2DAGA

Solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
GSSGSSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title Solution Structure of the First UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
source organism Homo sapiens
total genus 15
structure length 74
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dagA01
2WZJA 1VDLA 1WJ7A 2DAIA 2OOBA 4F1IA 2DI0A 3E46A 1E94E 3K9OA 2JNHA 1OKSA 1PGYA 2ZTCA 2LBCA 4UN2B 1HT1E 2RRUA 2LVPC 1R4GA 3E21A 1BVSA 1A5TA 3LCUA 1VEGA 1SG9A 1ZV1A 3H4JA 4Q7JA 1NV8A 1CUKA 2KNVA 1C7YA 2HAKA 3GLFE 2KNZA 1DV0A 4R71A 1VEKA 1WR1B 1DO2A 2MR9A 2KNAA 2O25A 2DAMA 2B3TA 1DO0A 5JI2E 1JR3E 2G3QA 2JZ1A 3T6PA 1QZEA 4G3OA 1MN3A 2DNAA 2L4FA 3GLGE 1YLAA 1EFUB 1ZMWA 2LVNC 1HT2E 2JY6B 1WIVA 2LVOC 1VQ1A 1TTEA 2K0BX 3IECA 1HQYE 1G4AE 2OOAA 2CP8A 2DHYA 2MROB 2JP7A 2MGWA 1TR8A 2QSFX 2LTUA 3FE3A 1VG5A 2LVAA 2DAKA 1IXSA 2MJ5B 1GO5A 2KHHA 2LVQD 4DBGB 3FRIA 1AIPC 2HWJA 4GEWA 4HEOA 1G41A 2H5XA 3GLIE 1ZMVA 1UFZA 3LCVB 2EKFA 1HJPA 1VEJA 2ZTDA 2L2DA 1XXHE 1Y8GA 2DZLA 1G3IA 1IM2A 2EKKA 3IHPA 2QHOB 3FRHA 4WP2A 2JZ0A 2DAEA 2L4EA 1XB2B 2R0IA 2DKLA 1OAIA 1NV9A 1WHCA 3B89A 1OTRA 1F4IA 2JY5A 2QNJA 3F92A 1ZMUA 1T43A 2DAGA 2JUJA 2JY8A 1Q02A 3MMPA 2JY7A 1IFYA 3GLHE 4F2LA 1T6OA 1P3QQ 3K9PA 2DENA 2OO9A 1WGLA 2BWEA 2K9DA 1OQYA 3BBZA 2EJSA 1KYIA 2CWBA 1V92A 2BWBA 1WGNA 5DFLA
chains in the Genus database with same CATH superfamily
3GPPA 2WZJA 4OVZB 4MB7A 1PJJA 4DV5M 2C99A 4G6ZA 3TWLA 1NNUC 1OIPA 2X4AA 4DV0M 1JQJC 1NY6A 5L8RF 3ZC7B 4DV2M 3DFZA 1OKSA 4S12A 2R44A 4LF8M 4GHAA 3J81S 1D0LA 4QHSA 4LJ6A 4BLCA 4M9XA 1FJGM 4PCZA 4FCTA 4KO8A 3J7BA 4DV3M 4IBKA 4PT5A 4DUZM 3BXWA 4DV4M 1L2CA 4FCVA 4AKIA 1A5TA 3LCUA 1VEGA 1ZV1A 4L78A 4AW4A 5C1BA 1V34A 4YHHM 3GLIA 1N33M 3T15A 4Q7JA 1CUKA 1OFHA 2KNVA 3HJSA 2DZNB 2QENA 3GLFE 2KNZA 3FTCA 4DV7M 4JI2M 5E26A 1Q39A 3JR4A 1XC8A 4XBOA 2DWZB 2KNAA 2VQEM 4LF4M 3HGIA 1DO0A 1OIZA 2L6OA 1IN6A 4LZJA 4PDGA 5JI2E 1IBMM 2G3QA 3T1YM 3T6PA 1QZEA 1RU3A 4G3OA 1E9SA 1MN3A 2KDLA 5BR8M 2DNAA 2QQ8A 5EXTA 3FTEA 1L2DA 2KRUA 2LVNC 4RNAA 1QAMA 1Z5AA 4CGYB 3U61A 2GNOA 3K8ZA 3M0EA 1X37A 3VLFB 1LTMA 5KPTA 1HR0M 3GQ3A 3KVWA 3GO8A 3I04M 5ITUA 3U6CA 1G4AE 2JA2A 4R3DA 1IN5A 4LJ8A 3IG5A 2KRKA 1C1KA 2OOAA 2CP8A 3W0FA 3I51A 1ZQ9A 5JI3E 3HHZA 1XWIA 3AV0A 3PNYA 4NXMM 4JI7M 1TGUA 2ZM6M 1QYRA 2Y21A 1LV7A 4YY3M 1HNZM 3L2AA 3C3DA 1IXSA 4LJAA 1GO5A 1SXJD 4WW0A 3FRIA 3UJNA 3UK6A 2CRUA 1YUBA 2R18A 2VQFM 1AUAA 1NY5A 3U5ZA 2D7GA 3GQ4A 3GLIE 1XMQM 3FYCA 1XXHB 3QYBA 3RFWA 4OX9M 2ZBKB 4L4UA 2I7PA 1ORYB 1VEJA 2R45A 1D0MA 3FUTA 3KOZE 5ITRA 3PVSA 1GLNA 3CGWA 3RE8A 3TE6A 3TWMA 2FE8A 3FRHA 2JZ0A 4BBAA 4LG2A 1QAQA 2VDBB 