2DAGA

Solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
GSSGSSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title Solution Structure of the First UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 74
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dagA01
2KNZA 2HWJA 1G3IA 2BWBA 1P3QQ 2CP8A 2DAEA 1HT1E 2QHOB 3MMPA 2LBCA 3F92A 4GEWA 1VEKA 1OQYA 2MR9A 3LCVB 1CUKA 2O25A 1R4GA 2OOBA 1GO5A 2QSFX 1F4IA 2DZLA 2ZTCA 1XB2B 1E94E 1VEGA 5JI2E 3T6PA 1Y8GA 2BWEA 4R71A 1UFZA 2DNAA 1JR3E 3GLIE 2JUJA 1WHCA 1OTRA 1YLAA 2KHHA 1ZMUA 2L4EA 2EKFA 2DAKA 1NV8A 2LVPC 2DENA 2MROB 2JNHA 2KNAA 1IM2A 2WZJA 1PGYA 1WGNA 2LVOC 3B89A 2HAKA 1DO2A 1ZMVA 2G3QA 3GLHE 2L4FA 2DAMA 1NV9A 1Q02A 2LVQD 2DHYA 3LCUA 4WP2A 1BVSA 1DV0A 2H5XA 1HQYE 1VDLA 1SG9A 2DAIA 1WJ7A 2QNJA 2JZ1A 3IHPA 1HJPA 2KNVA 3E21A 1XXHE 1ZMWA 2RRUA 2DAGA 1WR1B 2JZ0A 1OAIA 3BBZA 1A5TA 2LTUA 1QZEA 1DO0A 2DI0A 2JY8A 1HT2E 1TTEA 4UN2B 1G4AE 1AIPC 1EFUB 1T43A 2JY7A 3E46A 3K9OA 1T6OA 1KYIA 4HEOA 2OOAA 1WIVA 3K9PA 1IFYA 2EJSA 1MN3A 3FE3A 4DBGB 1V92A 2B3TA 1IXSA 2JY6B 1VG5A 2DKLA 2K0BX 1ZV1A 4G3OA 4Q7JA 4F2LA 1G41A 1WGLA 2JP7A 3IECA 3H4JA 1OKSA 2K9DA 2L2DA 3GLFE 4F1IA 1C7YA 2LVAA 2OO9A 3FRHA 1TR8A 1VEJA 2LVNC 2JY5A 2CWBA 1VQ1A 5DFLA 2ZTDA 2R0IA 3GLGE 2EKKA 3FRIA 2MJ5B 2MGWA
chains in the Genus database with same CATH superfamily
3DZDA 2Y0QA 3SAVA 4LF8M 2DWMA 3M6AA 3M7GA 4OX9M 3AOEA 4X65M 3HZJA 2HL7A 3B7NA 2VF8A 3QWLA 2K47A 5FSWA 3FUVA 1IXSB 4PD2A 3U61B 3LCVB 1N34M 1GL6A 4GITA 3PNVA 4NL4H 4DV2M 5FLXS 4LZJA 3TQSA 1F4IA 2DZLA 1IN6A 2JXNA 4IBIA 3GRVA 3SBJA 4GC5A 4S12A 5ITRA 4LF4M 4W5WA 1QAOA 3E9SA 1Y8GA 2V1UA 1IXRC 3HHXA 4B3TM 1JR3E 3GLIE 2XH9A 3D8LA 3HJQA 4GRIA 3GPPA 1R2ZA 1OTRA 1YLAA 1K82A 2KA6B 3SMSA 2I7PA 2L4EA 3U5ZB 5E6JA 2V1CA 3GQ5A 4RF1A 5JI3E 1NV8A 3IG8A 3GLFA 3HU3A 3I4VA 2WZJA 2GNOA 2W82A 3I4YA 4GHLA 3UMMA 4AI6A 2KXEA 2LVOC 3HWSA 1TDZA 3U60B 3B9PA 2F5NA 2FNAA 4R7GA 4QHTA 3R8FA 3KFUG 1L2BA 2G3QA 3JR4A 2DAMA 3GLIB 1J7KA 4LJ7A 3J7BA 1NO1A 4WP2A 2F5OA 3W0LB 2UXBM 2Q2EB 1DV0A 5FTNA 4OU7A 3ZCBB 3SAUA 2XZFA 1XMQM 3THGA 1PJIA 4LRSA 4K0KM 1SG9A 2QNJA 4LY6A 3IHPA 1RU3A 2L09A 2KRKA 3FTCA 3QAUA 1W5SA 4DV0M 4LGYA 1I94M 1XXHE 3JAMS 3U6LA 3D8BA 1R6BX 2ZAMA 5DYGA 2R18A 2F4VM 2R62A 2EO2A 1J09A 2Z4RA 2P5TA 4IIWA 4IBKA 2ZM6M 2LTUA 2A5YB 3LMMA 1QZEA 4FCWA 5IWAM 1XMOM 1EIJA 4L4UA 2JY8A 2XSZA 3FTDA 1TTEA 2RGOA 4UN2B 4D80A 4JI7M 3T1YM 2CRUA 4LFAM 3V76A 3NBXX 4JI3M 4GIPA 2BJVA 3VK7A 1T6OA 2Z8YM 1L1ZA 1IBLM 1GJSA 3FD9A 1IFYA 2EJSA 3L2AA 1SXJE 1QDTA 1IXSA 3VFDA 2K0BX 1ZV1A 1R7RA 3GLHB 3I01M 4G3OA 3Q8XA 4KODA 1G41A 4F2LA 1WGLA 2ERCA 3EIEA 5LMUM 3CF2A 2KZUA 3HJ8A 2KDLA 