2M60A

Enterocin 7b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
42
structure length
42
Chain Sequence
GAIAKLVAKFGWPFIKKFYKQIMQFIGQGWTIDQIEKWLKRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of the Linear Leaderless Bacteriocins Enterocin 7A and 7B Resemble Carnocyclin A, a Circular Antimicrobial Peptide
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Enterocin JSB
total genus 8
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2013-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.860 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2m60A00
2M60A 2M5ZA
chains in the Genus database with same CATH superfamily
4QHTA 1NV8A 1OIPA 2F5OA 3FE3A 2XFTA 3GO8A 4CHTB 2KZSA 2QZ4A 1WGNA 2XEPA 4DUYM 2JY5A 4JI6M 1TH3A 1R5LA 4LF9M 3KSJA 2E5LM 4R3DA 3THGA 2LVOC 1PM5A 1P3QQ 4HLQA 3U6PA 2J5YA 3FUVA 5KO3A 4B3MM 4S12A 2RKOA 3C3EA 5DFLA 4FWDA 4B7FA 3IHPA 4DV1M 4FCTA 1ZV1A 1OQYA 2DHYA 3E46A 4PCZA 2L4FA 5BR8M 2L6OA 3GPUA 2LVPC 1CUKA 2JA2A 4FW9A 4KT0F 4MH0E 3L26A 1D0LA 1OKSA 3M0EA 1XXHE 2Y0TA 2DAGA 4JI7M 3AJIB 1DO2A 1VDLA 4LJ4A 3UZUA 4NSRA 2Y0QA 4IJEA 2F5QA 1ZMVA 1TF0B 1KFVA 1IM2A 1I4WA 1R4GA 3FYCA 3HGIA 3SHGB 3ZC7B 1N77A 1G59A 4MGKE 3LVVA 1OAIA 3GLFA 4GHLA 2AHMA 3J27B 3RE8A 1NJGA 1IY1A 2XF3A 1JR3A 3HHWA 3SFZA 3CTWB 2QQ8A 3AOEC 4WW0A 1N34M 1J5EM 2VDBB 1E32A 1QANA 1TGUA 4FD2A 4MGZE 4DV5M 4AKIA 3LW5F 4GC9A 1TDHA 5IREB 3JAMS 3LCVB 4B3RM 4L4UA 4GRIA 3HJSA 3M6AA 4D82A 2OPFA 4GHAA 4AKHA 5EP4A 2CRUA 1IXSA 1QAMA 3GRUA 4X64M 2BWBA 3FRIA 1NNJA 1HNWM 5IWAM 2WSCF 2HAKA 5KQ8A 4WP2A 3L28A 1QDTA 1IXZA 2JWSA 1QUTA 4OU7A 1GABA 3H4JA 3KP0E 3MMPA 1GJSA 2DAKA 2DWZB 1Z5CA 3QYBA 3B89A 1QZEA 1XXHA 4LRTA 4AKGA 4JI3M 3VKHA 4B3TM 2L7HA 1T3TA 2XSZA 1OTRA 3DOAA 3A42A 2CV1A 4LJAA 4PDIA 1HJPA 4M0WA 5EXPA 4QOSA 2CP8A 1LV7A 2R44A 3AV0A 1IBMM 3D8BA 3T6PA 5ITRA 4LRSA 1MU5A 3SASA 1YE9A 2Y20A 1L8QA 2OO9A 2YQZA 3GLIE 2V1CA 2QP9X 3D8LA 1TH2A 3U6LA 1D2NA 2KW0A 3FKEA 4IBFA 2FFJA 2F4VM 2CFOA 4GMQA 2FOIC 1GLNA 3K9OA 1GKIA 3UK6A 3KVWA 4PDGA 4AG5A 3PVSA 4NXMM 4L78A 1IQPA 2QNJA 2V6ZM 4IBCA 2CHVA 4Y28F 1HNZM 2DXIA 2Y21A 2J7NA 3ZH9B 4DR3M 1DGFA 4XGIA 3F92A 3TWKA 3B7NA 2R4EA 1SXJD 1A5TA 4XBOA 1C7YA 3GPYA 4DR5M 3K9PA 4R71A 4AQYM 2UU9M 1PJTA 1K3XA 2FE8A 1PJJA 4DV3M 4LGMA 4JI4M 5LMNM 1J09A 3I51A 3Q8GA 4HL4A 1DV0A 5E26A 1DGHB 3H4MA 4BB9A 1N36M 3FYDA 3J7BA 3LQRA 2I7PA 5ITYA 3J2PB 2XLJA 3M7GA 1SXJA 4KHPM 4OVZA 1HQCA 2ZBKB 1Z59A 1XNQM 2C9OA 1AUAA 4XK8F 4LGYA 5GKNA 3VDUA 3R9XB 2QBYB 4QNMA 3HJQA 1ZQ9A 2M5ZA 1T43A 4JI8M 4AW4A 4JXJA 1DO0A 2KA6B 2D7HA 4X62M 3I01M 1XXHB 4AZFA 5JI2E 4Z8XA 1XB2B 4GIPA 1ZAEA 3PNVA 1QUSA 2JXNA 1TR8A 3U6DA 1NJFA 3GQ3A 3KOZE 2KRKA 3LQQA 1HR0M 4NSOB 3NBIA 1HQYE 2R4JA 1GJTA 1D0MA 3OTOM 1E94E 4RKUF 4D81A 4NC6A 2XZUA 1UFZA 4JI5M 4M0DA 1TDZA 1XMQM 5FTKA 1NY6A 2XSZD 5C18A 4FWGA 3KP1E 2UUCM 4OVZB 3HHZA 5LMUM 1N75A 1H6UA 3B7ZA 3SYKA 2C99A 2WZJA 3SBJA 2KNZA 3L29A 2LXEA 2ZAMA 3GLHE 3CF0A 4M9ZA 1WIVA 2JP7A 1NVMA 2DNAA 3GLIA 4FCWA 1Z5AA 4DV0M 4F1IA 2EKKA 3U6QA 1XMOM 1PRBA 2Q2EB 5EP2A 1DGBA 5ITQA 2Z8YM 1TH4A 4IBDA 3J80S 3JR5A 3DZDA 3GLFB 4II7A 2ERCA 3FTDA 2MH8A 1VG5A 4UN2B 1D0KA 3GRYA 3SC3A 4X65M 2QBYA 3HKPA 5FTJA 2FNAA 2DI0A 2ZAOA 2N35A 5EXXA 1E9RA 2UXBM 4B3SM 3HHYA 4BBAA 3GPPA 5EJCA 2LWXA 3B9PA 1G3IA 4LG2A 2BJWA 2KNVA 3VLFB 4KO8A 5EXTA 3C58A 2R46A 3VDPA 1WGLA 1IY2A 3E4RA 2JZ1A 1GL6A 4HEOA 3GRVA 1WHCA 2W82A 2YR0A 1N33M 3I4VA 1GL7A 1AIPC 4L16A 4F2LA 3HU2A 3FRHA 3U60B 1IN7A 1VQ1A 3KXEC 4LZZA 2XZFA 1L1ZA 2BJVA 2OOAA 2YNMD 2G3QA 1HT2E 1KSFX 2DENA 3A45A 3C3DA 1VEKA 1ORYB 2VQFM 