1Y8GA

Catalytic and ubiqutin-associated domains of mark2/par-1: inactive double mutant with selenomethionine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity-regulating kinase 2
total genus 85
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1y8gA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y8gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y8gA01
4DE4A 3PG3A 2ZAZA 4FKUA 3MPTA 2RRUA 5HCXA 5KMKA 4I4EA 2PVNA 4G6OA 3TV7A 5EI6A 4DFXE 4FL1A 3CGOA 5HLWA 3PLAE 2ZMDA 1LEZA 3C50A 5E8VA 3VHKA 3CQEA 3K3IA 3PXYA 3NUAA 2BHHA 4BDBA 4CG9A 2UUEA 4W8EA 1HOWA 3ACKA 4EOPA 3CPCA 3V5TA 4DH7A 4IDTA 4BB4A 2EXEA 2UW6A 4IWQA 5A54A 4FX3A 2X8DA 2UZLA 2XIRA 3VVHA 4KSPA 3D0EA 2BFXA 2WQNA 1A5TA 2JDRA 2VWBA 4AN3A 4BDEA 2GNFA 2B54A 4APPA 1YOJA 5HVJA 4B8LA 3U6HA 2WMSA 4NJ3A 2WPAA 3Q9XA 2PULA 2QHMA 3IW6A 4FV0A 4CNHA 4D2WA 3ULIA 2I40A 3OWLA 4Y5QA 1KE7A 3KF7A 5AA9A 4FZ6A 5CF8A 4N4SA 3QCYA 4AOJA 4ZAUA 2OZAB 3GGFA 1M17A 4RFZA 4M7IA 3OWKA 3V5LA 4QMYA 3VWAA 4XJ0A 4K8AA 2Y8OA 2XNPA 2Y0AA 1VYZA 5ANOA 4EH2A 5KKRB 1NVSA 4IVCA 3VS5A 5IQHA 3BELA 3R22A 3SAYA 1XHAA 2L2DA 1WBSA 2YJSA 2F7EE 4YHFA 3F88A 4F4PA 2XKDA 3KVWA 3ZSHA 2BILB 2WTIA 1A9UA 2QG5A 4IVDA 4UB7A 4XLIA 1UWHA 5HHWA 4D2VA 4QP1A 3ZO4A 5A4TA 4HGEA 1R39A 3W8QA 4TXCA 3UODA 2ITXA 3VULA 4XV2A 4YGAA 2NP8A 2FSTX 4M0ZA 4I0RA 4QMVA 3ZC6A 3P79A 4EHEA 4G3OA 3CD3A 4BDGA 2EU9A 3O17A 4F09A 2BVAA 5IQGA 2PUPA 3R30A 3QXOA 4FKJA 3UVPA 4RJ5A 2PZ5A 3ZFMA 5TE0A 2EJSA 2YFXA 3O2MA 1Q8ZA 4FSQA 4XG6A 3NUUA 4NYEA 4FKPA 2PYWA 4UMUA 3Q5ZA 3LMHA 1OB3A 2RG6A 4Q9SA 4L00A 4G3GA 5KX8A 1FVVA 3OXIA 1FOTA 4WKQA 5CQUA 5I5ZA 1H08A 4FT7A 4BRXA 4Q5HA 5IMXA 3HAVA 3ETAA 3ZRMA 4NKSA 4FTNA 5B2KA 4OT5A 2VWZA 4AN9A 2E9UA 1BVSA 2VX1A 4BCNA 4MTAA 2IZTA 4E6QA 2X2MA 3ITZA 4O7YA 2W06A 1BLXA 2A0CX 3E87A 4JG6A 3ZXZA 3Q4ZA 4AGWA 5JFWA 4FK3A 5GHVA 3A2CA 4U81A 4LRKA 4BI1A 5IA3A 5IH4A 1I09A 5BQ0A 4RIOA 3ZLWA 4M69A 2PMNX 1R0PA 3VNTA 2C6LA 2VO7A 2Q83A 4TRLA 4FTCA 4IM2A 4CV9A 5J9YA 2XZSA 3FMDA 5ANEA 4TN6A 4AP7A 5BUJA 5CU2A 4EUTA 2VU3A 3C0HA 4UX9A 4EYMA 2UZUE 3DZOA 3QTUA 3MJ1A 3ZZEA 1WVWA 4KSQA 4EOJA 5AV4A 2XYUA 1XXHE 4WNMA 3DV3A 2QR7A 2XNGA 5CU3A 3E62A 2GNGA 2VNWA 1H8FA 2C5XA 2O65A 1XH4A 2R7BA 3AT4A 1SVHA 2QURA 4FTRA 4J98A 4ANMA 4EEVA 5BVOA 3EZRA 5IMEA 5GZ8A 3FLNC 4M67A 1JLUE 1H1SA 4NW5A 5FTGA 3LFBA 5CU6A 2V62A 3AC5A 3ZMMA 2DZLA 4JQEA 1E94E 3L8XA 4KIKA 4AQCA 1ERKA 3TNQB 2E9NA 3UE4A 2XMYA 4FV3A 4O21A 1VEGA 4PTCA 3LZBA 3WZUA 4EZ7A 5CEQA 3OHTA 4NTSA 4K0YA 1S9IA 1J91A 4NWMA 4P2KA 4W8DA 4EC8A 2XRUA 3E21A 3AMBA 4Z7HA 4NCTA 4ZTNA 4AZVA 2ZB0A 3FMHA 5GJDA 1TQMA 3OCGA 3I5ZA 1P2AA 3WF7A 2ZV7A 5IKWA 1JKKA 3R01A 3V6RA 4BKYA 4YURA 5K0KA 2OZOA 3TNHA 3HAMA 1OL6A 2R3GA 4ZTQA 3RNIA 3FI4A 1R0EA 4R3PA 4R1VA 4PUZA 3C1XA 4ZS4A 2VTRA 2W1DA 3QKKA 4I5MA 4AOIA 3F2RA 2ZMCA 5HBEA 3ZFYA 3VBYA 3WOWA 3MIYA 4A4LA 4E6DA 1NY3A 1YKRA 3MY5A 5JK3A 3RPVA 4AF3A 4DEGA 4EYJA 4FV9A 3HV4A 1NV9A 2ZDUA 3LFEA 4H3BA 1T46A 4RQVA 1HCLA 4IIRA 3A60A 3FHRA 3VRZA 2WU6A 3A7GA 4ZSLA 3NIEA 3IS5A 5EH0A 4IWPA 2WQBA 4L43A 4C57A 1FBNA 3LXLA 2YAKA 5TO8A 1OIQA 1J7LA 1MRUA 3I5NA 3R2YA 1DV0A 5HE0A 3GP0A 5JKGA 3PA4A 5I9XA 3S1HA 3R8ZA 4FSNA 4BTFA 5EHLA 1VJYA 3B2WA 2OI4X 2XRWA 2RFDA 4FOBA 2ERZE 4C4FA 4QTCA 4H3QA 4Z16A 4LMUA 2UW8A 3DBEA 4NZWB 4CFFA 3F2AA 4EH5A 1GIHA 3SDJA 4CFUA 3VW8A 3K9OA 3BIZA 1O6LA 5FDXA 5JFSA 2OWBA 3PVBA 2K0BX 4ACDA 2JC6A 4I22A 4AW5A 1B38A 4JDIA 5DG5A 2BTSA 3HDNA 1XB2B 3D7TB 4KB8A 4ZJVA 5FBNC 5CSWA 5ICPA 4GL9A 4AUAA 5A4QA 3LLAA 1Q8UA 1WVXA 2FGIA 2WTKB 3R00A 2JEDA 5HD7A 4DH1A 3MH1A 1ZYSA 2QOFA 4BCGA 3Q9YA 4IC8A 3BHVA 2GTMA 3PJ2A 4GMYA 4WIHA 4NFNA 1H0VA 3KREA 2FSLX 2CSNA 4ITHA 4C35A 1YDTE 4LRMA 3QWKA 4DH5A 3BYMA 4CMUA 4IMYA 2VO6A 3FHIA 4M14A 2P2IA 4JRNA 5J87A 2H5XA 3UDBA 2AYPA 3OEZA 2X2LA 4FR4A 4YLLA 4BI0A 2JGZA 2W1FA 3IW8A 1KE6A 4GIHA 4WT6A 3F82A 1G5SA 4Y83A 3RKBA 2WMAA 2WOTA 4BCOA 4D2PA 1QPCA 4YBKA 4FSYA 3VQHA 3RINA 1O9UA 4YUQA 3R7IA 4OAVB 2ZDTA 3P23A 1B6CB 3R71A 4WNOA 3EH9A 3OT3A 5D1JA 4C38A 1LEWA 1XJDA 2B4SB 3M42A 4I41A 4JG7A 3CD8A 3FPMA 4WP2A 3IGOA 5L6PA 3VUGA 3E7VA 4ZXTA 3WI6A 4F7SA 3VC4A 2IVTA 3RWPA 2P55A 3WIGA 1MP8A 2YZAA 4G34A 3VBVA 4O0SA 4FA2A 2X7FA 2LVAA 2HIWA 4MKCA 2XA4A 4O6LA 4RA5A 1AGWA 4HYSA 4BDKA 2L4EA 2PSQA 3RZFA 3W2CA 3QZFA 3LM5A 4UALA 3RM6A 4CFNA 4FNWA 3H4JA 1QMZA 2R0UA 1H26A 1IM2A 2A4LA 3QC4A 4JAJA 4NUSA 1P4FA 4PL3A 4U42A 1OAIA 4ZEGA 4D55A 5KMIA 1PF8A 5I4NA 5E1EA 3D4QA 3RAKA 4YPDA 3EJ1A 3U4WA 2EXMA 4AZEA 5GZ9A 2ZJWA 3MVHA 5L8KA 3PXQA 4JX3A 4IACA 1IAJA 5BYLA 4RWLA 3PA5A 2Y6MA 2BHEA 2BWEA 3O8TA 4IZ7A 4XP2A 5IEYA 2CKEA 4OTPA 4RZVA 5L2TA 3AD6A 1ZZLA 2BMCA 3PIZA 4XOZA 5LOHA 3LHJA 3PRFA 5AR8A 4B8MA 5F95A 1LPUA 1IAHA 3QTXA 2ETMA 2OU7A 3QRKA 1PXLA 3PRIA 4R6VA 2JIUA 4M8TA 1M14A 4IZ5A 2GDOA 1FQ1B 3C4FA 3E88A 3KXXA 4WG5A 2IW6A 3NYOA 1M2RA 3CSVA 2OH4A 2VTLA 3OXTA 3NVKI 3LJ0A 1KSWA 3PP0A 5E8TA 2VO0A 4RVTA 2NPQA 5CSHA 4FKGA 3I79A 3ZO3A 4AE6A 4EQUA 3BLRA 2WGJA 4RX8A 4GKIA 3UVQA 4QD6A 4EOMA 4ONAA 4Y46A 5AEPA 4EOLA 5L2SA 3NMUF 3WZEA 5AP2A 3PUPA 3WILA 4F1IA 3E63A 