2M60A

Enterocin 7b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterocin JSB
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2013-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m60A00
2M60A 2M5ZA
chains in the Genus database with same CATH superfamily
2LHCA 2GQFA 1G41A 4LZJA 3FUTA 4LJ9A 1WIVA 1VDLA 5IWAM 1XMOM 3KS4A 3JAMS 1IFYA 4I5SA 2ZTDA 4RKUF 2LXEA 3NBIA 3B74A 1OIZA 1E32A 1I94M 4LFAM 4L15A 2C99A 5KPRA 4JN6A 1Q02A 4MGZE 5BPVA 3R8FA 2DZNB 4GKKM 1V92A 2Y0QA 3RGPA 1YUBA 3H4MA 4GHAA 4BLCA 3VKHA 3FTEA 1L1ZA 5EXPA 2N35A 2J7NA 2WZJA 4NRVA 2KNZA 1C1KA 4L78A 1SXJC 1Z59A 3MHVC 3U6OA 4LG2A 2O5RA 4X65M 5ITYA 4A3VB 1Z5BA 1T6OA 2RKOA 1J5EM 1W5TA 2XFSA 4BBAA 3FTDA 3UGJA 1F4IA 1NY6A 2BJWA 2MR9A 4G4QA 1OIPA 4LGMA 3WHLA 2UUAM 2JY5A 3U61A 4QNMA 1VEGA 2QPAA 4Q7JA 3KSJA 3E4RA 1E9SA 3C3DA 3HX3A 1N32M 3DZDA 3DA1A 3C9PA 1TDHA 1D0LA 4GIPA 1I4WA 1Y8GA 4K0KM 4FCWA 1GJTA 2GNOA 2KDLA 4LF9M 1ZMWA 2DAGA 3GLFA 4KHPM 2XZUA 4CHTB 1D0MA 4GKJM 1GKIA 2KEBA 3ILKA 4B3MM 3MJ5A 1PJTA 4G6ZA 4JI5M 2F5SA 4X66M 1DGGA 2ZM6M 3HJ8A 4OU7A 1NHGC 4R7GA 3NBXX 4QHSA 4RNAA 3THGA 2C5RA 2F5PA 2OOAA 4Y28F 2LNHC 3HJSA 4G4RA 3SASA 4JYAM 3OTOM 3CGWA 3E46A 7CATA 1HT2E 2BNKA 4AZFA 2L4EA 4JV5M 3CF2A 4MGHA 1GJSA 3R9XB 1K3XA 2HCBA 2M60A 1NNUC 5EXXA 1IN8A 2KNVA 2R44A 1VQ1A 1HR0M 3U60A 1AIPC 1SXJA 4XK8F 2UU9M 2DHYA 1K82A 3AV0A 3SHFA 4DV6M 1ZMUA 3LCUA 5E26A 1GVNA 4JI8M 5KPTA 4S12A 4DV3M 3NWLA 2ZBKB 2LVPC 2DENA 1DGBA 2Z3XA 4LCBA 3U61B 2DNAA 3TWMA 2QBYB 4JI3M 4L6V6 4NXNM 1W5SA 4OW0A 5JI2E 2FFJA 3FRIA 4REZA 1G8PA 2WSCF 1IY1A 1NJGA 2KXEA 2ZAMA 1IN5A 4GITA 3GQ3A 3GPYA 2D7GA 1QVRA 2LWXA 3GLFB 2DWNA 4FCTA 1N78A 4AKHA 3CF0A 2HWJA 3B89A 3W67A 2VQFM 1XHBA 3FTCA 3VFDA 4DR1M 3GQ4A 1XXHE 5F3WA 2YQZA 3FYDA 3I4VA 4F2LA 3HU3A 2I7PA 3T6PA 3HJQA 3TPZA 3B9PA 4NSOB 3LMMA 2OOBA 2JNHA 2DAIA 1IXRC 2XH9A 4LF4M 1OQYA 5EJCA 2DAEA 5ITXE 2O01F 3KFUG 4JI7M 3SATA 2LBCA 3E9SA 4II7A 1ZQ9A 3Q8GA 3A46A 1OTRA 2G3QA 4DV4M 3K8ZA 1G4AE 1VEJA 1E9RA 3D8BA 4X62M 1EIJA 2X4AA 5EQTA 2I7NA 2CUZA 3C3EA 4L16A 2WSEF 4DUZM 4LY6A 3W68A 2RRUA 1N36M 2QZ4A 3EIHA 3PVSA 3UMMA 2VIIA 3PFIA 1KYIA 3IECA 4NOOB 2APLA 2CFOA 3AKZA 1N34M 1L2DA 1FJGM 4B3RM 1J7KA 2CRUA 5DFLA 3GO8A 2Y21A 3SAVA 4LF7M 2UXBM 1QAOA 4NXMM 4YY3M 3J80S 5A2QS 3KDSE 3U5ZA 3V76A 1QQWA 2F5OA 2HHHM 5JI3E 2JZ1A 1WGLA 2VDBB 1HT1E 2RGHA 4QOSA 2YNMD 1DGFA 4GEWA 1QUTA 5BR8M 4LGYA 1GABA 1HNXM 2CHGA 2XGNA 1T43A 1YE9A 3UK6A 1XNQM 3L2AA 1JR3D 5EXSA 4MH0E 3LQRA 1PJQA 1NVMA 2KZUA 2XF3A 2VF7A 3KOXE 2LVQD 1H6UA 5KO3A 3C58A 1N75A 4I8OA 3SHGB 3IG8A 3PNYA 5EXTA 4G4OA 2LVOC 1G71A 3LQQA 2CHQA 1QZMA 1E94E 1LTMA 1VG5A 1WR1B 3K92A 2KRUA 3I01M 2DWLA 4OX9M 2UXDM 3K9OA 3SYLA 3VKGA 3Q8XA 1R5LA 4B7GA 3L27A 2DXIA 1ORYB 1G59A 5C18A 3U6PA 2QBYA 4LFBM 2KA6B 3KP0E 4IJFA 3HHYA 2FNAA 2R4EA 2LH0A 3B7ZA 5FTNA 3T15A 2KNAA 4B3SM 4ZPXA 2MGWA 4OVZB 2DZLA 2L6OA 4KO8A 1P3QQ 1TH2A 2OQ4A 1Z6TA 1IXSA 3T1HM 2KZSA 2ZTCA 4QOZC 2R45A 5DNYA 4IBFA 1DO0A 4P16A 4I81A 1XNRM 1SG9A 2BJVA 2L7HA 1HQYE 4DV5M 1IQPA 3GRYA 4M0DA 4DBGB 4JI4M 2CE7A 1GL7A 2JY8A 1R2YA 1HNZM 3SC3A 5FTLA 2Z7JA 2R4JA 1XXHB 1IN7A 3U5ZB 1XB2B 3DOAA 3HY5A 4AG5A 3M6AA 3TL4X 2HL7A 5L8RF 1DO2A 2KRKA 4HL4A 3KOWE 3RFWA 3SBJA 1JR3E 1QAQA 2XSZD 2XZFA 4JI2M 1S3SA 1EFUB 4RF1A 1WXQA 3VLFB 1ZMVA 2QHOB 3GPUA 3VK8A 1GLNA 4PT5A 3FYCA 3A42A 2Q2EB 3K9PA 1NY5A 4CISA 4ITQA 2RGOA 3MMPA 4IBGA 2JY7A 2C9CA 5FTKA 1DGHB 3GLHE 1XC8A 2FH0A 3GLGE 1PM5A 3L25A 2LVAA 2A5YB 1Z5AA 3JR4A 2R18A 3BOSA 4IBKA 2OPFA 2EUCA 3D8LA 2Z4SA 1HQCA 3J7AS 1MJGM 