1T6OA

Nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the attachment of a paramyxoviral polymerase to its template.
pubmed doi rcsb
source organism Measles virus
molecule tags Viral protein
molecule keywords phosphoprotein
total genus 15
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1t6oA00
1HJPA 2KNAA 1XB2B 2H5XA 2MJ5B 2RRUA 3T6PA 2DAKA 2MGWA 2DZLA 2KNZA 1UFZA 2LBCA 5DFLA 3MMPA 4GEWA 1Y8GA 2JP7A 1WJ7A 2EKKA 1EFUB 1TTEA 1VDLA 2DAGA 2K0BX 1VEKA 1A5TA 2KNVA 3GLHE 4F2LA 1AIPC 1KYIA 2JY6B 1G3IA 2HWJA 1WR1B 2CWBA 1MN3A 2DI0A 2B3TA 3GLFE 4F1IA 1OAIA 2O25A 1VEJA 2BWEA 2LVAA 2LVOC 1VQ1A 2OOBA 2L2DA 2DNAA 3IECA 1IFYA 2G3QA 1DV0A 1Q02A 1VEGA 1GO5A 2EKFA 1PGYA 1VG5A 2JZ0A 4WP2A 2MR9A 2DAIA 2LVNC 4UN2B 2OOAA 2LTUA 2QSFX 5JI2E 1WGNA 4Q7JA 1IM2A 2BWBA 3K9OA 1OTRA 3FRHA 2HAKA 1G41A 2ZTDA 1HT2E 1T6OA 2WZJA 1ZMUA 1C7YA 1R4GA 1IXSA 3GLIE 1CUKA 2LVQD 1XXHE 1DO2A 1ZMWA 3FRIA 1TR8A 2L4EA 3LCUA 1P3QQ 2OO9A 4R71A 2R0IA 1DO0A 2KHHA 2DHYA 3K9PA 1HT1E 2CP8A 2JZ1A 3LCVB 1V92A 1ZV1A 2LVPC 1ZMVA 3GLGE 1JR3E 3F92A 2JY8A 2DAMA 1OQYA 1SG9A 2QHOB 2QNJA 1F4IA 2DENA 1T43A 3BBZA 1NV9A 1YLAA 2EJSA 2JUJA 2MROB 3IHPA 1NV8A 2JNHA 1WIVA 2JY5A 2DAEA 1OKSA 1WHCA 1WGLA 2JY7A 3E46A 4HEOA 1G4AE 3B89A 1BVSA 2L4FA 1E94E 3E21A 1QZEA 2K9DA 1HQYE 4DBGB 2ZTCA 3FE3A 2DKLA 4G3OA 3H4JA
chains in the Genus database with same CATH superfamily
3I4VA 4I81A 2ZAMA 3GRRA 1R5LA 5E26A 4AKHA 1GKIA 2HCBA 2RRUA 3KOWE 3T6PA 3PNVA 3SC3A 5KPRA 2V1CA 2YQZA 2DAKA 4P16A 3AL0C 3L25A 4LZZA 2DXIA 3HJSA 3B9PA 4QNMA 2CEAA 3MMPA 3U5ZA 1V34A 1Y8GA 3J80S 1G8PA 1WJ7A 3NBXX 1XMOM 4NL4H 3PNYA 1D0KA 5FTJA 1ORYB 4G4QA 4QNRA 4AG6A 2XH9A 1VEKA 4L15A 3PVSA 4A3VB 3T15A 4L6V6 4FWDA 1Q3CA 3K92A 2JY6B 1NNUC 2HWJA 3GRUA 1WR1B 2N35A 2Z4RA 1TH2A 4HLQA 4I4LA 3R8FA 1N36M 2EA0A 3FTEA 4AZFA 5EP3A 4MM3B 2R62A 1TH4A 1FNNA 3UGJA 1IBMM 2P5TA 3GLFE 4ZPXA 3TWKA 3VLFB 1E32A 2VIIA 4IIWA 4IJFA 4GKJM 2LVAA 2UUBM 3K8ZA 3AFHA 4B3TM 4B3MM 2CHQA 8CATA 3U6SA 2FFJA 2DNAA 2L2DA 4XBOA 2G3QA 1KFVA 2ZANA 1Q02A 3L29A 1GO5A 3J7AS 3A42A 1Z5BA 1YE9A 1SXJC 1SXJA 3HY5A 3VK8A 1MJGM 2BNKA 2JZ0A 5EP2A 5DYGA 3JR5A 4LRTA 2XZUA 3I51A 2DAIA 2LVNC 3FUVA 3AKZA 2LTUA 1NY5A 3C58A 1E9SA 1SXJE 3GPYA 4AQYM 3T1YM 3VK7A 2LH0A 1OTRA 1XWIA 4IBIA 4JN6A 4GHAA 1N78A 4DR2M 2F5SA 2F4VM 3CF6E 2ZTDA 4FWHA 1HT2E 4LFAM 4DR4M 4GHLA 4LZJA 4LFBM 1T6OA 2LHGA 4CGYB 4WURA 1C7YA 1IXSA 4LF8M 4AG5A 1DO2A 4KT0F 1QANA 4LRSA 2L7IA 4DV7M 5BPVA 1C1KA 1ZMWA 3TWMA 3SYKA 2CE7A 4GMQA 3FYDA 3MHVC 4NXNM 1Z59A 1P3QQ 2DWZB 3D8LA 3LCUA 1R2YA 2DHRA 2OO9A 4LJ8A 4L4UA 2DHYA 1HT1E 3ZQJA 4IBDA 4NRVA 4DV6M 3KFUG 4DUZM 1IY2A 4RKUF 1TH3A 4LJ9A 1EE8A 1V92A 4B3RM 