1T6OA

Nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords phosphoprotein
publication title Structural basis for the attachment of a paramyxoviral polymerase to its template.
pubmed doi rcsb
source organism Measles virus
total genus 15
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1t6oA00
2HWJA 3GLHE 1PGYA 2DENA 1MN3A 1DV0A 2JY5A 3LCUA 1AIPC 2B3TA 2DI0A 2K0BX 1SG9A 2JNHA 1V92A 2JZ0A 2KHHA 3MMPA 1IM2A 2BWBA 2DKLA 2DAIA 1DO2A 2DAMA 3H4JA 1GO5A 1EFUB 1WIVA 1P3QQ 1WGNA 1G3IA 1OTRA 1ZMWA 2K9DA 3GLFE 2L2DA 2MR9A 2DAEA 2WZJA 1KYIA 2JP7A 1WHCA 2MROB 2ZTCA 4Q7JA 3FRIA 1Y8GA 1ZV1A 1T6OA 2HAKA 2QSFX 2QNJA 4R71A 1F4IA 2L4EA 2LVNC 1R4GA 1TR8A 1HJPA 1HT2E 1NV8A 2KNVA 1T43A 2R0IA 3FRHA 4F1IA 2MGWA 2DHYA 2H5XA 1G41A 3IECA 2LVPC 3GLIE 1ZMUA 1WGLA 2LVAA 1VDLA 1XB2B 2JY8A 3IHPA 4UN2B 2O25A 1DO0A 1VEGA 1C7YA 2JY7A 1E94E 3BBZA 1NV9A 1QZEA 2BWEA 1Q02A 2LTUA 4HEOA 1TTEA 2LVOC 3LCVB 4DBGB 1VQ1A 2EJSA 1HT1E 1YLAA 2MJ5B 3T6PA 2RRUA 2KNAA 2G3QA 1OKSA 1JR3E 4GEWA 1VEJA 1VEKA 2CWBA 1OAIA 2EKFA 5DFLA 4F2LA 3E46A 2JUJA 3GLGE 1IFYA 2EKKA 1A5TA 2OOBA 2DAGA 3E21A 2JY6B 1G4AE 2OO9A 1WJ7A 3FE3A 1CUKA 2DAKA 1VG5A 1IXSA 2KNZA 4WP2A 1ZMVA 2JZ1A 4G3OA 2QHOB 2ZTDA 2LBCA 3F92A 2L4FA 1WR1B 2OOAA 2LVQD 3K9OA 2CP8A 1HQYE 3K9PA 5JI2E 1UFZA 1XXHE 1OQYA 2DZLA 2DNAA 1BVSA 3B89A
chains in the Genus database with same CATH superfamily
1NSFA 2YR0A 3ILKA 3M6AA 4RF1A 1J5EM 3B7NA 1DV0A 1IN4A 2N35A 2CHQA 4FCTA 2DI0A 4IBEA 1L1ZA 3IG5A 4M9XA 1TH4A 3MMPA 2WSCF 3HGIA 1R5LA 3ZQJA 1DO2A 3HWSA 3H4JA 4B3TM 3UGJA 1G3IA 4REZA 4W5WA 1ZMWA 4LJ6A 4B7GA 3GRUA 1IN6A 3KDSE 2UU9M 3HU3A 4M0DA 1XMQM 1SXJA 2WZJA 2X49A 1IN8A 1SXJE 3C58A 3ZC7B 3NBIA 2MROB 3BXWA 3LQRA 4JXJA 4DV2M 1IY1A 3U6QA 4LJ9A 5KQ8A 3KOYE 4L4UA 2XFTA 3ZCBB 1T6OA 1IXSB 1NVMA 3GP1A 2F5QA 3J80S 4R71A 1GL6A 3FD9A 2OPFA 5EP2A 1HJPA 4QOSA 1PRBA 2LHCA 5FTLA 4G4QA 1QDTA 2FNAA 3GLFB 4F1IA 4AI6A 2MGWA 1PJQA 3KP0E 2DHYA 4JI0M 1QYRA 1OAOC 1Q3CA 3AOGA 3K92A 3NWLA 4FCVA 3TL4X 4X65M 3U6CA 1VDDA 3TWMA 2LVAA 3SARA 1VDLA 3W0LB 1XB2B 2JY8A 3IHPA 4PT5A 4UN2B 4CGYB 4PDGA 1V33A 1VEGA 3D8BA 4L78A 4FW9A 3QWLA 3T15A 4AKIA 3KSJA 4L6V6 4NOOB 3FKEA 3L2AA 3KFUG 4GKJM 4IJFA 4PCZA 1S3SA 2BWEA 2WSEF 4ZPXA 3DFZA 1L2BA 1Q02A 4X66M 3UMMA 1IY2A 2VDBB 2DZNB 2LVOC 2V1UA 2XSZD 2LWXA 1MJGM 4II7A 1C1KA 4DBGB 1D0MA 3GPUA 2MJ5B 3J2PB 3T6PA 4IBFA 4GMQA 5ITTA 3JR4A 2G3QA 5DNYA 3SASA 4JYAM 1FJGM 5C1BA 3TWKA 1VEJA 2X4AA 1XHBA 4B3RM 1OAIA 1MX0A 2EKFA 2UXBM 2W82A 2V6ZM 5FTNA 4L16A 2X8AA 5KO3A 2JUJA 1Z5BA 1R7RA 1NY6A 3GPPA 4ITQA 3GLGE 4YY3M 2UUBM 2R65A 3LW5F 3NBXX 2FE8A 4P16A 3SMPA 4LFBM 3L26A 2DAGA 2D7EA 3E21A 4GHAA 2Z4SA 3EIHA 2OO9A 