1T6OA

Nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the attachment of a paramyxoviral polymerase to its template.
pubmed doi rcsb
source organism Measles virus
molecule tags Viral protein
molecule keywords phosphoprotein
total genus 15
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1t6oA00
1T43A 1IFYA 4UN2B 1GO5A 2DAKA 1PGYA 4R71A 2JNHA 2JY5A 1NV9A 1VG5A 2MGWA 1BVSA 1ZMWA 1QZEA 2DKLA 4HEOA 3GLHE 1ZV1A 2DAEA 3K9PA 1G41A 1WR1B 2DAMA 2JY8A 3FRIA 1Y8GA 2KHHA 2JZ1A 2LVQD 2G3QA 1OAIA 3F92A 1VEGA 1XXHE 2JY6B 1TR8A 1NV8A 1VEKA 2DENA 2MJ5B 2LVPC 4Q7JA 4F1IA 1G4AE 2KNAA 1IXSA 2MROB 1IM2A 2L4EA 2O25A 2OO9A 2OOAA 1HJPA 4G3OA 2QSFX 2LTUA 2JP7A 2JUJA 2LVNC 1VQ1A 1R4GA 1MN3A 1XB2B 2RRUA 2DNAA 2KNZA 5JI2E 2CP8A 1OKSA 1V92A 1WJ7A 2WZJA 2DHYA 3H4JA 1VDLA 2ZTCA 1G3IA 2DI0A 3LCVB 1DV0A 3GLIE 1WHCA 2JY7A 3BBZA 2LVOC 1OQYA 3K9OA 2OOBA 3GLFE 3LCUA 2EKFA 1VEJA 2CWBA 1A5TA 2KNVA 1TTEA 2DAGA 1P3QQ 1UFZA 3MMPA 4WP2A 5DFLA 2BWEA 2B3TA 2R0IA 1OTRA 3B89A 1DO0A 3FE3A 3IECA 1HT2E 3FRHA 1E94E 1KYIA 1JR3E 2K9DA 2QHOB 4F2LA 1DO2A 1CUKA 4GEWA 3T6PA 1HT1E 1SG9A 1WGLA 2LBCA 2LVAA 1ZMVA 1EFUB 2MR9A 2ZTDA 4DBGB 2HAKA 2QNJA 2L2DA 3E46A 1Q02A 2DAIA 2DZLA 3E21A 2H5XA 2EKKA 2BWBA 1C7YA 1YLAA 1AIPC 2JZ0A 1F4IA 2L4FA 1ZMUA 3IHPA 1HQYE 2K0BX 3GLGE 2HWJA 1T6OA 1WGNA 1WIVA 2EJSA
chains in the Genus database with same CATH superfamily
4DR1M 5IZ7D 1GABA 1ZAEA 1GO5A 3LW5F 3THGA 1XNRM 2JNHA 2JY5A 3OTOM 1NV9A 3HJQA 1VG5A 2E5LM 1X37A 5GKNA 4GC5A 5ITQA 1PJIA 2DKLA 4PT5A 2DVWB 2F5OA 2DAEA 4D80A 1E32A 2UU9M 3F92A 1VEGA 2ERCA 1N78A 1JB0F 1QAMA 3E4RA 3HX3A 2DENA 4B7GA 3QYEA 4Q7JA 4NSRA 3PVSA 3Q8GA 2L7IA 1J5EM 4IBGA 3TQSA 4DV2M 3HU3A 4JI3M 1GL7A 2R4EA 1D0KA 3B7ZA 2CEAA 4X62M 2EA0A 1OAOC 3CTWB 4M9SA 2XGNA 3I51A 4FCTA 4MB7A 2JP7A 2JUJA 1R7RA 3W67A 1VQ1A 2W82A 3GPXA 1IBLM 4FCWA 1XXHB 4GIPA 5ITUA 2F4VM 1MX0A 1N77A 2NQ8C 3FTDA 4NC6A 2V6ZM 3KOYE 3GPPA 2FNAA 3FYCA 2CUZA 1XMQM 2DI0A 3KS8A 3HU1A 3SYKA 2HCBA 1G71A 1ZQ9A 1IN4A 1WHCA 3FTCA 4G6ZA 4AKHA 4LJAA 5ITTA 3FTEA 3BBZA 3FTFA 3UK6A 5KPZA 3L2AA 2EKFA 2GQFA 4M9ZA 4CIZA 3EIHA 4L4UA 1P3QQ 5EXPA 1FJGM 1UFZA 3LMMA 4WP2A 4JI6M 4FCVA 3T15A 3SAUA 4NRWA 4KHPM 2YNMD 1D0LA 1Z6TA 1HNWM 1IXRC 3HY5A 3QAUA 4DR4M 4DR7M 4G4QA 3KVWA 2M60A 3TE6A 3U6SA 2JWSA 5IT9S 2C98A 4B3SM 1MU5A 2K9DA 3UJNA 2V1CA 3KP1E 4NRVA 2CRUA 4RKUF 4CHTB 2DWNA 5DYGA 4NOOB 4MH0E 3UZUA 2F5SA 2DHRA 2LH0A 1HT1E 2R6FA 1Z5AA 1ORYB 3HHXA 4FWHA 2O01F 3KOZE 1QDTA 2MR9A 2C96A 3T1YM 4GKKM 4Z6YA 3QWLA 2UXDM 3KSXA 1QQWA 2XFSA 3ZQJA 3JAMS 2QQ8A 1N36M 5ITYA 3GQ5A 4AQYM 3HU2A 1NVMA 2DAIA 1QAQA 2QP9X 2R18A 3MK6A 1GVNA 2LXEA 1QVRA 1L2BA 2ZBKB 4OX9M 3K1JA 3TWMA 