2M60A

Enterocin 7b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Enterocin JSB
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2013-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m60A00
2M5ZA 2M60A
chains in the Genus database with same CATH superfamily
2K47A 1HQCA 4HEOA 3FRIA 3FUXA 1IQPA 3GLGB 4G4OA 4QNMA 2R0IA 3SARA 4G4RA 1Q39A 5KO3A 1T43A 1IM2A 3GRVA 3TQSA 5ITXE 2L09A 2R4EA 1GO5A 4A3VB 2HHHM 2R45A 1E94E 2EUCA 2C9CA 4OU7A 1X37A 2XFSA 1QAQA 2QNJA 2CP8A 4R7GA 3C58A 3U6EA 2KNVA 1OJLA 1NV9A 2E5LM 1W5SA 4F2LA 1PM5A 3CTWB 4IJFA 4NRWA 1JB0F 3IG8A 2MROB 2CV0A 4LGMA 2KZSA 4M9SA 1D0KA 1YUBA 2LXEA 3AJIB 2QQ8A 1D2NA 3LW5F 3RGPA 1Z5AA 4MGKE 3U60B 1EE8A 1TH2A 3FUVA 3J81S 4WURA 2EKKA 3L26A 3KOXE 2JNHA 2J7OA 4LGYA 1NVMA 1R2ZA 2WSFF 4QOSA 3FKEA 2O25A 3T15A 4DV1M 2UXDM 2DKLA 1GJTA 2Z3XA 3R9XB 3ZH9B 3SATA 3KSJA 4IJEA 1N77A 3FUWA 1NNJA 4LZZA 2XSZD 1P3QQ 4AG5A 3GLIA 4BBAA 2WZJA 2JY6B 5EXPA 1XXHE 4XGIA 4DR1M 3A46A 1IBMM 1IN8A 3LQQA 3GPXA 3A45A 3J2PB 3U5ZA 3AOGA 3GLFA 5ITQA 4FCWA 2XGNA 3T6PA 2VF7A 5ITXA 2RGHA 3BBZA 1G4AE 2M5ZA 1NHWC 3SFZA 2ZTCA 5EXSA 4GH9A 2M60A 3L2AA 1JR3D 2DZNB 3E9SA 3GLFB 8CATA 3HHWA 4BLCA 2ZTDA 4NL4H 4B3RM 3M0EA 2L4EA 2D7HA 4JI6M 3MHVC 3GPUA 2UXBM 1Q02A 1G71A 3HGIA 3GRYA 4B3MM 1IXZA 2Q2EB 3U6PA 2LVNC 3LCVB 1DGHA 2LVAA 2DHRA 2WSCF 5KPRA 3W0FA 1N33M 2VF8A 1TTEA 2EJSA 1IXSB 3KVWA 3QAUA 3ZC7B 5L8RF 4IBJA 3GQ3A 1FJGM 4YY3M 2MJ5B 2CHQA 4GHLA 2K6BA 5DYGA 4OVZA 5F3WA 4LY6A 3KW6A 4GMQA 1PJTA 2Z4SA 1QAOA 3GLGA 4MGZE 2JY5A 1EIJA 3U6MA 3E46A 5BPVA 3GPYA 4RKUF 3U61B 4YHHM 2NQ8C 1XWIA 2CFOA 1WHCA 4D80A 3FTEA 4JI5M 4LZJA 3J7BA 1GL7A 4LFAM 1D0LA 2MR9A 2LVPC 1V92A 3VK7A 4P16A 1V33A 2A5YB 3HHZA 4GIPA 1DV0A 1SXJC 3DA1A 3FYDA 3GLHE 1DGFA 3GP1A 1XB2B 2CEAA 2G3QA 3D8BA 4Z6YA 1IFYA 4PD2A 3DOAA 4PCZA 3AOEC 4LF5M 3GQ5A 2JP7A 3U6CA 2UUBM 2JXNA 1JR3A 2CE7A 2LNHC 5EP3A 4OW0A 3U6OA 2DWLA 3HX3A 4FCTA 1NO1A 2CV1A 2MH8A 4K0KM 4REZA 3SHFA 3B7QA 3SMSA 3A98B 3L29A 2X49A 3SBJA 4JV5M 2KA6B 4MGIE 4GHAA 3I51A 1JR3E 3B74A 3HJSA 2QSFX 4AKIA 1QDTA 3LQRA 4X64M 4LF7M 1Q3BA 1D0MA 3J27B 2QENA 3U6DA 3PNVA 3HKPA 3KSXA 1OAIA 3CF2A 5ITYA 2CHVA 1AUAA 4OVZB 2D7EA 2L4FA 1IN5A 2F4VM 2R6FA 4R3DA 4LCBA 3FRHA 2DAKA 2WSEF 4TUWA 4RF0A 1WJ7A 2CWBA 4LJAA 4PDGA 3AKZA 5EXTA 2HAKA 4DV6M 1C1KA 2R46A 2Z8YM 4LF6M 1IBLM 1CUKA 4RNAA 3UMMA 1R6BX 1OFIA 2JUJA 1VDLA 4X65M 1SXJE 4LJ8A 5FLXS 1KFVA 2I7PA 4B3TM 3F92A 1IN4A 2YFQA 4F1IA 2FH0A 4FW9A 1DO2A 1I4WA 2XF3A 1PJIA 3T38A 3UGJA 2OOAA 5A2QS 3L28A 2OQ4A 4DBGB 5ITTA 4LJ7A 3I04M 4FWDA 5GKNA 2XLJA 1OKSA 2DAGA 1QUSA 2KNAA 5KQDA 4JN6A 1K3WA 3I01M 4IIWA 5ITUA 2XZUA 4JI3M 3THGA 3PVSA 2HKJA 2YQZA 3I4VA 4FVMA 2KRKA 4Q7JA 5DNYA 1Y8GA 2VQFM 3TWKA 3GLHA 3E21A 2JZ0A 5LMUM 1QANA 1MJGM 2H5XA 3QYEA 3KXEC 2J7NA 1TR8A 1VDDA 3W68A 4DV0M 3T1HM 4LJ4A 2ZAOA 3GLHB 4GRIA 2BJVA 3ZCBB 1WR1B 1SXJB 2KHHA 3ZQJA 1PJJA 2BWBA 1L2DA 3WHKA 1N34M 2VDBB 4LRSA 4X62M 4LF8M 4DR2M 3CGWA 2QBYB 4LJ6A 4WP2A 3HU3A 1XNRM 2ZAMA 2Y0TA 1NY6A 4HL4A 1ZQ9A 5JI2E 4QNRA 1UM8A 1OFHA 3M7GA 2QHOB 1VQ1A 2LVQD 2ERCA 5E26A 1MU5A 4W5WA 4AW4A 2ZM6M 3BXWA 4I8OA 1YSYA 2C98A 3AFHA 4DR4M 2L7IA 5LMNM 2K9DA 1L2BA 1I94M 2F5OA 3NBIA 5IWAM 1SXJD 5ITRA 4G3OA 1XHBA 4LJ5A 1GL6A 3GRUA 2R62A 4OX9M 5EP1A 3SAUA 1WIVA 1N75A 2DWNA 1DGHB 4L16A 1IBKM 4MB7A 3AOEA 3KOWE 4X66M 2QBYA 1VEJA 3Q8GA 4GC5A 2KRUA 3B89A 1SG9A 2Z4RA 3K92A 4JI0M 4BB9A 2FNAA 4IBKA 4CIZA 4LJ9A 3IG5A 1YE9A 3VK8A 4WW0A 1XC8A 3SAVA 1LTMA 2QZ4A 2EO2A 1DGBA 1TH3A 3GLIE 1K3XA 4EIWA 2C96A 1HQYE 4XK8F 3CF0A 1QZMA 