2DAGA

Solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
publication title Solution Structure of the First UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 74
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dagA01
1WGLA 2DENA 1HQYE 1TTEA 2G3QA 1A5TA 1WHCA 1WGNA 2JY8A 1YLAA 2JZ0A 2LVAA 3LCVB 3GLFE 1OAIA 4G3OA 1VEGA 1JR3E 2O25A 1IM2A 1NV8A 1P3QQ 1WIVA 2JY6B 3E46A 2KNZA 2CP8A 4F1IA 2QHOB 3FE3A 2DKLA 1T6OA 1VDLA 2LBCA 2DHYA 1MN3A 1QZEA 4WP2A 1G41A 3E21A 4GEWA 2LVPC 1IFYA 1G3IA 3B89A 2DZLA 2K0BX 2JY5A 4HEOA 2BWEA 1CUKA 2B3TA 2LVNC 2OOBA 2EJSA 2QSFX 2H5XA 1R4GA 2L4FA 2WZJA 1ZMUA 3GLGE 4UN2B 2JZ1A 2KHHA 1Y8GA 1VEJA 1VEKA 1SG9A 1IXSA 2MROB 2DAKA 3H4JA 1E94E 3FRHA 2LVOC 2L4EA 1AIPC 1WR1B 2OO9A 1V92A 2JNHA 2JP7A 5DFLA 1DO0A 4DBGB 4F2LA 1XXHE 3BBZA 2LTUA 1OQYA 3FRIA 4R71A 2HAKA 1KYIA 4Q7JA 1HT1E 5JI2E 3IHPA 2QNJA 2K9DA 1WJ7A 3F92A 2MJ5B 3K9OA 3LCUA 1GO5A 1DO2A 1NV9A 1ZMWA 3K9PA 1OTRA 2DAIA 2HWJA 2EKFA 2RRUA 2KNAA 1VG5A 2R0IA 2KNVA 2ZTCA 3MMPA 1Q02A 2DAGA 2DNAA 1ZMVA 3IECA 1F4IA 2BWBA 1XB2B 1DV0A 1T43A 3T6PA 2OOAA 2CWBA 1BVSA 1HT2E 1HJPA 1PGYA 2JUJA 2JY7A 2MGWA 2MR9A 1OKSA 1EFUB 1TR8A 1C7YA 1UFZA 1ZV1A 1G4AE 2EKKA 2DAMA 3GLHE 2DAEA 2LVQD 3GLIE 2DI0A 2ZTDA 1VQ1A 2L2DA
chains in the Genus database with same CATH superfamily
3W0LB 4L16A 1DGGA 4G4NA 1N75A 1MU5A 1QAMA 2XH9A 3LCVB 2LVAA 2VF8A 3DA1A 4L6V6 1K3XA 1IXSB 1VEGA 3FTEA 2O25A 4LF8M 4W5WA 4MGYE 1J7KA 2XFSA 5FLXS 2OPFA 1NY5A 2QHOB 3KSJA 4DV3M 3FE3A 2KZSA 3SBJA 4LF5M 1T6OA 2CV2A 4I4LA 3T1HM 5FTNA 5IZ7D 3OTOM 1PJTA 3GPUA 2KW0A 3RFWA 2C5RA 4DV2M 2GNOA 4QOZC 3JR4A 2AHMA 4DR1M 3DZDA 5EQTA 3U60B 1GLNA 4IBEA 4FCVA 1PRBA 3Q8GA 3U6LA 2LVPC 3HHWA 1JQJC 2LHCA 3QYEA 5ITTA 3BOSA 2H1RA 3KOWE 4IJEA 5GKNA 3WHLA 3L2AA 2LVNC 2OOBA 2X8AA 1IY1A 2C9CA 3AJIB 2KXEA 3KS4A 4M9XA 1OJLA 4OW0A 4JI3M 2V1UA 1R4GA 2KDLA 1C1KA 2KRKA 3B7NA 3IG5A 5EP4A 3SASA 2MH8A 4UN2B 4KO8A 3M6AA 3I4YA 5EXPA 1EIJA 1VEJA 4NOOB 1NHGC 1SG9A 2P5TA 2E5LM 4LFBM 1N78A 2KZUA 3LVVA 2C9OA 3JAMS 4FCTA 4FWGA 2DAKA 3H4JA 1Z59A 5ITUA 3JR5A 1E9RA 3FRHA 4KT0F 2R45A 4YHHM 4XK8F 3E9SA 4GKKM 4AKIA 2EA0A 4CISA 5DFLA 3SAUA 1D2NA 2JA2A 3I01M 2F5SA 1E9SA 2LXEA 2M5ZA 4ZPXA 1KFVA 1OIZA 5LMUM 3A46A 3FRIA 3HGIA 2HAKA 1KYIA 3FD9A 4GIPA 5EJCA 4M0WA 1IY2A 1PJJA 3J7AS 1HT1E 1IBMM 5JI2E 1R2ZA 2QBYA 2QNJA 3LQRA 5DNYA 4NRWA 4JXJA 1WJ7A 3F92A 3K9OA 5KPRA 3KDSE 4LZJA 1GO5A 2HKJA 3U6DA 3FUVA 1OTRA 2I7PA 3MJ5A 4GRIA 3W68A 3UJNA 5F3WA 2QZ4A 1TGUA 3J2PB 4KLNA 2LWXA 2EKFA 3PVSA 3GRVA 2R0IA 1XXHA 3MMPA 1D0LA 1QDTA 4G4RA 1HNXM 4B08A 1EE8A 3GLIB 2VQFM 1ZMVA 4JI8M 3LQQA 3V76A 4P17A 1T43A 2OOAA 4IJFA 2X49A 4M0DA 3H4MA 4DUZM 