1YLAA 1AIPC 2JZ0A 4RF0A 5ITRA 2K6BA 3DA1A 2R46A 4L8RC 3RE8A 3AOEC 8CATA 3TPZA 4JI4M 1PJQA 1LTMA 4BLCA 3A45A 2A5YB 2G8LA 4LY6A 3VK8A 2CHVA 1IN5A 2FH0A 4NL4H 4DV4M 2I7NA 3KOWE 3M7GA 2HWJA 2Y0QA 4IBFA 4FWGA 1TF0B 4FWDA 1NSFA 4REZA 3GPUA 1RU3A 4UN2B 3KFUG 2OQ4A 4XK8F 2N35A 4CISA 4YHHM 3NBIA 3U6QA 1ZMWA 3KS4A 4HEOA 5EP3A 1IN8A 1Q3BA 3GLHE 1VDDA 1ZV1A 1TGUA 1QYRA 3K9PA 2DAMA 2FS1A 3SASA 1Y8GA 4JV5M 2WSCF 2YR0A 3U5ZB 2LVQD 3B7QA 3HJSA 3GP1A 3AJIB 2HL7A 5H37D 1TR8A 2J7NA 3HHYA 1VEKA 2XZUA 4I5SA 1IQPA 1QANA 5KQDA 2APLA 3L26A 3B7NA 4G4OA 2CHQA 2Q2EB 5FTMA 3GQ3A 1YUBA 2KRUA 5EP4A 2OOAA 3VK7A 3ZCBB 3FKEA 3AKZA 1IN6A 2LTUA 4RNAA 4LRSA 1SXJD 2LVNC 4IBBA 3GLGB 2OPFA 4LG2A 4X66M 5E6JA 1WXQA 3GRUA 3W0LB 2GNOA 1IXSB 3CF6E 4JXJA 5FTLA 2UXBM 3CF2A 3SHGB 5JI2E 3KXEC 1OKSA 1V92A 2DZOB 2O5RA 2DHYA 4X64M 1G3IA 3FUVA 2CE7A 1GL6A 3R9XB 1LV7A 2KA6B 3AOGA 4GHAA 2R65A 2XSZD 3QYBA 3J2PB 4JI2M 2LVOC 1I4WA 1IY1A 1OQYA 1C1KA 1E9RA 5A2QS 3U6LA 3LCUA 2KW0A 2DXIA 2DWZB 4LRTA 5KO3A 4LGMA 3C58A 2JXNA 2KNVA 1V34A 2CWBA 1TTEA 2G5GX 2QENA 3FD9A 1MJGM 3RFWA 1K3XA 4WURA 3L25A 3SATA 3MMPA 5DFLA 2BWEA 4LF8M 4DV1M 2B3TA 1G59A 3GLFA 3E9SA 3A98B 1DGHB 2R0IA 3C3EA 4LJ9A 2BNKA 3VLFB 1OFHA 1NJGA 2VF8A 4FW9A 4BB9A 1HT2E 1JR3E 3ILKA 4Y28F 3J80S 3JR5A 1DGBA 4QOSA 2R4JA 4NXNM 3K8ZA 5EQTA 1TH2A 3AL0C 1CUKA 4LJ7A 5F3WA 1HR0M 4LJ4A 3T6PA 3VDUA 3R8FA 2AHMA 3SMPA 4B08A 3PNYA 2QPAA 1SXJE 4KO8A 2UUBM 2L09A 3VFDA 1EFUB 1DGFA 3I01M 4OW0A 2ZTDA 1Z59A 1K3WA 2F5QA 3GLHB 3FUUA 2QNJA 4IBCA 2L2DA 3U60A 3GLFB 2RGOA 1Q02A 2BJWA 2DZLA 4IJFA 3GRRA 2Y0TA 3DFZA 4OU7A 3I4VA 4LJ5A 1YSYA 2FOIC 3Q8XA 3EIEA 1XC8A 5LMNM 2DWLA 1IN7A 3D8LA 1JR3D 4MGYE 2Z7JA 4YY3M 3LVVA 4ZPXA 3U60B 5EXXA 4II7A 3SHFA 2VIIA 2EO2A 1EIJA 3L29A 3RGPA 2LWXA 3CGWA 3BOSA 4GMQA 5C18A 1T6OA 3RGSA 4Z8XA 2LNHC 1WIVA 1G8PA 2EJSA 3BXWA 2L7HA 1Z5BA 4L15A 1PGYA 4R71A 3GLGA 2C5RA 4DR3M 1PJJA 5EP2A 2XZFA 2MGWA 4OVZB 1BVSA 3TWKA 1QZEA 3TL4X 3A46A 2CV0A 3HZJA 3L28A 1S3SA 4QHSA 1G41A 1WR1B 4DUYM 1L1TA 1IBKM 2JZ1A 3DOAA 1PRBA 3ZH9B 1OAIA 2KZSA 1HQCA 1XXHE 2JY6B 4L6V6 2C9CA 1GLNA 4MGZE 2JA2A 2MJ5B 2R62A 3U61A 4GHLA 3AFHA 1IXSA 4LF5M 2MROB 1QAOA 1OIPA 4M0DA 1SXJC 1IM2A 4P16A 4AG6A 3SAWA 4I8OA 1GJTA 2FFJA 4P17A 5EXSA 3U6EA 2QSFX 4AI6A 5ITXE 4PDIA 2X8AA 2DWMA 3U61B 3AOEA 3U6PA 3D8BA 4LF6M 4NSOB 3L27A 1L1ZA 3SAVA 2RRUA 2KDLA 3GRVA 3C9PA 2DNAA 5KQ8A 3DZDA 2CP8A 3H4JA 2CHGA 4LF7M 1DV0A 1K82A 1NHGC 3GLIE 1XWIA 2XH9A 4DR6M 3U6MA 4B7FA 3NWLA 4LZZA 4BBAA 4LF9M 5ITXA 4R7GA 4GH9A 5JI3E 2OOBA 4LJ6A 3KW6A 3GLFE 5LMUM 4QNMA 3LQQA 2I7PA 4IIWA 2Z3XA 1XHBA 1N33M 2DAGA 5E26A 2DZNB 1KSFX 4DR5M 5DNYA 3W0FA 4LFBM 3W68A 4IBDA 1IY2A 2D7HA 