4ZPXA 3A42A 3R8FA 4JI2M 3HJ8A 3LVVA 4AKGA 5FSWA 3EIEA 4M9ZA 4IBBA 3C3EA 3HU2A 4NC6A 4LF4M 4DV2M 2HWJA 1S3SA 2DAEA 1QUTA 2FFJA 4CISA 2F5PA 2LH0A 3VDPA 5EP2A 1NJFA 3B7NA 2Z7JA 7CATA 4KODA 2MGWA 4CGYB 5KPZA 3GLGE 2UXCM 4IBFA 3MJ5A 2G8LA 4II7A 1GVNA 3HU1A 1ZMVA 1HT1E 4XBOA 2JWSA 4DUZM 2HL7A 3V76A 2C99A 3DZDA 3KDSE 2ZBKB 1C7YA 1SXJA 4P17A 1TF0B 4GEWA 4JI7M 4LFBM 1ORYB 1TGUA 3FTDA 1XMOM 4AKHA 2EKFA 2LBCA 3SAWA 4FD2A 1MN3A 4JXJA 1AIPC 3MK6A 2I7NA 4MH0E 1NY5A 2R18A 1HR0M 2G5GX 2XH9A 3MMPA 4NXMM 2OO9A 2FE8A 2V1CA 1QZEA 3QYBA 2BWEA 4UN2B 2CUZA 1ZMUA 3VLFB 4DR5M 4LF9M 1HJPA 2HCBA 4DR7M 1K82A 4NOOB 2DAMA 1ZMWA 2O01F 3D8LA 1Z6TA 5FTJA 2J5YA 4IBCA 4R71A 3BOSA 3ILKA 3M6AA 4NXNM 2LWXA 1PRBA 1WGNA 1IY1A 4RF1A 4NRVA 1UFZA 1KSFX 1QDRA 3B7ZA 4M0WA 1PJQA 5C1BA 4GKJM 3KP0E 1L8QA 2KNZA 3SMPA 4LRTA 1IXRC 1QQWA 4DV3M 3DFZA 1NHGC 1IN7A 3H4JA 1OQYA 5EP4A 2BNKA 2OPFA 3HHXA 3HZJA 3FUTA 4KLNA 2QCUA 3H4MA 3AV0A 4PT5A 5KQ8A 2F5NA 3KS4A 2KXEA 4M0DA 2CV2A 4B08A 2C5RA 3C3DA 3WHLA 2QP9X 1RU3A 3K8ZA 1NJGA 1ZAEA 3TWMA 2C9OA 4IBIA 3PXGA 1DGGA 3PFIA 2W82A 4L6V6 1Z59A 2DZOB 2FOIC 3FTFA 3E4RA 1HNXM 1A5TA 2D7GA 4I4LA 4DR3M 1G59A 2LTUA 4B7GA 2KDLA 4FCVA 2DVWB 2FS1A 2LHCA 3K1JA 3FYCA 3PNYA 5IZ7D 1Q3CA 3JR4A 2N35A 3EIHA 3KOZE 1L1ZA 1GABA 4PDIA 5IREB 2KEBA 2VQEM 3VKGA 3FE3A 3GLFE 3K9OA 1JQJC 1IY2A 5KPTA 1NV8A 1TDHA 1OIZA 2L2DA 1GKIA 3JR5A 4LFCM 2JY7A 1L2CA 2XSZA 4G6ZA 4B3SM 4ANRA 2BJWA 2XFTA 2RKOA 4IBGA 1OAOC 3U6LA 3B9PA 4KT0F 3SASA 3LMMA 3TPZA 1TH4A 3HWSA 1W5TA 1EFUB 1HNWM 4ITQA 2AHMA 4Z8XA 3TE6A 4FWGA 1GJSA 3IHPA 4AQYM 2ZANA 1F4IA 1J09A 1NSFA 2DNAA 4MGHA 5EJCA 4G4NA 3FD9A 1FNNA 4I5SA 4IBDA 1BVSA 2V6ZM 4I81A 2X4AA 3RFWA 3SHGB 4KHPM 2EA0A 2DAIA 3W0LB 2UU9M 4JYAM 2O5RA 2Y0QA 5DYIA 1R5LA 2JA2A 4FWHA 4DV5M 4KO8A 3GRRA 1G8PA 2L7HA 2B3TA 3SC3A 1G3IA 3IECA 3SYKA 3KS8A 3UZUA 2DHYA 2QPAA 4JI4M 3J7AS 3AL0C 4DV7M 2JZ1A 3QWLA 2P5TA 1ZV1A 1QAMA 1WXQA 1J5EM 1G41A 3T1YM 2CRUA 1NNUC 2X8AA 4M9XA 2VIIA 1GLNA 3GO8A 1R7RA 3TWLA 4GITA 1Z5BA 3I4YA 4IBEA 1L1TA 3NWLA 2DWMA 1N78A 3VDUA 1IN6A 5FTMA 3HHYA 4B7FA 3FUUA 3U6QA 2XZFA 1KYIA 1MX0A 3U61A 4D81A 4AG6A 2KZUA 2LVOC 4MGYE 1N32M 3GPPA 3W67A 1VG5A 3HY5A 3U6SA 2V1UA 4HLQA 4JI1M 4D82A 5EXXA 1IY0A 1TDZA 4AI6A 3U5ZB 4L15A 1PGYA 4DR6M 1E32A 2UUCM 3TL4X 3GLIB 2UUAM 1IXSA 4L78A 1V34A 3UJNA 4DUYM 1WGLA 1R2YA 3KFUG 1OIPA 2YR0A 4JI8M 3FTCA 4NSOB 2K0BX 5JI3E 2DI0A 2RRUA 2LHGA 2Y20A 2DXIA 1H6UA 4B7HA 2Y21A 1Z5CA 4CJ6A 1LV7A 2OOBA 1VEGA 2F5SA 5FTNA 1HT2E 2APLA 1E9RA 1YLAA 2R65A 3UK6A 4AZFA 2H1RA 2YNMD 2L6OA 3U60A 1HNZM 1QYRA 3L25A 1T3TA 1R4GA 3RE8A 5H37D 3OTOM 2F5QA 2XEPA 2JY8A 4GKKM 4GC9A 1OTRA 2DZLA 3C9PA 4Y28F 2GNOA 3Q8XA 2R44A 5FTLA 3GQ4A 1N36M 1PJSA 2DENA 4L8RC 3LCUA 3J80S 2GQFA 4CHTB 3NBXX 3K9PA 3K2LA 4DV4M 4QOZC 1XXHB 3KOYE 3LVWA 3VFDA 5IT9S 1XMQM 1QVRA 3KP1E 3SYLA 3VKHA 1XXHA 1T6OA 1DO0A 2RGOA 5FTKA 4L4UA 2DWZB 4QHTA 3JAMS 2KW0A 4QHSA 3RGSA 4NSRA 5BR8M 2R4JA 1E9SA 4G4QA 2CHGA 5DFLA 4S12A 5EQTA 3CF6E 5E6JA 5C18A 1VEKA 3HJQA 4MM3B 4LG2A 1J7KA 3L27A 1XNQM
chains in the Genus database with same CATH topology