2R6FA 5IREB 5C1BA 2DVWB 8CATA 1IBLM 4M0WA 4JI0M 4DR5M 4LF6M 5EP1A 3B7NA 3SAWA 2DI0A 1V34A 1JB0F 5LMNM 2UUBM 2JXNA 2JZ0A 2V1CA 4GHLA 1OFIA 1Q3CA 1QYRA 3AOEA 3SAUA 2K47A 1IXSB 1CUKA 4IBBA 4LJ8A 2J5YA 4M9ZA 1HNWM 4MGYE 3VDPA 4FCVA 3ZC7B 3LVVA 4DR3M 1QDRA 4IBEA 3SFZA 1OKSA 5H37D 1JR3A 1NSFA 4IBJA 1TTEA 4AG6A 3HHWA 3L29A 3U6LA 5DYGA 1QZEA 4AKGA 5EP3A 2EKFA 2QQ8A 2M5ZA 4RF0A 1QDTA 4PDIA 1D2NA 3DFZA 5FTJA 3LCVB 3UZUA 3W0FA 2K6BA 4LFCM 3F92A 1JQJC 2XEPA 1TGUA 2EKKA 3GLGA 1V33A 4OVZA 1IY0A 4DUYM 3I04M 2QNJA 3K2LA 1X37A 3FTFA 1RU3A 3GRUA 3U6CA 4JI1M 1UM8A 4GRIA 2UXCM 2Z8YM 2CV0A 3U6QA 4WP2A 3VDUA 2DWZB 4JI6M 4D81A 1TDZA 1WJ7A 4FWHA 2Z4RA 4NRWA 3HKPA 4DR7M 2D7EA 4R71A 1WGNA 4KT0F 5DYIA 1PJJA 1OJLA 2KHHA 4AQYM 2L09A 3T38A 3GQ5A 4M9XA 1XXHA 2EJSA 2HKJA 2JWSA 3A98B 3J27B 3W0LB 4TUWA 4LRSA 4DR4M 4KODA 3L26A 1T3TA 2CV1A 4B08A 1IM2A 3GLIE 2L7IA 3L28A 2E5LM 5EP4A 1QAMA 1LV7A 1Q3BA 2VF8A 3J7BA 2Y20A 4B3TM 4KLNA 3GPPA 4IJEA 1QANA 4WURA 3U6MA 3GPXA 3GRVA 2X49A 1R6BX 2YR0A 4D80A 1YLAA 4NSRA 2XSZA 5ITXA 4DV2M 1IXZA 1J09A 3GLFE 4ANRA 4IBCA 4DV1M 3LVWA 4MB7A 1DGHA 2C96A 4XGIA 2FS1A 1N77A 2YFQA 2MH8A 4AI6A 5EP2A 2JY6B 4GH9A 1G3IA 4BB9A 2CP8A 3E21A 5IZ7D 1R7RA 2DHRA 3CF6E 4IBDA 5ITQA 5KQ8A 1TR8A 1WHCA 4LF8M 2JP7A 4PD2A 2R65A 3QAUA 1IBKM 1Q39A 2CHVA 3FUWA 4NC6A 4L8RC 2QSFX 3EIEA 3TWKA 3GLHB 4B7HA 5FSWA 4DR2M 3IHPA 1GO5A 3GLGB 2Y0TA 4R3DA 1TH4A 5IT9S 3KW6A 3ZH9B 3AOEC 1L2BA 4GC9A 5E6JA 1BVSA 4DV0M 1PGYA 2G5GX 1R2ZA 2MJ5B 3LW5F 1MX0A 1NV8A 1OAIA 3KSXA 2DWMA 3HHZA 4QNRA 3GLIA 3VK7A 4AKIA 1QUSA 3JR5A 2ZANA 3B7QA 2UUCM 1SXJE 3FUVA 4IBIA 3FKEA 5ITTA 5ITUA 1L8QA 1IY2A 3AJIB 2P5TA 2VQEM 1MU5A 2D7HA 4LRTA 2F5NA 5KPZA 1IN6A 4DV7M 4PCZA 1NJFA 4DR6M 3GRRA 3HHXA 4W5WA 1VEKA 2CWBA 3QWLA 4Z8XA 4LJAA 5FLXS 2R0IA 2F4VM 2R62A 4MM3B 1L1TA 4I4LA 2OO9A 2R46A 2O25A 4UN2B 2CEAA 3HU2A 1NNJA 4G3OA 4L4UA 3RE8A 4CIZA 1ZAEA 1PJIA 3SMSA 3KOYE 2W82A 2QENA 3T1YM 4LJ4A 1VDDA 1L2CA 3I4YA 2K0BX 2LTUA 3FD9A 3QYBA 2WSFF 2K9DA 4HEOA 2H5XA 1ZV1A 5FTMA 5GKNA 1PRBA 3HU1A 3PXGA 1MN3A 1N33M 3AOGA 3M0EA 3RGSA 2H1RA 4GC5A 2HAKA 2QP9X 4PDGA 3TWLA 3U6EA 3SMPA 4MGKE 1PJSA 1D0KA 4M9SA 1UFZA 2ERCA 3KOZE 4F1IA 3CTWB 1HJPA 4D82A 2LHGA 2LVNC 3MK6A 2NQ8C 3HZJA 4GMQA 3SYKA 4EIWA 4FD2A 3SARA 2CV2A 2FOIC 4G4NA 4FVMA 2G8LA 3TQSA 4P17A 3GLIB 1GL6A 1Z5CA 4FW9A 4QHTA 3TE6A 2X8AA 3J81S 4XBOA 4LZZA 4X64M 3U6SA 3GP1A 2XFTA 2XLJA 2B3TA 1AUAA 4FWGA 2V1UA 1XMQM 1A5TA 2DZOB 1NV9A 4LJ7A 4CGYB 2V6ZM 4FWDA 2DKLA 1R4GA 4LJ5A 3FRHA 5ITRA 1C7YA 3GLHA 1TH3A 3PNVA 2L4FA 4AW4A 2C9OA 2AHMA 2FE8A 1EE8A 2EO2A 3A45A 4JXJA 2DAKA 5LMUM 1NO1A 3UJNA 3U6DA 2BWEA 3AFHA 1DV0A 4CJ6A 4LF5M 3J2PB 2JA2A 1IN4A 4B7FA 3KVWA 2DAMA 3FUUA 1KSFX 1XWIA 2C98A 4HLQA 1IBMM 2EA0A 3HWSA 1KFVA 5KQDA 1NHWC 4WW0A 2F5QA 3KP1E 3FE3A 3BXWA 2MROB 2ZAOA 3IG5A 1OFHA 1OAOC 1SXJD 3K1JA 3KXEC 3HGIA 4LJ6A 1YSYA 4YHHM 1K3WA 2QCUA 4Z6YA 3H4JA 1FNNA 2L2DA 3WHKA 3I51A 4MGIE 2JUJA 1TF0B 3QYEA 4NL4H 3FUXA 3BBZA 3ZCBB 2BWBA 3U60B 3ZQJA 3AL0C 1SXJB 2KW0A 4IIWA 3KS8A 2J7OA 3M7GA
chains in the Genus database with same CATH topology