2DAEA 2X8AA 1IY0A 1YLAA 4JI0M 1PJIA 2XGNA 2L7IA 3BOSA 4DR6M 2Z7JA 3CF6E 1OFIA 1HT1E 1OIZA 3K2LA 4LFAM 4M9SA 1G8PA 1Q39A 4IBJA 4MB7A 2F5NA 3U6EA 2H1RA 4LJ9A 5FLXS 3SAVA 2VF7A 3EIEA 3VKGA 1L2DA 2K6BA 4EIWA 3L25A 1EIJA 5ITUA 4DR2M 1Q3CA 4L15A 3A46A 1QVRA 5KPZA 1KYIA 5ITXE 4LY6A 4BLCA 3W68A 5IT9S 1E9SA 2XH9A 2KDLA 2I7NA 8CATA 1Z6TA 2KHHA 2O5RA 4G6ZA 1PJSA 1EE8A 2DVWB 3FTCA 3FTFA 3RGPA 2LVQD 2D7EA 1JR3D 4REZA 3GQ5A 3U61A 4PD2A 3HWSA 1R2ZA 4Z6YA 2EKFA 3E21A 2DWMA 2X49A 2DAMA 1SXJC 4GH9A 1G71A 4DUZM 1QDRA 2C96A 3VK7A 4DBGB 2CUZA 4MGHA 5KQDA 4G4OA 1SG9A 1NHWC 1R7RA 4NOOB 3HZJA 5E6JA 1DGGA 4GKKM 4LF5M 4W5WA 1NNUC 5EQTA 2WSEF 2OOBA 4B7HA 1FJGM 2KXEA 2MJ5B 2VF8A 3SARA 2DZLA 3IG8A 1NSFA 4LZJA 2XFSA 3CF2A 3W67A 1L2BA 4Q7JA 3NBXX 2F5PA 2LVAA 3U60A 1F4IA 3J81S 4IIWA 3ZCBB 4IBBA 2ZTCA 3TWLA 3SHFA 4LFCM 2DZOB 5F3WA 1G4AE 3GLGA 2ZM6M 3AOEA 2A5YB 2HL7A 5KPTA 3GLIB 1BVSA 1HNXM 2J7OA 2VQEM 3U61B 2EUCA 3EIHA 3AFHA 4FCVA 3KFUG 2CHQA 1NY5A 4MGIE 3SAWA 3VFDA 2CV0A 3UMMA 2JY7A 3B7QA 4ZPXA 5A2QS 4KODA 1OFHA 4LF7M 5L8RF 3T1HM 2DAIA 3IECA 1S3SA 4CISA 4TUWA 1GVNA 3GPXA 3KS4A 1NV9A 1T6OA 4MM3B 3U6MA 2DWNA 2F5SA 3FUUA 3ZQJA 2JY6B 3KOWE 1Z5BA 2R62A 2K0BX 3SAUA 3E9SA 2LTUA 2RRUA 4IBEA 4P17A 1XHBA 3TWMA 3BBZA 1R6BX 4RF1A 1NHGC 2R18A 3U5ZA 2M60A 2OQ4A 1JQJC 2G8LA 3Q8XA 4IJFA 3SATA 4L8RC 1N78A 4WURA 1VEJA 4OX9M 1IFYA 2O25A 2CV2A 1N32M 3WHLA 3AL0C 2R65A 4LF6M 3KS8A 3QAUA 4I8OA 2B3TA 4DV2M 1XNRM 3U6CA 1WXQA 2V1UA 4GC5A 2MGWA 4NRVA 2DZNB 2KZUA 2Z4RA 5C1BA 3TPZA 1ZMWA 4LCBA 3V76A 2JY8A 5FSWA 4JI2M 2C98A 3L2AA 5FTNA 4G4QA 2RGOA 3B74A 4I81A 1Q02A 2HWJA 4K0KM 3AOGA 2BWEA 2LVNC 1MJGM 3HU1A 3UJNA 4ITQA 4QOZC 1PGYA 1OJLA 1VDDA 2MR9A 3C9PA 3SMPA 4YY3M 4CIZA 3GRRA 2UXDM 1EFUB 3IG5A 1C1KA 4KLNA 3SYLA 3GQ4A 5EP1A 7CATA 3KW6A 1SXJE 2K47A 2LHCA 1PJQA 2FS1A 3FUWA 4MGYE 5EXSA 4X66M 1L1TA 2D7GA 3GLGB 1UM8A 3PFIA 3U6SA 1SXJB 1TTEA 4IBIA 3J7AS 4M9XA 5DYIA 2DHRA 4RNAA 1DGHA 1W5TA 3A98B 3GLGE 2EO2A 1V92A 4ANRA 2DKLA 3U5ZB 2L09A 2CHGA 2KEBA 1G41A 1MX0A 1Q3BA 1QQWA 2BNKA 4B7GA 2L2DA 4GKJM 1YSYA 4I4LA 2Z4SA 3HU3A 1XWIA 3PNYA 5DYGA 2QENA 1IN4A 3LMMA 2GQFA 4NL4H 2UXCM 1OAOC 5EP3A 4JN6A 1IBLM 3KOYE 3GP1A 2GNOA 3I4YA 2Z3XA 4B08A 4D80A 2CE7A 3W0LB 2KNAA 2VIIA 4DV6M 2QPAA 3L27A 2ZANA 5BPVA 3PXGA 5KPRA 3W0FA 1MN3A 3GLHB 2K9DA 2HKJA 1WR1B 1I94M 4G3OA 1QAOA 4CJ6A 1LTMA 2WSFF 1RU3A 3K92A 2R6FA 3KSXA 3T1YM 2C5RA 3FTEA 5ITTA 4DV4M 4DR4M 3FUXA 2LH0A 4QHSA 4YHHM 1W5SA 1X37A 3NWLA 3UGJA 2C9CA 1IXSB 4LJ8A 4DR7M 2CEAA 3TL4X 4P16A 3CGWA 4DV7M 1JR3E 2JNHA 3AKZA 1R2YA 1YUBA 1IN5A 2G5GX 5DNYA 3HJ8A 3K8ZA 2X4AA 3U6OA 3MHVC 1XC8A 4RF0A 5FTMA 5FTLA 4LFBM 1IN6A 2JZ0A 2L4EA 4GEWA 3T15A 3KDSE 4JI1M 2DWLA 1QYRA 2P5TA 3VK8A 4FWHA 1V33A 2HCBA 3WHKA 5JI3E 4LF4M 5H37D 4LF8M 2LHGA 1QAQA 3TQSA 3JR4A 2JUJA 4DR1M 3MJ5A 1VEGA 5ITXA 2FH0A 4A3VB 2EJSA 1QZMA 1GO5A 3QYEA 5IZ7D 4AI6A 2UUAM 4IBGA 3ILKA 2QCUA 3QWLA 4I5SA 3RGSA 3KOXE 3GLFE 3DA1A 4OW0A 3BXWA 1Y8GA 3I04M 2KRUA 3GLHA 4LJ5A 3HHXA 2APLA 1NO1A 4G4RA 1WJ7A 2LBCA 4LJ7A 1JB0F 1FNNA 1IBKM 2CWBA 2QSFX 4GITA 1V34A 3K1JA 2RGHA 3T38A 3R8FA 2H5XA 1IXRC 2LNHC 3RFWA 1J7KA 2EA0A 3LCUA 2HHHM 4JYAM 4AG6A 3SMSA 2R45A 2ZTDA 1K3WA 4IBKA 4QNRA 2NQ8C 1IN8A 3HX3A 2YFQA 2QHOB 3DFZA 3FD9A 4NXNM 1ZMUA 2R0IA 4CGYB 2O01F 4G4NA 4NRWA 3HY5A 3FUTA 4R7GA 3TE6A 2MROB 4FVMA 4PT5A 3MK6A 4JV5M 1K82A 2UUBM 3LVWA 4L6V6 1L2CA 4LJ6A
chains in the Genus database with same CATH topology