3BXWA 3RE8A 3CF2A 3KP1E 1PJIA 3R9XB 1XHBA 3TPZA 3AJIB 2YNMD 3AOEC 1ZV1A 2WSEF 2C5RA 4G4RA 3L27A 3DFZA 2DAMA 3GLIB 2C9OA 1XMQM 4JI1M 2VF8A 4K0KM 5ITQA 4M9SA 2VDBB 2DENA 3BBZA 4IBJA 1NV9A 2KXEA 3U60B 2VQFM 4DR5M 2JUJA 3CTWB 4OVZB 3IHPA 1IN5A 4LF4M 2JNHA 3GP1A 3GO8A 3U6QA 2DAEA 2RKOA 3CF0A 3KOYE 3HJ8A 3J27B 1NNJA 4FW9A 3E4RA 4IBEA 3SATA 1T3TA 2K9DA 3C3DA 3LVWA 3FE3A 2XGNA 4FD2A 4FWGA 4G3OA 4QOSA 3SMPA 4PCZA 1N34M 2FH0A 4REZA 3LQRA 4G4OA 4QHSA 4EIWA 3VDUA 2E5LM 5EP4A 3KOXE 3FTFA 2X8AA 4ANRA 4JI3M 3M6AA 4DR1M 4GH9A 5C18A 1QYRA 3U6EA 4AKGA 2LBCA 1NJFA 4Y28F 5IT9S 3AOEA 3AOGA 1G59A 2L09A 3SASA 4JYAM 1NHGC 2FNAA 1YUBA 2OPFA 4X62M 3U61A 1G71A 1VDLA 2ZBKB 1GJTA 4IBFA 4MGKE 3QYEA 3U6DA 1XNQM 2J7NA 5ITUA 1A5TA 2KNVA 3T38A 1JR3D 3GLHE 4F2LA 1AIPC 2J5YA 4LF7M 4FVMA 2CWBA 1OAOC 1YSYA 2BJWA 2M60A 3K1JA 5L8RF 2UXCM 2Z3XA 3HHXA 1Z5AA 2R4JA 4BBAA 4F1IA 3U6MA 1K82A 1OAIA 1HQCA 2O25A 1QAQA 3KVWA 1VEJA 3L28A 4MH0E 3V76A 1OJLA 1NVMA 2BWEA 4OX9M 1QQWA 2R4EA 3SARA 4II7A 5IWAM 1IBKM 2XLJA 3J81S 3OTOM 1TDHA 3IECA 2D7EA 4JI8M 1PJSA 2W82A 2YR0A 2F5OA 1QDTA 4LF9M 3MJ5A 3GQ4A 1E9RA 2UUCM 2CFOA 1Q3BA 2R45A 5JI3E 4IBBA 5KPZA 1QAMA 5EXXA 3K2LA 4GKKM 4UN2B 3UMMA 2OOAA 2GQFA 3Q8GA 3SFZA 1IBLM 4B7GA 4Q7JA 1IM2A 2QCUA 2C9CA 1GVNA 2BWBA 4MGZE 5LMNM 3U6CA 1D2NA 3U61B 2HHHM 5IZ7D 1KSFX 1L1TA 3D8BA 2Z8YM 1D0LA 7CATA 2WZJA 2Z4SA 1QAOA 1CUKA 1IY1A 2GNOA 2APLA 3KSJA 4OW0A 3VDPA 4JI6M 2X49A 2NQ8C 2DVWB 3FD9A 1J09A 2F5PA 1Q39A 4KLNA 4W5WA 4QOZC 2O01F 2L4EA 5EJCA 3QYBA 3HZJA 2UUAM 3GPXA 1NY6A 4R71A 3RFWA 5ITXA 5C1BA 1QZMA 1R6BX 1DO0A 2X4AA 2XFSA 3C3EA 1JR3A 3K9PA 3NWLA 4GITA 4JXJA 2K6BA 4JI0M 2Y21A 4FCTA 1TDZA 2LNHC 1LTMA 1JB0F 4LGMA 4GC9A 3VFDA 5ITXE 3GQ3A 4IBKA 5KQDA 4JI2M 2XZFA 2V1UA 4TUWA 2LVPC 3HU2A 4NSOB 5FTLA 3F92A 4OVZA 2QHOB 3HHZA 3U60A 5A2QS 1XC8A 3HWSA 5E6JA 2Q2EB 1YLAA 1EIJA 3L26A 2ZM6M 4R7GA 3GLIA 3HJQA 2JY5A 2EO2A 1OKSA 3HX3A 1WHCA 1WGLA 5FSWA 1L2DA 3E46A 1PM5A 4HEOA 3HHYA 1G4AE 2QP9X 2L4FA 3FTCA 1QZEA 5GKNA 1HQYE 3RGPA 4PDIA 1WIVA 4NXMM 4CJ6A 4JV5M 1HJPA 3HKPA 2H5XA 4IJEA 4MB7A 3FUUA 3HGIA 2AHMA 3FTDA 4LY6A 1L8QA 4LFCM 4B7FA 1PRBA 3Q8XA 4BLCA 3U6PA 1N33M 4P17A 2DZLA 2KNZA 1UFZA 4RNAA 4Z8XA 5DFLA 1IXSB 3SAWA 4LJ4A 1L2CA 2CHGA 2EUCA 1V33A 2HKJA 3ZC7B 2I7PA 3W0LB 2QENA 1EFUB 4NRWA 4AI6A 4DV1M 1GL7A 2ERCA 4LJ5A 2K0BX 1AUAA 1IN7A 2VF7A 4M0DA 3M7GA 3W68A 1R2ZA 1OIZA 4DV4M 3QAUA 2XF3A 3FUWA 3U6LA 1XNRM 1G3IA 1MX0A 3LW5F 1J5EM 2BJVA 1MN3A 1SXJB 2XSZA 2DI0A 1L1ZA 1FJGM 3MK6A 4X66M 2B3TA 4DR3M 4KODA 3SAUA 1W5SA 3GPUA 4D82A 2RGHA 2CV1A 4XGIA 5DNYA 3KXEC 2QZ4A 1DGGA 3M0EA 1GL6A 2LVOC 3AV0A 2J7OA 3BOSA 4ITQA 3W0FA 2JWSA 1IFYA 1DV0A 2WSFF 1W5TA 3JR4A 2FE8A 2EKFA 3SBJA 3SAVA 2DZOB 1VG5A 4WP2A 4MGHA 3DA1A 4X64M 4DV0M 4IBGA 2MH8A 3THGA 2CHVA 2R6FA 1QDRA 3UJNA 2R44A 5JI2E 3CGWA 3EIEA 5KPTA 1QUTA 3T1HM 3K9OA 5ITYA 3FRHA 2Y0QA 2HAKA 1G41A 1DGBA 3WHLA 3A45A 3J7BA 2LXEA 1L2BA 1IN8A 1ZMUA 3U5ZB 3LMMA 2M5ZA 2CUZA 5EQTA 3KS8A 4JI5M 4JI7M 4LJ7A 1NO1A 4KHPM 3HU3A 3TL4X 4WW0A 2CV0A 2R0IA 2KRKA 4LG2A 2KHHA 3VKGA 2CRUA 3PFIA 1DGHA 2DWLA 4GRIA 1N77A 5FTNA 2KZUA 3DOAA 3I04M 3L2AA 2K47A 2JA2A 2JZ1A 3B7QA 1RU3A 2C96A 4LJAA 4NC6A 5H37D 3SHFA 4RF1A 1HR0M 4DV5M 3IG5A 4BB9A 1SG9A 2QNJA 3EIHA 3J2PB 3TQSA 5KQ8A 2DWMA 2D7GA 4DR7M 4AKIA 3TE6A 1T43A 2FS1A 1OFHA 2EJSA 2MROB 2KEBA 3GPPA 2YFQA 1IQPA 3LQQA 1NHWC 1OIPA 2Y0TA 5F3WA 2JY7A 4CISA 5ITTA 2QBYA 4IBCA 3B89A 4PD2A 2R18A 3HHWA 4QHTA 3KSXA 5FLXS 2DKLA 5EXPA 1HNWM 3B74A 3LVVA 2H1RA 1J7KA 4I8OA 2G8LA 4R3DA 2KNAA 5LMUM 1XB2B 2C99A 2MJ5B 3I01M 1PJJA 3SHGB 1TGUA 4JI4M 1TF0B 3VKHA 4MGIE 3PXGA 3FKEA 2MGWA 4LF6M 2L6OA 3C9PA 1GABA 1H6UA 4GIPA 5FTKA 4GEWA 4D81A 3FUTA 2JP7A 3B7ZA 2EKKA 4LGYA 2C98A 5FTMA 4Z6YA 2FOIC 4G6ZA 3GLGA 1GJSA 2RGOA 3GLFA 1TTEA 2DAGA 1IN4A 4DUYM 1LV7A 3SMSA 3KW6A 2OQ4A 1DGFA 4B7HA 3KDSE 2R65A 3QWLA 1KYIA 3A46A 1PJQA 1I4WA 5EXTA 4FCVA 2ZAOA 4PDGA 1NJGA 1IXZA 2Z7JA 3GQ5A 3W67A 2O5RA 2R46A 2QPAA 1N32M 2UXDM 4LCBA 3GLHA 1XXHA 4NSRA 5DYIA 5EXSA 3HU1A 1HNXM 1NSFA 1VQ1A 4YY3M 2OOBA 4MGYE 1XXHB 4RF0A 2XFTA 3GLHB 3NBIA 2UU9M 4L8RC 4DV2M 3GRYA 1K3XA 4YHHM 1VEGA 4CIZA 1QVRA 4CHTB 3TWLA 1PGYA 2JXNA 3SYLA 3ILKA 3KOZE 1D0MA 2G5GX 3UK6A 1ZQ9A 2MR9A 4PT5A 2LHCA 4D80A 3JAMS 1PJTA 3UZUA 3U6OA 1MU5A 2QSFX 5IREB 1HNZM 1WXQA 4LF5M 4S12A 1WGNA 2F5NA 2I7NA 3RGSA 3GLFB 3DZDA 1VDDA 3GLGB 2KZSA 4AW4A 4G4NA 1UM8A 2DWNA 2DZNB 1N75A 3H4JA 1R4GA 3H4MA 3GLIE 2LVQD 1XXHE 2UXBM 2Y20A 3ZCBB 2KA6B 2XEPA 4LJ6A 3FRIA 4L16A 1TR8A 1SXJD 4M9ZA 2CV2A 2XSZD 4M0WA 1QUSA 1JQJC 2A5YB 1IN6A 2WSCF 3WHKA 2HL7A 2CP8A 3LCVB 1IXRC 2QBYB 3FUXA 3GRVA 1X37A 4B3SM 4L78A 4DV3M 3I4YA 1IY0A 1ZMVA 2LWXA 1JR3E 4I5SA 2JY8A 3GLGE 4DR6M 1OQYA 3KP0E 4NOOB 1F4IA 2KDLA 4HL4A 3FYCA 1ZAEA 2L7HA 3IG8A 1I94M 3E9SA 1S3SA 1Z5CA 1NV8A 2D7HA 5ITRA 1Z6TA 4GC5A 2F5QA 4XK8F 1OFIA 2QQ8A 2ZTCA 4B08A 5KO3A 2KRUA 1GLNA 5EP1A 1BVSA 3A98B 1E94E 3E21A 2VQEM 4KO8A 4X65M 5BR8M 2V6ZM 4OU7A 1K3WA 1DGHB 3ZH9B 4M9XA 3KS4A 4DBGB 2KW0A 3B7NA 4FCWA 1R7RA
chains in the Genus database with same CATH topology
