4DV6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv6M02
4LFBM 4JI0M 5IWAM 1IBLM 5BR8M 2ZM6M 4DR3M 3U6CA 3SBJA 3W0FA 3A42A 1Q3BA 3GPPA 3GO8A 4DV7M 5ITRA 3J81S 3JAMS 4DR4M 3SAUA 2XZUA 4PDGA 4DUYM 2XZFA 3GPUA 4PCZA 1EE8A 3U6QA 3TWLA 1N36M 2UUBM 4DV5M 4DR1M 2UXDM 4DV6M 5IT9S 4K0KM 4KHPM 3SAWA 4OX9M 4B3RM 4MB7A 4NXMM 1HNWM 4NRWA 5FLXS 1L1TA 3T1HM 3SARA 1TDZA 2F4VM 3DOAA 1L2DA 2HKJA 4YY3M 5ITTA 3U6DA 4PDIA 4DV0M 1L2CA 4LFCM 4JYAM 1I94M 4X65M 4G4OA 4JI4M 3U6PA 2F5QA 1XMOM 1R2ZA 3TWMA 1PM5A 1K82A 1Q39A 1L1ZA 1HNXM 3U6SA 4DV2M 3JR4A 1N33M 1N34M 2F5NA 1Z5CA 2UXCM 4B3SM 3VK8A 4GKJM 4LF5M 1NNJA 2UUCM 4LF9M 1IBMM 4DR5M 2F5SA 1XNQM 4B3TM 2EA0A 4JI6M 2VQFM 3VK7A 1PJIA 4NXNM 3C58A 2VQEM 3GQ5A 3GQ4A 4JI7M 2UXBM 4JI8M 4ITQA 4NRVA 4DV4M 4LFAM 4JI3M 3TWKA 3GP1A 3JR5A 4G4NA 1Z5BA 2OQ4A 3J7AS 1TDHA 1KFVA 4DUZM 3U6LA 4PD2A 2F5OA 1MX0A 2Q2EB 1Q3CA 1J5EM 4GKKM 3GPXA 3A45A 5ITUA 4CISA 4LF8M 3J80S 5A2QS 4DV3M 1XNRM 4JI5M 1L2BA 3GQ3A 4JV5M 2HHHM 2ZBKB 1HR0M 2UU9M 4G4RA 3U6EA 1IBKM 2UUAM 4JI1M 1Z5AA 1HNZM 4X64M 1K3WA 4DR7M 4X66M 5ITYA 4AQYM 1FJGM 1Z59A 5LMNM 2F5PA 3OTOM 4G4QA 1R2YA 5ITXE 4YHHM 3GPYA 3SAVA 3SATA 1PJJA 4LF4M 3U6MA 4X62M 4LF7M 2E5LM 5ITXA 1MU5A 4B3MM 4DV1M 4LF6M 5ITQA 1N32M 3T1YM 2OPFA 3SASA 1XC8A 1XMQM 4DR6M 5LMUM 3U6OA 4DR2M 3A46A 4JI2M 1K3XA
chains in the Genus database with same CATH superfamily
4JI0M 5IWAM 4FCVA 1IBLM 3KDSE 4WP2A 2CWBA 3A42A 2KA6B 3GO8A 2D7EA 2DENA 1MN3A 4DUYM 2KNAA 3SHGB 3BOSA 3FUUA 3U6QA 4PCZA 1QZEA 1AUAA 5KPTA 1N36M 2R46A 4P16A 4DR1M 5IT9S 2CV2A 3THGA 4LG2A 4K0KM 2VIIA 5DYGA 1HNWM 2VF8A 2ZTCA 2R45A 4MGIE 4BB9A 4OW0A 1L1TA 1TDZA 2F4VM 2Z4RA 4L15A 1OJLA 2HKJA 4F1IA 2QPAA 3WHLA 2L6OA 5EXTA 4PDIA 1QVRA 1L2CA 4JYAM 1TH4A 1EFUB 2AHMA 2FNAA 2QQ8A 3GRUA 2QCUA 1IN6A 1XMOM 2KZUA 3TPZA 3AOEC 1ORYB 3ZC7B 1GABA 1L1ZA 7CATA 4DV2M 4BLCA 1JR3E 5DYIA 2HAKA 2F5NA 1JR3A 3K8ZA 2CHVA 5IREB 4B3SM 3NBXX 3VK8A 1AIPC 2DI0A 3I4YA 4L6V6 3FYCA 2X8AA 2Z8YM 3L27A 3HJSA 4DR5M 4B3TM 2DAIA 4JI6M 3VK7A 2DWNA 2VQEM 2KRUA 4JI7M 1YLAA 4JI8M 1YUBA 2NQ8C 2QHOB 1Y8GA 1Z5BA 5DNYA 3SHFA 3J7AS 4I5SA 5FTLA 4GITA 2L4FA 3SFZA 5BPVA 1IXRC 2DKLA 4PD2A 2BNKA 4LZJA 2QZ4A 3FUVA 1OAOC 1Q3CA 2K47A 2J7OA 4IBFA 4D80A 4L78A 3HHYA 2MH8A 1GKIA 4CJ6A 1VQ1A 3J80S 3D8BA 4JI5M 4NC6A 1OAIA 1N77A 4JV5M 2FH0A 3BBZA 2I7NA 5FSWA 2UU9M 4G4RA 1DO0A 3U6EA 1IBKM 2QBYA 4JI1M 3KFUG 3FTCA 4FWGA 4DR7M 4X66M 1WJ7A 3SC3A 2KHHA 1Z59A 2H5XA 2Z4SA 5KQ8A 5LMNM 1JQJC 1PRBA 2F5PA 2BWEA 1GJSA 1SXJE 2X4AA 4X62M 1SG9A 1PJTA 3B9PA 3V76A 4B7HA 3KP0E 1SXJA 5GKNA 1IM2A 1T43A 1FNNA 3TL4X 2J7NA 3HHXA 1T3TA 3IG5A 3M0EA 2CV0A 4Q7JA 2LNHC 4CGYB 1NSFA 4LF6M 1XXHE 2FFJA 1G3IA 3T1YM 4GEWA 4WW0A 3SYLA 1XXHA 5FTMA 5LMUM 3BXWA 4MH0E 1TR8A 3B7QA 2APLA 3I04M 5JI3E 2XSZA 1K3XA 3HU2A 1WGLA 5E26A 4LFBM 3UJNA 3J7BA 5L8RF 4DR3M 1EIJA 4AKIA 1Q3BA 3FRHA 1BVSA 4LJ6A 2KNZA 3GLGE 2VDBB 3J81S 4DR4M 3Q8XA 3DZDA 3W0LB 3QYEA 4NL4H 3GLGA 2XZFA 1WHCA 1Q02A 1OFIA 2EO2A 1S3SA 2D7HA 1XHBA 2CFOA 2M5ZA 4LJ8A 1LTMA 1R5LA 4KHPM 3SAWA 2MROB 2Z7JA 2QBYB 1HJPA 1QAMA 4OX9M 3HY5A 2O25A 1GVNA 5DFLA 4NRWA 2O5RA 4GRIA 3QYBA 1L2DA 2LVPC 4M0WA 4LJ5A 4LY6A 1IY0A 2ZANA 3TE6A 3U6DA 1NJGA 2CHQA 5JI2E 2BJVA 2KRKA 2DWMA 3I01M 3SMPA 4DV0M 3R8FA 3QAUA 3KXEC 4AI6A 2DZNB 1G41A 5EP2A 4WURA 1SXJB 1JB0F 1PM5A 4I8OA 4JN6A 4MM3B 1K82A 1C1KA 