4K0KM

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4k0kM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4k0kM02
2UUBM 4G4RA 4B3TM 1R2ZA 4DUZM 4DUYM 1N33M 3T1HM 4JI0M 1K3WA 5ITQA 2F5OA 4CISA 3U6PA 3U6SA 4DV4M 4JI5M 1IBKM 2UXCM 2UXBM 4DR4M 4DV6M 3W0FA 3SATA 3GPYA 4DV0M 4G4QA 3SARA 2UU9M 2F5QA 4KHPM 4LF9M 1EE8A 4DR2M 3OTOM 4LF8M 1Z59A 4LFBM 1PM5A 5BR8M 1Q3CA 3GO8A 4JI6M 3T1YM 1Z5AA 3U6OA 3SBJA 1Z5CA 5ITTA 3J80S 3SAVA 1XNQM 3GPPA 4B3RM 3U6QA 4X62M 4DV5M 2Q2EB 3U6MA 1XC8A 3U6DA 4K0KM 5LMNM 2UUAM 4X65M 4X64M 2F5NA 2F5PA 4B3MM 4JV5M 1PJJA 4NRVA 5ITUA 3TWMA 2HHHM 4LF5M 1IBMM 3A42A 3U6EA 5ITXE 2F4VM 4DV3M 5IWAM 4GKKM 4NXNM 3GPXA 4PCZA 3JAMS 3J7AS 4NXMM 3SAUA 1IBLM 4JI4M 4DR1M 4LFCM 1HR0M 2OPFA 1Z5BA 4AQYM 1L2BA 5ITXA 1L1TA 2F5SA 2OQ4A 4JI8M 4MB7A 1PJIA 1Q39A 3VK7A 4OX9M 1TDZA 4JI3M 4X66M 3A45A 5LMUM 2E5LM 4DR3M 1Q3BA 2ZM6M 2VQEM 4LF6M 2XZFA 4JYAM 2UXDM 1HNXM 1FJGM 1MX0A 4JI7M 3DOAA 1TDHA 3U6CA 4DR5M 1N36M 1J5EM 1XMQM 1L1ZA 3TWLA 2ZBKB 4G4OA 1MU5A 4DR7M 1N34M 1N32M 3JR5A 4G4NA 3J81S 5FLXS 4PDIA 4YY3M 3GPUA 3C58A 4JI1M 4B3SM 3A46A 4JI2M 4LF4M 3JR4A 3TWKA 4DR6M 1NNJA 4PD2A 4DV7M 5ITRA 3GP1A 3SAWA 3GQ3A 4PDGA 4DV1M 1HNWM 3U6LA 2EA0A 4DV2M 4GKJM 3VK8A 2XZUA 3SASA 4NRWA 1R2YA 1L2DA 1K3XA 1I94M 1XMOM 4ITQA 5ITYA 5A2QS 1L2CA 4LFAM 3GQ4A 1KFVA 1XNRM 4YHHM 1K82A 2HKJA 1HNZM 2UUCM 3GQ5A 5IT9S 2VQFM 4LF7M
chains in the Genus database with same CATH superfamily
5FSWA 4AW4A 3K2LA 1WJ7A 1R7RA 3M6AA 1R2ZA 1QAMA 3RGPA 3THGA 3HJQA 1HT1E 1QZMA 2X4AA 3LCUA 4LZZA 1K3WA 4CISA 2C99A 3C3EA 3RGSA 2RKOA 4JI5M 1ZMWA 3MK6A 3I04M 2UXBM 2JUJA 3H4MA 1G8PA 2KHHA 2EUCA 1E94E 2L6OA 2HL7A 3EIHA 3KS8A 1Z59A 3W68A 5BR8M 3WHLA 4JI6M 4LJ6A 1Z5AA 4I8OA 2XSZA 3FRHA 2Z4SA 1QUTA 4KLNA 4LGMA 2CHVA 5ITTA 1X37A 5KPZA 1UM8A 7CATA 1G3IA 4QOZC 4B3RM 1QDRA 2JXNA 3IG5A 1XC8A 3R8FA 5LMNM 1OKSA 2XF3A 2DENA 1OIZA 1Q02A 2EKKA 4LY6A 5DYIA 1XB2B 2MJ5B 2F5NA 4IBCA 2V1CA 3PNYA 1PJTA 3UJNA 3KSXA 2R4JA 2VDBB 1ORYB 4QNMA 2LTUA 3GLFE 2CV2A 2LH0A 4R7GA 4B08A 2HHHM 1GO5A 3UK6A 3U6EA 1GJTA 3U60B 2JY6B 4AZFA 5IWAM 3F92A 4NXNM 2AHMA 2KNVA 1FNNA 3TQSA 1VEGA 4B7FA 3J7AS 4XGIA 4DR1M 1XXHB 3KP0E 1GVNA 4QHSA 2HCBA 1Z5BA 1WGLA 5FTMA 4B7GA 3GLGA 5ITXA 1L1TA 3IHPA 2OQ4A 1SXJD 1DGFA 2D7EA 4WW0A 3BXWA 3I4YA 5KPRA 4MB7A 3ZQJA 1Q39A 3VK7A 2I7NA 4NSOB 1NO1A 1VEJA 4L4UA 4GITA 3FTCA 5FTLA 2LVPC 1Z6TA 2K0BX 4L6V6 1GABA 4IBGA 3HU3A 4FCTA 3HX3A 4IBFA 3FUTA 2LVNC 2P5TA 1WGNA 4Q7JA 1G71A 2VIIA 3L28A 4D80A 1OTRA 3DOAA 1G4AE 1N36M 1J5EM 2ZBKB 4LG2A 4G4OA 1MU5A 4DR7M 4G4NA 1NY6A 3FKEA 5GKNA 3Q8XA 3D8LA 1NJGA 1PGYA 1QANA 4Z8XA 4YY3M 3Q8GA 4FWHA 3GLFA 3D8BA 3HJ8A 1IY1A 4FWDA 2KNAA 3SAWA 2H1RA 3I4VA 1WHCA 2H5XA 2JA2A 1EIJA 1OAOC 1CUKA 3HGIA 4A3VB 1XXHE 3KDSE 2R46A 3VDUA 3LW5F 1L8QA 4KT0F 2XZUA 3SASA 1IN5A 2QNJA 3FUUA 4NRWA 3K8ZA 2CRUA 1R2YA 3GLHA 4AKGA 3ZC7B 3B9PA 4M9SA 2Y20A 1KFVA 2ZTCA 1QYRA 4GC9A 4IBBA 2R62A 2HWJA 2YFQA 5EP4A 1HNZM 3KOWE 4KODA 2UUCM 2QHOB 1E9RA 3GQ5A 2QCUA 1RU3A 5JI2E 5DNYA 1T6OA 4D82A 1GLNA 3HHXA 2QP9X 4G4RA 3U61B 3AOEA 1DGHA 2J5YA 1VG5A 1WXQA 1JR3E 2JWSA 3HJSA 3SHFA 4Z6YA 2KZSA 5ITQA 4QHTA 1DGBA 3U6PA 2XH9A 3BOSA 4DV4M 3HZJA 4F1IA 4M9XA 3TE6A 1IBKM 3CGWA 3LCVB 4REZA 2UXCM 3WHKA 2QQ8A 3FRIA 4LGYA 5KQ8A 4LJAA 2JZ0A 2CP8A 3ILKA 2RGHA 3AOGA 4UN2B 2C5RA 3SATA 5H37D 1GJSA 3M7GA 5FTKA 3UZUA 3VKHA 1E9SA 3SARA 3L29A 3SHGB 2F5QA 4KHPM 2QZ4A 2YR0A 3FUVA 1EE8A 2V6ZM 4DR2M 4LF8M 4RKUF 1D0KA 2DWZB 2LBCA 1JR3D 3GRVA 1Z5CA 3GLHE 2KA6B 2LVQD 1ZQ9A 2JY5A 1ZAEA 4FVMA 2FNAA 2DZNB 2K47A 3LQQA 3NWLA 5EXPA 5C18A 4KO8A 3DA1A 1WR1B 3U6DA 4HEOA 1PJQA 4L15A 2UUAM 4X65M 2F5PA 1V34A 3QWLA 5DFLA 4MGYE 3TWMA 3TL4X 1V33A 2KRKA 1IN4A 3A42A 4LF5M 1LV7A 4M9ZA 2NQ8C 1SXJA 2EKFA 4IBEA 2O01F 1GL7A 5ITXE 3KFUG 1N77A 2V1UA 2APLA 1NV8A 4GKKM 1QAQA 3J7BA 4JI4M 4AKIA 1GL6A 1IFYA 1TR8A 2L7IA 1HR0M 4MGIE 2A5YB 3B89A 4IBDA 3BBZA 2CV0A 2DAKA 4NSRA 5FTJA 