4K0KM

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 25
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4k0kM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4k0kM02
1HNWM 5ITXA 3U6SA 3U6QA 3U6PA 2UUAM 3TWLA 5FLXS 2Q2EB 5IT9S 4DR2M 5LMNM 4PDIA 5ITYA 3GP1A 2XZFA 4JI7M 2ZM6M 4DUYM 3SAUA 1IBLM 1K3WA 4LF7M 4LF9M 4AQYM 2F4VM 2VQFM 4DV2M 1PJIA 1XNQM 4NXNM 3GQ5A 4DR5M 4PD2A 1Q3BA 4JI1M 3GPXA 4OX9M 1FJGM 3T1HM 4YHHM 1KFVA 4LFCM 4PCZA 2F5QA 4PDGA 1HNZM 1XMOM 4B3SM 3A46A 2EA0A 4MB7A 3GPPA 2UUBM 5ITUA 3SAVA 4JI0M 1PJJA 2HHHM 3T1YM 4LFAM 3OTOM 3GO8A 3A45A 4DV0M 1PM5A 3GQ4A 2VQEM 4LF8M 1K82A 1MU5A 1L2BA 3J7AS 1EE8A 3U6CA 1TDHA 4DV4M 1TDZA 5IWAM 4GKKM 1N34M 4GKJM 2OQ4A 3W0FA 4DV1M 1XMQM 4CISA 1R2ZA 4G4OA 1IBKM 4G4RA 2UXDM 3J80S 2E5LM 1Q3CA 4X62M 4B3RM 4X65M 1XC8A 2UUCM 5A2QS 1Z5BA 4X66M 3GQ3A 1HNXM 4DUZM 1R2YA 4B3MM 4JI4M 4DV6M 5ITTA 1NNJA 3SASA 4G4NA 4DR4M 4DR7M 1L2DA 3SATA 5LMUM 2ZBKB 1L1TA 3JR5A 4DR6M 1N36M 3A42A 1J5EM 1IBMM 1N32M 4ITQA 4JI8M 4KHPM 1Z5AA 2F5NA 3GPUA 3VK7A 1Z5CA 2F5OA 1XNRM 3SARA 1L2CA 2OPFA 4B3TM 4NRVA 5ITXE 1Z59A 3J81S 2XZUA 4LF5M 5ITRA 4JV5M 3DOAA 3VK8A 4JI5M 4NRWA 3GPYA 5BR8M 1MX0A 4YY3M 3U6LA 3JAMS 3U6MA 4G4QA 2F5PA 3SBJA 4JI3M 3TWMA 1Q39A 3JR4A 4LFBM 2UXBM 4DR1M 3TWKA 2UU9M 4LF4M 4DV3M 3U6OA 4K0KM 4JI6M 3SAWA 3C58A 4JYAM 3U6DA 4DV5M 2F5SA 4LF6M 4NXMM 1K3XA 2HKJA 4DR3M 4JI2M 1N33M 4DV7M 1L1ZA 4X64M 2UXCM 1I94M 3U6EA 1HR0M 5ITQA
chains in the Genus database with same CATH superfamily
3K2LA 3FTEA 4LJ5A 5FTKA 3AKZA 4MH0E 1SXJB 1IXSB 1IY0A 1E32A 1ZMWA 2J7NA 3B9PA 3W68A 2DZNB 3BOSA 3U6QA 4RF0A 3I04M 3KFUG 1HT1E 2C5RA 3TQSA 1NHWC 4DR2M 2D7HA 5KPZA 5LMNM 4PT5A 2KEBA 2XSZA 2XZFA 1PRBA 4GRIA 3GLGB 2CEAA 3HHZA 1IN6A 4LF7M 1K3WA 4AQYM 2XFSA 2QP9X 4HL4A 3UK6A 4L16A 2BWBA 3FKEA 5BPVA 2R45A 1ZAEA 2R18A 1GVNA 2K9DA 3U61B 4L6V6 1PGYA 1Q3BA 1FJGM 4LJ8A 4MGKE 3GPXA 4LFCM 4YHHM 4GHLA 2F5QA 1HNZM 2EA0A 1KYIA 2A5YB 2FS1A 2KA6B 3FD9A 3FUWA 3M7GA 5E6JA 4JI0M 5ITUA 3GPPA 1PJJA 1GO5A 4FCWA 2K47A 1EFUB 2JWSA 2GNOA 3A45A 1YE9A 4D82A 3KP1E 1JQJC 3LQRA 5KPRA 3GQ4A 2WSEF 1PM5A 2RGOA 4LF8M 5E26A 4I81A 4P17A 1T43A 2JP7A 3J7AS 3HU1A 3CF2A 4RNAA 4B7FA 3MJ5A 2WZJA 4LRTA 5IWAM 1NY6A 2LTUA 3KOXE 1N34M 4GKKM 3HZJA 5FTLA 5H37D 3M0EA 2EO2A 2K0BX 2JNHA 1TH2A 2DVWB 1SXJD 2JY7A 3U60A 2G5GX 3THGA 4B3RM 1IM2A 2V6ZM 2FOIC 1IY2A 4R71A 2VF7A 2JZ1A 2XGNA 3I01M 3Q8GA 4XK8F 2MROB 5EXSA 4DV6M 4G4NA 3GRVA 4LY6A 3E46A 2BWEA 4CIZA 3VKHA 2KNVA 2DI0A 1N36M 1YSYA 2Z4SA 1IBMM 1N32M 3K8ZA 1IN4A 1XHBA 3HU2A 4ITQA 4KODA 1Z5AA 2DENA 4GEWA 3H4JA 5C18A 1J09A 3SARA 3R9XB 4B3TM 4NRVA 3HY5A 2QQ8A 3KDSE 2KNAA 2Y0TA 1T6OA 1ZQ9A 3DOAA 2C98A 3HJQA 4EIWA 4L78A 1MX0A 3RGPA 3U6MA 4GHAA 4G4QA 1DO0A 3HJSA 2UXBM 4IBFA 3VKGA 3LVWA 3QAUA 4GITA 2R65A 3KOYE 2QZ4A 2I7PA 2QBYB 3TE6A 2L4FA 2XH9A 3KS8A 1XWIA 4IBDA 2L7IA 2CRUA 3GLFE 3E21A 2J5YA 1G8PA 4JI6M 4NL4H 3L2AA 1NO1A 4F1IA 1Y8GA 3DFZA 2FFJA 4FCTA 1NHGC 1QYRA 1AUAA 3L27A 4IBKA 4M0DA 3PFIA 4JI2M 3LCUA 2CP8A 3MMPA 1T3TA 2QENA 4LZZA 4DV7M 1V33A 1JR3A 2QCUA 1L1ZA 1V92A 4X64M 1DGGA 2JZ0A 1I94M 3U6EA 1HR0M 4JI7M 2L6OA 1OQYA 4GH9A 1HNWM 3HKPA 2L7HA 2C96A 1HT2E 1GJSA 3U5ZA 1QANA 3EIEA 3SHFA 3PVSA 1HQCA 1XB2B 2CWBA 3C3EA 3FRHA 2G3QA 2MJ5B 5FTJA 3GLGA 5IT9S 2YNMD 1W5SA 1QUTA 3ZCBB 3AL0C 1TH3A 2X8AA 1DGFA 2KDLA 5ITYA 4GMQA 3GP1A 3FTFA 1VEGA 4LCBA 2DHRA 4LF9M 2DAKA 3AFHA 3GRYA 2LHGA 1XNQM 2BJVA 4NXNM 4DR5M 5KQDA 5EP4A 3GLFB 4HEOA 4JI1M 5KPTA 2L4EA 1OIPA 1S3SA 4B3SM 2HL7A 4WURA 4WP2A 1D2NA 1WHCA 4MGYE 1G41A 4LFAM 3CF6E 3OTOM 3KP0E 1IN8A 4KO8A 4Q7JA 4FW9A 3GO8A 3R8FA 4CGYB 2CV2A 3FUXA 4QNRA 1QAOA 2C9CA 1TF0B 2D7EA 1G71A 4LJ7A 1MU5A 2R44A 3RGSA 2YFQA 1TDHA 3MHVC 2JY6B 2XF3A 1OTRA 2K6BA 1DGBA 2KRKA 3KW6A 4OVZB 4B7GA 2CFOA 2MH8A 4DV1M 2DAMA 2DWZB 3FUUA 1XMQM 4AKHA 4CISA 1HJPA 1MJGM 2P5TA 4G4RA 1W5TA 1DV0A 3AV0A 3LCVB 1ZMUA 3LQQA 1Q3CA 2O01F 3FUTA 4X62M 4I4LA 4FVMA 