2AHMA

Crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
77
structure length
77
Chain Sequence
PLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, replication
molecule keywords Replicase polyprotein 1ab, light chain
publication title Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer
pubmed doi rcsb
source organism Sars coronavirus
total genus 30
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08716 nsp7 nsp7 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.370 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ahmA00
2AHMA 1YSYA
chains in the Genus database with same CATH superfamily
1QZEA 1DGFA 1XXHB 1OKSA 1NV9A 2XGNA 2BJVA 5JI3E 2OPFA 1NSFA 1T3TA 5DYGA 1NO1A 5JI2E 3UZUA 3KS8A 4AKGA 4IBGA 4DV3M 2CEAA 3BBZA 4IBCA 5C18A 4IBEA 2EJSA 3SAWA 3E21A 4M0DA 4ZPXA 1D0KA 2BWBA 2X4AA 3KP0E 4G4QA 3T1YM 1K3XA 3SAUA 1NJFA 4ANRA 5F3WA 2YR0A 3CF6E 3D8LA 3HU3A 1Q39A 4K0KM 2QENA 5KPZA 3GQ5A 3T38A 4OU7A 1EE8A 5ITXA 4IJFA 3E4RA 1N34M 4I5SA 2KRUA 2R0IA 1TR8A 1KFVA 3DZDA 2AHMA 2CP8A 3LQRA 4JXJA 5EQTA 2F5NA 1HNWM 1NY5A 1VEKA 3U6SA 4GRIA 4DV1M 1WJ7A 3GLHB 1PRBA 2DWMA 1Q3CA 2XF3A 2LTUA 2WSFF 3SYLA 3SASA 3NBXX 5EP1A 1ZQ9A 4DV2M 4JI0M 1ZAEA 1J5EM 1XMQM 5ITRA 3AKZA 4LJ4A 2EUCA 5FTLA 5EXSA 2Z8YM 4JI8M 3L25A 2F5OA 3GQ4A 5EJCA 5EP3A 2XLJA 4NXMM 3JAMS 4WP2A 1F4IA 2FH0A 3DOAA 2J5YA 2RKOA 3IG5A 2ZM6M 3PXGA 3QYEA 3TWKA 3FRHA 1T43A 1ZMUA 4P16A 4Q7JA 3T15A 3GLIB 4DV6M 1R2ZA 3TPZA 1R5LA 1S3SA 3TWMA 4KHPM 1IN4A 1NHWC 2VDBB 1TH2A 4R3DA 2CWBA 2CHQA 4NXNM 1ZV1A 2JY6B 1TTEA 3VKGA 4D81A 1Y8GA 4KODA 2M60A 3FTCA 4MGYE 2JUJA 1PJQA 3MMPA 3AOEA 3D8BA 3Q8GA 4PDGA 4DR1M 2QP9X 3ZH9B 1IN6A 3U6PA 3B7QA 2DAIA 2LVQD 3PNYA 2ERCA 1IXSB 4LRSA 3ZC7B 5ITTA 3M6AA 3GLGE 3LW5F 4JI1M 2DENA 4GIPA 2DWNA 3KOXE 4X66M 3J81S 3I51A 3GPXA 1PM5A 2LNHC 3H4MA 3I01M 4QNMA 3NWLA 2DHRA 4X62M 4AI6A 1L2DA 1SXJB 5IT9S 5ITQA 1C1KA 1E32A 1VQ1A 4HLQA 4L6V6 3J2PB 4X64M 1QAMA 2K47A 4JI2M 4LGYA 1GL6A 1D2NA 2L2DA 4UN2B 1IQPA 4Z8XA 3F92A 4I8OA 3K8ZA 2UUAM 2OOAA 3FYDA 1N33M 4RNAA 3FYCA 2C9OA 3GLHA 2KXEA 5C1BA 3HHZA 2I7NA 2LVNC 1JB0F 4YY3M 2DAKA 5FTMA 3FUXA 4QNRA 3HGIA 5ITUA 1L8QA 3I4VA 4PD2A 2X8AA 4B08A 3M7GA 3HJQA 2LHGA 4ITQA 2DZOB 3LVVA 3HHYA 2LBCA 3U5ZB 2KZSA 3CTWB 4GEWA 2H1RA 3T6PA 4CIZA 5IWAM 1XNRM 2KNVA 1QANA 4AG6A 2QBYA 2C96A 1Q3BA 2K9DA 1NV8A 2FFJA 3VK7A 4IBKA 3SYKA 3B7ZA 3J7BA 3UMMA 1L1TA 1XNQM 1IFYA 4JN6A 2M5ZA 2O01F 2XH9A 5E6JA 3LMMA 3FUUA 4MGKE 3SAVA 5ITXE 2Y20A 4QHSA 4D82A 3L27A 3U6MA 3GPYA 2K0BX 2D7HA 2UXCM 1PJTA 4QOSA 5KQDA 1MX0A 4IJEA 1IXSA 2ZAOA 1N75A 1ORYB 3FRIA 3CF0A 4DR3M 2DWLA 2UUBM 3JR5A 3WHLA 3L29A 2VF7A 3FKEA 1YE9A 4NC6A 3LCVB 4R71A 3DA1A 4FWGA 4A3VB 5IREB 4IBFA 4DV5M 2DAEA 1IM2A 1E94E 2L4EA 3W68A 1GO5A 2DVWB 2CE7A 4F2LA 3T1HM 2BNKA 3VLFB 5FLXS 1N78A 2LVAA 1GVNA 2KW0A 1W5SA 1VEGA 2G8LA 4HL4A 5DNYA 2CHGA 3K92A 5LMNM 4DR5M 1MN3A 4FWDA 5BR8M 3SBJA 2L7HA 3U61B 2JY5A 4LG2A 3ZCBB 1N32M 1DGGA 4MGHA 2QSFX 3C3DA 2JA2A 2Z4RA 1XXHE 5DYIA 1E9SA 3U6CA 3AOGA 2XSZA 4GHLA 3E9SA 1EIJA 1IY1A 1PJSA 1QUTA 2G5GX 1QQWA 3KP1E 2DXIA 4CGYB 1OQYA 4MB7A 1Z59A 4L78A 3UGJA 1DGHB 4DR7M 3EIEA 3CF2A 4LJ9A 3UJNA 1PGYA 3FUTA 3BOSA 2LWXA 1A5TA 1G3IA 1OFHA 1V92A 3MHVC 1G59A 5A2QS 2CV1A 1UM8A 3GPPA 2EKKA 1T6OA 3VDPA 3GLFB 3U6OA 3FUWA 1G71A 1GL7A 2KZUA 1QDTA 2Y21A 5IZ7D 3AOEC 7CATA 3J27B 5FTKA 4W5WA 4II7A 4L8RC 1MJGM 4KO8A 2WSEF 1Z6TA 5H37D 3OTOM 1K3WA 1V33A 1RU3A 4OW0A 3EIHA 1BVSA 3GLHE 1XXHA 2C98A 4LFAM 5KPTA 2O5RA 2FOIC 2Y0QA 2QPAA 3U6LA 2JY7A 2L7IA 4Y28F 4NOOB 2I7PA 2MR9A 2UUCM 4B3TM 1KSFX 4QHTA 3SARA 