1Y8GA

Catalytic and ubiqutin-associated domains of mark2/par-1: inactive double mutant with selenomethionine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity-regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 85
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1y8gA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y8gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y8gA01
4MNFA 2BZHB 3R1NA 5AM7A 4AGCA 5AP0A 4ZSAA 3E46A 2WGJA 3KCKA 4GMYA 4L53A 3C50A 5FXRA 2W5BA 5HVYA 1NVQA 2XIXA 3G33A 4CRSA 4U43A 1LEWA 3DK3A 2LTUA 2QU5A 4OGRA 2Y8OA 1OKSA 3LXLA 2OF4A 3PY0A 3QCQA 2YAKA 4CCBA 5CZIA 3TJDA 4DEAA 2PVLA 2ITTA 2AC3A 3BQRA 3EQBA 4NYEA 5CAUA 2ZTDA 3E8DA 2XIKA 4QYEA 4GU9A 3KRLA 5C26A 2BFYA 1FVVA 3LAUA 3BLHA 4LGGA 1APME 2P55A 5CQUA 3KXXA 4C37A 1ZWSA 2CWBA 4TNDA 2OFUA 3BV3A 3IOKA 1Q3WA 5ANIA 2ITVA 2E2BA 4D1XA 4RVLA 3DCVA 3RPYA 2W0JA 3DBFA 3ZXTA 4L42A 1OIRA 1UNGA 2XF0A 4GCJA 2JD5A 4ZMEA 5A6NA 4GK2A 2XM8A 2YM4A 4I1ZA 4XG7A 5EDQA 3FLQA 3VJOA 5DFPA 5ANJA 1SVGA 5A14A 5GZAA 3VHEA 4FV9A 4PF4A 3QUDA 4ZZNA 2QG7A 2PVKA 2C0OA 3EMGA 4FKVA 4QP1A 3UNKA 5J9ZA 4BY9E 5DH3A 4D58A 2Z7RA 4KKEA 3EJ1A 1UWHA 3ZO1A 5IMXA 3UZPA 3VBWA 5CQWA 1W8CA 1UV5A 3BU5A 5DR2A 4FEUA 3GQIA 1PHKA 4FOCA 4DGGA 3EQHA 4UXQA 3L8PA 5EYKA 3L9MA 3KB7A 4BIEA 3R9NA 4RC4A 3EQGA 4EJ7A 2XP2A 1IG1A 3OOGA 3A61A 3KRJA 5BQ0A 2VWZA 1XKKA 1UU9A 4WBBB 2G01A 3MH3A 5TE0A 3KXGA 1MP8A 3UOHA 1AGWA 1G8AA 5IQAA 2Y4IB 4DFZE 5HLNA 5DT0A 3CD8A 5FD2A 3A7IA 3OT3A 4V0GA 5K3YA 4ZJIA 1P4FA 3PXYA 4TYHB 4WUAA 4OT5A 3RPRA 3V5TA 4ANNA 4DFYA 4E6DA 3HRFA 3Q52A 5E1SA 4G16A 5FGKA 2R2PA 5HBEA 4ERWA 2DYLA 5LMBA 2HOGA 4QMSA 1QMZA 5AP2A 4IVAA 1FMKA 1XWSA 4XMOA 2W1IA 5D7AA 3V6SA 3LFEA 3ORMA 4IB5A 1OUKA 3G0EA 2JIIA 2PMOX 5CLPA 5E91A 4BZOA 4MEDA 5KE0A 1IFYA 4KD1A 4WSYA 5JGBA 1JVPP 2HZIA 1VEKA 5EQEA 2XKCA 3QZIA 3FE3A 5T3QA 5DRBA 3PLSA 4N0SA 5H8EA 4OAUC 2HIWA 1R39A 3O23A 4IBMA 2WEVA 3AG9A 2GU8A 4AOIA 4AG8A 5L2TA 4NM7A 2DENA 1TQPA 4XOYA 2ITUA 3FKLA 4CZUA 2YIYA 4OBPA 5JMSA 4A9SA 2FSTX 5DYJA 4LUDA 3QL8A 4IC7A 3E87A 5FDXA 2JDRA 5FBNC 4CFFA 5JFSA 5EKOA 1S9JA 3NCGA 3D7ZA 3FMEA 1R0PA 3RVGA 3SVVA 4XNEA 1PJKA 4O27B 4QYGA 4GL9A 2W05A 3HECA 3NMUF 2OKRA 4CFVA 3LXKA 3QA8A 4JR3A 3EZVA 4AXAA 4TYEA 2A1AB 2R3GA 4BWPA 3ATTA 5AMNA 5CS6A 4GKIA 4L68A 1ZY5A 3V5LA 5E8WA 3ZYAA 4ACCA 3E5AA 2YM3A 5L8JA 2IVUA 1SMHA 1V0OA 4QTDA 3AC5A 5IDNA 4H1JA 1SVEA 3PA3A 4RLKA 4BTKA 3TCPA 3ULZA 2GHGA 5LVLA 4E5AX 3V5JA 2C68A 2ONLA 1IA9A 3EN5A 1YW2A 4HPUE 3BZ3A 2WMUA 2ZDTA 3ZRMA 3JXWA 2UZBA 4NFNA 2J7TA 2C6MA 2EB3A 5CSWA 1OIQA 2VTTA 5CU2A 3VJNA 1W84A 4JOAA 3VUKA 3PYYA 3Q9WA 4B9DA 4IAZA 2X2MA 4FNWA 2QOHA 5EFQA 4FIHA 2QHMA 3M1SA 1S9IA 2FVDA 4DH1A 1SZMA 4IX5A 4YZDA 2HWJA 1BMKA 3CS9A 5IISA 2XK6A 4D5KA 3VUIA 2I1MA 2WMBA 3DFCB 4ANLA 2JY7A 2CPKE 5BVEA 1CKJA 5KMOA 5DRDA 1OTRA 2Y4PA 1H26A 2P2HA 3KCFA 4IAAA 2REIA 4ZLOA 2PZYA 2BHEA 2R3MA 3TKUA 4C35A 4C4EA 3EB0A 3ELJA 4MBIA 4TYHA 3SQQA 4BDEA 2VUWA 3G15A 4KNBA 3CCNA 2UVYA 2FB8A 4JBPA 5EI8A 3UPXA 5KMMA 4UYNA 5CAVA 4AA5A 4BB4A 5ACKA 4RFZA 4GS6A 2DHYA 5T6KA 2RRUA 3LFBA 3NPCA 3R2BA 4KIPA 3ZEPA 5JEBA 3AC4A 3MY5A 4EH3A 5KMIA 1G8SA 1OMWA 2CHLA 2Y9QA 4N4SA 2VAGA 5IQHA 4HYSA 3HA8A 4S33A 4PRJA 2DS1A 5ANEA 1ZOEA 3WIKA 2BWEA 3CJGA 1JSVA 2R3LA 3HVCA 3LCTA 3A60A 2C5OA 3GCPA 3HV4A 3O8PA 4H36A 4QMTA 1VDLA 5E8XA 5D9HA 1FVRA 3ITZA 2H96A 1UU8A 2YCFA 4NM5A 5AIRA 2G3QA 2IG7A 4FV1A 1SM2A 5FEDA 3FMLA 5AUYA 5HICA 2C6TA 4GEOA 4O2PA 3ZXZA 1ZY4A 5K4JA 1UVRA 4WKQA 3PTGA 4W9WA 4C62A 4D28A 3LW0A 4QP3A 5KBRA 5TT7A 3HEGA 4KRCA 1FOTA 3VVHA 4O83A 4IVCA 4J95A 5CAQA 2BHHA 4Y46A 2R3FA 4GVJA 4Y5HA 5CTPA 1CKPA 1JR3E 5KBQA 3MSSA 2XIYA 2VTJA 4QMOA 3ROCA 3S4QA 2VO3A 3Q6UA 5AEPA 3ALOA 5C03A 2EXMA 3GQLA 4JLCA 3FXXA 3FJQE 3CQUA 4FTCA 2WTDA 2GS7A 4O0RA 5AV1A 3ERKA 5HG8A 2PK9A 1ZLTA 5CF5A 3BBTB 4F08A 5IA2A 4FL2A 3EFLA 3NUXA 3GFWA 3P1AA 1AQ1A 1UNHA 5F20A 1MN3A 2ITYA 2QD9A 3VS6A 5BMSA 1QL6A 2W99B 3FV8A 5IQGA 2YM6A 2R4BA 4TYGA 3QRKA 4PL5A 4HYIA 1RJBA 3UP7A 4AFJA 4E4MA 3MTLA 3JY9A 4L7FA 1U4DA 4BDHA 4QNAA 4CD0A 3C5UA 1WBTA 3FEGA 5HKMA 2HZNA 3I4BA 3LHJA 2B9JA 4G17A 4GUEA 4O38A 2HZ4A 4UB7A 2XK4A 4L7SA 4BDGA 2CGWA 2PY3A 5BX0A 4F70A 4IFGA 3P86A 3DBQA 3GCSA 3K9PA 4IB3A 4M12A 1WAKA 3UJGA 3UIMA 3UC4A 3KN6A 4PPCA 3BHUA 4IC8A 3V5QA 3ZO4A 2PE2A 2YA9A 3W2PA 5I9WA 3W32A 3F88A 3OCBA 3QQFA 4AZEA 1HQYE 2NRUA 3MH1A 3I0QA 3R1SA 4DFBA 4GK4A 2ZM3A 2ZDUA 4BKYA 4OTHA 3R83A 3DQXA 4DINA 4GV1A 4HCVA 2O63A 2Z7SA 5JZNA 1QPJA 3MGYA 3S1HA 3I7CA 1YWVA 4FKSA 4GFGA 1CM8A 4I41A 3HMIA 2DKLA 2FYSA 2XK9A 5CAPA 1Q97A 1TKIA 3QRIA 3I6UA 4AZVA 5LVMA 4ORKA 2YM7A 3ENHA 5HO8A 4OTRA 2IZTA 2J0LA 1Q02A 2L4FA 2MGWA 2CGVA 3CXWA 4R8QA 3R8MA 4USEA 3BGZA 3FI3A 4KSPA 1TVOA 3PRIA 4E6CA 4HZSA 4YJTA 2EUFB 2JUJA 4FNZA 4XLVA 3BEGA 3DT1A 1UA2A 2BRMA 3UE4A 4XP2A 4E4XA 4E73A 1T46A 2NNWB 3UBDA 5E8SA 3VIDA 3H0ZA 4A4LA 4IJ9A 3FQEA 4I92A 4UMQA 1KE6A 2C69A 3QGYA 3KXMA 3RPSA 4HZRA 3LCUA 2LVOC 3EFWA 4GW8A 4EZ5A 4F1IA 4RX7A 4C7TA 5IH4A 2B9FA 3QLFA 5JQ8A 2UUEA 4BR3A 2Z02A 5BNJA 4DBNA 3FPMA 4CFNA 2O64A 4YJSA 