2KNAA

Solution structure of uba domain of xiap
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
GSAMADIGSEFEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Baculoviral IAP repeat-containing protein 4
publication title Backbone and side-chain 1H, 13C and 15N assignments of the ubiquitin-associated domain of human X-linked inhibitor of apoptosis protein
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knaA01
1KYIA 2G3QA 4UN2B 4R71A 1T6OA 3IECA 3GLIE 2LVQD 2LVPC 3K9OA 1VEKA 2JZ1A 2LTUA 1Y8GA 1EFUB 2DKLA 4Q7JA 2JUJA 1G4AE 2KNZA 3F92A 4F1IA 1ZMVA 2R0IA 2CP8A 1YLAA 2RRUA 2LVAA 1WHCA 1OKSA 1IM2A 3LCUA 2BWEA 2JP7A 2MGWA 1E94E 2JY7A 2ZTDA 1IXSA 1VQ1A 2DENA 2LVNC 2QHOB 1C7YA 1VEJA 1ZMUA 1IFYA 1VDLA 1MN3A 2BWBA 2ZTCA 2DAMA 2DNAA 2KNVA 2H5XA 2DAEA 2K0BX 1OTRA 2EKKA 1AIPC 1PGYA 1SG9A 2DHYA 3BBZA 5JI2E 2K9DA 2JY6B 1GO5A 2JNHA 1Q02A 3FE3A 1XXHE 4F2LA 2LBCA 1F4IA 3K9PA 1NV8A 2OO9A 2QSFX 2DI0A 1JR3E 1BVSA 2OOAA 1XB2B 4WP2A 1OQYA 1V92A 1G3IA 2DAIA 1NV9A 2B3TA 1DO2A 4GEWA 2QNJA 2L2DA 3T6PA 1DO0A 2EKFA 1UFZA 2L4FA 3MMPA 1P3QQ 1TTEA 2OOBA 1OAIA 3IHPA 2DAKA 2DAGA 1HT2E 3GLHE 2DZLA 3E21A 2EJSA 2HWJA 5DFLA 2MROB 2CWBA 4G3OA 3H4JA 1A5TA 2MJ5B 1HQYE 2MR9A 2JY5A 2WZJA 4HEOA 3FRIA 1HJPA 1ZV1A 1ZMWA 1VEGA 2O25A 1TR8A 1WGLA 3B89A 1HT1E 3GLFE 3FRHA 2KHHA 3GLGE 1G41A 1VG5A 1DV0A 2L4EA 1QZEA 4DBGB 1CUKA 2HAKA 1R4GA 1WGNA 1WJ7A 2KNAA 2LVOC 3LCVB 1T43A 2JY8A 3E46A 1WIVA 1WR1B 2JZ0A
chains in the Genus database with same CATH superfamily
1PJJA 1D0LA 1MX0A 1PJSA 4AI6A 3A46A 1T6OA 5IT9S 2YR0A 2LVPC 4OW0A 1V33A 2LTUA 1Y8GA 4Q7JA 2XFTA 4A3VB 3I4VA 5LMNM 2CFOA 1KFVA 3GP1A 3QWLA 4DR1M 3U60B 3HHZA 1J09A 3U6SA 2CP8A 1YLAA 3K92A 4LJ7A 3RGPA 3J81S 2UUAM 4LG2A 4XK8F 1TH3A 1EE8A 2DZNB 2L7IA 2YNMD 3U6PA 3AV0A 3HHXA 5EXSA 2JP7A 4NOOB 3VKGA 1QUSA 1YSYA 4MH0E 1YUBA 1LV7A 4D82A 4X65M 3E9SA 3FTDA 1C7YA 1XXHB 5IWAM 1TH2A 3MHVC 1IFYA 4PT5A 2C99A 2UUBM 4PCZA 3T1YM 3PNYA 1K3WA 3RFWA 2CHVA 5ITQA 2QQ8A 3KP1E 3AKZA 1SG9A 4IBFA 4RNAA 4L8RC 3D8BA 2Z3XA 3BBZA 2JY6B 2VF7A 1I4WA 3C9PA 4XBOA 5FSWA 1GL6A 4DV5M 1GO5A 2YQZA 2JNHA 1Q02A 1N78A 4G6ZA 4PD2A 2K6BA 1F4IA 3L2AA 3K9PA 2OO9A 2QBYA 4LGMA 1H6UA 4P16A 1OIPA 4DR7M 1JR3E 1BVSA 4LJ9A 2QP9X 1XB2B 1TDHA 4P17A 2LNHC 1G3IA 1I94M 4WURA 1PRBA 2FFJA 4LF5M 4GEWA 1DGFA 2QNJA 4IIWA 5BR8M 2LHCA 2UXBM 3TWKA 4B3TM 3T6PA 3H4MA 2F5OA 1DO0A 2O5RA 2EKFA 5FTJA 2CRUA 3GQ4A 4GIPA 2W82A 2Y0TA 1QAMA 4NL4H 2OOBA 1OAIA 4LFCM 1NSFA 3U6OA 2DAGA 4GITA 3C3EA 4LJ6A 2EJSA 3L29A 2ZM6M 1JR3A 2N35A 4B3SM 3JAMS 2DWNA 1R2YA 3E4RA 1OFIA 5DFLA 4MGZE 3H4JA 4GC5A 3TE6A 4TUWA 4IBJA 1HQYE 3VKHA 1QQWA 4Y28F 2DWMA 2J7NA 4EIWA 4LF7M 5EXXA 1R5LA 5E26A 2G8LA 