4B7HA 4M0WA 4TUWA 4AKGA 4KLNA 4FD2A 1NY6A 4AZFA 3FE3A 4PDGA 1QUSA 3IECA 3V76A 1N32M 3FRHA 3PNVA 3GO8A 1SXJA 2QHOB 1KFVA 4HLQA 2Y21A 4AW4A 1DO2A 4F2LA 1UM8A 4FVMA 4ITQA 2UXCM 4S12A 4CJ6A 4DR2M 5EXTA 4GEWA 3GPYA 1DGGA 3FYDA 1SG9A 1NHWC 3K92A 2LVAA 2MH8A 1Z5CA 4IBKA 4EIWA 1ZMVA 3I4YA 4LGYA 2VQEM 3GLIB 3NBXX 4DV7M 2Z8YM 2LHGA 3LQRA 4MGIE 5DYIA 2Z4RA 3SFZA 4X65M 3E46A 4WW0A 1XNQM 3E21A 5EP1A 3WHKA 3HGIA 2VDBB 2BWBA 1FNNA 4IJEA 4LFCM 2XF3A 1F4IA 2L4FA 1OJLA 2QZ4A 4MM3B 5KPRA 1N75A 1ZMUA 1NNUC 1Q3CA 1HQYE 3ZC7B 1TH4A 4GRIA 4QHTA 4OVZA 1YE9A 3GLGE 1L2DA 1J09A 5IREB 5KPTA 3M0EA 2KZUA 1IY0A 4IBIA 4JN6A 4IBEA 4NXMM 1T43A 3IG8A 2RGHA 3VDPA 2P5TA 2CV1A 1IFYA 3SMSA 3VKGA 1R6BX 2DAKA 1L8QA 3H4MA 4AG5A 1XMOM 4JI8M 1DGHA 1Q39A 2RKOA 2BJVA 2X49A 4GKJM 4L78A 4L16A 1GKIA 4LF4M 1E9SA 1J7KA 3HKPA 2M5ZA 3GRYA 1V33A 3LVWA 3UGJA 1PJTA 1TDHA 2K47A 2JY8A 3FRIA 3KDSE 3J27B 2KHHA 3B9PA 3SC3A 2C99A 2G3QA 2XLJA 2UUCM 4KODA 1NV8A 3M6AA 5FSWA 2C9OA 3IG5A 3HHZA 3T38A 3MJ5A 1IBMM 2LVPC 2YFQA 2VF7A 3MHVC 1G4AE 2KNAA 4F1IA 2ZAMA 4K0KM 3GLHA 2WSEF 4MGKE 4LFAM 2L4EA 2O25A 2OO9A 5FTNA 1OFIA 1HJPA 1JR3A 4QOZC 4G3OA 4LZJA 2QBYB 3UMMA 1R4GA 4QNRA 2HKJA 2UUAM 4JYAM 1D0MA 5FLXS 1MN3A 4CGYB 1XB2B 3HJ8A 4PCZA 2XSZA 4XGIA 2KNZA 4A3VB 1SXJB 3HWSA 4I4LA 1WJ7A 2WZJA 3T1HM 1VDLA 2R45A 2ZTCA 3A42A 2D7GA 2H1RA 3LCVB 3PFIA 3WHLA 4DUZM 1HNZM 3AV0A 3CF0A 2EUCA 1NO1A 2JY7A 1EE8A 5IWAM 4JI7M 1GJSA 3KP0E 4JI0M 3K9OA 2FE8A 2R44A 2KEBA 2J5YA 4ANRA 1VEJA 1R2ZA 1A5TA 4DV0M 3GLIA 3SYLA 4GITA 1NJFA 2HHHM 3K2LA 5C1BA 3JR4A 2F5PA 4D81A 1PM5A 4MGHA 5BR8M 2ZM6M 1QUTA 4R3DA 4GC9A 4DV6M 7CATA 3U6DA 1N34M 1OTRA 4LCBA 3B89A 3U6CA 3VKHA 2WSFF 1DO0A 3C3DA 1IXZA 2J7OA 4HL4A 2XFTA 5EJCA 1TDZA 4B3TM 4I81A 2CFOA 1QZMA 2YQZA 1E94E 1H6UA 1KYIA 1R5LA 4IBJA 4RF1A 4W5WA 5FTKA 4DV5M 5BPVA 4JI5M 3U5ZA 3FUXA 2CV2A 3GQ4A 3J7BA 1R2YA 3J7AS 2ZAOA 2X4AA 1L2CA 1W5TA 1PJSA 1WGLA 2LBCA 5L8RF 3PXGA 2XEPA 3KSJA 4KT0F 1OIZA 3SBJA 4D82A 1W5SA 2KRKA 3I04M 4DBGB 4AKIA 2ZANA 1QDRA 3KOXE 2LHCA 4XBOA 1NNJA 2HAKA 3TWLA 4DV3M 2QBYA 4B3RM 1HNXM 1NY5A 1TH3A 4B3MM 3B74A 2QCUA 2V1UA 4G4NA 1XXHA 2H5XA 4PD2A 2EKKA 1T3TA 2Y20A 4M9XA 1C7YA 3SARA 2Z4SA 3IHPA 2VQFM 4JI1M 1I94M 4G4RA 3FUTA 1JQJC 4LJ8A 3HHWA 5FTJA 2K0BX 3J81S 1AUAA 1D2NA 2D7EA 2KXEA 3U6OA 2L6OA 2F5NA 1WGNA 3FUWA
chains in the Genus database with same CATH topology
