2KNAA

Solution structure of uba domain of xiap
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'GSAMADIGSEFEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baculoviral IAP repeat-containing protein 4
publication title Backbone and side-chain 1H, 13C and 15N assignments of the ubiquitin-associated domain of human X-linked inhibitor of apoptosis protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knaA01
3FE3A 4DBGB 1XXHE 1XB2B 2ZTCA 3FRIA 1OAIA 2L4EA 2G3QA 1VEJA 4GEWA 2HWJA 2MROB 1ZMUA 2LVQD 2K9DA 2OOAA 1P3QQ 1DO2A 1OTRA 3FRHA 3K9PA 3GLIE 1VEKA 2B3TA 1G4AE 1C7YA 3E21A 1TTEA 1WIVA 1Q02A 2DENA 2EKKA 4R71A 1HT2E 2RRUA 1SG9A 2OOBA 2MR9A 2DAMA 2JZ1A 4Q7JA 1KYIA 2JY5A 3F92A 2LVOC 1HT1E 2DNAA 1TR8A 3B89A 2K0BX 3H4JA 1E94E 2LTUA 3IECA 3IHPA 1VQ1A 2LBCA 3LCVB 1YLAA 1T6OA 1R4GA 3LCUA 1IXSA 2LVPC 2CP8A 2DAGA 2JUJA 2EJSA 2BWEA 1G3IA 1OQYA 4G3OA 2KNVA 2QNJA 2L2DA 2KHHA 1GO5A 4HEOA 1F4IA 1VG5A 3MMPA 2LVNC 2MJ5B 1OKSA 1IFYA 1T43A 1G41A 1HQYE 1JR3E 2DAIA 1ZV1A 2LVAA 4WP2A 2DAKA 3T6PA 2DKLA 2H5XA 2O25A 2ZTDA 2L4FA 1NV8A 2DI0A 1DV0A 1HJPA 1UFZA 3E46A 1WR1B 1MN3A 1QZEA 2JY6B 4UN2B 1WGLA 1VDLA 1NV9A 1WJ7A 3GLFE 2OO9A 1Y8GA 2DHYA 2DZLA 1V92A 2JY8A 1IM2A 2MGWA 2QSFX 4F1IA 1WHCA 2BWBA 1ZMVA 2R0IA 3K9OA 1DO0A 1A5TA 2JY7A 2KNZA 2KNAA 2WZJA 2EKFA 1WGNA 2JZ0A 5DFLA 5JI2E 1PGYA 2HAKA 1AIPC 1CUKA 2CWBA 4F2LA 3GLHE 2DAEA 2JNHA 1EFUB 3GLGE 2QHOB 1BVSA 2JP7A 1VEGA 3BBZA 1ZMWA
chains in the Genus database with same CATH superfamily
3J7AS 3FE3A 3SAVA 2LHCA 2R18A 3GQ4A 4DBGB 2XGNA 1K82A 1PRBA 1XB2B 1OAIA 1TH4A 5E6JA 3SHFA 2XZUA 2HWJA 2FS1A 3AOEC 4XK8F 2F5NA 4JI7M 3B7NA 4TUWA 3DA1A 3U60B 2M5ZA 2RGOA 1ZMUA 2LVQD 2K9DA 2OOAA 2JA2A 2K6BA 4DV0M 1GJSA 1IXSB 5KPZA 3SFZA 1G59A 3AJIB 1E9SA 2HKJA 1G4AE 2KEBA 4B7GA 1XXHA 1PM5A 1N75A 1VDDA 3SHGB 5KO3A 1L2CA 1NNJA 1WIVA 2VF7A 4LJ9A 4W5WA 2CHQA 4DR6M 3ZC7B 1HT2E 4DV7M 4CIZA 5EP3A 2O5RA 4JI1M 4AKHA 4L8RC 3C9PA 1MX0A 3GRYA 4DV3M 1TR8A 5EXSA 2V6ZM 3KS8A 1V33A 4PDIA 4MM3B 2DZOB 2EUCA 3KP0E 1L8QA 3KVWA 1WXQA 5F3WA 2ZANA 3KW6A 1T6OA 4AG6A 1R4GA 3LCUA 2X4AA 1TH3A 2DAGA 2KXEA 4IBEA 4QNMA 2CUZA 4FWGA 1OQYA 3EIEA 3SMPA 5DYGA 3GPYA 2L2DA 3CF0A 2C96A 3R9XB 1GO5A 3VKHA 4ZPXA 3U6OA 2DWLA 4DR4M 4IBFA 3FTEA 3Q8XA 4LF8M 1TDHA 1OFHA 1OKSA 3M6AA 2VF8A 3GLHB 1T43A 1G41A 2V1CA 3SYKA 4B3SM 1JR3E 3U6DA 4LJAA 4ANRA 2DAIA 3GRRA 2LVAA 1E9RA 2Y21A 5ITTA 3HHXA 3T1HM 5FTLA 2DAKA 3T6PA 2C99A 3W67A 1Z6TA 2DVWB 4GRIA 2O25A 4LF4M 3PNYA 3FUTA 4RNAA 4DV1M 2DWMA 2Y0TA 2HCBA 1SXJC 5A2QS 2CHVA 3AOEA 1RU3A 4LFAM 2N35A 1UFZA 3JR5A 1TGUA 2AHMA 3BXWA 3I4YA 1KSFX 2LHGA 3T1YM 4IIWA 1NO1A 3ZCBB 4DV2M 1R5LA 3U5ZA 2G5GX 4DR5M 3U6QA 4LJ8A 