2AHMA

Crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
77
structure length
77
Chain Sequence
b'PLGSSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab, light chain
molecule tags Viral protein, replication
source organism Sars coronavirus
publication title Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer
pubmed doi rcsb
total genus 30
structure length 77
sequence length 77
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08716 nsp7 nsp7 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.370 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2ahmA00
2AHMA 1YSYA
chains in the Genus database with same CATH superfamily
1DGHA 3FRIA 1XWIA 1NNJA 2C96A 3U6CA 2K0BX 3LW5F 3SHGB 2M60A 1VDDA 2WSEF 2Z7JA 1MU5A 4DR7M 5IZ7D 5IWAM 4DR1M 4NC6A 1EIJA 1Q39A 1NJFA 3AOEA 4CGYB 3GLIB 2KZSA 1TF0B 4FWGA 3FUUA 4FW9A 3M6AA 4GHLA 2CRUA 1JB0F 1L8QA 2JY5A 1HT2E 1E9SA 1JR3A 3SYKA 5H37D 3IHPA 1CUKA 4G4OA 2F4VM 3AOEC 1E94E 2R62A 3U61B 4GITA 3VKGA 1HNXM 1VDLA 4DR4M 3TWMA 2VQEM 2HAKA 2QPAA 1XHBA 3KXEC 2JUJA 1QANA 3M0EA 2OQ4A 2F5OA 4FCWA 1GJSA 3KP0E 1IXZA 3U60B 2FFJA 2KEBA 1GVNA 3GP1A 1FNNA 3U6DA 1IN7A 2KXEA 2L6OA 3B7NA 3GLGE 1QVRA 3FUWA 1R2YA 1E9RA 3LVWA 2Y0TA 1FJGM 2YR0A 2YNMD 4RKUF 3R8FA 4B7HA 2NQ8C 2Y20A 3A45A 2QBYA 4NRWA 3J7AS 2LXEA 2Z3XA 4X65M 2KNVA 2X49A 3DA1A 5ITYA 2DVWB 4IBGA 3PNVA 5FTNA 4NXMM 2G5GX 1D0LA 3E4RA 4GC9A 2QCUA 1SG9A 5DNYA 4XK8F 3K92A 4LRTA 4MGZE 1XMOM 3FTEA 1PM5A 2OOBA 3K9PA 3LVVA 4KODA 1VG5A 5DYGA 3KVWA 1HJPA 1QZMA 5KPRA 2UU9M 1TH2A 3KFUG 4LF9M 1UFZA 4EIWA 3JR4A 3JAMS 4IBFA 3KSXA 4LFAM 4JI7M 1S3SA 3HY5A 4DUZM 2CWBA 1SXJE 2DHRA 3TQSA 5JI3E 4FCVA 1IM2A 2DXIA 4LJ7A 2K47A 4B7GA 3SAUA 1X37A 2JXNA 3NWLA 3VDPA 2ERCA 7CATA 2J7NA 3DFZA 3HGIA 1A5TA 3U6QA 2XFTA 3FYDA 3GPXA 1ZV1A 2KW0A 4LZJA 3D8LA 4QOZC 3K9OA 1Z59A 2EA0A 2D7EA 4QHTA 2R4EA 3HHWA 4LZZA 1NV9A 3K2LA 1G41A 3C58A 3AL0C 2AHMA 2R6FA 2BJWA 4QNRA 1Z5CA 3GRUA 4LJ6A 3RFWA 2RGHA 5ITXA 4LJ8A 1PJJA 2CV1A 1OJLA 3KOZE 4G4NA 4IBKA 1GL6A 3GLHE 4MH0E 3SHFA 2L2DA 3Q8GA 2VQFM 3MMPA 3U61A 1N78A 4GMQA 3HU1A 1LV7A 2HCBA 4L16A 4KT0F 3B74A 2MGWA 5EQTA 1NSFA 2KRUA 5ITQA 3T38A 5ITRA 1HQCA 1ZMVA 2JZ0A 3CTWB 4MGHA 2GNOA 4X66M 3FE3A 3H4JA 1TH3A 3KW6A 4MGKE 3U60A 1XB2B 2Z4SA 3UGJA 4DV1M 4DBGB 4S12A 3C3DA 2F5SA 2CP8A 2GQFA 1DGBA 3BOSA 4WURA 4DR2M 4L15A 3A46A 5ITTA 4LF7M 1T6OA 3DOAA 1SXJC 4REZA 2YFQA 3GLIE 2CHQA 2DZOB 3TL4X 3U6OA 4OX9M 2CUZA 2H5XA 3LQQA 3GLGB 4IBEA 1IQPA 3B7ZA 5EP1A 4YY3M 4FD2A 3L29A 1IFYA 2EO2A 2QNJA 2V6ZM 3U6SA 1QYRA 2LVAA 4AKGA 2UUBM 4I4LA 3EIEA 1TTEA 1GO5A 1QAMA 2LNHC 2VF7A 2L7IA 4R71A 1D0KA 4Z8XA 3OTOM 1PGYA 3VK7A 4OW0A 1XXHA 5KQ8A 1Z6TA 1VEJA 4CISA 1Q02A 2A5YB 2C98A 2EUCA 1IXRC 3ZCBB 1QAOA 2VIIA 3E21A 4DR3M 2O25A 2LVQD 5F3WA 3L27A 1PRBA 4LG2A 2MROB 3SMPA 4JI5M 1N36M 2O01F 2JY7A 4JI2M 3B89A 1DGFA 5C1BA 1OFHA 1LTMA 1WR1B 1ZMWA 2ZAMA 1KFVA 4K0KM 1IN8A 3M7GA 2CEAA 2JZ1A 1D2NA 3UMMA 3GLHA 4DUYM 2UUCM 3LMMA 1I4WA 2BWBA 2LTUA 3J2PB 4JI4M 2KHHA 2XZUA 5LMNM 4Z6YA 3D8BA 4FWHA 3GQ4A 2C99A 2LVNC 3ILKA 1Z5BA 3GLFA 3RE8A 2EKFA 1QQWA 2Y21A 2QQ8A 1QAQA 4DV7M 4F1IA 1PJTA 2KNAA 2KNZA 3VLFB 2F5NA 4WW0A 3QAUA 4TUWA 3TWKA 5BPVA 4W5WA 4AQYM 4ITQA 1QDRA 2DAMA 2UXCM 3IG8A 4PD2A 4JI6M 2DWZB 2MR9A 2QSFX 3RGSA 3FUXA 1WHCA 3CF6E 2FH0A 5EP4A 1NHGC 3FTDA 2LHCA 2RGOA 3CF0A 4IJFA 4JN6A 3T1HM 5EJCA 3I01M 1YE9A 3QYBA 4NXNM 2XZFA 1HNWM 2DZNB 1W5SA 1R6BX 5IREB 4L4UA 3ZC7B 1AIPC 3SASA 4P17A 5EXTA 2UXDM 3W0LB 1ORYB 1SXJD 1OTRA 2KA6B 4D81A 4JI1M 3R9XB 4IBDA 3VKHA 2JY8A 4QNMA 1QUTA 2WSFF 1J5EM 3SARA 1AUAA 4IBCA 1GABA 