4LF6M 4AZFA 5GKNA 3KXEC 3VKHA 2XZFA 3L28A 2O25A 2Z4SA 3PNVA 1N77A 4NSRA 4RF1A 1H6UA 4FVMA 4DV0M 3GRYA 2CUZA 3L2AA 1L2CA 4RKUF 4PDIA 2KRKA 3GPUA 2KA6B 1R7RA 4B7FA 4AG5A 4GKKM 1QYRA 1XHBA 3GO8A 1QVRA 3GLIE 1D0MA 3KSJA 2LVOC 1N36M 1IXRC 1FJGM 1AIPC 2N35A 4LJ5A 2CHVA 3QAUA 4IBBA 4L4UA 3FTFA 3C9PA 2VQEM 4FCTA 2K6BA 4GHAA 2LXEA 3KDSE 1ZMVA 3KOYE 4G3OA 3VK8A 4CJ6A 1DGHA 2XFTA 3IHPA 4JYAM 2R44A 1CUKA 3C58A 1JR3A 3HJSA 3MJ5A 1WIVA 3HHXA 3FTEA 1XWIA 1VG5A 1OJLA 1G8PA 4MGZE 1TDZA 4LZZA 1WR1B 4GKJM 4IIWA 3GLFA 2P5TA 2ZTCA 3B89A 3QYBA 2Z3XA 3SC3A 2LH0A 2D7GA 2R62A 4EIWA 1DGBA 2RGOA 2V1CA 1R6BX 3U6QA 1GKIA 2A5YB 2APLA 1SXJE 5LMUM 3BXWA 1XB2B 2QCUA 3HHWA 2JZ1A 1LV7A 4X65M 2XZUA 3I4YA 3GLIA 1Q02A 1UFZA 2VQFM 4G4NA 4F1IA 2XFSA 3A42A 1VEJA 4JI3M 3DFZA 2J7NA 1GJSA 4IBDA 1NHGC 3LCUA 2QQ8A 1MU5A 2L4FA 1QDRA 1OFIA 2F5QA 3QWLA 4KLNA 5ITYA 3UK6A 3A98B 2BWEA 1K82A 3E46A 5EXPA 2F5PA 1OIZA 2JXNA 1QAOA 3SMSA 1WHCA 3W0FA 1VDDA 4B7HA 4DR6M 2B3TA 2FE8A 2C5RA 2F4VM 1NY6A 2R65A 2VF8A 1IY2A 1QAQA 2L6OA 4LF4M 3THGA 3U6EA 2JP7A 1J09A 1D0LA 2Z7JA 2L09A 3SMPA 2LHCA 4XGIA 5KPRA 1DV0A 4B3SM 4FD2A 3B9PA 4GMQA 3KOZE 1SXJA 4M9XA 4D80A 3SFZA 5FSWA 3RE8A 1IN5A 5FTJA 8CATA 1L1ZA 1HNXM 4JI4M 3LQQA 5KO3A 1OAOC 1IBMM 1NNUC 2V1UA 4LF7M 3ZQJA 2GQFA 5EP4A 4CHTB 1HR0M 1G41A 2LVPC 1YUBA 4FW9A 2XSZD 1TH3A 2ZTDA 3CGWA 4GITA 2R45A 4JI7M 3R9XB 4GH9A 2VIIA 2R46A 3FUVA 1TH4A 4MH0E 1R4GA 4BBAA 1IXZA 1DO0A 1WGNA 3GRRA 3HX3A 3ILKA 3IG8A 1I4WA 5L8RF 4GC5A 5DFLA 2HWJA 2V6ZM 4IBJA 3U5ZA 1J7KA 2X49A 1L2BA 1NNJA 2ZBKB 2KDLA 4JV5M 4LJAA 3KFUG 3GRVA 4LF9M 3KS4A 3PVSA 4Z6YA 4R7GA 5KQ8A 3AL0C 1W5TA 1Z5CA 4FCVA 2MH8A 4IBIA 3U60B 3KVWA 3VFDA 3MK6A 1HJPA 2MGWA 4M9ZA 4L16A 1OIPA 3VDUA 2CV0A 4BB9A 4LF8M 2OO9A 4PT5A 3HU1A 4NSOB 5E26A 4B3RM 3K1JA 1ZMWA 3HU2A 3H4JA 3NBIA 4LFBM 2QHOB 4LCBA 4JI6M 2JY8A 1XMOM 2HCBA 3SHGB 2Q2EB 5BPVA 1JR3E 3TQSA 4LJ7A 1EFUB 1FNNA 3JR4A 1VDLA 3HY5A 1XC8A 2DI0A 1Z5BA 1JQJC 3AJIB 1Z5AA 3GLFE 2CFOA 2FNAA 2CV2A 4LRTA 3GLGB 3PFIA 4AQYM 3W0LB 2ZAMA 1OAIA 3V76A 2XEPA 3FE3A 4B7GA 4BLCA 3B7NA 2C9CA 1YSYA 2QNJA 3AV0A 4OVZB 4I4LA 1X37A 3J80S 2QBYB 4JI5M 3SATA 3Q8XA 2JNHA 4NRVA 3U61A 2R4JA 4AKHA 3AFHA 2DAMA 3J7AS 4OX9M 1HT2E 2KEBA 3GQ3A 2UXDM 1TGUA 1TDHA 4QOZC 3A45A 2ZANA 1IN7A 3IECA 4DR2M 4HEOA 2CRUA 1JR3D 1E9RA 2J7OA 1IBKM 3KOWE 2G3QA 1AUAA 4L15A 3A46A 2EO2A 2OOBA 1LTMA 2HAKA 1NVMA 3LVWA 1G4AE 4NL4H 2EA0A 1HT1E 3HWSA 4LFCM 2DZLA 4LY6A 4LZJA 4B3MM 3GRUA 2MROB 1C7YA 1WGLA 1YLAA 4LGMA 4XBOA 1IBLM 1TF0B 2QZ4A 1HNZM 4CISA 4MM3B 1KYIA 2KNAA 3U60A 1V34A 4WW0A 4DV7M 2YNMD 3L26A 3RFWA 1PJJA 3M0EA 4TUWA 2C99A 2DKLA 3W67A 4AKIA 1DO2A 2H5XA 2KNZA 4DUZM 2Y0TA 3R8FA 1I94M 1GJTA 4AW4A 2GNOA 3HZJA 2DHYA 2OQ4A 1NJGA 4RF0A 3HKPA 4G4OA 3TWLA 1GABA 2DZNB 1SG9A 3K9OA 5FTNA 3U6DA 4YHHM 3KSXA 4G4RA 3SHFA 4WURA 2KHHA 2W82A 1SXJC 4XK8F 4MGIE 2YFQA 3GLGA 2BJWA 1IY0A 2WSCF 4KT0F 3TE6A 2MJ5B 2RGHA 3B74A 3KW6A 4G6ZA 4PCZA 2DWZB 4OVZA 4LF5M 1P3QQ 4M0WA 1QUSA 1WXQA 3TL4X 1SXJD 1GLNA 3GP1A 1HQCA 2HL7A 4REZA 3FTDA 4P17A 3K9PA 3C3EA 1OTRA 4M9SA 5EP2A 2E5LM 4NRWA 4DR4M 5EXXA 2F5SA 3K2LA 3I04M 2DNAA 2UU9M 2R18A 1HQYE 2R4EA 2WZJA 4GC9A 5EXTA 4DBGB 4DV4M 4I81A 3RGPA 4FCWA 2HHHM 3WHKA 2D7EA 3HJ8A 2FS1A 1IN8A 2JWSA 2NQ8C 2RRUA 2R6FA 2UXBM 4LJ8A 4S12A 1PJIA 4LJ6A 2YQZA 3FD9A 4FWHA 2DAGA 2EKFA 2HKJA 3RGSA 1R2YA 1QZMA 4DUYM 2JZ0A
chains in the Genus database with same CATH topology