1HJPA 2KNAA 1XB2B 2H5XA 2MJ5B 2RRUA 3T6PA 2DAKA 2MGWA 2DZLA 2KNZA 1UFZA 2LBCA 5DFLA 3MMPA 4GEWA 1Y8GA 2JP7A 1WJ7A 2EKKA 1EFUB 1TTEA 1VDLA 2DAGA 2K0BX 1VEKA 1A5TA 2KNVA 3GLHE 4F2LA 1AIPC 1KYIA 2JY6B 1G3IA 2HWJA 1WR1B 2CWBA 1MN3A 2DI0A 2B3TA 3GLFE 4F1IA 1OAIA 2O25A 1VEJA 2BWEA 2LVAA 2LVOC 1VQ1A 2OOBA 2L2DA 2DNAA 3IECA 1IFYA 2G3QA 1DV0A 1Q02A 1VEGA 1GO5A 2EKFA 1PGYA 1VG5A 2JZ0A 4WP2A 2MR9A 2DAIA 2LVNC 4UN2B 2OOAA 2LTUA 2QSFX 5JI2E 1WGNA 4Q7JA 1IM2A 2BWBA 3K9OA 1OTRA 3FRHA 2HAKA 1G41A 2ZTDA 1HT2E 1T6OA 2WZJA 1ZMUA 1C7YA 1R4GA 1IXSA 3GLIE 1CUKA 2LVQD 1XXHE 1DO2A 1ZMWA 3FRIA 1TR8A 2L4EA 3LCUA 1P3QQ 2OO9A 4R71A 2R0IA 1DO0A 2KHHA 2DHYA 3K9PA 1HT1E 2CP8A 2JZ1A 3LCVB 1V92A 1ZV1A 2LVPC 1ZMVA 3GLGE 1JR3E 3F92A 2JY8A 2DAMA 1OQYA 1SG9A 2QHOB 2QNJA 1F4IA 2DENA 1T43A 3BBZA 1NV9A 1YLAA 2EJSA 2JUJA 2MROB 3IHPA 1NV8A 2JNHA 1WIVA 2JY5A 2DAEA 1OKSA 1WHCA 1WGLA 2JY7A 3E46A 4HEOA 1G4AE 3B89A 1BVSA 2L4FA 1E94E 3E21A 1QZEA 2K9DA 1HQYE 4DBGB 2ZTCA 3FE3A 2DKLA 4G3OA 3H4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJP A;  2KNA A;  1XB2 B;  2H5X A;  2MJ5 B;  2RRU A;  3T6P A;  2DAK A;  2MGW A;  2DZL A;  2KNZ A;  1UFZ A;  2LBC A;  5DFL A;  3MMP A;  4GEW A;  1Y8G A;  2JP7 A;  1WJ7 A;  2EKK A;  1EFU B;  1TTE A;  1VDL A;  2DAG A;  2K0B X;  1VEK A;  1A5T A;  2KNV A;  3GLH E;  4F2L A;  1AIP C;  1KYI A;  2JY6 B;  1G3I A;  2HWJ A;  1WR1 B;  2CWB A;  1MN3 A;  2DI0 A;  2B3T A;  3GLF E;  4F1I A;  1OAI A;  2O25 A;  1VEJ A;  2BWE A;  2LVA A;  2LVO C;  1VQ1 A;  2OOB A;  2L2D A;  2DNA A;  3IEC A;  1IFY A;  2G3Q A;  1DV0 A;  1Q02 A;  1VEG A;  1GO5 A;  2EKF A;  1PGY A;  1VG5 A;  2JZ0 A;  4WP2 A;  2MR9 A;  2DAI A;  2LVN C;  4UN2 B;  2OOA A;  2LTU A;  2QSF X;  5JI2 E;  1WGN A;  4Q7J A;  1IM2 A;  2BWB A;  3K9O A;  1OTR A;  3FRH A;  2HAK A;  1G41 A;  2ZTD A;  1HT2 E;  1T6O A;  2WZJ A;  1ZMU A;  1C7Y A;  1R4G A;  1IXS A;  3GLI E;  1CUK A;  2LVQ D;  1XXH E;  1DO2 A;  1ZMW A;  3FRI A;  1TR8 A;  2L4E A;  3LCU A;  1P3Q Q;  2OO9 A;  4R71 A;  2R0I A;  1DO0 A;  2KHH A;  2DHY A;  3K9P A;  1HT1 E;  2CP8 A;  2JZ1 A;  3LCV B;  1V92 A;  1ZV1 A;  2LVP C;  1ZMV A;  3GLG E;  1JR3 E;  3F92 A;  2JY8 A;  2DAM A;  1OQY A;  1SG9 A;  2QHO B;  2QNJ A;  1F4I A;  2DEN A;  1T43 A;  3BBZ A;  1NV9 A;  1YLA A;  2EJS A;  2JUJ A;  2MRO B;  3IHP A;  1NV8 A;  2JNH A;  1WIV A;  2JY5 A;  2DAE A;  1OKS A;  1WHC A;  1WGL A;  2JY7 A;  3E46 A;  4HEO A;  1G4A E;  3B89 A;  1BVS A;  2L4F A;  1E94 E;  3E21 A;  1QZE A;  2K9D A;  1HQY E;  4DBG B;  2ZTC A;  3FE3 A;  2DKL A;  4G3O A;  3H4J A; 
#chains in the Genus database with same CATH topology