3RE8A 1HJPA 4AG6A 1QDRA 3B74A 3K2LA 3JR4A 4FWHA 4DUYM 4G4OA 1JQJC 4IBCA 1WGLA 2EA0A 2VQEM 3CF2A 4MGHA 1GKIA 4X62M 3VDUA 4JI4M 3HX3A 5A2QS 1DV0A 1NHGC 2F5NA 1QZEA 3HKPA 1XC8A 4M9ZA 4LJ8A 4LZJA 4DR6M 3FUUA 2KNAA 2JY8A 3SFZA 1J7KA 3CF6E 1NNJA 2JZ0A 1PJQA 4I8OA 1KYIA 5ITYA 2G3QA 8CATA 2UXDM 3GLIE 3U6EA 1G8PA 4NXNM 3TL4X 3K9OA 3VFDA 2BJVA 4D80A 4AKHA 4NC6A 2DKLA 3LVVA 3TPZA 2DWLA 3DOAA 3LVWA 4FWDA 4NRVA 4GRIA 4OVZB 1J5EM 4G4RA 3KOZE 2R0IA 1GJTA 4W5WA 5EP1A 3SBJA 3EIHA 5ITTA 2Z4RA 2RRUA 2LVAA 2DVWB 3PNVA 2XF3A 2LWXA 3J7BA 4ITQA 1OKSA 5ITXE 2BWEA 2R45A 4DR2M 3A45A 4R3DA 2YFQA 2APLA 5DNYA 4OVZA 2R4JA 3RGSA 4YY3M 3SC3A 3GLIA 2ZTDA 5EXTA 1IXSA 3QYBA 1E9SA 1NY6A 1Z59A 4LGYA 2HCBA 3GPUA 1NNUC 4B08A 5BPVA 4LF4M 3GRVA 3KDSE 4BLCA 2V6ZM 1Z5CA 1N75A 4RF0A 4R7GA 4AW4A 2DAMA 2KNVA 3KVWA 1QAOA 2H5XA 2VF8A 1SXJB 1XNRM 2DAEA 1IY0A 3U6QA 2K0BX 3KP0E 4GH9A 2A5YB 2EKKA 4IBKA 2R4EA 4LFAM 5ITXA 2LXEA 4BB9A 4M0DA 2OQ4A 5JI2E 1N32M 5KPZA 7CATA 3T15A 4GHLA 4KT0F 2CHGA 3FE3A 1XXHE 4F2LA 3TQSA 5ITRA 4HL4A 1L8QA 3HZJA 3LQRA 3LW5F 2DI0A 2JWSA 1X37A 3U60A 3ILKA 4PDGA 2QENA 2OOAA 3KXEC 3NBIA 1ORYB 2KZSA 2H1RA 1R7RA 1OQYA 2G5GX 1HNZM 1AUAA 4GKKM 3FTCA 2KZUA 3HGIA 3C3DA 3QYEA 2L2DA 1RU3A 1GABA 1OIZA 4FWGA 4M9XA 1UFZA 3SHGB 3FYDA 1IBMM 5FLXS 4DV1M 1P3QQ 4Z8XA 3IHPA 4M9SA 1XXHA 1OJLA 3L28A 3LMMA 1IBKM 2UUCM 3V76A 2HHHM 3KS4A 3GLGB 4CISA 4CJ6A 2HWJA 3HJSA 4MM3B 1D2NA 1N33M 4DV4M 2VQFM 1V34A 4LF9M 2MROB 4QHTA 3SAVA 3K8ZA 4G3OA 4NSOB 4BBAA 1W5SA 3T38A 2FH0A 5ITUA 3GQ5A 3EIEA 2D7HA 2JY5A 2WZJA 4QOZC 2RGHA 1ZV1A 2V1CA 3W0LB 3SASA 4JYAM 1ZMWA 1GLNA 3UGJA 2O25A 1TR8A 3CF0A 1IN7A 3B9PA 1QAQA 2GNOA 3PFIA 1XMOM 5EP2A 1K3XA 5C18A 2L4EA 1MU5A 2HAKA 2ZAOA 2L09A 3I51A 2ERCA 1IN8A 3AJIB 3U6LA 1XWIA 1WJ7A 2D7GA 2KEBA 3LCVB 4JN6A 4REZA 3T1HM 4B3RM 2KA6B 3U6MA 1ZAEA 1IN4A 4AZFA 5KPTA 5C1BA 1LTMA 4L15A 5EP4A 3UZUA 1OFHA 1R2ZA 5EQTA 4JI6M 4DUZM 4R71A 4JI7M 1NO1A 3IECA 3J2PB 2LVQD 4DV3M 3FKEA 3HJ8A 3FUTA 5IREB 3U61B 2JZ1A 3FUXA 4I5SA 4OX9M 4QHSA 3IG8A 4LF8M 2KRUA 3L27A 4MGYE 3VK7A 1HNXM 4KODA 3F92A 4F1IA 4QOSA 1Z5BA 3HHYA 2M5ZA 1ZMVA 4FD2A 1KSFX 3SAUA 2CEAA 3DFZA 5IZ7D 3GPPA 3IG5A 1Q39A 2WSCF 3MK6A 1TH4A 3I4YA 5EP3A 4K0KM 4I81A 2FNAA 3K1JA 1WHCA 2D7EA 3B7NA 3U61A 5H37D 4DV7M 3L25A 2UXCM 2QPAA 1OAOC 3AOGA 3PVSA 1JR3D 1S3SA 4DR4M 4CGYB 1DGHB 1IXZA 1N77A 4GKJM 1E94E 2X49A 4JI8M 1SXJC 1HNWM 3R8FA 4KHPM 5FTKA 1FJGM 1L1TA 2DENA 2Y21A 1NY5A 3R9XB 2C96A 2R6FA 3FUVA 4B7HA 1VEJA 4WW0A 1TF0B 1ZMUA 3LQQA 4Z6YA 4X66M 2X4AA 4YHHM 1YE9A 1MN3A 3SYKA 2RGOA 1TDZA 1DGHA 2ZTCA 3UJNA 2DNAA 3HHWA 2ZBKB 4DV2M 4AG5A 4OU7A 3U6CA 2FS1A 1PM5A 2Y0QA 1OTRA 4KO8A 4L6V6 4RKUF 3SMPA 1L2BA 1PGYA 