4DV6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv6M02
4AQYM 4DR6M 3U6QA 4DUZM 2HHHM 4LF9M 3JR5A 2OPFA 3SAWA 1MU5A 4MB7A 4LF6M 1IBLM 2F5QA 1J5EM 4DV2M 4K0KM 4X66M 4JI0M 3VK8A 5IT9S 4GKJM 1TDHA 4DV1M 4JI1M 4PCZA 3J81S 3GP1A 2UU9M 3GQ5A 3SAUA 4DR1M 1NNJA 4LF5M 4NRWA 2F4VM 4KHPM 4DR2M 1XNQM 3U6OA 4DR7M 3GPXA 1HR0M 1Z5BA 1K3XA 2HKJA 4JI6M 2UXCM 4LF8M 4LFCM 3GQ3A 1XMOM 2Q2EB 1XMQM 2E5LM 4JI8M 3J80S 3A42A 1N32M 1XNRM 3J7AS 4GKKM 1Z59A 4G4OA 1PM5A 2XZFA 1K3WA 1L2BA 3T1YM 4LF4M 5ITXA 4DR5M 3C58A 5LMUM 2UXBM 4DV4M 4DR3M 4B3TM 4YHHM 2F5PA 3VK7A 3TWLA 5LMNM 4JI7M 3GO8A 5FLXS 1HNZM 2F5NA 4ITQA 3JAMS 3A46A 1Q39A 1HNXM 3W0FA 2UUAM 4JI2M 1L2CA 2ZBKB 4B3SM 1N34M 3SAVA 3T1HM 3U6EA 1TDZA 1IBMM 2F5OA 2UUCM 1R2YA 1PJJA 3GPYA 1FJGM 1KFVA 4LFBM 3U6CA 1MX0A 1HNWM 3U6MA 1IBKM 3U6PA 4X64M 3GPUA 3JR4A 4DV0M 4LF7M 2VQFM 4B3RM 4DR4M 1N36M 1N33M 5A2QS 3GPPA 5ITXE 4LFAM 2F5SA 4JYAM 1PJIA 3U6SA 3SASA 4JI5M 4DUYM 1EE8A 1Q3BA 4CISA 4JI3M 2UUBM 4OX9M 1L1TA 1L2DA 4YY3M 2EA0A 4NXMM 2VQEM 5ITUA 3OTOM 3GQ4A 4G4QA 3TWKA 5BR8M 2UXDM 4DV5M 1Q3CA 4G4RA 4G4NA 3TWMA 4NXNM 1Z5CA 3U6DA 4JV5M 4NRVA 1L1ZA 5ITQA 3A45A 5ITYA 4X65M 4DV3M 4PD2A 4JI4M 1Z5AA 3SARA 1I94M 3SATA 4DV6M 3SBJA 4DV7M 3U6LA 1K82A 5ITRA 5ITTA 4B3MM 2ZM6M 1R2ZA 3DOAA 4PDGA 4PDIA 5IWAM 2XZUA 1XC8A 2OQ4A 4X62M
chains in the Genus database with same CATH superfamily
1OAIA 5KQ8A 3FE3A 3U6QA 2VF8A 4DUZM 1IN5A 2R65A 3JR5A 1MN3A 2Z4SA 4Y28F 3HHYA 4JI5M 4LJ4A 2Y21A 2CFOA 1DGFA 1HJPA 1IN8A 3TPZA 1VEGA 4LF6M 1Q02A 4GC5A 4DV2M 4XK8F 3B74A 3VK8A 4FD2A 5IT9S 4QNRA 2JY5A 3T15A 3VLFB 1VEKA 3U5ZB 2V1UA 1QAMA 1R4GA 3UJNA 2RKOA 2XSZD 1NNJA 4LF5M 1HT2E 3MK6A 1KSFX 3GLHE 3U6OA 4PT5A 3GPXA 3LCUA 4D82A 2DVWB 2KNZA 1Z5BA 1IY0A 1V34A 2EKKA 3TQSA 5C18A 3GQ3A 1PJSA 3GRRA 4ANRA 3HHWA 1F4IA 4AG5A 1XMQM 2YQZA 4AKHA 2R4EA 3J80S 2LTUA 2FOIC 2QHOB 2XH9A 4LJAA 4MH0E 3KVWA 4JN6A 4D81A 3GLFE 1PJQA 1PM5A 1L2BA 2XZFA 1VG5A 4L4UA 4MGIE 3GLIE 1ZMUA 4GC9A 2L4FA 2KRUA 4LJ9A 3SFZA 3TWLA 3WHKA 3I4VA 2HWJA 4MGKE 3SYKA 3KDSE 4F1IA 1G3IA 4RKUF 2XLJA 1RU3A 1G59A 1AIPC 3JAMS 2WSCF 2K6BA 3HY5A 4REZA 1L2CA 2O25A 1LTMA 1DGBA 3ZQJA 4OW0A 3SAVA 1IBMM 1XXHA 2F5OA 2FH0A 1R2YA 1YLAA 1NO1A 1PJJA 1OKSA 2CHVA 3M7GA 2DWNA 3ILKA 4M0WA 3AV0A 1QYRA 1WJ7A 1R6BX 3IG5A 3U6CA 4LFBM 3AOEA 3K8ZA 2CHGA 1WXQA 2DENA 4M9SA 4WP2A 2FE8A 2L7IA 2QCUA 1XHBA 2FFJA 1GJSA 1HQYE 1VDDA 2MROB 4FCTA 3MJ5A 1E32A 3I01M 4FW9A 4LJ6A 2QZ4A 2M60A 4LF7M 4QNMA 2JA2A 3GRUA 2VQFM 4B3RM 1NVMA 2X4AA 4RNAA 3GLGE 3R8FA 3AOGA 4DR4M 1N33M 1GL6A 1PJIA 1NHWC 4L16A 2JY6B 3LW5F 4GEWA 4LZJA 3U60B 1Z6TA 2EUCA 4IBIA 4II7A 2QNJA 4GHAA 4OX9M 2XGNA 1L2DA 2BNKA 4EIWA 3A98B 4UN2B 2RRUA 4FVMA 4RF1A 3OTOM 2FS1A 4LY6A 2XEPA 5EP1A 3TWKA 2UXDM 2DAEA 4G4NA 4QOZC 4A3VB 3U6DA 2C5RA 3KOYE 1QDTA 4NRVA 3DA1A 2Y0TA 2CE7A 5ITQA 2DAKA 3A45A 4I4LA 5ITYA 4OU7A 2NQ8C 3K2LA 2DHYA 2L6OA 1I94M 4Z6YA 4DV6M 2Z8YM 4DV7M 3U6LA 3ZC7B 2AHMA 5ITTA 1DO0A 5F3WA 1PRBA 1QANA 1SXJA 2ERCA 5FSWA 5KO3A 1R2ZA 2LH0A 1Q39A 4W5WA 1QVRA 4I5SA 4DR6M 3C3DA 1OJLA 4GITA 2HHHM 1G4AE 1QAOA 3KS8A 2LVNC 3BBZA 3SAWA 2CV0A 1MU5A 4QHSA 5KQDA 1G71A 4HL4A 2XFTA 2F5QA 5DFLA 2L09A 2OO9A 1QDRA 3QYEA 2K0BX 4X66M 4K0KM 1QZEA 4GKJM 5DYIA 1W5TA 2K9DA 3UZUA 1W5SA 3UK6A 5FTKA 1DGHB 4Q7JA 3RGPA 3QYBA 1DGGA 3WHLA 4LJ5A 3SAUA 4DR1M 2F4VM 1NSFA 5JI3E 1I4WA 2JY7A 3PFIA 2R4JA 1IFYA 3C9PA 5JI2E 1IY2A 4GIPA 2R0IA 3HJSA 1QQWA 2DXIA 3EIEA 2WZJA 2HKJA 1VEJA 4JI6M 4LF8M 4LFCM 4XGIA 2XSZA 3IHPA 2X8AA 2DNAA 4LJ8A 3PXGA 4LGYA 2KNVA 3RFWA 2ZANA 4FCVA 3CGWA 2CUZA 3HJQA 3VFDA 4CJ6A 4I8OA 4JI8M 2DKLA 3B7QA 2QPAA 1Z59A 5H37D 2BJVA 3T1YM 2YFQA 2JXNA 1KYIA 5ITXA 4DR5M 3E4RA 1JR3E 3T6PA 1V92A 2UXBM 4LGMA 3EIHA 2Z4RA 4B3TM 1JQJC 1WIVA 2YNMD 5LMNM 4D80A 2DI0A 2RGHA 2VIIA 2LHCA 1QZMA 3K92A 4NSOB 1HNZM 1TTEA 3HKPA 2OOBA 3KSXA 4AI6A 4OVZB 2B3TA 3A46A 1JB0F 3W0FA 1NJFA 2DZOB 2H5XA 2QSFX 4AKGA 2XF3A 2R62A 