2AHMA

Crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
77
structure length
77
Chain Sequence
b'PLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab, light chain
publication title Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein, replication
total genus 30
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08716 nsp7 nsp7 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.370 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ahmA00
1YSYA 2AHMA
chains in the Genus database with same CATH superfamily
2CEAA 4MGYE 2D7GA 3E4RA 5EXXA 4DV3M 1ZMVA 4YY3M 3CTWB 2WSFF 4GC9A 5EXPA 3CF2A 2CV0A 3L27A 1OIZA 2WSCF 3TWLA 3U6PA 3T38A 4MGKE 3U61A 1WJ7A 3FRHA 1Z5CA 2Y0QA 1KFVA 4Y28F 2JY7A 4JI3M 2KXEA 4JI5M 1TH4A 3HHWA 3FE3A 1D0KA 1TTEA 3B7ZA 4LFCM 2R6FA 4AQYM 3SMSA 4X62M 4P16A 5KQDA 2D7HA 2H1RA 2K47A 3GLHA 3I04M 1IY2A 2KNVA 4B7HA 2QP9X 4NSRA 3GLIB 4R3DA 2R4JA 3HGIA 2XSZD 2BWEA 4LZZA 4NRWA 3J80S 1IQPA 4IBKA 3GPUA 3AV0A 4CIZA 5KO3A 1ZV1A 1QVRA 2CRUA 4RF1A 5FTMA 2ERCA 5H37D 3U6LA 3THGA 2HL7A 4XBOA 4Q7JA 4JI1M 5F3WA 3AKZA 4LJ4A 4G4QA 2V1CA 1YSYA 2ZTDA 4M9XA 3FTDA 2AHMA 3J81S 3LQQA 1P3QQ 1Z5BA 2CHQA 2LVOC 3LCVB 3SMPA 4DV0M 3B7QA 5FSWA 4OW0A 3CF0A 4BLCA 4NRVA 1EIJA 3IECA 2V6ZM 3JR5A 2ZM6M 2K6BA 1R2YA 3U6SA 3VKGA 4HEOA 4ZPXA 4IBFA 1QAMA 2R62A 2X49A 1NJFA 3FUWA 3NBXX 4WURA 4B7GA 3GLFE 2DWZB 2QPAA 5L8RF 3JR4A 1CUKA 5ITQA 1G59A 1WIVA 1HR0M 2UU9M 1MN3A 3KS4A 3GLIE 4B3TM 3FYCA 2ZANA 3IG8A 2UXDM 3FD9A 2RGOA 3VLFB 2EA0A 2Z4SA 4FWGA 4GH9A 2CE7A 4I4LA 4LF6M 1KYIA 4KT0F 5FTNA 4JXJA 4M0WA 2DZLA 4DBGB 2UXCM 4FWHA 1QDRA 2DAEA 5ITXA 1WXQA 4AKHA 2XH9A 4LZJA 2EO2A 2JP7A 1T6OA 1L1ZA 2X8AA 1WR1B 4LY6A 3T15A 3HU2A 1K3WA 2L2DA 2L09A 3C58A 4FCTA 2L4FA 3GLGB 3EIHA 4II7A 3GPXA 3RE8A 3SATA 4NC6A 2GNOA 1L8QA 1R7RA 1WHCA 3FTEA 4AW4A 1N78A 1VEJA 1UFZA 1OJLA 2R44A 2FFJA 2ZAMA 4IBEA 2I7NA 2EUCA 2Q2EB 4OVZB 4YHHM 2C5RA 3VKHA 3A42A 1MJGM 3GLHE 4L15A 3PFIA 3WHLA 2UXBM 1NHGC 1WGNA 3K1JA 1HQCA 3E9SA 3OTOM 3U6DA 4G3OA 4LJ9A 3SC3A 5EQTA 5E26A 1DGHA 1K82A 1VEKA 1EFUB 3TL4X 3BXWA 2QBYA 4MGZE 5C18A 4K0KM 3HJ8A 3SAUA 2JNHA 2C96A 2LBCA 2BJVA 3M7GA 7CATA 2Z3XA 2JUJA 4PDIA 2F5SA 4D82A 4DUZM 5LMUM 3UGJA 1NNJA 4P17A 2XZUA 3GQ4A 3HWSA 2Z4RA 1FJGM 2OOAA 4G4OA 2Y0TA 2JY8A 1YE9A 2JY6B 1KSFX 1V33A 2HAKA 3CF6E 5DNYA 2DAMA 2DHYA 4IJFA 4JI0M 4PDGA 3FUVA 3FTFA 2DAIA 3GLGE 2KZSA 1NO1A 3SYLA 2N35A 4I5SA 5JI2E 3ILKA 1TH3A 5LMNM 3VFDA 1W5SA 1XXHA 2L6OA 3F92A 3T6PA 3SBJA 3R8FA 3KDSE 2UUAM 4LG2A 1G4AE 4MGHA 2MR9A 4JI8M 3KP1E 4QHSA 4FVMA 1Q39A 4B3MM 3L29A 3AJIB 1N32M 1QZEA 2QNJA 4R71A 1XMQM 2HHHM 3HY5A 1N33M 3U6CA 1JQJC 4LJ8A 2KRUA 2D7EA 3SFZA 3FRIA 3U6MA 3FTCA 1G8PA 1ZAEA 2KNZA 1PRBA 2K0BX 1GABA 1IXSA 1DGGA 4X66M 3DFZA 1IXRC 4DV6M 2R65A 4FCVA 2M60A 1TH2A 4JI7M 2C98A 1UM8A 1N36M 1SXJC 2C99A 3HU3A 1NVMA 2APLA 2ZTCA 4AZFA 4IBDA 4CISA 1S3SA 4AG6A 2V1UA 3K92A 1IBKM 4L8RC 4FWDA 3GLFB 4G4RA 4JI6M 1OIPA 4QOSA 2LNHC 1Y8GA 3EIEA 3B89A 1MU5A 2LXEA 3FYDA 3K8ZA 3QYBA 4M9SA 4XK8F 2KNAA 5IWAM 3SAWA 2UUCM 2YNMD 3NBIA 2DZOB 4KO8A 3VK8A 2QENA 4LF4M 3W0FA 1F4IA 1Q3BA 3KS8A 2EKKA 1PM5A 3H4JA 2DZNB 3IHPA 3CGWA 5EP1A 2XGNA 1K3XA 4DUYM 4JN6A 1L1TA 2DWMA 2R18A 3ZCBB 1IXZA 3FUXA 3U61B 1VEGA 3KXEC 4LRTA 1DO2A 3LCUA 4GRIA 3TWKA 3UMMA 4LF7M 1R4GA 2YQZA 1L2DA 4PT5A 2CV2A 1BVSA 1OTRA 2FNAA 2XFTA 4MH0E 2QZ4A 3V76A 3W0LB 4D80A 4JI4M 2J7OA 2OO9A 2R46A 3M6AA 2LVQD 3GLHB 3KSXA 3PNYA 4AG5A 4RNAA 4L4UA 1XXHE 1JB0F 5EP2A 1ORYB 4AI6A 3SARA 2DWNA 1NHWC 2XSZA 2M5ZA 1RU3A 3AFHA 3K2LA 1L2BA 2E5LM 4JYAM 3SYKA 2JZ1A 3C3EA 