4DYMA 2QURA 4F64A 1J1CA 2CGXA 2Q0NA 3QHRA 4OTWA 4HVIA 3B2WA 3R02A 2BTRA 3RI1A 4HEOA 3DY7A 4WG5A 3DBCA 3ZH8A 1Q8WA 3TZ9A 3LLTA 1ZXEA 2I0VA 4M8TA 3OTVA 4FKIA 4L45A 3PA5A 5AUWA 2PHKA 1XH4A 3M2WA 3QBNA 1VYZA 4UWCA 2DAEA 3BU6A 1JAMA 5BYYA 3VUTA 5IA3A 1WJ7A 3SXRA 4AP7A 1A48A 2JY5A 2C3JA 3D7TA 2GDOA 3ZFYA 1ND4A 3F2RA 2P4IA 4L43A 4C4HA 1TR8A 4YO4A 4GT5A 3S3IA 4M97A 3PUPA 4Y95A 4EH5A 4FGBA 4EI4A 5DFLA 3GENA 5C27A 3WF7A 3DA6A 1R4GA 4FI1A 1HT2E 4WRGA 4FC0A 1H1RA 2ZM4A 2RGPA 2MR9A 4FKTA 2QODA 4IVBA 5AUZA 3ZRKA 4BHNA 1NY3A 2X4FA 1GZNA 3Q2JA 3ZUUA 2VNWA 4L9IA 1Q24A 3FI2A 5BVOA 5J1VA 1WBOA 2X6EA 2G9XA 2HW7A 4PNIA 4QYYA 3HRBA 3D4QA 4QMZA 4KIOA 1XBAA 3QC4A 3UO6A 4DAWA 3VS0A 3TWJA 4L67A 5CEPA 1P4OA 5HNGA 1IEPA 2JFLA 4BCHA 4BCJA 1OKWA 4AW0A 3PPJA 5C4LA 2F9GA 2DAMA 4YJNA 3BHTA 3PXKA 4ANOA 5AV2A 3MVHA 3V3VA 4EHEA 4BTJA 1Y91A 2F2CB 3CLYA 4U6RA 2I0HA 5CT0A 3AD6A 3ZM9A 3DJ6A 4BIBA 3DBDA 3D2IA 2JKOA 4QOXA 3MPMA 2PMIA 1U59A 3FQSA 5DWRA 3S00A 1PKGA 5LVNA 5I3RA 4TWNA 3OTUA 3QTIA 4ZXTA 3WZUA 4EUTA 4EZ3A 4KB8A 4AN2A 4CMOA 4YR8A 2JDVA 3VQHA 2LVQD 4JG6A 4Q9SA 2XBAA 4XRJA 4BFMA 4O6EA 4ONAA 2VO7A 3VN9A 4IVDA 1OKZA 4MD8E 3IDCA 4R71A 3QRJA 4I5PA 4Z3VA 2OLCA 4L01A 3PJCA 1QPEA 4V04A 2J6MA 3H9RA 4E4NA 2WD1A 5H3QA 2BDJA 3NNUA 2CN8A 4L46A 1ATPE 2B9IA 3EN9A 4FV7A 5EHLA 4D9UA 1OQYA 3PG3A 3UO5A 2R3KA 2ZAZA 3BLRA 3O96A 4MAOA 3QLGA 3MH2A 4ACGA 3CP9A 3R7GA 5FM3A 3E7VA 2CDZA 3F7ZA 4FTQA 4OBQA 2WTVA 3LIJA 5LWMA 4LM5A 1ZYSA 4JRVA 3MS9A 4L44A 2GNFA 4I4EA 4AAAA 4A9UA 3CR0A 1KE7A 4EK3A 4O7SA 2GTNA 2BUJA 4X2FA 2Z60A 3HDMA 5CANA 3ATSA 4ANMA 1YDSE 2GS2A 1KE8A 3DLSA 3FMDA 3PVUA 5E8TA 4AW5A 4EHGA 3LJ0A 3V6RA 3FZOA 4C33A 4C4GA 3SG8A 5DR9A 4XRLA 3UIBA 4E3CA 3PP0A 2OW3A 4X0MA 2VWXA 4XBUA 5AAFA 5FP6A 3VS5A 3QQGA 4X3FB 4USFA 4E8AA 2NRYA 5FTQA 3LLAA 1HCKA 4U42A 3IK3A 4RGJA 5HG5A 5GINE 1DAWA 1YQJA 2QOIA 2ETKA 2ZB0A 3OVVA 4BI1A 2WTKC 2IO6A 3IW8A 2LAVA 3QC9A 2YAAA 3CY3A 3LCOA 4K9YA 2OU7A 4JDIA 4E7WA 3OWJA 3Q2MA 4QYHA 3GC7A 1Y8YA 4DBGB 2WMQA 2LGCA 1A06A 2OIDA 2PVMA 1PXPA 1OKVA 2VTPA 3QALE 4RWIA 4NSTA 4YZCA 3ZLWA 3FLYA 4A07A 4B99A 5BYLA 1KYIA 2WQOA 3KRWA 4FIEA 3UODA 3FI8A 1ZOHA 5CWZA 3KREA 2JNHA 3GLIE 3P7BA 4L00A 1L3RE 4UEUA 4FIFA 5EHYA 1YHSA 3RPVA 4GSBA 3UZRA 3A4OX 3VUGA 1F5QA 3VS1A 3NAXA 4IDVA 3A62A 1R78A 3N9XA 2C6IA 3NNXA 2WIHA 5LJJA 3C5IA 3LCDA 4M66A 5L2WA 4IZ5A 2JY6B 2PVNA 5BUIA 3E93A 3W18A 3DU8A 2ZV7A 4W4WA 4W8DA 2W4KA 1DM2A 3HV7A 1OL1A 4UMUA 4CLJA 3B2TA 1M2PA 3FLZA 4BCFA 5I4NA 3FC1X 4C38A 3DKGA 3GCUA 2QKRA 3EZRA 4XEYA 2I40A 3MMPA 4O91A 4DCAA 4YLLA 1OGUA 3S0OA 3EQIA 3W10A 4DLIA 3QUEA 4QPSA 4A9RA 3GU7A 3W16A 2YISA 5F9EA 3KL8A 3SKCA 3CJFA 2XK7A 1JSUA 2B9HA 4AGUA 3NW7A 3FMMA 2ITXA 3NSZA 4FOBA 4UMTA 5H8BA 4D4RA 3OW3A 4FG9A 5L8KA 2ZTCA 4FSYA 4PPBA 4ZMFA 1T6OA 1T43A 2PVYA 4QO9A 2GNHA 2Q0BA 2NO3A 4QP8A 1J7UA 3BBZA 5HLPA 3OCSA 2ONLC 1I09A 2E9UA 1GZKA 4PP9A 1CTPE 2GFSA 2IVSA 4FL1A 4YHFA 4FSMA 2V62A 5EW3A 1E94E 5EHOA 1H1QA 5ETCA 2KHHA 5CEQA 2QO7A 3F5GA 5AUUA 3ZLYA 2WAJA 4QPAA 5K9IA 1TQMA 4K77A 4JIKA 4ZSJA 3ZFXA 2X9FA 1VEBA 3KULA 4MF1A 4QPMA 4BDCA 5AADA 3C0IA 2W7XA 3OFMA 4CKRA 3U6IA 4FKWA 1B6CB 2QQ7A 4G3FA 5CXHA 4DCEA 5A4QA 1Q61A 3ENMA 3G0FA 3JVRA 4FZ7A 4DN5A 4UMPA 3WYYA 1LUFA 3TZ7A 4F9WA 2A0CX 2Y4IC 4X3FA 3RM6A 3ZBXA 1GNGA 3ORXA 5L2QA 2UW7A 3A99A 2UZVA 3LKMA 3BX5A 3P79A 3MESA 3R28A 4X6RA 2DUVA 3LFQA 3ZEWA 3UPZA 3F66A 2BZJA 4XCUA 2IJMA 3UOKA 3WZKA 4BI0A 3CC6A 4IZ7A 4C59A 2IWIA 3MYGA 4BDFA 5EKNA 1VEJA 3UVPA 4ASEA 4FIIA 5JFVA 4JS8A 4NK9A 2QONA 2HENA 1M17A 4GFOA 4AZWA 4EKLA 3TIZA 4BBMA 2RG5A 4U7ZA 4ZSLA 1PKDA 2QI8A 5DEYA 3ZC5A 4EZ7A 5I9ZA 2XCHA 3MFSA 1YWNA 4EH4A 4FEXA 2IVTA 5ITAA 3BGQA 4F9YA 3HMPA 4P5ZA 1PXJA 2EVAA 4L3JA 2XB7A 4BBEA 1O6YA 5IPJA 3CSVA 4U81A 3FMKA 3DKOA 3QA0A 3C0GA 2A2AA 1MRUA 1YWRA 4NH1A 3OCGA 5M07A 3PVBA 4EONA 3CGOA 3LQ5A 4FV2A 4BGGA 2VTLA 4G3DA 5IA5A 4ZIMA 5EM8A 2QO2A 3QD4A 5A4EA 3EOCA 4JL9A 4LMUA 4O84A 3EYHA 2ZMDA 3JPVA 4AWIA 4MXYA 4C4JA 4O7LA 1RW8A 4D4SA 5CNOA 2CCHA 2R3QA 5DE2A 2XNEA 4ZSGA 5B2LA 2VV9A 4OLIA 5HBHA 2G15A 3EN6A 3RK5A 1XBCA 3AMAA 3UMXA 3EQFA 4AW2A 3TZ8A 4M84A 1Y6BA 3PJ2A 2CN5A 1LEZA 3JS2A 4PY1A 4TT7A 3FKOA 5EDRA 3N4VA 4EHZA 3CEKA 2DQ7X 2OZOA 5EM6A 2GNJA 1JSTA 5I9UA 2CKEA 5A4LA 3NS9A 2PMLX 4QTBA 4WHZA 4HGSA 3NW5A 5HNBA 4IDTA 3EQDA 2ITQA 4IWOA 2FH9A 2ZOQA 3QYZA 2F49A 3MVMA 4CV8A 2HXQA 2PVJA 2YM8A 3QTQA 2X7GA 2C1BA 4FNYA 3QTSA 3ROYA 1W0XC 3C13A 3DJ5A 4KIKA 5K5XA 1BX6A 3TL8A 2Y7JA 2GNGA 2UZOA 5AP3A 1M2QA 3ZC6A 3OCTA 5J87A 4U8ZA 4BDDA 5JH6A 4F6WA 3GGFA 2JDTA 4M14A 4PV0A 2BIYA 4D2SA 3C4EA 5E8YA 3FRIA 1H27A 3V51A 3VF8A 3NRMA 4JBOA 2XKDA 3CY2A 5IMEA 4J98A 1XR1A 2BCJA 2F7ZE 3C0HA 2QOCA 1KOBA 2WTCA 4I6BA 4DLJA 4O7TA 4AT5A 4XS2A 4O2ZA 4MF0A 3P0MA 3Q4ZA 4GG5A 3OC1A 1Q8YA 5KMNA 2BKKA 2RFNA 3CQEA 2IPXA 3N4UA 4FG8A 1Q5KA 4MHAA 5EYMA 3P78A 5KMKA 3C9WA 3V8TA 4FTNA 5GNKA 2UW9A 2P2IA 3TNQB 1E9HA 3FMNA 2XNNA 2YITA 3IHPA 5M53A 4YZNA 5DPVA 3FPQA 3CPBA 5DIAA 3VUHA 5IA4A 1MUOA 4BGQA 4RZVA 4RC2A 2W5AA 5LWNA 3WE8A 3LM0A 4QYFA 4YC8A 1BVSA 5C01A 5F4NA 3C4FA 3MIAA 5EM7A 