1Y8GA

Catalytic and ubiqutin-associated domains of mark2/par-1: inactive double mutant with selenomethionine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity-regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 85
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1y8gA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y8gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y8gA01
2BRHA 2O2UA 4L3PA 3OF0A 1Q8UA 2XIYA 3PVWA 3F92A 1UNLA 1WBOA 3NUSA 3R1NA 3ZEWA 2XEZA 3I7BA 1IA9A 4ZTNA 1U59A 4BC6A 3LM5A 2EWAA 3UQGA 4GYGA 4TNDA 3WF5A 5A4LA 4WRSA 3L8SA 3VUKA 1U54B 1OVEA 5DMZA 2R4BA 5HTCA 4WD5A 3EMGA 4BVUA 4IXPA 2O65A 4EYJA 2I7QA 5CF5A 3ACJA 5C8MA 4BWKA 4GK3A 4X2JA 5CVGA 1ZYLA 4LUDA 4NUSA 4XLVA 3QD3A 3WF8A 4MBLA 5CAOA 2JAMA 3PP1A 1HT1E 4KKEA 2P0CA 5DFPA 5ITAA 5ICPA 1QZEA 4DT9A 2OO9A 3OTVA 2PVFA 4MXAA 3I1AA 2QHNA 1PXJA 3PWYA 4YZMA 1RE8A 1Q8TA 5ETIA 4BFMA 4EONA 3HRCA 2QLUA 5HX8A 3L8XA 2OBJA 3S0OA 2Y0AA 2X7GA 1E9HA 3WI6A 1VDLA 2W1CA 1M17A 2PU8A 4H39A 1OPLA 3DDQA 2OO8X 4C62A 3UO5A 3HECA 2OJGA 1XH5A 3NAYA 4FSNA 4S31A 3T9IA 5B2LA 4N70A 2HXQA 2W17A 2Y9QA 4D5HA 1ZOEA 4PUZA 1RW8A 3QHWA 5GZ8A 5FP6A 4M69B 5DPVA 4J96A 2BIKB 3TNQB 4RX8A 5F94A 3R9NA 3SAYA 5HBHA 2C68A 3KB7A 3WIGA 5HTIA 3RHKA 3UBDA 2P4IA 4AE9A 5D9HA 2JBPA 3RAWA 4FSUA 4UMTA 4FSWA 3BEAA 2WELA 3THBA 4FODA 4G3DA 3PXQA 3C5UA 3PJ3A 4RGJA 3KRJA 2JDVA 3KXHA 4W4YA 4ANNA 5JGAA 1BUHA 3E3BX 4L53A 2FYSA 1IAHA 3G9LX 4F7LA 3PPKA 1OAIA 3MB7A 3ZBXA 4LRKA 4R8QA 4F0FA 2JUJA 4K1BA 1MRYA 2W99B 4OAUC 2VWYA 2J2IB 3UO4A 4BBEA 3E88A 4PY1A 4YUQA 4I5MA 3HAMA 3N4TA 1UFZA 1KOAA 4BDHA 4PDYA 4F4PA 4GG7A 3JY0A 2KNZA 4E6DA 4AA5A 3VS1A 3AC3A 3ROCA 2PZIA 4EC9A 2ZVAA 4HYIA 3Q9YA 5E8VA 4C38A 1DV0A 2X2KA 1ZARA 5ANKA 3WILA 5CAQA 1WBNA 5TE0A 5GNKA 5AUUA 1GNGA 4V0GB 4DBNA 2PVKA 2SRCA 3DKFA 2OJJA 2C6DA 3LCTA 4QPMA 4O1PA 1ZLTA 4W9WA 4RIXB 5K0XA 4FTUA 4DH1A 4L9IA 1BI8A 5IQCA 3BGQA 3GU7A 5CSXA 3LFDA 3ZFYA 1M7QA 3AOXA 4OTIA 4YPSA 2Y4PA 3JVRA 4I4FA 3DJ5A 2GS2A 2QR8A 5EYCA 5FBOA 3R6XA 4I4EA 4BI1A 4S30A 3ULIA 4CT2A 3FUPA 2QOIA 3P23A 4PNIA 4UN0C 1VEJA 1P3QQ 2VTPA 4I5PA 5EH0A 4IJ9A 4TYEA 3HDMA 1H1WA 2XP2A 2QOKA 3E8NA 3IKAA 3ULZA 4EH6A 2ZM1A 5IH4A 4O7NA 3R71A 4F63A 2UVYA 4GK2A 5DEYA 2CKPA 4EI4A 3VUMA 1KE7A 2BZJA 4HNFA 4FZ7A 4MTAA 2OH4A 3GUBA 5LXMA 4CLIA 4KIPA 3VQHA 5M09A 4R6VA 2CKOA 4FKVA 1IRKA 2Z02A 4GEWA 1W84A 3PA3A 1V92A 4I6QA 5AUZA 4OW8A 2J6MA 1H1QA 1U4DA 4B99A 5AP7A 3D2IA 4O0RA 3V6RA 4D1SA 3RM6A 3UIXA 4ARKA 4TYHA 4V0GA 2UZVA 2FSOX 5CAVA 1OL7A 1YXXA 5IEVA 4J98A 3FMMA 3N4UA 5T6KA 4E4NA 1L8TA 3V04A 3UYSA 4RSSA 2YLEA 4QP6A 4BICA 2V7AA 2XKDA 3FY0A 2VWBA 3BHYA 4Q7JA 3BWJA 4NTSA 2ITYA 3KCFA 4FIJA 5HNBA 5FXRA 4FGBA 4DEAA 5BVFA 2WO6A 3KRWA 4YTFA 2IZTA 2IW6A 3QTUA 1ZYDA 3DJ6A 4TT7A 4W4XA 5DRDA 4CKJA 1QCFA 3H0YA 3S00A 3S4QA 3PY3A 1KOBA 1K9AA 3CD8A 1R0PA 3EB0A 3TEIA 4O2ZA 3F5GA 4NM5A 4Q2AA 4DLJA 4O7SA 5IKWA 3SGCA 1FGKA 1XO2B 4FT3A 4JR7A 3OTUA 4TWOA 4GJ2A 2YIRA 4O0VA 4R3RA 2F57A 4DBXA 4JG8A 3R9RA 4FNWA 4BHZA 1REJA 4RFMA 4FVRA 4XOYA 5L6WL 3DU8A 3NW5A 5HOAA 2WMBA 3LIJA 4AAAA 4E6QA 4KKHA 1OUYA 2C3KA 2XJ0A 3BYVA 1OUKA 3OEZA 4NIFB 5KMMA 3ZO1A 3KL8A 2X4ZA 4XLIA 4HVDA 2B54A 3DV3A 4K77A 3ORMA 3R1QA 2JKOA 3ACKA 3TDWA 3BGZA 4F1TA 2J5EA 1PXPA 3I6UA 4EHGA 2ONLC 4KNBA 2GNHA 2A27A 3DK7A 4F7SA 3BRBA 3SG9A 3T3UA 2UZWE 5HG5A 4QT1A 2LGCA 4IWQA 3CTHA 3EWHA 3GFWA 5EM6A 3BGPA 3R00A 5I3OA 3UTOA 1ZY4A 4ZLOA 4FZ6A 3UMXA 3C7QA 5M51A 3S1HA 4FKWA 4IACA 1F0QA 1OIUA 2KULA 4XNEA 4DN5A 3IW8A 4K18A 5ACKA 4JDIA 3EQBA 3ZO2A 5M4UA 5LQFA 2P55A 5AUWA 4J8NA 4LMNA 4DGNA 2C5VA 5EQYA 3ORLA 3BQRA 3RAIA 1JKTA 3NVKI 3DGKA 5CVFA 3AC4A 3WBLA 5CXHA 2UW8A 4MWHA 5ANIA 3A4PA 3MH0A 4GYIA 2VO0A 4JS8A 2WZJA 4A9UA 4UEUA 1ZOHA 2RF9A 4Z16A 3PLAE 4Z7HA 2ZM3A 1LUFA 3L8PA 5I9VA 2WU7A 1OGUA 1P2AA 3QQUA 4AZEA 3F82A 5BNJA 3HMNA 3TWJA 2BVAA 1H0VA 2W5HA 2DUVA 2WGJA 3O17A 4MNEB 5A6NA 3RM7A 2OH0E 5HNGA 3BHTA 3NNUA 4DC2A 2VTMA 1OBDA 3Q52A 3R21A 3FI8A 4TWNA 4A9TA 1RDQE 3WZEA 3O8PA 3FL4A 3JS2A 1RJBA 4UYAA 3UZTA 1YDTE 3PP0A 1LPUA 5IA0A 5J7HA 2R3PA 3QQGA 4ENYA 4IJPA 1Q8WA 4RJ3A 5M06A 3KKVA 3GC9A 5HCZA 3PXFA 5D10A 2BALA 1PF8A 4EBVA 4FOBA 4FL3A 3V8SA 4HZRA 1J91A 2PY3A 3COMA 4DGMA 4XV2A 5IU2A 2XNBA 4EZ3A 4UZHA 2YAKA 2JY5A 4ZJVA 3F5XA 2HCKA 4CV9A 5IQGA 2GHLA 3KY2A 5ACBC 2G2IA 4GFGA 1JWHA 3VUTA 2ITVA 5AAFA 4FKSA 5HO8A 3UVQA 4ITHA 3CC6A 4NW6A 1PMEA 5L2WA 5EKNA 1M2PA 2EKKA 3MJ1A 5FG8A 3CKXA 4E6AA 4HEOA 4M12A 5CI6A 2EB2A 3L9PA 3PTGA 3R01A 3R1SA 1ERKA 5CZIA 3RK5A 1YWNA 3R04A 4LGHA 3F2AA 4NCTA 4C7TA 1YI6A 5C01A 3TNWA 5CAUA 2VX1A 2CJMA 4ORKA 3K2LA 3BBZA 3Q9ZA 3W8QA 2HAKA 4FUYA 4GV1A 3D7TA 2PHKA 4IC7A 4AW2A 4EOIA 5J1WA 2WQNA 1WZYA 2RSVA 1XH7A 1H01A 4EHEA 3T9TA 3AQVA 4EJ7A 3WZJA 1NVQA 5AJQA 3HDNA 5E92A 4KRCA 4APCA 4DINA 4EEVA 5I3RA 1WMKA 4R3CA 2WTDA 4ITIA 2QOQA 3QLFA 1FMOE 4I1ZA 4CCBA 3PSDA 2MROB 3EOCA 3F6XA 5CANA 4D5KA 1GZKA 4ZLYA 1G3IA 2PZYA 3M11A 4CNHA 4QP8A 5EQPA 4CG9A 4YZCA 2I6LA 4PPCA 3TKIA 1H08A 4QTDA 3LMHA 2OIQA 2REIA 5E90A 2I0HA 3FZSA 4R5YA 4DG2E 1BMKA 1P5EA 2UZOA 2V55A 3E7VA 