5EP3A 1QAOA 3GRUA 4W5WA 1TGUA 1VDDA 4I81A 3E21A 1IN8A 2MROB 2JXNA 3PNVA 3SHFA 1JR3E 3GP1A 3GQ3A 4OX9M 3U60A 4JI2M 2Z7JA 5E6JA 5DYIA 3VDPA 2F5PA 4IBGA 2O25A 5KPTA 4DV1M 1XHBA 2YR0A 1GJSA 2KA6B 4LGYA 2OOBA 3IG5A 1D0LA 3L2AA 2KW0A 4M9ZA 1SXJA 2P5TA 2RGHA 5EJCA 3GPPA 4R7GA 3KOXE 2MH8A 3HHYA 2UUBM 4LF5M 3TE6A 4I8OA 2RKOA 2ZAOA 4CHTB 4IIWA 4IBCA 1TDHA 1TDZA 4DR1M 1Z5AA 1LV7A 2FH0A 2VQEM 4NOOB 4WW0A 4LFAM 1WGLA 4REZA 3R9XB 3ZH9B 1MX0A 1E9SA 5FLXS 3K9PA 3KSJA 3D8BA 4B7FA 3NWLA 3HJQA 3GPYA 4LJ7A 2O01F 1I4WA 4LF8M 2O5RA 3GRRA 5JI3E 2NQ8C 3U6QA 3LQRA 2C9CA 3ZQJA 1D0MA 4CJ6A 4TUWA 1OQYA 3J2PB 4DV2M 1R6BX 3VK7A 4AKGA 2FOIC 1HT2E 4LJ6A 4D81A 1XC8A 1Q02A 4L16A 3GRYA 2G8LA 2F5QA 1SG9A 2DENA 2C9OA 3U5ZA 3FUTA 2F5NA 1PJTA 1NSFA 5A2QS 1IN6A 3GO8A 2X4AA 1IBMM 1QUTA 2VDBB 2QSFX 3K9OA 4RKUF 1YUBA 1VQ1A 2RRUA 2I7PA 3JAMS 1R2ZA 2LVNC 1E94E 1GL6A 1NV8A 2KEBA 2OPFA 1R5LA 1DGHB 3QAUA 1JR3D 3PXGA 3LMMA 4KHPM 2KZUA 3LVVA 2QBYB 4X64M 1AUAA 1PJQA 3I4VA 4L6V6 4Z6YA 2F4VM 2LWXA 1G3IA 4FCWA 2HKJA 4IBBA 2DAKA 5ITYA 3TPZA 5KQ8A 3BOSA 1PJIA 2DXIA 2VF7A 4GKKM 3DZDA 4AKIA 2KRKA 1TF0B 4GC5A 2CUZA 1DO0A 1HNXM 5ITXE 4DR6M 4QNRA 2QHOB 4M0DA 1QQWA 4NXMM 1SXJE 4PCZA 5KPRA 2DVWB 3C9PA 3MHVC 1ZMUA 4F2LA 5DFLA 4RF0A 4IJEA 2W82A 1XXHB 4KODA 5DYGA 4MGIE 5KPZA 2OQ4A 1OAOC 4DR3M 2BWBA 2HCBA 2Y21A 3GLIA 3U6OA 1J09A 3I51A 2VQFM 3ZC7B 2KDLA 1IN4A 4B3SM 1H6UA 3MJ5A 5BPVA 1C1KA 2EKFA 4IBIA 1IBLM 3HZJA 4GHAA 1G41A 3QYEA 5ITRA 1GO5A 3B9PA 4HL4A 2VF8A 1GJTA 4FD2A 3SHGB 4JV5M 1QYRA 1PGYA 2WSEF 4IBJA 4MB7A 4L78A 3RGPA 1IXSB 5IREB 5FTLA 3T1YM 4GKJM 2J5YA 3KP0E 5IZ7D 1N77A 1ZQ9A 1IFYA 2QQ8A 3RFWA 1OKSA 3QWLA 3UK6A 1D2NA 2L7HA 5EXTA 3A45A 4QNMA 1N34M 4EIWA 1VG5A 2XFSA 1L2CA 1QANA 2G5GX 1OFIA 4NSOB 5GKNA 1XNRM 1HQYE 2LHCA 3HHXA 2ZBKB 1NNUC 3VDUA 4CGYB 4S12A 1W5TA 4Z8XA 4BBAA 2MGWA 4UN2B 2WZJA 3M0EA 2DAGA 3HKPA 3J7AS 3FKEA 3RGSA 4LRSA 5EP4A 4X65M 2QCUA 3GRVA 3B7NA 1Q3CA 2LTUA 2CFOA 1GKIA 3Q8GA 2Z8YM 2G3QA 1SXJD 3J27B 2GQFA 3A46A 1Z59A 2JZ0A 8CATA 1N75A 1V92A 5IT9S 2DKLA 3FUUA 3B74A 4GIPA 4GHLA 4B08A 1XWIA 3GLGA 3HX3A 2XF3A 2R0IA 2L7IA 3AOEC 5FTJA 3KW6A 1Z6TA 2B3TA 2LH0A 3WHKA 2CV1A 4DR7M 1YLAA 3L25A 1E9RA 2EJSA 3Q8XA 4OVZA 1QZMA 3KVWA 2DWLA 1T3TA 3DA1A 2CP8A 4HLQA 2CHGA 2F5OA 2LVPC 1HNZM 1GLNA 3MK6A 3PVSA 1NY6A 3L26A 4DR2M 1AIPC 1T43A 1XNQM 2K9DA 1NJGA 5EXSA 2KHHA 1DGFA 3U60B 3C3DA 4ANRA 3H4MA 4PD2A 2DNAA 4NXNM 4F1IA 5C1BA 4LJ5A 1IY0A 3LVWA 3UJNA 3AL0C 3HU1A 4DV7M 1SXJB 3HJSA 3TQSA 5BR8M 3U6EA 2R45A 4GMQA 4LGMA 5ITTA 4LFBM 1OFHA 2XZFA 3I01M 3D8LA 1X37A 4G6ZA 3KFUG 4KLNA 4G4NA 1I94M 1IY1A 3A98B 3J7BA 2JY5A 3AOGA 2CWBA 2FS1A 2JWSA 1FNNA 2XEPA 1DV0A 2LVAA 3GQ5A 3I4YA 2CHVA 2MJ5B 4WP2A 2VIIA 3TWMA 1J7KA 3DOAA 1IM2A 4GITA 2A5YB 1OAIA 1DGBA 2H5XA 3W67A 1QAQA 2JA2A 3KOWE 1TR8A 2DI0A 4XGIA 2HWJA 4NL4H 1NY5A 3SASA 1V34A 1E32A 1VDLA 2J7NA 1IN7A 3E46A 4QHTA 1XMOM 1IN5A 1C7YA 4LCBA 3SAVA 1QUSA 4OU7A 4DV4M 4LF9M 2L4EA 2XLJA 4QOZC 3T1HM 4ITQA 4BB9A 3KOYE 4FW9A 3AOEA 5FTKA 3UZUA 5ITUA 2YFQA 1LTMA 2R4EA 3U5ZB 4DR5M 1ZMWA 1PJJA 1GVNA 1HJPA 3LW5F 3W68A 4DV5M 1XB2B 1G71A 4GEWA 3HHZA 1PJSA 1GL7A 2Y20A 3GLFA 4DR4M 2DHRA 3KOZE 4A3VB 2BNKA 1EE8A 1QDTA 2FE8A 1NV9A 1A5TA 1JR3A 4MM3B 3BBZA 1J5EM 1HNWM 2LHGA 3L28A 4LJAA 1HT1E 4B3RM 2BJWA 3MMPA
chains in the Genus database with same CATH topology
