4DV6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv6M02
4B3TM 4DR7M 1I94M 1IBMM 2E5LM 2F5PA 2Q2EB 4DR5M 2UUAM 3SAUA 1EE8A 2EA0A 2F5QA 4X64M 2VQFM 5LMNM 1L1TA 4LFCM 4DV2M 4JI3M 1R2ZA 4LF9M 4LF8M 3T1YM 1TDHA 4MB7A 1J5EM 1PJIA 5FLXS 4DV4M 4DUYM 1K3XA 4JYAM 1XNRM 5ITXE 1XNQM 4DR4M 1K3WA 5A2QS 1IBKM 3U6SA 3JR5A 3SATA 2UUBM 4JI7M 4JI5M 4NRWA 1L1ZA 3JAMS 3TWKA 1Z59A 5LMUM 2XZFA 1Z5CA 4JI1M 4LFBM 1N36M 4DR1M 3J81S 4YY3M 4GKKM 4JI4M 3J7AS 4JI6M 2UXBM 3GPYA 1HR0M 5ITRA 1TDZA 3T1HM 2UUCM 4LF7M 2F4VM 1Q3CA 5ITXA 1K82A 4B3RM 4YHHM 2UU9M 1IBLM 3U6DA 1L2CA 3JR4A 5ITTA 4DV3M 4JI8M 4PDGA 3A45A 3GPPA 1KFVA 2UXCM 4DV7M 3U6OA 1HNXM 4DV0M 3GQ4A 5IWAM 4GKJM 3SBJA 1N32M 3C58A 4X65M 3SASA 3VK8A 5IT9S 3VK7A 3GP1A 1HNWM 4PD2A 1PJJA 2ZBKB 3OTOM 3U6CA 4NXNM 4KHPM 1XC8A 1PM5A 1HNZM 1L2DA 1FJGM 3W0FA 3SAWA 2UXDM 3SAVA 4DUZM 1NNJA 1MU5A 1Z5AA 4LF5M 5BR8M 1L2BA 4G4OA 4CISA 1Q39A 1N34M 3U6PA 4B3MM 3A46A 4LF6M 4PCZA 4ITQA 2F5NA 2F5OA 3A42A 4NRVA 3GQ5A 4AQYM 1R2YA 1N33M 1XMOM 2OQ4A 4JI2M 4JV5M 3U6EA 4DR6M 1Q3BA 5ITUA 4OX9M 3TWMA 4DV1M 4DV5M 4DR3M 1Z5BA 3GPUA 3U6LA 5ITQA 4DR2M 3GO8A 3GQ3A 4G4NA 3GPXA 4G4QA 4LFAM 5ITYA 2HKJA 4X66M 2XZUA 2OPFA 4DV6M 4JI0M 4X62M 2ZM6M 4K0KM 3SARA 3J80S 2HHHM 3DOAA 3U6QA 4PDIA 3TWLA 4B3SM 2VQEM 2F5SA 4LF4M 1XMQM 4G4RA 1MX0A 3U6MA 4NXMM
chains in the Genus database with same CATH superfamily
4DR7M 8CATA 1IBMM 5BPVA 4DR5M 3SAUA 2ZANA 3HGIA 4I8OA 5FTKA 2EA0A 2R44A 4AZFA 4X64M 2CHVA 4UN2B 4L78A 2KRKA 4LZZA 4QOZC 4DV2M 2C98A 2O01F 2QHOB 2R0IA 2HAKA 3AOEA 3SHFA 4R7GA 3L28A 1PJIA 1NV9A 1NV8A 2RRUA 2AHMA 3UZUA 4JYAM 3MMPA 2KNVA 4FWHA 4MH0E 2D7GA 4HLQA 2KHHA 2LHCA 1K3WA 3R9XB 1XHBA 3GLFB 2JZ0A 4F1IA 1D0KA 1JR3D 2XF3A 4IJFA 2EJSA 2CV2A 3HJSA 2ZAOA 2DKLA 4JI5M 5EQTA 3PNYA 3KXEC 4NRWA 3B89A 1L1ZA 3PNVA 4FCWA 5L8RF 4MGZE 1Z59A 2DWMA 4AKHA 1IY0A 1Z5CA 2D7EA 1LTMA 2CE7A 3I4VA 4P16A 2C96A 2R46A 2XFSA 1IY2A 4MGHA 2R18A 2I7PA 3HZJA 1Q02A 5EXPA 3KSXA 4GC5A 1SXJD 5ITRA 2F4VM 3T1HM 1UM8A 5ITXA 1K82A 1TH4A 4IIWA 1IBLM 1N77A 1D2NA 3JR4A 1L2CA 3I01M 1NHWC 2KZSA 4JI8M 4WURA 3DA1A 4II7A 1VQ1A 3FE3A 1SXJA 4GIPA 3U60B 2WSFF 1E32A 4DV0M 2LVOC 2X8AA 3MJ5A 3SBJA 1N32M 4FCTA 1IQPA 4LRTA 4WP2A 1MJGM 3THGA 4GH9A 3VK8A 1J09A 4D81A 4QHTA 2BNKA 3AOGA 2ZBKB 3L26A 4XK8F 4OU7A 4AI6A 1HT2E 1XC8A 3KS8A 1IXRC 1EIJA 1TF0B 1PM5A 1GO5A 1NSFA 3GLHB 3W0FA 2XH9A 3SAVA 1QDRA 3GRYA 3HHZA 4FD2A 2N35A 1VEKA 2NQ8C 2YR0A 3KP1E 4MGYE 2D7HA 3KOWE 3SYLA 4FW9A 2KNAA 4I81A 2LH0A 1OIPA 3E9SA 3I4YA 1WIVA 3A46A 4B3MM 4LF6M 2F5NA 2ZAMA 2A5YB 3I51A 4DBGB 1TGUA 1GVNA 1ZV1A 4AQYM 4NRVA 3Q8GA 2Z4SA 4L4UA 2OQ4A 1EFUB 3BOSA 1DO0A 4LY6A 3TWMA 2QBYA 4DV5M 3GPUA 2RKOA 2DAKA 4B7HA 4DR2M 2CV1A 1OAOC 1GL7A 2FFJA 3FD9A 4IBFA 3GPXA 2Y0TA 3D8BA 2J7NA 2MH8A 4KLNA 2DHRA 4RF1A 3IECA 2XZUA 2DZOB 1XXHA 4X62M 2ZM6M 4RF0A 5DYIA 2JY8A 1PJQA 1DGGA 1VDLA 2L2DA 4LRSA 3GLIA 1NHGC 2FNAA 3TWLA 1G59A 1PGYA 5F3WA 5FTJA 3RGSA 3UK6A 3T38A 3UMMA 4GC9A 3W67A 4NSOB 2QPAA 2CV0A 5KO3A 4G4RA 1MX0A 4GEWA 3TL4X 1I94M 2JUJA 1EE8A 2F5QA 4LFCM 1IN4A 2VQFM 4B08A 4IBIA 3FYCA 4REZA 1R2ZA 5FTNA 3E4RA 3GLGA 2C99A 2Z3XA 1WGLA 1MN3A 1F4IA 1J5EM 4LJ6A 3NBXX 3U61A 2QNJA 5FLXS 1E94E 2R45A 3KOXE 4DUYM 1R7RA 2VIIA 2O25A 4NOOB 4DR4M 1IN8A 2RGHA 1HQCA 3BXWA 2XSZA 3AOEC 3GLHE 3K2LA 5KPRA 5A2QS 1IBKM 1P3QQ 3FUTA 3JR5A 2V1CA 4MGKE 3U5ZB 2KZUA 3WHLA 3FUVA 4W5WA 5LMUM 4LFBM 1TH2A 2GNOA 3L27A 3M6AA 5DYGA 1Y8GA 1VEJA 2MROB 4Z8XA 3HHYA 2LNHC 1GJSA 4GKKM 1T43A 3FKEA 2ZTCA 3CGWA 3WHKA 3R8FA 1C7YA 2EO2A 4AKGA 4RKUF 2W82A 2UU9M 3EIHA 4M9XA 2FOIC 4IBGA 1AUAA 2G5GX 2JXNA 2YFQA 3K92A 5ITTA 2KEBA 1X37A 2DZNB 3HHWA 3J7BA 4PDGA 2Y21A 3A45A 1R2YA 2UXCM 1HT1E 1NJGA 1OQYA 1OKSA 2R4EA 5IWAM 4GKJM 4S12A 1GL6A 1OJLA 1ZAEA 3SASA 4I4LA 3E46A 2LVQD 5JI2E 1HNWM 4B7GA 3RFWA 3VKHA 1SXJC 2Z7JA 2HL7A 4RNAA 3AFHA 3U6CA 4LJ5A 1JB0F 4KHPM 3LVVA 1HNZM 2DAGA 5EJCA 3E21A 3SAWA 3VLFB 5EP1A 