3THGA

Crystal structure of the creosote rubisco activase c-domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
PFTREDRIGVCKGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ribulose bisphosphate carboxylase/oxygenase activase 1, chlo
publication title Atomic resolution x-ray structure of the substrate recognition domain of higher plant ribulose-bisphosphate carboxylase/oxygenase (Rubisco) activase.
pubmed doi rcsb
source organism Larrea tridentata
molecule tags Protein binding
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1070 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3thgA00
3T15A 4W5WA 3THGA
chains in the Genus database with same CATH superfamily
2DZOB 1DGHB 1TH2A 2G3QA 4M0DA 4RNAA 4BB9A 4R71A 4PCZA 1IBLM 3U61A 3V76A 2EA0A 1R6BX 2FOIC 2M60A 1G59A 1S3SA 4LZJA 2YQZA 4NL4H 4MM3B 2QHOB 3L27A 1PJIA 2I7NA 2RRUA 4KHPM 4AI6A 1GL7A 4AG5A 1HNXM 3SATA 3HU1A 2DKLA 5FTNA 3KSJA 4B3SM 4GHAA 2LVQD 4BLCA 5A2QS 2XFTA 1T6OA 2CV1A 3TQSA 4ITQA 1D0KA 3LW5F 1D0LA 1Z59A 2L4EA 1DGFA 5IREB 3FTDA 4FCVA 3J80S 5ITUA 4L8RC 2HAKA 4LF4M 4MB7A 1VEJA 4PDIA 4LG2A 5GKNA 1R2YA 4AG6A 4X62M 3LQRA 3FKEA 3FRHA 4MGZE 3RFWA 1V92A 2EJSA 1Q39A 3L28A 2D7GA 1HNWM 1L8QA 2JY8A 1WHCA 2CHQA 3HJ8A 3JAMS 1OFHA 2GQFA 4NXMM 4PDGA 2VF8A 4W5WA 1IN4A 4DR1M 3C3DA 4JI8M 4B7GA 3NBIA 1TH3A 2WSCF 5KPZA 2ZM6M 4B7FA 5ITXA 2UXBM 1EE8A 3MHVC 1QAOA 2MROB 3HJQA 3I4YA 1WXQA 2YFQA 1H6UA 1D2NA 5C18A 1TDHA 5FSWA 2LWXA 1TR8A 1MN3A 2AHMA 2Q2EB 5F3WA 3Q8GA 3UK6A 1QANA 2DI0A 2QQ8A 4L6V6 4DBGB 1WIVA 3SMPA 4DR5M 2F5OA 5KPTA 3QYEA 4JXJA 3I51A 1JR3E 1OFIA 3PNYA 2DWLA 2F4VM 1G8PA 4MGHA 3GRUA 3U6LA 3T1HM 2DZLA 3UMMA 4MGKE 2LHGA 3C58A 2UUCM 2ERCA 1I94M 4IBBA 2CRUA 1OAOC 4F1IA 2R4JA 3GLFB 2VQEM 1R2ZA 1ZMWA 1HQYE 4L15A 3ZQJA 4B3MM 3HZJA 3CF0A 4DV6M 2C9OA 1L2CA 3UGJA 2VDBB 3I01M 2LH0A 1GLNA 4NSOB 5DYIA 5JI3E 5EXSA 1NSFA 3E46A 4GMQA 4WW0A 1R4GA 4Z8XA 3TWMA 3B7NA 2O25A 2LVOC 3U6OA 2C5RA 5E6JA 2XEPA 1I4WA 4G4RA 1R5LA 1OJLA 1QZMA 1UFZA 1XWIA 3B9PA 1IXZA 2Y21A 4B7HA 1NJFA 2F5QA 2OOAA 2J7NA 2R0IA 4QNRA 4IBEA 1ZMVA 2HHHM 3NWLA 2L7HA 1W5TA 2DAMA 5DFLA 1TF0B 4JYAM 1LV7A 3E4RA 2KNZA 4WP2A 4DUYM 2DWMA 4LY6A 4IBCA 4L16A 5ITTA 1L2BA 2DAGA 4G6ZA 3RGSA 1ZAEA 2OO9A 3AL0C 2CWBA 3FUTA 5EXPA 2LHCA 3VLFB 3GRVA 1T43A 2QP9X 3AOEC 3FD9A 5FTJA 1DV0A 4GC9A 2KRKA 1YSYA 2APLA 2CUZA 2R65A 3GLIA 4M9XA 3IG5A 1C7YA 4JI4M 2X8AA 2KRUA 1K3WA 1PJTA 2QBYB 4OX9M 3GQ3A 4MH0E 2XSZA 5ITRA 3SMSA 2Z7JA 3FTEA 4L78A 3GLGA 1T3TA 3FRIA 1IN5A 4PT5A 1GVNA 2L6OA 2JA2A 4OVZB 2QNJA 3JR5A 4AKHA 2CP8A 2WSEF 1W5SA 3W0FA 2H5XA 1NJGA 4JI5M 2K47A 1VDLA 1Q3CA 1QQWA 4LZZA 3VK7A 5DYGA 1PRBA 2C99A 5EP1A 4LFAM 3PVSA 1K3XA 4LJAA 1NHGC 2OOBA 4P17A 1IXSB 2JY6B 3KVWA 4GRIA 1VEGA 4JI7M 3WHLA 3J81S 1Z5BA 3K1JA 5DNYA 1TH4A 3W0LB 3QWLA 8CATA 3L29A 2D7HA 5FTKA 3GRRA 4JI6M 2UXCM 3GP1A 1RU3A 1DO2A 4DR4M 1NY5A 3U5ZB 5EXTA 5LMUM 2XSZD 4XBOA 1IY2A 3F92A 2C9CA 1QAMA 2DZNB 3SFZA 4CGYB 2XZFA 2XZUA 4GC5A 3U6PA 4GKKM 2P5TA 1SXJB 3FE3A 4X64M 1OQYA 1N75A 2JWSA 3T1YM 2QENA 4FWDA 2V1CA 2X49A 1SXJE 3BXWA 3LVWA 4BBAA 2VQFM 3U6MA 3ILKA 2EKFA 3GLHB 1TTEA 1NNJA 1K82A 1SG9A 3A42A 4LF5M 2CV2A 2LBCA 2WSFF 1IN7A 4I8OA 2OPFA 1X37A 3U6EA 2DWNA 2JNHA 2UXDM 1XXHB 3KFUG 2DAIA 1PJQA 4IBIA 3W68A 1HT1E 1XXHE 3TWKA 1KYIA 2J5YA 3VK8A 3J7AS 4X65M 4CJ6A 4AKIA 1L1ZA 1XNRM 3QYBA 4LRTA 1IBMM 1LTMA 3LCUA 3U60A 2W82A 2Y0TA 3AJIB 4LF6M 2LVNC 4LFBM 1KFVA 4FD2A 4FCTA 5KQDA 2ZBKB 2FS1A 4Y28F 1NY6A 4LGMA 2UU9M 3K9OA 3T15A 4JI2M 2HCBA 3SAWA 2CFOA 4DV5M 4LF7M 3T38A 2E5LM 1YUBA 2JXNA 3U6CA 4HEOA 2F5SA 1Y8GA 2DWZB 