4LF9M 2OQ4A 1QAQA 1OKSA 4QNMA 2QP9X 3UK6A 2UUCM 2XEPA 2L2DA 3UZUA 1ZQ9A 2DHRA 3GLFE 2DWZB 4Z8XA 3J27B 2ZAOA 1HQCA 4NXMM 3SMPA 2JA2A 3L25A 1TR8A 4L8RC 4IBEA 3CF6E 4IBGA 4DUZM 1QAMA 3GLGE 2R0IA 4XK8F 4YHHM 1IXZA 3B74A 3U5ZA 1HNZM 5EP3A 4QOSA 3TPZA 2QCUA 1N36M 2QBYB 4JYAM 1PJJA 1MX0A 3FUTA 3ZQJA 2KNZA 5DNYA 1ZAEA 2FE8A 2BWBA 2QHOB 4MH0E 5EXPA 2DAEA 3MMPA 3FYDA 2LBCA 1TH2A 1HNXM 1L1TA 4JI6M 1DGFA 2LXEA 2MR9A 4AQYM 3HY5A 4NRVA 3KS4A 1GLNA 1CUKA 2O25A 4B7HA 1GJTA 4GKKM 3AKZA 5LMNM 1R4GA 1Q3CA 2OOBA 2G8LA 3CGWA 4DV7M 2QSFX 2XSZD 4HL4A 2DXIA 2HHHM 1V34A 4AKGA 4FWHA 2Y21A 4GKJM 2YQZA 4LJ9A 4B3RM 1VEGA 5IREB 1PJTA 2FS1A 3SARA 1IN7A 3IG5A 5JI2E 3T6PA 3W67A 1IBMM 4MB7A 2J7OA 5KPRA 4R71A 2D7HA 2CHVA 2JUJA 1IY1A 4KHPM 1WHCA 2R4EA 3BXWA 2Y0TA 4IBCA 4BLCA 2CV1A 1DGHB 3BOSA 4LCBA 1QUSA 1IY2A 2CEAA 2LVPC 4MGZE 2E5LM 3VDUA 5GKNA 2JNHA 2KNAA 1IM2A 3SC3A 3KP0E 3PNYA 5DYIA 1G8PA 2LH0A 4AKIA 5EXSA 2DZOB 4OVZA 4EIWA 1VDDA 1XHBA 2KRUA 4LGMA 4AW4A 3J2PB 2XF3A 3GPUA 3C58A 4LJ8A 1N77A 2EA0A 1HR0M 3AFHA 3ZC7B 2LVQD 2HCBA 1H6UA 4ANRA 1D2NA 1Z6TA 1PJQA 1BVSA 4AG5A 2QQ8A 2WSCF 4PCZA 1JB0F 2H5XA 4LF5M 4I8OA 4GH9A 3GQ4A 1NJFA 4IBFA 3AV0A 4RF0A 3RE8A 1NSFA 2DAIA 4MGHA 1IQPA 3GLHA 1I4WA 1MU5A 3KOXE 2DVWB 2X4AA 1HJPA 3SYLA 1OJLA 2VDBB 4B3MM 1N32M 1KSFX 2M60A 4MGKE 3FUXA 3GRRA 2KNVA 4DV5M 1JQJC 3E21A 3KP1E 2RRUA 1J5EM 3A45A 4LFCM 4MGYE 2Z4SA 1Q39A 5C1BA 4Y28F 2Y20A 2FOIC 4QNRA 5ITXA 2HKJA 2L6OA 1OIPA 3TWKA 4MGIE 3HHWA 4NC6A 2R46A 3AJIB 2QBYA 1EFUB 4DR7M 1TH3A 1QQWA 1QDRA 2NQ8C 3LVWA 4M9XA 3CF0A 3LW5F 3C3DA 4DR2M 1OIZA 5FTMA 1Z5CA 3K9PA 4LJ4A 2N35A 4DBGB 1PJSA 2QZ4A 2YR0A 1QUTA 3HU1A 2BJWA 1NNJA 3QYEA 3B7QA 1NJGA 3K1JA 3SASA 4LZZA 4NXNM 1R5LA 4DR6M 4F1IA 4DV4M 2UUAM 4AZFA 2XFSA 3R9XB 3FRHA 1TDHA 2LVNC 4LRTA 3KOZE 3KSXA 2CV0A 3H4MA 4AG6A 5FTLA 2EUCA 3I04M 3J7AS 5IT9S 3HGIA 2X8AA 3K92A 4JN6A 5EP4A 2D7EA 1DGHA 3U6MA 2FFJA 3WHKA 1E32A 2R44A 3HX3A 3KW6A 5FTJA 3FTFA 4CGYB 1XXHB 3U6PA 1FNNA 1OAOC 2HWJA 3FKEA 3KVWA 1MJGM 3QYBA 5F3WA 1HT1E 4NSOB 4XBOA 1OFHA 4G6ZA 3F92A 1VEKA 4X64M 1OQYA 3U61A 3U6SA 4FWDA 4M9SA 2O5RA 3AOGA 2F5PA 2APLA 1Q3BA 1K3WA 1NY6A 3GRYA 3MJ5A 1GO5A 4FVMA 2L7HA 3RGSA 1SXJC 3RGPA 2UU9M 2H1RA 1IBKM 3MHVC 4DR3M 4JI1M 1E94E 2AHMA 5EJCA 2WSEF 4L15A 2G5GX 2BWEA 4WURA 3DA1A 1Z5AA 3T38A 1SXJB 4P16A 3JR5A 2KHHA 2C9CA 1R2YA 4GHAA 1YE9A 4DV3M 3WHLA 1QYRA 1E9RA 3FYCA 4I4LA 3Q8GA 1PGYA 1GKIA 1WGNA 3I51A 5KPZA 2JWSA 4FD2A 3LVVA 3ZH9B 2LHCA 3GLFB 4LF7M 4JI0M 1LV7A 5ITYA 4M0DA 2C5RA 4BB9A 2HAKA 3U6QA 1JR3A 4GC9A 3GLIA 1D0LA 2XLJA 3T1HM 2L4FA 3GLGB 3MK6A 3LQRA 4ITQA 1XNQM 1N78A 1NV9A 1L8QA 5ITUA 2LNHC 3LCUA 1QANA 3KS8A 2C9OA 4DR4M 3VKHA 