2DAGA

Solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
74
structure length
74
Chain Sequence
b'GSSGSSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 5
molecule tags Hydrolase
source organism Homo sapiens
publication title Solution Structure of the First UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
rcsb
total genus 15
structure length 74
sequence length 74
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2dagA01
1G3IA 2CWBA 2MGWA 2OOBA 1C7YA 5JI2E 2JY8A 3MMPA 1SG9A 1OQYA 4HEOA 1Y8GA 1VEGA 4WP2A 4F2LA 2H5XA 1XB2B 2EKKA 4DBGB 2KNVA 3B89A 2JUJA 1OTRA 1V92A 2KHHA 1EFUB 2LVQD 1ZV1A 2LTUA 1Q02A 1HT2E 2DNAA 3GLHE 4GEWA 2JY7A 3K9OA 2QSFX 1WR1B 2JY5A 1G41A 1DO0A 1F4IA 3LCUA 1OKSA 1ZMWA 2OO9A 2LVAA 2KNAA 1WJ7A 2LVOC 3E21A 2DAIA 2DKLA 1BVSA 2CP8A 1DV0A 1R4GA 1YLAA 1OAIA 1G4AE 2BWBA 2JZ0A 5DFLA 1AIPC 1VQ1A 2B3TA 1TR8A 1NV8A 1T6OA 1WIVA 2LBCA 1WHCA 3FRHA 4UN2B 1IFYA 3GLGE 2DAKA 2R0IA 2MJ5B 1GO5A 3T6PA 1VEJA 1JR3E 2ZTCA 2ZTDA 2OOAA 2KNZA 4R71A 1QZEA 2K9DA 3LCVB 3FE3A 1TTEA 4Q7JA 3GLFE 2DAMA 2O25A 1T43A 1VDLA 2WZJA 3BBZA 1P3QQ 2DI0A 1VEKA 2QNJA 1UFZA 1ZMUA 3F92A 1HT1E 1WGLA 3FRIA 3IHPA 2DENA 1ZMVA 2HAKA 2L2DA 1VG5A 3IECA 1WGNA 1E94E 2DZLA 2JP7A 1MN3A 2DAGA 4F1IA 2L4EA 2K0BX 1PGYA 2HWJA 4G3OA 2DAEA 1KYIA 2EKFA 1IXSA 2DHYA 3K9PA 2LVNC 2RRUA 2JZ1A 1HJPA 2LVPC 1NV9A 2EJSA 1IM2A 2JY6B 1XXHE 1HQYE 1CUKA 2BWEA 3E46A 3GLIE 2JNHA 2MR9A 3H4JA 2QHOB 2L4FA 2G3QA 1A5TA 1DO2A 2MROB
chains in the Genus database with same CATH superfamily
1G3IA 2CWBA 4MGZE 4BB9A 2FOIC 5KQ8A 2MGWA 3W68A 4OVZA 4A3VB 4PT5A 4AKIA 4NL4H 3KSXA 1IN7A 1PJSA 4DV2M 4LZJA 1OQYA 1QUSA 3RE8A 5ITYA 2XZFA 1NSFA 1SXJA 4F2LA 1JR3A 3FUXA 5EP2A 1K3WA 4JI8M 3SBJA 4I81A 4D81A 2O01F 2H5XA 2AHMA 3U61B 3SARA 4DBGB 2ZANA 3ZC7B 2KHHA 2LHGA 3KS4A 3GQ5A 4DR6M 1DGHA 4DR5M 2Y21A 4NOOB 2LVQD 3B7QA 1UM8A 2LTUA 3AFHA 4QHSA 3RFWA 1Q02A 3UGJA 4JV5M 1NY5A 3SATA 1OJLA 7CATA 3EIEA 5C18A 1WR1B 2D7HA 3SHGB 2KEBA 2F5PA 4GC9A 3CTWB 1X37A 1IBMM 4MGYE 3LCUA 4AW4A 3FKEA 1OKSA 3HU1A 1IN5A 3HZJA 4JI3M 2XEPA 2R46A 3L2AA 3TWKA 2KNAA 1WJ7A 1E32A 1QYRA 5ITQA 1Q39A 3GPUA 2EUCA 3KP0E 4BBAA 4LFBM 2DAIA 2DKLA 1TH3A 1BVSA 1Q3CA 1YLAA 2LHCA 4GKKM 1XMQM 4ITQA 5LMUM 3K2LA 2ZM6M 4KHPM 2LXEA 2BWBA 4PD2A 3U6CA 2BJWA 3E9SA 2B3TA 2YR0A 1TR8A 1WIVA 2LBCA 4PCZA 1N33M 2VDBB 2CHGA 4AG6A 3T6PA 1FJGM 4FCVA 3KP1E 1TGUA 1PJIA 2QBYA 2ZTCA 4X62M 2XF3A 4LRSA 3SHFA 2K9DA 3U6OA 2JWSA 3J81S 3LCVB 1DGGA 4Q7JA 3GLFE 4LF4M 1W5SA 3J27B 4GIPA 3FUTA 4B7HA 2WZJA 2UUBM 4IBEA 2DI0A 1QANA 1GL7A 2XH9A 5EP1A 2QNJA 1UFZA 3A45A 1S3SA 4DV7M 3JR4A 4G4QA 1HT1E 1HNZM 1L2CA 2HAKA 3D8BA 1NNUC 3EIHA 1IN8A 1VG5A 2UU9M 4JI2M 3SC3A 