4QHTA 2F5OA 2XFTA 3GO8A 4CHTB 2KZSA 2QZ4A 2XEPA 4DUYM 4JI6M 1TH3A 4LF9M 3KSJA 2E5LM 4R3DA 3THGA 1PM5A 4HLQA 3U6PA 3FUVA 5KO3A 4B3MM 4S12A 2RKOA 4FWDA 4B7FA 4DV1M 4FCTA 4PCZA 5BR8M 2L6OA 3GPUA 4FW9A 2JA2A 4MH0E 3L26A 3M0EA 2Y0TA 4JI7M 3AJIB 1DO2A 4LJ4A 3UZUA 4NSRA 2Y0QA 4IJEA 2F5QA 1KFVA 1IM2A 1I4WA 3FYCA 3HGIA 3SHGB 3ZC7B 1N77A 1G59A 4MGKE 3LVVA 3GLFA 4GHLA 2AHMA 3J27B 3RE8A 1NJGA 1IY1A 2XF3A 1JR3A 3HHWA 3SFZA 3CTWB 3AOEC 4WW0A 1N34M 1J5EM 1E32A 1QANA 1TGUA 4FD2A 4MGZE 4DV5M 4AKIA 4GC9A 1TDHA 5IREB 3JAMS 4B3RM 4L4UA 4GRIA 3HJSA 3M6AA 4D82A 2OPFA 4GHAA 4AKHA 5EP4A 1QAMA 3GRUA 4X64M 1NNJA 1HNWM 5IWAM 5KQ8A 3L28A 1IXZA 4OU7A 3KP0E 2DWZB 1Z5CA 1XXHA 4LRTA 4AKGA 4JI3M 3VKHA 4B3TM 2L7HA 1T3TA 2XSZA 3DOAA 3A42A 2CV1A 4LJAA 4PDIA 4M0WA 5EXPA 4QOSA 1LV7A 3AV0A 1IBMM 3D8BA 5ITRA 4LRSA 1MU5A 3SASA 1YE9A 2Y20A 1L8QA 2YQZA 3U6LA 2V1CA 2QP9X 3D8LA 1TH2A 1D2NA 2KW0A 3FKEA 4IBFA 2FFJA 2F4VM 2CFOA 4GMQA 2FOIC 1GLNA 3UK6A 1GKIA 3KVWA 4PDGA 4AG5A 3PVSA 4NXMM 4L78A 1IQPA 2V6ZM 4IBCA 2CHVA 1HNZM 2DXIA 2Y21A 2J7NA 3ZH9B 4DR3M 1DGFA 4XGIA 3TWKA 2R4EA 1SXJD 4XBOA 3GPYA 4DR5M 4AQYM 2UU9M 1K3XA 2FE8A 1PJJA 4DV3M 4LGMA 4JI4M 5LMNM 1J09A 3I51A 4HL4A 5E26A 1DGHB 3H4MA 4BB9A 1N36M 3FYDA 3J7BA 3LQRA 2I7PA 5ITYA 3J2PB 2XLJA 3M7GA 1SXJA 4KHPM 4OVZA 1HQCA 2ZBKB 1Z59A 1XNQM 2C9OA 4LGYA 5GKNA 3VDUA 3R9XB 2QBYB 4QNMA 3HJQA 1ZQ9A 2M5ZA 4JI8M 4AW4A 4JXJA 1DO0A 2KA6B 2D7HA 4X62M 1XXHB 4AZFA 5JI2E 4Z8XA 4GIPA 1ZAEA 3PNVA 3U6DA 1NJFA 3GQ3A 3KOZE 2KRKA 3LQQA 1HR0M 4NSOB 3NBIA 1HQYE 2R4JA 3OTOM 1E94E 4D81A 2XZUA 4JI5M 4M0DA 1TDZA 1XMQM 5FTKA 1NY6A 2XSZD 5C18A 4FWGA 3KP1E 2UUCM 4OVZB 3HHZA 5LMUM 1N75A 1H6UA 3SYKA 2C99A 3SBJA 3L29A 2LXEA 2ZAMA 3CF0A 4M9ZA 1NVMA 3GLIA 4FCWA 1Z5AA 4DV0M 1XMOM 3U6QA 2Q2EB 5EP2A 1DGBA 5ITQA 1TH4A 4IBDA 3J80S 3JR5A 3DZDA 3GLFB 4II7A 2ERCA 3FTDA 3SC3A 3GRYA 4X65M 2QBYA 3HKPA 5FTJA 2FNAA 2ZAOA 5EXXA 1E9RA 2UXBM 4B3SM 3HHYA 4BBAA 3GPPA 5EJCA 2LWXA 3B9PA 1G3IA 4LG2A 2BJWA 3VLFB 4KO8A 5EXTA 3C58A 2R46A 3VDPA 1IY2A 3E4RA 1GL6A 3GRVA 2W82A 2YR0A 1N33M 3I4VA 1GL7A 4L16A 3HU2A 3U60B 1IN7A 3KXEC 4LZZA 2XZFA 1L1ZA 2BJVA 2YNMD 1HT2E 1KSFX 3A45A 1ORYB 2VQFM 2X8AA 4JI0M 1IY0A 1PJIA 2XGNA 2L7IA 3BOSA 4DR6M 2Z7JA 3CF6E 1OFIA 1HT1E 3K2LA 4LFAM 4M9SA 1G8PA 1Q39A 4IBJA 4MB7A 2F5NA 3U6EA 2H1RA 4LJ9A 5FLXS 3SAVA 3EIEA 3VKGA 1L2DA 4EIWA 3L25A 5ITUA 4DR2M 1Q3CA 4L15A 3A46A 1QVRA 5KPZA 1KYIA 5ITXE 4LY6A 4BLCA 5IT9S 1E9SA 2XH9A 2I7NA 8CATA 1Z6TA 2O5RA 4G6ZA 1EE8A 2DVWB 3FTCA 3FTFA 3RGPA 2D7EA 1JR3D 4REZA 3GQ5A 3U61A 4PD2A 3HWSA 1R2ZA 4Z6YA 2DWMA 2X49A 1SXJC 4GH9A 4DUZM 2C96A 3VK7A 2CUZA 4MGHA 5KQDA 4G4OA 1NHWC 1R7RA 4NOOB 5E6JA 1DGGA 4GKKM 4LF5M 4W5WA 1NNUC 5EQTA 4B7HA 1FJGM 2KXEA 3SARA 3IG8A 1NSFA 4LZJA 2XFSA 3CF2A 1L2BA 2F5PA 3U60A 3J81S 4IIWA 3ZCBB 4IBBA 4LFCM 3TWLA 3SHFA 2DZOB 5F3WA 1G4AE 3GLGA 2ZM6M 3AOEA 2A5YB 2HL7A 5KPTA 3GLIB 1HNXM 2J7OA 2VQEM 3U61B 2EUCA 3EIHA 3AFHA 4FCVA 3KFUG 2CHQA 1NY5A 4MGIE 3SAWA 3VFDA 2CV0A 3UMMA 4ZPXA 5A2QS 4KODA 1OFHA 4LF7M 3T1HM 1S3SA 4CISA 4TUWA 1GVNA 3GPXA 3KS4A 3U6MA 2DWNA 4MM3B 2F5SA 3FUUA 3KOWE 1Z5BA 2R62A 3SAUA 3E9SA 4IBEA 1XHBA 3TWMA 1R6BX 4RF1A 1NHGC 2R18A 3U5ZA 2M60A 2OQ4A 1JQJC 2G8LA 3Q8XA 4IJFA 3SATA 4L8RC 1N78A 4WURA 4OX9M 2CV2A 1N32M 3WHLA 3AL0C 2R65A 4LF6M 3KS8A 3QAUA 4I8OA 1XNRM 4DV2M 3U6CA 1WXQA 2V1UA 4GC5A 4NRVA 2DZNB 2KZUA 2Z4RA 5C1BA 3TPZA 4LCBA 5FSWA 4JI2M 2C98A 3L2AA 5FTNA 4G4QA 2RGOA 4I81A 4K0KM 3AOGA 3HU1A 3UJNA 4ITQA 4QOZC 1OJLA 1VDDA 4YY3M 3SMPA 3GRRA 2UXDM 3IG5A 1C1KA 4KLNA 3SYLA 3GQ4A 5EP1A 7CATA 3KW6A 1SXJE 2K47A 3FUWA 4MGYE 5EXSA 1L1TA 4X66M 2D7GA 3GLGB 1UM8A 3PFIA 3U6SA 1SXJB 4IBIA 3J7AS 4M9XA 5DYIA 2DHRA 4RNAA 3A98B 1DGHA 1W5TA 2EO2A 3U5ZB 