4G6ZA 4HEOA 4BLCA 5KO3A 4LJ9A 3PXGA 2LBCA 2JY6B 3KP1E 1QZEA 2K9DA 4ANRA 2R65A 3TPZA 3BXWA 3QYEA 3V76A 2ZBKB 3GLIA 4AKHA 1IN6A 4PCZA 3SAWA 4LY6A 1K82A 3B7QA 2OO9A 3HU2A 4GEWA 4AG5A 4B3SM 2C9CA 2LHGA 1R2ZA 3K1JA 1NJGA 3HKPA 2DWNA 3SBJA 3F92A 3Q8XA 5FLXS 4FCTA 3W67A 4BBAA 3L25A 3C9PA 2XF3A 3WHKA 2FOIC 3GLHB 3MJ5A 2R18A 1G71A 4DV4M 5KPZA 4RF0A 3HHZA 4GRIA 4ZPXA 4PDGA 5ITUA 3DZDA 1L2BA 2L4FA 3HX3A 4NSOB 5JI2E 4LCBA 1G4AE 1H6UA 2DENA 2J7OA 1HQYE 4L78A 1F4IA 4M9XA 2UUAM 1D0MA 1DGGA 2ZTDA 2LVPC 3KDSE 3U6LA 3VK8A 4JV5M 2DHYA 2ZTCA 1YLAA 3AKZA 2KZUA 2R0IA 2DAEA 5FTJA 2P5TA 3GO8A 1Q3CA 3L26A 4NL4H 2XSZA 2XEPA 1YSYA 3C3EA 2J5YA 4JI3M 4A3VB 2RKOA 3A42A 2V1CA 3PVSA 3HZJA 3MK6A 1N33M 3LQRA 2G3QA 3UJNA 3FTCA 1R4GA 3HJSA 5IT9S 1NNUC 1TGUA 4KHPM 3EIHA 1GL7A 2EJSA 4R3DA 4LF8M 1JQJC 2H1RA 4OVZB 5A2QS 2WZJA 2X8AA 2Z8YM 4DV6M 4DV2M 3FYCA 3QWLA 1EFUB 4LGMA 3JR5A 2JWSA 2Z4RA 3SC3A 1XNQM 1P3QQ 4NSRA 2BNKA 4AKIA 3FUTA 5EXSA 4B3MM 1WIVA 1WXQA 3SYLA 2XGNA 3ZH9B 1MJGM 4G3OA 1ZQ9A 2D7HA 2X4AA 3BBZA 4MM3B 4CJ6A 3GPUA 2XSZD 4DR6M 3IG5A 4I8OA 2FS1A 3HWSA 1VEKA 2N35A 3FKEA 3U5ZA 3FTFA 4B3TM 3HJ8A 3T1YM 2LWXA 1N34M 3U6PA 4LJ4A 4LJAA 3AJIB 2BJVA 2I7PA 2L09A 3L2AA 4GHAA 1GKIA 4RF1A 3TWLA 2JNHA 2LH0A 2QHOB 3E46A 4HL4A 4YHHM 4DV3M 4LF5M 4LF6M 1OQYA 3A98B 3I4VA 2YQZA 4I5SA 1SXJB 1OFIA 3TE6A 1VEGA 8CATA 4AW4A 1L1ZA 4I81A 4B08A 4HLQA 1L1TA 1JR3E 2L7HA 2DKLA 5EXPA 2DAKA 5BR8M 2DZLA 4CIZA 2QZ4A 5EP3A 3KOXE 1I94M 3GPYA 4BB9A 1OIZA 2RRUA 2MJ5B 1PJIA 4AG6A 2JA2A 1DGHB 1RU3A 1T43A 2HWJA 4AZFA 4PDIA 1ZAEA 1XXHB 3AFHA 5DFLA 1OKSA 3J7BA 4WP2A 1IBMM 1IBLM 1IY1A 1QDTA 3U5ZB 2ZAOA 4RNAA 1J7KA 1IXSA 2E5LM 4NRVA 1XC8A 1TH4A 2CV2A 1NVMA 3T15A 1JR3D 1WJ7A 3KS8A 4IBJA 1N75A 1IY2A 3NBIA 3SAVA 4IIWA 4G4QA 2CV0A 3W0FA 1OAIA 3KSJA 3J27B 4QOSA 1W5TA 2BWEA 2CFOA 4MGIE 3PFIA 5FTLA 1SXJA 3GRVA 3U6EA 5DYIA 4D82A 2L4EA 3L28A 4LJ5A 2R44A 4LGYA 1L2CA 2ZANA 3SFZA 2HL7A 4PT5A 1GLNA 3KS4A 1NV8A 1YUBA 3LCVB 1J09A 4GIPA 2XFSA 3J81S 1WGNA 2DI0A 2F5QA 4GKKM 4JXJA 1V92A 4GH9A 2G8LA 1OIPA 4X62M 2QENA 3I51A 4UN2B 5EXXA 4R7GA 1QUSA 2C5RA 1E32A 5FTKA 1HNZM 3VDUA 4JI8M 1Q3BA 1PJSA 2FNAA 1HR0M 3I4YA 3K8ZA 2W82A 1IN4A 1GJTA 3H4MA 4JI0M 3WHLA 4MGYE 3ZQJA 5FSWA 5ITXE 1EE8A 4AI6A 3GQ3A 1N32M 4L6V6 5FTMA 4M9SA 1IBKM 2WSCF 3UK6A 4FVMA 3HJQA 4OVZA 3FUVA 5EP2A 1VQ1A 4XGIA 4KLNA 1XMQM 3THGA 4IBIA 3U6MA 1T3TA 3W68A 2I7NA 3MHVC 3VFDA 3GPPA 1K3WA 2FE8A 3KOWE 1C7YA 4DR5M 2KDLA 4X64M 3RGPA 4D80A 4CHTB 4JYAM 1NHWC 4NOOB 2QP9X 2KRKA 2QBYB 3FRHA 1XNRM 1ZMUA 1NY6A 2LVOC 4M9ZA 2V1UA 3NBXX 3IECA 2OOAA 1IY0A 3CF2A 4B7FA 1G59A 1N77A 1PJQA 2ZM6M 4L8RC 1R5LA 1G8PA 2DNAA 2XH9A 4II7A 2DAGA 2DWMA 5E6JA 5KQDA 4F2LA 3AV0A 4Q7JA 3PNYA 3J80S 1HT1E 2K6BA 2Q2EB 4IBBA 1G3IA 4DV5M 4G4RA 4OU7A 4LFCM 3GQ5A 2B3TA 2O5RA 3FD9A 1MX0A 3GLGA 4LF4M 4GKJM 2UXBM 1KYIA 1DO2A 2HKJA 1IXSB 2CHGA 4P16A 2JP7A 1TR8A 1Z5AA 2DWLA 4FWDA 2F5PA 4M0DA 2DAIA 2HHHM 1R7RA 4GC5A 3B9PA 1KSFX 5E26A 4M0WA 2VDBB 3CGWA 1L2DA 1DV0A 3LCUA 3SMSA 4MB7A 1WGLA 1UM8A 1OAOC 3HU3A 2CHVA 3E9SA 3GRYA 2D7GA 2R45A 5GKNA 2R4JA 1MN3A 1V33A 2VF8A 4LRSA 1TDHA 1NO1A 1Y8GA 2R46A 3HHXA 4LFBM 1NY5A 3I04M 3HHYA 3GLFE 1XXHE 2C9OA 1V34A 2M5ZA 2OPFA 5KPTA 1IN5A 4Y28F 3GLFB 3T6PA 3SATA 5L8RF 4B3RM 1C1KA 2Y0QA 5C18A 2CE7A 4QHSA 3UZUA 1BVSA 2APLA 2MH8A 4KO8A 2EKKA 4DV0M 4XBOA 2XLJA 1K3XA 1TDZA 5LMUM 4IJEA 1DO0A 3GRRA 3AOGA 3KOYE
chains in the Genus database with same CATH topology