1WJ7A 1QAOA 1W5TA 2ERCA 2DAKA 3HU1A 2ZTDA 2XGNA 2Y0QA 2L4FA 1V34A 2DWZB 3LVWA 3MJ5A 5ITRA 3VK7A 1TF0B 1R2ZA 3TQSA 2KXEA 4BLCA 2DVWB 1HNXM 1HNZM 2C98A 2LVQD 4MGHA 1WXQA 1K82A 4LF5M 4DV3M 3SHFA 4PD2A 2CP8A 3U6PA 5DYGA 5DYIA 4OW0A 1DGHB 2EO2A 3UJNA 3T38A 3SAWA 3T1HM 4GIPA 1TGUA 1IXZA 3B89A 2APLA 4XK8F 2F5SA 2FH0A 2DENA 2JA2A 4KODA 1AIPC 2K0BX 3KS4A 3FYDA 1SG9A 3FUVA 2CV0A 2F4VM 2KHHA 4KT0F 2LH0A 1QANA 2BNKA 3CF6E 1OIPA 1MU5A 2DWMA 4RF0A 3FUUA 4LF9M 2DWLA 3SMSA 1N75A 3D8LA 1YE9A 2D7GA 3L29A 3QYEA 3SC3A 4CIZA 4LZJA 3U61A 3FTCA 4ANRA 5H37D 4JI1M 1J7KA 1P3QQ 2QCUA 5FLXS 1OTRA 3A42A 2YQZA 1NHGC 2L2DA 4B08A 4KO8A 2Z8YM 4OU7A 2XZFA 2CV1A 4JV5M 3SYKA 1WHCA 1DGBA 5ITUA 2UXDM 4X62M 2ZM6M 3FRIA 4M9ZA 3HJSA 1IXRC 4GC5A 3J7AS 1SXJD 5EJCA 4PDIA 3U6MA 4GITA 1PJSA 1PM5A 3QYBA 2QNJA 2HHHM 4JI4M 2GNOA 1F4IA 3U6DA 1NJFA 1W5SA 2VIIA 2YNMD 5C18A 1TR8A 5EP4A 1IBKM 1N78A 1HT2E 4I4LA 2KNVA 2R0IA 3FRHA 2NQ8C 3FTEA 1OIZA 3IECA 1G41A 2XFSA 2O01F 1OJLA 1XXHB 5FTJA 4MGKE 4LF7M 2ZAMA 3HJ8A 2R6FA 3CGWA 1JB0F 4DV5M 3T1YM 3GLHB 4JI7M 3GPXA 3CF0A 1C7YA 1IQPA 4GRIA 4CISA 1QZEA 3VKHA 3SBJA 2J5YA 1NY5A 2KA6B 3GO8A 4LRTA 3DA1A 4HEOA 3B9PA 2EA0A 2WSFF 2R45A 4IBIA 3PNVA 4Y28F 4K0KM 3LCVB 5EP3A 3R9XB 3KOXE 2XZUA 1HT1E 1YLAA 1XC8A 1NNUC 1JR3A 3PNYA 5ITXA 5FTMA 5JI3E 3JR5A 4DV7M 3GQ3A 1AUAA 1JR3E 5ITXE 3OTOM 4S12A 1TDHA 3UZUA 4LF8M 5EXSA 4JI3M 2L6OA 4JN6A 4LJAA 1L2DA 4IBBA 3Q8GA 1GJTA 2G8LA 3U6LA 4DUZM 2R4JA 1Z59A 3DZDA 4QNRA 1J09A 2UXCM 1FNNA 4FD2A 1Z5AA 2L09A 3FTDA 5BR8M 3KXEC 2CUZA 2QQ8A 1N36M 4FWDA 1CUKA 1XWIA 4LJ4A 4OVZB 5KQDA 4OX9M 2P5TA 1IXSA 2FOIC 3K8ZA 2JZ1A 3QAUA 4I8OA 4LY6A 2QHOB 5LMUM 2K6BA 3AFHA 3W67A 1IN7A 4IBGA 3HHXA 3GLIB 4LRSA 1WR1B 4FCWA 2CRUA 3H4MA 4KLNA 2QENA 1Q3BA 2YFQA 2VF7A 4JI2M 5ITQA 3VDPA 5A2QS 5GKNA 2ZBKB 5FTKA 2J7NA 3K9PA 3GLGA 2C9CA 3FTFA 1OQYA 2R18A 2DZLA 2DNAA 2RRUA 4D80A 2HWJA 4LGMA 2KZSA 4TUWA 1IY0A 4KHPM 2KRUA 2M60A 3FYCA 3LCUA 3K2LA 2RGOA 2D7HA 1G8PA 2R4EA 4MGZE 5EXPA 1HR0M 2H1RA 4RNAA 2O5RA 2HCBA 5ITYA 1Z5CA 3W68A 2DAIA 2EUCA 2F5NA 5KPZA 2DAMA 2QP9X 4DV4M 1WIVA 5EP1A 4LFAM 3HU2A 3KOWE 2Q2EB 4FVMA 4AKGA 1H6UA 4DR4M 4IBDA 2MR9A 4L8RC 2DAEA 4R3DA 3AOEC 1N77A 2XSZA 2R46A 1QZMA 3U5ZB 4AKHA 1QVRA 4AQYM 1XMOM 4Q7JA 5KPRA 3BOSA 4GC9A 2RKOA 4MH0E 1E9RA 2BJWA 1LTMA 1ZV1A 2JWSA 5E26A 3PXGA 2I7NA 3VLFB 2HAKA 3HZJA 3I4YA 4QNMA 4AZFA 2Z3XA 1QQWA 2L4EA 2LVNC 4LCBA 3L25A 1R2YA 1R4GA 2VF8A 2Y0TA 3AJIB 3LQQA 4HLQA 4QHSA 3J81S 3U61B 2LXEA 4IJEA 3A45A 1DGGA 1NV8A 5BPVA 1T43A 3VK8A 3C3EA 3B74A 2QBYA 2H5XA 5F3WA 3U60A 2QZ4A 3SFZA 1XNQM 2LVPC 2C9OA 1WGLA 3U6SA 2CE7A 3J27B 2KEBA 4AG6A 2Z4RA 2CFOA 3RFWA 5FSWA 1DO0A 3KVWA 1QDRA 