1G41A 4LZJA 3FUTA 4LJ9A 5IWAM 1XMOM 3KS4A 3JAMS 4I5SA 2LXEA 3NBIA 1I94M 1E32A 4LFAM 4L15A 2C99A 5KPRA 4JN6A 4MGZE 5BPVA 3R8FA 2DZNB 4GKKM 2Y0QA 3RGPA 1YUBA 3H4MA 4GHAA 4BLCA 3VKHA 3FTEA 1L1ZA 5EXPA 2J7NA 4NRVA 1C1KA 4L78A 1SXJC 1Z59A 3MHVC 3U6OA 4LG2A 2O5RA 4X65M 5ITYA 4A3VB 1Z5BA 2RKOA 1J5EM 1W5TA 2XFSA 4BBAA 3FTDA 3UGJA 1NY6A 2BJWA 4G4QA 3WHLA 4LGMA 2UUAM 3U61A 4QNMA 2QPAA 3KSJA 3E4RA 1E9SA 1N32M 3DZDA 3DA1A 1TDHA 4GIPA 1I4WA 4K0KM 4FCWA 4LF9M 4KHPM 3GLFA 2XZUA 4CHTB 4GKJM 1GKIA 2KEBA 3ILKA 4B3MM 3MJ5A 4G6ZA 2F5SA 4X66M 1DGGA 2ZM6M 3HJ8A 4OU7A 1NHGC 4R7GA 4QHSA 4RNAA 3THGA 2C5RA 2F5PA 4G4RA 2LNHC 3HJSA 3SASA 4JYAM 3OTOM 7CATA 1HT2E 2BNKA 4AZFA 4JV5M 3CF2A 4MGHA 3R9XB 1K3XA 2HCBA 2M60A 1NNUC 5EXXA 1IN8A 1HR0M 3U60A 1SXJA 2UU9M 1K82A 3AV0A 3SHFA 4DV6M 5E26A 1GVNA 4JI8M 5KPTA 4S12A 4DV3M 3NWLA 2ZBKB 1DGBA 2Z3XA 4LCBA 3U61B 3TWMA 2QBYB 4JI3M 4NXNM 1W5SA 4OW0A 5JI2E 2FFJA 4REZA 1G8PA 3GQ3A 1IY1A 1NJGA 2KXEA 2ZAMA 1IN5A 4GITA 3GPYA 2D7GA 1QVRA 2LWXA 3GLFB 2DWNA 4FCTA 1N78A 4AKHA 3CF0A 2VQFM 1XHBA 3FTCA 3VFDA 4DR1M 3GQ4A 5F3WA 2YQZA 3FYDA 3I4VA 3HU3A 2I7PA 3HJQA 3TPZA 3B9PA 4NSOB 3LMMA 1IXRC 2XH9A 4LF4M 5EJCA 5ITXE 3KFUG 4JI7M 3SATA 4II7A 3E9SA 1ZQ9A 3A46A 4DV4M 3K8ZA 1G4AE 3D8BA 1E9RA 4X62M 2X4AA 5EQTA 2I7NA 2CUZA 4L16A 4DUZM 4LY6A 1N36M 2QZ4A 3EIHA 3PVSA 3UMMA 2VIIA 3PFIA 1KYIA 4NOOB 2CFOA 3AKZA 1N34M 1L2DA 1FJGM 4B3RM 1J7KA 3SAVA 3GO8A 2Y21A 4LF7M 2UXBM 1QAOA 4NXMM 4YY3M 3J80S 5A2QS 3KDSE 3U5ZA 1QQWA 2F5OA 2HHHM 5JI3E 4QOSA 1HT1E 2RGHA 2YNMD 1DGFA 5BR8M 4LGYA 1HNXM 2CHGA 2XGNA 3UK6A 1YE9A 1XNQM 3L2AA 1JR3D 5EXSA 4MH0E 3LQRA 1NVMA 2KZUA 2XF3A 3KOXE 5KO3A 1H6UA 3C58A 1N75A 4I8OA 3SHGB 3IG8A 3PNYA 5EXTA 4G4OA 3LQQA 2CHQA 1QZMA 1E94E 3K92A 2DWLA 2KRUA 2UXDM 4OX9M 3SYLA 3VKGA 3Q8XA 4B7GA 2DXIA 3L27A 1ORYB 1G59A 5C18A 3U6PA 2QBYA 4LFBM 2KA6B 3KP0E 4IJFA 3HHYA 2FNAA 2R4EA 2LH0A 5FTNA 3T15A 4B3SM 4ZPXA 4OVZB 2L6OA 4KO8A 1TH2A 2OQ4A 1Z6TA 3T1HM 2KZSA 4QOZC 2R45A 5DNYA 4IBFA 1DO0A 4P16A 4I81A 1XNRM 2BJVA 2L7HA 1HQYE 4DV5M 1IQPA 3GRYA 4M0DA 4JI4M 2CE7A 1GL7A 1R2YA 1HNZM 3SC3A 5FTLA 2Z7JA 2R4JA 1XXHB 1IN7A 3U5ZB 3DOAA 4AG5A 3M6AA 3TL4X 2HL7A 1DO2A 2KRKA 4HL4A 3KOWE 3RFWA 3SBJA 1QAQA 2XSZD 2XZFA 4JI2M 1S3SA 4RF1A 3VLFB 1WXQA 3GPUA 3VK8A 1GLNA 4PT5A 3FYCA 3A42A 2Q2EB 4CISA 1NY5A 4ITQA 2RGOA 4IBGA 2C9CA 5FTKA 1DGHB 1XC8A 1PM5A 3L25A 2A5YB 1Z5AA 3JR4A 2R18A 3BOSA 4IBKA 2OPFA 2EUCA 3D8LA 2Z4SA 1HQCA 3J7AS 5IREB 5C1BA 2DVWB 8CATA 1IBLM 4M0WA 4JI0M 4DR5M 4LF6M 5EP1A 3SAWA 5LMNM 2UUBM 2V1CA 4GHLA 1OFIA 1QYRA 1Q3CA 3AOEA 3SAUA 2K47A 1IXSB 4IBBA 1HNWM 4LJ8A 4M9ZA 4MGYE 3VDPA 4FCVA 3ZC7B 3LVVA 4DR3M 4IBEA 3SFZA 5H37D 1JR3A 1NSFA 4IBJA 4AG6A 3HHWA 3L29A 3U6LA 5DYGA 4AKGA 5EP3A 2M5ZA 4RF0A 4PDIA 1D2NA 3DFZA 5FTJA 3UZUA 3W0FA 4LFCM 1JQJC 2XEPA 1TGUA 3GLGA 4OVZA 1IY0A 4DUYM 3K2LA 1X37A 3FTFA 3GRUA 3U6CA 4JI1M 1UM8A 4GRIA 2UXCM 2CV0A 3U6QA 3VDUA 2DWZB 4JI6M 4D81A 1TDZA 4FWHA 2Z4RA 4NRWA 3HKPA 4DR7M 2D7EA 5DYIA 1PJJA 1OJLA 4AQYM 2L09A 3T38A 3GQ5A 4M9XA 1XXHA 2HKJA 3A98B 3J27B 3W0LB 4TUWA 4LRSA 4DR4M 4KODA 3L26A 1T3TA 2CV1A 4B08A 1IM2A 2E5LM 2L7IA 3L28A 5EP4A 1QAMA 1LV7A 1Q3BA 3J7BA 2Y20A 4B3TM 4KLNA 3GPPA 4IJEA 1QANA 4WURA 3U6MA 3GPXA 3GRVA 2X49A 1R6BX 2YR0A 4D80A 4DV2M 4NSRA 2XSZA 5ITXA 1IXZA 1J09A 4IBCA 4DV1M 3LVWA 4MB7A 1DGHA 2C96A 4XGIA 1N77A 2YFQA 4AI6A 5EP2A 4GH9A 4BB9A 1G3IA 5IZ7D 1R7RA 2DHRA 3CF6E 4IBDA 5ITQA 5KQ8A 4PD2A 2R65A 3QAUA 1IBKM 1Q39A 2CHVA 3FUWA 4L8RC 3EIEA 3TWKA 3GLHB 4B7HA 5FSWA 4DR2M 3GLGB 2Y0TA 4R3DA 1TH4A 5IT9S 3KW6A 3ZH9B 3AOEC 1L2BA 4GC9A 5E6JA 4DV0M 2G5GX 1R2ZA 1MX0A 3KSXA 2DWMA 3HHZA 4QNRA 3GLIA 3VK7A 4AKIA 3JR5A 2ZANA 2UUCM 1SXJE 3FUVA 4IBIA 3FKEA 5ITTA 5ITUA 1L8QA 1IY2A 3AJIB 2P5TA 2VQEM 1MU5A 2D7HA 4LRTA 2F5NA 5KPZA 1IN6A 4DV7M 4PCZA 1NJFA 4DR6M 3GRRA 3HHXA 4W5WA 3QWLA 4Z8XA 4LJAA 5FLXS 2F4VM 2R62A 4MM3B 1L1TA 4I4LA 2R46A 2CEAA 3HU2A 1NNJA 4L4UA 3RE8A 1ZAEA 1PJIA 3SMSA 3KOYE 2W82A 2QENA 3T1YM 