3THGA 4B3SM 2J7OA 4L6V6 3J2PB 3U6EA 1TDZA 2KDLA 2R44A 3IG8A 5FTLA 3M6AA 3HHZA 3GPYA 3W68A 4DBGB 1KFVA 3HU1A 4M0DA 3U6MA 3GLHA 1IBKM 1OQYA 4RF0A 5IZ7D 2CHQA 4GH9A 4X64M 3HGIA 1J09A 2KRKA 2V1CA 4I81A 1JR3D 1TGUA 3V76A 3UGJA 1N36M 5A2QS 3GPPA 4LFAM 2EJSA 1TH4A 3SASA 2ZAOA 2I7NA 3M0EA 5EXSA 2Y20A 3RGSA 1D0LA 3E46A 4JI4M 4LCBA 4HEOA 4CISA 3I51A 3GLFA 2L4EA 4AZFA 3I4YA 1MJGM 3FRIA 1UM8A 1NY6A 5BR8M 4DV5M 4G4RA 3TWMA 1IM2A 4NXNM 5EXXA 1TF0B 4Z8XA 1Z5CA 4GRIA 3L2AA 4G6ZA 3ZH9B 4CHTB 1PGYA 4X65M 1FNNA 3E21A 4L8RC 2DWLA 3SBJA 3L25A 1K82A 2BWEA 2ZAMA 1R5LA 2MH8A 4PDIA 2OQ4A 2RGOA 2VDBB 1NV8A 2DHRA 4FWGA 2H1RA 3B7ZA 3B9PA 4S12A 2MGWA 1ZQ9A 2YR0A 3U61A 2MR9A 4L15A 5EJCA 2G3QA 4MB7A 1GO5A 1IBLM 3L29A 3AKZA 3GLGA 3MHVC 3QWLA 2LVOC 1J5EM 4JI0M 3J27B 4WW0A 1TR8A 3SMSA 4KO8A 4JI1M 3J81S 5IREB 5FTMA 3VDUA 3H4JA 3GP1A 2LVAA 4KHPM 3KP0E 2HL7A 3AFHA 5KPRA 4TUWA 4DR2M 1Y8GA 1GABA 1NY5A 1XNQM 1QAQA 1LV7A 1WR1B 3PNYA 1ZMVA 3HU3A 2UXCM 1G8PA 2JP7A 4IBCA 1XXHB 3FUWA 2C99A 4IBJA 3CF2A 1T43A 1N78A 1XMOM 4KT0F 3TL4X 3LVVA 1C1KA 3A42A 3PNVA 2D7GA 5EP3A 4P17A 5FTNA 4B08A 3Q8GA 1XNRM 2GQFA 1K3WA 5EP2A 3FRHA 4LF4M 1UFZA 3SHGB 3FUTA 2MJ5B 3RE8A 3K9OA 3C58A 2QQ8A 2KXEA 2O01F 1ORYB 3U5ZA 3VK7A 4JI7M 1L8QA 2HCBA 3GO8A 4IBDA 2QBYA 3NWLA 2LHGA 1T6OA 3D8BA 2F5NA 3FYCA 5DYGA 1EFUB 1HT1E 3U61B 1XWIA 2OOAA 3HX3A 2UUAM 3J7BA 3HZJA 4M9ZA 3B7NA 1YUBA 1ZAEA 5E6JA 1GKIA 5FTJA 5GKNA 3T1HM 3HHXA 1HQCA 3HU2A 3MMPA 1C7YA 2UUCM 4G3OA 2JZ0A 3AOEC 3FTEA 4QHTA 1SXJD 1MX0A 1TH2A 2LWXA 3FD9A 1YE9A 2ZTCA 3R9XB 2M5ZA 2X49A 5EP4A 1OAOC 2VF7A 4R7GA 3BXWA 2QP9X 5C1BA 2XFSA 3U6PA 1IXZA 1V33A 3JR4A 3GPUA 4DV0M 1E9SA 4GMQA 4LZZA 2K47A 1QUSA 3HWSA 1SXJB 4QOSA 3SMPA 1X37A 2F5SA 1ZV1A 5ITXE 2G5GX 2HAKA 1H6UA 3PVSA 4DUYM 3C3EA 4IJEA 1D0MA 1DO2A 1IN7A 4R71A 2R6FA 1EIJA 1L1TA 4YY3M 2EO2A 1JR3A 2JUJA 3KW6A 1N77A 1OFIA 2WSFF 4MM3B 2CWBA 2KNAA 4IJFA 4JV5M 1L1ZA 2R45A 3KOZE 3FTCA 3LVWA 4CGYB 4FWDA 2KA6B 2L7HA 4M9XA 2L2DA 2J7NA 2KEBA 4DV3M 5BPVA 5L8RF 2QBYB 3SATA 3F92A 1P3QQ 2LXEA 2N35A 1SXJC 5ITRA 2W82A 3GRYA 1NNUC 2ZM6M 3DOAA 4PDGA 2XZUA 3KFUG 1XC8A 3FTFA 1GLNA 3E9SA 2QENA 4X62M 4AQYM 3LCVB 3U60A 4LF9M 4AW4A 1IY1A 1OIZA 3BOSA 3L28A 3L27A 2OPFA 2J5YA 4NSRA 2I7PA 4IBFA 4L78A 5DNYA 3GLIA 1AUAA 4LG2A 2DWMA 4GHLA 4P16A 2KW0A 2O5RA 3CF0A 3DZDA 2BWBA 2C9CA 2C98A 2G8LA 4IIWA 1IQPA 1TDHA 1XXHE 4LRTA 4DV1M 1BVSA 4PCZA 1GJTA 3SC3A 2CV1A 1IN4A 3GQ5A 2UU9M 2Z7JA 4NRWA 3VDPA 1WHCA 4NC6A 1E94E 2JY8A 3FUVA 3Q8XA 4MGHA 3LQRA 4DR7M 1IXRC 4BLCA 1HR0M 3DFZA 2EKFA 3SYLA 1K3XA 4IBKA 2LVQD 5EXTA 2Q2EB 3FUXA 1IN6A 5E26A 3CTWB 4AG6A 2E5LM 1WGLA 2DZNB 2C96A 3KXEC 1N32M 1WGNA 3J7AS 3GLHB 4GKKM 4MGYE 3AJIB 4G4OA 5KPZA 2P5TA 3QAUA 3T38A 5LMUM 1IXSA 1G41A 1R7RA 1OTRA 2FNAA 4WURA 4DV4M 4DR3M 4YHHM 2F5PA 3D8LA 4AKIA 1CUKA 2LVPC 1ZMWA 3FTDA 1DGHA 5EXPA 5FLXS 1YSYA 2Y0QA 4F2LA 2V6ZM 5KPTA 1OFHA 4XBOA 3TE6A 3GLFB 4BB9A 3I04M 4ITQA 1VDLA 2CP8A 3SHFA 2R18A 2CV2A 2D7EA 3HJ8A 1GL7A 3GLIB 1HNXM 4JI2M 3LMMA 3H4MA 2ZBKB 1N34M 2LBCA 2C9OA 4B7GA 1S3SA 1SXJE 3K1JA 2DAGA 1FJGM 4R3DA 2JWSA 4LJ7A 3FKEA 1J7KA 1HNWM 3ZCBB 1E9RA 4LRSA 4HLQA 3VKHA 2LNHC 3VKGA 1D0KA 2DAMA 2APLA 4B7HA 2GNOA 1DV0A 4IBBA 4JYAM 4KODA 2JZ1A 3NBIA 4B7FA 3U6SA 3B89A 2KHHA 3CF6E 1EE8A 1VQ1A 3IECA 1Q3BA 4FCWA 3GRVA 2WSEF 4JI3M 2UUBM 3KS4A 4JXJA 4ZPXA 4NL4H 1PJTA 2EA0A 4NXMM 4OVZA 3KSJA 2DZLA 3UMMA 8CATA 2VQEM 1D2NA 5ITUA 3AL0C 2DAIA 4IBEA 4FWHA 3GQ4A 4IBGA 1NHGC 3GLGB 4G4QA 2D7HA 1OIPA 1GVNA 1Q3CA 1NV9A 2DWZB 1SG9A 1QUTA 3K9PA 3FUUA 4MGZE 1IXSB 5EQTA 2A5YB 1T3TA 2KZSA 3KOWE 4NOOB 3W0LB 3W67A 7CATA 2Z3XA 2JNHA 2KZUA 3LQQA 1NJGA 1TH3A 2ZTDA 3FYDA 3KP1E 2BJWA 2R46A 1Z5AA 3NBXX 2CEAA 4KLNA 4PD2A 3KOXE 4CIZA 3L26A 3SARA 2CRUA 1A5TA 1N75A 1XB2B 4BBAA 4B3MM 5IWAM
chains in the Genus database with same CATH topology
