2AHMA

Crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
77
structure length
77
Chain Sequence
PLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab, light chain
publication title Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, replication
total genus 30
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08716 nsp7 nsp7 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.370 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ahmA00
2AHMA 1YSYA
chains in the Genus database with same CATH superfamily
4PCZA 2ZANA 2VDBB 2A5YB 1X37A 1NV8A 1OFIA 2JUJA 4QHSA 3V76A 3JR4A 4RF0A 3GQ5A 2XLJA 2KEBA 2R44A 4QNRA 3HZJA 4B08A 3LQRA 3T15A 2JA2A 1Y8GA 5L8RF 5ITUA 3E9SA 1W5SA 4X64M 4XK8F 4XGIA 3SAWA 5EXXA 2DAGA 3FUVA 3IG5A 3GLFB 1XMQM 2F5QA 5C18A 3LVWA 4GC9A 2C96A 1ZMUA 3FE3A 3E4RA 1NVMA 1OJLA 4CJ6A 1XXHB 5LMNM 1P3QQ 4GRIA 1C1KA 4OX9M 2EKFA 2R46A 2DHYA 5EP2A 2ZAOA 3Q8XA 2OOAA 4B7GA 4IJEA 1FJGM 2MROB 4GHAA 4QOZC 4AKGA 2OQ4A 1E94E 1VQ1A 5KQ8A 2VF8A 4PDGA 3VK8A 1Q02A 2FNAA 3EIHA 1HJPA 4R7GA 3J81S 4JI7M 2WSCF 4JI8M 2E5LM 1H6UA 2DI0A 1YLAA 1OKSA 2XH9A 3M6AA 2WSFF 2LVOC 1F4IA 1TH3A 1N32M 2OPFA 1RU3A 4TUWA 2ZTCA 3AKZA 2DZLA 4X62M 2QCUA 4FW9A 3L27A 3UGJA 3U6OA 2F5OA 2XFTA 1ZMWA 2FE8A 4UN2B 2P5TA 2CHVA 3M0EA 2JWSA 1R4GA 2G5GX 3SC3A 4FCTA 5DFLA 3FTCA 4LFCM 3J2PB 4MB7A 3GQ3A 4WW0A 5FTKA 1D2NA 3SASA 2I7NA 2JY8A 3MHVC 4DR3M 3K92A 3SYLA 4K0KM 2KW0A 5FTLA 3LCUA 3MMPA 2ZTDA 4NXNM 3GPYA 1GO5A 3C3EA 1LV7A 1L2BA 3TPZA 5IREB 3AJIB 3B7ZA 3QYEA 5KPTA 3J80S 4GC5A 3HHXA 1QZEA 4DR2M 1K3XA 2R18A 1SXJA 2VF7A 2Z8YM 3FKEA 4IBFA 3EIEA 1PM5A 4GKJM 3KOXE 4I4LA 4DR1M 4JV5M 2R6FA 1XWIA 2O5RA 3CF6E 1K3WA 1N34M 2CFOA 3HU3A 2HCBA 1IBMM 4JI5M 2FOIC 4LJ8A 4AW4A 3SBJA 2CP8A 5ITYA 3CGWA 2LVNC 3LQQA 2D7GA 3OTOM 5KO3A 3AV0A 4DV0M 2Q2EB 4RNAA 2OOBA 2V6ZM 3AOEA 3NBIA 4JI6M 1NJFA 4CHTB 3L28A 2WZJA 4LJ4A 4NC6A 2LVQD 4KO8A 2HHHM 1QANA 4LGYA 2LHGA 4LFBM 4R71A 1L1ZA 2O25A 2R65A 1DO0A 2KHHA 4F1IA 3HHWA 3BXWA 3GLIA 1WXQA 2DHRA 1VDDA 3L2AA 1MJGM 3HY5A 2X8AA 4LJAA 4Z8XA 5ITRA 4B3SM 4JI1M 3K9OA 3B9PA 3NBXX 1IY0A 1HQYE 3HGIA 4LF6M 5EQTA 3LMMA 2LH0A 2QSFX 4L78A 1IN4A 1WR1B 3ZCBB 3VK7A 4LFAM 3GLHA 1XNRM 1PRBA 5IWAM 3J7BA 1KFVA 3MJ5A 2DWLA 3U61A 2CV2A 1NJGA 1EIJA 3C9PA 2K47A 1WJ7A 2LHCA 3GLGA 3QYBA 4M9XA 1L1TA 3KP1E 4S12A 4R3DA 2KNVA 4MGZE 1NO1A 3R9XB 3AL0C 1OIZA 5ITTA 4LF4M 1BVSA 4DBGB 3TL4X 3DFZA 1R2ZA 1G59A 3FTDA 2W82A 4NOOB 2O01F 1S3SA 4DR7M 1TTEA 1VEKA 2LWXA 3HU2A 3KXEC 4WP2A 3KSXA 2CV1A 3J7AS 1GJSA 3E46A 2R4EA 2QBYB 4NRWA 3I4VA 4EIWA 3PXGA 4FD2A 2UXBM 2AHMA 3HJ8A 4DV4M 4NSOB 4G3OA 1VEJA 3FUTA 4NL4H 5EP1A 5EXPA 4QHTA 3GPUA 3FUXA 1IXZA 3UJNA 1GKIA 2NQ8C 2EO2A 4W5WA 1D0LA 2B3TA 3VDUA 4OU7A 4DV2M 5GKNA 2XSZD 1LTMA 2DVWB 2R0IA 4D81A 4M0DA 2C9OA 3KSJA 3B7QA 8CATA 1L2CA 4LJ5A 1HNZM 3FD9A 4CGYB 2XZUA 2OO9A 1R2YA 1QUSA 1SG9A 2LTUA 4FVMA 1IXSA 4M0WA 5ITXE 4BLCA 3TE6A 2KA6B 2WSEF 1R6BX 2EA0A 1QYRA 3ZC7B 4BB9A 2DKLA 1XHBA 4PDIA 5DYIA 3VKGA 1ZMVA 4AZFA 1NY6A 2QZ4A 1ZQ9A 4GKKM 2VQEM 3GRYA 4ZPXA 1K82A 1NSFA 3GRVA 3KOYE 3B74A 3TQSA 3GLFA 3A98B 2Z4SA 1GABA 1IM2A 4REZA 2XEPA 2ZBKB 5BPVA 1DO2A 3UMMA 1HNWM 1XXHA 3PFIA 4L15A 3I04M 2Z7JA 3I01M 5FTJA 5KPZA 5E6JA 4DV1M 2J5YA 3SARA 1JR3A 3H4JA 3A42A 3AOGA 4FWHA 1IFYA 2LVAA 2ERCA 1T6OA 3VLFB 2MJ5B 2JZ1A 2J7NA 3CF2A 3HJSA 3DOAA 1QZMA 1R7RA 2DWMA 1GVNA 4RKUF 2VQFM 3GQ4A 3AFHA 1Z5CA 2DAEA 3L25A 3TWLA 3HU1A 1OFHA 4L6V6 2Y20A 3KP0E 4KHPM 1L2DA 3HWSA 4MM3B 3TWKA 1VG5A 4DV7M 2DAIA 1PJTA 1N77A 3I51A 3FYDA 1HT1E 3PVSA 2L2DA 2RGOA 4JXJA 4KODA 1QDTA 2JP7A 