4HCVA 4R71A 4CZTA 5B2MA 4ZMEA 4JVGA 3R83A 1AQ1A 4S31A 1RW8A 1T6OA 3K3JA 4JNWA 4PTEA 1GIJA 5JN2A 5FQDC 4BCPA 2C6KA 4C7TA 4E4LA 3WF9A 3FKOA 4FT5A 4XV9A 5HD4A 3VBQA 4CYIA 4YTHA 5EFQA 2XIZA 4UWYA 3OWPA 4C4IA 2P33A 3VW6A 3F6XA 4USFA 3KMWA 3BX5A 4FIHA 4FKRA 3LAUA 3UTOA 3QTQA 4DFUA 3OS3A 5LJJA 3HA8A 3BHTA 4QMZA 3RK9A 3GC0A 3W2PA 2VTJA 1YI6A 4FVPA 1XKKA 3SXSA 1A48A 2XNMA 1FMOE 5FGKA 3IW7A 3R6XA 4L46A 5HESA 1SYKA 5FP6A 3MFUA 2PMOX 4FC0A 1M7NA 4YBJA 2C6IA 4J99A 4R7BA 5IDPA 5KHWA 3PLSA 3DT1A 2E9VA 4WG4A 4UEUA 2QOLA 3FLZA 3CE3A 4OAUC 1V0PA 2BZHB 1XBCA 4M13A 3NUNA 3Q96A 4NU1A 4B6LA 1PXMA 3I81A 5M55A 4EBVA 3R7UA 4CD0A 4EOOA 4I24A 5CVFA 4TT7A 3IGGA 3RALA 3TCPA 3SX9A 3VBXA 3B8QA 4OR5A 4U0IA 5M07A 3ZFXA 3VIDA 1JAMA 1YQJA 3FQEA 1CUKA 3KCKA 3O8PA 2PZRA 3AT2A 3NDMA 2W1HA 5CI7A 4ZTMA 3PWDA 4IFCA 5M08A 5IA0A 3AMAA 1YDRE 3R7EA 4PP9A 3QU0A 3QYZA 4ASDA 4QMQA 1YXTA 4FI1A 1F4IA 3WIKA 2Y7JA 2VTQA 5ANIA 4CSVA 3D7ZA 2HK5A 2ESMA 2Z7SA 3Q4CA 4KWPA 2DENA 2C4GA 4HW7A 3R8LA 3SC1A 4XG7A 2XCKA 3H9OA 4F9WA 3PFQA 4NM7A 4O0VA 4Z9LA 3Q6WA 4JDJA 4BGQA 4EH4A 3U55A 4BCIA 2V5QA 2NRYA 3P7CA 2WAJA 4NTTA 4A7CA 3MI9A 4OBQA 5GJFA 2OLCA 5J5SA 2C5NA 3FMLA 1Z5MA 2FSOX 2MROB 4NKAA 1OVEA 5JEBA 1GZKA 5AAGA 3LFFA 3VS7A 3TKIA 5FXQA 3ORMA 5KBRA 2VTHA 5H2UA 4KIOA 3PPJA 4GFMA 3FL4A 4ZS0A 3RCJA 1OBGA 3MTFA 4RIYB 4YC3A 2OJJA 3ACJA 3SOCA 5K5XA 2VUWA 2DYLA 4G31A 4AZWA 3GI3A 3E5AA 4O86A 3BYSA 4FYNA 4H39A 2YCRA 4HYHA 4YC6A 4ZSJA 1K9AA 2CMWA 3SXRA 4S34A 3MPAA 3VN9A 4YMJA 1PMEA 2WMBA 1OGUA 1SNUA 3RNYA 3T3UA 3MB6A 4IX3A 1ZLTA 3LCVB 4FT0A 5HG5A 5HEZA 4FTUA 4NM0A 2XBJA 1OMWA 3LMGA 3OOMA 5HNBA 4RX5A 3WF5A 3R73A 3HX4A 3ZH8A 4MF1A 3DZQA 3DXPA 2VX3A 3QLFA 3A4OX 4P7EA 3ZXTA 2JITA 3I4BA 4NL0A 2BAJA 4BIEA 2WFYA 1R1WA 4P4CA 3TXOA 3RAIA 1VR2A 5BUEA 4C2WA 2WNTA 5IA5A 5K0XA 2IW9A 1UKIA 2R4BA 3I60A 4G17A 4O0WA 5HO8A 3TACA 3W18A 1GIIA 3LXPA 4IB1A 4IAYA 5DR6A 4DFYA 2ITQA 1MQ4A 2ACXA 4MWIA 4BGGA 4EK4A 3U8WA 1RDQE 4F0IA 2OXXA 4DTAA 3BGPA 3HNGA 4A9UA 4AZSA 4IH8A 4QTAA 4BBFA 2RIOA 4RC2A 5CU4A 4ACCA 2E9PA 2YDKA 3F5PA 4K1BA 4KKHA 5IUIA 3JVSA 4YO6A 5HE3A 2GQRA 4CYJA 1LR4A 4M97A 5DT0A 3E8DA 3R8MA 3AC2A 3DJ7A 5L2IA 1V92A 3TIZA 5TOZA 3OY1A 4O84A 5IQIA 2R3FA 5JFXA 3U6IA 1QPDA 2O3PA 4CEGA 5H8EA 1IASA 4RGJA 1WR1B 1P3QQ 1UWJA 1J7UA 1KUTA 4UWCA 4FIIA 2MR9A 4GG5A 1IG1A 3EKNA 3FXXA 3MVLA 3PYYA 4TL0A 4K18A 4IAKA 3KY2A 4J53A 3MA6A 4L45A 1YHSA 2XNOA 1JQHA 2WEVA 3HA6A 3D83A 1UV5A 3SG8A 3OW3A 2G1TA 4FV1A 1OKYA 5LCKA 2XBAA 3A8WA 5B2LA 4RX7A 3SVVA 2O8YA 3LJ2A 4D1ZA 2ZV2A 1H28A 1ZYLA 3E46A 2FH9A 3EQBA 4BWPA 4JI9A 4XNEA 2EWAA 4RWKA 3HL7A 3MH0A 4H36A 5KBQA 3TUCA 3SLSA 2CCIA 3U4UA 4C02A 4ANNA 1PHKA 2R3PA 4OTFA 4FSZA 4DYMA 4XS2A 3PVGA 1R4GA 4UYNA 5JRQA 3LFCA 4NK9A 4GSBA 2CP8A 3DBFA 3OMVA 4NCTC 3NVMB 3QCXA 4JAIA 4FTQA 2A19B 4XH6A 4KNBA 4FTMA 3GOKA 4AW1A 4RJ8A 5E1SA 5LMKA 3N4UA 3TL8A 5ACBC 1RE8A 2CGVA 3W1FA 3KRWA 4BCJA 5HX8A 4CFWA 4GK2A 1YWVA 5KMOA 3ALOA 2CN8A 4Y85A 5CEOA 3FMEA 4DEAA 4QTBA 4BFMA 1DAYA 1SMHA 3QA0A 5AAEA 2KNAA 4JBPA 4L3JA 3LMIA 4TYGA 3ORPA 3GLHE 3HVCA 3N9XA 4FG7A 1WIVA 2XF0A 3QZIA 1ZYJA 3V01A 4QQJA 4CCBA 2PY3A 4PP7A 4CVAA 2GU8A 4FEQA 3UOJA 3GLGE 3BHUA 4NIFA 4FKQA 5LMAA 4IC7A 3EL7A 3DAEA 3Q4UA 5BUIA 3EMGA 2BRBA 3AGLA 2PUIA 4FTIA 3MH3A 2DAKA 4OBPA 5AUWA 5CENA 5AR4A 5E8WA 1PXOA 2R3MA 2Z7QA 5JZJA 3EN5A 4OTWA 2C0TA 2R3KA 5DLSA 1PXPA 4ERWA 4CKRA 4XV1A 4ZSAA 2BUJA 3MH2A 3OT8A 2WMTA 4C36A 3ZDIA 2G3QA 4FL3A 3TV4A 5BVDA 2LVNC 1BL7A 2QKWB 4FT3A 4OLIA 2CPKE 3NCZA 2R3OA 3Q2MA 3V3VA 5HTCA 3TKHA 3EFKA 3ET7A 4IFGA 5CNNA 4JBOA 3L9NA 5AP1A 2F2UA 1SZMA 4AFEA 3O51A 2GPHA 2VTMA 4XUFA 5KMJA 1MQBA 4HNIA 3O96A 3KULB 3VAPA 4RIWA 2OSCA 3E7OA 1V1KA 3QZHA 3DTCA 2C5YA 3QQFA 4ZK5A 4DBXA 3NUPA 2V7AA 4LV5A 4ORKA 4ARKA 4E7WA 3KCFA 3QGYA 3WYYA 2C47A 1M2PA 3I1AA 1Y8YA 3HKOA 4RVKA 5DFPA 3DA6A 4CG8A 5EK7A 5KO1A 3CTHA 2YM8A 1UU9A 3FDNA 3C4WA 1H4LA 1P5EA 2WO6A 4D2RA 1OPLA 1UU8A 1OL5A 2VWYA 3A61A 2B9JA 3CPBA 2Z2WA 3QD2B 4LGHA 3Q4TA 4KINA 2CGWA 2GFSA 3OZ6A 3QHWA 4D5HA 1KV2A 2F57A 5CAUA 4DINA 3ZLYA 3VS2A 3GNIB 2CNVA 5EHOA 1BX6A 5E8YA 4I6BA 3CJFA 5HIDA 5L8LA 3TM0A 3QX4A 5LMBA 4PDSA 2JD5A 1FGKA 4L6QA 2UZNA 3NW7A 2DS1A 3CR0A 5I3RA 1TQIA 5E90A 1PXJA 2QQ7A 4JQ8A 5DGZA 3UOKA 4DT9A 1MUOA 3HMPA 4EK8A 2IZRA 2XB7A 4RIWB 3PY3A 1CMKE 2RKUA 4IAAA 4Y8DA 4RWIA 3Q60A 4KBKA 4CFXA 1BI7A 3EQHA 1S9JA 4RIXA 4FKLA 3CBLA 3JUHA 3L9LA 2YIQA 3ODYX 4GU9A 4NEUA 5A14A 4ASXA 2W1IA 4QNAA 4BDCA 5IEXA 2GTNA 4ANQA 3TKUA 3LCOA 2EVAA 4LV8A 3JPVA 5ANKA 1E1VA 5K5NA 4BWXA 4QMTA 3DKGA 4PNKA 5I9ZA 4AT4A 1JKSA 2JIVA 5A3XA 3PJ8A 3Q32A 1IA9A 4A9RA 1ZYDA 4ALVA 3PY1A 2YCFA 5AWMA 4TNBA 4WBOA 2C1AA 1ZARA 3F69A 1J7IA 5EHYA 4L52A 2W05A 5HE2A 4HEOA 4EZ5A 5FM2A 1CKPA 3V5WA 3PXZA 2LVPC 3W16A 3TZMA 5IH6A 3KULA 2R3LA 3V5PA 3UJGA 3CXWA 2BR1A 4JR7A 2UZVA 4AOTA 4IBMA 3DDQA 4HZSA 3LQ8A 2HOGA 1VZOA 3QBNA 4ZTLA 4KAOA 3TIYA 1WJ7A 4MXYA 3GU4A 2IWIA 4U79A 5I9VA 1U59A 1WBPA 4FSTA 1X8BA 3EQDA 3K2LA 2QG7A 4R78A 3NZ0A 4UWBA 3UBDA 5CAPA 2KNZA 3KB7A 4JOAA 4E3CA 3AGMA 4FTKA 4FNYA 4KA3A 5EM7A 5AV1A 3ORKA 5FTOA 