5KQ8A 3U6QA 4DUZM 1IN5A 2R65A 3JR5A 2Z4SA 3HHYA 4LJ4A 2Y21A 2CFOA 1DGFA 1IN8A 3TPZA 4LF6M 4GC5A 4DV2M 3VK8A 4FD2A 5IT9S 4QNRA 3T15A 3VLFB 3U5ZB 2V1UA 1QAMA 3UJNA 2RKOA 2XSZD 1NNJA 4LF5M 1HT2E 3MK6A 1KSFX 3U6OA 4PT5A 3GPXA 4D82A 2DVWB 1Z5BA 1IY0A 3TQSA 5C18A 3GQ3A 3GRRA 3HHWA 4AG5A 1XMQM 2YQZA 4AKHA 2R4EA 3J80S 2FOIC 2XH9A 4LJAA 4MH0E 3KVWA 4JN6A 4D81A 1PM5A 1L2BA 2XZFA 4L4UA 4MGIE 4GC9A 2KRUA 4LJ9A 3SFZA 3TWLA 3WHKA 3I4VA 4MGKE 3SYKA 3KDSE 1G3IA 2XLJA 1G59A 3JAMS 1L2CA 4REZA 1DGBA 4OW0A 3SAVA 1IBMM 1XXHA 2F5OA 1R2YA 1PJJA 2CHVA 3M7GA 2DWNA 3ILKA 4M0WA 3AV0A 1QYRA 3U6CA 1R6BX 3IG5A 4LFBM 3AOEA 3K8ZA 2CHGA 1WXQA 4M9SA 2FE8A 2L7IA 2QCUA 1XHBA 2FFJA 1HQYE 1VDDA 4FCTA 4FW9A 3MJ5A 1E32A 4LJ6A 4LF7M 2QZ4A 2M60A 4QNMA 2JA2A 3GRUA 2VQFM 4B3RM 1NVMA 2X4AA 4RNAA 3R8FA 4DR4M 3AOGA 1N33M 1GL6A 1PJIA 1NHWC 4L16A 4JI5M 4LZJA 3U60B 1Z6TA 2EUCA 4IBIA 4II7A 4GHAA 4OX9M 2XGNA 1L2DA 2BNKA 4EIWA 3A98B 4FVMA 3OTOM 4RF1A 4LY6A 2XEPA 5EP1A 3TWKA 2UXDM 4G4NA 4QOZC 4A3VB 3U6DA 2C5RA 3KOYE 4NRVA 3DA1A 2Y0TA 2CE7A 5ITQA 3A45A 5ITYA 4I4LA 4OU7A 2NQ8C 3K2LA 2L6OA 1I94M 4Z6YA 4DV6M 4DV7M 3U6LA 3ZC7B 2AHMA 5ITTA 1DO0A 5F3WA 1QANA 1SXJA 2ERCA 5FSWA 5KO3A 1R2ZA 2LH0A 1Q39A 4W5WA 1QVRA 4I5SA 4DR6M 1OJLA 4GITA 2HHHM 1G4AE 1QAOA 3KS8A 3SAWA 2CV0A 1MU5A 4QHSA 5KQDA 4HL4A 2XFTA 2F5QA 2L09A 4K0KM 4X66M 4GKJM 5DYIA 1W5TA 3UZUA 1W5SA 3UK6A 5FTKA 1DGHB 3RGPA 1DGGA 3WHLA 4LJ5A 3SAUA 4DR1M 2F4VM 1NSFA 5JI3E 1I4WA 3PFIA 2R4JA 5JI2E 1IY2A 4GIPA 3HJSA 1QQWA 2DXIA 3EIEA 2HKJA 4JI6M 4LF8M 4LFCM 4XGIA 2XSZA 4LJ8A 2X8AA 3PXGA 4LGYA 3RFWA 2ZANA 4FCVA 3HJQA 2CUZA 3VFDA 4JI8M 4I8OA 2QPAA 1Z59A 5H37D 2BJVA 3T1YM 2YFQA 1KYIA 5ITXA 4DR5M 3E4RA 2UXBM 4LGMA 3EIHA 2Z4RA 4B3TM 1JQJC 2YNMD 5LMNM 4D80A 2RGHA 2VIIA 3K92A 1QZMA 4NSOB 1HNZM 3HKPA 4AI6A 3KSXA 4OVZB 3A46A 3W0FA 1NJFA 2DZOB 4AKGA 2XF3A 2R62A 3THGA 4B3SM 2J7OA 3J2PB 3U6EA 1TDZA 3IG8A 5FTLA 3M6AA 3HHZA 3GPYA 1KFVA 3HU1A 4M0DA 3U6MA 3GLHA 1IBKM 4RF0A 5IZ7D 2CHQA 4GH9A 4X64M 3HGIA 1J09A 2KRKA 2V1CA 4I81A 1JR3D 1TGUA 3UGJA 1N36M 5A2QS 3GPPA 4LFAM 1TH4A 3SASA 2ZAOA 2I7NA 3M0EA 5EXSA 2Y20A 3RGSA 4LCBA 4CISA 3I51A 3GLFA 4AZFA 3I4YA 1UM8A 1NY6A 5BR8M 4DV5M 4G4RA 3TWMA 1IM2A 4NXNM 5EXXA 4Z8XA 1Z5CA 4GRIA 3L2AA 4G6ZA 3ZH9B 4CHTB 4X65M 1FNNA 4L8RC 2DWLA 3SBJA 3L25A 1K82A 2ZAMA 4PDIA 2OQ4A 2RGOA 2DHRA 4FWGA 2H1RA 3B9PA 4S12A 1ZQ9A 2YR0A 3U61A 4L15A 5EJCA 4MB7A 1IBLM 3L29A 3AKZA 3GLGA 3MHVC 3QWLA 1J5EM 4JI0M 3J27B 4WW0A 3SMSA 4KO8A 4JI1M 3J81S 5IREB 5FTMA 3VDUA 3GP1A 4KHPM 3KP0E 2HL7A 3AFHA 5KPRA 4TUWA 4DR2M 1NY5A 1XNQM 1QAQA 1LV7A 3PNYA 3HU3A 2UXCM 1G8PA 4IBCA 1XXHB 3FUWA 2C99A 4IBJA 3CF2A 1N78A 1XMOM 3TL4X 3LVVA 1C1KA 3A42A 3PNVA 2D7GA 5EP3A 4B08A 5FTNA 1XNRM 1K3WA 5EP2A 4LF4M 3SHGB 3FUTA 3RE8A 3C58A 2KXEA 1ORYB 3U5ZA 3VK7A 4JI7M 1L8QA 2HCBA 3GO8A 4IBDA 2QBYA 3NWLA 3D8BA 2F5NA 3FYCA 5DYGA 3U61B 1HT1E 1XWIA 2UUAM 3J7BA 4M9ZA 1YUBA 1ZAEA 5E6JA 1GKIA 5FTJA 5GKNA 3T1HM 3HHXA 1HQCA 3HU2A 2UUCM 3AOEC 3FTEA 4QHTA 1SXJD 1MX0A 1TH2A 2LWXA 3FD9A 1YE9A 3R9XB 2M5ZA 2X49A 5EP4A 4R7GA 5C1BA 2QP9X 3U6PA 2XFSA 1IXZA 3JR4A 3GPUA 4DV0M 1E9SA 4GMQA 4LZZA 2K47A 3HWSA 1SXJB 4QOSA 3SMPA 1X37A 2F5SA 5ITXE 2G5GX 1H6UA 3PVSA 4DUYM 4IJEA 1DO2A 1IN7A 1L1TA 4YY3M 2EO2A 1JR3A 3KW6A 1N77A 1OFIA 4MM3B 4IJFA 4JV5M 1L1ZA 2R45A 3KOZE 3FTCA 3LVWA 4CGYB 4FWDA 2KA6B 2L7HA 4M9XA 2J7NA 2KEBA 4DV3M 5BPVA 2QBYB 3SATA 2LXEA 1SXJC 5ITRA 2W82A 3GRYA 1NNUC 2ZM6M 3DOAA 4PDGA 2XZUA 3KFUG 1XC8A 3E9SA 1GLNA 2QENA 4X62M 4AQYM 3U60A 4LF9M 4AW4A 1IY1A 3BOSA 3L28A 3L27A 2OPFA 4NSRA 4L78A 2I7PA 4IBFA 5DNYA 3GLIA 3FTFA 4LG2A 2DWMA 4GHLA 4P16A 2KW0A 2O5RA 3CF0A 3DZDA 2C9CA 2C98A 2G8LA 4IIWA 1IQPA 1TDHA 4LRTA 4DV1M 4PCZA 3SC3A 2CV1A 1IN4A 3GQ5A 2UU9M 2Z7JA 4NRWA 3VDPA 1E94E 3FUVA 3Q8XA 4MGHA 3LQRA 4DR7M 1IXRC 4BLCA 1HR0M 3DFZA 3SYLA 1K3XA 4IBKA 5EXTA 2Q2EB 3FUXA 1IN6A 5E26A 3CTWB 4AG6A 2E5LM 2DZNB 2C96A 3KXEC 1N32M 4GKKM 3J7AS 3GLHB 4MGYE 3AJIB 4G4OA 5KPZA 2P5TA 3QAUA 3T38A 5LMUM 