3UZUA 1V34A 4GMQA 3H4MA 2CEAA 2XSZD 3HKPA 4LF8M 2DAGA 1D0LA 4JI0M 4PDIA 4M9XA 2K0BX 4X65M 4LF6M 3M7GA 2X8AA 2XFTA 5KPRA 3HHWA 1IXSA 1OIZA 1JQJC 4CHTB 4YHHM 1XC8A 3A42A 2CV2A 1ZAEA 4IBJA 4G4NA 1XXHB 2JZ1A 3DA1A 3W67A 1R5LA 4LZZA 4II7A 4D82A 1IM2A 1HNWM 2BWEA 3I51A 1D2NA 3E46A 4RNAA 2DZOB 3VK7A 3GPYA 2MR9A 4JI6M 3ILKA 3H4JA 3TWLA 2L7HA 2QCUA 3SAWA 3HHXA 1GLNA 1DO2A 3K1JA 2L6OA 4GITA 3WHLA 1QVRA 2KZSA 1L2DA 4LG2A 1TF0B 1XXHA 2OPFA 2K47A 5IZ7D 3GLGB 1YUBA 2LH0A 1C7YA 4CISA 3SFZA 2JY8A 3MMPA 4XGIA 3VKGA 2BJVA 2FNAA 1IQPA 1XWIA 4MGIE 1MX0A 1VEGA 4WP2A 2FH0A 4B3TM 3HJQA 3L28A 3L29A 2HHHM 3J7AS 3R8FA 3DZDA 2NQ8C 4R3DA 4LGYA 1JB0F 1KFVA 1V92A 1IBLM 4NC6A 2UXBM 1ZV1A 2FE8A 1R2YA 3THGA 1HT2E 4GEWA 5IREB 3B7NA 2QPAA 4JI4M 2FS1A 1NNJA 1F4IA 4MGHA 1NY6A 3OTOM 3VK8A 4R7GA 2R44A 5FTNA 4L8RC 5L8RF 1YSYA 1AUAA 2LVAA 3U60B 3I4VA 3Q8XA 4OX9M 3AOEA 4IBFA 5IWAM 1RU3A 1PJJA 1EE8A 4NXMM 4B3RM 5FTLA 4OU7A 1E9SA 4LJ9A 1R4GA 3T1YM 2E5LM 1OAIA 1OFHA 5EXSA 3T15A 2R4JA 3QYBA 4PDGA 2KDLA 4JYAM 4NRWA 3I04M 1MJGM 5EJCA 1WHCA 3FRHA 2ZAOA 3GPXA 3GLGE 1J5EM 2DAKA 2R0IA 4DV0M 4LJ8A 2DXIA 2MJ5B 1GO5A 1L8QA 2VF8A 3K92A 3M6AA 4FW9A 3U5ZA 2VQEM 4DUZM 1GJTA 4IBGA 1QAQA 1VEJA 4B7FA 3BOSA 4IJFA 4NSOB 4QOSA 3TPZA 2DZNB 1IY1A 2GQFA 2V1CA 2R65A 4D80A 3TL4X 2V6ZM 4B7GA 3DFZA 5KPTA 3BXWA 3VFDA 4ANRA 3FTFA 4AKGA 5IT9S 1SXJE 3RGSA 3D8LA 4JI7M 3HY5A 2F5NA 3R9XB 1VEKA 2DWMA 3HU2A 2HL7A 3IG5A 4JI5M 3KVWA 2UUCM 1WGLA 3IHPA 3QYEA 4B3MM 2DENA 4MH0E 2CHVA 5KQDA 2VQFM 4FCTA 2KA6B 5EXPA 1G59A 3A98B 3IECA 3J2PB 1E94E 3HJ8A 4KODA 3FUUA 3CF2A 2JP7A 1MN3A 4GRIA 1SXJC 2D7EA 3W0FA 4B08A 2L4EA 3FTEA 4GHLA 3VLFB 3FD9A 3GLGA 2HWJA 1Z6TA 1SXJD 2C9CA 1J09A 2C5RA 4G3OA 1JR3D 1DGBA 1SXJB 2EA0A 1I94M 2ZAMA 1L2BA 4DV5M 1R7RA 3L27A 2C96A 4GHAA 2R18A 1NHWC 4FD2A 2LVPC 2Y0QA 2APLA 3U6SA 2RKOA 2XFSA 4NXNM 2CUZA 1XXHE 5JI3E 3LVWA 3I01M 2M5ZA 2C99A 4RF0A 2KXEA 3GLFB 3V76A 3ZH9B 4XBOA 4CIZA 4LF9M 4FWGA 1GABA 1HQCA 1R2ZA 2MROB 3CGWA 3L26A 3T1HM 2OOBA 3NBXX 2G8LA 4DR7M 4RKUF 2C9OA 3PVSA 3U6LA 2UXCM 3GRUA 4HEOA 4GC5A 4G6ZA 3Q8GA 4MM3B 2BNKA 1NO1A 1QDRA 5BR8M 1IXRC 2R4EA 1XB2B 2EKKA 1Z59A 2R62A 2YNMD 2KNVA 4LRTA 3GLIB 1K82A 2LWXA 4LJ6A 3PNYA 1EFUB 2G5GX 4P17A 2MH8A 5EXTA 4AQYM 3KW6A 2DNAA 2Z7JA 3JAMS 3GLHE 4G4RA 1W5TA 2JY7A 3K9OA 2QSFX 1QUTA 3J7BA 3GLHA 5LMNM 1V33A 4L78A 3HWSA 4KT0F 5E6JA 2QBYB 2OO9A 3IG8A 2QQ8A 1DGFA 4MGKE 1IN4A 3KOYE 3SAVA 2LVOC 3E21A 1Q3BA 1XHBA 3T38A 1TDHA 4GH9A 3A46A 1QAMA 3C9PA 1E9RA 2CP8A 2Z4SA 2DHRA 3SYLA 3U6PA 3U6QA 4OW0A 4FWHA 1N77A 3KXEC 4AZFA 4LGMA 4S12A 1KSFX 4RF1A 1T6OA 1OFIA 5EP4A 3CF6E 4LJAA 5EP3A 3KS8A 2XSZA 2F5QA 1G71A 4M0WA 1Z5AA 1N34M 5FTMA 4FCWA 2Y20A 5KPZA 