2AHMA

Crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
77
structure length
77
Chain Sequence
PLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, replication
molecule keywords Replicase polyprotein 1ab, light chain
total genus 30
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08716 nsp7 nsp7 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.370 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ahmA00
1YSYA 2AHMA
chains in the Genus database with same CATH superfamily
1ORYB 2XZFA 3AL0C 1BVSA 4LRSA 5FTMA 1GL6A 3J7AS 1H6UA 1QVRA 3B89A 3GLFA 3NBXX 2Z4SA 2F5OA 3M6AA 5DYIA 3KS4A 3LQRA 4OVZA 1HNXM 3FYDA 4DUZM 2DAMA 1YSYA 1JQJC 1AIPC 1Q3CA 2Z8YM 1N34M 1VEJA 4QHTA 3AOEC 4B3SM 1W5TA 2D7GA 2DHRA 4X66M 3FTFA 3GRYA 4K0KM 1DV0A 2K6BA 2L2DA 4S12A 4DR2M 3SFZA 1TGUA 5EXXA 3SHGB 1E9RA 2XFSA 3HGIA 1E9SA 2RRUA 1QDTA 1GJTA 4KODA 1HJPA 1HT2E 4GC9A 5DYGA 1OAIA 2CHVA 3TE6A 4R7GA 1XMOM 3KW6A 3B9PA 2DWMA 3HU3A 4LG2A 4NC6A 4LJ5A 3NBIA 1NNJA 3GLHA 1IFYA 3T1HM 1GABA 2CEAA 3T38A 3V76A 3W67A 1NV9A 1QANA 2F4VM 2JWSA 2F5PA 1A5TA 3UMMA 1EE8A 2J7NA 4LFAM 3GRUA 4JI3M 4CISA 4QOZC 1HT1E 1IY2A 2CWBA 4B3RM 2ZAMA 2X8AA 5BR8M 2LHGA 2YNMD 3HJQA 2H5XA 3B7NA 1QUTA 1D0KA 3GQ5A 3C58A 3E21A 3SAWA 1XXHA 3SYLA 2V1UA 2J5YA 2XH9A 4II7A 4CJ6A 4GMQA 3JR5A 1WHCA 1ZAEA 4LJ6A 3FE3A 3HJSA 1QZEA 4PT5A 2X49A 2C9CA 4W5WA 3GLFB 3TWLA 2G3QA 3WHKA 2Y21A 3RFWA 2KZUA 1I4WA 2JP7A 3HU1A 3MK6A 3FUUA 2L7IA 4IBFA 5EQTA 4BBAA 1N77A 4GKJM 1GO5A 1PGYA 3DFZA 3VKGA 1IXSB 4X65M 3SHFA 3LVVA 3GLFE 1L2CA 1G8PA 2F5QA 4MM3B 4DV6M 3HHXA 4P17A 3ZQJA 4JI6M 1DGHB 1VQ1A 1NY5A 1V92A 3HKPA 3J81S 1GJSA 4RF1A 2R65A 4IBIA 2HKJA 2R6FA 3BXWA 1TH4A 1G59A 3T6PA 3FUXA 1EIJA 2EUCA 2QBYA 1XXHB 1Y8GA 2AHMA 2R45A 5EXPA 5EP3A 4MGKE 4LZJA 4OW0A 2EKKA 3IHPA 4EIWA 5KPRA 4GHAA 2QNJA 1NV8A 2WZJA 2DWNA 3BOSA 1GLNA 3U6CA 1XHBA 1MN3A 3Q8GA 4F1IA 4JI1M 4AQYM 3FUVA 3GPYA 2DKLA 3KP1E 4A3VB 1D0LA 1W5SA 2R0IA 4HEOA 5E26A 4JI5M 2QHOB 3H4MA 1KFVA 2UUAM 3U6MA 1PJTA 3L2AA 5L8RF 5E6JA 4NL4H 4CHTB 2KRKA 3TQSA 1IN4A 1VEKA 2F5SA 2D7HA 2QENA 1PRBA 4LJ9A 1WGLA 1NJFA 3K9OA 1V33A 3J7BA 3MMPA 3NWLA 4AKHA 2KNAA 1KSFX 3T1YM 1IM2A 1P3QQ 2DAIA 3U6EA 2L7HA 3TWMA 1DO0A 1X37A 2O25A 1VDLA 3SC3A 1N32M 5EJCA 1LTMA 1DGGA 5FSWA 3IG8A 3TPZA 4I4LA 4MGYE 2QSFX 4XK8F 4IBBA 2CV0A 1OIZA 4LY6A 4D82A 4IBJA 3I04M 2BNKA 4HLQA 2JY7A 3FRIA 2MROB 3J80S 4DV4M 3FTEA 4IJEA 2K9DA 1VEGA 1R2YA 3K2LA 2OPFA 2JY6B 2FH0A 4Q7JA 4OX9M 2VIIA 2LXEA 4DR6M 4GHLA 1G4AE 3TWKA 3A98B 2ZTDA 3HHYA 1F4IA 1PJQA 2V1CA 1IQPA 2LVOC 3B7ZA 1V34A 4DV0M 1QAOA 1Z5CA 3RGPA 3K1JA 4GEWA 4ANRA 3GO8A 3VDUA 1TTEA 3I01M 3QYBA 1HQYE 4AKIA 1VDDA 5ITRA 4BLCA 3L25A 3D8LA 2ZM6M 4IBEA 1E32A 5FTLA 2DAKA 2Y0TA 3HY5A 1K3WA 1QYRA 2XEPA 3RGSA 4JYAM 4M0WA 3B74A 3FTCA 2VQEM 4Y28F 2DI0A 4FCTA 2R46A 3UJNA 4GRIA 2JNHA 4FW9A 3AJIB 4FCVA 1SXJB 2QP9X 4B08A 2C99A 2KXEA 4DR5M 4GKKM 3VK8A 2Z4RA 1CUKA 1KYIA 2BWBA 3I51A 4PCZA 4NSOB 1VG5A 1LV7A 1IXZA 1E94E 2DZLA 2MH8A 1PM5A 4WP2A 3SARA 3I4YA 1D0MA 4L6V6 2XLJA 4B3MM 4ZPXA 2R4JA 2QCUA 2LVQD 1WR1B 1MJGM 1OTRA 4IBGA 4L78A 1RU3A 5LMNM 2R62A 3OTOM 2Y0QA 3HZJA 4WURA 4JI0M 4JI4M 5DFLA 5ITUA 1OJLA 4LFBM 3J27B 1PJIA 3IG5A 1XXHE 3GRVA 2JXNA 2ZANA 4FWHA 3KDSE 2FFJA 4BB9A 3UZUA 1HR0M 2QBYB 5FTKA 3JAMS 4CIZA 3LW5F 3H4JA 3U60B 2Z7JA 1IBKM 1QAQA 3GLHB 4REZA 1DGHA 2LH0A 4L16A 2DENA 3ZCBB 4I81A 3HX3A 1R6BX 3GPUA 3KFUG 1XNQM 2XF3A 5EXSA 2VF8A 3SATA 5JI2E 1ZV1A 4MH0E 5C18A 3SAUA 3L27A 4IBCA 1IY1A 1OKSA 1NHWC 3BBZA 4G6ZA 1SXJD 3GQ4A 2LVNC 4M9ZA 2VDBB 1TR8A 1WXQA 2VF7A 1ZQ9A 