1G41A 1R7RA 2FNAA 4WURA 4DV4M 4DR3M 4YHHM 2F5PA 3D8LA 4AKIA 3FTDA 1DGHA 5EXPA 5FLXS 1YSYA 2Y0QA 2V6ZM 5KPTA 1OFHA 4XBOA 3TE6A 3GLFB 4BB9A 4ITQA 3SHFA 2R18A 2CV2A 2D7EA 3HJ8A 1GL7A 3GLIB 1HNXM 4JI2M 3LMMA 3H4MA 2ZBKB 1N34M 2C9OA 4B7GA 1S3SA 1SXJE 3K1JA 1FJGM 4R3DA 4LJ7A 3FKEA 1J7KA 1HNWM 3ZCBB 1E9RA 4LRSA 4HLQA 3VKHA 2LNHC 3VKGA 4B7HA 4IBBA 4JYAM 4KODA 3NBIA 4B7FA 3U6SA 3CF6E 1EE8A 4FCWA 1Q3BA 3GRVA 4JI3M 2UUBM 3KS4A 4JXJA 4ZPXA 4NL4H 2EA0A 4NXMM 4OVZA 3KSJA 3UMMA 8CATA 2VQEM 1D2NA 5ITUA 3AL0C 4IBEA 4FWHA 3GQ4A 4IBGA 1NHGC 3GLGB 4G4QA 2D7HA 1GVNA 1Q3CA 2DWZB 5EQTA 4MGZE 3FUUA 1IXSB 3W0LB 2A5YB 1T3TA 2KZSA 3KOWE 4NOOB 7CATA 2Z3XA 2KZUA 3LQQA 3KP1E 1NJGA 1TH3A 3FYDA 4KLNA 2BJWA 2R46A 1Z5AA 4PD2A 2CEAA 3L26A 3SARA 3KOXE 4JI4M 1N75A 4BBAA 4B3MM 5IWAM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY M;  4DR6 M;  3U6Q A;  4DUZ M;  2HHH M;  4LF9 M;  3JR5 A;  2OPF A;  3SAW A;  1MU5 A;  4MB7 A;  4LF6 M;  1IBL M;  2F5Q A;  1J5E M;  4DV2 M;  4K0K M;  4X66 M;  4JI0 M;  3VK8 A;  5IT9 S;  4GKJ M;  1TDH A;  4DV1 M;  4JI1 M;  4PCZ A;  3J81 S;  3GP1 A;  2UU9 M;  3GQ5 A;  3SAU A;  4DR1 M;  1NNJ A;  4LF5 M;  4NRW A;  2F4V M;  4KHP M;  4DR2 M;  1XNQ M;  3U6O A;  4DR7 M;  3GPX A;  1HR0 M;  1Z5B A;  1K3X A;  2HKJ A;  4JI6 M;  2UXC M;  4LF8 M;  4LFC M;  3GQ3 A;  1XMO M;  2Q2E B;  1XMQ M;  2E5L M;  4JI8 M;  3J80 S;  3A42 A;  1N32 M;  1XNR M;  3J7A S;  4GKK M;  1Z59 A;  4G4O A;  1PM5 A;  2XZF A;  1K3W A;  1L2B A;  3T1Y M;  4LF4 M;  5ITX A;  4DR5 M;  3C58 A;  5LMU M;  2UXB M;  4DV4 M;  4DR3 M;  4B3T M;  4YHH M;  2F5P A;  3VK7 A;  3TWL A;  5LMN M;  4JI7 M;  3GO8 A;  5FLX S;  1HNZ M;  2F5N A;  4ITQ A;  3JAM S;  3A46 A;  1Q39 A;  1HNX M;  3W0F A;  2UUA M;  4JI2 M;  1L2C A;  2ZBK B;  4B3S M;  1N34 M;  3SAV A;  3T1H M;  3U6E A;  1TDZ A;  1IBM M;  2F5O A;  2UUC M;  1R2Y A;  1PJJ A;  3GPY A;  1FJG M;  1KFV A;  4LFB M;  3U6C A;  1MX0 A;  1HNW M;  3U6M A;  1IBK M;  3U6P A;  4X64 M;  3GPU A;  3JR4 A;  4DV0 M;  4LF7 M;  2VQF M;  4B3R M;  4DR4 M;  1N36 M;  1N33 M;  5A2Q S;  3GPP A;  5ITX E;  4LFA M;  2F5S A;  4JYA M;  1PJI A;  3U6S A;  3SAS A;  4JI5 M;  4DUY M;  1EE8 A;  1Q3B A;  4CIS A;  4JI3 M;  2UUB M;  4OX9 M;  1L1T A;  1L2D A;  4YY3 M;  2EA0 A;  4NXM M;  2VQE M;  5ITU A;  3OTO M;  3GQ4 A;  4G4Q A;  3TWK A;  5BR8 M;  2UXD M;  4DV5 M;  1Q3C A;  4G4R A;  4G4N A;  3TWM A;  4NXN M;  1Z5C A;  3U6D A;  4JV5 M;  4NRV A;  1L1Z A;  5ITQ A;  3A45 A;  5ITY A;  4X65 M;  4DV3 M;  4PD2 A;  4JI4 M;  1Z5A A;  3SAR A;  1I94 M;  3SAT A;  4DV6 M;  3SBJ A;  4DV7 M;  3U6L A;  1K82 A;  5ITR A;  5ITT A;  4B3M M;  2ZM6 M;  1R2Z A;  3DOA A;  4PDG A;  4PDI A;  5IWA M;  2XZU A;  1XC8 A;  2OQ4 A;  4X62 M; 
#chains in the Genus database with same CATH topology
 1OAI A;  5KQ8 A;  3FE3 A;  3U6Q A;  2VF8 A;  4DUZ M;  1IN5 A;  2R65 A;  3JR5 A;  1MN3 A;  2Z4S A;  4Y28 F;  3HHY A;  4JI5 M;  4LJ4 A;  2Y21 A;  2CFO A;  1DGF A;  1HJP A;  1IN8 A;  3TPZ A;  1VEG A;  4LF6 M;  1Q02 A;  4GC5 A;  4DV2 M;  4XK8 F;  3B74 A;  3VK8 A;  4FD2 A;  5IT9 S;  4QNR A;  2JY5 A;  3T15 A;  3VLF B;  1VEK A;  3U5Z B;  2V1U A;  1QAM A;  1R4G A;  3UJN A;  2RKO A;  2XSZ D;  1NNJ A;  4LF5 M;  1HT2 E;  3MK6 A;  1KSF X;  3GLH E;  3U6O A;  4PT5 A;  3GPX A;  3LCU A;  4D82 A;  2DVW B;  2KNZ A;  1Z5B A;  1IY0 A;  1V34 A;  2EKK A;  3TQS A;  5C18 A;  3GQ3 A;  1PJS A;  3GRR A;  4ANR A;  3HHW A;  1F4I A;  4AG5 A;  1XMQ M;  2YQZ A;  4AKH A;  2R4E A;  3J80 S;  2LTU A;  2FOI C;  2QHO B;  2XH9 A;  4LJA A;  4MH0 E;  3KVW A;  4JN6 A;  4D81 A;  3GLF E;  1PJQ A;  1PM5 A;  1L2B A;  2XZF A;  1VG5 A;  4L4U A;  4MGI E;  3GLI E;  1ZMU A;  4GC9 A;  2L4F A;  2KRU A;  4LJ9 A;  3SFZ A;  3TWL A;  3WHK A;  3I4V A;  2HWJ A;  4MGK E;  3SYK A;  3KDS E;  4F1I A;  1G3I A;  4RKU F;  2XLJ A;  1RU3 A;  1G59 A;  1AIP C;  3JAM S;  2WSC F;  2K6B A;  3HY5 A;  4REZ A;  1L2C A;  2O25 A;  1LTM A;  1DGB A;  3ZQJ A;  4OW0 A;  3SAV A;  1IBM M;  1XXH A;  2F5O A;  2FH0 A;  1R2Y A;  1YLA A;  1NO1 A;  1PJJ A;  1OKS A;  2CHV A;  3M7G A;  2DWN A;  3ILK A;  4M0W A;  3AV0 A;  1QYR A;  1WJ7 A;  1R6B X;  3IG5 A;  3U6C A;  4LFB M;  3AOE A;  3K8Z A;  2CHG A;  1WXQ A;  2DEN A;  4M9S A;  4WP2 A;  2FE8 A;  2L7I A;  2QCU A;  1XHB A;  2FFJ A;  1GJS A;  1HQY E;  1VDD A;  2MRO B;  4FCT A;  3MJ5 A;  1E32 A;  3I01 M;  4FW9 A;  4LJ6 A;  2QZ4 A;  2M60 A;  4LF7 M;  4QNM A;  2JA2 A;  3GRU A;  2VQF M;  4B3R M;  1NVM A;  2X4A A;  4RNA A;  3GLG E;  3R8F A;  3AOG A;  4DR4 M;  1N33 M;  1GL6 A;  1PJI A;  1NHW C;  4L16 A;  2JY6 B;  3LW5 F;  4GEW A;  4LZJ A;  3U60 B;  1Z6T A;  2EUC A;  4IBI A;  4II7 A;  2QNJ A;  4GHA A;  4OX9 M;  2XGN A;  1L2D A;  2BNK A;  4EIW A;  3A98 B;  4UN2 B;  2RRU A;  4FVM A;  4RF1 A;  3OTO M;  2FS1 A;  4LY6 A;  2XEP A;  5EP1 A;  3TWK A;  2UXD M;  2DAE A;  4G4N A;  4QOZ C;  4A3V B;  3U6D A;  2C5R A;  3KOY E;  1QDT A;  4NRV A;  3DA1 A;  2Y0T A;  2CE7 A;  5ITQ A;  2DAK A;  3A45 A;  4I4L A;  5ITY A;  4OU7 A;  2NQ8 C;  3K2L A;  2DHY A;  2L6O A;  1I94 M;  4Z6Y A;  4DV6 M;  2Z8Y M;  4DV7 M;  3U6L A;  3ZC7 B;  2AHM A;  5ITT A;  1DO0 A;  5F3W A;  1PRB A;  1QAN A;  1SXJ A;  2ERC A;  5FSW A;  5KO3 A;  1R2Z A;  2LH0 A;  1Q39 A;  4W5W A;  1QVR A;  4I5S A;  4DR6 M;  3C3D A;  1OJL A;  4GIT A;  2HHH M;  1G4A E;  1QAO A;  3KS8 A;  2LVN C;  3BBZ A;  3SAW A;  2CV0 A;  1MU5 A;  4QHS A;  5KQD A;  1G71 A;  4HL4 A;  2XFT A;  2F5Q A;  5DFL A;  2L09 A;  2OO9 A;  1QDR A;  3QYE A;  2K0B X;  4X66 M;  4K0K M;  1QZE A;  4GKJ M;  5DYI A;  1W5T A;  2K9D A;  3UZU A;  1W5S A;  3UK6 A;  5FTK A;  1DGH B;  4Q7J A;  3RGP A;  3QYB A;  1DGG A;  3WHL A;  4LJ5 A;  3SAU A;  4DR1 M;  2F4V M;  1NSF A;  5JI3 E;  1I4W A;  2JY7 A;  3PFI A;  2R4J A;  1IFY A;  3C9P A;  5JI2 E;  1IY2 A;  4GIP A;  2R0I A;  3HJS A;  1QQW A;  2DXI A;  3EIE A;  2WZJ A;  2HKJ A;  1VEJ A;  4JI6 M;  4LF8 M;  4LFC M;  4XGI A;  2XSZ A;  3IHP A;  2X8A A;  2DNA A;  4LJ8 A;  3PXG A;  4LGY A;  2KNV A;  3RFW A;  2ZAN A;  4FCV A;  3CGW A;  2CUZ A;  3HJQ A;  3VFD A;  4CJ6 A;  4I8O A;  4JI8 M;  2DKL A;  3B7Q A;  2QPA A;  1Z59 A;  5H37 D;  2BJV A;  3T1Y M;  2YFQ A;  2JXN A;  1KYI A;  5ITX A;  4DR5 M;  3E4R A;  1JR3 E;  3T6P A;  1V92 A;  2UXB M;  4LGM A;  3EIH A;  2Z4R A;  4B3T M;  1JQJ C;  1WIV A;  2YNM D;  5LMN M;  4D80 A;  2DI0 A;  2RGH A;  2VII A;  2LHC A;  1QZM A;  3K92 A;  4NSO B;  1HNZ M;  1TTE A;  3HKP A;  2OOB A;  3KSX A;  4AI6 A;  4OVZ B;  2B3T A;  3A46 A;  1JB0 F;  3W0F A;  1NJF A;  2DZO B;  2H5X A;  2QSF X;  4AKG A;  2XF3 A;  2R62 A;  3THG A;  4B3S M;  2J7O A;  4L6V 6;  3J2P B;  3U6E A;  1TDZ A;  2KDL A;  2R44 A;  3IG8 A;  5FTL A;  3M6A A;  3HHZ A;  3GPY A;  3W68 A;  4DBG B;  1KFV A;  3HU1 A;  4M0D A;  3U6M A;  3GLH A;  1IBK M;  1OQY A;  4RF0 A;  5IZ7 D;  2CHQ A;  4GH9 A;  4X64 M;  3HGI A;  1J09 A;  2KRK A;  2V1C A;  4I81 A;  1JR3 D;  1TGU A;  3V76 A;  3UGJ A;  1N36 M;  5A2Q S;  3GPP A;  4LFA M;  2EJS A;  1TH4 A;  3SAS A;  2ZAO A;  2I7N A;  3M0E A;  5EXS A;  2Y20 A;  3RGS A;  1D0L A;  3E46 A;  4JI4 M;  4LCB A;  4HEO A;  4CIS A;  3I51 A;  3GLF A;  2L4E A;  4AZF A;  3I4Y A;  1MJG M;  3FRI A;  1UM8 A;  1NY6 A;  5BR8 M;  4DV5 M;  4G4R A;  3TWM A;  1IM2 A;  4NXN M;  5EXX A;  1TF0 B;  4Z8X A;  1Z5C A;  4GRI A;  3L2A A;  4G6Z A;  3ZH9 B;  4CHT B;  1PGY A;  4X65 M;  1FNN A;  3E21 A;  4L8R C;  2DWL A;  3SBJ A;  3L25 A;  1K82 A;  2BWE A;  2ZAM A;  1R5L A;  2MH8 A;  4PDI A;  2OQ4 A;  2RGO A;  2VDB B;  1NV8 A;  2DHR A;  4FWG A;  2H1R A;  3B7Z A;  3B9P A;  4S12 A;  2MGW A;  1ZQ9 A;  2YR0 A;  3U61 A;  2MR9 A;  4L15 A;  5EJC A;  2G3Q A;  4MB7 A;  1GO5 A;  1IBL M;  3L29 A;  3AKZ A;  3GLG A;  3MHV C;  3QWL A;  2LVO C;  1J5E M;  4JI0 M;  3J27 B;  4WW0 A;  1TR8 A;  3SMS A;  4KO8 A;  4JI1 M;  3J81 