4K0KM

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4k0kM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4k0kM02
4NRVA 4OX9M 1NNJA 3JR4A 1Z59A 3U6SA 1N33M 4LF7M 3SAVA 3TWKA 3GQ3A 4X66M 1KFVA 4DV5M 3SATA 3W0FA 2EA0A 4YHHM 3J81S 3T1YM 2F5OA 1L1ZA 2UUBM 2F4VM 4DV7M 1HNZM 1I94M 4DV3M 3J80S 5ITXA 5LMUM 1N36M 4DV2M 3U6EA 3GPYA 4PD2A 1HNWM 4DR7M 1K3XA 1L2DA 2XZUA 3DOAA 2HKJA 1PJIA 4JI7M 3SARA 5ITQA 3GQ4A 3A42A 4LF9M 4B3MM 4K0KM 4NXNM 5BR8M 1K82A 2E5LM 1J5EM 3OTOM 1Z5CA 3U6MA 3T1HM 1L2BA 1Q3BA 1L2CA 3VK8A 1IBKM 1Q3CA 1N32M 4JI3M 4X62M 2ZM6M 4PDIA 1TDZA 4DR5M 1Q39A 4YY3M 1XMOM 2F5QA 2UXCM 4G4OA 3GQ5A 4DUYM 4G4RA 2Q2EB 3GO8A 4DV0M 1XC8A 1EE8A 1XMQM 4DV6M 2ZBKB 4DR6M 3GPXA 1L1TA 4LF6M 5IT9S 3A45A 2UUAM 3JR5A 1PM5A 1HR0M 4ITQA 4DR1M 4JI4M 5ITYA 3VK7A 2F5PA 4DR3M 2VQEM 4DR2M 2UXBM 4JI2M 4JI1M 4KHPM 4NXMM 4CISA 3SAWA 2OPFA 1HNXM 3U6OA 4DR4M 4B3SM 1XNRM 3J7AS 1N34M 4DV1M 1R2ZA 3U6QA 1MU5A 3SBJA 4JI8M 3GP1A 3U6CA 1MX0A 1PJJA 1Z5BA 1R2YA 4LFCM 3TWLA 3TWMA 4B3TM 2UU9M 2VQFM 4X64M 5ITXE 4PCZA 4G4QA 4JV5M 1XNQM 5ITUA 1IBLM 4JYAM 4JI0M 3GPPA 3U6PA 2UXDM 2F5NA 2XZFA 4DV4M 5FLXS 3U6LA 5ITTA 1Z5AA 2OQ4A 3U6DA 4MB7A 4JI6M 4LF5M 5IWAM 2F5SA 4B3RM 3JAMS 1K3WA 5A2QS 3C58A 5ITRA 1IBMM 1FJGM 2HHHM 1TDHA 4PDGA 4AQYM 4NRWA 4GKJM 3A46A 4LF8M 3GPUA 4LF4M 5LMNM 4X65M 3SASA 4G4NA 4LFBM 4JI5M 3SAUA 2UUCM 4GKKM 4LFAM 4DUZM
chains in the Genus database with same CATH superfamily
4IBJA 2XF3A 3QAUA 3U6SA 1N33M 2V1CA 1OTRA 4UN2B 4LF7M 1IY2A 3SAVA 3T6PA 2GNOA 3GQ3A 1T43A 4L4UA 2L4FA 1JQJC 4X66M 1G71A 1XWIA 1KFVA 3UJNA 2RGOA 5FTNA 1L1ZA 5EP3A 3FUWA 4GEWA 2KEBA 3HU3A 1I94M 4FW9A 4M9SA 4L15A 1R5LA 1T3TA 2G5GX 2FH0A 2KZUA 3KOWE 3U6EA 5IREB 4DR7M 5EP4A 1L2DA 2QZ4A 3M0EA 3L27A 3E21A 2R65A 1PJIA 4FWGA 4CGYB 1OQYA 2JWSA 3I51A 4AI6A 1OIZA 1SXJC 3KP1E 2DWMA 1J5EM 2K47A 2A5YB 3T1HM 2CRUA 3EIEA 1QAMA 3FTCA 4FCWA 2KDLA 3B7NA 3GRUA 1IN5A 1JR3D 2J7NA 2QBYA 3E9SA 1TDZA 2ZAMA 2G8LA 1Q39A 2EKKA 4YY3M 3KFUG 3J7BA 1YE9A 4Z8XA 5KPTA 1AUAA 1ORYB 2BWEA 1GKIA 2DHYA 4RNAA 1XC8A 4W5WA 2CV1A 4DV6M 3UZUA 3GLIA 2DAKA 3VLFB 5F3WA 2DHRA 1L1TA 1SXJE 2BWBA 3U60B 2LNHC 2FOIC 5EXTA 1GO5A 3PVSA 4MGZE 4DR1M 3ZH9B 2QHOB 2RKOA 1JR3A 3LVWA 4JI1M 2JY5A 3VKHA 3QWLA 3FTDA 3U6OA 4KLNA 4NC6A 3PFIA 4B3SM 4IBEA 4MGYE 3J7AS 3T38A 3U6QA 1QANA 1ZQ9A 2QNJA 1MU5A 5KQ8A 4JI8M 4ANRA 3GP1A 1MX0A 2QPAA 3M6AA 1R2YA 4M9XA 4LFCM 1NY5A 4GHAA 2O5RA 1HQCA 1QZMA 4HLQA 2L09A 2Z4SA 4RKUF 2DENA 2XLJA 4JV5M 2LVQD 2RGHA 2R4EA 3UMMA 3SHFA 5ITUA 1G4AE 4JYAM 2Y0TA 1ZMUA 4JI0M 3U61B 3MK6A 3FYCA 1YLAA 2DWNA 1E9SA 4AZFA 1LTMA 3KOYE 2QCUA 3HHWA 2UXDM 1PGYA 1G3IA 1WHCA 2YNMD 5EP1A 1BVSA 2FNAA 2KNVA 1YUBA 4KODA 4LCBA 2EUCA 4OVZB 1HT1E 2Z7JA 4JI6M 1R6BX 5IWAM 1MN3A 5FSWA 2X8AA 4G3OA 2F5SA 2JUJA 4XK8F 1OAIA 5DNYA 2AHMA 4LGYA 2V6ZM 1GABA 3I04M 4F1IA 1E9RA 3AOEC 3W0LB 3GLIE 1GLNA 1OFHA 1TH2A 5DFLA 3C3DA 1OAOC 3DZDA 3GPUA 4LF8M 1NNUC 1NO1A 3IG5A 4B7GA 5LMNM 1SXJD 2KHHA 4LFBM 1VEGA 1JB0F 3SFZA 1PJTA 4JI5M 2J7OA 2EO2A 2N35A 1JR3E 3W68A 3Q8XA 4NRVA 4OX9M 3KDSE 3JR4A 4LY6A 2XH9A 2KA6B 3B89A 3QYBA 1WJ7A 1A5TA 3KS4A 3HHYA 2X4AA 3TWKA 2RRUA 2QSFX 3SATA 4IBCA 1N77A 4II7A 2DI0A 4I4LA 4FD2A 2CWBA 4KO8A 2OOAA 3HHXA 3MMPA 3FUVA 3GLFA 4FWHA 2Z3XA 2LVOC 3PNYA 2DWZB 3GPYA 2CUZA 4PD2A 2CP8A 1K3XA 2XEPA 3TQSA 4Z6YA 3UGJA 2XZUA 3K8ZA 3AL0C 2D7GA 2CV2A 4IBIA 4B3MM 4NXNM 2VDBB 3AV0A 2R46A 2JP7A 5BR8M 2LH0A 3U5ZB 2E5LM 3KOXE 3LQRA 2K9DA 4FCVA 2R44A 1Z5CA 4ZPXA 3U6MA 4EIWA 4MGIE 1VDLA 3LW5F 2DNAA 4LJ8A 5EQTA 2C98A 2QQ8A 1VDDA 2ZAOA 3KP0E 2X49A 1NY6A 4LF9M 1V33A 1NHWC 2XFTA 2YQZA 2K6BA 4WW0A 3ZCBB 4OU7A 4G4OA 2Q2EB 4GRIA 3GO8A 4REZA 4DV0M 1F4IA 1XMQM 1IN4A 1NJFA 1IQPA 4DR6M 2O25A 3GPXA 4LF6M 3GLHA 3A45A 2EJSA 1QUTA 2GQFA 1E94E 1WR1B 1QDRA 2LBCA 1PM5A 1HR0M 1QDTA 1KYIA 2BNKA 4RF1A 2C9OA 1TH4A 1G8PA 1OFIA 2VQEM 1ZMVA 4KHPM 4NXMM 4CISA 1HNXM 1DO2A 4D82A 3TL4X 3HKPA 2LVPC 3B9PA 