1Q02A 1SXJC 2N35A 3EIEA 5L8RF 3GQ5A 4DV4M 1N36M 1IM2A 1WJ7A 3FYDA 3J7BA 1FJGM 2C98A 4IBGA 4Q7JA 2C96A 2MH8A 4FCWA 1AIPC 3E21A 3TL4X 2R4EA 4REZA 3R8FA 3KP0E 1OKSA 5IZ7D 2FE8A 3J2PB 4GITA 2WZJA 4RF1A 3GLFE 1NV9A 1QUSA 3MMPA 5IWAM 2UUAM 4M0WA 5H37D 2CHGA 4ANRA 3L25A 4DR6M 1BVSA 3MK6A 3SYKA 4LFCM 3B74A 3GPUA 2G8LA 1E32A 3A45A 1DGBA 2QPAA 3U6QA 2DXIA 4I5SA 3C3EA 4B08A 1J7KA 3SAVA 4G4NA 2VF7A 4PD2A 1QDRA 2HWJA 3Q8XA 5EP2A 4YY3M 4IJEA 2R62A 1J5EM 3U6SA 2A5YB 2KNAA 4GKJM 1Z6TA 3LMMA 4Z6YA 4DV2M 3SARA 2KA6B 2DAEA 1XMQM 1HR0M 3HJSA 3J27B 2G5GX 2DHYA 3K2LA 2L7IA 4IBKA 1IY1A 2Y0QA 5BR8M 2JZ1A 3DA1A 4NXNM 1ZQ9A 2DNAA 4LF8M 3CGWA 3GPPA 5LMNM 3VKGA 1GKIA 4LGYA 3I4VA 1Z5CA 3KXEC 4IIWA 1N34M 2L4FA 5ITQA 4DV3M 2LVPC 1HJPA 3PNVA 3THGA 2JZ0A 3VFDA 2R45A 5FTLA 1FNNA 1IXSA 2CE7A 2B3TA 2YR0A 3CTWB 4NOOB 4LCBA 4GHLA 4FW9A 1ORYB 1G71A 3HY5A 4WURA 3DOAA 1QYRA 3GO8A 2ZTCA 1PJSA 1DGHA 1UM8A 2H1RA 3RGPA 2RGOA 1IXRC 4XK8F 2FH0A 2L09A 4JI1M 3KS8A 1OIPA 2R18A 1WGLA 3B7QA 3W67A 3BOSA 4F2LA 1HNZM 4K0KM 3SHGB 2X4AA 3AKZA 4B3TM 3VDPA 1VG5A 2XLJA 1QDTA 4CHTB 3KOZE 3SASA 4UN2B 4R7GA 2DVWB 2EO2A 2R46A 1SXJA 4DV7M 2XFSA 2EKKA 3M7GA 5EP3A 2QSFX 1VQ1A 2K6BA 3H4MA 2GNOA 2MJ5B 4QNMA 1WGNA 2CEAA 1Z5AA 3K8ZA 3A46A 3D8LA 3K92A 1IBKM 3GLIB 2KXEA 3FUXA 4LJ9A 1L2DA 2ZANA 3SBJA 4LF9M 1OAIA 3KP1E 4M9SA 4ZPXA 3TE6A 4LJ6A 1NNUC 2O5RA 2KW0A 3T6PA 4P16A 3KOXE 4IJFA 4QHSA 3GPYA 2D7EA 1EIJA 3FTFA 4JN6A 2DENA 1NVMA 2BWEA 3KOYE 4NSRA 3GLHE 3VDUA 4D81A 4QOZC 1AUAA 1OIZA 2XH9A 4EIWA 3ZCBB 4DR3M 3FUUA 1PM5A 1TGUA 3TWLA 4KLNA 1SXJD 2OQ4A 3CF2A 2RKOA 2EUCA 2KEBA 4CISA 1ZV1A 1V34A 4JV5M 1GL6A 1E94E 1HQCA 2XGNA 2ZAOA 2HL7A 3IG8A 3HHWA 4G3OA 2YNMD 2I7PA 2LTUA 2NQ8C 1A5TA 1JR3A 3AOEA 3C9PA 5BPVA 1XNQM 3U61B 3KDSE 2Z4RA 3AFHA 4LJ8A 1MX0A 1WR1B 1GJSA 3HHXA 3L2AA 4DV0M 2BJWA 4HL4A 1N32M 5C1BA 1C1KA 4LJ4A 4OW0A 3SAUA 2LNHC 3KW6A 1OTRA 1QZEA 3GLFA 1IN6A 1EFUB 2JP7A 1IY0A 3IECA 4TUWA 1YE9A 1IN8A 3KSXA 3GPXA 1VEKA 3H4JA 3AV0A 2HKJA 3ZC7B 2Z4SA 2QZ4A 3I04M 4LJ5A 3PXGA 4OU7A 3HWSA 5EP4A 1IFYA 2KZUA 2QCUA 3B7ZA 2KNVA 1MJGM 3TPZA 3SC3A 2DAKA 5E26A 3D8BA 4I4LA 4NC6A 1J09A 1JB0F 1JR3D 3HGIA 1NO1A 2VIIA 5FTMA 4DUZM 3U6DA 4KO8A 3GQ4A 1XB2B 1HT2E 4RKUF 5EXXA 4DR2M 3U60B 3HHYA 1Q3BA 3M6AA 1E9RA 4B3RM 1DGGA 3UZUA 3K9PA 1NV8A 2KZSA 3RE8A 1QAQA 5EJCA 1MU5A 5KPRA 3DZDA 4JI3M 4CIZA 5FLXS 3FTCA 3NBXX 4L4UA 1XHBA 3M0EA 5ITXE 4D82A 2Z3XA 5EQTA 1N33M 2JY5A 4JI0M 4A3VB 3KS4A 1JQJC 4D80A 2QBYA 4AKGA 4I81A 4IBDA 1TDZA 3KOWE 3SHFA 3E9SA 2UUBM 1DO0A 3R9XB 2K9DA 2V1UA 1KSFX 3SYLA 4OVZA 2MGWA 7CATA 4RF0A 2RGHA 2O01F 2Y20A 2CV0A 5IT9S 3B89A 1GJTA 2MR9A 1N78A 1NHWC 3EIHA 3ZH9B 2BNKA 4G4QA 4QOSA 4LJ7A 4KODA 4AW4A 2ZAMA 3VKHA 4LRSA 1F4IA 3MJ5A 4II7A 4AZFA 2LXEA 2M5ZA 4GH9A 5ITYA 3WHKA 3OTOM 1IQPA 4XGIA 2BWBA 2F5NA 2FNAA 3L26A 3DFZA 1QVRA 4QHTA 3FYCA 2R44A 2Z8YM 3U5ZA 4IBJA 1YLAA 4FVMA 3AOGA 2LVAA 1G4AE 3FUWA 3HKPA 2CHVA 1G3IA 4NRVA 4MGYE 4AQYM 1GO5A 2ZTDA 1G41A 3CF6E 3HU2A 3UJNA 2JY7A 1CUKA 3JR4A 1ZMUA 2FFJA 4NRWA 3HU3A 1L1TA 1R7RA 4GIPA 3LQQA 1GABA 4M9ZA 4HLQA 4G4OA 3GLHA 3LCVB 3HX3A 1QUTA 3GRYA 3PFIA 1N77A 2F5PA 4DR7M 5KO3A 1PJJA 3A98B 5KQ8A 4S12A 1XC8A 3IHPA 2JUJA 3GLIE 3BBZA 1XXHA 3FUVA 1D0MA 2KDLA 4GEWA 4DV1M 1E9SA 2J7OA 2R6FA 2XF3A 3QAUA 1VDDA 2K0BX 5JI2E 2V6ZM 1XMOM 1V33A 3LVVA 2KHHA 3GLGB 4YHHM 4KT0F 4FWHA 1PGYA 1P3QQ 4MGIE 3HHZA 4IBFA 3GLGE 4X66M 2BJVA 4FWGA 2DHRA 4R3DA 2L2DA
chains in the Genus database with same CATH topology