 3I4V A;  4I81 A;  2ZAM A;  3GRR A;  1R5L A;  5E26 A;  4AKH A;  1GKI A;  2HCB A;  2RRU A;  3KOW E;  3T6P A;  3PNV A;  3SC3 A;  5KPR A;  2V1C A;  2YQZ A;  2DAK A;  4P16 A;  3AL0 C;  3L25 A;  4LZZ A;  2DXI A;  3HJS A;  3B9P A;  4QNM A;  2CEA A;  3MMP A;  3U5Z A;  1V34 A;  1Y8G A;  3J80 S;  1G8P A;  1WJ7 A;  3NBX X;  1XMO M;  4NL4 H;  3PNY A;  1D0K A;  5FTJ A;  1ORY B;  4G4Q A;  4QNR A;  4AG6 A;  2XH9 A;  1VEK A;  4L15 A;  3PVS A;  4A3V B;  3T15 A;  4L6V 6;  4FWD A;  1Q3C A;  3K92 A;  2JY6 B;  1NNU C;  2HWJ A;  3GRU A;  1WR1 B;  2N35 A;  2Z4R A;  1TH2 A;  4HLQ A;  4I4L A;  3R8F A;  1N36 M;  2EA0 A;  3FTE A;  4AZF A;  5EP3 A;  4MM3 B;  2R62 A;  1TH4 A;  1FNN A;  3UGJ A;  1IBM M;  2P5T A;  3GLF E;  4ZPX A;  3TWK A;  3VLF B;  1E32 A;  2VII A;  4IIW A;  4IJF A;  4GKJ M;  2LVA A;  2UUB M;  3K8Z A;  3AFH A;  4B3T M;  4B3M M;  2CHQ A;  8CAT A;  3U6S A;  2FFJ A;  2DNA A;  2L2D A;  4XBO A;  2G3Q A;  1KFV A;  2ZAN A;  1Q02 A;  3L29 A;  1GO5 A;  3J7A S;  3A42 A;  1Z5B A;  1YE9 A;  1SXJ C;  1SXJ A;  3HY5 A;  3VK8 A;  1MJG M;  2BNK A;  2JZ0 A;  5EP2 A;  5DYG A;  3JR5 A;  4LRT A;  2XZU A;  3I51 A;  2DAI A;  2LVN C;  3FUV A;  3AKZ A;  2LTU A;  1NY5 A;  3C58 A;  1E9S A;  1SXJ E;  3GPY A;  4AQY M;  3T1Y M;  3VK7 A;  2LH0 A;  1OTR A;  1XWI A;  4IBI A;  4JN6 A;  4GHA A;  1N78 A;  4DR2 M;  2F5S A;  2F4V M;  3CF6 E;  2ZTD A;  4FWH A;  1HT2 E;  4LFA M;  4DR4 M;  4GHL A;  4LZJ A;  4LFB M;  1T6O A;  2LHG A;  4CGY B;  4WUR A;  1C7Y A;  1IXS A;  4LF8 M;  4AG5 A;  1DO2 A;  4KT0 F;  1QAN A;  4LRS A;  2L7I A;  4DV7 M;  5BPV A;  1C1K A;  1ZMW A;  3TWM A;  3SYK A;  2CE7 A;  4GMQ A;  3FYD A;  3MHV C;  4NXN M;  1Z59 A;  1P3Q Q;  2DWZ B;  3D8L A;  3LCU A;  1R2Y A;  2DHR A;  2OO9 A;  4LJ8 A;  4L4U A;  2DHY A;  1HT1 E;  3ZQJ A;  4IBD A;  4NRV A;  4DV6 M;  3KFU G;  4DUZ M;  1IY2 A;  4RKU F;  1TH3 A;  4LJ9 A;  1EE8 A;  1V92 A;  4B3R M;  3BXW A;  3RE8 A;  3CF2 A;  3KP1 E;  1PJI A;  3R9X B;  1XHB A;  3TPZ A;  3AJI B;  2YNM D;  3AOE C;  1ZV1 A;  2WSE F;  2C5R A;  4G4R A;  3L27 A;  3DFZ A;  2DAM A;  3GLI B;  2C9O A;  1XMQ M;  4JI1 M;  2VF8 A;  4K0K M;  5ITQ A;  4M9S A;  2VDB B;  2DEN A;  3BBZ A;  4IBJ A;  1NV9 A;  2KXE A;  3U60 B;  2VQF M;  4DR5 M;  2JUJ A;  3CTW B;  4OVZ B;  3IHP A;  1IN5 A;  4LF4 M;  2JNH A;  3GP1 A;  3GO8 A;  3U6Q A;  2DAE A;  2RKO A;  3CF0 A;  3KOY E;  3HJ8 A;  3J27 B;  1NNJ A;  4FW9 A;  3E4R A;  4IBE A;  3SAT A;  1T3T A;  2K9D A;  3C3D A;  3LVW A;  3FE3 A;  2XGN A;  4FD2 A;  4FWG A;  4G3O A;  4QOS A;  3SMP A;  4PCZ A;  1N34 M;  2FH0 A;  4REZ A;  3LQR A;  4G4O A;  4QHS A;  4EIW A;  3VDU A;  2E5L M;  5EP4 A;  3KOX E;  3FTF A;  2X8A A;  4ANR A;  4JI3 M;  3M6A A;  4DR1 M;  4GH9 A;  5C18 A;  1QYR A;  3U6E A;  4AKG A;  2LBC A;  1NJF A;  4Y28 F;  5IT9 S;  3AOE A;  3AOG A;  1G59 A;  2L09 A;  3SAS A;  4JYA M;  1NHG C;  2FNA A;  1YUB A;  2OPF A;  4X62 M;  3U61 A;  1G71 A;  1VDL A;  2ZBK B;  1GJT A;  4IBF A;  4MGK E;  3QYE A;  3U6D A;  1XNQ M;  