5KO3A 4LFBM 1L2DA 3A42A 2XZFA 2R65A 3M0EA 4IJEA 3KW6A 3CGWA 4QNMA 3VDPA 4LCBA 1Q3BA 4X64M 2QSFX 3NWLA 3U6DA 1IXRC 1DGBA 1JB0F 4B7GA 5F3WA 3GLHB 4NXMM 4WP2A 3UK6A 1SXJE 3Q8XA 5JI3E 3GRRA 2B3TA 1DO2A 2KRKA 2ZANA 2Y20A 5GKNA 3J7AS 2X8AA 2F5SA 3KSJA 4GC9A 2L4FA 4IBGA 4DR5M 3SAWA 4IBDA 4LJAA 4MGKE 3KOWE 2J5YA 2WSEF 1HT2E 3GLFB 2E5LM 4PDIA 3E21A 3JR5A 4ANRA 1D0MA 4CHTB 3J27B 3DZDA 2NQ8C 2I7PA 1QYRA 1SXJA 2QZ4A 3L26A 4L4UA 2Z7JA 2VIIA 1UM8A 2MR9A 3QAUA 3C58A 1QANA 5E6JA 1MJGM 1TGUA 1Z6TA 2FE8A 5EXPA 3GLFA 2BJWA 4DR3M 3DA1A 1VEGA 2JA2A 3VK8A 3B89A 2DWZB 2MH8A 2R18A 3WHKA 1NHWC 2Z4SA 2KHHA 3GLGE 1IQPA 1G41A 3M7GA 3NBXX 4NRWA 1D0KA 3W0FA 4FCWA 2GQFA 3HU1A 4AKGA 5KQDA 1W5TA 2LVOC 1WXQA 1T43A 3E46A 1WIVA 5FTNA 1SXJD 1WR1B 3SHFA 4LF6M 3HWSA 4AQYM 3BXWA 4IJFA 1QDTA 4JI5M 2R44A 1K82A 2XEPA 1C1KA 2KW0A 3HJQA 4XGIA 4UN2B 3VLFB 1XMQM 3HY5A 4ZPXA 2I7NA 2RKOA 3PXGA 3ZH9B 1QVRA 1VEKA 1EFUB 2EO2A 3AFHA 2JUJA 4JI0M 3GLGA 1G4AE 2AHMA 2KNZA 4JV5M 2F4VM 5FTMA 2JXNA 4L78A 1L1ZA 2R46A 2QBYB 2HL7A 2R62A 1IY1A 3GRUA 2V1UA 2BNKA 3FUWA 3I01M 3W68A 1Z5AA 5L8RF 2F5PA 1NJGA 2FOIC 2K47A 1IM2A 3LCUA 3TWLA 1EIJA 4LRTA 4FCTA 3KOYE 2CUZA 3GRYA 3I04M 4LY6A 3AOEC 2KDLA 4JI3M 2MGWA 3GO8A 1T3TA 2JY7A 5DYIA 4AKIA 3GPYA 1E9RA 4IBIA 4LJ4A 1VQ1A 2LVNC 1PJTA 4JXJA 2QHOB 3FD9A 3BOSA 4G4QA 2P5TA 4NSRA 4GMQA 3GPXA 5EJCA 1IN6A 5KPRA 1VDLA 2DXIA 1HR0M 2XH9A 2BWBA 4I4LA 3THGA 4RF1A 1R6BX 3ZCBB 2DHRA 1IN5A 4JI2M 2QCUA 2XZUA 2CV0A 1GJSA 1N36M 1AIPC 1VDDA 3CTWB 2EUCA 3Q8GA 4QNRA 4LZZA 3KFUG 5DYGA 2DHYA 2K9DA 1ZQ9A 2LHGA 3KS8A 1G71A 2C5RA 2CHQA 2LBCA 4LRSA 3W67A 2XGNA 1NV8A 2OPFA 2O01F 4II7A 3FTEA 4B3MM 4DV6M 2M60A 3HU2A 1V92A 2DAIA 1L2CA 1NV9A 3HU3A 1GVNA 4IBBA 3U5ZB 2DZOB 4G4NA 2L6OA 3D8LA 5KQ8A 3ZQJA 1N34M 4FCVA 1Q3CA 3SARA 3AL0C 4CIZA 3ZC7B 2ZAMA 2J7OA 2HKJA 3B7QA 1QUTA 1IBLM 1NJFA 3KOXE 2XSZA 3MMPA 4MB7A 3GQ3A 1NVMA 1G59A 1GL7A 1FNNA 1TTEA 5FTLA 4FW9A 3M6AA 2DAKA 3U5ZA 3MJ5A 2F5QA 2VDBB 3GLHE 2DZLA 2UU9M 1XHBA 2Q2EB 3UMMA 2CV1A 3WHLA 4M0WA 3AOEA 2C9CA 2CE7A 2LH0A 3SYLA 2CWBA 2XFSA 3J80S 3KSXA 1XNQM 1A5TA 4GHAA 2MJ5B 3FYCA 1QZMA 4B7FA 4HEOA 4JI1M 3FRIA 4D81A 1PJIA 1IY2A 4KLNA 2CV2A 4HLQA 1HT1E 2XSZD 3A98B 3OTOM 2XLJA 3FRHA 2C98A 4IBEA 3GLFE 3GLIB 1IXSB 2C9OA 1VG5A 3FTFA 3GLHA 5LMUM 1HQCA 4DBGB 1CUKA 4MGIE 2L7HA 3TWMA 2KXEA 1R4GA 3B7ZA 3SATA 4LJ5A 1DGGA 1WGNA 4L16A 2Z8YM 1E32A 4DV0M 3SMSA 4FVMA 4S12A 2WSFF
chains in the Genus database with same CATH topology