3KP0E 4CHTB 2XZUA 1OFIA 2O01F 3U6EA 3B89A 4QHTA 3AJIB 1IY0A 1J7KA 1PM5A 3A98B 2XZFA 4D80A 2LWXA 2XGNA 1ZMUA 4KT0F 4MGHA 4RF1A 2DAGA 2JY8A 3HJ8A 2QZ4A 1WXQA 1PJQA 3AOEC 3QAUA 2R62A 1P3QQ 4LGMA 3JR5A 2WSFF 3HKPA 4XK8F 3GLGA 5EP3A 3D8LA 5KPRA 4JXJA 4PD2A 2EJSA 1TDZA 1Q3BA 2CWBA 7CATA 1V92A 4X64M 4AG6A 4GIPA 3FTFA 2MH8A 3SARA 5ITYA 3W67A 2AHMA 1TH4A 1VDLA 1IN8A 3M6AA 3SMPA 1WJ7A 1NHWC 2DWMA 3SYLA 2GQFA 4I8OA 4CIZA 1UM8A 1NNJA 5IT9S 5F3WA 1DGBA 3TQSA 3E46A 2F4VM 1E94E 3AFHA 2QP9X 4QOZC 4QNRA 8CATA 1JR3D 3OTOM 1PGYA 4IJFA 2LBCA 4RF0A 4ZPXA 3HX3A 2UUBM 2OPFA 1HNXM 4G4QA 4CISA 4LFAM 4M0WA 2O5RA 1V33A 2RRUA 3E21A 4NOOB 2CHQA 4IBGA 4D82A 3HY5A 3H4JA 4GC5A 4Z6YA 4LRSA 4AZFA 4IJEA 4MGZE 1C7YA 5KQ8A 2P5TA 1H6UA 1DGGA 2X49A 3HHXA 4R71A 3W68A 1DO2A 1IBKM 1EIJA 2O25A 2DAMA 2B3TA 4M0DA 2F5OA 3PNVA 3BOSA 4GHLA 3HWSA 4Z8XA 4LF6M 2CV2A 4CJ6A 4LCBA 2C98A 3UMMA 3GPYA 1SXJA 3GLGE 3GLIB 3WHKA 4R7GA 4IBBA 4NRWA 2XFSA 4GKJM 2KZSA 2JY6B 2RKOA 4LFCM 2ERCA 3SBJA 1IN7A 3D8BA 3HU3A 3FUVA 2R46A 3J27B 3HHWA 3GLHA 4GH9A 3B7ZA 1PJTA 2WSEF 3LW5F 4HL4A 3NWLA 5EXSA 2DHYA 1E32A 3K2LA 3MJ5A 4DUYM 2LHGA 2MROB 3LVWA 3SAUA 2V6ZM 2JP7A 1TF0B 2MGWA 4FVMA 4ANRA 1N77A 4AG5A 1GL7A 4D81A 1W5SA 2Y0QA 2Z3XA 3VDPA 5LMUM 5GKNA 4G4OA 1Q3CA 3C9PA 1FNNA 3CF6E 1NO1A 1N75A 3IG8A 2V1CA 3KSJA 4OVZA 5DYIA 4LRTA 4IBCA 2JWSA 1QDRA 1G8PA 3U6PA 4GEWA 4K0KM 1DGFA 4HEOA 1ZMVA 1UFZA 3LCVB 1HJPA 3H4MA 2QBYB 2L2DA 5KQDA 1Y8GA 3SASA 5FTNA 2ZAOA 2J7NA 3LMMA 2EUCA 2XH9A 4LZZA 3LVVA 1IM2A 3EIEA 4GC9A 4LFBM 2L7HA 2XF3A 3SMSA 2DAEA 1VDDA 2OQ4A 3Q8XA 2DKLA 2LXEA 1K82A 3U5ZB 1NSFA 1SXJE 4DR6M 1WHCA 5ITTA 1OTRA 1K3WA 4AI6A 1GJTA 1D0KA 4GKKM 1N34M 2L7IA 1JR3A 3R8FA 1PJIA 2LHCA 4KHPM 2YFQA 1Q02A 2I7NA 3GLHE 4JN6A 3SYKA 4JV5M 4JYAM 2APLA 2H1RA 4EIWA 1WGLA 2BWEA 1OQYA 4KODA 2BJVA 3RGPA 2DWNA 3DZDA 2M5ZA 4IBEA 3U60B 2XSZA 1VEKA 4LJ9A 1YSYA 1HNWM 3J2PB 4L16A 5FTMA 1R5LA 2Q2EB 2DAIA 3UGJA 1QZMA 2N35A 2OOBA 3FUWA 2BJWA 2YNMD 4RKUF 4JI4M 3I01M 4I4LA 4MH0E 4F1IA 3FTDA 4GMQA 4IBJA 3U6SA 2JNHA 4HLQA 4OU7A 2LH0A 5A2QS 3GRYA 4L15A 2CE7A 4MGIE 1GVNA 3UZUA 2XEPA 3SAVA 1Z6TA 3J7AS 1R4GA 1R2YA 1K3XA 4NL4H 2Z8YM 2J7OA 3A42A 3AOEA 3LQQA 4X62M 3GLFB 3GPUA 3KOXE 5FLXS 1NV8A 2F5NA 2EO2A 1I94M 2CFOA 1XXHA 2HAKA 2HL7A 4I5SA 1QUTA 4M9SA 1WR1B 2MR9A 3KFUG 1N36M 1JR3E 5IREB 2JZ1A 1IN4A 2M60A 4GITA 4WURA 2VF7A 1EFUB 3B7QA 3LQRA 1HQCA 3E4RA 5FTLA 1XMOM 2YR0A 4X65M 4B3TM 1G71A 4IBDA 1TDHA 4B3MM 2QCUA 5FTJA 3TWKA 4XGIA 2HHHM 4FCWA 3E9SA 1VQ1A 5C18A 2K0BX 2J5YA 1Z59A 3GP1A 2R65A 2RGHA 2X8AA 5LMNM 4KLNA 4LJ5A 2L09A 2QPAA 2RGOA 1MX0A 4G4RA 4B3SM 1R7RA 4FWHA 3HJQA 3HHYA 2G8LA 1XHBA 4B7GA 4DV1M 2BNKA 2FOIC 4MGYE 