2XZUA 1JR3A 4F2LA 2R4EA 1QDRA 2J7OA 3U6QA 2RGHA 2YFQA 3ZH9B 1TH3A 2O01F 3K9PA 2KW0A 2XSZA 3HU2A 2RGOA 3VFDA 4B7GA 3AV0A 4JI8M 3MJ5A 2YQZA 3AOGA 8CATA 4IBKA 1N78A 1ZMUA 1ZMVA 4CGYB 1JB0F 4PD2A 4AZFA 3E9SA 4LF4M 3L28A 1AUAA 2CE7A 3ILKA 5JI3E 2E5LM 3D8BA 3HJ8A 5ITQA 2CRUA 1C7YA 4LCBA 2GQFA 3W68A 5ITTA 1PJSA 1K82A 3PNYA 2BJWA 3KOWE 1GVNA 4KT0F 4D81A 1OAOC 3A46A 4M9XA 1IN8A 3GLGE 2LHCA 1IXSA 4RF0A 4TUWA 2QPAA 2K0BX 2LWXA 4IBDA 5DNYA 3AOEA 2FS1A 4Z6YA 4B3TM 1QUSA 3FTDA 7CATA 1PJJA 2W82A 4QOSA 3GPXA 4LF5M 2MGWA 2L09A 4DUYM 3CF2A 4LGYA 1TDHA 2L4EA 3HWSA 3SYKA 2Z3XA 3GLHE 3U6PA 3E46A 3C3EA 4LF6M 1Z59A 3TL4X 4MGHA 1JR3E 4DV7M 3U61B 1IN7A 1IBMM 2K47A 1SXJE 4KLNA 2FNAA 1TDZA 1J7KA 3CGWA 2B3TA 2XGNA 4OU7A 3SBJA 1NSFA 3SASA 4GITA 2ZBKB 1TF0B 2KNZA 2KNVA 2A5YB 5EXTA 1D2NA 1Z5AA 2WSEF 3CTWB 3Q8XA 4G4QA 1L1ZA 2DAEA 2C9OA 3W0LB 1Q02A 3HHZA 2KEBA 2LTUA 3GRRA 4LZZA 2OO9A 3B7QA 4GIPA 3AKZA 3LVWA 3LCVB 2CFOA 4NXMM 2JZ1A 4DV2M 2JZ0A 1EFUB 1XMQM 1GKIA 3GPPA 2UUBM 4JI7M 3JR4A 1IN5A 3LMMA 2FOIC 2UXBM 2JA2A 3L26A 2XSZD 5KPTA 4X64M 3FKEA 3FUWA 1SG9A 3A42A 3C9PA 4LJ7A 3KS8A 3FRHA 3DZDA 1DO2A 5IREB 3A45A 4G4NA 1XC8A 4RKUF 5IT9S 4QNMA 4G4RA 4AG5A 1K3XA 3M7GA 4FD2A 5H37D 2APLA 3E4RA 3MHVC 2CHGA 3KSXA 4MGZE 2F5NA 3CF6E 1FNNA 1NJGA 3W0FA 3GLIB 2JY5A 4MB7A 1XWIA 3GQ3A 4KO8A 3VKHA 3KP0E 2DNAA 2HCBA 2DXIA 1L1TA 1N33M 4JXJA 4LFCM 1J09A 2EKFA 1OFHA 3LQQA 4LRTA 2KHHA 5KQDA 2HHHM 4JN6A 2M60A 3SAVA 4XGIA 1HQCA 1YE9A 3M0EA 2NQ8C 1R7RA 3KOXE 3VDPA 1G3IA 2DAGA 4NRVA 4ITQA 1C1KA 2ERCA 2WSFF 1JR3D 3HHWA 5A2QS 1UFZA 1S3SA 3LCUA 3VK7A 4B7HA 4AKGA 4NXNM 4M0DA 2KDLA 5KO3A 3U6SA 2C96A 1HNZM 4GH9A 2KRUA 2P5TA 1YLAA 2UU9M 3QAUA 3EIEA 1UM8A 1Z5BA 4R3DA 4LJ4A 4LF7M 2EJSA 3T15A 2H1RA 2G5GX 1IBLM 4UN2B 3SMPA 4D80A 3AFHA 1T6OA 3C3DA 4FCWA 1IXRC 3KSJA 4IIWA 5ITXA 2L6OA 2CP8A 2Y20A 2EO2A 1N75A 1Q39A 3DA1A 2CHQA 2LVAA 2RKOA 3K8ZA 5LMUM 2C98A 5BPVA 4OVZB 1I94M 2UXDM 5FTNA 3CF0A 4QHSA 1MX0A 2QQ8A 2I7PA 2QZ4A 4LJ8A 2DVWB 1FJGM 1QAMA 3U5ZA 3R9XB 1SXJA 1T3TA 5KPZA 4DR4M 2ZTCA 3UK6A 1DGBA 2CV2A 3PFIA 5IWAM 2KZSA 4DR3M 4P16A 3U6OA 4HL4A 1SXJC 3THGA 3U61A 2ZAOA 3U60A 3ZC7B 4QNRA 1WGNA 1QZMA 2HL7A 4PDGA 1Z6TA 1L2DA 3FYCA 3DOAA 1IY0A 4I8OA 3QYEA 4R71A 1HNWM 2DHYA 3GLGA 1NHGC 4DR1M 4G4OA 5EP1A 3KOYE 4DV5M 4LF9M 3U5ZB 4NSRA 2GNOA 4FWGA 2D7EA 3FD9A 3FUTA 1QQWA 4NRWA 5IZ7D 1L8QA 2DZNB 2V6ZM 2FE8A 4YHHM 3K92A 3UGJA 1XB2B 4AG6A 4DV3M 1MU5A 2YR0A 4FVMA 5EP4A 4LGMA 2VQFM 1R4GA 1TH2A 4AW4A 1G71A 4PDIA 1J5EM 3IECA 3RE8A 1NNUC 3GLGB 2L4FA 2LVPC 1XNRM 3I4VA 4GC5A 2JUJA 2UXCM 4M9SA 2DZOB 4NOOB 4L4UA 4IJFA 1OFIA 4X62M 3GLIA 3GLIE 2EA0A 3U6DA 3U6LA 1WJ7A 2C5RA 2CUZA 1DGFA 1R5LA 4L15A 2LNHC 4L8RC 4G3OA 4XBOA 1YUBA 1Q3BA 1OQYA 1R2ZA 5FTJA 2LBCA 2OOAA 4DR7M 4KHPM 2BJVA 2OQ4A 1NO1A 2JY8A 1IN6A 3PXGA 5F3WA 4JI2M 2HAKA 2M5ZA 5FLXS 3WHLA 4RNAA 2BWEA 5ITXE 4FWDA 3J2PB 5EP2A 5C1BA 1L2BA 2DWLA 4DBGB 2X4AA 3GP1A 3EIHA 3L29A 2R18A 4Z8XA 3QWLA 1T43A 2UUCM 1GL7A 2R44A 2DWZB 3KXEC 5ITYA 3VLFB 1G41A 3F92A 2Q2EB 4LJAA 2O5RA 4YY3M 1ZMWA 3KOZE 4JV5M 2WSCF 2CV1A 4WW0A 2OOBA 3R8FA 4I5SA 3PVSA 2MJ5B 5GKNA 1WIVA 4MGIE 4AI6A 5KQ8A 1OIPA 1NY6A 2MR9A 2KA6B 3PNVA 2XFTA 1NVMA 4DV1M 4LF8M 4B7FA 2HWJA 3SMSA 3KVWA 1N36M 2G8LA 2N35A 2I7NA
chains in the Genus database with same CATH topology