2DZOB 1DGHB 1TH2A 4BB9A 4M0DA 4RNAA 4PCZA 1IBLM 3U61A 2EA0A 1R6BX 2FOIC 2M60A 1G59A 1S3SA 4LZJA 2YQZA 4NL4H 4MM3B 3L27A 1PJIA 2I7NA 4KHPM 4AI6A 1GL7A 4AG5A 1HNXM 3SATA 3HU1A 4GHAA 5FTNA 3KSJA 4B3SM 5A2QS 4BLCA 2XFTA 2CV1A 3TQSA 4ITQA 1Z59A 1DGFA 5IREB 3FTDA 4FCVA 3J80S 5ITUA 4L8RC 4LF4M 4MB7A 4PDIA 4LG2A 5GKNA 1R2YA 4AG6A 4X62M 3LQRA 3FKEA 4MGZE 3RFWA 1Q39A 3L28A 2D7GA 1HNWM 1L8QA 2CHQA 3HJ8A 3JAMS 1OFHA 4NXMM 4PDGA 4W5WA 1IN4A 4DR1M 4JI8M 4B7GA 3NBIA 1TH3A 5KPZA 2ZM6M 4B7FA 5ITXA 2UXBM 1EE8A 3MHVC 1QAOA 3HJQA 3I4YA 1WXQA 2YFQA 1H6UA 1D2NA 5C18A 1TDHA 5FSWA 2LWXA 5F3WA 2AHMA 2Q2EB 3UK6A 1QANA 3SMPA 4DR5M 2F5OA 5KPTA 4JXJA 3I51A 1OFIA 3PNYA 2DWLA 2F4VM 1G8PA 4MGHA 3GRUA 3U6LA 3T1HM 3UMMA 4MGKE 3C58A 2UUCM 2ERCA 1I94M 4IBBA 3GLFB 2R4JA 2VQEM 1R2ZA 4B3MM 1HQYE 4L15A 3CF0A 4DV6M 2C9OA 1L2CA 3UGJA 2LH0A 1GLNA 4NSOB 5DYIA 5JI3E 5EXSA 1NSFA 4GMQA 4WW0A 4Z8XA 3TWMA 3U6OA 2C5RA 5E6JA 2XEPA 1I4WA 4G4RA 1OJLA 1QZMA 1XWIA 3B9PA 1IXZA 2Y21A 4B7HA 1NJFA 2F5QA 2J7NA 4QNRA 4IBEA 2HHHM 3NWLA 2L7HA 1W5TA 4JYAM 1LV7A 3E4RA 4DUYM 2DWMA 4LY6A 4IBCA 4L16A 5ITTA 1L2BA 4G6ZA 3RGSA 1ZAEA 3AL0C 3FUTA 5EXPA 3VLFB 3GRVA 2QP9X 3AOEC 3FD9A 5FTJA 4GC9A 2KRKA 1YSYA 2CUZA 2R65A 3GLIA 4M9XA 3IG5A 4JI4M 2X8AA 2KRUA 1K3WA 2QBYB 4OX9M 3GQ3A 4MH0E 2XSZA 5ITRA 3SMSA 2Z7JA 3FTEA 4L78A 3GLGA 1T3TA 1IN5A 4PT5A 1GVNA 2L6OA 2JA2A 4OVZB 3JR5A 4AKHA 3W0FA 1W5SA 1NJGA 4JI5M 2K47A 1Q3CA 1QQWA 4LZZA 3VK7A 5DYGA 2C99A 5EP1A 4LFAM 3PVSA 1K3XA 4LJAA 1NHGC 1IXSB 3KVWA 4GRIA 4JI7M 3WHLA 3J81S 1Z5BA 3K1JA 5DNYA 1TH4A 3W0LB 3QWLA 8CATA 3L29A 2D7HA 5FTKA 3GRRA 4JI6M 2UXCM 3GP1A 4DR4M 1DO2A 1NY5A 3U5ZB 5EXTA 5LMUM 2XSZD 4XBOA 1IY2A 3SFZA 2C9CA 1QAMA 2DZNB 2XZFA 4CGYB 2XZUA 4GC5A 3U6PA 4GKKM 2P5TA 1SXJB 4X64M 1N75A 3T1YM 2QENA 4FWDA 2V1CA 2X49A 1SXJE 4BBAA 3LVWA 2VQFM 3U6MA 3ILKA 3GLHB 1NNJA 1K82A 3A42A 4LF5M 2CV2A 1IN7A 4I8OA 2OPFA 1X37A 3U6EA 2DWNA 2UXDM 1XXHB 3KFUG 4IBIA 1HT1E 3TWKA 1KYIA 3VK8A 3J7AS 4X65M 4AKIA 1L1ZA 1XNRM 4LRTA 1IBMM 3U60A 2W82A 2Y0TA 3AJIB 4LF6M 4LFBM 1KFVA 4FD2A 4FCTA 5KQDA 2ZBKB 1NY6A 4LGMA 2UU9M 3T15A 4JI2M 2HCBA 3SAWA 2CFOA 4DV5M 4LF7M 3T38A 2E5LM 1YUBA 3U6CA 2F5SA 2DWZB 3EIEA 1SXJC 3GQ5A 1N36M 4DV4M 1IM2A 3FYDA 3J7BA 1FJGM 2C98A 4IBGA 2C96A 4FCWA 3TL4X 2R4EA 4REZA 3R8FA 3KP0E 5IZ7D 2FE8A 3J2PB 4GITA 4RF1A 5IWAM 2UUAM 3L25A 4DR6M 4M0WA 5H37D 2CHGA 3MK6A 3SYKA 4LFCM 3GPUA 2G8LA 1E32A 3A45A 1DGBA 2QPAA 3U6QA 2DXIA 4I5SA 4B08A 1J7KA 3SAVA 4G4NA 4PD2A 5EP2A 3Q8XA 4YY3M 4IJEA 2R62A 1J5EM 3U6SA 2A5YB 4GKJM 1Z6TA 3LMMA 4Z6YA 4DV2M 3SARA 2KA6B 1XMQM 1HR0M 3HJSA 3J27B 2G5GX 3K2LA 2L7IA 4IBKA 1IY1A 2Y0QA 5BR8M 3DA1A 4NXNM 1ZQ9A 4LF8M 3GPPA 5LMNM 3VKGA 1GKIA 4LGYA 3I4VA 1Z5CA 3KXEC 4IIWA 1N34M 5ITQA 4DV3M 3THGA 3PNVA 3VFDA 2R45A 5FTLA 1FNNA 2CE7A 2YR0A 3CTWB 4NOOB 4LCBA 4GHLA 4FW9A 1ORYB 4WURA 3DOAA 1QYRA 3GO8A 2H1RA 1DGHA 1UM8A 3RGPA 2RGOA 1IXRC 3KS8A 2L09A 4JI1M 2R18A 3BOSA 1HNZM 4K0KM 3SHGB 2X4AA 3AKZA 4B3TM 3VDPA 2XLJA 4CHTB 3KOZE 3SASA 4R7GA 2DVWB 2EO2A 2R46A 1SXJA 4DV7M 2XFSA 3M7GA 5EP3A 3H4MA 4QNMA 2CEAA 1Z5AA 3K8ZA 3A46A 3D8LA 3K92A 1IBKM 3GLIB 2KXEA 3FUXA 4LJ9A 1L2DA 2ZANA 3SBJA 4LF9M 3KP1E 4M9SA 4ZPXA 3TE6A 4LJ6A 1NNUC 2O5RA 2KW0A 4P16A 3KOXE 4IJFA 4QHSA 3GPYA 2D7EA 3FTFA 4JN6A 4D81A 1NVMA 3KOYE 4NSRA 3VDUA 4QOZC 2XH9A 4EIWA 3ZCBB 4DR3M 3FUUA 1PM5A 1TGUA 3TWLA 4KLNA 1SXJD 2OQ4A 3CF2A 2RKOA 2EUCA 2KEBA 4CISA 4JV5M 1GL6A 1E94E 1HQCA 2XGNA 2ZAOA 2HL7A 3IG8A 3HHWA 2YNMD 2I7PA 2NQ8C 3AOEA 5BPVA 1JR3A 1XNQM 3U61B 3KDSE 2Z4RA 3AFHA 4LJ8A 1MX0A 3HHXA 3L2AA 4DV0M 2BJWA 4HL4A 1N32M 5C1BA 1C1KA 4LJ4A 4OW0A 3SAUA 2LNHC 3KW6A 3GLFA 1IN6A 1IY0A 4TUWA 1YE9A 1IN8A 3KSXA 3GPXA 3AV0A 2HKJA 3ZC7B 