1T6OA

Nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
GASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords phosphoprotein
publication title Structural basis for the attachment of a paramyxoviral polymerase to its template.
pubmed doi rcsb
source organism Measles virus
molecule tags Viral protein
total genus 15
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1t6oA00
2QHOB 3K9PA 4R71A 1ZV1A 1VDLA 1KYIA 1C7YA 2H5XA 1UFZA 2JNHA 2HAKA 3GLHE 1DO0A 2LTUA 1QZEA 1VEKA 2DZLA 2QNJA 1OKSA 5JI2E 4WP2A 2KHHA 2BWBA 2LBCA 1HJPA 2R0IA 1R4GA 2MROB 3FE3A 2ZTCA 2LVOC 2L4EA 1OTRA 2MJ5B 4GEWA 1AIPC 1NV8A 1OAIA 2CWBA 1WHCA 2L2DA 2EKKA 2LVAA 1TR8A 1MN3A 2DAIA 2JUJA 4UN2B 1ZMUA 1TTEA 3MMPA 3FRHA 3E21A 1CUKA 4DBGB 3GLGE 2RRUA 2K0BX 4Q7JA 2DNAA 1HT1E 4F2LA 2DAGA 2EKFA 2JZ1A 2DAEA 2B3TA 1IM2A 2CP8A 1E94E 2BWEA 2KNAA 1OQYA 1SG9A 2WZJA 2DKLA 1GO5A 3K9OA 1HT2E 1F4IA 2K9DA 1EFUB 3LCUA 1BVSA 2JY7A 1WR1B 2DAMA 4G3OA 2LVNC 2HWJA 1WIVA 2JY5A 3BBZA 3IHPA 1WGLA 2L4FA 1Y8GA 2JY8A 2LVQD 3F92A 2JY6B 1Q02A 1HQYE 1T43A 1ZMVA 3T6PA 2OO9A 2DHYA 2OOAA 2MGWA 1V92A 2DENA 1WJ7A 3E46A 1G41A 2JP7A 1T6OA 1VEJA 1VG5A 2JZ0A 1IXSA 1G4AE 1JR3E 4F1IA 1IFYA 3LCVB 2ZTDA 3GLIE 2KNVA 2DI0A 1NV9A 3FRIA 3H4JA 3GLFE 1A5TA 3B89A 2MR9A 1PGYA 1XXHE 1VEGA 1DV0A 2OOBA 2QSFX 2G3QA 1ZMWA 5DFLA 1G3IA 1WGNA 2EJSA 1XB2B 2O25A 4HEOA 2DAKA 1P3QQ 1YLAA 1VQ1A 2LVPC 1DO2A 3IECA 2KNZA
chains in the Genus database with same CATH superfamily
3D8LA 2QHOB 2K6BA 3HZJA 1ZV1A 3GLFA 1XNQM 1QDTA 3HY5A 3GQ3A 2LWXA 5EXXA 2D7EA 1C7YA 2XSZA 3HJ8A 2UXCM 2DXIA 3GLHE 3KFUG 4LRTA 3FD9A 2LTUA 4LJ6A 2C5RA 1QZEA 3TE6A 3K2LA 2EA0A 2QZ4A 2KXEA 3HHXA 1K3WA 4GMQA 3K8ZA 5ITYA 2DHRA 2J5YA 3M0EA 3NWLA 4LGMA 4NOOB 1K82A 3KXEC 3FE3A 4I4LA 2ZTCA 2HL7A 4DV0M 2FH0A 1I94M 2YR0A 1N34M 3VDUA 1V34A 2L09A 3KS8A 1GABA 3A42A 3FUUA 1QUSA 4UN2B 3QAUA 3R8FA 5KO3A 2QBYA 1TTEA 5KPZA 1DGHA 4LF9M 4MGZE 4XBOA 1OJLA 4DBGB 4Z6YA 3B9PA 4JXJA 5H37D 1XWIA 1HT1E 3KOXE 2KW0A 3U5ZB 2VDBB 2Y21A 3QWLA 3HHWA 1MU5A 1NNUC 4WURA 3FYCA 4S12A 2B3TA 1PJQA 2KNAA 3J80S 3DOAA 4FCWA 4OX9M 1IN7A 4M0WA 3W0LB 1JQJC 4DR6M 2K9DA 4B7GA 4DR4M 4K0KM 4MGYE 3TWKA 5A2QS 3J7AS 2F5SA 2XEPA 4FW9A 1QAQA 5BR8M 1WR1B 1IY0A 2R46A 4G3OA 2LVNC 3BOSA 3W68A 4AG5A 3GLGB 2ZM6M 4DV1M 4PCZA 4L4UA 1TF0B 4IBGA 3U60B 4AKGA 1HQCA 1ZMVA 3M7GA 1XMOM 4LRSA 1IY2A 4PT5A 1G59A 4QHSA 2Z3XA 4IJEA 5EQTA 1H6UA 3WHLA 2FOIC 5E26A 1G41A 1QAOA 2JP7A 5E6JA 3GLIB 3A98B 2JZ0A 1W5SA 4HLQA 2LXEA 1G4AE 1IXSB 1IFYA 2C9OA 4LFBM 1FJGM 3GLIE 2BJVA 4QNRA 1EIJA 4NSOB 2KNVA 1SXJC 4L15A 1L1TA 4L6V6 5EP3A 2UU9M 4LF8M 1XXHB 2KZSA 1NJGA 1NV9A 3SAVA 4DV4M 4PD2A 1N75A 3I4YA 2CHGA 3H4JA 1Q3CA 