1Q39A 1UFZA 3AL0C 3HGIA 2CRUA 4GIPA 2A5YB 3FRIA 3NBIA 3JR4A 4I4LA 1DGGA 2R6FA 8CATA 1VDDA 1XXHB 3HX3A 4L16A 1PJQA 2EKKA 1D0KA 4LF5M 2JY6B 3WHKA 2HL7A 3RGSA 1HQYE 3U60A 4FD2A 2YQZA 4B7GA 1XNQM 2P5TA 1OIPA 3HHZA 2VQFM 1G59A 1PJIA 4NXNM 1LV7A 2KZSA 2L09A 2V1UA 3FTDA 4IBEA 4LGYA 4DBGB 2KW0A 4ITQA 1I4WA 3T15A 4QNMA 4LJ4A 3TWKA 3C3DA 3LCUA 3CTWB 2G3QA 3GLGB 3I4VA 3KOXE 4MGYE 4FCWA 4B08A 3HJQA 2LVAA 3ZQJA 4R7GA 1MX0A 2Q2EB 3LMMA 2L7HA 3RFWA 1J5EM 3GPXA 3C9PA 3HKPA 1R6BX 2DAMA 4NOOB 1R4GA 2LVQD 4CISA 2JP7A 2DHRA 2JUJA 1P3QQ 4LRSA 4FWHA 4LF8M 3L26A 1XNRM 2C5RA 3PNVA 4M9SA 3LVVA 3GRRA 1IN4A 4OU7A 4IBGA 1IXSA 1HNZM 3UK6A 2CP8A 3GRVA 3L28A 4ANRA 4MGKE 1FJGM 4D82A 2LVOC 4G4QA 2JZ1A 3C3EA 2XFTA 3EIEA 2HWJA 2LVNC 3CF6E 4QOSA 2WSFF 4RNAA 3U6MA 4LF7M 1QDTA 2KXEA 2XEPA 2XFSA 2FS1A 2JY5A 3AV0A 3KOZE 3VDPA 2DHYA 1PJSA 3MK6A 4B3MM 1NY6A 4KO8A 1YSYA 4DV1M 2LTUA 4M9XA 3U60B 1GJTA 3PXGA 3SASA 1XC8A 1J7KA 3CF2A 3U6OA 4AKHA 4DR2M 2GQFA 5H37D 1QZMA 2XGNA 2O01F 3UMMA 3VKHA 1NHWC 3KP1E 3IHPA 4IIWA 2ZM6M 3SBJA 3W0FA 3FTEA 2RGOA 3GLHE 1QAOA 5F3WA 1WR1B 3QWLA 5ITRA 1L8QA 3JAMS 1QUTA 1OIZA 5EP4A 3GLHA 3RE8A 1D0LA 3L29A 4NSRA 3U5ZA 2W82A 1NJFA 3TWLA 1ZV1A 5E6JA 4IBIA 3AJIB 4DV5M 4DV6M 4IBCA 1T6OA 2C9OA 5KPZA 4IBDA 4BBAA 1IXSB 2ZTDA 3T1HM 3PNYA 2K6BA 4S12A 1XB2B 4IBBA 1ZMVA 1X37A 1HQCA 1E9SA 3HHWA 4GHAA 1OTRA 5ITTA 1DGHB 3L25A 3B74A 1QUSA 1C7YA 2VF7A 2B3TA 1I94M 4X65M 2Z3XA 1DGBA 3Q8GA 2F5QA 2JY7A 3ZCBB 3TWMA 2KEBA 2Y0TA 3LW5F 1GL7A 2J5YA 4NSOB 3KVWA 3D8LA 1VDLA 1N33M 1W5TA 4RF1A 1IFYA 1DV0A 1NV8A 4G6ZA 4MGHA 2LBCA 1Z5CA 3VLFB 3LCVB 2UXCM 3AKZA 3GLFE 3M6AA 4I81A 4GKJM 3UGJA 4LF9M 3DA1A 2DNAA 1IBMM 2EA0A 2LWXA 3K9OA 3GLFA 2RKOA 3C58A 4W5WA 3GQ4A 2DAKA 4XBOA 4GHLA 5EXPA 2FE8A 2YNMD 2BJWA 1D0MA 2WSCF 4JI3M 2L2DA 1NY5A 3JR5A 2KNVA 3GLHB 4B7FA 1TDHA 1KFVA 4KLNA 3U5ZB 3LQRA 3U61A 4AG6A 2CUZA 3NWLA 2OOAA 2XH9A 2F5OA 3HZJA 3FTFA 2L7IA 5EJCA 4GKKM 3KOWE 3PVSA 2G8LA 2LHCA 5FTKA 2KDLA 3LQQA 3A45A 4LJ9A 2G5GX 3MJ5A 5ITUA 4G3OA 1GO5A 3ILKA 2V1CA 1RU3A 3B7ZA 1HT1E 5KO3A 5A2QS 4OVZA 1L2BA 4AW4A 3GQ3A 4HEOA 2HHHM 1QAQA 2ZBKB 4QHSA 1KYIA 2X49A 2UUAM 1J09A 1V92A 4X64M 3W68A 5ITYA 4FW9A 1E9RA 3FKEA 3ZH9B 2DAGA 3KSJA 3OTOM 1R2YA 2JNHA 2OO9A 1ZMWA 3IG8A 3HU1A 3IECA 2JWSA 1A5TA 4P17A 5KQDA 5ITXE 4YHHM 1NNUC 3GPYA 1QYRA 1Z6TA 3M7GA 5FTJA 1WGNA 1WXQA 4GMQA 2I7PA 4FVMA 3UZUA 2E5LM 5ITXA 3L2AA 5FTNA 1TH3A 3VFDA 2QSFX 1GL6A 2K9DA 2YFQA 3TQSA 2M60A 2RGHA 1CUKA 1ZAEA 4FCTA 1GLNA 4GC5A 3VDUA 3B89A 4Z6YA 2N35A 3FD9A 3T38A 3GLIE 4EIWA 2RRUA 2XLJA 3GLFB 3FE3A 1TH2A 2CE7A 2OPFA 3HWSA 3GLIA 2EKFA 2GNOA 4DR6M 3H4MA 4REZA 3KS8A 5C1BA 3SYKA 1IY1A 1G4AE 4UN2B 3RGPA 2CHGA 4JI2M 1JR3D 3GRYA 4PT5A 1SXJC 4AZFA 1D2NA 1TTEA 3U61B 5BR8M 3U6CA 3J2PB 3GPPA 4LZZA 2WZJA 1DGHA 4DV7M 1R7RA 3SAUA 1IN7A 4PDGA 2XZUA 2DVWB 3K92A 3K9PA 4QHTA 1IN8A 3GPUA 1EE8A 3SMSA 2ERCA 4OVZB 2UUBM 2UXDM 5EP1A 2H1RA 2R4EA 2R65A 5EP3A 4B3RM 3FYDA 4MB7A 1XWIA 4NXMM 1IQPA 2OOBA 5FLXS 3HJ8A 3SARA 3AOGA 1G8PA 3KOYE 2ZAOA 3DOAA 3KW6A 2DWZB 2CEAA 4YY3M 4LJ7A 3VKGA 4A3VB 2YR0A 4LFCM 4G4OA 4JI4M 2LHGA 3U6PA 4L8RC 2R44A 1DGFA 1R2ZA 1IXZA 1TGUA 2EJSA 4IBKA 2DAEA 2Y20A 1OQYA 1H6UA 2ZAMA 4AKGA 1QQWA 1IN5A 1HNXM 3LVWA 4F2LA 3U6SA 5EQTA 3CF0A 3E9SA 1ZMUA 3GLIB 1YE9A 3AFHA 4RKUF 1N34M 2DZOB 2HCBA 3AOEA 4R71A 2DXIA 4GH9A 1SXJD 1N78A 