1DGFA 1XXHB 2XGNA 2BJVA 5JI3E 2OPFA 1NSFA 1T3TA 5DYGA 5JI2E 3UZUA 3KS8A 4AKGA 4IBGA 4DV3M 2CEAA 4IBCA 5C18A 4IBEA 3SAWA 4M0DA 4ZPXA 4G4QA 3T1YM 2X4AA 3KP0E 1K3XA 3SAUA 1NJFA 5F3WA 2YR0A 3CF6E 3D8LA 3HU3A 1Q39A 4K0KM 2QENA 5KPZA 3GQ5A 3T38A 4OU7A 1EE8A 5ITXA 4IJFA 3E4RA 1N34M 4I5SA 2KRUA 1KFVA 3DZDA 2AHMA 3LQRA 4JXJA 5EQTA 2F5NA 1HNWM 1NY5A 3U6SA 4GRIA 4DV1M 3GLHB 2DWMA 1Q3CA 2XF3A 3SYLA 3SASA 5EP1A 1ZQ9A 4DV2M 4JI0M 1ZAEA 1J5EM 1XMQM 5ITRA 3AKZA 4LJ4A 2EUCA 5FTLA 5EXSA 4JI8M 3L25A 2F5OA 3GQ4A 5EJCA 5EP3A 2XLJA 4NXMM 3JAMS 3DOAA 2RKOA 3IG5A 2ZM6M 3PXGA 3TWKA 4P16A 3T15A 3GLIB 4DV6M 1R2ZA 3TPZA 1S3SA 3TWMA 4KHPM 1IN4A 1NHWC 1TH2A 4R3DA 2CHQA 4NXNM 3VKGA 4D81A 4KODA 2M60A 3FTCA 4MGYE 3AOEA 3D8BA 4PDGA 4DR1M 2QP9X 3ZH9B 1IN6A 3U6PA 3ZC7B 3PNYA 2ERCA 1IXSB 4LRSA 5ITTA 4JI1M 3M6AA 4GIPA 2DWNA 3KOXE 4X66M 3J81S 3I51A 3GPXA 1PM5A 2LNHC 3H4MA 4QNMA 3NWLA 2DHRA 4X62M 4AI6A 1L2DA 1SXJB 5IT9S 5ITQA 1C1KA 1E32A 4HLQA 3J2PB 4X64M 1QAMA 2K47A 4JI2M 4LGYA 1GL6A 1D2NA 1IQPA 4Z8XA 4I8OA 2UUAM 3K8ZA 3FYDA 1N33M 4RNAA 3FYCA 2C9OA 3GLHA 2KXEA 5C1BA 3HHZA 2I7NA 4YY3M 5FTMA 3FUXA 4QNRA 3HGIA 5ITUA 1L8QA 3I4VA 4PD2A 2X8AA 4B08A 3M7GA 3HJQA 4ITQA 2DZOB 3LVVA 3HHYA 3U5ZB 2KZSA 3CTWB 2H1RA 5IWAM 1XNRM 1QANA 4AG6A 2QBYA 2C96A 1Q3BA 2FFJA 3VK7A 4IBKA 3SYKA 3UMMA 3J7BA 1L1TA 1XNQM 4JN6A 2M5ZA 2XH9A 5E6JA 3LMMA 3FUUA 4MGKE 3SAVA 5ITXE 2Y20A 4QHSA 4D82A 3L27A 3U6MA 3GPYA 2D7HA 2UXCM 4QOSA 5KQDA 1MX0A 4IJEA 2ZAOA 1N75A 1ORYB 3CF0A 4DR3M 2DWLA 2UUBM 3JR5A 3WHLA 3L29A 3FKEA 1YE9A 3DA1A 4FWGA 4A3VB 5IREB 4IBFA 4DV5M 1IM2A 1E94E 2DVWB 2CE7A 3T1HM 2BNKA 3VLFB 5FLXS 1N78A 1GVNA 2KW0A 1W5SA 2G8LA 4HL4A 5DNYA 2CHGA 3K92A 5LMNM 4DR5M 5BR8M 4FWDA 3SBJA 2L7HA 3U61B 4LG2A 3ZCBB 1N32M 1DGGA 4MGHA 5DYIA 3U6CA 2JA2A 2Z4RA 1E9SA 3AOGA 2XSZA 4GHLA 3E9SA 1IY1A 2G5GX 1QQWA 3KP1E 2DXIA 4CGYB 4MB7A 1Z59A 4L78A 3UGJA 1DGHB 4DR7M 3EIEA 3CF2A 4LJ9A 3UJNA 3FUTA 3BOSA 2LWXA 3MHVC 1G3IA 1OFHA 1G59A 5A2QS 2CV1A 1UM8A 3GPPA 3VDPA 3GLFB 3U6OA 3FUWA 1GL7A 2KZUA 2Y21A 5IZ7D 3AOEC 7CATA 3J27B 5FTKA 4W5WA 4II7A 4L8RC 4KO8A 1Z6TA 5H37D 3OTOM 1K3WA 4OW0A 3EIHA 1XXHA 2C98A 4LFAM 5KPTA 2O5RA 2FOIC 2Y0QA 2QPAA 3U6LA 2L7IA 2UUCM 4NOOB 2I7PA 4B3TM 1KSFX 4QHTA 3SARA 4LF6M 4AZFA 5GKNA 3KXEC 3VKHA 2XZFA 3L28A 2Z4SA 3PNVA 1N77A 4NSRA 4RF1A 1H6UA 4FVMA 4DV0M 3GRYA 2CUZA 3L2AA 1L2CA 4PDIA 2KRKA 3GPUA 2KA6B 1R7RA 4B7FA 4AG5A 4GKKM 1QYRA 1XHBA 3GO8A 1QVRA 3KSJA 1N36M 1IXRC 1FJGM 4LJ5A 2CHVA 3QAUA 4IBBA 4L4UA 3FTFA 2VQEM 4FCTA 4GHAA 2LXEA 3KDSE 3KOYE 3VK8A 4JYAM 1DGHA 2XFTA 3C58A 1JR3A 3HJSA 3MJ5A 3HHXA 3FTEA 1XWIA 1OJLA 1G8PA 4MGZE 1TDZA 4LZZA 4GKJM 4IIWA 3GLFA 2P5TA 2Z3XA 3SC3A 2LH0A 2D7GA 2R62A 4EIWA 1DGBA 2RGOA 2V1CA 1R6BX 3U6QA 1GKIA 2A5YB 1SXJE 5LMUM 2QCUA 3HHWA 1LV7A 4X65M 2XZUA 3I4YA 3GLIA 2VQFM 4G4NA 2XFSA 3A42A 4JI3M 3DFZA 2J7NA 4IBDA 1NHGC 1MU5A 1OFIA 2F5QA 3QWLA 4KLNA 5ITYA 3UK6A 3A98B 1K82A 5EXPA 2F5PA 1QAOA 3SMSA 3W0FA 1VDDA 4B7HA 4DR6M 2FE8A 2C5RA 2F4VM 1NY6A 2R65A 1IY2A 1QAQA 2L6OA 4LF4M 3THGA 3U6EA 1J09A 2Z7JA 2L09A 3SMPA 4XGIA 5KPRA 4B3SM 4FD2A 3B9PA 4GMQA 3KOZE 1SXJA 4M9XA 4D80A 3SFZA 5FSWA 3RE8A 1IN5A 5FTJA 8CATA 1L1ZA 1HNXM 4JI4M 3LQQA 5KO3A 1IBMM 1NNUC 2V1UA 4LF7M 5EP4A 4CHTB 1HR0M 1G41A 1YUBA 4FW9A 2XSZD 1TH3A 4GITA 4JI7M 2R45A 3R9XB 4GH9A 2VIIA 2R46A 3FUVA 1TH4A 4MH0E 4BBAA 1IXZA 1DO0A 3GRRA 3ILKA 3IG8A 1I4WA 4GC5A 2V6ZM 4IBJA 3U5ZA 1J7KA 2X49A 1L2BA 1NNJA 2ZBKB 4JV5M 4LJAA 3KFUG 3GRVA 4LF9M 3KS4A 3PVSA 4Z6YA 4R7GA 5KQ8A 3AL0C 1W5TA 1Z5CA 4FCVA 4IBIA 3U60B 3KVWA 3VFDA 3MK6A 4M9ZA 4L16A 2CV0A 3VDUA 4LF8M 4BB9A 4PT5A 3HU1A 4NSOB 5E26A 4B3RM 3K1JA 3HU2A 3NBIA 4LFBM 4LCBA 4JI6M 1XMOM 2HCBA 3SHGB 2Q2EB 5BPVA 3TQSA 4LJ7A 3JR4A 1FNNA 1XC8A 1Z5BA 