2K47A 1HQCA 3FUXA 1IQPA 3GLGB 4G4OA 4QNMA 3SARA 4G4RA 1Q39A 5KO3A 3GRVA 1IM2A 3TQSA 5ITXE 2L09A 2R4EA 4A3VB 2HHHM 2R45A 1E94E 2EUCA 2C9CA 4OU7A 1X37A 2XFSA 1QAQA 4R7GA 3U6EA 3C58A 1OJLA 2E5LM 1W5SA 1PM5A 3CTWB 4IJFA 4NRWA 3IG8A 2CV0A 4LGMA 2KZSA 4M9SA 1YUBA 2LXEA 3AJIB 1D2NA 3RGPA 1Z5AA 4MGKE 3U60B 1EE8A 1TH2A 3FUVA 3J81S 4WURA 3L26A 3KOXE 2J7OA 4LGYA 1NVMA 1R2ZA 4QOSA 3FKEA 3T15A 4DV1M 2UXDM 2Z3XA 3R9XB 3ZH9B 3SATA 3KSJA 4IJEA 1N77A 3FUWA 1NNJA 4LZZA 2XSZD 4AG5A 3GLIA 4BBAA 5EXPA 4DR1M 4XGIA 3A46A 1IBMM 1IN8A 3LQQA 3GPXA 3A45A 3J2PB 3U5ZA 3AOGA 3GLFA 5ITQA 4FCWA 2XGNA 5ITXA 2RGHA 1G4AE 2M5ZA 1NHWC 3SFZA 5EXSA 4GH9A 2M60A 3L2AA 1JR3D 2DZNB 3E9SA 3GLFB 8CATA 3HHWA 4BLCA 4NL4H 4B3RM 3M0EA 2D7HA 4JI6M 3MHVC 3GPUA 2UXBM 3HGIA 3GRYA 4B3MM 1IXZA 2Q2EB 3U6PA 1DGHA 5KPRA 2DHRA 3W0FA 1N33M 3GQ3A 1IXSB 3KVWA 3QAUA 3ZC7B 1FJGM 4IBJA 4YY3M 2CHQA 4GHLA 5DYGA 4OVZA 5F3WA 4LY6A 3KW6A 4GMQA 2Z4SA 1QAOA 3GLGA 4MGZE 3U6MA 5BPVA 3GPYA 3U61B 4YHHM 2NQ8C 1XWIA 2CFOA 4D80A 3FTEA 4JI5M 4LZJA 3J7BA 1GL7A 4LFAM 3VK7A 4P16A 2A5YB 3HHZA 4GIPA 1SXJC 3DA1A 3FYDA 1DGFA 3GP1A 2CEAA 3D8BA 4Z6YA 4PD2A 3DOAA 4PCZA 3AOEC 4LF5M 3GQ5A 3U6CA 2UUBM 1JR3A 2CE7A 2LNHC 5EP3A 4OW0A 3U6OA 2DWLA 4FCTA 2CV1A 4K0KM 4REZA 3SHFA 3SMSA 3A98B 3L29A 2X49A 3SBJA 4JV5M 2KA6B 4MGIE 4GHAA 3I51A 3HJSA 4AKIA 3LQRA 4X64M 4LF7M 1Q3BA 3J27B 2QENA 3U6DA 3PNVA 3HKPA 3KSXA 3CF2A 5ITYA 2CHVA 4OVZB 2D7EA 1IN5A 2F4VM 4R3DA 4LCBA 4TUWA 4RF0A 4PDGA 4LJAA 3AKZA 5EXTA 4DV6M 1C1KA 2R46A 4LF6M 1IBLM 3UMMA 4RNAA 1R6BX 1OFIA 4X65M 5FLXS 1SXJE 4LJ8A 1KFVA 2I7PA 4B3TM 1IN4A 2YFQA 4FW9A 1DO2A 1I4WA 2XF3A 1PJIA 3T38A 3UGJA 5A2QS 3L28A 2OQ4A 5ITTA 4LJ7A 4FWDA 5GKNA 2XLJA 5KQDA 4JN6A 1K3WA 4IIWA 5ITUA 2XZUA 4JI3M 3THGA 3PVSA 3I4VA 2HKJA 4FVMA 2YQZA 2KRKA 5DNYA 2VQFM 3TWKA 3GLHA 5LMUM 1QANA 3KXEC 2J7NA 4DV0M 1VDDA 3T1HM 4LJ4A 2ZAOA 3GLHB 4GRIA 2BJVA 3ZCBB 1SXJB 1PJJA 1L2DA 3WHKA 1N34M 4LRSA 4X62M 4LF8M 4DR2M 2QBYB 4LJ6A 1XNRM 3HU3A 2ZAMA 2Y0TA 1NY6A 4HL4A 1ZQ9A 5JI2E 4QNRA 1UM8A 1OFHA 3M7GA 2ZM6M 2ERCA 5E26A 1MU5A 4W5WA 4AW4A 4I8OA 1YSYA 2C98A 3AFHA 4DR4M 2L7IA 5LMNM 1I94M 1L2BA 2F5OA 3NBIA 5IWAM 1SXJD 5ITRA 1XHBA 4LJ5A 1GL6A 3GRUA 2R62A 4OX9M 5EP1A 3SAUA 1N75A 2DWNA 1DGHB 4L16A 1IBKM 4MB7A 3AOEA 3KOWE 4X66M 2QBYA 4GC5A 2KRUA 3K92A 2Z4RA 4BB9A 4JI0M 2FNAA 4IBKA 4LJ9A 3IG5A 1YE9A 3VK8A 4WW0A 1XC8A 3SAVA 1DGBA 2EO2A 2QZ4A 1TH3A 1K3XA 4EIWA 2C96A 1HQYE 4ZPXA 3CF0A 1QZMA 3R8FA 3A42A 4JI2M 3HJ8A 3LVVA 4AKGA 5FSWA 3EIEA 4M9ZA 4IBBA 3HU2A 4LF4M 4DV2M 1S3SA 2FFJA 4CISA 2F5PA 2LH0A 3VDPA 5EP2A 1NJFA 2Z7JA 7CATA 4KODA 2UXCM 4CGYB 5KPZA 4IBFA 3MJ5A 2G8LA 4II7A 1GVNA 3HU1A 1HT1E 4XBOA 4DUZM 2HL7A 2C99A 3DZDA 3KDSE 2ZBKB 1SXJA 4JI7M 4LFBM 1ORYB 1TGUA 3FTDA 1XMOM 4AKHA 3SAWA 4FD2A 4JXJA 3MK6A 2I7NA 4MH0E 1NY5A 2R18A 1HR0M 2G5GX 2XH9A 4NXMM 2FE8A 2V1CA 4LF9M 4DR5M 2CUZA 3VLFB 2HCBA 4DR7M 1K82A 4NOOB 3D8LA 1Z6TA 5FTJA 4IBCA 3BOSA 3ILKA 3M6AA 4NXNM 2LWXA 1IY1A 4RF1A 4NRVA 1KSFX 4M0WA 5C1BA 4GKJM 3KP0E 1L8QA 3SMPA 4LRTA 1IXRC 1QQWA 4DV3M 3DFZA 1NHGC 1IN7A 5EP4A 2BNKA 2OPFA 3HHXA 4KLNA 3FUTA 5KQ8A 2QCUA 3H4MA 3AV0A 4PT5A 2F5NA 3KS4A 2KXEA 4M0DA 2CV2A 4B08A 2C5RA 3WHLA 2QP9X 3K8ZA 1NJGA 1ZAEA 3TWMA 2C9OA 4IBIA 3PXGA 1DGGA 3PFIA 2W82A 1Z59A 2DZOB 2FOIC 3FTFA 3E4RA 1HNXM 2D7GA 4I4LA 4DR3M 1G59A 4B7GA 4FCVA 2DVWB 3K1JA 3FYCA 3PNYA 5IZ7D 1Q3CA 3JR4A 3EIHA 3KOZE 1L1ZA 4PDIA 5IREB 2KEBA 2VQEM 3VKGA 1JQJC 1IY2A 5KPTA 3JR5A 1TDHA 1GKIA 4LFCM 1L2CA 2XSZA 4G6ZA 4B3SM 2BJWA 2XFTA 2RKOA 4IBGA 3U6LA 3B9PA 3SASA 3LMMA 3TPZA 1TH4A 3HWSA 1W5TA 1HNWM 4ITQA 2AHMA 4Z8XA 3TE6A 4FWGA 4AQYM 2ZANA 1J09A 1NSFA 4MGHA 5EJCA 4G4NA 3FD9A 1FNNA 4I5SA 4IBDA 2V6ZM 4I81A 2X4AA 3RFWA 3SHGB 4KHPM 2EA0A 3W0LB 2UU9M 4JYAM 2O5RA 2Y0QA 5DYIA 2JA2A 4FWHA 4DV5M 4KO8A 3GRRA 1G8PA 2L7HA 3SC3A 1G3IA 3SYKA 3KS8A 3UZUA 4JI4M 2QPAA 3J7AS 3AL0C 4DV7M 3QWLA 2P5TA 1QAMA 1WXQA 1J5EM 1G41A 3T1YM 1NNUC 2X8AA 4M9XA 2VIIA 1GLNA 3GO8A 1R7RA 3TWLA 