4M9ZA 4CIZA 1DO2A 1NNJA 2DWLA 2UUCM 3E21A 4QNRA 5EXSA 2F5SA 4FWDA 4AG5A 2L4EA 3KS4A 1TF0B 3H4JA 4IBJA 5EXXA 1NO1A 2XF3A 3GQ5A 2UXBM 3B7NA 4D81A 3PFIA 4GC9A 2MGWA 2QP9X 4KT0F 2QNJA 4NRVA 4LFAM 4DV4M 1NVMA 3GP1A 4G4NA 1KSFX 1NHGC 2JY8A 2OQ4A 4XGIA 4IJEA 3J27B 2FOIC 1VEKA 3K1JA 2R18A 2BWBA 4DUZM 1V33A 3U6LA 3FUXA 2XSZD 4LCBA 4XK8F 3EIHA 4IJFA 1OKSA 3W67A 2MJ5B 3FUTA 1F4IA 1VG5A 5IZ7D 1VEGA 1V34A 4LGMA 3DFZA 1WIVA 1QANA 4TUWA 2C9CA 3HU3A 2Y21A 1IY2A 1UM8A 2DZLA 3E4RA 1G71A 4CHTB 4DV3M 2EUCA 2QENA 2D7GA 4II7A 2R62A 3F92A 1HR0M 4JXJA 1Z5AA 1K3WA 4LJAA 2WSEF 2MR9A 4HL4A 1HT2E 3E46A 4AQYM 3MHVC 4L4UA 3R9XB 4QOZC 3KSXA 2LH0A 3SAVA 3SATA 2C99A 1PJJA 1NV9A 3I51A 3CGWA 1MJGM 4LF4M 1N75A 2C98A 5KPRA 2K0BX 1MU5A 2JZ0A 3T6PA 3MMPA 2JXNA 3A98B 1VEJA 2Y0QA 2JA2A 1E94E 1QDRA 4LRTA 2R4JA 4Z8XA 1PGYA 4M0DA 4KODA 5ITQA 1N32M 1E32A 4ZPXA 2LXEA 2V6ZM 4R3DA 3FUWA 4Y28F 1OFHA 1W5SA 5C18A 1XMQM 1ZQ9A 4RF0A 3K2LA 2CV1A 2R0IA 3A46A 2C96A 4HLQA 4MGZE
chains in the Genus database with same CATH topology
4JI0M 5IWAM 4FCVA 1IBLM 3KDSE 3A42A 2KA6B 3GO8A 2D7EA 4DUYM 3SHGB 3BOSA 3FUUA 3U6QA 4PCZA 5KPTA 1N36M 2R46A 4P16A 4DR1M 5IT9S 2CV2A 3THGA 4LG2A 4K0KM 2VIIA 5DYGA 1HNWM 4MGIE 2R45A 4BB9A 4OW0A 1L1TA 1TDZA 2F4VM 2Z4RA 4L15A 1OJLA 2HKJA 2QPAA 3WHLA 2L6OA 5EXTA 4PDIA 1QVRA 1L2CA 4JYAM 1TH4A 2AHMA 2FNAA 3GRUA 2QCUA 1IN6A 1XMOM 2KZUA 3TPZA 3AOEC 1ORYB 3ZC7B 1L1ZA 7CATA 4DV2M 4BLCA 5DYIA 2F5NA 1JR3A 3K8ZA 2CHVA 5IREB 4B3SM 3VK8A 3I4YA 3FYCA 2X8AA 3L27A 3HJSA 4DR5M 4B3TM 4JI6M 3VK7A 2DWNA 2VQEM 2KRUA 4JI7M 4JI8M 1YUBA 2NQ8C 1Z5BA 5DNYA 3SHFA 3J7AS 4I5SA 5FTLA 4GITA 3SFZA 5BPVA 1IXRC 4PD2A 2BNKA 4LZJA 2QZ4A 3FUVA 2K47A 1Q3CA 2J7OA 4IBFA 4D80A 4L78A 3HHYA 1GKIA 3J80S 3D8BA 4JI5M 1N77A 4JV5M 5FSWA 2I7NA 2UU9M 2QBYA 4G4RA 1DO0A 3U6EA 1IBKM 4JI1M 3KFUG 3L25A 3FTCA 4FWGA 4DR7M 4X66M 3SC3A 1Z59A 5KQ8A 2Z4SA 5LMNM 1JQJC 2F5PA 1SXJE 2X4AA 4X62M 3B9PA 4B7HA 3KP0E 1SXJA 5GKNA 1IM2A 1FNNA 3TL4X 2J7NA 3HHXA 1T3TA 3IG5A 3M0EA 2CV0A 2LNHC 4CGYB 1NSFA 4LF6M 2FFJA 1G3IA 3T1YM 4WW0A 3SYLA 1XXHA 5FTMA 5LMUM 4MH0E 5JI3E 2XSZA 1K3XA 3HU2A 4LFBM 5E26A 3UJNA 3J7BA 4DR3M 4AKIA 1Q3BA 4LJ6A 3J81S 4DR4M 3Q8XA 3DZDA 3W0LB 4NL4H 3GLGA 2XZFA 1OFIA 2EO2A 1S3SA 2D7HA 1XHBA 2CFOA 2M5ZA 4LJ8A 4KHPM 3SAWA 2Z7JA 2QBYB 1QAMA 4OX9M 1GVNA 4NRWA 2O5RA 4GRIA 1L2DA 4M0WA 3TE6A 4LJ5A 4LY6A 1IY0A 2ZANA 3U6DA 1NJGA 2CHQA 5JI2E 2BJVA 2KRKA 2DWMA 3SMPA 4DV0M 3R8FA 3QAUA 3KXEC 4AI6A 2DZNB 1G41A 5EP2A 4WURA 1SXJB 1PM5A 4I8OA 4JN6A 4MM3B 1K82A 1C1KA 1Q39A 3AL0C 3HGIA 4GIPA 2A5YB 3NBIA 3JR4A 4I4LA 1DGGA 8CATA 1VDDA 1XXHB 4L16A 4LF5M 3WHKA 2HL7A 3RGSA 1HQYE 3U60A 4FD2A 2YQZA 4B7GA 1XNQM 2P5TA 3HHZA 2VQFM 1G59A 1PJIA 4NXNM 1LV7A 2KZSA 2L09A 2V1UA 3FTDA 4IBEA 4LGYA 2KW0A 4ITQA 1I4WA 3T15A 4QNMA 4LJ4A 3TWKA 3CTWB 3GLGB 3I4VA 3KOXE 4MGYE 4FCWA 4B08A 3HJQA 4R7GA 1MX0A 2Q2EB 3LMMA 2L7HA 3RFWA 1J5EM 3GPXA 3HKPA 1R6BX 4NOOB 4CISA 2DHRA 4LRSA 4LF8M 4FWHA 3L26A 1XNRM 2C5RA 3PNVA 4M9SA 3LVVA 3GRRA 1IN4A 4OU7A 4IBGA 1HNZM 3UK6A 3GRVA 3L28A 1FJGM 4MGKE 4D82A 4G4QA 2XFTA 3EIEA 3CF6E 4QOSA 4RNAA 3U6MA 4LF7M 2KXEA 2XEPA 2XFSA 3AV0A 3VDPA 3KOZE 3MK6A 4B3MM 1NY6A 4KO8A 1YSYA 4DV1M 4M9XA 3U60B 3PXGA 3SASA 1XC8A 1J7KA 3CF2A 3U6OA 4AKHA 4DR2M 5H37D 1QZMA 2XGNA 3UMMA 3VKHA 1NHWC 3KP1E 4IIWA 2ZM6M 3SBJA 3FTEA 3W0FA 2RGOA 