3KVWA 4PT5A 4JI8M 3UMMA 4OVZB 4P17A 2M5ZA 1HQCA 4JI3M 2X8AA 4L16A 1ZMVA 2C9OA 1G41A 1KYIA 2L4EA 4P16A 1IQPA 2KXEA 3A45A 1A5TA 2L09A 1OIPA 5FTNA 1N78A 2XFTA 3FUWA 2X49A 3EIEA 1TGUA 2JNHA 4LF6M 2UXDM 4NC6A 1MX0A 1PJSA 1IXSB 2OOAA 2WSFF 3GLGE 3AL0C 1TH2A 3HHZA 5IREB 3FE3A 3T38A 3TWLA 4ZPXA 2QBYA 3JR5A 3J81S 3L27A 8CATA 2L2DA 5E26A 3B7QA 2MH8A 4IBKA 1PRBA 4JI1M 4JI2M 5F3WA 4LF4M 4FW9A 1OFHA 2VF8A 2Z7JA 3K9PA 1MJGM 1YLAA 3CF0A 2D7GA 4PDGA 4DBGB 3HHWA 5E6JA 4I5SA 3LVWA 2CUZA 4DV2M 3U5ZA 2OOBA 2DHYA 1LTMA 2G5GX 5DYGA 2R6FA 5EXSA 2DI0A 4CJ6A 2XLJA 4CGYB 1D2NA 4IBJA 5ITYA 1L2CA 3QYEA 1IM2A 4LFAM 2DNAA 3GQ4A 4AI6A 1AIPC 2HKJA 3AJIB 1R4GA 3KP1E 3CF6E 2XSZD 3NBXX 2DWLA 3KOZE 4M0WA 2DVWB 4XK8F 2UUBM 1DV0A 1IN7A 4B3TM 4G6ZA 4I81A 3CF2A 3QYBA 4DUYM 1N33M 4LJ5A 3B7ZA 5IZ7D 2CE7A 3U6SA 2DZOB 1D0MA 4DR4M 2CWBA 1W5TA 2KNZA 3W0FA 4DV6M 1I4WA 2C96A 4M0DA 5JI3E 3KOXE 1XWIA 3GPYA 1R5LA 4G4QA 5EJCA 2EO2A 5KO3A 1BVSA 1W5SA 2N35A 1TTEA 4OU7A 2UU9M 1NJFA 2D7HA 3FYDA 4W5WA 5L8RF 4LF9M 4RF1A 3R9XB 4MH0E 1PM5A 2LXEA 2QPAA 3T1YM 3HWSA 2OO9A 4L78A 3U6OA 2W82A 2LWXA 2F5OA 4HL4A 3L2AA 1D0LA 2FOIC 3IECA 2JP7A 4S12A 4GEWA 2J7NA 1J7KA 2R65A 1IN6A 4G3OA 4X62M 2M60A 3U6MA 3U6QA 4R3DA 2DAMA 1HT2E 1UFZA 1VEKA 1SXJB 2MROB 4X64M 4B3MM 4ANRA 3PXGA 3VKGA 3DZDA 4NL4H 1IBMM 3K9OA 2QENA 2CEAA 1C7YA 1YE9A 2F4VM 4DV3M 1TH3A 1VDDA 4FCWA 2K9DA 2QSFX 3J2PB 3SMSA 3AKZA 1IXRC 1OJLA 3GPXA 3JAMS 2GQFA 3U61A 3I51A 3GRYA 3E9SA 4NXMM 5EP3A 3TPZA 4LFCM 1NSFA 2OPFA 2DXIA 4JXJA 1L2BA 3FTEA 2F5SA 3SFZA 2YNMD 1NV9A 2CV1A 2DAEA 5EP2A 3K92A 2BJWA 4LJ4A 3A98B 4LJ9A 2LNHC 1KSFX 2GNOA 4OX9M 2CHGA 4CIZA 1TDZA 1JQJC 4X66M 2Z3XA 3L25A 1H6UA 2E5LM 1JB0F 1Q3BA 3CTWB 1SG9A 3E46A 2CFOA 2ZAMA 3HKPA 2ZM6M 4GC5A 4JYAM 1IY0A 5EP1A 2QBYB 3T6PA 1TDHA 4JI7M 3H4JA 2C98A 3I01M 5EQTA 1N75A 2R18A 1YSYA 1XMQM 1L1ZA 3SYKA 1QAOA 1IXSA 1N34M 1NHWC 2MGWA 5FLXS 3NBIA 3T15A 3W0LB 3QAUA 4BBAA 4BB9A 4PDIA 3VLFB 4L8RC 3GLIA 2R45A 4LZJA 3SC3A 3TWKA 2ZTDA 3PFIA 1NNJA 4XBOA 4AG6A 3GP1A 3GQ3A 3GLIE 1DO2A 1Y8GA 2O5RA 1IY2A 4LCBA 1QVRA 1JR3A 2EA0A 4GKJM 3K1JA 1VQ1A 4TUWA 2BWEA 4MGZE 4NOOB 1L2DA 1K3XA 3RFWA 1DO0A 3KW6A 1I94M 3FUXA 5A2QS 2JY7A 1VDLA 1XNRM 5IT9S 4II7A 2KW0A 3L26A 4WP2A 2JZ1A 2VQFM 3U60A 3ZCBB 4LF7M 2RGOA 4R71A 3UGJA 1E32A 3AOEC 4MM3B 2EJSA 2XGNA 3HY5A 4LRSA 3KOYE 4DUZM 1HJPA 1XXHA 3J27B 3PVSA 4IJFA 4WURA 4JI0M 3T1HM 1G59A 1NNUC 2C9CA 2ERCA 2LVOC 2BWBA 2FE8A 2ZANA 1AUAA 2KRUA 3RE8A 4LJ8A 4RNAA 4GRIA 3FTDA 2Y0TA 2O25A 4DV0M 3KS4A 1T43A 3GRRA 2BJVA 2XFSA 2G3QA 4FCVA 1EFUB 2K6BA 1V92A 3ZH9B 3OTOM 4LFBM 1Q3CA 3GO8A 3E21A 4MGHA 4LJ7A 2LHCA 3HHYA 4CHTB 2B3TA 3SBJA 1IN8A 1J09A 1NHGC 2DKLA 2FS1A 2WSCF 3FYCA 4GHAA 1XHBA 1YUBA 2R4EA 3HU1A 3J80S 3SAVA 1SXJC 4Y28F 1IXZA 2Z4RA 2WZJA 1XNQM 3GPPA 3MHVC 2Z8YM 2Q2EB 4D81A 4DV5M 3U5ZB 3DFZA 3W67A 1QZEA 3AFHA 4K0KM 2R44A 1T3TA 4QOSA 4JV5M 3GLFB 1PJJA 4NRVA 5ITUA 3SYLA 2KDLA 2DZLA 2KZUA 4OVZA 1TF0B 1OFIA 2WSEF 2XEPA 3VDPA 4LRTA 4PCZA 2CHQA 3SAUA 1IBLM 4I4LA 2VF7A 3V76A 3FD9A 4AQYM 2Y21A 4BLCA 5KQDA 1ZMUA 1QQWA 1OAIA 2L7HA 1PJIA 4IIWA 3MJ5A 3C3DA 4GIPA 3VFDA 1SXJE 4F2LA 4GHLA 2YQZA 4AG5A 5LMUM 1DGHB 4DR3M 1GKIA 1C1KA 1S3SA 3IG8A 5KPTA 2DWMA 1R6BX 1QUSA 2VQEM 2G8LA 2HAKA 2XZFA 3LMMA 3C9PA 1HNXM 1FJGM 1HQYE 3LQRA 2JY8A 3E4RA 4OW0A 5EXTA 3U6CA 3HU2A 4DR5M 2FFJA 3SMPA 2ZAOA 2RRUA 2FH0A 2LHGA 3GLIB 1NY5A 2L4FA 3B7NA 3PNVA 4QNRA 1N32M 2BNKA 5BPVA 2I7PA 5C1BA 2LVAA 4MGKE 4RF0A 2MR9A 3M0EA 1P3QQ 3GPUA 3C58A 3MMPA 1ZV1A 3FTFA 4B3SM 3A46A 3B74A 1MN3A 3JR4A 3KSJA 4IBIA 4DR6M 1NVMA 2DHRA 4PD2A 4DV7M 4FWGA 5ITRA 4GMQA 1OQYA 4DV1M 3AV0A 2Y0QA 1HNWM 1WIVA 1DGGA 4IJEA 3U6LA 2DAGA 3KXEC 3VK8A 4JN6A 1F4IA 5EXXA 3GLGB 4AKHA 1QDTA 3GRUA 4FD2A 2DAIA 4HLQA 1XMOM 4ITQA 2KEBA 1TH4A 3LVVA 4YHHM 2R0IA 4GH9A 1K82A 3GLHB 4EIWA 4B7HA 2J7OA 2DWNA
chains in the Genus database with same CATH topology
5FSWA 4AW4A 3K2LA 1R7RA 3M6AA 1R2ZA 1QAMA 3RGPA 3THGA 3HJQA 1HT1E 1QZMA 2X4AA 4LZZA 1K3WA 4CISA 2C99A 3RGSA 2RKOA 4JI5M 3MK6A 2UXBM 3H4MA 1G8PA 2EUCA 1E94E 2L6OA 2HL7A 3EIHA 3KS8A 1Z59A 5BR8M 3WHLA 4JI6M 4LJ6A 1Z5AA 4I8OA 2XSZA 2Z4SA 4KLNA 4LGMA 2CHVA 5ITTA 1X37A 5KPZA 1UM8A 7CATA 1G3IA 4QOZC 4B3RM 3IG5A 1XC8A 3R8FA 5LMNM 2XF3A 4LY6A 5DYIA 2F5NA 4IBCA 2V1CA 3PNYA 3UJNA 3KSXA 2R4JA 4QNMA 1ORYB 2HHHM 2CV2A 2LH0A 4R7GA 4B08A 3UK6A 3U6EA 3U60B 4AZFA 5IWAM 4NXNM 2AHMA 3TQSA 1FNNA 4B7FA 3J7AS 4XGIA 4DR1M 1XXHB 3KP0E 1GVNA 4QHSA 2HCBA 1Z5BA 4B7GA 3GLGA 5ITXA 1L1TA 2OQ4A 1SXJD 1DGFA 2D7EA 4WW0A 3I4YA 5KPRA 4MB7A 1Q39A 3VK7A 2I7NA 4NSOB 4L4UA 4GITA 3FTCA 5FTLA 1Z6TA 4IBGA 3HU3A 4FCTA 4IBFA 3FUTA 2P5TA 2VIIA 3L28A 4D80A 3DOAA 1G4AE 1N36M 1J5EM 2ZBKB 4LG2A 4G4OA 1MU5A 4DR7M 4G4NA 1NY6A 3FKEA 5GKNA 3Q8XA 3D8LA 1NJGA 1QANA 4Z8XA 4YY3M 4FWHA 3GLFA 3D8BA 3HJ8A 1IY1A 4FWDA 3SAWA 2H1RA 3I4VA 2JA2A 3HGIA 4A3VB 3KDSE 2R46A 3VDUA 1L8QA 2XZUA 3SASA 1IN5A 3FUUA 4NRWA 3K8ZA 1R2YA 4AKGA 3GLHA 3ZC7B 3B9PA 4M9SA 2Y20A 1KFVA 4IBBA 1QYRA 4GC9A 2R62A 5EP4A 2YFQA 1HNZM 3KOWE 4KODA 2UUCM 3GQ5A 1E9RA 2QCUA 5JI2E 5DNYA 4D82A 1GLNA 3HHXA 2QP9X 4G4RA 3U61B 3AOEA 1DGHA 1WXQA 3HJSA 3SHFA 4Z6YA 2KZSA 5ITQA 4QHTA 1DGBA 3U6PA 2XH9A 3BOSA 4DV4M 4M9XA 3TE6A 1IBKM 2UXCM 4REZA 3WHKA 5KQ8A 4LGYA 4LJAA 3ILKA 2RGHA 3AOGA 2C5RA 3SATA 5H37D 3M7GA 5FTKA 3UZUA 3VKHA 1E9SA 3SARA 3L29A 3SHGB 2F5QA 4KHPM 2QZ4A 2YR0A 3FUVA 1EE8A 2V6ZM 4DR2M 4LF8M 2DWZB 1JR3D 3GRVA 1Z5CA 2KA6B 1ZQ9A 1ZAEA 4FVMA 2FNAA 2DZNB 2K47A 3LQQA 3NWLA 5EXPA 5C18A 4KO8A 3DA1A 3U6DA 4L15A 2UUAM 4X65M 2F5PA 3QWLA 4MGYE 3TWMA 3TL4X 4LF5M 2KRKA 1IN4A 3A42A 1LV7A 4M9ZA 2NQ8C 1SXJA 4IBEA 5ITXE 1GL7A 3KFUG 1N77A 2V1UA 4GKKM 1QAQA 3J7BA 4JI4M 4AKIA 1GL6A 2L7IA 1HR0M 4MGIE 2A5YB 4IBDA 2CV0A 4NSRA 5FTJA 3KVWA 4PT5A 4JI8M 3UMMA 4OVZB 2M5ZA 1HQCA 4JI3M 2X8AA 4L16A 2C9OA 1G41A 1KYIA 5FTMA 4P16A 1IQPA 2KXEA 3A45A 2L09A 5FTNA 1N78A 2XFTA 3FUWA 2X49A 3EIEA 1TGUA 4LF6M 2UXDM 1MX0A 1IXSB 1TH2A 3HHZA 5IREB 3T38A 3TWLA 4ZPXA 2QBYA 3JR5A 3J81S 3L27A 8CATA 5E26A 4IBKA 4JI1M 4JI2M 5F3WA 4LF4M 4FW9A 1OFHA 2Z7JA 3CF0A 2D7GA 4PDGA 3HHWA 5E6JA 4I5SA 3LVWA 2CUZA 4DV2M 3U5ZA 2G5GX 5DYGA 5EXSA 2XLJA 4CGYB 1D2NA 4IBJA 5ITYA 1L2CA 1IM2A 4LFAM 3GQ4A 4AI6A 2HKJA 3AJIB 3KP1E 3CF6E 2XSZD 2DWLA 3KOZE 4M0WA 2DVWB 2UUBM 1IN7A 4B3TM 4G6ZA 4I81A 3CF2A 4DUYM 1N33M 4LJ5A 5IZ7D 2CE7A 3U6SA 2DZOB 4DR4M 4DV6M 1W5TA 3W0FA 1I4WA 2C96A 4M0DA 5JI3E 3KOXE 1XWIA 3GPYA 4G4QA 5EJCA 2EO2A 5KO3A 2UU9M 1W5SA 4OU7A 1NJFA 2D7HA 3FYDA 4W5WA 4LF9M 4RF1A 3R9XB 4MH0E 1PM5A 2LXEA 2QPAA 3T1YM 3HWSA 4L78A 3U6OA 2W82A 2LWXA 4HL4A 3L2AA 2FOIC 4S12A 2J7NA 1J7KA 2R65A 1IN6A 4X62M 3U6QA 2M60A 3U6MA 4R3DA 1HT2E 1SXJB 4X64M 4B3MM 3PXGA 3VKGA 3DZDA 4NL4H 1IBMM 2CEAA 2QENA 1YE9A 2F4VM 4DV3M 1TH3A 1VDDA 4FCWA 3J2PB 3SMSA 3AKZA 1IXRC 1OJLA 3GPXA 3JAMS 3U61A 3I51A 3GRYA 3E9SA 4NXMM 5EP3A 3TPZA 4LFCM 1NSFA 2OPFA 2DXIA 4JXJA 1L2BA 3FTEA 2F5SA 3SFZA 2YNMD 2CV1A 5EP2A 3K92A 2BJWA 4LJ4A 3A98B 4LJ9A 2LNHC 1KSFX 4OX9M 2CHGA 1TDZA 1JQJC 4X66M 2Z3XA 3L25A 1H6UA 2E5LM 1Q3BA 3CTWB 2CFOA 2ZAMA 3HKPA 2ZM6M 4GC5A 4JYAM 1IY0A 5EP1A 2QBYB 4JI7M 1TDHA 2C98A 5EQTA 1N75A 2R18A 1YSYA 1XMQM 1L1ZA 3SYKA 1QAOA 1N34M 1NHWC 5FLXS 3NBIA 3T15A 3W0LB 3QAUA 4BBAA 4BB9A 4PDIA 3VLFB 4L8RC 3GLIA 2R45A 4LZJA 3SC3A 3TWKA 3PFIA 1NNJA 4XBOA 4AG6A 3GP1A 3GQ3A 1DO2A 2O5RA 1IY2A 4LCBA 1QVRA 1JR3A 2EA0A 4GKJM 3K1JA 4TUWA 4MGZE 4NOOB 1L2DA 1K3XA 3RFWA 1DO0A 3KW6A 1I94M 3FUXA 5A2QS 1XNRM 5IT9S 4II7A 2KW0A 3L26A 2VQFM 3U60A 4LF7M 3ZCBB 2RGOA 3UGJA 1E32A 3AOEC 4MM3B 2XGNA 4DUZM 4LRSA 3KOYE 1XXHA 3PVSA 3J27B 4WURA 4IJFA 4JI0M 3T1HM 1G59A 2F5OA 1NNUC 2C9CA 2ERCA 2FE8A 2ZANA 2KRUA 3RE8A 4LJ8A 4RNAA 4GRIA 3FTDA 2Y0TA 4DV0M 3KS4A 3GRRA 2BJVA 2XFSA 4FCVA 3ZH9B 3OTOM 4LFBM 1Q3CA 3GO8A 3HHYA 4MGHA 4LJ7A 4CHTB 3SBJA 1IN8A 1J09A 1NHGC 3FYCA 4GHAA 1XHBA 1YUBA 2R4EA 3HU1A 3J80S 3SAVA 