1KYIA 2G3QA 4UN2B 4R71A 1T6OA 3IECA 3GLIE 2LVQD 2LVPC 3K9OA 1VEKA 2JZ1A 2LTUA 1Y8GA 1EFUB 2DKLA 4Q7JA 2JUJA 1G4AE 2KNZA 3F92A 4F1IA 1ZMVA 2R0IA 2CP8A 1YLAA 2RRUA 2LVAA 1WHCA 1OKSA 1IM2A 3LCUA 2BWEA 2JP7A 2MGWA 1E94E 2JY7A 2ZTDA 1IXSA 1VQ1A 2DENA 2LVNC 2QHOB 1C7YA 1VEJA 1ZMUA 1IFYA 1VDLA 1MN3A 2BWBA 2ZTCA 2DAMA 2DNAA 2KNVA 2H5XA 2DAEA 2K0BX 1OTRA 2EKKA 1AIPC 1PGYA 1SG9A 2DHYA 3BBZA 5JI2E 2K9DA 2JY6B 1GO5A 2JNHA 1Q02A 3FE3A 1XXHE 4F2LA 2LBCA 1F4IA 3K9PA 1NV8A 2OO9A 2QSFX 2DI0A 1JR3E 1BVSA 2OOAA 1XB2B 4WP2A 1OQYA 1V92A 1G3IA 2DAIA 1NV9A 2B3TA 1DO2A 4GEWA 2QNJA 2L2DA 3T6PA 1DO0A 2EKFA 1UFZA 2L4FA 3MMPA 1P3QQ 1TTEA 2OOBA 1OAIA 3IHPA 2DAKA 2DAGA 1HT2E 3GLHE 2DZLA 3E21A 2EJSA 2HWJA 5DFLA 2MROB 2CWBA 4G3OA 3H4JA 1A5TA 2MJ5B 1HQYE 2MR9A 2JY5A 2WZJA 4HEOA 3FRIA 1HJPA 1ZV1A 1ZMWA 1VEGA 2O25A 1TR8A 1WGLA 3B89A 1HT1E 3GLFE 3FRHA 2KHHA 3GLGE 1G41A 1VG5A 1DV0A 2L4EA 1QZEA 4DBGB 1CUKA 2HAKA 1R4GA 1WGNA 1WJ7A 2KNAA 2LVOC 3LCVB 1T43A 2JY8A 3E46A 1WIVA 1WR1B 2JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYI A;  2G3Q A;  4UN2 B;  4R71 A;  1T6O A;  3IEC A;  3GLI E;  2LVQ D;  2LVP C;  3K9O A;  1VEK A;  2JZ1 A;  2LTU A;  1Y8G A;  1EFU B;  2DKL A;  4Q7J A;  2JUJ A;  1G4A E;  2KNZ A;  3F92 A;  4F1I A;  1ZMV A;  2R0I A;  2CP8 A;  1YLA A;  2RRU A;  2LVA A;  1WHC A;  1OKS A;  1IM2 A;  3LCU A;  2BWE A;  2JP7 A;  2MGW A;  1E94 E;  2JY7 A;  2ZTD A;  1IXS A;  1VQ1 A;  2DEN A;  2LVN C;  2QHO B;  1C7Y A;  1VEJ A;  1ZMU A;  1IFY A;  1VDL A;  1MN3 A;  2BWB A;  2ZTC A;  2DAM A;  2DNA A;  2KNV A;  2H5X A;  2DAE A;  2K0B X;  1OTR A;  2EKK A;  1AIP C;  1PGY A;  1SG9 A;  2DHY A;  3BBZ A;  5JI2 E;  2K9D A;  2JY6 B;  1GO5 A;  2JNH A;  1Q02 A;  3FE3 A;  1XXH E;  4F2L A;  2LBC A;  1F4I A;  3K9P A;  1NV8 A;  2OO9 A;  2QSF X;  2DI0 A;  1JR3 E;  1BVS A;  2OOA A;  1XB2 B;  4WP2 A;  1OQY A;  1V92 A;  1G3I A;  2DAI A;  1NV9 A;  2B3T A;  1DO2 A;  4GEW A;  2QNJ A;  2L2D A;  3T6P A;  1DO0 A;  2EKF A;  1UFZ A;  2L4F A;  3MMP A;  1P3Q Q;  1TTE A;  2OOB A;  1OAI A;  3IHP A;  2DAK A;  2DAG A;  1HT2 E;  3GLH E;  2DZL A;  3E21 A;  2EJS A;  2HWJ A;  5DFL A;  2MRO B;  2CWB A;  4G3O A;  3H4J A;  1A5T A;  2MJ5 B;  1HQY E;  2MR9 A;  2JY5 A;  2WZJ A;  4HEO A;  3FRI A;  1HJP A;  1ZV1 A;  1ZMW A;  1VEG A;  2O25 A;  1TR8 A;  1WGL A;  3B89 A;  1HT1 E;  3GLF E;  3FRH A;  2KHH A;  3GLG E;  1G41 A;  1VG5 A;  1DV0 A;  2L4E A;  1QZE A;  4DBG B;  1CUK A;  2HAK A;  1R4G A;  1WGN A;  1WJ7 A;  2KNA A;  2LVO C;  3LCV B;  1T43 A;  2JY8 A;  3E46 A;  1WIV A;  1WR1 B;  2JZ0 A; 
#chains in the Genus database with same CATH topology