2Z4SA 2QZ4A 4LJ5A 3PXGA 4OU7A 3HWSA 5EP4A 2KZUA 2QCUA 3TPZA 3SC3A 5E26A 3D8BA 4I4LA 1J09A 3HGIA 1JR3D 5FTMA 4DUZM 2VIIA 3U6DA 4KO8A 3GQ4A 1HT2E 5EXXA 4DR2M 3U60B 3HHYA 1Q3BA 3M6AA 1E9RA 4B3RM 1DGGA 3UZUA 2KZSA 3RE8A 1QAQA 5EJCA 1MU5A 5KPRA 3DZDA 4JI3M 5FLXS 3FTCA 4L4UA 1XHBA 3M0EA 5ITXE 4D82A 2Z3XA 5EQTA 1N33M 4JI0M 4A3VB 4AKGA 3KS4A 1JQJC 4D80A 2QBYA 4I81A 4IBDA 1TDZA 3KOWE 3SHFA 3E9SA 2UUBM 1DO0A 3R9XB 2V1UA 1KSFX 3SYLA 4OVZA 7CATA 4RF0A 2RGHA 2Y20A 2CV0A 5IT9S 1N78A 1NHWC 3EIHA 3ZH9B 2BNKA 4G4QA 4QOSA 4LJ7A 4KODA 4AW4A 2ZAMA 3VKHA 4LRSA 3MJ5A 4II7A 4AZFA 2LXEA 2M5ZA 4GH9A 5ITYA 3WHKA 3OTOM 1IQPA 4XGIA 2F5NA 2FNAA 3L26A 3DFZA 1QVRA 4QHTA 3FYCA 3U5ZA 4IBJA 4FVMA 3AOGA 3FUWA 1G4AE 3HKPA 2CHVA 1G3IA 4NRVA 4MGYE 4AQYM 3CF6E 1G41A 3HU2A 3UJNA 3JR4A 4NRWA 2FFJA 3HU3A 1L1TA 1R7RA 4GIPA 3LQQA 4M9ZA 4HLQA 4G4OA 3GLHA 3GRYA 3PFIA 2F5PA 1N77A 4DR7M 5KO3A 1PJJA 3A98B 5KQ8A 4S12A 1XC8A 4DV1M 1XXHA 3FUVA 1E9SA 2J7OA 2XF3A 3QAUA 1VDDA 5JI2E 2V6ZM 1XMOM 3LVVA 3GLGB 4YHHM 4FWHA 4MGIE 3HHZA 4IBFA 4X66M 2BJVA 4FWGA 2DHRA 4R3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T15 A;  4W5W A;  3THG A; 
#chains in the Genus database with same CATH topology
 2DZO B;  1DGH B;  1TH2 A;  2G3Q A;  4M0D A;  4RNA A;  4BB9 A;  4R71 A;  4PCZ A;  1IBL M;  3U61 A;  3V76 A;  2EA0 A;  1R6B X;  2FOI C;  2M60 A;  1G59 A;  1S3S A;  4LZJ A;  2YQZ A;  4NL4 H;  4MM3 B;  2QHO B;  3L27 A;  1PJI A;  2I7N A;  2RRU A;  4KHP M;  4AI6 A;  1GL7 A;  4AG5 A;  1HNX M;  3SAT A;  3HU1 A;  2DKL A;  5FTN A;  3KSJ A;  4B3S M;  4GHA A;  2LVQ D;  4BLC A;  5A2Q S;  2XFT A;  1T6O A;  2CV1 A;  3TQS A;  4ITQ A;  1D0K A;  3LW5 F;  1D0L A;  1Z59 A;  2L4E A;  1DGF A;  5IRE B;  3FTD A;  4FCV A;  3J80 S;  5ITU A;  4L8R C;  2HAK A;  4LF4 M;  4MB7 A;  1VEJ A;  4PDI A;  4LG2 A;  5GKN A;  1R2Y A;  4AG6 A;  4X62 M;  3LQR A;  3FKE A;  3FRH A;  4MGZ E;  3RFW A;  1V92 A;  2EJS A;  1Q39 A;  3L28 A;  2D7G A;  1HNW M;  1L8Q A;  2JY8 A;  1WHC A;  2CHQ A;  3HJ8 A;  3JAM S;  1OFH A;  2GQF A;  4NXM M;  4PDG A;  2VF8 A;  4W5W A;  1IN4 A;  4DR1 M;  3C3D A;  4JI8 M;  4B7G A;  3NBI A;  1TH3 A;  2WSC F;  5KPZ A;  2ZM6 M;  4B7F A;  5ITX A;  2UXB M;  1EE8 A;  3MHV C;  1QAO A;  2MRO B;  3HJQ A;  3I4Y A;  1WXQ A;  2YFQ A;  1H6U A;  1D2N A;  5C18 A;  1TDH A;  5FSW A;  2LWX A;  1TR8 A;  1MN3 A;  2AHM A;  2Q2E B;  5F3W A;  3Q8G A;  3UK6 A;  1QAN A;  2DI0 A;  2QQ8 A;  4L6V 6;  4DBG B;  1WIV A;  3SMP A;  4DR5 M;  2F5O A;  5KPT A;  3QYE A;  4JXJ A;  3I51 A;  1JR3 E;  1OFI A;  3PNY A;  2DWL A;  2F4V M;  1G8P A;  4MGH A;  3GRU A;  3U6L A;  3T1H M;  2DZL A;  3UMM A;  4MGK E;  2LHG A;  3C58 A;  2UUC M;  2ERC A;  1I94 M;  4IBB A;  2CRU A;  1OAO C;  4F1I A;  2R4J A;  3GLF B;  2VQE M;  1R2Z A;  1ZMW A;  1HQY E;  4L15 A;  3ZQJ A;  4B3M M;  3HZJ A;  3CF0 A;  4DV6 M;  2C9O A;  1L2C A;  3UGJ A;  2VDB B;  3I01 M;  2LH0 A;  1GLN A;  4NSO B;  5DYI A;  5JI3 E;  5EXS A;  1NSF A;  3E46 A;  4GMQ A;  4WW0 A;  1R4G A;  4Z8X A;  3TWM A;  3B7N A;  2O25 A;  2LVO C;  3U6O A;  2C5R A;  5E6J A;  2XEP A;  1I4W A;  4G4R A;  1R5L A;  1OJL A;  1QZM A;  1UFZ A;  1XWI A;  3B9P A;  1IXZ A;  2Y21 A;  4B7H A;  1NJF A;  2F5Q A;  2OOA A;  2J7N A;  2R0I A;  4QNR A;  4IBE A;  1ZMV A;  2HHH M;  3NWL A;  2L7H A;  1W5T A;  2DAM A;  5DFL A;  1TF0 B;  4JYA M;  1LV7 A;  3E4R A;  2KNZ A;  4WP2 A;  4DUY M;  2DWM A;  4LY6 A;  4IBC A;  4L16 A;  5ITT A;  1L2B A;  2DAG A;  4G6Z A;  3RGS A;  1ZAE A;  2OO9 A;  3AL0 C;  2CWB A;  3FUT A;  5EXP A;  2LHC A;  3VLF B;  3GRV A;  1T43 A;  