2LWXA 1AUAA 1NHWC 3TL4X 4G4QA 3KXEC 1HQYE 1VDLA 8CATA 3GQ3A 2VQFM 3A46A 2FH0A 2V6ZM 1WJ7A 3PXGA 5ITTA 4JI5M 3VKGA 4IBBA 4LJ6A 2J5YA 5C18A 1N75A 3KOYE 2RGHA 2KW0A 4LG2A 3SHGB 4R3DA 4L16A 4RKUF 1WR1B 3CTWB 2K6BA 3BBZA 1TGUA 2XFTA 4ZPXA 4DR1M 3W0FA 1A5TA 2ZBKB 1OFIA 1ORYB 5ITQA 4D82A 2OPFA 2DI0A 3W68A 5KO3A 4KO8A 1AIPC 1G4AE 4JI8M 2VF7A 4HLQA 4FW9A 3HKPA 5KQ8A 2DWNA 1XXHA 3E46A 3K9OA 3KSJA 1XNRM 3K8ZA 3TWLA 1KYIA 1YUBA 1WIVA 3GPXA 2R65A 2L7IA 1MN3A 3FE3A 4REZA 3C9PA 2KEBA 2CUZA 2MH8A 2ZANA 2QENA 3HHZA 1D0KA 4Q7JA 2RKOA 2JP7A 3T15A 1JR3D 2O01F 4B7FA 3IECA 4MM3B 4DUYM 2C98A 1K3XA 2VIIA 1DGGA 2YNMD 3C3EA 3J81S 2R45A 1C7YA 2C96A 2LVAA 4B08A 3L29A 1IY0A 4DV1M 1SXJA 4A3VB 1FJGM 2DZNB 2CWBA 2M5ZA 1VQ1A 5DFLA 2ZTDA 4KT0F 3FRIA 2MJ5B 4PT5A 3OTOM 1V33A 4PDIA 5EXXA 5E26A 1KFVA 4XGIA 1G3IA 3GPYA 1P3QQ 2CP8A 3U6DA 4II7A 3SHFA 4NSRA 1YSYA 3UGJA 3GO8A 4GEWA 1GL7A 2CHQA 1Z5BA 4IJEA 5EXTA 4BBAA 1S3SA 1TH4A 3U6OA 3GLGA 3UJNA 3GP1A 5FTKA 2CE7A 4CIZA 4G4OA 1NHGC 2ZTCA 1XB2B 2GQFA 2Z7JA 4JI4M 2X49A 4I81A 1IN4A 4GMQA 3PVSA 4WW0A 2UXDM 4CISA 3PFIA 4L78A 1UFZA 1Z59A 2DNAA 3GRUA 5EQTA 4LJAA 1NNUC 3U60A 5H37D 2BNKA 1ZMUA 4B7GA 3AOEC 4IBDA 1LTMA 7CATA 2EKFA 4G4NA 2DAKA 3SFZA 5A2QS 3TWMA 2CV2A 2DENA 2MROB 1XC8A 4RNAA 2CFOA 4CJ6A 4M0WA 2J7NA 3B89A 1WXQA 4NRWA 1EE8A 1DO2A 4OVZB 1ZMVA 3GLHE 2Z3XA 1SXJD 5EP2A 4IBJA 1Q02A 2DHYA 2R4JA 3NBIA 1G59A 3L27A 4QHSA 3FUWA 2UXCM 1PRBA 1W5TA 2D7GA 2QPAA 4IJFA 1PM5A 4AKHA 1C1KA 2WSFF 3VDPA 4JI2M 1L2DA 4PDGA 3DFZA 5ITXE 3K2LA 4JV5M 2JZ1A 3HJSA 3L26A 4Z6YA 1QZMA 4X62M 3VK8A 1X37A 1IN8A 1GVNA 1NVMA 4OW0A 1GABA 5BR8M 2YFQA 4L6V6 1ZMWA 3VLFB 3SATA 3M0EA 2DAGA 1L2CA 4TUWA 1IN5A 3SAWA 3EIHA 2JZ0A 4LFBM 2F5SA 4B3SM 1OAIA 1UM8A 4YY3M 2C99A 3LQQA 4M9ZA 1DO0A 2F5QA 2LHGA 4LF6M 5BPVA 1HT2E 3J80S 2XGNA 3KDSE 4FCTA 2CHGA 4FCVA 4DV6M 1TF0B 4FWGA 1T43A 2JY7A 3U6CA 1NY5A 2DWLA 3A98B 1E9SA 3NWLA 4HEOA 4CHTB 4NOOB 2OOAA 1QVRA 3RFWA 2KZSA 1V92A 2B3TA 2R6FA 2JY6B 4KLNA 1VG5A 5KPTA 2DKLA 3FTEA 1N33M 4JXJA 1D0MA 4LJ5A 5EP1A 3B7ZA 3E4RA 5IZ7D 4DR5M 4P17A 2VQEM 1DGBA 3H4JA 3L28A 3SYKA 2K9DA 3ILKA 3HU2A 2XZUA 3KOWE 2OO9A 3AL0C 1T3TA 3U6EA 1VEJA 3A42A 3DOAA 3FUUA 5KQDA 5L8RF 2UUBM 2I7NA 4QOZC 2JY5A 1XWIA 3HHYA 1G71A 3TE6A 4X66M 4D81A 4G4RA 2EKKA 1HNWM 2MGWA 4I5SA
chains in the Genus database with same CATH topology