4C2VA 3BYMA 5HNIX 5HU3A 2KTYA 4HGLA 4Q9ZA 4E6QA 2ESMA 3OF0A 2GFCA 2GPHA 1R0EA 1V0BA 4MH7A 5KZIA 3TDVA 4KBCA 4JJRA 5C8MA 4JQ7A 1OUYA 1P2AA 1PW2A 4TWPA 4DGOA 4GYIA 4B8LA 5JKGA 5KKRC 2YIQA 3DFAA 4RIWB 4QQ5A 4YJVA 4M0YA 3ZDIA 4F9AA 5CEKA 3FYJX 3FZSA 2XNBA 4UWBA 4BCIA 5ANGA 5G1XA 5CASA 4KBKA 2FSOX 2KNVA 3Q9XA 4QP6A 3HAMA 4V01A 3KRXA 2CKOA 3JR1A 4IHPA 3E3PA 2RFSA 2EXEA 3TACA 4O0SA 4ZK5A 4WOVA 4FL3A 4FKPA 4ZY6A 1IASA 4M69B 5M55A 5TKDA 2OICA 1YXTA 4FSQA 2WU6A 4FV4A 5JI2E 3TI1A 3FMJA 5ANOA 2J0JA 5E4HA 3IW6A 4PUZA 4G1WA 1R1WA 2G1TA 4MCVA 4C36A 4Z55A 2WNTA 3K5UA 3FC2A 4ZEGA 4CXAA 3HNGA 2BR1A 4FIJA 3IPHA 1F0QA 1SVHA 4I3ZA 4NW6A 2PUUA 4FMQA 2JKQA 2UZWE 2ZV9A 4K11A 5GZ9A 2ZB1A 4RWJA 4ZY5A 2B0QA 2CKQA 4EC8A 5M44A 4D9TA 3QXPA 3D14A 1XHAA 2P3GX 3R30A 1FINA 3SA0A 5DOSA 5KZ0A 5M4CA 5B7VA 5EQYA 5EOBA 5C8KA 4MXOA 2WQEA 2Y6OA 2AUHA 4LG4A 3ZU7A 3D9VA 4FE2A 1BLXA 1O6LA 2F4JA 2X6DA 3A7GA 3R21A 4JIAA 4A4XA 1TQIA 2RG6A 4B4LA 4QMNA 4MVFA 2RKUA 4HNFA 2HWOA 4ZS0A 4A9TA 1YXXA 1PMNA 3MVLA 3O51A 3LCSA 2XKFA 4MQ2A 5L6WL 3D5XA 5LVOA 2V22A 1OL2A 3C4WA 4DGLC 1QPDA 4CRLA 5J5TA 2XIRA 1QZEA 1H0VA 2ITNA 3LJ1A 1V0PA 1RQQA 1G3NA 2QOFA 2O0UA 1MRYA 4FTLA 4FR4A 2IZRA 4IWPA 5HGIA 5M4UA 3EHAA 5KUPA 1H07A 3ZFMA 4GIHA 3NNWA 3ZRLA 1DI9A 2C3LA 4FT3A 4JAJA 5AP5A 2AYPA 4YNOA 3NUSA 4PMPA 4FEQA 3PY1A 5HO7A 4JRNA 4M15A 2PYWA 3TUDA 3T6PA 4FSZA 4ITJA 4R1VA 2CMWA 2C5NA 3DK7A 3GT8A 2XIZA 2GMXA 2XH5A 5CALA 2BMCA 2OI4X 1TTEA 3KN5A 2B55A 3Q4UA 3OD6X 4NU1A 5D12A 3MPTA 4YZMA 5CY3A 3IECA 3HRCA 1V92A 4Q5EA 4YURA 1URWA 4G6LA 3BYVA 4Y5QA 3NX8A 4YSMA 4EJNA 3TKIA 3VS2A 4RIWA 4BRXA 5M51A 3I79A 5KNJA 5HIBA 4I22A 4D55A 4XLIA 1F4IA 4F6SA 1Q3DA 4P2KA 4FBXA 3R8VA 3FYKX 2OBJA 3HMOA 4I24A 2Z8CA 2W1FA 5A4CA 1OBDA 4KRDA 2ZJWA 3KF4A 3PLAE 3LFNA 3GCQA 2BVAA 2VO0A 2PE0A 3LMHA 5I9VA 3MV5A 3RNIA 4LRMA 3L9PA 1REJA 3GVUA 3Q9ZA 3QYWA 4M69A 4II5A 4O6LA 2XYUA 4BWKA 5CU6A 2W17A 3R71A 3R9RA 3EFKA 1H1SA 2W1GA 4CG9A 4DEEA 1WBWA 3MFTA 4S31A 3FHIA 5EYDA 1JKKA 3QFVA 2QKWB 2VU3A 1OL6A 3POOA 4N6ZA 5FEEA 3SX9A 1JQHA 3QKLA 2VTSA 4GIIA 2VWWA 2GQRA 3NWWA 5FBOA 4ZAUA 1DI8A 4ANQA 1OL7A 4AUAA 1X8BA 4DFXE 3HX4A 3EH9A 4ZLYA 3SG9A 4BGHA 2BFXA 4G3EA 3HYHA 2W1EA 2XCKA 3ZMMA 4IX4A 4D2PA 4WP2A 4DG2E 3V5WA 3LM5A 2R5TA 5AM6A 4ASXA 2QVSE 2E9PA 3OY3A 3PXFA 3GU8A 4OTDA 5JZJA 5BVFA 5IG1A 3ANRA 4DH8A 3NDMA 4C3RA 2WMXA 2YIRA 1GIJA 4RA4A 1OKYA 3GUBA 4NM0A 2Z7QA 3I5NA 4AQCA 1REKA 3EL7A 4R5SA 4MX9A 4YHJA 3Q96A 4C8BA 2VX1A 5M56A 2YZAA 4J71A 4ZTLA 3MN3A 3ZSGA 1YRPA 4CFMA 4ZY4A 2QCSA 1SNXA 4G3GA 1E1VA 4YUQA 3D15A 5TF9A 4D0XA 3GBZA 3EN4A 4NKAA 5KKRB 4U45A 5M4IA 3F6XA 1VEGA 4ZOGA 2VWYA 2OK1A 5IDPA 2FO0A 2V7AA 4WA9A 1SNUA 2NP8A 5IA0A 2RL5A 4FT0A 3T9TA 2FSLX 2YCQA 2XEYA 5ANDA 4WNOA 5HVKA 5DMZA 4AFEA 4ZTRA 1OITA 3FXZA 3ORIA 4QMYA 4FTOA 3TN8A 3GCVA 1ZYDA 2XK3A 3QTUA 3OUNB 3LFDA 3VBYA 3OWPA 4QMLA 5CF8A 3BE9A 3L1SA 3MWUA 4EH7A 1H1PA 4RJ5A 4J7BA 4MKCA 4Q5HA 3SHEA 4HVDA 3D7TB 3FL5A 1KOAA 2YIXA 2B1PA 4F7LA 4S30A 2H8HA 5DT3A 2WO6A 4GEWA 3O0GA 3RJCA 2JZ0A 4P90A 1KE5A 4RIYB 4FTIA 4P4CA 3KMUA 3NVMB 4RJ4A 3U87A 2C3KA 4Y85A 3GOPA 5FTGA 3OBGA 4JT3A 4APPA 2EU9A 3R00A 1H08A 3MVJA 5L2IA 5D11A 1ZOGA 2YCSA 5HD7A 1JNKA 3JY0A 2JIUA 4U79A 2ERZE 4HPTE 4CZTA 4Z7HA 4S32A 4CG8A 4FKLA 1Q8ZA 3O17A 4PQNA 3QTWA 3V04A 4FT9A 4LL5A 3ZLSA 2R3PA 4EK6A 1WCCA 2AC5A 3ULIA 2JAVA 4X3FC 2ZVAA 3ETAA 5J79A 1OI9A 2UW6A 2VTQA 4N6YA 4AZTA 4NWMA 5HLWA 3VQUA 4CT1A 1ZARA 2WELA 3ACJA 4FICA 5CI6A 4O0VA 4I93A 3A4PA 4ACDA 4FKJA 2OJGA 4O0YA 2R64A 3M42A 4Z9LA 3R7OA 3T9IA 4D1SA 3PXZA 4O7RA 2IVVA 4DT9A 3FSKA 2BRHA 3R2YA 5KO1A 3WF9A 2KULA 4YTHA 1H01A 2B53A 3QZFA 3RTPA 5DEWA 1PXIA 4DTAA 2XVDA 3CIKA 3QWKA 3V8WA 4CT2A 5A4TA 3UOLA 2VZ6A 3QAME 4FK6A 4QNYA 4CMUA 4DH7A 4E20A 2XNMA 3OW4A 4ACHA 4XG3A 3PA4A 1WGLA 4D5HA 4HYUA 1FGIA 4BZNA 3MH0A 4I5MA 4W9XA 2VTRA 5EK7A 3FQHA 3WOWA 3ZZWA 4TW9A 3VO3A 3TNWA 4YTCA 2KNZA 3Q04A 3VUDA 4O22A 2VWVA 4CZYB 4MYGA 3A7HA 4ZLZA 1HT1E 2E9NA 3I60A 2YEXA 1ZMWA 3Q5IA 2WZJA 4P5QA 4CFXA 4YHTA 4QTCA 2HK5A 4RX9A 4PNKA 1CKIA 4AT4A 4BYJA 4LMNA 4CLIA 4JBVA 3QTRA 3IG7A 2ZM1A 4KS8A 4XV9A 1PXMA 3R01A 3FZTA 3TZMA 3DS6A 1XO2B 2EKFA 5AP7A 5HESA 1OAIA 4FT5A 4GVAA 4UWYA 3P23A 2VN9A 3LCVB 2XS0A 3LPBA 3R04A 4L52A 4QMPA 4EQUA 2R0IA 2QC6A 5J9YA 4IAFA 3HP2A 1IM2A 3FHRA 5BMMA 5J5SA 3LE6A 4IWDA 4G6OA 4PL4A 2VTMA 4PMSA 2O8YA 4TNBA 2Y6MA 4RIYA 3FWQA 1BL7A 4FV3A 3LQ8A 1ZMVA 4RFYA 2VTAA 4BICA 2WQNA 3GP0A 2BRNA 3NYNA 2LVAA 2BRGA 2C1AA 2YJRA 1FGKA 3IDBA 3EIDA 4PPAA 4C61A 4B6LA 5BUJA 5DN3A 3I0OA 3NCZA 3PJ3A 3RHXA 3QD3A 3NIZA 3RK7A 2ACXA 4BDKA 5J8IA 1XH8A 4LFIA 5HORA 1RE8A 3C4CA 2C0TA 5FEQA 2CCIA 2QR7A 4LRKA 4LOOA 1H24A 1PF8A 3PXQA 5DBXA 3WZJA 2X8IA 4K33A 3MJ2A 3PIYA 5HOAA 5JSMA 4LRJA 2F57A 3OXIA 3TV6A 1WVXA 3UOJA 3NR9A 2C30A 3UNZA 5CEIA 2ETMA 4AA0A 2F7XE 4MXAA 3E62A 3B8QA 4QMXA 4D2TA 1Y57A 3H10A 3F82A 1BI7A 4FYNA 4KAOA 4KA3A 4N70A 2PZ5A 5HE2A 4WG3A 3UIUA 1DV0A 4NIFA 5EI2A 1CDKA 2YLFA 1GO5A 1XXHE 3FDNA 1UFZA 3TT0A 4XV3A 4DH3A 4EH6A 4MXXA 3F7WA 4PTEA 5BVDA 1J91A 3W55A 2C5VA 2I6LA 3DKCA 4D2VA 5BYZA 