1Y8GA

Catalytic and ubiqutin-associated domains of mark2/par-1: inactive double mutant with selenomethionine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
302
Chain Sequence
HIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIALDAFCGAPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity-regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 85
structure length 302
sequence length 315
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1y8gA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1y8gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1y8gA01
1ZOEA 4RWJA 5J87A 3OUNB 4W4YA 3HNGA 4YJPA 4FL1A 4RWLA 3I5ZA 3DKFA 5HTCA 2JAMA 3SHEA 2R4BA 1XJDA 1XBCA 4KBKA 1H27A 1BLXA 2YIRA 4H3PA 2V22A 5HE3A 4GU9A 3G15A 1Q99A 4C3RA 3U8WA 2ZTDA 4IC7A 5EKNA 3F92A 3CEKA 3DCVA 2ONLA 5F9EA 1X8BA 1R78A 3C1XA 3QRJA 2C0OA 3DB8A 4QRCA 4M69B 4XOYA 4XV9A 3ID6C 2H8HA 2OOBA 3ZO2A 4NCTA 3SKCA 3QCSA 4AT3A 4EC8A 3Q32A 4BDKA 4BFMA 4MNEA 4D4RA 2RIOA 1W84A 3VS6A 3FL5A 3KRLA 4RA4A 3ENMA 5AUXA 3DBEA 2PU8A 4ZTSA 5CZHA 4LUDA 5M55A 2YAAA 5ICPA 1PMNA 3CKXA 5AP6A 2Y4PA 4AA0A 1SMHA 1Q3DA 2W5AA 4JI9A 3V8WA 2YM3A 4O0SA 1E94E 4JQ7A 2C6EA 1H08A 4I4FA 2QO2A 3FZPA 3NUUA 3A7FA 3VBVA 3BPRA 5CY3A 3AOXA 3T6PA 3BU5A 2VWXA 3A7HA 3FQHA 4TN6A 3PIYA 3FSKA 2VTHA 5LJJA 3E7VA 3KMWA 4IFCA 5HLNA 4O0UA 4RQVA 1J1CA 2UZDA 5TR6A 4MEDA 5L8KA 5M4IA 4C62A 4ZMEA 4M66A 2VTTA 1A5TA 4BICA 4AWIA 2IW6A 5KMJA 5CVFA 2B55A 1REJA 5J7HA 3NSZA 3T8OA 3CQUA 1PJKA 4G17A 2VZ6A 3KA0A 2UW9A 4O38A 4TNBA 3QHWA 1ZAOA 3GQLA 3AT2A 3GU5A 2XCKA 4TYHA 4EQUA 4NYEA 3OCTA 3S1HA 3PY1A 3GNIB 5FQDC 4YU2A 4M84A 3RKBA 4BCNA 3FMEA 3CTHA 1WCCA 2ZDTA 4RT7A 4G34A 2B54A 4O82A 5C8NA 2XKCA 3ZXTA 3NRMA 3W32A 2X4FA 4QNYA 3QL8A 3GFWA 2DAKA 2LVOC 3MY0A 5EFQA 2RG6A 4O83A 3PSDA 2XVDA 3OOGA 3TUDA 2YABA 4GS6A 4EH4A 4AQCA 1OKZA 2VWYA 3BQRA 3E63A 2R0IA 1U54A 3NEWA 1Y6BA 2ZM3A 5LVNA 4DA5A 1XH8A 4LFIA 3R7OA 4JG8A 1F4IA 2HZNA 4E4MA 1XH4A 1LPUA 1JR3E 1M7QA 2UVYA 3ETAA 4PUZA 2J0IA 2HCKA 3BQCA 3OW3A 4AN9A 4MNFA 5J9YA 3E64A 5L4QA 3PLAE 3HVCA 4GV1A 4GL9A 3RINA 4DH7A 1WJ7A 3RI1A 3ANQA 4DTKA 5I3OA 3E8CA 2ITOA 4DCAA 2Z7SA 4M14A 3FMJA 5H8GA 3V8SA 4KABA 5EG3A 1YW2A 1CM8A 2I7QA 5HGIA 2WNTA 4BL1A 3HA8A 4QMSA 4KD1A 3K2LA 3HUBA 1UFZA 1YHVA 2JDRA 2QU5A 5IG1A 2CNQA 2ACXA 3Q96A 4O21A 3TTJA 1DO2A 1JQHA 4JVGA 3U9NA 5L2TA 1OTRA 3OT3A 2ZJWA 3VRYA 3CGFA 3OXIA 3E5AA 3RWQA 2J0KA 5L6OA 3HKOA 1YWNA 5AWMA 4C38A 4IDTA 4J71A 4TYJA 4XEYA 4DE4A 3UVPA 3ZO4A 1F5QA 2QOFA 4XNEA 1PXNA 3DBCA 4GFOA 2WMVA 4NSTA 2O63A 5CSXA 3VBYA 2P55A 2BTSA 2CNUA 3M11A 3SD0A 3IDPA 4FG8A 5A54A 2PSQA 5DMZA 1Q61A 1KWPA 3SRVA 3CY2A 3Q2JA 1VYZA 2Y4IC 3F3ZA 4RRVA 5A46A 3RK9A 5KMNA 2LTUA 3ODYX 4JDIA 4OR5A 1RQQA 3Q53A 4F2LA 4IAKA 5CX9A 3SDJA 3VVHA 1Z5MA 2R3GA 4F1IA 4UEUA 1E9HA 4IB0A 4V0GA 1WBSA 3QTIA 4ASDA 4JDKA 4BTKA 4BWKA 2QOOA 3ET7A 3OY1A 3F82A 1GIHA 3FMDA 4QYEA 1PRYA 4TZRA 4L53A 1WVYA 4NUSA 2GTNA 1KE7A 3GEQA 4YTIA 4DGNA 2K0BX 3OP5A 3JVSA 4ASXA 3UQFA 3DBDA 4QP2A 1H1SA 3ZDIA 2CP8A 3PJCA 1OBGA 1QPCA 5JGDA 2YHVA 2YZLA 3LW0A 3P0MA 2R3LA 4Q2AA 2ITUA 2EU9A 2RL5A 1G5SA 4X21A 3BHUA 2W1GA 4F63A 3QQKA 2R9SA 3CIKA 5IEXA 2GS7A 2KNVA 3FXZA 1T45A 5D7AA 4C59A 4YUQA 3LQ3A 3LJ1A 3A60A 4LGDA 5E8ZA 3W8LA 3R21A 1TKIA 2WXVA 4RVTA 2G2HA 2W4JA 3MS9A 3ITZA 3PVWA 5HVKA 4LGGA 3HMNA 3ZO1A 5FEEA 4BDGA 4DEBA 3GENA 3TZ7A 2IZRA 3PSCA 5EHOA 4AW0A 4D2SA 4JR7A 2VTOA 2LBCA 4FG7A 4O0XA 2JY6B 4QMTA 3WZUA 2OLCA 4HZSA 5CF5A 2QKRA 3DAEA 2C47A 1T6OA 2HELA 1JAMA 3FLWA 4RJ3A 3PA4A 4W9WA 3WF9A 3KVXA 4QYHA 5EM5A 5BNJA 2OWBA 3SW7A 2X0GA 4X3FC 2XNEA 5HTIA 1W0XC 4YJTA 3TIYA 2WPAA 3LMGA 3OW4A 4YZMA 2EKKA 4L52A 2PVLA 3QRKA 1YXUA 4XG9A 3EQRA 3LFFA 5HNGA 5ANOA 1V1KA 4BCFA 2YJRA 3KXNA 2OZOA 3HDMA 2ZB0A 2JZ1A 3VUMA 4JDHA 4ANSA 2UZWE 3W2RA 4E73A 3RCJA 4OUCA 2BIYA 4ITHA 4EUTA 4CKRA 3DJ6A 4QTEA 4D0WA 4O0WA 4ITIA 4UN0C 3VUGA 1IA8A 4Q5EA 3BHYA 4CQEA 3UOJA 2YCQA 3BLRA 1OMWA 4GVJA 4ZS0A 4NJDA 3PIZA 2E9OA 2OICA 3QUPA 4AGWA 2EXCX 4XV1A 4BGGA 1OL7A 1PMVA 3QTXA 3T3UA 3PPKA 2EB3A 3QAME 5HBEA 1O9UA 3LOKA 3EKNA 3W2QA 4ZY4A 2WELA 4O0RA 1PYXA 3GCVA 3QCXA 4R3RA 1OBDA 1TTEA 3SC1A 3Q9YA 2X6DA 1PF8A 3HECA 4JS8A 5CU4A 5IQAA 3AC1A 4YZNA 5C1QB 2ITTA 4C2VA 4R7HA 3DBQA 1YI3A 2HOGA 3QF9A 3R9OA 3H0ZA 3ZBXA 2QO7A 4OBPA 3F3WA 4Q7JA 4UWCA 3FY0A 4X2NA 2DHYA 4NW6A 1PMUA 5AMNA 5CENA 4AFEA 4U0IA 5IQDA 3SV0A 1HCKA 2DKLA 1GO5A 2W7XA 3BYUA 3DT1A 3I7CA 3R63A 3RM6A 2WQNA 3C50A 3F7ZA 5KZ0A 4CXAA 5B2MA 1F3MC 2BRMA 3Q9WA 3OBGA 3IDBA 5J7BA 2UZEA 4OTQA 3C5IA 3NGAA 1WBOA 3C13A 2C6KA 3P7AA 2XH5A 4GEOA 4I0SA 3E92A 4KRDA 4LL5A 3E7OA 4UALA 2PVHA 3LFNA 4QMWA 4FZAB 5LVPA 4UYNA 1I44A 3CS9A 4LM5A 1Q4LA 1LUFA 2X39A 4QPMA 3VJOA 4J96A 3FV8A 3MB6A 3TNWA 4AA4A 4PP7A 2C1AA 3AMBA 3H10A 5ANDA 3MVMA 2XKDA 4J98A 2SRCA 2GSFA 5IUHA 4JT3A 4GT4A 2HZ0A 4IH8A 1H0WA 4ZJJA 4IVCA 5G1XA 5M4UA 3MGYA 4Y83A 2XYNA 2YM8A 2DUVA 3L9NA 4B7TA 5K4IA 4D1XA 2C6LA 4Z16A 4L43A 1HJPA 1Z57A 3MB7A 2XEYA 3U51A 4FSYA 4U3ZA 5LOHA 2UZNA 2ITZA 1IASA 2O8YA 3GC0A 1H24A 3MH2A 2GU8A 4RVMA 1ZRZA 3BBWA 3GU8A 2B9HA 3C0GA 3RPOA 2DZLA 