3KOYE 4DUZM 4NSRA 1MU5A 2QSFX 4EIWA 4M9SA 2VF8A 2CRUA 4G4OA 1SXJB 2LTUA 3TE6A 4PCZA 5FSWA 1OAIA 2F5OA 2QP9X 3T15A 2DWLA 3B7QA 4FWGA 1NY6A 2FH0A 1R6BX 3U6EA 4DR6M 2LBCA 3IG5A 2Y0QA 1N75A 3DFZA 2KXEA 2CHQA 4LZJA 4DV1M 1Z5BA 1CUKA 2K6BA 3U6LA 1XWIA 1QYRA 3KDSE 3LCUA 4HEOA 5JI3E 3GO8A 3LCVB 5EXXA 3SMSA 2JZ1A 2WSCF 3ILKA 3IG8A 3Q8XA 2QCUA 3FRIA 2L4FA 5EP2A 2BJWA 3FUWA 1DGFA 3SMPA 3L25A 1V33A 1KYIA 2JP7A 2DI0A 2LWXA 1QUSA 2QZ4A 3SARA 4GHAA 1E9SA 1IY1A 3J80S 1QDTA 1OFHA 3DOAA 1J7KA 4LJAA 3TPZA 3U6QA 3K9OA 4R3DA 4B3SM 4JXJA 3ZC7B 2CHGA 4LF4M 4CGYB 3L29A 1L8QA 3KS4A 1D0LA 3GLFE 3U6MA 5GKNA 2QBYB 3QYBA 2EKFA 1YE9A 2DENA 4Z6YA 2E5LM 2F5PA 2P5TA 3B7NA 4G6ZA 4Q7JA 3GRRA 1L1TA 4LGYA 1JR3E 3J2PB 5FTMA 4LF9M 1NY5A 2CP8A 4GHLA 2H5XA 3QAUA 3T1YM 1TDHA 4DV4M 3V76A 1K3XA 1V92A 1XXHB 1G71A 4OVZB 3HKPA 1IXSB 1NO1A 1XNRM 2L4EA 5ITXE 1AIPC 3CTWB 3GLHA 3M0EA 1XNQM 4GRIA 2LVAA 2MR9A 3U6SA 3W68A 3DZDA 3FTFA 1YUBA 4M9ZA 1OIZA 2R4JA 2UUBM 4JI7M 2M60A 1YLAA 1SXJE 5H37D 5C18A 2V6ZM 2Z8YM 3JAMS 4L6V6 1BVSA 2XZFA 3PXGA 2WSEF 3GLGB 1KSFX 1N36M 4DR1M 1IN5A 3MHVC 4D80A 3AKZA 3U61B 2K0BX 4LJ4A 2R65A 3B74A 2R6FA 2XSZD 2X4AA 4JI6M 1Z6TA 3NBIA 3GRVA 2UXBM 3K8ZA 1IM2A 2R62A 4CHTB 2UUCM 3VKGA 1Q3CA 1TH3A 1W5TA 4NL4H 1QZEA 4CIZA 2QENA 2CEAA 2ZTDA 4YHHM 2G3QA 2XEPA 3C9PA 1WHCA 2C5RA 1E9RA 1IN7A 2L7HA 4IJEA 2C9CA 4GMQA 4D82A 3GPPA 2WZJA 2DWZB 3U6OA 1HNXM 3KVWA 2J5YA 2V1UA 3GQ4A 1VEGA 3C58A 4M0DA 1D0MA 1ZMVA 4X65M 3SYKA 1G3IA 4PT5A 2H1RA 5IT9S 4LJ7A 4NXMM 1G41A 1RU3A 4TUWA 4PD2A 1QUTA 2DAMA 1PJJA 2EKKA 1C1KA 2OO9A 2B3TA 4JN6A 1A5TA 1PJTA 4MGIE 4LCBA 1GKIA 4L16A 1YSYA 2XGNA 4KODA 2DHYA 5DFLA 1FJGM 2QQ8A 3ZH9B 2KRUA 3AJIB 1FNNA 1G8PA 2L6OA 1NNJA 1Z5AA 1DGHA 2ERCA 4AKIA 4LF5M 1TTEA 2OOAA 2HCBA 4ZPXA 5IREB 5BR8M 1L2BA 1Q39A 1N34M 3SFZA 1QANA 1GLNA 1OTRA 2CFOA 2JA2A 4L15A 1QAMA 5EXTA 3U5ZA 4I5SA 2YQZA 2BWEA 2CUZA 2RGOA 3GQ5A 1XMOM 2JWSA 3VDPA 1S3SA 2OOBA 3C3DA 3NWLA 2FE8A 5ITUA 4DR3M 2LVNC 2VDBB 1PJSA 5KQ8A 5ITQA 3GLGE 2DZLA 4G4NA 2DNAA 4IBBA 2L7IA 2M5ZA 4LFAM 5DNYA 3HHXA 3FTEA 4M0WA 3FUXA 4HL4A 2DWNA 4DV6M 4P17A 4CJ6A 4JI0M 4QOSA 4XGIA 4BB9A 4ANRA 4R71A 2HHHM 2C9OA 4PDIA 1WJ7A 1XB2B 3IHPA 3HU3A 4F2LA 2XLJA 3HJQA 3GLFA 2JY6B 1WXQA 2X49A 2HWJA 4KO8A 4B3TM 2UUAM 1IN6A 2Q2EB 4OW0A 3K1JA 4IBKA 1JR3A 5LMNM 1ZMWA 3HY5A 2MJ5B 1GABA 3L2AA 3GRUA 4JI3M 4FVMA 4LF8M 3PFIA 4Y28F 3BBZA 2L09A 1VG5A 4MB7A 4QNMA 3D8LA 2KA6B 2KDLA 2FS1A 2APLA 2YNMD 1ZMUA 2LHGA 3ZQJA 3VDUA 2DXIA 3T6PA 1IFYA 1V34A 2DAEA 3LVWA 2BWBA 4AG5A 3EIEA 5IZ7D 4B7FA 5KQDA 4NC6A 3SATA 2MGWA 3PVSA 5FTLA 4IBJA 3MK6A 3B9PA 3I04M 3TWKA 1DGBA 1VDDA 3U60A 1G4AE 1GJTA 2XFTA 4JI1M 1PRBA 5KPTA 3J81S 1IXZA 4YY3M 3J27B 1QAQA 2DAIA 4GITA 4JI4M 3AL0C 3J7AS 2Z4RA 2JY5A 1SG9A 3RGPA 5EXSA 4IBCA 3GPYA 3QWLA 4BLCA 1HR0M 1TR8A 2GQFA 3C3EA 1TDZA 3KSJA 4LF7M 4LGMA 3CF0A 4B3RM 3QYEA 3B7ZA 1HJPA 3TQSA 3GLIB 3A98B 3U6DA 2K47A 4DV3M 1NJFA 2G8LA 3ZCBB 2LVPC 1NVMA 3LMMA 1KFVA 4DV7M 3LW5F 3FYDA 2VF7A 4LJ9A 2O5RA 2I7NA 3LQQA 1T3TA 1W5SA 1ORYB 2Y20A 3UJNA 4AG6A 2LXEA 2JNHA 2CWBA 3UGJA 3VK7A 4KT0F 5EP4A 3GP1A 4LJ8A 1QAOA 2KNZA 3OTOM 4NXNM 3HX3A 3FRHA 3AV0A 3H4MA 5EP3A 1L2DA 1JQJC 3KP0E 2UXDM 3HJ8A 4OVZA 2EUCA 3F92A 1IXSA 7CATA 1I4WA 5C1BA 4LG2A 1LV7A 2BJVA 4CISA 4L8RC 3U6PA 3SC3A 4ITQA 3M7GA 3FTCA 4IBEA 4AW4A 5E6JA 4XBOA 2DVWB 3A42A 1QQWA 3H4JA 3LQRA 4FCVA 1N33M 4QHSA 4JI2M 1QZMA 4JV5M 1ZQ9A 1Q3BA 4OX9M 4WW0A 4BBAA 4MM3B 3KW6A 1R4GA 4G3OA 5KPZA 3GQ3A 1T6OA 3SHGB 4G4QA 3KFUG 1DO2A 3HWSA 5ITYA 1R5LA 1DGHB 4QNRA 1HQYE 3RE8A 2HKJA 5E26A 3HU1A 3K9PA 3VFDA 4X66M 3CF6E 1OFIA 4FWDA 2OPFA 4K0KM 3HU2A 3W0LB 1XXHE 3FUUA 1WR1B 1UFZA 3CF2A 2JY7A 3KOZE 1N78A 1NNUC 2J7OA 1WGNA 3GLIE 2VQEM 2K9DA 2F5SA 1DV0A 4A3VB 1XMQM 2KW0A 1H6UA 3FTDA 4IBDA 1QVRA
chains in the Genus database with same CATH topology