4LJ4A 1VDDA 1L2CA 3I4YA 3FD9A 5FTMA 5GKNA 3HU1A 3PXGA 1N33M 3AOGA 3M0EA 3RGSA 2H1RA 4GC5A 2QP9X 4PDGA 3U6EA 3TWLA 4JI5M 3SMPA 4MGKE 4LF8M 4M9SA 3KOZE 2ERCA 3CTWB 4D82A 3MK6A 2NQ8C 4GMQA 3SYKA 4EIWA 4FD2A 3SARA 2CV2A 2FOIC 4G4NA 4FVMA 2G8LA 3TQSA 3GLIB 1GL6A 1Z5CA 4FW9A 4QHTA 3TE6A 2X8AA 3J81S 4XBOA 4LZZA 4X64M 3U6SA 3GP1A 2XFTA 2XLJA 4FWGA 2V1UA 1XMQM 2DZOB 4LJ7A 4CGYB 2V6ZM 4FWDA 4LJ5A 5ITRA 3GLHA 1TH3A 3PNVA 4AW4A 2C9OA 2AHMA 1EE8A 2EO2A 2FE8A 3A45A 4JXJA 5LMUM 3UJNA 3U6DA 3AFHA 4LF5M 3J2PB 2JA2A 1IN4A 4B7FA 3KVWA 3FUUA 1KSFX 1XWIA 2C98A 4HLQA 1IBMM 2EA0A 3HWSA 1KFVA 5KQDA 1NHWC 4WW0A 2F5QA 3KP1E 2ZAOA 3IG5A 1OFHA 3KXEC 1SXJD 3K1JA 4LJ6A 3HGIA 4YHHM 1YSYA 1K3WA 2QCUA 4Z6YA 1FNNA 3WHKA 3I51A 4MGIE 4NL4H 3FUXA 3ZCBB 3U60B 3AL0C 1SXJB 2KW0A 4IIWA 3KS8A 2J7OA 3M7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M60 A;  2M5Z A; 
#chains in the Genus database with same CATH topology
 2LHC A;  2GQF A;  1G41 A;  4LZJ A;  3FUT A;  4LJ9 A;  1WIV A;  1VDL A;  5IWA M;  1XMO M;  3KS4 A;  3JAM S;  1IFY A;  4I5S A;  2ZTD A;  4RKU F;  2LXE A;  3NBI A;  3B74 A;  1OIZ A;  1E32 A;  1I94 M;  4LFA M;  4L15 A;  2C99 A;  5KPR A;  4JN6 A;  1Q02 A;  4MGZ E;  5BPV A;  3R8F A;  2DZN B;  4GKK M;  1V92 A;  2Y0Q A;  3RGP A;  1YUB A;  3H4M A;  4GHA A;  4BLC A;  3VKH A;  3FTE A;  1L1Z A;  5EXP A;  2N35 A;  2J7N A;  2WZJ A;  4NRV A;  2KNZ A;  1C1K A;  4L78 A;  1SXJ C;  1Z59 A;  3MHV C;  3U6O A;  4LG2 A;  2O5R A;  4X65 M;  5ITY A;  4A3V B;  1Z5B A;  1T6O A;  2RKO A;  1J5E M;  1W5T A;  2XFS A;  4BBA A;  3FTD A;  3UGJ A;  1F4I A;  1NY6 A;  2BJW A;  2MR9 A;  4G4Q A;  1OIP A;  4LGM A;  3WHL A;  2UUA M;  2JY5 A;  3U61 A;  4QNM A;  1VEG A;  2QPA A;  4Q7J A;  3KSJ A;  3E4R A;  1E9S A;  3C3D A;  3HX3 A;  1N32 M;  3DZD A;  3DA1 A;  3C9P A;  1TDH A;  1D0L A;  4GIP A;  1I4W A;  1Y8G A;  4K0K M;  4FCW A;  1GJT A;  2GNO A;  2KDL A;  4LF9 M;  1ZMW A;  2DAG A;  3GLF A;  4KHP M;  2XZU A;  4CHT B;  1D0M A;  4GKJ M;  1GKI A;  2KEB A;  3ILK A;  4B3M M;  3MJ5 A;  1PJT A;  4G6Z A;  4JI5 M;  2F5S A;  4X66 M;  1DGG A;  2ZM6 M;  3HJ8 A;  4OU7 A;  1NHG C;  4R7G A;  3NBX X;  4QHS A;  4RNA A;  3THG A;  2C5R A;  2F5P A;  2OOA A;  4Y28 F;  2LNH C;  3HJS A;  4G4R A;  3SAS A;  4JYA M;  3OTO M;  3CGW A;  3E46 A;  7CAT A;  1HT2 E;  2BNK A;  4AZF A;  2L4E A;  4JV5 M;  3CF2 A;  4MGH A;  1GJS A;  3R9X B;  1K3X A;  2HCB A;  2M60 A;  1NNU C;  5EXX A;  1IN8 A;  2KNV A;  2R44 A;  1VQ1 A;  1HR0 M;  3U60 A;  1AIP C;  1SXJ A;  4XK8 F;  2UU9 M;  2DHY A;  1K82 A;  3AV0 A;  3SHF A;  4DV6 M;  1ZMU A;  3LCU A;  5E26 A;  1GVN A;  4JI8 M;  5KPT A;  4S12 A;  4DV3 M;  3NWL A;  2ZBK B;  2LVP C;  2DEN A;  1DGB A;  2Z3X A;  4LCB A;  3U61 B;  2DNA A;  3TWM A;  2QBY B;  4JI3 M;  4L6V 6;  4NXN M;  1W5S A;  4OW0 A;  5JI2 E;  2FFJ A;  3FRI A;  4REZ A;  1G8P A;  2WSC F;  1IY1 A;  1NJG A;  2KXE A;  2ZAM A;  1IN5 A;  4GIT A;  3GQ3 A;  3GPY A;  2D7G A;  1QVR A;  2LWX A;  3GLF B;  2DWN A;  4FCT A;  1N78 A;  4AKH A;  3CF0 A;  2HWJ A;  3B89 A;  3W67 A;  2VQF M;  1XHB A;  3FTC A;  3VFD A;  4DR1 M;  3GQ4 A;  1XXH E;  5F3W A;  2YQZ A;  3FYD A;  3I4V A;  4F2L A;  3HU3 A;  2I7P A;  3T6P A;  3HJQ A;  3TPZ A;  3B9P A;  4NSO B;  3LMM A;  2OOB A;  2JNH A;  2DAI A;  1IXR C;  2XH9 A;  4LF4 M;  1OQY A;  5EJC A;  2DAE A;  5ITX E;  2O01 F;  3KFU G;  4JI7 M;  3SAT A;  2LBC A;  3E9S A;  4II7 A;  1ZQ9 A;  3Q8G A;  3A46 A;  1OTR A;  2G3Q A;  4DV4 M;  3K8Z A;  1G4A E;  1VEJ A;  1E9R A;  3D8B A;  4X62 