5A2QS 1DGHB 1Z5BA 4X66M 2DAGA 4LJ4A 3SC3A 1HNXM 3T38A 2JXNA 2RRUA 4B7HA 1N78A 4B3MM 3HU3A 5ITTA 1SXJA 1QVRA 1G59A 3SASA 4D81A 3SATA 2ZANA 2ZBKB 3JR5A 4DR6M 3GRRA 5FTNA 4KHPM 4BB9A 1UFZA 2EKKA 1L2CA 2BJWA 3DZDA 4IBGA 5ITXE 3J81S 1V34A 2APLA 2XZUA 4LF5M 3IG8A 4JI5M 1OFHA 4M9XA 3GPYA 5BR8M 1F4IA 3JAMS 1L8QA 1X37A 2HAKA 4G3OA 1Q39A 2LVNC 3D8LA 4JI3M 7CATA 2DWLA 4TUWA 1SG9A 3L29A 2OOAA 3PNVA 3VFDA 4DV3M 3U6OA 2EJSA 4LF4M 4I8OA 2H1RA 3ZH9B 4LZJA 1NY5A 2I7NA 4DV5M 1XXHB 4MGZE 1H6UA 5DNYA 3KSXA 1K3XA 2HKJA 2MR9A 3GLHB 4DR3M 3J27B 1QAMA 1VG5A 4AI6A 3HX3A 2JY8A 2LVAA 3ZQJA 3V76A 2UXCM 2R0IA 1LV7A 1QAQA 2WSCF 3NWLA 1ORYB 4IBCA 1VQ1A 4MM3B 1HQYE 5ITXA 3K1JA 3BXWA 2DZLA 2XEPA 2Y21A 5EQTA 4QHTA 3U6PA 2UUAM 1YUBA 5FLXS 2Q2EB 2C99A 4M9ZA 2CE7A 2XFTA 4MGHA 2ERCA 1WIVA 4LG2A 2DAIA 4IIWA 4F2LA 4DUYM 1WXQA 3KS4A 2JUJA 3SAUA 1SXJC 4FWDA 2F4VM 4QHSA 1PJSA 1PJIA 1E9SA 1R4GA 3GQ5A 4PD2A 4OX9M 5KQ8A 4FWGA 4AKIA 1Z6TA 1KFVA 2KHHA 4LJAA 4PCZA 4AG5A 4PDGA 1XMOM 3B7QA 3B7ZA 2Z4RA 4MB7A 2UUBM 3SAVA 4RKUF 2HHHM 3T1YM 4BLCA 4II7A 4XBOA 2LXEA 5GKNA 3VK7A 1OIZA 4P16A 2KXEA 4DV0M 1VDDA 2KNZA 1TR8A 3B7NA 2VQEM 3FTDA 1D0MA 4XGIA 1K82A 1NV8A 1L2BA 2QNJA 4OVZA 1EE8A 2AHMA 3PNYA 3J2PB 4ZPXA 3W0LB 1TDZA 1GL6A 4MGIE 3FE3A 1VEKA 3SMSA 2DWNA 2L09A 4GKJM 2OQ4A 4JN6A 3W0FA 1OJLA 5EJCA 1A5TA 3GLIA 4LJ6A 4LGYA 5FSWA 1R2ZA 4G4OA 4R3DA 1IBKM 2ZAOA 3GLHA 2N35A 4BBAA 1RU3A 3J80S 2E5LM 5EXPA 1SXJE 3MK6A 2KW0A 1LTMA 2CV1A 4OW0A 1G3IA 1VEJA 2M60A 2UUCM 1IN5A 1DO2A 1D0LA 1G4AE 2EKFA 2XLJA 2B3TA 1QDTA 1ZV1A 4NSRA 4RF1A 3UGJA 4LJ9A 2X49A 2YQZA 2FE8A 2LWXA 4QOSA 1QUSA 5C1BA 3I51A 1GABA 2DZOB 1C1KA 3LVVA 4CHTB 1J5EM 5EXXA 2F5NA 2ZAMA 1QQWA 2J7OA 2MGWA 3GPUA 1OKSA 1Z5CA 2BNKA 1PJQA 3SYLA 1WJ7A 2DNAA 4UN2B 3UJNA 1P3QQ 5EP1A 4OU7A 1Z59A 4NSOB 4R7GA 4FCVA 3IECA 3K9PA 3VK8A 1NSFA 3SFZA 4NRWA 2CV0A 2Z3XA 1PJTA 4A3VB 3FRIA 2NQ8C 3SBJA 2VDBB 4FWHA 2LHCA 3TWMA 3B74A 1TTEA 2HWJA 1GL7A 1EIJA 2KZUA 3I4VA 3WHKA 4L15A 1XXHA 3KOWE 3QWLA 3GLIE 4L4UA 1R7RA 4CJ6A 2ZTCA 3BBZA 2LVOC 3U6DA 4M9SA 2WSFF 2OO9A 3QYEA 2F5SA 1UM8A 2KZSA 4LF6M 1QZMA 4NXMM 2DHYA 5IZ7D 2RGHA 3CTWB 4GIPA 1N33M 2VF8A 1GLNA 3TPZA 4L8RC 1WR1B 5EP2A 2H5XA 2KRUA 4IJFA 4Z6YA 2L2DA 3AOEC 3W67A 4FD2A 2ZTDA 4NOOB 2LVQD 3TL4X 3FTCA 3KVWA 2D7GA 4W5WA 3M6AA 5ITQA 2UU9M 3GLIB 2RKOA 3B89A 3U6SA 1CUKA 4KLNA 4KT0F 3QYBA 3TWLA 2JY5A 3CGWA 3F92A 2OOBA 3HGIA 4G6ZA 4QNMA 4HLQA 4GC9A 3RE8A 3ZC7B 5FTMA 3L28A 1IXSA 4PDIA 3VDPA 4DBGB 2LVPC 1IFYA 1DGHA 2ZM6M 3K9OA 2C9OA 1IBLM 2QHOB 2VQFM 4DV2M 1JR3E 3HJ8A 3WHLA 1NNUC 4Y28F 1MN3A 1QZEA 2X4AA 3GLHE 3I4YA 4LRSA 1OFIA 1IY1A 2LH0A 3T1HM 1XXHE 3IG5A 1WGLA 3A46A 2R4JA 2XSZD 2QBYA 2R62A 3D8BA 1ZMVA 3SMPA 1AIPC 1GJTA 2GQFA 4M0WA 3VDUA 3VLFB 1C7YA 2V1UA 3PXGA 3AOEA 2FNAA 1FNNA 5KO3A 1R5LA 1TH4A 2LBCA 1IQPA 3C9PA 1E9RA 2DWMA 3U6CA 4DV4M 3FYCA 2V1CA 2HCBA 2R6FA 2CHVA 3FYDA 1NV9A 3Q8XA 1TGUA 3L26A 3LW5F 2JA2A 2R46A 3LMMA 2W82A 4REZA 4WW0A 2FH0A 3CF0A 4S12A 5DYIA 1BVSA 1OAIA 3U5ZB 4NC6A 2YR0A 4IBJA 2UXDM 3UMMA 4GC5A 4ANRA 3EIHA 1D0KA 1VDLA 1OAOC 3ILKA 1J7KA 2CUZA 3H4MA 4IBIA 4B08A 4X65M 2Y20A 1XC8A 4JXJA 2DKLA 3UZUA 3KOZE 3GQ3A 5DFLA 3GLGE 2G8LA 5EP3A 4Z8XA 4AZFA 3J7BA 3U60B 4DUZM 1GKIA 1R2YA 4JI4M 5DYGA 1NNJA 4DR4M 3RFWA 2EUCA 4DR7M 2CHQA 3C3DA 4LGMA 3U61A 1L2DA 5LMUM 1NVMA 1L1TA 1NJFA 3A42A 3E4RA 1R6BX 3GLFA 5IREB 3FUVA 4JI8M 3A98B 3IHPA 2F5OA 1XNRM 1IN7A 2OPFA 4AG6A 2O25A 3T6PA 3GRUA 4JV5M 5ITRA 1KSFX 1IXZA 3T15A 1NJGA 3NBXX 5EXTA 3U6LA 3AJIB 2VIIA 4YY3M 2R4EA 4QOZC 2Z7JA 3AOGA 4D80A 2F5PA 3JR4A 4LFBM 5JI3E 1E94E 4IJEA 5L8RF 4AW4A 3TWKA 4DR1M 1JB0F 1WGNA 1QDRA 2CHGA 4IBBA 2M5ZA 4K0KM 2QSFX 3NBIA 2LNHC 1IXRC 8CATA 2QPAA 1N75A 3SAWA 1JR3D 3C58A 4IBEA 4JYAM 2O5RA 3DA1A 2Z8YM 1I4WA 1YLAA 4AKGA 3HWSA 3HHWA 3L25A 3KSJA 3HHXA 1N77A 3KXEC 3HHYA 3SYKA 2DXIA 2Y0QA 4I5SA 5JI2E 3SHGB 5F3WA 1Q02A 3K92A 2DAEA 3E9SA
chains in the Genus database with same CATH topology