2LH0A 2VIIA 3B89A 1QANA 1XXHE 2AHMA 2DWMA 2UUCM 4GC9A 3VK8A 3PNYA 3PNVA 2W82A 5FTJA 2G3QA 4I5SA 3WHKA 2CHVA 3J27B 5IT9S 3GPYA 3KOYE 4AG6A 3RFWA 1WGNA 3I51A 3U6MA 1Z5CA 1IN6A 2EJSA 2HHHM 4FVMA 1QDRA 3FUWA 4G6ZA 1P3QQ 1YLAA 3AOEA 1VQ1A 2C98A 3GRUA 3J7BA 1N33M 4X64M 4IBJA 3VLFB 2NQ8C 1QUTA 2KNZA 2Z4RA 3K9PA 1L2BA 3CF2A 4MH0E 4QNMA 2LNHC 4DV2M 4GKKM 1NHWC 4DV5M 3ZH9B 4OVZB 2KA6B 2HAKA 3PXGA 1IXRC 4DV3M 2J7NA 4WW0A 2Z7JA 2QNJA 3CTWB 2FS1A 4M9SA 4LGYA 5JI2E 5DNYA 4FWHA 3R9XB 4LJ7A 4MM3B 2DZNB 2M5ZA 4TUWA 1R4GA 4BBAA 3FKEA 1TDZA 2MROB 5BPVA 4QOSA 2XH9A 5C1BA 2LVOC 2L4EA 1Z59A 3SC3A 1OTRA 2MJ5B 1Z5AA 1DGFA 5ITXA 3SMSA 1AIPC 3U6SA 4ZPXA 1WHCA 4DUYM 2Y0TA 1G71A 1S3SA 2EKKA 2LVAA 1MN3A 1MX0A 2DAIA 1PRBA 3GLHB 2F4VM 1IXZA 1VDDA 3AOGA 4P17A 3T15A 3TPZA 4JI1M 4DR3M 3MMPA 3FRHA 3E21A 1CUKA 1OFHA 1OIPA 2RRUA 4ANRA 3GO8A 3L26A 2XFSA 1IBLM 2Z4SA 3QYEA 4NXMM 3SASA 3AV0A 3PFIA 4CHTB 1JB0F 2X8AA 4M9ZA 4BLCA 2F5QA 4DR5M 2DWZB 1D0KA 3JR4A 3U61B 3C9PA 5KPRA 2CUZA 2DKLA 4I8OA 5ITUA 1GO5A 3KW6A 5FSWA 1IN5A 2M60A 4G4RA 2J7OA 1C1KA 1EFUB 2YNMD 2V6ZM 5DYIA 5EP4A 3SFZA 4B7HA 2QCUA 4NXNM 3C58A 4GIPA 3KOZE 7CATA 3GLGA 2HWJA 3SBJA 2JY5A 1TDHA 3SYKA 2JXNA 2XSZD 2L4FA 4W5WA 2KDLA 1IBMM 2LVQD 1IN4A 3I01M 3VDPA 4GHLA 4MB7A 3SHFA 2DHYA 3VKGA 2OOAA 1R6BX 4Y28F 3LVVA 2R6FA 3JAMS 4NRVA 1QZMA 1D2NA 1DGGA 3E9SA 3FUXA 2CE7A 1PJTA 3U6OA 1VG5A 1NY5A 2DZOB 1X37A 1IXSA 2F5PA 4CISA 4F1IA 3AJIB 2CHQA 4GC5A 3LCVB 3J81S 4D81A 1GKIA 3FTDA 2C96A 4L16A 2ZAMA 3U6QA 4DR1M 2FFJA 1QYRA 3GLFB 3SAWA 1GJTA 1XXHA 2QP9X 2R44A 2C99A 3VKHA 4JI4M 3GLFE 1IBKM 1GL6A 3C3EA 4NL4H 4D80A 1YE9A 1DV0A 1UM8A 2CV2A 2OOBA 3KSJA 5DYGA 2P5TA 1G3IA 1JR3A 4X66M 1R2YA 4PDIA 3OTOM 1TH2A 4YY3M 1G8PA 3SAUA 4M0DA 3EIEA 4X65M 2ZANA 4CGYB 2L7HA 3IECA 3IG5A 3V76A 4B3SM 2DVWB 1FNNA 2KEBA 3QYBA 1J7KA 1OAOC 1VDLA 4GH9A 4IIWA 2QBYB 3B7QA 1J5EM 2H5XA 2N35A 1UFZA 4FCTA 4OVZA 4XGIA 4AQYM 5F3WA 5FTNA 5FTLA 1DO0A 1VEKA 2L6OA 2DZLA 1OKSA 1R7RA 5C18A 3THGA 1KSFX 4B3RM 2XFTA 2Y20A 1SXJD 4LJAA 2APLA 5FTKA 3W0FA 3U6CA 1PJIA 4A3VB 5ITRA 3AL0C 1YSYA 3C3DA 5FTMA 4RKUF 2DWLA 1T3TA 4LG2A 1E9SA 1ZQ9A 2XZFA 4KO8A 1NO1A 3SATA 5LMNM 1XNRM 2R65A 4R7GA 2KRUA 1OAIA 3KS4A 1YUBA 2Z8YM 3HU2A 3U6LA 2CWBA 2L2DA 4KLNA 4NRWA 1RU3A 1TR8A 3KP0E 2BJWA 3GLHA 1AUAA 4GKJM 2JUJA 1PJJA 1ZMUA 2UXBM 2X4AA 4REZA 2WSFF 3GRVA 3RGSA 4KHPM 5LMUM 3HU3A 4L78A 3HJQA 2K0BX 4DV6M 2H1RA 3AOEC 4Q7JA 4MGHA 1SXJB 4FWDA 4F2LA 1HNWM 2O01F 4LJ5A 2EKFA 2O5RA 2QQ8A 1Q39A 3EIHA 2YFQA 2DAEA 3UMMA 2WSCF 2YQZA 1SXJE 1IM2A 3U61A 2CP8A 4RF1A 2BWEA 3GPXA 4DR2M 1IQPA 1OIZA 3FUVA 3HJSA 1OQYA 1SG9A 2R62A 2WZJA 2OPFA 3TL4X 2JA2A 3HU1A 3K9OA 3KVWA 1HT2E 3LQQA 1R5LA 