1G8SA 5BX0A 1AD5A 4XMOA 4YHTA 1WGLA 2ZJWA 5CS6A 4H3PA 5L8KA 3U55A 2BDJA 1Q97A 1NY3A 2ZOQA 5I9YA 3VAPA 5DRBA 5IUHA 3P5KA 2J90A 5M4FA 3FRIA 4QQJA 5BYLA 5FDXA 3VULA 2UW0A 4CGAA 4IZYA 4G6NA 4YSMA 3LCSA 4ZEGA 3DFAA 3Q4UA 2LVPC 4XG4A 2JKQA 4DFBA 4FKGA 4W8EA 4FK3A 5L6OA 4K0YA 1J3HA 3UYTA 3G0FA 4E7WA 1V0PA 3EQRA 3MI9A 1UKIA 4FV1A 3BBWA 3SRVA 4FOCA 2Y6OA 4BTKA 1UU9A 1YRPA 2HWOA 1PGYA 3T8OA 3MTFA 4L67A 2ITTA 1CTPE 2BDWA 3Q53A 2UZNA 3F3VA 3IK3A 4YC8A 3R83A 3UG2A 2B9HA 3KF7A 1YXSA 3FXWA 1UNGA 4G2FA 5DT4A 4RRVA 4YPDA 2XZSA 4LV8A 3LXLA 3G5DA 3P4KA 4A07A 3ZOSA 2V22A 5DN3A 4FT7A 2XK9A 4BI2A 2O5KA 2RKUA 2QQ7A 3G9NA 4IVDA 4ASEA 4HGTA 1ATPE 3QCXA 3HLLA 3Q9XA 4XBUA 3TUDA 4YTIA 4BI0A 1XQZA 3KQ7A 1WFCA 2FVDA 2C3IB 4PL5A 3QCSA 4DGLC 3UO6A 2YITA 4C35A 4OAVB 3R9DA 4O0TA 2XIXA 3AXWA 3EN5A 3R8MA 4ANLA 3FQHA 4EHVA 2GTMA 3CXWA 2BRGA 4UYNA 5EHOA 3DKGA 4I6FA 3R8UA 1O6LA 5H9BA 4YHFA 3ZTXA 4BDGA 4YLKA 5F95A 4CLJA 2YFXA 3GCVA 3T6PA 3IGGA 4EH7A 5AV4A 3DBDA 1XBBA 1Z5MA 5LVNA 1URWA 3PG3A 4JBPA 2QU6A 4RZWA 2EJSA 5K9IA 3TUBA 4U9AA 4I94A 4JAJA 4JDJA 3R8ZA 4PTEA 2OJIA 2VTIA 3LMIA 1HT2E 4IW0A 1U5RA 4S33A 3U6IA 2OZOA 2IVVA 1YI3A 3G0EA 3NNVA 4KABA 2H9VA 4IB1A 5AV1A 3EN7A 3FMKA 4F9WA 1MRUA 4II5A 4FMQA 2VNYA 3D5VA 4UMQA 3QQLA 1WBPA 4C4IA 5L2SA 4X3FA 5DE2A 4IB5A 3PRIA 5KKRC 2IW9A 4ANOA 2W1IA 1Q5KA 2W1FA 3DKOA 4CZTA 2YWVA 4H1MA 3O7LB 4G9RA 4FSTA 3ODYX 5BMMA 1KYIA 2YABA 4ZMFA 2NRYA 1OKWA 3BLQA 5K5XA 3GCPA 2YM8A 1LR4A 1GIHA 1UWHA 4ZTHA 4AE6A 4CFUA 4MHAA 4CYJA 3LZBA 1V0OA 1REKA 2OXYA 3DAJA 5HEZA 4IVBA 1IA8A 2PMIA 3ZLWA 1W98A 4G1WA 3A62A 5IQEA 3TL8A 5K5NA 4PDOA 2YCFA 1U46A 3BE2A 3D4QA 4YO4A 2WTKB 3JPVA 5CU6A 5E1SA 3MY1A 4LRMA 4AGDA 3QF9A 4F08A 5LCJA 1HCKA 4WNMA 5CYIA 5JQ5A 2C0OA 3KXNA 3LXNA 3HGKA 3H10A 5KKRB 2ERZE 3W33A 3MESA 1JR3E 2QSFX 2X0GA 4IQ6A 4BKZA 2G9XA 4PQNA 3MH1A 4HCVA 5EDQA 4M8TA 3TIZA 3I5ZA 1O6KA 3ELJA 4JRVA 5DR2A 5KBQA 4KS8A 2C6IA 4XV3A 3O96A 5AR3A 4GUEA 3E8DA 4BIEA 1IXSA 1RQQA 1YWRA 2Z7SA 4FEWA 4HYUA 3C1XA 4O27B 2OZAB 5E8WA 1OPKA 4G6LA 4HNIA 4FYOA 4TW9A 2XF0A 4PTGA 4FX3A 5FEDA 2DNAA 5A46A 1Q99A 5JMSA 1IFYA 2HW6A 4B4LA 3NYNA 4X6QC 5E8YA 4OT5A 4HJOA 2JITA 4LOOA 3BEGA 5L4QA 3POZA 5BQ0A 3TCPA 4JG6A 4I6HA 4TNBA 1GJOA 3HA8A 4QMPA 4KIKA 3I0OA 3C5IA 3F66A 3ZZEA 3LLAA 2XKCA 3QA8A 3AC8A 4Q9SA 4ZTMA 5HE0A 3V8TA 2E2BA 4UXLA 5IEYA 5M44A 2FO0A 2C5NA 4AT3A 5LWNA 4FF8A 3M2WA 4WRGA 5TT7A 4B0GA 4GJ3A 4C2WA 1VQ1A 4XYFA 1A5TA 3KA0A 4GU9A 4RWLA 3FRHA 3O0GA 4U44A 1OKYA 4NKSA 3U6JA 3UOKA 3NUPA 2LTUA 2ZAZA 1KUTA 4D28A 1TQMA 2YIWA 2VX0A 2XKEA 5M56A 4GIIA 4FNZA 4PP9A 4NL0A 4JOAA 1M2RA 4A06A 3OMVA 5CT0A 3ZO4A 3LOKA 5KMJA 1TVOA 2VWIA 2BRBA 2OZAA 2BZHB 4FKLA 4RA5A 2J50A 5A4CA 4IWOA 4X2GA 1OKZA 5EYDA 3ZUVA 3IPHA 3ORNA 3DZOA 4H58A 5IQBA 1WCCA 2BAKA 2C6KA 1YXUA 4HGEA 1SM2A 4WNPA 4FV5A 3TIYA 1OECA 4J1RA 4H3BA 2PK9A 5JN2A 2BAJA 2OICA 4X7QA 5BVEA 5F9EA 4YR8A 2YM6A 1XJDA 1DS5A 1P4FA 4GS6A 5ANJA 5HORA 5JKGA 3AD4A 4CKRA 3R2YA 3LAUA 4PV0A 5CU2A 4IAAA 4PL3A 3V6SA 2JNHA 3MW1A 1U5QA 4G16A 3ZLXA 3KXMA 2YCRA 5CASA 4AWIA 3W2PA 3QUPA 3RZFA 4L00A 2HELA 3FKNA 2Y4IB 3VJNA 3ZRMA 3O71A 4B9DA 5CAPA 5M4CA 2W06A 4Y73A 3IW5A 4GH2A 2CWBA 2F2CB 1FOTA 2BPMA 4YP8A 1J1CA 1O6YA 4BGHA 3RPRA 3P7AA 2H6DA 5AR8A 1YQJA 3VHKA 2CNVA 3OFMA 4WG5A 5CU0A 2YM7A 4O22A 3KMUA 4C3FA 1GZNA 5E1EA 4Q5HA 4XV1A 3WF7A 4EQUA 1GO5A 1QL6A 2RFEA 4ZTSA 4GKIA 1YDSE 3VBTA 4O81A 4QMQA 5FUTA 4P5ZA 3SXRA 4J52A 3OXZA 2ITOA 1PXIA 2ESMA 2XKFA 3B8QA 5IA3A 5IDNA 3HMIA 4MD7E 4F0GA 3GENA 4IM3A 5EW8A 1A9UA 3KVXA 4HW7A 5KO1A 3R7UA 2GHMA 5GZ9A 3ZYAA 4L01A 2CKEA 5KMLA 4DBGB 2IO6A 2LVOC 1OIRA 3GC8A 4WHZA 3W2OA 4CV8A 4GW8A 1WBSA 2PUNA 3Q4ZA 4AN9A 3MGYA 1OB3A 3OCGA 1T43A 5K0KA 3N4VA 2YERA 3QTRA 5AUYA 3GC0A 4AOTA 4U5JA 1H1PA 1WBTA 4JX7A 5CTPA 4H1JA 4RJ4A 4UX9A 3R7IA 2QHOB 2OOAA 5JZNA 4EOMA 5M08A 4RZVA 2XM9A 5AV3A 4CMUA 1ZMVA 3P0MA 5KMIA 4QP2A 3U9NA 4UALA 3CY2A 3QUDA 1IG1A 5A14A 4FVPA 4R71A 3MS9A 5E8XA 2CNUA 2JDSA 5F4NA 4D2VA 4AT4A 4C34A 3RAHA 3HV7A 2OOBA 5GJGA 5K3YA 3R9HA 4WNOA 4NM3A 2XNEA 2J4ZA 3VW8A 3WOWA 4TYGA 5KX8A 1SYKA 4G3CA 4DT8A 4MX9A 3VJOA 4DE4A 2B7AA 5EI2A 4H05A 4FTRA 4OTHA 4BBFA 2IN6A 3TNHA 5DT3A 3TACA 3MA3A 3G6HA 4BYIA 4MBJA 5L6PA 3HVCA 5AP5A 4O6EA 4FG8A 1TR8A 1MUOA 5H8BA 3A8XA 2B4SB 5IUIA 4F6UA 2PYWA 2Z60A 5C8NA 2OWBA 4C61A 5AP0A 3C0IA 3LXKA 5D11A 5CU3A 3Q04A 1H1RA 1MRVA 1XH9A 2PWLA 1NVRA 3OCBA 4EUTA 4LGDA 2OI4X 2I0VA 4RQVA 4NTTA 3PVGA 4LG4A 4ID7A 2VZ6A 5DHJA 3FMHA 4JI9A 4O7VA 4W9XA 4E5AX 2ZB0A 3UOLA 2CSNA 5EK7A 2UVZA 1PXKA 4U0IA 3EKKA 3FDNA 2YCQA 2PULA 2F2UA 4QP4A 2PZPA 4XEYA 5EOLA 5FTQA 1OBGA 4BKJA 3RKBA 3UMWA 5LJJA 1PY5A 1JAMA 2CCHA 4JIAA 2W1GA 2BRNA 2AYPA 5I0BA 2JAVA 4PRJA 1OQYA 5HICA 4DGOA 4YJVA 5IF1A 4UWYA 2PPQA 2EKFA 3FMDA 3NGAA 4NKAA 3U51A 3DK6A 5JT2A 2XIKA 5HI2A 4ZMEA 3MVMA 2QOBA 3A7GA 2NPQA 4R78A 3UGCA 2CLXA 3R02A 4DLIA 4L43A 5JFSA 4TYJA 3AT2A 4HVGA 4E4XA 2DI0A 2ETRA 2OKRA 2C6TA 3C4CA 4WBOA 3F9NA 4ZZOA 5JZJA 1WAKA 4P4CA 3QCYA 4NT4A 2XS0A 1QPDA 3FLWA 5CXZA 5HIBA 3B2WA 2C4GA 3AMYA 4XG6A 5HO6A 3SDJA 4D4VA 4IM2A 1OITA 4ERKA 