2XYUA 2OO8X 2PVYA 3PP0A 3TUBA 3SXSA 1W98A 4KAOA 5AUUA 2ERZE 3HEGA 5EYCA 2IZTA 5DT3A 2XBAA 3WZJA 4I6FA 1M2RA 3DGKA 4EOMA 2PULA 4CYJA 4FGRA 1WHCA 2QHNA 3TI1A 2OZAB 5IISA 2X7OA 4ZSJA 3KREA 4L42A 3MTLA 4BCMA 2B0QA 4XMOA 5KO1A 3DZOA 2C69A 4ZY5A 3TNQB 3AD5A 4EYMA 4C57A 5IDPA 3AXWA 5KMLA 3EQCA 3IW4A 1UNLA 5FWKK 2ITQA 1JNKA 1JSUA 5DRBA 2UZBA 2VWIA 3JPVA 2GCDA 4ZOGA 5ETIA 4K1BA 3PA5A 4IAZA 3ALOA 4I20A 4JJRA 3IS5A 4WSQA 4WRSA 4ZTHA 3WILA 5K5XA 5FUTA 4M0ZA 4MBIA 3QZGA 2VAGA 3KVWA 2Y8OA 3GC7A 3NZ0A 4J99A 1UNHA 3DZQA 2BUJA 3FYKX 4FSUA 4G2FA 4PMSA 4QNAA 2I40A 3S3IA 4EOIA 3KRRA 1YOMA 2PUUA 5C4LA 4F1TA 3QD3A 3W2SA 5AADA 3II5A 1ZARA 2BFXA 2OW3A 1J7LA 3G51A 2H5XA 2KHHA 3G2FA 2K9DA 3FJQE 1W83A 3NW5A 3RJCA 3KGAA 4BDDA 2JNHA 2WMQA 3R7VA 4C34A 2R3IA 3AT4A 4BDIA 2G9XA 2C4GA 3FZ1A 5AV3A 4JL9A 2BRNA 1VJYA 4AE6A 3E62A 4ZTQA 3FMKA 4WNKA 3BYOA 4MF0A 5JQ5A 4CQGA 3WZDA 5IA3A 4L7SA 2G2IA 2KNAA 4O7ZA 2B52A 2BZIB 2VTNA 3DXNA 3D7TB 2RFSA 3QGWA 4GW8A 3NNVA 2XEZA 4R1VA 3HV6A 1H26A 2OU7A 4F70A 5AP3A 5FBNC 5D9HA 2V55A 2WGJA 3QD0A 1P4FA 1Y8GA 2OXXA 3UVRA 1OL1A 5EM8A 3AD4A 2FB8A 4NM0A 4FYNA 3FDNA 5HBJA 3O8UA 4PPCA 2QLUA 1J3HA 2B1PA 2YERA 3AG9A 4BN1A 4CG9A 1XKKA 3NCGA 5HVJA 4BCGA 1UU8A 2VWUA 2OKRA 5FTOA 2G01A 3KKVA 4NZWB 4BI0A 4DG0E 2PK9A 4OT6A 4O7TA 3M42A 3K3JA 1NVSA 3A8XA 3NNUA 1Q8YA 3ZBFA 4A9SA 3PA3A 5CTPA 3DK3A 2BZJA 3EN5A 4U81A 2XBJA 5IA5A 4OTPA 4TL0A 2VTIA 4L7FA 3ZU7A 4TRLA 4AXAA 2W1HA 5KMIA 5HU3A 3TL8A 4I22A 3F2NA 3MJ1A 4X2GA 3W2PA 2OXDA 1Y6AA 4F6SA 5IA0A 3D4QA 4CG8A 1KV1A 1UU7A 2ETMA 3FWQA 4FVRA 4I93A 4WUNA 4N70A 4DLJA 5CANA 4WG4A 1H8FA 5A6OA 3K9PA 3WZKA 4IX4A 3F9NA 4C4IA 3R8VA 3QA0A 3OXZA 3FL4A 1WR1B 4PY1A 4DCEA 5KNJA 5IEYA 4KWPA 5GINE 2JY5A 4JNWA 4ZLZA 4JIKA 4ZMFA 1YXTA 3EIDA 5EYDA 4PNKA 1XH7A 1PXLA 4AZFA 2UVZA 3PXRA 3A2CA 2XM9A 4RFMA 4EZ3A 5DG5A 3G6GA 3R30A 5HE0A 3RMFA 3ZSHA 4KIKA 4USEA 4FKIA 3HP2A 4S2ZA 4TT7A 4TWCA 1RE8A 4QTCA 2WEVA 1YI4A 5KCVA 4ACDA 1KE6A 1ZOHA 3FI4A 3JR1A 1IXSA 2Z7LA 4KKHA 2GFSA 3ZONA 5BUEA 1PXKA 5EM6A 4JRNA 3OTUA 4XHKB 1CUKA 3OWJA 4GMYA 4R7IA 4F9BA 4CZTA 3F2RA 2BPMA 3QZHA 3IK3A 4WD5A 3NLBA 2O64A 4FTMA 3R83A 3Q4CA 3KN5A 3O71A 4FKQA 1UKHA 4XV2A 5BMMA 3SAYA 4KBAA 3PXZA 5HD4A 3F5UA 4IANA 4U44A 3GP0A 2QVSE 5KMKA 2BIKB 3V5WA 5H2UA 2XNPA 5A14A 2CWBA 4GCJA 4TTHB 5FD2A 3PSBA 4ZJIA 5TO8A 4AZTA 3UOLA 4RX9A 5A4QA 3S0OA 5CXZA 3GFEA 4AOTA 4QQJA 1A48A 2CKOA 4HZRA 4FODA 4ZZMA 3VHKA 4S31A 2JUJA 4KA3A 2BKKA 2XIRA 4RBLA 3FMNA 4FUYA 5CSWA 3F3VA 3UZRA 4K0YA 5KZIA 1KV2A 2OFVA 4FOBA 5B0XA 5KE0A 5EDQA 3NAXA 2B53A 4F6UA 4MXXA 3NIEA 5A4TA 3FKLA 1YWVA 3RVGA 3L8XA 2DAIA 3VRZA 5EI2A 2YIXA 3IW5A 5DWRA 3EN7A 4G3EA 2NRYA 4J1RA 4NWMA 3B8RA 2XM8A 5BYYA 4O91A 3ZTXA 5CALA 2JGZA 2I0VA 4DFNA 4Q9ZA 1TQMA 5JH6A 4TYIA 5K5NA 2CCIA 4U97A 4XJ0A 3RAKA 4IHPA 2W1FA 4K33A 4FIHA 3VUKA 1FVTA 5DNRA 3ZLSA 1QMZA 4DT9A 2C6IA 2X9EA 5IQHA 4M8TA 4EWQA 3GT8A 4APCA 4UN2B 3AC5A 4MYGA 5HG8A 4O1PA 2F7EE 5DN3A 4AG8A 4E5AX 3RM7A 3UG1A 4CTBA 3C0IA 4DC2A 2C0TA 5FTQA 3CE3A 3DTWA 4J97A 4XG4A 4UWBA 1KOAA 5E8WA 4TYHB 5EYKA 2IW8A 2F57A 3BELA 4O6LA 3RBWA 4YC6A 3UYTA 4GVAA 4A4XA 3DQXA 3ZC6A 3VBXA 3IW8A 3U54A 2MGWA 1UU3A 3BHHA 2PHKA 1YVJA 2L2DA 4QQTA 2OGVA 2W9ZB 4PQNA 5DT4A 5AAGA 4DBGB 3CQWA 3EOCA 2J7TA 5IMXA 3TM0A 5C03A 1TVOA 4HYHA 4D2RA 3QZFA 4OGRA 1OGUA 2WOUA 4MQ2A 1Q24A 3RNIA 3TXOA 4OLIA 3D9VA 5CI7A 2ZV2A 3MN3A 1L3RE 5L2QA 1Q02A 3BV3A 5FP6A 3ZSGA 4N57A 5AP4A 3RPSA 1LEWA 2LVQD 1L8TA 1R3CA 2G1TA 3IDCA 3AQVA 4HYSA 2GQSA 4ORKA 3HMIA 4FV0A 2EVAA 3OUKA 3NUYA 4C61A 2OFUA 4AA5A 2YJSA 4OT5A 2QOIA 4F7SA 2R5TA 4ZS4A 3QXOA 1ZMVA 3ZRLA 4DEDA 3C5UA 4DYMA 5HLWA 3ZRKA 3E3PA 4L9IA 4OTRA 4KIPA 4N0SA 4V01A 5AV2A 4HCUA 4DGOA 5KKRB 2J6MA 3VS7A 5IUIA 5A3XA 5DFPA 4ZJVA 5JEBA 2GNHA 1UKIA 2C5YA 3P5KA 5HIDA 2BROA 2JKQA 4M67A 4U79A 2Z8CA 1P4OA 3Q52A 2VTSA 3QZIA 4F0FA 1GOLA 2XB7A 4CFWA 4BF2A 4UB7A 4E26A 1V92A 5IH5A 4M97A 5IQBA 3C7QA 3UTOA 3RCDA 3IW6A 3CTJA 1R4GA 2PL0A 4YO4A 4ERKA 4FV5A 5EKOA 2JDTA 4NL0A 2UW6A 5GIOE 3AC8A 4YNEA 4EEVA 1WFCA 3L1SA 5BMSA 4E6QA 5JGBA 4YPDA 3LCOA 5IQIA 2PUNA 5LQFA 4RIYA 2JKKA 1ZOGA 3G9NA 1H1QA 4YGAA 1OIUA 4QPSA 4NW5A 4YC8A 4QO9A 2QOCA 2PPQA 2FSMX 2OH0E 5CS6A 2E9NA 3L9PA 4AU8A 1FGKA 5CF4A 2PE2A 2BAKA 5IQEA 1HOWA 3TNHA 3VF9A 4C4EA 1HQYE 4AT5A 2G2FA 2YCRA 3R01A 2E9VA 2PVMA 3Q04A 3GXLA 2YN8A 3QCYA 5CVHA 3SRVB 1CMKE 1R39A 3H3CA 4PL5A 2JDSA 1SNXA 2E9UA 4JQ8A 3VC4A 4C0TA 2XRUA 4IXPA 4YTHA 5E1SA 3RWPA 2V5QA 4XUFA 5D1JA 5ANKA 5C27A 4MXZA 4GK3A 1OL6A 3ZLWA 4U42A 1H28A 2J5EA 3BV2A 4W4VA 2WU6A 1ZZLA 5AR5A 3I81A 2H9VA 2W1ZA 4O0TA 4R8QA 3VUIA 2KULA 2GMXA 5DBXA 5FXSA 3LFSA 4FV4A 4BWPA 4CMOA 4PDPA 1XH5A 3R7UA 1CKPA 4RZVA 2OO9A 1OPKA 2XZSA 2GHGA 1YDRE 3F2AA 3EFJA 1FINA 3HYHA 3P08A 5D12A 4DH1A 1G8AA 4O7SA 4F0GA 3DDPA 3R1NA 2A19B 3AC2A 4KSQA 4C02A 3OC1A 1BVSA 2B4SB 4FEQA 4J95A 4QQ5A 4WG5A 1FMKA 2Y6MA 5DR6A 2AUHA 5ANGA 3UYSA 3POZA 4P5QA 4QMQA 4LOPA 2XNBA 4OTGA 4X6QC 3TKUA 2LAVA 5FEQA 2WTKB 1SVEA 3I79A 4O2ZA 4BRXA 1HT1E 2VO6A 2WHBA 2UVXA 3AGLA 3W10A 5LMAA 4BDBA 3RHXA 2QR7A 4IWDA 1K9AA 3EN6A 3FLNC 5TOZA 5AR8A 4E4LA 4WSYA 