4IBDA 4II7A 2VQFM 1R2ZA 3L25A 5JI3E 3UK6A 3LCUA 1BVSA 2JY7A 1D0LA 3VK7A 2C9CA 4XK8F 1V33A 2F5NA 1N32M 2F5OA 2EUCA 4AI6A 3MK6A 1ORYB 2Y0QA 2DAMA 4IJFA 4P16A 1NY6A 4D82A 1PM5A 4QOZC 1WIVA 1QAMA 3IHPA 1IY1A 4B08A 3K92A 1L2DA 2BNKA 1GJSA 1KFVA 4JYAM 1HQYE 2XF3A 3L2AA 3T6PA 1PJSA 4RNAA 3KP1E 4CJ6A 1XC8A 2CV1A 3U5ZA 4JI7M 1N36M 1LTMA 2MGWA 3ZC7B 2DENA 1WJ7A 1XMQM 3TQSA 3I04M 5EXPA 3VFDA 3B7NA 1D0MA 1VEJA 3UGJA 3FYDA 3D8BA 4JI2M 2CRUA 3NBIA 1QVRA 2GQFA 3L28A 2E5LM 2JWSA 4LJ4A 2D7GA 3I4VA 3ILKA 4G4OA 5EXSA 1EE8A 4JI6M 3LMMA 1HR0M 4HL4A 5KQ8A 3FRIA 1DGBA 2FE8A 1A5TA 1TH3A 3U60A 5FLXS 4B3TM 3KDSE 4JI5M 1Z6TA 4DUZM 1VEGA 4GITA 2QSFX 3CF0A 4LF5M 5L8RF 1LV7A 1MJGM 1NJFA 1ZMWA 4LZZA 5DFLA 1Q3BA 4JI3M 3E4RA 1N77A 1W5TA 4MGIE 2WSEF 3SHGB 1XB2B 2O25A 3GLIA 4IBBA 4HEOA 2DAKA 4ITQA 4IBCA 4PDGA 3T1HM 3DFZA 1E32A 3Q8XA 4X62M 2VF8A 2QENA 5IZ7D 3LVWA 2I7NA 5ITXE 3LW5F 4R71A 4M9XA 2XGNA 1E9RA 5IREB 2D7HA 1KYIA 5EJCA 1J09A 2G5GX 2JNHA 2RGHA 4JI0M 4LF7M 4IBIA 4I81A 8CATA 3HGIA 3UJNA 2V1UA 4JV5M 1N78A 4LZJA 4WP2A 3NBXX 4JI8M 2KHHA 2BWBA 2LBCA 3T1YM 1HJPA 3FTFA 2R0IA 4LJ9A 2L7IA 3H4MA 4IBEA 1L2CA 3FTEA 1L8QA 3HHYA 2UXDM 4MGKE 4B3MM 3J2PB 4GEWA 1L1ZA 2UUAM 1NV8A 1WXQA 4LF6M 1GL7A 2ZBKB 3AKZA 1XHBA 3KOWE 4OW0A 1TGUA 4G4QA 3JR5A 2ZAOA 5ITQA 4AKIA 2Q2EB 4NC6A 1OFIA 4LF4M 3TWLA 3PVSA 4JN6A 2X49A 1I4WA 3RGPA 1DGHB 4LFCM 3GLGE 1TH4A 3DA1A 1SXJA 1NVMA 2DNAA 2FNAA 4DR7M 3IG8A 2DAGA 2JZ1A 2DWNA 2R4EA 3A45A 4R3DA 3CF6E 3U6DA 1Z5BA 3GQ5A 1K3XA 2MH8A 1JR3D 1E94E 4DV7M 4B7FA 1QQWA 3UZUA 3TWMA 2HCBA 4FWGA 1HNZM 1F4IA 3GPUA 3SYLA 2EO2A 3KSXA 3MJ5A 3BXWA 4GHAA 2CFOA 4LY6A 3U6PA 3A46A 1GVNA 4EIWA 4YHHM 4KODA 3ZCBB 3BBZA 4QHTA 3HKPA 4L8RC 4AKHA 3GRRA 2CEAA 3L27A 4NSRA 4CIZA 1WGLA 3GQ4A 2XZUA 2OQ4A 1Y8GA 2JY8A 1NHGC 3F92A 2JY6B 1Q02A 3K1JA 3GPPA 1T43A 4BB9A 2KRKA 2LHCA 2GNOA 2OO9A 4LCBA 1V92A 2G8LA 3LQRA 3M6AA 3E46A 2I7PA 4FCVA 1ZAEA 3FUTA 1NSFA 2RGOA 3B74A 1T6OA 2RKOA 3GRYA 3HHZA 4AZFA 1JR3E 5KPTA 2R45A 2CV0A 3ZQJA 4KT0F 2ZTDA 2VQEM 4IBFA 3T38A 4GRIA 2A5YB 2DI0A 4LFAM 2QPAA 4G4NA 4Z8XA 2K47A 2HKJA 5EXTA 5ITTA 3L29A 1GLNA 2R18A 5GKNA 3W67A 2MR9A 4IBKA 1PGYA 4AW4A 4OU7A 3B7ZA 2LHGA 2R4JA 5EP1A 4FD2A 3SARA 1HNXM 3MHVC 5EP2A 2XLJA 4LJ8A 2KZUA 3RE8A 2ERCA 3Q8GA 3SMPA 3DZDA 2V1CA 5KQDA 3CGWA 3U6EA 1IN8A 3HWSA 5IWAM 1NNJA 2LVPC 3AFHA 4RF0A 3HX3A 1DO2A 2UUBM 3GP1A 2VF7A 3FTCA
chains in the Genus database with same CATH topology