 1PJJ A;  1D0L A;  1MX0 A;  1PJS A;  4AI6 A;  3A46 A;  1T6O A;  5IT9 S;  2YR0 A;  2LVP C;  4OW0 A;  1V33 A;  2LTU A;  1Y8G A;  4Q7J A;  2XFT A;  4A3V B;  3I4V A;  5LMN M;  2CFO A;  1KFV A;  3GP1 A;  3QWL A;  4DR1 M;  3U60 B;  3HHZ A;  1J09 A;  3U6S A;  2CP8 A;  1YLA A;  3K92 A;  4LJ7 A;  3RGP A;  3J81 S;  2UUA M;  4LG2 A;  4XK8 F;  1TH3 A;  1EE8 A;  2DZN B;  2L7I A;  2YNM D;  3U6P A;  3AV0 A;  3HHX A;  5EXS A;  2JP7 A;  4NOO B;  3VKG A;  1QUS A;  1YSY A;  4MH0 E;  1YUB A;  1LV7 A;  4D82 A;  4X65 M;  3E9S A;  3FTD A;  1C7Y A;  1XXH B;  5IWA M;  1TH2 A;  3MHV C;  1IFY A;  4PT5 A;  2C99 A;  2UUB M;  4PCZ A;  3T1Y M;  3PNY A;  1K3W A;  3RFW A;  2CHV A;  5ITQ A;  2QQ8 A;  3KP1 E;  3AKZ A;  1SG9 A;  4IBF A;  4RNA A;  4L8R C;  3D8B A;  2Z3X A;  3BBZ A;  2JY6 B;  2VF7 A;  1I4W A;  3C9P A;  4XBO A;  5FSW A;  1GL6 A;  4DV5 M;  1GO5 A;  2YQZ A;  2JNH A;  1Q02 A;  1N78 A;  4G6Z A;  4PD2 A;  2K6B A;  1F4I A;  3L2A A;  3K9P A;  2OO9 A;  2QBY A;  4LGM A;  1H6U A;  4P16 A;  1OIP A;  4DR7 M;  1JR3 E;  1BVS A;  4LJ9 A;  2QP9 X;  1XB2 B;  1TDH A;  4P17 A;  2LNH C;  1G3I A;  1I94 M;  4WUR A;  1PRB A;  2FFJ A;  4LF5 M;  4GEW A;  1DGF A;  2QNJ A;  4IIW A;  5BR8 M;  2LHC A;  2UXB M;  3TWK A;  4B3T M;  3T6P A;  3H4M A;  2F5O A;  1DO0 A;  2O5R A;  2EKF A;  5FTJ A;  2CRU A;  3GQ4 A;  4GIP A;  2W82 A;  2Y0T A;  1QAM A;  4NL4 H;  2OOB A;  1OAI A;  4LFC M;  1NSF A;  3U6O A;  2DAG A;  4GIT A;  3C3E A;  4LJ6 A;  2EJS A;  3L29 A;  2ZM6 M;  1JR3 A;  2N35 A;  4B3S M;  3JAM S;  2DWN A;  1R2Y A;  3E4R A;  1OFI A;  5DFL A;  4MGZ E;  3H4J A;  4GC5 A;  3TE6 A;  4TUW A;  4IBJ A;  1HQY E;  3VKH A;  1QQW A;  4Y28 F;  2DWM A;  2J7N A;  4EIW A;  4LF7 M;  5EXX A;  1R5L A;  5E26 A;  2G8L A;  3RE8 A;  1HJP A;  4AG6 A;  1QDR A;  3B74 A;  3K2L A;  3JR4 A;  4FWH A;  4DUY M;  4G4O A;  1JQJ C;  4IBC A;  1WGL A;  2EA0 A;  2VQE M;  3CF2 A;  4MGH A;  1GKI A;  4X62 M;  3VDU A;  4JI4 M;  3HX3 A;  5A2Q S;  1DV0 A;  1NHG C;  2F5N A;  1QZE A;  3HKP A;  1XC8 A;  4M9Z A;  4LJ8 A;  4LZJ A;  4DR6 M;  3FUU A;  2KNA A;  2JY8 A;  3SFZ A;  1J7K A;  3CF6 E;  1NNJ A;  2JZ0 A;  1PJQ A;  4I8O A;  1KYI A;  5ITY A;  2G3Q A;  8CAT A;  2UXD M;  3GLI E;  3U6E A;  1G8P A;  4NXN M;  3TL4 X;  3K9O A;  3VFD A;  2BJV A;  4D80 A;  4AKH A;  4NC6 A;  2DKL A;  3LVV A;  3TPZ A;  2DWL A;  3DOA A;  3LVW A;  4FWD A;  4NRV A;  4GRI A;  4OVZ B;  1J5E M;  4G4R A;  3KOZ E;  2R0I A;  1GJT A;  4W5W A;  5EP1 A;  3SBJ A;  3EIH A;  5ITT A;  2Z4R A;  2RRU A;  2LVA A;  2DVW B;  3PNV A;  2XF3 A;  2LWX A;  3J7B A;  4ITQ A;  1OKS A;  5ITX E;  2BWE A;  2R45 A;  4DR2 M;  3A45 A;  4R3D A;  2YFQ A;  2APL A;  5DNY A;  4OVZ A;  2R4J A;  3RGS A;  4YY3 M;  3SC3 A;  3GLI A;  2ZTD A;  5EXT A;  1IXS A;  3QYB A;  1E9S A;  1NY6 A;  1Z59 A;  4LGY A;  2HCB A;  3GPU A;  1NNU C;  4B08 A;  5BPV A;  4LF4 M;  3GRV A;  3KDS E;  4BLC A;  2V6Z M;  1Z5C A;  1N75 A;  4RF0 A;  4R7G A;  4AW4 A;  