4GITA 1Z5BA 3I4YA 4IBEA 1L1TA 3NWLA 2DWMA 1N78A 3VDUA 1IN6A 5FTMA 3HHYA 4B7FA 3FUUA 3U6QA 2XZFA 1KYIA 1MX0A 3U61A 4D81A 4AG6A 2KZUA 1N32M 4MGYE 3GPPA 2V1UA 3U6SA 4JI1M 4HLQA 4D82A 5EXXA 1IY0A 1TDZA 4AI6A 3U5ZB 4L15A 4DR6M 1E32A 2UUCM 3TL4X 3GLIB 2UUAM 4L78A 1R2YA 3UJNA 4DUYM 3KFUG 4JI8M 2YR0A 3FTCA 4NSOB 5JI3E 2Y20A 2DXIA 1H6UA 4B7HA 2Y21A 1Z5CA 1LV7A 2F5SA 5FTNA 1HT2E 1E9RA 2R65A 3UK6A 4AZFA 2H1RA 2YNMD 2L6OA 3U60A 1HNZM 1QYRA 3L25A 1T3TA 3RE8A 5H37D 3OTOM 2F5QA 2XEPA 4GKKM 4GC9A 5FTLA 3GQ4A 3Q8XA 1N36M 4L8RC 3J80S 4CHTB 3K2LA 4DV4M 4QOZC 1XXHB 3KOYE 3LVWA 3VFDA 5IT9S 1XMQM 1QVRA 3KP1E 3SYLA 3VKHA 1XXHA 2RGOA 1DO0A 5FTKA 4L4UA 2DWZB 4QHTA 3JAMS 2KW0A 4QHSA 3RGSA 4NSRA 5BR8M 2R4JA 1E9SA 4G4QA 2CHGA 4S12A 5EQTA 3CF6E 5E6JA 5C18A 3HJQA 4MM3B 4LG2A 1J7KA 3L27A 1XNQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5Z A;  2M60 A; 
#chains in the Genus database with same CATH topology
 2K47 A;  1HQC A;  4HEO A;  3FRI A;  3FUX A;  1IQP A;  3GLG B;  4G4O A;  4QNM A;  2R0I A;  3SAR A;  4G4R A;  1Q39 A;  5KO3 A;  1T43 A;  1IM2 A;  3GRV A;  3TQS A;  5ITX E;  2L09 A;  2R4E A;  1GO5 A;  4A3V B;  2HHH M;  2R45 A;  1E94 E;  2EUC A;  2C9C A;  4OU7 A;  1X37 A;  2XFS A;  1QAQ A;  2QNJ A;  2CP8 A;  4R7G A;  3C58 A;  3U6E A;  2KNV A;  1OJL A;  1NV9 A;  2E5L M;  1W5S A;  4F2L A;  1PM5 A;  3CTW B;  4IJF A;  4NRW A;  1JB0 F;  3IG8 A;  2MRO B;  2CV0 A;  4LGM A;  2KZS A;  4M9S A;  1D0K A;  1YUB A;  2LXE A;  3AJI B;  2QQ8 A;  1D2N A;  3LW5 F;  3RGP A;  1Z5A A;  4MGK E;  3U60 B;  1EE8 A;  1TH2 A;  3FUV A;  3J81 S;  4WUR A;  2EKK A;  3L26 A;  3KOX E;  2JNH A;  2J7O A;  4LGY A;  1NVM A;  1R2Z A;  2WSF F;  4QOS A;  3FKE A;  2O25 A;  3T15 A;  4DV1 M;  2UXD M;  2DKL A;  1GJT A;  2Z3X A;  3R9X B;  3ZH9 B;  3SAT A;  3KSJ A;  4IJE A;  1N77 A;  3FUW A;  1NNJ A;  4LZZ A;  2XSZ D;  1P3Q Q;  4AG5 A;  3GLI A;  4BBA A;  2WZJ A;  2JY6 B;  5EXP A;  1XXH E;  4XGI A;  4DR1 M;  3A46 A;  1IBM M;  1IN8 A;  3LQQ A;  3GPX A;  3A45 A;  3J2P B;  3U5Z A;  3AOG A;  3GLF A;  5ITQ A;  4FCW A;  2XGN A;  3T6P A;  2VF7 A;  5ITX A;  2RGH A;  3BBZ A;  1G4A E;  2M5Z A;  1NHW C;  3SFZ A;  2ZTC A;  5EXS A;  4GH9 A;  2M60 A;  3L2A A;  1JR3 D;  2DZN B;  3E9S A;  3GLF B;  8CAT A;  3HHW A;  4BLC A;  2ZTD A;  4NL4 H;  4B3R M;  3M0E A;  2L4E A;  2D7H A;  4JI6 M;  3MHV C;  3GPU A;  2UXB M;  1Q02 A;  1G71 A;  3HGI A;  3GRY A;  4B3M M;  1IXZ A;  2Q2E B;  3U6P A;  2LVN C;  3LCV B;  1DGH A;  2LVA A;  2DHR A;  2WSC F;  5KPR A;  3W0F A;  1N33 M;  2VF8 A;  1TTE A;  2EJS A;  1IXS B;  3KVW A;  3QAU A;  3ZC7 B;  5L8R F;  4IBJ A;  3GQ3 A;  1FJG M;  4YY3 M;  2MJ5 B;  2CHQ A;  4GHL A;  2K6B A;  5DYG A;  4OVZ A;  5F3W A;  4LY6 A;  3KW6 A;  4GMQ A;  1PJT A;  2Z4S A;  1QAO A;  3GLG A;  4MGZ E;  2JY5 A;  1EIJ A;  3U6M A;  3E46 A;  5BPV A;  3GPY A;  4RKU F;  3U61 B;  4YHH M;  2NQ8 C;  1XWI A;  2CFO A;  1WHC A;  4D80 A;  3FTE A;  4JI5 M;  4LZJ A;  3J7B A;  1GL7 A;  4LFA M;  1D0L A;  2MR9 A;  2LVP C;  1V92 A;  3VK7 A;  4P16 A;  1V33 A;  2A5Y B;  3HHZ A;  4GIP A;  1DV0 A;  1SXJ C;  3DA1 A;  3FYD A;  3GLH E;  1DGF A;  3GP1 A;  1XB2 B;  2CEA A;  2G3Q A;  3D8B A;  4Z6Y A;  1IFY A;  4PD2 A;  3DOA A;  4PCZ A;  3AOE C;  4LF5 M;  3GQ5 A;  2JP7 A;  3U6C A;  2UUB M;  2JXN A;  1JR3 A;  2CE7 A;  2LNH C;  5EP3 A;  4OW0 A;  3U6O A;  2DWL A;  3HX3 A;  4FCT A;  1NO1 A;  2CV1 A;  2MH8 A;  4K0K M;  4REZ A;  3SHF A;  3B7Q A;  3SMS A;  3A98 B;  3L29 A;  2X49 A;  3SBJ A;  4JV5 M;  2KA6 B;  4MGI