2QHOB 3K9PA 4R71A 1ZV1A 1VDLA 1KYIA 1C7YA 2H5XA 1UFZA 2JNHA 2HAKA 3GLHE 1DO0A 2LTUA 1QZEA 1VEKA 2DZLA 2QNJA 1OKSA 5JI2E 4WP2A 2KHHA 2BWBA 2LBCA 1HJPA 2R0IA 1R4GA 2MROB 3FE3A 2ZTCA 2LVOC 2L4EA 1OTRA 2MJ5B 4GEWA 1AIPC 1NV8A 1OAIA 2CWBA 1WHCA 2L2DA 2EKKA 2LVAA 1TR8A 1MN3A 2DAIA 2JUJA 4UN2B 1ZMUA 1TTEA 3MMPA 3FRHA 3E21A 1CUKA 4DBGB 3GLGE 2RRUA 2K0BX 4Q7JA 2DNAA 1HT1E 4F2LA 2DAGA 2EKFA 2JZ1A 2DAEA 2B3TA 1IM2A 2CP8A 1E94E 2BWEA 2KNAA 1OQYA 1SG9A 2WZJA 2DKLA 1GO5A 3K9OA 1HT2E 1F4IA 2K9DA 1EFUB 3LCUA 1BVSA 2JY7A 1WR1B 2DAMA 4G3OA 2LVNC 2HWJA 1WIVA 2JY5A 3BBZA 3IHPA 1WGLA 2L4FA 1Y8GA 2JY8A 2LVQD 3F92A 2JY6B 1Q02A 1HQYE 1T43A 1ZMVA 3T6PA 2OO9A 2DHYA 2OOAA 2MGWA 1V92A 2DENA 1WJ7A 3E46A 1G41A 2JP7A 1T6OA 1VEJA 1VG5A 2JZ0A 1IXSA 1G4AE 1JR3E 4F1IA 1IFYA 3LCVB 2ZTDA 3GLIE 2KNVA 2DI0A 1NV9A 3FRIA 3H4JA 3GLFE 1A5TA 3B89A 2MR9A 1PGYA 1XXHE 1VEGA 1DV0A 2OOBA 2QSFX 2G3QA 1ZMWA 5DFLA 1G3IA 1WGNA 2EJSA 1XB2B 2O25A 4HEOA 2DAKA 1P3QQ 1YLAA 1VQ1A 2LVPC 1DO2A 3IECA 2KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHO B;  3K9P A;  4R71 A;  1ZV1 A;  1VDL A;  1KYI A;  1C7Y A;  2H5X A;  1UFZ A;  2JNH A;  2HAK A;  3GLH E;  1DO0 A;  2LTU A;  1QZE A;  1VEK A;  2DZL A;  2QNJ A;  1OKS A;  5JI2 E;  4WP2 A;  2KHH A;  2BWB A;  2LBC A;  1HJP A;  2R0I A;  1R4G A;  2MRO B;  3FE3 A;  2ZTC A;  2LVO C;  2L4E A;  1OTR A;  2MJ5 B;  4GEW A;  1AIP C;  1NV8 A;  1OAI A;  2CWB A;  1WHC A;  2L2D A;  2EKK A;  2LVA A;  1TR8 A;  1MN3 A;  2DAI A;  2JUJ A;  4UN2 B;  1ZMU A;  1TTE A;  3MMP A;  3FRH A;  3E21 A;  1CUK A;  4DBG B;  3GLG E;  2RRU A;  2K0B X;  4Q7J A;  2DNA A;  1HT1 E;  4F2L A;  2DAG A;  2EKF A;  2JZ1 A;  2DAE A;  2B3T A;  1IM2 A;  2CP8 A;  1E94 E;  2BWE A;  2KNA A;  1OQY A;  1SG9 A;  2WZJ A;  2DKL A;  1GO5 A;  3K9O A;  1HT2 E;  1F4I A;  2K9D A;  1EFU B;  3LCU A;  1BVS A;  2JY7 A;  1WR1 B;  2DAM A;  4G3O A;  2LVN C;  2HWJ A;  1WIV A;  2JY5 A;  3BBZ A;  3IHP A;  1WGL A;  2L4F A;  1Y8G A;  2JY8 A;  2LVQ D;  3F92 A;  2JY6 B;  1Q02 A;  1HQY E;  1T43 A;  1ZMV A;  3T6P A;  2OO9 A;  2DHY A;  2OOA A;  2MGW A;  1V92 A;  2DEN A;  1WJ7 A;  3E46 A;  1G41 A;  2JP7 A;  1T6O A;  1VEJ A;  1VG5 A;  2JZ0 A;  1IXS A;  1G4A E;  1JR3 E;  4F1I A;  1IFY A;  3LCV B;  2ZTD A;  3GLI E;  2KNV A;  2DI0 A;  1NV9 A;  3FRI A;  3H4J A;  3GLF E;  1A5T A;  3B89 A;  2MR9 A;  1PGY A;  1XXH E;  1VEG A;  1DV0 A;  2OOB A;  2QSF X;  2G3Q A;  1ZMW A;  5DFL A;  1G3I A;  1WGN A;  2EJS A;  1XB2 B;  2O25 A;  4HEO A;  2DAK A;  1P3Q Q;  1YLA A;  1VQ1 A;  2LVP C;  1DO2 A;  3IEC A;  2KNZ A; 
#chains in the Genus database with same CATH topology