3UJNA 1JR3E 2P5TA 4QNRA 2K6BA 4TUWA 2UXDM 2XGNA 3ZCBB 4R71A 1QZEA 1ORYB 4K0KM 2X49A 3CF0A 3L25A 4BLCA 3U5ZB 8CATA 2CFOA 1PM5A 3DOAA 1VDLA 2I7NA 3BBZA 3TQSA 1PJQA 1P3QQ 4WURA 3SYKA 4IBIA 4LCBA 4G4OA 3AOGA 1ZMUA 3FRIA 4DR1M 4REZA 3VKHA 3PNVA 1ZMVA 3HX3A 2L2DA 5FTKA 1WGNA 2KRUA 5A2QS 3M0EA 3TE6A 2DZLA 3LMMA 1NVMA 4X64M 2L7IA 4F1IA 4P16A 1T3TA 3HGIA 3LQRA 4OVZB 2DWNA 3U60A 4IBDA 4EIWA 4QOZC 1L1TA 4KO8A 2WSCF 3FYDA 2DAEA 1IBKM 2CV0A 1NJFA 2EKFA 2A5YB 3SASA 3ZQJA 3J80S 2CE7A 2DHYA 3K9PA 4JXJA 3B9PA 3QWLA 4IBCA 2H1RA 2LVNC 2RRUA 1D0KA 4W5WA 4AG5A 2R45A 5ITXA 5F3WA 1HNXM 1GKIA 3JR5A 1IN6A 2LNHC 1WXQA 1HQYE 2CHQA 2WSFF 3GLIE 4LY6A 2X4AA 3KFUG 3GPPA 3KSJA 1D0MA 4DV1M 1IXZA 4DR4M 4NRVA 5C1BA 2OQ4A 4M0DA 3GLHB 4X66M 1L1ZA 4XK8F 4HLQA 2C98A 1Z5CA 1NJGA 4LJ7A 1YE9A 5JI2E 2XLJA 5EQTA 5ITUA 3GLFA 2F5SA 1SG9A 1HR0M 2KZUA 3U6MA 3U6DA 1Y8GA 2UUAM 1XNQM 4DUYM 3C3DA 1GJSA 1OIPA 1R6BX 1ZQ9A 3MHVC 3LW5F 3B89A 4YY3M 2JUJA 1OTRA 2EO2A 2W82A 2DWZB 3GRRA 1XNRM 3MJ5A 4LJ4A 4Y28F 4DR3M 1Z5BA 3HJSA 2ZBKB 4HL4A 2CV1A 1K3XA 3PFIA 2V1UA 4LF5M 2JY5A 1G41A 1DO0A 3SMPA 3PXGA 3MK6A 2L09A 3KDSE 3LVVA 1LTMA 2I7PA 4LF7M 1DGHB 3B7ZA 3VDUA 1ZMWA 4B3SM 1NHGC 3NWLA 3GO8A 3U6EA 3UMMA 2F5OA 3FYCA 2HCBA 4L15A 3HHZA 3KOWE 3VDPA 2XZUA 3GQ4A 4Z6YA 3FUVA 2YFQA 5ITTA 1N75A 4GKJM 1QDTA 3LQQA 1FNNA 4CGYB 3GRVA 4FWDA 4I5SA 1IY0A 2RGOA 3B74A 4IJEA 2R6FA 3SMSA 2Q2EB 1G4AE 2JZ0A 4I4LA 4IBBA 3E4RA 5DFLA 1AIPC 1VQ1A 1N32M 4DV3M 1NV8A 1IFYA 4UN2B 2KW0A 4FVMA 2F4VM 4JI1M 1GL6A 3NBIA 1QAOA 1G8PA 3FTCA 5ITRA 5FTJA 1IXSB 4L6V6 1PRBA 3FTDA 3SAUA 2ZTDA 4I8OA 1QQWA 4LFCM 2OOAA 2KNZA 3QAUA 4Z8XA 1OAOC 3UK6A 3AL0C 1I4WA 1TTEA 2GNOA 2O5RA 2VF7A 2WSEF 3FE3A 5DYGA 1PJTA 3HU3A 2DAMA 2O25A 4AKHA 3FUWA 1T43A 4JN6A 2DWLA 2JA2A 2DVWB 2QZ4A 5GKNA 3WHKA 4AI6A 2VIIA 2Z3XA 4DV6M 2D7GA 2M60A 2KRKA 4M9SA 2FFJA 2J7OA 2QENA 3F92A 1LV7A 5BPVA 4QNMA 2JXNA 4CJ6A 2RGHA 2Y0TA 2YQZA 2Z8YM 1IY2A 1N78A 3AKZA 2QP9X 2HKJA 4IIWA 5EXXA 2J5YA 1MU5A 3HHYA 5FLXS 2N35A 1DV0A 3I4YA 4WW0A 1GVNA 3GLIA 3C58A 1QZMA 3K8ZA 1PGYA 3KOZE 4KLNA 4L16A 4L4UA 3W0LB 4IBKA 5ITXE 2ERCA 5H37D 4LFAM 5E26A 4DR2M 1KYIA 3KOXE 5DYIA 1H6UA 1VDDA 1TDZA 4MB7A 1TH4A 4M9ZA 5DNYA 3C3EA 1HJPA 1NV9A 5KO3A 3GQ3A 1EIJA 4QHTA 2EJSA 2JY6B 3GRYA 5FSWA 2Z4RA 1CUKA 3AOEC 2J7NA 2CRUA 2JNHA 3AV0A 4LJ5A 4ZPXA 3TWMA 1N36M 3GP1A 1C1KA 2QHOB 1XMOM 2L4FA 2G3QA 1A5TA 1J7KA 4DV4M 3U61A 4NSRA 1TH2A 3RGPA 3AJIB
chains in the Genus database with same CATH topology