2CEAA 4MGYE 2D7GA 3E4RA 5EXXA 4DV3M 4YY3M 3CTWB 4GC9A 5EXPA 3CF2A 2CV0A 3L27A 3TWLA 3U61A 3U6PA 3T38A 4MGKE 1Z5CA 2Y0QA 1KFVA 4JI3M 2KXEA 4JI5M 1TH4A 3HHWA 4LFCM 4AQYM 3SMSA 4X62M 4P16A 5KQDA 2D7HA 2H1RA 2K47A 3GLHA 4B7HA 1IY2A 2QP9X 4NSRA 3GLIB 4R3DA 2R4JA 3HGIA 2XSZD 4LZZA 4NRWA 3J80S 1IQPA 4IBKA 3GPUA 3AV0A 5KO3A 1QVRA 4RF1A 5FTMA 2ERCA 5H37D 3U6LA 3THGA 2HL7A 4XBOA 4JI1M 5F3WA 3AKZA 4LJ4A 4G4QA 2V1CA 1YSYA 4M9XA 3FTDA 2AHMA 3J81S 3LQQA 3SMPA 1Z5BA 2CHQA 4DV0M 5FSWA 4OW0A 3CF0A 4BLCA 4NRVA 2ZM6M 2V6ZM 3JR5A 1R2YA 3U6SA 3VKGA 4ZPXA 4IBFA 1QAMA 2R62A 2X49A 1NJFA 3FUWA 4WURA 4B7GA 2DWZB 2QPAA 3JR4A 1G59A 5ITQA 1HR0M 2UU9M 3KS4A 4B3TM 3FYCA 2ZANA 3IG8A 2UXDM 3FD9A 2RGOA 3VLFB 2EA0A 2Z4SA 4FWGA 4GH9A 2CE7A 4I4LA 4LF6M 1KYIA 5FTNA 4JXJA 4M0WA 2UXCM 4FWHA 5ITXA 1WXQA 4AKHA 2XH9A 4LZJA 2EO2A 1L1ZA 2X8AA 4LY6A 3T15A 3HU2A 1K3WA 2L09A 3C58A 4FCTA 3GLGB 3EIHA 4II7A 3GPXA 3RE8A 3SATA 1L8QA 1R7RA 3FTEA 4AW4A 1N78A 1OJLA 2FFJA 2ZAMA 4IBEA 2I7NA 2EUCA 2Q2EB 4OVZB 4YHHM 2C5RA 3VKHA 3A42A 4L15A 3PFIA 3WHLA 2UXBM 1NHGC 3K1JA 1HQCA 3E9SA 3OTOM 3U6DA 4LJ9A 3SC3A 5EQTA 5E26A 1DGHA 1K82A 3TL4X 2QBYA 4MGZE 5C18A 4K0KM 3HJ8A 3SAUA 2C96A 2BJVA 3M7GA 7CATA 2Z3XA 4PDIA 2F5SA 4D82A 4DUZM 5LMUM 3UGJA 1NNJA 2XZUA 3GQ4A 3HWSA 2Z4RA 1FJGM 4G4OA 2Y0TA 1YE9A 1KSFX 3CF6E 5DNYA 3FTFA 4IJFA 4JI0M 4PDGA 3FUVA 2KZSA 3SYLA 4I5SA 5JI2E 3ILKA 1TH3A 5LMNM 3VFDA 1W5SA 1XXHA 2L6OA 3SBJA 3R8FA 4LG2A 3KDSE 2UUAM 1G4AE 4MGHA 4JI8M 3KP1E 4QHSA 4FVMA 1Q39A 4B3MM 3L29A 3AJIB 1N32M 1XMQM 2HHHM 1N33M 3U6CA 1JQJC 4LJ8A 2KRUA 2D7EA 3SFZA 3U6MA 3FTCA 1G8PA 1ZAEA 1DGGA 4X66M 3DFZA 1IXRC 4DV6M 2R65A 4FCVA 2M60A 1TH2A 4JI7M 2C98A 1UM8A 1N36M 1SXJC 2C99A 3HU3A 1NVMA 4AZFA 4CISA 4IBDA 1S3SA 4AG6A 2V1UA 3K92A 1IBKM 4L8RC 4FWDA 3GLFB 4G4RA 4JI6M 4QOSA 2LNHC 3EIEA 1MU5A 2LXEA 3FYDA 3K8ZA 4M9SA 5IWAM 3SAWA 2UUCM 2YNMD 3NBIA 2DZOB 4KO8A 3VK8A 2QENA 4LF4M 3W0FA 1Q3BA 3KS8A 1PM5A 2DZNB 5EP1A 2XGNA 1K3XA 4DUYM 4JN6A 1L1TA 2DWMA 2R18A 3ZCBB 1IXZA 3FUXA 3U61B 3KXEC 4LRTA 1DO2A 4GRIA 3TWKA 3UMMA 4LF7M 2YQZA 1L2DA 4PT5A 2CV2A 2FNAA 2XFTA 4MH0E 2QZ4A 4JI4M 3W0LB 4D80A 2J7OA 2R46A 3M6AA 3GLHB 3KSXA 3PNYA 4AG5A 4RNAA 4L4UA 5EP2A 1ORYB 4AI6A 3SARA 2DWNA 1NHWC 2XSZA 2M5ZA 3AFHA 3K2LA 2E5LM 1L2BA 4JYAM 3SYKA 5EP3A 1QAOA 3GRUA 4W5WA 1TGUA 1VDDA 4I81A 1IN8A 3PNVA 3SHFA 3GP1A 3GQ3A 4OX9M 3U60A 4JI2M 2Z7JA 5E6JA 5DYIA 3VDPA 2F5PA 4IBGA 5KPTA 4DV1M 1XHBA 2YR0A 2KA6B 4LGYA 3IG5A 3L2AA 4M9ZA 2KW0A 1SXJA 2P5TA 2RGHA 5EJCA 3GPPA 4R7GA 3KOXE 2UUBM 3HHYA 4LF5M 3TE6A 4I8OA 2RKOA 2ZAOA 4CHTB 4IIWA 4IBCA 1TDHA 1TDZA 4DR1M 1Z5AA 1LV7A 2VQEM 4NOOB 4WW0A 4LFAM 3R9XB 4REZA 3ZH9B 1MX0A 1E9SA 5FLXS 3KSJA 3D8BA 4B7FA 3NWLA 3HJQA 3GPYA 4LJ7A 1I4WA 4LF8M 2O5RA 3GRRA 5JI3E 2NQ8C 3U6QA 3LQRA 2C9CA 4TUWA 3J2PB 4DV2M 1R6BX 3VK7A 4AKGA 2FOIC 1HT2E 4LJ6A 4D81A 1XC8A 4L16A 3GRYA 2G8LA 2F5QA 2C9OA 3U5ZA 3FUTA 2F5NA 1NSFA 5A2QS 1IN6A 3GO8A 2X4AA 1IBMM 3JAMS 1R2ZA 1YUBA 2I7PA 1E94E 1GL6A 2KEBA 2OPFA 3PXGA 1DGHB 3QAUA 1JR3D 3LMMA 4KHPM 2KZUA 3LVVA 2QBYB 4X64M 3I4VA 4Z6YA 2F4VM 2LWXA 1G3IA 4FCWA 2HKJA 4IBBA 5ITYA 3TPZA 5KQ8A 3BOSA 1PJIA 2DXIA 4GKKM 3DZDA 4AKIA 2KRKA 4GC5A 2CUZA 1DO0A 1HNXM 5ITXE 4DR6M 4QNRA 4M0DA 1QQWA 4NXMM 1SXJE 4PCZA 5KPRA 2DVWB 3MHVC 4RF0A 4IJEA 2W82A 1XXHB 4KODA 5DYGA 4MGIE 5KPZA 2OQ4A 4DR3M 2HCBA 2Y21A 3GLIA 3U6OA 1J09A 3I51A 2VQFM 3ZC7B 1IN4A 4B3SM 1H6UA 3MJ5A 5BPVA 1C1KA 4IBIA 1IBLM 4GHAA 1G41A 5ITRA 3B9PA 4HL4A 4JV5M 4FD2A 3SHGB 1QYRA 4L78A 4IBJA 4MB7A 3RGPA 1IXSB 5IREB 5FTLA 3T1YM 4GKJM 3KP0E 5IZ7D 1N77A 1ZQ9A 3RFWA 3QWLA 3UK6A 1D2NA 2L7HA 5EXTA 3A45A 4QNMA 1N34M 4EIWA 2XFSA 1L2CA 1QANA 2G5GX 1OFIA 4NSOB 5GKNA 1XNRM 1HQYE 3HHXA 2ZBKB 1NNUC 3VDUA 4CGYB 4S12A 1W5TA 4Z8XA 4BBAA 3M0EA 3HKPA 3J7AS 3FKEA 3RGSA 4LRSA 5EP4A 