1AUAA 2A5YB 3HHXA 1BVSA 2JY7A 3W0FA 4AZFA 2FS1A 2XEPA 4I81A 2Y21A 3GLIA 5ITYA 1Q3BA 4IBDA 3ILKA 1GJTA 2R44A 5C1BA 2J5YA 4DV1M 1G4AE 5JI3E 3Q8XA 3GLIE 4WURA 2DI0A 1Z5BA 3I04M 3M0EA 1QUTA 1QAQA 4FD2A 3VDPA 1WGLA 2DHRA 2G3QA 2DENA 2XLJA 1WGNA 1IN6A 2JZ0A 2RGOA 3KXEC 4D81A 5KPZA 4REZA 2V1CA 4Z6YA 1JB0F 1JR3E 2R4EA 4DUYM 4DV5M 3CF2A 4MH0E 1XMQM 1XNRM 4K0KM 2CHGA 1QDRA 3VK8A 2Z4SA 2CP8A 1LTMA 2R6FA 5C18A 1DGHA 4B3TM 3GLHA 4WW0A 1GKIA 3HU3A 3GRRA 3LW5F 4IBGA 4PDGA 2DHYA 4MGZE 3EIHA 4JN6A 1QUSA 1TH2A 3J81S 3UK6A 4WP2A 1SXJE 1DGFA 3HKPA 1YSYA 4GEWA 1IFYA 1Q39A 3B89A 3HU2A 4Y28F 2K0BX 4OVZB 1ZQ9A 2JY5A 4HEOA 2BWEA 2B3TA 4B3RM 4AKHA 4BLCA 1L8QA 1TF0B 4QNRA 1D0KA 3CF6E 3QAUA 2HL7A 4XBOA 2QSFX 3TWLA 1L2CA 4ITQA 4GHLA 1NJGA 2H5XA 4KODA 1N32M 3R8FA 2UUCM 2YQZA 2Z4RA 3B7QA 3TE6A 1TH4A 4FWDA 3SAVA 3PXGA 3U5ZB 2GQFA 1Z6TA 2F5PA 3VDUA 3A45A 2OQ4A 5EP3A 2HHHM 1IXSA 3UZUA 1GL7A 2JWSA 1UM8A 3FTCA 3FUXA 1E94E 3ZCBB 4TUWA 3GP1A 3LVWA 5E6JA 7CATA 2R4JA 5L8RF 1NNJA 2LVOC 2L4EA 1AIPC 1NVMA 1WR1B 2CE7A 3TPZA 1K3WA 1TDHA 5KQ8A 4AKGA 3U6CA 5FTKA 1R7RA 3IG8A 4LJ8A 4YY3M 4JI7M 4ANRA 4DBGB 5A2QS 2F5OA 2CV0A 3GRYA 3U60A 4MGIE 3T15A 1V33A 3U61B 4B7HA 2DWLA 4L15A 2XFTA 1TDZA 2D7HA 1S3SA 1IBKM 4DR6M 3ZH9B 1Z5AA 3SHGB 1GABA 4LCBA 1X37A 2I7NA 1LV7A 2RKOA 3GQ5A 5KQDA 2J7NA 2BJWA 4Z8XA 4IBKA 3VKGA 1OFHA 2MJ5B 2Z7JA 3K8ZA 2FNAA 4X66M 1PJQA 4NL4H 1D0MA 4JI0M 4MB7A 4AI6A 5FTMA 1ZMWA 2L7IA 3HZJA 3GQ3A 3K9PA 2Q2EB 4JI1M 4L8RC 2ZAOA 1QANA 4LJAA 5ITXE 4B3SM 2DWMA 2DAGA 1Z5CA 2APLA 4AQYM 2UUAM 2VIIA 3IECA 4CIZA 4NC6A 2WSEF 3L28A 4DR2M 1XB2B 2C99A 3C58A 3SYKA 1DV0A 4RKUF 1QQWA 4DR5M 3GRUA 3GLFB 2X4AA 3W67A 3NBXX 2JUJA 2MGWA 2MR9A 3MHVC 4LF6M 2FOIC 4DV4M 2EUCA 1EFUB 2KEBA 3KP0E 1IXRC 4LJ6A 1R5LA 4XGIA 1C7YA 2WSFF 3U6SA 2DAEA 4P16A 1QAOA 2LVQD 2ZTDA 1VQ1A 1N34M 4LFCM 2J7OA 4PT5A 2QPAA 2CEAA 3SFZA 4OX9M 4GC9A 4DV6M 1WHCA 3MK6A 1YLAA 2VQEM 3GLFE 4LRSA 1ZAEA 4IBJA 1L1TA 4G3OA 3L25A 3GPPA 2M60A 2FH0A 1IM2A 1NV8A 3KSXA 1GL6A 2L6OA 5ITRA 1P3QQ 1WIVA 3AV0A 2KNZA 3U6MA 2UUBM 4F1IA 4FWHA 2Z3XA 1YE9A 2DKLA 1VDLA 4CJ6A 1G71A 2LBCA 3GO8A 1N77A 3GPYA 3NWLA 1L2BA 2ZM6M 1XNQM 1NSFA 3GLGB 1DGBA 4HLQA 2C98A 2R18A 5DYIA 1MN3A 3U6OA 1QZEA 1G41A 2XSZA 3J27B 2Y0TA 2DWZB 5DYGA 3SYLA 2VDBB 1G3IA 3HHZA 4RF1A 2DZLA 2ZANA 3TL4X 1CUKA 4GC5A 3VLFB 3K2LA 4MGKE 4GKJM 4I8OA 1JR3A 1NJFA 4NXMM 4R7GA 4L78A 3AOEC 2ERCA 3A98B 1SXJB 2WZJA 3GLGE 1ZMUA 2JZ1A 2DZOB 2KHHA 3B9PA 2N35A 1W5SA 4B7FA 2R65A 1HNZM 3HWSA 3KS8A 3THGA 2Y20A 3KOZE 4LZZA 2BNKA 2L7HA 1SXJA 4JYAM 4LFAM 4B3MM 4LY6A 4FCWA 3FUUA 3SHFA 2OO9A 1IN4A 3FKEA 4B7GA 1PJIA 2NQ8C 3B7ZA 1XC8A 2CV1A 4LF7M 3AOGA 3C3EA 