4DR7M 8CATA 1IBMM 5BPVA 4DR5M 3SAUA 2ZANA 3HGIA 4I8OA 5FTKA 2EA0A 4AZFA 4X64M 2CHVA 4L78A 2KRKA 4LZZA 4QOZC 4DV2M 2C98A 3AOEA 3SHFA 4R7GA 3L28A 1PJIA 2AHMA 3UZUA 4JYAM 4FWHA 4MH0E 2D7GA 4HLQA 1K3WA 3R9XB 1XHBA 3GLFB 1JR3D 2XF3A 4IJFA 2CV2A 3HJSA 2ZAOA 4JI5M 5EQTA 3PNYA 3KXEC 4NRWA 1L1ZA 3PNVA 4FCWA 4MGZE 1Z59A 2DWMA 4AKHA 1IY0A 1Z5CA 2D7EA 2CE7A 3I4VA 4P16A 2C96A 2R46A 2XFSA 1IY2A 4MGHA 2R18A 2I7PA 5EXPA 3KSXA 4GC5A 1SXJD 5ITRA 2F4VM 3T1HM 1UM8A 5ITXA 1K82A 1TH4A 4IIWA 1IBLM 1N77A 1D2NA 3JR4A 1L2CA 1NHWC 2KZSA 4JI8M 4WURA 3DA1A 4II7A 4GIPA 1SXJA 3U60B 1E32A 4DV0M 2X8AA 3MJ5A 3SBJA 1N32M 4FCTA 1IQPA 4LRTA 3THGA 3VK8A 4GH9A 1J09A 4D81A 4QHTA 2BNKA 3AOGA 2ZBKB 3L26A 4OU7A 4AI6A 1HT2E 1XC8A 3KS8A 1IXRC 1PM5A 1NSFA 3GLHB 3W0FA 2XH9A 3SAVA 3GRYA 3HHZA 4FD2A 2NQ8C 2YR0A 3KP1E 4MGYE 2D7HA 3KOWE 3SYLA 4FW9A 4I81A 2LH0A 3E9SA 3I4YA 4B3MM 3A46A 4LF6M 2F5NA 2ZAMA 2A5YB 3I51A 1TGUA 1GVNA 4AQYM 4NRVA 2Z4SA 4L4UA 2OQ4A 3BOSA 1DO0A 4LY6A 3TWMA 2QBYA 4DV5M 3GPUA 2RKOA 4B7HA 4DR2M 2CV1A 1GL7A 2FFJA 3FD9A 4IBFA 3GPXA 2Y0TA 3D8BA 2J7NA 4KLNA 4RF1A 2DHRA 2XZUA 2DZOB 1XXHA 4X62M 2ZM6M 4RF0A 5DYIA 1DGGA 4LRSA 3GLIA 1NHGC 2FNAA 3TWLA 1G59A 5F3WA 5FTJA 3RGSA 3UK6A 3T38A 3UMMA 4GC9A 4NSOB 2QPAA 2CV0A 5KO3A 4G4RA 1MX0A 3TL4X 1I94M 1EE8A 2F5QA 4LFCM 1IN4A 2VQFM 4B08A 4IBIA 3FYCA 4REZA 1R2ZA 5FTNA 3E4RA 3GLGA 2C99A 2Z3XA 1J5EM 4LJ6A 3U61A 5FLXS 1E94E 2R45A 3KOXE 4DUYM 1R7RA 2VIIA 4NOOB 4DR4M 1IN8A 2RGHA 1HQCA 3K2LA 2XSZA 3AOEC 5KPRA 5A2QS 1IBKM 3FUTA 3JR5A 2V1CA 4MGKE 3U5ZB 2KZUA 3WHLA 3FUVA 4W5WA 5LMUM 4LFBM 1TH2A 3L27A 3M6AA 5DYGA 4Z8XA 3HHYA 2LNHC 4GKKM 3FKEA 3WHKA 3R8FA 2EO2A 4AKGA 2W82A 2UU9M 3EIHA 4M9XA 2FOIC 4IBGA 2G5GX 2YFQA 5ITTA 3K92A 2KEBA 3HHWA 1X37A 2DZNB 3J7BA 4PDGA 2Y21A 3A45A 2UXCM 1HT1E 1NJGA 2R4EA 5IWAM 4GKJM 4S12A 1GL6A 1OJLA 1ZAEA 3SASA 4I4LA 5JI2E 1HNWM 4B7GA 3RFWA 3VKHA 1SXJC 2Z7JA 2HL7A 4RNAA 3AFHA 3U6CA 4LJ5A 4KHPM 3LVVA 1HNZM 5EJCA 3SAWA 3VLFB 5EP1A 3KOYE 4DUZM 4NSRA 1MU5A 4EIWA 4M9SA 4G4OA 1SXJB 3TE6A 4PCZA 5FSWA 2F5OA 2QP9X 3T15A 2DWLA 4FWGA 1NY6A 1R6BX 3U6EA 4DR6M 3IG5A 2Y0QA 1N75A 3DFZA 2KXEA 2CHQA 4LZJA 4DV1M 1Z5BA 3U6LA 1XWIA 1QYRA 3KDSE 5JI3E 3GO8A 5EXXA 3SMSA 3IG8A 3ILKA 3Q8XA 2QCUA 5EP2A 2BJWA 3FUWA 1DGFA 3SMPA 3L25A 1KYIA 2LWXA 2QZ4A 4GHAA 3SARA 1E9SA 1IY1A 3J80S 1OFHA 3DOAA 1J7KA 4LJAA 3TPZA 3U6QA 4R3DA 4B3SM 4JXJA 3ZC7B 2CHGA 4LF4M 4CGYB 3L29A 1L8QA 3KS4A 3U6MA 4NXMM 5GKNA 2QBYB 1YE9A 4Z6YA 2E5LM 2F5PA 2P5TA 4G6ZA 1L1TA 3GRRA 4LGYA 3J2PB 5FTMA 4LF9M 1NY5A 4GHLA 3QAUA 3T1YM 1TDHA 4DV4M 1K3XA 1XXHB 4OVZB 3HKPA 1IXSB 1XNRM 5ITXE 3CTWB 3GLHA 3M0EA 1XNQM 4GRIA 3U6SA 3FTFA 3DZDA 1YUBA 4M9ZA 2R4JA 2UUBM 4JI7M 2M60A 5H37D 1SXJE 5C18A 2V6ZM 3JAMS 2XZFA 3PXGA 3GLGB 1KSFX 1N36M 4DR1M 1IN5A 3MHVC 4D80A 3AKZA 3U61B 4LJ4A 2R65A 2XSZD 2X4AA 4JI6M 1Z6TA 3NBIA 3GRVA 2UXBM 3K8ZA 1IM2A 2R62A 4CHTB 2UUCM 3VKGA 1Q3CA 1TH3A 1W5TA 4NL4H 2QENA 2CEAA 4YHHM 2XEPA 2C5RA 1E9RA 1IN7A 2L7HA 4IJEA 2C9CA 4GMQA 4D82A 3GPPA 2DWZB 3U6OA 1HNXM 3KVWA 2V1UA 3GQ4A 3C58A 4M0DA 4X65M 3SYKA 1G3IA 4PT5A 2H1RA 5IT9S 4LJ7A 1G41A 4TUWA 4PD2A 1PJJA 1C1KA 4JN6A 4MGIE 4LCBA 1GKIA 4L16A 1YSYA 2XGNA 4KODA 1FJGM 3ZH9B 2KRUA 3AJIB 1FNNA 1G8PA 2L6OA 1NNJA 1Z5AA 1DGHA 2ERCA 4AKIA 4LF5M 2HCBA 4ZPXA 5IREB 5BR8M 1L2BA 1Q39A 1N34M 3SFZA 1QANA 1GLNA 2CFOA 2JA2A 4L15A 1QAMA 5EXTA 3U5ZA 4I5SA 2YQZA 2CUZA 2RGOA 3GQ5A 1R2YA 1XMOM 3VDPA 1S3SA 3NWLA 2FE8A 5ITUA 4DR3M 5KQ8A 5ITQA 4G4NA 4IBBA 2L7IA 2M5ZA 4LFAM 5DNYA 3HHXA 3FTEA 4M0WA 3FUXA 4HL4A 2DWNA 4DV6M 4JI0M 4QOSA 4XGIA 4BB9A 2HHHM 2C9OA 4PDIA 3HU3A 2XLJA 3HJQA 3GLFA 1WXQA 4KO8A 2X49A 4B3TM 2UUAM 1IN6A 2Q2EB 4OW0A 3K1JA 4IBKA 1JR3A 5LMNM 3L2AA 3GRUA 4JI3M 4FVMA 4LF8M 3PFIA 2L09A 4MB7A 4QNMA 3D8LA 2KA6B 2YNMD 3VDUA 2DXIA 3LVWA 4AG5A 3EIEA 5IZ7D 4B7FA 5KQDA 3SATA 3PVSA 5FTLA 4IBJA 3MK6A 3B9PA 3TWKA 1DGBA 1VDDA 3U60A 1G4AE 2XFTA 4JI1M 5KPTA 3J81S 1IXZA 4YY3M 3J27B 1QAQA 4GITA 4JI4M 3AL0C 3J7AS 2Z4RA 3RGPA 5EXSA 