1T43A 1IFYA 4UN2B 1GO5A 2DAKA 1PGYA 4R71A 2JNHA 2JY5A 1NV9A 1VG5A 2MGWA 1BVSA 1ZMWA 1QZEA 2DKLA 4HEOA 3GLHE 1ZV1A 2DAEA 3K9PA 1G41A 1WR1B 2DAMA 2JY8A 3FRIA 1Y8GA 2KHHA 2JZ1A 2LVQD 2G3QA 1OAIA 3F92A 1VEGA 1XXHE 2JY6B 1TR8A 1NV8A 1VEKA 2DENA 2MJ5B 2LVPC 4Q7JA 4F1IA 1G4AE 2KNAA 1IXSA 2MROB 1IM2A 2L4EA 2O25A 2OO9A 2OOAA 1HJPA 4G3OA 2QSFX 2LTUA 2JP7A 2JUJA 2LVNC 1VQ1A 1R4GA 1MN3A 1XB2B 2RRUA 2DNAA 2KNZA 5JI2E 2CP8A 1OKSA 1V92A 1WJ7A 2WZJA 2DHYA 3H4JA 1VDLA 2ZTCA 1G3IA 2DI0A 3LCVB 1DV0A 3GLIE 1WHCA 2JY7A 3BBZA 2LVOC 1OQYA 3K9OA 2OOBA 3GLFE 3LCUA 2EKFA 1VEJA 2CWBA 1A5TA 2KNVA 1TTEA 2DAGA 1P3QQ 1UFZA 3MMPA 4WP2A 5DFLA 2BWEA 2B3TA 2R0IA 1OTRA 3B89A 1DO0A 3FE3A 3IECA 1HT2E 3FRHA 1E94E 1KYIA 1JR3E 2K9DA 2QHOB 4F2LA 1DO2A 1CUKA 4GEWA 3T6PA 1HT1E 1SG9A 1WGLA 2LBCA 2LVAA 1ZMVA 1EFUB 2MR9A 2ZTDA 4DBGB 2HAKA 2QNJA 2L2DA 3E46A 1Q02A 2DAIA 2DZLA 3E21A 2H5XA 2EKKA 2BWBA 1C7YA 1YLAA 1AIPC 2JZ0A 1F4IA 2L4FA 1ZMUA 3IHPA 1HQYE 2K0BX 3GLGE 2HWJA 1T6OA 1WGNA 1WIVA 2EJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T43 A;  1IFY A;  4UN2 B;  1GO5 A;  2DAK A;  1PGY A;  4R71 A;  2JNH A;  2JY5 A;  1NV9 A;  1VG5 A;  2MGW A;  1BVS A;  1ZMW A;  1QZE A;  2DKL A;  4HEO A;  3GLH E;  1ZV1 A;  2DAE A;  3K9P A;  1G41 A;  1WR1 B;  2DAM A;  2JY8 A;  3FRI A;  1Y8G A;  2KHH A;  2JZ1 A;  2LVQ D;  2G3Q A;  1OAI A;  3F92 A;  1VEG A;  1XXH E;  2JY6 B;  1TR8 A;  1NV8 A;  1VEK A;  2DEN A;  2MJ5 B;  2LVP C;  4Q7J A;  4F1I A;  1G4A E;  2KNA A;  1IXS A;  2MRO B;  1IM2 A;  2L4E A;  2O25 A;  2OO9 A;  2OOA A;  1HJP A;  4G3O A;  2QSF X;  2LTU A;  2JP7 A;  2JUJ A;  2LVN C;  1VQ1 A;  1R4G A;  1MN3 A;  1XB2 B;  2RRU A;  2DNA A;  2KNZ A;  5JI2 E;  2CP8 A;  1OKS A;  1V92 A;  1WJ7 A;  2WZJ A;  2DHY A;  3H4J A;  1VDL A;  2ZTC A;  1G3I A;  2DI0 A;  3LCV B;  1DV0 A;  3GLI E;  1WHC A;  2JY7 A;  3BBZ A;  2LVO C;  1OQY A;  3K9O A;  2OOB A;  3GLF E;  3LCU A;  2EKF A;  1VEJ A;  2CWB A;  1A5T A;  2KNV A;  1TTE A;  2DAG A;  1P3Q Q;  1UFZ A;  3MMP A;  4WP2 A;  5DFL A;  2BWE A;  2B3T A;  2R0I A;  1OTR A;  3B89 A;  1DO0 A;  3FE3 A;  3IEC A;  1HT2 E;  3FRH A;  1E94 E;  1KYI A;  1JR3 E;  2K9D A;  2QHO B;  4F2L A;  1DO2 A;  1CUK A;  4GEW A;  3T6P A;  1HT1 E;  1SG9 A;  1WGL A;  2LBC A;  2LVA A;  1ZMV A;  1EFU B;  2MR9 A;  2ZTD A;  4DBG B;  2HAK A;  2QNJ A;  2L2D A;  3E46 A;  1Q02 A;  2DAI A;  2DZL A;  3E21 A;  2H5X A;  2EKK A;  2BWB A;  1C7Y A;  1YLA A;  1AIP C;  2JZ0 A;  1F4I A;  2L4F A;  1ZMU A;  3IHP A;  1HQY E;  2K0B X;  3GLG E;  2HWJ A;  1T6O A;  1WGN A;  1WIV A;  2EJS A; 
#chains in the Genus database with same CATH topology