3FC1X 4MYGA 4RC3A 4RWKA 4YJRA 3LLTA 3OT3A 4I92A 4YBJA 4EOLA 4M0YA 1YDRE 4EH8A 5BUIA 5KHXA 1YXTA 1F3MC 3O7LD 2C1BA 4HVHA 3DCVA 1U54A 2DENA 5HE2A 3IOKA 4UV0A 4P5QA 3UVRA 4BCKA 3FV8A 4AG8A 2A4LA 4RLKA 2CGVA 2CHLA 3FYJX 4G17A 4FT0A 2VO6A 3FZRA 1SNXA 5FP5A 3RK7A 5IA4A 1VEKA 5HKMA 5CEQA 5AP2A 4BCPA 1YHVA 5DI1A 3EQCA 3VS4A 1UU7A 2WOTA 2YZAA 3NAXA 3DDPA 3DK3A 4OBQA 3A7IA 3TZMA 4WOVA 4ZSLA 4YJUA 5B2KA 2K9DA 1JKKA 3QHRA 2BTRA 3NYOA 4WSYA 4MQ1A 2WQOA 3FLNC 4HGSA 4BDBA 2PUPA 4E26A 4I0TA 2GNIA 5DGZA 4I0SA 4FKOA 4RJ8A 4U43A 2XYNA 2ZB1A 4MD8E 5J8IA 5E8ZA 1IR3A 1GIIA 3I0QA 4AW1A 4QYHA 3EL7A 3VQUA 3FQSA 3W8LA 1UKHA 2XM8A 5L8JA 3KGAA 3QRKA 4FEQA 4FV0A 3FZ1A 3OT8A 4JQ8A 4QMTA 3RPYA 3UIBA 4BCMA 4EBWA 4FSMA 4XP0A 4AN2A 4X2FA 3MBLA 5H3QA 4D9TA 2GMXA 2VWUA 3BYMA 4M69A 4RWIA 3P79A 5EHLA 5AR5A 5AUXA 4FNXA 3A61A 3PJ2A 2XRUA 3KXGA 1GY3A 3VUDA 2B9FA 4CEGA 5AEPA 3GLGE 2G2HA 1L3RE 2WMWA 3AT4A 4GSBA 3TZ8A 2FUMA 5IA1A 3K3JA 5FEQA 5AIRA 1KWPA 1YW2A 3LE6A 1E1XA 4JBVA 2GNGA 3A4OX 2VWZA 3EQHA 4Q9ZA 4AGCA 4BIDA 1M7NA 3BE9A 4QTAA 3LFBA 3U8WA 2XA4A 4DH5A 2WMXA 1CMKE 3I6WA 2XNPA 3C0HA 2HXLA 5F1ZA 4ACDA 1T6OA 3DZQA 3S3IA 4ZZNA 4RWJA 4TKSA 4FEVA 4WNKA 2JDOA 4ZS0A 2YAAA 3PG1A 4QTCA 2WEVA 4CFNA 2WKMA 3E8EA 4NJ3A 3WZKA 4IM0A 3QTZA 2IZUA 4CZYB 2R2PA 3VW6A 2BR1A 2Z2WA 1KV2A 3CIKA 2VX3A 3HX4A 3P08A 1OKSA 2J5FA 4O0UA 1PRYA 3LW0A 3WYXA 3VS6A 1Q8YA 2JEDA 2L4EA 2GNLA 4QRCA 2OSCA 4I41A 4RIXA 3ZLYA 3G15A 3SG8A 2JY6B 1YOLA 4KS7A 1YOJA 4N0SA 2IWIA 4GL9A 3DA6A 1Q3WA 3NLBA 2Z7LA 3OW3A 5EDRA 5J87A 3ZS5A 4G5JA 1FVVA 1FGIA 2PZRA 2HZ4A 4C33A 2QURA 4D2PA 2GS7A 3LVPA 4ZSJA 5HVJA 2DS1A 2IVUA 3V5WA 5LARA 4L7SA 4RIOA 4IWPA 2Z7QA 1CDKA 4C3RA 2W5AA 3GU4A 5D7VA 3IHPA 1A06A 3DS6A 2PE1A 3LFQA 4UXQA 5FQDC 3ORKA 2PL0A 4OUCA 1H27A 4FIGA 1WHCA 3PJCA 3RAKA 2P33A 3PE1A 4O1OA 2OXXA 4FEXA 3VBWA 4GEOA 3AC1A 4F65A 1NT2A 5CF6A 5HZNA 3R63A 4RJ7A 1G4AE 4OTGA 1BKXA 2G15A 2UW9A 4E73A 3PE2A 3RGFA 4CFVA 3NWWA 4KINA 4BCJA 3ZBFA 2X8EA 3W2RA 4GFMA 3ZRLA 2OK1A 2WMRA 4ANMA 5IISA 3NUUA 5IH6A 3LJ1A 2C6LA 2QKRA 2YISA 3A8WA 5HG9A 5BVDA 5LVPA 2BRMA 2BHHA 2OW3A 1OTRA 2QOLA 3COHA 3F3UA 4HPTE 4I0RA 3NMUF 2CDZA 3SOAA 3A99A 3W55A 2GQGA 1UU3A 4WT6A 4RFYA 5ETAA 2WAJA 4FTJA 4MXOA 4GU6A 4YJNA 3LFFA 3P7CA 3G90X 3BELA 4F09A 4JT3A 5K4IA 1PXLA 2ERKA 2XEYA 2QKWB 3BKBA 2UW5A 3FE3A 2CGUA 3FPQA 2X1NA 2OFVA 3QTXA 5GHVA 4G34A 4L7FA 4FT9A 3ZUUA 4FZDB 2F7ZE 4DITA 2BIYA 4AOIA 4BDDA 1VR2A 2OU7A 4C57A 4MVFA 2H8HA 2WTCA 4NCTC 5AP3A 3AD6A 5A54A 3GB2A 4FTOA 3SVVA 5A4TA 3RNIA 5FM3A 1AQ1A 4YZNA 4O84A 1NV9A 1UNHA 2VRXA 3FHIA 3Q9WA 3QGYA 2ZYBA 4MQ2A 3MH2A 3BU3A 3R73A 4QYEA 5FEEA 4D4SA 4FR4A 4BB4A 4NIFA 3GCQA 5DT0A 3CBLA 4C3PA 3PXYA 2ITZA 2EXEA 3R8VA 3R7GA 2VTLA 2UZDA 4R3PA 3ZEPA 4I93A 3WYYA 5HIEA 3UQFA 2DZLA 1B6CB 2JFLA 4FSRA 4JVGA 4QTBA 2WQBA 4HCTA 3SXSA 1Y6BA 4DHFA 3DTWA 4YJSA 4HCUA 4XV9A 4UMUA 4OTRA 3VUGA 2GCDA 4IFCA 5JFVA 2QC6A 4C4GA 4HOKA 3PVBA 5CX9A 3SHEA 3U54A 4EOPA 2J0KA 4FV9A 2X7OA 4E3CA 3A7HA 4IANA 4BTFA 2PMOX 2W9FB 3OZ6A 4ZTQA 1NXKA 3BYOA 1PMNA 4XG3A 3BLHA 3IW6A 3ZSGA 2C3JA 4JAIA 1XH8A 3SW4A 5FGKA 3V5PA 4LUEA 3RPSA 3K9OA 3MV5A 4LOPA 3V5JA 3EQIA 3AMBA 1TQPA 2WQMA 4A7CA 2UZBA 2UW4A 4EKKA 4AXAA 2YHVA 4BWPA 4FTAA 4IE9A 4O0SA 2F7EE 1Y6AA 4I22A 2ETKA 4L44A 5IA5A 2KTYA 2I0YA 3ANRA 4L8MA 4D55A 2GQRA 3KF4A 4XS2A 1V1KA 4XOZA 4C37A 3E93A 1E1VA 2PVLA 3LCDA 3ATSA 4TYIA 2ONLA 2X7FA 3SC1A 4BDKA 4C2VA 5J9YA 4BIBA 4DFZE 4GUBA 4BKYA 3CS9A 1XR1A 4TXCA 3LPBA 3WZUA 5LMBA 1FMKA 4FV3A 3K5UA 4X3JA 1W0XC 4LFIA 2ITWA 4MNEA 2C5YA 2R3IA 4FKUA 4BF2A 1K2PA 3GLHE 4L42A 2Q0NA 1BLXA 4XG7A 4NWMA 2W96B 1K3AA 3QCQA 3QKLA 3OW4A 2GFSA 2R3QA 3C50A 3U6HA 2YN8A 4L3JA 3HV6A 3I5NA 3ZM4A 4M66A 2R5TA 3BX5A 3GOKA 2JIVA 4YBKA 1GIJA 4MBIA 3CQEA 3H30A 4WIHA 5FTOA 1Q4LA 5E8TA 3NSZA 1HQYE 4PMSA 4AQCA 4FK6A 3TT0A 3QYZA 1JNKA 2WTJA 3MN3A 2BFYA 5JEBA 1OMWA 2YACA 1LEWA 2FA2A 2R3OA 1WR1B 1BI7A 3QZHA 3R7OA 5TKDA 5G1XA 2VN9A 3SA0A 3DAKA 4Y46A 4QMXA 5JI2E 4KSQA 4RLLA 3QFVA 4RVMA 2XYUA 1P14A 1ZYSA 2W1HA 4O86A 3VS7A 2XIRA 5E9EA 1XBAA 2C3LA 3KC3A 5L3AA 3NDMA 2DHYA 2QVSE 4AUAA 1GZOA 2W0JA 3PJ8A 1SVHA 3QAME 5TR6A 2YWPA 2JIUA 3FKLA 2VTJA 4RJ6A 5BYZA 3ZO3A 3F5PA 3D14A 2WFYA 3H9FA 2WXVA 4EK3A 5JFWA 2O8YA 3ZC5A 4O7RA 4CZUA 2UUEA 3BU5A 2C6MA 5BMSA 3MVLA 3E63A 1DO2A 4Y5HA 4K8AA 3F88A 3TV6A 4WSQA 4EH3A 3PWDA 3NUYA 3HUCA 2OG8A 5CSHA 3NW6A 4GFOA 3OCSA 3G6GA 3QRJA 3QXOA 4FTMA 3QQHA 4FV8A 1JKLA 4GKHA 3IOPA 4M14A 1FPUA 4BDCA 3QC4A 5EI6A 5JRQA 4USFA 4YZDA 2A0CX 2A2AA 3C51A 4IX5A 5HIDA 4YZBA 5HCXA 4EH5A 4PNKA 3PPZA 2QO7A 3TKHA 3KULB 3HMOA 3PIYA 3PLSA 3G51A 2RGPA 2Z7RA 4FVQA 1Z57A 4M84A 4WKQA 5I9WA 3OXTA 1FVRA 1ZV1A 4V01A 1S9IA 2W1DA 3TNPC 2B1PA 2R3FA 2BFXA 3PIXA 2PVYA 5C26A 4QMLA 5CF4A 4F9CA 4H3QA 4EQMA 2WB8A 3AD5A 3GP0A 3O51A 4YC6A 1ZYCA 5C03A 2X39A 3UPZA 3HUBA 4XRLA 2OIDA 2RL5A 4BCFA 4FIIA 5CSPA 2VTNA 4KAOA 5L2QA 3OUNB 5AV2A 5FRIA 2R3MA 3V5LA 4V04A 2PTKA 1OPJA 1OKVA 5TF9A 1DAWA 3CTQA 4J95A 4Y5QA 4KA3A 1H26A 2YDKA 5HESA 1YLAA 4HYSA 4WG4A 4A4LA 3HMPA 1GAGA 2X6DA 5KZIA 5J5TA 5BVNA 3QKKA 2C1AA 