4IBCA 3GPYA 3QWLA 4BLCA 1HR0M 1TDZA 4LF7M 3KSJA 4LGMA 3CF0A 4B3RM 3TQSA 3GLIB 3A98B 3U6DA 2K47A 4DV3M 1NJFA 2G8LA 3ZCBB 3LMMA 1NVMA 1KFVA 4DV7M 3FYDA 4LJ9A 2O5RA 2I7NA 3LQQA 1T3TA 1W5SA 1ORYB 2Y20A 3UJNA 4AG6A 2LXEA 3UGJA 3VK7A 5EP4A 3GP1A 4LJ8A 1QAOA 3OTOM 4NXNM 3AV0A 3H4MA 5EP3A 1L2DA 1JQJC 3KP0E 2UXDM 3HJ8A 4OVZA 2EUCA 7CATA 1I4WA 5C1BA 4LG2A 1LV7A 2BJVA 4CISA 4L8RC 3U6PA 3SC3A 4ITQA 3M7GA 3FTCA 4IBEA 4AW4A 5E6JA 4XBOA 2DVWB 3A42A 1QQWA 3LQRA 4FCVA 1N33M 4QHSA 4JI2M 1QZMA 4JV5M 1ZQ9A 1Q3BA 4OX9M 4WW0A 4BBAA 4MM3B 3KW6A 5KPZA 3GQ3A 3SHGB 4G4QA 3KFUG 1DO2A 3HWSA 5ITYA 4QNRA 1DGHB 1HQYE 3RE8A 2HKJA 5E26A 3HU1A 3VFDA 4X66M 2OPFA 3CF6E 1OFIA 4FWDA 4K0KM 3HU2A 3W0LB 3FUUA 3KOZE 3CF2A 1N78A 1NNUC 2J7OA 2VQEM 2F5SA 4A3VB 1XMQM 2KW0A 1H6UA 3FTDA 4IBDA 1QVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T M;  4DR7 M;  1I94 M;  1IBM M;  2E5L M;  2F5P A;  2Q2E B;  4DR5 M;  2UUA M;  3SAU A;  1EE8 A;  2EA0 A;  2F5Q A;  4X64 M;  2VQF M;  5LMN M;  1L1T A;  4LFC M;  4DV2 M;  4JI3 M;  1R2Z A;  4LF9 M;  4LF8 M;  3T1Y M;  1TDH A;  4MB7 A;  1J5E M;  1PJI A;  5FLX S;  4DV4 M;  4DUY M;  1K3X A;  4JYA M;  1XNR M;  5ITX E;  1XNQ M;  4DR4 M;  1K3W A;  5A2Q S;  1IBK M;  3U6S A;  3JR5 A;  3SAT A;  2UUB M;  4JI7 M;  4JI5 M;  4NRW A;  1L1Z A;  3JAM S;  3TWK A;  1Z59 A;  5LMU M;  2XZF A;  1Z5C A;  4JI1 M;  4LFB M;  1N36 M;  4DR1 M;  3J81 S;  4YY3 M;  4GKK M;  4JI4 M;  3J7A S;  4JI6 M;  2UXB M;  3GPY A;  1HR0 M;  5ITR A;  1TDZ A;  3T1H M;  2UUC M;  4LF7 M;  2F4V M;  1Q3C A;  5ITX A;  1K82 A;  4B3R M;  4YHH M;  2UU9 M;  1IBL M;  3U6D A;  1L2C A;  3JR4 A;  5ITT A;  4DV3 M;  4JI8 M;  4PDG A;  3A45 A;  3GPP A;  1KFV A;  2UXC M;  4DV7 M;  3U6O A;  1HNX M;  4DV0 M;  3GQ4 A;  5IWA M;  4GKJ M;  3SBJ A;  1N32 M;  3C58 A;  4X65 M;  3SAS A;  3VK8 A;  5IT9 S;  3VK7 A;  3GP1 A;  1HNW M;  4PD2 A;  1PJJ A;  2ZBK B;  3OTO M;  3U6C A;  4NXN M;  4KHP M;  1XC8 A;  1PM5 A;  1HNZ M;  1L2D A;  1FJG M;  3W0F A;  3SAW A;  2UXD M;  3SAV A;  4DUZ M;  1NNJ A;  1MU5 A;  1Z5A A;  4LF5 M;  5BR8 M;  1L2B A;  4G4O A;  4CIS A;  1Q39 A;  1N34 M;  3U6P A;  4B3M M;  3A46 A;  4LF6 M;  4PCZ A;  4ITQ A;  2F5N A;  2F5O A;  3A42 A;  4NRV A;  3GQ5 A;  4AQY M;  1R2Y A;  1N33 M;  1XMO M;  2OQ4 A;  4JI2 M;  4JV5 M;  3U6E A;  4DR6 M;  1Q3B A;  5ITU A;  4OX9 M;  3TWM A;  4DV1 M;  4DV5 M;  4DR3 M;  1Z5B A;  3GPU A;  3U6L A;  5ITQ A;  4DR2 M;  3GO8 A;  3GQ3 A;  4G4N A;  3GPX A;  4G4Q A;  4LFA M;  5ITY A;  2HKJ A;  4X66 M;  2XZU A;  2OPF A;  4DV6 M;  4JI0 M;  4X62 M;  2ZM6 M;  4K0K M;  3SAR A;  3J80 S;  2HHH M;  3DOA A;  3U6Q A;  4PDI A;  3TWL A;  4B3S M;  2VQE M;  2F5S A;  4LF4 M;  1XMQ M;  4G4R A;  1MX0 A;  3U6M A;  4NXM M; 
#chains in the Genus database with same CATH topology
 4DR7 M;  8CAT A;  1IBM M;  5BPV A;  4DR5 M;  3SAU A;  2ZAN A;  3HGI A;  4I8O A;  5FTK A;  2EA0 A;  2R44 A;  4AZF A;  4X64 M;  2CHV A;  4UN2 B;  4L78 A;  2KRK A;  4LZZ A;  4QOZ C;  4DV2 M;  2C98 A;  2O01 F;  2QHO B;  2R0I A;  2HAK A;  3AOE A;  3SHF A;  4R7G A;  3L28 A;  1PJI A;  1NV9 A;  1NV8 A;  2RRU A;  2AHM A;  3UZU A;  4JYA M;  3MMP A;  2KNV A;  4FWH A;  4MH0 E;  2D7G A;  4HLQ A;  2KHH A;  2LHC A;  1K3W A;  3R9X B;  1XHB A;  3GLF B;  2JZ0 A;  4F1I A;  1D0K A;  1JR3 D;  2XF3 A;  4IJF A;  2EJS A;  2CV2 A;  3HJS A;  2ZAO A;  2DKL A;  4JI5 M;  5EQT A;  3PNY A;  3KXE C;  4NRW A;  3B89 A;  1L1Z A;  3PNV A;  4FCW A;  5L8R F;  4MGZ E;  1Z59 A;  2DWM A;  4AKH A;  1IY0 A;  1Z5C A;  2D7E A;  1LTM A;  2CE7 A;  3I4V A;  4P16 A;  2C96 A;  2R46 A;  2XFS A;  1IY2 A;  4MGH A;  2R18 A;  2I7P A;  3HZJ A;  1Q02 A;  5EXP A;  3KSX A;  4GC5 A;  1SXJ D;  5ITR A;  2F4V M;  3T1H M;  1UM8 A;  5ITX A;  1K82 A;  1TH4 A;  4IIW A;  1IBL M;  1N77 A;  1D2N A;  3JR4 A;  1L2C A;  3I01 M;  1NHW C;  2KZS A;  4JI8 M;  4WUR A;  3DA1 A;  4II7 A;  1VQ1 A;  3FE3 A;  