2KNAA

Solution structure of uba domain of xiap
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
GSAMADIGSEFEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baculoviral IAP repeat-containing protein 4
publication title Backbone and side-chain 1H, 13C and 15N assignments of the ubiquitin-associated domain of human X-linked inhibitor of apoptosis protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 19
structure length 104
sequence length 104
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knaA01
2QNJA 2EKFA 1BVSA 2CP8A 2OOBA 3GLIE 2LBCA 1YLAA 1G4AE 2LVPC 4R71A 1V92A 5DFLA 5JI2E 1C7YA 1KYIA 3E46A 1OKSA 2JY6B 4Q7JA 2JY8A 1HQYE 1IFYA 2L4EA 2KNVA 2HWJA 2LVNC 1WGNA 2EKKA 1SG9A 4GEWA 2KNZA 2CWBA 2DHYA 4UN2B 2RRUA 2BWBA 1IXSA 1IM2A 2MGWA 1TTEA 2B3TA 3FRIA 1NV9A 3IHPA 2DZLA 2JY5A 4G3OA 1HJPA 1ZMWA 2DKLA 1ZMUA 1ZV1A 1VEGA 1OAIA 2QSFX 1HT1E 2DAGA 2KNAA 2DAKA 2LVOC 4DBGB 2K0BX 3GLFE 1F4IA 1NV8A 1XXHE 2JNHA 2H5XA 1GO5A 1MN3A 1WR1B 2DAIA 1Y8GA 1T6OA 1R4GA 1DV0A 3LCUA 2DAMA 3BBZA 1WGLA 1PGYA 3H4JA 4F1IA 3LCVB 1Q02A 1TR8A 2DNAA 3IECA 2OO9A 2ZTDA 2LVQD 2O25A 3GLGE 3FE3A 1XB2B 1OQYA 1E94E 2LVAA 1DO0A 1QZEA 2OOAA 1UFZA 1DO2A 3F92A 1EFUB 2WZJA 2HAKA 1VEJA 1AIPC 1CUKA 2JUJA 3GLHE 1JR3E 1WHCA 2JZ1A 2G3QA 2BWEA 2DI0A 1VEKA 1WJ7A 2MR9A 3T6PA 4WP2A 1G41A 2R0IA 2MJ5B 1VDLA 1T43A 2EJSA 2K9DA 3E21A 1G3IA 3MMPA 2KHHA 1P3QQ 3K9OA 2JY7A 2MROB 3FRHA 3K9PA 4HEOA 1A5TA 2LTUA 1WIVA 3B89A 1VG5A 2DAEA 1OTRA 2DENA 2L4FA 4F2LA 1HT2E 2JZ0A 1ZMVA 1VQ1A 2L2DA 2QHOB 2JP7A 2ZTCA
chains in the Genus database with same CATH superfamily
5FTMA 3ZCBB 4LFBM 4D81A 1PJTA 5L8RF 1EE8A 2C9OA 4LFAM 3U60B 4X62M 2R6FA 4GKJM 1IXRC 1IN7A 1S3SA 4IIWA 4AI6A 2LVPC 3J27B 4GMQA 2WSFF 4JI4M 3LMMA 4PD2A 5EJCA 1FNNA 3E46A 2YNMD 4KODA 5KQ8A 1IFYA 1HQYE 1YSYA 3SASA 4LZZA 4RKUF 3QYEA 3KP1E 3FKEA 4NSRA 3GLIB 2F5SA 1GJSA 3H4MA 2Z7JA 3C58A 2CWBA 4WW0A 1PJSA 4UN2B 5LMNM 2BWBA 1IM2A 1TTEA 3FRIA 3HHYA 1NV9A 3IHPA 4QOSA 3GQ5A 2E5LM 3A42A 2JA2A 2GQFA 1ZMWA 3THGA 3SATA 3U6EA 1W5TA 1MJGM 2K0BX 3VK7A 5GKNA 4S12A 2QENA 3GLFE 4NXNM 2VQEM 1L8QA 5IREB 3KP0E 1NJGA 3U6MA 3K2LA 4BBAA 3U6QA 1GO5A 1DGFA 2W82A 2EUCA 2R18A 3U61A 3SAVA 3V76A 3U6SA 1Z5BA 2FS1A 4DV5M 4JI8M 2CHQA 3VFDA 1PJIA 2QP9X 1XXHB 1D0LA 1Z6TA 2Y21A 1IY1A 4LCBA 2VF8A 4YY3M 2X49A 3AOEC 3B7ZA 3BBZA 1PGYA 1K3XA 4G4RA 5F3WA 3CF0A 1OFHA 4OVZA 3SHFA 4D80A 3T1HM 2G8LA 2KRKA 2CV1A 1HNZM 4DV1M 2LVQD 1PRBA 3A98B 4KT0F 1GL7A 1Z5CA 2FH0A 3FE3A 3MHVC 1E9RA 4LRSA 3HHZA 3LW5F 1SXJE 3I01M 2LVAA 1DO0A 3R8FA 4OX9M 4IJEA 2XZFA 2WZJA 3J7AS 4CJ6A 1AIPC 3VKGA 4FCVA 8CATA 4LGYA 3AL0C 1Q3CA 3GLGB 2UU9M 3GLHA 3L28A 5E6JA 3HU2A 2DI0A 4FCWA 3HY5A 1QANA 