4ZTHA 4PWNA 3RPOA 5CSPA 4JDKA 4DF3A 3KGAA 3QQUA 3GC8A 4K1BA 3O7LD 2OJFE 2VX3A 2XNGA 4TRLA 3GU5A 4EQCA 3QU0A 3RP9A 4DITA 4O7YA 3QUPA 4JI9A 2X7FA 4R6VA 4RLLA 3WF5A 1PMEA 3GLGE 2W1ZA 3KA0A 4U0IA 4K18A 2XK8A 4JXFA 1URCA 5EYCA 4FTJA 3MJ1A 4NKSA 3HUCA 4X2NA 5JFWA 2WTJA 5F95A 3H0YA 4RVMA 2P33A 4G9RA 5B2KA 3EN7A 1H4LA 3UVRA 2PWLA 4I20A 4IACA 4S2ZA 1K3AA 3UQCA 1G4AE 3B8RA 4G31A 4NT4A 1U5RA 3LFCA 2F7EE 3A2CA 4AS0A 4IWQA 3CKWA 4UZHA 4D4YA 3KULB 1Q62A 3PPKA 4E1ZA 3AC2A 5IUHA 1BYGA 4J99A 3K3IA 4EBWA 2ZV8A 2H9VA 3E3BX 3MW1A 2DAIA 3FL4A 4FTUA 3HGKA 2BAJA 2DAKA 4ZZOA 3W8LA 4RA5A 2JP7A 1U5QA 3E7OA 3O8TA 4R3CA 2C6LA 3THBA 2OJJA 5LQFA 5CNNA 1ERKA 5LXMA 3C51A 3KMMA 3TNIA 4CEGA 1DO2A 4OR5A 2CJMA 5DG5A 4IH8A 2GQGA 4DC2A 3R8UA 5AV4A 3P08A 4LL0A 2C5XA 3E92A 5ACBC 2OG8A 5CENA 3RBWA 3RINA 4ALUA 2ITPA 4BBFA 4QMQA 3ZCLA 2EXCX 2BTSA 3FZ1A 1Q99A 3I1AA 1VZOA 1ZZLA 4CCUA 2BZKB 1KV2A 3DBEA 2OXDA 4RC3A 4TY1A 3AC3A 2BPMA 1M7NA 4EWHA 1GIHA 2A4LA 2JKMA 1UKHA 3OT8A 4C4FA 3MIYA 4MWHA 4FKRA 2OJ9A 4FX3A 3HV3A 4ZJJA 3COKA 4A7CA 4EOSA 3RWQA 1KSWA 3IW5A 3DGKA 5HE3A 3DXQA 2QHNA 3L9LA 2PSQA 4EUUA 4BCOA 1IXSA 2RSVA 2QOBA 2PU8A 3BI6A 3A7JA 3BHYA 3DJ7A 5B2MA 4ENXA 2UZTA 3CGFA 3NAYA 2I7QA 3DB8A 2IZUA 4K2RA 4BZDA 4CKIA 1YOLA 4E5WA 2A19B 1XH7A 2J0MB 4XUFA 2BALA 3OUKA 2CP8A 1PXKA 2OXYA 2GHMA 2VTHA 3POZA 2XMYA 2R3JA 3VUMA 4JG7A 4R7BA 4F0FA 4EBVA 4F7NA 2O65A 3LZBA 4U97A 5AX3A 1IAHA 3CTHA 4QTAA 2EWAA 4JBQA 2J4ZA 1LR4A 4F0IA 5CU0A 5HX8A 2GSFA 3TEIA 3BGPA 4LV8A 4CQGA 4OTQA 2BKZA 3QZHA 3AT4A 4YJPA 1PYXA 4H3BA 4UX9A 4F09A 4DT8A 1Y6AA 3RK9A 5HI2A 1YHVA 1A5TA 4OTGA 3W2SA 4ASZA 3F2NA 3VS7A 5M09A 4GG7A 4H05A 3DNEA 3NUUA 3NUYA 4KIKB 3SV0A 4BC6A 5LVPA 5B0XA 5L3AA 5KHWA 2X1NA 5EH0A 4BDAA 3VW8A 2XYNA 4MXZA 1W98A 3BV2A 5IQIA 4YC6A 1WHCA 2C5YA 2YABA 1WBPA 4PL3A 2C6EA 3DAKA 2BRBA 3QQHA 4IZAA 5FDPA 4PDYA 4WT6A 3W2OA 4XP3A 5A3XA 4AGWA 2W5HA 3BHVA 2VNYA 3VWAA 3U6JA 2K0BX 5HIDA 3FMHA 4E6AA 3JYAA 2QU6A 4R7IA 4E5BA 4M0ZA 4X2JA 4FVQA 4K6ZA 3ZO2A 3Q53A 3LQ3A 1CSNA 2UZLA 5LARA 2X39A 3F5PA 4QP4A 4QT1A 4CYJA 3R6XA 5CX9A 4H1MA 4KKGA 4QP9A 4ZP5A 4R3PA 3UYTA 3VS4A 4DTKA 4BN1A 2UW3A 3SXFA 4D0WA 3W8QA 3AC1A 4KSQA 3QX2A 3QX4A 4FT7A 4BCPA 5F94A 5JT2A 2CNQA 4HCUA 2HY81 4G6NA 4RIXB 4DHFA 3FLNC 2PULA 4HGTA 4BDBA 3Q32A 3PFQA 4M67A 4NEUA 5GJDA 2JGZA 4IM0A 2RIOA 3PWDA 4GFMA 3GLFE 2JEDA 3GU6A 5T68A 3DTCA 3E64A 2GNIA 3AXWA 5AR8A 3UGCA 5M57A 4M3QA 4FZ6A 2W1HA 3R8ZA 4W4YA 4IE9A 3K2LA 4IANA 4RRVA 3SC1A 2XKEA 2J9MA 2QHOB 4HVSA 2OOAA 4U41A 3C1XA 4EK5A 3ORPA 4R78A 3QTZA 4RBLA 4G5JA 4DFLA 1ZMUA 4O7ZA 1OL5A 4I6HA 3VRYA 2QOQA 1A9UA 1W83A 4WBOA 4X2GA 4WIHA 1F3MC 4KKHA 3E21A 4U3YA 3PE1A 3RAHA 4XP0A 4L8MA 3ZDUA 4B0GA 4U9AA 4YSJA 3LFSA 3HP5A 4Z16A 3QXOA 1XH9A 5L4QA 4F65A 3H30A 4UN2B 2Z7LA 5KX8A 2LBCA 3HA6A 1UNLA 1KUTA 1LP4A 3GI3A 2PVHA 3AQVA 4O1PA 5EG3A 4BDJA 4CV9A 2C4GA 3MFUA 5E9EA 2I0EA 2O2UA 4YJQA 3SOAA 3RWPA 1C7YA 5DI1A 4TL0A 4RWKA 5EDPA 3I7BA 4RVTA 5AX9A 4XV1A 3ZLXA 1M14A 5K0KA 4HVHA 2EB2A 1Q8UA 4HNIA 3UDBA 3OWLA 3K9OA 4FKQA 3FBVA 2LVPC 3GEQA 4YNEA 5HCXA 3ZO3A 4PP7A 3F5UA 2PZRA 4ZSEA 3RNYA 2UZEA 3U4UA 5GZ8A 2YN8A 4TZRA 2FA2A 4NL0A 4JX7A 4F9BA 2VRXA 2BROA 4PDOA 3N51A 3UIXA 5IH5A 5I0BA 3SW7A 3OEZA 4X6QC 3ORLA 4E4LA 2XJ0A 3HAVA 5TR6A 4W8EA 2C6DA 4EOPA 3NNVA 4LI5A 2R3NA 4FV0A 4F4PA 2X0GA 3S2PA 4FG7A 2V0DA 2JITA 3OHTA 4DG3E 1XQZA 2LVNC 3PXRA 4AX8A 2GCDA 2JKKA 3ODZX 3Q3BA 2XRUA 4NJ3A 3CQWA 2JBPA 4O0WA 5CSHA 4AE9A 3PE2A 5L2SA 3W2CA 2XBJA 3DDPA 4JR7A 1SG9A 4QRCA 3TUBA 1GZ8A 1OZ1A 3NIEA 4RVKA 3AT2A 2WOTA 2RFDA 1T45A 2UZDA 5CI7A 5E8VA 4GH2A 5GHVA 4I23A 2QO9A 4XOZA 2IW8A 3R9HA 3G9NA 2WB8A 3H9OA 2ITZA 3HDNA 3K5VA 3LMIA 1OPKA 3LMGA 5EW9A 4MBLA 4RIXA 1Q4LA 4LQMA 4S34A 4MD7E 2HYYA 3CD3A 5D1JA 4ITIA 3QQJA 5JGAA 3BPRA 1XH5A 4FZFB 4OW8A 4RIOA 5EW8A 2DZLA 4DEHA 4CFWA 5JQ5A 3SW4A 2YACA 5LMKA 5JN2A 3FSFA 1GZOA 2YDKA 3R0TA 2GTMA 5J9LA 3BHHA 4RT7A 3GC9A 4O86A 1ZV1A 4W4XA 4EQMA 3DDQA 4AE6A 1O9UA 5HE1A 4EOOA 5I9XA 4OBOA 2W96B 4CMTA 2Z2WA 4OTPA 2W06A 4FUXA 3NUNA 4TXCA 1OPLA 4RG0A 5IU2A 1WGNA 4O1OA 1STCE 5AUXA 2WTIA 1BUHA 3GOKA 3T3VA 3IONA 5FM2A 3G51A 2H6DA 1ZYCA 5BVNA 1NW1A 4NTSA 3E8CA 4F7SA 4GKHA 2WFYA 1DS5A 4WNMA 5EOLA 2R3HA 5CAOA 4Y73A 4QD6A 4CSVA 5JRQA 2YZLA 4MNEB 3PJ1A 1G41A 3EQRA 3ZUVA 4QQTA 1OECA 2BDFA 2V7OA 2WPAA 3WILA 4PDSA 4M68A 3BYSA 4BCKA 5H2UA 2G2IA 2J5FA 3RM7A 4EOLA 5HQ0A 1MQ4A 3BIZA 3C4ZA 4EOQA 5IQBA 3BKBA 4H3PA 4FA2A 2QSFX 3C4XA 5CSVA 3F2AA 3ET7A 2BIKB 4K0YA 4ENYA 2UVZA 1KWPA 1Z9XA 3FXWA 5HTIA 2W9FB 3AC8A 2UVXA 4FSUA 4H39A 4W4VA 4YJOA 3VBXA 3CE3A 5H9BA 4EYJA 4UN0C 2W4JA 4H58A 4F7JA 4MQ1A 1Y8GA 1WZYA 3BBWA 5FTOA 5EM5A 4AGDA 1FMOE 2PTKA 5A9UA 1B38A 3FLSA 4KIQA 4GUBA 4DH5A 1JWHA 4YJRA 5FRIA 2XJ1A 4JX3A 3KXNA 4XG9A 4E93A 2XRWA 4EKKA 1XB2B 4RX5A 5C4KA 4Z7GA 4P7EA 3H3CA 3EQCA 4EL9A 5TOZA 5J1WA 3UVQA 2BWBA 4DE4A 5AR4A 4AU8A 3D5UA 4XH6A 4JQEA 4YZ9A 5HE0A 3P9JA 4JDHA 2E9VA 3G90X 3P4KA 2MJ5B 3PP1A 2UW8A 3PPZA 4RPVA 4XG4A 4ALVA 4AT3A 4O7VA 3QRUA 2HW6A 1G3IA 3A8XA 1P14A 1UU7A 1LPUA 5HVJA 3FAAA 4AA4A 5ICPA 2PUPA 3P7CA 3D83A 2WMWA 