4MEDA 5F1ZA 1PXNA 3R21A 4YJVA 1DI9A 4DC2A 4FGRA 3L8PA 4ITIA 2V22A 3QAME 5DT3A 2G15A 3GU5A 3VJNA 4HZRA 2CNUA 1YXVA 3QD0A 5FXSA 3PJ3A 5E8XA 5HG7A 2IW8A 1FVRA 3FKNA 4PDPA 1H24A 4QPMA 5DPVA 2XYNA 1WBOA 2RFEA 3QFVA 5M4FA 2G9XA 1KOBA 3ERKA 2B0QA 3OBJA 3FSFA 3GFEA 4ZTHA 1ZYCA 3WARA 5HZNA 2ERKA 5KKRC 3CC6A 3T9TA 4DBNA 2BRNA 2XNEA 4BCFA 4USEA 4C4GA 2IG7A 2BZIB 4RLLA 4BZDA 4MNEB 4C4HA 2RGPA 4L67A 1Y91A 3K54A 2J50A 4YZMA 2GSFA 5JH6A 4ZJIA 5AP6A 4FE2A 2ITNA 3NW5A 3O23A 1O6KA 5DEWA 5GINE 1Q5KA 2B3TA 2R3HA 3KRJA 3G6GA 4QNYA 3WZJA 3H9FA 3LKMA 3CS9A 4NT4A 4BBMA 3FZRA 1GZ8A 2C0IA 4LUEA 4IJ9A 4X2NA 4QP8A 4F9YA 3ZRLA 4EBWA 5HCYA 4HVDA 3D5UA 2Y4IC 4GK4A 5TT7A 3QTSA 4IAZA 2QOHA 5T6KA 3G9LX 4X6RA 1PXKA 5AA8A 2ZM1A 1U46A 4U6RA 5AIKA 1Q24A 5BYZA 2VWIA 5AMNA 2JFMA 3GB2A 3F7ZA 4BDAA 3HMNA 4D58A 1UA2A 5E9EA 5HIBA 4AS0A 5HICA 2PU8A 4X3JA 1OKZA 3LFAA 3AG9A 2WQOA 2HY81 5A9UA 5LWNA 2OW3A 3TN8A 3SXFA 4HJOA 2BAQA 4M12A 4X2FA 3ZONA 2C6TA 3NNWA 3AC1A 3SKCA 1WAKA 3B89A 3OXZA 5AM7A 1PYEA 3U6JA 5AUYA 4DN5A 4G1WA 4WO5A 3QQHA 4MD8E 4FV8A 3RGFA 3UOHA 4CZUA 4MVFA 2WKMA 3PXKA 5HVYA 5L2QA 2X39A 3D2KA 1PW2A 4AA4A 2BDWA 3BU6A 3PP1A 4CTCA 4II5A 4JG8A 2ZV8A 2YAAA 2YERA 3GENA 1YW2A 4CXAA 4DCAA 3A7HA 3K5VA 3IKAA 3KMMA 1OITA 3L9MA 3G2FA 3C4EA 3HMMA 4ZZMA 2WOUA 2JY6B 4BN1A 1OL7A 3C0GA 2GCDA 4AX8A 2J4ZA 4JJRA 4O96A 4ZY6A 4OUCA 1XR1A 4XBUA 1GJOA 3NW6A 5AR5A 2J7TA 4GVJA 3COMA 3KXMA 4EH6A 1HT2E 2C30A 4LGDA 5IUGA 3ZM4A 4N0SA 4TPTA 4QMLA 3SV0A 2W5HA 4RC4A 3FZ1A 3KRLA 5AIRA 1ND4A 2R9SA 5IA1A 4YU2A 5JT2A 3E93A 4FOCA 4I1ZA 2BRMA 2CDZA 4X7QA 3ZDUA 2HXQA 5HIEA 4RMZA 2BIYA 5JGAA 3RPYA 5KCVA 2QKRA 2VTAA 3BPRA 3DBQA 4L9IA 5K4JA 5D11A 5KUPA 3ZSGA 2YHVA 2QOKA 3TJCA 4JDKA 3I7BA 2E9OA 4TZRA 4MD7E 1AIPC 1PXIA 4ZLOA 1MRYA 4MQ2A 3RJCA 2W4JA 4RSSA 4KS8A 4UV0A 3NCGA 2IVVA 5HCZA 3VUMA 3H30A 4FSRA 4IWDA 3VF9A 1JOWB 4QYEA 4GYIA 3MGYA 3PG1A 4FVQA 2OJGA 4G6NA 3QXPA 4FSUA 4QRCA 4O7ZA 2EXCX 4AW2A 3LCTA 3R7GA 4ANSA 2XK9A 4W4WA 2C3KA 3BBTB 2JZ1A 2Z7LA 3Q2JA 3U9NA 5K9IA 3RHXA 3OUKA 2CCHA 4E5WA 3H0YA 1WFCA 2UW7A 3IDPA 2AUHA 5CS6A 4QTDA 4HPTE 3QQJA 4K9YA 4Q7JA 2OOBA 3F2NA 5FXRA 4YTFA 2VGPA 5C8NA 4QMWA 4ZTSA 2I0EA 3MBLA 3Q6UA 1ZMWA 2XS0A 3C7QA 3LIJA 3KXHA 5DE2A 2VTTA 4ANLA 2A1AB 4WG3A 1U4DA 3L8VA 4IEBA 2QU6A 1BKXA 1JR3E 4NIFB 5AV2A 5D10A 1DS5A 2NO3A 3F92A 3OD6X 4IB5A 4IQ6A 1JSUA 2KHHA 1PYXA 1XBAA 3D2IA 2PVHA 4CQEA 3SA0A 1XH9A 2F7ZE 4U97A 2PZYA 2QR8A 3L9PA 3FWQA 4QO9A 1PMVA 3JY0A 4H1MA 4WOVA 1TVOA 5LVLA 3R28A 2WTJA 1V0BA 3CJGA 4QMPA 4AT5A 5C4KA 3COKA 5GIPE 4GFGA 4B9DA 5AP3A 1VEBA 4O0TA 3WF6A 2H8HA 3P7AA 4UXLA 1U54B 4BC6A 1FMKA 4GIIA 4P5QA 5K3YA 3OFMA 4E20A 3OW4A 2BWBA 3PJCA 5AX3A 4ERKA 3WF8A 3GC7A 2R64A 3HP2A 4FYOA 4F64A 4I23A 3BGZA 3FMKA 2JP7A 4U43A 4M3QA 3E3BX 4FBXA 4TYHB 4X3FA 3EYHA 4CLIA 4OTHA 5DR2A 3R8PA 4JX7A 4I93A 2B53A 4FUXA 4IX6A 1MRVA 4BBEA 5CEIA 4F99A 1KOAA 4CMTA 4BDDA 4GJ3A 3P86A 2ZTCA 3DS6A 5DOSA 2EB3A 4PMSA 2OICA 3ORXA 1OBDA 2CHLA 2W4OA 2QO2A 3A7IA 4D5KA 4RVLA 4WSYA 4X2JA 5AUZA 4L7FA 1G8SA 4E93A 2BAKA 2WQEA 3PXRA 5AP5A 3TNWA 4FGBA 4KS7A 5EYMA 5EQPA 1WHCA 3ZOSA 3NUXA 4BDFA 5CF4A 4EK3A 4J95A 2OIDA 1OUYA 1MN3A 2WD1A 3KU2A 4GV1A 3RMFA 2YLFA 2W5BA 3IG7A 3PY0A 3L8SA 4YSMA 4BZNA 4FK6A 4CCUA 3QRUA 5AUXA 1V0OA 3RP9A 4QMMA 5LARA 1UKHA 1YI3A 2CGXA 3BLHA 3DPKA 3FKLA 4IE9A 2RFSA 1M2QA 3VS3A 3ROCA 4ZY5A 3NUYA 4O2PA 2R3QA 3GUBA 1PGYA 2QOBA 3E8EA 3IQ7A 4WUAA 3VQUA 5LWMA 2OBJA 5AR2A 4ZMFA 3KN6A 4QPSA 4BDHA 3A8XA 4QMNA 2YM3A 3BU3A 3PVUA 2JKKA 3FZOA 5EI8A 3V8WA 4C4JA 4XYFA 3G51A 4G3FA 3G0EA 5FWKK 4DHFA 2ITTA 3QQLA 3O0GA 3QUDA 5EDPA 2OIBA 4FV5A 4K2RA 3RI1A 2JUJA 4DGMA 3GBZA 4ITJA 4JIKA 2WMXA 4EL9A 4HVSA 3UP2A 3NNUA 4XMOA 5A4CA 5DMZA 5AAFA 3AD4A 2ZOQA 4TNDA 3CTQA 3R9NA 3QQUA 4TW9A 4MBJA 3POOA 4IZYA 4EORA 3VUTA 2UW5A 4D2SA 5J5TA 1Q8WA 4I6FA 3ZSIA 5HG9A 4I5PA 4BHZA 2VWWA 4V0GB 4BKJA 3HLLA 3Q9ZA 1JBPE 3V5QA 4MF0A 2WMVA 2WMRA 3LVPA 4F9AA 5CANA 2OK1A 4GVAA 3DY7A 4BCMA 4CQGA 3HRCA 4PF4A 1H27A 1GNGA 1ATPE 2HWOA 2QO7A 2C69A 3AXWA 4PY1A 4YLJA 4BR3A 3N51A 3DKFA 3CTJA 3F7WA 2VWXA 2B9HA 5B0XA 4AACA 4AGCA 3QZGA 3DBDA 3MS9A 1KWPA 4FMQA 1OKSA 1TR8A 5T3QA 2JBOA 4RIYA 3ENMA 3QF9A 3QWJA 2F7XE 4QPAA 2VGOA 3NIZA 4X0MA 1OM1A 4V04A 2JAVA 2OXYA 4BIBA 2CKPA 3A7FA 4RFYA 2X1NA 1BL6A 2B9FA 2XM9A 3PDTA 1P4OA 4FV6A 4OW8A 3UIXA 5CNOA 3NNXA 4ACMA 4E73A 5FLFA 5BVKA 3DXNA 2HZNA 3ZLXA 2GQSA 3C13A 2P0CA 2PE1A 3NYXA 2ZM4A 3GQIA 4G2FA 4XCUA 3V8TA 4ANOA 2PZIA 3LOKA 3E64A 2R0IA 3EFLA 3U87A 2O25A 3Q9WA 3A62A 5L3AA 4R7IA 2GS6A 3QCQA 2HW7A 1BMKA 4DFLA 4QQTA 1URCA 5C03A 2HELA 2JNHA 5ETFA 3U54A 5IU2A 4MBIA 4L44A 1EH4A 1H00A 1IXSA 4FKIA 4J96A 4NSTA 2CN5A 2J0IA 3OWJA 4O0UA 3V51A 3WE4A 2ZYBA 3CQUA 5DH3A 5ETIA 5CT7A 5ANDA 4J8NA 3R1NA 3FMJA 4E1ZA 2C6EA 5H9BA 4QMXA 3LCKA 1PRYA 3RAHA 4DBGB 3GCQA 1Q99A 3GVUA 5LCJA 5LVOA 5DRBA 4UZHA 3BRBA 4FV2A 5DVRA 1RJBA 4R3CA 2PVJA 5CZIA 3FPQA 4E26A 4F65A 2JY8A 5ACKA 2WIHA 5A6NA 3F9NA 2V7OA 3S2PA 3KMUA 4IB0A 2QI8A 1UU3A 2W4KA 3F66A 2YM4A 5AUVA 3SQQA 4PPAA 5EM5A 2H34A 2GNHA 2EUFB 4HYIA 3BV3A 2VD5A 2KULA 3DQXA 