3K8ZA 4JI6M 3THGA 3OTOM 1Y8GA 2DHYA 1V92A 3W0FA 1IBMM 1TH2A 3ILKA 4B3MM 1QAMA 4I8OA 1EIJA 2UU9M 2BWBA 1FNNA 3J2PB 5FTMA 3A45A 3I51A 4IJEA 3VK8A 2X49A 2DZNB 4MGKE 4YY3M 3HJSA 1A5TA 1GABA 2G8LA 3FUUA 4GIPA 3TPZA 5KQDA 1GKIA 2VQEM 3K2LA 3U6SA 3UK6A 4JI3M 2F4VM 3GPXA 1CUKA 1C1KA 4LRTA 1R2YA 2XFSA 3TWKA 3H4MA 2C9CA 4GITA 3TQSA 2UXDM 4R7GA 3U6PA 3FYDA 2UUAM 4L6V6 4IBGA 4NL4H 3TWMA 3I4VA 3KDSE 2ZBKB 1L1ZA 1JB0F 3GLIA 3L29A 1IN7A 2O01F 4GHAA 3B7QA 4BBAA 3GLHA 1J09A 2R6FA 3FRIA 3GLGA 2I7PA 4GEWA 1L2DA 2UUCM 4AKGA 4QHTA 3U61A 4G4RA 3MK6A 2R65A 1QUTA 1PJIA 3RFWA 1NSFA 5ITYA 3GLIE 4L16A 4B7HA 1C7YA 3E21A 4M0DA 2DWNA 1Q02A 2I7NA 4XBOA 1OIZA 3UGJA 4MH0E 3C3DA 4LF5M 4Q7JA 1KYIA 2UUBM 2FNAA 1IN8A 3M7GA 2KZUA 3KOWE 2DNAA 3AV0A 2UXBM 3FKEA 5FTNA 3J80S 3FTFA 1GVNA 1PJJA 2K0BX 3H4JA 2R62A 1QUSA 2M60A 1YE9A 4DV5M 1XWIA 2LTUA 5H37D 3U6CA 1VQ1A 2LBCA 4IBBA 2W82A 1YLAA 4YHHM 1D2NA 3T15A 1DGBA 3SBJA 2BWEA 3L28A 4OX9M 4G3OA 4QHSA 4LF9M 2QNJA 2A5YB 1IY1A 4BLCA 2FH0A 1OFIA 4CGYB 2KW0A 4HEOA 2KRKA 3IG5A 4JI2M 3U5ZB 3L25A 1IN5A 4GH9A 3VDUA 1HQCA 1VG5A 2XF3A 2DHRA 1NNUC 2LVNC 3AOGA 4LGMA 2P5TA 4LJ6A 1GLNA 3IG8A 3AKZA 1IFYA 4JI8M 1I4WA 1QQWA 2LWXA 3DOAA 3B9PA 5ITXE 5EP4A 1ZV1A 3PXGA 1GL6A 2L6OA 1NJGA 1OIPA 2XZFA 1DGHA 3HU2A 4D80A 3SAWA 3HHWA 2H5XA 2JXNA 2Z4SA 4G4QA 2XEPA 3KOXE 4AW4A 4WURA 1IN4A 3GRUA 5E26A 5EXTA 3AL0C 5IREB 1JR3A 1NY5A 3JR4A 1XMOM 4I4LA 3E46A 3KFUG 5KPTA 4NOOB 3SASA 4A3VB 3GQ5A 1ORYB 2Z8YM 1XC8A 4P17A 3GLFE 2KA6B 1E32A 2OO9A 3FUXA 4NSRA 3GLIB 1OJLA 4F1IA 2HHHM 3ZQJA 4L15A 1WHCA 1DGGA 1Z5CA 2Y0QA 1I94M 3GLGB 4AZFA 1IXZA 4LFBM 3K9OA 4DUZM 2YR0A 3ZH9B 2JY7A 1R6BX 2QQ8A 5ITUA 3U61B 2KNAA 1NVMA 1WGNA 3E4RA 5DFLA 3QWLA 3R8FA 4X66M 3U6MA 3GRVA 3I01M 2D7EA 2DXIA 3A42A 4LF6M 1LV7A 3KOYE 4M0WA 3TWLA 4F2LA 4FVMA 3E9SA 8CATA 3SARA 4AQYM 3T38A 3W68A 5C18A 1N34M 1GL7A 4JI4M 4CHTB 2DWZB 2QHOB 3GPPA 3HGIA 3L27A 1TF0B 4MB7A 1XHBA 4I5SA 4G4NA 2RRUA 2GQFA 4FCVA 1NHWC 5BPVA 4MGYE 4JN6A 2L4EA 4X62M 1IBLM 3LQRA 3B7ZA 4EIWA 2MROB 1PJSA 5KQ8A 3C58A 4CISA 3KXEC 1N33M 3LVVA 2QENA 4PDGA 1OTRA 3FRHA 1UM8A 3K9PA 4KODA 2Y20A 3J27B 3UJNA 3KSXA 4IBCA 4Z8XA 4Z6YA 1TTEA 3D8BA 5IWAM 3QYEA 2DENA 4NRVA 1NHGC 2R45A 4R71A 4LY6A 4RF1A 1SG9A 4FW9A 2MR9A 1W5SA 2DAMA 4D81A 3DZDA 2JZ1A 2EA0A 4G4OA 2CV1A 3F92A 1QDTA 1HT1E 5DNYA 3K1JA 1R7RA 4FCTA 4QNRA 5FTJA 3B89A 4LJ4A 2J7OA 1HNZM 1G71A 4OVZB 2VQFM 3CTWB 4JI0M 3RE8A 3WHKA 4B3RM 4LG2A 1IY2A 7CATA 3GLFB 3SC3A 4GMQA 1DGHB 4QOZC 3LCVB 4DV6M 5JI3E 1XNRM 4NC6A 3FUWA 3MHVC 2LVPC 2QP9X 2CHGA 4OW0A 3Q8GA 3RGPA 1G3IA 2RGHA 1Q3CA 1D0LA 2BNKA 4BB9A 2KHHA 2BJVA 3HX3A 1S3SA 3PFIA 3M0EA 4FWDA 3L26A 1X37A 2ZAMA 1JR3D 3NBXX 3J7BA 3B74A 