4L6V6 1QZEA 3V76A 3KW6A 1ZV1A 3K92A 2LHGA 1QQWA 2L7IA 4L16A 1ZMWA 2R0IA 3U6CA 1PJJA 4TUWA 3THGA 4AW4A 1VG5A 4BBAA 3B74A 4B3TM 2JZ0A 1T6OA 4LJ7A 1DGHB 2D7EA 3DA1A 5JI2E 2VQFM 1DO0A 2H5XA 4GHLA 2WZJA 4NSOB 3GLFE 1WIVA 2Y20A 4PCZA 1R7RA 3FTFA 2WSFF 3CGWA 2EKFA 2R18A 3RGSA 3I4VA 3FUUA 3GLGA 3CTWB 1WGLA 1GJSA 1XXHA 4IJFA 3U6PA 5IZ7D 2F5NA 3FRIA 4DV4M 3AOEA 1N78A 1DGGA 4M9ZA 3GRYA 2DAEA 5DYIA 2OQ4A 2DAMA 2HWJA 3HJSA 2C9CA 3L29A 4MB7A 4LF5M 4JN6A 1VEKA 4OW0A 4NOOB 2L2DA 3GRVA 3JAMS 1EIJA 4D81A 5ITRA 3FRHA 1IBMM 2JZ1A 4GC5A 4GKJM 4NRWA 2DVWB 3GLHE 2ZTCA 3CF0A 3SASA 4G4NA 4AKHA 4IBBA 3KSXA 1X37A 1CUKA 4CJ6A 1S3SA 3B7QA 2NQ8C 2Y0QA 4DUZM 4QOSA 1NNJA 2B3TA 1Z59A 3IECA 2CHVA 2VF8A 4M0WA 3D8BA 3LMMA 3AOGA 3SHGB 3BOSA 2DZNB 1EFUB 2H1RA 1SXJB 4IIWA 3M7GA 1UM8A 4GC9A 4YHHM 2EA0A 1OIPA 2YR0A 2UUBM 3UK6A 2F4VM 4P16A 4NL4H 1HT2E 4DV3M 2G3QA 3I01M 3KSJA 4XBOA 3AKZA 3DFZA 1IXSB 2JY6B 5LMUM 1J7KA 1G59A 4DV2M 1YSYA 3LVVA 3NWLA 1HNWM 2DWLA 3HU1A 2C5RA 3IG8A 2Z8YM 5C18A 2HKJA 3DOAA 1PJSA 3VDPA 4BLCA 3U60A 4L8RC 3LQQA 1C1KA 3A42A 3HY5A 4QNMA 1Z6TA 2JA2A 3WHKA 3GQ4A 1ZAEA 2DXIA 4K0KM 3VKGA 1K82A 1NV9A 2MROB 4QOZC 1L2BA 3GLGE 4GMQA 1Q3BA 1L2CA 4QNRA 2HL7A 3ZQJA 3VK8A 1IBKM 1XXHE 1Q3CA 3TPZA 3CF2A 3J27B 3HU2A 1PJQA 4X62M 2ZM6M 4DR5M 1XMOM 3RFWA 1TTEA 3GQ5A 4DUYM 3KS8A 3L25A 3E4RA 2MJ5B 2ZBKB 1R4GA 2R4JA 3WHLA 4HL4A 4FCTA 2UUAM 2C99A 2QP9X 4JI4M 5DYGA 3Q8GA 4XGIA 5ITYA 1Q02A 3VK7A 2DKLA 4WP2A 4DR2M 2DAGA 5GKNA 2APLA 2KNAA 2DZOB 2QBYB 4DR4M 2L6OA 4LGMA 2FFJA 5FTKA 2CFOA 1WXQA 3U61A 1N34M 2XFSA 3J2PB 2L4EA 2FE8A 1DV0A 2C96A 1HJPA 2MR9A 3GLIB 1Z5BA 1QAQA 2W82A 3C3EA 1PRBA 4OVZA 4AG6A 3TWMA 1DGBA 1TGUA 3SC3A 2XSZA 3KOZE 3K1JA 2UU9M 3C9PA 2M60A 2CHQA 1NVMA 3E46A 2WSEF 3QYEA 1SG9A 4G4QA 3SMPA 4R71A 3FE3A 4F2LA 1XNQM 3MHVC 1IFYA 1IBLM 1RU3A 3BBZA 2DAIA 1XB2B 2R62A 3H4JA 1QVRA 1XHBA 2ERCA 1IXZA 1I4WA 3K9OA 3SYKA 2R6FA 2CV0A 4QHTA 2KW0A 2XZFA 5FLXS 2CEAA 5ITTA 1Z5AA 1W5TA 3HHZA 3SYLA 4B7FA 2Z4RA 5EXPA 2ZTDA 3W67A 4MGHA 2ZANA 2J5YA 4LRTA 4B3RM 1K3WA 3PXGA 1H6UA 2YFQA 4G6ZA 3L26A 1E32A 4LJAA 1FJGM 2HHHM 1TR8A 3H4MA 1TDHA 5EJCA 4PDGA 1GJTA 3HWSA 3D8LA 4GKKM 4IJEA 3VDUA 3SAUA 4Q7JA 4R7GA 4B08A 3L2AA 3LCVB 3U5ZA 1D0MA 4KT0F 1MJGM 3MJ5A 3FD9A 1DGFA 1VEJA 2MGWA 3LCUA 4DV5M 4MGKE 3W0FA 2F5OA 3T1YM 3J81S 2BJWA 4LJ5A 3PNVA 4DV7M 2FS1A 1HNZM 4LZJA 3J80S 3CF6E 5JI3E 5ITXA 2D7HA 2WSCF 1N36M 4LG2A 4AKGA 5EP2A 2HCBA 4MM3B 1NHGC 2P5TA 1D0LA 2L7HA 1VQ1A 4JI7M 1V34A 5EXXA 5ITQA 3HJ8A 4JXJA 1NSFA 3R8FA 2KNZA 3B7ZA 2KRUA 3SARA 4IBFA 2LVNC 1P3QQ 5E6JA 5EXSA 3IHPA 5KPZA 2VF7A 1C7YA 2K0BX 5KQDA 3OTOM 4LRSA 5L8RF 1NV8A 2HAKA 5FTLA 1L8QA 1N32M 1D0KA 4AKIA 2Y21A 3FKEA 4JI3M 4CIZA 2O01F 4PDIA 1NJGA 3NBIA 1AIPC 4WURA 4AG5A 4FVMA 4PT5A 4R3DA 3GLFB 4G4RA 1J09A 2F5QA 2UXCM 3HZJA 1OJLA 1EE8A 1TH3A 4RF0A 3K2LA 5IT9S 3L28A 3FYDA 4FWDA 4I5SA 3A98B 2LXEA 3TE6A 1IN8A 4CHTB 1GVNA 1HQYE 1Y8GA 3JR5A 1DGHA 4ITQA 2MH8A 3FUXA 4LZZA 2F5PA 3KVWA 4IBGA 4DR3M 2UXBM 4JI2M 2OO9A 4MH0E 1KSFX 3SAWA 1IM2A 1LV7A 1QUSA 3BXWA 3HGIA 4GH9A 3VFDA 2OPFA 2M5ZA 3GRRA 3ILKA 1QAOA 5KPRA 1XNRM 1IN6A 5FTJA 4D80A 4DV1M 1R2ZA 2QENA 3RGPA 3ZC7B 8CATA 3SBJA 4DBGB 2KRKA 3SMSA 3NBXX 3HJQA 3GLHB 1IXRC 3TWLA 1OKSA 1IN7A 2OOBA 2JXNA 4S12A 1D2NA 4X64M 4Y28F 1W5SA 4HEOA 2LTUA 4LJ6A 3I4YA 5ITXE 1UFZA 2LVAA 2CE7A 3EIHA 2I7PA 1N75A 3R9XB 4I8OA 3K9PA 2XSZD 4BB9A 4IBDA 2KZSA 3HX3A 1GL6A 2V1UA 3GPPA 4I81A 4M0DA 4P17A 2JY8A 4L78A 3FUTA 4LJ9A 2DZLA 5BPVA 1IY1A 2VIIA 3AFHA 2CHGA 5E26A 7CATA 1G41A 2LWXA 2XGNA 2LHCA 5C1BA 3U6LA 4B7HA 3U6DA 5FTMA 1FNNA 2R45A 5A2QS 3C58A 1SXJA 3F92A 3T15A 2JNHA 5KO3A 3AJIB 2I7NA 4AQYM 4GIPA 4QHSA 4LJ4A 1TF0B 3RE8A 3GLGB 2JY7A 3A46A 1IXSA 1GL7A 3KXEC 2BJVA 4X65M 4LF4M 3FTEA 1XXHB 4GITA 2UUCM 1V92A 1WGNA 5H37D 4A3VB 1QYRA 2KXEA 4LFAM 4NSRA 4IBKA 1IY0A
chains in the Genus database with same CATH topology