1ORYB 2XZFA 3AL0C 4LRSA 5FTMA 3J7AS 1GL6A 1H6UA 1QVRA 3GLFA 2Z4SA 2F5OA 3M6AA 5DYIA 3KS4A 3LQRA 4OVZA 1HNXM 3FYDA 4DUZM 1YSYA 1JQJC 1Q3CA 1N34M 4QHTA 3AOEC 4B3SM 1W5TA 2D7GA 2DHRA 4X66M 3FTFA 3GRYA 4K0KM 4DR2M 4S12A 3SFZA 1TGUA 5EXXA 3SHGB 1E9RA 2XFSA 3HGIA 1E9SA 4KODA 5DYGA 1HT2E 4GC9A 2CHVA 3TE6A 4R7GA 1XMOM 3KW6A 3B9PA 2DWMA 3HU3A 4LG2A 1NNJA 4LJ5A 3NBIA 3GLHA 3T1HM 2CEAA 3T38A 1QANA 2F4VM 2F5PA 3UMMA 1EE8A 2J7NA 4LFAM 3GRUA 4JI3M 4CISA 4QOZC 1HT1E 1IY2A 4B3RM 2ZAMA 2X8AA 5BR8M 2YNMD 3HJQA 3GQ5A 3C58A 3SAWA 1XXHA 3SYLA 2V1UA 2XH9A 4II7A 3JR5A 4GMQA 1ZAEA 4LJ6A 4PT5A 3HJSA 2X49A 2C9CA 4W5WA 3GLFB 3TWLA 3WHKA 2Y21A 3RFWA 2KZUA 1I4WA 3MK6A 3HU1A 5EQTA 3FUUA 2L7IA 4IBFA 4BBAA 2VQFM 1N77A 4GKJM 3VKGA 3DFZA 1IXSB 4X65M 3SHFA 3LVVA 1L2CA 1G8PA 2F5QA 4MM3B 4DV6M 3HHXA 4JI6M 1DGHB 3HKPA 1NY5A 3J81S 4RF1A 2R65A 4IBIA 2HKJA 1TH4A 1G59A 3FUXA 2EUCA 2QBYA 1XXHB 2R45A 2AHMA 5EXPA 5EP3A 4MGKE 4LZJA 4OW0A 4EIWA 5KPRA 4GHAA 2DWNA 3BOSA 1GLNA 3U6CA 1XHBA 4JI1M 4AQYM 3FUVA 3GPYA 3KP1E 4A3VB 1W5SA 5E26A 4JI5M 3H4MA 1KFVA 2UUAM 3U6MA 3L2AA 5E6JA 4NL4H 4CHTB 2KRKA 3TQSA 1IN4A 2F5SA 2D7HA 2QENA 4LJ9A 1NJFA 4AKHA 3J7BA 3NWLA 1KSFX 3T1YM 1IM2A 3U6EA 2L7HA 3TWMA 1DO0A 1X37A 1N32M 3SC3A 5EJCA 1DGGA 5FSWA 3IG8A 3TPZA 4I4LA 4MGYE 4IBBA 2CV0A 4D82A 4LY6A 4IBJA 2BNKA 4HLQA 4DV4M 3J80S 3FTEA 4IJEA 1R2YA 3K2LA 2OPFA 4OX9M 2VIIA 2LXEA 4DR6M 4GHLA 1G4AE 3TWKA 3A98B 3HHYA 2V1CA 1IQPA 4DV0M 1QAOA 1Z5CA 3RGPA 3K1JA 3GO8A 3VDUA 1HQYE 4AKIA 1VDDA 5ITRA 4BLCA 3L25A 3D8LA 2ZM6M 4IBEA 1E32A 5FTLA 2Y0TA 1K3WA 1QYRA 2XEPA 3RGSA 4JYAM 4M0WA 3FTCA 2VQEM 4FCTA 3UJNA 2R46A 4GRIA 4FW9A 3AJIB 4FCVA 1SXJB 2QP9X 4B08A 2C99A 2KXEA 4DR5M 4GKKM 3VK8A 2Z4RA 1KYIA 3I51A 4PCZA 4NSOB 1LV7A 1IXZA 1E94E 3SARA 1PM5A 3I4YA 2XLJA 4B3MM 4ZPXA 2R4JA 2QCUA 4L78A 4IBGA 5LMNM 2R62A 3OTOM 2Y0QA 4WURA 4JI0M 4JI4M 5ITUA 1OJLA 4LFBM 3J27B 1PJIA 3IG5A 3GRVA 2ZANA 4FWHA 3KDSE 2FFJA 4BB9A 3UZUA 1HR0M 2QBYB 5FTKA 3JAMS 3U60B 2Z7JA 1IBKM 1QAQA 3GLHB 4REZA 1DGHA 2LH0A 4L16A 3ZCBB 4I81A 3KFUG 1R6BX 3GPUA 1XNQM 2XF3A 5EXSA 3SATA 5JI2E 4MH0E 5C18A 3SAUA 3L27A 4IBCA 1IY1A 1NHWC 4G6ZA 1SXJD 3GQ4A 4M9ZA 1WXQA 1ZQ9A 2XZUA 1JR3A 3U6QA 2R4EA 2J7OA 2RGHA 2YFQA 3ZH9B 1TH3A 2KW0A 2XSZA 3HU2A 2RGOA 3VFDA 4B7GA 3AV0A 4JI8M 3MJ5A 2YQZA 3AOGA 8CATA 4IBKA 1N78A 4CGYB 4PD2A 4AZFA 3E9SA 4LF4M 3L28A 2CE7A 3ILKA 5JI3E 2E5LM 3D8BA 3HJ8A 5ITQA 4LCBA 1K82A 5ITTA 3PNYA 2BJWA 3KOWE 1GVNA 3A46A 4D81A 4M9XA 1IN8A 4RF0A 4TUWA 2QPAA 2LWXA 5DNYA 4IBDA 3AOEA 4Z6YA 4B3TM 3FTDA 7CATA 1PJJA 2W82A 4QOSA 3GPXA 4LF5M 2L09A 4DUYM 3CF2A 4LGYA 1TDHA 2Z3XA 3HWSA 3SYKA 3U6PA 4LF6M 1Z59A 3TL4X 4MGHA 4DV7M 3U61B 1IN7A 1IBMM 2K47A 1SXJE 4KLNA 2FNAA 1TDZA 1J7KA 2XGNA 4OU7A 3SBJA 1NSFA 3SASA 4GITA 2ZBKB 2A5YB 5EXTA 1D2NA 1Z5AA 3CTWB 3Q8XA 4G4QA 1L1ZA 2C9OA 3W0LB 3HHZA 2KEBA 3GRRA 4LZZA 3AKZA 4GIPA 3LVWA 4NXMM 2CFOA 4DV2M 1XMQM 2UUBM 1GKIA 3GPPA 4JI7M 3JR4A 1IN5A 3LMMA 2FOIC 2UXBM 2JA2A 3L26A 2XSZD 5KPTA 4X64M 3FKEA 3FUWA 3A42A 4LJ7A 3KS8A 3DZDA 1DO2A 5IREB 3A45A 4G4NA 1XC8A 5IT9S 4QNMA 4G4RA 4AG5A 1K3XA 3M7GA 4FD2A 5H37D 4MGZE 3E4RA 3MHVC 2CHGA 3KSXA 2F5NA 3CF6E 1FNNA 1NJGA 3W0FA 3GLIB 4MB7A 1XWIA 3GQ3A 4KO8A 3VKHA 3KP0E 2DXIA 2HCBA 1L1TA 1N33M 4JXJA 4LFCM 1J09A 1OFHA 3LQQA 4LRTA 5KQDA 2HHHM 4JN6A 2M60A 3SAVA 4XGIA 1HQCA 1YE9A 3M0EA 2NQ8C 1R7RA 3KOXE 3VDPA 1G3IA 4NRVA 4ITQA 1C1KA 2ERCA 3HHWA 1JR3D 5A2QS 1S3SA 3VK7A 4B7HA 4AKGA 4NXNM 4M0DA 5KO3A 3U6SA 2C96A 1HNZM 4GH9A 2KRUA 2P5TA 2UU9M 3QAUA 3EIEA 1UM8A 1Z5BA 4R3DA 4LJ4A 4LF7M 3T15A 2H1RA 2G5GX 1IBLM 4D80A 3SMPA 3AFHA 4FCWA 1IXRC 3KSJA 4IIWA 5ITXA 2L6OA 2Y20A 2EO2A 1N75A 1Q39A 3DA1A 2CHQA 5LMUM 2RKOA 3K8ZA 2C98A 5BPVA 4OVZB 1I94M 2UXDM 5FTNA 3CF0A 4QHSA 1MX0A 2I7PA 2QZ4A 4LJ8A 2DVWB 1FJGM 1QAMA 3U5ZA 3R9XB 1SXJA 1T3TA 5KPZA 4DR4M 