2KNZA 2HWJA 1G3IA 2BWBA 1P3QQ 2CP8A 2DAEA 1HT1E 2QHOB 3MMPA 2LBCA 3F92A 4GEWA 1VEKA 1OQYA 2MR9A 3LCVB 1CUKA 2O25A 1R4GA 2OOBA 1GO5A 2QSFX 1F4IA 2DZLA 2ZTCA 1XB2B 1E94E 1VEGA 5JI2E 3T6PA 1Y8GA 2BWEA 4R71A 1UFZA 2DNAA 1JR3E 3GLIE 2JUJA 1WHCA 1OTRA 1YLAA 2KHHA 1ZMUA 2L4EA 2EKFA 2DAKA 1NV8A 2LVPC 2DENA 2MROB 2JNHA 2KNAA 1IM2A 2WZJA 1PGYA 1WGNA 2LVOC 3B89A 2HAKA 1DO2A 1ZMVA 2G3QA 3GLHE 2L4FA 2DAMA 1NV9A 1Q02A 2LVQD 2DHYA 3LCUA 4WP2A 1BVSA 1DV0A 2H5XA 1HQYE 1VDLA 1SG9A 2DAIA 1WJ7A 2QNJA 2JZ1A 3IHPA 1HJPA 2KNVA 3E21A 1XXHE 1ZMWA 2RRUA 2DAGA 1WR1B 2JZ0A 1OAIA 3BBZA 1A5TA 2LTUA 1QZEA 1DO0A 2DI0A 2JY8A 1HT2E 1TTEA 4UN2B 1G4AE 1AIPC 1EFUB 1T43A 2JY7A 3E46A 3K9OA 1T6OA 1KYIA 4HEOA 2OOAA 1WIVA 3K9PA 1IFYA 2EJSA 1MN3A 3FE3A 4DBGB 1V92A 2B3TA 1IXSA 2JY6B 1VG5A 2DKLA 2K0BX 1ZV1A 4G3OA 4Q7JA 4F2LA 1G41A 1WGLA 2JP7A 3IECA 3H4JA 1OKSA 2K9DA 2L2DA 3GLFE 4F1IA 1C7YA 2LVAA 2OO9A 3FRHA 1TR8A 1VEJA 2LVNC 2JY5A 2CWBA 1VQ1A 5DFLA 2ZTDA 2R0IA 3GLGE 2EKKA 3FRIA 2MJ5B 2MGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNZ A;  2HWJ A;  1G3I A;  2BWB A;  1P3Q Q;  2CP8 A;  2DAE A;  1HT1 E;  2QHO B;  3MMP A;  2LBC A;  3F92 A;  4GEW A;  1VEK A;  1OQY A;  2MR9 A;  3LCV B;  1CUK A;  2O25 A;  1R4G A;  2OOB A;  1GO5 A;  2QSF X;  1F4I A;  2DZL A;  2ZTC A;  1XB2 B;  1E94 E;  1VEG A;  5JI2 E;  3T6P A;  1Y8G A;  2BWE A;  4R71 A;  1UFZ A;  2DNA A;  1JR3 E;  3GLI E;  2JUJ A;  1WHC A;  1OTR A;  1YLA A;  2KHH A;  1ZMU A;  2L4E A;  2EKF A;  2DAK A;  1NV8 A;  2LVP C;  2DEN A;  2MRO B;  2JNH A;  2KNA A;  1IM2 A;  2WZJ A;  1PGY A;  1WGN A;  2LVO C;  3B89 A;  2HAK A;  1DO2 A;  1ZMV A;  2G3Q A;  3GLH E;  2L4F A;  2DAM A;  1NV9 A;  1Q02 A;  2LVQ D;  2DHY A;  3LCU A;  4WP2 A;  1BVS A;  1DV0 A;  2H5X A;  1HQY E;  1VDL A;  1SG9 A;  2DAI A;  1WJ7 A;  2QNJ A;  2JZ1 A;  3IHP A;  1HJP A;  2KNV A;  3E21 A;  1XXH E;  1ZMW A;  2RRU A;  2DAG A;  1WR1 B;  2JZ0 A;  1OAI A;  3BBZ A;  1A5T A;  2LTU A;  1QZE A;  1DO0 A;  2DI0 A;  2JY8 A;  1HT2 E;  1TTE A;  4UN2 B;  1G4A E;  1AIP C;  1EFU B;  1T43 A;  2JY7 A;  3E46 A;  3K9O A;  1T6O A;  1KYI A;  4HEO A;  2OOA A;  1WIV A;  3K9P A;  1IFY A;  2EJS A;  1MN3 A;  3FE3 A;  4DBG B;  1V92 A;  2B3T A;  1IXS A;  2JY6 B;  1VG5 A;  2DKL A;  2K0B X;  1ZV1 A;  4G3O A;  4Q7J A;  4F2L A;  1G41 A;  1WGL A;  2JP7 A;  3IEC A;  3H4J A;  1OKS A;  2K9D A;  2L2D A;  3GLF E;  4F1I A;  1C7Y A;  2LVA A;  2OO9 A;  3FRH A;  1TR8 A;  1VEJ A;  2LVN C;  2JY5 A;  2CWB A;  1VQ1 A;  5DFL A;  2ZTD A;  2R0I A;  3GLG E;  2EKK A;  3FRI A;  2MJ5 B;  2MGW A; 
#chains in the Genus database with same CATH topology