4IBJA 2XF3A 3QAUA 3U6SA 1N33M 2V1CA 4LF7M 1IY2A 3SAVA 3GQ3A 4L4UA 4X66M 1JQJC 1XWIA 1KFVA 3UJNA 2RGOA 5FTNA 1L1ZA 5EP3A 3FUWA 2KEBA 3HU3A 1I94M 4FW9A 4M9SA 4L15A 1T3TA 2G5GX 3KOWE 2KZUA 3U6EA 5IREB 4DR7M 5EP4A 1L2DA 2QZ4A 3M0EA 3L27A 2R65A 1PJIA 4FWGA 4CGYB 3I51A 4AI6A 1SXJC 3KP1E 2DWMA 1J5EM 2K47A 2A5YB 3T1HM 3EIEA 1QAMA 3FTCA 4FCWA 3GRUA 1IN5A 1JR3D 2J7NA 2QBYA 3E9SA 1TDZA 2ZAMA 2G8LA 1Q39A 4YY3M 3KFUG 3J7BA 1YE9A 4Z8XA 5KPTA 1ORYB 1GKIA 4RNAA 1XC8A 4W5WA 2CV1A 4DV6M 3UZUA 3GLIA 5F3WA 3VLFB 1L1TA 2DHRA 1SXJE 3U60B 2LNHC 2FOIC 5EXTA 3PVSA 4MGZE 4DR1M 3ZH9B 2RKOA 1JR3A 3LVWA 4JI1M 3VKHA 3QWLA 3FTDA 3U6OA 4KLNA 3PFIA 4B3SM 4IBEA 4MGYE 3J7AS 3T38A 3U6QA 1QANA 1ZQ9A 5KQ8A 1MU5A 4JI8M 3GP1A 1MX0A 2QPAA 3M6AA 1R2YA 4M9XA 4LFCM 1NY5A 4GHAA 2O5RA 1HQCA 1QZMA 4HLQA 2L09A 2Z4SA 2XLJA 4JV5M 2RGHA 2R4EA 3UMMA 3SHFA 5ITUA 1G4AE 4JYAM 2Y0TA 4JI0M 3U61B 3MK6A 3FYCA 2DWNA 1E9SA 4AZFA 3KOYE 2QCUA 3HHWA 2UXDM 1G3IA 2YNMD 5EP1A 2FNAA 4KODA 1YUBA 4LCBA 2EUCA 4OVZB 1HT1E 2Z7JA 4JI6M 1R6BX 5IWAM 5FSWA 2X8AA 2F5SA 5DNYA 2AHMA 4LGYA 2V6ZM 1E9RA 3AOEC 3W0LB 1GLNA 1OFHA 1TH2A 3DZDA 4LF8M 3GPUA 1NNUC 4B7GA 3IG5A 5LMNM 1SXJD 4LFBM 3SFZA 4JI5M 2J7OA 2EO2A 3Q8XA 4NRVA 4OX9M 3KDSE 3JR4A 4LY6A 2XH9A 2KA6B 3KS4A 3HHYA 2X4AA 3TWKA 3SATA 4IBCA 1N77A 4II7A 4I4LA 4FD2A 4KO8A 3HHXA 3FUVA 3GLFA 4FWHA 2Z3XA 3PNYA 2DWZB 3GPYA 2CUZA 4PD2A 1K3XA 2XEPA 3TQSA 4Z6YA 3UGJA 2XZUA 3K8ZA 3AL0C 2D7GA 2CV2A 4IBIA 4B3MM 4NXNM 3AV0A 2R46A 3U5ZB 5BR8M 2LH0A 2E5LM 3KOXE 3LQRA 4FCVA 1Z5CA 4ZPXA 3U6MA 4EIWA 4MGIE 4LJ8A 5EQTA 2C98A 1VDDA 2ZAOA 3KP0E 2X49A 1NY6A 1NHWC 2XFTA 2YQZA 4WW0A 3ZCBB 4OU7A 4G4OA 2Q2EB 4GRIA 3GO8A 4REZA 4DV0M 1XMQM 1IN4A 1NJFA 1IQPA 4DR6M 3GPXA 4LF6M 3GLHA 3A45A 1E94E 1PM5A 1HR0M 1KYIA 2BNKA 4RF1A 2C9OA 1TH4A 1G8PA 1OFIA 2VQEM 4KHPM 4NXMM 4CISA 1HNXM 1DO2A 4D82A 3TL4X 3HKPA 3B9PA 3KW6A 3K92A 4L16A 1QQWA 2L7IA 3U6CA 1PJJA 4TUWA 3THGA 4AW4A 4BBAA 4B3TM 4LJ7A 3DA1A 1DGHB 2D7EA 5JI2E 2VQFM 1DO0A 4GHLA 4NSOB 2Y20A 4PCZA 1R7RA 3FTFA 2R18A 3RGSA 3I4VA 3FUUA 3GLGA 3CTWB 1XXHA 4IJFA 3U6PA 5IZ7D 2F5NA 4DV4M 3AOEA 1N78A 1DGGA 4M9ZA 3GRYA 5DYIA 2OQ4A 4MB7A 3HJSA 2C9CA 3L29A 4LF5M 4JN6A 4OW0A 4NOOB 3JAMS 3GRVA 4D81A 5ITRA 1IBMM 4GC5A 4GKJM 4NRWA 2DVWB 3CF0A 3SASA 4G4NA 4AKHA 4IBBA 3KSXA 1X37A 1S3SA 2NQ8C 2Y0QA 4DUZM 4QOSA 1NNJA 1Z59A 2CHVA 4M0WA 3D8BA 3LMMA 3AOGA 3SHGB 3BOSA 2DZNB 2H1RA 1SXJB 4IIWA 3M7GA 1UM8A 4GC9A 4YHHM 2EA0A 2YR0A 2UUBM 3UK6A 2F4VM 4P16A 4NL4H 1HT2E 4DV3M 3KSJA 4XBOA 3AKZA 3DFZA 1IXSB 1G59A 5LMUM 1J7KA 4DV2M 1YSYA 3LVVA 3NWLA 1HNWM 2DWLA 3HU1A 2C5RA 3IG8A 5C18A 2HKJA 3DOAA 3VDPA 4BLCA 3U60A 4L8RC 3LQQA 1C1KA 3A42A 4QNMA 3WHKA 1Z6TA 2JA2A 3GQ4A 4LF9M 1ZAEA 2DXIA 4K0KM 3VKGA 1K82A 4QOZC 1L2BA 4GMQA 1Q3BA 1L2CA 4QNRA 2HL7A 3VK8A 1IBKM 1Q3CA 3TPZA 3CF2A 3J27B 3HU2A 4X62M 2ZM6M 4DR5M 1XMOM 3RFWA 3GQ5A 4DUYM 3KS8A 3L25A 3E4RA 2ZBKB 2R4JA 3WHLA 4HL4A 4FCTA 2UUAM 2C99A 2QP9X 4JI4M 5DYGA 4XGIA 5ITYA 3VK7A 4DR2M 5GKNA 2DZOB 2QBYB 4DR4M 2L6OA 4LGMA 2FFJA 5FTKA 2CFOA 1WXQA 3U61A 1N34M 2XFSA 3J2PB 2FE8A 2C96A 3GLIB 1Z5BA 1QAQA 2W82A 4OVZA 4AG6A 3TWMA 1DGBA 1TGUA 3SC3A 2XSZA 3KOZE 3K1JA 2UU9M 2M60A 2CHQA 1NVMA 4G4QA 3SMPA 1XNQM 3MHVC 1IBLM 2R62A 1QVRA 1XHBA 2ERCA 1IXZA 1I4WA 3SYKA 2CV0A 4QHTA 2KW0A 2XZFA 5FLXS 2CEAA 5ITTA 1Z5AA 1W5TA 3HHZA 3SYLA 4B7FA 2Z4RA 5EXPA 4MGHA 2ZANA 4LRTA 4B3RM 1K3WA 3PXGA 1H6UA 2YFQA 4G6ZA 3L26A 1E32A 4LJAA 1FJGM 2HHHM 3H4MA 1TDHA 5EJCA 4PDGA 3HWSA 3D8LA 4GKKM 4IJEA 3VDUA 3SAUA 4R7GA 4B08A 3L2AA 3U5ZA 3MJ5A 3FD9A 1DGFA 4DV5M 4MGKE 3W0FA 2F5OA 3T1YM 3J81S 2BJWA 4LJ5A 3PNVA 4DV7M 1HNZM 4LZJA 3J80S 3CF6E 5JI3E 5ITXA 2D7HA 4LG2A 1N36M 4AKGA 5EP2A 2HCBA 4MM3B 1NHGC 2P5TA 2L7HA 4JI7M 5EXXA 3R8FA 5ITQA 3HJ8A 4JXJA 1NSFA 3SARA 2KRUA 4IBFA 5EXSA 5E6JA 5KPZA 5KQDA 3OTOM 4LRSA 5FTLA 1L8QA 1N32M 4AKIA 2Y21A 3FKEA 4JI3M 4PDIA 1NJGA 3NBIA 4WURA 4AG5A 4FVMA 4PT5A 4R3DA 3GLFB 4G4RA 1J09A 2F5QA 2UXCM 