2J7N A;  5ITU A;  1A5T A;  2KNV A;  3T38 A;  1JR3 D;  3GLH E;  4F2L A;  1AIP C;  2J5Y A;  4LF7 M;  4FVM A;  2CWB A;  1OAO C;  1YSY A;  2BJW A;  2M60 A;  3K1J A;  5L8R F;  2UXC M;  2Z3X A;  3HHX A;  1Z5A A;  2R4J A;  4BBA A;  4F1I A;  3U6M A;  1K82 A;  1OAI A;  1HQC A;  2O25 A;  1QAQ A;  3KVW A;  1VEJ A;  3L28 A;  4MH0 E;  3V76 A;  1OJL A;  1NVM A;  2BWE A;  4OX9 M;  1QQW A;  2R4E A;  3SAR A;  4II7 A;  5IWA M;  1IBK M;  2XLJ A;  3J81 S;  3OTO M;  1TDH A;  3IEC A;  2D7E A;  4JI8 M;  1PJS A;  2W82 A;  2YR0 A;  2F5O A;  1QDT A;  4LF9 M;  3MJ5 A;  3GQ4 A;  1E9R A;  2UUC M;  2CFO A;  1Q3B A;  2R45 A;  5JI3 E;  4IBB A;  5KPZ A;  1QAM A;  5EXX A;  3K2L A;  4GKK M;  4UN2 B;  3UMM A;  2OOA A;  2GQF A;  3Q8G A;  3SFZ A;  1IBL M;  4B7G A;  4Q7J A;  1IM2 A;  2QCU A;  2C9C A;  1GVN A;  2BWB A;  4MGZ E;  5LMN M;  3U6C A;  1D2N A;  3U61 B;  2HHH M;  5IZ7 D;  1KSF X;  1L1T A;  3D8B A;  2Z8Y M;  1D0L A;  7CAT A;  2WZJ A;  2Z4S A;  1QAO A;  1CUK A;  1IY1 A;  2GNO A;  2APL A;  3KSJ A;  4OW0 A;  3VDP A;  4JI6 M;  2X49 A;  2NQ8 C;  2DVW B;  3FD9 A;  1J09 A;  2F5P A;  1Q39 A;  4KLN A;  4W5W A;  4QOZ C;  2O01 F;  2L4E A;  5EJC A;  3QYB A;  3HZJ A;  2UUA M;  3GPX A;  1NY6 A;  4R71 A;  3RFW A;  5ITX A;  5C1B A;  1QZM A;  1R6B X;  1DO0 A;  2X4A A;  2XFS A;  3C3E A;  1JR3 A;  3K9P A;  3NWL A;  4GIT A;  4JXJ A;  2K6B A;  4JI0 M;  2Y21 A;  4FCT A;  1TDZ A;  2LNH C;  1LTM A;  1JB0 F;  4LGM A;  4GC9 A;  3VFD A;  5ITX E;  3GQ3 A;  4IBK A;  5KQD A;  4JI2 M;  2XZF A;  2V1U A;  4TUW A;  2LVP C;  3HU2 A;  4NSO B;  5FTL A;  3F92 A;  4OVZ A;  2QHO B;  3HHZ A;  3U60 A;  5A2Q S;  1XC8 A;  3HWS A;  5E6J A;  2Q2E B;  1YLA A;  1EIJ A;  3L26 A;  2ZM6 M;  4R7G A;  3GLI A;  3HJQ A;  2JY5 A;  2EO2 A;  1OKS A;  3HX3 A;  1WHC A;  1WGL A;  5FSW A;  1L2D A;  3E46 A;  1PM5 A;  4HEO A;  3HHY A;  1G4A E;  2QP9 X;  2L4F A;  3FTC A;  1QZE A;  5GKN A;  1HQY E;  3RGP A;  4PDI A;  1WIV A;  4NXM M;  4CJ6 A;  4JV5 M;  1HJP A;  3HKP A;  2H5X A;  4IJE A;  4MB7 A;  3FUU A;  3HGI A;  2AHM A;  3FTD A;  4LY6 A;  1L8Q A;  4LFC M;  4B7F A;  1PRB A;  3Q8X A;  4BLC A;  3U6P A;  1N33 M;  4P17 A;  2DZL A;  2KNZ A;  1UFZ A;  4RNA A;  4Z8X A;  5DFL A;  1IXS B;  3SAW A;  4LJ4 A;  1L2C A;  2CHG A;  2EUC A;  1V33 A;  2HKJ A;  3ZC7 B;  2I7P A;  3W0L B;  2QEN A;  1EFU B;  4NRW A;  4AI6 A;  4DV1 M;  1GL7 A;  2ERC A;  4LJ5 A;  2K0B X;  1AUA A;  1IN7 A;  2VF7 A;  4M0D A;  3M7G A;  3W68 A;  1R2Z A;  1OIZ A;  4DV4 M;  3QAU A;  2XF3 A;  3FUW A;  3U6L A;  1XNR M;  1G3I A;  1MX0 A;  3LW5 F;  1J5E M;  2BJV A;  1MN3 A;  1SXJ B;  2XSZ A;  2DI0 A;  1L1Z A;  1FJG M;  3MK6 A;  4X66 M;  