 3DZD A;  2Y0Q A;  3SAV A;  4LF8 M;  2DWM A;  3M6A A;  3M7G A;  4OX9 M;  3AOE A;  4X65 M;  3HZJ A;  2HL7 A;  3B7N A;  2VF8 A;  3QWL A;  2K47 A;  5FSW A;  3FUV A;  1IXS B;  4PD2 A;  3U61 B;  3LCV B;  1N34 M;  1GL6 A;  4GIT A;  3PNV A;  4NL4 H;  4DV2 M;  5FLX S;  4LZJ A;  3TQS A;  1F4I A;  2DZL A;  1IN6 A;  2JXN A;  4IBI A;  3GRV A;  3SBJ A;  4GC5 A;  4S12 A;  5ITR A;  4LF4 M;  4W5W A;  1QAO A;  3E9S A;  1Y8G A;  2V1U A;  1IXR C;  3HHX A;  4B3T M;  1JR3 E;  3GLI E;  2XH9 A;  3D8L A;  3HJQ A;  4GRI A;  3GPP A;  1R2Z A;  1OTR A;  1YLA A;  1K82 A;  2KA6 B;  3SMS A;  2I7P A;  2L4E A;  3U5Z B;  5E6J A;  2V1C A;  3GQ5 A;  4RF1 A;  5JI3 E;  1NV8 A;  3IG8 A;  3GLF A;  3HU3 A;  3I4V A;  2WZJ A;  2GNO A;  2W82 A;  3I4Y A;  4GHL A;  3UMM A;  4AI6 A;  2KXE A;  2LVO C;  3HWS A;  1TDZ A;  3U60 B;  3B9P A;  2F5N A;  2FNA A;  4R7G A;  4QHT A;  3R8F A;  3KFU G;  1L2B A;  2G3Q A;  3JR4 A;  2DAM A;  3GLI B;  1J7K A;  4LJ7 A;  3J7B A;  1NO1 A;  4WP2 A;  2F5O A;  3W0L B;  2UXB M;  2Q2E B;  1DV0 A;  5FTN A;  4OU7 A;  3ZCB B;  3SAU A;  2XZF A;  1XMQ M;  3THG A;  1PJI A;  4LRS A;  4K0K M;  1SG9 A;  2QNJ A;  4LY6 A;  3IHP A;  1RU3 A;  2L09 A;  2KRK A;  3FTC A;  3QAU A;  1W5S A;  4DV0 M;  4LGY A;  1I94 M;  1XXH E;  3JAM S;  3U6L A;  3D8B A;  1R6B X;  2ZAM A;  5DYG A;  2R18 A;  2F4V M;  2R62 A;  2EO2 A;  1J09 A;  2Z4R A;  2P5T A;  4IIW A;  4IBK A;  2ZM6 M;  2LTU A;  2A5Y B;  3LMM A;  1QZE A;  4FCW A;  5IWA M;  1XMO M;  1EIJ A;  4L4U A;  2JY8 A;  2XSZ A;  3FTD A;  1TTE A;  2RGO A;  4UN2 B;  4D80 A;  4JI7 M;  3T1Y M;  2CRU A;  4LFA M;  3V76 A;  3NBX X;  4JI3 M;  4GIP A;  2BJV A;  3VK7 A;  1T6O A;  2Z8Y M;  1L1Z A;  1IBL M;  1GJS A;  3FD9 A;  1IFY A;  2EJS A;  3L2A A;  1SXJ E;  1QDT A;  1IXS A;  3VFD A;  2K0B X;  1ZV1 A;  1R7R A;  3GLH B;  3I01 M;  4G3O A;  3Q8X A;  4KOD A;  1G41 A;  4F2L A;  1WGL A;  2ERC A;  3EIE A;  5LMU M;  3CF2 A;  2KZU A;  3HJ8 A;  2KDL A;  4LF9 M;  2OQ4 A;  1QAQ A;  1OKS A;  4QNM A;  2QP9 X;  3UK6 A;  2UUC M;  2XEP A;  2L2D A;  3UZU A;  1ZQ9 A;  2DHR A;  3GLF E;  2DWZ B;  4Z8X A;  3J27 B;  2ZAO A;  1HQC A;  4NXM M;  3SMP A;  2JA2 A;  3L25 A;  1TR8 A;  4L8R C;  4IBE A;  3CF6 E;  4IBG A;  4DUZ M;  1QAM A;  3GLG E;  2R0I A;  4XK8 F;  4YHH M;  1IXZ A;  3B74 A;  3U5Z A;  1HNZ M;  5EP3 A;  4QOS A;  3TPZ A;  2QCU A;  1N36 M;  2QBY B;  4JYA M;  1PJJ A;  1MX0 A;  3FUT A;  3ZQJ A;  2KNZ A;  5DNY A;  1ZAE A;  2FE8 A;  2BWB A;  2QHO B;  4MH0 E;  5EXP A;  2DAE A;  3MMP A;  3FYD A;  2LBC A;  1TH2 A;  1HNX M;  1L1T A;  4JI6 M;  1DGF A;  2LXE A;  2MR9 A;  4AQY M;  3HY5 A;  4NRV A;  3KS4 A;  1GLN A;  1CUK A;  2O25 A;  4B7H A;  1GJT A;  4GKK M;  3AKZ A;  5LMN M;  1R4G A;  1Q3C A;  2OOB A;  2G8L A;  3CGW A;  4DV7 M;  2QSF X;  2XSZ D;  4HL4 A;  2DXI A;  2HHH M;  1V34 A;  4AKG A;  4FWH A;  2Y21 A;  4GKJ M;  2YQZ A;  4LJ9 A;  4B3R M;  1VEG A;  5IRE B;  1PJT A;  2FS1 A;  3SAR A;  1IN7 A;  3IG5 A;  5JI2 E;  3T6P A;  3W67 A;  1IBM M;  4MB7 A;  2J7O A;  