1G3IA 2CWBA 2MGWA 2OOBA 1C7YA 5JI2E 2JY8A 3MMPA 1SG9A 1OQYA 4HEOA 1Y8GA 1VEGA 4WP2A 4F2LA 2H5XA 1XB2B 2EKKA 4DBGB 2KNVA 3B89A 2JUJA 1OTRA 1V92A 2KHHA 1EFUB 2LVQD 1ZV1A 2LTUA 1Q02A 1HT2E 2DNAA 3GLHE 4GEWA 2JY7A 3K9OA 2QSFX 1WR1B 2JY5A 1G41A 1DO0A 1F4IA 3LCUA 1OKSA 1ZMWA 2OO9A 2LVAA 2KNAA 1WJ7A 2LVOC 3E21A 2DAIA 2DKLA 1BVSA 2CP8A 1DV0A 1R4GA 1YLAA 1OAIA 1G4AE 2BWBA 2JZ0A 5DFLA 1AIPC 1VQ1A 2B3TA 1TR8A 1NV8A 1T6OA 1WIVA 2LBCA 1WHCA 3FRHA 4UN2B 1IFYA 3GLGE 2DAKA 2R0IA 2MJ5B 1GO5A 3T6PA 1VEJA 1JR3E 2ZTCA 2ZTDA 2OOAA 2KNZA 4R71A 1QZEA 2K9DA 3LCVB 3FE3A 1TTEA 4Q7JA 3GLFE 2DAMA 2O25A 1T43A 1VDLA 2WZJA 3BBZA 1P3QQ 2DI0A 1VEKA 2QNJA 1UFZA 1ZMUA 3F92A 1HT1E 1WGLA 3FRIA 3IHPA 2DENA 1ZMVA 2HAKA 2L2DA 1VG5A 3IECA 1WGNA 1E94E 2DZLA 2JP7A 1MN3A 2DAGA 4F1IA 2L4EA 2K0BX 1PGYA 2HWJA 4G3OA 2DAEA 1KYIA 2EKFA 1IXSA 2DHYA 3K9PA 2LVNC 2RRUA 2JZ1A 1HJPA 2LVPC 1NV9A 2EJSA 1IM2A 2JY6B 1XXHE 1HQYE 1CUKA 2BWEA 3E46A 3GLIE 2JNHA 2MR9A 3H4JA 2QHOB 2L4FA 2G3QA 1A5TA 1DO2A 2MROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3I A;  2CWB A;  2MGW A;  2OOB A;  1C7Y A;  5JI2 E;  2JY8 A;  3MMP A;  1SG9 A;  1OQY A;  4HEO A;  1Y8G A;  1VEG A;  4WP2 A;  4F2L A;  2H5X A;  1XB2 B;  2EKK A;  4DBG B;  2KNV A;  3B89 A;  2JUJ A;  1OTR A;  1V92 A;  2KHH A;  1EFU B;  2LVQ D;  1ZV1 A;  2LTU A;  1Q02 A;  1HT2 E;  2DNA A;  3GLH E;  4GEW A;  2JY7 A;  3K9O A;  2QSF X;  1WR1 B;  2JY5 A;  1G41 A;  1DO0 A;  1F4I A;  3LCU A;  1OKS A;  1ZMW A;  2OO9 A;  2LVA A;  2KNA A;  1WJ7 A;  2LVO C;  3E21 A;  2DAI A;  2DKL A;  1BVS A;  2CP8 A;  1DV0 A;  1R4G A;  1YLA A;  1OAI A;  1G4A E;  2BWB A;  2JZ0 A;  5DFL A;  1AIP C;  1VQ1 A;  2B3T A;  1TR8 A;  1NV8 A;  1T6O A;  1WIV A;  2LBC A;  1WHC A;  3FRH A;  4UN2 B;  1IFY A;  3GLG E;  2DAK A;  2R0I A;  2MJ5 B;  1GO5 A;  3T6P A;  1VEJ A;  1JR3 E;  2ZTC A;  2ZTD A;  2OOA A;  2KNZ A;  4R71 A;  1QZE A;  2K9D A;  3LCV B;  3FE3 A;  1TTE A;  4Q7J A;  3GLF E;  2DAM A;  2O25 A;  1T43 A;  1VDL A;  2WZJ A;  3BBZ A;  1P3Q Q;  2DI0 A;  1VEK A;  2QNJ A;  1UFZ A;  1ZMU A;  3F92 A;  1HT1 E;  1WGL A;  3FRI A;  3IHP A;  2DEN A;  1ZMV A;  2HAK A;  2L2D A;  1VG5 A;  3IEC A;  1WGN A;  1E94 E;  2DZL A;  2JP7 A;  1MN3 A;  2DAG A;  4F1I A;  2L4E A;  2K0B X;  1PGY A;  2HWJ A;  4G3O A;  2DAE A;  1KYI A;  2EKF A;  1IXS A;  2DHY A;  3K9P A;  2LVN C;  2RRU A;  2JZ1 A;  1HJP A;  2LVP C;  1NV9 A;  2EJS A;  1IM2 A;  2JY6 B;  1XXH E;  1HQY E;  1CUK A;  2BWE A;  3E46 A;  3GLI E;  2JNH A;  2MR9 A;  3H4J A;  2QHO B;  2L4F A;  2G3Q A;  1A5T A;  1DO2 A;  2MRO B; 
#chains in the Genus database with same CATH topology