2XIXA 3R7YA 3TWJA 4DINA 4WO5A 3QKMA 4YLLA 3SG9A 3MV5A 4GFMA 4XP0A 2AC5A 3VS1A 3RPVA 5AX9A 3Q5ZA 4J8NA 4BDFA 4D0XA 5I9ZA 5M4FA 2L4EA 4LI5A 3R8LA 5CT0A 3OMVA 2BZHB 3CLYA 4M68A 2PVRA 3R1QA 2WEIA 4GK2A 2A2AA 1J1BA 3BGQA 3BU6A 4AW2A 3FQSA 5JSMA 2UUEA 1I09A 2QHOB 3M1SA 2ZMCA 4RFZA 2BVAA 3VQHA 4DITA 4D28A 2F2UA 1NVRA 4R1YA 1KE9A 3FC1X 4K9YA 3UIMA 5DA3A 3W16A 4RC3A 5EOBA 4BTFA 3B89A 3EQFA 3LCDA 4QYFA 3BZ3A 4CTCA 2C0IA 3FHRA 5M51A 2VWZA 4YJRA 2X8EA 4RIOA 1JKLA 1W7HA 3WIGA 5E8TA 3LJ2A 3DV3A 1W8CA 3PTGA 4JBVA 4I92A 4TWOA 3TG1A 4MF1A 3OWPA 4I24A 4E93A 4EI4A 4EK6A 1T43A 4E4XA 1OECA 3HMMA 4I94A 4F9WA 3LJ0A 3LVPA 1J7UA 2XNGA 2GQRA 4DFLA 2B9FA 1DS5A 2CKQA 4ZAUA 4ZZNA 2DAMA 3QUEA 2ONLC 2XK7A 3BGPA 4RZWA 3DKCA 2YAKA 5JFSA 4XOZA 2XNNA 3FLZA 5CU6A 3FY2A 1JLUE 3UDBA 2JY7A 4NCTC 4AFJA 3NNWA 5CAVA 5AP7A 4FKVA 4AW5A 4AZSA 3D2IA 3REPA 3EQHA 3W1FA 3U55A 2YEXA 4QMYA 1JKTA 2GHMA 4MXCA 2ITYA 1WZYA 3MWUA 3OTVA 2B9JA 1Q8TA 4O0VA 4PMMA 1YHWA 2QKWB 3WZEA 4M0YA 3RAWA 2VTAA 3C9WA 5JRSA 1GIIA 4JQEA 2FH9A 2OJ9A 4AN2A 3IOPA 5CEKA 3UIXA 4ZY6A 3FQEA 1LR4A 4HEOA 1OIRA 2CGWA 2VGPA 4CEGA 1IAHA 3ORKA 4QYGA 2VX1A 4CRSA 3P78A 1YXVA 2BAQA 4B8LA 3VW6A 3U4UA 4BCJA 4FICA 3R0TA 3GC8A 1UVRA 3LFAA 4FV3A 1BL7A 5E92A 1ERKA 2CN5A 4MWHA 3CKWA 1H1PA 4WOVA 2J50A 3K54A 3LXNA 3Q4ZA 4YLKA 3PPJA 5TT7A 2UZTA 3B2WA 1H4LA 3BLHA 2R3KA 4CFMA 3V5TA 4BKJA 1WAKA 3DS6A 2BDJA 3NUPA 3ZC5A 5HO7A 2O0UA 3OHTA 4IJ9A 1GY3A 1Q8ZA 3GCSA 4WNOA 2VNYA 2VU3A 4JG7A 1DV0A 2AYPA 3TNPC 3U87A 1VEKA 4LV8A 3UJGA 4F64A 5M08A 4RX8A 1JSVA 5HHWA 5AEPA 3AC4A 4HVGA 3CJFA 4IZAA 4OBOA 4EHZA 2W4KA 3DFCB 5LVOA 3PXFA 3KF7A 4DHFA 4UZDA 4JDJA 3E93A 4U40A 4Z9LA 4K11A 5HX8A 4IM2A 4L3JA 2YIYA 4IZYA 4WRGA 2X2LA 3LXKA 5LMBA 4BDCA 5G6VA 4IAAA 4CZUA 4E6AA 4PWNA 4FKWA 2Y9QA 5ETFA 4PL4A 4QP8A 4EK4A 5CU2A 3H30A 3QYZA 3DFAA 4DH5A 3FAAA 1O6KA 4XBUA 4AX8A 5LXMA 3L9MA 2LVAA 4O7LA 1YOJA 3TN8A 2QURA 5HX6A 2GDOA 3HV5A 4L8MA 2CCHA 4GFGA 3BWFA 3ORZA 4F08A 2J90A 3BYVA 2HWPA 2BRGA 3I5NA 3PUPA 3OD6X 4RIWA 4OBQA 4ENYA 4NM3A 3QQJA 4Y46A 5KKRC 2X8IA 3A8WA 5CYIA 3DOGA 1PW2A 4D4VA 4IAIA 3DNDA 5I9VA 4FNZA 2QOBA 1AQ1A 4D4SA 5IA4A 3L8PA 4NEUA 4HVIA 2C3JA 2P2HA 3NW7A 4FTKA 5CU0A 4UYAA 1WVXA 1Y91A 5DOSA 4O81A 3ZEPA 5J9ZA 4U5JA 3ZSIA 2ETKA 2EB2A 4FTUA 4O86A 2UW3A 4KIOA 4PDSA 3MVJA 4FTOA 1OIQA 4D2VA 2QU6A 3VQUA 4UWYA 4I6BA 2RFNA 3DJ7A 3QCQA 2YFXA 4UMQA 1IR3A 3EWHA 4F7NA 2FSTX 5EI6A 1SM2A 4KNBA 3GCPA 3PVBA 3GOKA 3BCEA 3ORTA 1GZNA 3NS9A 4F9YA 2HENA 2J2IB 3FI3A 3PRIA 4FKOA 2ITPA 4LV5A 2OOAA 1VEJA 3CJGA 5DVRA 5AP5A 5EW3A 3UC3A 3NIZA 3NX8A 3VF8A 4C4GA 1OI9A 4M69A 2PZRA 2CLXA 3EFKA 1S9IA 2ZB1A 2XK8A 4N6ZA 2BMCA 3O51A 3QLFA 3MH0A 3KULA 5M53A 3KMMA 3ORNA 3R7GA 2XK6A 4UZHA 5LMKC 4FSRA 4YLJA 3UZTA 3DNEA 3OROA 3IGGA 5CEQA 5HQ0A 4EOOA 4BIBA 1YXXA 4BCQA 3EH9A 2R64A 4ACGA 4FMQA 3TKIA 3RZFA 4L00A 3BYMA 3KXHA 4BZOA 4IAYA 4CLIA 1G8SA 2X2KA 5CI6A 2XNOA 2WMBA 5CEIA 5AV0A 5DEYA 3D2KA 3DLSA 4AGDA 3DAJA 2PUPA 4ZTNA 4RC4A 1Q62A 4KINA 2OBJA 2GTMA 4JLCA 3ANRA 5D11A 3Q3BA 3NAYA 2R3MA 5FG8A 5EQPA 3ZYAA 2XKEA 3F5PA 3Q4UA 5CEOA 1T46A 4DGLC 4EKKA 2X8DA 3JXWA 4Y5QA 2CLQA 1ATPE 2JAVA 4DH3A 3TIZA 4BR3A 2JITA 4GK4A 2UW5A 4KBCA 4WNMA 5L6PA 2WTKC 3OEZA 4EOJA 2GNLA 3JY9A 3E21A 4FKPA 3UVQA 2GNIA 4P90A 3LFQA 4R78A 3W8QA 4A07A 4KIKB 4EC9A 1AD5A 3IOKA 3KQ7A 1XHAA 2QG7A 2LVPC 2HYYA 1K2PA 3BRBA 2L4FA 1E1XA 3EQPA 5JT2A 2QOQA 4I21A 4XG6A 3QX4A 3R6XA 4F1OA 3FZRA 5IH6A 3D0EA 4O0YA 2BAJA 5BPYA 1YWRA 3PVGA 1CTPE 3A61A 3EFLA 3R73A 5ANIA 5T6KA 4DFUA 1G4AE 1WBVA 4FEXA 1NT2A 1M2QA 3R8ZA 2VWWA 4XG8A 4RWIA 5ITAA 5LVMA 3RTPA 4YZ9A 4EWHA 2LVNC 1WGLA 3PXKA 3D94A 2WO6A 2W1CA 3P1AA 4L3LA 4XBRA 3COHA 1H25A 3ROYA 4CSVA 4FIEA 2XF0A 2UZVA 4MQ1A 2BHEA 3BLQA 4USFA 4UMRA 3R7EA 4Q9SA 4KS7A 4C35A 1DI8A 4BI1A 2EUFB 4FEWA 5BVWA 4GSBA 4YZDA 4G5PA 4CD0A 4KB8A 4OW8A 2J5FA 3TCPA 2P33A 4GEWA 3WYYA 5AM7A 5T68A 2IZSA 2UW0A 4I5PA 1BMKA 2J51A 4WHZA 5I4NA 3IECA 2V7OA 3HX4A 3S4QA 3S00A 1ZMUA 3R71A 3V3VA 3H9RA 4YBKA 5E8UA 4DF3A 5AR4A 4FV6A 3A4PA 3KEXA 4IVAA 4U7ZA 3QRTA 4YJUA 5HIBA 3F5GA 3O96A 2YLEA 4C4FA 4X7QA 2JFMA 1OUYA 5EDPA 4G3DA 2C5VA 2QC6A 1OQYA 3KCFA 4WG3A 4AZEA 3CY3A 3LLAA 4MH7A 5GJFA 5FP5A 3NUSA 4FTJA 4YNOA 3NYVA 3OT8A 4EH6A 4QP6A 2YCSA 4FEUA 3TV7A 4ZLOA 2YZAA 4FKJA 4FUXA 2R3FA 4G31A 5M06A 2QO9A 4I23A 2WU7A 4L68A 5CWZA 4XRLA 3VUTA 1J7IA 3EHAA 2RFDA 1JBPE 2PTKA 5CNOA 4EBVA 2BFYA 2WTDA 4ASZA 4LQMA 4FSZA 3CP9A 3VUDA 1KE5A 2HIWA 4EYJA 4PX6A 4WBBB 3PY0A 2RG5A 3KL8A 4DFBA 3VS3A 5GZ8A 3PDTA 1FVVA 2VUWA 5BYLA 4I6QA 2X6EA 3EQGA 3QRUA 4AGCA 3TKHA 4JX3A 1ZXEA 3GQIA 2OG8A 4OTFA 4XCUA 3RALA 1LP4A 1Q3WA 2FYSA 2PMLX 2VWVA 3G0EA 3Q4TA 3M2WA 2OJIA 1XWSA 2O5KA 5GNKA 4BIDA 5JFXA 5E8VA 4NU1A 4A7CA 3LIJA 2HXLA 1Y8YA 4JAJA 2PE1A 1MRUA 1XBAA 4Y85A 4ACMA 4IIRA 4W8DA 5K0XA 3PJ2A 5IH4A 1YLAA 5E8SA 3O8TA 2CPKE 2I6LA 3GCQA 3A4OX 3DKGA 2C3IB 2FSLX 3C4XA 5AUVA 2ZV9A 3OCSA 4BCPA 4OTIA 4C2WA 4R5YA 3UP7A 4YJNA 4TWNA 3TDVA 3FRHA 3C4WA 4NFNA 4NIFA 4I5CA 2C3KA 3RNYA 2CDZA 2IG7A 1NV9A 3K3IA 1P3QQ 4HVSA 5KX8A 4PTEA 2BTRA 5DLSA 4EORA 3AGMA 3FZSA 1QZEA 4AOJA 3V01A 2OI4X 4HPUE 