S;  5IRE B;  5FTM A;  3VDU A;  3H4J A;  3GP1 A;  2LVA A;  4KHP M;  3KP0 E;  2HL7 A;  3AFH A;  5KPR A;  4TUW A;  4DR2 M;  1Y8G A;  1GAB A;  1NY5 A;  1XNQ M;  1QAQ A;  1LV7 A;  1WR1 B;  3PNY A;  1ZMV A;  3HU3 A;  2UXC M;  1G8P A;  2JP7 A;  4IBC A;  1XXH B;  3FUW A;  2C99 A;  4IBJ A;  3CF2 A;  1T43 A;  1N78 A;  1XMO M;  4KT0 F;  3TL4 X;  3LVV A;  1C1K A;  3A42 A;  3PNV A;  2D7G A;  5EP3 A;  4P17 A;  5FTN A;  4B08 A;  3Q8G A;  1XNR M;  2GQF A;  1K3W A;  5EP2 A;  3FRH A;  4LF4 M;  1UFZ A;  3SHG B;  3FUT A;  2MJ5 B;  3RE8 A;  3K9O A;  3C58 A;  2QQ8 A;  2KXE A;  2O01 F;  1ORY B;  3U5Z A;  3VK7 A;  4JI7 M;  1L8Q A;  2HCB A;  3GO8 A;  4IBD A;  2QBY A;  3NWL A;  2LHG A;  1T6O A;  3D8B A;  2F5N A;  3FYC A;  5DYG A;  1EFU B;  1HT1 E;  3U61 B;  1XWI A;  2OOA A;  3HX3 A;  2UUA M;  3J7B A;  3HZJ A;  4M9Z A;  3B7N A;  1YUB A;  1ZAE A;  5E6J A;  1GKI A;  5FTJ A;  5GKN A;  3T1H M;  3HHX A;  1HQC A;  3HU2 A;  3MMP A;  1C7Y A;  2UUC M;  4G3O A;  2JZ0 A;  3AOE C;  3FTE A;  4QHT A;  1SXJ D;  1MX0 A;  1TH2 A;  2LWX A;  3FD9 A;  1YE9 A;  2ZTC A;  3R9X B;  2M5Z A;  2X49 A;  5EP4 A;  1OAO C;  2VF7 A;  4R7G A;  3BXW A;  2QP9 X;  5C1B A;  2XFS A;  3U6P A;  1IXZ A;  1V33 A;  3JR4 A;  3GPU A;  4DV0 M;  1E9S A;  4GMQ A;  4LZZ A;  2K47 A;  1QUS A;  3HWS A;  1SXJ B;  4QOS A;  3SMP A;  1X37 A;  2F5S A;  1ZV1 A;  5ITX E;  2G5G X;  2HAK A;  1H6U A;  3PVS A;  4DUY M;  3C3E A;  4IJE A;  1D0M A;  1DO2 A;  1IN7 A;  4R71 A;  2R6F A;  1EIJ A;  1L1T A;  4YY3 M;  2EO2 A;  1JR3 A;  2JUJ A;  3KW6 A;  1N77 A;  1OFI A;  2WSF F;  4MM3 B;  2CWB A;  2KNA A;  4IJF A;  4JV5 M;  1L1Z A;  2R45 A;  3KOZ E;  3FTC A;  3LVW A;  4CGY B;  4FWD A;  2KA6 B;  2L7H A;  4M9X A;  2L2D A;  2J7N A;  2KEB A;  4DV3 M;  5BPV A;  5L8R F;  2QBY B;  3SAT A;  3F92 A;  1P3Q Q;  2LXE A;  2N35 A;  1SXJ C;  5ITR A;  2W82 A;  3GRY A;  1NNU C;  2ZM6 M;  3DOA A;  4PDG A;  2XZU A;  3KFU G;  1XC8 A;  3FTF A;  1GLN A;  3E9S A;  2QEN A;  4X62 M;  4AQY M;  3LCV B;  3U60 A;  4LF9 M;  4AW4 A;  1IY1 A;  1OIZ A;  3BOS A;  3L28 A;  3L27 A;  2OPF A;  2J5Y A;  4NSR A;  2I7P A;  4IBF A;  4L78 A;  5DNY A;  3GLI A;  1AUA A;  4LG2 A;  2DWM A;  4GHL A;  4P16 A;  2KW0 A;  2O5R A;  3CF0 A;  3DZD A;  2BWB A;  2C9C A;  2C98 A;  2G8L A;  4IIW A;  1IQP A;  1TDH A;  1XXH E;  4LRT A;  4DV1 M;  1BVS A;  4PCZ A;  1GJT A;  3SC3 A;  2CV1 A;  1IN4 A;  3GQ5 A;  2UU9 M;  2Z7J A;  4NRW A;  3VDP A;  1WHC A;  4NC6 A;  1E94 E;  2JY8 A;  3FUV A;  3Q8X A;  4MGH A;  3LQR A;  4DR7 M;  1IXR C;  4BLC A;  1HR0 M;  3DFZ A;  2EKF A;  3SYL A;  1K3X A;  4IBK A;  2LVQ D;  5EXT A;  2Q2E B;  3FUX A;  1IN6 A;  5E26 A;  3CTW B;  4AG6 A;  2E5L M;  1WGL A;  2DZN B;  2C96 A;  3KXE C;  1N32 M;  1WGN A;  3J7A S;  3GLH B;  4GKK M;  4MGY E;  3AJI B;  4G4O A;  5KPZ A;  2P5T A;  3QAU A;  3T38 A;  5LMU M;  1IXS A;  1G41 A;  1R7R A;  1OTR A;  2FNA A;  4WUR A;  4DV4 M;  4DR3 M;  4YHH M;  2F5P A;  3D8L A;  4AKI A;  1CUK A;  2LVP C;  1ZMW A;  3FTD A;  1DGH A;  5EXP A;  5FLX S;  1YSY A;  2Y0Q A;  4F2L A;  2V6Z M;  5KPT A;  1OFH A;  4XBO A;  3TE6 A;  3GLF B;  4BB9 A;  3I04 M;  4ITQ A;  1VDL A;  2CP8 A;  3SHF A;  2R18 A;  2CV2 A;  2D7E A;  3HJ8 A;  1GL7 A;  3GLI B;  1HNX M;  4JI2 M;  3LMM A;  3H4M A;  2ZBK B;  1N34 M;  2LBC A;  2C9O A;  4B7G A;  1S3S A;  1SXJ E;  3K1J A;  2DAG A;  1FJG M;  4R3D A;  2JWS A;  4LJ7 A;  3FKE A;  1J7K A;  1HNW M;  3ZCB B;  1E9R A;  4LRS A;  4HLQ A;  3VKH A;  2LNH C;  3VKG A;  1D0K A;  2DAM A;  2APL A;  4B7H A;  2GNO A;  1DV0 A;  4IBB A;  4JYA M;  4KOD A;  2JZ1 A;  3NBI A;  4B7F A;  3U6S A;  3B89 A;  2KHH A;  3CF6 E;  1EE8 A;  1VQ1 A;  3IEC A;  1Q3B A;  4FCW A;  3GRV A;  2WSE F;  4JI3 M;  2UUB M;  3KS4 A;  4JXJ A;  4ZPX A;  4NL4 H;  1PJT A;  2EA0 A;  4NXM M;  4OVZ A;  3KSJ A;  2DZL A;  3UMM A;  8CAT A;  2VQE M;  1D2N A;  5ITU A;  3AL0 C;  2DAI A;  4IBE A;  4FWH A;  3GQ4 A;  4IBG A;  1NHG C;  3GLG B;  4G4Q A;  2D7H A;  1OIP A;  1GVN A;  1Q3C A;  1NV9 A;  2DWZ B;  1SG9 A;  1QUT A;  3K9P A;  3FUU A;  4MGZ E;  1IXS B;  5EQT A;  2A5Y B;  1T3T A;  2KZS A;  3KOW E;  4NOO B;  3W0L B;  3W67 A;  7CAT A;  2Z3X A;  2JNH A;  2KZU A;  3LQQ A;  1NJG A;  1TH3 A;  2ZTD A;  3FYD A;  3KP1 E;  2BJW A;  2R46 A;  1Z5A A;  3NBX X;  2CEA A;  4KLN A;  4PD2 A;  3KOX E;  4CIZ A;  3L26 A;  3SAR A;  2CRU A;  1A5T A;  1N75 A;  1XB2 B;  4BBA A;  4B3M M;  5IWA M; 