2JY7A 4LGYA 3BBZA 1NV9A 1I4WA 8CATA 2MH8A 1Q39A 2G5GX 4DR3M 2LTUA 1TTEA 5EXXA 3J7BA 2XEPA 4D82A 5IREB 5LMNM 1N33M 2AHMA 3RGPA 3SAVA 3TE6A 3GRVA 1NJGA 1Z6TA 2E5LM 4LJ5A 4D81A 4GEWA 2CV2A 2CWBA 4FWHA 3SHGB 1NNJA 4MGIE 1SXJB 1D0KA 4LJ7A 3U6EA 5DFLA 1L1TA 2KRKA 3Q8XA 4DR5M 1IBLM 4R7GA 2UUCM 2OOBA 1YSYA 4I5SA 3I04M 2I7PA 4HL4A 4G6ZA 1L8QA 1JQJC 4QHTA 5IZ7D 4AG5A 4IBKA 4BBAA 2JY6B 1G4AE 2GQFA 3FE3A 3GRYA 2KNZA 2Z7JA 4G3OA 2QPAA 2LBCA 1X37A 1IN5A 4JI5M 3V76A 4B3MM 1QAMA 1PJJA 3SATA 1ZQ9A 4DR6M 3CTWB 3KP1E 4AW4A 4RKUF 3M7GA 1HQYE 1OFIA 1XXHA 2V1CA 2LHGA 3A98B 2UUAM 4DV0M 4IBJA 1XXHE 1ZAEA 3GLHA 3KW6A 3GRRA 3B7QA 3PVSA 1HNWM 1BVSA 1ORYB 4MB7A 2L7IA 3CF2A 3GLHE 5EXTA 2Y21A 5IWAM 3HHZA 5IT9S 1PGYA 1MN3A 2JY5A 4XGIA 2B3TA 4DR2M 2JNHA 1V92A 2JZ0A 4DR1M 1E9SA 4WW0A 2OQ4A 1K3XA 1IM2A 2BWBA 3PFIA 3VFDA 1GJSA 2DKLA 3A46A 1TH2A 1TH3A 2DZOB 4EIWA 1DGFA 2ZANA 3HX3A 1GO5A 1EFUB 1PJIA 1YUBA 3JAMS 4NSRA 3AOEA 3HY5A 2J7OA 2VQFM 1WGNA 4DR7M 4NRVA 1HQCA 4A3VB 3GLFA 2A5YB 1G71A 3GLGB 3KOZE 3KSXA 2K9DA 4WURA 4DUYM 3GLFE 3KS8A 1QUSA 3B7ZA 3HHYA 2C99A 2F5OA 3AL0C 1KYIA 4Z6YA 2JP7A 4NC6A 2VQEM 4CHTB 4G4NA 2R44A 2ZTCA 3TWLA 1EE8A 1SXJC 1GL7A 3I51A 1Y8GA 3UK6A 4I81A 2F5PA 1I94M 3I4VA 3L28A 3M0EA 3MHVC 4M0WA 1KFVA 4JI8M 2KDLA 2QSFX 5KPTA 2XF3A 4IBCA 1UM8A 4OVZA 4QOZC 3VDUA 3AV0A 4NXMM 4GKKM 4M9SA 3AKZA 1GKIA 4L15A 2M5ZA 4LF6M 4B3SM 2JXNA 3R8FA 3GLIA 3ZH9B 5E6JA 2LNHC 3FUXA 2XLJA 3LMMA 2C5RA 3GLIE 4JI6M 3SYLA 1ZMUA 1XNRM 1L2CA 4XBOA 5EQTA 4B7FA 2O25A 3W0FA 1NHWC 3TPZA 1IBMM 1E94E 4LF4M 3DOAA 2CHGA 1G59A 3U6OA 2DWNA 2HKJA 3GQ4A 1LV7A 1KSFX 2RGHA 4LZZA 4FWGA 4P17A 2K47A 4LJ8A 4NL4H 2DHRA 2CEAA 1VQ1A 3K1JA 2EJSA 4MM3B 3EIEA 4BB9A 2QBYB 3WHKA 1K3WA 2BJVA 4LG2A 4NRWA 3U60B 1QAQA 2KNAA 2XH9A 2DXIA 4DV6M 1OKSA 4GH9A 5L8RF 2C96A 2KW0A 3FUWA 4YHHM 3L27A 1VEKA 3LVVA 1R6BX 4NSOB 3VKGA 2FFJA 1N32M 4Z8XA 4F2LA 3E46A 3HHWA 3WHLA 4LFCM 3RGSA 1QUTA 1IFYA 1N34M 2R62A 4G4RA 2EKKA 1A5TA 1DGHA 7CATA 1GVNA 2HL7A 3U5ZA 1E32A 3HKPA 3I01M 3THGA 3SAUA 2ZAOA 3E4RA 1EIJA 1VG5A 4WP2A 1ZMVA 1NO1A 3FUTA 4NXNM 3C3DA 2KZUA 3F92A 1PJTA 4X64M 2CHVA 2FS1A 4DV1M 3RE8A 4B7HA 1RU3A 1OFHA 3GQ5A 3HJQA 1GLNA 4IIWA 2OOAA 1TDZA 3GPYA 2L7HA 1GABA 4GHLA 4G4OA 1D0LA 3K9OA 3C9PA 3IG8A 1JR3D 4MGYE 5JI2E 1UFZA 1D2NA 2Y20A 3E9SA 1T3TA 3MK6A 4CJ6A
chains in the Genus database with same CATH topology