1SXJC 1IXZA 2Z4RA 1XNQM 3GPPA 3MHVC 4DV5M 2Q2EB 4D81A 3U5ZB 3DFZA 3AFHA 4K0KM 1T3TA 4QOSA 4JV5M 3GLFB 1PJJA 4NRVA 5ITUA 3SYLA 2KZUA 4OVZA 1OFIA 2XEPA 3VDPA 4LRTA 4PCZA 2CHQA 3SAUA 1IBLM 4I4LA 3FD9A 4AQYM 2Y21A 4BLCA 5KQDA 1QQWA 2L7HA 1PJIA 4IIWA 3MJ5A 4GIPA 3VFDA 1SXJE 4GHLA 2YQZA 4AG5A 5LMUM 1DGHB 4DR3M 1GKIA 3IG8A 1C1KA 1S3SA 5KPTA 2DWMA 1R6BX 2VQEM 2G8LA 2XZFA 3LMMA 1HNXM 1FJGM 1HQYE 3LQRA 3E4RA 4OW0A 5EXTA 3U6CA 3HU2A 4DR5M 2FFJA 3SMPA 2ZAOA 3GLIB 1NY5A 1N32M 3PNVA 4QNRA 2BNKA 5BPVA 2I7PA 5C1BA 4MGKE 4RF0A 3M0EA 3GPUA 3C58A 3AL0C 3FTFA 4B3SM 3A46A 3JR4A 3KSJA 4IBIA 4DR6M 1NVMA 2DHRA 4PD2A 4DV7M 4FWGA 5ITRA 4GMQA 4DV1M 3AV0A 2Y0QA 1HNWM 4IJEA 1DGGA 3U6LA 3KXEC 3VK8A 4JN6A 5EXXA 3GLGB 4AKHA 3GRUA 4FD2A 4HLQA 1XMOM 4ITQA 2KEBA 1TH4A 3LVVA 4YHHM 1K82A 4GH9A 3GLHB 4EIWA 4B7HA 2J7OA 2DWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB M;  4G4R A;  4B3T M;  1R2Z A;  4DUZ M;  4DUY M;  1N33 M;  3T1H M;  4JI0 M;  1K3W A;  5ITQ A;  2F5O A;  4CIS A;  3U6P A;  3U6S A;  4DV4 M;  4JI5 M;  1IBK M;  2UXC M;  2UXB M;  4DR4 M;  4DV6 M;  3W0F A;  3SAT A;  3GPY A;  4DV0 M;  4G4Q A;  3SAR A;  2UU9 M;  2F5Q A;  4KHP M;  4LF9 M;  1EE8 A;  4DR2 M;  3OTO M;  4LF8 M;  1Z59 A;  4LFB M;  1PM5 A;  5BR8 M;  1Q3C A;  3GO8 A;  4JI6 M;  3T1Y M;  1Z5A A;  3U6O A;  3SBJ A;  1Z5C A;  5ITT A;  3J80 S;  3SAV A;  1XNQ M;  3GPP A;  4B3R M;  3U6Q A;  4X62 M;  4DV5 M;  2Q2E B;  3U6M A;  1XC8 A;  3U6D A;  4K0K M;  5LMN M;  2UUA M;  4X65 M;  4X64 M;  2F5N A;  2F5P A;  4B3M M;  4JV5 M;  1PJJ A;  4NRV A;  5ITU A;  3TWM A;  2HHH M;  4LF5 M;  1IBM M;  3A42 A;  3U6E A;  5ITX E;  2F4V M;  4DV3 M;  5IWA M;  4GKK M;  4NXN M;  3GPX A;  4PCZ A;  3JAM S;  3J7A S;  4NXM M;  3SAU A;  1IBL M;  4JI4 M;  4DR1 M;  4LFC M;  1HR0 M;  2OPF A;  1Z5B A;  4AQY M;  1L2B A;  5ITX A;  1L1T A;  2F5S A;  2OQ4 A;  4JI8 M;  4MB7 A;  1PJI A;  1Q39 A;  3VK7 A;  4OX9 M;  1TDZ A;  4JI3 M;  4X66 M;  3A45 A;  5LMU M;  2E5L M;  4DR3 M;  1Q3B A;  2ZM6 M;  2VQE M;  4LF6 M;  2XZF A;  4JYA M;  2UXD M;  1HNX M;  1FJG M;  1MX0 A;  4JI7 M;  3DOA A;  1TDH A;  3U6C A;  4DR5 M;  1N36 M;  1J5E M;  1XMQ M;  1L1Z A;  3TWL A;  2ZBK B;  4G4O A;  1MU5 A;  4DR7 M;  1N34 M;  1N32 M;  3JR5 A;  4G4N A;  3J81 S;  5FLX S;  4PDI A;  4YY3 M;  3GPU A;  3C58 A;  4JI1 M;  4B3S M;  3A46 A;  4JI2 M;  4LF4 M;  3JR4 A;  3TWK A;  4DR6 M;  1NNJ A;  4PD2 A;  4DV7 M;  5ITR A;  3GP1 A;  3SAW A;  3GQ3 A;  4PDG A;  4DV1 M;  1HNW M;  3U6L A;  2EA0 A;  4DV2 M;  4GKJ M;  3VK8 A;  2XZU A;  3SAS A;  4NRW A;  1R2Y A;  1L2D A;  1K3X A;  1I94 M;  1XMO M;  4ITQ A;  5ITY A;  5A2Q S;  1L2C A;  4LFA M;  3GQ4 A;  1KFV A;  1XNR M;  4YHH M;  1K82 A;  2HKJ A;  1HNZ M;  2UUC M;  3GQ5 A;  5IT9 S;  2VQF M;  4LF7 M; 
#chains in the Genus database with same CATH topology
 5FSW A;  4AW4 A;  3K2L A;  1WJ7 A;  1R7R A;  3M6A A;  1R2Z A;  1QAM A;  3RGP A;  3THG A;  3HJQ A;  1HT1 E;  1QZM A;  2X4A A;  3LCU A;  4LZZ A;  1K3W A;  4CIS A;  2C99 A;  3C3E A;  3RGS A;  2RKO A;  4JI5 M;  1ZMW A;  3MK6 A;  3I04 M;  2UXB M;  2JUJ A;  3H4M A;  1G8P A;  2KHH A;  2EUC A;  1E94 E;  2L6O A;  2HL7 A;  3EIH A;  3KS8 A;  1Z59 A;  3W68 A;  5BR8 M;  3WHL A;  4JI6 M;  4LJ6 A;  1Z5A A;  4I8O A;  2XSZ A;  3FRH A;  2Z4S A;  1QUT A;  4KLN A;  4LGM A;  2CHV A;  5ITT A;  1X37 A;  5KPZ A;  1UM8 A;  7CAT A;  1G3I A;  4QOZ C;  4B3R M;  1QDR A;  2JXN A;  3IG5 A;  1XC8 A;  3R8F A;  5LMN M;  1OKS A;  2XF3 A;  2DEN A;  1OIZ A;  1Q02 A;  2EKK A;  4LY6 A;  5DYI A;  1XB2 B;  2MJ5 B;  2F5N A;  4IBC A;  2V1C A;  3PNY A;  1PJT A;  3UJN A;  3KSX A;  2R4J A;  2VDB B;  1ORY B;  4QNM A;  2LTU A;  3GLF E;  2CV2 A;  2LH0 A;  4R7G A;  4B08 A;  2HHH M;  1GO5 A;  3UK6 A;  3U6E A;  1GJT A;  3U60 B;  2JY6 B;  4AZF A;  5IWA M;  3F92 A;  4NXN M;  2AHM A;  2KNV A;  1FNN A;  3TQS A;  1VEG A;  4B7F A;  3J7A S;  4XGI A;  4DR1 