1WJ7A 5IZ7D 2D7HA 4B7HA 1J7KA 3HU3A 3KOZE 4HLQA 1PM5A 2DVWB 2C99A 4DR6M 4WP2A 5DYIA 4K0KM 3KFUG 3SC3A 1L2DA 4JV5M 3AJIB 1NHWC 2F5OA 3LQQA 4G4QA 1IN4A 3CTWB 2LHCA 2D7GA 4B08A 2K9DA 3GRYA 3DZDA 5C1BA 2F5NA 4FW9A 1XHBA 2MH8A 3A46A 3A45A 1Q39A 4IBDA 4G4OA 1QAMA 1A5TA 3C3DA 4I81A 2DWLA 3L25A 4NC6A 5ITXA 1N34M 3B89A 2XGNA 4QHTA 4LF9M 2A5YB 1L1ZA 3WHLA 2HHHM 1OIZA 4R3DA 4AQYM 4M0WA 4GKKM 4LY6A 5FTLA 4DR3M 4P17A 4F2LA 1SXJB 2C5RA 2L2DA 1YUBA 2JP7A 2ZTCA 4LJ7A 2CUZA 1BVSA 1T3TA 4DUZM 4AW4A 2LBCA 3GLIE 1YLAA 1G4AE 1WXQA 5DFLA 5JI2E 3ZQJA 2UXCM 5ITUA 1KSFX 5ITYA 3MJ5A 2BJWA 2BNKA 2JY6B 5EP1A 3NWLA 1XC8A 3U5ZA 2RGOA 4IBJA 3KOYE 4LF4M 3BXWA 1E32A 4GC9A 3RGPA 1G59A 3OTOM 2CRUA 3HGIA 1GLNA 2G5GX 2HWJA 2LVNC 1WGNA 1SG9A 2V1CA 4BLCA 4LF7M 4MGYE 2DHYA 4DR5M 4L4UA 2RRUA 2KA6B 2XFSA 2B3TA 3R9XB 4DR7M 1IY0A 2JY5A 3PNYA 2Y0TA 1D0KA 1HJPA 2HCBA 2DKLA 1ZV1A 2AHMA 2X4AA 2ZBKB 2R62A 1PJQA 2C98A 3B9PA 1IXSB 2DAGA 2DHRA 2KNAA 3ZH9B 1DGHA 3I04M 3FTEA 1F4IA 1NV8A 1DGGA 1XXHE 3FUWA 3GLFA 2LHGA 2KEBA 4DR1M 2JNHA 2R4EA 3HU1A 1QYRA 3U6DA 5FLXS 1MN3A 4RF1A 1Y8GA 2H1RA 4B3RM 2QQ8A 2XSZA 1GVNA 2XF3A 3PNVA 4DR2M 4AKIA 2WSEF 2OQ4A 2F5PA 2L6OA 3D8BA 1JR3D 1NVMA 3J7BA 3NBIA 1N78A 1HQCA 4TUWA 3H4JA 4A3VB 1TR8A 4B7FA 4Z8XA 4IJFA 1C1KA 3NBXX 4WURA 1NSFA 1X37A 5EP4A 3GLGE 2CV0A 3ILKA 4FWHA 2LNHC 7CATA 2QBYB 4JI5M 2KW0A 1OQYA 1E94E 3LVVA 4ZPXA 2OOAA 4JI2M 3GPYA 3GQ4A 2FE8A 3DFZA 3L29A 2KRUA 1VEJA 1CUKA 1SXJC 1Z59A 2Y0QA 4IBKA 4Y28F 3SBJA 2JZ1A 4AKGA 3AOEA 2R4JA 1QDTA 3SHGB 5KPRA 1IN5A 3KDSE 1N77A 1N32M 2Z4RA 3TWLA 1G41A 2ZAOA 2LXEA 2UUBM 3FTFA 1YE9A 2UXBM 3TWKA 3E9SA 2F4VM 3C9PA 4KLNA 5ITRA 3L27A 1G3IA 2KHHA 2CE7A 1IY2A 4L78A 5EP2A 1TDHA 3FRHA 3VKHA 1IXZA 2K6BA 4IBGA 4B7GA 3PXGA 4XK8F 4GHLA 4JXJA 4FVMA 1VG5A 3GRVA 1TDZA 4DV4M 1R2ZA 4FWGA 2XSZD 1PJJA 4DUYM 3RE8A 3KOWE 4AG6A 3U60A 3KS8A 1QQWA 2ZAMA 3EIHA 4ITQA 3U6LA 3TQSA 3F92A 4NXMM 2QNJA 3AV0A 4JN6A 2HL7A 3SARA 4PCZA 2EKFA 3DOAA 5BPVA 5EXPA 4DV3M 4MGIE 2C9CA 2OOBA 2L7IA 1TH2A 3GLIA 5DNYA 3CF6E 5EXSA 1V92A 2HKJA 1R7RA 1NJFA 4I5SA 4IBBA 1KYIA 1OKSA 2DZOB 1GJTA 4Q7JA 2JY8A 2R46A 4L8RC 2X8AA 3T15A 2DWNA 3ZC7B 2L4EA 3UMMA 5H37D 3GPUA 4W5WA 2KNVA 4YHHM 1K3WA 4JYAM 2EKKA 3AOGA 3HHXA 2M5ZA 3HJQA 5FTJA 4IBFA 3W0LB 1QZMA 4DV2M 1N75A 3D8LA 1HR0M 1E9SA 1NNUC 4KHPM 2DZLA 4DV0M 4DR4M 5DYGA 3IG8A 3W67A 4P16A 1NNJA 1VEGA 1OAIA 2CHVA 2O01F 1HT1E 3UZUA 4DBGB 2XZUA 2R65A 4NL4H 4LRTA 3L26A 3HJ8A 4IBCA 1IN8A 3KS4A 3M6AA 1XXHA 2UUCM 1QAOA 3W0FA 2H5XA 4AZFA 2CFOA 3I4YA 5E26A 2DZNB 4JI6M 4IBEA 4GC5A 4G4NA 4MM3B 2YFQA 3MK6A 4FCTA 3U6OA 1DV0A 1G8PA 4B3SM 2NQ8C 3LCUA 1TGUA 1I94M 1NHGC 3FUXA 3U61B 1WGLA 4LG2A 4MGKE 3QYBA 3UK6A 3CGWA 2XH9A 