1JQJC 3AJIB 1Z5AA 2CFOA 2FNAA 2CV2A 4LRTA 3GLGB 3PFIA 4AQYM 3W0LB 2ZAMA 4B7GA 2XEPA 4BLCA 2C9CA 1YSYA 3AV0A 4OVZB 4I4LA 1X37A 3J80S 2QBYB 4JI5M 3SATA 3Q8XA 4NRVA 3U61A 2R4JA 4AKHA 3AFHA 3J7AS 4OX9M 1HT2E 2KEBA 3GQ3A 2UXDM 1TGUA 1TDHA 4QOZC 3A45A 2ZANA 1IN7A 4DR2M 1IBKM 1JR3D 1E9RA 2J7OA 3KOWE 3A46A 4L15A 2EO2A 3LVWA 1NVMA 1G4AE 4NL4H 2EA0A 1HT1E 3HWSA 4LFCM 4LY6A 4LZJA 4B3MM 3GRUA 4LGMA 4XBOA 1IBLM 2QZ4A 1HNZM 4CISA 4MM3B 1KYIA 3U60A 4WW0A 4DV7M 2YNMD 3L26A 3RFWA 1PJJA 3M0EA 4TUWA 2C99A 4AKIA 1DO2A 4DUZM 3R8FA 2Y0TA 1I94M 4AW4A 2OQ4A 1NJGA 4RF0A 3HKPA 4G4OA 3TWLA 2DZNB 5FTNA 3U6DA 4YHHM 3KSXA 4G4RA 3SHFA 4WURA 2W82A 1SXJC 4MGIE 2YFQA 3GLGA 2BJWA 1IY0A 3TE6A 2RGHA 4G6ZA 3KW6A 4PCZA 2DWZB 4OVZA 4LF5M 4M0WA 1WXQA 3TL4X 1SXJD 1GLNA 3GP1A 1HQCA 2HL7A 4REZA 3FTDA 5EP2A 4M9SA 2E5LM 4NRWA 4DR4M 5EXXA 2F5SA 3K2LA 2UU9M 2R18A 1HQYE 2R4EA 4GC9A 5EXTA 4DV4M 2HHHM 4I81A 3RGPA 4FCWA 3WHKA 2D7EA 3HJ8A 1IN8A 2NQ8C 2UXBM 4LJ8A 4S12A 1PJIA 4LJ6A 2YQZA 3FD9A 4FWHA 3RGSA 2HKJA 1R2YA 1QZMA 4DUYM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHM A;  1YSY A; 
#chains in the Genus database with same CATH topology
 1QZE A;  1DGF A;  1XXH B;  1OKS A;  1NV9 A;  2XGN A;  2BJV A;  5JI3 E;  2OPF A;  1NSF A;  1T3T A;  5DYG A;  1NO1 A;  5JI2 E;  3UZU A;  3KS8 A;  4AKG A;  4IBG A;  4DV3 M;  2CEA A;  3BBZ A;  4IBC A;  5C18 A;  4IBE A;  2EJS A;  3SAW A;  3E21 A;  4M0D A;  4ZPX A;  1D0K A;  2BWB A;  2X4A A;  3KP0 E;  4G4Q A;  3T1Y M;  1K3X A;  3SAU A;  1NJF A;  4ANR A;  5F3W A;  2YR0 A;  3CF6 E;  3D8L A;  3HU3 A;  1Q39 A;  4K0K M;  2QEN A;  5KPZ A;  3GQ5 A;  3T38 A;  4OU7 A;  1EE8 A;  5ITX A;  4IJF A;  3E4R A;  1N34 M;  4I5S A;  2KRU A;  2R0I A;  1TR8 A;  1KFV A;  3DZD A;  2AHM A;  2CP8 A;  3LQR A;  4JXJ A;  5EQT A;  2F5N A;  1HNW M;  1NY5 A;  1VEK A;  3U6S A;  4GRI A;  4DV1 M;  1WJ7 A;  3GLH B;  1PRB A;  2DWM A;  1Q3C A;  2XF3 A;  2LTU A;  2WSF F;  3SYL A;  3SAS A;  3NBX X;  5EP1 A;  1ZQ9 A;  4DV2 M;  4JI0 M;  1ZAE A;  1J5E M;  1XMQ M;  5ITR A;  3AKZ A;  4LJ4 A;  2EUC A;  5FTL A;  5EXS A;  2Z8Y M;  4JI8 M;  3L25 A;  2F5O A;  3GQ4 A;  5EJC A;  5EP3 A;  2XLJ A;  4NXM M;  3JAM S;  4WP2 A;  1F4I A;  2FH0 A;  3DOA A;  2J5Y A;  2RKO A;  3IG5 A;  2ZM6 M;  3PXG A;  3QYE A;  3TWK A;  3FRH A;  1T43 A;  1ZMU A;  4P16 A;  4Q7J A;  3T15 A;  3GLI B;  4DV6 M;  1R2Z A;  3TPZ A;  1R5L A;  1S3S A;  3TWM A;  4KHP M;  1IN4 A;  1NHW C;  2VDB B;  1TH2 A;  4R3D A;  2CWB A;  2CHQ A;  4NXN M;  1ZV1 A;  2JY6 B;  1TTE A;  3VKG A;  4D81 A;  1Y8G A;  4KOD A;  2M60 A;  3FTC A;  4MGY E;  2JUJ A;  1PJQ A;  3MMP A;  3AOE A;  3D8B A;  3Q8G A;  4PDG A;  4DR1 M;  2QP9 X;  3ZH9 B;  1IN6 A;  3U6P A;  3B7Q A;  2DAI A;  2LVQ D;  3PNY A;  2ERC A;  1IXS B;  4LRS A;  3ZC7 B;  5ITT A;  3M6A A;  3GLG E;  3LW5 F;  4JI1 M;  2DEN A;  4GIP A;  2DWN A;  3KOX E;  4X66 M;  3J81 S;  3I51 A;  3GPX A;  1PM5 A;  2LNH C;  3H4M A;  3I01 M;  4QNM A;  3NWL A;  2DHR A;  4X62 M;  4AI6 A;  1L2D A;  1SXJ B;  5IT9 S;  5ITQ A;  1C1K A;  1E32 A;  1VQ1 A;  4HLQ A;  4L6V 6;  3J2P B;  4X64 M;  1QAM A;  2K47 A;  4JI2 M;  4LGY A;  1GL6 A;  1D2N A;  2L2D A;  4UN2 B;  1IQP A;  4Z8X A;  3F92 A;  4I8O A;  3K8Z A;  2UUA M;  2OOA A;  3FYD A;  1N33 M;  4RNA A;  3FYC A;  2C9O A;  3GLH A;  2KXE A;  5C1B A;  3HHZ A;  2I7N A;  2LVN C;  1JB0 F;  4YY3 M;  2DAK A;  5FTM A;  3FUX A;  4QNR A;  3HGI A;  5ITU A;  1L8Q A;  3I4V A;  4PD2 A;  2X8A A;  4B08 A;  3M7G A;  3HJQ A;  2LHG A;  4ITQ A;  2DZO B;  3LVV A;  3HHY A;  2LBC A;  3U5Z B;  2KZS A;  3CTW