E;  4GHA A;  3I51 A;  1JR3 E;  3B74 A;  3HJS A;  2QSF X;  4AKI A;  1QDT A;  3LQR A;  4X64 M;  4LF7 M;  1Q3B A;  1D0M A;  3J27 B;  2QEN A;  3U6D A;  3PNV A;  3HKP A;  3KSX A;  1OAI A;  3CF2 A;  5ITY A;  2CHV A;  1AUA A;  4OVZ B;  2D7E A;  2L4F A;  1IN5 A;  2F4V M;  2R6F A;  4R3D A;  4LCB A;  3FRH A;  2DAK A;  2WSE F;  4TUW A;  4RF0 A;  1WJ7 A;  2CWB A;  4LJA A;  4PDG A;  3AKZ A;  5EXT A;  2HAK A;  4DV6 M;  1C1K A;  2R46 A;  2Z8Y M;  4LF6 M;  1IBL M;  1CUK A;  4RNA A;  3UMM A;  1R6B X;  1OFI A;  2JUJ A;  1VDL A;  4X65 M;  1SXJ E;  4LJ8 A;  5FLX S;  1KFV A;  2I7P A;  4B3T M;  3F92 A;  1IN4 A;  2YFQ A;  4F1I A;  2FH0 A;  4FW9 A;  1DO2 A;  1I4W A;  2XF3 A;  1PJI A;  3T38 A;  3UGJ A;  2OOA A;  5A2Q S;  3L28 A;  2OQ4 A;  4DBG B;  5ITT A;  4LJ7 A;  3I04 M;  4FWD A;  5GKN A;  2XLJ A;  1OKS A;  2DAG A;  1QUS A;  2KNA A;  5KQD A;  4JN6 A;  1K3W A;  3I01 M;  4IIW A;  5ITU A;  2XZU A;  4JI3 M;  3THG A;  3PVS A;  2HKJ A;  2YQZ A;  3I4V A;  4FVM A;  2KRK A;  4Q7J A;  5DNY A;  1Y8G A;  2VQF M;  3TWK A;  3GLH A;  3E21 A;  2JZ0 A;  5LMU M;  1QAN A;  1MJG M;  2H5X A;  3QYE A;  3KXE C;  2J7N A;  1TR8 A;  1VDD A;  3W68 A;  4DV0 M;  3T1H M;  4LJ4 A;  2ZAO A;  3GLH B;  4GRI A;  2BJV A;  3ZCB B;  1WR1 B;  1SXJ B;  2KHH A;  3ZQJ A;  1PJJ A;  2BWB A;  1L2D A;  3WHK A;  1N34 M;  2VDB B;  4LRS A;  4X62 M;  4LF8 M;  4DR2 M;  3CGW A;  2QBY B;  4LJ6 A;  4WP2 A;  3HU3 A;  1XNR M;  2ZAM A;  2Y0T A;  1NY6 A;  4HL4 A;  1ZQ9 A;  5JI2 E;  4QNR A;  1UM8 A;  1OFH A;  3M7G A;  2QHO B;  1VQ1 A;  2LVQ D;  2ERC A;  5E26 A;  1MU5 A;  4W5W A;  4AW4 A;  2ZM6 M;  3BXW A;  4I8O A;  1YSY A;  2C98 A;  3AFH A;  4DR4 M;  2L7I A;  5LMN M;  2K9D A;  1L2B A;  1I94 M;  2F5O A;  3NBI A;  5IWA M;  1SXJ D;  5ITR A;  4G3O A;  1XHB A;  4LJ5 A;  1GL6 A;  3GRU A;  2R62 A;  4OX9 M;  5EP1 A;  3SAU A;  1WIV A;  1N75 A;  2DWN A;  1DGH B;  4L16 A;  1IBK M;  4MB7 A;  3AOE A;  3KOW E;  4X66 M;  2QBY A;  1VEJ A;  3Q8G A;  4GC5 A;  2KRU A;  3B89 A;  1SG9 A;  2Z4R A;  3K92 A;  4JI0 M;  4BB9 A;  2FNA A;  4IBK A;  4CIZ A;  4LJ9 A;  3IG5 A;  1YE9 A;  3VK8 A;  4WW0 A;  1XC8 A;  3SAV A;  1LTM A;  2QZ4 A;  2EO2 A;  1DGB A;  1TH3 A;  3GLI E;  1K3X A;  4EIW A;  2C96 A;  1HQY E;  4XK8 F;  3CF0 A;  1QZM A;  4ZPX A;  3A42 A;  3R8F A;  4JI2 M;  3HJ8 A;  3LVV A;  4AKG A;  5FSW A;  3EIE A;  4M9Z A;  4IBB A;  3C3E A;  3HU2 A;  4NC6 A;  4LF4 M;  4DV2 M;  2HWJ A;  1S3S A;  2DAE A;  1QUT A;  2FFJ A;  4CIS A;  2F5P A;  2LH0 A;  3VDP A;  5EP2 A;  1NJF A;  3B7N A;  2Z7J A;  7CAT A;  4KOD A;  2MGW A;  4CGY B;  5KPZ A;  3GLG E;  2UXC M;  4IBF A;  3MJ5 A;  2G8L A;  4II7 A;  1GVN A;  3HU1 A;  1ZMV A;  1HT1 E;  4XBO A;  2JWS A;  4DUZ M;  2HL7 A;  3V76 A;  2C99 A;  3DZD A;  3KDS E;  2ZBK B;  1C7Y A;  1SXJ A;  4P17 A;  1TF0 B;  4GEW A;  4JI7 M;  4LFB M;  1ORY B;  1TGU A;  3FTD A;  1XMO M;  4AKH A;  2EKF A;  2LBC A;  3SAW A;  4FD2 A;  1MN3 A;  4JXJ A;  1AIP C;  3MK6 A;  2I7N A;  4MH0 E;  1NY5 A;  2R18 A;  1HR0 M;  2G5G X;  2XH9 A;  3MMP A;  4NXM M;  2OO9 A;  2FE8 A;  2V1C A;  1QZE A;  3QYB A;  2BWE A;  4UN2 B;  2CUZ A;  1ZMU A;  3VLF B;  4DR5 M;  4LF9 M;  1HJP A;  2HCB A;  4DR7 M;  1K82 A;  4NOO B;  2DAM A;  1ZMW A;  2O01 F;  3D8L A;  1Z6T A;  5FTJ A;  2J5Y A;  4IBC A;  4R71 A;  3BOS A;  3ILK A;  3M6A A;  4NXN M;  2LWX A;  1PRB A;  1WGN A;  1IY1 A;  4RF1 A;  4NRV A;  1UFZ A;  1KSF X;  1QDR A;  3B7Z A;  4M0W A;  1PJQ A;  5C1B A;  4GKJ M;  3KP0 E;  1L8Q A;  2KNZ A;  3SMP A;  4LRT A;  1IXR