4DGMA 3NYXA 1GIJA 3FMHA 2X1NA 5JRQA 5JK3A 1U59A 3LFBA 3TZ8A 4YSJA 1XH6A 3QRIA 2CKPA 2C5NA 5I9XA 4BC6A 5JQ8A 3G33A 4EQCA 4DTAA 4TY1A 4FT7A 4U3YA 2PZYA 2BZKB 4RIYB 1NA7A 4AW1A 3PJ8A 3R8PA 5KBQA 3F3TA 2HWJA 3ZFMA 5IU2A 5J1WA 4F09A 1YDTE 4ANOA 3UPZA 4HCTA 2DENA 3JUHA 4IB3A 3ORLA 3WF7A 2X7GA 1PXPA 2B7AA 4QMOA 4ZSEA 2EWAA 4EBWA 4QP1A 4YJSA 5F20A 3K5UA 4FV9A 2OJFE 3UODA 3W18A 3ZH8A 5L2IA 2PMIA 3MPTA 4FV1A 5LCJA 4JBOA 5CQUA 2ZAZA 4MTAA 3SQQA 3IG7A 2GQGA 4LGHA 3TT0A 1U5QA 4H05A 4ZTMA 4L46A 5HE2A 4TYEA 2JKMA 4IB5A 3ZXZA 5BVNA 4O7WA 1B38A 3F7WA 5AM6A 2CNVA 3DTCA 1GZ8A 3U4WA 3GCUA 5C8MA 5GHVA 3VAPA 3SG8A 3RAHA 5EQYA 2EKFA 3PZEA 3QFVA 2YACA 1IAJA 4X2FA 2QG5A 3L8SA 2GNGA 2YA9A 4FZ6A 4FL2A 4EH3A 1OVEA 2VO7A 3UO5A 3WF6A 2P3GX 5DIAA 5AA9A 4GRBA 3C51A 4P7EA 3CC6A 5CAOA 3V6SA 4FT3A 3R00A 3HP5A 2W0JA 2FUMA 3NNXA 5FDXA 3MYGA 4BVUA 1U5RA 3V5QA 4EHGA 2WZJA 1M7NA 4FE2A 3SW4A 3KC3A 2XIKA 3PVUA 3P7BA 4MNEB 5IQCA 3LXPA 3QTRA 4RG0A 2WTJA 3ZZWA 1OPJA 2HW6A 2I0YA 4M15A 2ITNA 4P4CA 3TV4A 3UG2A 3F66A 4EOQA 5E90A 1ZYSA 1PXJA 2CJMA 4B6LA 3KRJA 3O23A 1JVPP 2VV9A 3UQCA 3NUNA 4L67A 5JMSA 5AFVA 2IJMA 5CF6A 3DXPA 3I0OA 2R3OA 4F6WA 4I1ZA 4CFNA 1YI6A 4RIXA 4RSSA 3R9RA 5BVFA 4L01A 4BB4A 2P4IA 5AP0A 2WB8A 5EQEA 5CXHA 4YPSA 1H00A 2X81A 4RFYA 4B0GA 4CMTA 3VUHA 4F0IA 3N4TA 1A06A 4TXCA 4XX9A 2XK3A 3ATSA 3ZO3A 2J4ZA 4C33A 2QODA 3QYWA 4KUJA 5H8BA 2XCHA 3NMUF 2QONA 4A9YA 2QLQA 4FZFB 2OIQA 4M7IA 3QU0A 3HMOA 1BKXA 2VX3A 4UXLA 4CGAA 2FGIA 1SG9A 2Q0NA 2BILB 4FTIA 2VTPA 5BX0A 2WD1A 4QMXA 2PWLA 3O50A 4MX9A 4RQKA 1ZYLA 2GPHA 3BHVA 4GT3A 2JIVA 2QCSA 4PMTA 4ENXA 3TJDA 3MVHA 2YIWA 2WMAA 1FVRA 3CD3A 3MY1A 4ZIMA 1GJOA 3KRWA 3MPAA 2OZAA 3PJ3A 4DG2E 3ALNA 5AV1A 4CYIA 1LEZA 4DBXA 4XS2A 4F7JA 1VQ1A 1F0QA 3LCTA 1BI8A 3R9HA 3GUBA 3NWWA 5CU3A 3DPKA 4HVHA 4G6LA 3ZZEA 3OXTA 2W1IA 3E46A 5IZFA 1B39A 4LOOA 2OK1A 5FTGA 4FT9A 3ZHPC 3PPZA 3DKOA 4I5HA 3A7GA 3DB6A 4EJNA 3CD8A 2YITA 4D4YA 5DRDA 2V0DA 4BYIA 5C8KA 4W4XA 5C9CA 1U54B 3PWYA 4FX3A 4AS0A 2XMYA 3RK5A 3MSSA 2UZOA 3BEGA 4DEGA 4KIQA 1KOBA 3FZTA 3RK7A 4AGUA 2VNWA 1DI9A 2RFEA 4I4EA 3EL8A 3NR9A 3K9OA 4CKIA 4FVQA 4G3GA 2HK5A 3HLLA 2W1DA 4QTDA 3F3UA 4X6RA 4EOLA 4E5BA 2W9FB 3KMUA 4PDYA 3TDWA 4GH2A 1IRKA 4MKCA 4ACHA 5K4JA 2HZIA 1CKIA 4GYGA 2HZ4A 1VR2A 4A9RA 4E8AA 4YMJA 1HT2E 2VX0A 3ZEWA 4FSNA 3MMPA 1NY3A 1PKGA 3O8PA 4DBNA 5HLPA 4PL3A 2C6DA 4GU6A 3ZUTA 3MI9A 3UGCA 4BYJA 4DG3E 1ZWSA 4HNIA 5AUTA 5J95A 5CSHA 3BE9A 4K8AA 4NM7A 3GB2A 3PYYA 4IVDA 2VGOA 2PVJA 3PXQA 5AX3A 3W2OA 1BL6A 4BZDA 3VO3A 4C8BA 4E5WA 3QC4A 3I1AA 1H0VA 4XG2A 3TEIA 5LWMA 1MRVA 1ZV1A 4MK0A 4MAOA 1DO0A 4G3CA 4I6HA 4FK6A 4P5ZA 5BVEA 4II5A 3R9NA 5JN2A 4CFVA 3O17A 2BRBA 2C5XA 3D14A 2PZIA 4GUEA 4HGEA 4WUAA 4YHTA 5DT0A 3KCKA 4QOXA 3UNJA 1VG5A 3C4ZA 4GKIA 5KMOA 1KUTA 5J1VA 3GGFA 3DJ5A 5D41A 4G3OA 4R3PA 5DEWA 5A4LA 5L8JA 4CCBA 2YDKA 5F4NA 1OL5A 4FTTA 3SXRA 1MP8A 2PZPA 2IO6A 1WVWA 4DEIA 2PVKA 2WMWA 5E4HA 3ACKA 1PKDA 5B7VA 4CFUA 3GLHE 3H0YA 1ZY4A 2BCJA 3FLQA 4USDA 3ZUUA 3HAVA 4WIHA 4IWPA 3R8UA 3BGZA 2A0CX 3I6UA 4PF4A 3EN4A 1AIPC 2HAKA 3K5VA 3N4VA 4H39A 4EOPA 3FUPA 4V0GB 2W1EA 4D2TA 3FEGA 3VBQA 1P5EA 2OSCA 1UA2A 2FVDA 4G9CA 5B2KA 3UOKA 4GUBA 4RIWB 1VEBA 4G5JA 3R28A 4H1JA 4N6YA 2J0JA 4QMVA 3OCGA 4MWIA 5HORA 3VS2A 2G3QA 2BR1A 3HRFA 1PXIA 2R3JA 1PY5A 4WP2A 1UU9A 4HOKA 1EFUB 4YURA 1YDSE 1HCLA 3WYXA 3P4KA 4WNPA 4FT0A 4A9TA 3AMAA 5BQ0A 1R0EA 3P23A 4FBXA 4BCIA 1QPEA 1PXOA 3ZS5A 2CMWA 3ENHA 5CLPA 3FKNA 3LFEA 4RC2A 4FIIA 3DK6A 4R77A 3UE4A 3L8VA 3OG7A 4MD8E 3QTUA 3R02A 5DR9A 4AAAA 2X7FA 4RX5A 1JSTA 2VO0A 2ITVA 2W4OA 2OXYA 1UWJA 4LRJA 5LVLA 3LMHA 2F49A 3MDYA 4X2KA 3ULZA 3C4CA 3Q9ZA 4ZSGA 5HTBA 4EHEA 3EYHA 2CN8A 1G41A 4B99A 4BHZA 3PG3A 3Q2MA 2DWBA 2YISA 4HYIA 4FF8A 4PPAA 3WF8A 4YBJA 3KULB 5I5ZA 3KU2A 2PMOX 2WMSA 2YM5A 2PUIA 2WMUA 5HBHA 4D58A 5HU9A 3UC4A 3IO7A 1PMEA 3GBZA 4XG3A 5AR2A 3E87A 5M4CA 2PZ5A 4JBPA 4A06A 4ASEA 2UW4A 2HWOA 2UZUE 4FTQA 2OJGA 5HO8A 3CGOA 4GJ2A 4OTHA 5EH0A 3RGFA 4CMUA 4D2WA 3NUAA 2DS1A 4Z7GA 2MJ5B 5FGKA 3LMIA 4EZ5A 4XP2A 3OOMA 4L6QA 2BKZA 4S30A 3WI6A 3BKBA 5L3AA 4X3JA 2XJ1A 5HVYA 1OL2A 3UOHA 3OVVA 4IDVA 4YJVA 2JEDA 2HXQA 2DI0A 3N9XA 3VULA 1IG1A 5CF8A 4CLJA 3VIDA 5CSPA 5AA8A 5J5SA 3TV6A 5CEMA 1XB2B 3CQEA 3QUDA 5IPJA 3NCZA 2W99B 1OIYA 5HI2A 4NKAA 4R5SA 4C7TA 2OH4A 2V62A 3MIAA 5IA2A 3R22A 4XP3A 5AUYA 3U9CA 4FG9A 3V5LA 5GIPE 3B2TA 3LZBA 4CRLA 3D5UA 4L44A 4D9TA 1DM2A 5CAQA 4WA9A 2JKOA 5HNBA 5E8XA 4IM0A 1TQPA 4NK9A 2CHLA 4BBMA 5JGAA 4GIHA 5EM7A 4O96A 4TNDA 3H9OA 4E20A 4H58A 5F95A 3BE2A 4QMNA 2P2IA 4V05A 4G16A 3Q6WA 4JRVA 4QMMA 2WTWA 4IMYA 3PP1A 5I9UA 3BBZA 2O65A 2R7BA 2R3QA 3I60A 5EDRA 3LM0A 3UIUA 3EKKA 4LUEA 3AC3A 2DQ7X 3R9DA 5FDPA 5HZNA 2PYWA 4I5MA 4FTAA 4BTMA 5CT7A 3IGOA 4EJ7A 3OZ6A 4BBFA 4YHFA 2JC6A 4FTNA 2JP7A 3C4FA 4RJ6A 2B3TA 1KSWA 4QTBA 4FIGA 4O2PA 4X2JA 3ROCA 4BZNA 4FOCA 3V04A 5DHJA 5D10A 2Y6OA 5AIKA 1V0PA 1YRPA 1IA9A 2X4ZA 2WQOA 3N4UA 2YLFA 2P0CA 1KYIA 2HY81 4FTRA 2BHHA 2ESMA 3FLSA 3HV4A 4JG6A 4FKTA 5ETCA 2R3HA 3CR0A 1Q5KA 3WIKA 1C7YA 4FSWA 4FZ7A 2BRHA 3FC2A 3OWKA 3R1SA 4ID7A 1H1WA 4V04A 