2UW4A 5LCKA 3AGLA 3KXZA 4DGNA 1JLUE 4Y83A 3BLQA 1UKIA 3KU2A 4QQCA 1JOWB 1O6KA 3R63A 3WBLA 3BELA 2L2DA 2WOUA 5AUVA 3OMVA 2JLDA 2XEZA 1M52A 1GJOA 2BZIB 1XBBA 2B7AA 3GU4A 2OZAB 5CT7A 4F0GA 3Q4TA 5AJQA 3U4WA 2YWPA 3DXPA 4IAIA 4TPTA 3ZZEA 5BVKA 2W1CA 3MA3A 2R0UA 5L8LA 1XH6A 4FTKA 4AF3A 2UW0A 3BQCA 4F2LA 4AOJA 3QCYA 4LGHA 4TWOA 3SGCA 3LOKA 4DFUA 4X7QA 4D4VA 3GFEA 3S95A 3Q5ZA 4AACA 2BAKA 2JDSA 5CYIA 4FGRA 3EWHA 3QHWA 5E92A 3NGAA 5AR7A 2J2IB 4DEIA 2A27A 4I0TA 4BKZA 4XG2A 4YLJA 5IUGA 4MNEA 5FP5A 4LV5A 3F3VA 3FZRA 4MK0A 4C3FA 5K5NA 1IRKA 4QMMA 4KBAA 4EYMA 3ZBFA 3ZSHA 3R8PA 4IADA 3RAKA 4DA5A 4U5JA 2IN6A 4R1YA 5AP4A 3F92A 4EK8A 3TUCA 4IXPA 5I5ZA 2X9EA 5E8ZA 3W2QA 5E7RA 1RDQE 4CFUA 1K2PA 4RZWA 4APCA 4M13A 3H9FA 5FG8A 4FTMA 3PG1A 2I0YA 2OIQA 5HCZA 3TNPC 3BYUA 2V55A 5AR3A 5CVHA 4IZYA 4FK3A 2YJSA 3MPAA 5G6VA 3VULA 3P7AA 2X2LA 2PZIA 4WSQA 5LCJA 2R3IA 1NV8A 3OWKA 3G5DA 4EOIA 4R77A 4IAKA 5HEZA 4EEVA 1YHWA 3CTQA 1QCFA 3L8VA 4OUCA 2YHVA 2OOBA 2J0KA 3PWYA 1WBNA 4YGAA 4C34A 2OF2A 4FKOA 4R3RA 5EI6A 5M08A 2VTOA 3O2MA 3RGFA 2VO6A 2JAMA 4GJ2A 3KVWA 1PRYA 4IM2A 1H1WA 2WEIA 3E88A 2H5XA 2WTWA 3FKNA 4K8AA 2PL0A 4UYAA 1V1KA 4L3LA 2PZPA 1ZYLA 4NM3A 4USDA 5IKWA 3COMA 3DV3A 3Q6WA 3SOCA 5HBJA 4CGAA 3HUBA 2O25A 5AFVA 1Z57A 3AMYA 2XM9A 1AD5A 3Q60A 4BKJA 2IZSA 3O7LB 4GYGA 1KE9A 3MB7A 3R9OA 1H25A 4BDIA 1OVEA 1PXOA 4I0SA 2VWBA 3DZOA 1OIUA 2VTNA 2CLQA 2WQBA 4RQVA 4RX8A 4FUYA 2X8DA 3FY2A 2OZAA 4CNHA 4I6QA 4YPSA 3OY1A 2H34A 2HWPA 2QOLA 3K54A 4BIDA 5KMJA 4IX3A 3VC4A 5JK3A 4XV2A 4DTBA 3LCKA 3R8LA 1PY5A 2CNVA 3NVKI 2BILB 4GJ3A 1U54B 4IW0A 4OTFA 3OEFX 5BVWA 3ZM4A 1ZZ2A 3HMNA 4WUNA 3M11A 3G6HA 3TKHA 4A9YA 3FRHA 3BCEA 4PMMA 3TV7A 2GS6A 4AZFA 4D1ZA 1YOMA 3QTXA 3R1QA 1YXUA 3SD0A 3VRZA 2ZYBA 3JVSA 4LGDA 4CTCA 2DWBA 4FSRA 3MBLA 4XBRA 4ERKA 1BKXA 2RFEA 3FZPA 5FWKK 4O0TA 4C2WA 4Q2AA 5AV0A 1M2RA 4U44A 4XG8A 2QLQA 2XA4A 2EJSA 1NVSA 3TTIA 4UALA 3DQWA 3PZEA 4DG0E 1K9AA 4O7NA 5DA3A 3SLSA 2OIBA 2R7IA 4XG6A 3CKXA 4QTEA 4FTTA 4IJPA 5TO8A 5AP6A 5HIEA 1OM1A 2IW6A 3D2KA 4OAVB 3VBVA 3HMMA 3A8WA 4YJUA 5HD4A 3MB6A 4YBJA 5HTCA 1WIVA 2OFVA 2Q83A 1BI8A 2PPQA 4G3CA 3EYGA 2PUNA 3ORKA 4F99A 3N4TA 4H3QA 1WBVA 3ZONA 4IIRA 3F5XA 3PVWA 1YI3A 4TTHB 3TIYA 5E8UA 1W82A 5I3OA 4O96A 4RJ3A 3BU3A 3DAJA 3F3UA 3VW6A 4G5PA 5HHWA 4ACMA 2J0IA 1OIYA 4GT4A 3D5VA 3HKOA 1VJYA 5LMAA 2WQMA 4UXLA 2ZV2A 2VWUA 5FLFA 2QOOA 4FF8A 4FTRA 2QLUA 4QP7A 3U55A 3SDJA 4NIFB 4EOMA 4LYNA 1WVYA 2GNLA 2J5EA 3KK8A 5I9YA 2VX0A 3HZTA 3FUPA 3U9NA 2JDOA 2PE1A 4LOQA 4O0UA 4ARKA 3BWJA 1PXLA 3F3ZA 2YIWA 4NCTA 4R7HA 5KCVA 2PVFA 3R22A 4L6QA 3R7IA 2FUMA 4GK3A 2YDIA 3KRRA 3PRFA 4FV6A 3C7QA 3MY1A 5GJGA 3QGWA 3DB6A 4RJ6A 4WNKA 2XZSA 4HJOA 4IX6A 3ODYX 4C0TA 3UP2A 4XJ0A 3UYSA 3LJ2A 3W2RA 3AOXA 3GB2A 4BI2A 2O5KA 4A06A 4U80A 5IF1A 4BHZA 1VG5A 2W9ZB 3IS5A 3QQKA 3ZSIA 4J97A 4ANBA 5HO6A 2X4ZA 4J8MA 4WD5A 4Y8DA 4I94A 2OSCA 4FZAB 3AD4A 3QD0A 3WF8A 3MTFA 2C47A 3UMWA 4X3JA 1J3HA 4AW1A 1U54A 4C4IA 1UWJA 2CNUA 3R7UA 4F9CA 4JVGA 2JY8A 3R1YA 3REPA 1P3QQ 4ZTQA 2WKMA 1Q8TA 4TKSA 5HTBA 1EFUB 1PXNA 3ZUTA 4EC9A 1NA7A 4B8MA 3QRTA 4IEBA 5CU4A 2YWVA 3O8UA 2ITWA 5CEOA 5CSXA 3G2FA 3OG7A 4GRBA 2QR8A 3KKVA 4BCGA 4NFMA 3IDPA 1H00A 2B3TA 3DK6A 4YMJA 3RZBA 3WF6A 3U9CA 4ITHA 3KY2A 3OROA 3WE4A 4BTFA 2VGPA 4ZJVA 1SYKA 1MRVA 3MI9A 4UZDA 5IQFA 2SRCA 5DVRA 1IA8A 3ZHPC 3L9NA 3HL7A 3MY0A 4KS7A 5AR5A 5IH6A 3ACKA 3QQLA 2WU7A 3HV6A 4BYIA 3NEWA 1HCLA 5CZHA 4L3PA 3KQ7A 3ORTA 1ZAOA 2OO8X 3RALA 4O7WA 4A4OA 3RCJA 2ITOA 2KNAA 4I5CA 4NZWB 3OZ6A 2QOKA 4DGMA 5J95A 5HZNA 3U6HA 2R3RA 3EQPA 2DI0A 2P0CA 3EL8A 3UG1A 2OXXA 5A6OA 3IO7A 2XNPA 2JC6A 3EKNA 3E8EA 3RAWA 4XX9A 4AN3A 4RJ8A 1YLAA 3F61A 3IOPA 4HGEA 4PTCA 4O82A 2FSMX 3NYVA 3PIXA 5IEVA 2WMRA 2PUIA 4UV0A 3U8WA 2CLXA 4BCMA 3F69A 4J52A 3OS3A 2WMSA 5LOHA 3F3WA 4GT3A 3KEXA 5LMKC 4PMTA 2YM5A 2J51A 4UBAA 3R7YA 3L8SA 3KC3A 3PSCA 4FIGA 5IZFA 3QF9A 2J90A 3QCSA 1PMVA 1G5SA 3WZEA 4TN6A 5KMLA 2YLEA 4FV5A 2GQSA 4ID7A 3NUAA 5HCYA 1UU3A 1CMKE 3PJ8A 2X8EA 2XJ2A 5AIKA 4ALWA 1NV9A 4F1OA 2GHLA 3O71A 4E26A 4FNXA 2DNAA 4QQJA 4CTBA 4ZTMA 3COIA 1VQ1A 3D0EA 5E90A 5C8NA 2F2UA 1PMUA 3IKAA 3ZTXA 4N57A 4X2KA 3H4JA 4KUJA 2Y0AA 2HXLA 1HOWA 2OWBA 2WHBA 3GNIB 4AZSA 4BCQA 4GU6A 5IEYA 3UQFA 1YOJA 2HZ0A 4DEGA 3SAYA 4BL1A 3ORZA 5FQDC 2R7BA 4IAYA 4KINA 2X81A 3RAIA 2WIPA 4YPDA 1FBNA 1DAYA 3TXOA 2OH4A 3OXTA 1WMKA 1QPCA 4YLKA 4YU2A 3KMWA 1YXSA 3TJCA 2OO9A 4FKUA 5KHXA 5FXSA 3QKMA 4D2WA 3FLWA 4DEBA 4QMVA 3V5PA 5CXZA 4UY9A 4I5HA 4U3ZA 1JKTA 3NLBA 4J1RA 1VYWA 2EKKA 2B4SB 4IM3A 2ETRA 4DFNA 4DBXA 3ID6C 3QZGA 4WO5A 1DO0A 1YDTE 4BTMA 3L8XA 4J96A 3V01A 4DEDA 5AA8A 2VGOA 3COHA 3D94A 5D10A 3II5A 5ANKA 3U51A 5L6OA 3DTWA 4C58A 3OOMA 4G9CA 4MXCA 3G6GA 4KWPA 2QNJA 1GOLA 2CSNA 3JUHA 2QG5A 5C9CA 2OJIA 4JAIA 1ZYJA 2C3IB 5GIPE 4FVPA 2G2FA 4RQKA 1H8FA 5CU3A 2E9OA 1XJDA 3IW7A 4PX6A 3SXSA 2PMNX 1YXVA 2RF9A 5IUIA 3HV5A 5JRSA 3HLLA 5IEXA 1FPUA 3R7EA 5D7VA 5A46A 2JBOA 3Q4CA 4R5YA 3WARA 2ZMCA 2C6OA 5AR2A 1JBPE 2UW5A 3WI6A 1J7LA 5L6PA 4OTIA 3I6WA 2PVRA 1IR3A 3KVXA 3IGGA 1FVTA 3E63A 1JKSA 3TNHA 