 4DR1 M;  5IZ7 D;  1GAB A;  1ZAE A;  1GO5 A;  3LW5 F;  3THG A;  1XNR M;  2JNH A;  2JY5 A;  3OTO M;  1NV9 A;  3HJQ A;  1VG5 A;  2E5L M;  1X37 A;  5GKN A;  4GC5 A;  5ITQ A;  1PJI A;  2DKL A;  4PT5 A;  2DVW B;  2F5O A;  2DAE A;  4D80 A;  1E32 A;  2UU9 M;  3F92 A;  1VEG A;  2ERC A;  1N78 A;  1JB0 F;  1QAM A;  3E4R A;  3HX3 A;  2DEN A;  4B7G A;  3QYE A;  4Q7J A;  4NSR A;  3PVS A;  3Q8G A;  2L7I A;  1J5E M;  4IBG A;  3TQS A;  4DV2 M;  3HU3 A;  4JI3 M;  1GL7 A;  2R4E A;  1D0K A;  3B7Z A;  2CEA A;  4X62 M;  2EA0 A;  1OAO C;  3CTW B;  4M9S A;  2XGN A;  3I51 A;  4FCT A;  4MB7 A;  2JP7 A;  2JUJ A;  1R7R A;  3W67 A;  1VQ1 A;  2W82 A;  3GPX A;  1IBL M;  4FCW A;  1XXH B;  4GIP A;  5ITU A;  2F4V M;  1MX0 A;  1N77 A;  2NQ8 C;  3FTD A;  4NC6 A;  2V6Z M;  3KOY E;  3GPP A;  2FNA A;  3FYC A;  2CUZ A;  1XMQ M;  2DI0 A;  3KS8 A;  3HU1 A;  3SYK A;  2HCB A;  1G71 A;  1ZQ9 A;  1IN4 A;  1WHC A;  3FTC A;  4G6Z A;  4AKH A;  4LJA A;  5ITT A;  3FTE A;  3BBZ A;  3FTF A;  3UK6 A;  5KPZ A;  3L2A A;  2EKF A;  2GQF A;  4M9Z A;  4CIZ A;  3EIH A;  4L4U A;  1P3Q Q;  5EXP A;  1FJG M;  1UFZ A;  3LMM A;  4WP2 A;  4JI6 M;  4FCV A;  3T15 A;  3SAU A;  4NRW A;  4KHP M;  2YNM D;  1D0L A;  1Z6T A;  1HNW M;  1IXR C;  3HY5 A;  3QAU A;  4DR4 M;  4DR7 M;  4G4Q A;  3KVW A;  2M60 A;  3TE6 A;  3U6S A;  2JWS A;  5IT9 S;  2C98 A;  4B3S M;  1MU5 A;  2K9D A;  3UJN A;  2V1C A;  3KP1 E;  4NRV A;  2CRU A;  4RKU F;  4CHT B;  2DWN A;  5DYG A;  4NOO B;  4MH0 E;  3UZU A;  2F5S A;  2DHR A;  2LH0 A;  1HT1 E;  2R6F A;  1Z5A A;  1ORY B;  3HHX A;  4FWH A;  2O01 F;  3KOZ E;  1QDT A;  2MR9 A;  2C96 A;  3T1Y M;  4GKK M;  4Z6Y A;  3QWL A;  2UXD M;  3KSX A;  1QQW A;  2XFS A;  3ZQJ A;  3JAM S;  2QQ8 A;  1N36 M;  5ITY A;  3GQ5 A;  4AQY M;  3HU2 A;  1NVM A;  2DAI A;  1QAQ A;  2QP9 X;  2R18 A;  3MK6 A;  1GVN A;  2LXE A;  1QVR A;  1L2B A;  2ZBK B;  4OX9 M;  3K1J A;  3TWM A;  1YLA A;  1AIP C;  2JZ0 A;  4RF0 A;  5ITR A;  2K6B A;  3DA1 A;  2R46 A;  4L8R C;  3RE8 A;  3AOE C;  8CAT A;  3TPZ A;  4JI4 M;  1PJQ A;  1LTM A;  4BLC A;  3A45 A;  2A5Y B;  2G8L A;  4LY6 A;  3VK8 A;  2CHV A;  1IN5 A;  2FH0 A;  4NL4 H;  4DV4 M;  2I7N A;  3KOW E;  3M7G A;  2HWJ A;  2Y0Q A;  4IBF A;  4FWG A;  1TF0 B;  4FWD A;  1NSF A;  4REZ A;  3GPU A;  1RU3 A;  4UN2 B;  3KFU G;  2OQ4 A;  4XK8 F;  2N35 A;  4CIS A;  4YHH M;  3NBI A;  3U6Q A;  1ZMW A;  3KS4 A;  4HEO A;  5EP3 A;  1IN8 A;  1Q3B A;  3GLH E;  1VDD A;  1ZV1 A;  1TGU A;  1QYR A;  3K9P A;  2DAM A;  2FS1 A;  3SAS A;  1Y8G A;  4JV5 M;  2WSC F;  2YR0 A;  3U5Z B;  2LVQ D;  3B7Q A;  3HJS A;  3GP1 A;  3AJI B;  2HL7 A;  5H37 D;  1TR8 A;  2J7N A;  3HHY A;  1VEK A;  2XZU A;  4I5S A;  1IQP A;  1QAN A;  5KQD A;  2APL A;  3L26 A;  3B7N A;  4G4O A;  2CHQ A;  2Q2E B;  5FTM A;  3GQ3 A;  1YUB A;  2KRU A;  5EP4 A;  2OOA A;  3VK7 A;  3ZCB B;  3FKE A;  3AKZ A;  1IN6 A;  2LTU A;  4RNA A;  4LRS A;  1SXJ D;  2LVN C;  4IBB A;  3GLG B;  2OPF A;  4LG2 A;  4X66 M;  5E6J A;  1WXQ A;  3GRU A;  