2Y21A 1VDLA 2LXEA 3NWLA 1NNJA 2KDLA 1N33M 1T3TA 1PJSA 4M9ZA 2K6BA 4DR6M 1IY2A 2DXIA 5DNYA 4IBGA 4LZZA 5A2QS 1MU5A 1DV0A 1E32A 3SAUA 2Y0TA 2LNHC 1V33A 4YHHM 2L7HA 1WIVA 1GJTA 1NHGC 1Q3CA 3R8FA 4IBBA 4Y28F 4MGKE 4WURA 1I4WA 4QOSA 3VDPA 4DV5M 1IQPA 3K8ZA 4JI3M 1G41A 5F3WA 3GRRA 3UZUA 4JN6A 4BBAA 2JY5A 4MGYE 5JI2E 1CUKA 3WHKA 2UUCM 4IBIA 2FS1A 2GNOA 4LY6A 3FYCA 3TWMA 1TDZA 2DZNB 4D80A 2DWZB 2UUAM 4LJ9A 3M7GA 2APLA 1QDRA 4G4OA 1OIPA 4IJFA 1J7KA 4LJ7A 3FTEA 1DGGA 2C98A 3KDSE 4B3RM 2D7EA 2F4VM 2C9CA 1N75A 3B7NA 3WHLA 4G4QA 3U5ZB 3C58A 3RGPA 5JI3E 3W0LB 7CATA 1J09A 3SMSA 4NRVA 3JR5A 2KNAA 1Z6TA 2UXCM 3SFZA 3HKPA 1Z5BA 2DZOB 5EP4A 1R5LA 1OAIA 4L8RC 3FTFA 2QQ8A 4L4UA 3U6LA 3HX3A 3KVWA 4NSRA 4LF7M 3J27B 3BBZA 1WGNA 4AG6A 1GL7A 1E9RA 3T6PA 3W67A 3U60B 2DNAA 3A45A 2Y0QA 2L09A 3RGSA 2HWJA 1V92A 1ZV1A 2JNHA 4IIWA 2H1RA 4LZJA 1DGFA 2I7PA 3U6MA 3U6CA 3CF0A 4AI6A 2V1CA 2DAKA 2J7OA 4IBCA 1PGYA 2XZFA 4AQYM 3LW5F 3VKHA 4YY3M 2R45A 1HQCA 1TH4A 3FRIA 2LVPC 2C5RA 1IN5A 3H4MA 2BJWA 3IECA 1SXJD 4MGHA 1IBKM 3IG8A 4LGMA 1XC8A 4AKIA 3THGA 2L7IA 2F5PA 2QBYA 1G3IA 5FTNA 1IXRC 3FUUA 1AUAA 4P16A 3FUWA 1PJJA 2V1UA 3AOEC 1NV9A 2R62A 4I81A 2HAKA 1GL6A 1N78A 2BWBA 3SAVA 5EXTA 2MH8A 2C99A 1IY1A 1OAOC 2KZUA 2BWEA 4B7HA 3IHPA 2QPAA 3HHYA 1TF0B 4HEOA 4JI4M 2QNJA 2RGHA 3RFWA 4Z6YA 2CE7A 3KFUG 2R4JA 3VFDA 2EKKA 4GITA 1IN8A 1QAOA 3K1JA 3D8BA 2ZM6M 2JZ0A 1WGLA 2M60A 1Q39A 5C1BA 3ZH9B 2RKOA 1UM8A 3ZQJA 1YSYA 2FH0A 3SHFA 3BOSA 4PT5A 1SXJE 4G4NA 1DGHB 1Q3BA 3SMPA 4I5SA 4HL4A 1FNNA 1YE9A 1ZAEA 4Q7JA 2KZSA 3DA1A 1XMOM 1T43A 3Q8GA 2F5SA 2UU9M 4GEWA 1GLNA 3KW6A 4FCWA 1L8QA 4IBDA 1TH2A 4IBJA 4II7A 3QAUA 4GMQA 2CHQA 1KSFX 4LJ6A 3GP1A 3KOZE 4NXMM 1DGHA 3D8LA 3L29A 5FSWA 1PJQA 1QUTA 3MK6A 3U6EA 2XGNA 3F92A 2KNZA 2Z3XA 4G6ZA 4IBKA 4L16A 1HNXM 4GIPA 5IT9S 2DWNA 2CEAA 4I8OA 2M5ZA 4DUYM 4GHLA 1W5TA 2KRUA 4DR4M 3SHGB 3HHZA 3U6QA 2ZAMA 3PNYA 4LCBA 5ITXA 4D82A 2LBCA 3LCVB 2JXNA 5BR8M 2KXEA 1HT2E 3GLIE 4KLNA 1JQJC 4QNMA 1I94M 1WHCA 3T1YM 1HR0M 4FWDA 2QHOB 2L4EA 1TDHA 2G8LA 3C3DA 2MGWA 4B3TM 2EUCA 2YNMD 2L4FA 1QVRA 5DYGA 5KPRA 2K0BX 5LMUM 3U6DA 1SXJB 3GLHE 1PJIA 4KT0F 1G71A 4JI0M 1E9SA 2Z4RA 3KS4A 1Z59A 4DV6M 4GH9A 5FLXS 5IZ7D 4G4RA 2JY6B 3UK6A 2X49A 1TGUA 2MR9A 4MH0E 1D0MA 5EJCA 5KQDA 4JYAM 1DGBA 3FRHA 3QWLA 4ANRA 3W0FA 3GLGE 1XNQM 3GO8A 1YUBA 1UFZA 3GPPA 4X65M 4DV3M 2XSZA 2GQFA 2L6OA 4JI2M 2CWBA 3U5ZA 3ILKA 3CTWB 5EXSA 5E26A 2FFJA 1D0KA 3DZDA 4A3VB 4DUZM 3SATA 2QENA 1JR3D 2XF3A 3T1HM 1A5TA 4LRSA 4F2LA 3GLIB 2EJSA 1JB0F 1N36M 2D7HA 2K9DA 2CRUA 4HLQA 4IBEA 2QP9X 5ITQA 1OQYA 2CV0A 2UUBM 4P17A 4OVZB 2BJVA 1G4AE 1IN6A 3K2LA 2F5NA 2HKJA 2VIIA 3KOWE 3HJQA 4FCVA 3A46A 5H37D 4CISA 2CHGA 2HL7A 4LF8M 3GLHB 3GPXA 1EE8A 1G8PA 1QAMA 1AIPC 4DR5M 1TR8A 1QQWA 3RE8A 4OVZA 4PD2A 3U60A 3U61B 1V34A 3GRUA 1ORYB 4LG2A 1KYIA 4M9SA 3SYKA 1MX0A 2XFSA 3GLGB 2YFQA 2JY7A 3T38A 4LRTA 3E21A 1Z5AA 4FWGA 4CIZA 1SXJC 2X4AA 3GLFE 3I4YA 1NNUC 1VEGA 2BNKA 4LF5M 1NY5A 1XXHE 4ITQA 2CUZA 2G3QA 4OW0A 3U6PA 1J5EM 3B89A 1JR3E 3U6SA 1IN7A 4LF9M 3KS8A 4X66M 1EFUB 3K9PA 2DAMA 4MGIE 4AKHA 2YQZA 3LVVA 4XBOA 1MN3A 5EP3A 3W68A 2YR0A 4AG5A 2KRKA 2DENA 1IBLM 4B7FA 4B3MM 4RF1A 1C7YA 1NHWC 1OTRA 1QAQA 3JAMS 5FTMA 1XB2B 2N35A 2UXDM 2RRUA 3L26A 1IXSB 3PNVA 2H5XA
chains in the Genus database with same CATH topology