2UXDM 3SC3A 3ZC7B 3M7GA 1J5EM 4QOSA 1OAOC 4MGHA 3T38A 4F2LA 3GPXA 3FYDA 4G4OA 2LTUA 4GHAA 1OQYA 2Y0QA 1N33M 5EXXA 4QHSA 3FTDA 1G8PA 4R71A 2LHGA 3U6PA 4OVZA 5EXSA 2FFJA 4HL4A 3DFZA 4JI4M 4NXNM 3HHYA 2JXNA 1MX0A 2CRUA 4LRTA 2BJVA 4LJ5A 3CGWA 4X64M 3BXWA 5KO3A 1IBLM 1NHWC 1N36M 1NV9A 4LGYA 2C96A 3TQSA 4DV7M 3U5ZA 1GVNA 4IBIA 2DAIA 3HJSA 2D7GA 1V34A 2KNVA 2ZTCA 5IREB 4BB9A 3R9XB 2QCUA 3HJQA 1SXJC 2UU9M 1ORYB 2YR0A 5IT9S 1PJSA 3LMMA 5E26A 4L4UA 2W82A 3D8LA 2CUZA 2R62A 1QYRA 2D7EA 4CGYB 1TR8A 3CF0A 3QYBA 1UFZA 3U6QA 4DR4M 4BBAA 3FUWA 3I4VA 4FW9A 3U61A 2DXIA 5LMNM 3AFHA 4S12A 5ITXA 2F5NA 1W5TA 1HQYE 1TTEA 1WXQA 4GITA 1A5TA 4R3DA 4PD2A 2JY8A 2O01F 4JI6M 2UXBM 4PDIA 2R46A 1OAIA 3D8BA 5H37D 1K82A 3SAWA 1VDDA 3SMPA 4IBCA 4QNMA 4FVMA 1G59A 1IN7A 3PFIA 2ZBKB 2JY6B 3E46A 4GH9A 4IIWA 4LGMA 3GQ4A 4A3VB 3T1YM 4AG6A 4X62M 4LF4M 4II7A 4DR7M 2K47A 1IN8A 2KA6B 1HNWM 3AOEA 3K92A 2XF3A 1XHBA 3RGPA 2YNMD 1MJGM 1L1ZA 4KHPM 3E21A 3UMMA 3VK7A 3GLFA 4LF9M 4X65M 2DZNB 3AKZA 4NSRA 4G4QA 4JI2M 4NRVA 4LG2A 2L09A 1NY6A 2QBYB 3RGSA 3CTWB 8CATA 2EJSA 4IBFA 1QZMA 2Z8YM 4EIWA 5FTLA 2XZFA 4D80A 2L4FA 3K1JA 3SATA 4NSOB 4JV5M 2QP9X 4RF0A 3A42A 3KP1E 1RU3A 1Y8GA 2EO2A 4IBBA 1J09A 1Q3CA 1VEKA 1GJSA 1IY0A 1XXHB 4MM3B 3TWKA 2XGNA 3B74A 3KVWA 2MROB 4GMQA 2YFQA 4CHTB 1KSFX 2XZUA 3PNYA 1TH3A 5ITQA 2HCBA 3AL0C 2VF7A 4PCZA 2LH0A 4OU7A 5KPTA 2F5QA 1V92A 2G5GX 2JNHA 1NO1A 2CFOA 3HX3A 4LJ7A 4QHTA 5EXTA 2JP7A 1FJGM 1DO0A 3J80S 1XMOM 2F4VM 3HU1A 4LJ9A 2FE8A 1IQPA 1HR0M 1QVRA 3GLGA 3KOXE 1XXHE 4RNAA 3BBZA 1FNNA 5EP1A 3UGJA 3U6EA 1PM5A 1IXZA 1OIPA 1E32A 4Q7JA 1I94M 2DVWB 3KOYE 1T3TA 3TWMA 4LJ4A 2QQ8A 2V6ZM 2RGHA 1I4WA 3IHPA 2O5RA 3VFDA 4AG5A 3ZQJA 2K9DA 3KFUG 1H6UA 3L26A 3HJ8A 3LCUA 3SMSA 3FTFA 1DO2A 4M9SA 5FTJA 2CHQA 3FUTA 2CHVA 1IN5A 4DV0M 1YUBA 2XSZD 3J7BA 3VKHA 3WHKA 3QWLA 2HWJA 4M9ZA 3C9PA 2RRUA 2KNAA 1OFIA 1VG5A 3L27A 5FSWA 5BR8M 4D82A 1DGHB 1Q02A 4JI5M 3DOAA 3E4RA 1XWIA 3GLHB 2QENA 2DWNA 1JR3D 2DNAA 1F4IA 2ZAMA 3SARA 2BWBA 5EP2A 3I51A 4G6ZA 3T6PA 2G8LA 2CWBA 3L29A 3NBIA 4I5SA 2K6BA 2LNHC 3RE8A 1HT2E 1HJPA 1PGYA 1NNUC 2WSCF 2KRUA 3KW6A 1R6BX 1OKSA 3C3DA 5IWAM 1L2DA 2UXCM 1ZV1A 2EKKA 3GLHE 2DAMA 3FYCA 1SXJD 4AW4A 1HQCA 3EIEA 3HY5A 5BPVA 1R2YA 3PNVA 4DR3M 2L2DA
chains in the Genus database with same CATH topology