3TZ9A 3S95A 3G6HA 2KNZA 1JPAA 5HIEA 3ELJA 3V8TA 4ANBA 2ZMDA 4ZSAA 3UO4A 3FPQA 1VYWA 2WIPA 2UV2A 1XH9A 1RW8A 3EB0A 1V0BA 3LFCA 3OFMA 4IM3A 2VTMA 4B9DA 3TACA 4MBJA 4PNIA 2X2MA 3VJNA 2CKEA 1R0PA 5ANEA 2W17A 2JZ0A 1UWHA 2JD5A 2ZVAA 3ERKA 3MW1A 1MN3A 2F4JA 2RSVA 3P86A 4YZBA 4IWOA 5DI1A 3ZUVA 5AAFA 4A9UA 4DAWA 4E3CA 2EXMA 3G0FA 3CSVA 2RGPA 3O0GA 3CBLA 2YM6A 3MVLA 4UV0A 5AJQA 1OKYA 5HKMA 5FXRA 4FK3A 4C4HA 5GZAA 2C1BA 5KHWA 2IVVA 3PY3A 3LCVB 4ERWA 5CAPA 2UZLA 4EONA 3KF4A 2YWVA 3MFUA 2AC3A 4ZTLA 5GJDA 3SGCA 5HD7A 3UP2A 1WBWA 5LARA 4E7WA 5E1EA 4D5HA 2WAJA 4IADA 1ZZ2A 4D1ZA 4E6CA 3ATTA 4LYNA 3MPMA 3VWAA 4IBMA 3WOWA 3LPBA 5LMKA 3I0QA 4B8MA 3QQHA 3MBLA 3QQLA 4FKSA 4K2RA 4C37A 2E2BA 4QT1A 4GG5A 4X3FA 4S33A 5EHLA 2CGUA 1YKRA 3I7BA 4U80A 3E8DA 2BWEA 2R3PA 3IKAA 3Q9XA 5EHYA 3SOAA 4EOKA 3QALE 3E3BX 3EYGA 4NM5A 5F94A 4CKJA 2CGXA 3ORMA 4B4LA 1OKVA 2FA2A 3EJ1A 3HRBA 1VZOA 4ZXTA 4EH2A 3QWJA 4ALUA 1URWA 4YZCA 3WE8A 4UMTA 4PDOA 1QL6A 3EZVA 4RJ4A 2YIQA 3D83A 3MFSA 5A4EA 1EH4A 4Y95A 3MJ2A 5I9YA 2C30A 4IAFA 5AIRA 4FVPA 3EZRA 4F4PA 1TR8A 1OITA 4FI1A 3U6IA 4IQ6A 3D5XA 3SXFA 4NT4A 1YQJA 5KHXA 2Z02A 3RAIA 3SLSA 1M52A 3FXXA 3FI8A 3ZCLA 2H96A 3F69A 3KK9A 4U43A 1GZOA 4FV7A 4MCVA 3WE4A 4BKZA 4D55A 2X9FA 3P79A 3QD4A 3QWKA 4PV0A 4K77A 5CZIA 4UMPA 2VTLA 5DPVA 3QD2B 3FE3A 4TPTA 2VN9A 5FLFA 3UIBA 4NIFB 1BX6A 2DAEA 3DY7A 4YTFA 2CSNA 4E1ZA 1WBNA 5JFWA 5IQFA 2QOKA 2XUUA 1S9JA 2Q83A 2ITWA 3QQFA 2QOHA 2YM4A 1QPDA 3D7ZA 3ORXA 5FM3A 5GJGA 5BVKA 2R3NA 4I3ZA 3O7LB 3KK8A 4ONAA 4MXYA 3JVRA 3F88A 2C5OA 4LMUA 1PXMA 4O1OA 4AUAA 4BDEA 4L45A 1FPUA 2VTQA 5DH3A 3MA6A 4QP4A 3JY0A 5HG5A 4D2PA 3RPRA 3ZLYA 4AE9A 3W55A 4UBAA 2BWBA 2WMXA 3HRCA 4CZYB 3Q5IA 4KKGA 4LRKA 4IZ5A 5E8YA 4CV9A 1PYEA 4LMNA 2R3RA 3DK7A 3KXZA 2ITXA 1B6CB 4EKLA 4FNXA 3UQGA 4C3FA 3MESA 5HESA 2QHMA 3ZLXA 4G6OA 5DE2A 3SOCA 4QPAA 5L2WA 2XA4A 1FBNA 1IM2A 3V51A 5CEPA 5H3QA 5IUGA 5IA1A 4CV8A 4BCHA 5EW9A 3N51A 3VNTA 1AGWA 3C4EA 2JLDA 3A7IA 3R2YA 3MFTA 3QKLA 1OPLA 3R04A 5DFLA 2VD5A 3R2BA 1FGIA 3I4BA 4WKQA 2QR8A 4PP9A 4K18A 4KKEA 5E91A 2EJSA 2RF9A 1YOLA 3ZFXA 4PMPA 1DAYA 2ZM4A 3PIXA 5HNIX 3ZM9A 3BEAA 3HGKA 3DU8A 4ALVA 2F9GA 4OAUC 4M12A 5HG9A 2GS6A 4BHNA 3QLGA 5AUZA 2PE0A 2PVNA 4FV8A 4RVKA 5F1ZA 1PGYA 2NP8A 3BI6A 3NW6A 4YJQA 3HAMA 2XJ2A 3LQ5A 4DEAA 3GC9A 4IWQA 2I0HA 1XBBA 2OIDA 3EN9A 4PPBA 2DYLA 4FNYA 4J53A 4XH6A 1YHSA 3BX5A 2XIZA 4LL0A 3LQ8A 2IPXA 5GZ9A 4DFXE 4Z3VA 2OIBA 1URCA 2O2UA 3GOPA 4P2KA 1ZY5A 3DA6A 2W06A 5A6NA 5L2SA 5M07A 4IC8A 4O7YA 2XRWA 3EMGA 3SX9A 4D1SA 3P9JA 1VEGA 5J5TA 3ZDUA 1WIVA 1QCFA 2G15A 4YJOA 3MIYA 1M14A 4I0RA 5HG7A 5CASA 4JAIA 5FBOA 1SNUA 4CT2A 3A62A 4HW7A 4TWPA 3TTIA 3OF0A 3EFWA 3IHPA 2F7ZE 3MH1A 2BDFA 4RIXB 4AACA 5AR3A 3E8NA 5TF9A 3T9IA 4N4SA 3G90X 4UXQA 3OS3A 1BYGA 1WBTA 3ZFYA 4DFZE 5CQWA 2JIIA 3KB7A 5BYZA 5CVGA 3NUXA 3PFQA 4HGTA 5E7RA 5EOLA 4DFYA 4FA2A 4FR4A 4MD7E 1IEPA 2A1AB 3G9LX 5DGZA 5AP1A 5EK7A 1OAIA 5IF1A 3DXQA 1WMKA 4QMPA 4IW0A 1P2AA 3A7JA 4MD9E 5M56A 4M13A 4RX7A 4JBQA 4H3QA 2WTIA 4C36A 5I3RA 1M17A 2HY0A 4KSPA 3IONA 1XO2B 1CDKA 4ITJA 3VHEA 5BVOA 1OB3A 3GU4A 4BGQA 1SVGA 2ZV7A 3AD6A 2H34A 4QYYA 3S2PA 1SYKA 4RJ8A 3R1YA 3B8QA 4FSTA 2Y0AA 3FRIA 4C3PA 2J9MA 3UNZA 3P7CA 3LKMA 1OM1A 3O7LD 2QD9A 5A9UA 3ACJA 3UZPA 2YWPA 1YXSA 3ZMMA 4UX9A 2NRUA 2J0MB 2ZV8A 2LGCA 4S34A 3W2CA 4ALWA 4J7BA 4BDAA 2XK4A 3A99A 3WARA 4DN5A 3SVVA 4EUUA 1Q97A 3VN9A 2IN6A 4EH9A 4EQMA 1VDLA 1CKJA 2GHLA 4IZ7A 2ETRA 3RPYA 3UMWA 4AF3A 3LCKA 3LM5A 4F9AA 3PRFA 3H4JA 1O6YA 4QMZA 3QBNA 4J8MA 4HNFA 5DR2A 4PTGA 3LCUA 4IX6A 5AAEA 5IKWA 4NH1A 4QMLA 2GFCA 4BDJA 2JIUA 2C3LA 1JWHA 3MH3A 3NVKI 4W9XA 4R3CA 1NXKA 1GZKA 2REIA 3KXMA 3ORIA 4G3FA 4F1MA 4O7VA 5ACKA 2XS0A 2IVTA 4ACCA 2JDVA 4F9CA 2C6OA 2WTCA 3QC9A 2FO0A 3NYOA 4LRMA 4QTAA 4HGSA 3UNKA 5ACBC 3F61A 4IEBA 3F5XA 3QA8A 4Y73A 5HCYA 2JDOA 3PZHA 2WQEA 2VWBA 2VO3A 5H8EA 3ZRMA 4AN3A 2C6TA 4BWXA 4H1MA 3HUCA 2R2PA 3BHTA 2EXEA 2KTYA 3HV7A 4BI2A 3BU3A 4IFGA 4FIJA 4XYFA 3PLSA 3ZM4A 4QP7A 2WTVA 3FPMA 5JI2E 4DEHA 4NKSA 3TUCA 3HDNA 1JKSA 4ANQA 5IQGA 4HPTE 4APPA 4BKYA 2GNFA 3HV3A 4O27B 3UPXA 1STCE 4XRJA 2V7AA 4RJ5A 1G3IA 2ZTCA 3QGYA 3FZOA 4CNHA 2XP2A 4BIEA 2IVSA 2PMNX 3PJ1A 2QQ7A 4IX5A 3UO6A 2XNMA 1MRYA 3GI3A 3KRXA 2DNAA 5HICA 3IW7A 4NTSA 3HL7A 4O7NA 4FTLA 3EQDA 4OTWA 1ZYDA 4XV3A 2QI8A 1V0OA 5AV4A 2QOLA 1R1WA 4UMUA 3F6XA 3GLGE 4FNWA 5HEZA 4IJPA 3PWDA 4BCKA 3FHIA 1XXHE 5EI8A 1XR1A 4EZ7A 4YR8A 3QHRA 3COKA 1U46A 3V5PA 1OKWA 3VS0A 3LFDA 2RKUA 3GVUA 3L9LA 4H36A 5JKGA 1GNGA 3KY2A 4IVBA 5A4CA 2WQMA 5HO6A 4YTCA 5M09A 5KBRA 5M57A 2MROB 5L8LA 3IQ7A 4BBEA 1Q8UA 3BBTB 1PHKA 3QTWA 3W33A 5T3QA 4E4NA 2ERKA 1H07A 3SA0A 3LCSA 3VW8A 3DLZA 2Z7QA 2J0LA 4JOAA 5CSVA 3LAUA 3Q60A 3HA6A 4I41A 2Z7RA 2QNJA 2QSFX 1XQZA 4J52A 5C4KA 3IPHA 3LHJA 4KRCA 3QQGA 4IX3A 1FQ1B 3E88A 5D7VA 4FSMA 5H9BA 3TJCA 5B2LA 1FOTA 4EL9A 1K3AA 1ZLTA 4G1WA 2XJ0A 3T3VA 4IACA 3TNIA 4C4JA 1H01A 5CAUA 3U6HA 2JFLA 2JBPA 1M2PA 2GNJA 2NO3A 3GU6A 4KS8A 4X0MA 4U8ZA 3FLYA 5EW8A 3Q6UA 4A4LA 4O22A 5HE1A 5LWNA 4FZDB 4FKGA 4ANNA 2IZUA 3ULIA 5BUIA 5IDNA 4TYGA 3LXLA 2WMRA 2WQBA 