M;  1EIJ A;  2X4A A;  5EQT A;  2I7N A;  2CUZ A;  3C3E A;  4L16 A;  2WSE F;  4DUZ M;  4LY6 A;  3W68 A;  2RRU A;  1N36 M;  2QZ4 A;  3EIH A;  3PVS A;  3UMM A;  2VII A;  3PFI A;  1KYI A;  3IEC A;  4NOO B;  2APL A;  2CFO A;  3AKZ A;  1N34 M;  1L2D A;  1FJG M;  4B3R M;  1J7K A;  2CRU A;  5DFL A;  3GO8 A;  2Y21 A;  3SAV A;  4LF7 M;  2UXB M;  1QAO A;  4NXM M;  4YY3 M;  3J80 S;  5A2Q S;  3KDS E;  3U5Z A;  3V76 A;  1QQW A;  2F5O A;  2HHH M;  5JI3 E;  2JZ1 A;  1WGL A;  2VDB B;  1HT1 E;  2RGH A;  4QOS A;  2YNM D;  1DGF A;  4GEW A;  1QUT A;  5BR8 M;  4LGY A;  1GAB A;  1HNX M;  2CHG A;  2XGN A;  1T43 A;  1YE9 A;  3UK6 A;  1XNQ M;  3L2A A;  1JR3 D;  5EXS A;  4MH0 E;  3LQR A;  1PJQ A;  1NVM A;  2KZU A;  2XF3 A;  2VF7 A;  3KOX E;  2LVQ D;  1H6U A;  5KO3 A;  3C58 A;  1N75 A;  4I8O A;  3SHG B;  3IG8 A;  3PNY A;  5EXT A;  4G4O A;  2LVO C;  1G71 A;  3LQQ A;  2CHQ A;  1QZM A;  1E94 E;  1LTM A;  1VG5 A;  1WR1 B;  3K92 A;  2KRU A;  3I01 M;  2DWL A;  4OX9 M;  2UXD M;  3K9O A;  3SYL A;  3VKG A;  3Q8X A;  1R5L A;  4B7G A;  3L27 A;  2DXI A;  1ORY B;  1G59 A;  5C18 A;  3U6P A;  2QBY A;  4LFB M;  2KA6 B;  3KP0 E;  4IJF A;  3HHY A;  2FNA A;  2R4E A;  2LH0 A;  3B7Z A;  5FTN A;  3T15 A;  2KNA A;  4B3S M;  4ZPX A;  2MGW A;  4OVZ B;  2DZL A;  2L6O A;  4KO8 A;  1P3Q Q;  1TH2 A;  2OQ4 A;  1Z6T A;  1IXS A;  3T1H M;  2KZS A;  2ZTC A;  4QOZ C;  2R45 A;  5DNY A;  4IBF A;  1DO0 A;  4P16 A;  4I81 A;  1XNR M;  1SG9 A;  2BJV A;  2L7H A;  1HQY E;  4DV5 M;  1IQP A;  3GRY A;  4M0D A;  4DBG B;  4JI4 M;  2CE7 A;  1GL7 A;  2JY8 A;  1R2Y A;  1HNZ M;  3SC3 A;  5FTL A;  2Z7J A;  2R4J A;  1XXH B;  1IN7 A;  3U5Z B;  1XB2 B;  3DOA A;  3HY5 A;  4AG5 A;  3M6A A;  3TL4 X;  2HL7 A;  5L8R F;  1DO2 A;  2KRK A;  4HL4 A;  3KOW E;  3RFW A;  3SBJ A;  1JR3 E;  1QAQ A;  2XSZ D;  2XZF A;  4JI2 M;  1S3S A;  1EFU B;  4RF1 A;  1WXQ A;  3VLF B;  1ZMV A;  2QHO B;  3GPU A;  3VK8 A;  1GLN A;  4PT5 A;  3FYC A;  3A42 A;  2Q2E B;  3K9P A;  1NY5 A;  4CIS A;  4ITQ A;  2RGO A;  3MMP A;  4IBG A;  2JY7 A;  2C9C A;  5FTK A;  1DGH B;  3GLH E;  1XC8 A;  2FH0 A;  3GLG E;  1PM5 A;  3L25 A;  2LVA A;  2A5Y B;  1Z5A A;  3JR4 A;  2R18 A;  3BOS A;  4IBK A;  2OPF A;  2EUC A;  3D8L A;  2Z4S A;  1HQC A;  3J7A S;  1MJG M;  2R6F A;  5IRE B;  5C1B A;  2DVW B;  8CAT A;  1IBL M;  4M0W A;  4JI0 M;  4DR5 M;  4LF6 M;  5EP1 A;  3B7N A;  3SAW A;  2DI0 A;  1V34 A;  1JB0 F;  5LMN M;  2UUB M;  2JXN A;  2JZ0 A;  2V1C A;  4GHL A;  1OFI A;  1Q3C A;  1QYR A;  3AOE A;  3SAU A;  2K47 A;  1IXS B;  1CUK A;  4IBB A;  4LJ8 A;  2J5Y A;  4M9Z A;  1HNW M;  4MGY E;  3VDP A;  4FCV A;  3ZC7 B;  3LVV A;  4DR3 M;  1QDR A;  4IBE A;  3SFZ A;  1OKS A;  5H37 D;  1JR3 A;  1NSF A;  4IBJ A;  1TTE A;  4AG6 A;  3HHW A;  3L29 A;  3U6L A;  5DYG A;  1QZE A;  4AKG A;  5EP3 A;  2EKF A;  2QQ8 A;  2M5Z A;  4RF0 A;  1QDT A;  4PDI A;  1D2N A;  3DFZ A;  5FTJ A;  3LCV B;  3UZU A;  3W0F A;  2K6B A;  4LFC M;  3F92 A;  1JQJ C;  2XEP A;  1TGU A;  2EKK A;  3GLG A;  1V33 A;  4OVZ A;  1IY0 A;  4DUY M;  3I04 M;  2QNJ A;  3K2L A;  1X37 A;  3FTF A;  1RU3 A;  3GRU A;  3U6C A;  4JI1 M;  1UM8 A;  4GRI A;  2UXC M;  2Z8Y M;  2CV0 A;  3U6Q A;  4WP2 A;  3VDU A;  2DWZ B;  4JI6 M;  4D81 A;  1TDZ A;  1WJ7 A;  4FWH A;  2Z4R A;  4NRW A;  3HKP A;  4DR7 M;  2D7E A;  4R71 A;  1WGN A;  4KT0 F;  5DYI A;  1PJJ A;  1OJL A;  2KHH A;  4AQY M;  2L09 A;  3T38 A;  3GQ5 A;  4M9X A;  1XXH A;  2EJS A;  2HKJ A;  2JWS A;  3A98 B;  3J27 B;  3W0L B;  4TUW A;  4LRS A;  4DR4 