4X65M 2QCUA 3GRVA 1Q3CA 2CFOA 1GKIA 1SXJD 3J27B 3A46A 1Z59A 8CATA 1N75A 3FUUA 4GIPA 4GHLA 4B08A 1XWIA 3GLGA 2XF3A 2L7IA 3AOEC 5FTJA 3KW6A 1Z6TA 2LH0A 3WHKA 2CV1A 4DR7M 3L25A 1E9RA 3Q8XA 4OVZA 1QZMA 3KVWA 2DWLA 1T3TA 3DA1A 4HLQA 2CHGA 2F5OA 1HNZM 1GLNA 3MK6A 3PVSA 1NY6A 3L26A 4DR2M 1XNQM 1NJGA 5EXSA 1DGFA 3U60B 3H4MA 4PD2A 4NXNM 5C1BA 4LJ5A 1IY0A 3LVWA 3UJNA 3AL0C 3HU1A 4DV7M 1SXJB 3HJSA 3TQSA 5BR8M 3U6EA 2R45A 4GMQA 4LGMA 5ITTA 4LFBM 1OFHA 2XZFA 3D8LA 1X37A 4G6ZA 3KFUG 4KLNA 4G4NA 1I94M 1IY1A 3A98B 3J7BA 3AOGA 1FNNA 2XEPA 3GQ5A 3I4YA 2CHVA 2VIIA 3TWMA 1J7KA 3DOAA 1IM2A 4GITA 2A5YB 1DGBA 1QAQA 2JA2A 3KOWE 4XGIA 4NL4H 1NY5A 3SASA 1E32A 2J7NA 4QHTA 1IN7A 1XMOM 1IN5A 4LCBA 3SAVA 4OU7A 4DV4M 4LF9M 2XLJA 4QOZC 3T1HM 4ITQA 4BB9A 3KOYE 4FW9A 3AOEA 5FTKA 3UZUA 5ITUA 2YFQA 2R4EA 3U5ZB 4DR5M 1PJJA 1GVNA 4DV5M 3HHZA 1GL7A 2Y20A 3GLFA 4DR4M 2DHRA 3KOZE 4A3VB 2BNKA 1EE8A 2FE8A 1JR3A 4MM3B 1J5EM 1HNWM 3L28A 4LJAA 4B3RM 1HT1E 5IT9S 2BJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSY A;  2AHM A; 
#chains in the Genus database with same CATH topology
 2CEA A;  4MGY E;  2D7G A;  3E4R A;  5EXX A;  4DV3 M;  1ZMV A;  4YY3 M;  3CTW B;  2WSF F;  4GC9 A;  5EXP A;  3CF2 A;  2CV0 A;  3L27 A;  1OIZ A;  2WSC F;  3TWL A;  3U6P A;  3T38 A;  4MGK E;  3U61 A;  1WJ7 A;  3FRH A;  1Z5C A;  2Y0Q A;  1KFV A;  4Y28 F;  2JY7 A;  4JI3 M;  2KXE A;  4JI5 M;  1TH4 A;  3HHW A;  3FE3 A;  1D0K A;  1TTE A;  3B7Z A;  4LFC M;  2R6F A;  4AQY M;  3SMS A;  4X62 M;  4P16 A;  5KQD A;  2D7H A;  2H1R A;  2K47 A;  3GLH A;  3I04 M;  1IY2 A;  2KNV A;  4B7H A;  2QP9 X;  4NSR A;  3GLI B;  4R3D A;  2R4J A;  3HGI A;  2XSZ D;  2BWE A;  4LZZ A;  4NRW A;  3J80 S;  1IQP A;  4IBK A;  3GPU A;  3AV0 A;  4CIZ A;  5KO3 A;  1ZV1 A;  1QVR A;  2CRU A;  4RF1 A;  5FTM A;  2ERC A;  5H37 D;  3U6L A;  3THG A;  2HL7 A;  4XBO A;  4Q7J A;  4JI1 M;  5F3W A;  3AKZ A;  4LJ4 A;  4G4Q A;  2V1C A;  1YSY A;  2ZTD A;  4M9X A;  3FTD A;  2AHM A;  3J81 S;  3LQQ A;  1P3Q Q;  1Z5B A;  2CHQ A;  2LVO C;  3LCV B;  3SMP A;  4DV0 M;  3B7Q A;  5FSW A;  4OW0 A;  3CF0 A;  4BLC A;  4NRV A;  1EIJ A;  3IEC A;  2V6Z M;  3JR5 A;  2ZM6 M;  2K6B A;  1R2Y A;  3U6S A;  3VKG A;  4HEO A;  4ZPX A;  4IBF A;  1QAM A;  2R62 A;  2X49 A;  1NJF A;  3FUW A;  3NBX X;  4WUR A;  4B7G A;  3GLF E;  2DWZ B;  2QPA A;  5L8R F;  3JR4 A;  1CUK A;  5ITQ A;  1G59 A;  1WIV A;  1HR0 M;  2UU9 M;  1MN3 A;  3KS4 A;  3GLI E;  4B3T M;  3FYC A;  2ZAN A;  3IG8 A;  2UXD M;  3FD9 A;  2RGO A;  3VLF B;  2EA0 A;  2Z4S A;  4FWG A;  4GH9 A;  2CE7 A;  4I4L A;  4LF6 M;  1KYI A;  4KT0 F;  5FTN A;  4JXJ A;  4M0W A;  2DZL A;  4DBG B;  2UXC M;  4FWH A;  1QDR A;  2DAE A;  5ITX A;  1WXQ A;  4AKH A;  2XH9 A;  4LZJ A;  2EO2 A;  2JP7 A;  1T6O A;  1L1Z A;  2X8A A;  1WR1 B;  4LY6 A;  3T15 A;  3HU2 A;  1K3W A;  2L2D A;  2L09 A;  3C58 A;  4FCT A;  2L4F A;  3GLG B;  3EIH A;  4II7 A;  3GPX A;  3RE8 A;  3SAT A;  4NC6 A;  2GNO A;  1L8Q A;  1R7R A;  1WHC A;  3FTE A;  4AW4 A;  1N78 A;  1VEJ A;  1UFZ A;  1OJL A;  2R44 A;  2FFJ A;  2ZAM A;  4IBE A;  2I7N A;  2EUC A;  2Q2E B;  4OVZ B;  4YHH M;  2C5R A;  3VKH A;  3A42 A;  1MJG M;  3GLH E;  4L15 A;  3PFI A;  3WHL A;  2UXB M;  1NHG C;  1WGN A;  3K1J A;  1HQC A;  3E9S A;  3OTO M;  3U6D A;  4G3O A;  4LJ9 A;  3SC3 A;  5EQT A;  5E26 A;  1DGH A;  1K82 A;  1VEK A;  1EFU B;  3TL4 X;  3BXW A;  2QBY A;  4MGZ E;  5C18 A;  4K0K M;  3HJ8 A;  3SAU A;  2JNH A;  2C96 A;  2LBC A;  2BJV A;  3M7G A;  7CAT A;  2Z3X A;  2JUJ A;  4PDI A;  2F5S A;  4D82 A;  