C;  1QQW A;  4DV3 M;  3DFZ A;  1NHG C;  1IN7 A;  3H4J A;  1OQY A;  5EP4 A;  2BNK A;  2OPF A;  3HHX A;  3HZJ A;  3FUT A;  4KLN A;  2QCU A;  3H4M A;  3AV0 A;  4PT5 A;  5KQ8 A;  2F5N A;  3KS4 A;  2KXE A;  4M0D A;  2CV2 A;  4B08 A;  2C5R A;  3C3D A;  3WHL A;  2QP9 X;  1RU3 A;  3K8Z A;  1NJG A;  1ZAE A;  3TWM A;  2C9O A;  4IBI A;  3PXG A;  1DGG A;  3PFI A;  2W82 A;  4L6V 6;  1Z59 A;  2DZO B;  2FOI C;  3FTF A;  3E4R A;  1HNX M;  1A5T A;  2D7G A;  4I4L A;  4DR3 M;  1G59 A;  2LTU A;  4B7G A;  2KDL A;  4FCV A;  2DVW B;  2FS1 A;  2LHC A;  3K1J A;  3FYC A;  3PNY A;  5IZ7 D;  1Q3C A;  3JR4 A;  2N35 A;  3EIH A;  3KOZ E;  1L1Z A;  1GAB A;  4PDI A;  5IRE B;  2KEB A;  2VQE M;  3VKG A;  3FE3 A;  3GLF E;  3K9O A;  1JQJ C;  1IY2 A;  5KPT A;  1NV8 A;  1TDH A;  1OIZ A;  2L2D A;  1GKI A;  3JR5 A;  4LFC M;  2JY7 A;  1L2C A;  2XSZ A;  4G6Z A;  4B3S M;  4ANR A;  2BJW A;  2XFT A;  2RKO A;  4IBG A;  1OAO C;  3U6L A;  3B9P A;  4KT0 F;  3SAS A;  3LMM A;  3TPZ A;  1TH4 A;  3HWS A;  1W5T A;  1EFU B;  1HNW M;  4ITQ A;  2AHM A;  4Z8X A;  3TE6 A;  4FWG A;  1GJS A;  3IHP A;  4AQY M;  2ZAN A;  1F4I A;  1J09 A;  1NSF A;  2DNA A;  4MGH A;  5EJC A;  4G4N A;  3FD9 A;  1FNN A;  4I5S A;  4IBD A;  1BVS A;  2V6Z M;  4I81 A;  2X4A A;  3RFW A;  3SHG B;  4KHP M;  2EA0 A;  2DAI A;  3W0L B;  2UU9 M;  4JYA M;  2O5R A;  2Y0Q A;  5DYI A;  1R5L A;  2JA2 A;  4FWH A;  4DV5 M;  4KO8 A;  3GRR A;  1G8P A;  2L7H A;  2B3T A;  3SC3 A;  1G3I A;  3IEC A;  3SYK A;  3KS8 A;  3UZU A;  2DHY A;  2QPA A;  4JI4 M;  3J7A S;  3AL0 C;  4DV7 M;  2JZ1 A;  3QWL A;  2P5T A;  1ZV1 A;  1QAM A;  1WXQ A;  1J5E M;  1G41 A;  3T1Y M;  2CRU A;  1NNU C;  2X8A A;  4M9X A;  2VII A;  1GLN A;  3GO8 A;  1R7R A;  3TWL A;  4GIT A;  1Z5B A;  3I4Y A;  4IBE A;  1L1T A;  3NWL A;  2DWM A;  1N78 A;  3VDU A;  1IN6 A;  5FTM A;  3HHY A;  4B7F A;  3FUU A;  3U6Q A;  2XZF A;  1KYI A;  1MX0 A;  3U61 A;  4D81 A;  4AG6 A;  2KZU A;  2LVO C;  4MGY E;  1N32 M;  3GPP A;  3W67 A;  1VG5 A;  3HY5 A;  3U6S A;  2V1U A;  4HLQ A;  4JI1 M;  4D82 A;  5EXX A;  1IY0 A;  1TDZ A;  4AI6 A;  3U5Z B;  4L15 A;  1PGY A;  4DR6 M;  1E32 A;  2UUC M;  3TL4 X;  3GLI B;  2UUA M;  1IXS A;  4L78 A;  1V34 A;  3UJN A;  4DUY M;  1WGL A;  1R2Y A;  3KFU G;  1OIP A;  2YR0 A;  4JI8 M;  3FTC A;  4NSO B;  2K0B X;  5JI3 E;  2DI0 A;  2RRU A;  2LHG A;  2Y20 A;  2DXI A;  1H6U A;  4B7H A;  2Y21 A;  1Z5C A;  4CJ6 A;  1LV7 A;  2OOB A;  1VEG A;  2F5S A;  5FTN A;  1HT2 E;  2APL A;  1E9R A;  1YLA A;  2R65 A;  3UK6 A;  4AZF A;  2H1R A;  2YNM D;  2L6O A;  3U60 A;  1HNZ M;  1QYR A;  3L25 A;  1T3T A;  1R4G A;  3RE8 A;  5H37 D;  3OTO M;  2F5Q A;  2XEP A;  2JY8 A;  4GKK M;  4GC9 A;  1OTR A;  2DZL A;  3C9P A;  4Y28 F;  2GNO A;  3Q8X A;  2R44 A;  5FTL A;  3GQ4 A;  1N36 M;  1PJS A;  2DEN A;  4L8R C;  3LCU A;  3J80 S;  2GQF A;  4CHT B;  3NBX X;  3K9P A;  3K2L A;  4DV4 M;  4QOZ C;  1XXH B;  3KOY E;  3LVW A;  3VFD A;  5IT9 S;  1XMQ M;  1QVR A;  3KP1 E;  3SYL A;  3VKH A;  1XXH A;  1T6O A;  1DO0 A;  2RGO A;  5FTK A;  4L4U A;  2DWZ B;  4QHT A;  3JAM S;  2KW0 A;  4QHS A;  3RGS A;  4NSR A;  5BR8 M;  2R4J A;  1E9S A;  4G4Q A;  2CHG A;  5DFL A;  4S12 A;  5EQT A;  3CF6 E;  5E6J A;  5C18 A;  1VEK A;  3HJQ A;  4MM3 B;  4LG2 A;  1J7K A;  3L27 A;  1XNQ M; 
#chains in the Genus database with same CATH homology