1QAOA 5F3WA 3QWLA 5ITRA 1L8QA 3JAMS 5EP4A 3GLHA 3RE8A 3L29A 4NSRA 3U5ZA 2W82A 1NJFA 3TWLA 5E6JA 4IBIA 3AJIB 4DV5M 4DV6M 4IBCA 2C9OA 5KPZA 4IBDA 4BBAA 1IXSB 3T1HM 3PNYA 4S12A 4IBBA 1X37A 1HQCA 1E9SA 3HHWA 4GHAA 5ITTA 1DGHB 1I94M 4X65M 2Z3XA 1DGBA 2F5QA 3ZCBB 3TWMA 2KEBA 2Y0TA 1GL7A 4NSOB 3KVWA 3D8LA 1N33M 1W5TA 4RF1A 4G6ZA 4MGHA 1Z5CA 3VLFB 2UXCM 3AKZA 3M6AA 4I81A 4GKJM 3UGJA 4LF9M 3DA1A 1IBMM 2EA0A 2LWXA 3GLFA 2RKOA 3C58A 4W5WA 3GQ4A 4XBOA 4GHLA 5EXPA 2FE8A 2YNMD 2BJWA 4JI3M 1NY5A 3JR5A 3GLHB 4B7FA 1TDHA 1KFVA 4KLNA 3U5ZB 3LQRA 3U61A 4AG6A 2CUZA 3NWLA 2XH9A 2F5OA 3FTFA 2L7IA 5EJCA 4GKKM 3KOWE 3PVSA 2G8LA 5FTKA 3LQQA 4LJ9A 3A45A 2G5GX 3MJ5A 5ITUA 3ILKA 2V1CA 1HT1E 5KO3A 5A2QS 4OVZA 1L2BA 4AW4A 3GQ3A 2HHHM 1QAQA 2ZBKB 4QHSA 1KYIA 2X49A 2UUAM 1J09A 4X64M 5ITYA 4FW9A 1E9RA 3FKEA 3ZH9B 3KSJA 3OTOM 1R2YA 3IG8A 3HU1A 5KQDA 5ITXE 4YHHM 3GPYA 1NNUC 1QYRA 1Z6TA 3M7GA 5FTJA 1WXQA 4GMQA 2I7PA 4FVMA 3UZUA 2E5LM 5ITXA 3L2AA 5FTNA 1TH3A 3VFDA 1GL6A 3TQSA 2YFQA 2M60A 2RGHA 1ZAEA 4GC5A 4FCTA 1GLNA 3VDUA 4Z6YA 3FD9A 3T38A 4EIWA 2XLJA 3GLFB 1TH2A 2CE7A 2OPFA 3HWSA 3GLIA 4DR6M 3H4MA 4REZA 3KS8A 5C1BA 3SYKA 1IY1A 1G4AE 3RGPA 4JI2M 2CHGA 1JR3D 3GRYA 4PT5A 1SXJC 4AZFA 1D2NA 3U61B 5BR8M 3U6CA 3J2PB 3GPPA 4LZZA 1DGHA 4DV7M 1R7RA 3SAUA 1IN7A 4PDGA 2XZUA 2DVWB 3K92A 4QHTA 1IN8A 3GPUA 1EE8A 3SMSA 2ERCA 4OVZB 2UUBM 2UXDM 5EP1A 2H1RA 2R4EA 2R65A 5EP3A 4B3RM 3FYDA 4MB7A 1XWIA 4NXMM 1IQPA 5FLXS 3HJ8A 3SARA 3AOGA 1G8PA 3KOYE 2ZAOA 3DOAA 3KW6A 2DWZB 2CEAA 4YY3M 4LJ7A 3VKGA 4A3VB 2YR0A 4LFCM 4G4OA 4JI4M 3U6PA 4L8RC 1DGFA 1R2ZA 1IXZA 1TGUA 4IBKA 2Y20A 1H6UA 2ZAMA 4AKGA 1QQWA 1IN5A 1HNXM 3LVWA 3U6SA 5EQTA 3CF0A 3E9SA 3GLIB 1YE9A 3AFHA 1N34M 2DZOB 2HCBA 3AOEA 2DXIA 4GH9A 1SXJD 1N78A 4M9ZA 1DO2A 1NNJA 2DWLA 2UUCM 5EXSA 4QNRA 2F5SA 4FWDA 4AG5A 3KS4A 4IBJA 5EXXA 2XF3A 3GQ5A 2UXBM 4D81A 3PFIA 4GC9A 2QP9X 4NRVA 4DV4M 4LFAM 1NVMA 3GP1A 4G4NA 1KSFX 1NHGC 2OQ4A 4XGIA 4IJEA 3J27B 2FOIC 3K1JA 2R18A 4DUZM 3U6LA 3FUXA 2XSZD 4LCBA 3EIHA 4IJFA 3FUTA 5IZ7D 4LGMA 3DFZA 1QANA 4TUWA 2C9CA 3HU3A 2Y21A 1IY2A 1UM8A 3E4RA 4CHTB 4DV3M 2EUCA 2QENA 2D7GA 4II7A 2R62A 1HR0M 4JXJA 1Z5AA 1K3WA 4LJAA 4HL4A 1HT2E 4AQYM 3MHVC 4L4UA 3R9XB 4QOZC 3KSXA 2LH0A 3SAVA 3SATA 2C99A 1PJJA 3I51A 4LF4M 1N75A 2C98A 5KPRA 1MU5A 3A98B 2Y0QA 2JA2A 1E94E 4LRTA 4Z8XA 2R4JA 4M0DA 4KODA 5ITQA 1N32M 1E32A 4ZPXA 2LXEA 2V6ZM 4R3DA 3FUWA 1OFHA 1W5SA 5C18A 1XMQM 1ZQ9A 4RF0A 3K2LA 2CV1A 3A46A 2C96A 4HLQA 4MGZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB M;  4JI0 M;  5IWA M;  1IBL M;  5BR8 M;  2ZM6 M;  4DR3 M;  3U6C A;  3SBJ A;  3W0F A;  3A42 A;  1Q3B A;  3GPP A;  3GO8 A;  4DV7 M;  5ITR A;  3J81 S;  3JAM S;  4DR4 M;  3SAU A;  2XZU A;  4PDG A;  4DUY M;  2XZF A;  3GPU A;  4PCZ A;  1EE8 A;  3U6Q A;  3TWL A;  1N36 M;  2UUB M;  4DV5 M;  4DR1 M;  2UXD M;  4DV6 M;  5IT9 S;  4K0K M;  4KHP M;  3SAW A;  4OX9 M;  4B3R M;  4MB7 A;  4NXM M;  1HNW M;  4NRW A;  5FLX S;  1L1T A;  3T1H M;  3SAR A;  1TDZ A;  2F4V M;  3DOA A;  1L2D A;  2HKJ A;  4YY3 M;  5ITT A;  3U6D A;  4PDI A;  4DV0 M;  1L2C A;  4LFC M;  4JYA M;  1I94 M;  4X65 M;  4G4O A;  4JI4 M;  3U6P A;  2F5Q A;  1XMO M;  1R2Z A;  3TWM A;  1PM5 A;  1K82 A;  1Q39 A;  1L1Z A;  1HNX M;  3U6S A;  4DV2 M;  3JR4 A;  1N33 M;  1N34 M;  2F5N A;  1Z5C A;  2UXC M;  4B3S M;  