1DGHA 1XWIA 1NNJA 2C96A 3U6CA 3SHGB 2M60A 1VDDA 2Z7JA 1MU5A 4DR7M 5IZ7D 5IWAM 4DR1M 1Q39A 1NJFA 3AOEA 4CGYB 3GLIB 2KZSA 4FWGA 3FUUA 4FW9A 3M6AA 4GHLA 1L8QA 1HT2E 1E9SA 1JR3A 3SYKA 5H37D 4G4OA 2F4VM 3AOEC 1E94E 2R62A 3U61B 4GITA 3VKGA 1HNXM 4DR4M 3TWMA 2VQEM 2QPAA 1XHBA 3KXEC 3M0EA 1QANA 2OQ4A 2F5OA 4FCWA 3KP0E 1IXZA 3U60B 2FFJA 2KEBA 1GVNA 3GP1A 1FNNA 3U6DA 1IN7A 2KXEA 2L6OA 1QVRA 3FUWA 1R2YA 1E9RA 3LVWA 2Y0TA 1FJGM 2YR0A 2YNMD 3R8FA 4B7HA 2NQ8C 2Y20A 3A45A 2QBYA 4NRWA 3J7AS 2LXEA 2Z3XA 4X65M 2X49A 3DA1A 5ITYA 2DVWB 4IBGA 3PNVA 5FTNA 4NXMM 2G5GX 3E4RA 4GC9A 2QCUA 5DNYA 1XMOM 3K92A 4LRTA 4MGZE 3FTEA 1PM5A 4KODA 3LVVA 5KPRA 5DYGA 2UU9M 3KVWA 1QZMA 1TH2A 3KFUG 4LF9M 4EIWA 3JR4A 3JAMS 4IBFA 3KSXA 4LFAM 4JI7M 1S3SA 4DUZM 1SXJE 2DHRA 3TQSA 5JI3E 4FCVA 1IM2A 2DXIA 4LJ7A 2K47A 4B7GA 3SAUA 1X37A 3NWLA 3VDPA 2ERCA 7CATA 2J7NA 3DFZA 3HGIA 3U6QA 2XFTA 3FYDA 3GPXA 2KW0A 4LZJA 3D8LA 4QOZC 1Z59A 2EA0A 2D7EA 4QHTA 2R4EA 3HHWA 4LZZA 3K2LA 1G41A 3C58A 3AL0C 2AHMA 2BJWA 4QNRA 1Z5CA 3GRUA 4LJ6A 3RFWA 2RGHA 5ITXA 4LJ8A 1PJJA 2CV1A 1OJLA 3KOZE 4G4NA 4IBKA 1GL6A 4MH0E 3SHFA 2VQFM 3U61A 1N78A 4GMQA 3HU1A 1LV7A 2HCBA 4L16A 5EQTA 1NSFA 2KRUA 5ITQA 3T38A 5ITRA 1HQCA 4X66M 4MGHA 3CTWB 1TH3A 3KW6A 4MGKE 3U60A 2Z4SA 3UGJA 4DV1M 4S12A 2F5SA 1DGBA 3BOSA 4WURA 4DR2M 4L15A 3A46A 5ITTA 4LF7M 3DOAA 1SXJC 4REZA 2YFQA 2CHQA 2DZOB 3TL4X 3U6OA 4OX9M 2CUZA 3LQQA 3GLGB 4IBEA 1IQPA 5EP1A 4YY3M 4FD2A 3L29A 2EO2A 3U6SA 2V6ZM 1QYRA 4AKGA 2UUBM 4I4LA 3EIEA 1QAMA 2LNHC 2L7IA 4Z8XA 3OTOM 3VK7A 4OW0A 1XXHA 5KQ8A 1Z6TA 4CISA 2A5YB 2C98A 2EUCA 1IXRC 3ZCBB 1QAOA 2VIIA 4DR3M 5F3WA 3L27A 4LG2A 3SMPA 4JI5M 1N36M 4JI2M 1DGFA 5C1BA 1OFHA 2ZAMA 4K0KM 1KFVA 1IN8A 3M7GA 2CEAA 1D2NA 3UMMA 3GLHA 4DUYM 2UUCM 3LMMA 1I4WA 3J2PB 4JI4M 2XZUA 5LMNM 4Z6YA 3D8BA 4FWHA 3GQ4A 2C99A 3ILKA 3GLFA 1Z5BA 3RE8A 2Y21A 1QQWA 1QAQA 4DV7M 3VLFB 2F5NA 4WW0A 3QAUA 4TUWA 3TWKA 5BPVA 4W5WA 4AQYM 4ITQA 2UXCM 3IG8A 4PD2A 4JI6M 2DWZB 3RGSA 3FUXA 3CF6E 5EP4A 1NHGC 3FTDA 2RGOA 3CF0A 4IJFA 4JN6A 3T1HM 5EJCA 1YE9A 4NXNM 1HNWM 2XZFA 2DZNB 1W5SA 1R6BX 5IREB 4L4UA 3ZC7B 3SASA 2UXDM 5EXTA 3W0LB 1ORYB 1SXJD 2KA6B 4D81A 4JI1M 3R9XB 4IBDA 3VKHA 4QNMA 1J5EM 3SARA 4IBCA 4G6ZA 4BLCA 5KO3A 4LJ9A 3PXGA 3KP1E 2R65A 3TPZA 2ZBKB 3GLIA 4AKHA 1IN6A 4PCZA 3SAWA 4LY6A 1K82A 3HU2A 4AG5A 4B3SM 2C9CA 1R2ZA 3K1JA 1NJGA 3HKPA 2DWNA 3SBJA 3Q8XA 5FLXS 4FCTA 4BBAA 3L25A 2XF3A 3WHKA 2FOIC 3GLHB 3MJ5A 2R18A 4DV4M 5KPZA 4RF0A 3HHZA 4GRIA 4ZPXA 4PDGA 5ITUA 3DZDA 1L2BA 4NSOB 5JI2E 4LCBA 1G4AE 1H6UA 2J7OA 4L78A 1HQYE 4M9XA 2UUAM 1DGGA 3U6LA 3KDSE 3VK8A 4JV5M 3AKZA 2KZUA 5FTJA 2P5TA 3GO8A 1Q3CA 3L26A 4NL4H 2XSZA 2XEPA 1YSYA 4JI3M 4A3VB 2RKOA 3A42A 2V1CA 3PVSA 3MK6A 1N33M 3LQRA 3UJNA 3FTCA 3HJSA 5IT9S 1NNUC 1TGUA 4KHPM 3EIHA 1GL7A 4R3DA 4LF8M 1JQJC 2H1RA 4OVZB 5A2QS 2X8AA 4DV6M 4DV2M 3FYCA 3QWLA 4LGMA 3JR5A 2Z4RA 3SC3A 1XNQM 4NSRA 2BNKA 4AKIA 3FUTA 5EXSA 4B3MM 1WXQA 3SYLA 2XGNA 3ZH9B 1ZQ9A 2D7HA 2X4AA 4MM3B 3GPUA 4DR6M 2XSZD 3IG5A 4I8OA 3HWSA 3FTFA 3FKEA 3U5ZA 4B3TM 3HJ8A 3T1YM 2LWXA 1N34M 3U6PA 4LJ4A 4LJAA 3AJIB 2BJVA 2I7PA 2L09A 3L2AA 4GHAA 1GKIA 4RF1A 3TWLA 2LH0A 4HL4A 4DV3M 4YHHM 4LF5M 4LF6M 3A98B 3I4VA 2YQZA 4I5SA 1SXJB 1OFIA 3TE6A 8CATA 4AW4A 1L1ZA 4I81A 4B08A 4HLQA 1L1TA 5EXPA 2L7HA 5BR8M 2QZ4A 5EP3A 3KOXE 1I94M 3GPYA 4BB9A 1PJIA 4AG6A 2JA2A 1DGHB 4AZFA 4PDIA 1ZAEA 1XXHB 3AFHA 3J7BA 1IBMM 1IBLM 1IY1A 3U5ZB 2ZAOA 4RNAA 1J7KA 2E5LM 4NRVA 1XC8A 1TH4A 2CV2A 1NVMA 3T15A 1JR3D 3KS8A 4IBJA 1N75A 1IY2A 3NBIA 3SAVA 4IIWA 4G4QA 2CV0A 3W0FA 3KSJA 3J27B 4QOSA 1W5TA 2CFOA 4MGIE 3PFIA 5FTLA 1SXJA 3GRVA 3U6EA 5DYIA 4D82A 3L28A 4LJ5A 4LGYA 1L2CA 2ZANA 3SFZA 2HL7A 4PT5A 1GLNA 3KS4A 1YUBA 1J09A 4GIPA 