  3T1H M;  4PCZ A;  4GKK M;  3OTO M;  2KRK A;  4D80 A;  2A5Y B;  3UK6 A;  5C18 A;  3L25 A;  2UU9 M;  2BWE A;  1WIV A;  2Y21 A;  1D0L A;  3U6E A;  3H4M A;  1TDZ A;  5FTL A;  4DV7 M;  1SXJ D;  3L27 A;  4L6V 6;  4NRW A;  2CUZ A;  3SYL A;  4B7H A;  1TTE A;  3GLF B;  1C7Y A;  4LGY A;  3B89 A;  3HJS A;  4WW0 A;  5EJC A;  5EXP A;  5FLX S;  3J81 S;  1LV7 A;  1AIP C;  4Y28 F;  3PXG A;  2JY5 A;  3CTW B;  2QPA A;  1K3X A;  3SMP A;  2HL7 A;  4UN2 B;  4DR5 M;  1HT2 E;  3J7B A;  4LJ6 A;  1XNQ M;  4L4U A;  3BXW A;  4IBC A;  4KHP M;  1G71 A;  2JUJ A;  3GLI B;  4AZF A;  3MMP A;  2DEN A;  1QDR A;  2K0B X;  2HWJ A;  2V6Z M;  3U6Q A;  3FRH A;  2LTU A;  2LVA A;  2Y20 A;  3HWS A;  5DFL A;  4B3M M;  3ILK A;  3MK6 A;  2ZM6 M;  1EIJ A;  2BJV A;  4FWH A;  1N32 M;  4JI6 M;  1G4A E;  2O01 F;  4DV6 M;  2OOA A;  1SG9 A;  3SAU A;  3B9P A;  5L8R F;  1MU5 A;  2DWN A;  2LVN C;  4OX9 M;  4LF6 M;  3B7N A;  1N36 M;  1R4G A;  2J7O A;  4FWD A;  1GJS A;  3KOY E;  4X66 M;  1KYI A;  3HHY A;  4KOD A;  4A3V B;  2OOB A;  4KT0 F;  4RF0 A;  2WSC F;  3LQR A;  1VEK A;  1Z5B A;  3KOX E;  4IBI A;  4QHT A;  3GLG E;  4JI5 M;  2DWM A;  3GLG B;  4G4Q A;  2QZ4 A;  3UGJ A;  3UMM A;  2JY8 A;  4FVM A;  1JR3 D;  1L1T A;  2Y0Q A;  4Z6Y A;  5DYG A;  1N75 A;  1OJL A;  3KFU G;  2EKF A;  1XMQ M;  3TE6 A;  2QHO B;  2G8L A;  4L8R C;  1TDH A;  4B3R M;  2QEN A;  2CHG A;  2LVP C;  3C3E A;  1G8P A;  2MRO B;  4FD2 A;  2L09 A;  2DWL A;  2DI0 A;  1N78 A;  2DAI A;  2C99 A;  2R62 A;  5E26 A;  4DV1 M;  2I7P A;  3T38 A;  1PGY A;  2CV0 A;  1ZV1 A;  3Q8G A;  2UXB M;  3ZCB B;  4JI8 M;  2FE8 A;  4D81 A;  1E9S A;  2DHR A;  4BB9 A;  2X8A A;  2C9O A;  2D7E A;  5FTJ A;  2K47 A;  2J7N A;  2DKL A;  5BPV A;  4P17 A;  3GLG A;  2X4A A;  3ZH9 B;  2L7I A;  1HNZ M;  2LWX A;  4NRV A;  3FKE A;  4FCV A;  4Z8X A;  4K0K M;  3SMS A;  1D0M A;  2MR9 A;  4B3T M;  2ZTD A;  1IXR C;  4MH0 E;  3GLH A;  1NJG A;  1R7R A;  4JXJ A;  3VKH A;  4M9X A;  3JAM S;  5ITT A;  