1F4IA 4IBDA 4LF7M 2MJ5B 3AFHA 3A46A 2V1UA 4FWHA 3HWSA 2VDBB 2FE8A 1QVRA 2K47A 1XMQM 4X64M 3PVSA 3HHZA 3SATA 4GHLA 1QYRA 2WSFF 2DKLA 4NXMM 4AG5A 2L4FA 2MH8A 1J7KA 4M9XA 3PNVA 2XH9A 2R44A 1DV0A 5ITXA 3HJQA 1IY0A 3LW5F 1WR1B 2YNMD 1MN3A 1W5TA 3CF2A 2JY6B 3KSJA 4UN2B 5EQTA 1IQPA 4NRWA 3GO8A 5GKNA 1N77A 3K92A 1NV9A 2ZAOA 3DFZA 2QBYA 3GP1A 1QAOA 2JY8A 5IZ7D 1QAQA 1KFVA 2F5OA 2QSFX 3CF6E 4QOSA 1QDRA 3KS4A 4OU7A 1Z5BA 1HNXM 2FFJA 3LMMA 4LZZA 4OVZA 1ZMVA 4AKIA 2R0IA 3KP1E 1SXJE 1IBKM 2R4JA 3HY5A 3GLFA 5EXXA 3FYCA 1D0KA 2CEAA 2EKFA 1Z59A 2APLA 2JZ0A 2WZJA 3FUVA 3UMMA 4B3TM 2XSZD 4LFCM 2HL7A 1LTMA 1PGYA 2C9OA 2HAKA 5FLXS 4RKUF 2CWBA 4GKKM 5EJCA 2JNHA 2F5SA 4PT5A 4PCZA 2L7IA 2XFTA 3J81S 2KZSA 1GJTA 2EO2A 4REZA 2Z4RA 4CJ6A 5ITQA 3HU3A 4WW0A 1HNWM 2CV2A 2UXCM 1EE8A 3HHYA 2JP7A 4B08A 4IJFA 3BBZA 1ZMWA 4S12A 2E5LM 2CFOA 3GPUA 2R46A 4Y28F 1XXHE 2ZTCA 2J7NA 1N78A 2G3QA 1VEJA 2JWSA 3SYLA 2Z3XA 2L7HA 4R3DA 4PD2A 4LRSA 4IBIA 1FJGM 5EXPA 2KRUA 4RF0A 1P3QQ 1DO2A 2GNOA 3UZUA 1QZMA 1YUBA 2BJWA 2WSEF 4L4UA 2J5YA 1VEKA 3SMSA 2B3TA 3W0LB 4JV5M 3TL4X 1Z5AA 4KO8A 2EKKA 3SAUA 2OOBA 1TDZA 1NJFA 3U6EA 1OAOC 2D7HA 2JY5A 3BOSA 1ZQ9A 3HKPA 4FD2A 2LVOC 4P16A 5EP1A 3WHLA 2YQZA 3GQ3A 3HU1A 1N32M 5LMUM 3A98B 4DV4M 1E94E 1H6UA 2F5PA 1PJTA 4NSOB 5LMNM 3VK7A 2XSZA 1J5EM 3IECA 3CGWA 3IHPA 5KPRA 4KLNA 3U60A 1XNQM 1QANA 3RGSA 3EIHA 3NWLA 2QZ4A 3VLFB 2CV0A 4B7FA 1HR0M 1IXSA 2WSCF 2CP8A 3I04M 4LCBA 2VIIA 3TE6A 2JUJA 4DUYM 2EJSA 2LNHC 4L78A 1SXJB 5BR8M 4GC5A 2KNVA 3D8LA 1D0MA 2KDLA 1MJGM 2QBYB 4GKJM 2H1RA 1SXJD 2X8AA 1Q3BA 3MMPA 3NBIA 4IBJA 2QCUA 1V34A 2XLJA 2C5RA 5IT9S 2D7GA 4II7A 1T3TA 1HQYE 4M9SA 2C98A 2NQ8C 1ZAEA 4WP2A 4D82A 5L8RF 4KHPM 2LXEA 2F5QA 4K0KM 2ZTDA 4DR3M 3LVWA 3HJ8A 4DR2M 4AI6A 4MGIE 4M9ZA 1NV8A 2DI0A 2RKOA 3C3EA 2LH0A 3QYBA 3LQQA 5ITRA 2FOIC 1HJPA 1XXHB 3VFDA 1MU5A 1QZEA 1WGLA 2QPAA 2ERCA 4KT0F 1Q39A 1VDLA 5EP2A 3U6LA 4ITQA 3VKGA 1WJ7A 4HL4A 4LJ7A 1R2ZA 1NY6A 1G8PA 1DGFA 2OPFA 1K3XA 2DZLA 3FD9A 4G6ZA 1IM2A 2MGWA 3MJ5A 3QAUA 1IXRC 4I81A 2YFQA 5FTKA 4X65M 1YSYA 3L2AA 4DR1M 2Z7JA 4JYAM 1JQJC 2R4EA 4XGIA 4LGYA 4FCWA 2ZM6M 4NXNM 2CRUA 1DO0A 4LJ5A 4MGHA 1K3WA 1PJQA 2KNZA 3FTCA 3V76A 5JI2E 3HZJA 3FTDA 5DYIA 2OQ4A 1AIPC 4GC9A 1IN6A 3GLHE 2DAEA 5FSWA 1L1TA 4HLQA 1EFUB 1SXJA 2L09A 4MGZE 1N36M 4JI5M 3GLGE 4IBKA 2CE7A 1AUAA 2Q2EB 4DR7M 4LZJA 4JXJA 5C1BA 1L2BA 1BVSA 3JAMS 1VEGA 3VDPA 3KOZE
chains in the Genus database with same CATH topology