1WGLA 2DENA 1HQYE 1TTEA 2G3QA 1A5TA 1WHCA 1WGNA 2JY8A 1YLAA 2JZ0A 2LVAA 3LCVB 3GLFE 1OAIA 4G3OA 1VEGA 1JR3E 2O25A 1IM2A 1NV8A 1P3QQ 1WIVA 2JY6B 3E46A 2KNZA 2CP8A 4F1IA 2QHOB 3FE3A 2DKLA 1T6OA 1VDLA 2LBCA 2DHYA 1MN3A 1QZEA 4WP2A 1G41A 3E21A 4GEWA 2LVPC 1IFYA 1G3IA 3B89A 2DZLA 2K0BX 2JY5A 4HEOA 2BWEA 1CUKA 2B3TA 2LVNC 2OOBA 2EJSA 2QSFX 2H5XA 1R4GA 2L4FA 2WZJA 1ZMUA 3GLGE 4UN2B 2JZ1A 2KHHA 1Y8GA 1VEJA 1VEKA 1SG9A 1IXSA 2MROB 2DAKA 3H4JA 1E94E 3FRHA 2LVOC 2L4EA 1AIPC 1WR1B 2OO9A 1V92A 2JNHA 2JP7A 5DFLA 1DO0A 4DBGB 4F2LA 1XXHE 3BBZA 2LTUA 1OQYA 3FRIA 4R71A 2HAKA 1KYIA 4Q7JA 1HT1E 5JI2E 3IHPA 2QNJA 2K9DA 1WJ7A 3F92A 2MJ5B 3K9OA 3LCUA 1GO5A 1DO2A 1NV9A 1ZMWA 3K9PA 1OTRA 2DAIA 2HWJA 2EKFA 2RRUA 2KNAA 1VG5A 2R0IA 2KNVA 2ZTCA 3MMPA 1Q02A 2DAGA 2DNAA 1ZMVA 3IECA 1F4IA 2BWBA 1XB2B 1DV0A 1T43A 3T6PA 2OOAA 2CWBA 1BVSA 1HT2E 1HJPA 1PGYA 2JUJA 2JY7A 2MGWA 2MR9A 1OKSA 1EFUB 1TR8A 1C7YA 1UFZA 1ZV1A 1G4AE 2EKKA 2DAMA 3GLHE 2DAEA 2LVQD 3GLIE 2DI0A 2ZTDA 1VQ1A 2L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGL A;  2DEN A;  1HQY E;  1TTE A;  2G3Q A;  1A5T A;  1WHC A;  1WGN A;  2JY8 A;  1YLA A;  2JZ0 A;  2LVA A;  3LCV B;  3GLF E;  1OAI A;  4G3O A;  1VEG A;  1JR3 E;  2O25 A;  1IM2 A;  1NV8 A;  1P3Q Q;  1WIV A;  2JY6 B;  3E46 A;  2KNZ A;  2CP8 A;  4F1I A;  2QHO B;  3FE3 A;  2DKL A;  1T6O A;  1VDL A;  2LBC A;  2DHY A;  1MN3 A;  1QZE A;  4WP2 A;  1G41 A;  3E21 A;  4GEW A;  2LVP C;  1IFY A;  1G3I A;  3B89 A;  2DZL A;  2K0B X;  2JY5 A;  4HEO A;  2BWE A;  1CUK A;  2B3T A;  2LVN C;  2OOB A;  2EJS A;  2QSF X;  2H5X A;  1R4G A;  2L4F A;  2WZJ A;  1ZMU A;  3GLG E;  4UN2 B;  2JZ1 A;  2KHH A;  1Y8G A;  1VEJ A;  1VEK A;  1SG9 A;  1IXS A;  2MRO B;  2DAK A;  3H4J A;  1E94 E;  3FRH A;  2LVO C;  2L4E A;  1AIP C;  1WR1 B;  2OO9 A;  1V92 A;  2JNH A;  2JP7 A;  5DFL A;  1DO0 A;  4DBG B;  4F2L A;  1XXH E;  3BBZ A;  2LTU A;  1OQY A;  3FRI A;  4R71 A;  2HAK A;  1KYI A;  4Q7J A;  1HT1 E;  5JI2 E;  3IHP A;  2QNJ A;  2K9D A;  1WJ7 A;  3F92 A;  2MJ5 B;  3K9O A;  3LCU A;  1GO5 A;  1DO2 A;  1NV9 A;  1ZMW A;  3K9P A;  1OTR A;  2DAI A;  2HWJ A;  2EKF A;  2RRU A;  2KNA A;  1VG5 A;  2R0I A;  2KNV A;  2ZTC A;  3MMP A;  1Q02 A;  2DAG A;  2DNA A;  1ZMV A;  3IEC A;  1F4I A;  2BWB A;  1XB2 B;  1DV0 A;  1T43 A;  3T6P A;  2OOA A;  2CWB A;  1BVS A;  1HT2 E;  1HJP A;  1PGY A;  2JUJ A;  2JY7 A;  2MGW A;  2MR9 A;  1OKS A;  1EFU B;  1TR8 A;  1C7Y A;  1UFZ A;  1ZV1 A;  1G4A E;  2EKK A;  2DAM A;  3GLH E;  2DAE A;  2LVQ D;  3GLI E;  2DI0 A;  2ZTD A;  1VQ1 A;  2L2D A; 
#chains in the Genus database with same CATH topology