 3D8L A;  2QHO B;  2K6B A;  3HZJ A;  1ZV1 A;  3GLF A;  1XNQ M;  1QDT A;  3HY5 A;  3GQ3 A;  2LWX A;  5EXX A;  2D7E A;  1C7Y A;  2XSZ A;  3HJ8 A;  2UXC M;  2DXI A;  3GLH E;  3KFU G;  4LRT A;  3FD9 A;  2LTU A;  4LJ6 A;  2C5R A;  1QZE A;  3TE6 A;  3K2L A;  2EA0 A;  2QZ4 A;  2KXE A;  3HHX A;  1K3W A;  4GMQ A;  3K8Z A;  5ITY A;  2DHR A;  2J5Y A;  3M0E A;  3NWL A;  4LGM A;  4NOO B;  1K82 A;  3KXE C;  3FE3 A;  4I4L A;  2ZTC A;  2HL7 A;  4DV0 M;  2FH0 A;  1I94 M;  2YR0 A;  1N34 M;  3VDU A;  1V34 A;  2L09 A;  3KS8 A;  1GAB A;  3A42 A;  3FUU A;  1QUS A;  4UN2 B;  3QAU A;  3R8F A;  5KO3 A;  2QBY A;  1TTE A;  5KPZ A;  1DGH A;  4LF9 M;  4MGZ E;  4XBO A;  1OJL A;  4DBG B;  4Z6Y A;  3B9P A;  4JXJ A;  5H37 D;  1XWI A;  1HT1 E;  3KOX E;  2KW0 A;  3U5Z B;  2VDB B;  2Y21 A;  3QWL A;  3HHW A;  1MU5 A;  1NNU C;  4WUR A;  3FYC A;  4S12 A;  2B3T A;  1PJQ A;  2KNA A;  3J80 S;  3DOA A;  4FCW A;  4OX9 M;  1IN7 A;  4M0W A;  3W0L B;  1JQJ C;  4DR6 M;  2K9D A;  4B7G A;  4DR4 M;  4K0K M;  4MGY E;  3TWK A;  5A2Q S;  3J7A S;  2F5S A;  2XEP A;  4FW9 A;  1QAQ A;  5BR8 M;  1WR1 B;  1IY0 A;  2R46 A;  4G3O A;  2LVN C;  3BOS A;  3W68 A;  4AG5 A;  3GLG B;  2ZM6 M;  4DV1 M;  4PCZ A;  4L4U A;  1TF0 B;  4IBG A;  3U60 B;  4AKG A;  1HQC A;  1ZMV A;  3M7G A;  1XMO M;  4LRS A;  1IY2 A;  4PT5 A;  1G59 A;  4QHS A;  2Z3X A;  4IJE A;  5EQT A;  1H6U A;  3WHL A;  2FOI C;  5E26 A;  1G41 A;  1QAO A;  2JP7 A;  5E6J A;  3GLI B;  3A98 B;  2JZ0 A;  1W5S A;  4HLQ A;  2LXE A;  1G4A E;  1IXS B;  1IFY A;  2C9O A;  4LFB M;  1FJG M;  3GLI E;  2BJV A;  4QNR A;  1EIJ A;  4NSO B;  2KNV A;  1SXJ C;  4L15 A;  1L1T A;  4L6V 6;  5EP3 A;  2UU9 M;  4LF8 M;  1XXH B;  2KZS A;  1NJG A;  1NV9 A;  3SAV A;  4DV4 M;  4PD2 A;  1N75 A;  3I4Y A;  2CHG A;  3H4J A;  1Q3C A;  2LH0 A;  2VII A;  3B89 A;  1QAN A;  1XXH E;  2AHM A;  2DWM A;  2UUC M;  4GC9 A;  3VK8 A;  3PNY A;  3PNV A;  2W82 A;  5FTJ A;  2G3Q A;  4I5S A;  3WHK A;  2CHV A;  3J27 B;  5IT9 S;  3GPY A;  3KOY E;  4AG6 A;  3RFW A;  1WGN A;  3I51 A;  3U6M A;  1Z5C A;  1IN6 A;  2EJS A;  2HHH M;  4FVM A;  1QDR A;  3FUW A;  4G6Z A;  1P3Q Q;  1YLA A;  3AOE A;  1VQ1 A;  2C98 A;  3GRU A;  3J7B A;  1N33 M;  4X64 M;  4IBJ A;  3VLF B;  2NQ8 C;  1QUT A;  2KNZ A;  2Z4R A;  3K9P A;  1L2B A;  3CF2 A;  4MH0 E;  4QNM A;  2LNH C;  4DV2 M;  4GKK M;  1NHW C;  4DV5 M;  3ZH9 B;  4OVZ B;  2KA6 B;  2HAK A;  3PXG A;  1IXR C;  4DV3 M;  2J7N A;  4WW0 A;  2Z7J A;  2QNJ A;  3CTW B;  2FS1 A;  4M9S A;  4LGY A;  5JI2 E;  5DNY A;  4FWH A;  3R9X B;  4LJ7 A;  4MM3 B;  2DZN B;  2M5Z A;  4TUW A;  1R4G A;  4BBA A;  3FKE A;  1TDZ A;  2MRO B;  5BPV A;  4QOS A;  2XH9 A;  5C1B A;  2LVO C;  2L4E A;  1Z59 A;  3SC3 A;  1OTR A;  2MJ5 B;  1Z5A A;  1DGF A;  5ITX A;  3SMS A;  1AIP C;  3U6S A;  4ZPX A;  1WHC A;  4DUY M;  2Y0T A;  1G71 A;  1S3S A;  2EKK A;  2LVA A;  1MN3 A;  1MX0 A;  2DAI A;  1PRB A;  3GLH B;  2F4V M;  1IXZ A;  1VDD A;  3AOG A;  4P17 A;  3T15 