4PCZA 2ZANA 2A5YB 1X37A 1OFIA 4QHSA 3JR4A 4RF0A 3GQ5A 2XLJA 2KEBA 4QNRA 4B08A 3LQRA 3T15A 2JA2A 5ITUA 3SAWA 3E9SA 1W5SA 4X64M 4XGIA 5EXXA 3IG5A 3FUVA 3GLFB 1XMQM 2F5QA 5C18A 3LVWA 4GC9A 2C96A 3E4RA 1NVMA 1OJLA 1XXHB 5LMNM 4OX9M 4GRIA 1C1KA 2R46A 5EP2A 2ZAOA 3Q8XA 4B7GA 4QOZC 4IJEA 1FJGM 4GHAA 4AKGA 2OQ4A 1E94E 5KQ8A 4PDGA 3VK8A 2FNAA 3EIHA 4R7GA 3J81S 4JI7M 4JI8M 2E5LM 1H6UA 2XH9A 3M6AA 1TH3A 1N32M 2OPFA 4TUWA 3AKZA 4X62M 2QCUA 4FW9A 3L27A 3UGJA 3U6OA 2F5OA 2XFTA 2FE8A 2P5TA 2CHVA 3M0EA 2G5GX 3SC3A 4FCTA 4LFCM 3FTCA 3J2PB 4MB7A 3GQ3A 4WW0A 5FTKA 1D2NA 3SASA 2I7NA 3MHVC 4DR3M 3K92A 3SYLA 4K0KM 2KW0A 5FTLA 4NXNM 3GPYA 1LV7A 1L2BA 3TPZA 5IREB 3AJIB 5KPTA 3J80S 4GC5A 3HHXA 4DR2M 1K3XA 2R18A 1SXJA 1PM5A 3FKEA 4IBFA 3EIEA 4GKJM 3KOXE 4I4LA 4DR1M 4JV5M 1XWIA 2O5RA 3CF6E 1K3WA 1N34M 2CFOA 3HU3A 2HCBA 1IBMM 4JI5M 2FOIC 4LJ8A 4AW4A 3SBJA 5ITYA 3LQQA 2D7GA 3OTOM 5KO3A 3AV0A 4DV0M 2Q2EB 4RNAA 2V6ZM 3AOEA 3NBIA 4JI6M 1NJFA 4CHTB 3L28A 4LJ4A 4KO8A 2HHHM 1QANA 4LGYA 4LFBM 1L1ZA 2R65A 1DO0A 3GLIA 3HHWA 1WXQA 2DHRA 1VDDA 3L2AA 5ITRA 4LJAA 2X8AA 4Z8XA 4B3SM 4JI1M 3B9PA 1IY0A 1HQYE 3HGIA 4LF6M 5EQTA 3LMMA 2LH0A 4L78A 1IN4A 3ZCBB 3VK7A 4LFAM 3GLHA 1XNRM 5IWAM 3J7BA 1KFVA 3MJ5A 2DWLA 3U61A 2CV2A 1NJGA 2K47A 3GLGA 4M9XA 1L1TA 3KP1E 4S12A 4R3DA 4MGZE 3R9XB 3AL0C 5ITTA 4LF4M 3TL4X 3DFZA 1R2ZA 1G59A 3FTDA 2W82A 4NOOB 1S3SA 4DR7M 2LWXA 3HU2A 3KXEC 3J7AS 3KSXA 2CV1A 2R4EA 1IXSB 2QBYB 3I4VA 4EIWA 3PXGA 4FD2A 4NRWA 2AHMA 3HJ8A 2UXBM 4DV4M 4NSOB 5EP1A 3FUTA 4NL4H 5EXPA 4QHTA 3GPUA 3FUXA 1IXZA 3UJNA 1GKIA 2NQ8C 2EO2A 4W5WA 3VDUA 4OU7A 4DV2M 5GKNA 2XSZD 2DVWB 4D81A 8CATA 1L2CA 4M0DA 2C9OA 3KSJA 1HNZM 2F5NA 4LJ5A 3FD9A 4CGYB 2XZUA 1R2YA 4FVMA 4M0WA 5ITXE 4BLCA 3TE6A 2KA6B 1R6BX 2EA0A 1QYRA 3ZC7B 4BB9A 4PDIA 1XHBA 5DYIA 3VKGA 4AZFA 1NY6A 2QZ4A 1ZQ9A 4GKKM 2VQEM 3GRYA 4ZPXA 1K82A 1NSFA 3KOYE 3TQSA 3GLFA 3A98B 2Z4SA 1IM2A 4REZA 2XEPA 2ZBKB 5BPVA 1DO2A 3UMMA 1HNWM 1XXHA 3PFIA 4L15A 2Z7JA 5KPZA 5FTJA 4DV1M 5E6JA 3SARA 1JR3A 3A42A 3AOGA 4FWHA 2ERCA 3VLFB 2J7NA 3CF2A 3HJSA 3DOAA 1QZMA 1R7RA 2DWMA 1GVNA 2VQFM 3GQ4A 3AFHA 1Z5CA 3L25A 3TWLA 3HU1A 1OFHA 2Y20A 3KP0E 4KHPM 1L2DA 3HWSA 4MM3B 3TWKA 4DV7M 1N77A 3I51A 3FYDA 1HT1E 3PVSA 2RGOA 4JXJA 4KODA 3NWLA 2Y21A 1NNJA 2LXEA 1N33M 1T3TA 4M9ZA 4DR6M 1IY2A 2DXIA 5DNYA 4IBGA 4LZZA 5A2QS 1MU5A 1E32A 3SAUA 2Y0TA 2LNHC 4YHHM 2L7HA 1NHGC 1Q3CA 3R8FA 4IBBA 4MGKE 4WURA 1I4WA 4QOSA 3VDPA 4DV5M 1IQPA 3K8ZA 4JI3M 1G41A 5F3WA 3GRRA 3UZUA 4JN6A 4BBAA 4MGYE 5JI2E 2UUCM 3WHKA 4IBIA 4LY6A 3FYCA 3TWMA 1TDZA 2DZNB 4D80A 2DWZB 2UUAM 4LJ9A 3M7GA 4G4OA 4IJFA 1J7KA 4LJ7A 3FTEA 1DGGA 2C98A 3KDSE 4B3RM 2D7EA 2F4VM 2C9CA 1N75A 4G4QA 3WHLA 3U5ZB 3C58A 3RGPA 5JI3E 3W0LB 7CATA 1J09A 3SMSA 4NRVA 3JR5A 1Z6TA 2UXCM 3SFZA 3HKPA 1Z5BA 2DZOB 5EP4A 4L8RC 3FTFA 4L4UA 3U6LA 3KVWA 4NSRA 4LF7M 3J27B 4AG6A 1GL7A 1E9RA 3U60B 3A45A 2Y0QA 2L09A 3RGSA 4IIWA 2H1RA 4LZJA 1DGFA 2I7PA 3U6MA 3U6CA 3CF0A 4AI6A 2V1CA 2J7OA 4IBCA 2XZFA 4AQYM 3VKHA 4YY3M 2R45A 1HQCA 1TH4A 2C5RA 1IN5A 3H4MA 2BJWA 1SXJD 4MGHA 1IBKM 3IG8A 4LGMA 1XC8A 4AKIA 3THGA 2L7IA 2F5PA 2QBYA 1G3IA 5FTNA 1IXRC 3FUUA 4P16A 3FUWA 1PJJA 2V1UA 3AOEC 2R62A 4I81A 1GL6A 1N78A 3SAVA 5EXTA 2C99A 1IY1A 2KZUA 4B7HA 2QPAA 3HHYA 4JI4M 2RGHA 3RFWA 4Z6YA 2CE7A 3KFUG 2R4JA 3VFDA 4GITA 1IN8A 1QAOA 3K1JA 3D8BA 2ZM6M 2M60A 1Q39A 5C1BA 3ZH9B 2RKOA 1UM8A 1YSYA 3SHFA 3BOSA 4PT5A 1SXJE 4G4NA 1DGHB 1Q3BA 3SMPA 4I5SA 4HL4A 1FNNA 1YE9A 1ZAEA 2KZSA 3DA1A 1XMOM 2F5SA 2UU9M 1GLNA 3KW6A 4FCWA 1L8QA 4IBDA 1TH2A 4IBJA 4II7A 3QAUA 4GMQA 2CHQA 1KSFX 4LJ6A 3GP1A 3KOZE 4NXMM 1DGHA 3D8LA 3L29A 5FSWA 3MK6A 3U6EA 2XGNA 2Z3XA 4G6ZA 4IBKA 4L16A 1HNXM 4GIPA 5IT9S 2DWNA 2CEAA 4I8OA 2M5ZA 4DUYM 4GHLA 1W5TA 2KRUA 4DR4M 3SHGB 3HHZA 3U6QA 2ZAMA 3PNYA 4LCBA 5ITXA 