2UUAM 1TR8A 2C96A 2DHRA 2QSFX 3CF2A 3K1JA 1GKIA 3FE3A 4M9ZA 1VG5A 1EE8A 4AKGA 3GPXA 1IY1A 2LVAA 1I4WA 3CF0A 3FUUA 3U6MA 2MJ5B 3HZJA 2DXIA 4LF5M 2VF8A 3GRRA 3L28A 1MJGM 3VFDA 2YQZA 5ITQA 1DGHA 5H37D 2HWJA 5KO3A 4JI0M 2H5XA 3L25A 2Y0TA 2UXBM 4GRIA 2XLJA 3SAWA 4Y28F 1NJFA 2EKFA 4ITQA 4DR4M 3U6DA 1XXHE 4JI6M 4B7FA 2UUCM 3KXEC 1G3IA 4G4NA 3A45A 4IBFA 2EKKA 3IHPA 2QHOB 4WP2A 4LJ4A 2E5LM 2KXEA 2KW0A 1XB2B 5ITXA 3T38A 3U6LA 2R0IA 5FSWA 1J5EM 4MM3B 4QOSA 2CHGA 1SXJC 3QYEA 3U6QA 2KZUA 3ILKA 3Q8GA 1OJLA 3U61B 1JB0F 4P17A 3A46A 1N78A 1F4IA 1ZAEA 2HKJA 2JY5A 2UU9M 1GL6A 1T43A 2Y20A 4NC6A 2JUJA 3MMPA 4IBIA 4L6V6 4PDIA 2JY7A 5EP2A 4F2LA 4FWDA 3L26A 4NSOB 3AL0C 2UXDM 1PRBA 1NJGA 3KOWE 4DR2M 1R6BX 2K9DA 3BBZA 3DOAA 5IWAM 1KYIA 1D2NA 2WSCF 1IY2A 1L1ZA 1G59A 4BB9A 5IZ7D 3VDUA 3ZH9B 4AQYM 3SATA 1WGNA 5DFLA 2F5PA 1IXSB 2W82A 4NRVA 2Z4SA 2JXNA 2D7HA 4OW0A 3C3EA 3V76A 2C9OA 2K47A 2KA6B 1R2ZA 1GABA 1TH2A 2D7EA 3GRVA 5EXXA 3QWLA 2DI0A 3PXGA 3K9OA 4REZA 2UXCM 2NQ8C 2ZTCA 4JI5M 5DNYA 2KEBA 4UN2B 2DVWB 3EIHA 5EQTA 3FUXA 1GJSA 1HT1E 4II7A 2LVPC 2R4EA 1BVSA 4P16A 1L1TA 2CV0A 4AKHA 1L2BA 3NBIA 3TL4X 3JAMS 1XNQM 1SG9A 4X66M 1IQPA 3R9XB 4JI3M 5ITXE 3VK7A 4B3RM 1Z5BA 4B7HA 1S3SA 3THGA 1W5TA 1KFVA 5EP4A 3B7NA 3SFZA 1DV0A 1QAOA 2G5GX 3J80S 3K92A 2R4JA 2QBYA 2XFTA 1OAOC 3NBXX 3GLGB 2DWLA 2FFJA 3L27A 3KW6A 3ZQJA 1L8QA 1QVRA 2L4FA 1E9RA 3MHVC 3FD9A 1YLAA 1XNRM 1PJSA 1ZMWA 2K6BA 1HT2E 1WIVA 2CV1A 2LVOC 4JI1M 2DZOB 2A5YB 1TTEA 3IECA 3T1HM 3U6OA 1HQYE 1TH3A 3WHLA 3SHGB 4LY6A 3FKEA 3C58A 2CHVA 5EJCA 4DR5M 3B9PA 3KDSE 1J09A 1T3TA 2HCBA 3AOGA 2FNAA 2R6FA 3CTWB 1NVMA 2CEAA 4I81A 3KS4A 4W5WA 3HU2A 3KOYE 4NXNM 2FS1A 2C5RA 3I4YA 2LTUA 3TPZA 3DA1A 3U60A 4B08A 3GQ5A 2DAKA 4DR1M 2EA0A 2KHHA 2LVQD 2V1UA 3KP1E 2CUZA 4DBGB 4FW9A 1QANA 1MU5A 1AIPC 4LF7M 1QDTA 4DR3M 3RGSA 2LNHC 1G41A 5EXPA 2C9CA 2ZAMA 3L29A 4IIWA 4LGYA 5E6JA 3ZCBB 2F5QA 4TUWA 1IXRC 2ZTDA 2ZANA 2DZLA 4LJ7A 5DYGA 4FD2A 1NHGC 1QUSA 3MK6A 5EP1A 5FTKA 1KSFX 1YE9A 3M7GA 2L4EA 1SXJB 1DGHB 1N32M 2Z7JA 4JI8M 5BPVA 1OAIA 1IXZA 5KPZA 3GLFA 3KSXA 2F5SA 1NV9A 1QQWA 2Z4RA 3HU1A 2QNJA 3VKHA 3VK8A 3F92A 3GLHB 3FYDA 4MGKE 3SC3A 3KS8A 4NSRA 3GRUA 1IFYA 1T6OA 4FWGA 4DV6M 3SHFA 3K9PA 3AKZA 2DENA 3I4VA 2OO9A 3VKGA 3B74A 4QNMA 4A3VB 1Z5CA 4DR7M 2VIIA 4L8RC 2XSZD 3W0LB 2BWBA 1IBLM 2FH0A 4LF9M 3PFIA
chains in the Genus database with same CATH topology