2L09A 2CHGA 2KEBA 1G41A 1MX0A 1Q3BA 1QQWA 2BNKA 4B7GA 4GKJM 1YSYA 4I4LA 2Z4SA 3HU3A 1XWIA 3PNYA 5DYGA 2QENA 1IN4A 3LMMA 4NL4H 2UXCM 5EP3A 4JN6A 1IBLM 3KOYE 3GP1A 3I4YA 2Z3XA 4B08A 4D80A 2CE7A 3W0LB 2VIIA 4DV6M 2QPAA 3L27A 2ZANA 5BPVA 3PXGA 5KPRA 3W0FA 3GLHB 2HKJA 1I94M 1QAOA 3K92A 3KSXA 3T1YM 2C5RA 3FTEA 5ITTA 4DV4M 4DR4M 3FUXA 2LH0A 4QHSA 4YHHM 1W5SA 1X37A 3NWLA 3UGJA 2C9CA 1IXSB 4LJ8A 4DR7M 2CEAA 3TL4X 4P16A 4DV7M 3AKZA 1R2YA 1YUBA 1IN5A 2G5GX 5DNYA 3HJ8A 3K8ZA 2X4AA 3U6OA 3MHVC 1XC8A 4RF0A 5FTMA 5FTLA 4LFBM 1IN6A 3T15A 3KDSE 4JI1M 2DWLA 1QYRA 2P5TA 3VK8A 4FWHA 3WHKA 2HCBA 5JI3E 4LF4M 5H37D 4LF8M 1QAQA 3TQSA 3JR4A 4DR1M 3MJ5A 5ITXA 4A3VB 1QZMA 4AI6A 5IZ7D 2UUAM 4IBGA 3ILKA 2QCUA 3QWLA 4I5SA 3RGSA 3KOXE 3DA1A 4OW0A 2KRUA 3GLHA 4LJ5A 3HHXA 4G4RA 4LJ7A 1FNNA 1IBKM 4GITA 3K1JA 2RGHA 3T38A 3R8FA 1IXRC 2LNHC 3RFWA 1J7KA 2EA0A 2HHHM 4JYAM 4AG6A 3SMSA 2R45A 1K3WA 4IBKA 4QNRA 2NQ8C 1IN8A 2YFQA 3DFZA 3FD9A 4NXNM 4CGYB 4G4NA 4NRWA 3FUTA 4R7GA 3TE6A 4FVMA 4PT5A 3MK6A 4JV5M 1K82A 2UUBM 3LVWA 1L2CA 4LJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M60 A;  2M5Z A; 
#chains in the Genus database with same CATH topology
 4QHT A;  1NV8 A;  1OIP A;  2F5O A;  3FE3 A;  2XFT A;  3GO8 A;  4CHT B;  2KZS A;  2QZ4 A;  1WGN A;  2XEP A;  4DUY M;  2JY5 A;  4JI6 M;  1TH3 A;  1R5L A;  4LF9 M;  3KSJ A;  2E5L M;  4R3D A;  3THG A;  2LVO C;  1PM5 A;  1P3Q Q;  4HLQ A;  3U6P A;  2J5Y A;  3FUV A;  5KO3 A;  4B3M M;  4S12 A;  2RKO A;  3C3E A;  5DFL A;  4FWD A;  4B7F A;  3IHP A;  4DV1 M;  4FCT A;  1ZV1 A;  1OQY A;  2DHY A;  3E46 A;  4PCZ A;  2L4F A;  5BR8 M;  2L6O A;  3GPU A;  2LVP C;  1CUK A;  2JA2 A;  4FW9 A;  4KT0 F;  4MH0 E;  3L26 A;  1D0L A;  1OKS A;  3M0E A;  1XXH E;  2Y0T A;  2DAG A;  4JI7 M;  3AJI B;  1DO2 A;  1VDL A;  4LJ4 A;  3UZU A;  4NSR A;  2Y0Q A;  4IJE A;  2F5Q A;  1ZMV A;  1TF0 B;  1KFV A;  1IM2 A;  1I4W A;  1R4G A;  3FYC A;  3HGI A;  3SHG B;  3ZC7 B;  1N77 A;  1G59 A;  4MGK E;  3LVV A;  1OAI A;  3GLF A;  4GHL A;  2AHM A;  3J27 B;  3RE8 A;  1NJG A;  1IY1 A;  2XF3 A;  1JR3 A;  3HHW A;  3SFZ A;  3CTW B;  2QQ8 A;  3AOE C;  4WW0 A;  1N34 M;  1J5E M;  2VDB B;  1E32 A;  1QAN A;  1TGU A;  4FD2 A;  4MGZ E;  4DV5 M;  4AKI A;  3LW5 F;  4GC9 A;  1TDH A;  5IRE B;  3JAM S;  3LCV B;  4B3R M;  4L4U A;  4GRI A;  3HJS A;  3M6A A;  4D82 A;  2OPF A;  4GHA A;  4AKH A;  5EP4 A;  2CRU A;  1IXS A;  1QAM A;  3GRU A;  4X64 M;  2BWB A;  3FRI A;  1NNJ A;  1HNW M;  5IWA M;  2WSC F;  2HAK A;  5KQ8 A;  4WP2 A;  3L28 A;  1QDT A;  1IXZ A;  2JWS A;  1QUT A;  4OU7 A;  1GAB A;  3H4J A;  3KP0 E;  3MMP A;  1GJS A;  2DAK A;  2DWZ B;  1Z5C A;  3QYB A;  3B89 A;  1QZE A;  1XXH A;  4LRT A;  4AKG A;  4JI3 M;  3VKH A;  4B3T M;  2L7H A;  1T3T A;  2XSZ A;  1OTR A;  3DOA A;  3A42 A;  2CV1 A;  4LJA A;  4PDI A;  1HJP A;  4M0W A;  5EXP A;  4QOS A;  2CP8 A;  1LV7 A;  2R44 A;  3AV0 A;  1IBM M;  3D8B A;  3T6P A;  5ITR A;  4LRS A;  1MU5 A;  3SAS A;  1YE9 A;  2Y20 A;  1L8Q A;  2OO9 A;  2YQZ A;  3GLI E;  2V1C A;  2QP9 X;  3D8L A;  1TH2 A;  3U6L A;  1D2N A;  2KW0 A;  3FKE A;  4IBF A;  2FFJ A;  2F4V M;  2CFO A;  4GMQ A;  2FOI C;  1GLN A;  3K9O A;  1GKI A;  3UK6 A;  3KVW A;  4PDG A;  4AG5 A;  3PVS A;  4NXM M;  4L78 A;  1IQP A;  2QNJ A;  2V6Z M;  4IBC A;  2CHV A;  4Y28 F;  1HNZ M;  2DXI A;  2Y21 A;  2J7N A;  3ZH9 B;  4DR3 M;  1DGF A;  4XGI A;  3F92 A;  3TWK A;  3B7N A;  2R4E A;  1SXJ D;  1A5T A;  4XBO A;  1C7Y A;  3GPY A;  4DR5 M;  3K9P A;  4R71 A;  4AQY M;  2UU9 M;  1PJT A;  1K3X A;  2FE8 A;  1PJJ A;  4DV3 