 1G3I A;  2CWB A;  4MGZ E;  4BB9 A;  2FOI C;  5KQ8 A;  2MGW A;  3W68 A;  4OVZ A;  4A3V B;  4PT5 A;  4AKI A;  4NL4 H;  3KSX A;  1IN7 A;  1PJS A;  4DV2 M;  4LZJ A;  1OQY A;  1QUS A;  3RE8 A;  5ITY A;  2XZF A;  1NSF A;  1SXJ A;  4F2L A;  1JR3 A;  3FUX A;  5EP2 A;  1K3W A;  4JI8 M;  3SBJ A;  4I81 A;  4D81 A;  2O01 F;  2H5X A;  2AHM A;  3U61 B;  3SAR A;  4DBG B;  2ZAN A;  3ZC7 B;  2KHH A;  2LHG A;  3KS4 A;  3GQ5 A;  4DR6 M;  1DGH A;  4DR5 M;  2Y21 A;  4NOO B;  2LVQ D;  3B7Q A;  1UM8 A;  2LTU A;  3AFH A;  4QHS A;  3RFW A;  1Q02 A;  3UGJ A;  4JV5 M;  1NY5 A;  3SAT A;  1OJL A;  7CAT A;  3EIE A;  5C18 A;  1WR1 B;  2D7H A;  3SHG B;  2KEB A;  2F5P A;  4GC9 A;  3CTW B;  1X37 A;  1IBM M;  4MGY E;  3LCU A;  4AW4 A;  3FKE A;  1OKS A;  3HU1 A;  1IN5 A;  3HZJ A;  4JI3 M;  2XEP A;  2R46 A;  3L2A A;  3TWK A;  2KNA A;  1WJ7 A;  1E32 A;  1QYR A;  5ITQ A;  1Q39 A;  3GPU A;  2EUC A;  3KP0 E;  4BBA A;  4LFB M;  2DAI A;  2DKL A;  1TH3 A;  1BVS A;  1Q3C A;  1YLA A;  2LHC A;  4GKK M;  1XMQ M;  4ITQ A;  5LMU M;  3K2L A;  2ZM6 M;  4KHP M;  2LXE A;  2BWB A;  4PD2 A;  3U6C A;  2BJW A;  3E9S A;  2B3T A;  2YR0 A;  1TR8 A;  1WIV A;  2LBC A;  4PCZ A;  1N33 M;  2VDB B;  2CHG A;  4AG6 A;  3T6P A;  1FJG M;  4FCV A;  3KP1 E;  1TGU A;  1PJI A;  2QBY A;  2ZTC A;  4X62 M;  2XF3 A;  4LRS A;  3SHF A;  2K9D A;  3U6O A;  2JWS A;  3J81 S;  3LCV B;  1DGG A;  4Q7J A;  3GLF E;  4LF4 M;  1W5S A;  3J27 B;  4GIP A;  3FUT A;  4B7H A;  2WZJ A;  2UUB M;  4IBE A;  2DI0 A;  1QAN A;  1GL7 A;  2XH9 A;  5EP1 A;  2QNJ A;  1UFZ A;  3A45 A;  1S3S A;  4DV7 M;  3JR4 A;  4G4Q A;  1HT1 E;  1HNZ M;  1L2C A;  2HAK A;  3D8B A;  1NNU C;  3EIH A;  1IN8 A;  1VG5 A;  2UU9 M;  4JI2 M;  3SC3 A;  3UZU A;  1V34 A;  4GMQ A;  3H4M A;  2CEA A;  2XSZ D;  3HKP A;  4LF8 M;  2DAG A;  1D0L A;  4JI0 M;  4PDI A;  4M9X A;  2K0B X;  4X65 M;  4LF6 M;  3M7G A;  2X8A A;  2XFT A;  5KPR A;  3HHW A;  1IXS A;  1OIZ A;  1JQJ C;  4CHT B;  4YHH M;  1XC8 A;  3A42 A;  2CV2 A;  1ZAE A;  4IBJ A;  4G4N A;  1XXH B;  2JZ1 A;  3DA1 A;  3W67 A;  1R5L A;  4LZZ A;  4II7 A;  4D82 A;  1IM2 A;  1HNW M;  2BWE A;  3I51 A;  1D2N A;  3E46 A;  4RNA A;  2DZO B;  3VK7 A;  3GPY A;  2MR9 A;  4JI6 M;  3ILK A;  3H4J A;  3TWL A;  2L7H A;  2QCU A;  3SAW A;  3HHX A;  1GLN A;  1DO2 A;  3K1J A;  2L6O A;  4GIT A;  3WHL A;  1QVR A;  2KZS A;  1L2D A;  4LG2 A;  1TF0 B;  1XXH A;  2OPF A;  2K47 A;  5IZ7 D;  3GLG B;  1YUB A;  2LH0 A;  1C7Y A;  4CIS A;  3SFZ A;  2JY8 A;  3MMP A;  4XGI A;  3VKG A;  2BJV A;  2FNA A;  1IQP A;  1XWI A;  4MGI E;  1MX0 A;  1VEG A;  4WP2 A;  2FH0 A;  4B3T M;  3HJQ A;  3L28 A;  3L29 A;  2HHH M;  3J7A S;  3R8F A;  3DZD A;  2NQ8 C;  4R3D A;  4LGY A;  1JB0 F;  1KFV A;  1V92 A;  1IBL M;  4NC6 A;  2UXB M;  1ZV1 A;  2FE8 A;  1R2Y A;  3THG A;  1HT2 E;  4GEW A;  5IRE B;  3B7N A;  2QPA A;  4JI4 M;  2FS1 A;  1NNJ A;  1F4I A;  4MGH A;  1NY6 A;  3OTO M;  3VK8 A;  4R7G A;  2R44 A;  5FTN