4XX9A 3ULZA 2HZ4A 1WBTA 3R1QA 1NVRA 3EN9A 3NRMA 4FG8A 4DEIA 3SGCA 3T9IA 3ZBFA 4LYNA 4EONA 1CSNA 2YJRA 5AV0A 1GOLA 3EYGA 4RVMA 1KV1A 3OCBA 4XG8A 3PIYA 4YTCA 5JGDA 1UFZA 2WZJA 4X6QC 2W0JA 4J8MA 5DNRA 2CKQA 2B7AA 5DYJA 2FA2A 3RK5A 4C61A 4P90A 2IVSA 3EFWA 4C3RA 4EOKA 4I20A 3CQWA 3S0OA 4AA5A 2VRXA 2W17A 3EQRA 3KKVA 2OOAA 2FYSA 2XKCA 4J97A 5D9HA 4ZTRA 5KZIA 1L8TA 4EZ3A 1K3AA 2QOQA 4CKIA 1UVRA 4O0RA 5J9ZA 4O7WA 1Q97A 2OO9A 1HQYE 4CRLA 2O63A 2J2IB 3P9JA 2JKQA 4KD1A 4ZSGA 3DDPA 4FSMA 3QKLA 5E8SA 2CWBA 3E8CA 1ZXEA 3G9NA 2X9EA 5EW8A 1SG9A 1W8CA 4WRSA 4MXAA 3OC1A 3MB7A 4PV0A 3EQCA 2HW6A 5ANGA 5IA4A 1QZEA 2JDTA 3Q5IA 5IISA 2QODA 1A06A 1NA7A 1YXUA 2WU7A 3P78A 4PTGA 3AC3A 1XWSA 2VWVA 3IONA 4TYJA 3BWFA 4O2ZA 1EFUB 4ENYA 4F1TA 3UMXA 4FTJA 5M57A 3UZTA 3WYXA 3RCDA 4E8AA 2VV9A 1ZWSA 3MW1A 3VBTA 1PMUA 4J52A 4MX9A 4RJ3A 5HLPA 4ZY4A 4S2ZA 3V8SA 2IJMA 2RG5A 3LCDA 5H3QA 4YHJA 4CGAA 3EQGA 1SNXA 3MTLA 2R3RA 3NPCA 2XCHA 3O50A 3FUPA 2YCSA 3PSCA 4FSWA 4JXFA 4MWHA 4PMTA 4PQNA 3TUBA 2QHOB 2QO9A 4O7VA 1HCKA 1W84A 3KK8A 3KXGA 3QTIA 2BZJA 5CAOA 1DI8A 2ETKA 2F4JA 4DTBA 3NLBA 4FF8A 5FRIA 4YZNA 3GU6A 3NUSA 4XRJA 1ZRZA 4LOOA 5H8BA 4FKVA 4R7HA 4E4MA 3ZYAA 2HENA 2GMXA 2DWBA 1JVPP 4IB3A 3FQSA 1ZY4A 2O2UA 3ZRKA 2XK6A 2ZV9A 5AV3A 4KIKB 4A4XA 5CEKA 5JZNA 5TKDA 4CMOA 2PVMA 4ZSEA 1HT1E 2C5OA 1YLAA 5L8JA 3AD5A 5HVKA 2GNJA 3FC1X 2XIKA 3GFWA 3ORTA 3UPXA 1OI9A 5EDQA 3WZKA 1JNKA 3UQFA 1NT2A 4ZP5A 2W1CA 3GLFE 4W9XA 4HGTA 4OTIA 1IFYA 3FQHA 1OIYA 1PMNA 2P4IA 5D7AA 3FI2A 3LQ3A 3TDVA 2CJMA 3EWHA 2WMUA 1YXXA 5D41A 3OOGA 4CRSA 1OZ1A 3IOPA 1WBVA 3KFAA 1FINA 4IX5A 4XG2A 5L2WA 2W9FB 3ORZA 2I1MA 3RPOA 2C3IB 3MFRA 5J1VA 3DB8A 3KXZA 4E4XA 3KN5A 5FM3A 5H8GA 4AE9A 4PDYA 5AUTA 2WEIA 4RJ7A 3JY9A 4IAFA 4WA9A 4F7NA 4G5PA 1AD5A 3ODZX 5J7BA 1M52A 5CF5A 5IQCA 5C01A 4DFBA 1WMKA 2QLUA 4U40A 1CTPE 3F5XA 3QQKA 5AP7A 3QA8A 3QX2A 4U45A 5IDNA 5DEYA 4TWPA 4N6ZA 5CVHA 4F0FA 5J9LA 4AGUA 5GIOE 1ZAOA 1OQYA 3LW0A 4EI4A 1Q61A 2OZAA 3PIXA 4I6HA 3U9CA 4EOQA 3DFCB 3SOAA 5CZHA 3VUKA 2NRUA 1XH8A 3UMWA 3ZO2A 2MJ5B 3Q3BA 4G9CA 4XG3A 3ZEPA 1G3IA 3ZLSA 1F5QA 3IOKA 4O1PA 4I0SA 4JL9A 3UVRA 4O38A 4YZ9A 2C6MA 1JSTA 3OEFX 5ANJA 4DG3E 4CTBA 2OO8X 4MXCA 4K6ZA 2X0GA 2XK7A 4YSJA 4YC8A 2XEYA 3F3VA 3DJ5A 5EDRA 1Y6BA 5CALA 2VN9A 3AC8A 3H0ZA 2WXVA 4Q2AA 5M4CA 3ANQA 4Z3VA 3MJ2A 3FYJX 5BVFA 3ATTA 3D94A 3NWWA 3R0TA 4D1XA 4AAAA 4QYGA 5HTBA 5EQEA 3F3WA 4OTGA 3HMOA 2W1EA 4IZAA 4NJDA 2XJ0A 1JKTA 3DNDA 2MGWA 3TWJA 4FVRA 3GQLA 4NFMA 2Z8CA 2YCQA 4A9TA 3DAJA 1W0XC 4GYGA 2BRHA 3SW4A 1E1XA 3N4VA 2B52A 3C4XA 4F0GA 2JKOA 4G3DA 2LAVA 4GEWA 3W2SA 1YHWA 2GHGA 4W4VA 5EW9A 3VF8A 4FUYA 3HV6A 2ZM3A 2X6EA 3NYNA 4R5SA 3S3IA 4FZAB 4Y73A 1J1CA 2REIA 4LL0A 3FE3A 5BVWA 3VS1A 3QRJA 5J8IA 3FV8A 2UVXA 2YWVA 5CLPA 3BU5A 4UYAA 5CY3A 5D7VA 5DIAA 4BTKA 4EHZA 3BYVA 1GY3A 4CV8A 2LVOC 2Z7RA 3R9DA 4D0WA 2VTIA 1LP4A 2J5FA 4CT2A 4E6CA 1UNLA 3Q04A 3P5KA 4MQ1A 4F1MA 4BIDA 3C51A 4DH3A 4XLVA 3QGWA 1CM8A 3UP7A 3ELJA 2XNNA 1OKVA 1P14A 1SM2A 3FZPA 4RT7A 4DG0E 4EH7A 4BDJA 3EFJA 3VS0A 4DF3A 5LVMA 3P0MA 4LM5A 1B39A 4Z55A 4TTHB 1IRKA 4AGDA 5M4UA 1NW1A 4EUUA 4S32A 3GT8A 3HEGA 4IDVA 4NM3A 2DNAA 3SHEA 2OGVA 5FDPA 5A6OA 1GZOA 3BYOA 3DAKA 3M2WA 3NNVA 4JS8A 1QPEA 2WB8A 3R1SA 4LL5A 5C27A 3ORNA 4M68A 4ZZNA 5BVNA 5IH5A 1UNGA 2W1ZA 1OL1A 3F5GA 4P5ZA 4Z7GA 5JFVA 5HBJA 1Z9XA 4YJQA 4C2VA 2HXLA 5HI2A 1YI4A 4A4OA 3D5WA 5JMSA 2ITZA 3EHAA 4Q5EA 4DH8A 2JZ0A 4M66A 3ROYA 4O7SA 3RBWA 5CX9A 5AR7A 4H1JA 1XBBA 1H01A 3EQIA 2J90A 5FP5A 4F7JA 5IQAA 2DAEA 1FVTA 5A46A 5CEPA 3FSKA 2C1BA 3GU7A 3LXNA 5KMMA 3UNJA 5M09A 3DJ6A 2X7GA 3FAAA 2DAIA 2W99B 2EKFA 4RQKA 3MWUA 3ZBXA 4UN2B 2NNWB 2YM5A 4OTDA 2LVQD 4QYYA 3D14A 4HVIA 3II5A 3RM7A 3UIBA 5E4HA 5EQYA 3CP9A 3VS4A 4TY1A 3HV3A 5LVNA 4QQCA 4L3LA 3R9OA 2QU5A 5HNGA 4O81A 2C0OA 2ITOA 4EH3A 3GEQA 3GCSA 3TZ8A 2DQ7X 2GHMA 3PZHA 2ITPA 2R3NA 4IVBA 4X21A 4OT6A 1Q3DA 4DGOA 2HZIA 3BBWA 3DNEA 3HUCA 4C3PA 5CSXA 2EKKA 3C4ZA 4YJNA 3UIUA 1H25A 2CLXA 2PPQA 2XH5A 4OTRA 5JQ8A 5TR6A 3BI6A 1W7HA 4HGLA 2JLDA 4UMTA 3DCVA 4OGRA 2HY0A 3WZDA 4BF2A 5BPYA 3LFQA 4FNXA 2PMIA 4FKWA 4Y5HA 4M84A 3UNKA 2Q0BA 4FEWA 2OG8A 4DGGA 1GO5A 3E8NA 4FZDB 3SRVA 4YJOA 3C9WA 4AWIA 2YIWA 1DO0A 2JY7A 2B9IA 4UZDA 4PL5A 3UG1A 4A9YA 4UBAA 3RWQA 1WZYA 2H9VA 1WGLA 5M56A 3PSDA 5FEQA 1OECA 3LCSA 4I6QA 4KBCA 2KTYA 3FLQA 5BX0A 5AP0A 4PNIA 2OFUA 3BHHA 3IW5A 2X9FA 1NXKA 3FYKX 3UO6A 4YR8A 4QYFA 4D28A 5G6VA 3UPZA 1IA8A 3F3UA 3NGAA 2VX0A 4O7NA 3FY0A 3NAXA 4BYIA 4RA4A 4BCHA 4G6LA 3EB0A 4XRLA 5CVGA 5J95A 1DM2A 3P1AA 1VYWA 3ZUUA 4FZFB 1XH7A 3G6HA 2UVZA 3KK9A 2BTRA 2UV2A 3MV5A 5B7VA 3RPSA 1ZV1A 2ITUA 4KBAA 3WBLA 4ENXA 1KYIA 4N57A 3UGCA 4YJRA 3O8UA 2A27A 4AG8A 5CT0A 2J5EA 3KVXA 3ZEWA 4ACHA 4F6SA 3TUDA 4U3YA 3REPA 4JBVA 4K11A 3OCSA 4YJSA 2ITWA 2HYYA 2PK9A 3QKMA 3ZO1A 5IEVA 4GT4A 4HPUE 4M69B 5CF6A 2PMLX 2PVRA 3HRFA 2JAMA 3VHEA 5HBHA 3C5IA 3FRHA 4G9RA 3UYTA 2G2HA 1ZOGA 3S4QA 4GRBA 4PWNA 4UN0C 3R8VA 2G01A 2X81A 1YWNA 4GEOA 1PY5A 4DEEA 4DFZE 2OKRA 3EN4A 4FV7A 4F08A 5HU3A 5JQ5A 1WBWA 4J71A 1KE5A 4KUJA 2UZBA 1BUHA 2R2PA 