3KFAA 4LOQA 2ZDUA 5JZNA 4GKHA 3H9FA 2Y7JA 3OBJA 4PRJA 4ZSLA 5EYMA 2BALA 2WFYA 3G5DA 4M3QA 3MA3A 5K3YA 4FKRA 4K6ZA 4YO6A 2HW7A 4YSMA 4JX7A 3DBFA 3PE2A 4OTDA 5HOAA 2I0EA 4D9UA 4E6DA 3MY5A 4OAVB 5AP2A 4DH8A 5K9IA 4PTCA 1ND4A 3OEFX 3VBTA 1APME 2CGVA 4NJ3A 5KMMA 4F99A 4YP8A 2WKMA 3VS5A 4FSQA 1RJBA 4RJ7A 2Z2WA 4FV2A 4HYUA 3QX2A 1A9UA 3FKOA 1SVHA 3UMXA 4TKSA 4EH7A 2WMTA 5TE0A 3GLFE 4ZTRA 2FSOX 1TQIA 2F2CB 3LLTA 4MXOA 3DAKA 4AZVA 3CXWA 3PE1A 3PG1A 1ZYJA 3PXYA 3COIA 2VRXA 4FYOA 3VS4A 4BCOA 1Q8WA 1WBPA 2NPQA 2JBOA 3CPBA 3FMLA 1BI7A 3CPCA 4I0TA 3DDQA 3HZTA 2W05A 3UBDA 2VTJA 1OKSA 5FM2A 2YDIA 2OF2A 5FXQA 4CFFA 2W96B 4Y72A 3NDMA 4DTBA 3OWLA 4LG4A 4QP3A 4H3BA 4YC3A 5BVDA 4HJOA 4IE9A 2ZOQA 5AUWA 3HMPA 4MVFA 4W8EA 4U45A 3MFRA 4FEVA 4DLIA 3QTQA 4S32A 4WBOA 3BWJA 4ZP5A 1BUHA 3NPCA 4CVAA 4ZEGA 4WT6A 3ORPA 3T9TA 5KUPA 4XLVA 4RLLA 1RDQE 4QP9A 4CT1A 4DGGA 5J79A 4QD6A 2DAGA 2UW8A 3EQBA 4Q5HA 5AR7A 3R8MA 4FC0A 2NNWB 4G6NA 2O3PA 2PVFA 1WGNA 4XLIA 1QPJA 4AZWA 3WBLA 5C26A 1JOWB 2YDJA 1DAWA 3FMMA 3V6RA 1E1VA 4FT5A 4BDHA 4EH8A 3OCBA 4Z7HA 5ANJA 5HCXA 2Z60A 2OF4A 4U9AA 5J8IA 4AP7A 1OUKA 4ZK5A 1CSNA 4ARKA 5DYJA 4IB1A 4EHVA 2C6MA 3POOA 1UV5A 3AT3A 4GYIA 4RWKA 2A27A 1O6LA 4W4WA 4HVDA 4TW9A 4UY9A 4JIAA 2Y4IB 5I0BA 1NW1A 4R7BA 4DT8A 2MR9A 3DQWA 4CFXA 4QQCA 4QMUA 4MHAA 3JS2A 4O6EA 5ETAA 2VTRA 2XKFA 4NTTA 3V5JA 1NV8A 1OZ1A 5M44A 1Y57A 4GT5A 2W5BA 2PY3A 1IFYA 1G3NA 4RVLA 5LCKA 3TZMA 2YM7A 4EK3A 2IW9A 5IEVA 1ZYCA 3NVMB 4JXFA 3D7TA 1REKA 3GU7A 3THBA 5JZJA 3EQIA 4DEEA 1Z9XA 1H1RA 1MUOA 3AMYA 3E8EA 3FSFA 3CCNA 4MBLA 4L3PA 4RGJA 4Y5HA 3D5VA 4AT4A 5E9EA 3U6JA 4O7RA 4FIFA 4YHJA 3ZOSA 3GLIE 2WIHA 2IVUA 4C58A 2XIYA 2W5HA 4F7LA 4O84A 1KE8A 4BGHA 2I1MA 1FMOE 3QTZA 3EL7A 4U6RA 2ZYBA 4F65A 5BUJA 4ANLA 4ZZOA 3QXPA 4BTJA 3COMA 2BDWA 1JKKA 4HCVA 5TKDA 3ODZX 2A4LA 2GS2A 3I6WA 4AOIA 5CNNA 3VBWA 5IMEA 2H6DA 2RRUA 4R6VA 4ZLYA 2JY8A 4GJ3A 4BY9E 3D5WA 3BYSA 4FL3A 3R7IA 1ZMWA 4G9RA 1GAGA 3C0HA 4D5KA 4EOSA 1J91A 1U4DA 3O2MA 4R71A 4RPVA 4JR3A 4Y8DA 5FRIA 2Q0BA 4GIIA 4U41A 3FXWA 3KXGA 4EK8A 5K0KA 1MQBA 1UNGA 1Q41A 5JFVA 3KXXA 3RP9A 4ANMA 3QTSA 3OY3A 4RLKA 5HCZA 2IWIA 5L6WL 4FGBA 4Z55A 5J9LA 4FKLA 2ZM1A 3FBVA 2OJJA 4CCUA 4FTCA 4EH5A 2XK9A 3LE6A 2WOTA 2YCFA 3JYAA 4A4OA 4NFMA 3CTQA 3MTFA 4HGLA 1MQ4A 2UW7A 3FYJX 4XG7A 3RHKA 3BIZA 3QKKA 1SZMA 3KN6A 4EK5A 3NYNA 4FKUA 3RZBA 3QQUA 2R7IA 4RA5A 4X3FB 3WF5A 2E9PA 5I9WA 2B9IA 4MXAA 1W82A 3D15A 2F7XE 4RMZA 3FI2A 2O25A 1NVQA 2C68A 5FEDA 1P14A 4GG7A 5C01A 2R0UA
chains in the Genus database with same CATH superfamily
2XGNA 5J87A 5HTCA 3DKFA 3W0OA 3SHEA 4OU7A 2YIRA 4H3PA 4AQKA 3CEKA 3DCVA 5F9EA 3C1XA 1R78A 2H8HA 3ZO2A 4AT3A 4EC8A 1IY2A 3FL5A 3KRLA 4IBKA 3GLFB 5AUXA 2PU8A 1AUAA 2YAAA 1SMHA 1Q3DA 2YM3A 1ZAEA 1H08A 4KT0F 3SMSA 5DNYA 3T6PA 4LRSA 5LJJA 3W0RA 4O0UA 1J1CA 2UZDA 5TR6A 5L8KA 3CF0A 4M66A 4O4FA 4BICA 5KMJA 5CVFA 1REJA 5J7HA 3T8OA 2VZ6A 2UW9A 3QHWA 3GU5A 3AT2A 2V6ZM 3OCTA 4M84A 1SXJD 3FMEA 3CTHA 1WCCA 2X4FA 3J80S 3GFWA 3MY0A 1IY1A 3PSDA 2XVDA 2VWYA 1XH8A 3R7OA 1XH4A 2UVYA 3ETAA 4PUZA 4AN9A 2M5ZA 2DXIA 5L4QA 4GL9A 4DH7A 1WJ7A 3E8CA 3FYDA 3V8SA 1YW2A 3HA8A 4KD1A 3K2LA 2ACXA 3Q96A 4O21A 3OT3A 2ZJWA 3CGFA 4LF6M 3UVPA 1F5QA 2X0QA 2CHGA 3U6OA 2BTSA 3M11A 3IDPA 2PSQA 5DMZA 1KWPA 2Y4IC 4RRVA 1IN7A 1E9HA 4IB0A 1WBSA 4ASDA 2V1UA 4MGZE 3OY1A 4TZRA 4YTIA 4DGNA 3DBDA 1QQWA 1OBGA 1QPCA 2YHVA 3LW0A 3P0MA 4Q2AA 2AEGA 2W1GA 3QQKA 2R9SA 2KNVA 4YUQA 5D7AA 3LQ3A 3PVWA 5HVKA 4DEBA 4AW0A 2VTOA 3FTDA 1N34M 5CF5A 4LF5M 1T6OA 1E32A 3QYBA 5EM5A 3SW7A 2XNEA 3TIYA 4L52A 3QRKA 1V1KA 3KXNA 4ANSA 2ZB0A 4JDHA 4E73A 4EUTA 4OUCA 3DJ6A 4D0WA 3UOJA 4GVJA 2E9OA 2OICA 2EXCX 4BGGA 3QTXA 5HBEA 1O9UA 3QCXA 3SC1A 2ITTA 4C2VA 3R9OA 4OBPA 4X2NA 1L2CA 1GO5A 2WQNA 3F7ZA 4LFCM 4KRDA 2C6KA 4LL5A 2Z02A 4MGYE 4UALA 2PVHA 4QMWA 4FZAB 1QAQA 1QANA 3CS9A 4LM5A 4QPMA 3FV8A 3TNWA 4IH8A 4IVCA 2YM8A 4B7TA 4D1XA 4L43A 4U3ZA 5LOHA 1IASA 1H24A 4LF9M 3C0GA 3TUBA 3PP0A 1W98A 4I6FA 3DGKA 4FGRA 2DZNB 2B0QA 4BLCA 5KMLA 1UNLA 1N78A 2UZBA 2VWIA 2GCDA 4JJRA 2CEAA 3IS5A 4J99A 1UNHA 4G2FA 4PMSA 4QNAA 4EOIA 3QD3A 3II5A 2OW3A 2KHHA 1QDRA 2K9DA 2OPFA 3KGAA 2JNHA 2WMQA 4C34A 3FZ1A 4LF4M 4AE6A 3E62A 4ZTQA 3SHFA 2Z3XA 3BYOA 3WZDA 5IA3A 4L7SA 2B52A 2VTNA 4GW8A 3W0MA 5AP3A 2KW0A 5D9HA 2V55A 1OL1A 3LVVA 5HBJA 2XAOA 4PPCA 3AG9A 2OKRA 2G01A 4DG0E 4OT6A 3A8XA 2XARA 5CTPA 4U81A 5IA5A 4TL0A 4L7FA 4AXAA 5KMIA 1R2YA 2VIIA 4FVRA 4WUNA 4I93A 4N70A 1H8FA 5KNJA 2JY5A 4ZLZA 2DWLA 4JIKA 4ZMFA 1YXTA 2UVZA 4BBAA 3PXRA 3VLFB 5HE0A 4QTCA 2HCBA 3GRUA 3FKEA 3OWJA 2BPMA 5H37D 3IK3A 3UZPA 4FTMA 4FKQA 3O71A 5BMMA 4XV2A 2QVSE 5KMKA 4GCJA 3PSBA 2KEBA 5TO8A 5A4QA 3GFEA 4HZRA 4FODA 2XIRA 4RBLA 3FMNA 5CSWA 1KV2A 4FOBA 5B0XA 4AKHA 3NIEA 5A4TA 3RVGA 3VRZA 5EI2A 4G3EA 5BYYA 3ZTXA 5CALA 5K5NA 2CCIA 4U97A 3RAKA 2LHCA 4FIHA 1FVTA 4DT9A 2X9EA 4APCA 4UN2B 3AC5A 5HG8A 4QNRA 3DTWA 4J97A 5E8WA 5EYKA 2F57A 4GVAA 3DQXA 1DGHB 4QQTA 3CQWA 3TM0A 1TVOA 3QZFA 2WOUA 3TXOA 2ZV2A 3RPSA 1L8TA 4HYSA 4L4UA 3OUKA 2R5TA 4ZS4A 4AG5A 3U6LA 3C5UA 3ZRKA 4N0SA 5AV2A 3VS7A 5A3XA 2GNHA 