M;  4LGM A;  4JI4 M;  5LMN M;  1J09 A;  3I51 A;  3Q8G A;  4HL4 A;  1DV0 A;  5E26 A;  1DGH B;  3H4M A;  4BB9 A;  1N36 M;  3FYD A;  3J7B A;  3LQR A;  2I7P A;  5ITY A;  3J2P B;  2XLJ A;  3M7G A;  1SXJ A;  4KHP M;  4OVZ A;  1HQC A;  2ZBK B;  1Z59 A;  1XNQ M;  2C9O A;  1AUA A;  4XK8 F;  4LGY A;  5GKN A;  3VDU A;  3R9X B;  2QBY B;  4QNM A;  3HJQ A;  1ZQ9 A;  2M5Z A;  1T43 A;  4JI8 M;  4AW4 A;  4JXJ A;  1DO0 A;  2KA6 B;  2D7H A;  4X62 M;  3I01 M;  1XXH B;  4AZF A;  5JI2 E;  4Z8X A;  1XB2 B;  4GIP A;  1ZAE A;  3PNV A;  1QUS A;  2JXN A;  1TR8 A;  3U6D A;  1NJF A;  3GQ3 A;  3KOZ E;  2KRK A;  3LQQ A;  1HR0 M;  4NSO B;  3NBI A;  1HQY E;  2R4J A;  1GJT A;  1D0M A;  3OTO M;  1E94 E;  4RKU F;  4D81 A;  4NC6 A;  2XZU A;  1UFZ A;  4JI5 M;  4M0D A;  1TDZ A;  1XMQ M;  5FTK A;  1NY6 A;  2XSZ D;  5C18 A;  4FWG A;  3KP1 E;  2UUC M;  4OVZ B;  3HHZ A;  5LMU M;  1N75 A;  1H6U A;  3B7Z A;  3SYK A;  2C99 A;  2WZJ A;  3SBJ A;  2KNZ A;  3L29 A;  2LXE A;  2ZAM A;  3GLH E;  3CF0 A;  4M9Z A;  1WIV A;  2JP7 A;  1NVM A;  2DNA A;  3GLI A;  4FCW A;  1Z5A A;  4DV0 M;  4F1I A;  2EKK A;  3U6Q A;  1XMO M;  1PRB A;  2Q2E B;  5EP2 A;  1DGB A;  5ITQ A;  2Z8Y M;  1TH4 A;  4IBD A;  3J80 S;  3JR5 A;  3DZD A;  3GLF B;  4II7 A;  2ERC A;  3FTD A;  2MH8 A;  1VG5 A;  4UN2 B;  1D0K A;  3GRY A;  3SC3 A;  4X65 M;  2QBY A;  3HKP A;  5FTJ A;  2FNA A;  2DI0 A;  2ZAO A;  2N35 A;  5EXX A;  1E9R A;  2UXB M;  4B3S M;  3HHY A;  4BBA A;  3GPP A;  5EJC A;  2LWX A;  3B9P A;  1G3I A;  4LG2 A;  2BJW A;  2KNV A;  3VLF B;  4KO8 A;  5EXT A;  3C58 A;  2R46 A;  3VDP A;  1WGL A;  1IY2 A;  3E4R A;  2JZ1 A;  1GL6 A;  4HEO A;  3GRV A;  1WHC A;  2W82 A;  2YR0 A;  1N33 M;  3I4V A;  1GL7 A;  1AIP C;  4L16 A;  4F2L A;  3HU2 A;  3FRH A;  3U60 B;  1IN7 A;  1VQ1 A;  3KXE C;  4LZZ A;  2XZF A;  1L1Z A;  2BJV A;  2OOA A;  2YNM D;  2G3Q A;  1HT2 E;  1KSF X;  2DEN A;  3A45 A;  3C3D A;  1VEK A;  1ORY B;  2VQF M;  2DAE A;  2X8A A;  1IY0 A;  1YLA A;  4JI0 M;  1PJI A;  2XGN A;  2L7I A;  3BOS A;  4DR6 M;  2Z7J A;  3CF6 E;  1OFI A;  1HT1 E;  1OIZ A;  3K2L A;  4LFA M;  4M9S A;  1G8P A;  1Q39 A;  4IBJ A;  4MB7 A;  2F5N A;  3U6E A;  2H1R A;  4LJ9 A;  5FLX S;  3SAV A;  2VF7 A;  3EIE A;  3VKG A;  1L2D A;  2K6B A;  4EIW A;  3L25 A;  1EIJ A;  5ITU A;  4DR2 M;  1Q3C A;  4L15 A;  3A46 A;  1QVR A;  5KPZ A;  1KYI A;  5ITX E;  4LY6 A;  4BLC A;  3W68 A;  5IT9 S;  1E9S A;  2XH9 A;  2KDL A;  2I7N A;  8CAT A;  1Z6T A;  2KHH A;  2O5R A;  4G6Z A;  1PJS A;  1EE8 A;  2DVW B;  3FTC A;  3FTF A;  3RGP A;  2LVQ D;  2D7E A;  1JR3 D;  4REZ A;  3GQ5 A;  3U61 A;  4PD2 A;  3HWS A;  1R2Z A;  4Z6Y A;  2EKF A;  3E21 A;  2DWM A;  2X49 A;  2DAM A;  1SXJ C;  4GH9 A;  1G71 A;  4DUZ M;  1QDR A;  2C96 A;  3VK7 A;  4DBG B;  2CUZ A;  4MGH A;  5KQD A;  4G4O A;  1SG9 A;  1NHW C;  1R7R A;  4NOO B;  3HZJ A;  5E6J A;  1DGG A;  4GKK M;  4LF5 M;  4W5W A;  1NNU C;  5EQT A;  2WSE F;  2OOB A;  4B7H A;  1FJG M;  2KXE A;  2MJ5 B;  2VF8 A;  3SAR A;  2DZL A;  3IG8 A;  1NSF A;  4LZJ A;  2XFS A;  3CF2 A;  3W67 A;  1L2B A;  4Q7J A;  3NBX X;  2F5P A;  2LVA A;  3U60 A;  1F4I A;  3J81 S;  4IIW A;  3ZCB B;  4IBB A;  2ZTC A;  3TWL A;  3SHF A;  4LFC M;  2DZO B;  5F3W A;  1G4A E;  3GLG A;  2ZM6 M;  3AOE A;  2A5Y B;  2HL7 A;  5KPT A;  3GLI B;  1BVS A;  1HNX M;  2J7O A;  2VQE M;  3U61 B;  2EUC A;  3EIH A;  3AFH A;  4FCV A;  3KFU G;  2CHQ A;  1NY5 A;  4MGI E;  3SAW A;  3VFD A;  2CV0 A;  3UMM A;  2JY7 A;  3B7Q A;  4ZPX A;  5A2Q S;  4KOD A;  1OFH A;  4LF7 M;  5L8R F;  3T1H M;  2DAI A;  3IEC A;  