4R3D A;  3BOS A;  4PT5 A;  5LMN M;  1W5T A;  5EP4 A;  5ITX A;  4HL4 A;  2L7H A;  4NOO B;  4TUW A;  5FTK A;  2R4J A;  5DNY A;  3K8Z A;  2FH0 A;  4M9S A;  3D8B A;  2EA0 A;  2CFO A;  3VK8 A;  2QP9 X;  2F5Q A;  3B7Z A;  1ZQ9 A;  4B7G A;  2KZS A;  3GQ3 A;  1F4I A;  3U60 A;  3LVW A;  1GLN A;  3E46 A;  2GNO A;  4AKG A;  1TGU A;  2Y0T A;  3KOZ E;  2EKK A;  2R44 A;  2XH9 A;  4OW0 A;  5EXS A;  4BLC A;  3UJN A;  4P16 A;  1K82 A;  4ZPX A;  1G3I A;  4NC6 A;  2RGO A;  3SAR A;  1NHG C;  2BNK A;  2KXE A;  2KZU A;  4XBO A;  4CGY B;  2DAG A;  1J7K A;  2F5N A;  1J09 A;  2QCU A;  1WGN A;  3FTF A;  4LRS A;  4CHT B;  1XXH B;  1PM5 A;  5KO3 A;  2DZN B;  2DAE A;  3K9P A;  1OFH A;  1P3Q Q;  5EXX A;  3WHL A;  2ZTC A;  3FTE A;  3RE8 A;  1D0K A;  2CHQ A;  3HHZ A;  3HU1 A;  3FUX A;  1L2D A;  1IFY A;  5EQT A;  5JI2 E;  1Z5C A;  4W5W A;  3J2P B;  2Z8Y M;  4JYA M;  3SC3 A;  3KDS E;  1V34 A;  1HQC A;  2JZ0 A;  3FUU A;  4NSO B;  4QNR A;  2WSE F;  1OQY A;  3AOE A;  1YSY A;  3HHW A;  3SYK A;  1IXS B;  4G4R A;  3VDP A;  3FE3 A;  2KA6 B;  4G3O A;  1DGG A;  3W0L B;  3CF2 A;  3PNV A;  1WGL A;  1KFV A;  2C9C A;  1TH4 A;  3FUV A;  1DV0 A;  4M0W A;  1GO5 A;  3J80 S;  4LRT A;  4DUZ M;  3I4Y A;  4WP2 A;  2M60 A;  1UM8 A;  1Q39 A;  4FWG A;  4DV3 M;  2LH0 A;  2BWB A;  1JB0 F;  3V76 A;  4ANR A;  3DA1 A;  2Z4S A;  5FTM A;  3R8F A;  3MHV C;  3VDU A;  3CGW A;  3GRU A;  3M6A A;  1YE9 A;  1ORY B;  5EP1 A;  2D7G A;  2LNH C;  3FUW A;  2W82 A;  3IG5 A;  3MJ5 A;  2ERC A;  2JWS A;  1GVN A;  5ITQ A;  3GQ5 A;  1V33 A;  1EE8 A;  2CP8 A;  4XK8 F;  4DR2 M;  4JV5 M;  2OPF A;  1PJI A;  2MGW A;  3E9S A;  1DGH A;  3T1Y M;  2F5O A;  2JZ1 A;  1R2Z A;  3EIH A;  4IJF A;  3GRR A;  4L16 A;  4X64 M;  4DV0 M;  3A45 A;  2DWZ B;  1WR1 B;  2LBC A;  3TL4 X;  1OAO C;  1DGF A;  3QWL A;  3GPY A;  2VQF M;  3K1J A;  2VII A;  4MGH A;  2V1C A;  1VDL A;  4CIZ A;  1JQJ C;  1NSF A;  2DZL A;  2XFT A;  4FW9 A;  1Z5A A;  2DVW B;  4LF7 M;  2HAK A;  2LXE