5KPR A;  4R71 A;  2D7H A;  2CHV A;  2JUJ A;  1IY1 A;  4KHP M;  1WHC A;  2R4E A;  3BXW A;  2Y0T A;  4IBC A;  4BLC A;  2CV1 A;  1DGH B;  3BOS A;  4LCB A;  1QUS A;  1IY2 A;  2CEA A;  2LVP C;  4MGZ E;  2E5L M;  3VDU A;  5GKN A;  2JNH A;  2KNA A;  1IM2 A;  3SC3 A;  3KP0 E;  3PNY A;  5DYI A;  1G8P A;  2LH0 A;  4AKI A;  5EXS A;  2DZO B;  4OVZ A;  4EIW A;  1VDD A;  1XHB A;  2KRU A;  4LGM A;  4AW4 A;  3J2P B;  2XF3 A;  3GPU A;  3C58 A;  4LJ8 A;  1N77 A;  2EA0 A;  1HR0 M;  3AFH A;  3ZC7 B;  2LVQ D;  2HCB A;  1H6U A;  4ANR A;  1D2N A;  1Z6T A;  1PJQ A;  1BVS A;  4AG5 A;  2QQ8 A;  2WSC F;  4PCZ A;  1JB0 F;  2H5X A;  4LF5 M;  4I8O A;  4GH9 A;  3GQ4 A;  1NJF A;  4IBF A;  3AV0 A;  4RF0 A;  3RE8 A;  1NSF A;  2DAI A;  4MGH A;  1IQP A;  3GLH A;  1I4W A;  1MU5 A;  3KOX E;  2DVW B;  2X4A A;  1HJP A;  3SYL A;  1OJL A;  2VDB B;  4B3M M;  1N32 M;  1KSF X;  2M60 A;  4MGK E;  3FUX A;  3GRR A;  2KNV A;  4DV5 M;  1JQJ C;  3E21 A;  3KP1 E;  2RRU A;  1J5E M;  3A45 A;  4LFC M;  4MGY E;  2Z4S A;  1Q39 A;  5C1B A;  4Y28 F;  2Y20 A;  2FOI C;  4QNR A;  5ITX A;  2HKJ A;  2L6O A;  1OIP A;  3TWK A;  4MGI E;  3HHW A;  4NC6 A;  2R46 A;  3AJI B;  2QBY A;  1EFU B;  4DR7 M;  1TH3 A;  1QQW A;  1QDR A;  2NQ8 C;  3LVW A;  4M9X A;  3CF0 A;  3LW5 F;  3C3D A;  4DR2 M;  1OIZ A;  5FTM A;  1Z5C A;  3K9P A;  4LJ4 A;  2N35 A;  4DBG B;  1PJS A;  2QZ4 A;  2YR0 A;  1QUT A;  3HU1 A;  2BJW A;  1NNJ A;  3QYE A;  3B7Q A;  1NJG A;  3K1J A;  3SAS A;  4LZZ A;  4NXN M;  1R5L A;  4DR6 M;  4F1I A;  4DV4 M;  2UUA M;  4AZF A;  2XFS A;  3R9X B;  3FRH A;  1TDH A;  2LVN C;  4LRT A;  3KOZ E;  3KSX A;  2CV0 A;  3H4M A;  4AG6 A;  5FTL A;  2EUC A;  3I04 M;  3J7A S;  5IT9 S;  3HGI A;  2X8A A;  3K92 A;  4JN6 A;  5EP4 A;  2D7E A;  1DGH A;  3U6M A;  2FFJ A;  3WHK A;  1E32 A;  2R44 A;  3HX3 A;  3KW6 A;  5FTJ A;  3FTF A;  4CGY B;  1XXH B;  3U6P A;  1FNN A;  1OAO C;  2HWJ A;  3FKE A;  3KVW A;  1MJG M;  3QYB A;  5F3W A;  1HT1 E;  4NSO B;  4XBO A;  1OFH A;  4G6Z A;  3F92 A;  1VEK A;  4X64 M;  1OQY A;  3U61 A;  3U6S A;  4FWD A;  4M9S A;  2O5R A;  3AOG A;  2F5P A;  2APL A;  1Q3B A;  1K3W A;  1NY6 A;  3GRY A;  3MJ5 A;  1GO5 A;  4FVM A;  2L7H A;  3RGS A;  1SXJ C;  3RGP A;  2UU9 M;  2H1R A;  1IBK M;  3MHV C;  4DR3 M;  4JI1 M;  1E94 E;  2AHM A;  5EJC A;  2WSE F;  4L15 A;  2G5G X;  2BWE A;  4WUR A;  3DA1 A;  1Z5A A;  3T38 A;  1SXJ B;  4P16 A;  3JR5 A;  2KHH A;  2C9C A;  1R2Y A;  4GHA A;  1YE9 A;  4DV3 M;  3WHL A;  1QYR A;  1E9R A;  3FYC A;  4I4L A;  3Q8G A;  1PGY A;  1GKI A;  1WGN A;  3I51 A;  5KPZ A;  2JWS A;  4FD2 A;  3LVV A;  3ZH9 B;  2LHC A;  3GLF B;  4LF7 M;  4JI0 M;  1LV7 A;  