1S3S A;  4CIS A;  4TUW A;  1GVN A;  3GPX A;  3KS4 A;  1NV9 A;  1T6O A;  4MM3 B;  3U6M A;  2DWN A;  2F5S A;  3FUU A;  3ZQJ A;  2JY6 B;  3KOW E;  1Z5B A;  2R62 A;  2K0B X;  3SAU A;  3E9S A;  2LTU A;  2RRU A;  4IBE A;  4P17 A;  1XHB A;  3TWM A;  3BBZ A;  1R6B X;  4RF1 A;  1NHG C;  2R18 A;  3U5Z A;  2M60 A;  2OQ4 A;  1JQJ C;  2G8L A;  3Q8X A;  4IJF A;  3SAT A;  4L8R C;  1N78 A;  4WUR A;  1VEJ A;  4OX9 M;  1IFY A;  2O25 A;  2CV2 A;  1N32 M;  3WHL A;  3AL0 C;  2R65 A;  4LF6 M;  3KS8 A;  3QAU A;  4I8O A;  2B3T A;  4DV2 M;  1XNR M;  3U6C A;  1WXQ A;  2V1U A;  4GC5 A;  2MGW A;  4NRV A;  2DZN B;  2KZU A;  2Z4R A;  5C1B A;  3TPZ A;  1ZMW A;  4LCB A;  3V76 A;  2JY8 A;  5FSW A;  4JI2 M;  2C98 A;  3L2A A;  5FTN A;  4G4Q A;  2RGO A;  3B74 A;  4I81 A;  1Q02 A;  2HWJ A;  4K0K M;  3AOG A;  2BWE A;  2LVN C;  1MJG M;  3HU1 A;  3UJN A;  4ITQ A;  4QOZ C;  1PGY A;  1OJL A;  1VDD A;  2MR9 A;  3C9P A;  3SMP A;  4YY3 M;  4CIZ A;  3GRR A;  2UXD M;  1EFU B;  3IG5 A;  1C1K A;  4KLN A;  3SYL A;  3GQ4 A;  5EP1 A;  7CAT A;  3KW6 A;  1SXJ E;  2K47 A;  2LHC A;  1PJQ A;  2FS1 A;  3FUW A;  4MGY E;  5EXS A;  4X66 M;  1L1T A;  2D7G A;  3GLG B;  1UM8 A;  3PFI A;  3U6S A;  1SXJ B;  1TTE A;  4IBI A;  3J7A S;  4M9X A;  5DYI A;  2DHR A;  4RNA A;  1DGH A;  1W5T A;  3A98 B;  3GLG E;  2EO2 A;  1V92 A;  4ANR A;  2DKL A;  3U5Z B;  2L09 A;  2CHG A;  2KEB A;  1G41 A;  1MX0 A;  1Q3B A;  1QQW A;  2BNK A;  4B7G A;  2L2D A;  4GKJ M;  1YSY A;  4I4L A;  2Z4S A;  3HU3 A;  1XWI A;  3PNY A;  5DYG A;  2QEN A;  1IN4 A;  3LMM A;  2GQF A;  4NL4 H;  2UXC M;  1OAO C;  5EP3 A;  4JN6 A;  1IBL M;  3KOY E;  3GP1 A;  2GNO A;  3I4Y A;  2Z3X A;  4B08 A;  4D80 A;  2CE7 A;  3W0L B;  2KNA A;  2VII A;  4DV6 M;  2QPA A;  3L27 A;  2ZAN A;  5BPV A;  3PXG A;  5KPR A;  3W0F A;  1MN3 A;  3GLH B;  2K9D A;  2HKJ A;  1WR1 B;  1I94 M;  4G3O A;  1QAO A;  4CJ6 A;  1LTM A;  2WSF F;  1RU3 A;  3K92 A;  2R6F A;  3KSX A;  3T1Y M;  2C5R A;  3FTE A;  5ITT A;  4DV4 M;  4DR4 M;  3FUX A;  2LH0 A;  4QHS A;  4YHH M;  1W5S A;  1X37 A;  3NWL A;  3UGJ A;  2C9C A;  1IXS B;  4LJ8 A;  4DR7 M;  2CEA A;  3TL4 X;  4P16 A;  3CGW A;  4DV7 M;  1JR3 E;  2JNH A;  3AKZ A;  1R2Y A;  1YUB A;  1IN5 A;  2G5G X;  5DNY A;  3HJ8 A;  3K8Z A;  2X4A A;  3U6O A;  3MHV C;  1XC8 A;  4RF0 A;  5FTM A;  5FTL A;  4LFB M;  1IN6 A;  2JZ0 A;  2L4E A;  4GEW A;  3T15 A;  3KDS E;  4JI1 M;  2DWL A;  1QYR A;  2P5T A;  3VK8 A;  4FWH A;  1V33 A;  2HCB A;  3WHK A;  5JI3 E;  4LF4 M;  5H37 D;  4LF8 M;  2LHG A;  1QAQ A;  3TQS A;  3JR4 A;  2JUJ A;  4DR1 M;  3MJ5 A;  1VEG A;  5ITX A;  2FH0 A;  4A3V B;  2EJS A;  1QZM A;  1GO5 A;  3QYE A;  5IZ7 D;  4AI6 A;  2UUA M;  4IBG A;  3ILK A;  2QCU A;  3QWL A;  4I5S A;  3RGS A;  3KOX E;  3GLF E;  3DA1 A;  4OW0 A;  3BXW A;  1Y8G A;  3I04 M;  2KRU A;  3GLH A;  4LJ5 A;  3HHX A;  2APL A;  1NO1 A;  4G4R A;  1WJ7 A;  2LBC A;  4LJ7 A;  1JB0 F;  1FNN A;  1IBK M;  2CWB A;  2QSF X;  4GIT A;  1V34 A;  3K1J A;  2RGH A;  3T38 A;  3R8F A;  2H5X A;  1IXR C;  2LNH C;  3RFW A;  1J7K A;  2EA0 A;  3LCU A;  2HHH M;  4JYA M;  4AG6 A;  3SMS A;  2R45 A;  2ZTD A;  1K3W A;  4IBK A;  4QNR A;  2NQ8 C;  1IN8 A;  3HX3 A;  2YFQ A;  2QHO B;  3DFZ A;  3FD9 A;  4NXN M;  1ZMU A;  2R0I A;  4CGY B;  2O01 F;  4G4N A;  4NRW A;  3HY5 A;  3FUT A;  4R7G A;  3TE6 A;  2MRO B;  4FVM A;  4PT5 A;  3MK6 A;  4JV5 M;  1K82 A;  2UUB M;  3LVW A;  4L6V 6;  1L2C A;  4LJ6 A; 
#chains in the Genus database with same CATH homology