3W0L B;  2GNO A;  1IXS B;  3CF6 E;  4JXJ A;  5FTL A;  2UXB M;  3CF2 A;  3SHG B;  5JI2 E;  3KXE C;  1OKS A;  1V92 A;  2DZO B;  2O5R A;  2DHY A;  4X64 M;  1G3I A;  3FUV A;  2CE7 A;  1GL6 A;  3R9X B;  1LV7 A;  2KA6 B;  3AOG A;  4GHA A;  2R65 A;  2XSZ D;  3QYB A;  3J2P B;  4JI2 M;  2LVO C;  1I4W A;  1IY1 A;  1OQY A;  1C1K A;  1E9R A;  5A2Q S;  3U6L A;  3LCU A;  2KW0 A;  2DXI A;  2DWZ B;  4LRT A;  5KO3 A;  4LGM A;  3C58 A;  2JXN A;  2KNV A;  1V34 A;  2CWB A;  1TTE A;  2G5G X;  2QEN A;  3FD9 A;  1MJG M;  3RFW A;  1K3X A;  4WUR A;  3L25 A;  3SAT A;  3MMP A;  5DFL A;  2BWE A;  4LF8 M;  4DV1 M;  2B3T A;  1G59 A;  3GLF A;  3E9S A;  3A98 B;  1DGH B;  2R0I A;  3C3E A;  4LJ9 A;  2BNK A;  3VLF B;  1OFH A;  1NJG A;  2VF8 A;  4FW9 A;  4BB9 A;  1HT2 E;  1JR3 E;  3ILK A;  4Y28 F;  3J80 S;  3JR5 A;  1DGB A;  4QOS A;  2R4J A;  4NXN M;  3K8Z A;  5EQT A;  1TH2 A;  3AL0 C;  1CUK A;  4LJ7 A;  5F3W A;  1HR0 M;  4LJ4 A;  3T6P A;  3VDU A;  3R8F A;  2AHM A;  3SMP A;  4B08 A;  3PNY A;  2QPA A;  1SXJ E;  4KO8 A;  2UUB M;  2L09 A;  3VFD A;  1EFU B;  1DGF A;  3I01 M;  4OW0 A;  2ZTD A;  1Z59 A;  1K3W A;  2F5Q A;  3GLH B;  3FUU A;  2QNJ A;  4IBC A;  2L2D A;  3U60 A;  3GLF B;  2RGO A;  1Q02 A;  2BJW A;  2DZL A;  4IJF A;  3GRR A;  2Y0T A;  3DFZ A;  4OU7 A;  3I4V A;  4LJ5 A;  1YSY A;  2FOI C;  3Q8X A;  3EIE A;  1XC8 A;  5LMN M;  2DWL A;  1IN7 A;  3D8L A;  1JR3 D;  4MGY E;  2Z7J A;  4YY3 M;  3LVV A;  4ZPX A;  3U60 B;  5EXX A;  4II7 A;  3SHF A;  2VII A;  2EO2 A;  1EIJ A;  3L29 A;  3RGP A;  2LWX A;  3CGW A;  3BOS A;  4GMQ A;  5C18 A;  1T6O A;  3RGS A;  4Z8X A;  2LNH C;  1WIV A;  1G8P A;  2EJS A;  3BXW A;  2L7H A;  1Z5B A;  4L15 A;  1PGY A;  4R71 A;  3GLG A;  2C5R A;  4DR3 M;  1PJJ A;  5EP2 A;  2XZF A;  2MGW A;  4OVZ B;  1BVS A;  3TWK A;  1QZE A;  3TL4 X;  3A46 A;  2CV0 A;  3HZJ A;  3L28 A;  1S3S A;  4QHS A;  1G41 A;  1WR1 B;  4DUY M;  1L1T A;  1IBK M;  2JZ1 A;  3DOA A;  1PRB A;  3ZH9 B;  1OAI A;  2KZS A;  1HQC A;  1XXH E;  2JY6 B;  4L6V 6;  2C9C A;  1GLN A;  4MGZ E;  2JA2 A;  2MJ5 B;  2R62 A;  3U61 A;  4GHL A;  3AFH A;  1IXS A;  4LF5 M;  2MRO B;  1QAO A;  1OIP A;  4M0D A;  1SXJ C;  1IM2 A;  4P16 A;  4AG6 A;  3SAW A;  4I8O A;  1GJT A;  2FFJ A;  4P17 A;  5EXS A;  3U6E A;  2QSF X;  4AI6 A;  5ITX E;  4PDI A;  2X8A A;  2DWM A;  3U61 B;  3AOE A;  3U6P A;  3D8B A;  4LF6 M;  4NSO B;  3L27 A;  1L1Z A;  3SAV A;  2RRU A;  2KDL A;  3GRV A;  3C9P A;  2DNA A;  5KQ8 A;  3DZD A;  2CP8 A;  3H4J A;  2CHG A;  4LF7 M;  1DV0 A;  1K82 A;  1NHG C;  3GLI E;  1XWI A;  2XH9 A;  4DR6 M;  3U6M A;  4B7F A;  3NWL A;  4LZZ A;  4BBA A;  4LF9 M;  5ITX A;  4R7G A;  