B;  4GEW A;  2H1R A;  3T6P A;  4CIZ A;  5IWA M;  1XNR M;  2KNV A;  1QAN A;  4AG6 A;  2QBY A;  2C96 A;  1Q3B A;  2K9D A;  1NV8 A;  2FFJ A;  3VK7 A;  4IBK A;  3SYK A;  3B7Z A;  3J7B A;  3UMM A;  1L1T A;  1XNQ M;  1IFY A;  4JN6 A;  2M5Z A;  2O01 F;  2XH9 A;  5E6J A;  3LMM A;  3FUU A;  4MGK E;  3SAV A;  5ITX E;  2Y20 A;  4QHS A;  4D82 A;  3L27 A;  3U6M A;  3GPY A;  2K0B X;  2D7H A;  2UXC M;  1PJT A;  4QOS A;  5KQD A;  1MX0 A;  4IJE A;  1IXS A;  2ZAO A;  1N75 A;  1ORY B;  3FRI A;  3CF0 A;  4DR3 M;  2DWL A;  2UUB M;  3JR5 A;  3WHL A;  3L29 A;  2VF7 A;  3FKE A;  1YE9 A;  4NC6 A;  3LCV B;  4R71 A;  3DA1 A;  4FWG A;  4A3V B;  5IRE B;  4IBF A;  4DV5 M;  2DAE A;  1IM2 A;  1E94 E;  2L4E A;  3W68 A;  1GO5 A;  2DVW B;  2CE7 A;  4F2L A;  3T1H M;  2BNK A;  3VLF B;  5FLX S;  1N78 A;  2LVA A;  1GVN A;  2KW0 A;  1W5S A;  1VEG A;  2G8L A;  4HL4 A;  5DNY A;  2CHG A;  3K92 A;  5LMN M;  4DR5 M;  1MN3 A;  4FWD A;  5BR8 M;  3SBJ A;  2L7H A;  3U61 B;  2JY5 A;  4LG2 A;  3ZCB B;  1N32 M;  1DGG A;  4MGH A;  2QSF X;  3C3D A;  2JA2 A;  2Z4R A;  1XXH E;  5DYI A;  1E9S A;  3U6C A;  3AOG A;  2XSZ A;  4GHL A;  3E9S A;  1EIJ A;  1IY1 A;  1PJS A;  1QUT A;  2G5G X;  1QQW A;  3KP1 E;  2DXI A;  4CGY B;  1OQY A;  4MB7 A;  1Z59 A;  4L78 A;  3UGJ A;  1DGH B;  4DR7 M;  3EIE A;  3CF2 A;  4LJ9 A;  3UJN A;  1PGY A;  3FUT A;  3BOS A;  2LWX A;  1A5T A;  1G3I A;  1OFH A;  1V92 A;  3MHV C;  1G59 A;  5A2Q S;  2CV1 A;  1UM8 A;  3GPP A;  2EKK A;  1T6O A;  3VDP A;  3GLF B;  3U6O A;  3FUW A;  1G71 A;  1GL7 A;  2KZU A;  1QDT A;  2Y21 A;  5IZ7 D;  3AOE C;  7CAT A;  3J27 B;  5FTK A;  4W5W A;  4II7 A;  4L8R C;  1MJG M;  4KO8 A;  2WSE F;  1Z6T A;  5H37 D;  3OTO M;  1K3W A;  1V33 A;  1RU3 A;  4OW0 A;  3EIH A;  1BVS A;  3GLH E;  1XXH A;  2C98 A;  4LFA M;  5KPT A;  2O5R A;  2FOI C;  2Y0Q A;  2QPA A;  3U6L A;  2JY7 A;  2L7I A;  4Y28 F;  4NOO B;  2I7P A;  2MR9 A;  2UUC M;  4B3T M;  1KSF X;  4QHT A;  3SAR A;  4LF6 M;  4AZF A;  5GKN A;  3KXE C;  3VKH A;  2XZF A;  3L28 A;  2O25 A;  2Z4S A;  3PNV A;  1N77 A;  4NSR A;  4RF1 A;  1H6U A;  4FVM A;  4DV0 M;  3GRY A;  2CUZ A;  3L2A A;  1L2C A;  4RKU F;  4PDI A;  2KRK A;  3GPU A;  2KA6 B;  1R7R A;  4B7F A;  4AG5 A;  4GKK M;  1QYR A;  1XHB A;  3GO8 A;  1QVR A;  3GLI E;  1D0M A;  3KSJ A;  2LVO C;  1N36 M;  1IXR C;  1FJG M;  1AIP C;  2N35 A;  4LJ5 A;  2CHV A;  3QAU A;  4IBB A;  4L4U A;  3FTF A;  3C9P A;  2VQE M;  4FCT A;  2K6B A;  4GHA A;  2LXE A;  3KDS E;  1ZMV A;  3KOY E;  4G3O A;  3VK8 A;  4CJ6 A;  1DGH A;  2XFT A;  3IHP A;  4JYA M;  2R44 A;  1CUK A;  3C58 A;  1JR3 A;  3HJS A;  3MJ5 A;  1WIV A;  3HHX A;  3FTE A;  1XWI A;  1VG5 A;  1OJL A;  1G8P A;  4MGZ E;  1TDZ A;  4LZZ A;  1WR1 B;  4GKJ M;  4IIW A;  3GLF A;  2P5T A;  2ZTC A;  3B89 A;  3QYB A;  2Z3X A;  3SC3 A;  2LH0 A;  2D7G A;  2R62 A;  4EIW A;  1DGB A;  2RGO A;  2V1C A;  1R6B X;  3U6Q A;  1GKI A;  2A5Y B;  2APL A;  1SXJ E;  5LMU M;  3BXW A;  1XB2 B;  2QCU A;  3HHW A;  2JZ1 A;  1LV7 A;  4X65 M;  2XZU A;  3I4Y A;  3GLI A;  1Q02 A;  1UFZ A;  2VQF M;  4G4N A;  4F1I A;  2XFS A;  3A42 A;  1VEJ A;  4JI3 M;  3DFZ A;  2J7N A;  1GJS A;  4IBD A;  1NHG C;  3LCU A;  2QQ8 A;  1MU5 A;  2L4F A;  1QDR A;  1OFI A;  2F5Q A;  3QWL A;  4KLN A;  5ITY A;  3UK6 A;  3A98 B;  2BWE A;  1K82 A;  3E46 A;  5EXP A;  2F5P A;  1OIZ A;  2JXN A;  1QAO A;  3SMS A;  1WHC A;  3W0F A;  1VDD A;  4B7H A;  4DR6 M;  2B3T A;  2FE8 A;  2C5R A;  2F4V M;  1NY6 A;  2R65 A;  2VF8 A;  1IY2 A;  1QAQ A;  2L6O A;  4LF4 M;  3THG A;  3U6E A;  2JP7 A;  