3FE3A 4DBGB 1XXHE 1XB2B 2ZTCA 3FRIA 1OAIA 2L4EA 2G3QA 1VEJA 4GEWA 2HWJA 2MROB 1ZMUA 2LVQD 2K9DA 2OOAA 1P3QQ 1DO2A 1OTRA 3FRHA 3K9PA 3GLIE 1VEKA 2B3TA 1G4AE 1C7YA 3E21A 1TTEA 1WIVA 1Q02A 2DENA 2EKKA 4R71A 1HT2E 2RRUA 1SG9A 2OOBA 2MR9A 2DAMA 2JZ1A 4Q7JA 1KYIA 2JY5A 3F92A 2LVOC 1HT1E 2DNAA 1TR8A 3B89A 2K0BX 3H4JA 1E94E 2LTUA 3IECA 3IHPA 1VQ1A 2LBCA 3LCVB 1YLAA 1T6OA 1R4GA 3LCUA 1IXSA 2LVPC 2CP8A 2DAGA 2JUJA 2EJSA 2BWEA 1G3IA 1OQYA 4G3OA 2KNVA 2QNJA 2L2DA 2KHHA 1GO5A 4HEOA 1F4IA 1VG5A 3MMPA 2LVNC 2MJ5B 1OKSA 1IFYA 1T43A 1G41A 1HQYE 1JR3E 2DAIA 1ZV1A 2LVAA 4WP2A 2DAKA 3T6PA 2DKLA 2H5XA 2O25A 2ZTDA 2L4FA 1NV8A 2DI0A 1DV0A 1HJPA 1UFZA 3E46A 1WR1B 1MN3A 1QZEA 2JY6B 4UN2B 1WGLA 1VDLA 1NV9A 1WJ7A 3GLFE 2OO9A 1Y8GA 2DHYA 2DZLA 1V92A 2JY8A 1IM2A 2MGWA 2QSFX 4F1IA 1WHCA 2BWBA 1ZMVA 2R0IA 3K9OA 1DO0A 1A5TA 2JY7A 2KNZA 2KNAA 2WZJA 2EKFA 1WGNA 2JZ0A 5DFLA 5JI2E 1PGYA 2HAKA 1AIPC 1CUKA 2CWBA 4F2LA 3GLHE 2DAEA 2JNHA 1EFUB 3GLGE 2QHOB 1BVSA 2JP7A 1VEGA 3BBZA 1ZMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE3 A;  4DBG B;  1XXH E;  1XB2 B;  2ZTC A;  3FRI A;  1OAI A;  2L4E A;  2G3Q A;  1VEJ A;  4GEW A;  2HWJ A;  2MRO B;  1ZMU A;  2LVQ D;  2K9D A;  2OOA A;  1P3Q Q;  1DO2 A;  1OTR A;  3FRH A;  3K9P A;  3GLI E;  1VEK A;  2B3T A;  1G4A E;  1C7Y A;  3E21 A;  1TTE A;  1WIV A;  1Q02 A;  2DEN A;  2EKK A;  4R71 A;  1HT2 E;  2RRU A;  1SG9 A;  2OOB A;  2MR9 A;  2DAM A;  2JZ1 A;  4Q7J A;  1KYI A;  2JY5 A;  3F92 A;  2LVO C;  1HT1 E;  2DNA A;  1TR8 A;  3B89 A;  2K0B X;  3H4J A;  1E94 E;  2LTU A;  3IEC A;  3IHP A;  1VQ1 A;  2LBC A;  3LCV B;  1YLA A;  1T6O A;  1R4G A;  3LCU A;  1IXS A;  2LVP C;  2CP8 A;  2DAG A;  2JUJ A;  2EJS A;  2BWE A;  1G3I A;  1OQY A;  4G3O A;  2KNV A;  2QNJ A;  2L2D A;  2KHH A;  1GO5 A;  4HEO A;  1F4I A;  1VG5 A;  3MMP A;  2LVN C;  2MJ5 B;  1OKS A;  1IFY A;  1T43 A;  1G41 A;  1HQY E;  1JR3 E;  2DAI A;  1ZV1 A;  2LVA A;  4WP2 A;  2DAK A;  3T6P A;  2DKL A;  2H5X A;  2O25 A;  2ZTD A;  2L4F A;  1NV8 A;  2DI0 A;  1DV0 A;  1HJP A;  1UFZ A;  3E46 A;  1WR1 B;  1MN3 A;  1QZE A;  2JY6 B;  4UN2 B;  1WGL A;  1VDL A;  1NV9 A;  1WJ7 A;  3GLF E;  2OO9 A;  1Y8G A;  2DHY A;  2DZL A;  1V92 A;  2JY8 A;  1IM2 A;  2MGW A;  2QSF X;  4F1I A;  1WHC A;  2BWB A;  1ZMV A;  2R0I A;  3K9O A;  1DO0 A;  1A5T A;  2JY7 A;  2KNZ A;  2KNA A;  2WZJ A;  2EKF A;  1WGN A;  2JZ0 A;  5DFL A;  5JI2 E;  1PGY A;  2HAK A;  1AIP C;  1CUK A;  2CWB A;  4F2L A;  3GLH E;  2DAE A;  2JNH A;  1EFU B;  3GLG E;  2QHO B;  1BVS A;  2JP7 A;  1VEG A;  3BBZ A;  1ZMW A; 
#chains in the Genus database with same CATH topology