 3W0L B;  4L16 A;  1DGG A;  4G4N A;  1N75 A;  1MU5 A;  1QAM A;  2XH9 A;  3LCV B;  2LVA A;  2VF8 A;  3DA1 A;  4L6V 6;  1K3X A;  1IXS B;  1VEG A;  3FTE A;  2O25 A;  4LF8 M;  4W5W A;  4MGY E;  1J7K A;  2XFS A;  5FLX S;  2OPF A;  1NY5 A;  2QHO B;  3KSJ A;  4DV3 M;  3FE3 A;  2KZS A;  3SBJ A;  4LF5 M;  1T6O A;  2CV2 A;  4I4L A;  3T1H M;  5FTN A;  5IZ7 D;  3OTO M;  1PJT A;  3GPU A;  2KW0 A;  3RFW A;  2C5R A;  4DV2 M;  2GNO A;  4QOZ C;  3JR4 A;  2AHM A;  4DR1 M;  3DZD A;  5EQT A;  3U60 B;  1GLN A;  4IBE A;  4FCV A;  1PRB A;  3Q8G A;  3U6L A;  2LVP C;  3HHW A;  1JQJ C;  2LHC A;  3QYE A;  5ITT A;  3BOS A;  2H1R A;  3KOW E;  4IJE A;  5GKN A;  3WHL A;  3L2A A;  2LVN C;  2OOB A;  2X8A A;  1IY1 A;  2C9C A;  3AJI B;  2KXE A;  3KS4 A;  4M9X A;  1OJL A;  4OW0 A;  4JI3 M;  2V1U A;  1R4G A;  2KDL A;  1C1K A;  2KRK A;  3B7N A;  3IG5 A;  5EP4 A;  3SAS A;  2MH8 A;  4UN2 B;  4KO8 A;  3M6A A;  3I4Y A;  5EXP A;  1EIJ A;  1VEJ A;  4NOO B;  1NHG C;  1SG9 A;  2P5T A;  2E5L M;  4LFB M;  1N78 A;  2KZU A;  3LVV A;  2C9O A;  3JAM S;  4FCT A;  4FWG A;  2DAK A;  3H4J A;  1Z59 A;  5ITU A;  3JR5 A;  1E9R A;  3FRH A;  4KT0 F;  2R45 A;  4YHH M;  4XK8 F;  3E9S A;  4GKK M;  4AKI A;  2EA0 A;  4CIS A;  5DFL A;  3SAU A;  1D2N A;  2JA2 A;  3I01 M;  2F5S A;  1E9S A;  2LXE A;  2M5Z A;  4ZPX A;  1KFV A;  1OIZ A;  5LMU M;  3A46 A;  3FRI A;  3HGI A;  2HAK A;  1KYI A;  3FD9 A;  4GIP A;  5EJC A;  4M0W A;  1IY2 A;  1PJJ A;  3J7A S;  1HT1 E;  1IBM M;  5JI2 E;  1R2Z A;  2QBY A;  2QNJ A;  3LQR A;  5DNY A;  4NRW A;  4JXJ A;  1WJ7 A;  3F92 A;  3K9O A;  5KPR A;  3KDS E;  4LZJ A;  1GO5 A;  2HKJ A;  3U6D A;  3FUV A;  1OTR A;  2I7P A;  3MJ5 A;  4GRI A;  3W68 A;  3UJN A;  5F3W A;  2QZ4 A;  1TGU A;  3J2P B;  4KLN A;  2LWX A;  2EKF A;  3PVS A;  3GRV A;  2R0I A;  1XXH A;  3MMP A;  1D0L A;  1QDT A;  4G4R A;  1HNX M;  4B08 A;  1EE8 A;  3GLI B;  2VQF M;  1ZMV A;  4JI8 M;  3LQQ A;  3V76 A;  4P17 A;  1T43 A;  2OOA A;  4IJF A;  2X49 A;  4M0D A;  3H4M A;  4DUZ M;  1AUA A;  2A5Y B;  3HHX A;  1BVS A;  2JY7 A;  3W0F A;  4AZF A;  2FS1 A;  2XEP A;  4I81 A;  2Y21 A;  3GLI A;  5ITY A;  1Q3B A;  4IBD A;  3ILK A;  1GJT A;  2R44 A;  5C1B A;  2J5Y A;  4DV1 M;  1G4A E;  5JI3 E;  3Q8X A;  3GLI E;  4WUR A;  2DI0 A;  1Z5B A;  3I04 M;  3M0E A;  1QUT A;  1QAQ A;  4FD2 A;  3VDP A;  1WGL A;  2DHR A;  2G3Q A;  2DEN A;  2XLJ A;  1WGN A;  1IN6 A;  2JZ0 A;  2RGO A;  3KXE C;  4D81 A;  5KPZ A;  4REZ A;  2V1C A;  4Z6Y A;  1JB0 F;  1JR3 E;  2R4E A;  4DUY M;  4DV5 M;  3CF2 A;  4MH0 E;  1XMQ M;  1XNR M;  4K0K M;  2CHG A;  1QDR A;  3VK8 A;  2Z4S A;  2CP8 A;  1LTM A;  2R6F A;  5C18 A;  1DGH A;  4B3T M;  3GLH A;  4WW0 A;  1GKI A;  3HU3 A;  3GRR A;  3LW5 F;  4IBG A;  4PDG A;  2DHY A;  4MGZ E;  3EIH A;  4JN6 A;  1QUS A;  1TH2 A;  3J81 S;  3UK6 A;  4WP2 A;  1SXJ E;  1DGF A;  3HKP A;  1YSY A;  4GEW A;  1IFY A;  1Q39 A;  3B89 A;  3HU2 A;  4Y28 F;  2K0B X;  4OVZ B;  1ZQ9 A;  2JY5 A;  4HEO A;  2BWE A;  2B3T A;  4B3R M;  4AKH A;  4BLC A;  1L8Q A;  