4DUZ M;  5LMU M;  3UGJ A;  1NNJ A;  4P17 A;  2XZU A;  3GQ4 A;  3HWS A;  2Z4R A;  1FJG M;  2OOA A;  4G4O A;  2Y0T A;  2JY8 A;  1YE9 A;  2JY6 B;  1KSF X;  1V33 A;  2HAK A;  3CF6 E;  5DNY A;  2DAM A;  2DHY A;  4IJF A;  4JI0 M;  4PDG A;  3FUV A;  3FTF A;  2DAI A;  3GLG E;  2KZS A;  1NO1 A;  3SYL A;  2N35 A;  4I5S A;  5JI2 E;  3ILK A;  1TH3 A;  5LMN M;  3VFD A;  1W5S A;  1XXH A;  2L6O A;  3F92 A;  3T6P A;  3SBJ A;  3R8F A;  3KDS E;  2UUA M;  4LG2 A;  1G4A E;  4MGH A;  2MR9 A;  4JI8 M;  3KP1 E;  4QHS A;  4FVM A;  1Q39 A;  4B3M M;  3L29 A;  3AJI B;  1N32 M;  1QZE A;  2QNJ A;  4R71 A;  1XMQ M;  2HHH M;  3HY5 A;  1N33 M;  3U6C A;  1JQJ C;  4LJ8 A;  2KRU A;  2D7E A;  3SFZ A;  3FRI A;  3U6M A;  3FTC A;  1G8P A;  1ZAE A;  2KNZ A;  1PRB A;  2K0B X;  1GAB A;  1IXS A;  1DGG A;  4X66 M;  3DFZ A;  1IXR C;  4DV6 M;  2R65 A;  4FCV A;  2M60 A;  1TH2 A;  4JI7 M;  2C98 A;  1UM8 A;  1N36 M;  1SXJ C;  2C99 A;  3HU3 A;  1NVM A;  2APL A;  2ZTC A;  4AZF A;  4IBD A;  4CIS A;  1S3S A;  4AG6 A;  2V1U A;  3K92 A;  1IBK M;  4L8R C;  4FWD A;  3GLF B;  4G4R A;  4JI6 M;  1OIP A;  4QOS A;  2LNH C;  1Y8G A;  3EIE A;  3B89 A;  1MU5 A;  2LXE A;  3FYD A;  3K8Z A;  3QYB A;  4M9S A;  4XK8 F;  2KNA A;  5IWA M;  3SAW A;  2UUC M;  2YNM D;  3NBI A;  2DZO B;  4KO8 A;  3VK8 A;  2QEN A;  4LF4 M;  3W0F A;  1F4I A;  1Q3B A;  3KS8 A;  2EKK A;  1PM5 A;  3H4J A;  2DZN B;  3IHP A;  3CGW A;  5EP1 A;  2XGN A;  1K3X A;  4DUY M;  4JN6 A;  1L1T A;  2DWM A;  2R18 A;  3ZCB B;  1IXZ A;  3FUX A;  3U61 B;  1VEG A;  3KXE C;  4LRT A;  1DO2 A;  3LCU A;  4GRI A;  3TWK A;  3UMM A;  4LF7 M;  1R4G A;  2YQZ A;  1L2D A;  4PT5 A;  2CV2 A;  1BVS A;  1OTR A;  2FNA A;  2XFT A;  4MH0 E;  2QZ4 A;  3V76 A;  3W0L B;  4D80 A;  4JI4 M;  2J7O A;  2OO9 A;  2R46 A;  3M6A A;  2LVQ D;  3GLH B;  3KSX A;  3PNY A;  4AG5 A;  4RNA A;  4L4U A;  1XXH E;  1JB0 F;  5EP2 A;  1ORY B;  4AI6 A;  3SAR A;  2DWN A;  1NHW C;  2XSZ A;  2M5Z A;  1RU3 A;  3AFH A;  3K2L A;  1L2B A;  2E5L M;  4JYA M;  3SYK A;  2JZ1 A;  3C3E A;  5EP3 A;  1QAO A;  3GRU A;  4W5W A;  1TGU A;  1VDD A;  4I81 A;  3E21 A;  1IN8 A;  2MRO B;  2JXN A;  3PNV A;  3SHF A;  1JR3 E;  3GP1 A;  3GQ3 A;  4OX9 M;  3U60 A;  4JI2 M;  2Z7J A;  5E6J A;  5DYI A;  3VDP A;  2F5P A;  4IBG A;  2O25 A;  5KPT A;  4DV1 M;  1XHB A;  2YR0 A;  1GJS A;  2KA6 B;  4LGY A;  2OOB A;  3IG5 A;  1D0L A;  3L2A A;  2KW0 A;  4M9Z A;  1SXJ A;  2P5T A;  2RGH A;  5EJC A;  3GPP A;  4R7G A;  3KOX E;  2MH8 A;  3HHY A;  2UUB M;  4LF5 M;  3TE6 A;  4I8O A;  2RKO A;  2ZAO A;  4CHT B;  4IIW A;  4IBC A;  1TDH A;  1TDZ A;  4DR1 M;  1Z5A A;  1LV7 A;  2FH0 A;  2VQE M;  4NOO B;  4WW0 A;  4LFA M;  1WGL A;  4REZ A;  3R9X B;  3ZH9 B;  1MX0 A;  1E9S A;  5FLX S;  3K9P A;  3KSJ A;  3D8B A;  4B7F A;  3NWL A;  3HJQ A;  3GPY A;  4LJ7 A;  2O01 F;  1I4W A;  4LF8 M;  2O5R A;  3GRR A;  5JI3 E;  2NQ8 C;  3U6Q A;  3LQR A;  2C9C A;  3ZQJ A;  1D0M A;  4CJ6 A;  4TUW A;  1OQY A;  3J2P B;  4DV2 M;  1R6B X;  3VK7 A;  4AKG A;  2FOI C;  1HT2 E;  4LJ6 A;  4D81 A;  1XC8 A;  1Q02 A;  4L16 A;  3GRY A;  2G8L A;  2F5Q A;  1SG9 A;  2DEN A;  2C9O A;  3U5Z A;  3FUT A;  2F5N A;  1PJT A;  1NSF A;  5A2Q S;  1IN6 A;  3GO8 A;  2X4A A;  1IBM M;  1QUT A;  2VDB B;  2QSF X;  3K9O A;  4RKU F;  1YUB A;  1VQ1 A;  2RRU A;  2I7P A;  3JAM S;  1R2Z A;  2LVN C;  1E94 E;  1GL6 A;  1NV8 A;  2KEB A;  2OPF A;  1R5L A;  1DGH B;  3QAU A;  1JR3 D;  3PXG A;  3LMM A;  4KHP M;  2KZU A;  3LVV A;  2QBY B;  4X64 M;  1AUA A;  1PJQ A;  3I4V A;  4L6V 6;  4Z6Y A;  2F4V M;  