2XFSA 3J81S 2F5QA 4GKKM 4JXJA 4GH9A 2G8LA 4X62M 2QENA 3I51A 5EXXA 4R7GA 2C5RA 1E32A 5FTKA 1HNZM 3VDUA 4JI8M 1Q3BA 1HR0M 2FNAA 3I4YA 3K8ZA 2W82A 1IN4A 3H4MA 4JI0M 3WHLA 5FSWA 4MGYE 4AI6A 5ITXE 1EE8A 3GQ3A 1N32M 5FTMA 4M9SA 1IBKM 3UK6A 4FVMA 3HJQA 4OVZA 3FUVA 5EP2A 4XGIA 4KLNA 1XMQM 3THGA 4IBIA 3U6MA 1T3TA 2I7NA 3MHVC 3VFDA 3GPPA 1K3WA 2FE8A 3KOWE 4DR5M 4X64M 3RGPA 4D80A 4CHTB 4JYAM 1NHWC 4NOOB 2QP9X 2KRKA 2QBYB 1XNRM 1NY6A 4M9ZA 2V1UA 1IY0A 3CF2A 4B7FA 1G59A 1N77A 2ZM6M 4L8RC 1G8PA 4II7A 2XH9A 2DWMA 5E6JA 5KQDA 3AV0A 3PNYA 3J80S 1HT1E 2Q2EB 4IBBA 1G3IA 4DV5M 4G4RA 4OU7A 4LFCM 3GQ5A 2O5RA 3FD9A 1MX0A 3GLGA 4LF4M 4GKJM 2UXBM 1KYIA 1DO2A 2HKJA 1IXSB 2CHGA 4P16A 1Z5AA 2DWLA 4FWDA 2F5PA 4M0DA 2HHHM 1R7RA 4GC5A 3B9PA 1KSFX 5E26A 4M0WA 1L2DA 3SMSA 4MB7A 1UM8A 3HU3A 2CHVA 3E9SA 3GRYA 2D7GA 2R45A 5GKNA 2R4JA 4LRSA 1TDHA 2R46A 3HHXA 4LFBM 1NY5A 3HHYA 2C9OA 2M5ZA 2OPFA 5KPTA 1IN5A 3GLFB 3SATA 4B3RM 1C1KA 2Y0QA 5C18A 2CE7A 4QHSA 3UZUA 4KO8A 4DV0M 4XBOA 2XLJA 1K3XA 1TDZA 5LMUM 4IJEA 1DO0A 3GRRA 3AOGA 3KOYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHM A;  1YSY A; 
#chains in the Genus database with same CATH topology
 1DGH A;  3FRI A;  1XWI A;  1NNJ A;  2C96 A;  3U6C A;  2K0B X;  3LW5 F;  3SHG B;  2M60 A;  1VDD A;  2WSE F;  2Z7J A;  1MU5 A;  4DR7 M;  5IZ7 D;  5IWA M;  4DR1 M;  4NC6 A;  1EIJ A;  1Q39 A;  1NJF A;  3AOE A;  4CGY B;  3GLI B;  2KZS A;  1TF0 B;  4FWG A;  3FUU A;  4FW9 A;  3M6A A;  4GHL A;  2CRU A;  1JB0 F;  1L8Q A;  2JY5 A;  1HT2 E;  1E9S A;  1JR3 A;  3SYK A;  5H37 D;  3IHP A;  1CUK A;  4G4O A;  2F4V M;  3AOE C;  1E94 E;  2R62 A;  3U61 B;  4GIT A;  3VKG A;  1HNX M;  1VDL A;  4DR4 M;  3TWM A;  2VQE M;  2HAK A;  2QPA A;  1XHB A;  3KXE C;  2JUJ A;  1QAN A;  3M0E A;  2OQ4 A;  2F5O A;  4FCW A;  1GJS A;  3KP0 E;  1IXZ A;  3U60 B;  2FFJ A;  2KEB A;  1GVN A;  3GP1 A;  1FNN A;  3U6D A;  1IN7 A;  2KXE A;  2L6O A;  3B7N A;  3GLG E;  1QVR A;  3FUW A;  1R2Y A;  1E9R A;  3LVW A;  2Y0T A;  1FJG M;  2YR0 A;  2YNM D;  4RKU F;  3R8F A;  4B7H A;  2NQ8 C;  2Y20 A;  3A45 A;  2QBY A;  4NRW A;  3J7A S;  2LXE A;  2Z3X A;  4X65 M;  2KNV A;  2X49 A;  3DA1 A;  5ITY A;  2DVW B;  4IBG A;  3PNV A;  5FTN A;  4NXM M;  2G5G X;  1D0L A;  3E4R A;  4GC9 A;  2QCU A;  1SG9 A;  5DNY A;  4XK8 F;  3K92 A;  4LRT A;  4MGZ E;  1XMO M;  3FTE A;  1PM5 A;  2OOB A;  3K9P A;  3LVV A;  4KOD A;  1VG5 A;  5DYG A;  3KVW A;  1HJP A;  1QZM A;  5KPR A;  2UU9 M;  1TH2 A;  3KFU G;  4LF9 M;  1UFZ A;  4EIW A;  3JR4 A;  3JAM S;  4IBF A;  3KSX A;  4LFA M;  4JI7 M;  1S3S A;  3HY5 A;  4DUZ M;  2CWB A;  1SXJ E;  2DHR A;  3TQS A;  5JI3 E;  4FCV A;  1IM2 A;  2DXI A;  4LJ7 A;  2K47 A;  4B7G A;  3SAU A;  1X37 A;  2JXN A;  3NWL A;  3VDP A;  2ERC A;  7CAT A;  2J7N A;  3DFZ A;  3HGI A;  1A5T A;  3U6Q A;  2XFT A;  3FYD A;  3GPX A;  1ZV1 A;  2KW0 A;  4LZJ A;  3D8L A;  4QOZ C;  3K9O A;  1Z59 A;  2EA0 A;  2D7E A;  4QHT A;  2R4E A;  3HHW A;  4LZZ A;  1NV9 A;  3K2L A;  1G41 A;  3C58 A;  3AL0 C;  2AHM A;  2R6F A;  2BJW A;  4QNR A;  1Z5C A;  3GRU A;  4LJ6 A;  3RFW A;  2RGH A;  5ITX A;  4LJ8 A;  1PJJ A;  2CV1 A;  1OJL A;  3KOZ E;  4G4N A;  4IBK A;  1GL6 A;  3GLH E;  4MH0 E;  3SHF A;  2L2D A;  3Q8G A;  2VQF M;  3MMP A;  3U61 A;  1N78 A;  4GMQ A;  3HU1 A;  1LV7 A;  2HCB A;  4L16 A;  4KT0 F;  3B74 A;  2MGW A;  5EQT A;  1NSF A;  2KRU A;  5ITQ A;  3T38 A;  5ITR A;  1HQC A;  1ZMV A;  2JZ0 A;  3CTW B;  4MGH A;  2GNO A;  4X66 M;  3FE3 A;  3H4J A;  1TH3 A;  3KW6 A;  4MGK E;  3U60 A;  1XB2 B;  2Z4S A;  3UGJ A;  4DV1 