3VK8 A;  4GKJ M;  4LF5 M;  1NNJ A;  2UUC M;  4LF9 M;  1IBM M;  4DR5 M;  2F5S A;  1XNQ M;  4B3T M;  2EA0 A;  4JI6 M;  2VQF M;  3VK7 A;  1PJI A;  4NXN M;  3C58 A;  2VQE M;  3GQ5 A;  3GQ4 A;  4JI7 M;  2UXB M;  4JI8 M;  4ITQ A;  4NRV A;  4DV4 M;  4LFA M;  4JI3 M;  3TWK A;  3GP1 A;  3JR5 A;  4G4N A;  1Z5B A;  2OQ4 A;  3J7A S;  1TDH A;  1KFV A;  4DUZ M;  3U6L A;  4PD2 A;  2F5O A;  1MX0 A;  2Q2E B;  1Q3C A;  1J5E M;  4GKK M;  3GPX A;  3A45 A;  5ITU A;  4CIS A;  4LF8 M;  3J80 S;  5A2Q S;  4DV3 M;  1XNR M;  4JI5 M;  1L2B A;  3GQ3 A;  4JV5 M;  2HHH M;  2ZBK B;  1HR0 M;  2UU9 M;  4G4R A;  3U6E A;  1IBK M;  2UUA M;  4JI1 M;  1Z5A A;  1HNZ M;  4X64 M;  1K3W A;  4DR7 M;  4X66 M;  5ITY A;  4AQY M;  1FJG M;  1Z59 A;  5LMN M;  2F5P A;  3OTO M;  4G4Q A;  1R2Y A;  5ITX E;  4YHH M;  3GPY A;  3SAV A;  3SAT A;  1PJJ A;  4LF4 M;  3U6M A;  4X62 M;  4LF7 M;  2E5L M;  5ITX A;  1MU5 A;  4B3M M;  4DV1 M;  4LF6 M;  5ITQ A;  1N32 M;  3T1Y M;  2OPF A;  3SAS A;  1XC8 A;  1XMQ M;  4DR6 M;  5LMU M;  3U6O A;  4DR2 M;  3A46 A;  4JI2 M;  1K3X A; 
#chains in the Genus database with same CATH topology
 4JI0 M;  5IWA M;  4FCV A;  1IBL M;  3KDS E;  4WP2 A;  2CWB A;  3A42 A;  2KA6 B;  3GO8 A;  2D7E A;  2DEN A;  1MN3 A;  4DUY M;  2KNA A;  3SHG B;  3BOS A;  3FUU A;  3U6Q A;  4PCZ A;  1QZE A;  1AUA A;  5KPT A;  1N36 M;  2R46 A;  4P16 A;  4DR1 M;  5IT9 S;  2CV2 A;  3THG A;  4LG2 A;  4K0K M;  2VII A;  5DYG A;  1HNW M;  2VF8 A;  2ZTC A;  2R45 A;  4MGI E;  4BB9 A;  4OW0 A;  1L1T A;  1TDZ A;  2F4V M;  2Z4R A;  4L15 A;  1OJL A;  2HKJ A;  4F1I A;  2QPA A;  3WHL A;  2L6O A;  5EXT A;  4PDI A;  1QVR A;  1L2C A;  4JYA M;  1TH4 A;  1EFU B;  2AHM A;  2FNA A;  2QQ8 A;  3GRU A;  2QCU A;  1IN6 A;  1XMO M;  2KZU A;  3TPZ A;  3AOE C;  1ORY B;  3ZC7 B;  1GAB A;  1L1Z A;  7CAT A;  4DV2 M;  4BLC A;  1JR3 E;  5DYI A;  2HAK A;  2F5N A;  1JR3 A;  3K8Z A;  2CHV A;  5IRE B;  4B3S M;  3NBX X;  3VK8 A;  1AIP C;  2DI0 A;  3I4Y A;  4L6V 6;  3FYC A;  2X8A A;  2Z8Y M;  3L27 A;  3HJS A;  4DR5 M;  4B3T M;  2DAI A;  4JI6 M;  3VK7 A;  2DWN A;  2VQE M;  2KRU A;  4JI7 M;  1YLA A;  4JI8 M;  1YUB A;  2NQ8 C;  2QHO B;  1Y8G A;  1Z5B A;  5DNY A;  3SHF A;  3J7A S;  4I5S A;  5FTL A;  4GIT A;  2L4F A;  3SFZ A;  5BPV A;  1IXR C;  2DKL A;  4PD2 A;  2BNK A;  4LZJ A;  2QZ4 A;  3FUV A;  1OAO C;  1Q3C A;  2K47 A;  2J7O A;  4IBF A;  4D80 A;  4L78 A;  3HHY A;  2MH8 A;  1GKI A;  4CJ6 A;  1VQ1 A;  3J80 S;  3D8B A;  4JI5 M;  4NC6 A;  1OAI A;  1N77 A;  4JV5 M;  2FH0 A;  3BBZ A;  2I7N A;  5FSW A;  2UU9 M;  4G4R A;  1DO0 A;  3U6E A;  1IBK M;  2QBY A;  4JI1 M;  3KFU G;  3FTC A;  4FWG A;  4DR7 M;  4X66 M;  1WJ7 A;  3SC3 A;  2KHH A;  1Z59 A;  2H5X A;  2Z4S A;  5KQ8 A;  5LMN M;  1JQJ C;  1PRB A;  2F5P A;  2BWE A;  1GJS A;  1SXJ E;  2X4A A;  4X62 M;  1SG9 A;  1PJT A;  3B9P A;  3V76 A;  4B7H A;  3KP0 E;  1SXJ A;  5GKN A;  1IM2 A;  1T43 A;  1FNN A;  3TL4 X;  2J7N A;  3HHX A;  1T3T A;  3IG5 A;  3M0E A;  2CV0 A;  4Q7J A;  2LNH C;  4CGY B;  1NSF A;  4LF6 M;  1XXH E;  2FFJ A;  1G3I A;  3T1Y M;  4GEW A;  4WW0 A;  3SYL A;  1XXH A;  5FTM A;  5LMU M;  3BXW A;  4MH0 E;  1TR8 A;  3B7Q A;  2APL A;  3I04 M;  5JI3 E;  2XSZ A;  1K3X A;  3HU2 A;  1WGL A;  5E26 A;  4LFB M;  3UJN A;  3J7B A;  5L8R F;  4DR3 M;  1EIJ A;  4AKI A;  1Q3B