1SXJ A;  4GIP A;  3U60 B;  2WSF F;  1E32 A;  4DV0 M;  2LVO C;  2X8A A;  3MJ5 A;  3SBJ A;  1N32 M;  4FCT A;  1IQP A;  4LRT A;  4WP2 A;  1MJG M;  3THG A;  4GH9 A;  3VK8 A;  1J09 A;  4D81 A;  4QHT A;  2BNK A;  3AOG A;  2ZBK B;  3L26 A;  4XK8 F;  4OU7 A;  4AI6 A;  1HT2 E;  1XC8 A;  3KS8 A;  1IXR C;  1EIJ A;  1TF0 B;  1PM5 A;  1GO5 A;  1NSF A;  3GLH B;  3W0F A;  2XH9 A;  3SAV A;  1QDR A;  3GRY A;  3HHZ A;  4FD2 A;  2N35 A;  1VEK A;  2NQ8 C;  2YR0 A;  3KP1 E;  4MGY E;  2D7H A;  3KOW E;  3SYL A;  4FW9 A;  2KNA A;  4I81 A;  2LH0 A;  1OIP A;  3E9S A;  3I4Y A;  1WIV A;  3A46 A;  4B3M M;  4LF6 M;  2F5N A;  2ZAM A;  2A5Y B;  3I51 A;  4DBG B;  1TGU A;  1GVN A;  1ZV1 A;  4AQY M;  4NRV A;  3Q8G A;  2Z4S A;  4L4U A;  2OQ4 A;  1EFU B;  3BOS A;  1DO0 A;  4LY6 A;  3TWM A;  2QBY A;  4DV5 M;  3GPU A;  2RKO A;  2DAK A;  4B7H A;  4DR2 M;  2CV1 A;  1OAO C;  1GL7 A;  2FFJ A;  3FD9 A;  4IBF A;  3GPX A;  2Y0T A;  3D8B A;  2J7N A;  2MH8 A;  4KLN A;  2DHR A;  4RF1 A;  3IEC A;  2XZU A;  2DZO B;  1XXH A;  4X62 M;  2ZM6 M;  4RF0 A;  5DYI A;  2JY8 A;  1PJQ A;  1DGG A;  1VDL A;  2L2D A;  4LRS A;  3GLI A;  1NHG C;  2FNA A;  3TWL A;  1G59 A;  1PGY A;  5F3W A;  5FTJ A;  3RGS A;  3UK6 A;  3T38 A;  3UMM A;  4GC9 A;  3W67 A;  4NSO B;  2QPA A;  2CV0 A;  5KO3 A;  4G4R A;  1MX0 A;  4GEW A;  3TL4 X;  1I94 M;  2JUJ A;  1EE8 A;  2F5Q A;  4LFC M;  1IN4 A;  2VQF M;  4B08 A;  4IBI A;  3FYC A;  4REZ A;  1R2Z A;  5FTN A;  3E4R A;  3GLG A;  2C99 A;  2Z3X A;  1WGL A;  1MN3 A;  1F4I A;  1J5E M;  4LJ6 A;  3NBX X;  3U61 A;  2QNJ A;  5FLX S;  1E94 E;  2R45 A;  3KOX E;  4DUY M;  1R7R A;  2VII A;  2O25 A;  4NOO B;  4DR4 M;  1IN8 A;  2RGH A;  1HQC A;  3BXW A;  2XSZ A;  3AOE C;  3GLH E;  3K2L A;  5KPR A;  5A2Q S;  1IBK M;  1P3Q Q;  3FUT A;  3JR5 A;  2V1C A;  4MGK E;  3U5Z B;  2KZU A;  3WHL A;  3FUV A;  4W5W A;  5LMU M;  4LFB M;  1TH2 A;  2GNO A;  3L27 A;  3M6A A;  5DYG A;  1Y8G A;  1VEJ A;  2MRO B;  4Z8X A;  3HHY A;  2LNH C;  1GJS A;  4GKK M;  1T43 A;  3FKE A;  2ZTC A;  3CGW A;  3WHK A;  3R8F A;  1C7Y A;  2EO2 A;  4AKG A;  4RKU F;  2W82 A;  2UU9 M;  3EIH A;  4M9X A;  2FOI C;  4IBG A;  1AUA A;  2G5G X;  2JXN A;  2YFQ A;  3K92 A;  5ITT A;  2KEB A;  1X37 A;  2DZN B;  3HHW A;  3J7B A;  4PDG A;  2Y21 A;  3A45 A;  1R2Y A;  2UXC M;  1HT1 E;  1NJG A;  1OQY A;  1OKS A;  2R4E A;  5IWA M;  4GKJ M;  4S12 A;  1GL6 A;  1OJL A;  1ZAE A;  3SAS A;  4I4L A;  3E46 A;  2LVQ D;  5JI2 E;  1HNW M;  4B7G A;  3RFW A;  3VKH A;  1SXJ C;  2Z7J A;  2HL7 A;  4RNA A;  3AFH A;  3U6C A;  4LJ5 A;  1JB0 F;  4KHP M;  3LVV A;  1HNZ M;  2DAG A;  5EJC A;  3E21 A;  3SAW A;  3VLF B;  5EP1 A;  3KOY E;  4DUZ M;  4NSR A;  1MU5 A;  2QSF X;  4EIW A;  4M9S A;  2VF8 A;  2CRU A;  4G4O A;  1SXJ B;  2LTU A;  3TE6 A;  4PCZ A;  5FSW A;  1OAI A;  2F5O A;  2QP9 X;  3T15 A;  2DWL A;  3B7Q A;  4FWG A;  1NY6 A;  2FH0 A;  1R6B X;  3U6E A;  4DR6 M;  2LBC A;  3IG5 A;  2Y0Q A;  1N75 A;  3DFZ A;  2KXE A;  2CHQ A;  4LZJ A;  4DV1 M;  1Z5B A;  1CUK A;  2K6B A;  3U6L A;  1XWI A;  1QYR A;  3KDS E;  3LCU A;  4HEO A;  5JI3 E;  3GO8 A;  3LCV B;  5EXX A;  3SMS A;  2JZ1 A;  2WSC F;  3ILK A;  3IG8 A;  3Q8X A;  2QCU A;  3FRI A;  2L4F A;  5EP2 A;  2BJW A;  3FUW A;  1DGF A;  3SMP A;  3L25 A;  1V33 A;  1KYI A;  2JP7 A;  2DI0 A;  2LWX A;  1QUS A;  2QZ4 A;  3SAR A;  4GHA A;  1E9S A;  1IY1 A;  3J80 S;  1QDT A;  1OFH A;  3DOA A;  1J7K A;  4LJA A;  3TPZ A;  3U6Q A;  3K9O A;  4R3D A;  4B3S M;  4JXJ A;  3ZC7 B;  2CHG A;  4LF4 M;  4CGY B;  3L29 A;  1L8Q A;  3KS4 A;  1D0L A;  3GLF E;  3U6M A;  5GKN A;  2QBY B;  3QYB A;  2EKF A;  1YE9 A;  2DEN A;  4Z6Y A;  2E5L M;  2F5P A;  2P5T A;  3B7N A;  4G6Z A;  4Q7J A;  3GRR A;  1L1T A;  4LGY A;  1JR3 E;  3J2P B;  5FTM A;  4LF9 M;  1NY5 A;  2CP8 A;  4GHL A;  2H5X A;  3QAU A;  3T1Y M;  1TDH A;  4DV4 M;  3V76 A;  1K3X A;  1V92 A;  1XXH B;  1G71 