5HIDA 2Z8CA 3QZIA 2XB7A 4CFWA 3UTOA 1R4GA 2PL0A 2JDTA 4NL0A 3AC8A 1WFCA 5JGBA 1ZOGA 1OIUA 2YNMD 4NW5A 4QO9A 3U6CA 2PPQA 2OH0E 4DV3M 2Z7JA 4LJAA 2E9VA 3VC4A 1R39A 5E1SA 4QHSA 2V5QA 5C27A 3SFZA 1OL6A 3BV2A 2WU6A 4O0TA 4R8QA 3VUIA 4DV2M 4FV4A 2XZSA 4C02A 4J95A 2QENA 3UYSA 2Y6MA 4P5QA 4QMQA 2XNBA 3I79A 3W10A 3HHZA 5LMAA 2QR7A 4E4LA 2XIXA 3R7YA 4WO5A 4YLLA 3VDUA 4J8NA 4LY6A 5CT0A 2BZHB 4M68A 4GK2A 3BGQA 3BU6A 3VQHA 1NVRA 3FC1X 3W16A 4RC3A 4BTFA 3EQFA 5F3WA 5M51A 2VWZA 1R6BX 4JBVA 4TWOA 3AKLA 4F9WA 1OECA 2B9FA 4ZAUA 3QUEA 3PNYA 4CIZA 3BGPA 3DKCA 5JFSA 5CU6A 3PFYA 3NNWA 3W1FA 1OGYA 2YEXA 2GHMA 1WZYA 1Q8TA 4O0VA 3WZEA 3RAWA 2VTAA 4BJJA 4O4BB 5JRSA 1NVMA 4AN2A 4AI6A 3UIXA 3FQEA 2VGPA 1IAHA 3P78A 4B8LA 3U4UA 4FICA 3LFAA 1BL7A 4WOVA 3CKWA 1H1PA 4YLKA 2P5TA 4DR6M 2FFJA 3V5TA 4BKJA 1Q8ZA 4WNOA 2VNYA 4LV8A 3UJGA 1JSVA 4HVGA 4IZAA 4OBOA 4EHZA 3DFCB 4JDJA 4U40A 2YIYA 5ITRA 3LXKA 4BDCA 4E6AA 3QYZA 3DFAA 3FAAA 4AX8A 4CISA 5HX6A 2CCHA 4GFGA 1D0MA 4OBQA 3QQJA 4Y46A 2X8IA 1PW2A 4D4VA 3JR4A 2QOBA 4O81A 4U5JA 4UWYA 1TH4A 3GOKA 3Q8XA 4F9YA 2HENA 5EXTA 2ITPA 4LV5A 2XEPA 5AP5A 5DVRA 3NIZA 2PZRA 2CLXA 2FS1A 4N6ZA 2XK8A 4I81A 3R7GA 2XK6A 3GLFA 4UZHA 3OROA 3EH9A 4FMQA 3TKIA 2GQFA 3KXHA 2X2KA 5DEYA 2APLA 3CF6E 3DLSA 4ZTNA 3GO8A 3SBJA 2OBJA 2GTMA 3NAYA 1GABA 4Y5QA 2CLQA 1ATPE 4BR3A 4KBCA 2UW5A 2GNLA 3M7GA 3W8QA 4KIKB 1IXRC 2L4FA 2QOQA 4I21A 4F1OA 3D0EA 4O0YA 5BPYA 1CTPE 4FEXA 4EWHA 1WGLA 3SC3A 4ANRA 4MQ1A 4UMRA 2J7NA 4M0WA 4KS7A 4C35A 5AM7A 2UW0A 3KP0E 2V7OA 3S4QA 3R71A 3FTCA 5AR4A 4IVAA 3A4PA 2YLEA 2UUAM 1R7RA 5EDPA 3CY3A 3LLAA 4YNOA 3OT8A 4FEUA 2WU7A 4L68A 1J7IA 3EHAA 3U61B 2RFDA 2BFYA 1KE5A 2HIWA 4EYJA 4PX6A 4JV5M 2RG5A 3PDTA 5BYLA 3KOWE 1Q3WA 2FYSA 3M2WA 4MM3B 5JFXA 5E8VA 4NU1A 2HXLA 1Y8YA 4KLNA 4ACMA 3O8TA 2CPKE 3GCQA 3C4XA 4OTIA 3FRHA 4I5CA 2C3KA 3RNYA 2IG7A 1NV9A 3K3IA 1P3QQ 1QZEA 2X1NA 5JK3A 4YSJA 1XH6A 2CKPA 4BC6A 4DTAA 4EQCA 2BZKB 2HWJA 5IU2A 5J1WA 1YDTE 4ANOA 3WF7A 2B7AA 4PT5A 3T38A 3W18A 2ZAMA 3IG7A 4LGHA 4L46A 3ZXZA 3I04M 2CNVA 5E26A 3U4WA 5GHVA 3TE6A 3R8FA 5FLXS 1IAJA 3L8SA 2GNGA 2VO7A 5AA9A 4NRWA 4P7EA 3V6SA 4FT3A 3R00A 1U5RA 4EHGA 1M7NA 3SW4A 2XIKA 5IQCA 2HW6A 4EOQA 2OQ4A 4B6LA 3KRJA 3O23A 4IIWA 5AFVA 4HLQA 2R3OA 4RSSA 1V33A 2WB8A 5EQEA 5CXHA 4YPSA 4F0IA 2X81A 3N4TA 2XF3A 1A06A 2XK3A 4C33A 2QODA 2XCHA 2QONA 2QLQA 1BKXA 2VX3A 1SG9A 5BX0A 2PWLA 4GT3A 2JIVA 3MVHA 2A5YB 3GUBA 4G6LA 3ZZEA 3OXTA 4LOOA 4EJNA 2V0DA 3VKGA 1U54B 4AS0A 2XMYA 4O4EA 2UZOA 3RK7A 4Y28F 4I4EA 3NR9A 2KDLA 3BL7A 4E5BA 2W9FB 3KMUA 5K4JA 2HZIA 2HZ4A 4GU6A 4DG3E 1ZWSA 2PVJA 4AXFA 5AX3A 4E5WA 5LWMA 1MRVA 5BVEA 4G3CA 4I6HA 4FK6A 3LQQA 4CFVA 3O17A 2C5XA 2PZIA 4WUAA 5DT0A 3KCKA 3C4ZA 3GGFA 4G3OA 4CCBA 2PZPA 2WMWA 4CFUA 4USDA 3ZUUA 3HAVA 3MJ5A 4IWPA 3R8UA 2A0CX 4H39A 4EOPA 3FEGA 4GC5A 3VBQA 2OSCA 2FVDA 4G9CA 5FTLA 3UOKA 4RIWB 4G5JA 3TYKA 2J0JA 2KZUA 3OCGA 2G3QA 2BR1A 4GH9A 4HOKA 1EFUB 1HCLA 4WNPA 4A9TA 3AMAA 4FBXA 1PXOA 3HJSA 3DK6A 3UE4A 1V34A 3QTUA 2ITVA 1UWJA 3RE8A 2F49A 3MDYA 4X2KA 3A46A 4B99A 1N33M 4KO8A 3PG3A 2DWBA 2YISA 1N32M 2YM5A 2WMUA 4MGKE 3IO7A 3E87A 2HWOA 4FTQA 3KIOC 4OTHA 4X62M 3LMIA 4S30A 3WI6A 3BKBA 5L3AA 1KSFX 1OL2A 4IDVA 4YJVA 2JEDA 2HXQA 3VIDA 5CSPA 1XB2B 3CQEA 3NCZA 2W99B 5IA2A 3R22A 5GIPE 1GL7A 2QPAA 4D9TA 1DM2A 3A98B 5JGAA 2WTWA 4IMYA 3PP1A 3UIUA 3EKKA 2DQ7X 5HZNA 5FDPA 3A45A 3OZ6A 4RJ6A 4QTBA 4X2JA 5DHJA 1KYIA 4JG6A 3VONA 2R3HA 1Q5KA 4V04A 3S95A 3ELJA 2ZMDA 1XH9A 3OFMA 3TACA 4MBJA 2CKEA 2W17A 3ERKA 3P86A 2RSVA 4Z55A 4IWOA 5AAFA 1OKYA 3LCVB 2YWVA 3SGCA 3UP2A 1WBWA 5LARA 2WAJA 4O4CA 1ZZ2A 3ATTA 3MPMA 3LPBA 4K2RA 4S33A 4U80A 4EOKA 2R3PA 3QALE 3EYGA 1OFHA 4B4LA 3EJ1A 3B7ZA 3QWJA 4ALUA 3FUUA 4RJ4A 1EH4A 4Y95A 4F4PA 3EZRA 2AHMA 4FI1A 3FXXA 8CATA 3WE4A 4D55A 2X9FA 3P79A 3QWKA 2VTLA 2VN9A 2DAEA 2CSNA 4E1ZA 1WBNA 5JFWA 3HHXA 1K82A 2Q83A 2ITWA 5BVKA 1QPDA 3EIHA 4I3ZA 2L09A 4L45A 4D2PA 1FPUA 2VTQA 5DH3A 5HG5A 3ZLYA 4UBAA 4P16A 3Q5IA 4KKGA 1PYEA 4LMNA 2R3RA 1B6CB 4FNXA 3SOCA 2XA4A 5IUGA 5H3QA 4BCHA 3VNTA 1AGWA 3C4EA 2JLDA 3R2YA 3QKLA 1OPLA 1D0KA 4KKEA 3HZJA 2ZM4A 3BEAA 3HGKA 4ALVA 4IBCA 1IXSB 4BHNA 2X0PA 5F1ZA 1J5EM 4GIPA 3LQ5A 1XBBA 1IBKM 2E5LM 4J53A 4LL0A 2OIBA 5L2SA 4IC8A 3P9JA 5EP1A 4YJOA 1M14A 5FBOA 1SNUA 4FD2A 4CT2A 4TWPA 3IHPA 3MH1A 2CHVA 2BDFA 4RIXB 5AR3A 3E8NA 3T9IA 4N4SA 3G90X 1WBTA 2JIIA 3KB7A 3PFQA 5EOLA 5KUPA 4FA2A 2A1AB 3G9LX 5DGZA 5IF1A 1WMKA 4QMPA 4IW0A 1HNZM 4KSPA 1XO2B 4ITJA 5BVOA 4QYYA 4RJ8A 1NJFA 2J9MA 2EA0A 5A9UA 4O4DA 2YWPA 3ZMMA 4UX9A 2ZV8A 4J7BA 3VN9A 4EH9A 2GHLA 3UMWA 2ETRA 3LCKA 3PRFA 3H4JA 1O6YA 5DR2A 2XFSA 4IX6A 2C3LA 1JWHA 4G3FA 4O7VA 4AXDA 5ACKA 2JDVA 4F9CA 3F61A 4IEBA 4Y73A 2JDOA 2WQEA 2VO3A 3BHTA 7CATA 3ZM4A 5JI2E 1DGBA 3HDNA 4AQYM 3HV3A 4O27B 1STCE 5ITXA 3QGYA 1MRYA 3PVSA 3EQDA 4OTWA 2QI8A 1V0OA 3F6XA 3Q8GA 5EI8A 4REZA 1OKWA 5M57A 1Q8UA 3BBTB 4E4NA 4AKIA 2ERKA 1H07A 3VW8A 2Z7QA 3Q60A 4J52A 2QNJA 4KRCA 3QQGA 5D7VA 4FSMA 1GJTA 5B2LA 1ZLTA 2JFLA 2UXCM 4KS8A 3Q6UA 3ULIA 5IDNA 3LXLA 2WMRA 2DVWB 2Y7JA 2WFYA 4M3QA 3MA3A 4K6ZA 4YO6A 2HW7A 3PE2A 