 2K47 A;  1HQC A;  3FUX A;  1IQP A;  3GLG B;  4G4O A;  4QNM A;  3SAR A;  4G4R A;  1Q39 A;  5KO3 A;  3GRV A;  1IM2 A;  3TQS A;  5ITX E;  2L09 A;  2R4E A;  4A3V B;  2HHH M;  2R45 A;  1E94 E;  2EUC A;  2C9C A;  4OU7 A;  1X37 A;  2XFS A;  1QAQ A;  4R7G A;  3U6E A;  3C58 A;  1OJL A;  2E5L M;  1W5S A;  1PM5 A;  3CTW B;  4IJF A;  4NRW A;  3IG8 A;  2CV0 A;  4LGM A;  2KZS A;  4M9S A;  1YUB A;  2LXE A;  3AJI B;  1D2N A;  3RGP A;  1Z5A A;  4MGK E;  3U60 B;  1EE8 A;  1TH2 A;  3FUV A;  3J81 S;  4WUR A;  3L26 A;  3KOX E;  2J7O A;  4LGY A;  1NVM A;  1R2Z A;  4QOS A;  3FKE A;  3T15 A;  4DV1 M;  2UXD M;  2Z3X A;  3R9X B;  3ZH9 B;  3SAT A;  3KSJ A;  4IJE A;  1N77 A;  3FUW A;  1NNJ A;  4LZZ A;  2XSZ D;  4AG5 A;  3GLI A;  4BBA A;  5EXP A;  4DR1 M;  4XGI A;  3A46 A;  1IBM M;  1IN8 A;  3LQQ A;  3GPX A;  3A45 A;  3J2P B;  3U5Z A;  3AOG A;  3GLF A;  5ITQ A;  4FCW A;  2XGN A;  5ITX A;  2RGH A;  1G4A E;  2M5Z A;  1NHW C;  3SFZ A;  5EXS A;  4GH9 A;  2M60 A;  3L2A A;  1JR3 D;  2DZN B;  3E9S A;  3GLF B;  8CAT A;  3HHW A;  4BLC A;  4NL4 H;  4B3R M;  3M0E A;  2D7H A;  4JI6 M;  3MHV C;  3GPU A;  2UXB M;  3HGI A;  3GRY A;  4B3M M;  1IXZ A;  2Q2E B;  3U6P A;  1DGH A;  5KPR A;  2DHR A;  3W0F A;  1N33 M;  3GQ3 A;  1IXS B;  3KVW A;  3QAU A;  3ZC7 B;  1FJG M;  4IBJ A;  4YY3 M;  2CHQ A;  4GHL A;  5DYG A;  4OVZ A;  5F3W A;  4LY6 A;  3KW6 A;  4GMQ A;  2Z4S A;  1QAO A;  3GLG A;  4MGZ E;  3U6M A;  5BPV A;  3GPY A;  3U61 B;  4YHH M;  2NQ8 C;  1XWI A;  2CFO A;  4D80 A;  3FTE A;  4JI5 M;  4LZJ A;  3J7B A;  1GL7 A;  4LFA M;  3VK7 A;  4P16 A;  2A5Y B;  3HHZ A;  4GIP A;  1SXJ C;  3DA1 A;  3FYD A;  1DGF A;  3GP1 A;  2CEA A;  3D8B A;  4Z6Y A;  4PD2 A;  3DOA A;  4PCZ A;  3AOE C;  4LF5 M;  3GQ5 A;  3U6C A;  2UUB M;  1JR3 A;  2CE7 A;  2LNH C;  5EP3 A;  4OW0 A;  3U6O A;  2DWL A;  4FCT A;  2CV1 A;  4K0K M;  4REZ A;  3SHF A;  3SMS A;  3A98 B;  3L29 A;  2X49 A;  3SBJ A;  4JV5 M;  2KA6 B;  4MGI E;  4GHA A;  3I51 A;  3HJS A;  4AKI A;  3LQR A;  4X64 M;  4LF7 M;  1Q3B A;  3J27 B;  2QEN A;  3U6D A;  3PNV A;  3HKP A;  3KSX A;  3CF2 A;  5ITY A;  2CHV A;  4OVZ B;  2D7E A;  1IN5 A;  2F4V M;  4R3D A;  4LCB A;  4TUW A;  4RF0 A;  4PDG A;  4LJA A;  3AKZ A;  5EXT A;  4DV6 M;  1C1K A;  2R46 A;  4LF6 M;  1IBL M;  3UMM A;  4RNA A;  1R6B X;  1OFI A;  4X65 M;  5FLX S;  1SXJ E;  4LJ8 A;  1KFV A;  2I7P A;  4B3T M;  1IN4 A;  2YFQ A;  4FW9 A;  1DO2 A;  1I4W A;  2XF3 A;  1PJI A;  3T38 A;  3UGJ A;  5A2Q S;  3L28 A;  2OQ4 A;  5ITT A;  4LJ7 A;  4FWD A;  5GKN A;  2XLJ A;  5KQD A;  4JN6 A;  1K3W A;  4IIW A;  5ITU A;  2XZU A;  4JI3 M;  3THG A;  3PVS A;  3I4V A;  2HKJ A;  4FVM A;  2YQZ A;  2KRK A;  5DNY A;  2VQF M;  3TWK A;  3GLH A;  5LMU M;  1QAN A;  3KXE C;  2J7N A;  4DV0 M;  1VDD A;  3T1H M;  4LJ4 A;  2ZAO A;  3GLH B;  4GRI A;  2BJV A;  3ZCB B;  1SXJ B;  1PJJ A;  1L2D A;  3WHK A;  1N34 M;  4LRS A;  4X62 M;  4LF8 M;  4DR2 M;  2QBY B;  4LJ6 A;  1XNR M;  3HU3 A;  2ZAM A;  2Y0T A;  1NY6 A;  4HL4 A;  1ZQ9 A;  5JI2 E;  4QNR A;  1UM8 A;  1OFH A;  3M7G A;  2ZM6 M;  2ERC A;  5E26 A;  1MU5 A;  4W5W A;  4AW4 A;  4I8O A;  1YSY A;  2C98 A;  3AFH A;  4DR4 M;  2L7I A;  5LMN M;  1I94 M;  1L2B A;  2F5O A;  3NBI A;  5IWA M;  1SXJ D;  5ITR A;  1XHB A;  4LJ5 A;  1GL6 A;  3GRU A;  2R62 A;  4OX9 M;  5EP1 A;  3SAU A;  1N75 A;  2DWN A;  1DGH B;  4L16 A;  1IBK M;  4MB7 A;  3AOE A;  3KOW E;  4X66 M;  2QBY A;  4GC5 A;  2KRU A;  3K92 A;  2Z4R A;  4BB9 A;  4JI0 M;  2FNA A;  4IBK A;  4LJ9 A;  3IG5 A;  1YE9 A;  3VK8 A;  4WW0 A;  1XC8 A;  3SAV A;  1DGB A;  2EO2 A;  2QZ4 A;  1TH3 A;  1K3X A;  4EIW A;  2C96 A;  1HQY E;  4ZPX A;  3CF0 A;  1QZM A;  3R8F A;  3A42 