1YWVA 2R0UA 2VTTA 1BL7A 2PVMA 3CE3A 3FYKX 3H3CA 4JLCA 5EG3A 4X2KA 1JPAA 3UDBA 3E46A 3H4JA 5FXSA 4YJTA 4DGGA 4O21A 4ANBA 3E64A 2E9PA 3OEFX 3GFEA 1JSTA 2VWXA 4EK5A 4QYFA 3PYYA 3WARA 3B89A 3PFQA 3QD2B 3AGMA 3P7BA 5HCYA 2O3PA 2QODA 4N6ZA 3LFEA 3UODA 3LCUA 4NEUA 1F4IA 2QOFA 2C0TA 2RFNA 3II5A 1H0WA 4TWPA 4U80A 3V8WA 3VN9A 1JLUE 3CCNA 3CLYA 1CM8A 1YOMA 3FXZA 4EOJA 1R4GA 3EL8A 3DLZA 1T45A 4BTMA 3FSFA 4BDEA 3S95A 2R7IA 4JJRA 4K11A 3COKA 3RP9A 5AP1A 4EOQA 4F7JA 4ZY5A 4F99A 2RFSA 3KK9A 4FTCA 2J51A 3OHTA 5DR9A 2HENA 3LFAA 4CMTA 2AUHA 5A3XA 4BN1A 4XH6A 4ENXA 2ZMCA 5AWMA 2MR9A 4FZFB 3BYUA 4QP3A 2UV2A 3EJ1A 4U45A 2XJ1A 3D83A 3B2TA 4XP2A 4R5SA 2A19B 4FIHA 4F7NA 2QLQA 2VGOA 2X4FA 3ZCLA 4ZY6A 5I9UA 3TXOA 5I5ZA 2YEXA 3MSSA 1NV8A 3KK8A 3GT8A 3QX2A 3RTPA 2WIHA 4A4XA 1AGWA 4NFMA 3TV4A 2Y8OA 3EYHA 3OOGA 5BUEA 4FV2A 2Q83A 4BY9E 5T3QA 3GQLA 3HP5A 2BCJA 4ZP5A 3UC4A 1NVSA 4YJPA 2G1TA 2Y6MA 3NZ0A 4RPVA 3U4WA 1Q62A 2G01A 1ZAOA 4OTDA 4UWBA 3FMEA 4OBOA 1Q41A 2JGZA 3QTIA 2O64A 2QCSA 4Z7GA 2VWWA 2XCHA 3CKWA 1W8CA 2P2HA 3BV2A 1FBNA 2YM4A 1HCLA 3MFTA 2C69A 2DKLA 4IAYA 3HMMA 3N51A 3NUNA 2C5OA 2YIYA 3MPAA 4LYNA 4XG2A 5CU4A 4EZ5A 3OG7A 3OWLA 2C6EA 3HV3A 2FB8A 3VS3A 3GXLA 4S32A 3LCKA 5B2MA 2BZIB 3QQFA 4OGRA 3FLQA 2R3NA 1H00A 2L2DA 1H4LA 3BIZA 4LRJA 4UY9A 3ENHA 3QD4A 3UNJA 5B0XA 4EH4A 1CKJA 3C4WA 4GT4A 3W2CA 2VV9A 3Q96A 4BCNA 1B39A 3AMAA 4ANSA 2E9UA 3Q32A 2ZV2A 3UE4A 3MYGA 2OFUA 4NYEA 4E4LA 5EQEA 1VG5A 4GK4A 4QMSA 3FL5A 4C4EA 3GCSA 4EQCA 3JR1A 2R3HA 3C4ZA 4FL1A 5A4EA 4Z3VA 1UA2A 4DFNA 5CALA 3LJ0A 2X8DA 4JXFA 4MK0A 3TG1A 3W32A 4IH8A 5GZAA 4ZOGA 1PKDA 5IDPA 4YURA 3ZONA 2VUWA 3E92A 3S2PA 3MH3A 3FJQE 4MXYA 3BI6A 3E3PA 3GBZA 3KEXA 5CNNA 5LMAA 3LXPA 4FSZA 3TZ7A 4A4OA 1PMUA 4FA2A 4FGRA 2P2IA 2ZTDA 5IMEA 2R3KA 2YDJA 3TI1A 4AZFA 5D1JA 1H07A 1YHWA 3IONA 3QYWA 2QNJA 5BVKA 4DEHA 4DEIA 4F1IA 4JQEA 3BLRA 5ETFA 3L9LA 5HG8A 2PE2A 1DO0A 5KMKA 3GGFA 5GIOE 1CKIA 2VO7A 4MXCA 3FPMA 3Q2JA 2XBAA 2J0LA 3POOA 5JGDA 2NNWB 1VYWA 2ZV8A 5FTGA 2YIQA 2ITQA 4FKQA 3BPRA 4FNYA 3ORPA 3PSBA 4UB7A 4AFJA 2QG5A 2AC3A 4RX7A 3V3VA 3DJ7A 5A4QA 4FBXA 4F64A 3W2QA 4RC4A 3RWPA 4AS0A 1ZY5A 2OJFE 4OTFA 4RA4A 2GPHA 1Q61A 3DB6A 4QQCA 3DBEA 5EYKA 5I9XA 3QRUA 5EYMA 1J7IA 3IECA 2HY81 2R3RA 5FXQA 3ZDUA 3DXPA 3AC5A 3C0GA 2EXCX 3JVSA 3RPOA 2YCSA 3PRFA 2XK3A 4L45A 4QNAA 4CTBA 4G31A 3V5QA 4FV6A 4AX8A 5IUGA 2BDFA 3CPCA 4V05A 3OOMA 3FMLA 2J0JA 3ORZA 1HOWA 1ZZLA 2X8IA 2B9JA 1XH4A 4YU2A 4ZTLA 5HBEA 5EM7A 1KV1A 4RMZA 2QO9A 3NCGA 4LQMA 1Q24A 2HZIA 5FDPA 2VWVA 5E8UA 5M55A 3UPXA 3W18A 4C4HA 3UNZA 4F1MA 4R1YA 4BDAA 4J7BA 4FC0A 3A7JA 2HWJA 3OROA 4S2ZA 2CN5A 4OTQA 3VRYA 3WZDA 3MVJA 4G5PA 4CFWA 1G5SA 5DLSA 4CFMA 3VIDA 4DCAA 4XBRA 4JQ7A 5CEPA 2NO3A 4XG8A 3QQKA 2YZLA 5ANEA 2EB3A 2IVSA 4Y72A 4Y83A 4ALVA 2J0MB 3CSVA 4ZXTA 4ALWA 1G41A 1PKGA 4WO5A 5FWKK 2XIZA 4FV7A 4DEEA 4YMJA 4DTAA 4O0YA 1A48A 4I23A 1XH6A 4NJDA 3FSKA 5B7VA 4PWNA 2W4OA 2WPAA 1FVTA 2ITXA 1QMZA 5AR2A 5TO8A 3C9WA 1IM2A 3VNTA 1TTEA 3OXIA 1GOLA 4JNWA 3LQ8A 3O23A 1F5QA 5CENA 2JC6A 4KD1A 4F9AA 4N57A 3ZMMA 1PMVA 4J71A 3TTJA 4AW0A 2HW7A 2DYLA 2C47A 5IZFA 3SX9A 4ZAUA 3HEGA 3HP2A 4G3EA 4G3FA 4KUJA 3D5XA 2YIXA 4ONAA 4ZTRA 3ALNA 4ZSAA 2DAGA 4I6BA 2JY8A 4EORA 4DEBA 4D2TA 3RK9A 5AX3A 1CKPA 1OL5A 3AT3A 2XK8A 3QBNA 5KE0A 5JQ8A 5LMKA 3ATTA 1NW1A 2KNAA 2YJRA 4FE2A 5EKOA 2WOUA 4AFEA 4D1ZA 3K54A 1JOWB 4UN2B 2YDIA 5CSVA 1ZRZA 2C30A 5DWRA 4TPTA 1WBWA 2CCIA 4C36A 5CNOA 4D58A 3TZ9A 2RIOA 4I20A 5DIAA 4GRBA 3VO3A 4GVJA 4U3ZA 4RIWB 4EK6A 2WNTA 3EZRA 3P86A 4QD6A 3IW4A 3HV5A 4FI1A 3OVVA 4FSYA 2YA9A 2CLQA 5F20A 1J7UA 4IIRA 2IW8A 1YHSA 2GS6A 4FIFA 1DI8A 4KBAA 4RVTA 1G8AA 5E4HA 1PXNA 4U6RA 3PA4A 5IG1A 1PHKA 4CRLA 4G9CA 4IEBA 2RRUA 4TRLA 4A9YA 5DYJA 3COIA 3FAAA 4FKJA 4KKGA 4AZWA 3EZVA 4Z55A 3QWJA 5LCKA 4ACMA 4FKTA 3NEWA 3D5UA 4S34A 3ZUTA 5AX9A 4D4RA 2HY0A 4DFXE 5M4IA 4O83A 2WMQA 3P78A 3RMFA 3NUAA 1H1SA 4PPAA 4IZ5A 2VTRA 4IAFA 3F3TA 3KRXA 1KE5A 5H8EA 2BMCA 2HOGA 3L1SA 5HD7A 4QMUA 5HVKA 5DNRA 4EUUA 1KE9A 5AADA 2GNJA 3CPBA 3WF6A 3ZC6A 4FICA 4C8BA 4GVAA 4FSQA 4IADA 4OLIA 4JDKA 5LVLA 4AZTA 2YJSA 5HQ0A 2HZNA 3PY1A 5FLFA 5CVHA 1JBPE 2WQEA 3UP2A 5D41A 2CN8A 2XJ2A 3KMMA 5IQIA 2BKZA 2WMTA 3MY5A 4RIWA 5DEWA 4ASDA 3E87A 2R3GA 3CY3A 3Q4TA 3TV7A 1V0BA 1HJPA 3R7YA 2UZEA 3LQ5A 3FXXA 3TTIA 4ACHA 3B8RA 4JRNA 2VTAA 4GIHA 3JXWA 3R30A 2PUUA 4MH7A 4AGUA 3IDBA 2BKKA 2ETMA 3F2RA 2CGWA 1IEPA 4ZSEA 3MVHA 3KRLA 5M57A 5GJFA 3V5TA 3CP9A 3EQDA 5D12A 3FBVA 3VS0A 1EFUB 1MQ4A 3BBTB 4LI5A 2HZ0A 4YJQA 5CSWA 3VBQA 1PXOA 1Q8ZA 2DQ7X 4KIOA 3OCTA 4QMYA 2JZ1A 3PXZA 4N6YA 1G3NA 2DWBA 4ZLZA 3QX4A 2BZKB 4M15A 4BDJA 2PE0A 1R78A 3ROYA 3GEQA 4QPSA 4CVAA 2JLDA 2V62A 4LL5A 4Y95A 1DM2A 5EM8A 1M14A 2L4FA 4QP1A 4EHZA 4F9YA 4YSJA 4FG7A 4J53A 2WTWA 3AGLA 4CFFA 5JK3A 2OIBA 3R1YA 5HLNA 4EOSA 4IC8A 3OS3A 4XCUA 1P4OA 2RFDA 4NU1A 4CMOA 2JDRA 2GTNA 4FKIA 4EWQA 5CF8A 5IMXA 1QPCA 1DI9A 3UVPA 2UW7A 2X2MA 3SKCA 4TN6A 5JSMA 3UC3A 2BILB 4AACA 4PMTA 3Q6UA 3U9CA 4DH7A 4TYHB 4MKCA 4XG9A 2R0IA 1ZXEA 2QU5A 3RNYA 3UQCA 4EK4A 2YLFA 4NH1A 3RALA 4M67A 4U7ZA 