A;  2EJS A;  3U6L A;  2RGH A;  2KHH A;  4JI1 M;  3KS4 A;  2QQ8 A;  1IBL M;  1WJ7 A;  4G6Z A;  5BR8 M;  2XF3 A;  1HT1 E;  3H4J A;  2ZAN A;  1W5S A;  2HCB A;  1QUT A;  3HGI A;  3KP1 E;  4LFA M;  1NY5 A;  3RGP A;  1HR0 M;  4IBE A;  3VK7 A;  4DV5 M;  1E94 E;  2XLJ A;  2F5S A;  1IBM M;  1YUB A;  3GLI E;  1DO0 A;  1OAI A;  4G4O A;  1HQY E;  1XXH E;  1Z59 A;  3FTD A;  4BBA A;  4MM3 B;  4LFC M;  2J5Y A;  3U61 B;  2KNZ A;  1QDT A;  1R6B X;  1QVR A;  1TH2 A;  1QZE A;  4LCB A;  3SFZ A;  2UUC M;  3CF6 E;  4GKJ M;  1QQW A;  4NL4 H;  2KRU A;  4B3S M;  1L2C A;  3A98 B;  2VDB B;  3GO8 A;  4NXM M;  5IT9 S;  3QYE A;  3FTC A;  3VKG A;  1MN3 A;  4LJA A;  4GC9 A;  1L2B A;  4IBK A;  4ITQ A;  4LZZ A;  4JI4 M;  1HNW M;  4CJ6 A;  4IBF A;  2UXD M;  1XB2 B;  4LJ8 A;  1IY0 A;  1XNR M;  1H6U A;  1N33 M;  1IXS A;  3UZU A;  2RRU A;  1KSF X;  2G3Q A;  4OU7 A;  3GLF A;  3T6P A;  2XGN A;  1E9R A;  1QYR A;  3ZQJ A;  1NNJ A;  1J5E M;  5JI3 E;  1TH3 A;  1NO1 A;  4PDG A;  3LQQ A;  2L6O A;  5A2Q S;  1IN8 A;  1DO2 A;  2QNJ A;  4AKH A;  1L1Z A;  4I8O A;  4RF1 A;  1OIP A;  3DZD A;  4LJ7 A;  3GLI A;  4OVZ B;  1L8Q A;  4JI3 M;  1YLA A;  3IHP A;  4JI7 M;  3J7A S;  4DR4 M;  1GJT A;  2LHC A;  3LCV B;  4B7F A;  4Q7J A;  1PJS A;  2UUA M;  4GHL A;  1IM2 A;  4KLN A;  3KP0 E;  3KSX A;  2CWB A;  1IQP A;  5IRE B;  4DV2 M;  2LVO C;  3J27 B;  4NXN M;  1I4W A;  1QUS A;  3LVV A;  2GQF A;  3NBX X;  4DV4 M;  2RKO A;  2YQZ A;  3AFH A;  2B3T A;  2O5R A;  3GP1 A;  4L15 A;  1VQ1 A;  3AOG A;  4AG5 A;  4LF4 M;  2Z4R A;  3U6P A;  3EIE A;  3U60 B;  1R2Y A;  4IJE A;  1ZMW A;  2DXI A;  4LF9 M;  4PD2 A;  3HJ8 A;  2EO2 A;  4AQY M;  2CE7 A;  3RFW A;  2QBY A;  4DR6 M;  3U6M A;  1I94 M;  3U6O A;  3IEC A;  4M0D A;  4DR1 M;  3TWL A;  1SXJ E;  4II7 A;  4JN6 A;  4RKU F;  3TQS A;  4DR3 M;  1G59 A;  2JNH A;  2APL A;  1OKS A;  2BJW A;  2CHV A;  2XFS A;  3PFI A;  4B08 A;  1XMO M;  2YNM D;  4MGY E;  2V1U A;  3M7G A;  4NSR A;  4LJ4 A;  4AI6 