2WZJA 1VDLA 1WJ7A 2DAIA 2OOBA 4F1IA 2DI0A 3E46A 1E94E 3K9OA 2JNHA 1OKSA 1PGYA 2ZTCA 2LBCA 4UN2B 1HT1E 2RRUA 2LVPC 1R4GA 3E21A 1BVSA 1A5TA 3LCUA 1VEGA 1SG9A 1ZV1A 3H4JA 4Q7JA 1NV8A 1CUKA 2KNVA 1C7YA 2HAKA 3GLFE 2KNZA 1DV0A 4R71A 1VEKA 1WR1B 1DO2A 2MR9A 2KNAA 2O25A 2DAMA 2B3TA 1DO0A 5JI2E 1JR3E 2G3QA 2JZ1A 3T6PA 1QZEA 4G3OA 1MN3A 2DNAA 2L4FA 3GLGE 1YLAA 1EFUB 1ZMWA 2LVNC 1HT2E 2JY6B 1WIVA 2LVOC 1VQ1A 1TTEA 2K0BX 3IECA 1HQYE 1G4AE 2OOAA 2CP8A 2DHYA 2MROB 2JP7A 2MGWA 1TR8A 2QSFX 2LTUA 3FE3A 1VG5A 2LVAA 2DAKA 1IXSA 2MJ5B 1GO5A 2KHHA 2LVQD 4DBGB 3FRIA 1AIPC 2HWJA 4GEWA 4HEOA 1G41A 2H5XA 3GLIE 1ZMVA 1UFZA 3LCVB 2EKFA 1HJPA 1VEJA 2ZTDA 2L2DA 1XXHE 1Y8GA 2DZLA 1G3IA 1IM2A 2EKKA 3IHPA 2QHOB 3FRHA 4WP2A 2JZ0A 2DAEA 2L4EA 1XB2B 2R0IA 2DKLA 1OAIA 1NV9A 1WHCA 3B89A 1OTRA 1F4IA 2JY5A 2QNJA 3F92A 1ZMUA 1T43A 2DAGA 2JUJA 2JY8A 1Q02A 3MMPA 2JY7A 1IFYA 3GLHE 4F2LA 1T6OA 1P3QQ 3K9PA 2DENA 2OO9A 1WGLA 2BWEA 2K9DA 1OQYA 3BBZA 2EJSA 1KYIA 2CWBA 1V92A 2BWBA 1WGNA 5DFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZJ A;  1VDL A;  1WJ7 A;  2DAI A;  2OOB A;  4F1I A;  2DI0 A;  3E46 A;  1E94 E;  3K9O A;  2JNH A;  1OKS A;  1PGY A;  2ZTC A;  2LBC A;  4UN2 B;  1HT1 E;  2RRU A;  2LVP C;  1R4G A;  3E21 A;  1BVS A;  1A5T A;  3LCU A;  1VEG A;  1SG9 A;  1ZV1 A;  3H4J A;  4Q7J A;  1NV8 A;  1CUK A;  2KNV A;  1C7Y A;  2HAK A;  3GLF E;  2KNZ A;  1DV0 A;  4R71 A;  1VEK A;  1WR1 B;  1DO2 A;  2MR9 A;  2KNA A;  2O25 A;  2DAM A;  2B3T A;  1DO0 A;  5JI2 E;  1JR3 E;  2G3Q A;  2JZ1 A;  3T6P A;  1QZE A;  4G3O A;  1MN3 A;  2DNA A;  2L4F A;  3GLG E;  1YLA A;  1EFU B;  1ZMW A;  2LVN C;  1HT2 E;  2JY6 B;  1WIV A;  2LVO C;  1VQ1 A;  1TTE A;  2K0B X;  3IEC A;  1HQY E;  1G4A E;  2OOA A;  2CP8 A;  2DHY A;  2MRO B;  2JP7 A;  2MGW A;  1TR8 A;  2QSF X;  2LTU A;  3FE3 A;  1VG5 A;  2LVA A;  2DAK A;  1IXS A;  2MJ5 B;  1GO5 A;  2KHH A;  2LVQ D;  4DBG B;  3FRI A;  1AIP C;  2HWJ A;  4GEW A;  4HEO A;  1G41 A;  2H5X A;  3GLI E;  1ZMV A;  1UFZ A;  3LCV B;  2EKF A;  1HJP A;  1VEJ A;  2ZTD A;  2L2D A;  1XXH E;  1Y8G A;  2DZL A;  1G3I A;  1IM2 A;  2EKK A;  3IHP A;  2QHO B;  3FRH A;  4WP2 A;  2JZ0 A;  2DAE A;  2L4E A;  1XB2 B;  2R0I A;  2DKL A;  1OAI A;  1NV9 A;  1WHC A;  3B89 A;  1OTR A;  1F4I A;  2JY5 A;  2QNJ A;  3F92 A;  1ZMU A;  1T43 A;  2DAG A;  2JUJ A;  2JY8 A;  1Q02 A;  3MMP A;  2JY7 A;  1IFY A;  3GLH E;  4F2L A;  1T6O A;  1P3Q Q;  3K9P A;  2DEN A;  2OO9 A;  1WGL A;  2BWE A;  2K9D A;  1OQY A;  3BBZ A;  2EJS A;  1KYI A;  2CWB A;  1V92 A;  2BWB A;  1WGN A;  5DFL A; 
#chains in the Genus database with same CATH topology