#chains in the Genus database with same CATH homology
 5KQ8 A;  3U6Q A;  4DUZ M;  1IN5 A;  2R65 A;  3JR5 A;  2Z4S A;  3HHY A;  4LJ4 A;  2Y21 A;  2CFO A;  1DGF A;  1IN8 A;  3TPZ A;  4LF6 M;  4GC5 A;  4DV2 M;  3VK8 A;  4FD2 A;  5IT9 S;  4QNR A;  3T15 A;  3VLF B;  3U5Z B;  2V1U A;  1QAM A;  3UJN A;  2RKO A;  2XSZ D;  1NNJ A;  4LF5 M;  1HT2 E;  3MK6 A;  1KSF X;  3U6O A;  4PT5 A;  3GPX A;  4D82 A;  2DVW B;  1Z5B A;  1IY0 A;  3TQS A;  5C18 A;  3GQ3 A;  3GRR A;  3HHW A;  4AG5 A;  1XMQ M;  2YQZ A;  4AKH A;  2R4E A;  3J80 S;  2FOI C;  2XH9 A;  4LJA A;  4MH0 E;  3KVW A;  4JN6 A;  4D81 A;  1PM5 A;  1L2B A;  2XZF A;  4L4U A;  4MGI E;  4GC9 A;  2KRU A;  4LJ9 A;  3SFZ A;  3TWL A;  3WHK A;  3I4V A;  4MGK E;  3SYK A;  3KDS E;  1G3I A;  2XLJ A;  1G59 A;  3JAM S;  1L2C A;  4REZ A;  1DGB A;  4OW0 A;  3SAV A;  1IBM M;  1XXH A;  2F5O A;  1R2Y A;  1PJJ A;  2CHV A;  3M7G A;  2DWN A;  3ILK A;  4M0W A;  3AV0 A;  1QYR A;  3U6C A;  1R6B X;  3IG5 A;  4LFB M;  3AOE A;  3K8Z A;  2CHG A;  1WXQ A;  4M9S A;  2FE8 A;  2L7I A;  2QCU A;  1XHB A;  2FFJ A;  1HQY E;  1VDD A;  4FCT A;  4FW9 A;  3MJ5 A;  1E32 A;  4LJ6 A;  4LF7 M;  2QZ4 A;  2M60 A;  4QNM A;  2JA2 A;  3GRU A;  2VQF M;  4B3R M;  1NVM A;  2X4A A;  4RNA A;  3R8F A;  4DR4 M;  3AOG A;  1N33 M;  1GL6 A;  1PJI A;  1NHW C;  4L16 A;  4JI5 M;  4LZJ A;  3U60 B;  1Z6T A;  2EUC A;  4IBI A;  4II7 A;  4GHA A;  4OX9 M;  2XGN A;  1L2D A;  2BNK A;  4EIW A;  3A98 B;  4FVM A;  3OTO M;  4RF1 A;  4LY6 A;  2XEP A;  5EP1 A;  3TWK A;  2UXD M;  4G4N A;  4QOZ C;  4A3V B;  3U6D A;  2C5R A;  3KOY E;  4NRV A;  3DA1 A;  2Y0T A;  2CE7 A;  5ITQ A;  3A45 A;  5ITY A;  4I4L A;  4OU7 A;  2NQ8 C;  3K2L A;  2L6O A;  1I94 M;  4Z6Y A;  4DV6 M;  4DV7 M;  3U6L A;  3ZC7 B;  2AHM A;  5ITT A;  1DO0 A;  5F3W A;  1QAN A;  1SXJ A;  2ERC A;  5FSW A;  5KO3 A;  1R2Z A;  2LH0 A;  1Q39 A;  4W5W A;  1QVR A;  4I5S A;  4DR6 M;  1OJL A;  4GIT A;  2HHH M;  1G4A E;  1QAO A;  3KS8 A;  3SAW A;  2CV0 A;  1MU5 A;  4QHS A;  5KQD A;  4HL4 A;  2XFT A;  2F5Q A;  2L09 A;  4K0K M;  4X66 M;  4GKJ M;  5DYI A;  1W5T A;  3UZU A;  1W5S A;  3UK6 A;  5FTK A;  1DGH B;  3RGP A;  1DGG A;  3WHL A;  4LJ5 A;  3SAU A;  4DR1 M;  2F4V M;  1NSF A;  5JI3 E;  1I4W A;  3PFI A;  2R4J A;  5JI2 E;  1IY2 A;  4GIP A;  3HJS A;  1QQW A;  2DXI A;  3EIE A;  2HKJ A;  4JI6 M;  4LF8 M;  4LFC M;  4XGI A;  2XSZ A;  4LJ8 A;  2X8A A;  3PXG A;  4LGY A;  3RFW A;  2ZAN A;  4FCV A;  3HJQ A;  2CUZ A;  3VFD A;  4JI8 M;  4I8O A;  2QPA A;  1Z59 A;  5H37 D;  2BJV A;  3T1Y M;  2YFQ A;  1KYI A;  5ITX A;  4DR5 M;  3E4R A;  2UXB M;  4LGM A;  3EIH A;  2Z4R A;  4B3T M;  1JQJ C;  2YNM D;  5LMN M;  4D80 A;  2RGH A;  2VII A;  3K92 A;  1QZM A;  4NSO B;  1HNZ M;  3HKP A;  4AI6 A;  3KSX A;  4OVZ B;  3A46 A;  3W0F A;  1NJF A;  2DZO B;  4AKG A;  2XF3 A;  2R62 A;  3THG A;  4B3S M;  2J7O A;  3J2P B;  3U6E A;  1TDZ A;  3IG8 A;  5FTL A;  3M6A A;  3HHZ A;  3GPY A;  1KFV A;  3HU1 A;  4M0D A;  3U6M A;  3GLH A;  1IBK M;  4RF0 A;  5IZ7 D;  2CHQ A;  4GH9 A;  4X64 M;  3HGI A;  1J09 A;  2KRK A;  2V1C A;  4I81 A;  1JR3 D;  1TGU A;  3UGJ A;  1N36 M;  5A2Q S;  3GPP A;  4LFA M;  1TH4 A;  3SAS A;  2ZAO A;  2I7N A;  3M0E A;  5EXS A;  2Y20 A;  3RGS A;  4LCB A;  4CIS A;  3I51 A;  3GLF A;  4AZF A;  3I4Y A;  1UM8 A;  1NY6 A;  5BR8 M;  4DV5 M;  4G4R A;  3TWM A;  1IM2 A;  4NXN