A;  3JR4 A;  2L2D A;  4FCT A;  1VDD A;  2R6F A;  2KW0 A;  1FNN A;  2CRU A;  4HLQ A;  1Q3B A;  1TR8 A;  2CEA A;  2DAK A;  3FD9 A;  4D82 A;  7CAT A;  5KQD A;  2XZU A;  2E5L M;  3GLH B;  4QOS A;  2X49 A;  3KSJ A;  1NY6 A;  2YR0 A;  2JA2 A;  3KW6 A;  4AG6 A;  1WHC A;  3AL0 C;  3SBJ A;  2DAM A;  4GC5 A;  2FS1 A;  2Q2E B;  4QHS A;  1QAN A;  1D2N A;  3GPX A;  3AJI B;  1QZM A;  3PNY A;  4XGI A;  3TWK A;  1T3T A;  2G5G X;  2CV2 A;  5ITY A;  3D8L A;  3GLH E;  1IN7 A;  3TWM A;  1Q02 A;  2N35 A;  4MB7 A;  4REZ A;  3VFD A;  1BVS A;  1GAB A;  4LJ9 A;  4AW4 A;  1NVM A;  3I01 M;  1IXZ A;  4IBB A;  3BBZ A;  1JR3 A;  2C96 A;  1R5L A;  2KEB A;  4X65 M;  1IY1 A;  4GRI A; 
#chains in the Genus database with same CATH homology
 1QAM A;  1WXQ A;  5E6J A;  3ZC7 B;  1C1K A;  4IBJ A;  4GHA A;  2ZAM A;  3U5Z A;  5FSW A;  1S3S A;  4PDI A;  3U6D A;  4FCW A;  1N77 A;  3HJQ A;  4JI2 M;  3DOA A;  5F3W A;  2Z7J A;  1IN5 A;  3A42 A;  1K3W A;  3KOW E;  1Z6T A;  3KVW A;  3M0E A;  4LF5 M;  2ZBK B;  2FOI C;  3C58 A;  1IBK M;  4G4N A;  3Q8X A;  2Z3X A;  4GH9 A;  4GIP A;  4LY6 A;  4OVZ A;  5ITX E;  3HKP A;  1NHW C;  3I4V A;  4RNA A;  4CIS A;  3FYC A;  1N34 M;  1DGB A;  1G41 A;  2H1R A;  2VQE M;  1IN6 A;  1SXJ A;  3LMM A;  2NQ8 C;  1QAO A;  4YHH M;  4IBD A;  4MGZ E;  3SHG B;  3W0F A;  1SXJ B;  2R65 A;  3GPU A;  4AKI A;  3PVS A;  3NBI A;  3WHK A;  4GMQ A;  4MGI E;  5LMU M;  5KPR A;  2R18 A;  3AKZ A;  3SAS A;  2CV1 A;  2DZO B;  3L2A A;  4EIW A;  1NNU C;  5KQ8 A;  1OFI A;  5FTN A;  4JI0 M;  3U61 A;  2UUB M;  3KXE C;  3L28 A;  2P5T A;  1XWI A;  4IBG A;  1E32 A;  3RGS A;  3VLF B;  5IZ7 D;  5IWA M;  3FYD A;  4MGK E;  4QNM A;  1QAQ A;  2HKJ A;  4M9Z A;  3SAW A;  1GL7 A;  1FJG M;  3NWL A;  2EUC A;  2R4E A;  4LGM A;  3TPZ A;  4I81 A;  3AOE C;  3SAT A;  4LF8 M;  3CF0 A;  4IIW A;  2FFJ A;  2XZF A;  3HU3 A;  3GQ4 A;  1SXJ C;  3JR5 A;  2XSZ D;  2I7N A;  3U6S A;  2UXC M;  1GKI A;  3THG A;  5EXT A;  2R45 A;  3IG8 