1J09 A;  1D0L A;  2Z7J A;  2L09 A;  3SMP A;  2LHC A;  4XGI A;  5KPR A;  1DV0 A;  4B3S M;  4FD2 A;  3B9P A;  4GMQ A;  3KOZ E;  1SXJ A;  4M9X A;  4D80 A;  3SFZ A;  5FSW A;  3RE8 A;  1IN5 A;  5FTJ A;  8CAT A;  1L1Z A;  1HNX M;  4JI4 M;  3LQQ A;  5KO3 A;  1OAO C;  1IBM M;  1NNU C;  2V1U A;  4LF7 M;  3ZQJ A;  2GQF A;  5EP4 A;  4CHT B;  1HR0 M;  1G41 A;  2LVP C;  1YUB A;  4FW9 A;  2XSZ D;  1TH3 A;  2ZTD A;  3CGW A;  4GIT A;  2R45 A;  4JI7 M;  3R9X B;  4GH9 A;  2VII A;  2R46 A;  3FUV A;  1TH4 A;  4MH0 E;  1R4G A;  4BBA A;  1IXZ A;  1DO0 A;  1WGN A;  3GRR A;  3HX3 A;  3ILK A;  3IG8 A;  1I4W A;  5L8R F;  4GC5 A;  5DFL A;  2HWJ A;  2V6Z M;  4IBJ A;  3U5Z A;  1J7K A;  2X49 A;  1L2B A;  1NNJ A;  2ZBK B;  2KDL A;  4JV5 M;  4LJA A;  3KFU G;  3GRV A;  4LF9 M;  3KS4 A;  3PVS A;  4Z6Y A;  4R7G A;  5KQ8 A;  3AL0 C;  1W5T A;  1Z5C A;  4FCV A;  2MH8 A;  4IBI A;  3U60 B;  3KVW A;  3VFD A;  3MK6 A;  1HJP A;  2MGW A;  4M9Z A;  4L16 A;  1OIP A;  3VDU A;  2CV0 A;  4BB9 A;  4LF8 M;  2OO9 A;  4PT5 A;  3HU1 A;  4NSO B;  5E26 A;  4B3R M;  3K1J A;  1ZMW A;  3HU2 A;  3H4J A;  3NBI A;  4LFB M;  2QHO B;  4LCB A;  4JI6 M;  2JY8 A;  1XMO M;  2HCB A;  3SHG B;  2Q2E B;  5BPV A;  1JR3 E;  3TQS A;  4LJ7 A;  1EFU B;  1FNN A;  3JR4 A;  1VDL A;  3HY5 A;  1XC8 A;  2DI0 A;  1Z5B A;  1JQJ C;  3AJI B;  1Z5A A;  3GLF E;  2CFO A;  2FNA A;  2CV2 A;  4LRT A;  3GLG B;  3PFI A;  4AQY M;  3W0L B;  2ZAM A;  1OAI A;  3V76 A;  2XEP A;  3FE3 A;  4B7G A;  4BLC A;  3B7N A;  2C9C A;  1YSY A;  2QNJ A;  3AV0 A;  4OVZ B;  4I4L A;  1X37 A;  3J80 S;  2QBY B;  4JI5 M;  3SAT A;  3Q8X A;  2JNH A;  4NRV A;  3U61 A;  2R4J A;  4AKH A;  3AFH A;  2DAM A;  3J7A S;  4OX9 M;  1HT2 E;  2KEB A;  3GQ3 A;  2UXD M;  1TGU A;  1TDH A;  4QOZ C;  3A45 A;  2ZAN A;  1IN7 A;  3IEC A;  4DR2 M;  4HEO A;  2CRU A;  1JR3 D;  1E9R A;  2J7O A;  1IBK M;  3KOW E;  2G3Q A;  1AUA A;  4L15 A;  3A46 A;  2EO2 A;  2OOB A;  1LTM A;  2HAK A;  1NVM A;  3LVW A;  1G4A E;  4NL4 H;  2EA0 A;  1HT1 E;  3HWS A;  4LFC M;  2DZL A;  4LY6 A;  4LZJ A;  4B3M M;  3GRU A;  2MRO B;  1C7Y A;  1WGL A;  1YLA A;  4LGM A;  4XBO A;  1IBL M;  1TF0 B;  2QZ4 A;  1HNZ M;  4CIS A;  4MM3 B;  1KYI A;  2KNA A;  3U60 A;  1V34 A;  4WW0 A;  4DV7 M;  2YNM D;  3L26 A;  3RFW A;  1PJJ A;  3M0E A;  4TUW A;  2C99 A;  2DKL A;  3W67 A;  4AKI A;  1DO2 A;  2H5X A;  2KNZ A;  4DUZ M;  2Y0T A;  3R8F A;  1I94 M;  1GJT A;  4AW4 A;  2GNO A;  3HZJ A;  2DHY A;  2OQ4 A;  1NJG A;  4RF0 A;  3HKP A;  4G4O A;  3TWL A;  1GAB A;  2DZN B;  1SG9 A;  3K9O A;  5FTN A;  3U6D A;  4YHH M;  3KSX A;  4G4R A;  3SHF A;  4WUR A;  2KHH A;  2W82 A;  1SXJ C;  4XK8 F;  4MGI E;  2YFQ A;  3GLG A;  2BJW A;  1IY0 A;  2WSC F;  4KT0 F;  3TE6 A;  2MJ5 B;  2RGH A;  3B74 A;  3KW6 A;  4G6Z A;  4PCZ A;  2DWZ B;  4OVZ A;  4LF5 M;  1P3Q Q;  4M0W A;  1QUS A;  1WXQ A;  3TL4 X;  1SXJ D;  1GLN A;  3GP1 A;  1HQC A;  2HL7 A;  4REZ A;  3FTD A;  4P17 A;  3K9P A;  3C3E A;  1OTR A;  4M9S A;  5EP2 A;  2E5L M;  4NRW A;  4DR4 M;  5EXX A;  2F5S A;  3K2L A;  3I04 M;  2DNA A;  2UU9 M;  2R18 A;  1HQY E;  2R4E A;  2WZJ A;  4GC9 A;  5EXT A;  4DBG B;  4DV4 M;  4I81 A;  3RGP A;  4FCW A;  2HHH M;  3WHK A;  2D7E A;  3HJ8 A;  2FS1 A;  1IN8 A;  2JWS A;  2NQ8 C;  2RRU A;  2R6F A;  2UXB M;  4LJ8 A;  4S12 A;  1PJI A;  4LJ6 A;  2YQZ A;  3FD9 A;  4FWH A;  2DAG A;  2EKF A;  2HKJ A;  3RGS A;  1R2Y A;  1QZM A;  4DUY M;  2JZ0 A; 
#chains in the Genus database with same CATH homology