 4QHT A;  2F5O A;  2XFT A;  3GO8 A;  4CHT B;  2KZS A;  2QZ4 A;  2XEP A;  4DUY M;  4JI6 M;  1TH3 A;  4LF9 M;  3KSJ A;  2E5L M;  4R3D A;  3THG A;  1PM5 A;  4HLQ A;  3U6P A;  3FUV A;  5KO3 A;  4B3M M;  4S12 A;  2RKO A;  4FWD A;  4B7F A;  4DV1 M;  4FCT A;  4PCZ A;  5BR8 M;  2L6O A;  3GPU A;  4FW9 A;  2JA2 A;  4MH0 E;  3L26 A;  3M0E A;  2Y0T A;  4JI7 M;  3AJI B;  1DO2 A;  4LJ4 A;  3UZU A;  4NSR A;  2Y0Q A;  4IJE A;  2F5Q A;  1KFV A;  1IM2 A;  1I4W A;  3FYC A;  3HGI A;  3SHG B;  3ZC7 B;  1N77 A;  1G59 A;  4MGK E;  3LVV A;  3GLF A;  4GHL A;  2AHM A;  3J27 B;  3RE8 A;  1NJG A;  1IY1 A;  2XF3 A;  1JR3 A;  3HHW A;  3SFZ A;  3CTW B;  3AOE C;  4WW0 A;  1N34 M;  1J5E M;  1E32 A;  1QAN A;  1TGU A;  4FD2 A;  4MGZ E;  4DV5 M;  4AKI A;  4GC9 A;  1TDH A;  5IRE B;  3JAM S;  4B3R M;  4L4U A;  4GRI A;  3HJS A;  3M6A A;  4D82 A;  2OPF A;  4GHA A;  4AKH A;  5EP4 A;  1QAM A;  3GRU A;  4X64 M;  1NNJ A;  1HNW M;  5IWA M;  5KQ8 A;  3L28 A;  1IXZ A;  4OU7 A;  3KP0 E;  2DWZ B;  1Z5C A;  1XXH A;  4LRT A;  4AKG A;  4JI3 M;  3VKH A;  4B3T M;  2L7H A;  1T3T A;  2XSZ A;  3DOA A;  3A42 A;  2CV1 A;  4LJA A;  4PDI A;  4M0W A;  5EXP A;  4QOS A;  1LV7 A;  3AV0 A;  1IBM M;  3D8B A;  5ITR A;  4LRS A;  1MU5 A;  3SAS A;  1YE9 A;  2Y20 A;  1L8Q A;  2YQZ A;  3U6L A;  2V1C A;  2QP9 X;  3D8L A;  1TH2 A;  1D2N A;  2KW0 A;  3FKE A;  4IBF A;  2FFJ A;  2F4V M;  2CFO A;  4GMQ A;  2FOI C;  1GLN A;  3UK6 A;  1GKI A;  3KVW A;  4PDG A;  4AG5 A;  3PVS A;  4NXM M;  4L78 A;  1IQP A;  2V6Z M;  4IBC A;  2CHV A;  1HNZ M;  2DXI A;  2Y21 A;  2J7N A;  3ZH9 B;  4DR3 M;  1DGF A;  4XGI A;  3TWK A;  2R4E A;  1SXJ D;  4XBO A;  3GPY A;  4DR5 M;  4AQY M;  2UU9 M;  1K3X A;  2FE8 A;  1PJJ A;  4DV3 M;  4LGM A;  4JI4 M;  5LMN M;  1J09 A;  3I51 A;  4HL4 A;  5E26 A;  1DGH B;  3H4M A;  4BB9 A;  1N36 M;  3FYD A;  3J7B A;  3LQR A;  2I7P A;  5ITY A;  3J2P B;  2XLJ A;  3M7G A;  1SXJ A;  4KHP M;  4OVZ A;  1HQC A;  2ZBK B;  1Z59 A;  1XNQ M;  2C9O A;  4LGY A;  5GKN A;  3VDU A;  3R9X B;  2QBY B;  4QNM A;  3HJQ A;  1ZQ9 A;  2M5Z A;  4JI8 M;  4AW4 A;  4JXJ A;  1DO0 A;  2KA6 B;  2D7H A;  4X62 M;  1XXH B;  4AZF A;  5JI2 E;  4Z8X A;  4GIP A;  1ZAE A;  3PNV A;  3U6D A;  1NJF A;  3GQ3 A;  3KOZ E;  2KRK A;  3LQQ A;  1HR0 M;  4NSO B;  3NBI A;  1HQY E;  2R4J A;  3OTO M;  1E94 E;  4D81 A;  2XZU A;  4JI5 M;  4M0D A;  1TDZ A;  1XMQ M;  5FTK A;  1NY6 A;  2XSZ D;  5C18 A;  4FWG A;  3KP1 E;  2UUC M;  4OVZ B;  3HHZ A;  5LMU M;  1N75 A;  1H6U A;  3SYK A;  2C99 A;  3SBJ A;  3L29 A;  2LXE A;  2ZAM A;  3CF0 A;  4M9Z A;  1NVM A;  3GLI A;  4FCW A;  1Z5A A;  4DV0 M;  1XMO M;  3U6Q A;  2Q2E B;  5EP2 A;  1DGB A;  5ITQ A;  1TH4 A;  4IBD A;  3J80 S;  3JR5 A;  3DZD A;  3GLF B;  4II7 A;  2ERC A;  3FTD A;  3SC3 A;  3GRY A;  4X65 M;  2QBY A;  3HKP A;  5FTJ A;  2FNA A;  2ZAO A;  5EXX A;  1E9R A;  2UXB M;  4B3S M;  3HHY A;  4BBA A;  3GPP A;  5EJC A;  2LWX A;  3B9P A;  1G3I A;  4LG2 A;  2BJW A;  3VLF B;  4KO8 A;  5EXT A;  3C58 A;  2R46 A;  3VDP A;  1IY2 A;  3E4R A;  1GL6 A;  3GRV A;  2W82 A;  2YR0 A;  1N33 M;  3I4V A;  1GL7 A;  4L16 A;  3HU2 A;  3U60 B;  1IN7 A;  3KXE C;  4LZZ A;  2XZF A;  1L1Z A;  2BJV A;  2YNM D;  1HT2 E;  1KSF X;  3A45 A;  1ORY B;  2VQF M;  2X8A A;  4JI0 M;  1IY0 A;  1PJI A;  2XGN A;  2L7I A;  3BOS A;  4DR6 M;  2Z7J A;  3CF6 E;  1OFI A;  1HT1 E;  3K2L A;  4LFA M;  4M9S A;  1G8P A;  1Q39 A;  4IBJ A;  4MB7 A;  2F5N A;  3U6E A;  2H1R A;  4LJ9 A;  5FLX S;  3SAV A;  3EIE A;  3VKG A;  1L2D A;  4EIW A;  3L25 A;  5ITU A;  4DR2 M;  1Q3C A;  4L15 A;  3A46 A;  1QVR A;  5KPZ A;  1KYI A;  5ITX E;  4LY6 A;  4BLC