2QP9 X;  3AOE C;  3FD9 A;  5FTJ A;  1DV0 A;  4GC9 A;  2KRK A;  1YSY A;  2APL A;  2CUZ A;  2R65 A;  3GLI A;  4M9X A;  3IG5 A;  1C7Y A;  4JI4 M;  2X8A A;  2KRU A;  1K3W A;  1PJT A;  2QBY B;  4OX9 M;  3GQ3 A;  4MH0 E;  2XSZ A;  5ITR A;  3SMS A;  2Z7J A;  3FTE A;  4L78 A;  3GLG A;  1T3T A;  3FRI A;  1IN5 A;  4PT5 A;  1GVN A;  2L6O A;  2JA2 A;  4OVZ B;  2QNJ A;  3JR5 A;  4AKH A;  2CP8 A;  2WSE F;  1W5S A;  3W0F A;  2H5X A;  1NJG A;  4JI5 M;  2K47 A;  1VDL A;  1Q3C A;  1QQW A;  4LZZ A;  3VK7 A;  5DYG A;  1PRB A;  2C99 A;  5EP1 A;  4LFA M;  3PVS A;  1K3X A;  4LJA A;  1NHG C;  2OOB A;  4P17 A;  1IXS B;  2JY6 B;  3KVW A;  4GRI A;  1VEG A;  4JI7 M;  3WHL A;  3J81 S;  1Z5B A;  3K1J A;  5DNY A;  1TH4 A;  3W0L B;  3QWL A;  8CAT A;  3L29 A;  2D7H A;  5FTK A;  3GRR A;  4JI6 M;  2UXC M;  3GP1 A;  1RU3 A;  1DO2 A;  4DR4 M;  1NY5 A;  3U5Z B;  5EXT A;  5LMU M;  2XSZ D;  4XBO A;  1IY2 A;  3F92 A;  2C9C A;  1QAM A;  2DZN B;  3SFZ A;  4CGY B;  2XZF A;  2XZU A;  4GC5 A;  3U6P A;  4GKK M;  2P5T A;  1SXJ B;  3FE3 A;  4X64 M;  1OQY A;  1N75 A;  2JWS A;  3T1Y M;  2QEN A;  4FWD A;  2V1C A;  2X49 A;  1SXJ E;  3BXW A;  3LVW A;  4BBA A;  2VQF M;  3U6M A;  3ILK A;  2EKF A;  3GLH B;  1TTE A;  1NNJ A;  1K82 A;  1SG9 A;  3A42 A;  4LF5 M;  2CV2 A;  2LBC A;  2WSF F;  1IN7 A;  4I8O A;  2OPF A;  1X37 A;  3U6E A;  2DWN A;  2JNH A;  2UXD M;  1XXH B;  3KFU G;  2DAI A;  1PJQ A;  4IBI A;  3W68 A;  1HT1 E;  1XXH E;  3TWK A;  1KYI A;  2J5Y A;  3VK8 A;  3J7A S;  4X65 M;  4CJ6 A;  4AKI A;  1L1Z A;  1XNR M;  3QYB A;  4LRT A;  1IBM M;  1LTM A;  3LCU A;  3U60 A;  2W82 A;  2Y0T A;  3AJI B;  4LF6 M;  2LVN C;  4LFB M;  1KFV A;  4FD2 A;  4FCT A;  5KQD A;  2ZBK B;  2FS1 A;  4Y28 F;  1NY6 A;  4LGM A;  2UU9 M;  3K9O A;  3T15 A;  4JI2 M;  2HCB A;  3SAW A;  2CFO A;  4DV5 M;  4LF7 M;  3T38 A;  2E5L M;  1YUB A;  2JXN A;  3U6C A;  4HEO A;  2F5S A;  1Y8G A;  2DWZ B;  1Q02 A;  1SXJ C;  2N35 A;  3EIE A;  5L8R F;  3GQ5 A;  4DV4 M;  1N36 M;  1IM2 A;  1WJ7 A;  3FYD A;  3J7B A;  1FJG M;  2C98 A;  4IBG A;  4Q7J A;  2C96 A;  2MH8 A;  4FCW A;  1AIP C;  3E21 A;  3TL4 X;  2R4E A;  4REZ A;  3R8F A;  3KP0 E;  1OKS A;  5IZ7 D;  2FE8 A;  3J2P B;  4GIT A;  2WZJ A;  4RF1 A;  3GLF E;  1NV9 A;  1QUS A;  3MMP A;  5IWA M;  2UUA M;  4M0W A;  5H37 D;  2CHG A;  4ANR A;  3L25 A;  4DR6 M;  1BVS A;  3MK6 A;  3SYK A;  4LFC M;  3B74 A;  3GPU A;  2G8L A;  1E32 A;  3A45 A;  1DGB A;  2QPA A;  3U6Q A;  2DXI A;  4I5S A;  3C3E A;  4B08 A;  1J7K A;  3SAV A;  4G4N A;  2VF7 A;  4PD2 A;  1QDR A;  2HWJ A;  3Q8X A;  5EP2 A;  4YY3 M;  4IJE A;  2R62 A;  1J5E M;  3U6S A;  2A5Y B;  2KNA A;  4GKJ M;  1Z6T A;  3LMM A;  4Z6Y A;  4DV2 M;  3SAR A;  2KA6 B;  2DAE A;  1XMQ M;  1HR0 M;  3HJS A;  3J27 B;  2G5G X;  2DHY A;  3K2L A;  2L7I A;  4IBK A;  1IY1 A;  2Y0Q A;  5BR8 M;  2JZ1 A;  3DA1 A;  4NXN M;  1ZQ9 A;  2DNA A;  4LF8 M;  3CGW A;  3GPP A;  5LMN M;  3VKG A;  1GKI A;  4LGY A;  3I4V A;  1Z5C A;  3KXE C;  4IIW A;  1N34 M;  2L4F A;  5ITQ A;  4DV3 M;  2LVP C;  1HJP A;  3PNV A;  3THG A;  2JZ0 A;  3VFD A;  2R45 A;  5FTL A;  1FNN A;  1IXS A;  2CE7 A;  2B3T A;  2YR0 A;  3CTW B;  4NOO B;  4LCB A;  4GHL A;  4FW9 A;  1ORY B;  1G71 A;  3HY5 A;  4WUR A;  3DOA A;  1QYR A;  3GO8 A;  2ZTC A;  1PJS A;  1DGH A;  1UM8 A;  2H1R A;  3RGP A;  2RGO A;  1IXR C;  4XK8 F;  2FH0 A;  2L09 A;  4JI1 M;  3KS8 A;  1OIP A;  2R18 A;  1WGL A;  3B7Q A;  3W67 A;  3BOS A;  4F2L A;  1HNZ M;  4K0K M;  3SHG B;  2X4A A;  3AKZ A;  4B3T M;  3VDP A;  1VG5 A;  2XLJ A;  1QDT A;  4CHT B;  3KOZ E;  