2HWJA 3GLHE 1PGYA 2DENA 1MN3A 1DV0A 2JY5A 3LCUA 1AIPC 2B3TA 2DI0A 2K0BX 1SG9A 2JNHA 1V92A 2JZ0A 2KHHA 3MMPA 1IM2A 2BWBA 2DKLA 2DAIA 1DO2A 2DAMA 3H4JA 1GO5A 1EFUB 1WIVA 1P3QQ 1WGNA 1G3IA 1OTRA 1ZMWA 2K9DA 3GLFE 2L2DA 2MR9A 2DAEA 2WZJA 1KYIA 2JP7A 1WHCA 2MROB 2ZTCA 4Q7JA 3FRIA 1Y8GA 1ZV1A 1T6OA 2HAKA 2QSFX 2QNJA 4R71A 1F4IA 2L4EA 2LVNC 1R4GA 1TR8A 1HJPA 1HT2E 1NV8A 2KNVA 1T43A 2R0IA 3FRHA 4F1IA 2MGWA 2DHYA 2H5XA 1G41A 3IECA 2LVPC 3GLIE 1ZMUA 1WGLA 2LVAA 1VDLA 1XB2B 2JY8A 3IHPA 4UN2B 2O25A 1DO0A 1VEGA 1C7YA 2JY7A 1E94E 3BBZA 1NV9A 1QZEA 2BWEA 1Q02A 2LTUA 4HEOA 1TTEA 2LVOC 3LCVB 4DBGB 1VQ1A 2EJSA 1HT1E 1YLAA 2MJ5B 3T6PA 2RRUA 2KNAA 2G3QA 1OKSA 1JR3E 4GEWA 1VEJA 1VEKA 2CWBA 1OAIA 2EKFA 5DFLA 4F2LA 3E46A 2JUJA 3GLGE 1IFYA 2EKKA 1A5TA 2OOBA 2DAGA 3E21A 2JY6B 1G4AE 2OO9A 1WJ7A 3FE3A 1CUKA 2DAKA 1VG5A 1IXSA 2KNZA 4WP2A 1ZMVA 2JZ1A 4G3OA 2QHOB 2ZTDA 2LBCA 3F92A 2L4FA 1WR1B 2OOAA 2LVQD 3K9OA 2CP8A 1HQYE 3K9PA 5JI2E 1UFZA 1XXHE 1OQYA 2DZLA 2DNAA 1BVSA 3B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HWJ A;  3GLH E;  1PGY A;  2DEN A;  1MN3 A;  1DV0 A;  2JY5 A;  3LCU A;  1AIP C;  2B3T A;  2DI0 A;  2K0B X;  1SG9 A;  2JNH A;  1V92 A;  2JZ0 A;  2KHH A;  3MMP A;  1IM2 A;  2BWB A;  2DKL A;  2DAI A;  1DO2 A;  2DAM A;  3H4J A;  1GO5 A;  1EFU B;  1WIV A;  1P3Q Q;  1WGN A;  1G3I A;  1OTR A;  1ZMW A;  2K9D A;  3GLF E;  2L2D A;  2MR9 A;  2DAE A;  2WZJ A;  1KYI A;  2JP7 A;  1WHC A;  2MRO B;  2ZTC A;  4Q7J A;  3FRI A;  1Y8G A;  1ZV1 A;  1T6O A;  2HAK A;  2QSF X;  2QNJ A;  4R71 A;  1F4I A;  2L4E A;  2LVN C;  1R4G A;  1TR8 A;  1HJP A;  1HT2 E;  1NV8 A;  2KNV A;  1T43 A;  2R0I A;  3FRH A;  4F1I A;  2MGW A;  2DHY A;  2H5X A;  1G41 A;  3IEC A;  2LVP C;  3GLI E;  1ZMU A;  1WGL A;  2LVA A;  1VDL A;  1XB2 B;  2JY8 A;  3IHP A;  4UN2 B;  2O25 A;  1DO0 A;  1VEG A;  1C7Y A;  2JY7 A;  1E94 E;  3BBZ A;  1NV9 A;  1QZE A;  2BWE A;  1Q02 A;  2LTU A;  4HEO A;  1TTE A;  2LVO C;  3LCV B;  4DBG B;  1VQ1 A;  2EJS A;  1HT1 E;  1YLA A;  2MJ5 B;  3T6P A;  2RRU A;  2KNA A;  2G3Q A;  1OKS A;  1JR3 E;  4GEW A;  1VEJ A;  1VEK A;  2CWB A;  1OAI A;  2EKF A;  5DFL A;  4F2L A;  3E46 A;  2JUJ A;  3GLG E;  1IFY A;  2EKK A;  1A5T A;  2OOB A;  2DAG A;  3E21 A;  2JY6 B;  1G4A E;  2OO9 A;  1WJ7 A;  3FE3 A;  1CUK A;  2DAK A;  1VG5 A;  1IXS A;  2KNZ A;  4WP2 A;  1ZMV A;  2JZ1 A;  4G3O A;  2QHO B;  2ZTD A;  2LBC A;  3F92 A;  2L4F A;  1WR1 B;  2OOA A;  2LVQ D;  3K9O A;  2CP8 A;  1HQY E;  3K9P A;  5JI2 E;  1UFZ A;  1XXH E;  1OQY A;  2DZL A;  2DNA A;  1BVS A;  3B89 A; 
#chains in the Genus database with same CATH topology