4FIJA 2XEZA 1IEPA 4ALUA 5KZ0A 4DAWA 3QCSA 2XK4A 3GC9A 2QONA 3VUHA 4C37A 4U7ZA 1JSVA 3KXNA 3TNIA 3ENHA 4QP2A 4W9WA 5DA3A 2ZTDA 3LFNA 1CKIA 2JKMA 1G41A 2B1PA 4KIPA 1Y57A 2J6MA 1YDSE 2I0HA 4XP3A 3QD4A 2ITYA 2ITVA 3FMMA 4F63A 1OPKA 2OXDA 4EJNA 5F20A 3I6WA 2HWJA 2Z02A 5BVEA 5GJGA 4F9BA 5IQEA 5FTQA 3TJDA 2WTVA 2OJFE 2GNIA 2UW4A 3OP5A 3UO5A 1BYGA 4CFMA 2AC3A 1GAGA 2JIIA 2R5TA 2RSVA 2XVDA 3I6UA 5M53A 3GXLA 5DBXA 4B0GA 1VEKA 4EHGA 2HAKA 4I5CA 3LFSA 1FPUA 5HG8A 4JIAA 5IUHA 1R78A 1H1RA 4BYJA 3JS2A 5FG8A 4PMMA 2PL0A 3F3TA 4USDA 3BKBA 4PDOA 5GNKA 4PL4A 3HV7A 4L53A 4AZTA 2WELA 4I3ZA 5D12A 3CKXA 4GS6A 2VTOA 3JR1A 3N4TA 3DOGA 2YDJA 3JXWA 4RBLA 3QRTA 4MXZA 3UOLA 4D0XA 3TV6A 3BE2A 2UZOA 4UMRA 3P08A 3IECA 4D4YA 3AMYA 3PTGA 2VTNA 3F3ZA 4LMNA 4FV4A 5E91A 5F94A 4LGGA 4TYHA 1OUKA 4X3FB 4BTJA 3PA3A 1CDKA 3QL8A 3MPMA 4IADA 4L7SA 4UMQA 3FI8A 4EJ7A 3HUBA 2J0MB 4W4YA 5HE1A 1T45A 4YJUA 3I0OA 3LPBA 4IVAA 4R1YA 2ZVAA 1U5QA 5LMKC 4QQ5A 1OTRA 3UZRA 5E8UA 2X8IA 2YM7A 4I4FA 4XG4A 4KKGA 3UZPA 4FIEA 2ETRA 3R9RA 2Y9QA 4EK6A 4BZOA 3JYAA 5AFVA 3E3PA 4BCQA 3AQVA 4EKLA 5C1QB 5BMSA 4R77A 1G3NA 1W98A 3UC4A 2C3JA 3EQPA 4GUBA 2P3GX 1WVYA 4B7TA 3ZU7A 3RVGA 3GCUA 5CQWA 4QMOA 4TWNA 4DLJA 3O7LD 3BQRA 3EKKA 3HECA 3FY2A 4KRDA 2ZB1A 3FLWA 2YM6A 5CSVA 5EM6A 3V5JA 2DUVA 2R3JA 3M1SA 1DAWA 2PUUA 2RL5A 1YOMA 3VBWA 3EIDA 2OH0E 4PMPA 3KC3A 4I21A 3GLIE 3MA3A 4JR3A 4QMSA 3PWYA 4F70A 3COHA 3ORLA 5BMMA 4JRVA 2IZUA 3QD3A 4X2KA 2P2HA 3C5UA 3P4KA 4LG4A 3OF0A 4YJPA 1QCFA 4A9SA 4GJ2A 4YPSA 3FZSA 4O7LA 4FTTA 3BE9A 4MXOA 3BEGA 4YZDA 2FSMX 5E92A 4GG7A 3ANRA 4YP8A 1JKLA 1F0QA 2HCKA 2J0JA 4AU8A 4UMPA 4DEDA 3VUIA 4ZZOA 3S00A 2I0VA 4W4XA 2BDFA 2JFLA 4WNPA 2UVYA 4RC3A 3O7LB 3FLYA 3Q53A 2GQGA 4GT3A 2IZSA 1REKA 5GZAA 1HJPA 2UZTA 3OVVA 4O0YA 3F5UA 5DWRA 4S33A 1Z57A 2BFYA 3NS9A 4MCVA 3EQFA 1Q8TA 4GH2A 4RWJA 4XOYA 3R8UA 4B99A 5I9WA 5CU0A 1BI8A 2C3LA 3PXFA 5TF9A 4YNEA 1Q8YA 1ZY5A 4ACGA 4O82A 3MVMA 4C59A 2YIRA 3PSBA 4V01A 1CKJA 2VWUA 3V04A 4F9CA 4FG9A 4F6WA 2I7QA 3ATSA 5IQDA 4O6EA 2RFNA 3KRRA 5AADA 4IJPA 2GFCA 5J79A 3HP5A 4XBRA 1DO2A 3QHRA 1APME 3T3VA 5E7RA 3EN7A 3SD0A 3KEXA 4FKTA 4O27B 5DRDA 3K9PA 2HZ0A 4KIQA 4APCA 2XK3A 3NEWA 2XIYA 5L6OA 1H07A 2Z60A 4EC9A 1Y6AA 5HLNA 5I0BA 4O83A 4QT1A 1QL6A 2C6OA 4AZFA 4R3RA 4F1OA 4IWOA 3D9VA 1XQZA 2KNVA 2C68A 3IO7A 3MN3A 3HZTA 4D9TA 2QOCA 3LFDA 3THBA 3UC3A 2JDVA 4GFOA 3U51A 4C4EA 4IX4A 4RX9A 3L1SA 4RPVA 1C7YA 4EHVA 5IZFA 4RJ4A 2DAGA 4BICA 1YHVA 4C3FA 3COIA 1REJA 2LGCA 2X8EA 4O91A 1L3RE 3Q52A 1SVEA 3FI3A 4ALWA 1ZZ2A 4OTQA 3CCNA 3W2OA 3W8LA 5IPJA 4U9AA 2CKOA 4GKHA 3G33A 2ONLA 2G2FA 2X2KA 1Q02A 2J51A 3PPKA 4S30A 4BTMA 3F61A 3DGKA 3MVJA 4TKSA 1LUFA 4RG0A 2SRCA 4MAOA 2QVSE 3QALE 3HV5A 3LQ5A 4N70A 3NYVA 1ZMUA 1H0WA 3ZUTA 3TDWA 3GC8A 3SW7A 3H9RA 3C0IA 3FJQE 4EH8A 4MXXA 1PKDA 2UW0A 3E92A 3VJOA 2VAGA 2J0LA 2PVFA 4ZLYA 5M44A 3A99A 3ZCLA 4PX6A 2E2BA 1WBNA 1VG5A 2CLQA 4LOPA 1O6YA 2YITA 3NR9A 4MHAA 4MH7A 4GU6A 4C62A 4B4LA 1YOLA 1I44A 1OPJA 2R3IA 3PE2A 2UW9A 4FKSA 4U5JA 1W83A 4QYHA 3QC9A 3UQCA 4C8BA 1PKGA 4FTAA 4HYUA 1TKIA 3QUPA 5JRSA 3IK3A 4GUEA 2IN6A 4YZBA 4PRJA 1JWHA 4BWKA 5CEMA 4DA5A 2YDIA 5FEDA 1VEJA 2X7OA 5C26A 2F9GA 4QOXA 4MD9E 5CYIA 5EOBA 3IPHA 5DN3A 5IF1A 3VRYA 1G8AA 2BCJA 3A4PA 2Q0NA 3NAYA 4F6UA 4NH1A 1OL2A 4DEHA 2IPXA 5A4EA 3OTUA 5CAQA 4AA0A 2BDJA 2JDOA 3DFAA 4BY9E 5A4LA 2A2AA 2PE2A 4RLKA 2HWPA 3ZZWA 1VQ1A 2YABA 3IHPA 4UXQA 4HCTA 3PE1A 4PPCA 4L8MA 4DGLC 1F3MC 4Y72A 4L68A 4L42A 2R7IA 3BBZA 4DTKA 4DG2E 5HQ0A 1J3HA 2WMWA 4DT8A 1WCCA 4HVHA 3BCEA 3LLTA 3ORIA 2OFVA 2X6DA 2DKLA 3JVRA 4M0YA 2Y4IB 5JGBA 5M51A 3LJ1A 1RQQA 5CAVA 4I5HA 4QP6A 4MNEA 2DI0A 3FBVA 2WTKC 4KKEA 4TYIA 1J1BA 1U54A 3KL8A 2DAMA 1Q3WA 4MBLA 2AC5A 2YIYA 1XH6A 2Y4PA 1TQPA 3TZ7A 4U3ZA 1ZOEA 2BIKB 3QTRA 4R8QA 3SRVB 5CXZA 3DK7A 2W5AA 4E5AX 2XP2A 5L6WL 4WSQA 4BI2A 4LFIA 4FICA 4WUNA 4D2TA 5KMLA 4QTEA 3R7YA 4FIGA 3T6PA 4TWCA 4ANBA 1NV8A 3GOPA 4WBBB 4FEXA 2W1GA 3ZHPC 4DFNA 4HCUA 4F7LA 3WE8A 1YRPA 2PE0A 3P7BA 4YNOA 1M7QA 1U5RA 3MDYA 4JLCA 4EK5A 3BYUA 3DB6A 4ASZA 2H6DA 3ZC5A 3DK6A 2F2CB 3QLGA 5IG1A 2BRGA 2PWLA 2W96B 2Y6OA 4H05A 5EKOA 5HU9A 2CGUA 1Q4LA 5CXHA 4C58A 3VO3A 5CWZA 2QOIA 4FTLA 5I3OA 4DGNA 4WNKA 2QLQA 2WTCA 2GNLA 2W9ZB 4UY9A 4RFMA 4E5BA 5AJQA 1IR3A 4G16A 5DT4A 4BDIA 5E8ZA 4LRJA 3KGAA 2BROA 3W2QA 3W2RA 2UZWE 3EL8A 3G5DA 4K33A 1UU7A 3OUNB 5ETCA 3TEIA 3M11A 3O71A 4EQMA 3HRBA 1QPJA 2ONLC 1W82A 4D4RA 3HDMA 3CY2A 2XUUA 3BHYA 2XIXA 3FMNA 5CASA 3UNZA 5J7HA 3RK7A 4JQ7A 4CZYB 2WHBA 2V0DA 5M4IA 2XNBA 3DXQA 5CTPA 4H58A 2GS2A 4XV3A 2QSFX 4C34A 3LM0A 2XJ1A 1H1QA 5DHJA 4ZJJA 4BGHA 4EQCA 3DLSA 4AFJA 1YVJA 3PPZA 3R9HA 2BKZA 4H3PA 1GZNA 4QP3A 2OF2A 2YISA 5HNIX 2VO3A 2PVLA 5EM8A 2EB2A 3BV2A 5FD2A 2WQMA 5AM6A 2XJ2A 3OG7A 2OF4A 4D1SA 4EWQA 3G90X 2FO0A 3KQ7A 2PHKA 3RHKA 4FT9A 4AN2A 4D4SA 2QOOA 5FEEA 3HYHA 5L4QA 1YXSA 3G0FA 5AR3A 5FBOA 4F2LA 3LXKA 4U80A 4QP7A 4EKKA 1ZMVA 4E4NA 5FUTA 3EZVA 2QC6A 4AXAA 3RPRA 3BWJA 2VZ6A 4V0GA 4EOIA 2OJIA 2QHNA 2OJ9A 3QTWA 1Q62A 5KNJA 5HO6A 5KE0A 4XG9A 2YN8A 2JBPA 3GU8A 4I0TA 4J7BA 