 3GPP A;  2WZJ A;  4OVZ B;  4MB7 A;  1PJJ A;  4DV5 M;  2C99 A;  4G6Z A;  3TWL A;  1NNU C;  1OIP A;  2X4A A;  4DV0 M;  1JQJ C;  1NY6 A;  5L8R F;  3ZC7 B;  4DV2 M;  3DFZ A;  1OKS A;  4S12 A;  2R44 A;  4LF8 M;  4GHA A;  3J81 S;  1D0L A;  4QHS A;  4LJ6 A;  4BLC A;  4M9X A;  1FJG M;  4PCZ A;  4FCT A;  4KO8 A;  3J7B A;  4DV3 M;  4IBK A;  4PT5 A;  4DUZ M;  3BXW A;  4DV4 M;  1L2C A;  4FCV A;  4AKI A;  1A5T A;  3LCU A;  1VEG A;  1ZV1 A;  4L78 A;  4AW4 A;  5C1B A;  1V34 A;  4YHH M;  3GLI A;  1N33 M;  3T15 A;  4Q7J A;  1CUK A;  1OFH A;  2KNV A;  3HJS A;  2DZN B;  2QEN A;  3GLF E;  2KNZ A;  3FTC A;  4DV7 M;  4JI2 M;  5E26 A;  1Q39 A;  3JR4 A;  1XC8 A;  4XBO A;  2DWZ B;  2KNA A;  2VQE M;  4LF4 M;  3HGI A;  1DO0 A;  1OIZ A;  2L6O A;  1IN6 A;  4LZJ A;  4PDG A;  5JI2 E;  1IBM M;  2G3Q A;  3T1Y M;  3T6P A;  1QZE A;  1RU3 A;  4G3O A;  1E9S A;  1MN3 A;  2KDL A;  5BR8 M;  2DNA A;  2QQ8 A;  5EXT A;  3FTE A;  1L2D A;  2KRU A;  2LVN C;  4RNA A;  1QAM A;  1Z5A A;  4CGY B;  3U61 A;  2GNO A;  3K8Z A;  3M0E A;  1X37 A;  3VLF B;  1LTM A;  5KPT A;  1HR0 M;  3GQ3 A;  3KVW A;  3GO8 A;  3I04 M;  5ITU A;  3U6C A;  1G4A E;  2JA2 A;  4R3D A;  1IN5 A;  4LJ8 A;  3IG5 A;  2KRK A;  1C1K A;  2OOA A;  2CP8 A;  3W0F A;  3I51 A;  1ZQ9 A;  5JI3 E;  3HHZ A;  1XWI A;  3AV0 A;  3PNY A;  4NXM M;  4JI7 M;  1TGU A;  2ZM6 M;  1QYR A;  2Y21 A;  1LV7 A;  4YY3 M;  1HNZ M;  3L2A A;  3C3D A;  1IXS A;  4LJA A;  1GO5 A;  1SXJ D;  4WW0 A;  3FRI A;  3UJN A;  3UK6 A;  2CRU A;  1YUB A;  2R18 A;  2VQF M;  1AUA A;  1NY5 A;  3U5Z A;  2D7G A;  3GQ4 A;  3GLI E;  1XMQ M;  3FYC A;  1XXH B;  3QYB A;  3RFW A;  4OX9 M;  2ZBK B;  4L4U A;  2I7P A;  1ORY B;  1VEJ A;  2R45 A;  1D0M A;  3FUT A;  3KOZ E;  5ITR A;  3PVS A;  1GLN A;  3CGW A;  3RE8 A;  3TE6 A;  3TWM A;  2FE8 A;  3FRH A;  2JZ0 A;  4BBA A;  4LG2 A;  1QAQ A;  2VDB B;  3KP0 E;  4CHT B;  2XZU A;  1OFI A;  2O01 F;  3U6E A;  3B89 A;  4QHT A;  3AJI B;  1IY0 A;  1J7K A;  1PM5 A;  3A98 B;  2XZF A;  4D80 A;  2LWX A;  2XGN A;  1ZMU A;  4KT0 F;  4MGH A;  4RF1 A;  2DAG A;  2JY8 A;  3HJ8 A;  2QZ4 A;  1WXQ A;  1PJQ A;  3AOE C;  3QAU A;  2R62 A;  1P3Q Q;  4LGM A;  3JR5 A;  2WSF F;  3HKP A;  4XK8 F;  3GLG A;  5EP3 A;  3D8L A;  5KPR A;  4JXJ A;  4PD2 A;  2EJS A;  1TDZ A;  1Q3B A;  2CWB A;  7CAT A;  1V92 A;  4X64 M;  4AG6 A;  4GIP A;  3FTF A;  2MH8 A;  3SAR A;  5ITY A;  3W67 A;  2AHM A;  1TH4 A;  1VDL A;  1IN8 A;  3M6A A;  3SMP A;  1WJ7 A;  1NHW C;  2DWM A;  3SYL A;  2GQF A;  4I8O A;  4CIZ A;  1UM8 A;  1NNJ A;  5IT9 S;  5F3W A;  1DGB A;  3TQS A;  3E46 A;  2F4V M;  1E94 E;  3AFH A;  2QP9 X;  4QOZ C;  4QNR A;  8CAT A;  1JR3 D;  3OTO M;  1PGY A;  4IJF A;  2LBC A;  4RF0 A;  4ZPX A;  3HX3 A;  2UUB M;  2OPF A;  1HNX M;  4G4Q A;  4CIS A;  4LFA M;  4M0W A;  2O5R A;  1V33 A;  2RRU A;  3E21 A;  4NOO B;  2CHQ A;  4IBG A;  4D82 A;  3HY5 A;  3H4J A;  4GC5 A;  4Z6Y A;  4LRS A;  4AZF A;  4IJE A;  4MGZ E;  1C7Y A;  5KQ8 A;  2P5T A;  1H6U A;  1DGG