M;  1XXH B;  3KP0 E;  1GVN A;  4QHS A;  2HCB A;  1Z5B A;  1WGL A;  5FTM A;  4B7G A;  3GLG A;  5ITX A;  1L1T A;  3IHP A;  2OQ4 A;  1SXJ D;  1DGF A;  2D7E A;  4WW0 A;  3BXW A;  3I4Y A;  5KPR A;  4MB7 A;  3ZQJ A;  1Q39 A;  3VK7 A;  2I7N A;  4NSO B;  1NO1 A;  1VEJ A;  4L4U A;  4GIT A;  3FTC A;  5FTL A;  2LVP C;  1Z6T A;  2K0B X;  4L6V 6;  1GAB A;  4IBG A;  3HU3 A;  4FCT A;  3HX3 A;  4IBF A;  3FUT A;  2LVN C;  2P5T A;  1WGN A;  4Q7J A;  1G71 A;  2VII A;  3L28 A;  4D80 A;  1OTR A;  3DOA A;  1G4A E;  1N36 M;  1J5E M;  2ZBK B;  4LG2 A;  4G4O A;  1MU5 A;  4DR7 M;  4G4N A;  1NY6 A;  3FKE A;  5GKN A;  3Q8X A;  3D8L A;  1NJG A;  1PGY A;  1QAN A;  4Z8X A;  4YY3 M;  3Q8G A;  4FWH A;  3GLF A;  3D8B A;  3HJ8 A;  1IY1 A;  4FWD A;  2KNA A;  3SAW A;  2H1R A;  3I4V A;  1WHC A;  2H5X A;  2JA2 A;  1EIJ A;  1OAO C;  1CUK A;  3HGI A;  4A3V B;  1XXH E;  3KDS E;  2R46 A;  3VDU A;  3LW5 F;  1L8Q A;  4KT0 F;  2XZU A;  3SAS A;  1IN5 A;  2QNJ A;  3FUU A;  4NRW A;  3K8Z A;  2CRU A;  1R2Y A;  3GLH A;  4AKG A;  3ZC7 B;  3B9P A;  4M9S A;  2Y20 A;  1KFV A;  2ZTC A;  1QYR A;  4GC9 A;  4IBB A;  2R62 A;  2HWJ A;  2YFQ A;  5EP4 A;  1HNZ M;  3KOW E;  4KOD A;  2UUC M;  2QHO B;  1E9R A;  3GQ5 A;  2QCU A;  1RU3 A;  5JI2 E;  5DNY A;  1T6O A;  4D82 A;  1GLN A;  3HHX A;  2QP9 X;  4G4R A;  3U61 B;  3AOE A;  1DGH A;  2J5Y A;  1VG5 A;  1WXQ A;  1JR3 E;  2JWS A;  3HJS A;  3SHF A;  4Z6Y A;  2KZS A;  5ITQ A;  4QHT A;  1DGB A;  3U6P A;  2XH9 A;  3BOS A;  4DV4 M;  3HZJ A;  4F1I A;  4M9X A;  3TE6 A;  1IBK M;  3CGW A;  3LCV B;  4REZ A;  2UXC M;  3WHK A;  2QQ8 A;  3FRI A;  4LGY A;  5KQ8 A;  4LJA A;  2JZ0 A;  2CP8 A;  3ILK A;  2RGH A;  3AOG A;  4UN2 B;  2C5R A;  3SAT A;  5H37 D;  1GJS A;  3M7G A;  5FTK A;  3UZU A;  3VKH A;  1E9S A;  3SAR A;  3L29 A;  3SHG B;  2F5Q A;  4KHP M;  2QZ4 A;  2YR0 A;  3FUV A;  1EE8 A;  2V6Z M;  4DR2 M;  4LF8 M;  4RKU F;  1D0K A;  2DWZ B;  2LBC A;  1JR3 D;  3GRV A;  1Z5C A;  3GLH E;  2KA6 B;  2LVQ D;  1ZQ9 A;  2JY5 A;  1ZAE A;  4FVM A;  2FNA A;  2DZN B;  2K47 A;  3LQQ A;  3NWL A;  5EXP A;  5C18 A;  4KO8 A;  3DA1 A;  1WR1 B;  3U6D A;  4HEO A;  1PJQ A;  4L15 A;  2UUA M;  4X65 M;  2F5P A;  1V34 A;  3QWL A;  5DFL A;  4MGY E;  3TWM A;  3TL4 X;  1V33 A;  2KRK A;  1IN4 A;  3A42 A;  4LF5 M;  1LV7 A;  4M9Z A;  2NQ8 C;  1SXJ A;  2EKF A;  4IBE A;  2O01 F;  1GL7 A;  5ITX E;  3KFU G;  1N77 A;  2V1U A;  2APL A;  1NV8 A;  4GKK M;  1QAQ A;  3J7B A;  4JI4 M;  4AKI A;  1GL6 A;  1IFY A;  1TR8 A;  2L7I A;  1HR0 M;  4MGI E;  2A5Y B;  3B89 A;  4IBD A;  3BBZ A;  2CV0 A;  2DAK A;  4NSR A;  5FTJ A;  3KVW A;  4PT5 A;  4JI8 M;  3UMM A;  4OVZ B;  4P17 A;  2M5Z A;  1HQC A;  4JI3 M;  2X8A A;  4L16 A;  1ZMV A;  2C9O A;  1G41 A;  1KYI A;  2L4E A;  4P16 A;  1IQP A;  2KXE A;  3A45 A;  1A5T A;  2L09 A;  1OIP A;  5FTN A;  1N78 A;  2XFT A;  3FUW A;  2X49 A;  3EIE A;  1TGU A;  2JNH A;  4LF6 M;  2UXD M;  4NC6 A;  1MX0 A;  1PJS A;  1IXS B;  2OOA A;  2WSF F;  3GLG E;  3AL0 C;  1TH2 A;  3HHZ A;  5IRE B;  3FE3 A;  3T38 A;  3TWL A;  4ZPX A;  2QBY A;  3JR5 A;  3J81 S;  3L27 A;  8CAT A;  2L2D A;  5E26 A;  3B7Q A;  2MH8 A;  4IBK A;  1PRB A;  4JI1 M;  4JI2 M;  5F3W A;  4LF4 M;  4FW9 A;  1OFH A;  2VF8 A;  2Z7J A;  3K9P A;  1MJG M;  1YLA A;  3CF0 A;  2D7G A;  4PDG A;  4DBG B;  3HHW A;  5E6J A;  4I5S A;  3LVW A;  2CUZ A;  4DV2 M;  3U5Z A;  2OOB A;  2DHY A;  1LTM A;  2G5G X;  5DYG A;  2R6F A;  5EXS A;  2DI0 A;  4CJ6 A;  2XLJ A;  4CGY B;  1D2N A;  4IBJ A;  5ITY A;  1L2C A;  3QYE A;  1IM2 A;  4LFA M;  2DNA A;  3GQ4 A;  4AI6 A;  1AIP C;  2HKJ A;  3AJI B;  1R4G A;  3KP1 E;  3CF6 E;  2XSZ D;  3NBX X;  2DWL A;  3KOZ E;  4M0W A;  2DVW B;  4XK8 F;  2UUB M;  1DV0 A;  1IN7 A;  4B3T M;  4G6Z A;  4I81 A;  3CF2 A;  3QYB A;  4DUY M;  1N33 M;  4LJ5 A;  3B7Z A;  5IZ7 D;  2CE7 A;  3U6S A;  2DZO B;  1D0M A;  4DR4 M;  2CWB A;  1W5T A;  2KNZ A;  3W0F A;  4DV6 M;  1I4W A;  2C96 A;  4M0D A;  5JI3 E;  3KOX E;  1XWI A;  3GPY A;  1R5L A;  4G4Q A;  5EJC A;  2EO2 A;  5KO3 A;  1BVS A;  1W5S A;  2N35 A;  1TTE A;  4OU7 A;  2UU9 M;  1NJF A;  2D7H A;  3FYD A;  4W5W A;  5L8R F;  4LF9 M;  4RF1 A;  3R9X B;  4MH0 E;  1PM5 A;  2LXE A;  2QPA A;  3T1Y M;  3HWS A;  2OO9 A;  4L78 A;  3U6O A;  2W82 A;  2LWX A;  2F5O A;  4HL4 A;  3L2A A;  1D0L A;  2FOI C;  3IEC A;  2JP7 A;  4S12 A;  4GEW A;  2J7N A;  1J7K A;  2R65 A;  1IN6 A;  4G3O A;  4X62 M;  2M60 A;  3U6M A;  3U6Q A;  4R3D A;  2DAM A;  1HT2 E;  1UFZ A;  1VEK A;  1SXJ B;  2MRO B;  4X64 M;  4B3M M;  4ANR A;  3PXG A;  3VKG A;  3DZD A;  4NL4 H;  1IBM M;  3K9O A;  2QEN A;  2CEA A;  1C7Y A;  1YE9 A;  2F4V M;  4DV3 M;  1TH3 A;  1VDD A;  4FCW A;  2K9D A;  2QSF X;  3J2P B;  3SMS A;  3AKZ A;  1IXR C;  1OJL A;  3GPX A;  3JAM S;  2GQF A;  3U61 A;  3I51 A;  3GRY A;  3E9S A;  4NXM M;  5EP3 A;  3TPZ A;  4LFC M;  1NSF A;  2OPF A;  2DXI A;  4JXJ A;  1L2B A;  3FTE A;  2F5S A;  3SFZ A;  2YNM D;  1NV9 A;  2CV1 A;  2DAE A;  5EP2 A;  3K92 A;  2BJW A;  4LJ4 A;  3A98 B;  4LJ9 A;  2LNH C;  1KSF X;  2GNO A;  4OX9 M;  2CHG A;  4CIZ A;  1TDZ A;  1JQJ C;  4X66 M;  2Z3X A;  3L25 A;  1H6U A;  2E5L M;  1JB0 F;  1Q3B A;  3CTW B;  1SG9 A;  3E46 A;  2CFO A;  2ZAM A;  3HKP A;  2ZM6 M;  4GC5 A;  4JYA M;  1IY0 A;  5EP1 A;  2QBY B;  3T6P A;  1TDH A;  4JI7 M;  3H4J A;  2C98 A;  3I01 M;  5EQT A;  1N75 A;  2R18 A;  1YSY A;  1XMQ M;  1L1Z A;  3SYK A;  1QAO A;  1IXS A;  1N34 M;  1NHW C;  2MGW A;  5FLX S;  3NBI A;  3T15 A;  3W0L B;  3QAU A;  4BBA A;  4BB9 A;  4PDI A;  3VLF B;  4L8R C;  3GLI A;  2R45 A;  4LZJ A;  3SC3 A;  3TWK A;  2ZTD A;  3PFI A;  1NNJ A;  4XBO A;  4AG6 A;  3GP1 A;  3GQ3 A;  3GLI E;  1DO2 A;  1Y8G A;  2O5R A;  1IY2 A;  4LCB A;  1QVR A;  1JR3 A;  2EA0 A;  4GKJ M;  3K1J A;  1VQ1 A;  4TUW A;  2BWE A;  4MGZ E;  4NOO B;  1L2D A;  1K3X A;  3RFW A;  1DO0 A;  3KW6 A;  1I94 M;  3FUX A;  5A2Q S;  2JY7 A;  1VDL A;  1XNR M;  5IT9 S;  4II7 A;  2KW0 A;  3L26 A;  4WP2 A;  2JZ1 A;  2VQF M;  3U60 A;  3ZCB B;  4LF7 M;  2RGO A;  4R71 A;  3UGJ A;  1E32 A;  3AOE C;  4MM3 B;  2EJS A;  2XGN A;  3HY5 A;  4LRS A;  3KOY E;  4DUZ M;  1HJP A;  1XXH A;  3J27 B;  3PVS A;  4IJF A;  4WUR A;  4JI0 M;  3T1H M;  1G59 A;  1NNU C;  2C9C A;  2ERC A;  2LVO C;  2BWB A;  2FE8 A;  2ZAN A;  1AUA A;  2KRU A;  3RE8 A;  4LJ8 A;  4RNA A;  4GRI A;  3FTD A;  2Y0T A;  2O25 A;  4DV0 M;  3KS4 A;  1T43 A;  3GRR A;  2BJV A;  2XFS A;  2G3Q A;  4FCV A;  1EFU B;  2K6B A;  1V92 A;  3ZH9 B;  3OTO M;  4LFB M;  1Q3C A;  3GO8 A;  3E21 A;  4MGH A;  4LJ7 A;  2LHC A;  3HHY A;  4CHT B;  2B3T A;  3SBJ A;  1IN8 A;  1J09 A;  1NHG C;  2DKL A;  2FS1 A;  2WSC F;  3FYC A;  4GHA A;  1XHB A;  1YUB A;  2R4E A;  3HU1 A;  3J80 S;  3SAV A;  1SXJ C;  4Y28 F;  1IXZ A;  2Z4R A;  2WZJ A;  1XNQ M;  3GPP A;  3MHV C;  2Z8Y M;  2Q2E B;  4D81 A;  4DV5 M;  3U5Z B;  3DFZ A;  3W67 A;  1QZE A;  3AFH A;  4K0K M;  2R44 A;  1T3T A;  4QOS A;  4JV5 M;  3GLF B;  1PJJ A;  4NRV A;  5ITU A;  3SYL A;  2KDL A;  2DZL A;  2KZU A;  4OVZ A;  1TF0 B;  1OFI A;  2WSE F;  2XEP A;  3VDP A;  4LRT A;  4PCZ A;  2CHQ A;  3SAU A;  1IBL M;  4I4L A;  2VF7 A;  3V76 A;  3FD9 A;  4AQY M;  2Y21 A;  4BLC A;  5KQD A;  1ZMU A;  1QQW A;  1OAI A;  2L7H A;  1PJI A;  4IIW A;  3MJ5 A;  3C3D A;  4GIP A;  3VFD A;  1SXJ E;  4F2L A;  4GHL A;  2YQZ A;  4AG5 A;  5LMU M;  1DGH B;  4DR3 M;  1GKI A;  1C1K A;  1S3S A;  3IG8 A;  5KPT A;  2DWM A;  1R6B X;  1QUS A;  2VQE M;  2G8L A;  2HAK A;  2XZF A;  3LMM A;  3C9P A;  1HNX M;  1FJG M;  1HQY E;  3LQR A;  2JY8 A;  3E4R A;  4OW0 A;  5EXT A;  3U6C A;  3HU2 A;  4DR5 M;  2FFJ A;  3SMP A;  2ZAO A;  2RRU A;  2FH0 A;  2LHG A;  3GLI B;  1NY5 A;  2L4F A;  3B7N A;  3PNV A;  4QNR A;  1N32 M;  2BNK A;  5BPV A;  2I7P A;  5C1B A;  2LVA A;  4MGK E;  4RF0 A;  2MR9 A;  3M0E A;  1P3Q Q;  3GPU A;  3C58 A;  3MMP A;  1ZV1 A;  3FTF A;  4B3S M;  3A46 A;  3B74 A;  1MN3 A;  3JR4 A;  3KSJ A;  4IBI A;  4DR6 M;  1NVM A;  2DHR A;  4PD2 A;  4DV7 M;  4FWG A;  5ITR A;  4GMQ A;  1OQY A;  4DV1 M;  3AV0 A;  2Y0Q A;  1HNW M;  1WIV A;  1DGG A;  4IJE A;  3U6L A;  2DAG A;  3KXE C;  3VK8 A;  4JN6 A;  1F4I A;  5EXX A;  3GLG B;  4AKH A;  1QDT A;  3GRU A;  4FD2 A;  2DAI A;  4HLQ A;  1XMO M;  4ITQ A;  2KEB A;  1TH4 A;  3LVV A;  4YHH M;  2R0I A;  4GH9 A;  1K82 A;  3GLH B;  4EIW A;  4B7H A;  2J7O A;  2DWN A; 