4ZS4A 3KXXA 4L68A 2XVDA 4MWIA 4YGAA 5J79A 4KIQA 4ASXA 4R7IA 4U79A 3RCDA 3W10A 4FEUA 4BCHA 4TL0A 4BZDA 4Q5EA 2FSMX 2V7OA 4PMMA 4GT5A 3VUIA 3D94A 2ZV9A 3DLSA 2P3GX 3KMWA 4KBCA 4BZOA 5M53A 2EVAA 3I79A 3QZIA 3R7VA 4FTKA 4YHJA 4G3GA 4L6QA 3MIYA 2XK6A 3NIEA 5CWZA 2B53A 2MJ5B 2HYYA 3ZSHA 3FLSA 4QYYA 2BROA 4ACGA 4FG9A 3EH9A 3BWFA 4ZJJA 3DNDA 1H28A 2PMNX 2UW3A 3MDYA 4QO9A 5FM2A 3BYSA 2WTIA 1JVPP 4TZRA 3R8LA 3RZBA 2I1MA 1R39A 2ACXA 4BBMA 3Q4CA 5HX6A 1B38A 1R3CA 4RBLA 4XP3A 3HNGA 1H8FA 2IJMA 3V01A 3KN5A 4DYMA 1IAJA 4IX6A 3C4EA 4MEDA 3KN6A 3D15A 2AC5A 2CMWA 4AZVA 2XB7A 4ITJA 4WG3A 4D9UA 4DG3E 3UZPA 1APME 4BYJA 3F5UA 3CJGA 4UMPA 3EN9A 2JD5A 2NRUA 5JH6A 5HTBA 2NP8A 3MA6A 2G3QA 3PPJA 4O38A 3BQCA 3FZOA 4AN3A 1W83A 4Y85A 5C8KA 4EH9A 5AUTA 3DQXA 4M7IA 3VVHA 1PYEA 3BV3A 3Q6WA 3TKUA 2UVXA 4AF3A 3I81A 2ITNA 1OL6A 3QZFA 4M97A 3NYVA 2UZUE 3EQGA 4QMZA 1WVWA 4R7BA 3ZXTA 5E91A 4XUFA 3FMNA 3PVUA 4FTIA 4FKRA 3UOHA 4EWHA 5BYYA 3P1AA 1PXMA 3FI4A 3ET7A 1CUKA 2VGPA 1OM1A 1Y8GA 1JSUA 5H2UA 2CNQA 5DR6A 2B9IA 3RI1A 3ENMA 2WU6A 3GU8A 5EDPA 2ZDUA 4Z9LA 3ITZA 3HRBA 4P7EA 4MF1A 4BL1A 4EOOA 2QG7A 4FTLA 1XKKA 1WJ7A 3ALOA 4RT7A 3WE4A 1SVEA 3VHEA 4WBBB 1BVSA 4HZSA 4BHNA 4NFNA 3QQJA 2GSFA 1T46A 3FLZA 2XNOA 4XJ0A 4GCJA 3REPA 3VUHA 4PPBA 4A9RA 4D0XA 5H8GA 5I9ZA 4YC3A 2VTSA 4KB8A 2OF2A 4AA4A 5BPYA 2XCKA 3QU0A 3H9OA 3IG7A 3HAVA 2X6EA 3DAEA 4I21A 1YKRA 5AV0A 3R28A 4DTKA 4BR3A 1MQBA 5C27A 3I7CA 4I24A 3BCEA 5ETCA 5JGBA 1J1BA 3KCKA 4FTQA 4YJOA 1UWJA 3ZLSA 3A7FA 3D9VA 4WA9A 4MD9E 1ZOGA 2GHGA 5ANDA 4E93A 4F2LA 4J99A 2E9NA 3LQ3A 5KNJA 5C4LA 1O9UA 5C9CA 4RG0A 1KE8A 4D0WA 5AAEA 3GNIB 4RVKA 1Q3DA 3D2KA 3MIAA 3VF8A 2DAEA 3EN6A 4O96A 3ZHPC 3QTWA 4HVIA 2UZLA 4JBOA 4O0XA 5EHYA 2WEIA 5LWMA 2WMVA 4EKLA 3GI3A 4O6LA 4U81A 3VF9A 5CEOA 4LV5A 4OR5A 5AA9A 4XRJA 2XNGA 3G2FA 4HVSA 5AIKA 5J7BA 5AM6A 4CG8A 2BWBA 2PVRA 2E9VA 3ZRKA 2WIPA 5EI8A 2H5XA 2F49A 2QOOA 4O7ZA 2YM5A 4JG7A 5GINE 4K9YA 4DH3A 3NS9A 2PVNA 1WVYA 4YTHA 4CYIA 4EC8A 5IQHA 2VTOA 3D7TB 2A1AB 2JBOA 4DFLA 4IX3A 4PX6A 3N9XA 4PTCA 5HG7A 2X9FA 3W16A 3QALE 2HWPA 2O0UA 3KXZA 4K33A 3SLSA 5A9UA 2PSQA 3JUHA 4IB0A 4YLJA 2I40A 3LCVB 5KCVA 3AG9A 3MPMA 4DA5A 2QOCA 3LKMA 4DH8A 3K9PA 3F7ZA 3NX8A 3PSCA 4KRDA 3PXKA 4IDVA 3PZHA 4IWDA 4M0ZA 3D5WA 4R1VA 3UP7A 2IZSA 4ZK5A 5AAGA 2EU9A 3R2BA 3EFWA 4DAWA 2GQSA 4O7YA 3OBJA 3OUKA 4XX9A 4EZ7A 4FUXA 1M2QA 2VU3A 2ZDTA 3NPCA 4CT1A 4LL0A 3F61A 3QD0A 4ZY4A 3UZRA 1WGNA 1ZWSA 2PZ5A 1GZ8A 5EFQA 5L8LA 4DG0E 3OWJA 4FYNA 3Q5ZA 4U40A 3O8TA 5DFLA 4MXZA 1XB2B 1YI4A 3QUEA 3PIZA 4I5HA 4RIYB 3DNEA 4TWCA 2CP8A 4P2KA 5KZ0A 2IPXA 2XUUA 3CQWA 4IAKA 5KMOA 3TDVA 2VNWA 4YZ9A 4USEA 3FHRA 4JR3A 4EH2A 2HIWA 1TQIA 3HKOA 1X8BA 5HVYA 4X6RA 1KSWA 5LVMA 3C4XA 2PVJA 2C6OA 5J9ZA 4GG5A 4X21A 4CRSA 3D0EA 2E9OA 3EFLA 5CZHA 4AW5A 2C0IA 3I4BA 4U8ZA 3SRVB 2ZV7A 5IQFA 3QXPA 4XHKB 3EKNA 3M42A 4QPAA 3KU2A 4FZAB 2OLCA 4USDA 4NZWB 4EOKA 1XXHE 4EJNA 4A9SA 3P9JA 4I5CA 2FSTX 4G6OA 3GCUA 2DAKA 4IX4A 2PMLX 3KVWA 4QMWA 3QL8A 4W4WA 3RVGA 1BYGA 3RWQA 4B6LA 3NIZA 3EQFA 3ORTA 2JKKA 4O91A 4QNYA 3FZPA 4W8DA 3FLYA 5HGIA 4CQGA 2GDOA 4QP9A 3SXFA 4MNFA 3F7WA 4CTCA 1OZ1A 3KFAA 2WHBA 4UBAA 5EW9A 3UIUA 1ZZ2A 3PXRA 4IHPA 3VC4A 4BDFA 1R0EA 5CLPA 3LCOA 4X3FC 3HRFA 2GFCA 5BVOA 2FGIA 2RG5A 3Q3BA 3BZ3A 3MMPA 4NK9A 3ZSIA 4DEDA 5HO7A 2V0DA 1Y57A 4IVAA 5T68A 3TJCA 4RIYA 3VBYA 2QO2A 4BZNA 5KBRA 3TUCA 2GNFA 5HU9A 2R3LA 3TJDA 3DBFA 2JFMA 5I4NA 3QRTA 5CT7A 4MXXA 3ZFMA 4F6WA 3DPKA 2RG6A 4LMUA 3CGFA 4OT6A 3U87A 4BGGA 1DAYA 3LM0A 5IEXA 4QTEA 3AC2A 4QMOA 3FQEA 3IDCA 3GLFE 3IO7A 2BUJA 3OWPA 5J95A 3RCJA 3VBXA 5EOBA 3DFCB 3VBVA 4RX5A 1LP4A 4U41A 5G6VA 3V51A 3ETAA 2B55A 5ANOA 2QI8A 3R9OA 4MAOA 1UV5A 3NNWA 2ZTCA 3PZEA 4I3ZA 3RHXA 1JSVA 3NUXA 4X3FB 3CEKA 4BGQA 3C13A 5EW3A 4EYMA 4YNOA 4B8MA 5FBNC 3E8CA 3NYXA 1MP8A 2XH5A 5DA3A 3FKOA 1E94E 4E20A 4RFZA 4YTCA 4BRXA 1QPEA 3TM0A 1STCE 1AIPC 2ITUA 2QHMA 3VWAA 5CQWA 2CKQA 2I0EA 4E4MA 4KWPA 4OTWA 2H96A 3GOPA 3FMJA 2LVAA 1W82A 1YXVA 3PA5A 4FIEA 4JX3A 1FINA 1UU8A 4IZAA 1Y8YA 3NCZA 2LVQD 2W7XA 4PDPA 5KUPA 3CD3A 4E8AA 1XBCA 5BVWA 3VRZA 4UMRA 3ORXA 5AR4A 4B8LA 3CJFA 5IH5A 2W1ZA 2XMYA 1OL1A 4ZJIA 2OJ9A 4U3YA 1YVJA 4QQTA 3MJ2A 3F3ZA 3QTQA 4GMYA 4R77A 4O82A 4QMNA 5DG5A 4FV4A 1J7LA 3TN8A 2BAQA 4NW5A 5C4KA 3MFUA 5L2IA 1SZMA 2F4JA 1MN3A 1W7HA 3NNXA 4X0MA 5CY3A 2QONA 4CKIA 3A2CA 2WTKC 4DF3A 4RC2A 4C02A 3DTCA 3DT1A 3PJ1A 4FTNA 5CQUA 1EH4A 3GLIE 2WTVA 3SOCA 5AFVA 3UOJA 3KULA 3JYAA 5ANGA 3F2NA 4GT3A 3VS5A 4MF0A 1FQ1B 1SNUA 5JFXA 1ND4A 5J9LA 4F1OA 4OTPA 3L9MA 3W1FA 4D4YA 2YM3A 3IGOA 3NRMA 2W4KA 4MCVA 4APPA 5HLWA 4TY1A 4O2PA 4PF4A 3E7OA 2J0IA 4ERWA 4W4VA 4F70A 3SD0A 3EHAA 1CSNA 4DTBA 3PUPA 2QOHA 4JBQA 3KREA 4E6CA 3O50A 1H25A 4E1ZA 4L3LA 2XK7A 2JIIA 3MWUA 4KIKB 2XBJA 4FL2A 3ZFXA 3KRRA 5BUJA 3ID6C 3HL7A 1WVXA 2R3JA 2R9SA 4QMMA 1C7YA 4F0IA 4D2WA 3GU6A 4AZSA 4B7TA 3EFKA 3R8PA 4NM7A 4EK8A 3K5VA 1WBVA 2GU8A 5DBXA 3WF9A 3IW7A 3Q5IA 2MGWA 3H9RA 3OP5A 5HNIX 3NW7A 2H34A 3F3WA 3EN4A 3GU5A 3HZTA 4CFXA 4UZDA 2CGXA 4IBMA 2O63A 2C5XA 2W4JA 2F9GA 3E5AA 3F69A 4K6ZA 4QYGA 4ASZA 3E62A 4JIKA 4O7LA 5LOHA 1URCA 5K4JA 4CD0A 4IB3A 1VEBA 3SW7A 1H24A 4AOJA 4IAZA 5HLPA 3I60A 2VTQA 3C4FA 5CI7A 1PJKA 4JL9A 3ERKA 4QMVA 4AT5A 1PYXA 4PDSA 1OI9A 4O7TA 4NM0A 3NVMB 2VD5A 3UIMA 2DAMA 1OIYA 4ALUA 3EFJA 4FTTA 2CPKE 4F6SA 2O25A 3PY0A 3DKCA 4IDTA 4BCGA 4BTJA 3QLGA 2WMUA 5JRSA 5M07A 4LM5A 4DFUA 3CGOA 2FSLX 2XRWA 4WUAA 3DY7A 4CQEA 3OY1A 2G2FA 2KHHA 1Q02A 2BTSA 2Z8CA 3OD6X 4ACCA 2BWEA 4E5WA 1ZMWA 2IG7A 3BHUA 3FY2A 4PMPA 3UNKA 3CTJA 4BCOA 4FT5A 1IASA 4ZIMA 3W2SA 2OXDA 2XK4A 2DAIA 2B3TA 4OBPA 2OGVA 4DFYA 3FI2A 3MPTA 1Y91A 4C0TA 5L2TA 3GC7A 5TOZA 4BWXA 3DB8A 4Y8DA 1KE6A 2WMAA 2FH9A 1WIVA 3ORIA 3DQWA 5DOSA 3FC2A 4J97A 3WE8A 3ZH8A 1BX6A 3EYGA 2QR7A 5E7RA 2X81A 3K3IA 1JKSA 3OWKA 2Y4IC 4IVCA 3ANQA 4HGLA 4M13A 3RJCA 4AU8A 4J8MA 5HE3A 2JY7A 3WIKA 4HYHA 3U4UA 3MFSA 5HHWA 4YNEA 2W5BA 3QTSA 1VYZA 4CSVA 5IQAA 4C59A 3JY9A 3NR9A 2QD9A 3HA6A 3SQQA 2XNMA 4H36A 3M1SA 4YLLA 3MB6A 2LBCA 2UZTA 4D1XA 4C58A 3QKMA 1Z9XA 3QC9A 4ZZMA 1XWSA 2J9MA 2LAVA 2LVNC 3LHJA 1SVGA 3ZDIA 2Y7JA 4O7WA 5FD2A 5GJDA 4C4JA 1SG9A 3D7ZA 3OC1A 1VZOA 2Q0BA 3LFSA 3QRIA 4G3OA 4R7HA 4ZSGA 4DEGA 5LMKC 2JP7A 3QWKA 3DBCA 4K2RA 4LGGA 5AA8A 2UW6A 4ANQA 2B0QA 3LMGA 3FZTA 3ZM9A 3QZGA 4CCUA 1BL6A 3A60A 3O2MA 2ZM4A 5IA2A 3DBQA 2EUFB 2HK5A 1JQHA 4JDHA 5IPJA 3SV0A 4IZ7A 3EIDA 1LEZA 1I09A 3DXNA 3HYHA 5DH3A 2PUIA 4U97A 1M52A 4PP7A 5AR7A 2W1EA 4UWCA 1UVRA 3L9NA 4BCIA 4BCQA 2BHEA 4IAIA 4RVLA 2K0BX 3UJGA 2ITPA 3O8UA 2JKMA 4N4SA 5GIPE 1PW2A 2VTHA 2OF4A 5D7AA 2F7XE 3IQ7A 4BDIA 3BHHA 2IZRA 3L8VA 4QP7A 2XNNA 5DVRA 4IFGA 3RBWA 1TKIA 3BHVA 2W9ZB 3R22A 4FKPA 4M3QA 4AA0A 5AP4A 5KHWA 4NSTA 4PL4A 3MTLA 4D2RA 3DXQA 4EL9A 1R1WA 2EXMA 1OIQA 3EQPA 2R7BA 3FEGA 3DOGA 3LFCA 3OY3A 3ODZX 4RJ5A 5E8SA 2J7TA 2JZ0A 1ZMUA 4P90A 5A6OA 3RPVA 4LOQA 4C4FA 2KNVA 4YO6A 5AM7A 5LVOA 4HPUE 4RQKA 5KMNA 2VO3A 3R7EA 1I44A 1NA7A 3IS5A 3RINA 3LJ2A 2W05A 4WP2A 4TTHB 3CQUA 5IQDA 2WD1A 2VAGA 3Q2MA 4KSPA 3ZU7A 4AP7A 1VEGA 3R0TA 3T3VA 3G33A 3FI3A 4RX9A 5HE1A 5C1QB 1OL2A 2R64A 5CEIA 4D2SA 4F9BA 3CR0A 2IVTA 2ZMDA 3BU6A 3MY0A 4QQ5A 1SMHA 2V5QA 4L52A 5AMNA 3FWQA 4X2NA 3H0ZA 3HV4A 3LFNA 5EM5A 2B52A 5J5SA 4WUNA 4QOXA 4E5BA 3ZXZA 4KBKA 5HD4A 3PDTA 2PVHA 4M68A 2WMSA 3GVUA 5HU3A 5AP6A 4IMYA 2X2LA 3Q60A 3VS2A 1ZYJA 3E21A 3OBGA 5CEMA 2JDTA 5J1VA 4DCEA 1S9JA 4L46A 1XHAA 3TNIA 4AGWA 4U42A 4O0WA 1QPJA 3GQIA 3IDPA 3QGWA 5HBJA 2X9EA 5AUVA 4CXAA 3UG1A 3QA0A 1VJYA 5CEKA 3MFRA 3ZZWA
chains in the Genus database with same CATH superfamily
2O2UA 3W18A 4LZJA 3R1NA 4AW4A 3NUSA 3UQGA 4GYGA 3HGIA 3L8SA 3VUKA 4D81A 4IXPA 4GK3A 1NO1A 4NUSA 4MBLA 2JAMA 2Y0QA 4KKEA 5ITAA 5ICPA 3I1AA 2QHNA 1TDZA 4BFMA 4EONA 2OBJA 3S0OA 2X7GA 1M17A 4FSNA 4S31A 3RE8A 4N70A 1ZOEA 4J96A 5HTIA 5DYGA 4FSUA 1QANA 4ANNA 3KXHA 1BUHA 4L53A 4F7LA 1OAIA 2AHMA 4LRKA 4F0FA 4K1BA 2W99B 2J2IB 3N4TA 4GG7A 2PZIA 1DV0A 2X2KA 5ANKA 1WBNA 5GNKA 1GNGA 4V0GB 4DBNA 5DMZA 4O1PA 4RIXB 2JWSA 3BGQA 3GU7A 1M7QA 1DGHB 3ULIA 4PNIA 4TYEA 4EH6A 5IH4A 4WURA 4F63A 4FZ7A 3PNYA 4KIPA 3VQHA 5M09A 2CKOA 3L25A 1OJLA 4GEWA 1W84A 1V92A 5AUZA 4XK8F 4O0RA 4YY3M 4D1SA 2E5LM 4V0GA 2FSOX 3BXWA 5CAVA 1YXXA 5IEVA 4J98A 3FMMA 3UYSA 1NJFA 4RSSA 2V7AA 5HNBA 1ZYDA 3DJ6A 4TT7A 5DRDA 3PY3A 1K9AA 3A46A 4O7SA 4Q2AA 3SGCA 2C9CA 5IKWA 1FGKA 4GJ2A 2MH8A 4DBXA 1NSFA 4JMQA 3KL8A 4XLIA 2B54A 3DV3A 3ORMA 2J5EA 2ONLC 4KNBA 2GNHA 3DK7A 2UZWE 5HG5A 4QT1A 2LGCA 3CTHA 5EM6A 3R00A 4ZLOA 1F0QA 2CHGA 4J8NA 5EQYA 3M0EA 3BQRA 3WBLA 5ANIA 3A4PA 3MH0A 4JS8A 1ZOHA 3FKEA 3QQUA 4BBAA 2BVAA 5HNGA 1OBDA 2VTMA 3FI8A 4TWNA 3FL4A 5J7HA 2R3PA 3SHFA 5M06A 5D10A 4EBVA 1J91A 2PY3A 4XV2A 2YAKA 2HCKA 4CV9A 5ACBC 2G2IA 2ITVA 5HO8A 3UVQA 4ITHA 1PMEA 3MJ1A 4JI7M 4HEOA 1K3XA 3PTGA 3RK5A 1YWNA 3R04A 3TNWA 5CAUA 3W8QA 3D7TA 2PHKA 2WQNA 3WZJA 2F5PA 3EOCA 1GZKA 1G3IA 4QP8A 4CG9A 4CHTB 3LMHA 3E7VA 2V55A 1G8SA 5BX0A 2ZJWA 5L8KA 5DRBA 3SFZA 3FRIA 4QQJA 4G6NA 2R6FA 3HZJA 4YSMA 4XG4A 4FKGA 3MI9A 4FV1A 1UKIA 4RKUF 4FOCA 3E9SA 5FTLA 1CTPE 1QDTA 3UG2A 3KF7A 4YPDA 4A07A 3ZOSA 5DN3A 2O5KA 4ASEA 4XBUA 2C3IB 3R9DA 4O0TA 3AXWA 3R8MA 4EHVA 3FQHA 1XC8A 2D7HA 4UYNA 5EHOA 3DKGA 2FS1A 4YLKA 5F95A 2YFXA 3GCVA 4JBPA 4RZWA 4PTEA 2OJIA 1HT2E 3G0EA 1YI3A 3NNVA 4KABA 3FMKA 1WBPA 2W1IA 4FSTA 4JN6A 2YABA 2NRYA 4DEAA 3GCPA 1LR4A 4AE6A 4CFUA 2OXYA 3DAJA 1W98A 2KRKA 2YCFA 4AGDA 3QF9A 5LCJA 1HCKA 4AKHA 4KODA 4OVZB 4PQNA 4HCVA 3ELJA 5DR2A 4JRVA 4KS8A 2C6IA 5AR3A 2KA6B 2Z7SA 4FEWA 4NOOB 5E8WA 4FX3A 2DNAA 1N75A 4HJOA 3POZA 5EQTA 3TCPA 4I6HA 1GJOA 3HA8A 5ITTA 3C5IA 2XKCA 4UXLA 4GRIA 4FF8A 1VQ1A 1A5TA 3KA0A 4DUYM 3FRHA 3O0GA 4U44A 4NKSA 3C3DA 3NUPA 2XKEA 5M56A 4A06A 5CT0A 3IPHA 3HHZA 1DS5A 2A5YB 3AD4A 3LAUA 5CU2A 4IAAA 4G16A 3ZLXA 4L00A 3VJNA 4B9DA 3IW5A 4BGHA 5AR8A 1QL6A 2RFEA 4ZTSA 4GKIA 1TF0B 4QMQA 4P5ZA 3SXRA 3OXZA 1PXIA 3B8QA 4B3SM 3GENA 4IM3A 5KO1A 4M9ZA 3R7UA 1WBSA 2PUNA 4AN9A 1OB3A 3N4VA 3I51A 2YERA 4AOTA 2OQ4A 4RJ4A 4EOMA 2OOAA 4RZVA 5AV3A 3KOYE 4FVPA 3GLHB 5F4NA 2IF8A 4AT4A 3HV7A 2OOBA 4NM3A 2XNEA 5KX8A 4G3CA 4DT8A 3HY5A 2B7AA 1IN6A 3TNHA 2CV2A 4BYIA 1RU3A 4DR1M 