 3J7A S;  3FE3 A;  3SAV A;  2LHC A;  2R18 A;  3GQ4 A;  4DBG B;  2XGN A;  1K82 A;  1PRB A;  1XB2 B;  1OAI A;  1TH4 A;  5E6J A;  3SHF A;  2XZU A;  2HWJ A;  2FS1 A;  3AOE C;  4XK8 F;  2F5N A;  4JI7 M;  3B7N A;  4TUW A;  3DA1 A;  3U60 B;  2M5Z A;  2RGO A;  1ZMU A;  2LVQ D;  2K9D A;  2OOA A;  2JA2 A;  2K6B A;  4DV0 M;  1GJS A;  1IXS B;  5KPZ A;  3SFZ A;  1G59 A;  3AJI B;  1E9S A;  2HKJ A;  1G4A E;  2KEB A;  4B7G A;  1XXH A;  1PM5 A;  1N75 A;  1VDD A;  3SHG B;  5KO3 A;  1L2C A;  1NNJ A;  1WIV A;  2VF7 A;  4LJ9 A;  4W5W A;  2CHQ A;  4DR6 M;  3ZC7 B;  1HT2 E;  4DV7 M;  4CIZ A;  5EP3 A;  2O5R A;  4JI1 M;  4AKH A;  4L8R C;  3C9P A;  1MX0 A;  3GRY A;  4DV3 M;  1TR8 A;  5EXS A;  2V6Z M;  3KS8 A;  1V33 A;  4PDI A;  4MM3 B;  2DZO B;  2EUC A;  3KP0 E;  1L8Q A;  3KVW A;  1WXQ A;  5F3W A;  2ZAN A;  3KW6 A;  1T6O A;  4AG6 A;  1R4G A;  3LCU A;  2X4A A;  1TH3 A;  2DAG A;  2KXE A;  4IBE A;  4QNM A;  2CUZ A;  4FWG A;  1OQY A;  3EIE A;  3SMP A;  5DYG A;  3GPY A;  2L2D A;  3CF0 A;  2C96 A;  3R9X B;  1GO5 A;  3VKH A;  4ZPX A;  3U6O A;  2DWL A;  4DR4 M;  4IBF A;  3FTE A;  3Q8X A;  4LF8 M;  1TDH A;  1OFH A;  1OKS A;  3M6A A;  2VF8 A;  3GLH B;  1T43 A;  1G41 A;  2V1C A;  3SYK A;  4B3S M;  1JR3 E;  3U6D A;  4LJA A;  4ANR A;  2DAI A;  3GRR A;  2LVA A;  1E9R A;  2Y21 A;  5ITT A;  3HHX A;  3T1H M;  5FTL A;  2DAK A;  3T6P A;  2C99 A;  3W67 A;  1Z6T A;  2DVW B;  4GRI A;  2O25 A;  4LF4 M;  3PNY A;  3FUT A;  4RNA A;  4DV1 M;  2DWM A;  2Y0T A;  2HCB A;  1SXJ C;  5A2Q S;  2CHV A;  3AOE A;  1RU3 A;  4LFA M;  2N35 A;  1UFZ A;  3JR5 A;  1TGU A;  2AHM A;  3BXW A;  3I4Y A;  1KSF X;  2LHG A;  3T1Y M;  4IIW A;  1NO1 A;  3ZCB B;  4DV2 M;  1R5L A;  3U5Z A;  2G5G X;  4DR5 M;  3U6Q A;  4LJ8 A;  3K8Z A;  4JI6 M;  3THG A;  3OTO M;  1Y8G A;  2DHY A;  1V92 A;  3W0F A;  1IBM M;  1TH2 A;  3ILK A;  4B3M M;  1QAM A;  4I8O A;  1EIJ A;  2UU9 M;  2BWB A;  1FNN A;  3J2P B;  5FTM A;  3A45 A;  3I51 A;  4IJE A;  3VK8 A;  2X49 A;  2DZN B;  4MGK E;  4YY3 M;  3HJS A;  1A5T A;  1GAB A;  2G8L A;  3FUU A;  4GIP A;  3TPZ A;  5KQD A;  1GKI A;  2VQE M;  3K2L A;  3U6S A;  3UK6 A;  4JI3 M;  2F4V M;  3GPX A;  1CUK A;  1C1K A;  4LRT A;  1R2Y A;  2XFS A;  3TWK A;  3H4M A;  2C9C A;  4GIT A;  3TQS A;  2UXD M;  4R7G A;  3U6P A;  3FYD A;  2UUA M;  4L6V 6;  4IBG A;  4NL4 H;  3TWM A;  3I4V A;  3KDS E;  2ZBK B;  1L1Z A;  1JB0 F;  3GLI A;  3L29 A;  1IN7 A;  2O01 F;  4GHA A;  3B7Q A;  4BBA A;  3GLH A;  1J09 A;  2R6F A;  3FRI A;  3GLG A;  2I7P A;  4GEW A;  1L2D A;  2UUC M;  4AKG A;  4QHT A;  3U61 A;  4G4R A;  3MK6 A;  2R65 A;  1QUT A;  1PJI A;  3RFW A;  1NSF A;  5ITY A;  3GLI E;  4L16 A;  4B7H A;  1C7Y A;  3E21 A;  4M0D A;  2DWN A;  1Q02 A;  2I7N A;  4XBO A;  1OIZ A;  3UGJ A;  4MH0 E;  3C3D A;  4LF5 M;  4Q7J A;  1KYI A;  2UUB M;  2FNA A;  1IN8 A;  3M7G A;  2KZU A;  3KOW E;  2DNA A;  3AV0 A;  2UXB M;  3FKE A;  5FTN A;  3J80 S;  3FTF A;  1GVN A;  1PJJ A;  2K0B