A;  3TPZ A;  4JI1 M;  4DR3 M;  3MMP A;  3FRH A;  3E21 A;  1CUK A;  1OFH A;  1OIP A;  2RRU A;  4ANR A;  3GO8 A;  3L26 A;  2XFS A;  1IBL M;  2Z4S A;  3QYE A;  4NXM M;  3SAS A;  3AV0 A;  3PFI A;  4CHT B;  1JB0 F;  2X8A A;  4M9Z A;  4BLC A;  2F5Q A;  4DR5 M;  2DWZ B;  1D0K A;  3JR4 A;  3U61 B;  3C9P A;  5KPR A;  2CUZ A;  2DKL A;  4I8O A;  5ITU A;  1GO5 A;  3KW6 A;  5FSW A;  1IN5 A;  2M60 A;  4G4R A;  2J7O A;  1C1K A;  1EFU B;  2YNM D;  2V6Z M;  5DYI A;  5EP4 A;  3SFZ A;  4B7H A;  2QCU A;  4NXN M;  3C58 A;  4GIP A;  3KOZ E;  7CAT A;  3GLG A;  2HWJ A;  3SBJ A;  2JY5 A;  1TDH A;  3SYK A;  2JXN A;  2XSZ D;  2L4F A;  4W5W A;  2KDL A;  1IBM M;  2LVQ D;  1IN4 A;  3I01 M;  3VDP A;  4GHL A;  4MB7 A;  3SHF A;  2DHY A;  3VKG A;  2OOA A;  1R6B X;  4Y28 F;  3LVV A;  2R6F A;  3JAM S;  4NRV A;  1QZM A;  1D2N A;  1DGG A;  3E9S A;  3FUX A;  2CE7 A;  1PJT A;  3U6O A;  1VG5 A;  1NY5 A;  2DZO B;  1X37 A;  1IXS A;  2F5P A;  4CIS A;  4F1I A;  3AJI B;  2CHQ A;  4GC5 A;  3LCV B;  3J81 S;  4D81 A;  1GKI A;  3FTD A;  2C96 A;  4L16 A;  2ZAM A;  3U6Q A;  4DR1 M;  2FFJ A;  1QYR A;  3GLF B;  3SAW A;  1GJT A;  1XXH A;  2QP9 X;  2R44 A;  2C99 A;  3VKH A;  4JI4 M;  3GLF E;  1IBK M;  1GL6 A;  3C3E A;  4NL4 H;  4D80 A;  1YE9 A;  1DV0 A;  1UM8 A;  2CV2 A;  2OOB A;  3KSJ A;  5DYG A;  2P5T A;  1G3I A;  1JR3 A;  4X66 M;  1R2Y A;  4PDI A;  3OTO M;  1TH2 A;  4YY3 M;  1G8P A;  3SAU A;  4M0D A;  3EIE A;  4X65 M;  2ZAN A;  4CGY B;  2L7H A;  3IEC A;  3IG5 A;  3V76 A;  4B3S M;  2DVW B;  1FNN A;  2KEB A;  3QYB A;  1J7K A;  1OAO C;  1VDL A;  4GH9 A;  4IIW A;  2QBY B;  3B7Q A;  1J5E M;  2H5X A;  2N35 A;  1UFZ A;  4FCT A;  4OVZ A;  4XGI A;  4AQY M;  5F3W A;  5FTN A;  5FTL A;  1DO0 A;  1VEK A;  2L6O A;  2DZL A;  1OKS A;  1R7R A;  5C18 A;  3THG A;  1KSF X;  4B3R M;  2XFT A;  2Y20 A;  1SXJ D;  4LJA A;  2APL A;  5FTK A;  3W0F A;  3U6C A;  1PJI A;  4A3V B;  5ITR A;  3AL0 C;  1YSY A;  3C3D A;  5FTM A;  4RKU F;  2DWL A;  1T3T A;  4LG2 A;  1E9S A;  1ZQ9 A;  2XZF A;  4KO8 A;  1NO1 A;  3SAT A;  5LMN M;  1XNR M;  2R65 A;  4R7G A;  2KRU A;  1OAI A;  3KS4 A;  1YUB A;  2Z8Y M;  3HU2 A;  3U6L A;  2CWB A;  2L2D A;  4KLN A;  4NRW A;  1RU3 A;  1TR8 A;  3KP0 E;  2BJW A;  3GLH A;  1AUA A;  4GKJ M;  2JUJ A;  1PJJ A;  1ZMU A;  2UXB M;  2X4A A;  4REZ A;  2WSF F;  3GRV A;  3RGS A;  4KHP M;  5LMU M;  3HU3 A;  4L78 A;  3HJQ A;  2K0B X;  4DV6 M;  2H1R A;  3AOE C;  4Q7J A;  4MGH A;  1SXJ B;  4FWD A;  4F2L A;  1HNW M;  2O01 F;  4LJ5 A;  2EKF A;  2O5R A;  2QQ8 A;  1Q39 A;  3EIH A;  2YFQ A;  2DAE A;  3UMM A;  2WSC F;  2YQZ A;  1SXJ E;  1IM2 A;  3U61 A;  2CP8 A;  4RF1 A;  2BWE A;  3GPX A;  