 1DGF A;  1XXH B;  2XGN A;  2BJV A;  5JI3 E;  2OPF A;  1NSF A;  1T3T A;  5DYG A;  5JI2 E;  3UZU A;  3KS8 A;  4AKG A;  4IBG A;  4DV3 M;  2CEA A;  4IBC A;  5C18 A;  4IBE A;  3SAW A;  4M0D A;  4ZPX A;  4G4Q A;  3T1Y M;  2X4A A;  3KP0 E;  1K3X A;  3SAU A;  1NJF A;  5F3W A;  2YR0 A;  3CF6 E;  3D8L A;  3HU3 A;  1Q39 A;  4K0K M;  2QEN A;  5KPZ A;  3GQ5 A;  3T38 A;  4OU7 A;  1EE8 A;  5ITX A;  4IJF A;  3E4R A;  1N34 M;  4I5S A;  2KRU A;  1KFV A;  3DZD A;  2AHM A;  3LQR A;  4JXJ A;  5EQT A;  2F5N A;  1HNW M;  1NY5 A;  3U6S A;  4GRI A;  4DV1 M;  3GLH B;  2DWM A;  1Q3C A;  2XF3 A;  3SYL A;  3SAS A;  5EP1 A;  1ZQ9 A;  4DV2 M;  4JI0 M;  1ZAE A;  1J5E M;  1XMQ M;  5ITR A;  3AKZ A;  4LJ4 A;  2EUC A;  5FTL A;  5EXS A;  4JI8 M;  3L25 A;  2F5O A;  3GQ4 A;  5EJC A;  5EP3 A;  2XLJ A;  4NXM M;  3JAM S;  3DOA A;  2RKO A;  3IG5 A;  2ZM6 M;  3PXG A;  3TWK A;  4P16 A;  3T15 A;  3GLI B;  4DV6 M;  1R2Z A;  3TPZ A;  1S3S A;  3TWM A;  4KHP M;  1IN4 A;  1NHW C;  1TH2 A;  4R3D A;  2CHQ A;  4NXN M;  3VKG A;  4D81 A;  4KOD A;  2M60 A;  3FTC A;  4MGY E;  3AOE A;  3D8B A;  4PDG A;  4DR1 M;  2QP9 X;  3ZH9 B;  1IN6 A;  3U6P A;  3ZC7 B;  3PNY A;  2ERC A;  1IXS B;  4LRS A;  5ITT A;  4JI1 M;  3M6A A;  4GIP A;  2DWN A;  3KOX E;  4X66 M;  3J81 S;  3I51 A;  3GPX A;  1PM5 A;  2LNH C;  3H4M A;  4QNM A;  3NWL A;  2DHR A;  4X62 M;  4AI6 A;  1L2D A;  1SXJ B;  5IT9 S;  5ITQ A;  1C1K A;  1E32 A;  4HLQ A;  3J2P B;  4X64 M;  1QAM A;  2K47 A;  4JI2 M;  4LGY A;  1GL6 A;  1D2N A;  1IQP A;  4Z8X A;  4I8O A;  2UUA M;  3K8Z A;  3FYD A;  1N33 M;  4RNA A;  3FYC A;  2C9O A;  3GLH A;  2KXE A;  5C1B A;  3HHZ A;  2I7N A;  4YY3 M;  5FTM A;  3FUX A;  4QNR A;  3HGI A;  5ITU A;  1L8Q A;  3I4V A;  4PD2 A;  2X8A A;  4B08 A;  3M7G A;  3HJQ A;  4ITQ A;  2DZO B;  3LVV A;  3HHY A;  3U5Z B;  2KZS A;  3CTW B;  2H1R A;  5IWA M;  1XNR M;  1QAN A;  4AG6 A;  2QBY A;  2C96 A;  1Q3B A;  2FFJ A;  3VK7 A;  4IBK A;  3SYK A;  3UMM A;  3J7B A;  1L1T A;  1XNQ M;  4JN6 A;  2M5Z A;  2XH9 A;  5E6J A;  3LMM A;  3FUU A;  4MGK E;  3SAV A;  5ITX E;  2Y20 A;  4QHS A;  4D82 A;  3L27 A;  3U6M A;  3GPY A;  2D7H A;  2UXC M;  4QOS A;  5KQD A;  1MX0 A;  4IJE A;  2ZAO A;  1N75 A;  1ORY B;  3CF0 A;  4DR3 M;  2DWL A;  2UUB M;  3JR5 A;  3WHL A;  3L29 A;  3FKE A;  1YE9 A;  3DA1 A;  4FWG A;  4A3V B;  5IRE B;  4IBF A;  4DV5 M;  1IM2 A;  1E94 E;  2DVW B;  2CE7 A;  3T1H M;  2BNK A;  3VLF B;  5FLX S;  1N78 A;  1GVN A;  2KW0 A;  1W5S A;  2G8L A;  4HL4 A;  5DNY A;  2CHG A;  3K92 A;  5LMN M;  4DR5 M;  5BR8 M;  4FWD A;  3SBJ A;  2L7H A;  3U61 B;  4LG2 A;  3ZCB B;  1N32 M;  1DGG A;  4MGH A;  5DYI A;  3U6C A;  2JA2 A;  2Z4R A;  1E9S A;  3AOG A;  2XSZ A;  4GHL A;  3E9S A;  1IY1 A;  2G5G X;  1QQW A;  3KP1 E;  2DXI A;  4CGY B;  4MB7 A;  1Z59 A;  4L78 A;  3UGJ A;  1DGH B;  4DR7 M;  3EIE A;  3CF2 A;  4LJ9 A;  3UJN A;  3FUT A;  3BOS A;  2LWX A;  3MHV C;  1G3I A;  1OFH A;  1G59 A;  5A2Q S;  2CV1 A;  1UM8 A;  3GPP A;  3VDP A;  3GLF B;  3U6O A;  3FUW A;  1GL7 A;  2KZU A;  2Y21 A;  5IZ7 D;  3AOE C;  7CAT A;  3J27 B;  5FTK A;  4W5W A;  4II7 A;  4L8R C;  4KO8 A;  1Z6T A;  5H37 D;  3OTO M;  1K3W A;  4OW0 A;  3EIH A;  1XXH A;  2C98 A;  4LFA M;  5KPT A;  2O5R A;  2FOI C;  2Y0Q A;  2QPA A;  3U6L A;  2L7I A;  2UUC M;  4NOO B;  2I7P A;  4B3T M;  1KSF X;  4QHT A;  3SAR A;  4LF6 M;  4AZF A;  5GKN A;  3KXE C;  3VKH A;  2XZF A;  3L28 A;  2Z4S A;  3PNV A;  1N77 A;  4NSR A;  4RF1 A;  1H6U A;  4FVM A;  4DV0 M;  3GRY A;  2CUZ A;  3L2A A;  1L2C A;  4PDI A;  2KRK A;  3GPU A;  2KA6 B;  1R7R A;  4B7F A;  4AG5 A;  4GKK M;  1QYR A;  1XHB A;  3GO8 A;  