A;  5EP2 A;  2C5R A;  3U5Z B;  5KPZ A;  3HHX A;  1DGH B;  3SAV A;  1X37 A;  4X62 M;  3E4R A;  5ITR A;  4YY3 M;  2AHM A;  3L29 A;  1NJF A;  1ZAE A;  2M5Z A;  3K92 A;  4LG2 A;  3R9X B;  3KS8 A;  4DUY M;  2D7H A;  5C1B A;  4LFB M;  5H37 D;  1GL6 A;  3T15 A;  1HNX M;  3DFZ A;  3AV0 A;  2ZAO A;  5ITU A;  2FNA A;  3GRV A;  4I4L A;  2OQ4 A;  3U6C A;  1MX0 A;  4R7G A;  3GPP A;  2QBY B;  2R46 A;  1XC8 A;  4LZJ A;  1XHB A;  5EP3 A;  4L78 A;  3QAU A;  3A46 A;  1PJJ A;  3I51 A;  3SHF A;  4GIT A;  4S12 A;  2XSZ A;  3L26 A;  4I5S A;  3HU2 A;  4DR7 M;  2F5P A;  5KPT A;  5GKN A;  3FUT A;  1Q3C A;  4QOZ C;  2YFQ A;  5DYI A;  2HHH M;  4LJ5 A;  4WUR A;  2F4V M;  2XEP A;  3GRY A;  3K2L A;  8CAT A;  1IN4 A;  1IY2 A;  4KO8 A;  1XXH A;  2C98 A;  3T1H M;  4PCZ A;  4GKK M;  3OTO M;  2KRK A;  4D80 A;  2A5Y B;  3UK6 A;  5C18 A;  3L25 A;  2UU9 M;  1TDZ A;  2Y21 A;  3U6E A;  3H4M A;  5FTL A;  4DV7 M;  1SXJ D;  3L27 A;  4NRW A;  2CUZ A;  3SYL A;  4B7H A;  3GLF B;  4LGY A;  5EJC A;  3HJS A;  4WW0 A;  5EXP A;  4B3S M;  5FLX S;  3J81 S;  1LV7 A;  3PXG A;  1K3X A;  3CTW B;  2QPA A;  3SMP A;  2HL7 A;  4DR5 M;  1HT2 E;  3J7B A;  4LJ6 A;  1XNQ M;  4L4U A;  4IBC A;  4KHP M;  3GLI B;  4AZF A;  2V6Z M;  3U6Q A;  2Y20 A;  3HWS A;  4B3M M;  3ILK A;  3MK6 A;  2ZM6 M;  2BJV A;  4FWH A;  1N32 M;  4JI6 M;  1G4A E;  4DV6 M;  3SAU A;  3B9P A;  1MU5 A;  2DWN A;  4OX9 M;  4LF6 M;  1N36 M;  2J7O A;  4FWD A;  3KOY E;  4X66 M;  1KYI A;  3HHY A;  4KOD A;  4A3V B;  4RF0 A;  3LQR A;  4IBI A;  1Z5B A;  4QHT A;  3KOX E;  4JI5 M;  2DWM A;  3GLG B;  4G4Q A;  2QZ4 A;  3UGJ A;  3UMM A;  4FVM A;  1JR3 D;  1L1T A;  2Y0Q A;  4Z6Y A;  5DYG A;  1N75 A;  1OJL A;  3KFU G;  1XMQ M;  3TE6 A;  2G8L A;  4L8R C;  1TDH A;  4B3R M;  2QEN A;  2CHG A;  4FD2 A;  1G8P A;  2DWL A;  2L09 A;  1N78 A;  2C99 A;  2R62 A;  5E26 A;  4DV1 M;  2I7P A;  3T38 A;  2CV0 A;  2UXB M;  3ZCB B;  4JI8 M;  2FE8 A;  4D81 A;  1E9S A;  2DHR A;  4BB9 A;  2X8A A;  