 1NSF A;  2YR0 A;  3ILK A;  3M6A A;  4RF1 A;  1J5E M;  3B7N A;  1DV0 A;  1IN4 A;  2N35 A;  2CHQ A;  4FCT A;  2DI0 A;  4IBE A;  1L1Z A;  3IG5 A;  4M9X A;  1TH4 A;  3MMP A;  2WSC F;  3HGI A;  1R5L A;  3ZQJ A;  1DO2 A;  3HWS A;  3H4J A;  4B3T M;  3UGJ A;  1G3I A;  4REZ A;  4W5W A;  1ZMW A;  4LJ6 A;  4B7G A;  3GRU A;  1IN6 A;  3KDS E;  2UU9 M;  3HU3 A;  4M0D A;  1XMQ M;  1SXJ A;  2WZJ A;  2X49 A;  1IN8 A;  1SXJ E;  3C58 A;  3ZC7 B;  3NBI A;  2MRO B;  3BXW A;  3LQR A;  4JXJ A;  4DV2 M;  1IY1 A;  3U6Q A;  4LJ9 A;  5KQ8 A;  3KOY E;  4L4U A;  2XFT A;  3ZCB B;  1T6O A;  1IXS B;  1NVM A;  3GP1 A;  2F5Q A;  3J80 S;  4R71 A;  1GL6 A;  3FD9 A;  2OPF A;  5EP2 A;  1HJP A;  4QOS A;  1PRB A;  2LHC A;  5FTL A;  4G4Q A;  1QDT A;  2FNA A;  3GLF B;  4F1I A;  4AI6 A;  2MGW A;  1PJQ A;  3KP0 E;  2DHY A;  4JI0 M;  1QYR A;  1OAO C;  1Q3C A;  3AOG A;  3K92 A;  3NWL A;  4FCV A;  3TL4 X;  4X65 M;  3U6C A;  1VDD A;  3TWM A;  2LVA A;  3SAR A;  1VDL A;  3W0L B;  1XB2 B;  2JY8 A;  3IHP A;  4PT5 A;  4UN2 B;  4CGY B;  4PDG A;  1V33 A;  1VEG A;  3D8B A;  4L78 A;  4FW9 A;  3QWL A;  3T15 A;  4AKI A;  3KSJ A;  4L6V 6;  4NOO B;  3FKE A;  3L2A A;  3KFU G;  4GKJ M;  4IJF A;  4PCZ A;  1S3S A;  2BWE A;  2WSE F;  4ZPX A;  3DFZ A;  1L2B A;  1Q02 A;  4X66 M;  3UMM A;  1IY2 A;  2VDB B;  2DZN B;  2LVO C;  2V1U A;  2XSZ D;  2LWX A;  1MJG M;  4II7 A;  1C1K A;  4DBG B;  1D0M A;  3GPU A;  2MJ5 B;  3J2P B;  3T6P A;  4IBF A;  4GMQ A;  5ITT A;  3JR4 A;  2G3Q A;  5DNY A;  3SAS A;  4JYA M;  1FJG M;  5C1B A;  3TWK A;  1VEJ A;  2X4A A;  1XHB A;  4B3R M;  1OAI A;  1MX0 A;  2EKF A;  2UXB M;  2W82 A;  2V6Z M;  5FTN A;  4L16 A;  2X8A A;  5KO3 A;  2JUJ A;  1Z5B A;  1R7R A;  1NY6 A;  3GPP A;  4ITQ A;  3GLG E;  4YY3 M;  2UUB M;  2R65 A;  3LW5 F;  3NBX X;  2FE8 A;  4P16 A;  3SMP A;  4LFB M;  3L26 A;  2DAG A;  2D7E A;  3E21 A;  4GHA A;  2Z4S A;  3EIH A;  2OO9 A;  1WJ7 A;  1QAO A;  1W5T A;  2ERC A;  2DAK A;  3HU1 A;  2ZTD A;  2XGN A;  2Y0Q A;  2L4F A;  1V34 A;  2DWZ B;  3LVW A;  3MJ5 A;  5ITR A;  3VK7 A;  1TF0 B;  1R2Z A;  3TQS A;  2KXE A;  4BLC A;  2DVW B;  1HNX M;  1HNZ M;  2C98 A;  2LVQ D;  4MGH A;  1WXQ A;  1K82 A;  4LF5 M;  4DV3 M;  3SHF A;  4PD2 A;  2CP8 A;  3U6P A;  5DYG A;  5DYI A;  4OW0 A;  1DGH B;  2EO2 A;  3UJN A;  3T38 A;  3SAW A;  3T1H M;  4GIP A;  1TGU A;  1IXZ A;  3B89 A;  2APL A;  4XK8 F;  2F5S A;  2FH0 A;  2DEN A;  2JA2 A;  4KOD A;  1AIP C;  2K0B X;  3KS4 A;  3FYD A;  1SG9 A;  3FUV A;  2CV0 A;  2F4V M;  2KHH A;  4KT0 F;  2LH0 A;  1QAN A;  2BNK A;  3CF6 E;  1OIP A;  1MU5 A;  2DWM A;  4RF0 A;  3FUU A;  4LF9 M;  2DWL A;  3SMS A;  1N75 A;  3D8L A;  1YE9 A;  2D7G A;  3L29 A;  3QYE A;  3SC3 A;  4CIZ A;  4LZJ A;  3U61 A;  3FTC A;  4ANR A;  5H37 D;  4JI1 M;  1J7K A;  1P3Q Q;  2QCU A;  5FLX S;  1OTR A;  3A42 A;  2YQZ A;  1NHG C;  2L2D A;  4B08 A;  4KO8 A;  2Z8Y M;  4OU7 A;  2XZF A;  2CV1 A;  4JV5 M;  3SYK A;  1WHC A;  1DGB A;  5ITU A;  2UXD M;  4X62 M;  2ZM6 M;  3FRI A;  