4X2GA 1KE8A 4GK3A 4XHKB 5KHXA 2YEXA 4A07A 4ZIMA 1Y8GA 1T43A 5T68A 2JY5A 4IHPA 2FVDA 3TTIA 4L01A 2DHYA 1FGIA 3BLQA 5LVPA 4BKZA 5C8KA 3RTPA 4C33A 3DKOA 3B8RA 5LXMA 4FKOA 1VDLA 1XH5A 2J9MA 2K9DA 3GCPA 2QCSA 3A7JA 4M15A 2PTKA 4U8ZA 5F9EA 3C4CA 4FZ7A 4X3FC 2PUNA 2BKKA 5I9UA 4FODA 3FC2A 2UZEA 3UIMA 3R63A 4XEYA 4E6AA 3PJ1A 1JPAA 3D7TA 4MYGA 4AT3A 4G5JA 2YA9A 4FTOA 5EI2A 2LBCA 4K77A 3QTZA 5M06A 1K2PA 2X4ZA 3D5XA 3OROA 5EW3A 3CEKA 2G2IA 5ETAA 1NVQA 3FXZA 3R04A 2XKEA 5EYDA 4PPBA 3V6SA 3IDBA 4FNZA 1UNHA 4MNFA 5BYYA 3ID6C 3DQWA 4IXPA 3UYSA 3W10A 2XK8A 2B55A 3TNPC 3I7CA 1E9HA 3DLZA 3CY3A 4HGSA 3VS6A 1OKWA 4J1RA 3OCTA 1WGNA 3R1YA 2OIQA 3I0QA 3MYGA 4G3EA 4IANA 4IW0A 4L3PA 2I6LA 4I94A 3T8OA 4BL1A 2VNYA 3MFTA 4ZOGA 5HTIA 3MY1A 2C6DA 4EOSA 5IQBA 3DU8A 4I92A 4LOQA 3POZA 3DTWA 2XM8A 3FXWA 4BHNA 3ZUVA 2C5VA 4DLIA 2X4FA 4BVUA 3D5VA 2PZPA 3H3CA 3RZBA 3EOCA 4NM5A 5DFLA 1Q41A 3OTVA 1H1WA 5EKNA 3HMIA 2J0KA 2WIPA 2JDSA 3D15A 3PZEA 5JSMA 3G15A 5HGIA 4A06A 4LUDA 5F4NA 3AC4A 4BCKA 3VUDA 4QMUA 2LTUA 2WMQA 4G3CA 1PJKA 4RIXB 4NW6A 3CIKA 4KABA 2QD9A 3CGFA 1OIUA 3FRIA 2WTDA 3AOXA 4R5YA 4RJ6A 4YZCA 5DI1A 4D9UA 2UW3A 3K5UA 4IM0A 5C8MA 2WTWA 5EOLA 5CI6A 1STCE 5I9YA 3IDCA 1URWA 3BGQA 3MSSA 4GW8A 3KA0A 4YLKA 3UO4A 4CLJA 4U41A 3ZM9A 2XKFA 3DBCA 4GCJA 3UG2A 3MIAA 1TTEA 4RZWA 4DITA 4O0XA 3QYWA 4EH9A 4HVGA 4ID7A 4QP9A 3BQCA 5HX6A 3CLYA 4FL2A 3TZ9A 5KMNA 5JI2E 3TTJA 3LCUA 4V05A 4WD5A 4OBOA 5CSPA 1ZOHA 4WHZA 3S95A 4WRGA 5LQFA 3HGKA 3AT3A 4GT5A 4QP4A 2F49A 3KF4A 3UQGA 3OBGA 2V55A 2VTPA 4Y95A 4YTIA 2VTSA 4HNFA 1SVGA 3MFSA 3CKWA 3W55A 3TG1A 4AW0A 5HORA 4KRCA 3ZS5A 4FEUA 1OIRA 2UZDA 5BNJA 2O0UA 4CT1A 2PVYA 5DR9A 5EYKA 4JDHA 3EN6A 3FL5A 4LI5A 3LE6A 4TYEA 4Q9ZA 4CKJA 2YACA 5HO7A 3QRIA 3DK3A 1YWRA 4C0TA 3SG9A 2FB8A 4YJTA 4MK0A 5G1XA 5IA2A 3QUEA 3MY0A 2W7XA 3BEAA 3NSZA 3NX8A 4FIFA 4U44A 3R02A 4JT3A 3R2BA 1XO2B 2O64A 2GS7A 5AP4A 4IM3A 3ALNA 4O22A 4O7RA 2CNQA 4RRVA 3TI1A 5IQFA 4DEBA 3BZ3A 2GHLA 2H96A 5ITAA 3FEGA 2O5KA 3W33A 4CFVA 4XP0A 4O7TA 4N6YA 3GCVA 4EWHA 4ASEA 4YHTA 2YWPA 2BPMA 4IAIA 3B2TA 3RAWA 2I0YA 3KRXA 3W32A 1G4AE 3H10A 3QQGA 5C4LA 3DKCA 1KE9A 3TT0A 3MMPA 5EYCA 2L4FA 4O1OA 2IO6A 5C9CA 3PVWA 2QNJA 3OY3A 5HKMA 4LQMA 4TWOA 3ZTXA 4YO4A 4FEVA 5EG3A 1R3CA 1H1PA 2IVUA 2YLEA 4HOKA 2YZLA 2BZKB 4JBQA 4D4VA 5K4IA 3R7OA 2RF9A 3R7VA 5J1WA 4DCEA 3MESA 3FLSA 2FUMA 5AX9A 3IW4A 2YIXA 3FZTA 5HOAA 2PVKA 4ZLZA 5AUUA 2BALA
chains in the Genus database with same CATH superfamily
4DE4A 4IBEA 3PG3A 3AOEC 2ZAZA 2M5ZA 4FKUA 3MPTA 2RRUA 5HCXA 5KMKA 2V1CA 3L2AA 4I4EA 3IG5A 2PVNA 4G6OA 2XZUA 1W2FA 3TV7A 4B7GA 5EI6A 4FL1A 3CGOA 4DFXE 5HLWA 3PLAE 2ZMDA 1LEZA 3C50A 5E8VA 2RKOA 3UJNA 3VHKA 3CQEA 3K3IA 3PXYA 3NUAA 4AXDA 2BHHA 4BDBA 2QQ8A 4CG9A 4M9XA 2UUEA 4W8EA 1HOWA 3ACKA 4EOPA 3CPCA 3V5TA 4DH7A 4IDTA 3ULZA 2EXEA 2UW6A 4IWQA 4BB4A 3THGA 4FX3A 2X8DA 2UZLA 2XIRA 3VVHA 4KSPA 5A54A 3D0EA 2BFXA 2WQNA 1A5TA 4B3RM 5IZ7D 3VK8A 2JDRA 4IBIA 2VWBA 2GNFA 4AN3A 4B7HA 2B54A 4APPA 1YOJA 5HVJA 1XHBA 4B8LA 2WMSA 3U6HA 4NJ3A 2WPAA 3Q9XA 2PULA 2QHMA 3IW6A 4FV0A 4CNHA 4D2WA 3ULIA 2BNKA 2I40A 3OWLA 4Y5QA 1KE7A 3KF7A 5AA9A 4FZ6A 4DV6M 4S12A 5CF8A 4N4SA 3NBIA 2CV0A 3QCYA 5HU3A 4AOJA 3ZC7B 4ZAUA 2OZAB 3GGFA 3FYCA 1M17A 4RFZA 4M7IA 3OWKA 3V5LA 4QMYA 3VWAA 4XJ0A 4K8AA 2Y8OA 2JWSA 2XNPA 2Y0AA 1VYZA 5ANOA 4EH2A 3HU3A 5KKRB 1OAOC 1NVSA 4IVCA 3I4VA 3VS5A 5IQHA 3J81S 3BELA 3R22A 3SAYA 1XHAA 2L2DA 1WBSA 2YJSA 2F7EE 4YHFA 2JXNA 3F88A 2XKDA 3KVWA 4F4PA 3ZSHA 2BILB 2WTIA 1A9UA 2QG5A 4IVDA 4UB7A 4XLIA 1UWHA 5HHWA 4D2VA 4QP1A 3ZO4A 1OGYA 5A4TA 4HGEA 1R39A 3GRRA 3W8QA 4TXCA 3UODA 2ITXA 3VULA 1NNJA 4XV2A 4YGAA 2NP8A 2FSTX 4M0ZA 4I0RA 4QMVA 2ZAOA 3HU1A 3ZC6A 3P79A 4EHEA 4G3OA 3CD3A 4BDGA 2EU9A 3O17A 4F09A 2BVAA 1QYRA 2PUPA 5IQGA 3R30A 3QXOA 4FKJA 3UVPA 4RJ5A 2PZ5A 1OIZA 4DHJA 3ZFMA 4JI0M 1IN7A 5TE0A 2EJSA 1Z5AA 2YFXA 3O2MA 1Q8ZA 3NFFB 4FSQA 4XG6A 3NUUA 4NYEA 4FKPA 2PYWA 4UMUA 3Q5ZA 3LMHA 1OB3A 2RG6A 4Q9SA 4L00A 4G3GA 5KX8A 1FVVA 3OXIA 1FOTA 4WKQA 5CQUA 4QNRA 5I5ZA 1H08A 4FT7A 4BRXA 4Q5HA 5IMXA 3HAVA 3I04M 3ETAA 3ZRMA 2APLA 4MGZE 4X62M 4NKSA 4FTNA 5B2KA 4OT5A 2VWZA 4AN9A 2E9UA 1BVSA 2VX1A 4BCNA 4MTAA 2IZTA 4E6QA 2X2MA 3ITZA 4O7YA 2W06A 1BLXA 2A0CX 3E87A 4JG6A 3EIEA 3Q4ZA 3ZXZA 4AGWA 4XGIA 4FK3A 5GHVA 3A2CA 4U81A 3VKHA 4LRKA 4BI1A 5IA3A 5IH4A 1I09A 5BQ0A 4RIOA 3ZLWA 4M69A 2PMNX 1R0PA 3VNTA 2C6LA 2VO7A 3GLHA 4TRLA 3L25A 2Q83A 4FTCA 4IM2A 4CV9A 5J9YA 3KOWE 3KP1E 4YY3M 2XZSA 3FMDA 5ANEA 4TN6A 4AP7A 5BUJA 5CU2A 3KSJA 2VU3A 1PJQA 3C0HA 4EUTA 2EA0A 4UX9A 4EYMA 2UZUE 3DZOA 3QTUA 3MJ1A 3ZZEA 1WVWA 4KSQA 4EOJA 5AV4A 3OTOM 2XYUA 1XXHE 4WNMA 3DV3A 2QR7A 2XNGA 5CU3A 3E62A 2GNGA 1XH4A 1L2DA 1H8FA 2C5XA 2O65A 2QURA 2R7BA 1SVHA 2VNWA 4L4UA 3AT4A 4FTRA 4ANMA 4EEVA 3EZRA 5BVOA 5IMEA 5GZ8A 3FLNC 4M67A 1JLUE 1H1SA 4NW5A 5FTGA 3SBJA 3LFBA 2V62A 3AC5A 4NL4H 5CU6A 2DZLA 3B7NA 4JQEA 3ZMMA 1E94E 3L8XA 4KIKA 4AQCA 1ERKA 4BJJA 3TNQB 2E9NA 3UE4A 2XMYA 4FV3A 4O21A 1VEGA 4PTCA 3LZBA 2UXDM 3WZUA 4EZ7A 3SAWA 5CEQA 3OHTA 4NTSA 4K0YA 1S9IA 1J91A 4NWMA 