M;  4DBG B;  4S12 A;  3C3D A;  2F5S A;  2CP8 A;  2GQF A;  1DGB A;  3BOS A;  4WUR A;  4DR2 M;  4L15 A;  3A46 A;  5ITT A;  4LF7 M;  1T6O A;  3DOA A;  1SXJ C;  4REZ A;  2YFQ A;  3GLI E;  2CHQ A;  2DZO B;  3TL4 X;  3U6O A;  4OX9 M;  2CUZ A;  2H5X A;  3LQQ A;  3GLG B;  4IBE A;  1IQP A;  3B7Z A;  5EP1 A;  4YY3 M;  4FD2 A;  3L29 A;  1IFY A;  2EO2 A;  2QNJ A;  2V6Z M;  3U6S A;  1QYR A;  2LVA A;  4AKG A;  2UUB M;  4I4L A;  3EIE A;  1TTE A;  1GO5 A;  1QAM A;  2LNH C;  2VF7 A;  2L7I A;  4R71 A;  1D0K A;  4Z8X A;  3OTO M;  1PGY A;  3VK7 A;  4OW0 A;  1XXH A;  5KQ8 A;  1Z6T A;  1VEJ A;  4CIS A;  1Q02 A;  2A5Y B;  2C98 A;  2EUC A;  1IXR C;  3ZCB B;  1QAO A;  2VII A;  3E21 A;  4DR3 M;  2O25 A;  2LVQ D;  5F3W A;  3L27 A;  1PRB A;  4LG2 A;  2MRO B;  3SMP A;  4JI5 M;  1N36 M;  2O01 F;  2JY7 A;  4JI2 M;  3B89 A;  1DGF A;  5C1B A;  1OFH A;  1LTM A;  1WR1 B;  1ZMW A;  2ZAM A;  1KFV A;  4K0K M;  1IN8 A;  3M7G A;  2CEA A;  2JZ1 A;  1D2N A;  3UMM A;  3GLH A;  4DUY M;  2UUC M;  3LMM A;  1I4W A;  2BWB A;  2LTU A;  3J2P B;  4JI4 M;  2KHH A;  2XZU A;  5LMN M;  4Z6Y A;  3D8B A;  4FWH A;  3GQ4 A;  2C99 A;  2LVN C;  3ILK A;  1Z5B A;  3GLF A;  3RE8 A;  2EKF A;  1QQW A;  2Y21 A;  2QQ8 A;  1QAQ A;  4DV7 M;  4F1I A;  1PJT A;  2KNA A;  2KNZ A;  3VLF B;  2F5N A;  4WW0 A;  3QAU A;  4TUW A;  3TWK A;  5BPV A;  4W5W A;  4AQY M;  4ITQ A;  1QDR A;  2DAM A;  2UXC M;  3IG8 A;  4PD2 A;  4JI6 M;  2DWZ B;  2MR9 A;  2QSF X;  3RGS A;  3FUX A;  1WHC A;  3CF6 E;  2FH0 A;  5EP4 A;  1NHG C;  3FTD A;  2LHC A;  2RGO A;  3CF0 A;  4IJF A;  4JN6 A;  3T1H M;  5EJC A;  3I01 M;  1YE9 A;  3QYB A;  4NXN M;  2XZF A;  1HNW M;  2DZN B;  1W5S A;  1R6B X;  5IRE B;  4L4U A;  3ZC7 B;  1AIP C;  3SAS A;  4P17 A;  5EXT A;  2UXD M;  3W0L B;  1ORY B;  1SXJ D;  1OTR A;  2KA6 B;  4D81 A;  4JI1 M;  3R9X B;  4IBD A;  3VKH A;  2JY8 A;  4QNM A;  1QUT A;  2WSF F;  1J5E M;  3SAR A;  1AUA A;  4IBC A;  1GAB A;  4G6Z A;  4HEO A;  4BLC A;  5KO3 A;  4LJ9 A;  3PXG A;  2LBC A;  2JY6 B;  3KP1 E;  1QZE A;  2K9D A;  4ANR A;  2R65 A;  3TPZ A;  3BXW A;  3QYE A;  3V76 A;  2ZBK B;  3GLI A;  4AKH A;  1IN6 A;  4PCZ A;  3SAW A;  4LY6 A;  1K82 A;  3B7Q A;  2OO9 A;  3HU2 A;  4GEW A;  4AG5 A;  4B3S M;  2C9C A;  2LHG A;  1R2Z A;  3K1J A;  1NJG A;  3HKP A;  2DWN A;  3SBJ A;  3F92 A;  3Q8X A;  5FLX S;  4FCT A;  3W67 A;  4BBA A;  3L25 A;  3C9P A;  2XF3 A;  3WHK A;  2FOI C;  3GLH B;  3MJ5 A;  2R18 A;  1G71 A;  4DV4 M;  5KPZ A;  4RF0 A;  3HHZ A;  4GRI A;  4ZPX A;  4PDG A;  5ITU A;  3DZD A;  1L2B A;  2L4F A;  3HX3 A;  4NSO B;  5JI2 E;  4LCB A;  1G4A E;  1H6U A;  2DEN A;  2J7O A;  1HQY E;  4L78 A;  1F4I A;  4M9X A;  2UUA M;  1D0M A;  1DGG A;  2ZTD A;  2LVP C;  3KDS E;  3U6L A;  3VK8 A;  4JV5 M;  2DHY A;  2ZTC A;  1YLA A;  3AKZ A;  2KZU A;  2R0I A;  2DAE A;  5FTJ A;  2P5T A;  3GO8 A;  1Q3C A;  3L26 A;  4NL4 H;  2XSZ A;  2XEP A;  1YSY A;  3C3E A;  2J5Y A;  4JI3 M;  4A3V B;  2RKO A;  3A42 A;  2V1C A;  3PVS A;  3HZJ A;  3MK6 A;  1N33 M;  3LQR A;  2G3Q A;  3UJN A;  3FTC A;  1R4G A;  3HJS A;  5IT9 S;  1NNU C;  1TGU A;  4KHP M;  3EIH A;  1GL7 A;  2EJS A;  4R3D A;  4LF8 M;  1JQJ C;  2H1R A;  4OVZ B;  5A2Q S;  2WZJ A;  2X8A A;  2Z8Y M;  4DV6 M;  4DV2 M;  3FYC A;  3QWL A;  1EFU B;  4LGM A;  3JR5 A;  2JWS A;  2Z4R A;  3SC3 A;  1XNQ M;  1P3Q Q;  4NSR A;  2BNK A;  4AKI A;  3FUT A;  5EXS A;  4B3M M;  1WIV A;  1WXQ A;  3SYL A;  2XGN A;  3ZH9 B;  1MJG M;  4G3O A;  1ZQ9 A;  2D7H A;  2X4A A;  3BBZ A;  4MM3 B;  4CJ6 A;  3GPU A;  2XSZ D;  4DR6 M;  3IG5 A;  4I8O A;  