A;  2X49 A;  3HHX A;  4R71 A;  3W68 A;  1DO2 A;  1IBK M;  1EIJ A;  2O25 A;  2DAM A;  2B3T A;  4M0D A;  2F5O A;  3PNV A;  3BOS A;  4GHL A;  3HWS A;  4Z8X A;  4LF6 M;  2CV2 A;  4CJ6 A;  4LCB A;  2C98 A;  3UMM A;  3GPY A;  1SXJ A;  3GLG E;  3GLI B;  3WHK A;  4R7G A;  4IBB A;  4NRW A;  2XFS A;  4GKJ M;  2KZS A;  2JY6 B;  2RKO A;  4LFC M;  2ERC A;  3SBJ A;  1IN7 A;  3D8B A;  3HU3 A;  3FUV A;  2R46 A;  3J27 B;  3HHW A;  3GLH A;  4GH9 A;  3B7Z A;  1PJT A;  2WSE F;  3LW5 F;  4HL4 A;  3NWL A;  5EXS A;  2DHY A;  1E32 A;  3K2L A;  3MJ5 A;  4DUY M;  2LHG A;  2MRO B;  3LVW A;  3SAU A;  2V6Z M;  2JP7 A;  1TF0 B;  2MGW A;  4FVM A;  4ANR A;  1N77 A;  4AG5 A;  1GL7 A;  4D81 A;  1W5S A;  2Y0Q A;  2Z3X A;  3VDP A;  5LMU M;  5GKN A;  4G4O A;  1Q3C A;  3C9P A;  1FNN A;  3CF6 E;  1NO1 A;  1N75 A;  3IG8 A;  2V1C A;  3KSJ A;  4OVZ A;  5DYI A;  4LRT A;  4IBC A;  2JWS A;  1QDR A;  1G8P A;  3U6P A;  4GEW A;  4K0K M;  1DGF A;  4HEO A;  1ZMV A;  1UFZ A;  3LCV B;  1HJP A;  3H4M A;  2QBY B;  2L2D A;  5KQD A;  1Y8G A;  3SAS A;  5FTN A;  2ZAO A;  2J7N A;  3LMM A;  2EUC A;  2XH9 A;  4LZZ A;  3LVV A;  1IM2 A;  3EIE A;  4GC9 A;  4LFB M;  2L7H A;  2XF3 A;  3SMS A;  2DAE A;  1VDD A;  2OQ4 A;  3Q8X A;  2DKL A;  2LXE A;  1K82 A;  3U5Z B;  1NSF A;  1SXJ E;  4DR6 M;  1WHC A;  5ITT A;  1OTR A;  1K3W A;  4AI6 A;  1GJT A;  1D0K A;  4GKK M;  1N34 M;  2L7I A;  1JR3 A;  3R8F A;  1PJI A;  2LHC A;  4KHP M;  2YFQ A;  1Q02 A;  2I7N A;  3GLH E;  4JN6 A;  3SYK A;  4JV5 M;  4JYA M;  2APL A;  2H1R A;  4EIW A;  1WGL A;  2BWE A;  1OQY A;  4KOD A;  2BJV A;  3RGP A;  2DWN A;  3DZD A;  2M5Z A;  4IBE A;  3U60 B;  2XSZ A;  1VEK A;  4LJ9 A;  1YSY A;  1HNW M;  3J2P B;  4L16 A;  5FTM A;  1R5L A;  2Q2E B;  2DAI A;  3UGJ A;  1QZM A;  2N35 A;  2OOB A;  3FUW A;  2BJW A;  2YNM D;  4RKU F;  4JI4 M;  3I01 M;  4I4L A;  4MH0 E;  4F1I A;  3FTD A;  4GMQ A;  4IBJ A;  3U6S A;  2JNH A;  4HLQ A;  4OU7 A;  2LH0 A;  5A2Q S;  3GRY A;  4L15 A;  2CE7 A;  4MGI E;  1GVN A;  3UZU A;  2XEP A;  3SAV A;  1Z6T A;  3J7A S;  1R4G A;  1R2Y A;  1K3X A;  4NL4 H;  2Z8Y M;  2J7O A;  3A42 A;  3AOE A;  3LQQ A;  4X62 M;  3GLF B;  3GPU A;  3KOX E;  5FLX S;  1NV8 A;  2F5N A;  2EO2 A;  1I94 M;  2CFO A;  1XXH A;  2HAK A;  2HL7 A;  4I5S A;  1QUT A;  4M9S A;  1WR1 B;  2MR9 A;  3KFU G;  1N36 M;  1JR3 E;  5IRE B;  2JZ1 A;  1IN4 A;  2M60 A;  4GIT A;  4WUR A;  2VF7 A;  1EFU B;  3B7Q A;  3LQR A;  1HQC A;  3E4R A;  5FTL A;  1XMO M;  2YR0 A;  4X65 M;  4B3T M;  1G71 A;  4IBD A;  1TDH A;  4B3M M;  2QCU A;  5FTJ A;  3TWK A;  4XGI A;  2HHH M;  4FCW A;  3E9S A;  1VQ1 A;  5C18 A;  2K0B X;  2J5Y A;  1Z59 A;  3GP1 A;  2R65 