3K2LA 3FTEA 4LJ5A 5FTKA 3AKZA 4MH0E 1SXJB 1IXSB 1IY0A 1E32A 2J7NA 3U6QA 3B9PA 2DZNB 3BOSA 4RF0A 3KFUG 1HT1E 2C5RA 3TQSA 1NHWC 4DR2M 5KPZA 5LMNM 4PT5A 2KEBA 2XSZA 2XZFA 4GRIA 3GLGB 2CEAA 3HHZA 1IN6A 4LF7M 1K3WA 4AQYM 2XFSA 2QP9X 4HL4A 3UK6A 4L16A 5BPVA 3FKEA 2R45A 1ZAEA 2R18A 1GVNA 3U61B 1FJGM 1Q3BA 4LJ8A 4MGKE 3GPXA 4LFCM 4YHHM 4GHLA 2F5QA 1HNZM 2EA0A 1KYIA 2A5YB 2KA6B 3FD9A 3FUWA 3M7GA 5E6JA 4JI0M 5ITUA 3GPPA 1PJJA 4FCWA 2K47A 3A45A 1YE9A 4D82A 3KP1E 1JQJC 3LQRA 5KPRA 3GQ4A 1PM5A 2RGOA 4LF8M 5E26A 4I81A 3J7AS 3HU1A 3CF2A 4RNAA 4B7FA 3MJ5A 5IWAM 4LRTA 1NY6A 1N34M 3KOXE 4GKKM 5FTLA 5H37D 3M0EA 2EO2A 1TH2A 2DVWB 1SXJD 3U60A 2G5GX 3THGA 4B3RM 1IM2A 2V6ZM 2FOIC 1IY2A 2XGNA 5EXSA 4DV6M 4G4NA 3GRVA 4LY6A 3VKHA 1N36M 1YSYA 2Z4SA 1IBMM 1N32M 3K8ZA 1IN4A 1XHBA 3HU2A 4ITQA 4KODA 1Z5AA 5C18A 1J09A 3SARA 3R9XB 4B3TM 4NRVA 3KDSE 2Y0TA 3DOAA 1ZQ9A 3HJQA 2C98A 4EIWA 3U6MA 4L78A 1MX0A 3RGPA 4GHAA 4G4QA 1DO0A 3HJSA 2UXBM 4IBFA 3VKGA 3LVWA 3QAUA 4GITA 2R65A 3KOYE 2QZ4A 2I7PA 2QBYB 3TE6A 2XH9A 3KS8A 1XWIA 4IBDA 2L7IA 4JI6M 1G8PA 4NL4H 3L2AA 3DFZA 2FFJA 4FCTA 1NHGC 1QYRA 3L27A 4IBKA 4M0DA 3PFIA 4JI2M 1T3TA 2QENA 4LZZA 4DV7M 1JR3A 2QCUA 1L1ZA 4X64M 1DGGA 1I94M 3U6EA 1HR0M 4JI7M 2L6OA 4GH9A 1HNWM 3HKPA 2L7HA 2C96A 1HT2E 3U5ZA 1QANA 3EIEA 3SHFA 3PVSA 1HQCA 3GLGA 5FTJA 5IT9S 2YNMD 1W5SA 3ZCBB 3AL0C 1TH3A 2X8AA 1DGFA 5ITYA 3GP1A 4GMQA 3FTFA 4LCBA 2DHRA 4LF9M 3AFHA 3GRYA 1XNQM 2BJVA 4NXNM 4DR5M 5KQDA 5EP4A 3GLFB 4JI1M 5KPTA 1S3SA 4B3SM 2HL7A 4WURA 1D2NA 4MGYE 1G41A 4LFAM 3CF6E 3OTOM 3KP0E 1IN8A 4KO8A 3R8FA 4FW9A 3GO8A 4CGYB 2CV2A 3FUXA 4QNRA 1QAOA 2C9CA 2D7EA 4LJ7A 1MU5A 3RGSA 2YFQA 1TDHA 3MHVC 2XF3A 1DGBA 2KRKA 3KW6A 4OVZB 4B7GA 2CFOA 4DV1M 2DWZB 3FUUA 1XMQM 4AKHA 4CISA 2P5TA 4G4RA 1W5TA 3AV0A 3LQQA 1Q3CA 3FUTA 4X62M 4I4LA 4FVMA 5A2QS 1DGHB 1Z5BA 4X66M 4LJ4A 3SC3A 1HNXM 3T38A 1N78A 4B7HA 4B3MM 3HU3A 5ITTA 1SXJA 1QVRA 1G59A 3SASA 4D81A 3SATA 2ZANA 2ZBKB 3JR5A 4DR6M 3GRRA 5FTNA 4KHPM 4BB9A 1L2CA 2BJWA 3DZDA 4IBGA 5ITXE 3J81S 2XZUA 4LF5M 3IG8A 4JI5M 1OFHA 4M9XA 3GPYA 5BR8M 3JAMS 1L8QA 1X37A 4JI3M 7CATA 1Q39A 3D8LA 4TUWA 2DWLA 3L29A 4LF4M 3PNVA 3VFDA 4DV3M 3U6OA 4I8OA 2H1RA 3ZH9B 4LZJA 1NY5A 2I7NA 4DV5M 1XXHB 4MGZE 1H6UA 5DNYA 3KSXA 1K3XA 2HKJA 3GLHB 4DR3M 3J27B 1QAMA 4AI6A 2UXCM 1LV7A 1QAQA 3NWLA 4MM3B 1ORYB 4IBCA 1HQYE 5ITXA 3K1JA 2XEPA 2Y21A 5EQTA 4QHTA 3U6PA 2UUAM 1YUBA 5FLXS 2Q2EB 2C99A 4M9ZA 2CE7A 2XFTA 4MGHA 2ERCA 4LG2A 4IIWA 4DUYM 1WXQA 3KS4A 3SAUA 1SXJC 4FWDA 2F4VM 4QHSA 1PJIA 1E9SA 3GQ5A 4PD2A 4OX9M 5KQ8A 4FWGA 4AKIA 1Z6TA 1KFVA 4PCZA 4LJAA 4AG5A 4PDGA 1XMOM 2Z4RA 4MB7A 2UUBM 3SAVA 2HHHM 3T1YM 4BLCA 4II7A 4XBOA 2LXEA 5GKNA 4P16A 2KXEA 4DV0M 1VDDA 2VQEM 3FTDA 4XGIA 1K82A 1L2BA 4OVZA 1EE8A 2AHMA 3PNYA 3J2PB 4ZPXA 3W0LB 1TDZA 1GL6A 4MGIE 3SMSA 2DWNA 2L09A 4GKJM 2OQ4A 4JN6A 3W0FA 1OJLA 5EJCA 3GLIA 4LJ6A 4LGYA 5FSWA 1R2ZA 4G4OA 4R3DA 1IBKM 2ZAOA 3GLHA 4BBAA 3J80S 2E5LM 5EXPA 1SXJE 3MK6A 2KW0A 2CV1A 4OW0A 1G3IA 2M60A 2UUCM 1IN5A 1DO2A 1G4AE 2XLJA 4NSRA 4RF1A 3UGJA 4LJ9A 2X49A 2YQZA 2FE8A 2LWXA 4QOSA 5C1BA 3I51A 2DZOB 3LVVA 1C1KA 4CHTB 1J5EM 5EXXA 2F5NA 2ZAMA 1QQWA 2J7OA 3GPUA 3VK7A 1Z5CA 2BNKA 3SYLA 3UJNA 5EP1A 4OU7A 1Z59A 4NSOB 4R7GA 4FCVA 3VK8A 1NSFA 3SFZA 4NRWA 2CV0A 2Z3XA 4A3VB 2NQ8C 3SBJA 3TWMA 4FWHA 1GL7A 2KZUA 3I4VA 3WHKA 4L15A 1XXHA 3KOWE 3QWLA 4L4UA 1R7RA 3U6DA 4M9SA 2F5SA 1UM8A 2KZSA 4LF6M 1QZMA 4NXMM 5IZ7D 2RGHA 3CTWB 4GIPA 1N33M 4L8RC 1GLNA 3TPZA 5EP2A 2KRUA 4IJFA 4Z6YA 3AOEC 4FD2A 4NOOB 3TL4X 3FTCA 3KVWA 2D7GA 4W5WA 3M6AA 5ITQA 2UU9M 3GLIB 2RKOA 3U6SA 4KLNA 3TWLA 4G6ZA 3HGIA 4QNMA 4HLQA 4GC9A 3RE8A 3ZC7B 5FTMA 3L28A 4PDIA 3VDPA 1DGHA 2ZM6M 2C9OA 1IBLM 2VQFM 4DV2M 3HJ8A 3WHLA 1NNUC 2X4AA 3I4YA 4LRSA 1OFIA 1IY1A 2LH0A 3T1HM 3IG5A 3A46A 2R4JA 2XSZD 2QBYA 2R62A 3D8BA 3SMPA 3VLFB 4M0WA 3VDUA 2V1UA 3PXGA 3AOEA 2FNAA 1FNNA 5KO3A 1TH4A 1IQPA 1E9RA 2DWMA 