A;  4OVZ B;  3HKP A;  1IXS B;  1NO1 A;  1XNR M;  2L4E A;  5ITX E;  1AIP C;  3CTW B;  3GLH A;  3M0E A;  1XNQ M;  4GRI A;  2LVA A;  2MR9 A;  3U6S A;  3W68 A;  3DZD A;  3FTF A;  1YUB A;  4M9Z A;  1OIZ A;  2R4J A;  2UUB M;  4JI7 M;  2M60 A;  1YLA A;  1SXJ E;  5H37 D;  5C18 A;  2V6Z M;  2Z8Y M;  3JAM S;  4L6V 6;  1BVS A;  2XZF A;  3PXG A;  2WSE F;  3GLG B;  1KSF X;  1N36 M;  4DR1 M;  1IN5 A;  3MHV C;  4D80 A;  3AKZ A;  3U61 B;  2K0B X;  4LJ4 A;  2R65 A;  3B74 A;  2R6F A;  2XSZ D;  2X4A A;  4JI6 M;  1Z6T A;  3NBI A;  3GRV A;  2UXB M;  3K8Z A;  1IM2 A;  2R62 A;  4CHT B;  2UUC M;  3VKG A;  1Q3C A;  1TH3 A;  1W5T A;  4NL4 H;  1QZE A;  4CIZ A;  2QEN A;  2CEA A;  2ZTD A;  4YHH M;  2G3Q A;  2XEP A;  3C9P A;  1WHC A;  2C5R A;  1E9R A;  1IN7 A;  2L7H A;  4IJE A;  2C9C A;  4GMQ A;  4D82 A;  3GPP A;  2WZJ A;  2DWZ B;  3U6O A;  1HNX M;  3KVW A;  2J5Y A;  2V1U A;  3GQ4 A;  1VEG A;  3C58 A;  4M0D A;  1D0M A;  1ZMV A;  4X65 M;  3SYK A;  1G3I A;  4PT5 A;  2H1R A;  5IT9 S;  4LJ7 A;  4NXM M;  1G41 A;  1RU3 A;  4TUW A;  4PD2 A;  1QUT A;  2DAM A;  1PJJ A;  2EKK A;  1C1K A;  2OO9 A;  2B3T A;  4JN6 A;  1A5T A;  1PJT A;  4MGI E;  4LCB A;  1GKI A;  4L16 A;  1YSY A;  2XGN A;  4KOD A;  2DHY A;  5DFL A;  1FJG M;  2QQ8 A;  3ZH9 B;  2KRU A;  3AJI B;  1FNN A;  1G8P A;  2L6O A;  1NNJ A;  1Z5A A;  1DGH A;  2ERC A;  4AKI A;  4LF5 M;  1TTE A;  2OOA A;  2HCB A;  4ZPX A;  5IRE B;  5BR8 M;  1L2B A;  1Q39 A;  1N34 M;  3SFZ A;  1QAN A;  1GLN A;  1OTR A;  2CFO A;  2JA2 A;  4L15 A;  1QAM A;  5EXT A;  3U5Z A;  4I5S A;  2YQZ A;  2BWE A;  2CUZ A;  2RGO A;  3GQ5 A;  1XMO M;  2JWS A;  3VDP A;  1S3S A;  2OOB A;  3C3D A;  3NWL A;  2FE8 A;  5ITU A;  4DR3 M;  2LVN C;  2VDB B;  1PJS A;  5KQ8 A;  5ITQ A;  3GLG E;  2DZL A;  4G4N A;  2DNA A;  4IBB A;  2L7I A;  2M5Z A;  4LFA M;  5DNY A;  3HHX A;  3FTE A;  4M0W A;  3FUX A;  4HL4 A;  2DWN A;  4DV6 M;  4P17 A;  4CJ6 A;  4JI0 M;  4QOS A;  4XGI A;  4BB9 A;  4ANR A;  4R71 A;  2HHH M;  2C9O A;  4PDI A;  1WJ7 A;  1XB2 B;  3IHP A;  3HU3 A;  4F2L A;  2XLJ A;  3HJQ A;  3GLF A;  2JY6 B;  1WXQ A;  2X49 A;  2HWJ A;  4KO8 A;  4B3T M;  2UUA M;  1IN6 A;  2Q2E B;  4OW0 A;  3K1J A;  4IBK A;  1JR3 A;  5LMN M;  1ZMW A;  3HY5 A;  2MJ5 B;  1GAB A;  3L2A A;  3GRU A;  4JI3 M;  4FVM A;  4LF8 M;  3PFI A;  4Y28 F;  3BBZ A;  2L09 A;  1VG5 A;  4MB7 A;  4QNM A;  3D8L A;  2KA6 B;  2KDL A;  2FS1 A;  2APL A;  2YNM D;  1ZMU A;  2LHG A;  3ZQJ A;  3VDU A;  2DXI A;  3T6P A;  1IFY A;  1V34 A;  2DAE A;  3LVW A;  2BWB A;  4AG5 A;  3EIE A;  5IZ7 D;  4B7F A;  5KQD A;  4NC6 A;  3SAT A;  2MGW A;  3PVS A;  5FTL A;  4IBJ A;  3MK6 A;  3B9P A;  3I04 M;  3TWK A;  1DGB A;  1VDD A;  3U60 A;  1G4A E;  1GJT A;  2XFT A;  4JI1 M;  1PRB A;  5KPT A;  3J81 S;  1IXZ A;  4YY3 M;  3J27 B;  1QAQ A;  2DAI A;  4GIT A;  4JI4 M;  3AL0 C;  3J7A S;  2Z4R A;  2JY5 A;  1SG9 A;  3RGP A;  5EXS A;  4IBC A;  3GPY A;  3QWL A;  4BLC A;  1HR0 M;  1TR8 A;  2GQF A;  3C3E A;  1TDZ A;  3KSJ A;  4LF7 M;  4LGM A;  3CF0 A;  4B3R M;  3QYE A;  3B7Z A;  1HJP A;  3TQS A;  3GLI B;  3A98 B;  3U6D A;  2K47 A;  4DV3 M;  1NJF A;  2G8L A;  3ZCB B;  2LVP C;  1NVM A;  3LMM A;  1KFV A;  4DV7 M;  3LW5 F;  3FYD A;  2VF7 A;  4LJ9 A;  2O5R A;  2I7N A;  3LQQ A;  1T3T A;  1W5S A;  1ORY B;  2Y20 A;  3UJN A;  4AG6 A;  2LXE A;  2JNH A;  2CWB A;  3UGJ A;  3VK7 A;  4KT0 F;  5EP4 A;  3GP1 A;  4LJ8 A;  1QAO A;  2KNZ A;  3OTO M;  4NXN M;  3HX3 A;  3FRH A;  3AV0 A;  3H4M A;  5EP3 A;  1L2D A;  1JQJ C;  3KP0 E;  2UXD M;  3HJ8 A;  4OVZ A;  2EUC A;  3F92 A;  1IXS A;  7CAT A;  1I4W A;  5C1B A;  4LG2 A;  1LV7 A;  2BJV A;  4CIS A;  4L8R C;  3U6P A;  3SC3 A;  4ITQ A;  3M7G A;  3FTC A;  4IBE A;  4AW4 A;  5E6J A;  4XBO A;  2DVW B;  3A42 A;  1QQW A;  3H4J A;  3LQR A;  4FCV A;  1N33 M;  4QHS A;  4JI2 M;  1QZM A;  4JV5 M;  1ZQ9 A;  1Q3B A;  4OX9 M;  4WW0 A;  4BBA A;  4MM3 B;  3KW6 A;  1R4G A;  4G3O A;  5KPZ A;  3GQ3 A;  1T6O A;  3SHG B;  4G4Q A;  3KFU G;  1DO2 A;  3HWS A;  5ITY A;  1R5L A;  1DGH B;  4QNR A;  1HQY E;  3RE8 A;  2HKJ A;  5E26 A;  3HU1 A;  3K9P A;  3VFD A;  4X66 M;  3CF6 E;  1OFI A;  4FWD A;  2OPF A;  4K0K M;  3HU2 A;  3W0L B;  1XXH E;  3FUU A;  1WR1 B;  1UFZ A;  3CF2 A;  2JY7 A;  3KOZ E;  1N78 A;  1NNU C;  2J7O A;  1WGN A;  3GLI E;  2VQE M;  2K9D A;  2F5S A;  1DV0 A;  4A3V B;  1XMQ M;  2KW0 A;  1H6U A;  3FTD A;  4IBD A;  1QVR A; 