2C9O A;  2D7E A;  5FTJ A;  2K47 A;  2J7N A;  5BPV A;  3GLG A;  1HNZ M;  2X4A A;  3ZH9 B;  2L7I A;  2LWX A;  4NRV A;  3FKE A;  4FCV A;  4Z8X A;  4K0K M;  3SMS A;  4B3T M;  1IXR C;  4MH0 E;  3GLH A;  1NJG A;  1R7R A;  4JXJ A;  3VKH A;  4M9X A;  3JAM S;  5ITT A;  4R3D A;  3BOS A;  4PT5 A;  5LMN M;  1W5T A;  5EP4 A;  5ITX A;  4HL4 A;  2L7H A;  4NOO B;  4TUW A;  5FTK A;  2R4J A;  5DNY A;  3K8Z A;  4M9S A;  3D8B A;  2EA0 A;  2CFO A;  3VK8 A;  2QP9 X;  2F5Q A;  1ZQ9 A;  4B7G A;  2KZS A;  3GQ3 A;  3U60 A;  3LVW A;  1GLN A;  4AKG A;  1TGU A;  2Y0T A;  3KOZ E;  2XH9 A;  4OW0 A;  5EXS A;  4BLC A;  3UJN A;  4P16 A;  1K82 A;  4ZPX A;  1G3I A;  2RGO A;  3SAR A;  1NHG C;  2BNK A;  2KXE A;  2KZU A;  4XBO A;  4CGY B;  2F5N A;  1J7K A;  1J09 A;  2QCU A;  3FTF A;  4LRS A;  4CHT B;  1XXH B;  1PM5 A;  5KO3 A;  2DZN B;  5EXX A;  3WHL A;  1OFH A;  3FTE A;  3RE8 A;  2CHQ A;  3HHZ A;  3HU1 A;  3FUX A;  1L2D A;  5EQT A;  5JI2 E;  1Z5C A;  4W5W A;  3J2P B;  4JYA M;  3SC3 A;  3KDS E;  1HQC A;  3FUU A;  4NSO B;  4QNR A;  3AOE A;  3HHW A;  1YSY A;  3SYK A;  1IXS B;  4G4R A;  3VDP A;  2KA6 B;  3W0L B;  1DGG A;  3CF2 A;  3PNV A;  1KFV A;  2C9C A;  1TH4 A;  3FUV A;  4M0W A;  3J80 S;  4LRT A;  4DUZ M;  3I4Y A;  2M60 A;  1UM8 A;  1Q39 A;  4FWG A;  4DV3 M;  2LH0 A;  3DA1 A;  2Z4S A;  5FTM A;  3R8F A;  3MHV C;  3VDU A;  3M6A A;  3GRU A;  1YE9 A;  1ORY B;  5EP1 A;  2D7G A;  2LNH C;  3FUW A;  2W82 A;  3IG5 A;  3MJ5 A;  2ERC A;  1GVN A;  5ITQ A;  3GQ5 A;  1EE8 A;  4DR2 M;  4JV5 M;  2OPF A;  1PJI A;  3E9S A;  1DGH A;  3T1Y M;  2F5O A;  1R2Z A;  3EIH A;  4IJF A;  3GRR A;  4L16 A;  4X64 M;  4DV0 M;  3A45 A;  2DWZ B;  3TL4 X;  1DGF A;  3QWL A;  3GPY A;  2VQF M;  3K1J A;  2VII A;  4MGH A;  2V1C A;  1JQJ C;  1NSF A;  2XFT A;  4FW9 A;  1Z5A A;  2DVW B;  4LF7 M;  2LXE A;  3U6L A;  2RGH A;  4JI1 M;  3KS4 A;  1IBL M;  4G6Z A;  5BR8 M;  2XF3 A;  1HT1 E;  2ZAN A;  1W5S A;  2HCB A;  4LFA M;  3HGI A;  3KP1 E;  1NY5 