4D82A 5BR8M 2KXEA 1HT2E 4KLNA 1JQJC 4QNMA 1I94M 3T1YM 1HR0M 4FWDA 1TDHA 2G8LA 4B3TM 2EUCA 2YNMD 5DYGA 1QVRA 5KPRA 5LMUM 3U6DA 1SXJB 1PJIA 4JI0M 1E9SA 2Z4RA 3KS4A 1Z59A 4DV6M 4GH9A 5FLXS 5IZ7D 4G4RA 3UK6A 2X49A 1TGUA 4MH0E 5EJCA 5KQDA 4JYAM 1DGBA 3QWLA 3W0FA 1XNQM 3GO8A 1YUBA 3GPPA 4X65M 4DV3M 2XSZA 2L6OA 4JI2M 3U5ZA 3ILKA 3CTWB 5EXSA 5E26A 2FFJA 3DZDA 4DUZM 4A3VB 3SATA 2QENA 1JR3D 2XF3A 3T1HM 4LRSA 3GLIB 1N36M 2D7HA 4HLQA 4IBEA 5ITQA 2QP9X 2CV0A 2UUBM 4OVZB 2BJVA 1G4AE 1IN6A 3K2LA 2HKJA 2VIIA 3KOWE 3HJQA 4FCVA 3A46A 5H37D 4CISA 2CHGA 2HL7A 4LF8M 3GLHB 3GPXA 1EE8A 1G8PA 1QAMA 4DR5M 1QQWA 3RE8A 4OVZA 4PD2A 3U60A 3U61B 3GRUA 1ORYB 4LG2A 1KYIA 4M9SA 3SYKA 1MX0A 2XFSA 3GLGB 2YFQA 3T38A 4LRTA 4FWGA 1Z5AA 1SXJC 2X4AA 3I4YA 1NNUC 2BNKA 4LF5M 1NY5A 4ITQA 2CUZA 4OW0A 3U6PA 1J5EM 3U6SA 1IN7A 4LF9M 3KS8A 4X66M 4AKHA 4MGIE 2YQZA 3LVVA 4XBOA 5EP3A 2YR0A 4AG5A 2KRKA 1IBLM 4B7FA 4B3MM 4RF1A 1NHWC 1QAQA 3JAMS 5FTMA 2UXDM 3L26A 3GRVA 3PNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHM A;  1YSY A; 
#chains in the Genus database with same CATH topology
 4PCZ A;  2ZAN A;  2VDB B;  2A5Y B;  1X37 A;  1NV8 A;  1OFI A;  2JUJ A;  4QHS A;  3V76 A;  3JR4 A;  4RF0 A;  3GQ5 A;  2XLJ A;  2KEB A;  2R44 A;  4QNR A;  3HZJ A;  4B08 A;  3LQR A;  3T15 A;  2JA2 A;  1Y8G A;  5L8R F;  5ITU A;  3E9S A;  1W5S A;  4X64 M;  4XK8 F;  4XGI A;  3SAW A;  5EXX A;  2DAG A;  3FUV A;  3IG5 A;  3GLF B;  1XMQ M;  2F5Q A;  5C18 A;  3LVW A;  4GC9 A;  2C96 A;  1ZMU A;  3FE3 A;  3E4R A;  1NVM A;  1OJL A;  4CJ6 A;  1XXH B;  5LMN M;  1P3Q Q;  4GRI A;  1C1K A;  4OX9 M;  2EKF A;  2R46 A;  2DHY A;  5EP2 A;  2ZAO A;  3Q8X A;  2OOA A;  4B7G A;  4IJE A;  1FJG M;  2MRO B;  4GHA A;  4QOZ C;  4AKG A;  2OQ4 A;  1E94 E;  1VQ1 A;  5KQ8 A;  2VF8 A;  4PDG A;  3VK8 A;  1Q02 A;  2FNA A;  3EIH A;  1HJP A;  4R7G A;  3J81 S;  4JI7 M;  2WSC F;  4JI8 M;  2E5L M;  1H6U A;  2DI0 A;  1YLA A;  1OKS A;  2XH9 A;  3M6A A;  2WSF F;  2LVO C;  1F4I A;  1TH3 A;  1N32 M;  2OPF A;  1RU3 A;  4TUW A;  2ZTC A;  3AKZ A;  2DZL A;  4X62 M;  2QCU A;  4FW9 A;  3L27 A;  3UGJ A;  3U6O A;  2F5O A;  2XFT A;  1ZMW A;  2FE8 A;  4UN2 B;  2P5T A;  2CHV A;  3M0E A;  2JWS A;  1R4G A;  2G5G X;  3SC3 A;  4FCT A;  5DFL A;  3FTC A;  4LFC M;  3J2P B;  4MB7 A;  3GQ3 A;  4WW0 A;  5FTK A;  1D2N A;  3SAS A;  2I7N A;  2JY8 A;  3MHV C;  4DR3 M;  3K92 A;  3SYL A;  4K0K M;  2KW0 A;  5FTL A;  3LCU A;  3MMP A;  2ZTD A;  4NXN M;  3GPY A;  1GO5 A;  3C3E A;  1LV7 A;  1L2B A;  3TPZ A;  5IRE B;  3AJI B;  3B7Z A;  3QYE A;  5KPT A;  3J80 S;  4GC5 A;  3HHX A;  1QZE A;  4DR2 M;  1K3X A;  2R18 A;  1SXJ A;  2VF7 A;  2Z8Y M;  3FKE A;  4IBF A;  3EIE A;  1PM5 A;  4GKJ M;  3KOX E;  4I4L A;  4DR1 M;  4JV5 M;  2R6F A;  1XWI A;  2O5R A;  3CF6 E;  1K3W A;  1N34 M;  2CFO A;  3HU3 A;  2HCB A;  1IBM M;  4JI5 M;  2FOI C;  4LJ8 A;  4AW4 A;  3SBJ A;  2CP8 A;  5ITY A;  3CGW A;  2LVN C;  3LQQ A;  2D7G A;  3OTO M;  5KO3 A;  3AV0 A;  4DV0 M;  2Q2E B;  4RNA A;  2OOB A;  2V6Z M;  3AOE A;  3NBI A;  4JI6 M;  1NJF A;  4CHT B;  3L28 A;  2WZJ A;  4LJ4 A;  4NC6 A;  2LVQ D;  4KO8 A;  2HHH M;  1QAN A;  4LGY A;  2LHG A;  4LFB M;  4R71 A;  1L1Z A;  2O25 A;  2R65 A;  1DO0 A;  2KHH A;  4F1I A;  3HHW A;  3BXW A;  3GLI A;  1WXQ A;  2DHR A;  1VDD A;  3L2A A;  1MJG M;  3HY5 A;  2X8A A;  4LJA A;  4Z8X A;  5ITR A;  4B3S M;  4JI1 M;  3K9O A;  3B9P A;  3NBX X;  1IY0 A;  1HQY E;  3HGI A;  4LF6 M;  5EQT A;  3LMM A;  2LH0 A;  2QSF X;  4L78 A;  1IN4 A;  1WR1 B;  3ZCB B;  3VK7 A;  4LFA M;  3GLH