3U6CA 4DV4M 3FYCA 2V1CA 2HCBA 3FYDA 2CHVA 3Q8XA 3L26A 1TGUA 2JA2A 2R46A 3LMMA 2W82A 4REZA 4WW0A 5DYIA 3CF0A 4S12A 3U5ZB 2YR0A 4IBJA 2UXDM 3UMMA 4GC5A 3EIHA 3ILKA 4B08A 1J7KA 2CUZA 3H4MA 4IBIA 4X65M 1XC8A 2Y20A 4JXJA 3UZUA 3KOZE 3GQ3A 2G8LA 5EP3A 4Z8XA 4AZFA 3J7BA 3U60B 4DUZM 1GKIA 1R2YA 4JI4M 5DYGA 1NNJA 4DR4M 3RFWA 2EUCA 4DR7M 2CHQA 3U61A 4LGMA 1L2DA 5LMUM 1NVMA 1L1TA 1NJFA 3A42A 3E4RA 1R6BX 3GLFA 5IREB 3FUVA 4JI8M 3A98B 2F5OA 1XNRM 1IN7A 2OPFA 4AG6A 3GRUA 4JV5M 5ITRA 1KSFX 1IXZA 3T15A 1NJGA 5EXTA 3U6LA 3AJIB 2VIIA 4YY3M 2R4EA 4QOZC 2Z7JA 3AOGA 4D80A 2F5PA 3JR4A 4LFBM 5JI3E 1E94E 4IJEA 4DR1M 4AW4A 3TWKA 2CHGA 4IBBA 2M5ZA 4K0KM 3NBIA 2LNHC 1IXRC 8CATA 2QPAA 1N75A 3SAWA 1JR3D 3C58A 4IBEA 4JYAM 2O5RA 3DA1A 1I4WA 4AKGA 3HWSA 3HHWA 3L25A 3KSJA 3HHXA 1N77A 3KXEC 3HHYA 3SYKA 2DXIA 2Y0QA 4I5SA 5JI2E 3SHGB 5F3WA 3K92A 2D7HA 3E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW M;  5ITX A;  3U6S A;  3U6Q A;  3U6P A;  2UUA M;  3TWL A;  5FLX S;  2Q2E B;  5IT9 S;  4DR2 M;  5LMN M;  4PDI A;  5ITY A;  3GP1 A;  2XZF A;  4JI7 M;  2ZM6 M;  4DUY M;  3SAU A;  1IBL M;  1K3W A;  4LF7 M;  4LF9 M;  4AQY M;  2F4V M;  2VQF M;  4DV2 M;  1PJI A;  1XNQ M;  4NXN M;  3GQ5 A;  4DR5 M;  4PD2 A;  1Q3B A;  4JI1 M;  3GPX A;  4OX9 M;  1FJG M;  3T1H M;  4YHH M;  1KFV A;  4LFC M;  4PCZ A;  2F5Q A;  4PDG A;  1HNZ M;  1XMO M;  4B3S M;  3A46 A;  2EA0 A;  4MB7 A;  3GPP A;  2UUB M;  5ITU A;  3SAV A;  4JI0 M;  1PJJ A;  2HHH M;  3T1Y M;  4LFA M;  3OTO M;  3GO8 A;  3A45 A;  4DV0 M;  1PM5 A;  3GQ4 A;  2VQE M;  4LF8 M;  1K82 A;  1MU5 A;  1L2B A;  3J7A S;  1EE8 A;  3U6C A;  1TDH A;  4DV4 M;  1TDZ A;  5IWA M;  4GKK M;  1N34 M;  4GKJ M;  2OQ4 A;  3W0F A;  4DV1 M;  1XMQ M;  4CIS A;  1R2Z A;  4G4O A;  1IBK M;  4G4R A;  2UXD M;  3J80 S;  2E5L M;  1Q3C A;  4X62 M;  4B3R M;  4X65 M;  1XC8 A;  2UUC M;  5A2Q S;  1Z5B A;  4X66 M;  3GQ3 A;  1HNX M;  4DUZ M;  1R2Y A;  4B3M M;  4JI4 M;  4DV6 M;  5ITT A;  1NNJ A;  3SAS A;  4G4N A;  4DR4 M;  4DR7 M;  1L2D A;  3SAT A;  5LMU M;  2ZBK B;  1L1T A;  3JR5 A;  4DR6 M;  1N36 M;  3A42 A;  1J5E M;  1IBM M;  1N32 M;  4ITQ A;  4JI8 M;  4KHP M;  1Z5A A;  2F5N A;  3GPU A;  3VK7 A;  1Z5C A;  2F5O A;  1XNR M;  3SAR A;  1L2C A;  2OPF A;  4B3T M;  4NRV A;  5ITX E;  1Z59 A;  3J81 S;  2XZU A;  4LF5 M;  5ITR A;  4JV5 M;  3DOA A;  3VK8 A;  4JI5 M;  4NRW A;  3GPY A;  5BR8 M;  1MX0 A;  4YY3 M;  3U6L A;  3JAM S;  3U6M A;  4G4Q A;  2F5P A;  3SBJ A;  4JI3 M;  3TWM A;  1Q39 A;  3JR4 A;  4LFB M;  2UXB M;  4DR1 M;  3TWK A;  2UU9 M;  4LF4 M;  4DV3 M;  3U6O A;  4K0K M;  4JI6 M;  3SAW A;  3C58 A;  4JYA M;  3U6D A;  4DV5 M;  2F5S A;  4LF6 M;  4NXM M;  1K3X A;  2HKJ A;  4DR3 M;  4JI2 M;  1N33 M;  4DV7 M;  1L1Z A;  4X64 M;  2UXC M;  1I94 M;  3U6E A;  1HR0 M;  5ITQ A; 
#chains in the Genus database with same CATH topology
 3K2L A;  3FTE A;  4LJ5 A;  5FTK A;  3AKZ A;  4MH0 E;  1SXJ B;  1IXS B;  1IY0 A;  1E32 A;  1ZMW A;  2J7N A;  3B9P A;  3W68 A;  2DZN B;  3BOS A;  3U6Q A;  4RF0 A;  3I04 M;  3KFU G;  1HT1 E;  2C5R A;  3TQS A;  1NHW C;  4DR2 M;  2D7H A;  5KPZ A;  5LMN M;  4PT5 A;  2KEB A;  2XSZ A;  2XZF A;  1PRB A;  4GRI A;  3GLG B;  2CEA A;  3HHZ A;  1IN6 A;  4LF7 M;  1K3W A;  4AQY M;  2XFS A;  2QP9 X;  4HL4 A;  3UK6 A;  4L16 A;  2BWB A;  3FKE A;  5BPV A;  2R45 A;  1ZAE A;  2R18 A;  1GVN A;  2K9D A;  3U61 B;  4L6V 6;  1PGY A;  1Q3B A;  1FJG M;  4LJ8 A;  4MGK E;  3GPX A;  4LFC M;  4YHH M;  4GHL A;  2F5Q A;  1HNZ M;  2EA0 A;  1KYI A;  2A5Y B;  2FS1 A;  2KA6 B;  3FD9 A;  3FUW A;  3M7G A;  5E6J A;  4JI0 M;  5ITU A;  3GPP A;  1PJJ A;  1GO5 A;  4FCW A;  2K47 A;  1EFU B;  2JWS A;  2GNO A;  3A45 A;  1YE9 A;  4D82 A;  3KP1 E;  1JQJ C;  3LQR A;  5KPR A;  3GQ4 A;  2WSE F;  1PM5 A;  2RGO A;  4LF8 M;  5E26 A;  4I81 A;  4P17 A;  1T43 A;  2JP7 A;  3J7A S;  3HU1 A;  3CF2 A;  4RNA A;  4B7F A;  3MJ5 A;  2WZJ A;  4LRT A;  5IWA M;  1NY6 A;  2LTU A;  3KOX E;  1N34 M;  4GKK M;  3HZJ A;  5FTL A;  5H37 D;  3M0E A;  2EO2 A;  2K0B X;  2JNH A;  1TH2 A;  2DVW B;  1SXJ D;  2JY7 A;  3U60 A;  2G5G X;  3THG A;  4B3R M;  1IM2 A;  2V6Z M;  2FOI C;  1IY2 A;  4R71 A;  2VF7 A;  2JZ1 A;  2XGN A;  3I01 M;  3Q8G A;  4XK8 F;  2MRO B;  5EXS A;  4DV6 M;  4G4N A;  3GRV A;  4LY6 A;  3E46 A;  2BWE A;  4CIZ A;  3VKH A;  2KNV A;  2DI0 A;  1N36 M;  1YSY A;  2Z4S A;  1IBM M;  1N32 M;  3K8Z A;  1IN4 A;  1XHB A;  3HU2 A;  4ITQ A;  4KOD A;  1Z5A A;  2DEN A;  4GEW A;  3H4J A;  5C18 A;  1J09 A;  3SAR A;  3R9X B;  4B3T M;  4NRV A;  3HY5 A;  2QQ8 A;  3KDS E;  2KNA A;  2Y0T A;  1T6O A;  1ZQ9 A;  3DOA A;  2C98 A;  3HJQ A;  4EIW A;  4L78 A;  1MX0 A;  3RGP A;  3U6M A;  4GHA A;  4G4Q A;  1DO0 A;  3HJS A;  2UXB M;  4IBF A;  3VKG A;  3LVW A;  3QAU A;  4GIT A;  2R65 A;  3KOY E;  2QZ4 A;  2I7P A;  2QBY B;  3TE6 A;  2L4F A;  2XH9 A;  3KS8 A;  1XWI A;  4IBD A;  2L7I A;  2CRU A;  3GLF E;  3E21 A;  2J5Y A;  1G8P A;  4JI6 M;  4NL4 H;  3L2A A;  1NO1 A;  4F1I A;  1Y8G A;  3DFZ A;  2FFJ A;  4FCT A;  1NHG C;  1QYR A;  1AUA A;  3L27 A;  4IBK A;  4M0D A;  3PFI A;  4JI2 M;  3LCU A;  2CP8 A;  3MMP A;  1T3T A;  2QEN A;  4LZZ A;  4DV7 M;  1V33 A;  1JR3 A;  2QCU A;  1L1Z A;  1V92 A;  4X64 M;  1DGG A;  2JZ0 A;  1I94 M;  3U6E A;  1HR0 M;  4JI7 M;  2L6O A;  1OQY A;  4GH9 A;  1HNW M;  3HKP A;  2L7H A;  2C96 A;  1HT2 E;  1GJS A;  3U5Z A;  1QAN A;  3EIE A;  3SHF A;  3PVS A;  1HQC A;  1XB2 B;  2CWB A;  3C3E A;  3FRH A;  2G3Q A;  2MJ5 B;  5FTJ A;  3GLG A;  5IT9 S;  2YNM D;  1W5S A;  1QUT A;  3ZCB B;  3AL0 C;  1TH3 A;  2X8A A;  1DGF A;  2KDL A;  5ITY A;  4GMQ A;  3GP1 A;  3FTF A;  1VEG A;  4LCB A;  2DHR A;  4LF9 M;  2DAK A;  3AFH A;  3GRY A;  2LHG A;  1XNQ M;  2BJV A;  4NXN M;  4DR5 M;  5KQD A;  5EP4 A;  3GLF B;  4HEO A;  4JI1 M;  5KPT A;  2L4E A;  1OIP A;  1S3S A;  4B3S M;  2HL7 A;  4WUR A;  4WP2 A;  1D2N A;  1WHC A;  4MGY E;  1G41 A;  4LFA M;  3CF6 E;  3OTO M;  3KP0 E;  1IN8 A;  4KO8 A;  4Q7J A;  4FW9 A;  3GO8 A;  3R8F A;  4CGY B;  2CV2 A;  3FUX A;  4QNR A;  1QAO A;  2C9C A;  1TF0 B;  2D7E A;  1G71 A;  4LJ7 A;  1MU5 A;  2R44 A;  3RGS A;  2YFQ A;  1TDH A;  3MHV C;  2JY6 B;  2XF3 A;  1OTR A;  2K6B A;  1DGB A;  2KRK A;  3KW6 A;  4OVZ B;  4B7G A;  2CFO A;  2MH8 A;  4DV1 M;  2DAM A;  2DWZ B;  3FUU A;  1XMQ M;  4AKH A;  4CIS A;  1HJP A;  1MJG M;  2P5T A;  4G4R A;  1W5T A;  1DV0 A;  3AV0 A;  3LCV B;  1ZMU A;  3LQQ A;  1Q3C A;  2O01 F;  3FUT A;  4X62 M;  4I4L A;  4FVM A;  5A2Q S;  1DGH B;  1Z5B A;  4X66 M;  2DAG A;  4LJ4 A;  3SC3 A;  1HNX M;  3T38 A;  2JXN A;  2RRU A;  4B7H A;  1N78 A;  4B3M M;  3HU3 A;  5ITT A;  1SXJ A;  1QVR A;  1G59 A;  3SAS A;  4D81 A;  3SAT A;  2ZAN A;  2ZBK B;  3JR5 A;  4DR6 M;  3GRR A;  5FTN A;  4KHP M;  4BB9 A;  1UFZ A;  2EKK A;  1L2C A;  2BJW A;  3DZD A;  4IBG A;  5ITX E;  3J81 S;  1V34 A;  2APL A;  2XZU A;  4LF5 M;  3IG8 A;  4JI5 M;  1OFH A;  4M9X A;  3GPY A;  5BR8 M;  1F4I A;  3JAM S;  1L8Q A;  1X37 A;  2HAK A;  4G3O A;  1Q39 A;  2LVN C;  3D8L A;  4JI3 M;  7CAT A;  2DWL A;  4TUW A;  1SG9 A;  3L29 A;  2OOA A;  3PNV A;  3VFD A;  4DV3 M;  3U6O A;  2EJS A;  4LF4 M;  4I8O A;  2H1R A;  3ZH9 B;  4LZJ A;  1NY5 A;  2I7N A;  4DV5 M;  1XXH B;  4MGZ E;  1H6U A;  5DNY A;  3KSX A;  1K3X A;  2HKJ A;  2MR9 A;  3GLH B;  4DR3 M;  3J27 B;  1QAM A;  1VG5 A;  4AI6 A;  3HX3 A;  2JY8 A;  2LVA A;  3ZQJ A;  3V76 A;  2UXC M;  2R0I A;  1LV7 A;  1QAQ A;  2WSC F;  3NWL A;  1ORY B;  4IBC A;  1VQ1 A;  4MM3 B;  1HQY E;  5ITX A;  3K1J A;  3BXW A;  2DZL A;  2XEP A;  2Y21 A;  5EQT A;  4QHT A;  3U6P A;  2UUA M;  1YUB A;  5FLX S;  2Q2E B;  2C99 A;  4M9Z A;  2CE7 A;  2XFT A;  4MGH A;  2ERC A;  1WIV A;  4LG2 A;  2DAI A;  4IIW A;  4F2L A;  4DUY M;  1WXQ A;  3KS4 A;  2JUJ A;  3SAU A;  1SXJ C;  4FWD A;  2F4V M;  4QHS A;  1PJS A;  1PJI A;  1E9S