1OJLA 1EE8A 1TH3A 4RF0A 3K2LA 5IT9S 3L28A 3FYDA 4FWDA 4I5SA 3A98B 2LXEA 3TE6A 1IN8A 4CHTB 1GVNA 1HQYE 3JR5A 1DGHA 4ITQA 3FUXA 4LZZA 2F5PA 3KVWA 4IBGA 4DR3M 2UXBM 4JI2M 4MH0E 3SAWA 1KSFX 1IM2A 1LV7A 3HGIA 4GH9A 3VFDA 2OPFA 2M5ZA 3GRRA 3ILKA 1QAOA 5KPRA 1XNRM 1IN6A 5FTJA 4D80A 4DV1M 1R2ZA 2QENA 3RGPA 3ZC7B 8CATA 3SBJA 2KRKA 3SMSA 3HJQA 3GLHB 1IXRC 3TWLA 1IN7A 4S12A 1D2NA 4X64M 1W5SA 4LJ6A 3I4YA 5ITXE 2CE7A 3EIHA 2I7PA 1N75A 3R9XB 4I8OA 2XSZD 4BB9A 4IBDA 2KZSA 1GL6A 2V1UA 3GPPA 4I81A 4M0DA 4L78A 3FUTA 4LJ9A 5BPVA 1IY1A 2VIIA 3AFHA 2CHGA 5E26A 7CATA 1G41A 2LWXA 2XGNA 5C1BA 3U6LA 4B7HA 3U6DA 5FTMA 1FNNA 2R45A 5A2QS 3C58A 1SXJA 3T15A 5KO3A 3AJIB 2I7NA 4AQYM 4GIPA 4QHSA 4LJ4A 3RE8A 3GLGB 3A46A 1GL7A 3KXEC 2BJVA 4X65M 4LF4M 3FTEA 1XXHB 4GITA 2UUCM 5H37D 4A3VB 1QYRA 2KXEA 4LFAM 4NSRA 4IBKA 1IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRV A;  4OX9 M;  1NNJ A;  3JR4 A;  1Z59 A;  3U6S A;  1N33 M;  4LF7 M;  3SAV A;  3TWK A;  3GQ3 A;  4X66 M;  1KFV A;  4DV5 M;  3SAT A;  3W0F A;  2EA0 A;  4YHH M;  3J81 S;  3T1Y M;  2F5O A;  1L1Z A;  2UUB M;  2F4V M;  4DV7 M;  1HNZ M;  1I94 M;  4DV3 M;  3J80 S;  5ITX A;  5LMU M;  1N36 M;  4DV2 M;  3U6E A;  3GPY A;  4PD2 A;  1HNW M;  4DR7 M;  1K3X A;  1L2D A;  2XZU A;  3DOA A;  2HKJ A;  1PJI A;  4JI7 M;  3SAR A;  5ITQ A;  3GQ4 A;  3A42 A;  4LF9 M;  4B3M M;  4K0K M;  4NXN M;  5BR8 M;  1K82 A;  2E5L M;  1J5E M;  3OTO M;  1Z5C A;  3U6M A;  3T1H M;  1L2B A;  1Q3B A;  1L2C A;  3VK8 A;  1IBK M;  1Q3C A;  1N32 M;  4JI3 M;  4X62 M;  2ZM6 M;  4PDI A;  1TDZ A;  4DR5 M;  1Q39 A;  4YY3 M;  1XMO M;  2F5Q A;  2UXC M;  4G4O A;  3GQ5 A;  4DUY M;  4G4R A;  2Q2E B;  3GO8 A;  4DV0 M;  1XC8 A;  1EE8 A;  1XMQ M;  4DV6 M;  2ZBK B;  4DR6 M;  3GPX A;  1L1T A;  4LF6 M;  5IT9 S;  3A45 A;  2UUA M;  3JR5 A;  1PM5 A;  1HR0 M;  4ITQ A;  4DR1 M;  4JI4 M;  5ITY A;  3VK7 A;  2F5P A;  4DR3 M;  2VQE M;  4DR2 M;  2UXB M;  4JI2 M;  4JI1 M;  4KHP M;  4NXM M;  4CIS A;  3SAW A;  2OPF A;  1HNX M;  3U6O A;  4DR4 M;  4B3S M;  1XNR M;  3J7A S;  1N34 M;  4DV1 M;  1R2Z A;  3U6Q A;  1MU5 A;  3SBJ A;  4JI8 M;  3GP1 A;  3U6C A;  1MX0 A;  1PJJ A;  1Z5B A;  1R2Y A;  4LFC M;  3TWL A;  3TWM A;  4B3T M;  2UU9 M;  2VQF M;  4X64 M;  5ITX E;  4PCZ A;  4G4Q A;  4JV5 M;  1XNQ M;  5ITU A;  1IBL M;  4JYA M;  4JI0 M;  3GPP A;  3U6P A;  2UXD M;  2F5N A;  2XZF A;  4DV4 M;  5FLX S;  3U6L A;  5ITT A;  1Z5A A;  2OQ4 A;  3U6D A;  4MB7 A;  4JI6 M;  4LF5 M;  5IWA M;  2F5S A;  4B3R M;  3JAM S;  1K3W A;  5A2Q S;  3C58 A;  5ITR A;  1IBM M;  1FJG M;  2HHH M;  1TDH A;  4PDG A;  4AQY M;  4NRW A;  4GKJ M;  3A46 A;  4LF8 M;  3GPU A;  4LF4 M;  5LMN M;  4X65 M;  3SAS A;  4G4N A;  4LFB M;  4JI5 M;  3SAU A;  2UUC M;  4GKK M;  4LFA M;  4DUZ M; 
#chains in the Genus database with same CATH topology
 4IBJ A;  2XF3 A;  3QAU A;  3U6S A;  1N33 M;  2V1C A;  1OTR A;  4UN2 B;  4LF7 M;  1IY2 A;  3SAV A;  3T6P A;  2GNO A;  3GQ3 A;  1T43 A;  4L4U A;  2L4F A;  1JQJ C;  4X66 M;  1G71 A;  1XWI A;  1KFV A;  3UJN A;  2RGO A;  5FTN A;  1L1Z A;  5EP3 A;  3FUW A;  4GEW A;  2KEB A;  3HU3 A;  1I94 M;  4FW9 A;  4M9S A;  4L15 A;  1R5L A;  1T3T A;  2G5G X;  2FH0 A;  2KZU A;  3KOW E;  3U6E A;  5IRE B;  4DR7 M;  5EP4 A;  1L2D A;  2QZ4 A;  3M0E A;  3L27 A;  3E21 A;  2R65 A;  1PJI A;  4FWG A;  4CGY B;  1OQY A;  2JWS A;  3I51 A;  4AI6 A;  1OIZ A;  1SXJ C;  3KP1 E;  2DWM A;  1J5E M;  2K47 A;  2A5Y B;  3T1H M;  2CRU A;  3EIE A;  1QAM A;  3FTC A;  4FCW A;  2KDL A;  3B7N A;  3GRU A;  1IN5 A;  1JR3 D;  2J7N A;  2QBY A;  3E9S A;  1TDZ A;  2ZAM A;  2G8L A;  1Q39 A;  2EKK A;  4YY3 M;  3KFU G;  3J7B A;  1YE9 A;  4Z8X A;  5KPT A;  1AUA A;  1ORY B;  2BWE A;  1GKI A;  2DHY A;  4RNA A;  1XC8 A;  4W5W A;  2CV1 A;  4DV6 M;  3UZU A;  3GLI A;  2DAK A;  3VLF B;  5F3W A;  2DHR A;  1L1T A;  1SXJ E;  2BWB A;  3U60 B;  2LNH C;  2FOI C;  5EXT