4F1IA 4MH0E 2DWMA 2DNAA 1XWIA 2ZTDA 3FTDA 4XBOA 4KO8A 5IWAM 3LQRA 3JR5A 3M0EA 1R5LA 1XB2B 2V6ZM 2J5YA 3FUVA 3UGJA 5FSWA 3GLGA 4OVZB 4LZJA 1KFVA 1QZEA 4PDIA 1UFZA 3HKPA 2XFTA 4M9SA 1D2NA 5ITXE 3J81S 3T1YM 1QDRA 3FUUA 1XMOM 2VIIA 4LJAA 3TWMA 3SYLA 4Z6YA 3AKZA 4AG5A 1JR3E 2ERCA 2LH0A 3AFHA 4LJ4A 1HNWM 2BWEA 1OIPA 3M7GA 1UM8A 4QNMA 3BOSA 1LV7A 3C3EA 2QPAA 4REZA 2BJVA 1MU5A 2P5TA 4FWDA 4DV6M 5KO3A 1V34A 1OJLA 1Z5AA 2KXEA 2MJ5B 3GLHB 1NY5A 4QNRA 5ITTA 1DGBA 1VDLA 1T43A 1N36M 2UUAM 3SAWA 2I7NA 1H6UA 3PVSA 2UXDM 4G6ZA 4MB7A 3K9OA 4JI3M 4LGMA 5KQDA 1AUAA 4B3TM 4JI7M 2JY7A 3KSXA 2MROB 1SXJA 5EQTA 3GRUA 4CIZA 4GH9A 1WIVA 4ANRA 2N35A 4LF8M 4OW0A 3VDPA 2FNAA 3K1JA 3DA1A 1OTRA 2J7NA 3KVWA 3QWLA 5ITQA 2VF7A 2RKOA 1R2YA 1K82A 5EXXA 4AKHA 2L4FA 4DV7M 2FOIC 4QOZC 5JI3E 1HT2E 1ZMVA 2L09A 3RFWA 1GL6A 5FTKA 4GITA 3JR4A 3KW6A 4L6V6 5LMUM 3VK8A 3GP1A 2R44A 1ORYB 2CHGA 1LTMA 4RF0A 2DXIA 2CP8A 5KPZA 2XEPA 2O5RA 3WHKA 4R71A 4LFCM 3U6PA 2JXNA 4MGZE 1C7YA 4GHAA 2QCUA 4CHTB 1J09A 3JAMS 1L2CA 3TE6A 3SFZA 4XGIA 3J80S 1VDDA 3FD9A 1L2BA 1TF0B 2C96A 3HZJA 4NRVA 4GEWA 2V1UA 1Q3BA 2KNZA 2GNOA 5KPTA 4M9ZA 2OPFA 3U5ZB 2EO2A 1IXSA 2KDLA 2MGWA 4MGHA 2EA0A 3K92A 4II7A 4OU7A 4G3OA 2YR0A 3PFIA 4NOOB 3FYDA 2XLJA 1ZMUA 4JI0M 1I4WA 3CF2A 4M0DA 4PT5A 1JQJC 4D82A 5A2QS 2QSFX 4RNAA 4R7GA 1XNQM 2DAKA 2LVOC 3HX3A 3GQ3A 4LF5M 1R6BX 3B74A 3U6CA 4GIPA 4GRIA 3B7QA 2JWSA 3GO8A 2F5QA 4L16A 2LWXA 4FD2A 1GKIA 1IN6A 1OFIA 5C18A 1GABA 1IBKM 1N33M 1WR1B 1SXJD 2DAIA 2RGHA 2WSCF 1DGHB 1G71A 2Y20A 3I4VA 3L2AA 4CISA 4M9XA 1T6OA 4JI1M 4HL4A 3RGSA 3GLFB 1R4GA 4LJ5A 1TH3A 3KSJA 3T38A 2J7OA 1XMQM 1EIJA 2DAMA 4BB9A 2KZUA 3J2PB 1L1TA 4EIWA 3KXEC 1RU3A 1W5SA 2M60A 4X65M 2QBYA 4B3MM 2L7HA 3HWSA 3LCVB 1Q02A 3VDUA 2R45A 2ZM6M 3IECA 2DWZB 3FUTA 4I8OA 1D0MA 2OO9A 4PDGA 3UJNA 3QAUA 3SMSA 1HNXM 2O25A 1IQPA 5EXTA 2CV2A 2Q2EB 2D7EA 3GPXA 1DO2A 4LJ9A 5IT9S 1EFUB 3W68A 2HAKA 1QUSA 3GRRA 4LJ6A 5FTNA 2JUJA 1FJGM 3GLHE 2FFJA 1WHCA 3SYKA 1JR3A 2G3QA 4I4LA 3I51A 1VEKA 2APLA 1IBLM 2MR9A 4LJ8A 1J5EM 1JB0F 3T6PA 4X64M 2Z4SA 1TH4A 4CGYB 2R0IA 3TL4X 3GPPA 2VQFM 3HHWA 3Q8GA 4NSOB 3EIEA 2VDBB 3SAUA 1QUTA 2EJSA 3B7NA 3TPZA 3FYCA 1IBMM 2ZANA 3E21A 5EP3A 4NRWA 3MMPA 4L15A 3KOXE 1NO1A 1P3QQ 1ZAEA 2YQZA 2QZ4A 2CEAA 3FTCA 2Z3XA 3K9PA 2I7PA 3E4RA 4HEOA 3VLFB 1MX0A 2LTUA 3LVWA 4X66M 5BR8M 3SMPA 1QAQA 1QVRA 2DAEA 3K8ZA 2KZSA 4IBIA 2DENA 2K47A 1NY6A 2Z8YM 4QHSA 1V33A 1XNRM 1ZQ9A 1OAOC 2JZ0A 3Q8XA 3IG5A 4LF6M 1VQ1A 2QHOB 3HJSA
chains in the Genus database with same CATH topology