3UK6A 1DGBA 2CV2A 3PFIA 5IWAM 2KZSA 4DR3M 4P16A 3U6OA 4HL4A 1SXJC 3THGA 3U61A 2ZAOA 3U60A 3ZC7B 4QNRA 1QZMA 2HL7A 4PDGA 1Z6TA 1L2DA 3FYCA 3DOAA 1IY0A 4I8OA 1HNWM 3GLGA 1NHGC 4DR1M 4G4OA 5EP1A 3KOYE 4DV5M 4LF9M 3U5ZB 4NSRA 4FWGA 2D7EA 3FD9A 3FUTA 1QQWA 4NRWA 5IZ7D 1L8QA 2DZNB 2V6ZM 2FE8A 4YHHM 3K92A 3UGJA 4DV3M 4AG6A 1MU5A 2YR0A 4FVMA 5EP4A 4LGMA 4AW4A 1TH2A 4PDIA 1J5EM 3RE8A 1NNUC 3GLGB 1XNRM 3I4VA 4GC5A 2UXCM 4M9SA 2DZOB 4NOOB 4L4UA 4IJFA 1OFIA 4X62M 3GLIA 2EA0A 3U6DA 3U6LA 2C5RA 2CUZA 1DGFA 4L15A 2LNHC 4L8RC 4XBOA 1YUBA 1Q3BA 1R2ZA 4KHPM 5FTJA 4DR7M 2BJVA 2OQ4A 1IN6A 3PXGA 5F3WA 4JI2M 2M5ZA 5FLXS 3WHLA 4RNAA 5ITXE 4FWDA 3J2PB 5EP2A 5C1BA 1L2BA 2DWLA 2X4AA 3GP1A 3EIHA 3L29A 2R18A 4Z8XA 3QWLA 2UUCM 1GL7A 5ITYA 2DWZB 3KXEC 3VLFB 1G41A 2Q2EB 4LJAA 2O5RA 4YY3M 3KOZE 4JV5M 2CV1A 4WW0A 3R8FA 4I5SA 3PVSA 5GKNA 4MGIE 4AI6A 5KQ8A 1NY6A 2KA6B 3PNVA 2XFTA 1NVMA 4DV1M 4LF8M 4B7FA 3SMSA 3KVWA 1N36M 2G8LA 2I7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSY A;  2AHM A; 
#chains in the Genus database with same CATH topology
 1ORY B;  2XZF A;  3AL0 C;  1BVS A;  4LRS A;  5FTM A;  1GL6 A;  3J7A S;  1H6U A;  1QVR A;  3B89 A;  3GLF A;  3NBX X;  2Z4S A;  2F5O A;  3M6A A;  5DYI A;  3KS4 A;  3LQR A;  4OVZ A;  1HNX M;  3FYD A;  4DUZ M;  2DAM A;  1YSY A;  1JQJ C;  1AIP C;  1Q3C A;  2Z8Y M;  1N34 M;  1VEJ A;  4QHT A;  3AOE C;  4B3S M;  1W5T A;  2D7G A;  2DHR A;  4X66 M;  3FTF A;  3GRY A;  4K0K M;  1DV0 A;  2K6B A;  2L2D A;  4S12 A;  4DR2 M;  3SFZ A;  1TGU A;  5EXX A;  3SHG B;  1E9R A;  2XFS A;  3HGI A;  1E9S A;  2RRU A;  1QDT A;  1GJT A;  4KOD A;  1HJP A;  1HT2 E;  4GC9 A;  5DYG A;  1OAI A;  2CHV A;  3TE6 A;  4R7G A;  1XMO M;  3KW6 A;  3B9P A;  2DWM A;  3HU3 A;  4LG2 A;  4NC6 A;  4LJ5 A;  3NBI A;  1NNJ A;  3GLH A;  1IFY A;  3T1H M;  1GAB A;  2CEA A;  3T38 A;  3V76 A;  3W67 A;  1NV9 A;  1QAN A;  2F4V M;  2JWS A;  2F5P A;  1A5T A;  3UMM A;  1EE8 A;  2J7N A;  4LFA M;  3GRU A;  4JI3 M;  4CIS A;  4QOZ C;  1HT1 E;  1IY2 A;  2CWB A;  4B3R M;  2ZAM A;  2X8A A;  5BR8 M;  2LHG A;  2YNM D;  3HJQ A;  2H5X A;  3B7N A;  1QUT A;  1D0K A;  3GQ5 A;  3C58 A;  3E21 A;  3SAW A;  1XXH A;  3SYL A;  2V1U A;  2J5Y A;  2XH9 A;  4II7 A;  4CJ6 A;  4GMQ A;  3JR5 A;  1WHC A;  1ZAE A;  4LJ6 A;  3FE3 A;  3HJS A;  1QZE A;  4PT5 A;  2X49 A;  2C9C A;  4W5W A;  3GLF B;  3TWL A;  2G3Q A;  3WHK A;  2Y21 A;  3RFW A;  2KZU A;  1I4W A;  2JP7 A;  3HU1 A;  3MK6 A;  3FUU A;  2L7I A;  4IBF A;  5EQT A;  4BBA A;  1N77 A;  4GKJ M;  1GO5 A;  1PGY A;  3DFZ A;  3VKG A;  1IXS B;  4X65 M;  3SHF A;  3LVV A;  3GLF E;  1L2C A;  1G8P A;  2F5Q A;  4MM3 B;  4DV6 M;  3HHX A;  4P17 A;  3ZQJ A;  4JI6 M;  1DGH B;  1VQ1 A;  1NY5 A;  1V92 A;  3HKP A;  3J81 S;  1GJS A;  4RF1 A;  2R65 A;  4IBI A;  2HKJ A;  2R6F A;  3BXW A;  1TH4 A;  1G59 A;  3T6P A;  3FUX A;  1EIJ A;  2EUC A;  2QBY A;  1XXH B;  1Y8G A;  2AHM A;  2R45 A;  5EXP A;  5EP3 A;  4MGK E;  4LZJ A;  4OW0 A;  2EKK A;  3IHP A;  4EIW A;  5KPR A;  4GHA A;  2QNJ A;  1NV8 A;  2WZJ A;  2DWN A;  3BOS A;  1GLN A;  3U6C A;  1XHB A;  1MN3 A;  3Q8G A;  4F1I A;  4JI1 M;  4AQY M;  3FUV A;  3GPY A;  2DKL A;  3KP1 E;  4A3V B;  1D0L A;  1W5S A;  2R0I A;  4HEO A;  5E26 A;  4JI5 M;  2QHO B;  3H4M A;  1KFV A;  2UUA M;  3U6M A;  1PJT A;  3L2A A;  5L8R F;  5E6J A;  4NL4 H;  4CHT B;  2KRK A;  3TQS A;  1IN4 A;  1VEK A;  2F5S A;  2D7H A;  2QEN A;  1PRB A;  4LJ9 A;  1WGL A;  1NJF A;  3K9O A;  1V33 A;  3J7B A;  3MMP A;  3NWL A;  4AKH A;  2KNA A;  1KSF X;  3T1Y M;  