A;  4JI2 M;  3HJ8 A;  3LVV A;  4AKG A;  5FSW A;  3EIE A;  4M9Z A;  4IBB A;  3HU2 A;  4LF4 M;  4DV2 M;  1S3S A;  2FFJ A;  4CIS A;  2F5P A;  2LH0 A;  3VDP A;  5EP2 A;  1NJF A;  2Z7J A;  7CAT A;  4KOD A;  2UXC M;  4CGY B;  5KPZ A;  4IBF A;  3MJ5 A;  2G8L A;  4II7 A;  1GVN A;  3HU1 A;  1HT1 E;  4XBO A;  4DUZ M;  2HL7 A;  2C99 A;  3DZD A;  3KDS E;  2ZBK B;  1SXJ A;  4JI7 M;  4LFB M;  1ORY B;  1TGU A;  3FTD A;  1XMO M;  4AKH A;  3SAW A;  4FD2 A;  4JXJ A;  3MK6 A;  2I7N A;  4MH0 E;  1NY5 A;  2R18 A;  1HR0 M;  2G5G X;  2XH9 A;  4NXM M;  2FE8 A;  2V1C A;  4LF9 M;  4DR5 M;  2CUZ A;  3VLF B;  2HCB A;  4DR7 M;  1K82 A;  4NOO B;  3D8L A;  1Z6T A;  5FTJ A;  4IBC A;  3BOS A;  3ILK A;  3M6A A;  4NXN M;  2LWX A;  1IY1 A;  4RF1 A;  4NRV A;  1KSF X;  4M0W A;  5C1B A;  4GKJ M;  3KP0 E;  1L8Q A;  3SMP A;  4LRT A;  1IXR C;  1QQW A;  4DV3 M;  3DFZ A;  1NHG C;  1IN7 A;  5EP4 A;  2BNK A;  2OPF A;  3HHX A;  4KLN A;  3FUT A;  5KQ8 A;  2QCU A;  3H4M A;  3AV0 A;  4PT5 A;  2F5N A;  3KS4 A;  2KXE A;  4M0D A;  2CV2 A;  4B08 A;  2C5R A;  3WHL A;  2QP9 X;  3K8Z A;  1NJG A;  1ZAE A;  3TWM A;  2C9O A;  4IBI A;  3PXG A;  1DGG A;  3PFI A;  2W82 A;  1Z59 A;  2DZO B;  2FOI C;  3FTF A;  3E4R A;  1HNX M;  2D7G A;  4I4L A;  4DR3 M;  1G59 A;  4B7G A;  4FCV A;  2DVW B;  3K1J A;  3FYC A;  3PNY A;  5IZ7 D;  1Q3C A;  3JR4 A;  3EIH A;  3KOZ E;  1L1Z A;  4PDI A;  5IRE B;  2KEB A;  2VQE M;  3VKG A;  1JQJ C;  1IY2 A;  5KPT A;  3JR5 A;  1TDH A;  1GKI A;  4LFC M;  1L2C A;  2XSZ A;  4G6Z A;  4B3S M;  2BJW A;  2XFT A;  2RKO A;  4IBG A;  3U6L A;  3B9P A;  3SAS A;  3LMM A;  3TPZ A;  1TH4 A;  3HWS A;  1W5T A;  1HNW M;  4ITQ A;  2AHM A;  4Z8X A;  3TE6 A;  4FWG A;  4AQY M;  2ZAN A;  1J09 A;  1NSF A;  4MGH A;  5EJC A;  4G4N A;  3FD9 A;  1FNN A;  4I5S A;  4IBD A;  2V6Z M;  4I81 A;  2X4A A;  3RFW A;  3SHG B;  4KHP M;  2EA0 A;  3W0L B;  2UU9 M;  4JYA M;  2O5R A;  2Y0Q A;  5DYI A;  2JA2 A;  4FWH A;  4DV5 M;  4KO8 A;  3GRR A;  1G8P A;  2L7H A;  3SC3 A;  1G3I A;  3SYK A;  3KS8 A;  3UZU A;  4JI4 M;  2QPA A;  3J7A S;  3AL0 C;  4DV7 M;  3QWL A;  2P5T A;  1QAM A;  1WXQ A;  1J5E M;  1G41 A;  3T1Y M;  1NNU C;  2X8A A;  4M9X A;  2VII A;  1GLN A;  3GO8 A;  1R7R A;  3TWL A;  4GIT A;  1Z5B A;  3I4Y A;  4IBE A;  1L1T A;  3NWL A;  2DWM A;  1N78 A;  3VDU A;  1IN6 A;  5FTM A;  3HHY A;  4B7F A;  3FUU A;  3U6Q A;  2XZF A;  1KYI A;  1MX0 A;  3U61 A;  4D81 A;  4AG6 A;  2KZU A;  1N32 M;  4MGY E;  3GPP A;  2V1U A;  3U6S A;  4JI1 M;  4HLQ A;  4D82 A;  5EXX A;  1IY0 A;  1TDZ A;  4AI6 A;  3U5Z B;  4L15 A;  4DR6 M;  1E32 A;  2UUC M;  3TL4 X;  3GLI B;  2UUA M;  4L78 A;  1R2Y A;  3UJN A;  4DUY M;  3KFU G;  4JI8 M;  2YR0 A;  3FTC A;  4NSO B;  5JI3 E;  2Y20 A;  2DXI A;  1H6U A;  4B7H A;  2Y21 A;  1Z5C A;  1LV7 A;  2F5S A;  5FTN A;  1HT2 E;  1E9R A;  2R65 A;  3UK6 A;  4AZF A;  2H1R A;  2YNM D;  2L6O A;  3U60 A;  1HNZ M;  1QYR A;  3L25 A;  1T3T A;  3RE8 A;  5H37 D;  3OTO M;  2F5Q A;  2XEP A;  4GKK M;  4GC9 A;  5FTL A;  3GQ4 A;  3Q8X A;  1N36 M;  4L8R C;  3J80 S;  4CHT B;  3K2L A;  4DV4 M;  4QOZ C;  1XXH B;  3KOY E;  3LVW A;  3VFD A;  5IT9 S;  1XMQ M;  1QVR A;  3KP1 E;  3SYL A;  3VKH A;  1XXH A;  2RGO A;  1DO0 A;  5FTK A;  4L4U A;  2DWZ B;  4QHT A;  3JAM S;  2KW0 A;  4QHS A;  3RGS A;  4NSR A;  5BR8 M;  2R4J A;  1E9S A;  4G4Q A;  2CHG A;  4S12 A;  5EQT A;  3CF6 E;  5E6J A;  5C18 A;  3HJQ A;  4MM3 B;  4LG2 A;  1J7K A;  3L27 A;  1XNQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...