A;  1XNR M;  1PRB A;  5IWA M;  3J7B A;  1KFV A;  3MJ5 A;  2DWL A;  3U61 A;  2CV2 A;  1NJG A;  1EIJ A;  3C9P A;  2K47 A;  1WJ7 A;  2LHC A;  3GLG A;  3QYB A;  4M9X A;  1L1T A;  3KP1 E;  4S12 A;  4R3D A;  2KNV A;  4MGZ E;  1NO1 A;  3R9X B;  3AL0 C;  1OIZ A;  5ITT A;  4LF4 M;  1BVS A;  4DBG B;  3TL4 X;  3DFZ A;  1R2Z A;  1G59 A;  3FTD A;  2W82 A;  4NOO B;  2O01 F;  1S3S A;  4DR7 M;  1TTE A;  1VEK A;  2LWX A;  3HU2 A;  3KXE C;  4WP2 A;  3KSX A;  2CV1 A;  3J7A S;  1GJS A;  3E46 A;  2R4E A;  2QBY B;  4NRW A;  3I4V A;  4EIW A;  3PXG A;  4FD2 A;  2UXB M;  2AHM A;  3HJ8 A;  4DV4 M;  4NSO B;  4G3O A;  1VEJ A;  3FUT A;  4NL4 H;  5EP1 A;  5EXP A;  4QHT A;  3GPU A;  3FUX A;  1IXZ A;  3UJN A;  1GKI A;  2NQ8 C;  2EO2 A;  4W5W A;  1D0L A;  2B3T A;  3VDU A;  4OU7 A;  4DV2 M;  5GKN A;  2XSZ D;  1LTM A;  2DVW B;  2R0I A;  4D81 A;  4M0D A;  2C9O A;  3KSJ A;  3B7Q A;  8CAT A;  1L2C A;  4LJ5 A;  1HNZ M;  3FD9 A;  4CGY B;  2XZU A;  2OO9 A;  1R2Y A;  1QUS A;  1SG9 A;  2LTU A;  4FVM A;  1IXS A;  4M0W A;  5ITX E;  4BLC A;  3TE6 A;  2KA6 B;  2WSE F;  1R6B X;  2EA0 A;  1QYR A;  3ZC7 B;  4BB9 A;  2DKL A;  1XHB A;  4PDI A;  5DYI A;  3VKG A;  1ZMV A;  4AZF A;  1NY6 A;  2QZ4 A;  1ZQ9 A;  4GKK M;  2VQE M;  3GRY A;  4ZPX A;  1K82 A;  1NSF A;  3GRV A;  3KOY E;  3B74 A;  3TQS A;  3GLF A;  3A98 B;  2Z4S A;  1GAB A;  1IM2 A;  4REZ A;  2XEP A;  2ZBK B;  5BPV A;  1DO2 A;  3UMM A;  1HNW M;  1XXH A;  3PFI A;  4L15 A;  3I04 M;  2Z7J A;  3I01 M;  5FTJ A;  5KPZ A;  5E6J A;  4DV1 M;  2J5Y A;  3SAR A;  1JR3 A;  3H4J A;  3A42 A;  3AOG A;  4FWH A;  1IFY A;  2LVA A;  2ERC A;  1T6O A;  3VLF B;  2MJ5 B;  2JZ1 A;  2J7N A;  3CF2 A;  3HJS A;  3DOA A;  1QZM A;  1R7R A;  2DWM A;  1GVN A;  4RKU F;  2VQF M;  3GQ4 A;  3AFH A;  1Z5C A;  2DAE A;  3L25 A;  3TWL A;  3HU1 A;  1OFH A;  4L6V 6;  2Y20 A;  3KP0 E;  4KHP M;  1L2D A;  3HWS A;  4MM3 B;  3TWK A;  1VG5 A;  4DV7 M;  2DAI A;  1PJT A;  1N77 A;  3I51 A;  3FYD A;  1HT1 E;  3PVS A;  2L2D A;  2RGO A;  4JXJ A;  4KOD A;  1QDT A;  2JP7 A;  2Y21 A;  1VDL A;  2LXE A;  3NWL A;  1NNJ A;  2KDL A;  1N33 M;  1T3T A;  1PJS A;  4M9Z A;  2K6B A;  4DR6 M;  1IY2 A;  2DXI A;  5DNY A;  4IBG A;  4LZZ A;  5A2Q S;  1MU5 A;  1DV0 A;  1E32 A;  3SAU A;  2Y0T A;  2LNH C;  1V33 A;  4YHH M;  2L7H A;  1WIV A;  1GJT A;  1NHG C;  1Q3C A;  3R8F A;  4IBB A;  4Y28 F;  4MGK E;  4WUR A;  1I4W A;  4QOS A;  3VDP A;  4DV5 M;  1IQP A;  3K8Z A;  4JI3 M;  1G41 A;  5F3W A;  3GRR A;  3UZU A;  4JN6 A;  4BBA A;  2JY5 A;  4MGY E;  5JI2 E;  1CUK A;  3WHK A;  2UUC M;  4IBI A;  2FS1 A;  2GNO A;  4LY6 A;  3FYC A;  3TWM A;  1TDZ A;  2DZN B;  4D80 A;  2DWZ B;  2UUA M;  4LJ9 A;  3M7G A;  2APL A;  1QDR A;  4G4O A;  1OIP A;  4IJF A;  1J7K A;  4LJ7 A;  3FTE A;  1DGG A;  2C98 A;  3KDS E;  4B3R M;  2D7E A;  2F4V M;  2C9C A;  1N75 A;  3B7N A;  3WHL A;  4G4Q A;  3U5Z B;  3C58 A;  3RGP A;  5JI3 E;  3W0L B;  7CAT A;  1J09 A;  3SMS A;  4NRV A;  3JR5 A;  2KNA A;  1Z6T A;  2UXC M;  3SFZ A;  3HKP A;  1Z5B A;  2DZO B;  5EP4 A;  1R5L A;  1OAI A;  4L8R C;  3FTF A;  2QQ8 A;  4L4U A;  3U6L A;  3HX3 A;  3KVW A;  4NSR A;  4LF7 M;  3J27 B;  3BBZ A;  1WGN A;  4AG6 A;  1GL7 A;  1E9R A;  3T6P A;  3W67 A;  3U60 B;  2DNA A;  3A45 A;  2Y0Q A;  2L09 A;  3RGS A;  2HWJ A;  1V92 A;  1ZV1 A;  2JNH A;  4IIW A;  2H1R A;  4LZJ A;  1DGF A;  2I7P A;  3U6M A;  3U6C A;  3CF0 A;  4AI6 A;  2V1C A;  2DAK A;  2J7O A;  4IBC A;  1PGY A;  2XZF A;  4AQY M;  3LW5 F;  3VKH A;  4YY3 M;  2R45 A;  1HQC A;  1TH4 A;  3FRI A;  2LVP C;  