2FS1 A;  3HWS A;  1VEK A;  2N35 A;  3FKE A;  3U5Z A;  3FTF A;  4B3T M;  3HJ8 A;  3T1Y M;  2LWX A;  1N34 M;  3U6P A;  4LJ4 A;  4LJA A;  3AJI B;  2BJV A;  2I7P A;  2L09 A;  3L2A A;  4GHA A;  1GKI A;  4RF1 A;  3TWL A;  2JNH A;  2LH0 A;  2QHO B;  3E46 A;  4HL4 A;  4YHH M;  4DV3 M;  4LF5 M;  4LF6 M;  1OQY A;  3A98 B;  3I4V A;  2YQZ A;  4I5S A;  1SXJ B;  1OFI A;  3TE6 A;  1VEG A;  8CAT A;  4AW4 A;  1L1Z A;  4I81 A;  4B08 A;  4HLQ A;  1L1T A;  1JR3 E;  2L7H A;  2DKL A;  5EXP A;  2DAK A;  5BR8 M;  2DZL A;  4CIZ A;  2QZ4 A;  5EP3 A;  3KOX E;  1I94 M;  3GPY A;  4BB9 A;  1OIZ A;  2RRU A;  2MJ5 B;  1PJI A;  4AG6 A;  2JA2 A;  1DGH B;  1RU3 A;  1T43 A;  2HWJ A;  4AZF A;  4PDI A;  1ZAE A;  1XXH B;  3AFH A;  5DFL A;  1OKS A;  3J7B A;  4WP2 A;  1IBM M;  1IBL M;  1IY1 A;  1QDT A;  3U5Z B;  2ZAO A;  4RNA A;  1J7K A;  1IXS A;  2E5L M;  4NRV A;  1XC8 A;  1TH4 A;  2CV2 A;  1NVM A;  3T15 A;  1JR3 D;  1WJ7 A;  3KS8 A;  4IBJ A;  1N75 A;  1IY2 A;  3NBI A;  3SAV A;  4IIW A;  4G4Q A;  2CV0 A;  3W0F A;  1OAI A;  3KSJ A;  3J27 B;  4QOS A;  1W5T A;  2BWE A;  2CFO A;  4MGI E;  3PFI A;  5FTL A;  1SXJ A;  3GRV A;  3U6E A;  5DYI A;  4D82 A;  2L4E A;  3L28 A;  4LJ5 A;  2R44 A;  4LGY A;  1L2C A;  2ZAN A;  3SFZ A;  2HL7 A;  4PT5 A;  1GLN A;  3KS4 A;  1NV8 A;  1YUB A;  3LCV B;  1J09 A;  4GIP A;  2XFS A;  3J81 S;  1WGN A;  2DI0 A;  2F5Q A;  4GKK M;  4JXJ A;  1V92 A;  4GH9 A;  2G8L A;  1OIP A;  4X62 M;  2QEN A;  3I51 A;  4UN2 B;  5EXX A;  4R7G A;  1QUS A;  2C5R A;  1E32 A;  5FTK A;  1HNZ M;  3VDU A;  4JI8 M;  1Q3B A;  1PJS A;  2FNA A;  1HR0 M;  3I4Y A;  3K8Z A;  2W82 A;  1IN4 A;  1GJT A;  3H4M A;  4JI0 M;  3WHL A;  4MGY E;  3ZQJ A;  5FSW A;  5ITX E;  1EE8 A;  4AI6 A;  3GQ3 A;  1N32 M;  4L6V 6;  5FTM A;  4M9S A;  1IBK M;  2WSC F;  3UK6 A;  4FVM A;  3HJQ A;  4OVZ A;  3FUV A;  5EP2 A;  1VQ1 A;  4XGI A;  4KLN A;  1XMQ M;  3THG A;  4IBI A;  3U6M A;  1T3T A;  3W68 A;  2I7N A;  3MHV C;  3VFD A;  3GPP A;  1K3W A;  2FE8 A;  3KOW E;  1C7Y A;  4DR5 M;  2KDL A;  4X64 M;  3RGP A;  4D80 A;  4CHT B;  4JYA M;  1NHW C;  4NOO B;  2QP9 X;  2KRK A;  2QBY B;  3FRH A;  1XNR M;  1ZMU A;  1NY6 A;  2LVO C;  4M9Z A;  2V1U A;  3NBX X;  3IEC A;  2OOA A;  1IY0 A;  3CF2 A;  4B7F A;  1G59 A;  1N77 A;  1PJQ A;  2ZM6 M;  4L8R C;  1R5L A;  1G8P A;  2DNA A;  2XH9 A;  4II7 A;  2DAG A;  2DWM A;  5E6J A;  5KQD A;  4F2L A;  3AV0 A;  4Q7J A;  3PNY A;  3J80 S;  1HT1 E;  2K6B A;  2Q2E B;  4IBB A;  1G3I A;  4DV5 M;  4G4R A;  4OU7 A;  4LFC M;  3GQ5 A;  2B3T A;  2O5R A;  3FD9 A;  1MX0 A;  3GLG A;  4LF4 M;  4GKJ M;  2UXB M;  1KYI A;  1DO2 A;  2HKJ A;  1IXS B;  2CHG A;  4P16 A;  2JP7 A;  1TR8 A;  1Z5A A;  2DWL A;  4FWD A;  2F5P A;  4M0D A;  2DAI A;  2HHH M;  1R7R A;  4GC5 A;  3B9P A;  1KSF X;  5E26 A;  4M0W A;  2VDB B;  3CGW A;  1L2D A;  1DV0 A;  3LCU A;  3SMS A;  4MB7 A;  1WGL A;  1UM8 A;  1OAO C;  3HU3 A;  2CHV A;  3E9S A;  3GRY A;  2D7G A;  2R45 A;  5GKN A;  2R4J A;  1MN3 A;  1V33 A;  2VF8 A;  4LRS A;  1TDH A;  1NO1 A;  1Y8G A;  2R46 A;  3HHX A;  4LFB M;  1NY5 A;  3I04 M;  3HHY A;  3GLF E;  1XXH E;  2C9O A;  1V34 A;  2M5Z A;  2OPF A;  5KPT A;  1IN5 A;  4Y28 F;  3GLF B;  3T6P A;  3SAT A;  5L8R F;  4B3R M;  1C1K A;  2Y0Q A;  5C18 A;  2CE7 A;  4QHS A;  3UZU A;  1BVS A;  2APL A;  2MH8 A;  4KO8 A;  2EKK A;  4DV0 M;  4XBO A;  2XLJ A;  1K3X A;  1TDZ A;  5LMU M;  4IJE A;  1DO0 A;  3GRR A;  3AOG A;  3KOY E; 
#chains in the Genus database with same CATH homology