4M9Z A;  3HJS A;  1IXR C;  4GC5 A;  3J7A S;  1SXJ D;  5EJC A;  4PDI A;  3U6M A;  4GIT A;  1PJS A;  1PM5 A;  3QYB A;  2QNJ A;  2HHH M;  4JI4 M;  2GNO A;  1F4I A;  3U6D A;  1NJF A;  1W5S A;  2VII A;  2YNM D;  5C18 A;  1TR8 A;  5EP4 A;  1IBK M;  1N78 A;  1HT2 E;  4I4L A;  2KNV A;  2R0I A;  3FRH A;  2NQ8 C;  3FTE A;  1OIZ A;  3IEC A;  1G41 A;  2XFS A;  2O01 F;  1OJL A;  1XXH B;  5FTJ A;  4MGK E;  4LF7 M;  2ZAM A;  3HJ8 A;  2R6F A;  3CGW A;  1JB0 F;  4DV5 M;  3T1Y M;  3GLH B;  4JI7 M;  3GPX A;  3CF0 A;  1C7Y A;  1IQP A;  4GRI A;  4CIS A;  1QZE A;  3VKH A;  3SBJ A;  2J5Y A;  1NY5 A;  2KA6 B;  3GO8 A;  4LRT A;  3DA1 A;  4HEO A;  3B9P A;  2EA0 A;  2WSF F;  2R45 A;  4IBI A;  3PNV A;  4Y28 F;  4K0K M;  3LCV B;  5EP3 A;  3R9X B;  3KOX E;  2XZU A;  1HT1 E;  1YLA A;  1XC8 A;  1NNU C;  1JR3 A;  3PNY A;  5ITX A;  5FTM A;  5JI3 E;  3JR5 A;  4DV7 M;  3GQ3 A;  1AUA A;  1JR3 E;  5ITX E;  3OTO M;  4S12 A;  1TDH A;  3UZU A;  4LF8 M;  5EXS A;  4JI3 M;  2L6O A;  4JN6 A;  4LJA A;  1L2D A;  4IBB A;  3Q8G A;  1GJT A;  2G8L A;  3U6L A;  4DUZ M;  2R4J A;  1Z59 A;  3DZD A;  4QNR A;  1J09 A;  2UXC M;  1FNN A;  4FD2 A;  1Z5A A;  2L09 A;  3FTD A;  5BR8 M;  3KXE C;  2CUZ A;  2QQ8 A;  1N36 M;  4FWD A;  1CUK A;  1XWI A;  4LJ4 A;  4OVZ B;  5KQD A;  4OX9 M;  2P5T A;  1IXS A;  2FOI C;  3K8Z A;  2JZ1 A;  3QAU A;  4I8O A;  4LY6 A;  2QHO B;  5LMU M;  2K6B A;  3AFH A;  3W67 A;  1IN7 A;  4IBG A;  3HHX A;  3GLI B;  4LRS A;  1WR1 B;  4FCW A;  2CRU A;  3H4M A;  4KLN A;  2QEN A;  1Q3B A;  2YFQ A;  2VF7 A;  4JI2 M;  5ITQ A;  3VDP A;  5A2Q S;  5GKN A;  2ZBK B;  5FTK A;  2J7N A;  3K9P A;  3GLG A;  2C9C A;  3FTF A;  1OQY A;  2R18 A;  2DZL A;  2DNA A;  2RRU A;  4D80 A;  2HWJ A;  4LGM A;  2KZS A;  4TUW A;  1IY0 A;  4KHP M;  2KRU A;  2M60 A;  3FYC A;  3LCU A;  3K2L A;  2RGO A;  2D7H A;  1G8P A;  2R4E A;  4MGZ E;  5EXP A;  1HR0 M;  2H1R A;  4RNA A;  2O5R A;  2HCB A;  5ITY A;  1Z5C A;  3W68 A;  2DAI A;  2EUC A;  2F5N A;  5KPZ A;  2DAM A;  2QP9 X;  4DV4 M;  1WIV A;  5EP1 A;  4LFA M;  3HU2 A;  3KOW E;  2Q2E B;  4FVM A;  4AKG A;  1H6U A;  4DR4 M;  4IBD A;  2MR9 A;  4L8R C;  2DAE A;  4R3D A;  3AOE C;  1N77 A;  2XSZ A;  2R46 A;  1QZM A;  3U5Z B;  4AKH A;  1QVR A;  4AQY M;  1XMO M;  4Q7J A;  5KPR A;  3BOS A;  4GC9 A;  2RKO A;  4MH0 E;  1E9R A;  2BJW A;  1LTM A;  1ZV1 A;  2JWS A;  5E26 A;  3PXG A;  2I7N A;  3VLF B;  2HAK A;  3HZJ A;  3I4Y A;  4QNM A;  4AZF A;  2Z3X A;  1QQW A;  2L4E A;  2LVN C;  4LCB A;  3L25 A;  1R2Y A;  1R4G A;  2VF8 A;  2Y0T A;  3AJI B;  3LQQ A;  4HLQ A;  4QHS A;  3J81 S;  3U61 B;  2LXE A;  4IJE A;  3A45 A;  1DGG A;  1NV8 A;  5BPV A;  