2C5R A;  1IN5 A;  3H4M A;  2BJW A;  3IEC A;  1SXJ D;  4MGH A;  1IBK M;  3IG8 A;  4LGM A;  1XC8 A;  4AKI A;  3THG A;  2L7I A;  2F5P A;  2QBY A;  1G3I A;  5FTN A;  1IXR C;  3FUU A;  1AUA A;  4P16 A;  3FUW A;  1PJJ A;  2V1U A;  3AOE C;  1NV9 A;  2R62 A;  4I81 A;  2HAK A;  1GL6 A;  1N78 A;  2BWB A;  3SAV A;  5EXT A;  2MH8 A;  2C99 A;  1IY1 A;  1OAO C;  2KZU A;  2BWE A;  4B7H A;  3IHP A;  2QPA A;  3HHY A;  1TF0 B;  4HEO A;  4JI4 M;  2QNJ A;  2RGH A;  3RFW A;  4Z6Y A;  2CE7 A;  3KFU G;  2R4J A;  3VFD A;  2EKK A;  4GIT A;  1IN8 A;  1QAO A;  3K1J A;  3D8B A;  2ZM6 M;  2JZ0 A;  1WGL A;  2M60 A;  1Q39 A;  5C1B A;  3ZH9 B;  2RKO A;  1UM8 A;  3ZQJ A;  1YSY A;  2FH0 A;  3SHF A;  3BOS A;  4PT5 A;  1SXJ E;  4G4N A;  1DGH B;  1Q3B A;  3SMP A;  4I5S A;  4HL4 A;  1FNN A;  1YE9 A;  1ZAE A;  4Q7J A;  2KZS A;  3DA1 A;  1XMO M;  1T43 A;  3Q8G A;  2F5S A;  2UU9 M;  4GEW A;  1GLN A;  3KW6 A;  4FCW A;  1L8Q A;  4IBD A;  1TH2 A;  4IBJ A;  4II7 A;  3QAU A;  4GMQ A;  2CHQ A;  1KSF X;  4LJ6 A;  3GP1 A;  3KOZ E;  4NXM M;  1DGH A;  3D8L A;  3L29 A;  5FSW A;  1PJQ A;  1QUT A;  3MK6 A;  3U6E A;  2XGN A;  3F92 A;  2KNZ A;  2Z3X A;  4G6Z A;  4IBK A;  4L16 A;  1HNX M;  4GIP A;  5IT9 S;  2DWN A;  2CEA A;  4I8O A;  2M5Z A;  4DUY M;  4GHL A;  1W5T A;  2KRU A;  4DR4 M;  3SHG B;  3HHZ A;  3U6Q A;  2ZAM A;  3PNY A;  4LCB A;  5ITX A;  4D82 A;  2LBC A;  3LCV B;  2JXN A;  5BR8 M;  2KXE A;  1HT2 E;  3GLI E;  4KLN A;  1JQJ C;  4QNM A;  1I94 M;  1WHC A;  3T1Y M;  1HR0 M;  4FWD A;  2QHO B;  2L4E A;  1TDH A;  2G8L A;  3C3D A;  2MGW A;  4B3T M;  2EUC A;  2YNM D;  2L4F A;  1QVR A;  5DYG A;  5KPR A;  2K0B X;  5LMU M;  3U6D A;  1SXJ B;  3GLH E;  1PJI A;  4KT0 F;  1G71 A;  4JI0 M;  1E9S A;  2Z4R A;  3KS4 A;  1Z59 A;  4DV6 M;  4GH9 A;  5FLX S;  5IZ7 D;  4G4R A;  2JY6 B;  3UK6 A;  2X49 A;  1TGU A;  2MR9 A;  4MH0 E;  1D0M A;  5EJC A;  5KQD A;  4JYA M;  1DGB A;  3FRH A;  3QWL A;  4ANR A;  3W0F A;  3GLG E;  1XNQ M;  3GO8 A;  1YUB A;  1UFZ A;  3GPP A;  4X65 M;  4DV3 M;  2XSZ A;  2GQF A;  2L6O A;  4JI2 M;  2CWB A;  3U5Z A;  3ILK A;  3CTW B;  5EXS A;  5E26 A;  2FFJ A;  1D0K A;  3DZD A;  4A3V B;  4DUZ M;  3SAT A;  2QEN A;  1JR3 D;  2XF3 A;  3T1H M;  1A5T A;  4LRS A;  4F2L A;  3GLI B;  2EJS A;  1JB0 F;  1N36 M;  2D7H A;  2K9D A;  2CRU A;  4HLQ A;  4IBE A;  2QP9 X;  5ITQ A;  1OQY A;  2CV0 A;  2UUB M;  4P17 A;  4OVZ B;  2BJV A;  1G4A E;  1IN6 A;  3K2L A;  2F5N A;  2HKJ A;  2VII A;  3KOW E;  3HJQ A;  4FCV A;  3A46 A;  5H37 D;  4CIS A;  2CHG A;  2HL7 A;  4LF8 M;  3GLH B;  3GPX A;  1EE8 A;  1G8P A;  1QAM A;  1AIP C;  4DR5 M;  1TR8 A;  1QQW A;  3RE8 A;  4OVZ A;  4PD2 A;  3U60 A;  3U61 B;  1V34 A;  3GRU A;  1ORY B;  4LG2 A;  1KYI A;  4M9S A;  3SYK A;  1MX0 A;  2XFS A;  3GLG B;  2YFQ A;  2JY7 A;  3T38 A;  4LRT A;  3E21 A;  1Z5A A;  4FWG A;  4CIZ A;  1SXJ C;  2X4A A;  3GLF E;  3I4Y A;  1NNU C;  1VEG A;  2BNK A;  4LF5 M;  1NY5 A;  1XXH E;  4ITQ A;  2CUZ A;  2G3Q A;  4OW0 A;  3U6P A;  1J5E M;  3B89 A;  1JR3 E;  3U6S A;  1IN7 A;  4LF9 M;  3KS8 A;  4X66 M;  1EFU B;  3K9P A;  2DAM A;  4MGI E;  4AKH A;  2YQZ A;  3LVV A;  4XBO A;  1MN3 A;  5EP3 A;  3W68 A;  2YR0 A;  4AG5 A;  2KRK A;  2DEN A;  1IBL M;  4B7F A;  4B3M M;  4RF1 A;  1C7Y A;  1NHW C;  1OTR A;  1QAQ A;  3JAM S;  5FTM A;  1XB2 B;  2N35 A;  2UXD M;  2RRU A;  3L26 A;  1IXS B;  3PNV A;  2H5X A; 
#chains in the Genus database with same CATH homology