A;  4L8R C;  5L8R F;  1YSY A;  1AUA A;  2LVA A;  3U60 B;  3I4V A;  3Q8X A;  4OX9 M;  3AOE A;  4IBF A;  5IWA M;  1RU3 A;  1PJJ A;  1EE8 A;  4NXM M;  4B3R M;  5FTL A;  4OU7 A;  1E9S A;  4LJ9 A;  1R4G A;  3T1Y M;  2E5L M;  1OAI A;  1OFH A;  5EXS A;  3T15 A;  2R4J A;  3QYB A;  4PDG A;  2KDL A;  4JYA M;  4NRW A;  3I04 M;  1MJG M;  5EJC A;  1WHC A;  3FRH A;  2ZAO A;  3GPX A;  3GLG E;  1J5E M;  2DAK A;  2R0I A;  4DV0 M;  4LJ8 A;  2DXI A;  2MJ5 B;  1GO5 A;  1L8Q A;  2VF8 A;  3K92 A;  3M6A A;  4FW9 A;  3U5Z A;  2VQE M;  4DUZ M;  1GJT A;  4IBG A;  1QAQ A;  1VEJ A;  4B7F A;  3BOS A;  4IJF A;  4NSO B;  4QOS A;  3TPZ A;  2DZN B;  1IY1 A;  2GQF A;  2V1C A;  2R65 A;  4D80 A;  3TL4 X;  2V6Z M;  4B7G A;  3DFZ A;  5KPT A;  3BXW A;  3VFD A;  4ANR A;  3FTF A;  4AKG A;  5IT9 S;  1SXJ E;  3RGS A;  3D8L A;  4JI7 M;  3HY5 A;  2F5N A;  3R9X B;  1VEK A;  2DWM A;  3HU2 A;  2HL7 A;  3IG5 A;  4JI5 M;  3KVW A;  2UUC M;  1WGL A;  3IHP A;  3QYE A;  4B3M M;  2DEN A;  4MH0 E;  2CHV A;  5KQD A;  2VQF M;  4FCT A;  2KA6 B;  5EXP A;  1G59 A;  3A98 B;  3IEC A;  3J2P B;  1E94 E;  3HJ8 A;  4KOD A;  3FUU A;  3CF2 A;  2JP7 A;  1MN3 A;  4GRI A;  1SXJ C;  2D7E A;  3W0F A;  4B08 A;  2L4E A;  3FTE A;  4GHL A;  3VLF B;  3FD9 A;  3GLG A;  2HWJ A;  1Z6T A;  1SXJ D;  2C9C A;  1J09 A;  2C5R A;  4G3O A;  1JR3 D;  1DGB A;  1SXJ B;  2EA0 A;  1I94 M;  2ZAM A;  1L2B A;  4DV5 M;  1R7R A;  3L27 A;  2C96 A;  4GHA A;  2R18 A;  1NHW C;  4FD2 A;  2LVP C;  2Y0Q A;  2APL A;  3U6S A;  2RKO A;  2XFS A;  4NXN M;  2CUZ A;  1XXH E;  5JI3 E;  3LVW A;  3I01 M;  2M5Z A;  2C99 A;  4RF0 A;  2KXE A;  3GLF B;  3V76 A;  3ZH9 B;  4XBO A;  4CIZ A;  4LF9 M;  4FWG A;  1GAB A;  1HQC A;  1R2Z A;  2MRO B;  3CGW A;  3L26 A;  3T1H M;  2OOB A;  3NBX X;  2G8L A;  4DR7 M;  4RKU F;  2C9O A;  3PVS A;  3U6L A;  2UXC M;  3GRU A;  4HEO A;  4GC5 A;  4G6Z A;  3Q8G A;  4MM3 B;  2BNK A;  1NO1 A;  1QDR A;  5BR8 M;  1IXR C;  2R4E A;  1XB2 B;  2EKK A;  1Z59 A;  2R62 A;  2YNM D;  2KNV A;  4LRT A;  3GLI B;  1K82 A;  2LWX A;  4LJ6 A;  3PNY A;  1EFU B;  2G5G X;  4P17 A;  2MH8 A;  5EXT A;  4AQY M;  3KW6 A;  2DNA A;  2Z7J A;  3JAM S;  3GLH E;  4G4R A;  1W5T A;  2JY7 A;  3K9O A;  2QSF X;  1QUT A;  3J7B A;  3GLH A;  5LMN M;  1V33 A;  4L78 A;  3HWS A;  4KT0 F;  5E6J A;  2QBY B;  2OO9 A;  3IG8 A;  2QQ8 A;  1DGF A;  4MGK E;  1IN4 A;  3KOY E;  3SAV A;  2LVO C;  3E21 A;  1Q3B A;  1XHB A;  3T38 A;  1TDH A;  4GH9 A;  3A46 A;  1QAM A;  3C9P A;  1E9R A;  2CP8 A;  2Z4S A;  2DHR A;  3SYL A;  3U6P A;  3U6Q A;  4OW0 A;  4FWH A;  1N77 A;  3KXE C;  4AZF A;  4LGM A;  4S12 A;  1KSF X;  4RF1 A;  1T6O A;  1OFI A;  5EP4 A;  3CF6 E;  4LJA