4FG8A 5KQ8A 1MUOA 3A8XA 5IUIA 4F6UA 4IBBA 2QPAA 3LXKA 5D11A 4LGDA 4LG4A 1J5EM 1GKIA 2CEAA 3HJ8A 3UOLA 5EK7A 4R7GA 4U0IA 1PXKA 2XAOA 3FDNA 2F2UA 4QP4A 5EOLA 1PY5A 1JAMA 2W1GA 3FMDA 3NGAA 4DR5M 2QOBA 4DLIA 4L43A 4E4XA 2C6TA 3F9NA 4P4CA 3QCYA 3FYDA 2XS0A 3FLWA 5HIBA 1OITA 4MYGA 4RWKA 2C1BA 3IOKA 2AQXA 4P5QA 3UVRA 5FP5A 4G17A 5IA4A 5CEQA 5AP2A 2JXNA 1IY1A 3VS4A 3EQCA 2WOTA 2YZAA 4OBQA 3A7IA 4AG6A 3DZDA 1JKKA 2BTRA 2WQOA 4QOZC 4I0TA 4FKOA 5E8ZA 4AW1A 3QRKA 4FV0A 4L78A 4FSMA 4X2FA 5H3QA 2GMXA 3BYMA 4M69A 5EHLA 4FNXA 3PJ2A 4CEGA 1L3RE 2WMWA 3AT4A 4B7HA 5IA1A 3LE6A 2GNGA 3EQHA 5EXXA 3UK6A 3DZQA 4ZZNA 4RWJA 4FEVA 2WEVA 4CFNA 2IZUA 2VX3A 3HX4A 3P08A 4O0UA 4QRCA 3G15A 4GL9A 3DA6A 1Q3WA 2Z7LA 4LY6A 1FGIA 2QURA 1IBMM 2GS7A 4L7SA 4IWPA 2Z7QA 2W5AA 2DZOB 3ORKA 2PL0A 4OUCA 1WHCA 2P33A 2OXXA 3VBWA 4GEOA 3R63A 4E73A 1BKXA 3ZH9B 3W2RA 3NUUA 3LJ1A 2QKRA 2OW3A 4I0RA 4HPTE 3A99A 2GQGA 4RFYA 5ETAA 4FTJA 4MXOA 4GU6A 1IY2A 3G90X 3BELA 1N78A 3FE3A 3QTXA 4L7FA 4FT9A 2BIYA 5AP3A 4FTOA 5FM3A 4O84A 4YZNA 3QGYA 2VRXA 3MH2A 3R73A 2LNHC 4FR4A 2VTLA 2UZDA 4YJSA 4XV9A 4UMUA 2QC6A 4C4GA 4HOKA 4EOPA 2J0KA 4FV9A 4QHTA 3BYOA 1PMNA 2Z4SA 2C3JA 3RPSA 3EQIA 3AMBA 2WQMA 4FTAA 4IE9A 4I22A 4D55A 3ANRA 4C37A 2PVLA 5GKNA 3LCDA 2ONLA 4KO8A 2X7FA 4BDKA 4QHSA 4BIBA 1NHGC 4FV3A 4X3JA 1W0XC 4MNEA 4PCZA 2C5YA 1BLXA 4CJ6A 3I5NA 2R5TA 2JIVA 3CQEA 4AQCA 3QYZA 2AEGA 2BFYA 3SYLA 1LEWA 2FA2A 3R7OA 4HL4A 4B08A 5TKDA 2VN9A 4Y46A 3KS8A 4KSQA 4IJEA 2XYUA 2W1HA 1XBAA 5L3AA 3LW5F 3W0MA 2W0JA 2ZAOA 3QAME 1NVMA 3FKLA 5BYZA 5JFWA 3ZC5A 3E63A 4K8AA 3NUYA 3OCSA 3QXOA 3QC4A 5EI6A 2A2AA 4YZBA 5HCXA 4PNKA 3PPZA 3PIYA 2Z7RA 5I9WA 4L4UA 1FVRA 4O4BB 2R3FA 5C26A 3UPZA 5C03A 1ST4A 4BCFA 2OIDA 2RL5A 5CSPA 2UXBM 2OPFA 2R3MA 3V5LA 4V04A 2PTKA 4J95A 2YDKA 5HESA 4WG4A 1GAGA 2X6DA 3QKKA 2C1AA 2R0UA 3CE3A 4CQGA 1BL7A 4JLCA 3H4JA 5FXSA 4YJTA 4O21A 1Q3BA 3GFEA 2VWXA 3PYYA 3AGMA 2O3PA 4Z8XA 2QOFA 3II5A 1HNWM 3CLYA 1YOMA 3FXZA 4EOJA 3S95A 4ZY5A 3KK9A 4XH6A 4ENXA 4QP3A 2XJ1A 4R5SA 4FIHA 4F7NA 2QLQA 2VGOA 2X4FA 4ZY6A 3TXOA 4JI5M 2KZUA 8CATA 4DV6M 3HP5A 3E4RA 2G1TA 2P5TA 4OBOA 1Q41A 2JGZA 2O64A 2QCSA 1HCLA 3MPAA 4LYNA 4XG2A 1MX0A 3VS3A 3HV3A 2FB8A 2EO2A 3FLQA 3HU3A 4EH4A 4UY9A 3UNJA 3QD4A 1CKJA 4GT4A 3Q96A 3UE4A 3MYGA 1JQJC 4QMSA 3JR1A 4EQCA 3C4ZA 4FL1A 4DFNA 5IDPA 4YURA 3ZONA 4MXYA 3BI6A 3KEXA 5CNNA 3TZ7A 5IMEA 3TI1A 5D1JA 3L9LA 3GGFA 3IG8A 5JGDA 2J0LA 2NNWB 5FTGA 1VYWA 2ITQA 3ORPA 4AFJA 4F64A 4OTFA 2GPHA 3LQQA 5EYKA 2R3RA 3ZDUA 2YCSA 4IBEA 1KSFX 1L2BA 5IUGA 3FMLA 1HOWA 4O4FA 4MGIE 1KV1A 4FWHA 4LQMA 5FDPA 2VWVA 4BDAA 4MGYE 2X0OA 4S2ZA 2CN5A 4OTQA 3WZDA 3MVJA 4CFWA 1G5SA 5DLSA 2NO3A 2EB3A 5FWKK 4WO5A 1A48A 4NJDA 3FSKA 2W4OA 1FVTA 2ITXA 3VNTA 1IXZA 4KD1A 4J71A 4LFBM 5IZFA 3SX9A 3P5JC 3HEGA 3HP2A 4IIWA 4G3EA 4ONAA 5C18A 4ZTRA 2JY8A 1XXHB 3UZUA 2XK8A 5EKOA 4AFEA 1QAOA 1WBWA 4D58A 3TZ9A 2RIOA 4FW9A 3EZRA 4QD6A 3HV5A 4FSYA 5F20A 4KBAA 1G8AA 4X66M 5IG1A 1PHKA 2RRUA 4TRLA 3FAAA 4FKJA 4KKGA 3QWJA 4GMQA 4S34A 5AX9A 4DFXE 2DZNB 2WMQA 4IAFA 3F3TA 2IEWA 2BMCA 5HD7A 5AADA 3CPBA 4AZTA 5CVHA 3UP2A 2CN8A 4IBFA 2WMTA 3CY3A 1V0BA 1HJPA 3PUFC 3LQ5A 4ACHA 2PUUA 2BKKA 4IJFA 1IEPA 5GJFA 4I5SA 3FBVA 1MQ4A 4YJQA 3BBTB 3UDZA 1Q8ZA 3GRYA 3PXZA 1G3NA 4BDJA 1QAMA 3GEQA 4CVAA 2K6BA 1DM2A 4YSJA 2WTWA 5JK3A 2OIBA 2RFDA 5LMBA 2GTNA 1QPCA 5JSMA 1FJGM 4PMTA 4XG9A 4ZS4A 3RALA 3RCDA 3C9PA 4W5WA 4BCHA 2FSMX 3VUIA 2ZV9A 3KMWA 5M53A 4L6QA 5CWZA 2MJ5B 3ZSHA 2Z4RA 4QYYA 2BROA 4ACGA 3MDYA 2WTIA 4TZRA 1R39A 4RBLA 4XP3A 3HNGA 3KN5A 4DYMA 4MEDA 3D15A 2AC5A 1PJTA 4ITJA 4WG3A 3UZPA 1APME 3F5UA 3CJGA 1XNRM 3EN9A 5HTBA 2NP8A 4JYAM 3PPJA 4Y85A 5C8KA 4M7IA 1PYEA 3BV3A 3DOAA 2WSFF 3EQGA 2RGHA 3UOHA 4EWHA 3P1AA 1PXMA 2DXIA 1JSUA 2CNQA 5DR6A 3ENMA 2WU6A 2R18A 2ZDUA 2QG7A 4FTLA 1XKKA 3ALOA 2XALA 1H6UA 4BHNA 2GSFA 3VUHA 4GCJA 4A9RA 4PPBA 4KB8A 3QU0A 3IG7A 2LWXA 3HAVA 3DAEA 4DTKA 5C27A 4YJOA 1UWJA 3ZLSA 3D9VA 2E9NA 5C4LA 5C9CA 1KE8A 4D0WA 1Q3DA 3VF8A 2DAEA 3EN6A 4HVIA 3QTWA 2UZLA 4U81A 5EP4A 4XRJA 2Z8YM 1SXJA 5AIKA 5AM6A 2BWBA 2E9VA 4O7ZA 4K9YA 3NS9A 3HKPA 5E6JA 1WVYA 4DFLA 2JBOA 2X9FA 3QALE 3SLSA 4K33A 3PZHA 4R1VA 5AAGA 4B7FA 3F61A 3UZRA 1ZWSA 1GZ8A 3OWJA 4FYNA 4MXZA 4I5HA 1YI4A 4P2KA 5KZ0A 5KMOA 3HKOA 3D0EA 2E9OA 3EFLA 4U8ZA 3SRVB 2ZV7A 4FZAB 4EJNA 4A9SA 4I5CA 4XRLA 3QL8A 3NIZA 4O91A 4QNYA 3NFFB 2GDOA 4DR4M 5L8RF 4CTCA 2WHBA 1MJGM 3PXRA 4IHPA 5CLPA 2RG5A 3VBYA 4BZNA 2GNFA 5HU9A 2JFMA 3GPPA 3ZFMA 2RG6A 4BGGA 4QTEA 3FQEA 3IDCA 3GLFE 3IO7A 2BUJA 3DFCB 3VBVA 4FD2A 1LP4A 3V51A 3NNWA 3PZEA 3CEKA 3SARA 5FBNC 3NYXA 1MP8A 2XH5A 5DA3A 2KW0A 4BRXA 3TM0A 2QHMA 4E4MA 4KWPA 2H96A 2H1RA 1Y8YA 4PDPA 5AR4A 5IH5A 2W1ZA 4U3YA 2F5OA 4QQTA 4FV4A 2BAQA 4LFAM 4X0MA 5CY3A 2QONA 4CKIA 3A2CA 4RC2A 4FTNA 1EH4A 3GLIE 3UOJA 3KULA 1OAOC 3F2NA 2YR0A 3W1FA 5HLWA 3NRMA 2W4KA 4O2PA 3CF2A 4PF4A 1HQCA 4F70A 2QOHA 2XK7A 3MWUA 2R9SA 4P16A 1C7YA 4F0IA 4AZSA 3R8PA 4EK8A 1WBVA 3IW7A 3H9RA 5F3WA 4IBMA 5LOHA 4CD0A 4IB3A 1VEBA 1H24A 5HLPA 2VTQA 3CTWB 4O7TA 2VD5A 1OIYA 3B74A 2V1UA 3PY0A 