1IM2 A;  1P3Q Q;  2DAI A;  3U6E A;  2L7H A;  3TWM A;  1DO0 A;  1X37 A;  2O25 A;  1VDL A;  3SC3 A;  1N32 M;  5EJC A;  1LTM A;  1DGG A;  5FSW A;  3IG8 A;  3TPZ A;  4I4L A;  4MGY E;  2QSF X;  4XK8 F;  4IBB A;  2CV0 A;  1OIZ A;  4LY6 A;  4D82 A;  4IBJ A;  3I04 M;  2BNK A;  4HLQ A;  2JY7 A;  3FRI A;  2MRO B;  3J80 S;  4DV4 M;  3FTE A;  4IJE A;  2K9D A;  1VEG A;  1R2Y A;  3K2L A;  2OPF A;  2JY6 B;  2FH0 A;  4Q7J A;  4OX9 M;  2VII A;  2LXE A;  4DR6 M;  4GHL A;  1G4A E;  3TWK A;  3A98 B;  2ZTD A;  3HHY A;  1F4I A;  1PJQ A;  2V1C A;  1IQP A;  2LVO C;  3B7Z A;  1V34 A;  4DV0 M;  1QAO A;  1Z5C A;  3RGP A;  3K1J A;  4GEW A;  4ANR A;  3GO8 A;  3VDU A;  1TTE A;  3I01 M;  3QYB A;  1HQY E;  4AKI A;  1VDD A;  5ITR A;  4BLC A;  3L25 A;  3D8L A;  2ZM6 M;  4IBE A;  1E32 A;  5FTL A;  2DAK A;  2Y0T A;  3HY5 A;  1K3W A;  1QYR A;  2XEP A;  3RGS A;  4JYA M;  4M0W A;  3B74 A;  3FTC A;  2VQE M;  4Y28 F;  2DI0 A;  4FCT A;  2R46 A;  3UJN A;  4GRI A;  2JNH A;  4FW9 A;  3AJI B;  4FCV A;  1SXJ B;  2QP9 X;  4B08 A;  2C99 A;  2KXE A;  4DR5 M;  4GKK M;  3VK8 A;  2Z4R A;  1CUK A;  1KYI A;  2BWB A;  3I51 A;  4PCZ A;  4NSO B;  1VG5 A;  1LV7 A;  1IXZ A;  1E94 E;  2DZL A;  2MH8 A;  1PM5 A;  4WP2 A;  3SAR A;  3I4Y A;  1D0M A;  4L6V 6;  2XLJ A;  4B3M M;  4ZPX A;  2R4J A;  2QCU A;  2LVQ D;  1WR1 B;  1MJG M;  1OTR A;  4IBG A;  4L78 A;  1RU3 A;  5LMN M;  2R62 A;  3OTO M;  2Y0Q A;  3HZJ A;  4WUR A;  4JI0 M;  4JI4 M;  5DFL A;  5ITU A;  1OJL A;  4LFB M;  3J27 B;  1PJI A;  3IG5 A;  1XXH E;  3GRV A;  2JXN A;  2ZAN A;  4FWH A;  3KDS E;  2FFJ A;  4BB9 A;  3UZU A;  1HR0 M;  2QBY B;  5FTK A;  3JAM S;  4CIZ A;  3LW5 F;  3H4J A;  3U60 B;  2Z7J A;  1IBK M;  1QAQ A;  3GLH B;  4REZ A;  1DGH A;  2LH0 A;  4L16 A;  2DEN A;  3ZCB B;  4I81 A;  3HX3 A;  1R6B X;  3GPU A;  3KFU G;  1XNQ M;  2XF3 A;  5EXS A;  2VF8 A;  3SAT A;  5JI2 E;  1ZV1 A;  4MH0 E;  5C18 A;  3SAU A;  3L27 A;  4IBC A;  1IY1 A;  1OKS A;  1NHW C;  3BBZ A;  4G6Z A;  1SXJ D;  3GQ4 A;  2LVN C;  4M9Z A;  2VDB B;  1TR8 A;  1WXQ A;  2VF7 A;  1ZQ9 A;  2XZU A;  1JR3 A;  4F2L A;  2R4E A;  1QDR A;  2J7O A;  3U6Q A;  2RGH A;  2YFQ A;  3ZH9 B;  1TH3 A;  2O01 F;  3K9P A;  2KW0 A;  2XSZ A;  3HU2 A;  2RGO A;  3VFD A;  4B7G A;  3AV0 A;  4JI8 M;  3MJ5 A;  2YQZ A;  3AOG A;  8CAT A;  4IBK A;  1N78 A;  1ZMU A;  1ZMV A;  4CGY B;  1JB0 F;  4PD2 A;  4AZF A;  3E9S A;  4LF4 M;  3L28 A;  1AUA A;  2CE7 A;  3ILK A;  5JI3 E;  2E5L M;  3D8B A;  3HJ8 A;  5ITQ A;  2CRU A;  1C7Y A;  4LCB A;  2GQF A;  3W68 A;  5ITT A;  1PJS A;  1K82 A;  3PNY A;  2BJW A;  3KOW E;  1GVN A;  4KT0 F;  4D81 A;  1OAO C;  3A46 A;  4M9X A;  1IN8 A;  3GLG E;  2LHC A;  1IXS A;  4RF0 A;  4TUW A;  2QPA A;  2K0B X;  2LWX A;  4IBD A;  5DNY A;  3AOE A;  2FS1 A;  4Z6Y A;  4B3T M;  1QUS A;  3FTD A;  7CAT A;  1PJJ A;  2W82 A;  4QOS A;  3GPX A;  4LF5 M;  2MGW A;  2L09 A;  4DUY M;  3CF2 A;  4LGY A;  1TDH A;  2L4E A;  3HWS A;  3SYK A;  2Z3X A;  3GLH E;  3U6P A;  3E46 A;  3C3E A;  4LF6 M;  1Z59 A;  3TL4 X;  4MGH A;  1JR3 E;  4DV7 M;  3U61 B;  1IN7 A;  1IBM M;  2K47 A;  1SXJ E;  4KLN A;  2FNA A;  1TDZ A;  1J7K A;  3CGW A;  2B3T A;  2XGN A;  4OU7 A;  3SBJ A;  1NSF A;  3SAS A;  4GIT A;  2ZBK B;  1TF0 B;  2KNZ A;  2KNV A;  2A5Y B;  5EXT A;  1D2N A;  1Z5A A;  2WSE F;  3CTW B;  3Q8X A;  4G4Q A;  1L1Z A;  2DAE A;  2C9O A;  3W0L B;  1Q02 A;  3HHZ A;  2KEB A;  2LTU A;  3GRR A;  4LZZ A;  2OO9 A;  3B7Q A;  4GIP A;  3AKZ A;  3LVW A;  3LCV B;  2CFO A;  4NXM M;  2JZ1 A;  4DV2 M;  2JZ0 A;  1EFU B;  