X;  3H4J A;  2R62 A;  1QUS A;  2M60 A;  1YE9 A;  4DV5 M;  1XWI A;  2LTU A;  5H37 D;  3U6C A;  1VQ1 A;  2LBC A;  4IBB A;  2W82 A;  1YLA A;  4YHH M;  1D2N A;  3T15 A;  1DGB A;  3SBJ A;  2BWE A;  3L28 A;  4OX9 M;  4G3O A;  4QHS A;  4LF9 M;  2QNJ A;  2A5Y B;  1IY1 A;  4BLC A;  2FH0 A;  1OFI A;  4CGY B;  2KW0 A;  4HEO A;  2KRK A;  3IG5 A;  4JI2 M;  3U5Z B;  3L25 A;  1IN5 A;  4GH9 A;  3VDU A;  1HQC A;  1VG5 A;  2XF3 A;  2DHR A;  1NNU C;  2LVN C;  3AOG A;  4LGM A;  2P5T A;  4LJ6 A;  1GLN A;  3IG8 A;  3AKZ A;  1IFY A;  4JI8 M;  1I4W A;  1QQW A;  2LWX A;  3DOA A;  3B9P A;  5ITX E;  5EP4 A;  1ZV1 A;  3PXG A;  1GL6 A;  2L6O A;  1NJG A;  1OIP A;  2XZF A;  1DGH A;  3HU2 A;  4D80 A;  3SAW A;  3HHW A;  2H5X A;  2JXN A;  2Z4S A;  4G4Q A;  2XEP A;  3KOX E;  4AW4 A;  4WUR A;  1IN4 A;  3GRU A;  5E26 A;  5EXT A;  3AL0 C;  5IRE B;  1JR3 A;  1NY5 A;  3JR4 A;  1XMO M;  4I4L A;  3E46 A;  3KFU G;  5KPT A;  4NOO B;  3SAS A;  4A3V B;  3GQ5 A;  1ORY B;  2Z8Y M;  1XC8 A;  4P17 A;  3GLF E;  2KA6 B;  1E32 A;  2OO9 A;  3FUX A;  4NSR A;  3GLI B;  1OJL A;  4F1I A;  2HHH M;  3ZQJ A;  4L15 A;  1WHC A;  1DGG A;  1Z5C A;  2Y0Q A;  1I94 M;  3GLG B;  4AZF A;  1IXZ A;  4LFB M;  3K9O A;  4DUZ M;  2YR0 A;  3ZH9 B;  2JY7 A;  1R6B X;  2QQ8 A;  5ITU A;  3U61 B;  2KNA A;  1NVM A;  1WGN A;  3E4R A;  5DFL A;  3QWL A;  3R8F A;  4X66 M;  3U6M A;  3GRV A;  3I01 M;  2D7E A;  2DXI A;  3A42 A;  4LF6 M;  1LV7 A;  3KOY E;  4M0W A;  3TWL A;  4F2L A;  4FVM A;  3E9S A;  8CAT A;  3SAR A;  4AQY M;  3T38 A;  3W68 A;  5C18 A;  1N34 M;  1GL7 A;  4JI4 M;  4CHT B;  2DWZ B;  2QHO B;  3GPP A;  3HGI A;  3L27 A;  1TF0 B;  4MB7 A;  1XHB A;  4I5S A;  4G4N A;  2RRU A;  2GQF A;  4FCV A;  1NHW C;  5BPV A;  4MGY E;  4JN6 A;  2L4E A;  4X62 M;  1IBL M;  3LQR A;  3B7Z A;  4EIW A;  2MRO B;  1PJS A;  5KQ8 A;  3C58 A;  4CIS A;  3KXE C;  1N33 M;  3LVV A;  2QEN A;  4PDG A;  1OTR A;  3FRH A;  1UM8 A;  3K9P A;  4KOD A;  2Y20 A;  3J27 B;  3UJN A;  3KSX A;  4IBC A;  4Z8X A;  4Z6Y A;  1TTE A;  3D8B A;  5IWA M;  3QYE A;  2DEN A;  4NRV A;  1NHG C;  2R45 A;  4R71 A;  4LY6 A;  4RF1 A;  1SG9 A;  4FW9 A;  2MR9 A;  1W5S A;  2DAM A;  4D81 A;  3DZD A;  2JZ1 A;  2EA0 A;  4G4O A;  2CV1 A;  3F92 A;  1QDT A;  1HT1 E;  5DNY A;  3K1J A;  1R7R A;  4FCT A;  4QNR A;  5FTJ A;  3B89 A;  4LJ4 A;  2J7O A;  1HNZ M;  1G71 A;  4OVZ B;  2VQF M;  3CTW B;  4JI0 M;  3RE8 A;  3WHK A;  4B3R M;  4LG2 A;  1IY2 A;  7CAT A;  3GLF B;  3SC3 A;  4GMQ A;  1DGH B;  4QOZ C;  3LCV B;  4DV6 M;  5JI3 E;  1XNR M;  4NC6 A;  3FUW A;  3MHV C;  2LVP C;  2QP9 X;  2CHG A;  4OW0 A;  3Q8G A;  3RGP A;  1G3I A;  2RGH A;  1Q3C A;  1D0L A;  2BNK A;  