2QNJA 2EKFA 1BVSA 2CP8A 2OOBA 3GLIE 2LBCA 1YLAA 1G4AE 2LVPC 4R71A 1V92A 5DFLA 5JI2E 1C7YA 1KYIA 3E46A 1OKSA 2JY6B 4Q7JA 2JY8A 1HQYE 1IFYA 2L4EA 2KNVA 2HWJA 2LVNC 1WGNA 2EKKA 1SG9A 4GEWA 2KNZA 2CWBA 2DHYA 4UN2B 2RRUA 2BWBA 1IXSA 1IM2A 2MGWA 1TTEA 2B3TA 3FRIA 1NV9A 3IHPA 2DZLA 2JY5A 4G3OA 1HJPA 1ZMWA 2DKLA 1ZMUA 1ZV1A 1VEGA 1OAIA 2QSFX 1HT1E 2DAGA 2KNAA 2DAKA 2LVOC 4DBGB 2K0BX 3GLFE 1F4IA 1NV8A 1XXHE 2JNHA 2H5XA 1GO5A 1MN3A 1WR1B 2DAIA 1Y8GA 1T6OA 1R4GA 1DV0A 3LCUA 2DAMA 3BBZA 1WGLA 1PGYA 3H4JA 4F1IA 3LCVB 1Q02A 1TR8A 2DNAA 3IECA 2OO9A 2ZTDA 2LVQD 2O25A 3GLGE 3FE3A 1XB2B 1OQYA 1E94E 2LVAA 1DO0A 1QZEA 2OOAA 1UFZA 1DO2A 3F92A 1EFUB 2WZJA 2HAKA 1VEJA 1AIPC 1CUKA 2JUJA 3GLHE 1JR3E 1WHCA 2JZ1A 2G3QA 2BWEA 2DI0A 1VEKA 1WJ7A 2MR9A 3T6PA 4WP2A 1G41A 2R0IA 2MJ5B 1VDLA 1T43A 2EJSA 2K9DA 3E21A 1G3IA 3MMPA 2KHHA 1P3QQ 3K9OA 2JY7A 2MROB 3FRHA 3K9PA 4HEOA 1A5TA 2LTUA 1WIVA 3B89A 1VG5A 2DAEA 1OTRA 2DENA 2L4FA 4F2LA 1HT2E 2JZ0A 1ZMVA 1VQ1A 2L2DA 2QHOB 2JP7A 2ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNJ A;  2EKF A;  1BVS A;  2CP8 A;  2OOB A;  3GLI E;  2LBC A;  1YLA A;  1G4A E;  2LVP C;  4R71 A;  1V92 A;  5DFL A;  5JI2 E;  1C7Y A;  1KYI A;  3E46 A;  1OKS A;  2JY6 B;  4Q7J A;  2JY8 A;  1HQY E;  1IFY A;  2L4E A;  2KNV A;  2HWJ A;  2LVN C;  1WGN A;  2EKK A;  1SG9 A;  4GEW A;  2KNZ A;  2CWB A;  2DHY A;  4UN2 B;  2RRU A;  2BWB A;  1IXS A;  1IM2 A;  2MGW A;  1TTE A;  2B3T A;  3FRI A;  1NV9 A;  3IHP A;  2DZL A;  2JY5 A;  4G3O A;  1HJP A;  1ZMW A;  2DKL A;  1ZMU A;  1ZV1 A;  1VEG A;  1OAI A;  2QSF X;  1HT1 E;  2DAG A;  2KNA A;  2DAK A;  2LVO C;  4DBG B;  2K0B X;  3GLF E;  1F4I A;  1NV8 A;  1XXH E;  2JNH A;  2H5X A;  1GO5 A;  1MN3 A;  1WR1 B;  2DAI A;  1Y8G A;  1T6O A;  1R4G A;  1DV0 A;  3LCU A;  2DAM A;  3BBZ A;  1WGL A;  1PGY A;  3H4J A;  4F1I A;  3LCV B;  1Q02 A;  1TR8 A;  2DNA A;  3IEC A;  2OO9 A;  2ZTD A;  2LVQ D;  2O25 A;  3GLG E;  3FE3 A;  1XB2 B;  1OQY A;  1E94 E;  2LVA A;  1DO0 A;  1QZE A;  2OOA A;  1UFZ A;  1DO2 A;  3F92 A;  1EFU B;  2WZJ A;  2HAK A;  1VEJ A;  1AIP C;  1CUK A;  2JUJ A;  3GLH E;  1JR3 E;  1WHC A;  2JZ1 A;  2G3Q A;  2BWE A;  2DI0 A;  1VEK A;  1WJ7 A;  2MR9 A;  3T6P A;  4WP2 A;  1G41 A;  2R0I A;  2MJ5 B;  1VDL A;  1T43 A;  2EJS A;  2K9D A;  3E21 A;  1G3I A;  3MMP A;  2KHH A;  1P3Q Q;  3K9O A;  2JY7 A;  2MRO B;  3FRH A;  3K9P A;  4HEO A;  1A5T A;  2LTU A;  1WIV A;  3B89 A;  1VG5 A;  2DAE A;  1OTR A;  2DEN A;  2L4F A;  4F2L A;  1HT2 E;  2JZ0 A;  1ZMV A;  1VQ1 A;  2L2D A;  2QHO B;  2JP7 A;  2ZTC A; 
#chains in the Genus database with same CATH topology