5ITY A;  4M0D A;  2C5R A;  4BB9 A;  2HAK A;  3U6Q A;  1JR3 A;  4GC9 A;  3GLI A;  1D0L A;  2XLJ A;  3T1H M;  2L4F A;  3GLG B;  3MK6 A;  3LQR A;  4ITQ A;  1XNQ M;  1N78 A;  1NV9 A;  1L8Q A;  5ITU A;  2LNH C;  3LCU A;  1QAN A;  3KS8 A;  2C9O A;  4DR4 M;  3VKH A;  2LWX A;  1AUA A;  1NHW C;  3TL4 X;  4G4Q A;  3KXE C;  1HQY E;  1VDL A;  8CAT A;  3GQ3 A;  2VQF M;  3A46 A;  2FH0 A;  2V6Z M;  1WJ7 A;  3PXG A;  5ITT A;  4JI5 M;  3VKG A;  4IBB A;  4LJ6 A;  2J5Y A;  5C18 A;  1N75 A;  3KOY E;  2RGH A;  2KW0 A;  4LG2 A;  3SHG B;  4R3D A;  4L16 A;  4RKU F;  1WR1 B;  3CTW B;  2K6B A;  3BBZ A;  1TGU A;  2XFT A;  4ZPX A;  4DR1 M;  3W0F A;  1A5T A;  2ZBK B;  1OFI A;  1ORY B;  5ITQ A;  4D82 A;  2OPF A;  2DI0 A;  3W68 A;  5KO3 A;  4KO8 A;  1AIP C;  1G4A E;  4JI8 M;  2VF7 A;  4HLQ A;  4FW9 A;  3HKP A;  5KQ8 A;  2DWN A;  1XXH A;  3E46 A;  3K9O A;  3KSJ A;  1XNR M;  3K8Z A;  3TWL A;  1KYI A;  1YUB A;  1WIV A;  3GPX A;  2R65 A;  2L7I A;  1MN3 A;  3FE3 A;  4REZ A;  3C9P A;  2KEB A;  2CUZ A;  2MH8 A;  2ZAN A;  2QEN A;  3HHZ A;  1D0K A;  4Q7J A;  2RKO A;  2JP7 A;  3T15 A;  1JR3 D;  2O01 F;  4B7F A;  3IEC A;  4MM3 B;  4DUY M;  2C98 A;  1K3X A;  2VII A;  1DGG A;  2YNM D;  3C3E A;  3J81 S;  2R45 A;  1C7Y A;  2C96 A;  2LVA A;  4B08 A;  3L29 A;  1IY0 A;  4DV1 M;  1SXJ A;  4A3V B;  1FJG M;  2DZN B;  2CWB A;  2M5Z A;  1VQ1 A;  5DFL A;  2ZTD A;  4KT0 F;  3FRI A;  2MJ5 B;  4PT5 A;  3OTO M;  1V33 A;  4PDI A;  5EXX A;  5E26 A;  1KFV A;  4XGI A;  1G3I A;  3GPY A;  1P3Q Q;  2CP8 A;  3U6D A;  4II7 A;  3SHF A;  4NSR A;  1YSY A;  3UGJ A;  3GO8 A;  4GEW A;  1GL7 A;  2CHQ A;  1Z5B A;  4IJE A;  5EXT A;  4BBA A;  1S3S A;  1TH4 A;  3U6O A;  3GLG A;  3UJN A;  3GP1 A;  5FTK A;  2CE7 A;  4CIZ A;  4G4O A;  1NHG C;  2ZTC A;  1XB2 B;  2GQF A;  2Z7J A;  4JI4 M;  2X49 A;  4I81 A;  1IN4 A;  4GMQ A;  3PVS A;  4WW0 A;  2UXD M;  4CIS A;  3PFI A;  4L78 A;  1UFZ A;  1Z59 A;  2DNA A;  3GRU A;  5EQT A;  4LJA A;  1NNU C;  3U60 A;  5H37 D;  2BNK A;  1ZMU A;  4B7G A;  3AOE C;  4IBD A;  1LTM A;  7CAT A;  2EKF A;  4G4N A;  2DAK A;  3SFZ A;  5A2Q S;  3TWM A;  2CV2 A;  2DEN A;  2MRO B;  1XC8 A;  4RNA A;  2CFO A;  4CJ6 A;  4M0W A;  2J7N A;  3B89 A;  1WXQ A;  4NRW A;  1EE8 A;  1DO2 A;  4OVZ B;  1ZMV A;  3GLH E;  2Z3X A;  1SXJ D;  5EP2 A;  4IBJ A;  1Q02 A;  2DHY A;  2R4J A;  3NBI A;  1G59 A;  3L27 A;  4QHS A;  3FUW A;  2UXC M;  1PRB A;  1W5T A;  2D7G A;  2QPA A;  4IJF A;  1PM5 A;  4AKH A;  1C1K A;  2WSF F;  3VDP A;  4JI2 M;  1L2D A;  4PDG A;  3DFZ A;  5ITX E;  3K2L A;  4JV5 M;  2JZ1 A;  3HJS A;  3L26 A;  4Z6Y A;  1QZM A;  4X62 M;  3VK8 A;  1X37 A;  1IN8 A;  1GVN A;  