4GH9 A;  5JI3 E;  2OOB A;  4LJ6 A;  3KW6 A;  3GLF E;  5LMU M;  4QNM A;  3LQQ A;  2I7P A;  4IIW A;  2Z3X A;  1XHB A;  1N33 M;  2DAG A;  5E26 A;  2DZN B;  1KSF X;  4DR5 M;  5DNY A;  3W0F A;  4LFB M;  3W68 A;  4IBD A;  1IY2 A;  2D7H A;  4B7H A;  4M0W A;  4TUW A;  4AKG A;  4KLN A;  4FD2 A;  1NY6 A;  4AZF A;  3FE3 A;  4PDG A;  1QUS A;  3IEC A;  3V76 A;  1N32 M;  3FRH A;  3PNV A;  3GO8 A;  1SXJ A;  2QHO B;  1KFV A;  4HLQ A;  2Y21 A;  4AW4 A;  1DO2 A;  4F2L A;  1UM8 A;  4FVM A;  4ITQ A;  2UXC M;  4S12 A;  4CJ6 A;  4DR2 M;  5EXT A;  4GEW A;  3GPY A;  1DGG A;  3FYD A;  1SG9 A;  1NHW C;  3K92 A;  2LVA A;  2MH8 A;  1Z5C A;  4IBK A;  4EIW A;  1ZMV A;  3I4Y A;  4LGY A;  2VQE M;  3GLI B;  3NBX X;  4DV7 M;  2Z8Y M;  2LHG A;  3LQR A;  4MGI E;  5DYI A;  2Z4R A;  3SFZ A;  4X65 M;  3E46 A;  4WW0 A;  1XNQ M;  3E21 A;  5EP1 A;  3WHK A;  3HGI A;  2VDB B;  2BWB A;  1FNN A;  4IJE A;  4LFC M;  2XF3 A;  1F4I A;  2L4F A;  1OJL A;  2QZ4 A;  4MM3 B;  5KPR A;  1N75 A;  1ZMU A;  1NNU C;  1Q3C A;  1HQY E;  3ZC7 B;  1TH4 A;  4GRI A;  4QHT A;  4OVZ A;  1YE9 A;  3GLG E;  1L2D A;  1J09 A;  5IRE B;  5KPT A;  3M0E A;  2KZU A;  1IY0 A;  4IBI A;  4JN6 A;  4IBE A;  4NXM M;  1T43 A;  3IG8 A;  2RGH A;  3VDP A;  2P5T A;  2CV1 A;  1IFY A;  3SMS A;  3VKG A;  1R6B X;  2DAK A;  1L8Q A;  3H4M A;  4AG5 A;  1XMO M;  4JI8 M;  1DGH A;  1Q39 A;  2RKO A;  2BJV A;  2X49 A;  4GKJ M;  4L78 A;  4L16 A;  1GKI A;  4LF4 M;  1E9S A;  1J7K A;  3HKP A;  2M5Z A;  3GRY A;  1V33 A;  3LVW A;  3UGJ A;  1PJT A;  1TDH A;  2K47 A;  2JY8 A;  3FRI A;  3KDS E;  3J27 B;  2KHH A;  3B9P A;  3SC3 A;  2C99 A;  2G3Q A;  2XLJ A;  2UUC M;  4KOD A;  1NV8 A;  3M6A A;  5FSW A;  2C9O A;  3IG5 A;  3HHZ A;  3T38 A;  3MJ5 A;  1IBM M;  2LVP C;  2YFQ A;  2VF7 A;  3MHV C;  1G4A E;  2KNA A;  4F1I A;  2ZAM A;  4K0K M;  3GLH A;  2WSE F;  4MGK E;  4LFA M;  2L4E A;  2O25 A;  2OO9 A;  5FTN A;  1OFI A;  1HJP A;  1JR3 A;  4QOZ C;  4G3O A;  4LZJ A;  2QBY B;  3UMM A;  1R4G A;  4QNR A;  2HKJ A;  2UUA M;  4JYA M;  1D0M A;  5FLX S;  1MN3 A;  4CGY B;  1XB2 B;  3HJ8 A;  4PCZ A;  2XSZ A;  4XGI A;  2KNZ A;  4A3V B;  1SXJ B;  3HWS A;  4I4L A;  1WJ7 A;  2WZJ A;  3T1H M;  1VDL A;  2R45 A;  2ZTC A;  3A42 A;  2D7G A;  2H1R A;  3LCV B;  3PFI A;  3WHL A;  4DUZ M;  1HNZ M;  3AV0 A;  3CF0 A;  2EUC A;  1NO1 A;  2JY7 A;  1EE8 A;  5IWA M;  4JI7 M;  1GJS A;  3KP0 E;  4JI0 M;  3K9O A;  2FE8 A;  2R44 A;  2KEB A;  2J5Y A;  4ANR A;  1VEJ A;  1R2Z A;  1A5T A;  4DV0 M;  3GLI A;  3SYL A;  4GIT A;  1NJF A;  2HHH M;  3K2L A;  5C1B A;  3JR4 A;  2F5P A;  4D81 A;  1PM5 A;  4MGH A;  5BR8 M;  2ZM6 M;  1QUT A;  4R3D A;  4GC9 A;  4DV6 