1TF0 B;  4QNR A;  1D0K A;  3CF6 E;  3QAU A;  2HL7 A;  4XBO A;  2QSF X;  3TWL A;  1L2C A;  4ITQ A;  4GHL A;  1NJG A;  2H5X A;  4KOD A;  1N32 M;  3R8F A;  2UUC M;  2YQZ A;  2Z4R A;  3B7Q A;  3TE6 A;  1TH4 A;  4FWD A;  3SAV A;  3PXG A;  3U5Z B;  2GQF A;  1Z6T A;  2F5P A;  3VDU A;  3A45 A;  2OQ4 A;  5EP3 A;  2HHH M;  1IXS A;  3UZU A;  1GL7 A;  2JWS A;  1UM8 A;  3FTC A;  3FUX A;  1E94 E;  3ZCB B;  4TUW A;  3GP1 A;  3LVW A;  5E6J A;  7CAT A;  2R4J A;  5L8R F;  1NNJ A;  2LVO C;  2L4E A;  1AIP C;  1NVM A;  1WR1 B;  2CE7 A;  3TPZ A;  1K3W A;  1TDH A;  5KQ8 A;  4AKG A;  3U6C A;  5FTK A;  1R7R A;  3IG8 A;  4LJ8 A;  4YY3 M;  4JI7 M;  4ANR A;  4DBG B;  5A2Q S;  2F5O A;  2CV0 A;  3GRY A;  3U60 A;  4MGI E;  3T15 A;  1V33 A;  3U61 B;  4B7H A;  2DWL A;  4L15 A;  2XFT A;  1TDZ A;  2D7H A;  1S3S A;  1IBK M;  4DR6 M;  3ZH9 B;  1Z5A A;  3SHG B;  1GAB A;  4LCB A;  1X37 A;  2I7N A;  1LV7 A;  2RKO A;  3GQ5 A;  5KQD A;  2J7N A;  2BJW A;  4Z8X A;  4IBK A;  3VKG A;  1OFH A;  2MJ5 B;  2Z7J A;  3K8Z A;  2FNA A;  4X66 M;  1PJQ A;  4NL4 H;  1D0M A;  4JI0 M;  4MB7 A;  4AI6 A;  5FTM A;  1ZMW A;  2L7I A;  3HZJ A;  3GQ3 A;  3K9P A;  2Q2E B;  4JI1 M;  4L8R C;  2ZAO A;  1QAN A;  4LJA A;  5ITX E;  4B3S M;  2DWM A;  2DAG A;  1Z5C A;  2APL A;  4AQY M;  2UUA M;  2VII A;  3IEC A;  4CIZ A;  4NC6 A;  2WSE F;  3L28 A;  4DR2 M;  1XB2 B;  2C99 A;  3C58 A;  3SYK A;  1DV0 A;  4RKU F;  1QQW A;  4DR5 M;  3GRU A;  3GLF B;  2X4A A;  3W67 A;  3NBX X;  2JUJ A;  2MGW A;  2MR9 A;  3MHV C;  4LF6 M;  2FOI C;  4DV4 M;  2EUC A;  1EFU B;  2KEB A;  3KP0 E;  1IXR C;  4LJ6 A;  1R5L A;  4XGI A;  1C7Y A;  2WSF F;  3U6S A;  2DAE A;  4P16 A;  1QAO A;  2LVQ D;  2ZTD A;  1VQ1 A;  1N34 M;  4LFC M;  2J7O A;  4PT5 A;  2QPA A;  2CEA A;  3SFZ A;  4OX9 M;  4GC9 A;  4DV6 M;  1WHC A;  3MK6 A;  1YLA A;  2VQE M;  3GLF E;  4LRS A;  1ZAE A;  4IBJ A;  1L1T A;  4G3O A;  3L25 A;  3GPP A;  2M60 A;  2FH0 A;  1IM2 A;  1NV8 A;  3KSX A;  1GL6 A;  2L6O A;  5ITR A;  1P3Q Q;  1WIV A;  3AV0 A;  2KNZ A;  3U6M A;  2UUB M;  4F1I A;  4FWH A;  2Z3X A;  1YE9 A;  2DKL A;  1VDL A;  4CJ6 A;  1G71 A;  2LBC A;  3GO8 A;  1N77 A;  3GPY A;  3NWL A;  1L2B A;  2ZM6 M;  1XNQ M;  1NSF A;  3GLG B;  1DGB A;  4HLQ A;  2C98 A;  2R18 A;  5DYI A;  1MN3 A;  3U6O A;  1QZE A;  1G41 A;  2XSZ A;  3J27 B;  2Y0T A;  2DWZ B;  5DYG A;  3SYL A;  2VDB B;  1G3I A;  3HHZ A;  4RF1 A;  2DZL A;  2ZAN A;  3TL4 X;  1CUK A;  4GC5 A;  3VLF B;  3K2L A;  4MGK E;  4GKJ M;  4I8O A;  1JR3 A;  1NJF A;  4NXM M;  4R7G A;  4L78 A;  3AOE C;  2ERC A;  3A98 B;  1SXJ B;  2WZJ A;  3GLG E;  1ZMU A;  2JZ1 A;  2DZO B;  2KHH A;  3B9P A;  