1NVM A;  4OW0 A;  1GAB A;  5BR8 M;  2YFQ A;  4L6V 6;  1ZMW A;  3VLF B;  3SAT A;  3M0E A;  2DAG A;  1L2C A;  4TUW A;  1IN5 A;  3SAW A;  3EIH A;  2JZ0 A;  4LFB M;  2F5S A;  4B3S M;  1OAI A;  1UM8 A;  4YY3 M;  2C99 A;  3LQQ A;  4M9Z A;  1DO0 A;  2F5Q A;  2LHG A;  4LF6 M;  5BPV A;  1HT2 E;  3J80 S;  2XGN A;  3KDS E;  4FCT A;  2CHG A;  4FCV A;  4DV6 M;  1TF0 B;  4FWG A;  1T43 A;  2JY7 A;  3U6C A;  1NY5 A;  2DWL A;  3A98 B;  1E9S A;  3NWL A;  4HEO A;  4CHT B;  4NOO B;  2OOA A;  1QVR A;  3RFW A;  2KZS A;  1V92 A;  2B3T A;  2R6F A;  2JY6 B;  4KLN A;  1VG5 A;  5KPT A;  2DKL A;  3FTE A;  1N33 M;  4JXJ A;  1D0M A;  4LJ5 A;  5EP1 A;  3B7Z A;  3E4R A;  5IZ7 D;  4DR5 M;  4P17 A;  2VQE M;  1DGB A;  3H4J A;  3L28 A;  3SYK A;  2K9D A;  3ILK A;  3HU2 A;  2XZU A;  3KOW E;  2OO9 A;  3AL0 C;  1T3T A;  3U6E A;  1VEJ A;  3A42 A;  3DOA A;  3FUU A;  5KQD A;  5L8R F;  2UUB M;  2I7N A;  4QOZ C;  2JY5 A;  1XWI A;  3HHY A;  1G71 A;  3TE6 A;  4X66 M;  4D81 A;  4G4R A;  2EKK A;  1HNW M;  2MGW A;  4I5S A; 
#chains in the Genus database with same CATH homology
 2KNZ A;  2HWJ A;  1G3I A;  2BWB A;  1P3Q Q;  2CP8 A;  2DAE A;  1HT1 E;  2QHO B;  3MMP A;  2LBC A;  3F92 A;  4GEW A;  1VEK A;  1OQY A;  2MR9 A;  3LCV B;  1CUK A;  2O25 A;  1R4G A;  2OOB A;  1GO5 A;  2QSF X;  1F4I A;  2DZL A;  2ZTC A;  1XB2 B;  1E94 E;  1VEG A;  5JI2 E;  3T6P A;  1Y8G A;  2BWE A;  4R71 A;  1UFZ A;  2DNA A;  1JR3 E;  3GLI E;  2JUJ A;  1WHC A;  1OTR A;  1YLA A;  2KHH A;  1ZMU A;  2L4E A;  2EKF A;  2DAK A;  1NV8 A;  2LVP C;  2DEN A;  2MRO B;  2JNH A;  2KNA A;  1IM2 A;  2WZJ A;  1PGY A;  1WGN A;  2LVO C;  3B89 A;  2HAK A;  1DO2 A;  1ZMV A;  2G3Q A;  3GLH E;  2L4F A;  2DAM A;  1NV9 A;  1Q02 A;  2LVQ D;  2DHY A;  3LCU A;  4WP2 A;  1BVS A;  1DV0 A;  2H5X A;  1HQY E;  1VDL A;  1SG9 A;  2DAI A;  1WJ7 A;  2QNJ A;  2JZ1 A;  3IHP A;  1HJP A;  2KNV A;  3E21 A;  1XXH E;  1ZMW A;  2RRU A;  2DAG A;  1WR1 B;  2JZ0 A;  1OAI A;  3BBZ A;  1A5T A;  2LTU A;  1QZE A;  1DO0 A;  2DI0 A;  2JY8 A;  1HT2 E;  1TTE A;  4UN2 B;  1G4A E;  1AIP C;  1EFU B;  1T43 A;  2JY7 A;  3E46 A;  3K9O A;  1T6O A;  1KYI A;  4HEO A;  2OOA A;  1WIV A;  3K9P A;  1IFY A;  2EJS A;  1MN3 A;  3FE3 A;  4DBG B;  1V92 A;  2B3T A;  1IXS A;  2JY6 B;  1VG5 A;  2DKL A;  2K0B X;  1ZV1 A;  4G3O A;  4Q7J A;  4F2L A;  1G41 A;  1WGL A;  2JP7 A;  3IEC A;  3H4J A;  1OKS A;  2K9D A;  2L2D A;  3GLF E;  4F1I A;  1C7Y A;  2LVA A;  2OO9 A;  3FRH A;  1TR8 A;  1VEJ A;  2LVN C;  2JY5 A;  2CWB A;  1VQ1 A;  5DFL A;  2ZTD A;  2R0I A;  3GLG E;  2EKK A;  3FRI A;  2MJ5 B;  2MGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...