A;  2RGH A;  2X8A A;  5LMN M;  4KLN A;  4LJ5 A;  2L09 A;  2QPA A;  2RGO A;  1MX0 A;  4G4R A;  4B3S M;  1R7R A;  4FWH A;  3HJQ A;  3HHY A;  2G8L A;  1XHB A;  4B7G A;  4DV1 M;  2BNK A;  2FOI C;  4MGY E;  2UUA M;  1TR8 A;  2C96 A;  2DHR A;  2QSF X;  3CF2 A;  3K1J A;  1GKI A;  3FE3 A;  4M9Z A;  1VG5 A;  1EE8 A;  4AKG A;  3GPX A;  1IY1 A;  2LVA A;  1I4W A;  3CF0 A;  3FUU A;  3U6M A;  2MJ5 B;  3HZJ A;  2DXI A;  4LF5 M;  2VF8 A;  3GRR A;  3L28 A;  1MJG M;  3VFD A;  2YQZ A;  5ITQ A;  1DGH A;  5H37 D;  2HWJ A;  5KO3 A;  4JI0 M;  2H5X A;  3L25 A;  2Y0T A;  2UXB M;  4GRI A;  2XLJ A;  3SAW A;  4Y28 F;  1NJF A;  2EKF A;  4ITQ A;  4DR4 M;  3U6D A;  1XXH E;  4JI6 M;  4B7F A;  2UUC M;  3KXE C;  1G3I A;  4G4N A;  3A45 A;  4IBF A;  2EKK A;  3IHP A;  2QHO B;  4WP2 A;  4LJ4 A;  2E5L M;  2KXE A;  2KW0 A;  1XB2 B;  5ITX A;  3T38 A;  3U6L A;  2R0I A;  5FSW A;  1J5E M;  4MM3 B;  4QOS A;  2CHG A;  1SXJ C;  3QYE A;  3U6Q A;  2KZU A;  3ILK A;  3Q8G A;  1OJL A;  3U61 B;  1JB0 F;  4P17 A;  3A46 A;  1N78 A;  1F4I A;  1ZAE A;  2HKJ A;  2JY5 A;  2UU9 M;  1GL6 A;  1T43 A;  2Y20 A;  4NC6 A;  2JUJ A;  3MMP A;  4IBI A;  4L6V 6;  4PDI A;  2JY7 A;  5EP2 A;  4F2L A;  4FWD A;  3L26 A;  4NSO B;  3AL0 C;  2UXD M;  1PRB A;  1NJG A;  3KOW E;  4DR2 M;  1R6B X;  2K9D A;  3BBZ A;  3DOA A;  5IWA M;  1KYI A;  1D2N A;  2WSC F;  1IY2 A;  1L1Z A;  1G59 A;  4BB9 A;  5IZ7 D;  3VDU A;  3ZH9 B;  4AQY M;  3SAT A;  1WGN A;  5DFL A;  2F5P A;  1IXS B;  2W82 A;  4NRV A;  2Z4S A;  2JXN A;  2D7H A;  4OW0 A;  3C3E A;  3V76 A;  2C9O A;  2K47 A;  2KA6 B;  1R2Z A;  1GAB A;  1TH2 A;  2D7E A;  3GRV A;  5EXX A;  3QWL A;  2DI0 A;  3PXG A;  3K9O A;  4REZ A;  2UXC M;  2NQ8 C;  2ZTC A;  4JI5 M;  5DNY A;  2KEB A;  4UN2 B;  2DVW B;  3EIH A;  5EQT A;  3FUX A;  1GJS A;  1HT1 E;  4II7 A;  2LVP C;  2R4E A;  1BVS A;  4P16 A;  1L1T A;  2CV0 A;  4AKH A;  1L2B A;  3NBI A;  3TL4 X;  3JAM S;  1XNQ M;  1SG9 A;  4X66 M;  1IQP A;  3R9X B;  4JI3 M;  5ITX E;  3VK7 A;  4B3R M;  1Z5B A;  4B7H A;  1S3S A;  3THG A;  1W5T A;  1KFV A;  5EP4 A;  3B7N A;  3SFZ A;  1DV0 A;  1QAO A;  2G5G X;  3J80 S;  3K92 A;  2R4J A;  2QBY A;  2XFT A;  1OAO C;  3NBX X;  3GLG B;  2DWL A;  2FFJ A;  3L27 A;  3KW6 A;  3ZQJ A;  1L8Q A;  1QVR A;  2L4F A;  1E9R A;  3MHV C;  3FD9 A;  1YLA A;  1XNR M;  1PJS A;  1ZMW A;  2K6B A;  1HT2 E;  1WIV A;  2CV1 A;  2LVO C;  4JI1 M;  2DZO B;  2A5Y B;  1TTE A;  3IEC A;  3T1H M;  3U6O A;  1HQY E;  1TH3 A;  3WHL A;  3SHG B;  4LY6 A;  3FKE A;  3C58 A;  2CHV A;  5EJC A;  4DR5 M;  3B9P A;  3KDS E;  1J09 A;  1T3T A;  2HCB A;  3AOG A;  2FNA A;  2R6F A;  3CTW B;  1NVM A;  2CEA A;  4I81 A;  