3T38A 4P2KA 4W8DA 2XRUA 4EC8A 3E21A 3AMBA 4Z7HA 3AKLA 4NCTA 4ZTNA 4AZVA 2ZB0A 3FMHA 5GJDA 1TQMA 3OCGA 3I5ZA 1P2AA 3WF7A 2ZV7A 5IKWA 1JKKA 2FH0A 3R01A 3V6RA 4BKYA 5K0KA 2OZOA 2K47A 3TNHA 4YURA 3HAMA 3U60B 3UK6A 1OL6A 1H6UA 2R3GA 4ZTQA 3RNIA 4G4RA 3FI4A 1R0EA 4R3PA 4WW0A 4R1VA 4PUZA 3C1XA 5ITYA 2VTRA 2W1DA 3QKKA 4ZS4A 4I5MA 4AOIA 3F2RA 2ZMCA 5HBEA 3ZFYA 3VBYA 3WOWA 3MIYA 1ZQ9A 4A4LA 1NY3A 4E6DA 1YKRA 3TWLA 3MY5A 5JK3A 3RPVA 4AF3A 4DEGA 4EYJA 1N34M 4FV9A 3HV4A 1NV9A 2ZDUA 3SARA 3LFEA 4H3BA 1T46A 4RQVA 1HCLA 4IIRA 3A60A 3FHRA 3VRZA 2WU6A 3A7GA 4ZSLA 4Z6YA 3NIEA 3IS5A 5EH0A 3RFWA 4IWPA 2WQBA 4L43A 3T1HM 4C57A 4FCWA 1FBNA 3LXLA 2YAKA 5TO8A 1OIQA 1J7LA 1MRUA 4QOZC 3QWLA 4QEBA 3I5NA 1UM8A 1IBMM 1DV0A 3R2YA 5HE0A 3GP0A 5JKGA 3PA4A 4QDVA 5I9XA 3S1HA 3R8ZA 4FSNA 4BTFA 5IH5A 5EHLA 1VJYA 3B2WA 1KSFX 2OI4X 4LF4M 2XRWA 2RFDA 4FOBA 2ERZE 4C4FA 4QTCA 4H3QA 2FS1A 4Z16A 4LMUA 2UW8A 3DBEA 4NZWB 4CFFA 3F2AA 4EH5A 1GIHA 3SDJA 4CFUA 3VW8A 3K9OA 3BIZA 1O6LA 5FDXA 2KDLA 5JFSA 2OWBA 3PVBA 2K0BX 4ACDA 2JC6A 4I22A 4AW5A 1B38A 4JDIA 5DG5A 2BTSA 3HDNA 3GPPA 1XB2B 3D7TB 2AEGA 1DGHB 4KB8A 4ZJVA 5FBNC 5CSWA 5ICPA 4GL9A 4AUAA 5A4QA 3LLAA 1Q8UA 1WVXA 2FGIA 2WTKB 3EIHA 2JEDA 3R00A 5HD7A 4DH1A 4P17A 3MH1A 1ZYSA 2QOFA 4BCGA 3Q9YA 4IC8A 2XALA 3BHVA 3SAVA 2GTMA 3PJ2A 4GMYA 1NJGA 4WIHA 1XMLA 4NFNA 1H0VA 1FJGM 2FSLX 3KREA 2CSNA 4ITHA 4C35A 1YDTE 4LRMA 3QWKA 4DH5A 3BYMA 4CMUA 4IMYA 2VO6A 3FHIA 1TDHA 2P2IA 4JRNA 4M14A 5J87A 2H5XA 3UDBA 2AYPA 3OEZA 2X2LA 4FR4A 4YLLA 4BI0A 2JGZA 2W1FA 3IW8A 1KE6A 1L2BA 4GIHA 3F82A 1G5SA 4WT6A 4Y83A 2WMAA 2WOTA 3RKBA 4BCOA 1QPCA 4YBKA 4FSYA 3VQHA 3RINA 1O9UA 4D2PA 1QZMA 3R7IA 4OAVB 2ZDTA 3P23A 3GRYA 1IN6A 1B6CB 3R71A 3EH9A 3OT3A 4WNOA 5D1JA 4C38A 1LEWA 1XJDA 2B4SB 3M42A 4I41A 4JG7A 1MJGM 3CD8A 3FPMA 4WP2A 3IGOA 5L6PA 3VUGA 3E7VA 4ZXTA 3HGIA 3WI6A 4F7SA 3UDTA 3L27A 2IVTA 4M0WA 3RWPA 3VC4A 4JI2M 2P55A 3WIGA 3UDZA 1MP8A 2YZAA 4G34A 3VBVA 4O0SA 4FA2A 2X7FA 2LVAA 4TUWA 2HIWA 2XA4A 3AOEA 4MKCA 1AGWA 4HYSA 4O6LA 4RA5A 4BDKA 3GQ4A 2L4EA 3ZQJA 2PSQA 3RZFA 3QZFA 3W2CA 3LM5A 2XH9A 4UALA 3RM6A 4CFNA 4FNWA 3H4JA 1QMZA 2R0UA 3GLGA 1IM2A 1H26A 2A4LA 3QC4A 4JAJA 1P4FA 4PL3A 4U42A 1OAIA 3PXGA 4ZEGA 4D55A 1PF8A 5I4NA 3LQQA 2R18A 2X0OA 5E1EA 3D4QA 3RAKA 4YPDA 2KA6B 3EJ1A 2EXMA 3U4WA 4AZEA 5GZ9A 2ZJWA 3AL0C 1JR3D 3AFHA 3MVHA 5L8KA 3KP0E 5FLXS 3PXQA 4JX3A 4IACA 1IAJA 5BYLA 4RWLA 3PA5A 2Y6MA 2BHEA 2BWEA 1C1KA 3O8TA 4IZ7A 4XP2A 5IEYA 2CKEA 4OTPA 4RZVA 2R65A 3AD6A 1ZZLA 2BMCA 2WSFF 4LGMA 5L2TA 2XAOA 3PIZA 4XOZA 5LOHA 1OFIA 3LHJA 3PRFA 5AR8A 4B8MA 5F95A 1LPUA 1IAHA 3QTXA 2ETMA 2OU7A 3QRKA 1PXLA 3PRIA 4R6VA 2JIUA 4DUZM 4M8TA 1M14A 4IZ5A 2GDOA 1FQ1B 3C4FA 3E88A 3KXXA 4WG5A 2IW6A 3NYOA 1M2RA 3CSVA 2OH4A 2VTLA 3OXTA 3HJQA 3NVKI 3LJ0A 1KSWA 3PP0A 5E8TA 2VO0A 4RVTA 2NPQA 5CSHA 4FKGA 3I79A 3ZO3A 4AE6A 4EQUA 3TQSA 2C99A 3BLRA 2WGJA 4RX8A 4GKIA 3AKZA 3UVQA 2DZNB 4QD6A 2QENA 4EOMA 4ONAA 4Y46A 5AEPA 4EOLA 5L2SA 3NMUF 3WZEA 5AP2A 3PUPA 3WILA 4F1IA 3JR4A 2CEAA 3E63A 4HCVA 4R71A 4CZTA 5B2MA 4ZMEA 4JVGA 3R83A 1AQ1A 4S31A 2BJWA 1RW8A 1T6OA 3K3JA 4JNWA 4PTEA 1GIJA 5JN2A 5FQDC 4BCPA 4B3MM 2C6KA 4C7TA 3WF9A 4E4LA 3FKOA 4FT5A 1L1TA 4XV9A 5HD4A 3VBQA 4CYIA 4YTHA 5EFQA 2XIZA 2P5TA 1DGBA 4UWYA 3OWPA 4C4IA 2P33A 3VW6A 3F6XA 4USFA 3KMWA 3BX5A 4FIHA 4FKRA 3LAUA 3UTOA 3QTQA 4AW4A 4DFUA 3OS3A 5LJJA 3GLHB 3HA8A 2PVKA 3BHTA 4QMZA 3RK9A 3GC0A 3W2PA 2VTJA 1YI6A 4FVPA 1XKKA 3SXSA 1A48A 2XNMA 2D7EA 1FMOE 3IW7A 5FGKA 3R6XA 4L46A 5HESA 1SYKA 1L8QA 5FP6A 3MFUA 2PMOX 4FC0A 1M7NA 4YBJA 2C6IA 4J99A 4R7BA 5IDPA 5KHWA 3PLSA 3DT1A 2E9VA 4WG4A 4UEUA 1VLRA 2QOLA 3FLZA 3CE3A 4OAUC 1V0PA 2BZHB 1XBCA 4M13A 3NUNA 3Q96A 4NU1A 4B6LA 1PXMA 3I81A 5M55A 4EBVA 3R7UA 4CD0A 4EOOA 4I24A 4QOSA 5CVFA 4TT7A 3IGGA 3RALA 3TCPA 4IBKA 3SX9A 3VBXA 4X64M 3B8QA 4OR5A 4U0IA 5M07A 3ZFXA 5EXTA 3VIDA 1JAMA 1YQJA 3FQEA 1CUKA 1R2ZA 3RGSA 3KCKA 3O8PA 3HZJA 4KODA 2PZRA 3AT2A 3NDMA 2W1HA 1TZDA 5CI7A 3PWDA 4IFCA 4ZTMA 5M08A 5IA0A 3AMAA 1YDRE 3R7EA 4PP9A 3QU0A 3QYZA 2F5OA 4ASDA 1YXTA 3TL4X 4QMQA 4AKGA 1F4IA 4FI1A 5EXPA 2VTQA 2Y7JA 5ANIA 3WIKA 4CSVA 3D7ZA 2HK5A 2ESMA 2Z7SA 3Q4CA 3AOGA 4KWPA 2DENA 2C4GA 4HW7A 3R8LA 3SC1A 4XG7A 2XCKA 3H9OA 4F9WA 5BV3A 2J5YA 3PFQA 4NM7A 4O0VA 3Q6WA 4JDJA 4Z9LA 4BGQA 4EH4A 3U55A 4BCIA 1AUAA 2V5QA 2NRYA 3P7CA 2R45A 2KRUA 2WAJA 4NTTA 3LVWA 4A7CA 3MI9A 4B3SM 4OBQA 5GJFA 2OLCA 5J5SA 2C5NA 3FMLA 3QAUA 1Z5MA 2FSOX 2CRUA 2MROB 3SMSA 3GLGB 4NKAA 1OVEA 4AKIA 1GZKA 5JEBA 5AAGA 4W5WA 3LFFA 5E92A 3VS7A 3FYDA 3TKIA 5FXQA 3ORMA 5KBRA 4AU8A 2VTHA 4DG0E 4R3DA 5H2UA 4KIOA 3PPJA 4GFMA 3FL4A 4ZS0A 3RCJA 1OBGA 4JI8M 3MTFA 4RIYB 4DHIB 4YC3A 2OJJA 3ACJA 3SOCA 3W0NA 5K5XA 1FNNA 2VUWA 2DYLA 3PVSA 4G31A 3GI3A 3E5AA 4AZWA 4O86A 3BYSA 4FYNA 3UZUA 2YCRA 4H39A 4HYHA 4YC6A 1K9AA 2CMWA 4ZSJA 4S34A 3MPAA 3SXRA 3VN9A 1PMEA 4YMJA 2WMBA 1OGUA 1SNUA 3RNYA 4JMQA 2GNOA 4BB9A 3MB6A 3T3UA 4IX3A 1ZLTA 3LCVB 2QP9X 1E32A 4GH9A 4FT0A 5HG5A 5HEZA 4FTUA 4NM0A 2XBJA 1OMWA 3VFDA 3M0EA 3LMGA 3OOMA 5HNBA 3WF5A 4RX5A 3R73A 3HX4A 3Q8GA 