2B3T A;  4DR3 M;  4KOD A;  3SAU A;  1W5S A;  3GPU A;  4D82 A;  2RGH A;  2CV1 A;  4XGI A;  5DNY A;  3KXE C;  2QZ4 A;  1DGG A;  3M0E A;  1GL6 A;  2LVO C;  3AV0 A;  2J7O A;  3BOS A;  4ITQ A;  3W0F A;  2JWS A;  1IFY A;  1DV0 A;  2WSF F;  1W5T A;  3JR4 A;  2FE8 A;  2EKF A;  3SBJ A;  3SAV A;  2DZO B;  1VG5 A;  4WP2 A;  4MGH A;  3DA1 A;  4X64 M;  4DV0 M;  4IBG A;  2MH8 A;  3THG A;  2CHV A;  2R6F A;  1QDR A;  3UJN A;  2R44 A;  5JI2 E;  3CGW A;  3EIE A;  5KPT A;  1QUT A;  3T1H M;  3K9O A;  5ITY A;  3FRH A;  2Y0Q A;  2HAK A;  1G41 A;  1DGB A;  3WHL A;  3A45 A;  3J7B A;  2LXE A;  1L2B A;  1IN8 A;  1ZMU A;  3U5Z B;  3LMM A;  2M5Z A;  2CUZ A;  5EQT A;  3KS8 A;  4JI5 M;  4JI7 M;  4LJ7 A;  1NO1 A;  4KHP M;  3HU3 A;  3TL4 X;  4WW0 A;  2CV0 A;  2R0I A;  2KRK A;  4LG2 A;  2KHH A;  3VKG A;  2CRU A;  3PFI A;  1DGH A;  2DWL A;  4GRI A;  1N77 A;  5FTN A;  2KZU A;  3DOA A;  3I04 M;  3L2A A;  2K47 A;  2JA2 A;  2JZ1 A;  3B7Q A;  1RU3 A;  2C96 A;  4LJA A;  4NC6 A;  5H37 D;  3SHF A;  4RF1 A;  1HR0 M;  4DV5 M;  3IG5 A;  4BB9 A;  1SG9 A;  2QNJ A;  3EIH A;  3J2P B;  3TQS A;  5KQ8 A;  2DWM A;  2D7G A;  4DR7 M;  4AKI A;  3TE6 A;  1T43 A;  2FS1 A;  1OFH A;  2EJS A;  2MRO B;  2KEB A;  3GPP A;  2YFQ A;  1IQP A;  3LQQ A;  1NHW C;  1OIP A;  2Y0T A;  5F3W A;  2JY7 A;  4CIS A;  5ITT A;  2QBY A;  4IBC A;  3B89 A;  4PD2 A;  2R18 A;  3HHW A;  4QHT A;  3KSX A;  5FLX S;  2DKL A;  5EXP A;  1HNW M;  3B74 A;  3LVV A;  2H1R A;  1J7K A;  4I8O A;  2G8L A;  4R3D A;  2KNA A;  5LMU M;  1XB2 B;  2C99 A;  2MJ5 B;  3I01 M;  1PJJ A;  3SHG B;  1TGU A;  4JI4 M;  1TF0 B;  3VKH A;  4MGI E;  3PXG A;  3FKE A;  2MGW A;  4LF6 M;  2L6O A;  3C9P A;  1GAB A;  1H6U A;  4GIP A;  5FTK A;  4GEW A;  4D81 A;  3FUT A;  2JP7 A;  3B7Z A;  2EKK A;  4LGY A;  2C98 A;  5FTM A;  4Z6Y A;  2FOI C;  4G6Z A;  3GLG A;  1GJS A;  2RGO A;  3GLF A;  1TTE A;  2DAG A;  1IN4 A;  4DUY M;  1LV7 A;  3SMS A;  3KW6 A;  2OQ4 A;  1DGF A;  4B7H A;  3KDS E;  2R65 A;  3QWL A;  1KYI A;  3A46 A;  1PJQ A;  1I4W A;  5EXT A;  4FCV A;  2ZAO A;  4PDG A;  1NJG A;  1IXZ A;  2Z7J A;  3GQ5 A;  3W67 A;  2O5R A;  2R46 A;  2QPA A;  1N32 M;  2UXD M;  4LCB A;  3GLH A;  1XXH A;  4NSR A;  5DYI A;  5EXS A;  3HU1 A;  1HNX M;  1NSF A;  1VQ1 A;  4YY3 M;  2OOB A;  4MGY E;  1XXH B;  4RF0 A;  2XFT A;  3GLH B;  3NBI A;  2UU9 M;  4L8R C;  4DV2 M;  3GRY A;  1K3X A;  4YHH M;  1VEG A;  4CIZ A;  1QVR A;  4CHT B;  3TWL A;  1PGY A;  2JXN A;  3SYL A;  3ILK A;  3KOZ E;  1D0M A;  2G5G X;  3UK6 A;  1ZQ9 A;  2MR9 A;  4PT5 A;  2LHC A;  4D80 A;  3JAM S;  1PJT A;  3UZU A;  3U6O A;  1MU5 A;  2QSF X;  5IRE B;  1HNZ M;  1WXQ A;  4LF5 M;  4S12 