M;  4KOD A;  3L26 A;  1T3T A;  2CV1 A;  4B08 A;  1IM2 A;  3GLI E;  2L7I A;  3L28 A;  2E5L M;  5EP4 A;  1QAM A;  1LV7 A;  1Q3B A;  2VF8 A;  3J7B A;  2Y20 A;  4B3T M;  4KLN A;  3GPP A;  4IJE A;  1QAN A;  4WUR A;  3U6M A;  3GPX A;  3GRV A;  2X49 A;  1R6B X;  2YR0 A;  4D80 A;  1YLA A;  4NSR A;  2XSZ A;  5ITX A;  4DV2 M;  1IXZ A;  1J09 A;  3GLF E;  4ANR A;  4IBC A;  4DV1 M;  3LVW A;  4MB7 A;  1DGH A;  2C96 A;  4XGI A;  2FS1 A;  1N77 A;  2YFQ A;  2MH8 A;  4AI6 A;  5EP2 A;  2JY6 B;  4GH9 A;  1G3I A;  4BB9 A;  2CP8 A;  3E21 A;  5IZ7 D;  1R7R A;  2DHR A;  3CF6 E;  4IBD A;  5ITQ A;  5KQ8 A;  1TR8 A;  1WHC A;  4LF8 M;  2JP7 A;  4PD2 A;  2R65 A;  3QAU A;  1IBK M;  1Q39 A;  2CHV A;  3FUW A;  4NC6 A;  4L8R C;  2QSF X;  3EIE A;  3TWK A;  3GLH B;  4B7H A;  5FSW A;  4DR2 M;  3IHP A;  1GO5 A;  3GLG B;  2Y0T A;  4R3D A;  1TH4 A;  5IT9 S;  3KW6 A;  3ZH9 B;  3AOE C;  1L2B A;  4GC9 A;  5E6J A;  1BVS A;  4DV0 M;  1PGY A;  2G5G X;  1R2Z A;  2MJ5 B;  3LW5 F;  1MX0 A;  1NV8 A;  1OAI A;  3KSX A;  2DWM A;  3HHZ A;  4QNR A;  3GLI A;  3VK7 A;  4AKI A;  1QUS A;  3JR5 A;  2ZAN A;  3B7Q A;  2UUC M;  1SXJ E;  3FUV A;  4IBI A;  3FKE A;  5ITT A;  5ITU A;  1L8Q A;  1IY2 A;  3AJI B;  2P5T A;  2VQE M;  1MU5 A;  2D7H A;  4LRT A;  2F5N A;  5KPZ A;  1IN6 A;  4DV7 M;  4PCZ A;  1NJF A;  4DR6 M;  3GRR A;  3HHX A;  4W5W A;  1VEK A;  2CWB A;  3QWL A;  4Z8X A;  4LJA A;  5FLX S;  2R0I A;  2F4V M;  2R62 A;  4MM3 B;  1L1T A;  4I4L A;  2OO9 A;  2R46 A;  2O25 A;  4UN2 B;  2CEA A;  3HU2 A;  1NNJ A;  4G3O A;  4L4U A;  3RE8 A;  4CIZ A;  1ZAE A;  1PJI A;  3SMS A;  3KOY E;  2W82 A;  2QEN A;  3T1Y M;  4LJ4 A;  1VDD A;  1L2C A;  3I4Y A;  2K0B X;  2LTU A;  3FD9 A;  3QYB A;  2WSF F;  2K9D A;  4HEO A;  2H5X A;  1ZV1 A;  5FTM A;  5GKN A;  1PRB A;  3HU1 A;  3PXG A;  1MN3 A;  1N33 M;  3AOG A;  3M0E A;  3RGS A;  2H1R A;  4GC5 A;  2HAK A;  2QP9 X;  4PDG A;  3TWL A;  3U6E A;  3SMP A;  4MGK E;  1PJS A;  1D0K A;  4M9S A;  1UFZ A;  2ERC A;  3KOZ E;  4F1I A;  3CTW B;  1HJP A;  4D82 A;  2LHG A;  2LVN C;  3MK6 A;  2NQ8 C;  3HZJ A;  4GMQ A;  3SYK A;  4EIW A;  4FD2 A;  3SAR A;  2CV2 A;  2FOI C;  4G4N A;  4FVM A;  2G8L A;  3TQS A;  4P17 A;  3GLI B;  1GL6 A;  1Z5C A;  4FW9 A;  4QHT A;  3TE6 A;  2X8A A;  3J81 S;  4XBO A;  4LZZ A;  4X64 M;  3U6S A;  3GP1 A;  2XFT A;  2XLJ A;  2B3T A;  1AUA A;  4FWG A;  2V1U A;  1XMQ M;  1A5T A;  2DZO B;  1NV9 A;  4LJ7 A;  4CGY B;  2V6Z M;  4FWD A;  2DKL A;  1R4G A;  4LJ5 A;  3FRH A;  5ITR A;  1C7Y A;  3GLH A;  1TH3 A;  3PNV A;  2L4F A;  4AW4 A;  2C9O A;  2AHM A;  2FE8 A;  1EE8 A;  2EO2 A;  3A45 A;  4JXJ A;  2DAK A;  5LMU M;  1NO1 A;  3UJN A;  3U6D A;  2BWE A;  3AFH A;  1DV0 A;  4CJ6 A;  4LF5 M;  3J2P B;  2JA2 A;  1IN4 A;  4B7F A;  3KVW A;  2DAM A;  3FUU A;  1KSF X;  1XWI A;  2C98 A;  4HLQ A;  1IBM M;  2EA0 A;  3HWS A;  1KFV A;  5KQD A;  1NHW C;  4WW0 A;  2F5Q A;  3KP1 E;  3FE3 A;  3BXW A;  2MRO B;  2ZAO A;  3IG5 A;  1OFH A;  1OAO C;  1SXJ D;  3K1J A;  3KXE C;  3HGI A;  4LJ6 A;  1YSY A;  4YHH M;  1K3W A;  2QCU A;  4Z6Y A;  3H4J A;  1FNN A;  2L2D A;  3WHK A;  3I51 A;  4MGI E;  2JUJ A;  1TF0 B;  3QYE A;  4NL4 H;  3FUX A;  3BBZ A;  3ZCB B;  2BWB A;  3U60 B;  3ZQJ A;  3AL0 C;  1SXJ B;  2KW0 A;  4IIW A;  3KS8 A;  2J7O A;  3M7G A; 
#chains in the Genus database with same CATH homology