 1DGH A;  1XWI A;  1NNJ A;  2C96 A;  3U6C A;  3SHG B;  2M60 A;  1VDD A;  2Z7J A;  1MU5 A;  4DR7 M;  5IZ7 D;  5IWA M;  4DR1 M;  1Q39 A;  1NJF A;  3AOE A;  4CGY B;  3GLI B;  2KZS A;  4FWG A;  3FUU A;  4FW9 A;  3M6A A;  4GHL A;  1L8Q A;  1HT2 E;  1E9S A;  1JR3 A;  3SYK A;  5H37 D;  4G4O A;  2F4V M;  3AOE C;  1E94 E;  2R62 A;  3U61 B;  4GIT A;  3VKG A;  1HNX M;  4DR4 M;  3TWM A;  2VQE M;  2QPA A;  1XHB A;  3KXE C;  3M0E A;  1QAN A;  2OQ4 A;  2F5O A;  4FCW A;  3KP0 E;  1IXZ A;  3U60 B;  2FFJ A;  2KEB A;  1GVN A;  3GP1 A;  1FNN A;  3U6D A;  1IN7 A;  2KXE A;  2L6O A;  1QVR A;  3FUW A;  1R2Y A;  1E9R A;  3LVW A;  2Y0T A;  1FJG M;  2YR0 A;  2YNM D;  3R8F A;  4B7H A;  2NQ8 C;  2Y20 A;  3A45 A;  2QBY A;  4NRW A;  3J7A S;  2LXE A;  2Z3X A;  4X65 M;  2X49 A;  3DA1 A;  5ITY A;  2DVW B;  4IBG A;  3PNV A;  5FTN A;  4NXM M;  2G5G X;  3E4R A;  4GC9 A;  2QCU A;  5DNY A;  1XMO M;  3K92 A;  4LRT A;  4MGZ E;  3FTE A;  1PM5 A;  4KOD A;  3LVV A;  5KPR A;  5DYG A;  2UU9 M;  3KVW A;  1QZM A;  1TH2 A;  3KFU G;  4LF9 M;  4EIW A;  3JR4 A;  3JAM S;  4IBF A;  3KSX A;  4LFA M;  4JI7 M;  1S3S A;  4DUZ M;  1SXJ E;  2DHR A;  3TQS A;  5JI3 E;  4FCV A;  1IM2 A;  2DXI A;  4LJ7 A;  2K47 A;  4B7G A;  3SAU A;  1X37 A;  3NWL A;  3VDP A;  2ERC A;  7CAT A;  2J7N A;  3DFZ A;  3HGI A;  3U6Q A;  2XFT A;  3FYD A;  3GPX A;  2KW0 A;  4LZJ A;  3D8L A;  4QOZ C;  1Z59 A;  2EA0 A;  2D7E A;  4QHT A;  2R4E A;  3HHW A;  4LZZ A;  3K2L A;  1G41 A;  3C58 A;  3AL0 C;  2AHM A;  2BJW A;  4QNR A;  1Z5C A;  3GRU A;  4LJ6 A;  3RFW A;  2RGH A;  5ITX A;  4LJ8 A;  1PJJ A;  2CV1 A;  1OJL A;  3KOZ E;  4G4N A;  4IBK A;  1GL6 A;  4MH0 E;  3SHF A;  2VQF M;  3U61 A;  1N78 A;  4GMQ A;  3HU1 A;  1LV7 A;  2HCB A;  4L16 A;  5EQT A;  1NSF A;  2KRU A;  5ITQ A;  3T38 A;  5ITR A;  1HQC A;  4X66 M;  4MGH A;  3CTW B;  1TH3 A;  3KW6 A;  4MGK E;  3U60 A;  2Z4S A;  3UGJ A;  4DV1 M;  4S12 A;  2F5S A;  1DGB A;  3BOS A;  4WUR A;  4DR2 M;  4L15 A;  3A46 A;  5ITT A;  4LF7 M;  3DOA A;  1SXJ C;  4REZ A;  2YFQ A;  2CHQ A;  2DZO B;  3TL4 X;  3U6O A;  4OX9 M;  2CUZ A;  3LQQ A;  3GLG B;  4IBE A;  1IQP A;  5EP1 A;  4YY3 M;  4FD2 A;  3L29 A;  2EO2 A;  3U6S A;  2V6Z M;  1QYR A;  4AKG A;  2UUB M;  4I4L A;  3EIE A;  1QAM A;  2LNH C;  2L7I A;  4Z8X A;  3OTO M;  3VK7 A;  4OW0 A;  1XXH A;  5KQ8 A;  1Z6T A;  4CIS A;  2A5Y B;  2C98 A;  2EUC A;  1IXR C;  3ZCB B;  1QAO A;  2VII A;  4DR3 M;  5F3W A;  3L27 A;  4LG2 A;  3SMP A;  4JI5 M;  1N36 M;  4JI2 M;  1DGF A;  5C1B A;  1OFH A;  2ZAM A;  4K0K M;  1KFV A;  1IN8 A;  3M7G A;  2CEA A;  1D2N A;  3UMM A;  3GLH A;  4DUY M;  2UUC M;  3LMM A;  1I4W A;  3J2P B;  4JI4 M;  2XZU A;  5LMN M;  4Z6Y A;  3D8B A;  4FWH A;  3GQ4 A;  2C99 A;  3ILK A;  3GLF A;  1Z5B A;  3RE8 A;  2Y21 A;  1QQW A;  1QAQ A;  4DV7 M;  3VLF B;  2F5N A;  4WW0 A;  3QAU A;  4TUW A;  3TWK A;  5BPV A;  4W5W A;  4AQY M;  4ITQ A;  2UXC M;  3IG8 A;  4PD2 A;  4JI6 M;  2DWZ B;  3RGS A;  3FUX A;  3CF6 E;  5EP4 A;  1NHG C;  3FTD A;  2RGO A;  3CF0 A;  4IJF A;  4JN6 A;  3T1H M;  5EJC A;  1YE9 A;  4NXN M;  1HNW M;  2XZF A;  2DZN B;  1W5S A;  1R6B X;  5IRE B;  4L4U A;  3ZC7 B;  3SAS A;  2UXD M;  5EXT A;  3W0L B;  1ORY B;  1SXJ D;  2KA6 B;  4D81 A;  4JI1 M;  3R9X B;  4IBD A;  3VKH A;  4QNM A;  1J5E M;  3SAR A;  4IBC A;  4G6Z A;  4BLC A;  5KO3 A;  4LJ9 A;  3PXG A;  3KP1 E;  2R65 A;  3TPZ A;  2ZBK B;  3GLI A;  4AKH A;  1IN6 A;  4PCZ A;  3SAW A;  4LY6 A;  1K82 A;  3HU2 A;  4AG5 A;  4B3S M;  2C9C A;  1R2Z A;  3K1J A;  1NJG A;  3HKP A;  2DWN A;  3SBJ A;  3Q8X A;  5FLX S;  4FCT A;  4BBA A;  3L25 A;  2XF3 A;  3WHK A;  2FOI