#chains in the Genus database with same CATH homology
 4DR7 M;  8CAT A;  1IBM M;  5BPV A;  4DR5 M;  3SAU A;  2ZAN A;  3HGI A;  4I8O A;  5FTK A;  2EA0 A;  4AZF A;  4X64 M;  2CHV A;  4L78 A;  2KRK A;  4LZZ A;  4QOZ C;  4DV2 M;  2C98 A;  3AOE A;  3SHF A;  4R7G A;  3L28 A;  1PJI A;  2AHM A;  3UZU A;  4JYA M;  4FWH A;  4MH0 E;  2D7G A;  4HLQ A;  1K3W A;  3R9X B;  1XHB A;  3GLF B;  1JR3 D;  2XF3 A;  4IJF A;  2CV2 A;  3HJS A;  2ZAO A;  4JI5 M;  5EQT A;  3PNY A;  3KXE C;  4NRW A;  1L1Z A;  3PNV A;  4FCW A;  4MGZ E;  1Z59 A;  2DWM A;  4AKH A;  1IY0 A;  1Z5C A;  2D7E A;  2CE7 A;  3I4V A;  4P16 A;  2C96 A;  2R46 A;  2XFS A;  1IY2 A;  4MGH A;  2R18 A;  2I7P A;  5EXP A;  3KSX A;  4GC5 A;  1SXJ D;  5ITR A;  2F4V M;  3T1H M;  1UM8 A;  5ITX A;  1K82 A;  1TH4 A;  4IIW A;  1IBL M;  1N77 A;  1D2N A;  3JR4 A;  1L2C A;  1NHW C;  2KZS A;  4JI8 M;  4WUR A;  3DA1 A;  4II7 A;  4GIP A;  1SXJ A;  3U60 B;  1E32 A;  4DV0 M;  2X8A A;  3MJ5 A;  3SBJ A;  1N32 M;  4FCT A;  1IQP A;  4LRT A;  3THG A;  3VK8 A;  4GH9 A;  1J09 A;  4D81 A;  4QHT A;  2BNK A;  3AOG A;  2ZBK B;  3L26 A;  4OU7 A;  4AI6 A;  1HT2 E;  1XC8 A;  3KS8 A;  1IXR C;  1PM5 A;  1NSF A;  3GLH B;  3W0F A;  2XH9 A;  3SAV A;  3GRY A;  3HHZ A;  4FD2 A;  2NQ8 C;  2YR0 A;  3KP1 E;  4MGY E;  2D7H A;  3KOW E;  3SYL A;  4FW9 A;  4I81 A;  2LH0 A;  3E9S A;  3I4Y A;  4B3M M;  3A46 A;  4LF6 M;  2F5N A;  2ZAM A;  2A5Y B;  3I51 A;  1TGU A;  1GVN A;  4AQY M;  4NRV A;  2Z4S A;  4L4U A;  2OQ4 A;  3BOS A;  1DO0 A;  4LY6 A;  3TWM A;  2QBY A;  4DV5 M;  3GPU A;  2RKO A;  4B7H A;  4DR2 M;  2CV1 A;  1GL7 A;  2FFJ A;  3FD9 A;  4IBF A;  3GPX A;  2Y0T A;  3D8B A;  2J7N A;  4KLN A;  4RF1 A;  2DHR A;  2XZU A;  2DZO B;  1XXH A;  4X62 M;  2ZM6 M;  4RF0 A;  5DYI A;  1DGG A;  4LRS A;  3GLI A;  1NHG C;  2FNA A;  3TWL A;  1G59 A;  5F3W A;  5FTJ A;  3RGS A;  3UK6 A;  3T38 A;  3UMM A;  4GC9 A;  4NSO B;  2QPA A;  2CV0 A;  5KO3 A;  4G4R A;  1MX0 A;  3TL4 X;  1I94 M;  1EE8 A;  2F5Q A;  4LFC M;  1IN4 A;  2VQF M;  4B08 A;  4IBI A;  3FYC A;  4REZ A;  1R2Z A;  5FTN A;  3E4R A;  3GLG A;  2C99 A;  2Z3X A;  1J5E M;  4LJ6 A;  3U61 A;  5FLX S;  1E94 E;  2R45 A;  3KOX E;  4DUY M;  1R7R A;  2VII A;  4NOO B;  4DR4 M;  1IN8 A;  2RGH A;  1HQC A;  3K2L A;  2XSZ A;  3AOE C;  5KPR A;  5A2Q S;  1IBK M;  3FUT A;  3JR5 A;  2V1C A;  4MGK E;  3U5Z B;  2KZU A;  3WHL A;  3FUV A;  4W5W A;  5LMU M;  4LFB M;  1TH2 A;  3L27 A;  3M6A A;  5DYG A;  4Z8X A;  3HHY A;  2LNH C;  4GKK M;  3FKE A;  3WHK A;  3R8F A;  2EO2 A;  4AKG A;  2W82 A;  2UU9 M;  3EIH A;  4M9X A;  2FOI C;  4IBG A;  2G5G X;  2YFQ A;  5ITT A;  3K92 A;  2KEB A;  3HHW A;  1X37 A;  2DZN B;  3J7B A;  4PDG A;  2Y21 A;  3A45 A;  2UXC M;  1HT1 E;  1NJG A;  2R4E A;  5IWA M;  4GKJ M;  4S12 A;  1GL6 A;  1OJL A;  1ZAE A;  3SAS A;  4I4L A;  5JI2 E;  1HNW M;  4B7G A;  3RFW A;  3VKH A;  1SXJ C;  2Z7J A;  2HL7 A;  4RNA A;  3AFH A;  3U6C A;  4LJ5 A;  4KHP M;  3LVV A;  1HNZ M;  5EJC A;  3SAW A;  3VLF B;  5EP1 A;  3KOY E;  4DUZ M;  4NSR A;  1MU5 A;  4EIW A;  4M9S A;  4G4O A;  1SXJ B;  3TE6 A;  4PCZ A;  5FSW A;  2F5O A;  2QP9 X;  3T15 A;  2DWL A;  4FWG A;  1NY6 A;  1R6B X;  3U6E A;  4DR6 M;  3IG5 A;  2Y0Q A;  1N75 A;  3DFZ A;  2KXE A;  2CHQ A;  4LZJ A;  4DV1 M;  1Z5B A;  3U6L A;  1XWI A;  1QYR A;  3KDS E;  5JI3 E;  3GO8 A;  5EXX A;  3SMS A;  3IG8 