3SAS A;  4UN2 B;  4R7G A;  2DVW B;  2EO2 A;  2R46 A;  1SXJ A;  4DV7 M;  2XFS A;  2EKK A;  3M7G A;  5EP3 A;  2QSF X;  1VQ1 A;  2K6B A;  3H4M A;  2GNO A;  2MJ5 B;  4QNM A;  1WGN A;  2CEA A;  1Z5A A;  3K8Z A;  3A46 A;  3D8L A;  3K92 A;  1IBK M;  3GLI B;  2KXE A;  3FUX A;  4LJ9 A;  1L2D A;  2ZAN A;  3SBJ A;  4LF9 M;  1OAI A;  3KP1 E;  4M9S A;  4ZPX A;  3TE6 A;  4LJ6 A;  1NNU C;  2O5R A;  2KW0 A;  3T6P A;  4P16 A;  3KOX E;  4IJF A;  4QHS A;  3GPY A;  2D7E A;  1EIJ A;  3FTF A;  4JN6 A;  2DEN A;  1NVM A;  2BWE A;  3KOY E;  4NSR A;  3GLH E;  3VDU A;  4D81 A;  4QOZ C;  1AUA A;  1OIZ A;  2XH9 A;  4EIW A;  3ZCB B;  4DR3 M;  3FUU A;  1PM5 A;  1TGU A;  3TWL A;  4KLN A;  1SXJ D;  2OQ4 A;  3CF2 A;  2RKO A;  2EUC A;  2KEB A;  4CIS A;  1ZV1 A;  1V34 A;  4JV5 M;  1GL6 A;  1E94 E;  1HQC A;  2XGN A;  2ZAO A;  2HL7 A;  3IG8 A;  3HHW A;  4G3O A;  2YNM D;  2I7P A;  2LTU A;  2NQ8 C;  1A5T A;  1JR3 A;  3AOE A;  3C9P A;  5BPV A;  1XNQ M;  3U61 B;  3KDS E;  2Z4R A;  3AFH A;  4LJ8 A;  1MX0 A;  1WR1 B;  1GJS A;  3HHX A;  3L2A A;  4DV0 M;  2BJW A;  4HL4 A;  1N32 M;  5C1B A;  1C1K A;  4LJ4 A;  4OW0 A;  3SAU A;  2LNH C;  3KW6 A;  1OTR A;  1QZE A;  3GLF A;  1IN6 A;  1EFU B;  2JP7 A;  1IY0 A;  3IEC A;  4TUW A;  1YE9 A;  1IN8 A;  3KSX A;  3GPX A;  1VEK A;  3H4J A;  3AV0 A;  2HKJ A;  3ZC7 B;  2Z4S A;  2QZ4 A;  3I04 M;  4LJ5 A;  3PXG A;  4OU7 A;  3HWS A;  5EP4 A;  1IFY A;  2KZU A;  2QCU A;  3B7Z A;  2KNV A;  1MJG M;  3TPZ A;  3SC3 A;  2DAK A;  5E26 A;  3D8B A;  4I4L A;  4NC6 A;  1J09 A;  1JB0 F;  1JR3 D;  3HGI A;  1NO1 A;  2VII A;  5FTM A;  4DUZ M;  3U6D A;  4KO8 A;  3GQ4 A;  1XB2 B;  1HT2 E;  4RKU F;  5EXX A;  4DR2 M;  3U60 B;  3HHY A;  1Q3B A;  3M6A A;  1E9R A;  4B3R M;  1DGG A;  3UZU A;  3K9P A;  1NV8 A;  2KZS A;  3RE8 A;  1QAQ A;  5EJC A;  1MU5 A;  5KPR A;  3DZD A;  4JI3 M;  4CIZ A;  5FLX S;  3FTC A;  3NBX X;  4L4U A;  1XHB A;  3M0E A;  5ITX E;  4D82 A;  2Z3X A;  5EQT A;  1N33 M;  2JY5 A;  4JI0 M;  4A3V B;  3KS4 A;  1JQJ C;  4D80 A;  2QBY A;  4AKG A;  4I81 A;  4IBD A;  1TDZ A;  3KOW E;  3SHF A;  3E9S A;  2UUB M;  1DO0 A;  3R9X B;  2K9D A;  2V1U A;  1KSF X;  3SYL A;  4OVZ A;  2MGW A;  7CAT A;  4RF0 A;  2RGH A;  2O01 F;  2Y20 A;  2CV0 A;  5IT9 S;  3B89 A;  1GJT A;  2MR9 A;  1N78 A;  1NHW C;  3EIH A;  3ZH9 B;  2BNK A;  4G4Q A;  4QOS A;  4LJ7 A;  4KOD A;  4AW4 A;  2ZAM A;  3VKH A;  4LRS A;  1F4I A;  3MJ5 A;  4II7 A;  4AZF A;  2LXE A;  2M5Z A;  4GH9 A;  5ITY A;  3WHK A;  3OTO M;  1IQP A;  4XGI A;  2BWB A;  2F5N A;  2FNA A;  3L26 A;  3DFZ A;  1QVR A;  4QHT A;  3FYC A;  2R44 A;  2Z8Y M;  3U5Z A;  4IBJ A;  1YLA A;  4FVM A;  3AOG A;  2LVA A;  1G4A E;  3FUW A;  3HKP A;  2CHV A;  1G3I A;  4NRV A;  4MGY E;  4AQY M;  1GO5 A;  2ZTD A;  1G41 A;  3CF6 E;  3HU2 A;  3UJN A;  2JY7 A;  1CUK A;  3JR4 A;  1ZMU A;  2FFJ A;  4NRW A;  3HU3 A;  1L1T A;  1R7R A;  4GIP A;  3LQQ A;  1GAB A;  4M9Z A;  4HLQ A;  4G4O A;  3GLH A;  3LCV B;  3HX3 A;  1QUT A;  3GRY A;  3PFI A;  1N77 A;  2F5P A;  4DR7 M;  5KO3 A;  1PJJ A;  3A98 B;  5KQ8 A;  4S12 A;  1XC8 A;  3IHP A;  2JUJ A;  3GLI E;  3BBZ A;  1XXH A;  3FUV A;  1D0M A;  2KDL A;  4GEW A;  4DV1 M;  1E9S A;  2J7O A;  2R6F A;  2XF3 A;  3QAU A;  1VDD A;  2K0B X;  5JI2 E;  2V6Z M;  1XMO M;  1V33 A;  3LVV A;  2KHH A;  3GLG B;  4YHH M;  4KT0 F;  4FWH A;  1PGY A;  1P3Q Q;  4MGI E;  3HHZ A;  4IBF A;  3GLG E;  4X66 M;  2BJV A;  4FWG A;  2DHR A;  4R3D A;  2L2D A; 
#chains in the Genus database with same CATH homology