A;  3FRH A;  1BVS A;  4LJ6 A;  2KNZ A;  3GLG E;  2VDB B;  3J81 S;  4DR4 M;  3Q8X A;  3DZD A;  3W0L B;  3QYE A;  4NL4 H;  3GLG A;  2XZF A;  1WHC A;  1Q02 A;  1OFI A;  2EO2 A;  1S3S A;  2D7H A;  1XHB A;  2CFO A;  2M5Z A;  4LJ8 A;  1LTM A;  1R5L A;  4KHP M;  3SAW A;  2MRO B;  2Z7J A;  2QBY B;  1HJP A;  1QAM A;  4OX9 M;  3HY5 A;  2O25 A;  1GVN A;  5DFL A;  4NRW A;  2O5R A;  4GRI A;  3QYB A;  1L2D A;  2LVP C;  4M0W A;  4LJ5 A;  4LY6 A;  1IY0 A;  2ZAN A;  3TE6 A;  3U6D A;  1NJG A;  2CHQ A;  5JI2 E;  2BJV A;  2KRK A;  2DWM A;  3I01 M;  3SMP A;  4DV0 M;  3R8F A;  3QAU A;  3KXE C;  4AI6 A;  2DZN B;  1G41 A;  5EP2 A;  4WUR A;  1SXJ B;  1JB0 F;  1PM5 A;  4I8O A;  4JN6 A;  4MM3 B;  1K82 A;  1C1K A;  1Q39 A;  1UFZ A;  3AL0 C;  3HGI A;  2CRU A;  4GIP A;  2A5Y B;  3FRI A;  3NBI A;  3JR4 A;  4I4L A;  1DGG A;  2R6F A;  8CAT A;  1VDD A;  1XXH B;  3HX3 A;  4L16 A;  1PJQ A;  2EKK A;  1D0K A;  4LF5 M;  2JY6 B;  3WHK A;  2HL7 A;  3RGS A;  1HQY E;  3U60 A;  4FD2 A;  2YQZ A;  4B7G A;  1XNQ M;  2P5T A;  1OIP A;  3HHZ A;  2VQF M;  1G59 A;  1PJI A;  4NXN M;  1LV7 A;  2KZS A;  2L09 A;  2V1U A;  3FTD A;  4IBE A;  4LGY A;  4DBG B;  2KW0 A;  4ITQ A;  1I4W A;  3T15 A;  4QNM A;  4LJ4 A;  3TWK A;  3C3D A;  3LCU A;  3CTW B;  2G3Q A;  3GLG B;  3I4V A;  3KOX E;  4MGY E;  4FCW A;  4B08 A;  3HJQ A;  2LVA A;  3ZQJ A;  4R7G A;  1MX0 A;  2Q2E B;  3LMM A;  2L7H A;  3RFW A;  1J5E M;  3GPX A;  3C9P A;  3HKP A;  1R6B X;  2DAM A;  4NOO B;  1R4G A;  2LVQ D;  4CIS A;  2JP7 A;  2DHR A;  2JUJ A;  1P3Q Q;  4LRS A;  4FWH A;  4LF8 M;  3L26 A;  1XNR M;  2C5R A;  3PNV A;  4M9S A;  3LVV A;  3GRR A;  1IN4 A;  4OU7 A;  4IBG A;  1IXS A;  1HNZ M;  3UK6 A;  2CP8 A;  3GRV A;  3L28 A;  4ANR A;  4MGK E;  1FJG M;  4D82 A;  2LVO C;  4G4Q A;  2JZ1 A;  3C3E A;  2XFT A;  3EIE A;  2HWJ A;  2LVN C;  3CF6 E;  4QOS A;  2WSF F;  4RNA A;  3U6M A;  4LF7 M;  1QDT A;  2KXE A;  2XEP A;  2XFS A;  2FS1 A;  2JY5 A;  3AV0 A;  3KOZ E;  3VDP A;  2DHY A;  1PJS A;  3MK6 A;  4B3M M;  1NY6 A;  4KO8 A;  1YSY A;  4DV1 M;  2LTU A;  4M9X A;  3U60 B;  1GJT A;  3PXG A;  3SAS A;  1XC8 A;  1J7K A;  3CF2 A;  3U6O A;  4AKH A;  4DR2 M;  2GQF A;  5H37 D;  1QZM A;  2XGN A;  2O01 F;  3UMM A;  3VKH A;  1NHW C;  3KP1 E;  3IHP A;  4IIW A;  2ZM6 M;  3SBJ A;  3W0F A;  3FTE A;  2RGO A;  3GLH E;  1QAO A;  5F3W A;  1WR1 B;  3QWL A;  5ITR A;  1L8Q A;  3JAM S;  1QUT A;  1OIZ A;  5EP4 A;  3GLH A;  3RE8 A;  1D0L A;  3L29 A;  4NSR A;  3U5Z A;  2W82 A;  1NJF A;  3TWL A;  1ZV1 A;  5E6J A;  4IBI A;  3AJI B;  4DV5 M;  4DV6 M;  4IBC A;  1T6O A;  2C9O A;  5KPZ A;  4IBD A;  4BBA A;  1IXS B;  2ZTD A;  3T1H M;  3PNY A;  2K6B A;  4S12 A;  1XB2 B;  4IBB A;  1ZMV A;  1X37 A;  1HQC A;  1E9S A;  3HHW A;  4GHA A;  1OTR A;  5ITT A;  1DGH B;  3L25 A;  3B74 A;  1QUS A;  1C7Y A;  2VF7 A;  2B3T A;  1I94 M;  4X65 M;  2Z3X A;  1DGB A;  3Q8G A;  2F5Q A;  2JY7 A;  3ZCB B;  3TWM A;  2KEB A;  2Y0T A;  3LW5 F;  1GL7 A;  2J5Y A;  4NSO B;  3KVW A;  3D8L A;  1VDL A;  1N33 M;  1W5T A;  4RF1 A;  1IFY A;  1DV0 A;  1NV8 A;  4G6Z A;  4MGH A;  2LBC A;  1Z5C A;  3VLF B;  3LCV B;  2UXC M;  3AKZ A;  3GLF E;  3M6A A;  4I81 A;  4GKJ M;  3UGJ A;  4LF9 M;  3DA1 A;  2DNA A;  1IBM M;  2EA0 A;  2LWX A;  3K9O A;  3GLF A;  2RKO A;  3C58 A;  4W5W A;  3GQ4 A;  2DAK A;  4XBO