A;  3ILK A;  3Q8X A;  2QCU A;  5EP2 A;  2BJW A;  3FUW A;  1DGF A;  3SMP A;  3L25 A;  1KYI A;  2LWX A;  2QZ4 A;  4GHA A;  3SAR A;  1E9S A;  1IY1 A;  3J80 S;  1OFH A;  3DOA A;  1J7K A;  4LJA A;  3TPZ A;  3U6Q A;  4R3D A;  4B3S M;  4JXJ A;  3ZC7 B;  2CHG A;  4LF4 M;  4CGY B;  3L29 A;  1L8Q A;  3KS4 A;  3U6M A;  4NXM M;  5GKN A;  2QBY B;  1YE9 A;  4Z6Y A;  2E5L M;  2F5P A;  2P5T A;  4G6Z A;  1L1T A;  3GRR A;  4LGY A;  3J2P B;  5FTM A;  4LF9 M;  1NY5 A;  4GHL A;  3QAU A;  3T1Y M;  1TDH A;  4DV4 M;  1K3X A;  1XXH B;  4OVZ B;  3HKP A;  1IXS B;  1XNR M;  5ITX E;  3CTW B;  3GLH A;  3M0E A;  1XNQ M;  4GRI A;  3U6S A;  3FTF A;  3DZD A;  1YUB A;  4M9Z A;  2R4J A;  2UUB M;  4JI7 M;  2M60 A;  5H37 D;  1SXJ E;  5C18 A;  2V6Z M;  3JAM S;  2XZF A;  3PXG A;  3GLG B;  1KSF X;  1N36 M;  4DR1 M;  1IN5 A;  3MHV C;  4D80 A;  3AKZ A;  3U61 B;  4LJ4 A;  2R65 A;  2XSZ D;  2X4A A;  4JI6 M;  1Z6T A;  3NBI A;  3GRV A;  2UXB M;  3K8Z A;  1IM2 A;  2R62 A;  4CHT B;  2UUC M;  3VKG A;  1Q3C A;  1TH3 A;  1W5T A;  4NL4 H;  2QEN A;  2CEA A;  4YHH M;  2XEP A;  2C5R A;  1E9R A;  1IN7 A;  2L7H A;  4IJE A;  2C9C A;  4GMQ A;  4D82 A;  3GPP A;  2DWZ B;  3U6O A;  1HNX M;  3KVW A;  2V1U A;  3GQ4 A;  3C58 A;  4M0D A;  4X65 M;  3SYK A;  1G3I A;  4PT5 A;  2H1R A;  5IT9 S;  4LJ7 A;  1G41 A;  4TUW A;  4PD2 A;  1PJJ A;  1C1K A;  4JN6 A;  4MGI E;  4LCB A;  1GKI A;  4L16 A;  1YSY A;  2XGN A;  4KOD A;  1FJG M;  3ZH9 B;  2KRU A;  3AJI B;  1FNN A;  1G8P A;  2L6O A;  1NNJ A;  1Z5A A;  1DGH A;  2ERC A;  4AKI A;  4LF5 M;  2HCB A;  4ZPX A;  5IRE B;  5BR8 M;  1L2B A;  1Q39 A;  1N34 M;  3SFZ A;  1QAN A;  1GLN A;  2CFO A;  2JA2 A;  4L15 A;  1QAM A;  5EXT A;  3U5Z A;  4I5S A;  2YQZ A;  2CUZ A;  2RGO A;  3GQ5 A;  1R2Y A;  1XMO M;  3VDP A;  1S3S A;  3NWL A;  2FE8 A;  5ITU A;  4DR3 M;  5KQ8 A;  5ITQ A;  4G4N A;  4IBB A;  2L7I A;  2M5Z A;  4LFA M;  5DNY A;  3HHX A;  3FTE A;  4M0W A;  3FUX A;  4HL4 A;  2DWN A;  4DV6 M;  4JI0 M;  4QOS A;  4XGI A;  4BB9 A;  2HHH M;  2C9O A;  4PDI A;  3HU3 A;  2XLJ A;  3HJQ A;  3GLF A;  1WXQ A;  4KO8 A;  2X49 A;  4B3T M;  2UUA M;  1IN6 A;  2Q2E B;  4OW0 A;  3K1J A;  4IBK A;  1JR3 A;  5LMN M;  3L2A A;  3GRU A;  4JI3 M;  4FVM A;  4LF8 M;  3PFI A;  2L09 A;  4MB7 A;  4QNM A;  3D8L A;  2KA6 B;  2YNM D;  3VDU A;  2DXI A;  3LVW A;  4AG5 A;  3EIE A;  5IZ7 D;  4B7F A;  5KQD A;  3SAT A;  3PVS A;  5FTL A;  4IBJ A;  3MK6 A;  3B9P A;  3TWK A;  1DGB A;  1VDD A;  3U60 A;  1G4A E;  2XFT A;  4JI1 M;  5KPT A;  3J81 S;  1IXZ A;  4YY3 M;  3J27 B;  1QAQ A;  4GIT A;  4JI4 M;  3AL0 C;  3J7A S;  2Z4R A;  3RGP A;  5EXS A;  4IBC A;  3GPY A;  3QWL A;  4BLC A;  1HR0 M;  1TDZ A;  4LF7 M;  3KSJ A;  4LGM A;  3CF0 A;  4B3R M;  3TQS A;  3GLI B;  3A98 B;  3U6D A;  2K47 A;  4DV3 M;  1NJF A;  2G8L A;  3ZCB B;  3LMM A;  1NVM A;  1KFV A;  4DV7 M;  3FYD A;  4LJ9 A;  2O5R A;  2I7N A;  3LQQ A;  1T3T A;  1W5S A;  1ORY B;  2Y20 A;  3UJN A;  4AG6 A;  2LXE A;  3UGJ A;  3VK7 A;  5EP4 A;  3GP1 A;  4LJ8 A;  1QAO A;  3OTO M;  4NXN M;  3AV0 A;  3H4M A;  5EP3 A;  1L2D A;  1JQJ C;  3KP0 E;  2UXD M;  3HJ8 A;  4OVZ A;  2EUC A;  7CAT A;  1I4W A;  5C1B A;  4LG2 A;  1LV7 A;  2BJV A;  4CIS A;  4L8R C;  3U6P A;  3SC3 A;  4ITQ A;  3M7G A;  3FTC A;  4IBE A;  4AW4 A;  5E6J A;  4XBO A;  2DVW B;  3A42 A;  1QQW A;  3LQR A;  4FCV A;  1N33 M;  4QHS A;  4JI2 M;  1QZM A;  4JV5 M;  1ZQ9 A;  1Q3B A;  4OX9 M;  4WW0 A;  4BBA A;  4MM3 B;  3KW6 A;  5KPZ A;  3GQ3 A;  3SHG B;  4G4Q A;  3KFU G;  1DO2 A;  3HWS A;  5ITY A;  4QNR A;  1DGH B;  1HQY E;  3RE8 A;  2HKJ A;  5E26 A;  3HU1 A;  3VFD A;  4X66 M;  2OPF A;  3CF6 E;  1OFI A;  4FWD A;  4K0K M;  3HU2 A;  3W0L B;  3FUU A;  3KOZ E;  3CF2 A;  1N78 A;  1NNU C;  2J7O A;  2VQE M;  2F5S A;  4A3V B;  1XMQ M;  2KW0 A;  1H6U A;  3FTD A;  4IBD A;  1QVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...