2I0EA 3MY5A 5AP2A 4DH8A 1ND4A 4PTCA 3VBTA 1APME 4QNMA 4RJ7A 1A9UA 3VKHA 3UMXA 2WMTA 5TE0A 4MXOA 3DAKA 3CXWA 3COIA 3KS8A 1Q8WA 2NPQA 3CPBA 2VTJA 5FM2A 5FXQA 2W96B 3OWLA 4LG4A 3HMPA 4ZP5A 3ZC7B 4XLVA 4RLLA 1RDQE 4CT1A 3U61A 3EQBA 4FC0A 4MB7A 3WBLA 3FMMA 1E1VA 2LWXA 4Z7HA 2OF4A 5J8IA 1OUKA 1CSNA 2C6MA 2X8AA 1NW1A 5ETAA 4NTTA 1OZ1A 1IFYA 4JXFA 5FTNA 1L8QA 3AMYA 3E8EA 1QZMA 4L3PA 5E9EA 3GLIE 2XIYA 4F7LA 4F65A 5BUJA 4ZZOA 1JKKA 4HCVA 5TKDA 3ODZX 2A4LA 3I6WA 4AOIA 3VBWA 4GJ3A 3BYSA 4G9RA 4EOSA 4R71A 5K0KA 1MQBA 4LZZA 4NXMM 3RP9A 1LTMA 4ANMA 4RLKA 5HCZA 5L6WL 3FBVA 4FTCA 4DV0M 4NFMA 1SZMA 3RZBA 2R7IA 5I9WA 4MXAA 1NVQA 2C68A 5C01A 3IDBA 1P14A 3B7QA 4W4YA 4FL1A 3I5ZA 2R4BA 1XBCA 1H27A 4GU9A 3G15A 3U8WA 2ZTDA 4IC7A 5EKNA 3UMMA 1UM8A 2XALA 3ID6C 4NCTA 3SKCA 3Q32A 4BFMA 1W84A 3VS6A 4ZTSA 5CZHA 3QYEA 1PMNA 5AP6A 4AA0A 2W5AA 4JI9A 2EO2A 2C6EA 2QO2A 4OVZB 3NUUA 3VBVA 5CY3A 2G5GX 2VWXA 3A7HA 3FQHA 4TN6A 4RQVA 4C62A 2VTTA 4AWIA 2B55A 3RGPA 4O38A 3GQLA 4NYEA 3S1HA 4YU2A 3RKBA 2Y0QA 3VFDA 3PUFC 2ZDTA 4G34A 4O82A 5C8NA 3NRMA 3W32A 5EFQA 4O83A 1OKZA 1QDTA 1U54A 3NEWA 1Y6BA 2ZM3A 5LVNA 4LFIA 1F4IA 1GL6A 4GKJM 2HCKA 2J0IA 5J9YA 3RI1A 5I3OA 2ITOA 4DCAA 4M14A 3FMJA 5H8GA 4KABA 1CM8A 2I7QA 4BL1A 2WNTA 2QU5A 1JQHA 3U9NA 5L2TA 3TWKA 2CUZA 3VRYA 3E5AA 3KW6A 3RWQA 2J0KA 4C38A 4XEYA 4XNEA 1PXNA 2WMVA 5CSXA 3VBYA 2P55A 3SD0A 1Q61A 1VYZA 5A46A 3RK9A 5KMNA 2LTUA 4JDIA 5CX9A 1FJGM 3VVHA 1Z5MA 4UEUA 4BWKA 1PRYA 1YUBA 1D0LA 1WVYA 1KE7A 3J81S 3JVSA 4QP2A 1H1SA 2VQFM 2CP8A 3PJCA 5JGDA 2YZLA 2R3LA 2EU9A 5IEXA 1T45A 3A60A 3W8LA 2G2HA 3MS9A 3ITZA 4LGGA 3ZO1A 4BDGA 4FG7A 2JY6B 4QMTA 2QKRA 3SMPA 2HELA 3KVXA 4QYHA 2OWBA 2WPAA 3LMGA 3OW4A 2EKKA 2YJRA 2OZOA 2JZ1A 2UZWE 4ITHA 4CQEA 3BHYA 3BLRA 3U5ZB 3PPKA 1IBLM 3LOKA 4ZY4A 1D2NA 1PYXA 4R3RA 3KSJA 2X6DA 1PF8A 3Q9YA 5CU4A 5C1QB 1MX0A 3DBQA 4R7HA 1YI3A 2HOGA 4Q7JA 4UWCA 3ML1A 3FTFA 4U0IA 5IQDA 3SV0A 3NBIA 2DKLA 3DT1A 3RM6A 3R63A 5B2MA 1F3MC 2C9OA 1WBOA 3C13A 4GEOA 4I0SA 2XH5A 3LFNA 4UYNA 1Q4LA 4J96A 2C1AA 4J98A 5LMNM 2GSFA 4JT3A 4ZJJA 2XYNA 5K4IA 2DUVA 1HJPA 1Z57A 3MB7A 2JA2A 3RPOA 2XYUA 2PVYA 3SXSA 4KAOA 5AUUA 4EOMA 2QHNA 3TI1A 5IISA 2X7OA 3KREA 4L42A 3MTLA 1Z5BA 5KO1A 4ZY5A 2VF7A 3TNQB 2X4AA 4C57A 5IDPA 4ZOGA 4K1BA 3PA5A 4I20A 5K5XA 4MBIA 3QZGA 2Y8OA 3GC7A 4F1TA 1J7LA 2H5XA 3FJQE 4BDDA 2C4GA 5AV3A 2BRNA 3FMKA 4HL4A 3GQ4A 2KNAA 4O7ZA 4KHPM 3D7TB 3QGWA 3NNVA 2XEZA 3KSXA 3AD4A 2FB8A 4NM0A 4FYNA 3FDNA 3NCGA 4BI0A 4NZWB 4LV7A 2PK9A 3M42A 3K3JA 1NVSA 3ZBFA 3PA3A 3EN5A 1NNJA 4OTPA 3ZU7A 2QQ8A 5HU3A 3TL8A 4I22A 4JI2M 4X2GA 2OXDA 3D4QA 4CG8A 1KV1A 2ETMA 3FWQA 5CANA 4WG4A 4IX4A 3F9NA 3L29A 2C99A 3R8VA 4KWPA 4JNWA 3TPZA 4PNKA 1XH7A 3A2CA 3W0LB 4S2ZA 5KCVA 4PDGA 3JR1A 1IXSA 4KKHA 2GFSA 1PXKA 5EM6A 1UKHA 1OJLA 3PXZA 4IANA 3GP0A 2BIKB 3V5WA 4QQJA 3VHKA 4AXEA 4KA3A 4FUYA 1YSYA 4X66M 4K0YA 5KE0A 5EDQA 4F6UA 3B8RA 2XM8A 4O91A 2MH8A 4Q9ZA 4XJ0A 4K33A 2W1FA 4M8TA 4MYGA 4O1PA 4G6ZA 2C0TA 3CE3A 4XG4A 1KOAA 4O6LA 3RBWA 4YC6A 4A4XA 3ZC6A 3IW8A 3U54A 2PHKA 1XMQM 4M9SA 2W9ZB 1OGUA 4MQ2A 5ITQA 4OLIA 5L2QA 5CI7A 3MN3A 1L3RE 3BV3A 5FP6A 5AP4A 2LVQD 2GQSA 4ORKA 4LGMA 2EVAA 4C61A 2YJSA 2QOIA 3QXOA 3ZRLA 4DEDA 4KIPA 1Q39A 1QYRA 4DGOA 2J6MA 5IUIA 5DFPA 2C5YA 2BROA 1P4OA 3Q52A 2VTSA 4F0FA 4E26A 4M97A 5IQBA 3C7QA 4YO4A 4YHHM 4ERKA 1Q3BA 4YNEA 4EEVA 5BMSA 4E6QA 4YPDA 4IJEA 4TUWA 4RIYA 2JKKA 1H1QA 4QPSA 2QOCA 2E9NA 4C4EA 3GXLA 3H3CA 1SNXA 2E9UA 4JQ8A 4IXPA 3RWPA 5D1JA 5ANKA 4MXZA 3ZLWA 4U42A 1PJSA 2J5EA 1ZZLA 2KULA 2GMXA 5DBXA 3LFSA 4BWPA 4CMOA 4PDPA 2OO9A 2GHGA 3F2AA 3EFJA 3P08A 4DDIA 1G8AA 2A19B 3AC2A 4FEQA 1BVSA 4CYIA 1FMKA 5ANGA 2WTKB 3AGLA 3RHXA 1FNNA 4IWDA 3SG9A 3VS1A 2CV2A 3RPVA 4BDFA 4D0XA 5M4FA 1GVNA 1Z5CA 4LI5A 2PVRA 2WEIA 4QDVA 2A2AA 4M9XA 3FQSA 5JSMA 4DITA 4R1YA 1KE9A 5EOBA 3LCDA 4BB9A 3WIGA 3LJ2A 4I92A 3OWPA 4E93A 1T43A 4I94A 4DFLA 1QAMA 4XOZA 4AFJA 2JY7A 4FKVA 4AW5A 3REPA 3EQHA 2ITYA 2B9JA 4G4RA 4M0YA 2FH9A 4NSOB 3IOPA 5CEKA 1LR4A 4CEGA 4HEOA 3AV0A 1OIRA 3VW6A 3LXNA 3Q4ZA 3ZC5A 2BDJA 5FTMA 3OHTA 4JG7A 3TNPC 4F64A 1N75A 2ZANA 3CJFA 2DWMA 3THGA 2W4KA 5LVOA 3PXFA 3KF7A 2DHRA 4L3JA 2X2LA 4CZUA 4FKWA 4PL4A 4QP8A 3AJIB 3H30A 4DH5A 4XBUA 3L9MA 1YOJA 4L8MA 3ORZA 3BYVA 3PUPA 2HWPA 5EJCA 4IAIA 4FNZA 4HVIA 2C3JA 5CU0A 3ZEPA 5J9ZA 2ETKA 4PDSA 1OIQA 4D2VA 3VQUA 2YFXA 1IR3A 3PRIA 4FKOA 2OOAA 5EW3A 4C4GA 3GPXA 1OI9A 3QLFA 3KULA 2NYAA 4FSRA 3DNEA 1HR0M 4BIBA 4BCQA 2R64A 4ACGA 4OVZA 4CLIA 5CI6A 2WMBA 4AGDA 4RC4A 1YE9A 4JLCA 3ANRA 5D11A 5EQPA 2XKEA 4PDIA 1T46A 2X8DA 3JXWA 2JAVA 4DH3A 3TIZA 4GK4A 2WTKC 4EOJA 1E9SA 3E21A 1H6UA 4P90A 3LFQA 4R78A 1AD5A 1XHAA 2LVPC 3BRBA 3EQPA 3QX4A 4GC9A 1ZQ9A 4LJ6A 3PVGA 5ANIA 1Z5AA 4YZ9A 2Z4RA 3PXKA 3D94A 3COHA 1H25A 3SYLA 4FIEA 2XF0A 2UZVA 3R7EA 1DI8A 4BI1A 4FEWA 5BVWA 4OW8A 2J5FA 2P33A 3WYYA 4I5PA 4WHZA 1L2DA 3IECA 3V3VA 3GLHA 4YJUA 3F5GA 2R6FA 4C4FA 4X7QA 2QC6A 4MH7A 5GJFA 3NYVA 4EH6A 3TV7A 4FKJA 4G31A 2QO9A 4I23A 3I01M 5CNOA 3QAUA 2C98A 4FSZA 3CP9A 3VUDA 3PY0A 4DFBA 3JAMS 3QWLA 5GZ8A 5ITUA 4I6QA 4AGCA 4JX3A 4F78A 3RGSA 3GQIA