 2DZO B;  1DGH B;  1TH2 A;  4BB9 A;  4M0D A;  4RNA A;  4PCZ A;  1IBL M;  3U61 A;  2EA0 A;  1R6B X;  2FOI C;  2M60 A;  1G59 A;  1S3S A;  4LZJ A;  2YQZ A;  4NL4 H;  4MM3 B;  3L27 A;  1PJI A;  2I7N A;  4KHP M;  4AI6 A;  1GL7 A;  4AG5 A;  1HNX M;  3SAT A;  3HU1 A;  4GHA A;  5FTN A;  3KSJ A;  4B3S M;  5A2Q S;  4BLC A;  2XFT A;  2CV1 A;  3TQS A;  4ITQ A;  1Z59 A;  1DGF A;  5IRE B;  3FTD A;  4FCV A;  3J80 S;  5ITU A;  4L8R C;  4LF4 M;  4MB7 A;  4PDI A;  4LG2 A;  5GKN A;  1R2Y A;  4AG6 A;  4X62 M;  3LQR A;  3FKE A;  4MGZ E;  3RFW A;  1Q39 A;  3L28 A;  2D7G A;  1HNW M;  1L8Q A;  2CHQ A;  3HJ8 A;  3JAM S;  1OFH A;  4NXM M;  4PDG A;  4W5W A;  1IN4 A;  4DR1 M;  4JI8 M;  4B7G A;  3NBI A;  1TH3 A;  5KPZ A;  2ZM6 M;  4B7F A;  5ITX A;  2UXB M;  1EE8 A;  3MHV C;  1QAO A;  3HJQ A;  3I4Y A;  1WXQ A;  2YFQ A;  1H6U A;  1D2N A;  5C18 A;  1TDH A;  5FSW A;  2LWX A;  5F3W A;  2AHM A;  2Q2E B;  3UK6 A;  1QAN A;  3SMP A;  4DR5 M;  2F5O A;  5KPT A;  4JXJ A;  3I51 A;  1OFI A;  3PNY A;  2DWL A;  2F4V M;  1G8P A;  4MGH A;  3GRU A;  3U6L A;  3T1H M;  3UMM A;  4MGK E;  3C58 A;  2UUC M;  2ERC A;  1I94 M;  4IBB A;  3GLF B;  2R4J A;  2VQE M;  1R2Z A;  4B3M M;  1HQY E;  4L15 A;  3CF0 A;  4DV6 M;  2C9O A;  1L2C A;  3UGJ A;  2LH0 A;  1GLN A;  4NSO B;  5DYI A;  5JI3 E;  5EXS A;  1NSF A;  4GMQ A;  4WW0 A;  4Z8X A;  3TWM A;  3U6O A;  2C5R A;  5E6J A;  2XEP A;  1I4W A;  4G4R A;  1OJL A;  1QZM A;  1XWI A;  3B9P A;  1IXZ A;  2Y21 A;  4B7H A;  1NJF A;  2F5Q A;  2J7N A;  4QNR A;  4IBE A;  2HHH M;  3NWL A;  2L7H A;  1W5T A;  4JYA M;  1LV7 A;  3E4R A;  4DUY M;  2DWM A;  4LY6 A;  4IBC A;  4L16 A;  5ITT A;  1L2B A;  4G6Z A;  3RGS A;  1ZAE A;  3AL0 C;  3FUT A;  5EXP A;  3VLF B;  3GRV A;  2QP9 X;  3AOE C;  3FD9 A;  5FTJ A;  4GC9 A;  2KRK A;  1YSY A;  2CUZ A;  2R65 A;  3GLI A;  4M9X A;  3IG5 A;  4JI4 M;  2X8A A;  2KRU A;  1K3W A;  2QBY B;  4OX9 M;  3GQ3 A;  4MH0 E;  2XSZ A;  5ITR A;  3SMS A;  2Z7J A;  3FTE A;  4L78 A;  3GLG A;  1T3T A;  1IN5 A;  4PT5 A;  1GVN A;  2L6O A;  2JA2 A;  4OVZ B;  3JR5 A;  4AKH A;  3W0F A;  1W5S A;  1NJG A;  4JI5 M;  2K47 A;  1Q3C A;  1QQW A;  4LZZ A;  3VK7 A;  5DYG A;  2C99 A;  5EP1 A;  4LFA M;  3PVS A;  1K3X A;  4LJA A;  1NHG C;  1IXS B;  3KVW A;  4GRI A;  4JI7 M;  3WHL A;  3J81 S;  1Z5B A;  3K1J A;  5DNY A;  1TH4 A;  3W0L B;  3QWL A;  8CAT A;  3L29 A;  2D7H A;  5FTK A;  3GRR A;  4JI6 M;  2UXC M;  3GP1 A;  4DR4 M;  1DO2 A;  1NY5 A;  3U5Z B;  5EXT A;  5LMU M;  2XSZ D;  4XBO A;  1IY2 A;  3SFZ A;  2C9C A;  1QAM A;  2DZN B;  2XZF A;  4CGY B;  2XZU A;  4GC5 A;  3U6P A;  4GKK M;  2P5T A;  1SXJ B;  4X64 M;  1N75 A;  3T1Y M;  2QEN A;  4FWD A;  2V1C A;  2X49 A;  1SXJ E;  4BBA A;  3LVW A;  2VQF M;  3U6M A;  3ILK A;  3GLH B;  1NNJ A;  1K82 A;  3A42 A;  4LF5 M;  2CV2 A;  1IN7 A;  4I8O A;  2OPF A;  1X37 A;  3U6E A;  2DWN A;  2UXD M;  1XXH B;  3KFU G;  4IBI A;  1HT1 E;  3TWK A;  1KYI A;  3VK8 A;  3J7A S;  4X65 M;  4AKI A;  1L1Z A;  1XNR M;  4LRT A;  1IBM M;  3U60 A;  2W82 A;  2Y0T A;  3AJI B;  4LF6 M;  4LFB M;  1KFV A;  4FD2 A;  4FCT A;  5KQD A;  2ZBK B;  1NY6 A;  4LGM A;  2UU9 M;  3T15 A;  4JI2 M;  2HCB A;  3SAW A;  2CFO A;  4DV5 M;  4LF7 M;  3T38 A;  2E5L M;  1YUB A;  3U6C A;  2F5S A;  2DWZ B;  3EIE A;  1SXJ C;  3GQ5 A;  1N36 M;  4DV4 M;  1IM2 A;  3FYD A;  3J7B A;  1FJG M;  2C98 A;  4IBG A;  2C96 A;  4FCW A;  3TL4 X;  2R4E A;  4REZ A;  3R8F A;  3KP0 E;  5IZ7 D;  2FE8 A;  3J2P B;  4GIT A;  4RF1 A;  5IWA M;  2UUA M;  3L25 A;  4DR6 M;  4M0W A;  5H37 D;  2CHG A;  3MK6 A;  3SYK A;  4LFC M;  3GPU A;  2G8L A;  1E32 A;  3A45 A;  1DGB