2LWX A;  1G3I A;  4FCW A;  2HKJ A;  4IBB A;  2DAK A;  5ITY A;  3TPZ A;  5KQ8 A;  3BOS A;  1PJI A;  2DXI A;  2VF7 A;  4GKK M;  3DZD A;  4AKI A;  2KRK A;  1TF0 B;  4GC5 A;  2CUZ A;  1DO0 A;  1HNX M;  5ITX E;  4DR6 M;  4QNR A;  2QHO B;  4M0D A;  1QQW A;  4NXM M;  1SXJ E;  4PCZ A;  5KPR A;  2DVW B;  3C9P A;  3MHV C;  1ZMU A;  4F2L A;  5DFL A;  4RF0 A;  4IJE A;  2W82 A;  1XXH B;  4KOD A;  5DYG A;  4MGI E;  5KPZ A;  2OQ4 A;  1OAO C;  4DR3 M;  2BWB A;  2HCB A;  2Y21 A;  3GLI A;  3U6O A;  1J09 A;  3I51 A;  2VQF M;  3ZC7 B;  2KDL A;  1IN4 A;  4B3S M;  1H6U A;  3MJ5 A;  5BPV A;  1C1K A;  2EKF A;  4IBI A;  1IBL M;  3HZJ A;  4GHA A;  1G41 A;  3QYE A;  5ITR A;  1GO5 A;  3B9P A;  4HL4 A;  2VF8 A;  1GJT A;  4FD2 A;  3SHG B;  4JV5 M;  1QYR A;  1PGY A;  2WSE F;  4IBJ A;  4MB7 A;  4L78 A;  3RGP A;  1IXS B;  5IRE B;  5FTL A;  3T1Y M;  4GKJ M;  2J5Y A;  3KP0 E;  5IZ7 D;  1N77 A;  1ZQ9 A;  1IFY A;  2QQ8 A;  3RFW A;  1OKS A;  3QWL A;  3UK6 A;  1D2N A;  2L7H A;  5EXT A;  3A45 A;  4QNM A;  1N34 M;  4EIW A;  1VG5 A;  2XFS A;  1L2C A;  1QAN A;  2G5G X;  1OFI A;  4NSO B;  5GKN A;  1XNR M;  1HQY E;  2LHC A;  3HHX A;  2ZBK B;  1NNU C;  3VDU A;  4CGY B;  4S12 A;  1W5T A;  4Z8X A;  4BBA A;  2MGW A;  4UN2 B;  2WZJ A;  3M0E A;  2DAG A;  3HKP A;  3J7A S;  3FKE A;  3RGS A;  4LRS A;  5EP4 A;  4X65 M;  2QCU A;  3GRV A;  3B7N A;  1Q3C A;  2LTU A;  2CFO A;  1GKI A;  3Q8G A;  2Z8Y M;  2G3Q A;  1SXJ D;  3J27 B;  2GQF A;  3A46 A;  1Z59 A;  2JZ0 A;  8CAT A;  1N75 A;  1V92 A;  5IT9 S;  2DKL A;  3FUU A;  3B74 A;  4GIP A;  4GHL A;  4B08 A;  1XWI A;  3GLG A;  3HX3 A;  2XF3 A;  2R0I A;  2L7I A;  3AOE C;  5FTJ A;  3KW6 A;  1Z6T A;  2B3T A;  2LH0 A;  3WHK A;  2CV1 A;  4DR7 M;  1YLA A;  3L25 A;  1E9R A;  2EJS A;  3Q8X A;  4OVZ A;  1QZM A;  3KVW A;  2DWL A;  1T3T A;  3DA1 A;  2CP8 A;  4HLQ A;  2CHG A;  2F5O A;  2LVP C;  1HNZ M;  1GLN A;  3MK6 A;  3PVS A;  1NY6 A;  3L26 A;  4DR2 M;  1AIP C;  1T43 A;  1XNQ M;  2K9D A;  1NJG A;  5EXS A;  2KHH A;  1DGF A;  3U60 B;  3C3D A;  4ANR A;  3H4M A;  4PD2 A;  2DNA A;  4NXN M;  4F1I A;  5C1B A;  4LJ5 A;  1IY0 A;  3LVW A;  3UJN A;  3AL0 C;  3HU1 A;  4DV7 M;  1SXJ B;  3HJS A;  3TQS A;  5BR8 M;  3U6E A;  2R45 A;  4GMQ A;  4LGM A;  5ITT A;  4LFB M;  1OFH A;  2XZF A;  3I01 M;  3D8L A;  1X37 A;  4G6Z A;  3KFU G;  4KLN A;  4G4N A;  1I94 M;  1IY1 A;  3A98 B;  3J7B A;  2JY5 A;  3AOG A;  2CWB A;  2FS1 A;  2JWS A;  1FNN A;  2XEP A;  1DV0 A;  2LVA A;  3GQ5 A;  3I4Y A;  2CHV A;  2MJ5 B;  4WP2 A;  2VII A;  3TWM A;  1J7K A;  3DOA A;  1IM2 A;  4GIT A;  2A5Y B;  1OAI A;  1DGB A;  2H5X A;  3W67 A;  1QAQ A;  2JA2 A;  3KOW E;  1TR8 A;  2DI0 A;  4XGI A;  2HWJ A;  4NL4 H;  1NY5 A;  3SAS A;  1V34 A;  1E32 A;  1VDL A;  2J7N A;  1IN7 A;  3E46 A;  4QHT A;  1XMO M;  1IN5 A;  1C7Y A;  4LCB A;  3SAV A;  1QUS A;  4OU7 A;  4DV4 M;  4LF9 M;  2L4E A;  2XLJ A;  4QOZ C;  3T1H M;  4ITQ A;  4BB9 A;  3KOY E;  4FW9 A;  3AOE A;  5FTK A;  3UZU A;  5ITU A;  2YFQ A;  1LTM A;  2R4E A;  3U5Z B;  4DR5 M;  1ZMW A;  1PJJ A;  1GVN A;  1HJP A;  3LW5 F;  3W68 A;  4DV5 M;  1XB2 B;  1G71 A;  4GEW A;  3HHZ A;  1PJS A;  1GL7 A;  2Y20 A;  3GLF A;  4DR4 M;  2DHR A;  3KOZ E;  4A3V B;  2BNK A;  1EE8 A;  1QDT A;  2FE8 A;  1NV9 A;  1A5T A;  1JR3 A;  4MM3 B;  3BBZ A;  1J5E M;  1HNW M;  2LHG A;  3L28 A;  4LJA A;  1HT1 E;  4B3R M;  2BJW A;  3MMP A; 
#chains in the Genus database with same CATH homology
 2CEA A;  4MGY E;  2D7G A;  3E4R A;  5EXX A;  4DV3 M;  4YY3 M;  3CTW B;  4GC9 A;  5EXP A;  3CF2 A;  2CV0 A;  3L27 A;  3TWL A;  3U61 A;  3U6P A;  3T38 A;  4MGK E;  1Z5C A;  2Y0Q A;  1KFV A;  4JI3 M;  2KXE A;  4JI5 M;  1TH4 A;  3HHW A;  4LFC M;  4AQY M;  3SMS A;  4X62 M;  4P16 A;  5KQD A;  2D7H A;  2H1R A;  2K47 A;  3GLH A;  4B7H A;  1IY2 A;  2QP9 X;  4NSR A;  3GLI B;  4R3D A;  2R4J A;  3HGI A;  2XSZ D;  4LZZ A;  4NRW A;  3J80 S;  1IQP A;  4IBK A;  3GPU A;  3AV0 A;  5KO3 A;  1QVR A;  4RF1 A;  5FTM A;  2ERC A;  5H37 D;  3U6L A;  3THG A;  2HL7 A;  4XBO A;  4JI1 M;  5F3W A;  3AKZ A;  4LJ4 A;  4G4Q A;  2V1C A;  1YSY A;  4M9X A;  3FTD A;  2AHM A;  3J81 S;  3LQQ A;  3SMP A;  1Z5B A;  2CHQ A;  4DV0 M;  5FSW A;  4OW0 A;  3CF0 A;  4BLC A;  4NRV A;  2ZM6 M;  2V6Z M;  3JR5 A;  1R2Y A;  3U6S A;  3VKG A;  4ZPX A;  4IBF A;  1QAM A;  2R62 A;  2X49 A;  1NJF A;  3FUW A;  4WUR A;  4B7G A;  2DWZ B;  2QPA A;  3JR4 A;  1G59 A;  5ITQ A;  1HR0 M;  2UU9 M;  3KS4 A;  4B3T M;  3FYC A;  2ZAN A;  3IG8 A;  2UXD M;  3FD9 A;  2RGO A;  3VLF B;  2EA0 A;  2Z4S A;  4FWG A;  4GH9 A;  2CE7 A;  4I4L A;  4LF6 M;  1KYI A;  5FTN A;  4JXJ A;  4M0W A;  2UXC M;  4FWH A;  5ITX A;  1WXQ A;  4AKH A;  2XH9 A;  4LZJ A;  2EO2 A;  1L1Z A;  2X8A A;  4LY6 A;  3T15 A;  3HU2 A;  1K3W A;  2L09 A;  3C58 A;  4FCT A;  3GLG B;  3EIH A;  4II7 A;  3GPX A;  3RE8 A;  3SAT A;  1L8Q A;  1R7R A;  3FTE A;  4AW4 A;  1N78 A;  1OJL A;  2FFJ A;  2ZAM A;  4IBE A;  2I7N A;  2EUC A;  2Q2E B;  4OVZ B;  4YHH M;  2C5R A;  3VKH A;  3A42 A;  4L15 A;  3PFI A;  3WHL A;  2UXB M;  1NHG C;  3K1J A;  1HQC A;  3E9S A;  3OTO M;  3U6D A;  4LJ9 A;  3SC3 A;  5EQT A;  5E26 A;  1DGH A;  1K82 A;  3TL4 X;  2QBY A;  4MGZ E;  5C18 A;  4K0K M;  3HJ8 A;  3SAU A;  2C96 A;  2BJV A;  3M7G A;  7CAT A;  2Z3X A;  4PDI A;  2F5S A;  4D82 A;  4DUZ M;  5LMU M;  3UGJ A;  1NNJ A;  2XZU A;  3GQ4 A;  3HWS A;  2Z4R A;  1FJG M;  4G4O A;  2Y0T A;  1YE9 A;  1KSF X;  3CF6 E;  5DNY A;  3FTF A;  4IJF A;  4JI0 M;  4PDG A;  3FUV A;  2KZS A;  3SYL A;  4I5S A;  5JI2 E;  3ILK A;  1TH3 A;  5LMN M;  3VFD A;  1W5S A;  1XXH A;  2L6O A;  3SBJ A;  3R8F A;  4LG2 A;  3KDS E;  2UUA M;  1G4A E;  4MGH A;  4JI8 M;  3KP1 E;  4QHS A;  4FVM A;  1Q39 A;  4B3M M;  3L29 A;  3AJI B;  1N32 M;  1XMQ M;  2HHH M;  1N33 M;  3U6C A;  1JQJ C;  4LJ8 A;  2KRU A;  2D7E A;  3SFZ A;  3U6M A;  3FTC A;  1G8P A;  1ZAE A;  1DGG A;  4X66 M;  3DFZ A;  1IXR C;  4DV6 M;  2R65 A;  4FCV A;  2M60 A;  1TH2 A;  4JI7 M;  2C98 A;  1UM8 A;  1N36 M;  1SXJ C;  2C99 A;  3HU3 A;  1NVM A;  4AZF A;  4CIS A;  4IBD A;  1S3S A;  4AG6 A;  2V1U A;  3K92 A;  1IBK M;  4L8R C;  4FWD A;  3GLF B;  4G4R A;  4JI6 M;  4QOS A;  2LNH C;  3EIE A;  1MU5 A;  2LXE A;  3FYD A;  3K8Z A;  4M9S A;  5IWA M;  3SAW A;  2UUC M;  2YNM D;  3NBI A;  2DZO B;  4KO8 A;  3VK8 A;  2QEN A;  4LF4 M;  3W0F A;  1Q3B A;  3KS8 A;  1PM5 A;  2DZN B;  5EP1 A;  2XGN A;  1K3X A;  4DUY M;  4JN6 A;  1L1T A;  2DWM A;  2R18 A;  3ZCB B;  1IXZ A;  3FUX A;  3U61 B;  3KXE C;  4LRT A;  1DO2 A;  4GRI A;  3TWK A;  3UMM A;  4LF7 M;  2YQZ A;  1L2D A;  4PT5 A;  2CV2 A;  2FNA A;  2XFT A;  4MH0 E;  2QZ4 A;  4JI4 M;  3W0L B;  4D80 A;  2J7O A;  2R46 A;  3M6A A;  3GLH B;  3KSX A;  3PNY A;  4AG5 A;  4RNA A;  4L4U A;  5EP2 A;  1ORY B;  4AI6 A;  3SAR A;  2DWN A;  1NHW C;  2XSZ A;  2M5Z A;  3AFH A;  3K2L A;  2E5L M;  1L2B A;  4JYA M;  3SYK A;  5EP3 A;  1QAO A;  3GRU A;  4W5W A;  1TGU A;  1VDD A;  4I81 A;  1IN8 A;  3PNV A;  3SHF A;  3GP1 A;  3GQ3 A;  4OX9 M;  3U60 A;  4JI2 M;  2Z7J A;  5E6J A;  5DYI A;  3VDP A;  2F5P A;  4IBG A;  5KPT A;  4DV1 M;  1XHB A;  