A;  1GO5 A;  3PVS A;  4MGZ E;  4DR1 M;  3ZH9 B;  2QHO B;  2RKO A;  1JR3 A;  3LVW A;  4JI1 M;  2JY5 A;  3VKH A;  3QWL A;  3FTD A;  3U6O A;  4KLN A;  4NC6 A;  3PFI A;  4B3S M;  4IBE A;  4MGY E;  3J7A S;  3T38 A;  3U6Q A;  1QAN A;  1ZQ9 A;  2QNJ A;  1MU5 A;  5KQ8 A;  4JI8 M;  4ANR A;  3GP1 A;  1MX0 A;  2QPA A;  3M6A A;  1R2Y A;  4M9X A;  4LFC M;  1NY5 A;  4GHA A;  2O5R A;  1HQC A;  1QZM A;  4HLQ A;  2L09 A;  2Z4S A;  4RKU F;  2DEN A;  2XLJ A;  4JV5 M;  2LVQ D;  2RGH A;  2R4E A;  3UMM A;  3SHF A;  5ITU A;  1G4A E;  4JYA M;  2Y0T A;  1ZMU A;  4JI0 M;  3U61 B;  3MK6 A;  3FYC A;  1YLA A;  2DWN A;  1E9S A;  4AZF A;  1LTM A;  3KOY E;  2QCU A;  3HHW A;  2UXD M;  1PGY A;  1G3I A;  1WHC A;  2YNM D;  5EP1 A;  1BVS A;  2FNA A;  2KNV A;  1YUB A;  4KOD A;  4LCB A;  2EUC A;  4OVZ B;  1HT1 E;  2Z7J A;  4JI6 M;  1R6B X;  5IWA M;  1MN3 A;  5FSW A;  2X8A A;  4G3O A;  2F5S A;  2JUJ A;  4XK8 F;  1OAI A;  5DNY A;  2AHM A;  4LGY A;  2V6Z M;  1GAB A;  3I04 M;  4F1I A;  1E9R A;  3AOE C;  3W0L B;  3GLI E;  1GLN A;  1OFH A;  1TH2 A;  5DFL A;  3C3D A;  1OAO C;  3DZD A;  3GPU A;  4LF8 M;  1NNU C;  1NO1 A;  3IG5 A;  4B7G A;  5LMN M;  1SXJ D;  2KHH A;  4LFB M;  1VEG A;  1JB0 F;  3SFZ A;  1PJT A;  4JI5 M;  2J7O A;  2EO2 A;  2N35 A;  1JR3 E;  3W68 A;  3Q8X A;  4NRV A;  4OX9 M;  3KDS E;  3JR4 A;  4LY6 A;  2XH9 A;  2KA6 B;  3B89 A;  3QYB A;  1WJ7 A;  1A5T A;  3KS4 A;  3HHY A;  2X4A A;  3TWK A;  2RRU A;  2QSF X;  3SAT A;  4IBC A;  1N77 A;  4II7 A;  2DI0 A;  4I4L A;  4FD2 A;  2CWB A;  4KO8 A;  2OOA A;  3HHX A;  3MMP A;  3FUV A;  3GLF A;  4FWH A;  2Z3X A;  2LVO C;  3PNY A;  2DWZ B;  3GPY A;  2CUZ A;  4PD2 A;  2CP8 A;  1K3X A;  2XEP A;  3TQS A;  4Z6Y A;  3UGJ A;  2XZU A;  3K8Z A;  3AL0 C;  2D7G A;  2CV2 A;  4IBI A;  4B3M M;  4NXN M;  2VDB B;  3AV0 A;  2R46 A;  2JP7 A;  5BR8 M;  2LH0 A;  3U5Z B;  2E5L M;  3KOX E;  3LQR A;  2K9D A;  4FCV A;  2R44 A;  1Z5C A;  4ZPX A;  3U6M A;  4EIW A;  4MGI E;  1VDL A;  3LW5 F;  2DNA A;  4LJ8 A;  5EQT A;  2C98 A;  2QQ8 A;  1VDD A;  2ZAO A;  3KP0 E;  2X49 A;  1NY6 A;  4LF9 M;  1V33 A;  1NHW C;  2XFT A;  2YQZ A;  2K6B A;  4WW0 A;  3ZCB B;  4OU7 A;  4G4O A;  2Q2E B;  4GRI A;  3GO8 A;  4REZ A;  4DV0 M;  1F4I A;  1XMQ M;  1IN4 A;  1NJF A;  1IQP A;  4DR6 M;  2O25 A;  3GPX A;  4LF6 M;  3GLH A;  3A45 A;  2EJS A;  1QUT A;  2GQF A;  1E94 E;  1WR1 B;  1QDR A;  2LBC A;  1PM5 A;  1HR0 M;  1QDT A;  1KYI A;  2BNK A;  4RF1 A;  2C9O A;  1TH4 A;  1G8P A;  1OFI A;  2VQE M;  1ZMV A;  4KHP M;  4NXM M;  4CIS A;  1HNX M;  1DO2 A;  4D82 A;  3TL4 X;  3HKP A;  2LVP C;  3B9P A;  4L6V 6;  1QZE A;  3V76 A;  3KW6 A;  1ZV1 A;  3K92 A;  2LHG A;  1QQW A;  2L7I A;  4L16 A;  1ZMW A;  2R0I A;  3U6C A;  1PJJ A;  4TUW A;  3THG A;  4AW4 A;  1VG5 A;  4BBA A;  3B74 A;  4B3T M;  2JZ0 A;  1T6O A;  4LJ7 A;  1DGH B;  2D7E A;  3DA1 A;  5JI2 E;  2VQF M;  1DO0 A;  2H5X A;  4GHL A;  2WZJ A;  4NSO B;  3GLF E;  1WIV A;  2Y20 A;  4PCZ A;  1R7R A;  3FTF A;  2WSF F;  3CGW A;  2EKF A;  2R18 A;  3RGS A;  3I4V A;  3FUU A;  3GLG A;  3CTW B;  1WGL A;  1GJS A;  1XXH A;  4IJF A;  3U6P A;  5IZ7 D;  2F5N A;  3FRI A;  4DV4 M;  3AOE A;  1N78 A;  1DGG A;  4M9Z A;  3GRY A;  2DAE A;  5DYI A;  2OQ4 A;  2DAM A;  2HWJ A;  3HJS A;  2C9C A;  3L29 A;  4MB7 A;  4LF5 M;  4JN6 A;  1VEK A;  4OW0 A;  4NOO B;  2L2D A;  3GRV A;  3JAM S;  1EIJ A;  4D81 A;  5ITR A;  3FRH A;  1IBM M;  2JZ1 A;  4GC5 A;  4GKJ M;  4NRW A;  2DVW B;  3GLH E;  2ZTC A;  3CF0 A;  3SAS A;  4G4N A;  4AKH A;  4IBB A;  3KSX A;  1X37 A;  1CUK A;  4CJ6 A;  1S3S A;  3B7Q A;  2NQ8 C;  2Y0Q A;  4DUZ M;  4QOS A;  1NNJ A;  2B3T A;  1Z59 A;  3IEC A;  2CHV A;  2VF8 A;  4M0W A;  3D8B A;  3LMM A;  3AOG A;  3SHG B;  3BOS A;  2DZN B;  1EFU B;  2H1R A;  1SXJ B;  4IIW A;  3M7G A;  1UM8 A;  4GC9 A;  4YHH M;  2EA0 A;  1OIP A;  2YR0 A;  2UUB M;  3UK6 A;  2F4V M;  4P16 A;  4NL4 