A;  2QPA A;  3U6Q A;  2DXI A;  4I5S A;  4B08 A;  1J7K A;  3SAV A;  4G4N A;  4PD2 A;  5EP2 A;  3Q8X A;  4YY3 M;  4IJE A;  2R62 A;  1J5E M;  3U6S A;  2A5Y B;  4GKJ M;  1Z6T A;  3LMM A;  4Z6Y A;  4DV2 M;  3SAR A;  2KA6 B;  1XMQ M;  1HR0 M;  3HJS A;  3J27 B;  2G5G X;  3K2L A;  2L7I A;  4IBK A;  1IY1 A;  2Y0Q A;  5BR8 M;  3DA1 A;  4NXN M;  1ZQ9 A;  4LF8 M;  3GPP A;  5LMN M;  3VKG A;  1GKI A;  4LGY A;  3I4V A;  1Z5C A;  3KXE C;  4IIW A;  1N34 M;  5ITQ A;  4DV3 M;  3THG A;  3PNV A;  3VFD A;  2R45 A;  5FTL A;  1FNN A;  2CE7 A;  2YR0 A;  3CTW B;  4NOO B;  4LCB A;  4GHL A;  4FW9 A;  1ORY B;  4WUR A;  3DOA A;  1QYR A;  3GO8 A;  2H1R A;  1DGH A;  1UM8 A;  3RGP A;  2RGO A;  1IXR C;  3KS8 A;  2L09 A;  4JI1 M;  2R18 A;  3BOS A;  1HNZ M;  4K0K M;  3SHG B;  2X4A A;  3AKZ A;  4B3T M;  3VDP A;  2XLJ A;  4CHT B;  3KOZ E;  3SAS A;  4R7G A;  2DVW B;  2EO2 A;  2R46 A;  1SXJ A;  4DV7 M;  2XFS A;  3M7G A;  5EP3 A;  3H4M A;  4QNM A;  2CEA A;  1Z5A A;  3K8Z A;  3A46 A;  3D8L A;  3K92 A;  1IBK M;  3GLI B;  2KXE A;  3FUX A;  4LJ9 A;  1L2D A;  2ZAN A;  3SBJ A;  4LF9 M;  3KP1 E;  4M9S A;  4ZPX A;  3TE6 A;  4LJ6 A;  1NNU C;  2O5R A;  2KW0 A;  4P16 A;  3KOX E;  4IJF A;  4QHS A;  3GPY A;  2D7E A;  3FTF A;  4JN6 A;  4D81 A;  1NVM A;  3KOY E;  4NSR A;  3VDU A;  4QOZ C;  2XH9 A;  4EIW A;  3ZCB B;  4DR3 M;  3FUU A;  1PM5 A;  1TGU A;  3TWL A;  4KLN A;  1SXJ D;  2OQ4 A;  3CF2 A;  2RKO A;  2EUC A;  2KEB A;  4CIS A;  4JV5 M;  1GL6 A;  1E94 E;  1HQC A;  2XGN A;  2ZAO A;  2HL7 A;  3IG8 A;  3HHW A;  2YNM D;  2I7P A;  2NQ8 C;  3AOE A;  5BPV A;  1JR3 A;  1XNQ M;  3U61 B;  3KDS E;  2Z4R A;  3AFH A;  4LJ8 A;  1MX0 A;  3HHX A;  3L2A A;  4DV0 M;  2BJW A;  4HL4 A;  1N32 M;  5C1B A;  1C1K A;  4LJ4 A;  4OW0 A;  3SAU A;  2LNH C;  3KW6 A;  3GLF A;  1IN6 A;  1IY0 A;  4TUW A;  1YE9 A;  1IN8 A;  3KSX A;  3GPX A;  3AV0 A;  2HKJ A;  3ZC7 B;  2Z4S A;  2QZ4 A;  4LJ5 A;  3PXG A;  4OU7 A;  3HWS A;  5EP4 A;  2KZU A;  2QCU A;  3TPZ A;  3SC3 A;  5E26 A;  3D8B A;  4I4L A;  1J09 A;  3HGI A;  1JR3 D;  5FTM A;  4DUZ M;  2VII A;  3U6D A;  4KO8 A;  3GQ4 A;  1HT2 E;  5EXX A;  4DR2 M;  3U60 B;  3HHY A;  1Q3B A;  3M6A A;  1E9R A;  4B3R M;  1DGG A;  3UZU A;  2KZS A;  3RE8 A;  1QAQ A;  5EJC A;  1MU5 A;  5KPR A;  3DZD A;  4JI3 M;  5FLX S;  3FTC A;  4L4U A;  1XHB A;  3M0E A;  5ITX E;  4D82 A;  2Z3X A;  5EQT A;  1N33 M;  4JI0 M;  4A3V B;  4AKG A;  3KS4 A;  1JQJ C;  4D80 A;  2QBY A;  4I81 A;  4IBD A;  1TDZ A;  3KOW E;  3SHF A;  3E9S A;  2UUB M;  1DO0 A;  3R9X B;  2V1U A;  1KSF X;  3SYL A;  4OVZ A;  7CAT A;  4RF0 A;  2RGH A;  2Y20 A;  2CV0 A;  5IT9 S;  1N78 A;  1NHW C;  3EIH A;  3ZH9 B;  2BNK A;  4G4Q A;  4QOS A;  4LJ7 A;  4KOD A;  4AW4 A;  2ZAM A;  3VKH A;  4LRS A;  3MJ5 A;  4II7 A;  4AZF A;  2LXE A;  2M5Z A;  4GH9 A;  5ITY A;  3WHK A;  3OTO M;  1IQP A;  4XGI A;  2F5N A;  2FNA A;  3L26 A;  3DFZ A;  1QVR A;  4QHT A;  3FYC A;  3U5Z A;  4IBJ A;  4FVM A;  3AOG A;  3FUW A;  1G4A E;  3HKP A;  2CHV A;  1G3I A;  4NRV A;  4MGY E;  4AQY M;  3CF6 E;  1G41 A;  3HU2 A;  3UJN A;  3JR4 A;  4NRW A;  2FFJ A;  3HU3 A;  1L1T A;  1R7R A;  4GIP A;  3LQQ A;  4M9Z A;  4HLQ A;  4G4O A;  3GLH A;  3GRY A;  3PFI A;  2F5P A;  1N77 A;  4DR7 M;  5KO3 A;  1PJJ A;  3A98 B;  5KQ8 A;  4S12 A;  1XC8 A;  4DV1 M;  1XXH A;  3FUV A;  1E9S A;  2J7O A;  2XF3 A;  3QAU A;  1VDD A;  5JI2 E;  2V6Z M;  1XMO M;  3LVV A;  3GLG B;  4YHH M;  4FWH A;  4MGI E;  3HHZ A;  4IBF A;  4X66 M;  2BJV A;  4FWG A;  2DHR A;  4R3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...