C;  3GLH B;  3MJ5 A;  2R18 A;  4DV4 M;  5KPZ A;  4RF0 A;  3HHZ A;  4GRI A;  4ZPX A;  4PDG A;  5ITU A;  3DZD A;  1L2B A;  4NSO B;  5JI2 E;  4LCB A;  1G4A E;  1H6U A;  2J7O A;  4L78 A;  1HQY E;  4M9X A;  2UUA M;  1DGG A;  3U6L A;  3KDS E;  3VK8 A;  4JV5 M;  3AKZ A;  2KZU A;  5FTJ A;  2P5T A;  3GO8 A;  1Q3C A;  3L26 A;  4NL4 H;  2XSZ A;  2XEP A;  1YSY A;  4JI3 M;  4A3V B;  2RKO A;  3A42 A;  2V1C A;  3PVS A;  3MK6 A;  1N33 M;  3LQR A;  3UJN A;  3FTC A;  3HJS A;  5IT9 S;  1NNU C;  1TGU A;  4KHP M;  3EIH A;  1GL7 A;  4R3D A;  4LF8 M;  1JQJ C;  2H1R A;  4OVZ B;  5A2Q S;  2X8A A;  4DV6 M;  4DV2 M;  3FYC A;  3QWL A;  4LGM A;  3JR5 A;  2Z4R A;  3SC3 A;  1XNQ M;  4NSR A;  2BNK A;  4AKI A;  3FUT A;  5EXS A;  4B3M M;  1WXQ A;  3SYL A;  2XGN A;  3ZH9 B;  1ZQ9 A;  2D7H A;  2X4A A;  4MM3 B;  3GPU A;  4DR6 M;  2XSZ D;  3IG5 A;  4I8O A;  3HWS A;  3FTF A;  3FKE A;  3U5Z A;  4B3T M;  3HJ8 A;  3T1Y M;  2LWX A;  1N34 M;  3U6P A;  4LJ4 A;  4LJA A;  3AJI B;  2BJV A;  2I7P A;  2L09 A;  3L2A A;  4GHA A;  1GKI A;  4RF1 A;  3TWL A;  2LH0 A;  4HL4 A;  4DV3 M;  4YHH M;  4LF5 M;  4LF6 M;  3A98 B;  3I4V A;  2YQZ A;  4I5S A;  1SXJ B;  1OFI A;  3TE6 A;  8CAT A;  4AW4 A;  1L1Z A;  4I81 A;  4B08 A;  4HLQ A;  1L1T A;  5EXP A;  2L7H A;  5BR8 M;  2QZ4 A;  5EP3 A;  3KOX E;  1I94 M;  3GPY A;  4BB9 A;  1PJI A;  4AG6 A;  2JA2 A;  1DGH B;  4AZF A;  4PDI A;  1ZAE A;  1XXH B;  3AFH A;  3J7B A;  1IBM M;  1IBL M;  1IY1 A;  3U5Z B;  2ZAO A;  4RNA A;  1J7K A;  2E5L M;  4NRV A;  1XC8 A;  1TH4 A;  2CV2 A;  1NVM A;  3T15 A;  1JR3 D;  3KS8 A;  4IBJ A;  1N75 A;  1IY2 A;  3NBI A;  3SAV A;  4IIW A;  4G4Q A;  2CV0 A;  3W0F A;  3KSJ A;  3J27 B;  4QOS A;  1W5T A;  2CFO A;  4MGI E;  3PFI A;  5FTL A;  1SXJ A;  3GRV A;  3U6E A;  5DYI A;  4D82 A;  3L28 A;  4LJ5 A;  4LGY A;  1L2C A;  2ZAN A;  3SFZ A;  2HL7 A;  4PT5 A;  1GLN A;  3KS4 A;  1YUB A;  1J09 A;  4GIP A;  2XFS A;  3J81 S;  2F5Q A;  4GKK M;  4JXJ A;  4GH9 A;  2G8L A;  4X62 M;  2QEN A;  3I51 A;  5EXX A;  4R7G A;  2C5R A;  1E32 A;  5FTK A;  1HNZ M;  3VDU A;  4JI8 M;  1Q3B A;  1HR0 M;  2FNA A;  3I4Y A;  3K8Z A;  2W82 A;  1IN4 A;  3H4M A;  4JI0 M;  3WHL A;  5FSW A;  4MGY E;  4AI6 A;  5ITX E;  1EE8 A;  3GQ3 A;  1N32 M;  5FTM A;  4M9S A;  1IBK M;  3UK6 A;  4FVM A;  3HJQ A;  4OVZ A;  3FUV A;  5EP2 A;  4XGI A;  4KLN A;  1XMQ M;  3THG A;  4IBI A;  3U6M A;  1T3T A;  2I7N A;  3MHV C;  3VFD A;  3GPP A;  1K3W A;  2FE8 A;  3KOW E;  4DR5 M;  4X64 M;  3RGP A;  4D80 A;  4CHT B;  4JYA M;  1NHW C;  4NOO B;  2QP9 X;  2KRK A;  2QBY B;  1XNR M;  1NY6 A;  4M9Z A;  2V1U A;  1IY0 A;  3CF2 A;  4B7F A;  1G59 A;  1N77 A;  2ZM6 M;  4L8R C;  1G8P A;  4II7 A;  2XH9 A;  2DWM A;  5E6J A;  5KQD A;  3AV0 A;  3PNY A;  3J80 S;  1HT1 E;  2Q2E B;  4IBB A;  1G3I A;  4DV5 M;  4G4R A;  4OU7 A;  4LFC M;  3GQ5 A;  2O5R A;  3FD9 A;  1MX0 A;  3GLG A;  4LF4 M;  4GKJ M;  2UXB M;  1KYI A;  1DO2 A;  2HKJ A;  1IXS B;  2CHG A;  4P16 A;  1Z5A A;  2DWL A;  4FWD A;  2F5P A;  4M0D A;  2HHH M;  1R7R A;  4GC5 A;  3B9P A;  1KSF X;  5E26 A;  4M0W A;  1L2D A;  3SMS A;  4MB7 A;  1UM8 A;  3HU3 A;  2CHV A;  3E9S A;  3GRY A;  2D7G A;  2R45 A;  5GKN A;  2R4J A;  4LRS A;  1TDH A;  2R46 A;  3HHX A;  4LFB M;  1NY5 A;  3HHY A;  2C9O A;  2M5Z A;  2OPF A;  5KPT A;  1IN5 A;  3GLF B;  3SAT A;  4B3R M;  1C1K A;  2Y0Q A;  5C18 A;  2CE7 A;  4QHS A;  3UZU A;  4KO8 A;  4DV0 M;  4XBO A;  2XLJ A;  1K3X A;  1TDZ A;  5LMU M;  4IJE A;  1DO0 A;  3GRR A;  3AOG A;  3KOY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...