2DAM A;  2KNV A;  3KVW A;  1QAO A;  2H5X A;  2VF8 A;  1SXJ B;  1XNR M;  2DAE A;  1IY0 A;  3U6Q A;  2K0B X;  3KP0 E;  4GH9 A;  2A5Y B;  2EKK A;  4IBK A;  2R4E A;  4LFA M;  5ITX A;  2LXE A;  4BB9 A;  4M0D A;  2OQ4 A;  5JI2 E;  1N32 M;  5KPZ A;  7CAT A;  3T15 A;  4GHL A;  4KT0 F;  2CHG A;  3FE3 A;  1XXH E;  4F2L A;  3TQS A;  5ITR A;  4HL4 A;  1L8Q A;  3HZJ A;  3LQR A;  3LW5 F;  2DI0 A;  2JWS A;  1X37 A;  3U60 A;  3ILK A;  4PDG A;  2QEN A;  2OOA A;  3KXE C;  3NBI A;  1ORY B;  2KZS A;  2H1R A;  1R7R A;  1OQY A;  2G5G X;  1HNZ M;  1AUA A;  4GKK M;  3FTC A;  2KZU A;  3HGI A;  3C3D A;  3QYE A;  2L2D A;  1RU3 A;  1GAB A;  1OIZ A;  4FWG A;  4M9X A;  1UFZ A;  3SHG B;  3FYD A;  1IBM M;  5FLX S;  4DV1 M;  1P3Q Q;  4Z8X A;  3IHP A;  4M9S A;  1XXH A;  1OJL A;  3L28 A;  3LMM A;  1IBK M;  2UUC M;  3V76 A;  2HHH M;  3KS4 A;  3GLG B;  4CIS A;  4CJ6 A;  2HWJ A;  3HJS A;  4MM3 B;  1D2N A;  1N33 M;  4DV4 M;  2VQF M;  1V34 A;  4LF9 M;  2MRO B;  4QHT A;  3SAV A;  3K8Z A;  4G3O A;  4NSO B;  4BBA A;  1W5S A;  3T38 A;  2FH0 A;  5ITU A;  3GQ5 A;  3EIE A;  2D7H A;  2JY5 A;  2WZJ A;  4QOZ C;  2RGH A;  1ZV1 A;  2V1C A;  3W0L B;  3SAS A;  4JYA M;  1ZMW A;  1GLN A;  3UGJ A;  2O25 A;  1TR8 A;  3CF0 A;  1IN7 A;  3B9P A;  1QAQ A;  2GNO A;  3PFI A;  1XMO M;  5EP2 A;  1K3X A;  5C18 A;  2L4E A;  1MU5 A;  2HAK A;  2ZAO A;  2L09 A;  3I51 A;  2ERC A;  1IN8 A;  3AJI B;  3U6L A;  1XWI A;  1WJ7 A;  2D7G A;  2KEB A;  3LCV B;  4JN6 A;  4REZ A;  3T1H M;  4B3R M;  2KA6 B;  3U6M A;  1ZAE A;  1IN4 A;  4AZF A;  5KPT A;  5C1B A;  1LTM A;  4L15 A;  5EP4 A;  3UZU A;  1OFH A;  1R2Z A;  5EQT A;  4JI6 M;  4DUZ M;  4R71 A;  4JI7 M;  1NO1 A;  3IEC A;  3J2P B;  2LVQ D;  4DV3 M;  3FKE A;  3HJ8 A;  3FUT A;  5IRE B;  3U61 B;  2JZ1 A;  3FUX A;  4I5S A;  4OX9 M;  4QHS A;  3IG8 A;  4LF8 M;  2KRU A;  3L27 A;  4MGY E;  3VK7 A;  1HNX M;  4KOD A;  3F92 A;  4F1I A;  4QOS A;  1Z5B A;  3HHY A;  2M5Z A;  1ZMV A;  4FD2 A;  1KSF X;  3SAU A;  2CEA A;  3DFZ A;  5IZ7 D;  3GPP A;  3IG5 A;  1Q39 A;  2WSC F;  3MK6 A;  1TH4 A;  3I4Y A;  5EP3 A;  4K0K M;  4I81 A;  2FNA A;  3K1J A;  1WHC A;  2D7E A;  3B7N A;  3U61 A;  5H37 D;  4DV7 M;  3L25 A;  2UXC M;  2QPA A;  1OAO C;  3AOG A;  3PVS A;  1JR3 D;  1S3S A;  4DR4 M;  4CGY B;  1DGH B;  1IXZ A;  1N77 A;  4GKJ M;  1E94 E;  2X49 A;  4JI8 M;  1SXJ C;  1HNW M;  3R8F A;  4KHP M;  5FTK A;  1FJG M;  1L1T A;  2DEN A;  2Y21 A;  1NY5 A;  3R9X B;  2C96 A;  2R6F A;  3FUV A;  4B7H A;  1VEJ A;  4WW0 A;  1TF0 B;  1ZMU A;  3LQQ A;  4Z6Y A;  4X66 M;  2X4A A;  4YHH M;  1YE9 A;  1MN3 A;  3SYK A;  2RGO A;  1TDZ A;  1DGH A;  2ZTC A;  3UJN A;  2DNA A;  3HHW A;  2ZBK B;  