 5FTM A;  3ZCB B;  4LFB M;  4D81 A;  1PJT A;  5L8R F;  1EE8 A;  2C9O A;  4LFA M;  3U60 B;  4X62 M;  2R6F A;  4GKJ M;  1IXR C;  1IN7 A;  1S3S A;  4IIW A;  4AI6 A;  2LVP C;  3J27 B;  4GMQ A;  2WSF F;  4JI4 M;  3LMM A;  4PD2 A;  5EJC A;  1FNN A;  3E46 A;  2YNM D;  4KOD A;  5KQ8 A;  1IFY A;  1HQY E;  1YSY A;  3SAS A;  4LZZ A;  4RKU F;  3QYE A;  3KP1 E;  3FKE A;  4NSR A;  3GLI B;  2F5S A;  1GJS A;  3H4M A;  2Z7J A;  3C58 A;  2CWB A;  4WW0 A;  1PJS A;  4UN2 B;  5LMN M;  2BWB A;  1IM2 A;  1TTE A;  3FRI A;  3HHY A;  1NV9 A;  3IHP A;  4QOS A;  3GQ5 A;  2E5L M;  3A42 A;  2JA2 A;  2GQF A;  1ZMW A;  3THG A;  3SAT A;  3U6E A;  1W5T A;  1MJG M;  2K0B X;  3VK7 A;  5GKN A;  4S12 A;  2QEN A;  3GLF E;  4NXN M;  2VQE M;  1L8Q A;  5IRE B;  3KP0 E;  1NJG A;  3U6M A;  3K2L A;  4BBA A;  3U6Q A;  1GO5 A;  1DGF A;  2W82 A;  2EUC A;  2R18 A;  3U61 A;  3SAV A;  3V76 A;  3U6S A;  1Z5B A;  2FS1 A;  4DV5 M;  4JI8 M;  2CHQ A;  3VFD A;  1PJI A;  2QP9 X;  1XXH B;  1D0L A;  1Z6T A;  2Y21 A;  1IY1 A;  4LCB A;  2VF8 A;  4YY3 M;  2X49 A;  3AOE C;  3B7Z A;  3BBZ A;  1PGY A;  1K3X A;  4G4R A;  5F3W A;  3CF0 A;  1OFH A;  4OVZ A;  3SHF A;  4D80 A;  3T1H M;  2G8L A;  2KRK A;  2CV1 A;  1HNZ M;  4DV1 M;  2LVQ D;  1PRB A;  3A98 B;  4KT0 F;  1GL7 A;  1Z5C A;  2FH0 A;  3FE3 A;  3MHV C;  1E9R A;  4LRS A;  3HHZ A;  3LW5 F;  1SXJ E;  3I01 M;  2LVA A;  1DO0 A;  3R8F A;  4OX9 M;  4IJE A;  2XZF A;  2WZJ A;  3J7A S;  4CJ6 A;  1AIP C;  3VKG A;  4FCV A;  8CAT A;  4LGY A;  3AL0 C;  1Q3C A;  3GLG B;  2UU9 M;  3GLH A;  3L28 A;  5E6J A;  3HU2 A;  2DI0 A;  4FCW A;  3HY5 A;  1QAN A;  1WJ7 A;  5IZ7 D;  2D7H A;  4B7H A;  1J7K A;  3HU3 A;  3KOZ E;  4HLQ A;  1PM5 A;  2DVW B;  2C99 A;  4DR6 M;  4WP2 A;  5DYI A;  4K0K M;  3KFU G;  3SC3 A;  1L2D A;  4JV5 M;  3AJI B;  1NHW C;  2F5O A;  3LQQ A;  4G4Q A;  1IN4 A;  3CTW B;  2LHC A;  2D7G A;  4B08 A;  2K9D A;  3GRY A;  3DZD A;  5C1B A;  2F5N A;  4FW9 A;  1XHB A;  2MH8 A;  3A46 A;  3A45 A;  1Q39 A;  4IBD A;  4G4O A;  1QAM A;  1A5T A;  3C3D A;  4I81 A;  2DWL A;  3L25 A;  4NC6 A;  5ITX A;  1N34 M;  3B89 A;  2XGN A;  4QHT A;  4LF9 M;  2A5Y B;  1L1Z A;  3WHL A;  2HHH M;  1OIZ A;  4R3D A;  4AQY M;  4M0W A;  4GKK M;  4LY6 A;  5FTL A;  4DR3 M;  4P17 A;  4F2L A;  1SXJ B;  2C5R A;  2L2D A;  1YUB A;  2JP7 A;  2ZTC A;  4LJ7 A;  2CUZ A;  1BVS A;  1T3T A;  4DUZ M;  4AW4 A;  2LBC A;  3GLI E;  1YLA A;  1G4A E;  1WXQ A;  5DFL A;  5JI2 E;  3ZQJ A;  2UXC M;  5ITU A;  1KSF X;  5ITY A;  3MJ5 A;  2BJW A;  2BNK A;  2JY6 B;  5EP1 A;  3NWL A;  1XC8 A;  3U5Z A;  2RGO A;  4IBJ A;  3KOY E;  4LF4 M;  3BXW A;  1E32 A;  4GC9 A;  3RGP A;  1G59 A;  3OTO M;  2CRU A;  3HGI A;  1GLN A;  2G5G X;  2HWJ A;  2LVN C;  1WGN A;  1SG9 A;  2V1C A;  4BLC A;  4LF7 M;  4MGY E;  2DHY A;  4DR5 M;  4L4U A;  2RRU A;  2KA6 B;  2XFS A;  2B3T A;  3R9X B;  4DR7 M;  1IY0 A;  2JY5 A;  3PNY A;  2Y0T A;  1D0K A;  