#chains in the Genus database with same CATH homology
 5FSW A;  4AW4 A;  3K2L A;  1R7R A;  3M6A A;  1R2Z A;  1QAM A;  3RGP A;  3THG A;  3HJQ A;  1HT1 E;  1QZM A;  2X4A A;  4LZZ A;  1K3W A;  4CIS A;  2C99 A;  3RGS A;  2RKO A;  4JI5 M;  3MK6 A;  2UXB M;  3H4M A;  1G8P A;  2EUC A;  1E94 E;  2L6O A;  2HL7 A;  3EIH A;  3KS8 A;  1Z59 A;  5BR8 M;  3WHL A;  4JI6 M;  4LJ6 A;  1Z5A A;  4I8O A;  2XSZ A;  2Z4S A;  4KLN A;  4LGM A;  2CHV A;  5ITT A;  1X37 A;  5KPZ A;  1UM8 A;  7CAT A;  1G3I A;  4QOZ C;  4B3R M;  3IG5 A;  1XC8 A;  3R8F A;  5LMN M;  2XF3 A;  4LY6 A;  5DYI A;  2F5N A;  4IBC A;  2V1C A;  3PNY A;  3UJN A;  3KSX A;  2R4J A;  4QNM A;  1ORY B;  2HHH M;  2CV2 A;  2LH0 A;  4R7G A;  4B08 A;  3UK6 A;  3U6E A;  3U60 B;  4AZF A;  5IWA M;  4NXN M;  2AHM A;  3TQS A;  1FNN A;  4B7F A;  3J7A S;  4XGI A;  4DR1 M;  1XXH B;  3KP0 E;  1GVN A;  4QHS A;  2HCB A;  1Z5B A;  4B7G A;  3GLG A;  5ITX A;  1L1T A;  2OQ4 A;  1SXJ D;  1DGF A;  2D7E A;  4WW0 A;  3I4Y A;  5KPR A;  4MB7 A;  1Q39 A;  3VK7 A;  2I7N A;  4NSO B;  4L4U A;  4GIT A;  3FTC A;  5FTL A;  1Z6T A;  4IBG A;  3HU3 A;  4FCT A;  4IBF A;  3FUT A;  2P5T A;  2VII A;  3L28 A;  4D80 A;  3DOA A;  1G4A E;  1N36 M;  1J5E M;  2ZBK B;  4LG2 A;  4G4O A;  1MU5 A;  4DR7 M;  4G4N A;  1NY6 A;  3FKE A;  5GKN A;  3Q8X A;  3D8L A;  1NJG A;  1QAN A;  4Z8X A;  4YY3 M;  4FWH A;  3GLF A;  3D8B A;  3HJ8 A;  1IY1 A;  4FWD A;  3SAW A;  2H1R A;  3I4V A;  2JA2 A;  3HGI A;  4A3V B;  3KDS E;  2R46 A;  3VDU A;  1L8Q A;  2XZU A;  3SAS A;  1IN5 A;  3FUU A;  4NRW A;  3K8Z A;  1R2Y A;  4AKG A;  3GLH A;  3ZC7 B;  3B9P A;  4M9S A;  2Y20 A;  1KFV A;  4IBB A;  1QYR A;  4GC9 A;  2R62 A;  5EP4 A;  2YFQ A;  1HNZ M;  3KOW E;  4KOD A;  2UUC M;  3GQ5 A;  1E9R A;  2QCU A;  5JI2 E;  5DNY A;  4D82 A;  1GLN A;  3HHX A;  2QP9 X;  4G4R A;  3U61 B;  3AOE A;  1DGH A;  1WXQ A;  3HJS A;  3SHF A;  4Z6Y A;  2KZS A;  5ITQ A;  4QHT A;  1DGB A;  3U6P A;  2XH9 A;  3BOS A;  4DV4 M;  4M9X A;  3TE6 A;  1IBK M;  2UXC M;  4REZ A;  3WHK A;  5KQ8 A;  4LGY A;  4LJA A;  3ILK A;  2RGH A;  3AOG A;  2C5R A;  3SAT A;  5H37 D;  3M7G A;  5FTK A;  3UZU A;  3VKH A;  1E9S A;  3SAR A;  3L29 A;  3SHG B;  2F5Q A;  4KHP M;  2QZ4 A;  2YR0 A;  3FUV A;  1EE8 A;  2V6Z M;  4DR2 M;  4LF8 M;  2DWZ B;  1JR3 D;  3GRV A;  1Z5C A;  2KA6 B;  1ZQ9 A;  1ZAE A;  4FVM A;  2FNA A;  2DZN B;  2K47 A;  3LQQ A;  3NWL A;  5EXP A;  5C18 A;  4KO8 A;  3DA1 A;  3U6D A;  4L15 A;  2UUA M;  4X65 M;  2F5P A;  3QWL A;  4MGY E;  3TWM A;  3TL4 X;  4LF5 M;  2KRK A;  1IN4 A;  3A42 A;  1LV7 A;  4M9Z A;  2NQ8 C;  1SXJ A;  4IBE A;  5ITX E;  1GL7 A;  3KFU G;  1N77 A;  2V1U A;  4GKK M;  1QAQ A;  3J7B A;  4JI4 M;  4AKI A;  1GL6 A;  2L7I A;  1HR0 M;  4MGI E;  2A5Y B;  4IBD A;  2CV0 A;  4NSR A;  5FTJ A;  3KVW A;  4PT5 A;  4JI8 M;  3UMM A;  4OVZ B;  2M5Z A;  1HQC A;  4JI3 M;  2X8A A;  4L16 A;  2C9O A;  1G41 A;  1KYI A;  5FTM A;  4P16 A;  1IQP A;  2KXE A;  3A45 A;  2L09 A;  5FTN A;  1N78 A;  2XFT A;  3FUW A;  2X49 A;  3EIE A;  1TGU A;  4LF6 M;  2UXD M;  1MX0 A;  1IXS B;  1TH2 A;  3HHZ A;  5IRE B;  3T38 A;  3TWL A;  4ZPX A;  2QBY A;  3JR5 A;  3J81 S;  3L27 A;  8CAT A;  5E26 A;  4IBK A;  4JI1 M;  4JI2 M;  5F3W A;  4LF4 M;  4FW9 A;  1OFH A;  2Z7J A;  3CF0 A;  2D7G A;  4PDG A;  3HHW A;  5E6J A;  4I5S A;  3LVW A;  2CUZ A;  4DV2 M;  3U5Z