4HVGA 3DKFA 3R73A 5HG9A 3VHKA 1GY3A 3DZQA 2BDWA 3DXNA 5JFXA 5IQDA 1FQ1B 2VD5A 4Y72A 2WXVA 5AWMA 3TV4A 3I5ZA 4JG8A 1OB3A 4QMWA 3VF9A 3WYXA 5M06A 1AIPC 1BL6A 1OBGA 4CVAA 1WVWA 2XNOA 2WMAA 3ORNA 4FSNA 4TYJA 2B52A 3RZFA 3CPCA 5AUTA 1JPAA 1NVRA 3PZHA 4ZZMA 4UMRA 3LVPA 3DNDA 3IGOA 5C1QB 2WMTA 3UZTA 5GIOE 3TTJA 3SRVB 3VS3A 3MDYA 4ZS4A 1YKRA 1CUKA 3B89A 1M7QA 3KF7A 3PVGA 4YP8A 5M4FA 2L4EA 5A54A 2JZ1A 5GJFA 4BCNA 5HG7A 3TM0A 4CYIA 5IQCA 2DAGA 5F1ZA 4O81A 5BPYA 4G34A 4FSWA 3BRBA 4EOKA 4NTTA 1I44A 4PTGA 4LUEA 3Q9YA 3MA6A 4YO6A 1GIIA 3R9DA 3BYOA 4YTIA 4LOPA 1WBSA 2YERA 3UTOA 4HW7A 1NXKA 3AD5A 3EFJA 4EH9A 4FEWA 1YI6A 3CBLA 3NZ0A 4Q7JA 3QWJA 4FYOA 5CVFA 3DPKA 3WZDA 4YZBA 1B39A 3OP5A 3TDWA 3RKBA 3LFAA 4TYIA 4TWCA 4EH8A 1W7HA 3AGMA 2X7OA 1OPJA 5D41A 3A7FA 5J7HA 2FGIA 4FVRA 2X2KA 4MBJA 3P5KA 2ERKA 4C3PA 1PYEA 4J53A 4EORA 4RFMA 3QCXA 4YTFA 4RWLA 5H8GA 5IQEA 3AT3A 5DR6A 2CKPA 3V8SA 3W1FA 4NJDA 4CQEA 1P5EA 1YVJA 4YC3A 1R3CA 2R9SA 3CTJA 4FSTA 3RMFA 5CF4A 3OBJA 1WFCA 3F3TA 2O3PA 3FY0A 3LXPA 1IAJA 4C57A 4ASDA 5K0XA 4X21A 3BEAA 2IW9A 4IMYA 5AAEA 5FUTA 3UO4A 3VNTA 3RCDA 1Z5MA 3UNJA 1PGYA 4IQ6A 3K3JA 4IB1A 3AMBA 3GC0A 4O21A 4AN9A 2YDJA 4IB0A 4BVUA 4BWXA 4ZTSA 2G2HA 4KABA 3T3UA 4I0RA 3I81A 4JNWA 4F6UA 3PDTA 2K9DA 3DLZA 3E8NA 4O0XA 4EHVA 4EOJA 5IA1A 1L8TA 4WNPA 3ZOSA 5AA9A 5HU9A 4QMUA 3F9NA 3EKKA 3BE2A 2HAKA 5DT4A 3IQ7A 4JDJA 3PIZA 5E1EA 4IFCA 1YI4A 4C02A 4WRSA 4D2RA 3PSBA 3GXLA 2NPQA 4G2FA 4YBKA 3TG1A 3UG2A 4FKGA 2J50A 4EH2A 1E1XA 2HCKA 3NYXA 4EK4A 4V05A 4G3OA 1VR2A 2UZNA 4FODA 4XHKB 1NT2A 2JIVA 3RHKA 3IW4A 5CVGA 3UC3A 5CF6A 2UV2A 4HOKA 3ANQA 4HYHA 3PY3A 5ETAA 2OGVA 3SRVA 3R7VA 1U46A 2VWIA 1JKLA 2B54A 4XYFA 4ZTNA 4CKJA 1HJPA 3KK9A 4FEVA 5EQPA 5AP1A 3MFRA 2JFMA 5BUEA 4MTAA 4NUSA 3U54A 3LXNA 4PDPA 4RSSA 4FZDB 4MD9E 5K4IA 3W33A 2W4OA 4ANSA 2V5QA 3DAEA 2WMVA 3VBTA 4F1TA 4B7TA 2UZUE 3ZS5A 3UQGA 4AOTA 5CEMA 2C6KA 4I6FA 4FTAA 1Q41A 1YDRE 3LFFA 4I21A 4MWIA 4QP2A 4M7IA 2MROB 5J7BA 1MQBA 5FXQA 3D5WA 3G9LX 1H0WA 4I4FA 2XUUA 4FV8A 5DLSA 5DNRA 5AAGA 4V0GB 5ETFA 3GLHE 4F63A 1ZRZA 3O50A 1H28A 3KXHA 4RMZA 1KV1A 2BAQA 2WTKB 2OH0E 3KFAA 5DGZA 5ETIA 3VBQA 2W1DA 3VAPA 3ALNA 3NW6A 3QKKA 2R3OA 4JQ8A 4RJ7A 2YCRA 5DHJA 2VTIA 3FI4A 5AV3A 4OT6A 4HCTA 3NYOA 2YFXA 1GAGA 3PSDA 2HELA 4F1MA 2HY0A 5HX6A 2C0IA 4EWQA 1J1BA 4U40A 3NUPA 3BWFA 4NW5A 3T8OA 2CGUA 3OXZA 3WIGA 3QD2B 4WG4A 4J8NA 5JGDA 1WR1B 4BF2A 4NCTC 1J7IA 1EH4A 3DOGA
chains in the Genus database with same CATH superfamily
4ZSAA 1NHWC 4GMYA 2WGJA 3C50A 5HVYA 4U43A 1LEWA 4OGRA 3LXLA 1TDZA 4CCBA 4DEAA 2ITTA 3EQBA 2ZTDA 5CQUA 3C58A 2XAOA 1ZWSA 2CWBA 4TNDA 2Z4SA 4GCJA 2XM8A 4I1ZA 4XG7A 4LJ4A 5DFPA 1ST4A 5EP4A 5GZAA 3VHEA 4CHTB 4PF4A 3QUDA 4FKVA 3EMGA 3UNKA 4D58A 4KKEA 1UWHA 1W8CA 4FEUA 2XP2A 3OOGA 4IBIA 2G01A 3MH3A 5ITYA 5DT0A 3OT3A 4YHHM 1NNJA 1P4FA 4ERWA 2DYLA 3UDZA 4QMSA 5AP2A 3LFEA 4IB5A 3G0EA 5CLPA 5JGBA 1VEKA 5EQEA 5T3QA 3PLSA 1SXJD 2WEVA 2CRUA 4AG8A 4NM7A 1TQPA 4A9SA 5FBNC 4CFFA 5EKOA 1S9JA 3NCGA 1PJKA 2OKRA 3EZVA 2A1AB 3KP1E 3VONA 1ZY5A 4ACCA 3AC5A 3GPXA 2GHGA 3V5JA 1IA9A 3EN5A 2ZBKB 3ZRMA 4NFNA 2J7TA 5CSWA 2VTTA 3VJNA 3VUKA 3W0RA 2X2MA 4FNWA 1LV7A 1SZMA 4YZDA 2Y4PA 3KCFA 2P2HA 4OAUC 2BHEA 1GVNA 3G15A 2VUWA 5EI8A 3UPXA 4O4DA 5CAVA 5ACKA 2DHYA 3LFBA 3MY5A 4HYSA 2BWEA 3HVCA 3LCTA 3A60A 3GCPA 3O8PA 4H36A 8CATA 2IG7A 1UVRA 3PTGA 4KRCA 1CKPA 3GLIB 2XIYA 5L8RF 2VO3A 5AEPA 3GQLA 3FXXA 3FJQE 4FTCA 2GS7A 1ZLTA 5IA2A 3GFWA 2QD9A 3FV8A 2R4BA 3B7ZA 3QRKA 4PL5A 3AKZA 4HYIA 4CD0A 3LHJA 2XK4A 4F70A 4IFGA 4DR3M 3K9PA 4M12A 3UIMA 3KN6A 4PPCA 4QNRA 4IC8A 2PE2A 3W32A 1HQYE 2ZDUA 4BKYA 4OTHA 4HCVA 2Z7SA 3MGYA 3S1HA 1YWVA 2IZTA 2L4FA 3R8MA 4R8QA 1TVOA 4YJTA 2JUJA 3UK6A 4XLVA 3DT1A 4XP2A 2NNWB 4A4LA 1KE6A 3U6CA 2C69A 3KXMA 2B9FA 3QLFA 2AHMA 3FPMA 2O64A 2QURA 3QHRA 3R02A 5HTBA 3ZH8A 2I0VA 4FKIA 2PHKA 4UWCA 1VYZA 3SXRA 2C3JA 3D7TA 3F2RA 1J09A 3ZFYA 1ND4A 4GT5A 3PUPA 4FGBA 5C27A 4FI1A 4WRGA 4FC0A 2LNHC 4FKTA 4IVBA 2QODA 1NY3A 5BVOA 3HRBA 4KIOA 3QC4A 4DAWA 3VS0A 4B7FA 2JFLA 4AW0A 3PPJA 3BHTA 1PJTA 3ZM9A 2BNKA 3AD6A 3DJ6A 4MGIE 2D7EA 2BJWA 5LVNA 3VQHA 2LVQD 4BFMA 2VO7A 2DWZB 4R71A 2OLCA 4L01A 2J6MA 2WD1A 1ATPE 4FV7A 1OQYA 3UO5A 4ACGA 3MH2A 2XGNA 4OBQA 3HU1A 2GNFA 4AAAA 3CR0A 4O7SA 2GTNA 2BUJA 4X2FA 2Z60A 3ATSA 3A98B 1YDSE 3FMDA 1KE8A 4DHJA 4EHGA 3V6RA 4C33A 3UIBA 4XBUA 5FTQA 3LLAA 1HCKA 4U42A 5HG5A 1YQJA 2IO6A 3QC9A 4LY6A 3OWJA 3GC7A 1Y8YA 1A06A 2OIDA 4HL4A 2PVMA 4RWIA 4B99A 3UODA 1ZOHA 2JNHA 4UEUA 4I81A 4GSBA 5ITUA 4IDVA 3NNXA 5LJJA 4DV3M 2PVNA 1W2FA 3E93A 2ZV7A 1DM2A 3HV7A 1OL1A 4CLJA 1M2PA 3FLZA 3DKGA 3GCUA 2QKRA 3EQIA 4DLIA 4O4FA 2V1CA 3KL8A 3SKCA 1JSUA 2B9HA 4AGUA 5H8BA 5L8KA 4FSYA 4QO9A 2Q0BA 4QP8A 1J7UA 3OCSA 1GZKA 2IVSA 5EW3A 1E94E 1H1QA 4DR5M 3ZLYA 2WAJA 3ZFXA 4FKWA 4G3FA 3G0FA 1LUFA 3TZ7A 4KO8A 2V1UA 3T15A 3ZBXA 3BX5A 2VQEM 3UPZA 3F66A 3I04M 3CC6A 4IZ7A 3NBIA 2IWIA 3MYGA 4ASEA 4NK9A 1M17A 4EKLA 4U7ZA 1PKDA 4F9YA 3HMPA 4P5ZA 2EVAA 1O6YA 3CSVA 3FMKA 3C0GA 4NH1A 1K3WA 3PUFC 2VTLA 5EM8A 4O84A 3JPVA 4C4JA 1RW8A 5DE2A 5B2LA 1G59A 4OLIA 3EN6A 3RK5A 2LWXA 3EQFA 3TZ8A 3JS2A 1LEZA 4TT7A 4LRTA 2DQ7X 5A4LA 3NS9A 4G6ZA 2PMLX 4WHZA 4HGSA 3NW5A 5F3WA 2FH9A 2ZOQA 4CV8A 4FNYA 3C13A 5AP3A 4JI5M 4PV0A 1NY6A 1DGGA 3AOEC 4JBOA 5IMEA 4W5WA 4O7TA 3L25A 2QOCA 2O01F 3SC3A 1Q8YA 3N4UA 4FG8A 5EYMA 3KFUG 3C9WA 1E9HA 5M53A 3IHPA 4YZNA 3FPQA 3CPBA 5DIAA 4RC2A 3LM0A 4QYFA 1BVSA 5EM7A 5HNIX 5HU3A 2KTYA 4Q9ZA 3OF0A 2GPHA 1R0EA 4KBCA 1OUYA 4TWPA 4M0YA 2R4JA 4DR2M 3Q9XA 4V01A 3KRXA 1PJIA 4O0SA 4XGIA 3B7QA 2OQ4A 2WU6A 3FMJA 5E4HA 4MCVA 2G1TA 4C36A 4Z55A 1F0QA 4I3ZA 2JKQA 2CKQA 5M44A 2P3GX 3R30A 5B7VA 4JI6M 3W0OA 3R21A 4LJ6A 3MVLA 3O51A 5L6WL 3LCSA 2XKFA 2V22A 4DGLC 1QPDA 4CRLA 2ITNA 2QOFA 5HGIA 4FTLA 4IWPA 2DXIA 2R6FA 3ZFMA 2C3LA 4JAJA 5AP5A 3NUSA 4PMPA 5EP3A 5HO7A 4M15A 2PYWA 2XIZA 4YZMA 4Q5EA 1URWA 3BYVA 4Y5QA 4YSMA 3VS2A 2CUZA 3R8VA 2OBJA 3KF4A 2BVAA 2PE0A 3MV5A 4LRMA 3GVUA 3Q9ZA 4O6LA 4BWKA 3M6AA 2VU3A 5FEEA 2VTSA 2GQRA 2VWWA 2F5OA 4NSRA 1X8BA 2BFXA 4G3EA 4DG2E 4WP2A 1IN8A 3LM5A 5AM6A 2QVSE 4OTDA 4DH8A 1Q3CA 3NDMA 1REKA 1JR3D 4MX9A 4C8BA 4G3GA 4YUQA 3D15A 3EN4A 5KKRB 5M4IA 3F6XA 3LVWA 2V7AA 2NP8A 3T9TA 2XEYA 4AFEA 1OITA 3ORIA 3TN8A 3GCVA 3LFDA 3VBYA 5CF8A 4EH7A 4GC5A 4HVDA 1N75A 2H8HA 2WO6A 3RJCA 3GPYA 1KE5A 3OBGA 4APPA 3R00A 1H08A 5D11A 4MH0E 1JNKA 2JIUA 4CZTA 3V04A 3ZLSA 4EK6A 2Z7JA 5J79A 5EP2A 3ETAA 3W0FA 4N6YA 1ZARA 4O0VA 4O0YA 2OJGA 3R7OA 2R64A 3M42A 3T9IA 4D1SA 1H01A 3RTPA 1IN6A 3CIKA 3QWKA 3V8WA 4CT2A 5A4TA 4CMUA 4FK6A 3OW4A 4ACHA 3BL9A 2LHGA 3FQHA 3D8LA 3WOWA 3VO3A 2KNZA 2CHQA 4O22A 4CZYB 4ZLZA 2F5QA 4CFXA 4YHTA 4QTCA 2NQ8C 3QTRA 2ZM1A 4KS8A 3FZTA 2EKFA 5HESA 3KP0E 4FT5A 4EQUA 3LPBA 2QC6A 2QBYB 4G6OA 2Y6MA 1BL7A 4RFYA 2VTAA 2BRGA 2YJRA 5BUJA 1IBLM 3I0OA 3PJ3A 2ACXA 5J8IA 4LFIA 2C0TA 1GL7A 2CCIA 4LRKA 3WZJA 2X8IA 4LRJA 2F57A 3OXIA 2C30A 1SXJC 4DHIB 4FYNA 4KA3A 1DV0A 4NIFA 5EI2A 3FDNA 4JI1M 4DH3A 4MXXA 3F7WA 4PTEA 3L28A 3QQUA 4K1BA 3O7LD 4AKIA 4DITA 4RLLA 3VKHA 2W1ZA 1R2YA 2WTJA 5F95A 3H0YA 4G9RA 2CV1A 3EN7A 1H4LA 4PT5A 4I20A 3M0EA 1U5RA 3LFCA 4AI6A 2F7EE 4AS0A 3CKWA 2QBYA 3AC2A 3E3BX 3FL4A 2Z3XA 2X0OA 2JP7A 4R3CA 2C6LA 5LQFA 3C51A 4DR4M 1DO2A 4DC2A 4LL0A 2ITPA 2EXCX 4CCUA 2BZKB 3AC3A 1GIHA 1UKHA 3HY5A 4A7CA 2C99A 3RWQA 3IW5A 5HE3A 4LCBA 4EUUA 1IXRC 4JXJA 3CGFA 2I7QA 4BZDA 2J0MB 4XUFA 4Z8XA 1FJGM 3OUKA 4R7BA 3VUMA 4JG7A 3ZH9B 2O65A 1IAHA 4QTAA 2X0QA 2GSFA 2BKZA 4I5SA 4H3BA 1Y6AA 3RK9A 4OTGA 3F2NA 4GG7A 3NUYA 4KIKB 5KHWA 2X1NA 5EH0A 4BDAA 2XYNA 4YC6A 2C5YA 2LH0A 1WBPA 2C6EA 2BRBA 4IZAA 5FDPA 4PDYA 4WT6A 4XP3A 4AGWA 3BHVA 2K0BX 5HIDA 4E6AA 3JYAA 4E5BA 4FVQA 1CSNA 2X39A 4BN1A 2UW3A 4D0WA 3QX2A 4FT7A 2CNQA 4RIXB 1TH3A 3FLNC 3Q32A 4M67A 2JGZA 3GLFE 3E64A 3AXWA 5M57A 4M3QA 4FZ6A 4W4YA 4IE9A 2VIIA 2XKEA 3KXEC 4AXFA 4RBLA 4DFLA 2XANA 4I6HA 3VRYA 4R7GA 1W83A 4XP0A 4B0GA 4YSJA 3LFSA 1XH9A 3HA6A 1KUTA 3GI3A 3SOAA 2O2UA 4TL0A 5AX9A 3UDBA 3K9OA 3ZO3A 2XSZD 2FA2A 4F9BA 2VRXA 3UIXA 5I0BA 2LXEA 3HAVA 2C6DA 4F4PA 2R3NA 3S2PA 3OHTA 4DG3E 3ODZX 4AE9A 2XBJA 1GZ8A 2RFDA 1T45A 2UZDA 4GH2A 4I23A 3G9NA 3HDNA 1OPKA 3LMGA 4MBLA 4RIXA 5D1JA 4MD7E 4ITIA 1ZQ9A 4FZFB 4IBGA 3SW4A 5JN2A 5J9LA 4RT7A 4IBFA 3GC9A 1ZV1A 4EQMA 4AE6A 1D0LA 4EOOA 2Z2WA 1OPLA 5IU2A 1STCE 5AUXA 5FM2A 2H6DA 4NTSA 3W0QA 4CSVA 3ZUVA 4IBJA 2WPAA 3BYSA 3RM7A 3BIZA 4EOQA 2X4AA 3BKBA 3AC8A 5H9BA 5EM5A 4KIQA 3HWSA 2XJ1A 3KXNA 4E93A 4Z7GA 3H3CA 3EQCA 4EL9A 3UVQA 4JQEA 2E9VA 1G3IA 4JI0M 1Z5AA 4DGNA 3BLQA 1UKIA 3KU2A 1O6KA 5AUVA 2JLDA 3HGIA 1GJOA 2BZIB 1XBBA 5CT7A 5AJQA 4IAIA 3ZZEA 2R0UA 4FTKA 3BQCA 4LGHA 5E92A 3NGAA 2J2IB 3SFZA 4YLJA 5IUGA 3QAUA 4LV5A 3F3VA 3FZRA 5K5NA 1SXJE 3F92A 5I5ZA 1K2PA 4LZJA 3H9FA 3KDSE 2I0YA 2OIQA 2V55A 5AR3A 2J7NA 4IAKA 3CTQA 1QCFA 4FKOA 4R3RA 4IM2A 1H1WA 2H5XA 4L3LA 2PZPA 4NM3A 3Q6WA 5AFVA 3B74A 3MB7A 1L2BA 2XF3A 4BDIA 3SARA 1PXOA 1OIUA 4RQVA 3UMMA 2CV0A 5FTKA 4IX3A 3LCKA 4QNMA 3NVKI 3CF0A 1U54B 3HMNA 7CATA 4A9YA 3R1QA 4O4BB 3JVSA 4G4NA 4XBRA 1BKXA 2RFEA 5FWKK 4O0TA 2QLQA 2EJSA 1NVSA 4UALA 1K9AA 3SLSA 4XG6A 3CKXA 3L29A 4IJPA 5TO8A 2IW6A 2C9CA 3HMMA 4AG5A 4TUWA 4YJUA 5HD4A 1WIVA 2PPQA 4PD2A 3EYGA 1WBVA 3ZONA 3F5XA 5I3OA 3BU3A 3DAJA 3F3UA 5HHWA 3D5VA 3HKOA 5LMAA 2L6OA 2VWUA 4FTRA 2QLUA 4PDGA 1WVYA 2J5EA 4LOQA 3F3ZA 2PVFA 3DB6A 4C0TA 3W2RA 2XZUA 4BHZA 3QQKA 3ZSIA 4WD5A 2OSCA 3QD0A 5ITTA 3UMWA 1U54A 1UWJA 2JY8A 2WKMA 3I01M 2YWVA 4IEBA 3G2FA 3OG7A 4GRBA 2QR8A 4YMJA 3VK8A 3WE4A 2VGPA 1SYKA 4UZDA 5DVRA 3ZHPC 4KS7A 5IH6A 1NVMA 3ACKA 2XZFA 2WU7A 4L3PA 3ORTA 3RALA 4MGZE 3RCJA 2ITOA 2KNAA 4M0DA 3OZ6A 4AG6A 1OAOC 3EKNA 4O82A 2FSMX 1IXZA 4BCMA 5LOHA 3F3WA 4GT3A 3KC3A 4M0WA 2J90A 1G5SA 3WZEA 3NUAA 5HCYA 1UU3A 1CMKE 2XJ2A 2GHLA 4FNXA 4CTBA 3COIA 3D0EA 2F2UA 1PMUA 3IKAA 4KUJA 2HXLA 4WURA 2HZ0A 3TWMA 4BL1A 4KINA 2X81A 3RAIA 1FBNA 2OH4A 4YLKA 3KMWA 1YXSA 3V5PA 4J1RA 2EKKA 4IM3A 3J7BA 4DDGA 3ID6C 1DO0A 4BTMA 3L8XA 4DR1M 4MXCA 3G6GA 2QNJA 4NYEA 5GIPE 3JUHA 5C9CA 4RQKA 2E9OA 3IW7A 2BJVA 5IEXA 3HU3A 3GRVA 3HV5A 3R7EA 2ERCA 2JBOA 3WARA 5AR2A 1TZDA 3IGGA 5HG9A 3VHKA 3DZQA 2BDWA 3DXNA 5AWMA 1OB3A 