H;  1HT2 E;  4DV3 M;  2G3Q A;  3I01 M;  3KSJ A;  4XBO A;  3AKZ A;  3DFZ A;  1IXS B;  2JY6 B;  5LMU M;  1J7K A;  1G59 A;  4DV2 M;  1YSY A;  3LVV A;  3NWL A;  1HNW M;  2DWL A;  3HU1 A;  2C5R A;  3IG8 A;  2Z8Y M;  5C18 A;  2HKJ A;  3DOA A;  1PJS A;  3VDP A;  4BLC A;  3U60 A;  4L8R C;  3LQQ A;  1C1K A;  3A42 A;  3HY5 A;  4QNM A;  1Z6T A;  2JA2 A;  3WHK A;  3GQ4 A;  1ZAE A;  2DXI A;  4K0K M;  3VKG A;  1K82 A;  1NV9 A;  2MRO B;  4QOZ C;  1L2B A;  3GLG E;  4GMQ A;  1Q3B A;  1L2C A;  4QNR A;  2HL7 A;  3ZQJ A;  3VK8 A;  1IBK M;  1XXH E;  1Q3C A;  3TPZ A;  3CF2 A;  3J27 B;  3HU2 A;  1PJQ A;  4X62 M;  2ZM6 M;  4DR5 M;  1XMO M;  3RFW A;  1TTE A;  3GQ5 A;  4DUY M;  3KS8 A;  3L25 A;  3E4R A;  2MJ5 B;  2ZBK B;  1R4G A;  2R4J A;  3WHL A;  4HL4 A;  4FCT A;  2UUA M;  2C99 A;  2QP9 X;  4JI4 M;  5DYG A;  3Q8G A;  4XGI A;  5ITY A;  1Q02 A;  3VK7 A;  2DKL A;  4WP2 A;  4DR2 M;  2DAG A;  5GKN A;  2APL A;  2KNA A;  2DZO B;  2QBY B;  4DR4 M;  2L6O A;  4LGM A;  2FFJ A;  5FTK A;  2CFO A;  1WXQ A;  3U61 A;  1N34 M;  2XFS A;  3J2P B;  2L4E A;  2FE8 A;  1DV0 A;  2C96 A;  1HJP A;  2MR9 A;  3GLI B;  1Z5B A;  1QAQ A;  2W82 A;  3C3E A;  1PRB A;  4OVZ A;  4AG6 A;  3TWM A;  1DGB A;  1TGU A;  3SC3 A;  2XSZ A;  3KOZ E;  3K1J A;  2UU9 M;  3C9P A;  2M60 A;  2CHQ A;  1NVM A;  3E46 A;  2WSE F;  3QYE A;  1SG9 A;  4G4Q A;  3SMP A;  4R71 A;  3FE3 A;  4F2L A;  1XNQ M;  3MHV C;  1IFY A;  1IBL M;  1RU3 A;  3BBZ A;  2DAI A;  1XB2 B;  2R62 A;  3H4J A;  1QVR A;  1XHB A;  2ERC A;  1IXZ A;  1I4W A;  3K9O A;  3SYK A;  2R6F A;  2CV0 A;  4QHT A;  2KW0 A;  2XZF A;  5FLX S;  2CEA A;  5ITT A;  1Z5A A;  1W5T A;  3HHZ A;  3SYL A;  4B7F A;  2Z4R A;  5EXP A;  2ZTD A;  3W67 A;  4MGH A;  2ZAN A;  2J5Y A;  4LRT A;  4B3R M;  1K3W A;  3PXG A;  1H6U A;  2YFQ A;  4G6Z A;  3L26 A;  1E32 A;  4LJA A;  1FJG M;  2HHH M;  1TR8 A;  3H4M A;  1TDH A;  5EJC A;  4PDG A;  1GJT A;  3HWS A;  3D8L A;  4GKK M;  4IJE A;  3VDU A;  3SAU A;  4Q7J A;  4R7G A;  4B08 A;  3L2A A;  3LCV B;  3U5Z A;  1D0M A;  4KT0 F;  1MJG M;  3MJ5 A;  3FD9 A;  1DGF A;  1VEJ A;  2MGW A;  3LCU A;  4DV5 M;  4MGK E;  3W0F A;  2F5O A;  3T1Y M;  3J81 S;  2BJW A;  4LJ5 A;  3PNV A;  4DV7 M;  2FS1 A;  1HNZ M;  4LZJ A;  3J80 S;  3CF6 E;  5JI3 E;  5ITX A;  2D7H A;  2WSC F;  1N36 M;  4LG2 A;  4AKG A;  5EP2 A;  2HCB A;  4MM3 B;  1NHG C;  2P5T A;  1D0L A;  2L7H A;  1VQ1 A;  4JI7 M;  1V34 A;  5EXX A;  5ITQ A;  3HJ8 A;  4JXJ A;  1NSF A;  3R8F A;  2KNZ A;  3B7Z A;  2KRU A;  3SAR A;  4IBF A;  2LVN C;  1P3Q Q;  5E6J A;  5EXS A;  3IHP A;  5KPZ A;  2VF7 A;  1C7Y A;  2K0B X;  5KQD A;  3OTO M;  4LRS A;  5L8R F;  1NV8 A;  2HAK A;  5FTL A;  1L8Q A;  1N32 M;  1D0K A;  4AKI A;  2Y21 A;  3FKE A;  4JI3 M;  4CIZ A;  2O01 F;  4PDI A;  1NJG A;  3NBI A;  1AIP C;  4WUR A;  4AG5 A;  4FVM A;  4PT5 A;  4R3D A;  3GLF B;  4G4R A;  1J09 A;  2F5Q A;  2UXC M;  3HZJ A;  1OJL A;  1EE8 A;  1TH3 A;  4RF0 A;  3K2L A;  5IT9 S;  3L28 A;  3FYD A;  4FWD A;  4I5S A;  3A98 B;  2LXE A;  3TE6 A;  1IN8 A;  4CHT B;  1GVN A;  1HQY E;  1Y8G A;  3JR5 A;  1DGH A;  4ITQ A;  2MH8 A;  3FUX A;  4LZZ A;  2F5P A;  3KVW A;  4IBG A;  4DR3 M;  2UXB M;  4JI2 M;  2OO9 A;  4MH0 E;  1KSF X;  3SAW A;  1IM2 A;  1LV7 A;  1QUS A;  3BXW A;  3HGI A;  4GH9 A;  3VFD A;  2OPF A;  2M5Z A;  3GRR A;  3ILK A;  1QAO A;  5KPR A;  1XNR M;  1IN6 A;  5FTJ A;  4D80 A;  4DV1 M;  1R2Z A;  2QEN A;  3RGP A;  3ZC7 B;  8CAT A;  3SBJ A;  4DBG B;  2KRK A;  3SMS A;  3NBX X;  3HJQ A;  3GLH B;  1IXR C;  3TWL A;  1OKS A;  1IN7 A;  2OOB A;  2JXN A;  4S12 A;  1D2N A;  4X64 M;  4Y28 F;  1W5S A;  4HEO A;  2LTU A;  4LJ6 A;  3I4Y A;  5ITX E;  1UFZ A;  2LVA A;  2CE7 A;  3EIH A;  2I7P A;  1N75 A;  3R9X B;  4I8O A;  3K9P A;  2XSZ D;  4BB9 A;  4IBD A;  2KZS A;  3HX3 A;  1GL6 A;  2V1U A;  3GPP A;  4I81 A;  4M0D A;  4P17 A;  2JY8 A;  4L78 A;  3FUT A;  4LJ9 A;  2DZL A;  5BPV A;  1IY1 A;  2VII A;  3AFH A;  2CHG A;  5E26 A;  7CAT A;  1G41 A;  2LWX A;  2XGN A;  2LHC A;  5C1B A;  3U6L A;  4B7H A;  3U6D A;  5FTM A;  1FNN A;  2R45 A;  5A2Q S;  3C58 A;  1SXJ A;  3F92 A;  3T15 A;  2JNH A;  5KO3 A;  3AJI B;  2I7N A;  4AQY M;  4GIP A;  4QHS A;  4LJ4 A;  1TF0 B;  3RE8 A;  3GLG B;  2JY7 A;  3A46 A;  1IXS A;  1GL7 A;  3KXE C;  2BJV A;  4X65 M;  4LF4 M;  3FTE A;  1XXH B;  4GIT A;  2UUC M;  1V92 A;  1WGN A;  5H37 D;  4A3V B;  1QYR A;  2KXE A;  4LFA M;  4NSR A;  4IBK A;  1IY0 A; 