1XMQ M;  1GKI A;  3GPP A;  2UUB M;  4JI7 M;  3JR4 A;  1IN5 A;  3LMM A;  2FOI C;  2UXB M;  2JA2 A;  3L26 A;  2XSZ D;  5KPT A;  4X64 M;  3FKE A;  3FUW A;  1SG9 A;  3A42 A;  3C9P A;  4LJ7 A;  3KS8 A;  3FRH A;  3DZD A;  1DO2 A;  5IRE B;  3A45 A;  4G4N A;  1XC8 A;  4RKU F;  5IT9 S;  4QNM A;  4G4R A;  4AG5 A;  1K3X A;  3M7G A;  4FD2 A;  5H37 D;  2APL A;  3E4R A;  3MHV C;  2CHG A;  3KSX A;  4MGZ E;  2F5N A;  3CF6 E;  1FNN A;  1NJG A;  3W0F A;  3GLI B;  2JY5 A;  4MB7 A;  1XWI A;  3GQ3 A;  4KO8 A;  3VKH A;  3KP0 E;  2DNA A;  2HCB A;  2DXI A;  1L1T A;  1N33 M;  4JXJ A;  4LFC M;  1J09 A;  2EKF A;  1OFH A;  3LQQ A;  4LRT A;  2KHH A;  5KQD A;  2HHH M;  4JN6 A;  2M60 A;  3SAV A;  4XGI A;  1HQC A;  1YE9 A;  3M0E A;  2NQ8 C;  1R7R A;  3KOX E;  3VDP A;  1G3I A;  2DAG A;  4NRV A;  4ITQ A;  1C1K A;  2ERC A;  2WSF F;  1JR3 D;  3HHW A;  5A2Q S;  1UFZ A;  1S3S A;  3LCU A;  3VK7 A;  4B7H A;  4AKG A;  4NXN M;  4M0D A;  2KDL A;  5KO3 A;  3U6S A;  2C96 A;  1HNZ M;  4GH9 A;  2KRU A;  2P5T A;  1YLA A;  2UU9 M;  3QAU A;  3EIE A;  1UM8 A;  1Z5B A;  4R3D A;  4LJ4 A;  4LF7 M;  2EJS A;  3T15 A;  2H1R A;  2G5G X;  1IBL M;  4UN2 B;  3SMP A;  4D80 A;  3AFH A;  1T6O A;  3C3D A;  4FCW A;  1IXR C;  3KSJ A;  4IIW A;  5ITX A;  2L6O A;  2CP8 A;  2Y20 A;  2EO2 A;  1N75 A;  1Q39 A;  3DA1 A;  2CHQ A;  2LVA A;  2RKO A;  3K8Z A;  5LMU M;  2C98 A;  5BPV A;  4OVZ B;  1I94 M;  2UXD M;  5FTN A;  3CF0 A;  4QHS A;  1MX0 A;  2QQ8 A;  2I7P A;  2QZ4 A;  4LJ8 A;  2DVW B;  1FJG M;  1QAM A;  3U5Z A;  3R9X B;  1SXJ A;  1T3T A;  5KPZ A;  4DR4 M;  2ZTC A;  3UK6 A;  1DGB A;  2CV2 A;  3PFI A;  5IWA M;  2KZS A;  4DR3 M;  4P16 A;  3U6O A;  4HL4 A;  1SXJ C;  3THG A;  3U61 A;  2ZAO A;  3U60 A;  3ZC7 B;  4QNR A;  1WGN A;  1QZM A;  2HL7 A;  4PDG A;  1Z6T A;  1L2D A;  3FYC A;  3DOA A;  1IY0 A;  4I8O A;  3QYE A;  4R71 A;  1HNW M;  2DHY A;  3GLG A;  1NHG C;  4DR1 M;  4G4O A;  5EP1 A;  3KOY E;  4DV5 M;  4LF9 M;  3U5Z B;  4NSR A;  2GNO A;  4FWG A;  2D7E A;  3FD9 A;  3FUT A;  1QQW A;  4NRW A;  5IZ7 D;  1L8Q A;  2DZN B;  2V6Z M;  2FE8 A;  4YHH M;  3K92 A;  3UGJ A;  1XB2 B;  4AG6 A;  4DV3 M;  1MU5 A;  2YR0 A;  4FVM A;  5EP4 A;  4LGM A;  2VQF M;  1R4G A;  1TH2 A;  4AW4 A;  1G71 A;  4PDI A;  1J5E M;  3IEC A;  3RE8 A;  1NNU C;  3GLG B;  2L4F A;  2LVP C;  1XNR M;  3I4V A;  4GC5 A;  2JUJ A;  2UXC M;  4M9S A;  2DZO B;  4NOO B;  4L4U A;  4IJF A;  1OFI A;  4X62 M;  3GLI A;  3GLI E;  2EA0 A;  3U6D A;  3U6L A;  1WJ7 A;  2C5R A;  2CUZ A;  1DGF A;  1R5L A;  4L15 A;  2LNH C;  4L8R C;  4G3O A;  4XBO A;  1YUB A;  1Q3B A;  1OQY A;  1R2Z A;  5FTJ A;  2LBC A;  2OOA A;  4DR7 M;  4KHP M;  2BJV A;  2OQ4 A;  1NO1 A;  2JY8 A;  1IN6 A;  3PXG A;  5F3W A;  4JI2 M;  2HAK A;  2M5Z A;  5FLX S;  3WHL A;  4RNA A;  2BWE A;  5ITX E;  4FWD A;  3J2P B;  5EP2 A;  5C1B A;  1L2B A;  2DWL A;  4DBG B;  2X4A A;  3GP1 A;  3EIH A;  3L29 A;  2R18 A;  4Z8X A;  3QWL A;  1T43 A;  2UUC M;  1GL7 A;  2R44 A;  2DWZ B;  3KXE C;  5ITY A;  3VLF B;  1G41 A;  3F92 A;  2Q2E B;  4LJA A;  2O5R A;  4YY3 M;  1ZMW A;  3KOZ E;  4JV5 M;  2WSC F;  2CV1 A;  4WW0 A;  2OOB A;  3R8F A;  4I5S A;  3PVS A;  2MJ5 B;  5GKN A;  1WIV A;  4MGI E;  4AI6 A;  5KQ8 A;  1OIP A;  1NY6 A;  2MR9 A;  2KA6 B;  3PNV A;  2XFT A;  1NVM A;  4DV1 M;  4LF8 M;  4B7F A;  2HWJ A;  3SMS A;  3KVW A;  1N36 M;  2G8L A;  2N35 A;  2I7N A; 
#chains in the Genus database with same CATH homology