1QVR A;  3KSJ A;  1N36 M;  1IXR C;  1FJG M;  4LJ5 A;  2CHV A;  3QAU A;  4IBB A;  4L4U A;  3FTF A;  2VQE M;  4FCT A;  4GHA A;  2LXE A;  3KDS E;  3KOY E;  3VK8 A;  4JYA M;  1DGH A;  2XFT A;  3C58 A;  1JR3 A;  3HJS A;  3MJ5 A;  3HHX A;  3FTE A;  1XWI A;  1OJL A;  1G8P A;  4MGZ E;  1TDZ A;  4LZZ A;  4GKJ M;  4IIW A;  3GLF A;  2P5T A;  2Z3X A;  3SC3 A;  2LH0 A;  2D7G A;  2R62 A;  4EIW A;  1DGB A;  2RGO A;  2V1C A;  1R6B X;  3U6Q A;  1GKI A;  2A5Y B;  1SXJ E;  5LMU M;  2QCU A;  3HHW A;  1LV7 A;  4X65 M;  2XZU A;  3I4Y A;  3GLI A;  2VQF M;  4G4N A;  2XFS A;  3A42 A;  4JI3 M;  3DFZ A;  2J7N A;  4IBD A;  1NHG C;  1MU5 A;  1OFI A;  2F5Q A;  3QWL A;  4KLN A;  5ITY A;  3UK6 A;  3A98 B;  1K82 A;  5EXP A;  2F5P A;  1QAO A;  3SMS A;  3W0F A;  1VDD A;  4B7H A;  4DR6 M;  2FE8 A;  2C5R A;  2F4V M;  1NY6 A;  2R65 A;  1IY2 A;  1QAQ A;  2L6O A;  4LF4 M;  3THG A;  3U6E A;  1J09 A;  2Z7J A;  2L09 A;  3SMP A;  4XGI A;  5KPR A;  4B3S M;  4FD2 A;  3B9P A;  4GMQ A;  3KOZ E;  1SXJ A;  4M9X A;  4D80 A;  3SFZ A;  5FSW A;  3RE8 A;  1IN5 A;  5FTJ A;  8CAT A;  1L1Z A;  1HNX M;  4JI4 M;  3LQQ A;  5KO3 A;  1IBM M;  1NNU C;  2V1U A;  4LF7 M;  5EP4 A;  4CHT B;  1HR0 M;  1G41 A;  1YUB A;  4FW9 A;  2XSZ D;  1TH3 A;  4GIT A;  4JI7 M;  2R45 A;  3R9X B;  4GH9 A;  2VII A;  2R46 A;  3FUV A;  1TH4 A;  4MH0 E;  4BBA A;  1IXZ A;  1DO0 A;  3GRR A;  3ILK A;  3IG8 A;  1I4W A;  4GC5 A;  2V6Z M;  4IBJ A;  3U5Z A;  1J7K A;  2X49 A;  1L2B A;  1NNJ A;  2ZBK B;  4JV5 M;  4LJA A;  3KFU G;  3GRV A;  4LF9 M;  3KS4 A;  3PVS A;  4Z6Y A;  4R7G A;  5KQ8 A;  3AL0 C;  1W5T A;  1Z5C A;  4FCV A;  4IBI A;  3U60 B;  3KVW A;  3VFD A;  3MK6 A;  4M9Z A;  4L16 A;  2CV0 A;  3VDU A;  4LF8 M;  4BB9 A;  4PT5 A;  3HU1 A;  4NSO B;  5E26 A;  4B3R M;  3K1J A;  3HU2 A;  3NBI A;  4LFB M;  4LCB A;  4JI6 M;  1XMO M;  2HCB A;  3SHG B;  2Q2E B;  5BPV A;  3TQS A;  4LJ7 A;  3JR4 A;  1FNN A;  1XC8 A;  1Z5B A;  1JQJ C;  3AJI B;  1Z5A A;  2CFO A;  2FNA A;  2CV2 A;  4LRT A;  3GLG B;  3PFI A;  4AQY M;  3W0L B;  2ZAM A;  4B7G A;  2XEP A;  4BLC A;  2C9C A;  1YSY A;  3AV0 A;  4OVZ B;  4I4L A;  1X37 A;  3J80 S;  2QBY B;  4JI5 M;  3SAT A;  3Q8X A;  4NRV A;  3U61 A;  2R4J A;  4AKH A;  3AFH A;  3J7A S;  4OX9 M;  1HT2 E;  2KEB A;  3GQ3 A;  2UXD M;  1TGU A;  1TDH A;  4QOZ C;  3A45 A;  2ZAN A;  1IN7 A;  4DR2 M;  1IBK M;  1JR3 D;  1E9R A;  2J7O A;  3KOW E;  3A46 A;  4L15 A;  2EO2 A;  3LVW A;  1NVM A;  1G4A E;  4NL4 H;  2EA0 A;  1HT1 E;  3HWS A;  4LFC M;  4LY6 A;  4LZJ A;  4B3M M;  3GRU A;  4LGM A;  4XBO A;  1IBL M;  2QZ4 A;  1HNZ M;  4CIS A;  4MM3 B;  1KYI A;  3U60 A;  4WW0 A;  4DV7 M;  2YNM D;  3L26 A;  3RFW A;  1PJJ A;  3M0E A;  4TUW A;  2C99 A;  4AKI A;  1DO2 A;  4DUZ M;  3R8F A;  2Y0T A;  1I94 M;  4AW4 A;  2OQ4 A;  1NJG A;  4RF0 A;  3HKP A;  4G4O A;  3TWL A;  2DZN B;  5FTN A;  3U6D A;  4YHH M;  3KSX A;  4G4R A;  3SHF A;  4WUR A;  2W82 A;  1SXJ C;  4MGI E;  2YFQ A;  3GLG A;  2BJW A;  1IY0 A;  3TE6 A;  2RGH A;  4G6Z A;  3KW6 A;  4PCZ A;  2DWZ B;  4OVZ A;  4LF5 M;  4M0W A;  1WXQ A;  3TL4 X;  1SXJ D;  1GLN A;  3GP1 A;  1HQC A;  2HL7 A;  4REZ A;  3FTD A;  5EP2 A;  4M9S A;  2E5L M;  4NRW A;  4DR4 M;  5EXX A;  2F5S A;  3K2L A;  2UU9 M;  2R18 A;  1HQY E;  2R4E A;  4GC9 A;  5EXT A;  4DV4 M;  2HHH M;  4I81 A;  3RGP A;  4FCW A;  3WHK A;  2D7E A;  3HJ8 A;  1IN8 A;  2NQ8 C;  2UXB M;  4LJ8 A;  4S12 A;  1PJI A;  4LJ6 A;  2YQZ A;  3FD9 A;  4FWH A;  3RGS A;  2HKJ A;  1R2Y A;  1QZM A;  4DUY M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...