A;  4GHL A;  5EXP A;  2FE8 A;  2YNM D;  2BJW A;  1D0M A;  2WSC F;  4JI3 M;  2L2D A;  1NY5 A;  3JR5 A;  2KNV A;  3GLH B;  4B7F A;  1TDH A;  1KFV A;  4KLN A;  3U5Z B;  3LQR A;  3U61 A;  4AG6 A;  2CUZ A;  3NWL A;  2OOA A;  2XH9 A;  2F5O A;  3HZJ A;  3FTF A;  2L7I A;  5EJC A;  4GKK M;  3KOW E;  3PVS A;  2G8L A;  2LHC A;  5FTK A;  2KDL A;  3LQQ A;  3A45 A;  4LJ9 A;  2G5G X;  3MJ5 A;  5ITU A;  4G3O A;  1GO5 A;  3ILK A;  2V1C A;  1RU3 A;  3B7Z A;  1HT1 E;  5KO3 A;  5A2Q S;  4OVZ A;  1L2B A;  4AW4 A;  3GQ3 A;  4HEO A;  2HHH M;  1QAQ A;  2ZBK B;  4QHS A;  1KYI A;  2X49 A;  2UUA M;  1J09 A;  1V92 A;  4X64 M;  3W68 A;  5ITY A;  4FW9 A;  1E9R A;  3FKE A;  3ZH9 B;  2DAG A;  3KSJ A;  3OTO M;  1R2Y A;  2JNH A;  2OO9 A;  1ZMW A;  3IG8 A;  3HU1 A;  3IEC A;  2JWS A;  1A5T A;  4P17 A;  5KQD A;  5ITX E;  4YHH M;  1NNU C;  3GPY A;  1QYR A;  1Z6T A;  3M7G A;  5FTJ A;  1WGN A;  1WXQ A;  4GMQ A;  2I7P A;  4FVM A;  3UZU A;  2E5L M;  5ITX A;  3L2A A;  5FTN A;  1TH3 A;  3VFD A;  2QSF X;  1GL6 A;  2K9D A;  2YFQ A;  3TQS A;  2M60 A;  2RGH A;  1CUK A;  1ZAE A;  4FCT A;  1GLN A;  4GC5 A;  3VDU A;  3B89 A;  4Z6Y A;  2N35 A;  3FD9 A;  3T38 A;  3GLI E;  4EIW A;  2RRU A;  2XLJ A;  3GLF B;  3FE3 A;  1TH2 A;  2CE7 A;  2OPF A;  3HWS A;  3GLI A;  2EKF A;  2GNO A;  4DR6 M;  3H4M A;  4REZ A;  3KS8 A;  5C1B A;  3SYK A;  1IY1 A;  1G4A E;  4UN2 B;  3RGP A;  2CHG A;  4JI2 M;  1JR3 D;  3GRY A;  4PT5 A;  1SXJ C;  4AZF A;  1D2N A;  1TTE A;  3U61 B;  5BR8 M;  3U6C A;  3J2P B;  3GPP A;  4LZZ A;  2WZJ A;  1DGH A;  4DV7 M;  1R7R A;  3SAU A;  1IN7 A;  4PDG A;  2XZU A;  2DVW B;  3K92 A;  3K9P A;  4QHT A;  1IN8 A;  3GPU A;  1EE8 A;  3SMS A;  2ERC A;  4OVZ B;  2UUB M;  2UXD M;  5EP1 A;  2H1R A;  2R4E A;  2R65 A;  5EP3 A;  4B3R M;  3FYD A;  4MB7 A;  1XWI A;  4NXM M;  1IQP A;  2OOB A;  5FLX S;  3HJ8 A;  3SAR A;  3AOG A;  1G8P A;  3KOY E;  2ZAO A;  3DOA A;  3KW6 A;  2DWZ B;  2CEA A;  4YY3 M;  4LJ7 A;  3VKG A;  4A3V B;  2YR0 A;  4LFC M;  4G4O A;  4JI4 M;  2LHG A;  3U6P A;  4L8R C;  2R44 A;  1DGF A;  1R2Z A;  1IXZ A;  1TGU A;  2EJS A;  4IBK A;  2DAE A;  2Y20 A;  1OQY A;  1H6U A;  2ZAM A;  4AKG A;  1QQW A;  1IN5 A;  1HNX M;  3LVW A;  4F2L A;  3U6S A;  5EQT A;  3CF0 A;  3E9S A;  1ZMU A;  3GLI B;  1YE9 A;  3AFH A;  4RKU F;  1N34 M;  2DZO B;  2HCB A;  3AOE A;  4R71 A;  2DXI A;  4GH9 A;  1SXJ D;  1N78 A;  4M9Z A;  4CIZ A;  1DO2 A;  1NNJ A;  2DWL A;  2UUC M;  3E21 A;  4QNR A;  5EXS A;  2F5S A;  4FWD A;  4AG5 A;  2L4E A;  3KS4 A;  1TF0 B;  3H4J A;  4IBJ A;  5EXX A;  1NO1 A;  2XF3 A;  3GQ5 A;  2UXB M;  3B7N A;  4D81 A;  3PFI A;  4GC9 A;  2MGW A;  2QP9 X;  4KT0 F;  2QNJ A;  4NRV A;  4LFA M;  4DV4 M;  1NVM A;  3GP1 A;  4G4N A;  1KSF X;  1NHG C;  2JY8 A;  2OQ4 A;  4XGI A;  4IJE A;  3J27 B;  2FOI C;  1VEK A;  3K1J A;  2R18 A;  2BWB A;  4DUZ M;  1V33 A;  3U6L A;  3FUX A;  2XSZ D;  4LCB A;  4XK8 F;  3EIH A;  4IJF A;  1OKS A;  3W67 A;  2MJ5 B;  3FUT A;  1F4I A;  1VG5 A;  5IZ7 D;  1VEG A;  1V34 A;  4LGM A;  3DFZ A;  1WIV A;  1QAN A;  4TUW A;  2C9C A;  3HU3 A;  2Y21 A;  1IY2 A;  1UM8 A;  2DZL A;  3E4R A;  1G71 A;  4CHT B;  4DV3 M;  2EUC A;  2QEN A;  2D7G A;  4II7 A;  2R62 A;  3F92 A;  1HR0 M;  4JXJ A;  1Z5A A;  1K3W A;  4LJA A;  2WSE F;  2MR9 A;  4HL4 A;  1HT2 E;  3E46 A;  4AQY M;  3MHV