#chains in the Genus database with same CATH homology
 4IBJ A;  2XF3 A;  3QAU A;  3U6S A;  1N33 M;  2V1C A;  4LF7 M;  1IY2 A;  3SAV A;  3GQ3 A;  4L4U A;  4X66 M;  1JQJ C;  1XWI A;  1KFV A;  3UJN A;  2RGO A;  5FTN A;  1L1Z A;  5EP3 A;  3FUW A;  2KEB A;  3HU3 A;  1I94 M;  4FW9 A;  4M9S A;  4L15 A;  1T3T A;  2G5G X;  3KOW E;  2KZU A;  3U6E A;  5IRE B;  4DR7 M;  5EP4 A;  1L2D A;  2QZ4 A;  3M0E A;  3L27 A;  2R65 A;  1PJI A;  4FWG A;  4CGY B;  3I51 A;  4AI6 A;  1SXJ C;  3KP1 E;  2DWM A;  1J5E M;  2K47 A;  2A5Y B;  3T1H M;  3EIE A;  1QAM A;  3FTC A;  4FCW A;  3GRU A;  1IN5 A;  1JR3 D;  2J7N A;  2QBY A;  3E9S A;  1TDZ A;  2ZAM A;  2G8L A;  1Q39 A;  4YY3 M;  3KFU G;  3J7B A;  1YE9 A;  4Z8X A;  5KPT A;  1ORY B;  1GKI A;  4RNA A;  1XC8 A;  4W5W A;  2CV1 A;  4DV6 M;  3UZU A;  3GLI A;  5F3W A;  3VLF B;  1L1T A;  2DHR A;  1SXJ E;  3U60 B;  2LNH C;  2FOI C;  5EXT A;  3PVS A;  4MGZ E;  4DR1 M;  3ZH9 B;  2RKO A;  1JR3 A;  3LVW A;  4JI1 M;  3VKH A;  3QWL A;  3FTD A;  3U6O A;  4KLN A;  3PFI A;  4B3S M;  4IBE A;  4MGY E;  3J7A S;  3T38 A;  3U6Q A;  1QAN A;  1ZQ9 A;  5KQ8 A;  1MU5 A;  4JI8 M;  3GP1 A;  1MX0 A;  2QPA A;  3M6A A;  1R2Y A;  4M9X A;  4LFC M;  1NY5 A;  4GHA A;  2O5R A;  1HQC A;  1QZM A;  4HLQ A;  2L09 A;  2Z4S A;  2XLJ A;  4JV5 M;  2RGH A;  2R4E A;  3UMM A;  3SHF A;  5ITU A;  1G4A E;  4JYA M;  2Y0T A;  4JI0 M;  3U61 B;  3MK6 A;  3FYC A;  2DWN A;  1E9S A;  4AZF A;  3KOY E;  2QCU A;  3HHW A;  2UXD M;  1G3I A;  2YNM D;  5EP1 A;  2FNA A;  4KOD A;  1YUB A;  4LCB A;  2EUC A;  4OVZ B;  1HT1 E;  2Z7J A;  4JI6 M;  1R6B X;  5IWA M;  5FSW A;  2X8A A;  2F5S A;  5DNY A;  2AHM A;  4LGY A;  2V6Z M;  1E9R A;  3AOE C;  3W0L B;  1GLN A;  1OFH A;  1TH2 A;  3DZD A;  4LF8 M;  3GPU A;  1NNU C;  4B7G A;  3IG5 A;  5LMN M;  1SXJ D;  4LFB M;  3SFZ A;  4JI5 M;  2J7O A;  2EO2 A;  3Q8X A;  4NRV A;  4OX9 M;  3KDS E;  3JR4 A;  4LY6 A;  2XH9 A;  2KA6 B;  3KS4 A;  3HHY A;  2X4A A;  3TWK A;  3SAT A;  4IBC A;  1N77 A;  4II7 A;  4I4L A;  4FD2 A;  4KO8 A;  3HHX A;  3FUV A;  3GLF A;  4FWH A;  2Z3X A;  3PNY A;  2DWZ B;  3GPY A;  2CUZ A;  4PD2 A;  1K3X A;  2XEP A;  3TQS A;  4Z6Y A;  3UGJ A;  2XZU A;  3K8Z A;  3AL0 C;  2D7G A;  2CV2 A;  4IBI A;  4B3M M;  4NXN M;  3AV0 A;  2R46 A;  3U5Z B;  5BR8 M;  2LH0 A;  2E5L M;  3KOX E;  3LQR A;  4FCV A;  1Z5C A;  4ZPX A;  3U6M A;  4EIW A;  4MGI E;  4LJ8 A;  5EQT A;  2C98 A;  1VDD A;  2ZAO A;  3KP0 E;  2X49 A;  1NY6 A;  1NHW C;  2XFT A;  2YQZ A;  4WW0 A;  3ZCB B;  4OU7 A;  4G4O A;  2Q2E B;  4GRI A;  3GO8 A;  4REZ A;  4DV0 M;  1XMQ M;  1IN4 A;  1NJF A;  1IQP A;  4DR6 M;  3GPX A;  4LF6 M;  3GLH A;  3A45 A;  1E94 E;  1PM5 A;  1HR0 M;  1KYI A;  2BNK A;  4RF1 A;  2C9O A;  1TH4 A;  1G8P A;  1OFI A;  2VQE M;  4KHP M;  4NXM M;  4CIS A;  1HNX M;  1DO2 A;  4D82 A;  3TL4 X;  3HKP A;  3B9P A;  3KW6 A;  3K92 A;  4L16 A;  1QQW A;  2L7I A;  3U6C A;  1PJJ A;  4TUW A;  3THG A;  4AW4 A;  4BBA A;  4B3T M;  4LJ7 A;  3DA1 A;  1DGH B;  2D7E A;  5JI2 E;  2VQF M;  1DO0 A;  4GHL A;  4NSO B;  2Y20 A;  4PCZ A;  1R7R A;  3FTF A;  2R18 A;  3RGS A;  3I4V A;  3FUU A;  3GLG A;  3CTW B;  1XXH A;  4IJF A;  3U6P A;  5IZ7 D;  2F5N A;  4DV4 M;  3AOE A;  1N78 A;  1DGG A;  4M9Z A;  3GRY A;  5DYI A;  2OQ4 A;  4MB7 A;  3HJS A;  2C9C A;  3L29 A;  4LF5 M;  4JN6 A;  4OW0 A;  4NOO B;  3JAM S;  3GRV