A;  3RGP A;  1HR0 M;  4IBE A;  3VK7 A;  4DV5 M;  1E94 E;  2XLJ A;  2F5S A;  1IBM M;  1YUB A;  1DO0 A;  4G4O A;  1HQY E;  1Z59 A;  3FTD A;  4BBA A;  4MM3 B;  4LFC M;  3U61 B;  4LCB A;  1QVR A;  1R6B X;  1TH2 A;  2UUC M;  4GKJ M;  3SFZ A;  3CF6 E;  1QQW A;  4NL4 H;  2KRU A;  1L2C A;  3A98 B;  3GO8 A;  4NXM M;  5IT9 S;  3FTC A;  3VKG A;  1L2B A;  4LJA A;  4GC9 A;  4IBK A;  4ITQ A;  4LZZ A;  4JI4 M;  1HNW M;  4IBF A;  2UXD M;  4LJ8 A;  1IY0 A;  1XNR M;  1H6U A;  1N33 M;  3UZU A;  1KSF X;  4OU7 A;  3GLF A;  2XGN A;  1E9R A;  1QYR A;  1J5E M;  1NNJ A;  5JI3 E;  1TH3 A;  4PDG A;  3LQQ A;  2L6O A;  5A2Q S;  1IN8 A;  1DO2 A;  4AKH A;  1L1Z A;  4I8O A;  4RF1 A;  3DZD A;  4LJ7 A;  3GLI A;  4OVZ B;  1L8Q A;  4JI3 M;  4JI7 M;  3J7A S;  4DR4 M;  4B7F A;  2UUA M;  4GHL A;  1IM2 A;  4KLN A;  3KP0 E;  3KSX A;  1IQP A;  5IRE B;  4DV2 M;  3J27 B;  4NXN M;  1I4W A;  3LVV A;  4DV4 M;  2RKO A;  2YQZ A;  3AFH A;  2O5R A;  3GP1 A;  4L15 A;  3AOG A;  4AG5 A;  4LF4 M;  2Z4R A;  3U6P A;  3EIE A;  3U60 B;  1R2Y A;  4IJE A;  2DXI A;  4LF9 M;  4PD2 A;  3HJ8 A;  2EO2 A;  4AQY M;  2CE7 A;  3RFW A;  2QBY A;  4DR6 M;  3U6M A;  1I94 M;  3U6O A;  4M0D A;  4DR1 M;  3TWL A;  1SXJ E;  4II7 A;  4JN6 A;  3TQS A;  4DR3 M;  1G59 A;  2BJW A;  2CHV A;  4B08 A;  2XFS A;  3PFI A;  1XMO M;  2YNM D;  4MGY E;  2V1U A;  3M7G A;  4NSR A;  4LJ4 A;  4AI6 A;  3JR4 A;  4FCT A;  1VDD A;  4HLQ A;  2KW0 A;  1FNN A;  4D82 A;  1Q3B A;  2CEA A;  3FD9 A;  5KQD A;  2XZU A;  2E5L M;  7CAT A;  3GLH B;  4QOS A;  2X49 A;  3KSJ A;  1NY6 A;  2YR0 A;  2JA2 A;  3KW6 A;  4AG6 A;  3AL0 C;  3SBJ A;  4QHS A;  4GC5 A;  2Q2E B;  1QAN A;  1D2N A;  3GPX A;  3AJI B;  1QZM A;  3PNY A;  4XGI A;  3TWK A;  1T3T A;  2G5G X;  2CV2 A;  5ITY A;  3D8L A;  1IN7 A;  3TWM A;  4REZ A;  4MB7 A;  3VFD A;  4LJ9 A;  4AW4 A;  1NVM A;  1IXZ A;  4IBB A;  1JR3 A;  2C96 A;  2KEB A;  4X65 M;  1IY1 A;  4GRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...