 1ORY B;  2XZF A;  3AL0 C;  4LRS A;  5FTM A;  3J7A S;  1GL6 A;  1H6U A;  1QVR A;  3GLF A;  2Z4S A;  2F5O A;  3M6A A;  5DYI A;  3KS4 A;  3LQR A;  4OVZ A;  1HNX M;  3FYD A;  4DUZ M;  1YSY A;  1JQJ C;  1Q3C A;  1N34 M;  4QHT A;  3AOE C;  4B3S M;  1W5T A;  2D7G A;  2DHR A;  4X66 M;  3FTF A;  3GRY A;  4K0K M;  4DR2 M;  4S12 A;  3SFZ A;  1TGU A;  5EXX A;  3SHG B;  1E9R A;  2XFS A;  3HGI A;  1E9S A;  4KOD A;  5DYG A;  1HT2 E;  4GC9 A;  2CHV A;  3TE6 A;  4R7G A;  1XMO M;  3KW6 A;  3B9P A;  2DWM A;  3HU3 A;  4LG2 A;  1NNJ A;  4LJ5 A;  3NBI A;  3GLH A;  3T1H M;  2CEA A;  3T38 A;  1QAN A;  2F4V M;  2F5P A;  3UMM A;  1EE8 A;  2J7N A;  4LFA M;  3GRU A;  4JI3 M;  4CIS A;  4QOZ C;  1HT1 E;  1IY2 A;  4B3R M;  2ZAM A;  2X8A A;  5BR8 M;  2YNM D;  3HJQ A;  3GQ5 A;  3C58 A;  3SAW A;  1XXH A;  3SYL A;  2V1U A;  2XH9 A;  4II7 A;  3JR5 A;  4GMQ A;  1ZAE A;  4LJ6 A;  4PT5 A;  3HJS A;  2X49 A;  2C9C A;  4W5W A;  3GLF B;  3TWL A;  3WHK A;  2Y21 A;  3RFW A;  2KZU A;  1I4W A;  3MK6 A;  3HU1 A;  5EQT A;  3FUU A;  2L7I A;  4IBF A;  4BBA A;  2VQF M;  1N77 A;  4GKJ M;  3VKG A;  3DFZ A;  1IXS B;  4X65 M;  3SHF A;  3LVV A;  1L2C A;  1G8P A;  2F5Q A;  4MM3 B;  4DV6 M;  3HHX A;  4JI6 M;  1DGH B;  3HKP A;  1NY5 A;  3J81 S;  4RF1 A;  2R65 A;  4IBI A;  2HKJ A;  1TH4 A;  1G59 A;  3FUX A;  2EUC A;  2QBY A;  1XXH B;  2R45 A;  2AHM A;  5EXP A;  5EP3 A;  4MGK E;  4LZJ A;  4OW0 A;  4EIW A;  5KPR A;  4GHA A;  2DWN A;  3BOS A;  1GLN A;  3U6C A;  1XHB A;  4JI1 M;  4AQY M;  3FUV A;  3GPY A;  3KP1 E;  4A3V B;  1W5S A;  5E26 A;  4JI5 M;  3H4M A;  1KFV A;  2UUA M;  3U6M A;  3L2A A;  5E6J A;  4NL4 H;  4CHT B;  2KRK A;  3TQS A;  1IN4 A;  2F5S A;  2D7H A;  2QEN A;  4LJ9 A;  1NJF A;  4AKH A;  3J7B A;  3NWL A;  1KSF X;  3T1Y M;  1IM2 A;  3U6E A;  2L7H A;  3TWM A;  1DO0 A;  1X37 A;  1N32 M;  3SC3 A;  5EJC A;  1DGG A;  5FSW A;  3IG8 A;  3TPZ A;  4I4L A;  4MGY E;  4IBB A;  2CV0 A;  4D82 A;  4LY6 A;  4IBJ A;  2BNK A;  4HLQ A;  4DV4 M;  3J80 S;  3FTE A;  4IJE A;  1R2Y A;  3K2L A;  2OPF A;  4OX9 M;  2VII A;  2LXE A;  4DR6 M;  4GHL A;  1G4A E;  3TWK A;  3A98 B;  3HHY A;  2V1C A;  1IQP A;  4DV0 M;  1QAO A;  1Z5C A;  3RGP A;  3K1J A;  3GO8 A;  3VDU A;  1HQY E;  4AKI A;  1VDD A;  5ITR A;  4BLC A;  3L25 A;  3D8L A;  2ZM6 M;  4IBE A;  1E32 A;  5FTL A;  2Y0T A;  1K3W A;  1QYR A;  2XEP A;  3RGS A;  4JYA M;  4M0W A;  3FTC A;  2VQE M;  4FCT A;  3UJN A;  2R46 A;  4GRI A;  4FW9 A;  3AJI B;  4FCV A;  1SXJ B;  2QP9 X;  4B08 A;  2C99 A;  2KXE A;  4DR5 M;  4GKK M;  3VK8 A;  2Z4R A;  1KYI A;  3I51 A;  4PCZ A;  4NSO B;  1LV7 A;  1IXZ A;  1E94 E;  3SAR A;  1PM5 A;  3I4Y A;  2XLJ A;  4B3M M;  4ZPX A;  2R4J A;  2QCU A;  4L78 A;  4IBG A;  5LMN M;  2R62 A;  3OTO M;  2Y0Q A;  4WUR A;  4JI0 M;  4JI4 M;  5ITU A;  1OJL A;  4LFB M;  3J27 B;  1PJI A;  3IG5 A;  3GRV A;  2ZAN A;  4FWH A;  3KDS E;  2FFJ A;  4BB9 A;  3UZU A;  1HR0 M;  2QBY B;  5FTK A;  3JAM S;  3U60 B;  2Z7J A;  1IBK M;  1QAQ A;  3GLH B;  4REZ A;  1DGH A;  2LH0 A;  4L16 A;  3ZCB B;  4I81 A;  3KFU G;  1R6B X;  3GPU A;  1XNQ M;  2XF3 A;  5EXS A;  3SAT A;  5JI2 E;  4MH0 E;  5C18 A;  3SAU A;  3L27 A;  4IBC A;  1IY1 A;  1NHW C;  4G6Z A;  1SXJ D;  3GQ4 A;  4M9Z A;  1WXQ A;  1ZQ9 A;  2XZU A;  1JR3 A;  3U6Q A;  2R4E A;  2J7O A;  2RGH A;  2YFQ A;  3ZH9 B;  1TH3 A;  2KW0 A;  2XSZ A;  3HU2 A;  2RGO A;  3VFD A;  4B7G A;  3AV0 A;  4JI8 M;  3MJ5 A;  2YQZ A;  3AOG A;  8CAT A;  4IBK A;  1N78 A;  4CGY B;  4PD2 A;  4AZF A;  3E9S A;  4LF4 M;  3L28 A;  2CE7 A;  3ILK A;  5JI3 E;  2E5L M;  3D8B A;  3HJ8 A;  5ITQ A;  4LCB A;  1K82 A;  5ITT A;  3PNY A;  2BJW A;  3KOW