A;  2G5G X;  5DYG A;  5EXS A;  2XLJ A;  4CGY B;  1D2N A;  4IBJ A;  5ITY A;  1L2C A;  1IM2 A;  4LFA M;  3GQ4 A;  4AI6 A;  2HKJ A;  3AJI B;  3KP1 E;  3CF6 E;  2XSZ D;  2DWL A;  3KOZ E;  4M0W A;  2DVW B;  2UUB M;  1IN7 A;  4B3T M;  4G6Z A;  4I81 A;  3CF2 A;  4DUY M;  1N33 M;  4LJ5 A;  5IZ7 D;  2CE7 A;  3U6S A;  2DZO B;  4DR4 M;  4DV6 M;  1W5T A;  3W0F A;  1I4W A;  2C96 A;  4M0D A;  5JI3 E;  3KOX E;  1XWI A;  3GPY A;  4G4Q A;  5EJC A;  2EO2 A;  5KO3 A;  2UU9 M;  1W5S A;  4OU7 A;  1NJF A;  2D7H A;  3FYD A;  4W5W A;  4LF9 M;  4RF1 A;  3R9X B;  4MH0 E;  1PM5 A;  2LXE A;  2QPA A;  3T1Y M;  3HWS A;  4L78 A;  3U6O A;  2W82 A;  2LWX A;  4HL4 A;  3L2A A;  2FOI C;  4S12 A;  2J7N A;  1J7K A;  2R65 A;  1IN6 A;  4X62 M;  3U6Q A;  2M60 A;  3U6M A;  4R3D A;  1HT2 E;  1SXJ B;  4X64 M;  4B3M M;  3PXG A;  3VKG A;  3DZD A;  4NL4 H;  1IBM M;  2CEA A;  2QEN A;  1YE9 A;  2F4V M;  4DV3 M;  1TH3 A;  1VDD A;  4FCW A;  3J2P B;  3SMS A;  3AKZ A;  1IXR C;  1OJL A;  3GPX A;  3JAM S;  3U61 A;  3I51 A;  3GRY A;  3E9S A;  4NXM M;  5EP3 A;  3TPZ A;  4LFC M;  1NSF A;  2OPF A;  2DXI A;  4JXJ A;  1L2B A;  3FTE A;  2F5S A;  3SFZ A;  2YNM D;  2CV1 A;  5EP2 A;  3K92 A;  2BJW A;  4LJ4 A;  3A98 B;  4LJ9 A;  2LNH C;  1KSF X;  4OX9 M;  2CHG A;  1TDZ A;  1JQJ C;  4X66 M;  2Z3X A;  3L25 A;  1H6U A;  2E5L M;  1Q3B A;  3CTW B;  2CFO A;  2ZAM A;  3HKP A;  2ZM6 M;  4GC5 A;  4JYA M;  1IY0 A;  5EP1 A;  2QBY B;  4JI7 M;  1TDH A;  2C98 A;  5EQT A;  1N75 A;  2R18 A;  1YSY A;  1XMQ M;  1L1Z A;  3SYK A;  1QAO A;  1N34 M;  1NHW C;  5FLX S;  3NBI A;  3T15 A;  3W0L B;  3QAU A;  4BBA A;  4BB9 A;  4PDI A;  3VLF B;  4L8R C;  3GLI A;  2R45 A;  4LZJ A;  3SC3 A;  3TWK A;  3PFI A;  1NNJ A;  4XBO A;  4AG6 A;  3GP1 A;  3GQ3 A;  1DO2 A;  2O5R A;  1IY2 A;  4LCB A;  1QVR A;  1JR3 A;  2EA0 A;  4GKJ M;  3K1J A;  4TUW A;  4MGZ E;  4NOO B;  1L2D A;  1K3X A;  3RFW A;  1DO0 A;  3KW6 A;  1I94 M;  3FUX A;  5A2Q S;  1XNR M;  5IT9 S;  4II7 A;  2KW0 A;  3L26 A;  2VQF M;  3U60 A;  4LF7 M;  3ZCB B;  2RGO A;  3UGJ A;  1E32 A;  3AOE C;  4MM3 B;  2XGN A;  4DUZ M;  4LRS A;  3KOY E;  1XXH A;  3PVS A;  3J27 B;  4WUR A;  4IJF A;  4JI0 M;  3T1H M;  1G59 A;  2F5O A;  1NNU C;  2C9C A;  2ERC A;  2FE8 A;  2ZAN A;  2KRU A;  3RE8 A;  4LJ8 A;  4RNA A;  4GRI A;  3FTD A;  2Y0T A;  4DV0 M;  3KS4 A;  3GRR A;  2BJV A;  2XFS A;  4FCV A;  3ZH9 B;  3OTO M;  4LFB M;  1Q3C A;  3GO8 A;  3HHY A;  4MGH A;  4LJ7 A;  4CHT B;  3SBJ A;  1IN8 A;  1J09 A;  1NHG C;  3FYC A;  4GHA A;  1XHB A;  1YUB A;  2R4E A;  3HU1 A;  3J80 S;  3SAV A;  1SXJ C;  1IXZ A;  2Z4R A;  1XNQ M;  3GPP A;  3MHV C;  4DV5 M;  2Q2E B;  4D81 A;  3U5Z B;  3DFZ A;  3AFH A;  4K0K M;  1T3T A;  4QOS A;  4JV5 M;  3GLF B;  1PJJ A;  4NRV A;  5ITU A;  3SYL A;  2KZU A;  4OVZ A;  1OFI A;  2XEP A;  3VDP A;  4LRT A;  4PCZ A;  2CHQ A;  3SAU A;  1IBL M;  4I4L A;  3FD9 A;  4AQY M;  2Y21 A;  4BLC A;  5KQD A;  1QQW A;  2L7H A;  1PJI A;  4IIW A;  3MJ5 A;  4GIP A;  3VFD A;  1SXJ E;  4GHL A;  2YQZ A;  4AG5 A;  5LMU M;  1DGH B;  4DR3 M;  1GKI A;  3IG8 A;  1C1K A;  1S3S A;  5KPT A;  2DWM A;  1R6B X;  2VQE M;  2G8L A;  2XZF A;  3LMM A;  1HNX M;  1FJG M;  1HQY E;  3LQR A;  3E4R A;  4OW0 A;  5EXT A;  3U6C A;  3HU2 A;  4DR5 M;  2FFJ A;  3SMP A;  2ZAO A;  3GLI B;  1NY5 A;  1N32 M;  3PNV A;  4QNR A;  2BNK A;  5BPV A;  2I7P A;  5C1B A;  4MGK E;  4RF0 A;  3M0E A;  3GPU A;  3C58 A;  3AL0 C;  3FTF A;  4B3S M;  3A46 A;  3JR4 A;  3KSJ A;  4IBI A;  4DR6 M;  1NVM A;  2DHR A;  4PD2 A;  4DV7 M;  4FWG A;  5ITR A;  4GMQ A;  4DV1 M;  3AV0 A;  2Y0Q A;  1HNW M;  4IJE A;  1DGG A;  3U6L A;  3KXE C;  3VK8 A;  4JN6 A;  5EXX A;  3GLG B;  4AKH A;  3GRU A;  4FD2 A;  4HLQ A;  1XMO M;  4ITQ A;  2KEB A;  1TH4 A;  3LVV A;  4YHH M;  1K82 A;  4GH9 A;  3GLH B;  4EIW A;  4B7H A;  2J7O A;  2DWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...