 4PCZ A;  2ZAN A;  2A5Y B;  1X37 A;  1OFI A;  4QHS A;  3JR4 A;  4RF0 A;  3GQ5 A;  2XLJ A;  2KEB A;  4QNR A;  4B08 A;  3LQR A;  3T15 A;  2JA2 A;  5ITU A;  3SAW A;  3E9S A;  1W5S A;  4X64 M;  4XGI A;  5EXX A;  3IG5 A;  3FUV A;  3GLF B;  1XMQ M;  2F5Q A;  5C18 A;  3LVW A;  4GC9 A;  2C96 A;  3E4R A;  1NVM A;  1OJL A;  1XXH B;  5LMN M;  4OX9 M;  4GRI A;  1C1K A;  2R46 A;  5EP2 A;  2ZAO A;  3Q8X A;  4B7G A;  4QOZ C;  4IJE A;  1FJG M;  4GHA A;  4AKG A;  2OQ4 A;  1E94 E;  5KQ8 A;  4PDG A;  3VK8 A;  2FNA A;  3EIH A;  4R7G A;  3J81 S;  4JI7 M;  4JI8 M;  2E5L M;  1H6U A;  2XH9 A;  3M6A A;  1TH3 A;  1N32 M;  2OPF A;  4TUW A;  3AKZ A;  4X62 M;  2QCU A;  4FW9 A;  3L27 A;  3UGJ A;  3U6O A;  2F5O A;  2XFT A;  2FE8 A;  2P5T A;  2CHV A;  3M0E A;  2G5G X;  3SC3 A;  4FCT A;  4LFC M;  3FTC A;  3J2P B;  4MB7 A;  3GQ3 A;  4WW0 A;  5FTK A;  1D2N A;  3SAS A;  2I7N A;  3MHV C;  4DR3 M;  3K92 A;  3SYL A;  4K0K M;  2KW0 A;  5FTL A;  4NXN M;  3GPY A;  1LV7 A;  1L2B A;  3TPZ A;  5IRE B;  3AJI B;  5KPT A;  3J80 S;  4GC5 A;  3HHX A;  4DR2 M;  1K3X A;  2R18 A;  1SXJ A;  1PM5 A;  3FKE A;  4IBF A;  3EIE A;  4GKJ M;  3KOX E;  4I4L A;  4DR1 M;  4JV5 M;  1XWI A;  2O5R A;  3CF6 E;  1K3W A;  1N34 M;  2CFO A;  3HU3 A;  2HCB A;  1IBM M;  4JI5 M;  2FOI C;  4LJ8 A;  4AW4 A;  3SBJ A;  5ITY A;  3LQQ A;  2D7G A;  3OTO M;  5KO3 A;  3AV0 A;  4DV0 M;  2Q2E B;  4RNA A;  2V6Z M;  3AOE A;  3NBI A;  4JI6 M;  1NJF A;  4CHT B;  3L28 A;  4LJ4 A;  4KO8 A;  2HHH M;  1QAN A;  4LGY A;  4LFB M;  1L1Z A;  2R65 A;  1DO0 A;  3GLI A;  3HHW A;  1WXQ A;  2DHR A;  1VDD A;  3L2A A;  5ITR A;  4LJA A;  2X8A A;  4Z8X A;  4B3S M;  4JI1 M;  3B9P A;  1IY0 A;  1HQY E;  3HGI A;  4LF6 M;  5EQT A;  3LMM A;  2LH0 A;  4L78 A;  1IN4 A;  3ZCB B;  3VK7 A;  4LFA M;  3GLH A;  1XNR M;  5IWA M;  3J7B A;  1KFV A;  3MJ5 A;  2DWL A;  3U61 A;  2CV2 A;  1NJG A;  2K47 A;  3GLG A;  4M9X A;  1L1T A;  3KP1 E;  4S12 A;  4R3D A;  4MGZ E;  3R9X B;  3AL0 C;  5ITT A;  4LF4 M;  3TL4 X;  3DFZ A;  1R2Z A;  1G59 A;  3FTD A;  2W82 A;  4NOO B;  1S3S A;  4DR7 M;  2LWX A;  3HU2 A;  3KXE C;  3J7A S;  3KSX A;  2CV1 A;  2R4E A;  1IXS B;  2QBY B;  3I4V A;  4EIW A;  3PXG A;  4FD2 A;  4NRW A;  2AHM A;  3HJ8 A;  2UXB M;  4DV4 M;  4NSO B;  5EP1 A;  3FUT A;  4NL4 H;  5EXP A;  4QHT A;  3GPU A;  3FUX A;  1IXZ A;  3UJN A;  1GKI A;  2NQ8 C;  2EO2 A;  4W5W A;  3VDU A;  4OU7 A;  4DV2 M;  5GKN A;  2XSZ D;  2DVW B;  4D81 A;  8CAT A;  1L2C A;  4M0D A;  2C9O A;  3KSJ A;  1HNZ M;  2F5N A;  4LJ5 A;  3FD9 A;  4CGY B;  2XZU A;  1R2Y A;  4FVM A;  4M0W A;  5ITX E;  4BLC A;  3TE6 A;  2KA6 B;  1R6B X;  2EA0 A;  1QYR A;  3ZC7 B;  4BB9 A;  4PDI A;  1XHB A;  5DYI A;  3VKG A;  4AZF A;  1NY6 A;  2QZ4 A;  1ZQ9 A;  4GKK M;  2VQE M;  3GRY A;  4ZPX A;  1K82 A;  1NSF A;  3KOY E;  3TQS A;  3GLF A;  3A98 B;  2Z4S A;  1IM2 A;  4REZ A;  2XEP A;  2ZBK B;  5BPV A;  1DO2 A;  3UMM A;  1HNW M;  1XXH A;  3PFI A;  4L15 A;  2Z7J A;  5KPZ A;  5FTJ A;  4DV1 M;  5E6J A;  3SAR A;  1JR3 A;  3A42 A;  3AOG A;  4FWH A;  2ERC A;  3VLF B;  2J7N A;  3CF2 A;  3HJS A;  3DOA A;  1QZM A;  1R7R A;  2DWM A;  1GVN A;  2VQF M;  3GQ4 A;  3AFH A;  1Z5C A;  3L25 A;  3TWL A;  3HU1 A;  1OFH A;  2Y20 A;  3KP0 E;  4KHP M;  1L2D A;  3HWS A;  4MM3 B;  3TWK A;  4DV7 M;  1N77 A;  3I51 A;  3FYD A;  1HT1 E;  3PVS A;  2RGO A;  4JXJ A;  4KOD A;  3NWL A;  2Y21 A;  1NNJ A;  2LXE A;  1N33 M;  1T3T A;  4M9Z A;  4DR6 M;  1IY2 A;  2DXI A;  5DNY A;  4IBG A;  4LZZ A;  5A2Q S;  1MU5 A;  1E32 A;  3SAU A;  2Y0T A;  2LNH C;  4YHH M;  2L7H A;  1NHG C;  1Q3C A;  3R8F A;  4IBB A;  4MGK E;  4WUR A;  1I4W A;  4QOS A;  