2YR0 A;  2KA6 B;  4LGY A;  3IG5 A;  3L2A A;  4M9Z A;  2KW0 A;  1SXJ A;  2P5T A;  2RGH A;  5EJC A;  3GPP A;  4R7G A;  3KOX E;  2UUB M;  3HHY A;  4LF5 M;  3TE6 A;  4I8O A;  2RKO A;  2ZAO A;  4CHT B;  4IIW A;  4IBC A;  1TDH A;  1TDZ A;  4DR1 M;  1Z5A A;  1LV7 A;  2VQE M;  4NOO B;  4WW0 A;  4LFA M;  3R9X B;  4REZ A;  3ZH9 B;  1MX0 A;  1E9S A;  5FLX S;  3KSJ A;  3D8B A;  4B7F A;  3NWL A;  3HJQ A;  3GPY A;  4LJ7 A;  1I4W A;  4LF8 M;  2O5R A;  3GRR A;  5JI3 E;  2NQ8 C;  3U6Q A;  3LQR A;  2C9C A;  4TUW A;  3J2P B;  4DV2 M;  1R6B X;  3VK7 A;  4AKG A;  2FOI C;  1HT2 E;  4LJ6 A;  4D81 A;  1XC8 A;  4L16 A;  3GRY A;  2G8L A;  2F5Q A;  2C9O A;  3U5Z A;  3FUT A;  2F5N A;  1NSF A;  5A2Q S;  1IN6 A;  3GO8 A;  2X4A A;  1IBM M;  3JAM S;  1R2Z A;  1YUB A;  2I7P A;  1E94 E;  1GL6 A;  2KEB A;  2OPF A;  3PXG A;  1DGH B;  3QAU A;  1JR3 D;  3LMM A;  4KHP M;  2KZU A;  3LVV A;  2QBY B;  4X64 M;  3I4V A;  4Z6Y A;  2F4V M;  2LWX A;  1G3I A;  4FCW A;  2HKJ A;  4IBB A;  5ITY A;  3TPZ A;  5KQ8 A;  3BOS A;  1PJI A;  2DXI A;  4GKK M;  3DZD A;  4AKI A;  2KRK A;  4GC5 A;  2CUZ A;  1DO0 A;  1HNX M;  5ITX E;  4DR6 M;  4QNR A;  4M0D A;  1QQW A;  4NXM M;  1SXJ E;  4PCZ A;  5KPR A;  2DVW B;  3MHV C;  4RF0 A;  4IJE A;  2W82 A;  1XXH B;  4KOD A;  5DYG A;  4MGI E;  5KPZ A;  2OQ4 A;  4DR3 M;  2HCB A;  2Y21 A;  3GLI A;  3U6O A;  1J09 A;  3I51 A;  2VQF M;  3ZC7 B;  1IN4 A;  4B3S M;  1H6U A;  3MJ5 A;  5BPV A;  1C1K A;  4IBI A;  1IBL M;  4GHA A;  1G41 A;  5ITR A;  3B9P A;  4HL4 A;  4JV5 M;  4FD2 A;  3SHG B;  1QYR A;  4L78 A;  4IBJ A;  4MB7 A;  3RGP A;  1IXS B;  5IRE B;  5FTL A;  3T1Y M;  4GKJ M;  3KP0 E;  5IZ7 D;  1N77 A;  1ZQ9 A;  3RFW A;  3QWL A;  3UK6 A;  1D2N A;  2L7H A;  5EXT A;  3A45 A;  4QNM A;  1N34 M;  4EIW A;  2XFS A;  1L2C A;  1QAN A;  2G5G X;  1OFI A;  4NSO B;  5GKN A;  1XNR M;  1HQY E;  3HHX A;  2ZBK B;  1NNU C;  3VDU A;  4CGY B;  4S12 A;  1W5T A;  4Z8X A;  4BBA A;  3M0E A;  3HKP A;  3J7A S;  3FKE A;  3RGS A;  4LRS A;  5EP4 A;  4X65 M;  2QCU A;  3GRV A;  1Q3C A;  2CFO A;  1GKI A;  1SXJ D;  3J27 B;  3A46 A;  1Z59 A;  8CAT A;  1N75 A;  3FUU A;  4GIP A;  4GHL A;  4B08 A;  1XWI A;  3GLG A;  2XF3 A;  2L7I A;  3AOE C;  5FTJ A;  3KW6 A;  1Z6T A;  2LH0 A;  3WHK A;  2CV1 A;  4DR7 M;  3L25 A;  1E9R A;  3Q8X A;  4OVZ A;  1QZM A;  3KVW A;  2DWL A;  1T3T A;  3DA1 A;  4HLQ A;  2CHG A;  2F5O A;  1HNZ M;  1GLN A;  3MK6 A;  3PVS A;  1NY6 A;  3L26 A;  4DR2 M;  1XNQ M;  1NJG A;  5EXS A;  1DGF A;  3U60 B;  3H4M A;  4PD2 A;  4NXN M;  5C1B A;  4LJ5 A;  1IY0 A;  3LVW A;  3UJN A;  3AL0 C;  3HU1 A;  4DV7 M;  1SXJ B;  3HJS A;  3TQS A;  5BR8 M;  3U6E A;  2R45 A;  4GMQ A;  4LGM A;  5ITT A;  4LFB M;  1OFH A;  2XZF A;  3D8L A;  1X37 A;  4G6Z A;  3KFU G;  4KLN A;  4G4N A;  1I94 M;  1IY1 A;  3A98 B;  3J7B A;  3AOG A;  1FNN A;  2XEP A;  3GQ5 A;  3I4Y A;  2CHV A;  2VII A;  3TWM A;  1J7K A;  3DOA A;  1IM2 A;  4GIT A;  2A5Y B;  1DGB A;  1QAQ A;  2JA2 A;  3KOW E;  4XGI A;  4NL4 H;  1NY5 A;  3SAS A;  1E32 A;  2J7N A;  4QHT A;  1IN7 A;  1XMO M;  1IN5 A;  4LCB A;  3SAV A;  4OU7 A;  4DV4 M;  4LF9 M;  2XLJ A;  4QOZ C;  3T1H M;  4ITQ A;  4BB9 A;  3KOY E;  4FW9 A;  3AOE A;  5FTK A;  3UZU A;  5ITU A;  2YFQ A;  2R4E A;  3U5Z B;  4DR5 M;  1PJJ A;  1GVN A;  4DV5 M;  3HHZ A;  1GL7 A;  2Y20 A;  3GLF A;  4DR4 M;  2DHR A;  3KOZ E;  4A3V B;  2BNK A;  1EE8 A;  2FE8 A;  1JR3 A;  4MM3 B;  1J5E M;  1HNW M;  3L28 A;  4LJA A;  4B3R M;  1HT1 E;  5IT9 S;  2BJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...