1HJP A;  2HCB A;  2DKL A;  1ZV1 A;  2AHM A;  2X4A A;  2ZBK B;  2R62 A;  1PJQ A;  2C98 A;  3B9P A;  1IXS B;  2DAG A;  2DHR A;  2KNA A;  3ZH9 B;  1DGH A;  3I04 M;  3FTE A;  1F4I A;  1NV8 A;  1DGG A;  1XXH E;  3FUW A;  3GLF A;  2LHG A;  2KEB A;  4DR1 M;  2JNH A;  2R4E A;  3HU1 A;  1QYR A;  3U6D A;  5FLX S;  1MN3 A;  4RF1 A;  1Y8G A;  2H1R A;  4B3R M;  2QQ8 A;  2XSZ A;  1GVN A;  2XF3 A;  3PNV A;  4DR2 M;  4AKI A;  2WSE F;  2OQ4 A;  2F5P A;  2L6O A;  3D8B A;  1JR3 D;  1NVM A;  3J7B A;  3NBI A;  1N78 A;  1HQC A;  4TUW A;  3H4J A;  4A3V B;  1TR8 A;  4B7F A;  4Z8X A;  4IJF A;  1C1K A;  3NBX X;  4WUR A;  1NSF A;  1X37 A;  5EP4 A;  3GLG E;  2CV0 A;  3ILK A;  4FWH A;  2LNH C;  7CAT A;  2QBY B;  4JI5 M;  2KW0 A;  1OQY A;  1E94 E;  3LVV A;  4ZPX A;  2OOA A;  4JI2 M;  3GPY A;  3GQ4 A;  2FE8 A;  3DFZ A;  3L29 A;  2KRU A;  1VEJ A;  1CUK A;  1SXJ C;  1Z59 A;  2Y0Q A;  4IBK A;  4Y28 F;  3SBJ A;  2JZ1 A;  4AKG A;  3AOE A;  2R4J A;  1QDT A;  3SHG B;  5KPR A;  1IN5 A;  3KDS E;  1N77 A;  1N32 M;  2Z4R A;  3TWL A;  1G41 A;  2ZAO A;  2LXE A;  2UUB M;  3FTF A;  1YE9 A;  2UXB M;  3TWK A;  3E9S A;  2F4V M;  3C9P A;  4KLN A;  5ITR A;  3L27 A;  1G3I A;  2KHH A;  2CE7 A;  1IY2 A;  4L78 A;  5EP2 A;  1TDH A;  3FRH A;  3VKH A;  1IXZ A;  2K6B A;  4IBG A;  4B7G A;  3PXG A;  4XK8 F;  4GHL A;  4JXJ A;  4FVM A;  1VG5 A;  3GRV A;  1TDZ A;  4DV4 M;  1R2Z A;  4FWG A;  2XSZ D;  1PJJ A;  4DUY M;  3RE8 A;  3KOW E;  4AG6 A;  3U60 A;  3KS8 A;  1QQW A;  2ZAM A;  3EIH A;  4ITQ A;  3U6L A;  3TQS A;  3F92 A;  4NXM M;  2QNJ A;  3AV0 A;  4JN6 A;  2HL7 A;  3SAR A;  4PCZ A;  2EKF A;  3DOA A;  5BPV A;  5EXP A;  4DV3 M;  4MGI E;  2C9C A;  2OOB A;  2L7I A;  1TH2 A;  3GLI A;  5DNY A;  3CF6 E;  5EXS A;  1V92 A;  2HKJ A;  1R7R A;  1NJF A;  4I5S A;  4IBB A;  1KYI A;  1OKS A;  2DZO B;  1GJT A;  4Q7J A;  2JY8 A;  2R46 A;  4L8R C;  2X8A A;  3T15 A;  2DWN A;  3ZC7 B;  2L4E A;  3UMM A;  5H37 D;  3GPU A;  4W5W A;  2KNV A;  4YHH M;  1K3W A;  4JYA M;  2EKK A;  3AOG A;  3HHX A;  2M5Z A;  3HJQ A;  5FTJ A;  4IBF A;  3W0L B;  1QZM A;  4DV2 M;  1N75 A;  3D8L A;  1HR0 M;  1E9S A;  1NNU C;  4KHP M;  2DZL A;  4DV0 M;  4DR4 M;  5DYG A;  3IG8 A;  3W67 A;  4P16 A;  1NNJ A;  1VEG A;  1OAI A;  2CHV A;  2O01 F;  1HT1 E;  3UZU A;  4DBG B;  2XZU A;  2R65 A;  4NL4 H;  4LRT A;  3L26 A;  3HJ8 A;  4IBC A;  1IN8 A;  3KS4 A;  3M6A A;  1XXH A;  2UUC M;  1QAO A;  3W0F A;  2H5X A;  4AZF A;  2CFO A;  3I4Y A;  5E26 A;  2DZN B;  4JI6 M;  4IBE A;  4GC5 A;  4G4N A;  4MM3 B;  2YFQ A;  3MK6 A;  4FCT A;  3U6O A;  1DV0 A;  1G8P A;  4B3S M;  2NQ8 C;  3LCU A;  1TGU A;  1I94 M;  1NHG C;  3FUX A;  3U61 B;  1WGL A;  4LG2 A;  