3VDP A;  4DV5 M;  1IQP A;  3K8Z A;  4JI3 M;  1G41 A;  5F3W A;  3GRR A;  3UZU A;  4JN6 A;  4BBA A;  4MGY E;  5JI2 E;  2UUC M;  3WHK A;  4IBI A;  4LY6 A;  3FYC A;  3TWM A;  1TDZ A;  2DZN B;  4D80 A;  2DWZ B;  2UUA M;  4LJ9 A;  3M7G A;  4G4O A;  4IJF A;  1J7K A;  4LJ7 A;  3FTE A;  1DGG A;  2C98 A;  3KDS E;  4B3R M;  2D7E A;  2F4V M;  2C9C A;  1N75 A;  4G4Q A;  3WHL A;  3U5Z B;  3C58 A;  3RGP A;  5JI3 E;  3W0L B;  7CAT A;  1J09 A;  3SMS A;  4NRV A;  3JR5 A;  1Z6T A;  2UXC M;  3SFZ A;  3HKP A;  1Z5B A;  2DZO B;  5EP4 A;  4L8R C;  3FTF A;  4L4U A;  3U6L A;  3KVW A;  4NSR A;  4LF7 M;  3J27 B;  4AG6 A;  1GL7 A;  1E9R A;  3U60 B;  3A45 A;  2Y0Q A;  2L09 A;  3RGS A;  4IIW A;  2H1R A;  4LZJ A;  1DGF A;  2I7P A;  3U6M A;  3U6C A;  3CF0 A;  4AI6 A;  2V1C A;  2J7O A;  4IBC A;  2XZF A;  4AQY M;  3VKH A;  4YY3 M;  2R45 A;  1HQC A;  1TH4 A;  2C5R A;  1IN5 A;  3H4M A;  2BJW A;  1SXJ D;  4MGH A;  1IBK M;  3IG8 A;  4LGM A;  1XC8 A;  4AKI A;  3THG A;  2L7I A;  2F5P A;  2QBY A;  1G3I A;  5FTN A;  1IXR C;  3FUU A;  4P16 A;  3FUW A;  1PJJ A;  2V1U A;  3AOE C;  2R62 A;  4I81 A;  1GL6 A;  1N78 A;  3SAV A;  5EXT A;  2C99 A;  1IY1 A;  2KZU A;  4B7H A;  2QPA A;  3HHY A;  4JI4 M;  2RGH A;  3RFW A;  4Z6Y A;  2CE7 A;  3KFU G;  2R4J A;  3VFD A;  4GIT A;  1IN8 A;  1QAO A;  3K1J A;  3D8B A;  2ZM6 M;  2M60 A;  1Q39 A;  5C1B A;  3ZH9 B;  2RKO A;  1UM8 A;  1YSY A;  3SHF A;  3BOS A;  4PT5 A;  1SXJ E;  4G4N A;  1DGH B;  1Q3B A;  3SMP A;  4I5S A;  4HL4 A;  1FNN A;  1YE9 A;  1ZAE A;  2KZS A;  3DA1 A;  1XMO M;  2F5S A;  2UU9 M;  1GLN A;  3KW6 A;  4FCW A;  1L8Q A;  4IBD A;  1TH2 A;  4IBJ A;  4II7 A;  3QAU A;  4GMQ A;  2CHQ A;  1KSF X;  4LJ6 A;  3GP1 A;  3KOZ E;  4NXM M;  1DGH A;  3D8L A;  3L29 A;  5FSW A;  3MK6 A;  3U6E A;  2XGN A;  2Z3X A;  4G6Z A;  4IBK A;  4L16 A;  1HNX M;  4GIP A;  5IT9 S;  2DWN A;  2CEA A;  4I8O A;  2M5Z A;  4DUY M;  4GHL A;  1W5T A;  2KRU A;  4DR4 M;  3SHG B;  3HHZ A;  3U6Q A;  2ZAM A;  3PNY A;  4LCB A;  5ITX A;  4D82 A;  5BR8 M;  2KXE A;  1HT2 E;  4KLN A;  1JQJ C;  4QNM A;  1I94 M;  3T1Y M;  1HR0 M;  4FWD A;  1TDH A;  2G8L A;  4B3T M;  2EUC A;  2YNM D;  5DYG A;  1QVR A;  5KPR A;  5LMU M;  3U6D A;  1SXJ B;  1PJI A;  4JI0 M;  1E9S A;  2Z4R A;  3KS4 A;  1Z59 A;  4DV6 M;  4GH9 A;  5FLX S;  5IZ7 D;  4G4R A;  3UK6 A;  2X49 A;  1TGU A;  4MH0 E;  5EJC A;  5KQD A;  4JYA M;  1DGB A;  3QWL A;  3W0F A;  1XNQ M;  3GO8 A;  1YUB A;  3GPP A;  4X65 M;  4DV3 M;  2XSZ A;  2L6O A;  4JI2 M;  3U5Z A;  3ILK A;  3CTW B;  5EXS A;  5E26 A;  2FFJ A;  3DZD A;  4DUZ M;  4A3V B;  3SAT A;  2QEN A;  1JR3 D;  2XF3 A;  3T1H M;  4LRS A;  3GLI B;  1N36 M;  2D7H A;  4HLQ A;  4IBE A;  5ITQ A;  2QP9 X;  2CV0 A;  2UUB M;  4OVZ B;  2BJV A;  1G4A E;  1IN6 A;  3K2L A;  2HKJ A;  2VII A;  3KOW E;  3HJQ A;  4FCV A;  3A46 A;  5H37 D;  4CIS A;  2CHG A;  2HL7 A;  4LF8 M;  3GLH B;  3GPX A;  1EE8 A;  1G8P A;  1QAM A;  4DR5 M;  1QQW A;  3RE8 A;  4OVZ A;  4PD2 A;  3U60 A;  3U61 B;  3GRU A;  1ORY B;  4LG2 A;  1KYI A;  4M9S A;  3SYK A;  1MX0 A;  2XFS A;  3GLG B;  2YFQ A;  3T38 A;  4LRT A;  4FWG A;  1Z5A A;  1SXJ C;  2X4A A;  3I4Y A;  1NNU C;  2BNK A;  4LF5 M;  1NY5 A;  4ITQ A;  2CUZ A;  4OW0 A;  3U6P A;  1J5E M;  3U6S A;  1IN7 A;  4LF9 M;  3KS8 A;  4X66 M;  4AKH A;  4MGI E;  2YQZ A;  3LVV A;  4XBO A;  5EP3 A;  2YR0 A;  4AG5 A;  2KRK A;  1IBL M;  4B7F A;  4B3M M;  4RF1 A;  1NHW C;  1QAQ A;  3JAM S;  5FTM A;  2UXD M;  3L26 A;  3GRV A;  3PNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...