4DR2 M;  1IQP A;  1OIZ A;  3FUV A;  3HJS A;  1OQY A;  1SG9 A;  2R62 A;  2WZJ A;  2OPF A;  3TL4 X;  2JA2 A;  3HU1 A;  3K9O A;  3KVW A;  1HT2 E;  3LQQ A;  1R5L A;  4IBD A;  4II7 A;  2VQF M;  1R2Z A;  3L25 A;  5JI3 E;  3UK6 A;  3LCU A;  1BVS A;  2JY7 A;  1D0L A;  3VK7 A;  2C9C A;  4XK8 F;  1V33 A;  2F5N A;  1N32 M;  2F5O A;  2EUC A;  4AI6 A;  3MK6 A;  1ORY B;  2Y0Q A;  2DAM A;  4IJF A;  4P16 A;  1NY6 A;  4D82 A;  1PM5 A;  4QOZ C;  1WIV A;  1QAM A;  3IHP A;  1IY1 A;  4B08 A;  3K92 A;  1L2D A;  2BNK A;  1GJS A;  1KFV A;  4JYA M;  1HQY E;  2XF3 A;  3L2A A;  3T6P A;  1PJS A;  4RNA A;  3KP1 E;  4CJ6 A;  1XC8 A;  2CV1 A;  3U5Z A;  4JI7 M;  1N36 M;  1LTM A;  2MGW A;  3ZC7 B;  2DEN A;  1WJ7 A;  1XMQ M;  3TQS A;  3I04 M;  5EXP A;  3VFD A;  3B7N A;  1D0M A;  1VEJ A;  3UGJ A;  3FYD A;  3D8B A;  4JI2 M;  2CRU A;  3NBI A;  1QVR A;  2GQF A;  3L28 A;  2E5L M;  2JWS A;  4LJ4 A;  2D7G A;  3I4V A;  3ILK A;  4G4O A;  5EXS A;  1EE8 A;  4JI6 M;  3LMM A;  1HR0 M;  4HL4 A;  5KQ8 A;  3FRI A;  1DGB A;  2FE8 A;  1A5T A;  1TH3 A;  3U60 A;  5FLX S;  4B3T M;  3KDS E;  4JI5 M;  1Z6T A;  4DUZ M;  1VEG A;  4GIT A;  2QSF X;  3CF0 A;  4LF5 M;  5L8R F;  1LV7 A;  1MJG M;  1NJF A;  1ZMW A;  4LZZ A;  5DFL A;  1Q3B A;  4JI3 M;  3E4R A;  1N77 A;  1W5T A;  4MGI E;  2WSE F;  3SHG B;  1XB2 B;  2O25 A;  3GLI A;  4IBB A;  4HEO A;  2DAK A;  4ITQ A;  4IBC A;  4PDG A;  3T1H M;  3DFZ A;  1E32 A;  3Q8X A;  4X62 M;  2VF8 A;  2QEN A;  5IZ7 D;  3LVW A;  2I7N A;  5ITX E;  3LW5 F;  4R71 A;  4M9X A;  2XGN A;  1E9R A;  5IRE B;  2D7H A;  1KYI A;  5EJC A;  1J09 A;  2G5G X;  2JNH A;  2RGH A;  4JI0 M;  4LF7 M;  4IBI A;  4I81 A;  8CAT A;  3HGI A;  3UJN A;  2V1U A;  4JV5 M;  1N78 A;  4LZJ A;  4WP2 A;  3NBX X;  4JI8 M;  2KHH A;  2BWB A;  2LBC A;  3T1Y M;  1HJP A;  3FTF A;  2R0I A;  4LJ9 A;  2L7I A;  3H4M A;  4IBE A;  1L2C A;  3FTE A;  1L8Q A;  3HHY A;  2UXD M;  4MGK E;  4B3M M;  3J2P B;  4GEW A;  1L1Z A;  2UUA M;  1NV8 A;  1WXQ A;  4LF6 M;  1GL7 A;  2ZBK B;  3AKZ A;  1XHB A;  3KOW E;  4OW0 A;  1TGU A;  4G4Q A;  3JR5 A;  2ZAO A;  5ITQ A;  4AKI A;  2Q2E B;  4NC6 A;  1OFI A;  4LF4 M;  3TWL A;  3PVS A;  4JN6 A;  2X49 A;  1I4W A;  3RGP A;  1DGH B;  4LFC M;  3GLG E;  1TH4 A;  3DA1 A;  1SXJ A;  1NVM A;  2DNA A;  2FNA A;  4DR7 M;  3IG8 A;  2DAG A;  2JZ1 A;  2DWN A;  2R4E A;  3A45 A;  4R3D A;  3CF6 E;  3U6D A;  1Z5B A;  3GQ5 A;  1K3X A;  2MH8 A;  1JR3 D;  1E94 E;  4DV7 M;  4B7F A;  1QQW A;  3UZU A;  3TWM A;  2HCB A;  4FWG A;  1HNZ M;  1F4I A;  3GPU A;  3SYL A;  2EO2 A;  3KSX A;  3MJ5 A;  3BXW A;  4GHA A;  2CFO A;  4LY6 A;  3U6P A;  3A46 A;  1GVN A;  4EIW A;  4YHH M;  4KOD A;  