4MGK E;  3QYB A;  3UK6 A;  3CGW A;  2XH9 A;  4F1I A;  4MH0 E;  2DWM A;  2DNA A;  1XWI A;  2ZTD A;  3FTD A;  4XBO A;  4KO8 A;  5IWA M;  3LQR A;  3JR5 A;  3M0E A;  1R5L A;  1XB2 B;  2V6Z M;  2J5Y A;  3FUV A;  3UGJ A;  5FSW A;  3GLG A;  4OVZ B;  4LZJ A;  1KFV A;  1QZE A;  4PDI A;  1UFZ A;  3HKP A;  2XFT A;  4M9S A;  1D2N A;  5ITX E;  3J81 S;  3T1Y M;  1QDR A;  3FUU A;  1XMO M;  2VII A;  4LJA A;  3TWM A;  3SYL A;  4Z6Y A;  3AKZ A;  4AG5 A;  1JR3 E;  2ERC A;  2LH0 A;  3AFH A;  4LJ4 A;  1HNW M;  2BWE A;  1OIP A;  3M7G A;  1UM8 A;  4QNM A;  3BOS A;  1LV7 A;  3C3E A;  2QPA A;  4REZ A;  2BJV A;  1MU5 A;  2P5T A;  4FWD A;  4DV6 M;  5KO3 A;  1V34 A;  1OJL A;  1Z5A A;  2KXE A;  2MJ5 B;  3GLH B;  1NY5 A;  4QNR A;  5ITT A;  1DGB A;  1VDL A;  1T43 A;  1N36 M;  2UUA M;  3SAW A;  2I7N A;  1H6U A;  3PVS A;  2UXD M;  4G6Z A;  4MB7 A;  3K9O A;  4JI3 M;  4LGM A;  5KQD A;  1AUA A;  4B3T M;  4JI7 M;  2JY7 A;  3KSX A;  2MRO B;  1SXJ A;  5EQT A;  3GRU A;  4CIZ A;  4GH9 A;  1WIV A;  4ANR A;  2N35 A;  4LF8 M;  4OW0 A;  3VDP A;  2FNA A;  3K1J A;  3DA1 A;  1OTR A;  2J7N A;  3KVW A;  3QWL A;  5ITQ A;  2VF7 A;  2RKO A;  1R2Y A;  1K82 A;  5EXX A;  4AKH A;  2L4F A;  4DV7 M;  2FOI C;  4QOZ C;  5JI3 E;  1HT2 E;  1ZMV A;  2L09 A;  3RFW A;  1GL6 A;  5FTK A;  4GIT A;  3JR4 A;  3KW6 A;  4L6V 6;  5LMU M;  3VK8 A;  3GP1 A;  2R44 A;  1ORY B;  2CHG A;  1LTM A;  4RF0 A;  2DXI A;  2CP8 A;  5KPZ A;  2XEP A;  2O5R A;  3WHK A;  4R71 A;  4LFC M;  3U6P A;  2JXN A;  4MGZ E;  1C7Y A;  4GHA A;  2QCU A;  4CHT B;  1J09 A;  3JAM S;  1L2C A;  3TE6 A;  3SFZ A;  4XGI A;  3J80 S;  1VDD A;  3FD9 A;  1L2B A;  1TF0 B;  2C96 A;  3HZJ A;  4NRV A;  4GEW A;  2V1U A;  1Q3B A;  2KNZ A;  2GNO A;  5KPT A;  4M9Z A;  2OPF A;  3U5Z B;  2EO2 A;  1IXS A;  2KDL A;  2MGW A;  4MGH A;  2EA0 A;  3K92 A;  4II7 A;  4OU7 A;  4G3O A;  2YR0 A;  3PFI A;  4NOO B;  3FYD A;  2XLJ A;  1ZMU A;  4JI0 M;  1I4W A;  3CF2 A;  4M0D A;  4PT5 A;  1JQJ C;  4D82 A;  5A2Q S;  2QSF X;  4RNA A;  4R7G A;  1XNQ M;  2DAK A;  2LVO C;  3HX3 A;  3GQ3 A;  4LF5 M;  1R6B X;  3B74 A;  3U6C A;  4GIP A;  4GRI A;  3B7Q A;  2JWS A;  3GO8 A;  2F5Q A;  4L16 A;  2LWX A;  4FD2 A;  1GKI A;  1IN6 A;  1OFI A;  5C18 A;  1GAB A;  1IBK M;  1N33 M;  1WR1 B;  1SXJ D;  2DAI A;  2RGH A;  2WSC F;  1DGH B;  1G71 A;  2Y20 A;  3I4V A;  3L2A A;  4CIS A;  4M9X A;  1T6O A;  4JI1 M;  4HL4 A;  3RGS A;  3GLF B;  1R4G A;  4LJ5 A;  1TH3 A;  3KSJ A;  3T38 A;  2J7O A;  1XMQ M;  1EIJ A;  2DAM A;  4BB9 A;  2KZU A;  3J2P B;  1L1T A;  4EIW A;  3KXE C;  1RU3 A;  1W5S A;  2M60 A;  4X65 M;  2QBY A;  4B3M M;  2L7H A;  3HWS A;  3LCV B;  1Q02 A;  3VDU A;  2R45 A;  2ZM6 M;  3IEC A;  2DWZ B;  3FUT A;  4I8O A;  1D0M A;  2OO9 A;  4PDG A;  3UJN A;  3QAU A;  3SMS A;  1HNX M;  2O25 A;  1IQP A;  5EXT A;  2CV2 A;  2Q2E B;  2D7E A;  3GPX A;  1DO2 A;  4LJ9 A;  5IT9 S;  1EFU B;  3W68 A;  2HAK A;  1QUS A;  3GRR A;  4LJ6 A;  5FTN A;  2JUJ A;  1FJG M;  3GLH E;  2FFJ A;  1WHC A;  3SYK A;  1JR3 A;  2G3Q A;  4I4L A;  3I51 A;  1VEK A;  2APL A;  1IBL M;  2MR9 A;  4LJ8 A;  1J5E M;  1JB0 F;  3T6P A;  4X64 M;  2Z4S A;  1TH4 A;  4CGY B;  2R0I A;  3TL4 X;  3GPP A;  2VQF M;  3HHW A;  3Q8G A;  4NSO B;  3EIE A;  2VDB B;  3SAU A;  1QUT A;  2EJS A;  3B7N A;  3TPZ A;  3FYC A;  1IBM M;  2ZAN A;  3E21 A;  5EP3 A;  4NRW A;  3MMP A;  4L15 A;  3KOX E;  1NO1 A;  1P3Q Q;  1ZAE A;  2YQZ A;  2QZ4 A;  2CEA A;  3FTC A;  2Z3X A;  3K9P A;  2I7P A;  3E4R A;  4HEO A;  3VLF B;  1MX0 A;  2LTU A;  3LVW A;  4X66 M;  5BR8 M;  3SMP A;  1QAQ A;  1QVR A;  2DAE A;  3K8Z A;  2KZS A;  4IBI A;  2DEN A;  2K47 A;  1NY6 A;  2Z8Y M;  4QHS A;  1V33 A;  1XNR M;  1ZQ9 A;  1OAO C;  2JZ0 A;  3Q8X A;  3IG5 A;  4LF6 M;  1VQ1 A;  2QHO B;  3HJS A; 
#chains in the Genus database with same CATH homology
 2QNJ A;  2EKF A;  1BVS A;  2CP8 A;  2OOB A;  3GLI E;  2LBC A;  1YLA A;  1G4A E;  2LVP C;  4R71 A;  1V92 A;  5DFL A;  5JI2 E;  1C7Y A;  1KYI A;  3E46 A;  1OKS A;  2JY6 B;  4Q7J A;  2JY8 A;  1HQY E;  1IFY A;  2L4E A;  2KNV A;  2HWJ A;  2LVN C;  1WGN A;  2EKK A;  1SG9 A;  4GEW A;  2KNZ A;  2CWB A;  2DHY A;  4UN2 B;  2RRU A;  2BWB A;  1IXS A;  1IM2 A;  2MGW A;  1TTE A;  2B3T A;  3FRI A;  1NV9 A;  3IHP A;  2DZL A;  2JY5 A;  4G3O A;  1HJP A;  1ZMW A;  2DKL A;  1ZMU A;  1ZV1 A;  1VEG A;  1OAI A;  2QSF X;  1HT1 E;  2DAG A;  2KNA A;  2DAK A;  2LVO C;  4DBG B;  2K0B X;  3GLF E;  1F4I A;  1NV8 A;  1XXH E;  2JNH A;  2H5X A;  1GO5 A;  1MN3 A;  1WR1 B;  2DAI A;  1Y8G A;  1T6O A;  1R4G A;  1DV0 A;  3LCU A;  2DAM A;  3BBZ A;  1WGL A;  1PGY A;  3H4J A;  4F1I A;  3LCV B;  1Q02 A;  1TR8 A;  2DNA A;  3IEC A;  2OO9 A;  2ZTD A;  2LVQ D;  2O25 A;  3GLG E;  3FE3 A;  1XB2 B;  1OQY A;  1E94 E;  2LVA A;  1DO0 A;  1QZE A;  2OOA A;  1UFZ A;  1DO2 A;  3F92 A;  1EFU B;  2WZJ A;  2HAK A;  1VEJ A;  1AIP C;  1CUK A;  2JUJ A;  3GLH E;  1JR3 E;  1WHC A;  2JZ1 A;  2G3Q A;  2BWE A;  2DI0 A;  1VEK A;  1WJ7 A;  2MR9 A;  3T6P A;  4WP2 A;  1G41 A;  2R0I A;  2MJ5 B;  1VDL A;  1T43 A;  2EJS A;  2K9D A;  3E21 A;  1G3I A;  3MMP A;  2KHH A;  1P3Q Q;  3K9O A;  2JY7 A;  2MRO B;  3FRH A;  3K9P A;  4HEO A;  1A5T A;  2LTU A;  1WIV A;  3B89 A;  1VG5 A;  2DAE A;  1OTR A;  2DEN A;  2L4F A;  4F2L A;  1HT2 E;  2JZ0 A;  1ZMV A;  1VQ1 A;  2L2D A;  2QHO B;  2JP7 A;  2ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...