4BB9 A;  2KHH A;  2BJV A;  3HX3 A;  1S3S A;  3PFI A;  3M0E A;  4FWD A;  3L26 A;  1X37 A;  2ZAM A;  1JR3 D;  3NBX X;  3J7B A;  3B74 A;  1F4I A;  4IBD A;  4LF7 M;  2MJ5 B;  3AFH A;  3A46 A;  2V1U A;  4FWH A;  3HWS A;  2VDB B;  2FE8 A;  1QVR A;  2K47 A;  1XMQ M;  4X64 M;  3PVS A;  3HHZ A;  3SAT A;  4GHL A;  1QYR A;  2WSF F;  2DKL A;  4NXM M;  4AG5 A;  2L4F A;  2MH8 A;  1J7K A;  4M9X A;  3PNV A;  2XH9 A;  2R44 A;  1DV0 A;  5ITX A;  3HJQ A;  1IY0 A;  3LW5 F;  1WR1 B;  2YNM D;  1MN3 A;  1W5T A;  3CF2 A;  2JY6 B;  3KSJ A;  4UN2 B;  5EQT A;  1IQP A;  4NRW A;  3GO8 A;  5GKN A;  1N77 A;  3K92 A;  1NV9 A;  2ZAO A;  3DFZ A;  2QBY A;  3GP1 A;  1QAO A;  2JY8 A;  5IZ7 D;  1QAQ A;  1KFV A;  2F5O A;  2QSF X;  3CF6 E;  4QOS A;  1QDR A;  3KS4 A;  4OU7 A;  1Z5B A;  1HNX M;  2FFJ A;  3LMM A;  4LZZ A;  4OVZ A;  1ZMV A;  4AKI A;  2R0I A;  3KP1 E;  1SXJ E;  1IBK M;  2R4J A;  3HY5 A;  3GLF A;  5EXX A;  3FYC A;  1D0K A;  2CEA A;  2EKF A;  1Z59 A;  2APL A;  2JZ0 A;  2WZJ A;  3FUV A;  3UMM A;  4B3T M;  2XSZ D;  4LFC M;  2HL7 A;  1LTM A;  1PGY A;  2C9O A;  2HAK A;  5FLX S;  4RKU F;  2CWB A;  4GKK M;  5EJC A;  2JNH A;  2F5S A;  4PT5 A;  4PCZ A;  2L7I A;  2XFT A;  3J81 S;  2KZS A;  1GJT A;  2EO2 A;  4REZ A;  2Z4R A;  4CJ6 A;  5ITQ A;  3HU3 A;  4WW0 A;  1HNW M;  2CV2 A;  2UXC M;  1EE8 A;  3HHY A;  2JP7 A;  4B08 A;  4IJF A;  3BBZ A;  1ZMW A;  4S12 A;  2E5L M;  2CFO A;  3GPU A;  2R46 A;  4Y28 F;  1XXH E;  2ZTC A;  2J7N A;  1N78 A;  2G3Q A;  1VEJ A;  2JWS A;  3SYL A;  2Z3X A;  2L7H A;  4R3D A;  4PD2 A;  4LRS A;  4IBI A;  1FJG M;  5EXP A;  2KRU A;  4RF0 A;  1P3Q Q;  1DO2 A;  2GNO A;  3UZU A;  1QZM A;  1YUB A;  2BJW A;  2WSE F;  4L4U A;  2J5Y A;  1VEK A;  3SMS A;  2B3T A;  3W0L B;  4JV5 M;  3TL4 X;  1Z5A A;  4KO8 A;  2EKK A;  3SAU A;  2OOB A;  1TDZ A;  1NJF A;  3U6E A;  1OAO C;  2D7H A;  2JY5 A;  3BOS A;  1ZQ9 A;  3HKP A;  4FD2 A;  2LVO C;  4P16 A;  5EP1 A;  3WHL A;  2YQZ A;  3GQ3 A;  3HU1 A;  1N32 M;  5LMU M;  3A98 B;  4DV4 M;  1E94 E;  1H6U A;  2F5P A;  1PJT A;  4NSO B;  5LMN M;  3VK7 A;  2XSZ A;  1J5E M;  3IEC A;  3CGW A;  3IHP A;  5KPR A;  4KLN A;  3U60 A;  1XNQ M;  1QAN A;  3RGS A;  3EIH A;  3NWL A;  2QZ4 A;  3VLF B;  2CV0 A;  4B7F A;  1HR0 M;  1IXS A;  2WSC F;  2CP8 A;  3I04 M;  4LCB A;  2VII A;  3TE6 A;  2JUJ A;  4DUY M;  2EJS A;  2LNH C;  4L78 A;  1SXJ B;  5BR8 M;  4GC5 A;  2KNV A;  3D8L A;  1D0M A;  2KDL A;  1MJG M;  2QBY B;  4GKJ M;  2H1R A;  1SXJ D;  2X8A A;  1Q3B A;  3MMP A;  3NBI A;  4IBJ A;  2QCU A;  1V34 A;  2XLJ A;  2C5R A;  5IT9 S;  2D7G A;  4II7 A;  1T3T A;  1HQY E;  4M9S A;  2C98 A;  2NQ8 C;  1ZAE A;  4WP2 A;  4D82 A;  5L8R F;  