A;  1R4G A;  3GQ5 A;  4PD2 A;  4OX9 M;  5KQ8 A;  4FWG A;  4AKI A;  1Z6T A;  1KFV A;  2KHH A;  4LJA A;  4PCZ A;  4AG5 A;  4PDG A;  1XMO M;  3B7Q A;  3B7Z A;  2Z4R A;  4MB7 A;  2UUB M;  3SAV A;  4RKU F;  2HHH M;  3T1Y M;  4BLC A;  4II7 A;  4XBO A;  2LXE A;  5GKN A;  3VK7 A;  1OIZ A;  4P16 A;  2KXE A;  4DV0 M;  1VDD A;  2KNZ A;  1TR8 A;  3B7N A;  2VQE M;  3FTD A;  1D0M A;  4XGI A;  1K82 A;  1NV8 A;  1L2B A;  2QNJ A;  4OVZ A;  1EE8 A;  2AHM A;  3PNY A;  3J2P B;  4ZPX A;  3W0L B;  1TDZ A;  1GL6 A;  4MGI E;  3FE3 A;  1VEK A;  3SMS A;  2DWN A;  2L09 A;  4GKJ M;  2OQ4 A;  4JN6 A;  3W0F A;  1OJL A;  5EJC A;  1A5T A;  3GLI A;  4LJ6 A;  4LGY A;  5FSW A;  1R2Z A;  4G4O A;  4R3D A;  1IBK M;  2ZAO A;  3GLH A;  2N35 A;  4BBA A;  1RU3 A;  3J80 S;  2E5L M;  5EXP A;  1SXJ E;  3MK6 A;  2KW0 A;  1LTM A;  2CV1 A;  4OW0 A;  1G3I A;  1VEJ A;  2M60 A;  2UUC M;  1IN5 A;  1DO2 A;  1D0L A;  1G4A E;  2EKF A;  2XLJ A;  2B3T A;  1QDT A;  1ZV1 A;  4NSR A;  4RF1 A;  3UGJ A;  4LJ9 A;  2X49 A;  2YQZ A;  2FE8 A;  2LWX A;  4QOS A;  1QUS A;  5C1B A;  3I51 A;  1GAB A;  2DZO B;  1C1K A;  3LVV A;  4CHT B;  1J5E M;  5EXX A;  2F5N A;  2ZAM A;  1QQW A;  2J7O A;  2MGW A;  3GPU A;  1OKS A;  1Z5C A;  2BNK A;  1PJQ A;  3SYL A;  1WJ7 A;  2DNA A;  4UN2 B;  3UJN A;  1P3Q Q;  5EP1 A;  4OU7 A;  1Z59 A;  4NSO B;  4R7G A;  4FCV A;  3IEC A;  3K9P A;  3VK8 A;  1NSF A;  3SFZ A;  4NRW A;  2CV0 A;  2Z3X A;  1PJT A;  4A3V B;  3FRI A;  2NQ8 C;  3SBJ A;  2VDB B;  4FWH A;  2LHC A;  3TWM A;  3B74 A;  1TTE A;  2HWJ A;  1GL7 A;  1EIJ A;  2KZU A;  3I4V A;  3WHK A;  4L15 A;  1XXH A;  3KOW E;  3QWL A;  3GLI E;  4L4U A;  1R7R A;  4CJ6 A;  2ZTC A;  3BBZ A;  2LVO C;  3U6D A;  4M9S A;  2WSF F;  2OO9 A;  3QYE A;  2F5S A;  1UM8 A;  2KZS A;  4LF6 M;  1QZM A;  4NXM M;  2DHY A;  5IZ7 D;  2RGH A;  3CTW B;  4GIP A;  1N33 M;  2VF8 A;  1GLN A;  3TPZ A;  4L8R C;  1WR1 B;  5EP2 A;  2H5X A;  2KRU A;  4IJF A;  4Z6Y A;  2L2D A;  3AOE C;  3W67 A;  4FD2 A;  2ZTD A;  4NOO B;  2LVQ D;  3TL4 X;  3FTC A;  3KVW A;  2D7G A;  4W5W A;  3M6A A;  5ITQ A;  2UU9 M;  3GLI B;  2RKO A;  3B89 A;  3U6S A;  1CUK A;  4KLN A;  4KT0 F;  3QYB A;  3TWL A;  2JY5 A;  3CGW A;  3F92 A;  2OOB A;  3HGI A;  4G6Z A;  4QNM A;  4HLQ A;  4GC9 A;  3RE8 A;  3ZC7 B;  5FTM A;  3L28 A;  1IXS A;  4PDI A;  3VDP A;  4DBG B;  2LVP C;  1IFY A;  1DGH A;  2ZM6 M;  3K9O A;  2C9O A;  1IBL M;  2QHO B;  2VQF M;  4DV2 M;  1JR3 E;  3HJ8 A;  3WHL A;  1NNU C;  4Y28 F;  1MN3 A;  1QZE A;  2X4A A;  3GLH E;  3I4Y A;  4LRS A;  1OFI A;  1IY1 A;  2LH0 A;  3T1H M;  1XXH E;  3IG5 A;  1WGL A;  3A46 A;  2R4J A;  2XSZ D;  2QBY A;  2R62 A;  3D8B A;  1ZMV A;  3SMP A;  1AIP C;  1GJT A;  2GQF A;  4M0W A;  3VDU A;  3VLF B;  1C7Y A;  2V1U A;  3PXG A;  3AOE A;  2FNA A;  1FNN A;  5KO3 A;  1R5L A;  1TH4 A;  2LBC A;  1IQP A;  3C9P A;  1E9R A;  2DWM A;  3U6C A;  4DV4 M;  3FYC A;  2V1C A;  2HCB A;  2R6F A;  2CHV A;  3FYD A;  1NV9 A;  3Q8X A;  1TGU A;  3L26 A;  3LW5 F;  2JA2 A;  2R46 A;  3LMM A;  2W82 A;  4REZ A;  4WW0 A;  2FH0 A;  3CF0 A;  4S12 A;  5DYI A;  1BVS A;  1OAI A;  3U5Z B;  4NC6 A;  2YR0 A;  4IBJ A;  2UXD M;  3UMM A;  4GC5 A;  4ANR A;  3EIH A;  1D0K A;  1VDL A;  1OAO C;  3ILK A;  1J7K A;  2CUZ A;  3H4M A;  4IBI A;  4B08 A;  4X65 M;  2Y20 A;  1XC8 A;  4JXJ A;  2DKL A;  3UZU A;  3KOZ E;  3GQ3 A;  5DFL A;  3GLG E;  2G8L A;  5EP3 A;  4Z8X A;  4AZF A;  3J7B A;  3U60 B;  4DUZ M;  1GKI A;  1R2Y A;  4JI4 M;  5DYG A;  1NNJ A;  4DR4 M;  3RFW A;  2EUC A;  4DR7 M;  2CHQ A;  3C3D A;  4LGM A;  3U61 A;  1L2D A;  5LMU M;  1NVM A;  1L1T A;  1NJF A;  3A42 A;  3E4R A;  1R6B X;  3GLF A;  5IRE B;  3FUV A;  4JI8 M;  3A98 B;  3IHP A;  2F5O A;  1XNR M;  1IN7 A;  2OPF A;  4AG6 A;  2O25 A;  3T6P A;  3GRU A;  4JV5 M;  5ITR A;  1KSF X;  1IXZ A;  3T15 A;  1NJG A;  3NBX X;  5EXT A;  3U6L A;  3AJI B;  2VII A;  4YY3 M;  2R4E A;  4QOZ C;  2Z7J A;  3AOG A;  4D80 A;  2F5P A;  3JR4 A;  4LFB M;  5JI3 E;  1E94 E;  4IJE A;  5L8R F;  4AW4 A;  3TWK A;  4DR1 M;  1JB0 F;  1WGN A;  1QDR A;  2CHG A;  4IBB A;  2M5Z A;  4K0K M;  2QSF X;  3NBI A;  2LNH C;  1IXR C;  8CAT A;  2QPA A;  1N75 A;  3SAW A;  1JR3 D;  3C58 A;  4IBE A;  4JYA M;  2O5R A;  3DA1 A;  2Z8Y M;  1I4W A;  1YLA A;  4AKG A;  3HWS A;  3HHW A;  3L25 A;  3KSJ A;  3HHX A;  1N77 A;  3KXE C;  3HHY A;  3SYK A;  2DXI A;  2Y0Q A;  4I5S A;  5JI2 E;  3SHG B;  5F3W A;  1Q02 A;  3K92 A;  2DAE A;  3E9S A; 