1T43 A;  3VK8 A;  3C3E A;  3B74 A;  2QBY A;  2H5X A;  5F3W A;  3U60 A;  2QZ4 A;  3SFZ A;  1XNQ M;  2LVP C;  2C9O A;  1WGL A;  3U6S A;  2CE7 A;  3J27 B;  2KEB A;  4AG6 A;  2Z4R A;  2CFO A;  3RFW A;  5FSW A;  1DO0 A;  3KVW A;  1QDR A;  2JY7 A;  4LGY A;  3BBZ A;  1NV9 A;  1I4W A;  8CAT A;  2MH8 A;  1Q39 A;  2G5G X;  4DR3 M;  2LTU A;  1TTE A;  5EXX A;  3J7B A;  2XEP A;  4D82 A;  5IRE B;  5LMN M;  1N33 M;  2AHM A;  3RGP A;  3SAV A;  3TE6 A;  3GRV A;  1NJG A;  1Z6T A;  2E5L M;  4LJ5 A;  4D81 A;  4GEW A;  2CV2 A;  2CWB A;  4FWH A;  3SHG B;  1NNJ A;  4MGI E;  1SXJ B;  1D0K A;  4LJ7 A;  3U6E A;  5DFL A;  1L1T A;  2KRK A;  3Q8X A;  4DR5 M;  1IBL M;  4R7G A;  2UUC M;  2OOB A;  1YSY A;  4I5S A;  3I04 M;  2I7P A;  4HL4 A;  4G6Z A;  1L8Q A;  1JQJ C;  4QHT A;  5IZ7 D;  4AG5 A;  4IBK A;  4BBA A;  2JY6 B;  1G4A E;  2GQF A;  3FE3 A;  3GRY A;  2KNZ A;  2Z7J A;  4G3O A;  2QPA A;  2LBC A;  1X37 A;  1IN5 A;  4JI5 M;  3V76 A;  4B3M M;  1QAM A;  1PJJ A;  3SAT A;  1ZQ9 A;  4DR6 M;  3CTW B;  3KP1 E;  4AW4 A;  4RKU F;  3M7G A;  1HQY E;  1OFI A;  1XXH A;  2V1C A;  2LHG A;  3A98 B;  2UUA M;  4DV0 M;  4IBJ A;  1XXH E;  1ZAE A;  3GLH A;  3KW6 A;  3GRR A;  3B7Q A;  3PVS A;  1HNW M;  1BVS A;  1ORY B;  4MB7 A;  2L7I A;  3CF2 A;  3GLH E;  5EXT A;  2Y21 A;  5IWA M;  3HHZ A;  5IT9 S;  1PGY A;  1MN3 A;  2JY5 A;  4XGI A;  2B3T A;  4DR2 M;  2JNH A;  1V92 A;  2JZ0 A;  4DR1 M;  1E9S A;  4WW0 A;  2OQ4 A;  1K3X A;  1IM2 A;  2BWB A;  3PFI A;  3VFD A;  1GJS A;  2DKL A;  3A46 A;  1TH2 A;  1TH3 A;  2DZO B;  4EIW A;  1DGF A;  2ZAN A;  3HX3 A;  1GO5 A;  1EFU B;  1PJI A;  1YUB A;  3JAM S;  4NSR A;  3AOE A;  3HY5 A;  2J7O A;  2VQF M;  1WGN A;  4DR7 M;  4NRV A;  1HQC A;  4A3V B;  3GLF A;  2A5Y B;  1G71 A;  3GLG B;  3KOZ E;  3KSX A;  2K9D A;  4WUR A;  4DUY M;  3GLF E;  3KS8 A;  1QUS A;  3B7Z A;  3HHY A;  2C99 A;  2F5O A;  3AL0 C;  1KYI A;  4Z6Y A;  2JP7 A;  4NC6 A;  2VQE M;  4CHT B;  4G4N A;  2R44 A;  2ZTC A;  3TWL A;  1EE8 A;  1SXJ C;  1GL7 A;  3I51 A;  1Y8G A;  3UK6 A;  4I81 A;  2F5P A;  1I94 M;  3I4V A;  3L28 A;  3M0E A;  3MHV C;  4M0W A;  1KFV A;  4JI8 M;  2KDL A;  2QSF X;  5KPT A;  2XF3 A;  4IBC A;  1UM8 A;  4OVZ A;  4QOZ C;  3VDU A;  3AV0 A;  4NXM M;  4GKK M;  4M9S A;  3AKZ A;  1GKI A;  4L15 A;  2M5Z A;  4LF6 M;  4B3S M;  2JXN A;  3R8F A;  3GLI A;  3ZH9 B;  5E6J A;  2LNH C;  3FUX A;  2XLJ A;  3LMM A;  2C5R A;  3GLI E;  4JI6 M;  3SYL A;  1ZMU A;  1XNR M;  1L2C A;  4XBO A;  5EQT A;  4B7F A;  2O25 A;  3W0F A;  1NHW C;  3TPZ A;  1IBM M;  1E94 E;  4LF4 M;  3DOA A;  2CHG A;  1G59 A;  3U6O A;  2DWN A;  2HKJ A;  3GQ4 A;  1LV7 A;  1KSF X;  2RGH A;  4LZZ A;  4FWG A;  4P17 A;  2K47 A;  4LJ8 A;  4NL4 H;  2DHR A;  2CEA A;  1VQ1 A;  3K1J A;  2EJS A;  4MM3 B;  3EIE A;  4BB9 A;  2QBY B;  3WHK A;  1K3W A;  2BJV A;  4LG2 A;  4NRW A;  3U60 B;  1QAQ A;  2KNA A;  2XH9 A;  2DXI A;  4DV6 M;  1OKS A;  4GH9 A;  5L8R F;  2C96 A;  2KW0 A;  3FUW A;  4YHH M;  3L27 A;  1VEK A;  3LVV A;  1R6B X;  4NSO B;  3VKG A;  2FFJ A;  1N32 M;  4Z8X A;  4F2L A;  3E46 A;  3HHW A;  3WHL A;  4LFC M;  3RGS A;  1QUT A;  1IFY A;  1N34 M;  2R62 A;  4G4R A;  2EKK A;  1A5T A;  1DGH A;  7CAT A;  1GVN A;  2HL7 A;  3U5Z A;  1E32 A;  3HKP A;  3I01 M;  3THG A;  3SAU A;  2ZAO A;  3E4R A;  1EIJ A;  1VG5 A;  4WP2 A;  1ZMV A;  1NO1 A;  3FUT A;  4NXN M;  3C3D A;  2KZU A;  3F92 A;  1PJT A;  4X64 M;  2CHV A;  2FS1 A;  4DV1 M;  3RE8 A;  4B7H A;  1RU3 A;  1OFH A;  3GQ5 A;  3HJQ A;  1GLN A;  4IIW A;  2OOA A;  1TDZ A;  3GPY A;  2L7H A;  1GAB A;  4GHL A;  4G4O A;  1D0L A;  3K9O A;  3C9P A;  3IG8 A;  1JR3 D;  4MGY E;  5JI2 E;  1UFZ A;  1D2N A;  2Y20 A;  3E9S A;  1T3T A;  3MK6 A;  4CJ6 A; 
#chains in the Genus database with same CATH homology
 2HWJ A;  3GLH E;  1PGY A;  2DEN A;  1MN3 A;  1DV0 A;  2JY5 A;  3LCU A;  1AIP C;  2B3T A;  2DI0 A;  2K0B X;  1SG9 A;  2JNH A;  1V92 A;  2JZ0 A;  2KHH A;  3MMP A;  1IM2 A;  2BWB A;  2DKL A;  2DAI A;  1DO2 A;  2DAM A;  3H4J A;  1GO5 A;  1EFU B;  1WIV A;  1P3Q Q;  1WGN A;  1G3I A;  1OTR A;  1ZMW A;  2K9D A;  3GLF E;  2L2D A;  2MR9 A;  2DAE A;  2WZJ A;  1KYI A;  2JP7 A;  1WHC A;  2MRO B;  2ZTC A;  4Q7J A;  3FRI A;  1Y8G A;  1ZV1 A;  1T6O A;  2HAK A;  2QSF X;  2QNJ A;  4R71 A;  1F4I A;  2L4E A;  2LVN C;  1R4G A;  1TR8 A;  1HJP A;  1HT2 E;  1NV8 A;  2KNV A;  1T43 A;  2R0I A;  3FRH A;  4F1I A;  2MGW A;  2DHY A;  2H5X A;  1G41 A;  3IEC A;  2LVP C;  3GLI E;  1ZMU A;  1WGL A;  2LVA A;  1VDL A;  1XB2 B;  2JY8 A;  3IHP A;  4UN2 B;  2O25 A;  1DO0 A;  1VEG A;  1C7Y A;  2JY7 A;  1E94 E;  3BBZ A;  1NV9 A;  1QZE A;  2BWE A;  1Q02 A;  2LTU A;  4HEO A;  1TTE A;  2LVO C;  3LCV B;  4DBG B;  1VQ1 A;  2EJS A;  1HT1 E;  1YLA A;  2MJ5 B;  3T6P A;  2RRU A;  2KNA A;  2G3Q A;  1OKS A;  1JR3 E;  4GEW A;  1VEJ A;  1VEK A;  2CWB A;  1OAI A;  2EKF A;  5DFL A;  4F2L A;  3E46 A;  2JUJ A;  3GLG E;  1IFY A;  2EKK A;  1A5T A;  2OOB A;  2DAG A;  3E21 A;  2JY6 B;  1G4A E;  2OO9 A;  1WJ7 A;  3FE3 A;  1CUK A;  2DAK A;  1VG5 A;  1IXS A;  2KNZ A;  4WP2 A;  1ZMV A;  2JZ1 A;  4G3O A;  2QHO B;  2ZTD A;  2LBC A;  3F92 A;  2L4F A;  1WR1 B;  2OOA A;  2LVQ D;  3K9O A;  2CP8 A;  1HQY E;  3K9P A;  5JI2 E;  1UFZ A;  1XXH E;  1OQY A;  2DZL A;  2DNA A;  1BVS A;  3B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...