4KHP M;  2LXE A;  2F5Q A;  4K0K M;  2ZTD A;  4DR3 M;  3LVW A;  3HJ8 A;  4DR2 M;  4AI6 A;  4MGI E;  4M9Z A;  1NV8 A;  2DI0 A;  2RKO A;  3C3E A;  2LH0 A;  3QYB A;  3LQQ A;  5ITR A;  2FOI C;  1HJP A;  1XXH B;  3VFD A;  1MU5 A;  1QZE A;  1WGL A;  2QPA A;  2ERC A;  4KT0 F;  1Q39 A;  1VDL A;  5EP2 A;  3U6L A;  4ITQ A;  3VKG A;  1WJ7 A;  4HL4 A;  4LJ7 A;  1R2Z A;  1NY6 A;  1G8P A;  1DGF A;  2OPF A;  1K3X A;  2DZL A;  3FD9 A;  4G6Z A;  1IM2 A;  2MGW A;  3MJ5 A;  3QAU A;  1IXR C;  4I81 A;  2YFQ A;  5FTK A;  4X65 M;  1YSY A;  3L2A A;  4DR1 M;  2Z7J A;  4JYA M;  1JQJ C;  2R4E A;  4XGI A;  4LGY A;  4FCW A;  2ZM6 M;  4NXN M;  2CRU A;  1DO0 A;  4LJ5 A;  4MGH A;  1K3W A;  1PJQ A;  2KNZ A;  3FTC A;  3V76 A;  5JI2 E;  3HZJ A;  3FTD A;  5DYI A;  2OQ4 A;  1AIP C;  4GC9 A;  1IN6 A;  3GLH E;  2DAE A;  5FSW A;  1L1T A;  4HLQ A;  1EFU B;  1SXJ A;  2L09 A;  4MGZ E;  1N36 M;  4JI5 M;  3GLG E;  4IBK A;  2CE7 A;  1AUA A;  2Q2E B;  4DR7 M;  4LZJ A;  4JXJ A;  5C1B A;  1L2B A;  1BVS A;  3JAM S;  1VEG A;  3VDP A;  3KOZ E; 
#chains in the Genus database with same CATH homology
 3FE3 A;  4DBG B;  1XXH E;  1XB2 B;  2ZTC A;  3FRI A;  1OAI A;  2L4E A;  2G3Q A;  1VEJ A;  4GEW A;  2HWJ A;  2MRO B;  1ZMU A;  2LVQ D;  2K9D A;  2OOA A;  1P3Q Q;  1DO2 A;  1OTR A;  3FRH A;  3K9P A;  3GLI E;  1VEK A;  2B3T A;  1G4A E;  1C7Y A;  3E21 A;  1TTE A;  1WIV A;  1Q02 A;  2DEN A;  2EKK A;  4R71 A;  1HT2 E;  2RRU A;  1SG9 A;  2OOB A;  2MR9 A;  2DAM A;  2JZ1 A;  4Q7J A;  1KYI A;  2JY5 A;  3F92 A;  2LVO C;  1HT1 E;  2DNA A;  1TR8 A;  3B89 A;  2K0B X;  3H4J A;  1E94 E;  2LTU A;  3IEC A;  3IHP A;  1VQ1 A;  2LBC A;  3LCV B;  1YLA A;  1T6O A;  1R4G A;  3LCU A;  1IXS A;  2LVP C;  2CP8 A;  2DAG A;  2JUJ A;  2EJS A;  2BWE A;  1G3I A;  1OQY A;  4G3O A;  2KNV A;  2QNJ A;  2L2D A;  2KHH A;  1GO5 A;  4HEO A;  1F4I A;  1VG5 A;  3MMP A;  2LVN C;  2MJ5 B;  1OKS A;  1IFY A;  1T43 A;  1G41 A;  1HQY E;  1JR3 E;  2DAI A;  1ZV1 A;  2LVA A;  4WP2 A;  2DAK A;  3T6P A;  2DKL A;  2H5X A;  2O25 A;  2ZTD A;  2L4F A;  1NV8 A;  2DI0 A;  1DV0 A;  1HJP A;  1UFZ A;  3E46 A;  1WR1 B;  1MN3 A;  1QZE A;  2JY6 B;  4UN2 B;  1WGL A;  1VDL A;  1NV9 A;  1WJ7 A;  3GLF E;  2OO9 A;  1Y8G A;  2DHY A;  2DZL A;  1V92 A;  2JY8 A;  1IM2 A;  2MGW A;  2QSF X;  4F1I A;  1WHC A;  2BWB A;  1ZMV A;  2R0I A;  3K9O A;  1DO0 A;  1A5T A;  2JY7 A;  2KNZ A;  2KNA A;  2WZJ A;  2EKF A;  1WGN A;  2JZ0 A;  5DFL A;  5JI2 E;  1PGY A;  2HAK A;  1AIP C;  1CUK A;  2CWB A;  4F2L A;  3GLH E;  2DAE A;  2JNH A;  1EFU B;  3GLG E;  2QHO B;  1BVS A;  2JP7 A;  1VEG A;  3BBZ A;  1ZMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...