4BCGA 4BTJA 2WMUA 4DFUA 4LFCM 3OY1A 2KHHA 3WHLA 3OD6X 1ZMWA 3BHUA 3CTJA 4BCOA 1IASA 4DHIB 3GQ4A 2DAIA 2B3TA 4OBPA 2OGVA 3MPTA 3U60B 2FH9A 4ZPXA 4XGIA 1JKSA 4IVCA 3TMOA 4J8MA 3WIKA 3U4UA 4YNEA 3MB6A 2UZTA 1K3WA 2KDLA 2J9MA 3LHJA 4C4JA 1SG9A 3OC1A 2Q0BA 4ZSGA 4G3OA 5LMKC 2JP7A 4LGGA 2UW6A 3LMGA 1JQHA 4IZ7A 2EA0A 1I09A 1M52A 4UWCA 3L9NA 4IAIA 2K0BX 4N4SA 3MJ5A 2VTHA 2F7XE 2XNNA 4IFGA 3BHVA 3FTCA 5KHWA 4NSTA 4D2RA 3DXQA 4EL9A 4OW0A 2VF8A 1QDRA 2R7BA 3FEGA 3DOGA 5E8SA 2J7TA 2CV1A 5AM7A 3PXGA 4HPUE 5KMNA 5EXPA 1TGUA 4CISA 4RX9A 2IVTA 5AMNA 5ITUA 3FWQA 4X2NA 3HV4A 3LFNA 5J5SA 4DR2M 3ZXZA 4KBKA 3PDTA 2WMSA 5HU3A 5AP6A 4IMYA 5ITQA 7CATA 1XHAA 1QPJA 3IDPA 4CXAA 2CRUA 3MFRA 2BRHA 3OF0A 3F92A 5ITXE 3ZEWA 2XEZA 4BC6A 3LM5A 4TNDA 1OVEA 2R4BA 5HTCA 4EYJA 4X2JA 5CVGA 1ZYLA 4XLVA 3SASA 5DFPA 1QZEA 3SC3A 4DDIA 4LDTA 1RE8A 3L8XA 1E9HA 4C62A 3UO5A 2HXQA 4D5HA 3QHWA 5DPVA 1PJJA 5F94A 5HBHA 2C68A 3KB7A 3TWLA 3UBDA 2P4IA 4UMTA 2WELA 4FODA 4W4YA 5JGAA 3E3BX 1IAHA 3PPKA 3ZBXA 1L1ZA 2VWYA 4YUQA 1UFZA 1KOAA 4BDHA 3GPYA 1PJQA 4AA5A 4E6DA 3HJSA 4EC9A 2ZVAA 4HYIA 4C38A 3LCTA 5K0XA 1BI8A 5IQCA 3JVRA 4I4FA 2GS2A 4I4EA 2GQFA 4S30A 3FUPA 2VTPA 4I5PA 1PJSA 2XP2A 3IKAA 1OIZA 3ULZA 2CKPA 4EI4A 2OH4A 5LXMA 4CLIA 3GQ5A 4R6VA 1IRKA 2Z02A 4I6QA 4OW8A 2J6MA 4B99A 3PNVA 1NY5A 3D2IA 2J7NA 4TYHA 2UZVA 4I6LA 3N4UA 2YLEA 1IBLM 2VWBA 3BHYA 3BWJA 2ITYA 5FXRA 5BVFA 2DHRA 4W4XA 4CKJA 3H0YA 3KOZE 3CD8A 3TEIA 4O2ZA 3F5GA 1XO2B 4O0VA 2YIRA 4BHZA 1UM8A 2WMBA 1E9SA 2ZANA 4F7SA 2A27A 3T3UA 4IWQA 3EWHA 5I3OA 3BGPA 4FZ6A 3UMXA 5ITYA 1OIUA 5ACKA 3EQBA 3ZO2A 5M4UA 4LMNA 4DGNA 2C5VA 3NVKI 1JKTA 5CXHA 4MWHA 4LJAA 2VO0A 4A9UA 4UEUA 4Z7HA 3L8PA 4AZEA 5FTNA 4G4RA 4GHLA 3F82A 5BNJA 3TWJA 2RGOA 1H0VA 2OH0E 4DC2A 3NNUA 3WZEA 3JS2A 1RJBA 4UYAA 2XF3A 2R4EA 2BALA 1PF8A 3COMA 2XNBA 3F5XA 5IQGA 3U6LA 5EKNA 3CKXA 3L9PA 3R1SA 1ERKA 5CZIA 4B3RM 1XMOM 4LGHA 4NCTA 4C7TA 1D0LA 2CJMA 3BBZA 3Q9ZA 2HAKA 4AW2A 4EOIA 1WZYA 4EHEA 3T9TA 3AQVA 1NVQA 3HDNA 4APCA 4EEVA 2QOQA 4CCBA 3LVVA 5CANA 4LF4M 4D5KA 4CNHA 4YZCA 3TPZA 1H08A 2OIQA 5E90A 4R5YA 1P5EA 2UZOA 1AD5A 4YHTA 4H3PA 3U55A 2BDJA 1Q97A 1NY3A 5I9YA 3VAPA 5BYLA 4CGAA 4IZYA 2JKQA 5L6OA 4FK3A 3UYTA 3EQRA 3BBWA 2Y6OA 4BTKA 1UU9A 1PGYA 4L67A 3Q53A 2UZNA 3F3VA 3IK3A 4G2FA 3G5DA 2RKUA 4HGTA 3Q9XA 1WFCA 3QCSA 3UO6A 1TZDA 2L09A 2GTMA 3CXWA 2BRGA 1O6LA 5H9BA 3ZTXA 3HU2A 3IGGA 4EH7A 1XBBA 1R2YA 5LVNA 1URWA 1JR3D 2QU6A 4U9AA 4JAJA 3R8ZA 1U5RA 2H9VA 3EN7A 1TH4A 4F9WA 4UMQA 3D5VA 3QQLA 5DE2A 5KKRC 2IW9A 1N32M 4CZTA 3O7LB 4G9RA 5BMMA 3ODYX 4ZMFA 1W2CA 3BLQA 1GIHA 4ZTHA 1V0OA 1REKA 5HEZA 3ZLWA 1IA8A 2PMIA 4G1WA 5IQEA 4AXEA 4YO4A 3JPVA 5CU6A 2O5RA 3MY1A 4LRMA 4WNMA 2C0OA 3H10A 3W33A 2QSFX 2X0GA 2G9XA 3Q8GA 5KBQA 4GUEA 3JR4A 1YWRA 3SYKA 2OZAB 2XF0A 2FOIC 5FEDA 5A46A 4OT5A 2JITA 3BEGA 1Z5BA 4JG6A 4KIKA 4Q9SA 4ZTMA 3V8TA 5IEYA 5TT7A 4G4QA 4B0GA 4XYFA 4RWLA 1OKYA 3UOKA 1KUTA 3C58A 1M2RA 3TE6A 2DWMA 2OZAA 4FKLA 4RA5A 4X2GA 2QCUA 2BAKA 2C6KA 5JN2A 4H3BA 4YR8A 5ANJA 4GS6A 5HORA 4CKRA 3R2YA 4PV0A 4PL3A 3V6SA 2JNHA 1U5QA 4AWIA 2HELA 3FKNA 2R45A 3O71A 2W06A 3BL7A 2CWBA 2BPMA 1J1CA 1YQJA 2CNVA 3OFMA 5CU0A 2YM7A 4O22A 3KMUA 5E1EA 4XV1A 4LF6M 3WF7A 1GO5A 4O81A 5FUTA 2ITOA 2ESMA 3HMIA 4F0GA 1A9UA 3KVXA 2GHMA 5GZ9A 4L01A 3KOWE 3U6DA 1OIRA 3GC8A 4CV8A 1T43A 1W2DA 3QTRA 1DGFA 1WBTA 4UX9A 4H1JA 5JZNA 4UALA 3QUDA 2L7HA 1G8PA 4R71A 3R9HA 4WNOA 2J4ZA 5KPZA 4TYGA 2N35A 2ZM6M 4DE4A 4H05A 4OTHA 2VQEM 1IN8A 3TACA 3W0NA 3MA3A 4MBJA 1TR8A 5H8BA 1V33A 2PYWA 5C8NA 3C0IA 1E9RA 3Q04A 1H1RA 4GH9A 2I0VA 4RQVA 4W9XA 2PULA 4XEYA 5FTQA 4JIAA 2CCHA 2JAVA 1OFHA 1OQYA 5HICA 4YJVA 5IF1A 4GC9A 3U51A 2XIKA 5HI2A 4ZMEA 2L7IA 5JFSA 1ST0A 3AT2A 2ETRA 1W2FA 3FUVA 4ZZOA 5CXZA 3GPXA 3B2WA 2C4GA 3AMYA 4XG6A 2BNKA 4ERKA 4YJRA 2QENA 4M0YA 3I01M 5KHXA 3O7LD 3DCVA 1U54A 2DENA 5HE2A 4UV0A 4BCKA 3FV8A 4RLKA 3FYJX 2VO6A 1VEKA 2XZUA 5HKMA 1ORYB 3NAXA 4ZSLA 3QHRA 3NYOA 2R4JA 4HGSA 4E26A 3RGPA 4I0SA 4U43A 4QYHA 3EL7A 3VQUA 3FQSA 5L8JA 3KGAA 3FZ1A 3UIBA 4JQ8A 4XP0A 3MBLA 4D9TA 2VWUA 4RWIA 3P79A 2XRUA 1GY3A 4AKIA 2G2HA 5AIRA 1YW2A 1E1XA 4JBVA 3A4OX 4Q9ZA 1M7NA 4QTAA 3U8WA 2XNPA 2HXLA 5F1ZA 4WNKA 3QTZA 4CZYB 3CF0A 1PRYA 2J5FA 3WYXA 3VS6A 2D7EA 2JEDA 3SG8A 4I41A 3OW3A 5EDRA 5J87A 1FVVA 4ZSJA 2DS1A 2IVUA 4RIOA 3V76A 5D7VA 3DS6A 2PE1A 1H27A 4FIGA 3PE1A 2X0QA 4FEXA 3AC1A 1NT2A 1G4AE 3PE2A 3RGFA 4CFVA 4KINA 2X8EA 4GFMA 3ZRLA 2OK1A 4D82A 2C6LA 2YISA 2BRMA 2BHHA 1OTRA 3COHA 2CDZA 4WT6A 2WAJA 4F09A 2XEYA 2UW5A 4DITA 1VR2A 3GB2A 3SVVA 1HNZM 3VLFB 1AQ1A 1NV9A 2ZYBA 4NIFA 5E26A 3R8VA 3ZEPA 1B6CB 4QTBA 2JFLA 4FSRA 4JVGA 4HCTA 1Y6BA 4IFCA 3U54A 2X4AA 2X7OA 4NSRA 4IANA 1NXKA 3GQ3A 3SW4A 3V5PA 4CZUA 3D8BA 3K9OA 4LOPA 3MV5A 4A7CA 1TQPA 2UZBA 2UW4A 3BLAA 2YHVA 1DGBA 2F7EE 1Y6AA 4L44A 5IA5A 4L8MA 2VIIA 4TYIA 3CS9A 3LPBA 3WZUA 1FMKA 4LFIA 4FKUA 3GLHE 2Q0NA 4XG7A 2W96B 1K3AA 3QCQA 2CFOA 3QKLA 3U6HA 3HV6A 2XSZD 3BX5A 1GIJA 3H30A 3NSZA 1NNUC 3ZC7B 3SAVA 5JEBA 4FWDA 2R3OA 3SA0A 4AXDA 1OIPA 4RVMA 4O86A 2XIRA 5E9EA 3KC3A 1YSYA 2QVSE 4AXCA