A;  5EP3 A;  3KS8 A;  2XSZ A;  2F5Q A;  1G71 A;  4M0W A;  1Z5A A;  1N34 M;  5FTM A;  4FCW A;  2Y20 A;  5KPZ A;  3UJN A;  1JR3 E;  2P5T A;  4QNR A;  2K6B A;  4TUW A;  2UXD M;  2XGN A;  3ZCB B;  4R71 A;  1QZE A;  1ORY B;  4K0K M;  2X49 A;  3CF0 A;  3L25 A;  4BLC A;  3U5Z B;  8CAT A;  2CFO A;  1PM5 A;  3DOA A;  1VDL A;  2I7N A;  3BBZ A;  3TQS A;  1PJQ A;  1P3Q Q;  4WUR A;  3SYK A;  4IBI A;  4LCB A;  4G4O A;  3AOG A;  1ZMU A;  3FRI A;  4DR1 M;  4REZ A;  3VKH A;  3PNV A;  1ZMV A;  3HX3 A;  2L2D A;  5FTK A;  1WGN A;  2KRU A;  5A2Q S;  3M0E A;  3TE6 A;  2DZL A;  3LMM A;  1NVM A;  4X64 M;  2L7I A;  4F1I A;  4P16 A;  1T3T A;  3HGI A;  3LQR A;  4OVZ B;  2DWN A;  3U60 A;  4IBD A;  4EIW A;  4QOZ C;  1L1T A;  4KO8 A;  2WSC F;  3FYD A;  2DAE A;  1IBK M;  2CV0 A;  1NJF A;  2EKF A;  2A5Y B;  3SAS A;  3ZQJ A;  3J80 S;  2CE7 A;  2DHY A;  3K9P A;  4JXJ A;  3B9P A;  3QWL A;  4IBC A;  2H1R A;  2LVN C;  2RRU A;  1D0K A;  4W5W A;  4AG5 A;  2R45 A;  5ITX A;  5F3W A;  1HNX M;  1GKI A;  3JR5 A;  1IN6 A;  2LNH C;  1WXQ A;  1HQY E;  2CHQ A;  2WSF F;  3GLI E;  4LY6 A;  2X4A A;  3KFU G;  3GPP A;  3KSJ A;  1D0M A;  4DV1 M;  1IXZ A;  4DR4 M;  4NRV A;  5C1B A;  2OQ4 A;  4M0D A;  3GLH B;  4X66 M;  1L1Z A;  4XK8 F;  4HLQ A;  2C98 A;  1Z5C A;  1NJG A;  4LJ7 A;  1YE9 A;  5JI2 E;  2XLJ A;  5EQT A;  5ITU A;  3GLF A;  2F5S A;  1SG9 A;  1HR0 M;  2KZU A;  3U6M A;  3U6D A;  1Y8G A;  2UUA M;  1XNQ M;  4DUY M;  3C3D A;  1GJS A;  1OIP A;  1R6B X;  1ZQ9 A;  3MHV C;  3LW5 F;  3B89 A;  4YY3 M;  2JUJ A;  1OTR A;  2EO2 A;  2W82 A;  2DWZ B;  3GRR A;  1XNR M;  3MJ5 A;  4LJ4 A;  4Y28 F;  4DR3 M;  1Z5B A;  3HJS A;  2ZBK B;  4HL4 A;  2CV1 A;  1K3X A;  3PFI A;  2V1U A;  4LF5 M;  2JY5 A;  1G41 A;  1DO0 A;  3SMP A;  3PXG A;  3MK6 A;  2L09 A;  3KDS E;  3LVV A;  1LTM A;  2I7P A;  4LF7 M;  1DGH B;  3B7Z A;  3VDU A;  1ZMW A;  4B3S M;  1NHG C;  3NWL A;  3GO8 A;  3U6E A;  3UMM A;  2F5O A;  3FYC A;  2HCB A;  4L15 A;  3HHZ A;  3KOW E;  3VDP A;  2XZU A;  3GQ4 A;  4Z6Y A;  3FUV A;  2YFQ A;  5ITT A;  1N75 A;  4GKJ M;  1QDT A;  3LQQ A;  1FNN A;  4CGY B;  3GRV A;  4FWD A;  4I5S A;  1IY0 A;  2RGO A;  3B74 A;  4IJE A;  2R6F A;  3SMS A;  2Q2E B;  1G4A E;  2JZ0 A;  4I4L A;  4IBB A;  3E4R A;  5DFL A;  1AIP C;  1VQ1 A;  1N32 M;  4DV3 M;  1NV8 A;  1IFY A;  4UN2 B;  2KW0 A;  4FVM A;  2F4V M;  4JI1 M;  1GL6 A;  3NBI A;  1QAO A;  1G8P A;  3FTC A;  5ITR A;  5FTJ A;  1IXS B;  4L6V 6;  1PRB A;  3FTD A;  3SAU A;  2ZTD A;  4I8O A;  1QQW A;  4LFC M;  2OOA A;  2KNZ A;  3QAU A;  4Z8X A;  1OAO C;  3UK6 A;  3AL0 C;  1I4W A;  1TTE A;  2GNO A;  2O5R A;  2VF7 A;  2WSE F;  3FE3 A;  5DYG A;  1PJT A;  3HU3 