2N35 A;  1W5S A;  4B7F A;  2R65 A;  1HNZ M;  3HWS A;  3KS8 A;  3THG A;  2Y20 A;  3KOZ E;  4LZZ A;  2BNK A;  2L7H A;  1SXJ A;  4JYA M;  4LFA M;  4B3M M;  4LY6 A;  4FCW A;  3FUU A;  3SHF A;  2OO9 A;  1IN4 A;  3FKE A;  4B7G A;  1PJI A;  2NQ8 C;  3B7Z A;  1XC8 A;  2CV1 A;  4LF7 M;  3AOG A;  3C3E A;  2UXD M;  3SC3 A;  3ZC7 B;  3M7G A;  1J5E M;  4QOS A;  1OAO C;  4MGH A;  3T38 A;  4F2L A;  3GPX A;  3FYD A;  4G4O A;  2LTU A;  4GHA A;  1OQY A;  2Y0Q A;  1N33 M;  5EXX A;  4QHS A;  3FTD A;  1G8P A;  4R71 A;  2LHG A;  3U6P A;  4OVZ A;  5EXS A;  2FFJ A;  4HL4 A;  3DFZ A;  4JI4 M;  4NXN M;  3HHY A;  2JXN A;  1MX0 A;  2CRU A;  4LRT A;  2BJV A;  4LJ5 A;  3CGW A;  4X64 M;  3BXW A;  5KO3 A;  1IBL M;  1NHW C;  1N36 M;  1NV9 A;  4LGY A;  2C96 A;  3TQS A;  4DV7 M;  3U5Z A;  1GVN A;  4IBI A;  2DAI A;  3HJS A;  2D7G A;  1V34 A;  2KNV A;  2ZTC A;  5IRE B;  4BB9 A;  3R9X B;  2QCU A;  3HJQ A;  1SXJ C;  2UU9 M;  1ORY B;  2YR0 A;  5IT9 S;  1PJS A;  3LMM A;  5E26 A;  4L4U A;  2W82 A;  3D8L A;  2CUZ A;  2R62 A;  1QYR A;  2D7E A;  4CGY B;  1TR8 A;  3CF0 A;  3QYB A;  1UFZ A;  3U6Q A;  4DR4 M;  4BBA A;  3FUW A;  3I4V A;  4FW9 A;  3U61 A;  2DXI A;  5LMN M;  3AFH A;  4S12 A;  5ITX A;  2F5N A;  1W5T A;  1HQY E;  1TTE A;  1WXQ A;  4GIT A;  1A5T A;  4R3D A;  4PD2 A;  2JY8 A;  2O01 F;  4JI6 M;  2UXB M;  4PDI A;  2R46 A;  1OAI A;  3D8B A;  5H37 D;  1K82 A;  3SAW A;  1VDD A;  3SMP A;  4IBC A;  4QNM A;  4FVM A;  1G59 A;  1IN7 A;  3PFI A;  2ZBK B;  2JY6 B;  3E46 A;  4GH9 A;  4IIW A;  4LGM A;  3GQ4 A;  4A3V B;  3T1Y M;  4AG6 A;  4X62 M;  4LF4 M;  4II7 A;  4DR7 M;  2K47 A;  1IN8 A;  2KA6 B;  1HNW M;  3AOE A;  3K92 A;  2XF3 A;  1XHB A;  3RGP A;  2YNM D;  1MJG M;  1L1Z A;  4KHP M;  3E21 A;  3UMM A;  3VK7 A;  3GLF A;  4LF9 M;  4X65 M;  2DZN B;  3AKZ A;  4NSR A;  4G4Q A;  4JI2 M;  4NRV A;  4LG2 A;  2L09 A;  1NY6 A;  2QBY B;  3RGS A;  3CTW B;  8CAT A;  2EJS A;  4IBF A;  1QZM A;  2Z8Y M;  4EIW A;  5FTL A;  2XZF A;  4D80 A;  2L4F A;  3K1J A;  3SAT A;  4NSO B;  4JV5 M;  2QP9 X;  4RF0 A;  3A42 A;  3KP1 E;  1RU3 A;  1Y8G A;  2EO2 A;  4IBB A;  1J09 A;  1Q3C A;  1VEK A;  1GJS A;  1IY0 A;  1XXH B;  4MM3 B;  3TWK A;  2XGN A;  3B74 A;  3KVW A;  2MRO B;  4GMQ A;  2YFQ A;  4CHT B;  1KSF X;  2XZU A;  3PNY A;  1TH3 A;  5ITQ A;  2HCB A;  3AL0 C;  2VF7 A;  4PCZ A;  2LH0 A;  4OU7 A;  5KPT A;  2F5Q A;  1V92 A;  2G5G X;  2JNH A;  1NO1 A;  2CFO A;  3HX3 A;  4LJ7 A;  4QHT A;  5EXT A;  2JP7 A;  1FJG M;  1DO0 A;  3J80 S;  1XMO M;  2F4V M;  3HU1 A;  4LJ9 A;  2FE8 A;  1IQP A;  1HR0 M;  1QVR A;  3GLG A;  3KOX E;  1XXH E;  4RNA A;  3BBZ A;  1FNN A;  5EP1 A;  3UGJ A;  3U6E A;  1PM5 A;  1IXZ A;  1OIP A;  1E32 A;  4Q7J A;  1I94 M;  2DVW B;  3KOY E;  1T3T A;  3TWM A;  4LJ4 A;  2QQ8 A;  2V6Z M;  2RGH A;  1I4W A;  3IHP A;  2O5R A;  3VFD A;  4AG5 A;  3ZQJ A;  2K9D A;  3KFU G;  1H6U A;  3L26 A;  3HJ8 A;  3LCU A;  3SMS A;  3FTF A;  1DO2 A;  4M9S A;  5FTJ A;  2CHQ A;  3FUT A;  2CHV A;  1IN5 A;  4DV0 M;  1YUB A;  2XSZ D;  3J7B A;  3VKH A;  3WHK A;  3QWL A;  2HWJ A;  4M9Z A;  3C9P A;  2RRU A;  2KNA A;  1OFI A;  1VG5 A;  3L27 A;  5FSW A;  5BR8 M;  4D82 A;  1DGH B;  1Q02 A;  4JI5 M;  3DOA A;  3E4R A;  1XWI A;  3GLH B;  2QEN A;  2DWN A;  1JR3 D;  2DNA A;  1F4I A;  2ZAM A;  3SAR A;  2BWB A;  5EP2 A;  3I51 A;  4G6Z A;  3T6P A;  2G8L A;  2CWB A;  3L29 A;  3NBI A;  4I5S A;  2K6B A;  2LNH C;  3RE8 A;  1HT2 E;  1HJP A;  1PGY A;  1NNU C;  2WSC F;  2KRU A;  3KW6 A;  1R6B X;  1OKS A;  3C3D A;  5IWA M;  1L2D A;  2UXC M;  1ZV1 A;  2EKK A;  3GLH E;  2DAM A;  3FYC A;  1SXJ D;  4AW4 A;  1HQC A;  3EIE A;  3HY5 A;  5BPV A;  1R2Y A;  3PNV A;  4DR3 M;  2L2D A; 
#chains in the Genus database with same CATH homology
 1WGL A;  2DEN A;  1HQY E;  1TTE A;  2G3Q A;  1A5T A;  1WHC A;  1WGN A;  2JY8 A;  1YLA A;  2JZ0 A;  2LVA A;  3LCV B;  3GLF E;  1OAI A;  4G3O A;  1VEG A;  1JR3 E;  2O25 A;  1IM2 A;  1NV8 A;  1P3Q Q;  1WIV A;  2JY6 B;  3E46 A;  2KNZ A;  2CP8 A;  4F1I A;  2QHO B;  3FE3 A;  2DKL A;  1T6O A;  1VDL A;  2LBC A;  2DHY A;  1MN3 A;  1QZE A;  4WP2 A;  1G41 A;  3E21 A;  4GEW A;  2LVP C;  1IFY A;  1G3I A;  3B89 A;  2DZL A;  2K0B X;  2JY5 A;  4HEO A;  2BWE A;  1CUK A;  2B3T A;  2LVN C;  2OOB A;  2EJS A;  2QSF X;  2H5X A;  1R4G A;  2L4F A;  2WZJ A;  1ZMU A;  3GLG E;  4UN2 B;  2JZ1 A;  2KHH A;  1Y8G A;  1VEJ A;  1VEK A;  1SG9 A;  1IXS A;  2MRO B;  2DAK A;  3H4J A;  1E94 E;  3FRH A;  2LVO C;  2L4E A;  1AIP C;  1WR1 B;  2OO9 A;  1V92 A;  2JNH A;  2JP7 A;  5DFL A;  1DO0 A;  4DBG B;  4F2L A;  1XXH E;  3BBZ A;  2LTU A;  1OQY A;  3FRI A;  4R71 A;  2HAK A;  1KYI A;  4Q7J A;  1HT1 E;  5JI2 E;  3IHP A;  2QNJ A;  2K9D A;  1WJ7 A;  3F92 A;  2MJ5 B;  3K9O A;  3LCU A;  1GO5 A;  1DO2 A;  1NV9 A;  1ZMW A;  3K9P A;  1OTR A;  2DAI A;  2HWJ A;  2EKF A;  2RRU A;  2KNA A;  1VG5 A;  2R0I A;  2KNV A;  2ZTC A;  3MMP A;  1Q02 A;  2DAG A;  2DNA A;  1ZMV A;  3IEC A;  1F4I A;  2BWB A;  1XB2 B;  1DV0 A;  1T43 A;  3T6P A;  2OOA A;  2CWB A;  1BVS A;  1HT2 E;  1HJP A;  1PGY A;  2JUJ A;  2JY7 A;  2MGW A;  2MR9 A;  1OKS A;  1EFU B;  1TR8 A;  1C7Y A;  1UFZ A;  1ZV1 A;  1G4A E;  2EKK A;  2DAM A;  3GLH E;  2DAE A;  2LVQ D;  3GLI E;  2DI0 A;  2ZTD A;  1VQ1 A;  2L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...