3AKLA 1OBGA 3VFDA 5AUTA 1GJTA 1JPAA 3SATA 4ZZMA 5C1QB 5GIOE 4MGYE 1YKRA 1M7QA 2JZ1A 5GJFA 4CYIA 5F1ZA 3BRBA 4EOKA 4PTGA 3Q9YA 2YFQA 3KOWE 3BYOA 4HW7A 1NXKA 3EFJA 4Q7JA 3TDWA 3AGMA 2X7OA 1OPJA 5J7HA 4MBJA 4FJVA 2XEPA 4C3PA 2CKPA 3V8SA 4NJDA 4CQEA 1YVJA 3CTJA 3OBJA 1WFCA 3BEAA 2IW9A 1TFFA 3UO4A 3KSJA 3K3JA 4AN9A 3KS4A 2YDJA 3I81A 4JNWA 3E8NA 4QMUA 3EKKA 3PIZA 4IFCA 4G2FA 4FKGA 2J50A 3NYXA 4EK4A 4G3OA 3RHKA 2UV2A 4HYHA 5ETAA 2OGVA 3R7VA 2VWIA 1HJPA 5EQPA 5BUEA 4NUSA 3U54A 5K4IA 4FZDB 4QDVA 2V5QA 3VBTA 4P16A 4FTAA 1YDRE 2MROB 2L7IA 3G9LX 2XUUA 3FUWA 5DLSA 5DNRA 5AAGA 4RMZA 3KFAA 3ALNA 2R3OA 2YCRA 1QYRA 5DHJA 2VTIA 1GKIA 3NYOA 2YFXA 3PSDA 2HELA 3T8OA 1J7IA 2BZHB 2GNOA 5H37D 2YNMD 3KCKA 2W5BA 3G33A 2C9OA 4CRSA 1OKSA 2OF4A 5CZIA 3TJDA 2PVLA 2AC3A 3BQRA 2XIKA 2BFYA 1FVVA 3LAUA 3BLHA 3KXXA 3QWLA 2OFUA 1Q3WA 2R45A 2E2BA 3DCVA 2W0JA 1OIRA 1UNGA 2XF0A 2YM4A 5DH3A 5DR2A 3GQIA 4LFCM 1PHKA 3L8PA 5EYKA 4RC4A 4EJ7A 1IG1A 1W2CA 2VWZA 1XKKA 1UU9A 1G8AA 4DFZE 2LHCA 5FD2A 3A7IA 4ZJIA 3TYKA 4ANNA 4E6DA 3Q52A 5E1SA 4G16A 5LMBA 2HOGA 1FMKA 5D7AA 1OUKA 5E91A 1IFYA 2J5YA 1IN7A 3QZIA 3FE3A 1R39A 3AG9A 2GU8A 5L2TA 4XOYA 2DENA 4CZUA 4OBPA 3GP1A 5FDXA 4QHTA 3RVGA 3SVVA 4XNEA 4QYGA 4CFVA 4JR3A 4AXAA 4TYEA 4L68A 3V5LA 3FTCA 4QTDA 4H1JA 3PA3A 3C9PA 3PNVA 3ULZA 5LVLA 2C68A 1YW2A 4HPUE 2UZBA 3Q9WA 4IAZA 2QOHA 4FIHA 2QHMA 4DH1A 5IISA 2I1MA 5BVEA 4KLNA 1H26A 4IAAA 2REIA 2PZYA 4C35A 4C4EA 3ELJA 4MBIA 2UVYA 4JBPA 4UYNA 4BB4A 4RFZA 3NPCA 4N4SA 3CJGA 5E8XA 4QMTA 1VDLA 5D9HA 5AIRA 2H96A 4NM5A 5AUYA 5HICA 1ZY4A 4C62A 1N77A 4QP3A 2F5NA 4NRVA 5KBRA 5TT7A 3HEGA 3VVHA 1JQJC 4Y46A 3SMPA 1JR3E 1RU3A 4QMOA 3ROCA 3Q6UA 2EXMA 4O0RA 3ERKA 5CF5A 3BBTB 1AQ1A 5F20A 5BMSA 2APLA 4E4MA 3MTLA 1U4DA 1WBTA 5HKMA 3I4BA 4L7SA 5BX0A 3P86A 4GH9A 3UJGA 3AOEA 1GL6A 4EIWA 3U60A 3F88A 3R1SA 4GK4A 2ZM3A 5JZNA 1QPJA 4FKSA 1CM8A 2FYSA 1Q97A 5LVMA 4ORKA 3I4YA 2YM7A 2MGWA 2CFOA 4KSPA 3PRIA 2EUFB 4E73A 3UE4A 3VIDA 5E8SA 1X37A 4UMQA 2KA6B 3DA1A 3LCUA 4GW8A 4F1IA 4C7TA 4BR3A 5BNJA 4YJSA 1J1CA 4OTWA 2Q0NA 4HVIA 5KPZA 4HEOA 3DY7A 3LLTA 1ZXEA 4L45A 2DAEA 5IA3A 1WJ7A 4AP7A 1A48A 4C4HA 1TR8A 1D0KA 4M97A 4Y95A 3DA6A 2ZM4A 4BHNA 3Q2JA 5J1VA 4QYYA 3FUTA 1XBAA 1P4OA 5HNGA 4DV7M 4BCJA 1OKWA 4ANOA 5AV2A 4BTJA 2K6BA 3W0LB 4BIBA 2PMIA 1U59A 5DWRA 2RGHA 5I3RA 4CMOA 4Q9SA 4I5PA 3QRJA 1QPEA 3H9RA 4E4NA 4L46A 1C1KA 3EN9A 5EHLA 2ZAZA 4GHLA 3QLGA 3E7VA 4FTQA 4LM5A 4L44A 4A9UA 1KE7A 5E8TA 4C4GA 3PP0A 4BDFA 4USFA 4E8AA 4RGJA 5GINE 3OVVA 2QOIA 2ETKA 2WTKC 2LAVA 2YAAA 3Q2MA 2WMQA 3R7UA 5B2MA 1PXPA 2VTPA 3ZLWA 4A07A 2L7HA 1KYIA 3KRWA 4FIEA 3KREA 3GLIE 4L00A 5EHYA 4LJ7A 2C6IA 3C5IA 2WIHA 1NO1A 3LCDA 4IZ5A 2JY6B 3W18A 3FC1X 3EZRA 4O91A 4YLLA 3QUEA 2VF7A 2YISA 3NW7A 4FG9A 2ZTCA 4PPBA 1T6OA 5HLPA 4PP9A 2V62A 3SMSA 2KHHA 5CEQA 4ZSJA 4JIKA 4BDCA 1EIJA 5AADA 3U6IA 3OFMA 1B6CB 3HU2A 2QQ7A 5CXHA 4DCEA 3ENMA 2A0CX 1VDDA 1GNGA 5L2QA 2UW7A 3LKMA 4X6RA 2DUVA 3LFQA 2BZJA 3UOKA 4BI0A 4CISA 5EKNA 1VEJA 3UVPA 5JFVA 1NJGA 2QONA 4GFOA 3TIZA 4BBMA 2RG5A 3BOSA 2IVTA 5ITAA 4L3JA 2XB7A 4X65M 4FV2A 4G3DA 5IA5A 5A4EA 2QO2A 3QD4A 4AWIA 4D4SA 4ZSGA 2XNEA 5HBHA 4CJ6A 3PJ2A 5EDRA 2OZOA 2GNJA 1JSTA 2UU9M 5I9UA 2CKEA 5HNBA 4LJAA 1MJGM 3QYZA 2HXQA 2X7GA 2C1BA 3ROYA 2GNGA 2UZOA 3ZC6A 5J87A 5JH6A 3GGFA 2JDTA 4M14A 4D2SA 3C4EA 3C0HA 2WTCA 2IEWA 4AT5A 4XS2A 4MF0A 3Q4ZA 3OC1A 2QPAA 1SXJA 3V8TA 2UW9A 2P2IA 1V34A 3FMNA 2YITA 5IA4A 2W5AA 3WE8A 3C4FA 4C2VA 3BYMA 4HGLA 4E6QA 2ESMA 2GFCA 4MH7A 5KZIA 5C8MA 4DGOA 4B8LA 5KKRC 4RIWB 4F9AA 5CEKA 3CTWB 3JR1A 2CKOA 3E3PA 2RFSA 4ZY6A 1IASA 5TKDA 5BPVA 4FV4A 5JI2E 2J0JA 4PUZA 4G1WA 3FC2A 4ZEGA 4CXAA 2V6ZM 4FIJA 2ZAMA 4NW6A 2PUUA 2ZB1A 2B0QA 3QXPA 3D14A 1XHAA 2WQEA 2Y6OA 4LG4A 3ZU7A 4FE2A 1O6LA 2F4JA 4A4XA 4QMNA 2RKUA 2HWOA 4MQ2A 3D5XA 1Z5CA 3LJ1A 2O0UA 3U61B 4JRNA 2DWLA 4ITJA 3AKKA 4R1VA 2CMWA 2C5NA 2GMXA 5CALA 2FOIC 2OI4X 3Q4UA 2B55A 3IECA 3HRCA 1V92A 4YURA 3NX8A 4NSOB 4EJNA 4RIWA 4I22A 4P2KA 4FBXA 5A4CA 1XXHB 4KRDA 3PLAE 4O4EA 5I9VA 4JI3M 3L9PA 1REJA 3SYKA 3R71A 2P5TA 4S31A 5EYDA 3QFVA 1OL6A 1JQHA 4GIIA 1K3XA 1DI8A 3ML1A 1OL7A 4DFXE 3U6OA 3EH9A 4D2PA 4ASXA 5EXPA 5IG1A 2WMXA 2YIRA 4RA4A 2Z7QA 2VX1A 3MN3A 3ZSGA 4CFMA 4B3RM 4ZY4A 2QCSA 1SNXA 1E1VA 4D0XA 3GBZA 4NKAA 4U45A 3KSXA 3HHXA 5IA0A 1AUAA 3FXZA 1ZYDA 3QTUA 3OUNB 3BE9A 2KDLA 4J7BA 3SHEA 1XXHA 3FL5A 5DT3A 3O0GA 4RIYB 4FTIA 4P4CA 3NVMB 3U87A 2C3KA 5L2IA 3MVJA 1ZOGA 2Y20A 3JY0A 4U79A 1IY2A 4S32A 3GQ4A 1Q8ZA 3O17A 4LL5A 2F5PA 4X3FC 1OI9A 2UW6A 4I93A 3A4PA 3FSKA 3R2YA 5KO1A 3WF9A 2B53A 1PXIA 2XVDA 3QAME 4DH7A 3PA4A 4IBEA 1NSFA 1HT1E 2HK5A 1CKIA 4AT4A 4LMNA 4JBVA 4O4CA 1XO2B 2UXBM 1OAIA 4GVAA 4DV0M 3SAWA 3EIEA 2R0IA 5J9YA 3FHRA 5BMMA 3LE6A 4PL4A 2O8YA 4RIYA 4FV3A 3LQ8A 2WQNA 3GP0A 5KO3A 4PPAA 4C61A 3NCZA 4BDKA 1PF8A 5DBXA 2GQFA 3MJ2A 5HOAA 3UNZA 5CEIA 2F7XE 3MJ5A 1BI7A 4N70A 2PZ5A 3W55A 2I6LA 4D2VA 3RPOA 3KGAA 2OJFE 3QU0A 2R4EA 3QUPA 2X7FA 4JI9A 4R6VA 3WF5A 3L26A 3KA0A 4JXFA 1URCA 5EYCA 3MJ1A 3UVRA 1G4AE 3T38A 4G31A 1IBKM 3A2CA 4IWQA 3KULB 3PPKA 4E1ZA 5IUHA