 1G41 A;  4LZJ A;  3FUT A;  4LJ9 A;  5IWA M;  1XMO M;  3KS4 A;  3JAM S;  4I5S A;  2LXE A;  3NBI A;  1I94 M;  1E32 A;  4LFA M;  4L15 A;  2C99 A;  5KPR A;  4JN6 A;  4MGZ E;  5BPV A;  3R8F A;  2DZN B;  4GKK M;  2Y0Q A;  3RGP A;  1YUB A;  3H4M A;  4GHA A;  4BLC A;  3VKH A;  3FTE A;  1L1Z A;  5EXP A;  2J7N A;  4NRV A;  1C1K A;  4L78 A;  1SXJ C;  1Z59 A;  3MHV C;  3U6O A;  4LG2 A;  2O5R A;  4X65 M;  5ITY A;  4A3V B;  1Z5B A;  2RKO A;  1J5E M;  1W5T A;  2XFS A;  4BBA A;  3FTD A;  3UGJ A;  1NY6 A;  2BJW A;  4G4Q A;  3WHL A;  4LGM A;  2UUA M;  3U61 A;  4QNM A;  2QPA A;  3KSJ A;  3E4R A;  1E9S A;  1N32 M;  3DZD A;  3DA1 A;  1TDH A;  4GIP A;  1I4W A;  4K0K M;  4FCW A;  4LF9 M;  4KHP M;  3GLF A;  2XZU A;  4CHT B;  4GKJ M;  1GKI A;  2KEB A;  3ILK A;  4B3M M;  3MJ5 A;  4G6Z A;  2F5S A;  4X66 M;  1DGG A;  2ZM6 M;  3HJ8 A;  4OU7 A;  1NHG C;  4R7G A;  4QHS A;  4RNA A;  3THG A;  2C5R A;  2F5P A;  4G4R A;  2LNH C;  3HJS A;  3SAS A;  4JYA M;  3OTO M;  7CAT A;  1HT2 E;  2BNK A;  4AZF A;  4JV5 M;  3CF2 A;  4MGH A;  3R9X B;  1K3X A;  2HCB A;  2M60 A;  1NNU C;  5EXX A;  1IN8 A;  1HR0 M;  3U60 A;  1SXJ A;  2UU9 M;  1K82 A;  3AV0 A;  3SHF A;  4DV6 M;  5E26 A;  1GVN A;  4JI8 M;  5KPT A;  4S12 A;  4DV3 M;  3NWL A;  2ZBK B;  1DGB A;  2Z3X A;  4LCB A;  3U61 B;  3TWM A;  2QBY B;  4JI3 M;  4NXN M;  1W5S A;  4OW0 A;  5JI2 E;  2FFJ A;  4REZ A;  1G8P A;  3GQ3 A;  1IY1 A;  1NJG A;  2KXE A;  2ZAM A;  1IN5 A;  4GIT A;  3GPY A;  2D7G A;  1QVR A;  2LWX A;  3GLF B;  2DWN A;  4FCT A;  1N78 A;  4AKH A;  3CF0 A;  2VQF M;  1XHB A;  3FTC A;  3VFD A;  4DR1 M;  3GQ4 A;  5F3W A;  2YQZ A;  3FYD A;  3I4V A;  3HU3 A;  2I7P A;  3HJQ A;  3TPZ A;  3B9P A;  4NSO B;  3LMM A;  1IXR C;  2XH9 A;  4LF4 M;  5EJC A;  5ITX E;  3KFU G;  4JI7 M;  3SAT A;  4II7 A;  3E9S A;  1ZQ9 A;  3A46 A;  4DV4 M;  3K8Z A;  1G4A E;  3D8B A;  1E9R A;  4X62 M;  2X4A A;  5EQT A;  2I7N A;  2CUZ A;  4L16 A;  4DUZ M;  4LY6 A;  1N36 M;  2QZ4 A;  3EIH A;  3PVS A;  3UMM A;  2VII A;  3PFI A;  1KYI A;  4NOO B;  2CFO A;  3AKZ A;  1N34 M;  1L2D A;  1FJG M;  4B3R M;  1J7K A;  3SAV A;  3GO8 A;  2Y21 A;  4LF7 M;  2UXB M;  1QAO A;  4NXM M;  4YY3 M;  3J80 S;  5A2Q S;  3KDS E;  3U5Z A;  1QQW A;  2F5O A;  2HHH M;  5JI3 E;  4QOS A;  1HT1 E;  2RGH A;  2YNM D;  1DGF A;  5BR8 M;  4LGY A;  1HNX M;  2CHG A;  2XGN A;  3UK6 A;  1YE9 A;  1XNQ M;  3L2A A;  1JR3 D;  5EXS A;  4MH0 E;  3LQR A;  1NVM A;  2KZU A;  2XF3 A;  3KOX E;  5KO3 A;  1H6U A;  3C58 A;  1N75 A;  4I8O A;  3SHG B;  3IG8 A;  3PNY A;  5EXT A;  4G4O A;  3LQQ A;  2CHQ A;  1QZM A;  1E94 E;  3K92 A;  2DWL A;  2KRU A;  2UXD M;  4OX9 M;  3SYL A;  3VKG A;  3Q8X A;  4B7G A;  2DXI A;  3L27 A;  1ORY B;  1G59 A;  5C18 A;  3U6P A;  2QBY A;  4LFB M;  2KA6 B;  3KP0 E;  4IJF A;  3HHY A;  2FNA A;  2R4E A;  2LH0 A;  5FTN A;  3T15 A;  4B3S M;  4ZPX A;  4OVZ B;  2L6O A;  4KO8 A;  1TH2 A;  2OQ4 A;  1Z6T A;  3T1H M;  2KZS A;  4QOZ C;  2R45 A;  5DNY A;  4IBF A;  1DO0 A;  4P16 A;  4I81 A;  1XNR M;  2BJV A;  2L7H A;  1HQY E;  4DV5 M;  1IQP A;  3GRY A;  4M0D A;  4JI4 M;  2CE7 A;  1GL7 A;  1R2Y A;  1HNZ M;  3SC3 A;  5FTL A;  2Z7J A;  2R4J A;  1XXH B;  1IN7 A;  3U5Z B;  3DOA A;  4AG5 A;  3M6A A;  3TL4 X;  2HL7 A;  1DO2 A;  2KRK A;  4HL4 A;  3KOW E;  3RFW A;  3SBJ A;  1QAQ A;  2XSZ D;  2XZF A;  4JI2 M;  1S3S A;  4RF1 A;  3VLF B;  1WXQ A;  3GPU A;  3VK8 A;  1GLN A;  4PT5 A;  3FYC A;  3A42 A;  2Q2E B;  4CIS A;  1NY5 A;  4ITQ A;  2RGO A;  4IBG A;  2C9C A;  5FTK A;  1DGH B;  1XC8 A;  1PM5 A;  3L25 A;  2A5Y B;  1Z5A A;  3JR4 A;  2R18 A;  3BOS A;  4IBK A;  2OPF A;  2EUC A;  3D8L A;  2Z4S A;  1HQC A;  3J7A S;  5IRE B;  5C1B