3KS4 A;  4W5W A;  3HU2 A;  3KOY E;  4NXN M;  2FS1 A;  2C5R A;  3I4Y A;  2LTU A;  3TPZ A;  3DA1 A;  3U60 A;  4B08 A;  3GQ5 A;  2DAK A;  4DR1 M;  2EA0 A;  2KHH A;  2LVQ D;  2V1U A;  3KP1 E;  2CUZ A;  4DBG B;  4FW9 A;  1QAN A;  1MU5 A;  1AIP C;  4LF7 M;  1QDT A;  4DR3 M;  3RGS A;  2LNH C;  1G41 A;  5EXP A;  2C9C A;  2ZAM A;  3L29 A;  4IIW A;  4LGY A;  5E6J A;  3ZCB B;  2F5Q A;  4TUW A;  1IXR C;  2ZTD A;  2ZAN A;  2DZL A;  4LJ7 A;  5DYG A;  4FD2 A;  1NHG C;  1QUS A;  3MK6 A;  5EP1 A;  5FTK A;  1KSF X;  1YE9 A;  3M7G A;  2L4E A;  1SXJ B;  1DGH B;  1N32 M;  2Z7J A;  4JI8 M;  5BPV A;  1OAI A;  1IXZ A;  5KPZ A;  3GLF A;  3KSX A;  2F5S A;  1NV9 A;  1QQW A;  2Z4R A;  3HU1 A;  2QNJ A;  3VKH A;  3VK8 A;  3F92 A;  3GLH B;  3FYD A;  4MGK E;  3SC3 A;  3KS8 A;  4NSR A;  3GRU A;  1IFY A;  1T6O A;  4FWG A;  4DV6 M;  3SHF A;  3K9P A;  3AKZ A;  2DEN A;  3I4V A;  2OO9 A;  3VKG A;  3B74 A;  4QNM A;  4A3V B;  1Z5C A;  4DR7 M;  2VII A;  4L8R C;  2XSZ D;  3W0L B;  2BWB A;  1IBL M;  2FH0 A;  4LF9 M;  3PFI A; 
#chains in the Genus database with same CATH homology
 2WZJ A;  1VDL A;  1WJ7 A;  2DAI A;  2OOB A;  4F1I A;  2DI0 A;  3E46 A;  1E94 E;  3K9O A;  2JNH A;  1OKS A;  1PGY A;  2ZTC A;  2LBC A;  4UN2 B;  1HT1 E;  2RRU A;  2LVP C;  1R4G A;  3E21 A;  1BVS A;  1A5T A;  3LCU A;  1VEG A;  1SG9 A;  1ZV1 A;  3H4J A;  4Q7J A;  1NV8 A;  1CUK A;  2KNV A;  1C7Y A;  2HAK A;  3GLF E;  2KNZ A;  1DV0 A;  4R71 A;  1VEK A;  1WR1 B;  1DO2 A;  2MR9 A;  2KNA A;  2O25 A;  2DAM A;  2B3T A;  1DO0 A;  5JI2 E;  1JR3 E;  2G3Q A;  2JZ1 A;  3T6P A;  1QZE A;  4G3O A;  1MN3 A;  2DNA A;  2L4F A;  3GLG E;  1YLA A;  1EFU B;  1ZMW A;  2LVN C;  1HT2 E;  2JY6 B;  1WIV A;  2LVO C;  1VQ1 A;  1TTE A;  2K0B X;  3IEC A;  1HQY E;  1G4A E;  2OOA A;  2CP8 A;  2DHY A;  2MRO B;  2JP7 A;  2MGW A;  1TR8 A;  2QSF X;  2LTU A;  3FE3 A;  1VG5 A;  2LVA A;  2DAK A;  1IXS A;  2MJ5 B;  1GO5 A;  2KHH A;  2LVQ D;  4DBG B;  3FRI A;  1AIP C;  2HWJ A;  4GEW A;  4HEO A;  1G41 A;  2H5X A;  3GLI E;  1ZMV A;  1UFZ A;  3LCV B;  2EKF A;  1HJP A;  1VEJ A;  2ZTD A;  2L2D A;  1XXH E;  1Y8G A;  2DZL A;  1G3I A;  1IM2 A;  2EKK A;  3IHP A;  2QHO B;  3FRH A;  4WP2 A;  2JZ0 A;  2DAE A;  2L4E A;  1XB2 B;  2R0I A;  2DKL A;  1OAI A;  1NV9 A;  1WHC A;  3B89 A;  1OTR A;  1F4I A;  2JY5 A;  2QNJ A;  3F92 A;  1ZMU A;  1T43 A;  2DAG A;  2JUJ A;  2JY8 A;  1Q02 A;  3MMP A;  2JY7 A;  1IFY A;  3GLH E;  4F2L A;  1T6O A;  1P3Q Q;  3K9P A;  2DEN A;  2OO9 A;  1WGL A;  2BWE A;  2K9D A;  1OQY A;  3BBZ A;  2EJS A;  1KYI A;  2CWB A;  1V92 A;  2BWB A;  1WGN A;  5DFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...