3ZCB B;  3BBZ A;  4QHT A;  3HKP A;  4L8R C;  4AKH A;  3GRR A;  2CEA A;  3L27 A;  4NSR A;  4CIZ A;  1WGL A;  3GQ4 A;  2XZU A;  2OQ4 A;  1Y8G A;  2JY8 A;  1NHG C;  3F92 A;  2JY6 B;  1Q02 A;  3K1J A;  3GPP A;  1T43 A;  4BB9 A;  2KRK A;  2LHC A;  2GNO A;  2OO9 A;  4LCB A;  1V92 A;  2G8L A;  3LQR A;  3M6A A;  3E46 A;  2I7P A;  4FCV A;  1ZAE A;  3FUT A;  1NSF A;  2RGO A;  3B74 A;  1T6O A;  2RKO A;  3GRY A;  3HHZ A;  4AZF A;  1JR3 E;  5KPT A;  2R45 A;  2CV0 A;  3ZQJ A;  4KT0 F;  2ZTD A;  2VQE M;  4IBF A;  3T38 A;  4GRI A;  2A5Y B;  2DI0 A;  4LFA M;  2QPA A;  4G4N A;  4Z8X A;  2K47 A;  2HKJ A;  5EXT A;  5ITT A;  3L29 A;  1GLN A;  2R18 A;  5GKN A;  3W67 A;  2MR9 A;  4IBK A;  1PGY A;  4AW4 A;  4OU7 A;  3B7Z A;  2LHG A;  2R4J A;  5EP1 A;  4FD2 A;  3SAR A;  1HNX M;  3MHV C;  5EP2 A;  2XLJ A;  4LJ8 A;  2KZU A;  3RE8 A;  2ERC A;  3Q8G A;  3SMP A;  3DZD A;  2V1C A;  5KQD A;  3CGW A;  3U6E A;  1IN8 A;  3HWS A;  5IWA M;  1NNJ A;  2LVP C;  3AFH A;  4RF0 A;  3HX3 A;  1DO2 A;  2UUB M;  3GP1 A;  2VF7 A;  3FTC A; 
#chains in the Genus database with same CATH homology
 2QHO B;  3K9P A;  4R71 A;  1ZV1 A;  1VDL A;  1KYI A;  1C7Y A;  2H5X A;  1UFZ A;  2JNH A;  2HAK A;  3GLH E;  1DO0 A;  2LTU A;  1QZE A;  1VEK A;  2DZL A;  2QNJ A;  1OKS A;  5JI2 E;  4WP2 A;  2KHH A;  2BWB A;  2LBC A;  1HJP A;  2R0I A;  1R4G A;  2MRO B;  3FE3 A;  2ZTC A;  2LVO C;  2L4E A;  1OTR A;  2MJ5 B;  4GEW A;  1AIP C;  1NV8 A;  1OAI A;  2CWB A;  1WHC A;  2L2D A;  2EKK A;  2LVA A;  1TR8 A;  1MN3 A;  2DAI A;  2JUJ A;  4UN2 B;  1ZMU A;  1TTE A;  3MMP A;  3FRH A;  3E21 A;  1CUK A;  4DBG B;  3GLG E;  2RRU A;  2K0B X;  4Q7J A;  2DNA A;  1HT1 E;  4F2L A;  2DAG A;  2EKF A;  2JZ1 A;  2DAE A;  2B3T A;  1IM2 A;  2CP8 A;  1E94 E;  2BWE A;  2KNA A;  1OQY A;  1SG9 A;  2WZJ A;  2DKL A;  1GO5 A;  3K9O A;  1HT2 E;  1F4I A;  2K9D A;  1EFU B;  3LCU A;  1BVS A;  2JY7 A;  1WR1 B;  2DAM A;  4G3O A;  2LVN C;  2HWJ A;  1WIV A;  2JY5 A;  3BBZ A;  3IHP A;  1WGL A;  2L4F A;  1Y8G A;  2JY8 A;  2LVQ D;  3F92 A;  2JY6 B;  1Q02 A;  1HQY E;  1T43 A;  1ZMV A;  3T6P A;  2OO9 A;  2DHY A;  2OOA A;  2MGW A;  1V92 A;  2DEN A;  1WJ7 A;  3E46 A;  1G41 A;  2JP7 A;  1T6O A;  1VEJ A;  1VG5 A;  2JZ0 A;  1IXS A;  1G4A E;  1JR3 E;  4F1I A;  1IFY A;  3LCV B;  2ZTD A;  3GLI E;  2KNV A;  2DI0 A;  1NV9 A;  3FRI A;  3H4J A;  3GLF E;  1A5T A;  3B89 A;  2MR9 A;  1PGY A;  1XXH E;  1VEG A;  1DV0 A;  2OOB A;  2QSF X;  2G3Q A;  1ZMW A;  5DFL A;  1G3I A;  1WGN A;  2EJS A;  1XB2 B;  2O25 A;  4HEO A;  2DAK A;  1P3Q Q;  1YLA A;  1VQ1 A;  2LVP C;  1DO2 A;  3IEC A;  2KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...