#chains in the Genus database with same CATH homology
 3K2L A;  3FTE A;  4LJ5 A;  5FTK A;  3AKZ A;  4MH0 E;  1SXJ B;  1IXS B;  1IY0 A;  1E32 A;  2J7N A;  3U6Q A;  3B9P A;  2DZN B;  3BOS A;  4RF0 A;  3KFU G;  1HT1 E;  2C5R A;  3TQS A;  1NHW C;  4DR2 M;  5KPZ A;  5LMN M;  4PT5 A;  2KEB A;  2XSZ A;  2XZF A;  4GRI A;  3GLG B;  2CEA A;  3HHZ A;  1IN6 A;  4LF7 M;  1K3W A;  4AQY M;  2XFS A;  2QP9 X;  4HL4 A;  3UK6 A;  4L16 A;  5BPV A;  3FKE A;  2R45 A;  1ZAE A;  2R18 A;  1GVN A;  3U61 B;  1FJG M;  1Q3B A;  4LJ8 A;  4MGK E;  3GPX A;  4LFC M;  4YHH M;  4GHL A;  2F5Q A;  1HNZ M;  2EA0 A;  1KYI A;  2A5Y B;  2KA6 B;  3FD9 A;  3FUW A;  3M7G A;  5E6J A;  4JI0 M;  5ITU A;  3GPP A;  1PJJ A;  4FCW A;  2K47 A;  3A45 A;  1YE9 A;  4D82 A;  3KP1 E;  1JQJ C;  3LQR A;  5KPR A;  3GQ4 A;  1PM5 A;  2RGO A;  4LF8 M;  5E26 A;  4I81 A;  3J7A S;  3HU1 A;  3CF2 A;  4RNA A;  4B7F A;  3MJ5 A;  5IWA M;  4LRT A;  1NY6 A;  1N34 M;  3KOX E;  4GKK M;  5FTL A;  5H37 D;  3M0E A;  2EO2 A;  1TH2 A;  2DVW B;  1SXJ D;  3U60 A;  2G5G X;  3THG A;  4B3R M;  1IM2 A;  2V6Z M;  2FOI C;  1IY2 A;  2XGN A;  5EXS A;  4DV6 M;  4G4N A;  3GRV A;  4LY6 A;  3VKH A;  1N36 M;  1YSY A;  2Z4S A;  1IBM M;  1N32 M;  3K8Z A;  1IN4 A;  1XHB A;  3HU2 A;  4ITQ A;  4KOD A;  1Z5A A;  5C18 A;  1J09 A;  3SAR A;  3R9X B;  4B3T M;  4NRV A;  3KDS E;  2Y0T A;  3DOA A;  1ZQ9 A;  3HJQ A;  2C98 A;  4EIW A;  3U6M A;  4L78 A;  1MX0 A;  3RGP A;  4GHA A;  4G4Q A;  1DO0 A;  3HJS A;  2UXB M;  4IBF A;  3VKG A;  3LVW A;  3QAU A;  4GIT A;  2R65 A;  3KOY E;  2QZ4 A;  2I7P A;  2QBY B;  3TE6 A;  2XH9 A;  3KS8 A;  1XWI A;  4IBD A;  2L7I A;  4JI6 M;  1G8P A;  4NL4 H;  3L2A A;  3DFZ A;  2FFJ A;  4FCT A;  1NHG C;  1QYR A;  3L27 A;  4IBK A;  4M0D A;  3PFI A;  4JI2 M;  1T3T A;  2QEN A;  4LZZ A;  4DV7 M;  1JR3 A;  2QCU A;  1L1Z A;  4X64 M;  1DGG A;  1I94 M;  3U6E A;  1HR0 M;  4JI7 M;  2L6O A;  4GH9 A;  1HNW M;  3HKP A;  2L7H A;  2C96 A;  1HT2 E;  3U5Z A;  1QAN A;  3EIE A;  3SHF A;  3PVS A;  1HQC A;  3GLG A;  5FTJ A;  5IT9 S;  2YNM D;  1W5S A;  3ZCB B;  3AL0 C;  1TH3 A;  2X8A A;  1DGF A;  5ITY A;  3GP1 A;  4GMQ A;  3FTF A;  4LCB A;  2DHR A;  4LF9 M;  3AFH A;  3GRY A;  1XNQ M;  2BJV A;  4NXN M;  4DR5 M;  5KQD A;  5EP4 A;  3GLF B;  4JI1 M;  5KPT A;  1S3S A;  4B3S M;  2HL7 A;  4WUR A;  1D2N A;  4MGY E;  1G41 A;  4LFA M;  3CF6 E;  3OTO M;  3KP0 E;  1IN8 A;  4KO8 A;  3R8F A;  4FW9 A;  3GO8 A;  4CGY B;  2CV2 A;  3FUX A;  4QNR A;  1QAO A;  2C9C A;  2D7E A;  4LJ7 A;  1MU5 A;  3RGS A;  2YFQ A;  1TDH A;  3MHV C;  2XF3 A;  1DGB A;  2KRK A;  3KW6 A;  4OVZ B;  4B7G A;  2CFO A;  4DV1 M;  2DWZ B;  3FUU A;  1XMQ M;  4AKH A;  4CIS A;  2P5T A;  4G4R A;  1W5T A;  3AV0 A;  3LQQ A;  1Q3C A;  3FUT A;  4X62 M;  4I4L A;  4FVM A;  5A2Q S;  1DGH B;  1Z5B A;  4X66 M;  4LJ4 A;  3SC3 A;  1HNX M;  3T38 A;  1N78 A;  4B7H A;  4B3M M;  3HU3 A;  5ITT A;  1SXJ A;  1QVR A;  1G59 A;  3SAS A;  4D81 A;  3SAT A;  2ZAN A;  2ZBK B;  3JR5 A;  4DR6 M;  3GRR A;  5FTN A;  4KHP M;  4BB9 A;  1L2C A;  2BJW A;  3DZD A;  4IBG A;  5ITX E;  3J81 S;  2XZU A;  4LF5 M;  3IG8 A;  4JI5 M;  1OFH A;  4M9X A;  3GPY A;  5BR8 M;  3JAM S;  1L8Q A;  1X37 A;  4JI3 M;  7CAT A;  1Q39 A;  3D8L A;  4TUW A;  2DWL A;  3L29 A;  4LF4 M;  3PNV A;  3VFD A;  4DV3 M;  3U6O A;  4I8O A;  2H1R A;  3ZH9 B;  4LZJ A;  1NY5 A;  2I7N A;  4DV5 M;  1XXH B;  4MGZ E;  1H6U A;  5DNY A;  3KSX A;  1K3X A;  2HKJ A;  3GLH B;  4DR3 M;  3J27 B;  1QAM A;  4AI6 A;  2UXC M;  1LV7 A;  1QAQ A;  3NWL A;  4MM3 B;  1ORY B;  4IBC A;  1HQY E;  5ITX A;  3K1J A;  2XEP A;  2Y21 A;  5EQT A;  4QHT A;  3U6P A;  2UUA M;  1YUB A;  5FLX S;  2Q2E B;  2C99 A;  4M9Z A;  2CE7 A;  2XFT A;  4MGH A;  2ERC A;  4LG2 A;  4IIW A;  4DUY M;  1WXQ A;  3KS4 A;  3SAU A;  1SXJ C;  4FWD A;  2F4V M;  4QHS A;  1PJI A;  1E9S A;  3GQ5 A;  4PD2 A;  4OX9 M;  5KQ8 A;  4FWG A;  4AKI A;  1Z6T A;  1KFV A;  4PCZ A;  4LJA A;  4AG5 A;  4PDG A;  1XMO M;  2Z4R A;  4MB7 A;  2UUB M;  3SAV A;  2HHH M;  3T1Y M;  4BLC A;  4II7 A;  4XBO A;  2LXE A;  5GKN A;  4P16 A;  2KXE A;  4DV0 M;  1VDD A;  2VQE M;  3FTD A;  4XGI A;  1K82 A;  1L2B A;  4OVZ A;  1EE8 A;  2AHM A;  3PNY A;  3J2P B;  4ZPX A;  3W0L B;  1TDZ A;  1GL6 A;  4MGI E;  3SMS A;  2DWN A;  2L09 A;  4GKJ M;  2OQ4 A;  4JN6 A;  3W0F A;  1OJL A;  5EJC A;  3GLI A;  4LJ6 A;  4LGY A;  5FSW A;  1R2Z A;  4G4O A;  4R3D A;  1IBK M;  2ZAO A;  3GLH A;  4BBA A;  3J80 S;  2E5L M;  5EXP A;  1SXJ E;  3MK6 A;  2KW0 A;  2CV1 A;  4OW0 A;  1G3I A;  2M60 A;  2UUC M;  1IN5 A;  1DO2 A;  1G4A E;  2XLJ A;  4NSR A;  4RF1 A;  3UGJ A;  4LJ9 A;  2X49 A;  2YQZ A;  2FE8 A;  2LWX A;  4QOS A;  5C1B A;  3I51 A;  2DZO B;  3LVV A;  1C1K A;  4CHT B;  1J5E M;  5EXX A;  2F5N A;  2ZAM A;  1QQW A;  2J7O A;  3GPU A;  3VK7 A;  1Z5C A;  2BNK A;  3SYL A;  3UJN A;  5EP1 A;  4OU7 A;  1Z59 A;  4NSO B;  4R7G A;  4FCV A;  3VK8 A;  1NSF A;  3SFZ A;  4NRW A;  2CV0 A;  2Z3X A;  4A3V B;  2NQ8 C;  3SBJ A;  3TWM A;  4FWH A;  1GL7 A;  2KZU A;  3I4V A;  3WHK A;  4L15 A;  1XXH A;  3KOW E;  3QWL A;  4L4U A;  1R7R A;  3U6D A;  4M9S A;  2F5S A;  1UM8 A;  2KZS A;  4LF6 M;  1QZM A;  4NXM M;  5IZ7 D;  2RGH A;  3CTW B;  4GIP A;  1N33 M;  4L8R C;  1GLN A;  3TPZ A;  5EP2 A;  2KRU A;  4IJF A;  4Z6Y A;  3AOE C;  4FD2 A;  4NOO B;  3TL4 X;  3FTC A;  3KVW A;  2D7G A;  4W5W A;  3M6A A;  5ITQ A;  2UU9 M;  3GLI B;  2RKO A;  3U6S A;  4KLN A;  3TWL A;  4G6Z A;  3HGI A;  4QNM A;  4HLQ A;  4GC9 A;  3RE8 A;  3ZC7 B;  5FTM A;  3L28 A;  4PDI A;  3VDP A;  1DGH A;  2ZM6 M;  2C9O A;  1IBL M;  2VQF M;  4DV2 M;  3HJ8 A;  3WHL A;  1NNU C;  2X4A A;  3I4Y A;  4LRS A;  1OFI A;  1IY1 A;  2LH0 A;  3T1H M;  3IG5 A;  3A46 A;  2R4J A;  2XSZ D;  2QBY A;  2R62 A;  3D8B A;  3SMP A;  3VLF B;  4M0W A;  3VDU A;  2V1U A;  3PXG A;  3AOE A;  2FNA A;  1FNN A;  5KO3 A;  1TH4 A;  1IQP A;  1E9R A;  2DWM A;  3U6C A;  4DV4 M;  3FYC A;  2V1C A;  2HCB A;  3FYD A;  2CHV A;  3Q8X A;  3L26 A;  1TGU A;  2JA2 A;  2R46 A;  3LMM A;  2W82 A;  4REZ A;  4WW0 A;  5DYI A;  3CF0 A;  4S12 A;  3U5Z B;  2YR0 A;  4IBJ A;  2UXD M;  3UMM A;  4GC5 A;  3EIH A;  3ILK A;  4B08 A;  1J7K A;  2CUZ A;  3H4M A;  4IBI A;  4X65 M;  1XC8 A;  2Y20 A;  4JXJ A;  3UZU A;  3KOZ E;  3GQ3 A;  2G8L A;  5EP3 A;  4Z8X A;  4AZF A;  3J7B A;  3U60 B;  4DUZ M;  1GKI A;  1R2Y A;  4JI4 M;  5DYG A;  1NNJ A;  4DR4 M;  3RFW A;  2EUC A;  4DR7 M;  2CHQ A;  3U61 A;  4LGM A;  1L2D A;  5LMU M;  1NVM A;  1L1T A;  1NJF A;  3A42 A;  3E4R A;  1R6B X;  3GLF A;  5IRE B;  3FUV A;  4JI8 M;  3A98 B;  2F5O A;  1XNR M;  1IN7 A;  2OPF A;  4AG6 A;  3GRU A;  4JV5 M;  5ITR A;  1KSF X;  1IXZ A;  3T15 A;  1NJG A;  5EXT A;  3U6L A;  3AJI B;  2VII A;  4YY3 M;  2R4E A;  4QOZ C;  2Z7J A;  3AOG A;  4D80 A;  2F5P A;  3JR4 A;  4LFB M;  5JI3 E;  1E94 E;  4IJE A;  4DR1 M;  4AW4 A;  3TWK A;  2CHG A;  4IBB A;  2M5Z A;  4K0K M;  3NBI A;  2LNH C;  1IXR C;  8CAT A;  2QPA A;  1N75 A;  3SAW A;  1JR3 D;  3C58 A;  4IBE A;  4JYA M;  2O5R A;  3DA1 A;  1I4W A;  4AKG A;  3HWS A;  3HHW A;  3L25 A;  3KSJ A;  3HHX A;  1N77 A;  3KXE C;  3HHY A;  3SYK A;  2DXI A;  2Y0Q A;  4I5S A;  5JI2 E;  3SHG B;  5F3W A;  3K92 A;  2D7H A;  3E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...