A;  2DAM A;  2O25 A;  4AKH A;  3FUW A;  1T43 A;  4JN6 A;  2DWL A;  2JA2 A;  2DVW B;  2QZ4 A;  5GKN A;  3WHK A;  4AI6 A;  2VII A;  2Z3X A;  4DV6 M;  2D7G A;  2M60 A;  2KRK A;  4M9S A;  2FFJ A;  2J7O A;  2QEN A;  3F92 A;  1LV7 A;  5BPV A;  4QNM A;  2JXN A;  4CJ6 A;  2RGH A;  2Y0T A;  2YQZ A;  2Z8Y M;  1IY2 A;  1N78 A;  3AKZ A;  2QP9 X;  2HKJ A;  4IIW A;  5EXX A;  2J5Y A;  1MU5 A;  3HHY A;  5FLX S;  2N35 A;  1DV0 A;  3I4Y A;  4WW0 A;  1GVN A;  3GLI A;  3C58 A;  1QZM A;  3K8Z A;  1PGY A;  3KOZ E;  4KLN A;  4L16 A;  4L4U A;  3W0L B;  4IBK A;  5ITX E;  2ERC A;  5H37 D;  4LFA M;  5E26 A;  4DR2 M;  1KYI A;  3KOX E;  5DYI A;  1H6U A;  1VDD A;  1TDZ A;  4MB7 A;  1TH4 A;  4M9Z A;  5DNY A;  3C3E A;  1HJP A;  1NV9 A;  5KO3 A;  3GQ3 A;  1EIJ A;  4QHT A;  2EJS A;  2JY6 B;  3GRY A;  5FSW A;  2Z4R A;  1CUK A;  3AOE C;  2J7N A;  2CRU A;  2JNH A;  3AV0 A;  4LJ5 A;  4ZPX A;  3TWM A;  1N36 M;  3GP1 A;  1C1K A;  2QHO B;  1XMO M;  2L4F A;  2G3Q A;  1A5T A;  1J7K A;  4DV4 M;  3U61 A;  4NSR A;  1TH2 A;  3RGP A;  3AJI B; 
#chains in the Genus database with same CATH homology
 1G3I A;  2CWB A;  2MGW A;  2OOB A;  1C7Y A;  5JI2 E;  2JY8 A;  3MMP A;  1SG9 A;  1OQY A;  4HEO A;  1Y8G A;  1VEG A;  4WP2 A;  4F2L A;  2H5X A;  1XB2 B;  2EKK A;  4DBG B;  2KNV A;  3B89 A;  2JUJ A;  1OTR A;  1V92 A;  2KHH A;  1EFU B;  2LVQ D;  1ZV1 A;  2LTU A;  1Q02 A;  1HT2 E;  2DNA A;  3GLH E;  4GEW A;  2JY7 A;  3K9O A;  2QSF X;  1WR1 B;  2JY5 A;  1G41 A;  1DO0 A;  1F4I A;  3LCU A;  1OKS A;  1ZMW A;  2OO9 A;  2LVA A;  2KNA A;  1WJ7 A;  2LVO C;  3E21 A;  2DAI A;  2DKL A;  1BVS A;  2CP8 A;  1DV0 A;  1R4G A;  1YLA A;  1OAI A;  1G4A E;  2BWB A;  2JZ0 A;  5DFL A;  1AIP C;  1VQ1 A;  2B3T A;  1TR8 A;  1NV8 A;  1T6O A;  1WIV A;  2LBC A;  1WHC A;  3FRH A;  4UN2 B;  1IFY A;  3GLG E;  2DAK A;  2R0I A;  2MJ5 B;  1GO5 A;  3T6P A;  1VEJ A;  1JR3 E;  2ZTC A;  2ZTD A;  2OOA A;  2KNZ A;  4R71 A;  1QZE A;  2K9D A;  3LCV B;  3FE3 A;  1TTE A;  4Q7J A;  3GLF E;  2DAM A;  2O25 A;  1T43 A;  1VDL A;  2WZJ A;  3BBZ A;  1P3Q Q;  2DI0 A;  1VEK A;  2QNJ A;  1UFZ A;  1ZMU A;  3F92 A;  1HT1 E;  1WGL A;  3FRI A;  3IHP A;  2DEN A;  1ZMV A;  2HAK A;  2L2D A;  1VG5 A;  3IEC A;  1WGN A;  1E94 E;  2DZL A;  2JP7 A;  1MN3 A;  2DAG A;  4F1I A;  2L4E A;  2K0B X;  1PGY A;  2HWJ A;  4G3O A;  2DAE A;  1KYI A;  2EKF A;  1IXS A;  2DHY A;  3K9P A;  2LVN C;  2RRU A;  2JZ1 A;  1HJP A;  2LVP C;  1NV9 A;  2EJS A;  1IM2 A;  2JY6 B;  1XXH E;  1HQY E;  1CUK A;  2BWE A;  3E46 A;  3GLI E;  2JNH A;  2MR9 A;  3H4J A;  2QHO B;  2L4F A;  2G3Q A;  1A5T A;  1DO2 A;  2MRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...