A;  4D81 A;  5ITR A;  1IBM M;  4GC5 A;  4GKJ M;  4NRW A;  2DVW B;  3CF0 A;  3SAS A;  4G4N A;  4AKH A;  4IBB A;  3KSX A;  1X37 A;  1S3S A;  2NQ8 C;  2Y0Q A;  4DUZ M;  4QOS A;  1NNJ A;  1Z59 A;  2CHV A;  4M0W A;  3D8B A;  3LMM A;  3AOG A;  3SHG B;  3BOS A;  2DZN B;  2H1R A;  1SXJ B;  4IIW A;  3M7G A;  1UM8 A;  4GC9 A;  4YHH M;  2EA0 A;  2YR0 A;  2UUB M;  3UK6 A;  2F4V M;  4P16 A;  4NL4 H;  1HT2 E;  4DV3 M;  3KSJ A;  4XBO A;  3AKZ A;  3DFZ A;  1IXS B;  1G59 A;  5LMU M;  1J7K A;  4DV2 M;  1YSY A;  3LVV A;  3NWL A;  1HNW M;  2DWL A;  3HU1 A;  2C5R A;  3IG8 A;  5C18 A;  2HKJ A;  3DOA A;  3VDP A;  4BLC A;  3U60 A;  4L8R C;  3LQQ A;  1C1K A;  3A42 A;  4QNM A;  3WHK A;  1Z6T A;  2JA2 A;  3GQ4 A;  4LF9 M;  1ZAE A;  2DXI A;  4K0K M;  3VKG A;  1K82 A;  4QOZ C;  1L2B A;  4GMQ A;  1Q3B A;  1L2C A;  4QNR A;  2HL7 A;  3VK8 A;  1IBK M;  1Q3C A;  3TPZ A;  3CF2 A;  3J27 B;  3HU2 A;  4X62 M;  2ZM6 M;  4DR5 M;  1XMO M;  3RFW A;  3GQ5 A;  4DUY M;  3KS8 A;  3L25 A;  3E4R A;  2ZBK B;  2R4J A;  3WHL A;  4HL4 A;  4FCT A;  2UUA M;  2C99 A;  2QP9 X;  4JI4 M;  5DYG A;  4XGI A;  5ITY A;  3VK7 A;  4DR2 M;  5GKN A;  2DZO B;  2QBY B;  4DR4 M;  2L6O A;  4LGM A;  2FFJ A;  5FTK A;  2CFO A;  1WXQ A;  3U61 A;  1N34 M;  2XFS A;  3J2P B;  2FE8 A;  2C96 A;  3GLI B;  1Z5B A;  1QAQ A;  2W82 A;  4OVZ A;  4AG6 A;  3TWM A;  1DGB A;  1TGU A;  3SC3 A;  2XSZ A;  3KOZ E;  3K1J A;  2UU9 M;  2M60 A;  2CHQ A;  1NVM A;  4G4Q A;  3SMP A;  1XNQ M;  3MHV C;  1IBL M;  2R62 A;  1QVR A;  1XHB A;  2ERC A;  1IXZ A;  1I4W A;  3SYK A;  2CV0 A;  4QHT A;  2KW0 A;  2XZF A;  5FLX S;  2CEA A;  5ITT A;  1Z5A A;  1W5T A;  3HHZ A;  3SYL A;  4B7F A;  2Z4R A;  5EXP A;  4MGH A;  2ZAN A;  4LRT A;  4B3R M;  1K3W A;  3PXG A;  1H6U A;  2YFQ A;  4G6Z A;  3L26 A;  1E32 A;  4LJA A;  1FJG M;  2HHH M;  3H4M A;  1TDH A;  5EJC A;  4PDG A;  3HWS A;  3D8L A;  4GKK M;  4IJE A;  3VDU A;  3SAU A;  4R7G A;  4B08 A;  3L2A A;  3U5Z A;  3MJ5 A;  3FD9 A;  1DGF A;  4DV5 M;  4MGK E;  3W0F A;  2F5O A;  3T1Y M;  3J81 S;  2BJW A;  4LJ5 A;  3PNV A;  4DV7 M;  1HNZ M;  4LZJ A;  3J80 S;  3CF6 E;  5JI3 E;  5ITX A;  2D7H A;  4LG2 A;  1N36 M;  4AKG A;  5EP2 A;  2HCB A;  4MM3 B;  1NHG C;  2P5T A;  2L7H A;  4JI7 M;  5EXX A;  3R8F A;  5ITQ A;  3HJ8 A;  4JXJ A;  1NSF A;  3SAR A;  2KRU A;  4IBF A;  5EXS A;  5E6J A;  5KPZ A;  5KQD A;  3OTO M;  4LRS A;  5FTL A;  1L8Q A;  1N32 M;  4AKI A;  2Y21 A;  3FKE A;  4JI3 M;  4PDI A;  1NJG A;  3NBI A;  4WUR A;  4AG5 A;  4FVM A;  4PT5 A;  4R3D A;  3GLF B;  4G4R A;  1J09 A;  2F5Q A;  2UXC M;  1OJL A;  1EE8 A;  1TH3 A;  4RF0 A;  3K2L A;  5IT9 S;  3L28 A;  3FYD A;  4FWD A;  4I5S A;  3A98 B;  2LXE A;  3TE6 A;  1IN8 A;  4CHT B;  1GVN A;  1HQY E;  3JR5 A;  1DGH A;  4ITQ A;  3FUX A;  4LZZ A;  2F5P A;  3KVW A;  4IBG A;  4DR3 M;  2UXB M;  4JI2 M;  4MH0 E;  3SAW A;  1KSF X;  1IM2 A;  1LV7 A;  3HGI A;  4GH9 A;  3VFD A;  2OPF A;  2M5Z A;  3GRR A;  3ILK A;  1QAO A;  5KPR A;  1XNR M;  1IN6 A;  5FTJ A;  4D80 A;  4DV1 M;  1R2Z A;  2QEN A;  3RGP A;  3ZC7 B;  8CAT A;  3SBJ A;  2KRK A;  3SMS A;  3HJQ A;  3GLH B;  1IXR C;  3TWL A;  1IN7 A;  4S12 A;  1D2N A;  4X64 M;  1W5S A;  4LJ6 A;  3I4Y A;  5ITX E;  2CE7 A;  3EIH A;  2I7P A;  1N75 A;  3R9X B;  4I8O A;  2XSZ D;  4BB9 A;  4IBD A;  2KZS A;  1GL6 A;  2V1U A;  3GPP A;  4I81 A;  4M0D A;  4L78 A;  3FUT A;  4LJ9 A;  5BPV A;  1IY1 A;  2VII A;  3AFH A;  2CHG A;  5E26 A;  7CAT A;  1G41 A;  2LWX A;  2XGN A;  5C1B A;  3U6L A;  4B7H A;  3U6D A;  5FTM A;  1FNN A;  2R45 A;  5A2Q S;  3C58 A;  1SXJ A;  3T15 A;  5KO3 A;  3AJI B;  2I7N A;  4AQY M;  4GIP A;  4QHS A;  4LJ4 A;  3RE8 A;  3GLG B;  3A46 A;  1GL7 A;  3KXE C;  2BJV A;  4X65 M;  4LF4 M;  3FTE A;  1XXH B;  4GIT A;  2UUC M;  5H37 D;  4A3V B;  1QYR A;  2KXE A;  4LFA M;  4NSR A;  4IBK A;  1IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...