3ZH8A 4MF1A 3DZQA 5KQDA 3DXPA 2VX3A 3QLFA 3A4OX 4P7EA 3ZXTA 2JITA 3I4BA 4NL0A 2BAJA 4BIEA 2WFYA 1R1WA 4P4CA 3TXOA 3ML1A 3RAIA 1VR2A 5BUEA 4C2WA 2WNTA 5IA5A 1JQJC 5FSWA 3HU2A 5K0XA 2IW9A 3PNYA 1UKIA 2R4BA 3I60A 4G17A 4O0WA 3HX3A 5HO8A 4I5SA 3TACA 1GIIA 3LXPA 4IB1A 4IAYA 3W18A 2XSZA 5DR6A 4DFYA 4JV5M 1MQ4A 2ACXA 2XZFA 2ITQA 4MWIA 4BGGA 2XEPA 3U8WA 4EK4A 3L28A 1RDQE 4F0IA 2OXXA 4DTAA 3M7GA 3BGPA 3HNGA 4A9UA 4AZSA 4IH8A 4QTAA 4BBFA 4JI5M 1IBLM 5EP2A 2RIOA 4RC2A 2E9PA 2YDKA 3F5PA 5CU4A 4ACCA 4K1BA 4KKHA 1E9RA 5IUIA 3JVSA 4YO6A 4DF3A 5HE3A 2GQRA 4CYJA 1LR4A 4M97A 5DT0A 3E8DA 3R8MA 3AC2A 3DJ7A 5L2IA 1V92A 3TIZA 5TOZA 3OY1A 4O84A 5IQIA 2R3FA 2FE8A 3RJCA 5JFXA 1QPDA 2O3PA 4CEGA 3U6IA 2R4JA 5H8EA 1IASA 4RGJA 1WR1B 1P3QQ 1UWJA 1J7UA 1KUTA 4UWCA 4FIIA 2MR9A 4GG5A 1IG1A 3EKNA 3FXXA 3MVLA 3PYYA 4TL0A 1J5EM 4IAKA 3KY2A 4K18A 4J53A 3MA6A 4L45A 3VKGA 1YHSA 2XNOA 1JQHA 2WEVA 3HA6A 3D83A 1UV5A 3NFGB 3O5AA 3SG8A 3OW3A 1R6BX 2G1TA 4FV1A 1OKYA 3FUXA 2XBAA 5LCKA 4AXCA 1D0LA 4IBDA 3A8WA 5B2LA 4RX7A 3SVVA 2O8YA 3LJ2A 4LFBM 2ZV2A 1H28A 1ZYLA 3E46A 2FH9A 4D1ZA 3EQBA 4BWPA 2Z4RA 4JI9A 2EWAA 4RWKA 3HL7A 4RNAA 4XNEA 3MH0A 2CV1A 4FD2A 4FRFA 4H36A 5KBQA 3TUCA 3SLSA 2CCIA 3U4UA 4C02A 4ANNA 1PHKA 2R3PA 4OTFA 4FSZA 4DYMA 4XS2A 3PVGA 1R4GA 4UYNA 2VIIA 3U6PA 3LFCA 5JRQA 4G6ZA 4GSBA 4NK9A 2CP8A 3DBFA 3OMVA 4NCTC 3NVMB 3KS8A 5IQAA 3QCXA 2QZ4A 4JAIA 4FTQA 2A19B 2VQFM 8CATA 4FTMA 3GOKA 4KNBA 4RJ8A 4XH6A 5E1SA 5LMKA 3N4UA 1GVNA 3TL8A 5ACBC 1RE8A 1JB0F 2CGVA 3W1FA 3KRWA 4BCJA 5HX8A 4CFWA 4GK2A 1YWVA 5KMOA 3ALOA 1PRBA 2CN8A 2LXEA 4Y85A 5CEOA 3FMEA 4DEAA 4LGYA 4OU7A 4QTBA 1XC8A 4BFMA 1DAYA 1SMHA 3QA0A 5AAEA 2KNAA 2H1RA 4JBPA 3FUVA 4L3JA 2XLJA 4TYGA 3LMIA 3ORPA 3GLHE 3GRVA 3HVCA 3N9XA 1WIVA 2XF0A 3QZIA 1ZYJA 4FG7A 4QQJA 3V01A 2PY3A 4CCBA 4CVAA 2GU8A 4FEQA 3UOJA 3GLGE 3BHUA 4NIFA 4FKQA 5LMAA 4IC7A 3EL7A 3DAEA 3Q4UA 5BUIA 3EMGA 2BRBA 3AGLA 2PUIA 4FTIA 3MH3A 2DAKA 4OBPA 5AUWA 5CENA 5AR4A 1W2CA 5E8WA 1PXOA 1ST0A 2R3MA 2Z7QA 5JZJA 3EN5A 3SYKA 2C0TA 2R3KA 2JA2A 1PXPA 4OTWA 5DLSA 4ERWA 4CKRA 3W0QA 3DA1A 1SXJC 3Q8XA 4XV1A 1IXSB 2UU9M 2BUJA 2WMTA 3MH2A 3OT8A 4C36A 3ZDIA 2G3QA 3MJ5A 1J7KA 4FL3A 2LVNC 1BL7A 3TV4A 2QKWB 4YUQA 2KRKA 4FT3A 4OLIA 2CPKE 3NCZA 2R3OA 2V6ZM 3U6MA 3Q2MA 3TKHA 3V3VA 5HTCA 1HNWM 1ORYB 5IT9S 3EFKA 1NY5A 3ET7A 3L9NA 4IFGA 4JBOA 5CNNA 5AP1A 1Q3BA 2F2UA 1SZMA 4AFEA 3O51A 2GPHA 2VTMA 4XUFA 5KMJA 1MQBA 1SXJE 4HNIA 3O96A 3KULB 1S3SA 3VAPA 4RIWA 2OSCA 3E7OA 1V1KA 3QZHA 3DTCA 2C5YA 3QQFA 1N36M 4ZK5A 4DBXA 3NUPA 2V7AA 4LV5A 4ORKA 4ARKA 4E7WA 3L29A 3RE8A 3KCFA 3QGYA 3WYYA 2C47A 1M2PA 3I1AA 1Y8YA 3HKOA 4RVKA 5DFPA 3DA6A 4CG8A 5EK7A 5KO1A 3CTHA 2YM8A 1UU9A 3FDNA 2WO6A 1H4LA 1P5EA 3C4WA 4D2RA 1OPLA 1UU8A 1OL5A 2VWYA 3A61A 4AG5A 2B9JA 3CPBA 4FCTA 2Z2WA 3QD2B 4LGHA 3Q4TA 4KINA 2CGWA 2GFSA 3OZ6A 3QHWA 4D5HA 4LFCM 1KV2A 2F57A 1N33M 5CAUA 4DINA 3ZLYA 3ZDUA 3VS2A 2R4EA 3GNIB 2CNVA 3SYLA 2AQXA 1BX6A 5E8YA 5EHOA 4I6BA 3CJFA 5HIDA 5L8LA 3TM0A 3QX4A 5LMBA 4PDSA 1G8PA 2JD5A 4GKKM 1FGKA 4L6QA 2UZNA 3NW7A 2DS1A 3CR0A 5I3RA 1TQIA 5E90A 1TF0B 4LRTA 1PXJA 2QQ7A 4JQ8A 4O4BB 5DGZA 3UOKA 4DT9A 3C3DA 1MUOA 1NNUC 3AV0A 3HMPA 4EK8A 2IZRA 5JQ5A 2XB7A 4RIWB 3PY3A 1CMKE 2RKUA 4IAAA 1GJTA 4Y8DA 4RWIA 3Q60A 3KOZE 4KBKA 4CFXA 1BI7A 3EQHA 1S9JA 4RIXA 4FKLA 3PFYA 3CBLA 3JUHA 3L9LA 2YIQA 3ODYX 4GU9A 4NEUA 5A14A 4ASXA 1IN5A 2W1IA 4QNAA 4BDCA 5IEXA 2GTNA 4ANQA 3TKUA 3LCOA 2EVAA 4LV8A 3JPVA 5ANKA 2FNAA 1E1VA 4BWXA 4QMTA 4G4OA 3DKGA 4PNKA 5I9ZA 5K5NA 4AT4A 4JI6M 1JKSA 2JIVA 5A3XA 3PJ8A 3Q32A 1IA9A 4AW1A 4A9RA 1ZYDA 4ALVA 5EP4A 3PY1A 5GKNA 2YCFA 5AWMA 4TNBA 4WBOA 2C1AA 1ZARA 3F69A 1J7IA 2DHRA 5EHYA 4L52A 2W05A 4D82A 4ANRA 5HE2A 4HEOA 2LHCA 4EZ5A 5FM2A 1CKPA 3V5WA 1K3WA 3PXZA 4FJVA 2LVPC 3W16A 3TZMA 5GZAA 5IH6A 3KULA 2R3LA 4REZA 3V5PA 2QPAA 4GITA 3CGWA 3UJGA 3CXWA 2BR1A 4JR7A 2UZVA 4AOTA 4IBMA 3DDQA 4HZSA 3LQ8A 2HOGA 2XGNA 1VZOA 3QBNA 4MH0E 4KAOA 5FTJA 4ZTLA 3TIYA 1G71A 1WJ7A 4LF9M 4MXYA 3KXEC 2IWIA 3GU4A 4U79A 5I9VA 1U59A 1WBPA 4FSTA 1X8BA 3EQDA 3K2LA 2QG7A 4R78A 3NZ0A 4UWBA 3UBDA 5CAPA 2KNZA 3KB7A 4JOAA 4E3CA 3AGMA 4U44A 4FTKA 4FNYA 4KA3A 5EM7A 5AV1A 3UDSA 3ORKA 5FTOA 2YFQA 4MEDA 5F1ZA 4WURA 1PXNA 3R21A 4YJVA 1DI9A 4DC2A 4FGRA 3L8PA 4ITIA 2V22A 3QAME 5DT3A 2G15A 3GU5A 3VJNA 4HZRA 2CNUA 1YXVA 3QD0A 5FXSA 3PJ3A 5E8XA 5HG7A 2IW8A 1FVRA 3FKNA 4PDPA 1H24A 4QPMA 5DPVA 4DR6M 1WBOA 2DWNA 2RFEA 2XYNA 3QFVA 5M4FA 1JR3A 2G9XA 1KOBA 1QAQA 3ERKA 2B0QA 3OBJA 3FSFA 3MHVC 3GFEA 1ZYCA 4ZTHA 3WARA 5HZNA 5DYIA 2ERKA 5KKRC 3CC6A 3T9TA 4DBNA 2BRNA 1XMOM 2XNEA 4BCFA 4USEA 4C4GA 2IG7A 4QHTA 2BZIB 4RLLA 4MNEB 4BZDA 2RGPA 4L67A 4C4HA 1Y91A 3ZCBB 3K54A 2J50A 4YZMA 5KPTA 2GSFA 5JH6A 4ZJIA 5AP6A 1HR0M 2ITNA 3NW5A 3O23A 1O6KA 4FE2A 5DEWA 5GINE 1Q5KA 2B3TA 2R3HA 3KRJA 3G6GA 4QNYA 3D8LA 3H9FA 4RF0A 4GKJM 3CS9A 4NT4A 3WZJA 4BBMA 3FZRA 1GZ8A 4LZJA 2C0IA 4IJ9A 2RGHA 4LUEA 4QP8A 4X2NA 4F9YA 3ZRLA 4EBWA 5HCYA 4HVDA 3D5UA 2Y4IC 4GK4A 3TUDA 5TT7A 3QTSA 3HHWA 4IAZA 2XANA 2QOHA 5T6KA 3G9LX 4X6RA 1PXKA 5AA8A 3W68A 2R62A