4DV2 M;  4AG5 A;  4OU7 A;  3U6C A;  2FS1 A;  1PM5 A;  2Y0Q A;  1OTR A;  4KO8 A;  4L6V 6;  4RKU F;  3SMP A;  1L2B A;  1PGY A;  5KO3 A;  4LFB M;  1L2D A;  3A42 A;  2XZF A;  2R65 A;  3M0E A;  4IJE A;  3KW6 A;  3CGW A;  4QNM A;  3VDP A;  4LCB A;  1Q3B A;  4X64 M;  2QSF X;  3NWL A;  3U6D A;  1IXR C;  1DGB A;  1JB0 F;  4B7G A;  5F3W A;  3GLH B;  4NXM M;  4WP2 A;  3UK6 A;  1SXJ E;  3Q8X A;  5JI3 E;  3GRR A;  2B3T A;  1DO2 A;  2KRK A;  2ZAN A;  2Y20 A;  5GKN A;  3J7A S;  2X8A A;  2F5S A;  3KSJ A;  4GC9 A;  2L4F A;  4IBG A;  4DR5 M;  3SAW A;  4IBD A;  4LJA A;  4MGK E;  3KOW E;  2J5Y A;  2WSE F;  1HT2 E;  3GLF B;  2E5L M;  4PDI A;  3E21 A;  3JR5 A;  4ANR A;  1D0M A;  4CHT B;  3J27 B;  3DZD A;  2NQ8 C;  2I7P A;  1QYR A;  1SXJ A;  2QZ4 A;  3L26 A;  4L4U A;  2Z7J A;  2VII A;  1UM8 A;  2MR9 A;  3QAU A;  3C58 A;  1QAN A;  5E6J A;  1MJG M;  1TGU A;  1Z6T A;  2FE8 A;  5EXP A;  3GLF A;  2BJW A;  4DR3 M;  3DA1 A;  1VEG A;  2JA2 A;  3VK8 A;  3B89 A;  2DWZ B;  2MH8 A;  2R18 A;  3WHK A;  1NHW C;  2Z4S A;  2KHH A;  3GLG E;  1IQP A;  1G41 A;  3M7G A;  3NBX X;  4NRW A;  1D0K A;  3W0F A;  4FCW A;  2GQF A;  3HU1 A;  4AKG A;  5KQD A;  1W5T A;  2LVO C;  1WXQ A;  1T43 A;  3E46 A;  1WIV A;  5FTN A;  1SXJ D;  1WR1 B;  3SHF A;  4LF6 M;  3HWS A;  4AQY M;  3BXW A;  4IJF A;  1QDT A;  4JI5 M;  2R44 A;  1K82 A;  2XEP A;  1C1K A;  2KW0 A;  3HJQ A;  4XGI A;  4UN2 B;  3VLF B;  1XMQ M;  3HY5 A;  4ZPX A;  2I7N A;  2RKO A;  3PXG A;  3ZH9 B;  1QVR A;  1VEK A;  1EFU B;  2EO2 A;  3AFH A;  2JUJ A;  4JI0 M;  3GLG A;  1G4A E;  2AHM A;  2KNZ A;  4JV5 M;  2F4V M;  5FTM A;  2JXN A;  4L78 A;  1L1Z A;  2R46 A;  2QBY B;  2HL7 A;  2R62 A;  1IY1 A;  3GRU A;  2V1U A;  2BNK A;  3FUW A;  3I01 M;  3W68 A;  1Z5A A;  5L8R F;  2F5P A;  1NJG A;  2FOI C;  2K47 A;  1IM2 A;  3LCU A;  3TWL A;  1EIJ A;  4LRT A;  4FCT A;  3KOY E;  2CUZ A;  3GRY A;  3I04 M;  4LY6 A;  3AOE C;  2KDL A;  4JI3 M;  2MGW A;  3GO8 A;  1T3T A;  2JY7 A;  5DYI A;  4AKI A;  3GPY A;  1E9R A;  4IBI A;  4LJ4 A;  1VQ1 A;  2LVN C;  1PJT A;  4JXJ A;  2QHO B;  3FD9 A;  3BOS A;  4G4Q A;  2P5T A;  4NSR A;  4GMQ A;  3GPX A;  5EJC A;  1IN6 A;  5KPR A;  1VDL A;  2DXI A;  1HR0 M;  2XH9 A;  2BWB A;  4I4L A;  3THG A;  4RF1 A;  1R6B X;  3ZCB B;  2DHR A;  1IN5 A;  4JI2 M;  2QCU A;  2XZU A;  2CV0 A;  1GJS A;  1N36 M;  1AIP C;  1VDD A;  3CTW B;  2EUC A;  3Q8G A;  4QNR A;  4LZZ A;  3KFU G;  5DYG A;  2DHY A;  2K9D A;  1ZQ9 A;  2LHG A;  3KS8 A;  1G71 A;  2C5R A;  2CHQ A;  2LBC A;  4LRS A;  3W67 A;  2XGN A;  1NV8 A;  2OPF A;  2O01 F;  4II7 A;  3FTE A;  4B3M M;  4DV6 M;  2M60 A;  3HU2 A;  1V92 A;  2DAI A;  1L2C A;  1NV9 A;  3HU3 