M;  5EXX A;  4Z8X A;  1Z5C A;  4GRI A;  3L2A A;  4G6Z A;  3ZH9 B;  4CHT B;  4X65 M;  1FNN A;  4L8R C;  2DWL A;  3SBJ A;  3L25 A;  1K82 A;  2ZAM A;  4PDI A;  2OQ4 A;  2RGO A;  2DHR A;  4FWG A;  2H1R A;  3B9P A;  4S12 A;  1ZQ9 A;  2YR0 A;  3U61 A;  4L15 A;  5EJC A;  4MB7 A;  1IBL M;  3L29 A;  3AKZ A;  3GLG A;  3MHV C;  3QWL A;  1J5E M;  4JI0 M;  3J27 B;  4WW0 A;  3SMS A;  4KO8 A;  4JI1 M;  3J81 S;  5IRE B;  5FTM A;  3VDU A;  3GP1 A;  4KHP M;  3KP0 E;  2HL7 A;  3AFH A;  5KPR A;  4TUW A;  4DR2 M;  1NY5 A;  1XNQ M;  1QAQ A;  1LV7 A;  3PNY A;  3HU3 A;  2UXC M;  1G8P A;  4IBC A;  1XXH B;  3FUW A;  2C99 A;  4IBJ A;  3CF2 A;  1N78 A;  1XMO M;  3TL4 X;  3LVV A;  1C1K A;  3A42 A;  3PNV A;  2D7G A;  5EP3 A;  4B08 A;  5FTN A;  1XNR M;  1K3W A;  5EP2 A;  4LF4 M;  3SHG B;  3FUT A;  3RE8 A;  3C58 A;  2KXE A;  1ORY B;  3U5Z A;  3VK7 A;  4JI7 M;  1L8Q A;  2HCB A;  3GO8 A;  4IBD A;  2QBY A;  3NWL A;  3D8B A;  2F5N A;  3FYC A;  5DYG A;  3U61 B;  1HT1 E;  1XWI A;  2UUA M;  3J7B A;  4M9Z A;  1YUB A;  1ZAE A;  5E6J A;  1GKI A;  5FTJ A;  5GKN A;  3T1H M;  3HHX A;  1HQC A;  3HU2 A;  2UUC M;  3AOE C;  3FTE A;  4QHT A;  1SXJ D;  1MX0 A;  1TH2 A;  2LWX A;  3FD9 A;  1YE9 A;  3R9X B;  2M5Z A;  2X49 A;  5EP4 A;  4R7G A;  5C1B A;  2QP9 X;  3U6P A;  2XFS A;  1IXZ A;  3JR4 A;  3GPU A;  4DV0 M;  1E9S A;  4GMQ A;  4LZZ A;  2K47 A;  3HWS A;  1SXJ B;  4QOS A;  3SMP A;  1X37 A;  2F5S A;  5ITX E;  2G5G X;  1H6U A;  3PVS A;  4DUY M;  4IJE A;  1DO2 A;  1IN7 A;  1L1T A;  4YY3 M;  2EO2 A;  1JR3 A;  3KW6 A;  1N77 A;  1OFI A;  4MM3 B;  4IJF A;  4JV5 M;  1L1Z A;  2R45 A;  3KOZ E;  3FTC A;  3LVW A;  4CGY B;  4FWD A;  2KA6 B;  2L7H A;  4M9X A;  2J7N A;  2KEB A;  4DV3 M;  5BPV A;  2QBY B;  3SAT A;  2LXE A;  1SXJ C;  5ITR A;  2W82 A;  3GRY A;  1NNU C;  2ZM6 M;  3DOA A;  4PDG A;  2XZU A;  3KFU G;  1XC8 A;  3E9S A;  1GLN A;  2QEN A;  4X62 M;  4AQY M;  3U60 A;  4LF9 M;  4AW4 A;  1IY1 A;  3BOS A;  3L28 A;  3L27 A;  2OPF A;  4NSR A;  4L78 A;  2I7P A;  4IBF A;  5DNY A;  3GLI A;  3FTF A;  4LG2 A;  2DWM A;  4GHL A;  4P16 A;  2KW0 A;  2O5R A;  3CF0 A;  3DZD A;  2C9C A;  2C98 A;  2G8L A;  4IIW A;  1IQP A;  1TDH A;  4LRT A;  4DV1 M;  4PCZ A;  3SC3 A;  2CV1 A;  1IN4 A;  3GQ5 A;  2UU9 M;  2Z7J A;  4NRW A;  3VDP A;  1E94 E;  3FUV A;  3Q8X A;  4MGH A;  3LQR A;  4DR7 M;  1IXR C;  4BLC A;  1HR0 M;  3DFZ A;  3SYL A;  1K3X A;  4IBK A;  5EXT A;  2Q2E B;  3FUX A;  1IN6 A;  5E26 A;  3CTW B;  4AG6 A;  2E5L M;  2DZN B;  2C96 A;  3KXE C;  1N32 M;  4GKK M;  3J7A S;  3GLH B;  4MGY E;  3AJI B;  4G4O A;  5KPZ A;  2P5T A;  3QAU A;  3T38 A;  5LMU M;  1G41 A;  1R7R A;  2FNA A;  4WUR A;  4DV4 M;  4DR3 M;  4YHH M;  2F5P A;  3D8L A;  4AKI A;  3FTD A;  1DGH A;  5EXP A;  5FLX S;  1YSY A;  2Y0Q A;  2V6Z M;  5KPT A;  1OFH A;  4XBO A;  3TE6 A;  3GLF B;  4BB9 A;  4ITQ A;  3SHF A;  2R18 A;  2CV2 A;  2D7E A;  3HJ8 A;  1GL7 A;  3GLI B;  1HNX M;  4JI2 M;  3LMM A;  3H4M A;  2ZBK B;  1N34 M;  2C9O A;  4B7G A;  1S3S A;  1SXJ E;  3K1J A;  1FJG M;  4R3D A;  4LJ7 A;  3FKE A;  1J7K A;  1HNW M;  3ZCB B;  1E9R A;  4LRS A;  4HLQ A;  3VKH A;  2LNH C;  3VKG A;  4B7H A;  4IBB A;  4JYA M;  4KOD A;  3NBI A;  4B7F A;  3U6S A;  3CF6 E;  1EE8 A;  4FCW A;  1Q3B A;  3GRV A;  4JI3 M;  2UUB M;  3KS4 A;  4JXJ A;  4ZPX A;  4NL4 H;  2EA0 A;  4NXM M;  4OVZ A;  3KSJ A;  3UMM A;  8CAT A;  2VQE M;  1D2N A;  5ITU A;  3AL0 C;  4IBE A;  4FWH A;  3GQ4 A;  4IBG A;  1NHG C;  3GLG B;  4G4Q A;  2D7H A;  1GVN A;  1Q3C A;  2DWZ B;  5EQT A;  4MGZ E;  3FUU A;  1IXS B;  3W0L B;  2A5Y B;  1T3T A;  2KZS A;  3KOW E;  4NOO B;  7CAT A;  2Z3X A;  2KZU A;  3LQQ A;  3KP1 E;  1NJG A;  1TH3 A;  3FYD A;  4KLN A;  2BJW A;  2R46 A;  1Z5A A;  4PD2 A;  2CEA A;  3L26 A;  3SAR A;  3KOX E;  4JI4 M;  1N75 A;  4BBA A;  4B3M M;  5IWA M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...