E;  1GVN A;  3A46 A;  4D81 A;  4M9X A;  1IN8 A;  4RF0 A;  4TUW A;  2QPA A;  2LWX A;  5DNY A;  4IBD A;  3AOE A;  4Z6Y A;  4B3T M;  3FTD A;  7CAT A;  1PJJ A;  2W82 A;  4QOS A;  3GPX A;  4LF5 M;  2L09 A;  4DUY M;  3CF2 A;  4LGY A;  1TDH A;  2Z3X A;  3HWS A;  3SYK A;  3U6P A;  4LF6 M;  1Z59 A;  3TL4 X;  4MGH A;  4DV7 M;  3U61 B;  1IN7 A;  1IBM M;  2K47 A;  1SXJ E;  4KLN A;  2FNA A;  1TDZ A;  1J7K A;  2XGN A;  4OU7 A;  3SBJ A;  1NSF A;  3SAS A;  4GIT A;  2ZBK B;  2A5Y B;  5EXT A;  1D2N A;  1Z5A A;  3CTW B;  3Q8X A;  4G4Q A;  1L1Z A;  2C9O A;  3W0L B;  3HHZ A;  2KEB A;  3GRR A;  4LZZ A;  3AKZ A;  4GIP A;  3LVW A;  4NXM M;  2CFO A;  4DV2 M;  1XMQ M;  2UUB M;  1GKI A;  3GPP A;  4JI7 M;  3JR4 A;  1IN5 A;  3LMM A;  2FOI C;  2UXB M;  2JA2 A;  3L26 A;  2XSZ D;  5KPT A;  4X64 M;  3FKE A;  3FUW A;  3A42 A;  4LJ7 A;  3KS8 A;  3DZD A;  1DO2 A;  5IRE B;  3A45 A;  4G4N A;  1XC8 A;  5IT9 S;  4QNM A;  4G4R A;  4AG5 A;  1K3X A;  3M7G A;  4FD2 A;  5H37 D;  4MGZ E;  3E4R A;  3MHV C;  2CHG A;  3KSX A;  2F5N A;  3CF6 E;  1FNN A;  1NJG A;  3W0F A;  3GLI B;  4MB7 A;  1XWI A;  3GQ3 A;  4KO8 A;  3VKH A;  3KP0 E;  2DXI A;  2HCB A;  1L1T A;  1N33 M;  4JXJ A;  4LFC M;  1J09 A;  1OFH A;  3LQQ A;  4LRT A;  5KQD A;  2HHH M;  4JN6 A;  2M60 A;  3SAV A;  4XGI A;  1HQC A;  1YE9 A;  3M0E A;  2NQ8 C;  1R7R A;  3KOX E;  3VDP A;  1G3I A;  4NRV A;  4ITQ A;  1C1K A;  2ERC A;  3HHW A;  1JR3 D;  5A2Q S;  1S3S A;  3VK7 A;  4B7H A;  4AKG A;  4NXN M;  4M0D A;  5KO3 A;  3U6S A;  2C96 A;  1HNZ M;  4GH9 A;  2KRU A;  2P5T A;  2UU9 M;  3QAU A;  3EIE A;  1UM8 A;  1Z5B A;  4R3D A;  4LJ4 A;  4LF7 M;  3T15 A;  2H1R A;  2G5G X;  1IBL M;  4D80 A;  3SMP A;  3AFH A;  4FCW A;  1IXR C;  3KSJ A;  4IIW A;  5ITX A;  2L6O A;  2Y20 A;  2EO2 A;  1N75 A;  1Q39 A;  3DA1 A;  2CHQ A;  5LMU M;  2RKO A;  3K8Z A;  2C98 A;  5BPV A;  4OVZ B;  1I94 M;  2UXD M;  5FTN A;  3CF0 A;  4QHS A;  1MX0 A;  2I7P A;  2QZ4 A;  4LJ8 A;  2DVW B;  1FJG M;  1QAM A;  3U5Z A;  3R9X B;  1SXJ A;  1T3T A;  5KPZ A;  4DR4 M;  3UK6 A;  1DGB A;  2CV2 A;  3PFI A;  5IWA M;  2KZS A;  4DR3 M;  4P16 A;  3U6O A;  4HL4 A;  1SXJ C;  3THG A;  3U61 A;  2ZAO A;  3U60 A;  3ZC7 B;  4QNR A;  1QZM A;  2HL7 A;  4PDG A;  1Z6T A;  1L2D A;  3FYC A;  3DOA A;  1IY0 A;  4I8O A;  1HNW M;  3GLG A;  1NHG C;  4DR1 M;  4G4O A;  5EP1 A;  3KOY E;  4DV5 M;  4LF9 M;  3U5Z B;  4NSR A;  4FWG A;  2D7E A;  3FD9 A;  3FUT A;  1QQW A;  4NRW A;  5IZ7 D;  1L8Q A;  2DZN B;  2V6Z M;  2FE8 A;  4YHH M;  3K92 A;  3UGJ A;  4DV3 M;  4AG6 A;  1MU5 A;  2YR0 A;  4FVM A;  5EP4 A;  4LGM A;  4AW4 A;  1TH2 A;  4PDI A;  1J5E M;  3RE8 A;  1NNU C;  3GLG B;  1XNR M;  3I4V A;  4GC5 A;  2UXC M;  4M9S A;  2DZO B;  4NOO B;  4L4U A;  4IJF A;  1OFI A;  4X62 M;  3GLI A;  2EA0 A;  3U6D A;  3U6L A;  2C5R A;  2CUZ A;  1DGF A;  4L15 A;  2LNH C;  4L8R C;  4XBO A;  1YUB A;  1Q3B A;  1R2Z A;  4KHP M;  5FTJ A;  4DR7 M;  2BJV A;  2OQ4 A;  1IN6 A;  3PXG A;  5F3W A;  4JI2 M;  2M5Z A;  5FLX S;  3WHL A;  4RNA A;  5ITX E;  4FWD A;  3J2P B;  5EP2 A;  5C1B A;  1L2B A;  2DWL A;  2X4A A;  3GP1 A;  3EIH A;  3L29 A;  2R18 A;  4Z8X A;  3QWL A;  2UUC M;  1GL7 A;  5ITY A;  2DWZ B;  3KXE C;  3VLF B;  1G41 A;  2Q2E B;  4LJA A;  2O5R A;  4YY3 M;  3KOZ E;  4JV5 M;  2CV1 A;  4WW0 A;  3R8F A;  4I5S A;  3PVS A;  5GKN A;  4MGI E;  4AI6 A;  5KQ8 A;  1NY6 A;  2KA6 B;  3PNV A;  2XFT A;  1NVM A;  4DV1 M;  4LF8 M;  4B7F A;  3SMS A;  3KVW A;  1N36 M;  2G8L A;  2I7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...