A;  1GVN A;  4IBB A;  3U5Z B;  2DZO B;  4G4N A;  2L6O A;  3D8L A;  5KQ8 A;  3ZQJ A;  1N34 M;  4FCV A;  1Q3C A;  3SAR A;  3AL0 C;  4CIZ A;  3ZC7 B;  2ZAM A;  2J7O A;  2HKJ A;  3B7Q A;  1QUT A;  1IBL M;  1NJF A;  3KOX E;  2XSZ A;  3MMP A;  4MB7 A;  3GQ3 A;  1NVM A;  1G59 A;  1GL7 A;  1FNN A;  1TTE A;  5FTL A;  4FW9 A;  3M6A A;  2DAK A;  3U5Z A;  3MJ5 A;  2F5Q A;  2VDB B;  3GLH E;  2DZL A;  2UU9 M;  1XHB A;  2Q2E B;  3UMM A;  2CV1 A;  3WHL A;  4M0W A;  3AOE A;  2C9C A;  2CE7 A;  2LH0 A;  3SYL A;  2CWB A;  2XFS A;  3J80 S;  3KSX A;  1XNQ M;  1A5T A;  4GHA A;  2MJ5 B;  3FYC A;  1QZM A;  4B7F A;  4HEO A;  4JI1 M;  3FRI A;  4D81 A;  1PJI A;  1IY2 A;  4KLN A;  2CV2 A;  4HLQ A;  1HT1 E;  2XSZ D;  3A98 B;  3OTO M;  2XLJ A;  3FRH A;  2C98 A;  4IBE A;  3GLF E;  3GLI B;  1IXS B;  2C9O A;  1VG5 A;  3FTF A;  3GLH A;  5LMU M;  1HQC A;  4DBG B;  1CUK A;  4MGI E;  2L7H A;  3TWM A;  2KXE A;  1R4G A;  3B7Z A;  3SAT A;  4LJ5 A;  1DGG A;  1WGN A;  4L16 A;  2Z8Y M;  1E32 A;  4DV0 M;  3SMS A;  4FVM A;  4S12 A;  2WSF F; 
#chains in the Genus database with same CATH homology
 1KYI A;  2G3Q A;  4UN2 B;  4R71 A;  1T6O A;  3IEC A;  3GLI E;  2LVQ D;  2LVP C;  3K9O A;  1VEK A;  2JZ1 A;  2LTU A;  1Y8G A;  1EFU B;  2DKL A;  4Q7J A;  2JUJ A;  1G4A E;  2KNZ A;  3F92 A;  4F1I A;  1ZMV A;  2R0I A;  2CP8 A;  1YLA A;  2RRU A;  2LVA A;  1WHC A;  1OKS A;  1IM2 A;  3LCU A;  2BWE A;  2JP7 A;  2MGW A;  1E94 E;  2JY7 A;  2ZTD A;  1IXS A;  1VQ1 A;  2DEN A;  2LVN C;  2QHO B;  1C7Y A;  1VEJ A;  1ZMU A;  1IFY A;  1VDL A;  1MN3 A;  2BWB A;  2ZTC A;  2DAM A;  2DNA A;  2KNV A;  2H5X A;  2DAE A;  2K0B X;  1OTR A;  2EKK A;  1AIP C;  1PGY A;  1SG9 A;  2DHY A;  3BBZ A;  5JI2 E;  2K9D A;  2JY6 B;  1GO5 A;  2JNH A;  1Q02 A;  3FE3 A;  1XXH E;  4F2L A;  2LBC A;  1F4I A;  3K9P A;  1NV8 A;  2OO9 A;  2QSF X;  2DI0 A;  1JR3 E;  1BVS A;  2OOA A;  1XB2 B;  4WP2 A;  1OQY A;  1V92 A;  1G3I A;  2DAI A;  1NV9 A;  2B3T A;  1DO2 A;  4GEW A;  2QNJ A;  2L2D A;  3T6P A;  1DO0 A;  2EKF A;  1UFZ A;  2L4F A;  3MMP A;  1P3Q Q;  1TTE A;  2OOB A;  1OAI A;  3IHP A;  2DAK A;  2DAG A;  1HT2 E;  3GLH E;  2DZL A;  3E21 A;  2EJS A;  2HWJ A;  5DFL A;  2MRO B;  2CWB A;  4G3O A;  3H4J A;  1A5T A;  2MJ5 B;  1HQY E;  2MR9 A;  2JY5 A;  2WZJ A;  4HEO A;  3FRI A;  1HJP A;  1ZV1 A;  1ZMW A;  1VEG A;  2O25 A;  1TR8 A;  1WGL A;  3B89 A;  1HT1 E;  3GLF E;  3FRH A;  2KHH A;  3GLG E;  1G41 A;  1VG5 A;  1DV0 A;  2L4E A;  1QZE A;  4DBG B;  1CUK A;  2HAK A;  1R4G A;  1WGN A;  1WJ7 A;  2KNA A;  2LVO C;  3LCV B;  1T43 A;  2JY8 A;  3E46 A;  1WIV A;  1WR1 B;  2JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...