A;  5IT9 S;  1E9S A;  2XH9 A;  2I7N A;  8CAT A;  1Z6T A;  2O5R A;  4G6Z A;  1EE8 A;  2DVW B;  3FTC A;  3FTF A;  3RGP A;  2D7E A;  1JR3 D;  4REZ A;  3GQ5 A;  3U61 A;  4PD2 A;  3HWS A;  1R2Z A;  4Z6Y A;  2DWM A;  2X49 A;  1SXJ C;  4GH9 A;  4DUZ M;  2C96 A;  3VK7 A;  2CUZ A;  4MGH A;  5KQD A;  4G4O A;  1NHW C;  1R7R A;  4NOO B;  5E6J A;  1DGG A;  4GKK M;  4LF5 M;  4W5W A;  1NNU C;  5EQT A;  4B7H A;  1FJG M;  2KXE A;  3SAR A;  3IG8 A;  1NSF A;  4LZJ A;  2XFS A;  3CF2 A;  1L2B A;  2F5P A;  3U60 A;  3J81 S;  4IIW A;  3ZCB B;  4IBB A;  4LFC M;  3TWL A;  3SHF A;  2DZO B;  5F3W A;  1G4A E;  3GLG A;  2ZM6 M;  3AOE A;  2A5Y B;  2HL7 A;  5KPT A;  3GLI B;  1HNX M;  2J7O A;  2VQE M;  3U61 B;  2EUC A;  3EIH A;  3AFH A;  4FCV A;  3KFU G;  2CHQ A;  1NY5 A;  4MGI E;  3SAW A;  3VFD A;  2CV0 A;  3UMM A;  4ZPX A;  5A2Q S;  4KOD A;  1OFH A;  4LF7 M;  3T1H M;  1S3S A;  4CIS A;  4TUW A;  1GVN A;  3GPX A;  3KS4 A;  3U6M A;  2DWN A;  4MM3 B;  2F5S A;  3FUU A;  3KOW E;  1Z5B A;  2R62 A;  3SAU A;  3E9S A;  4IBE A;  1XHB A;  3TWM A;  1R6B X;  4RF1 A;  1NHG C;  2R18 A;  3U5Z A;  2M60 A;  2OQ4 A;  1JQJ C;  2G8L A;  3Q8X A;  4IJF A;  3SAT A;  4L8R C;  1N78 A;  4WUR A;  4OX9 M;  2CV2 A;  1N32 M;  3WHL A;  3AL0 C;  2R65 A;  4LF6 M;  3KS8 A;  3QAU A;  4I8O A;  1XNR M;  4DV2 M;  3U6C A;  1WXQ A;  2V1U A;  4GC5 A;  4NRV A;  2DZN B;  2KZU A;  2Z4R A;  5C1B A;  3TPZ A;  4LCB A;  5FSW A;  4JI2 M;  2C98 A;  3L2A A;  5FTN A;  4G4Q A;  2RGO A;  4I81 A;  4K0K M;  3AOG A;  3HU1 A;  3UJN A;  4ITQ A;  4QOZ C;  1OJL A;  1VDD A;  4YY3 M;  3SMP A;  3GRR A;  2UXD M;  3IG5 A;  1C1K A;  4KLN A;  3SYL A;  3GQ4 A;  5EP1 A;  7CAT A;  3KW6 A;  1SXJ E;  2K47 A;  3FUW A;  4MGY E;  5EXS A;  1L1T A;  4X66 M;  2D7G A;  3GLG B;  1UM8 A;  3PFI A;  3U6S A;  1SXJ B;  4IBI A;  3J7A S;  4M9X A;  5DYI A;  2DHR A;  4RNA A;  3A98 B;  1DGH A;  1W5T A;  2EO2 A;  3U5Z B;  2L09 A;  2CHG A;  2KEB A;  1G41 A;  1MX0 A;  1Q3B A;  1QQW A;  2BNK A;  4B7G A;  4GKJ M;  1YSY A;  4I4L A;  2Z4S A;  3HU3 A;  1XWI A;  3PNY A;  5DYG A;  2QEN A;  1IN4 A;  3LMM A;  4NL4 H;  2UXC M;  5EP3 A;  4JN6 A;  1IBL M;  3KOY E;  3GP1 A;  3I4Y A;  2Z3X A;  4B08 A;  4D80 A;  2CE7 A;  3W0L B;  2VII A;  4DV6 M;  2QPA A;  3L27 A;  2ZAN A;  5BPV A;  3PXG A;  5KPR A;  3W0F A;  3GLH B;  2HKJ A;  1I94 M;  1QAO A;  3K92 A;  3KSX A;  3T1Y M;  2C5R A;  3FTE A;  5ITT A;  4DV4 M;  4DR4 M;  3FUX A;  2LH0 A;  4QHS A;  4YHH M;  1W5S A;  1X37 A;  3NWL A;  3UGJ A;  2C9C A;  1IXS B;  4LJ8 A;  4DR7 M;  2CEA A;  3TL4 X;  4P16 A;  4DV7 M;  3AKZ A;  1R2Y A;  1YUB A;  1IN5 A;  2G5G X;  5DNY A;  3HJ8 A;  3K8Z A;  2X4A A;  3U6O A;  3MHV C;  1XC8 A;  4RF0 A;  5FTM A;  5FTL A;  4LFB M;  1IN6 A;  3T15 A;  3KDS E;  4JI1 M;  2DWL A;  1QYR A;  2P5T A;  3VK8 A;  4FWH A;  3WHK A;  2HCB A;  5JI3 E;  4LF4 M;  5H37 D;  4LF8 M;  1QAQ A;  3TQS A;  3JR4 A;  4DR1 M;  3MJ5 A;  5ITX A;  4A3V B;  1QZM A;  4AI6 A;  5IZ7 D;  2UUA M;  4IBG A;  3ILK A;  2QCU A;  3QWL A;  4I5S A;  3RGS A;  3KOX E;  3DA1 A;  4OW0 A;  2KRU A;  3GLH A;  4LJ5 A;  3HHX A;  4G4R A;  4LJ7 A;  1FNN A;  1IBK M;  4GIT A;  3K1J A;  2RGH A;  3T38 A;  3R8F A;  1IXR C;  2LNH C;  3RFW A;  1J7K A;  2EA0 A;  2HHH M;  4JYA M;  4AG6 A;  3SMS A;  2R45 A;  1K3W A;  4IBK A;  4QNR A;  2NQ8 C;  1IN8 A;  2YFQ A;  3DFZ A;  3FD9 A;  4NXN M;  4CGY B;  4G4N A;  4NRW A;  3FUT A;  4R7G A;  3TE6 A;  4FVM A;  4PT5 A;  3MK6 A;  4JV5 M;  1K82 A;  2UUB M;  3LVW A;  1L2C A;  4LJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...