A;  1WGN A;  2F5N A;  2I7N A;  3RGS A;  3GLF B;  3DZD A;  1VDD A;  3GLG B;  2KZS A;  4AW4 A;  4G4N A;  1UM8 A;  2DWN A;  2DZN B;  1N75 A;  3H4J A;  1R4G A;  3H4M A;  3GLI E;  2LVQ D;  1XXH E;  2UXB M;  2Y20 A;  3ZCB B;  2KA6 B;  2XEP A;  4LJ6 A;  3FRI A;  4L16 A;  1TR8 A;  1SXJ D;  4M9Z A;  2CV2 A;  2XSZ D;  4M0W A;  1QUS A;  1JQJ C;  2A5Y B;  1IN6 A;  2WSC F;  3WHK A;  2HL7 A;  2CP8 A;  3LCV B;  1IXR C;  2QBY B;  3FUX A;  3GRV A;  1X37 A;  4B3S M;  4L78 A;  4DV3 M;  3I4Y A;  1IY0 A;  1ZMV A;  2LWX A;  1JR3 E;  4I5S A;  2JY8 A;  3GLG E;  4DR6 M;  1OQY A;  3KP0 E;  4NOO B;  1F4I A;  2KDL A;  4HL4 A;  3FYC A;  1ZAE A;  2L7H A;  3IG8 A;  1I94 M;  3E9S A;  1S3S A;  1Z5C A;  1NV8 A;  2D7H A;  5ITR A;  1Z6T A;  4GC5 A;  2F5Q A;  4XK8 F;  1OFI A;  2QQ8 A;  2ZTC A;  4B08 A;  5KO3 A;  2KRU A;  1GLN A;  5EP1 A;  1BVS A;  3A98 B;  1E94 E;  3E21 A;  2VQE M;  4KO8 A;  4X65 M;  5BR8 M;  2V6Z M;  4OU7 A;  1K3W A;  1DGH B;  3ZH9 B;  4M9X A;  3KS4 A;  4DBG B;  2KW0 A;  3B7N A;  4FCW A;  1R7R A; 
#chains in the Genus database with same CATH homology
 1HJP A;  2KNA A;  1XB2 B;  2H5X A;  2MJ5 B;  2RRU A;  3T6P A;  2DAK A;  2MGW A;  2DZL A;  2KNZ A;  1UFZ A;  2LBC A;  5DFL A;  3MMP A;  4GEW A;  1Y8G A;  2JP7 A;  1WJ7 A;  2EKK A;  1EFU B;  1TTE A;  1VDL A;  2DAG A;  2K0B X;  1VEK A;  1A5T A;  2KNV A;  3GLH E;  4F2L A;  1AIP C;  1KYI A;  2JY6 B;  1G3I A;  2HWJ A;  1WR1 B;  2CWB A;  1MN3 A;  2DI0 A;  2B3T A;  3GLF E;  4F1I A;  1OAI A;  2O25 A;  1VEJ A;  2BWE A;  2LVA A;  2LVO C;  1VQ1 A;  2OOB A;  2L2D A;  2DNA A;  3IEC A;  1IFY A;  2G3Q A;  1DV0 A;  1Q02 A;  1VEG A;  1GO5 A;  2EKF A;  1PGY A;  1VG5 A;  2JZ0 A;  4WP2 A;  2MR9 A;  2DAI A;  2LVN C;  4UN2 B;  2OOA A;  2LTU A;  2QSF X;  5JI2 E;  1WGN A;  4Q7J A;  1IM2 A;  2BWB A;  3K9O A;  1OTR A;  3FRH A;  2HAK A;  1G41 A;  2ZTD A;  1HT2 E;  1T6O A;  2WZJ A;  1ZMU A;  1C7Y A;  1R4G A;  1IXS A;  3GLI E;  1CUK A;  2LVQ D;  1XXH E;  1DO2 A;  1ZMW A;  3FRI A;  1TR8 A;  2L4E A;  3LCU A;  1P3Q Q;  2OO9 A;  4R71 A;  2R0I A;  1DO0 A;  2KHH A;  2DHY A;  3K9P A;  1HT1 E;  2CP8 A;  2JZ1 A;  3LCV B;  1V92 A;  1ZV1 A;  2LVP C;  1ZMV A;  3GLG E;  1JR3 E;  3F92 A;  2JY8 A;  2DAM A;  1OQY A;  1SG9 A;  2QHO B;  2QNJ A;  1F4I A;  2DEN A;  1T43 A;  3BBZ A;  1NV9 A;  1YLA A;  2EJS A;  2JUJ A;  2MRO B;  3IHP A;  1NV8 A;  2JNH A;  1WIV A;  2JY5 A;  2DAE A;  1OKS A;  1WHC A;  1WGL A;  2JY7 A;  3E46 A;  4HEO A;  1G4A E;  3B89 A;  1BVS A;  2L4F A;  1E94 E;  3E21 A;  1QZE A;  2K9D A;  1HQY E;  4DBG B;  2ZTC A;  3FE3 A;  2DKL A;  4G3O A;  3H4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...