A;  2DVW B;  8CAT A;  1IBL M;  4M0W A;  4JI0 M;  4DR5 M;  4LF6 M;  5EP1 A;  3SAW A;  5LMN M;  2UUB M;  2V1C A;  4GHL A;  1OFI A;  1QYR A;  1Q3C A;  3AOE A;  3SAU A;  2K47 A;  1IXS B;  4IBB A;  1HNW M;  4LJ8 A;  4M9Z A;  4MGY E;  3VDP A;  4FCV A;  3ZC7 B;  3LVV A;  4DR3 M;  4IBE A;  3SFZ A;  5H37 D;  1JR3 A;  1NSF A;  4IBJ A;  4AG6 A;  3HHW A;  3L29 A;  3U6L A;  5DYG A;  4AKG A;  5EP3 A;  2M5Z A;  4RF0 A;  4PDI A;  1D2N A;  3DFZ A;  5FTJ A;  3UZU A;  3W0F A;  4LFC M;  1JQJ C;  2XEP A;  1TGU A;  3GLG A;  4OVZ A;  1IY0 A;  4DUY M;  3K2L A;  1X37 A;  3FTF A;  3GRU A;  3U6C A;  4JI1 M;  1UM8 A;  4GRI A;  2UXC M;  2CV0 A;  3U6Q A;  3VDU A;  2DWZ B;  4JI6 M;  4D81 A;  1TDZ A;  4FWH A;  2Z4R A;  4NRW A;  3HKP A;  4DR7 M;  2D7E A;  5DYI A;  1PJJ A;  1OJL A;  4AQY M;  2L09 A;  3T38 A;  3GQ5 A;  4M9X A;  1XXH A;  2HKJ A;  3A98 B;  3J27 B;  3W0L B;  4TUW A;  4LRS A;  4DR4 M;  4KOD A;  3L26 A;  1T3T A;  2CV1 A;  4B08 A;  1IM2 A;  2E5L M;  2L7I A;  3L28 A;  5EP4 A;  1QAM A;  1LV7 A;  1Q3B A;  3J7B A;  2Y20 A;  4B3T M;  4KLN A;  3GPP A;  4IJE A;  1QAN A;  4WUR A;  3U6M A;  3GPX A;  3GRV A;  2X49 A;  1R6B X;  2YR0 A;  4D80 A;  4DV2 M;  4NSR A;  2XSZ A;  5ITX A;  1IXZ A;  1J09 A;  4IBC A;  4DV1 M;  3LVW A;  4MB7 A;  1DGH A;  2C96 A;  4XGI A;  1N77 A;  2YFQ A;  4AI6 A;  5EP2 A;  4GH9 A;  4BB9 A;  1G3I A;  5IZ7 D;  1R7R A;  2DHR A;  3CF6 E;  4IBD A;  5ITQ A;  5KQ8 A;  4PD2 A;  2R65 A;  3QAU A;  1IBK M;  1Q39 A;  2CHV A;  3FUW A;  4L8R C;  3EIE A;  3TWK A;  3GLH B;  4B7H A;  5FSW A;  4DR2 M;  3GLG B;  2Y0T A;  4R3D A;  1TH4 A;  5IT9 S;  3KW6 A;  3ZH9 B;  3AOE C;  1L2B A;  4GC9 A;  5E6J A;  4DV0 M;  2G5G X;  1R2Z A;  1MX0 A;  3KSX A;  2DWM A;  3HHZ A;  4QNR A;  3GLI A;  3VK7 A;  4AKI A;  3JR5 A;  2ZAN A;  2UUC M;  1SXJ E;  3FUV A;  4IBI A;  3FKE A;  5ITT A;  5ITU A;  1L8Q A;  1IY2 A;  3AJI B;  2P5T A;  2VQE M;  1MU5 A;  2D7H A;  4LRT A;  2F5N A;  5KPZ A;  1IN6 A;  4DV7 M;  4PCZ A;  1NJF A;  4DR6 M;  3GRR A;  3HHX A;  4W5W A;  3QWL A;  4Z8X A;  4LJA A;  5FLX S;  2F4V M;  2R62 A;  4MM3 B;  1L1T A;  4I4L A;  2R46 A;  2CEA A;  3HU2 A;  1NNJ A;  4L4U A;  3RE8 A;  1ZAE A;  1PJI A;  3SMS A;  3KOY E;  2W82 A;  2QEN A;  3T1Y M;  4LJ4 A;  1VDD A;  1L2C A;  3I4Y A;  3FD9 A;  5FTM A;  5GKN A;  3HU1 A;  3PXG A;  1N33 M;  3AOG A;  3M0E A;  3RGS A;  2H1R A;  4GC5 A;  2QP9 X;  4PDG A;  3U6E A;  3TWL A;  4JI5 M;  3SMP A;  4MGK E;  4LF8 M;  4M9S A;  3KOZ E;  2ERC A;  3CTW B;  4D82 A;  3MK6 A;  2NQ8 C;  4GMQ A;  3SYK A;  4EIW A;  4FD2 A;  3SAR A;  2CV2 A;  2FOI C;  4G4N A;  4FVM A;  2G8L A;  3TQS A;  3GLI B;  1GL6 A;  1Z5C A;  4FW9 A;  4QHT A;  3TE6 A;  2X8A A;  3J81 S;  4XBO A;  4LZZ A;  4X64 M;  3U6S A;  3GP1 A;  2XFT A;  2XLJ A;  4FWG A;  2V1U A;  1XMQ M;  2DZO B;  4LJ7 A;  4CGY B;  2V6Z M;  4FWD A;  4LJ5 A;  5ITR A;  3GLH A;  1TH3 A;  3PNV A;  4AW4 A;  2C9O A;  2AHM A;  1EE8 A;  2EO2 A;  2FE8 A;  3A45 A;  4JXJ A;  5LMU M;  3UJN A;  3U6D A;  3AFH A;  4LF5 M;  3J2P B;  2JA2 A;  1IN4 A;  4B7F A;  3KVW A;  3FUU A;  1KSF X;  1XWI A;  2C98 A;  4HLQ A;  1IBM M;  2EA0 A;  3HWS A;  1KFV A;  5KQD A;  1NHW C;  4WW0 A;  2F5Q A;  3KP1 E;  2ZAO A;  3IG5 A;  1OFH A;  3KXE C;  1SXJ D;  3K1J A;  4LJ6 A;  3HGI A;  4YHH M;  1YSY A;  1K3W A;  2QCU A;  4Z6Y A;  1FNN A;  3WHK A;  3I51 A;  4MGI E;  4NL4 H;  3FUX A;  3ZCB B;  3U60 B;  3AL0 C;  1SXJ B;  2KW0 A;  4IIW A;  3KS8 A;  2J7O A;  3M7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...