M;  7CAT A;  3U6D A;  1N34 M;  1OTR A;  4LCB A;  3B89 A;  3U6C A;  3VKH A;  2WSF F;  1DO0 A;  3C3D A;  1IXZ A;  2J7O A;  4HL4 A;  2XFT A;  5EJC A;  1TDZ A;  4B3T M;  4I81 A;  2CFO A;  1QZM A;  2YQZ A;  1E94 E;  1H6U A;  1KYI A;  1R5L A;  4IBJ A;  4RF1 A;  4W5W A;  5FTK A;  4DV5 M;  5BPV A;  4JI5 M;  3U5Z A;  3FUX A;  2CV2 A;  3GQ4 A;  3J7B A;  1R2Y A;  3J7A S;  2ZAO A;  2X4A A;  1L2C A;  1W5T A;  1PJS A;  1WGL A;  2LBC A;  5L8R F;  3PXG A;  2XEP A;  3KSJ A;  4KT0 F;  1OIZ A;  3SBJ A;  4D82 A;  1W5S A;  2KRK A;  3I04 M;  4DBG B;  4AKI A;  2ZAN A;  1QDR A;  3KOX E;  2LHC A;  4XBO A;  1NNJ A;  2HAK A;  3TWL A;  4DV3 M;  2QBY A;  4B3R M;  1HNX M;  1NY5 A;  1TH3 A;  4B3M M;  3B74 A;  2QCU A;  2V1U A;  4G4N A;  1XXH A;  2H5X A;  4PD2 A;  2EKK A;  1T3T A;  2Y20 A;  4M9X A;  1C7Y A;  3SAR A;  2Z4S A;  3IHP A;  2VQF M;  4JI1 M;  1I94 M;  4G4R A;  3FUT A;  1JQJ C;  4LJ8 A;  3HHW A;  5FTJ A;  2K0B X;  3J81 S;  1AUA A;  1D2N A;  2D7E A;  2KXE A;  3U6O A;  2L6O A;  2F5N A;  1WGN A;  3FUW A; 
#chains in the Genus database with same CATH homology
 1T43 A;  1IFY A;  4UN2 B;  1GO5 A;  2DAK A;  1PGY A;  4R71 A;  2JNH A;  2JY5 A;  1NV9 A;  1VG5 A;  2MGW A;  1BVS A;  1ZMW A;  1QZE A;  2DKL A;  4HEO A;  3GLH E;  1ZV1 A;  2DAE A;  3K9P A;  1G41 A;  1WR1 B;  2DAM A;  2JY8 A;  3FRI A;  1Y8G A;  2KHH A;  2JZ1 A;  2LVQ D;  2G3Q A;  1OAI A;  3F92 A;  1VEG A;  1XXH E;  2JY6 B;  1TR8 A;  1NV8 A;  1VEK A;  2DEN A;  2MJ5 B;  2LVP C;  4Q7J A;  4F1I A;  1G4A E;  2KNA A;  1IXS A;  2MRO B;  1IM2 A;  2L4E A;  2O25 A;  2OO9 A;  2OOA A;  1HJP A;  4G3O A;  2QSF X;  2LTU A;  2JP7 A;  2JUJ A;  2LVN C;  1VQ1 A;  1R4G A;  1MN3 A;  1XB2 B;  2RRU A;  2DNA A;  2KNZ A;  5JI2 E;  2CP8 A;  1OKS A;  1V92 A;  1WJ7 A;  2WZJ A;  2DHY A;  3H4J A;  1VDL A;  2ZTC A;  1G3I A;  2DI0 A;  3LCV B;  1DV0 A;  3GLI E;  1WHC A;  2JY7 A;  3BBZ A;  2LVO C;  1OQY A;  3K9O A;  2OOB A;  3GLF E;  3LCU A;  2EKF A;  1VEJ A;  2CWB A;  1A5T A;  2KNV A;  1TTE A;  2DAG A;  1P3Q Q;  1UFZ A;  3MMP A;  4WP2 A;  5DFL A;  2BWE A;  2B3T A;  2R0I A;  1OTR A;  3B89 A;  1DO0 A;  3FE3 A;  3IEC A;  1HT2 E;  3FRH A;  1E94 E;  1KYI A;  1JR3 E;  2K9D A;  2QHO B;  4F2L A;  1DO2 A;  1CUK A;  4GEW A;  3T6P A;  1HT1 E;  1SG9 A;  1WGL A;  2LBC A;  2LVA A;  1ZMV A;  1EFU B;  2MR9 A;  2ZTD A;  4DBG B;  2HAK A;  2QNJ A;  2L2D A;  3E46 A;  1Q02 A;  2DAI A;  2DZL A;  3E21 A;  2H5X A;  2EKK A;  2BWB A;  1C7Y A;  1YLA A;  1AIP C;  2JZ0 A;  1F4I A;  2L4F A;  1ZMU A;  3IHP A;  1HQY E;  2K0B X;  3GLG E;  2HWJ A;  1T6O A;  1WGN A;  1WIV A;  2EJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...