C;  4L4U A;  3R9X B;  4QOZ C;  3KSX A;  2LH0 A;  3SAV A;  3SAT A;  2C99 A;  1PJJ A;  1NV9 A;  3I51 A;  3CGW A;  1MJG M;  4LF4 M;  1N75 A;  2C98 A;  5KPR A;  2K0B X;  1MU5 A;  2JZ0 A;  3T6P A;  3MMP A;  2JXN A;  3A98 B;  1VEJ A;  2Y0Q A;  2JA2 A;  1E94 E;  1QDR A;  4LRT A;  2R4J A;  4Z8X A;  1PGY A;  4M0D A;  4KOD A;  5ITQ A;  1N32 M;  1E32 A;  4ZPX A;  2LXE A;  2V6Z M;  4R3D A;  3FUW A;  4Y28 F;  1OFH A;  1W5S A;  5C18 A;  1XMQ M;  1ZQ9 A;  4RF0 A;  3K2L A;  2CV1 A;  2R0I A;  3A46 A;  2C96 A;  4HLQ A;  4MGZ E; 
#chains in the Genus database with same CATH homology
 4JI0 M;  5IWA M;  4FCV A;  1IBL M;  3KDS E;  3A42 A;  2KA6 B;  3GO8 A;  2D7E A;  4DUY M;  3SHG B;  3BOS A;  3FUU A;  3U6Q A;  4PCZ A;  5KPT A;  1N36 M;  2R46 A;  4P16 A;  4DR1 M;  5IT9 S;  2CV2 A;  3THG A;  4LG2 A;  4K0K M;  2VII A;  5DYG A;  1HNW M;  4MGI E;  2R45 A;  4BB9 A;  4OW0 A;  1L1T A;  1TDZ A;  2F4V M;  2Z4R A;  4L15 A;  1OJL A;  2HKJ A;  2QPA A;  3WHL A;  2L6O A;  5EXT A;  4PDI A;  1QVR A;  1L2C A;  4JYA M;  1TH4 A;  2AHM A;  2FNA A;  3GRU A;  2QCU A;  1IN6 A;  1XMO M;  2KZU A;  3TPZ A;  3AOE C;  1ORY B;  3ZC7 B;  1L1Z A;  7CAT A;  4DV2 M;  4BLC A;  5DYI A;  2F5N A;  1JR3 A;  3K8Z A;  2CHV A;  5IRE B;  4B3S M;  3VK8 A;  3I4Y A;  3FYC A;  2X8A A;  3L27 A;  3HJS A;  4DR5 M;  4B3T M;  4JI6 M;  3VK7 A;  2DWN A;  2VQE M;  2KRU A;  4JI7 M;  4JI8 M;  1YUB A;  2NQ8 C;  1Z5B A;  5DNY A;  3SHF A;  3J7A S;  4I5S A;  5FTL A;  4GIT A;  3SFZ A;  5BPV A;  1IXR C;  4PD2 A;  2BNK A;  4LZJ A;  2QZ4 A;  3FUV A;  2K47 A;  1Q3C A;  2J7O A;  4IBF A;  4D80 A;  4L78 A;  3HHY A;  1GKI A;  3J80 S;  3D8B A;  4JI5 M;  1N77 A;  4JV5 M;  5FSW A;  2I7N A;  2UU9 M;  2QBY A;  4G4R A;  1DO0 A;  3U6E A;  1IBK M;  4JI1 M;  3KFU G;  3L25 A;  3FTC A;  4FWG A;  4DR7 M;  4X66 M;  3SC3 A;  1Z59 A;  5KQ8 A;  2Z4S A;  5LMN M;  1JQJ C;  2F5P A;  1SXJ E;  2X4A A;  4X62 M;  3B9P A;  4B7H A;  3KP0 E;  1SXJ A;  5GKN A;  1IM2 A;  1FNN A;  3TL4 X;  2J7N A;  3HHX A;  1T3T A;  3IG5 A;  3M0E A;  2CV0 A;  2LNH C;  4CGY B;  1NSF A;  4LF6 M;  2FFJ A;  1G3I A;  3T1Y M;  4WW0 A;  3SYL A;  1XXH A;  5FTM A;  5LMU M;  4MH0 E;  5JI3 E;  2XSZ A;  1K3X A;  3HU2 A;  4LFB M;  5E26 A;  3UJN A;  3J7B A;  4DR3 M;  4AKI A;  1Q3B A;  4LJ6 A;  3J81 S;  4DR4 M;  3Q8X A;  3DZD A;  3W0L B;  4NL4 H;  3GLG A;  2XZF A;  1OFI A;  2EO2 A;  1S3S A;  2D7H A;  1XHB A;  2CFO A;  2M5Z A;  4LJ8 A;  4KHP M;  3SAW A;  2Z7J A;  2QBY B;  1QAM A;  4OX9 M;  1GVN A;  4NRW A;  2O5R A;  4GRI A;  1L2D A;  4M0W A;  3TE6 A;  4LJ5 A;  4LY6 A;  1IY0 A;  2ZAN A;  3U6D A;  1NJG A;  2CHQ A;  5JI2 E;  2BJV A;  2KRK A;  2DWM A;  3SMP A;  4DV0 M;  3R8F A;  3QAU A;  3KXE C;  4AI6 A;  2DZN B;  1G41 A;  5EP2 A;  4WUR A;  1SXJ B;  1PM5 A;  4I8O A;  4JN6 A;  4MM3 B;  1K82 A;  1C1K A;  1Q39 A;  3AL0 C;  3HGI A;  4GIP A;  2A5Y B;  3NBI A;  3JR4 A;  4I4L A;  1DGG A;  8CAT A;  1VDD A;  1XXH B;  4L16 A;  4LF5 M;  3WHK A;  2HL7 A;  3RGS A;  1HQY E;  3U60 A;  4FD2 A;  2YQZ A;  4B7G A;  1XNQ M;  2P5T A;  3HHZ A;  2VQF M;  1G59 A;  1PJI A;  4NXN M;  1LV7 A;  2KZS A;  2L09 A;  2V1U A;  3FTD A;  4IBE A;  4LGY A;  2KW0 A;  4ITQ A;  1I4W A;  3T15 A;  4QNM A;  4LJ4 A;  3TWK A;  3CTW B;  3GLG B;  3I4V A;  3KOX E;  4MGY E;  4FCW A;  4B08 A;  3HJQ A;  4R7G A;  1MX0 A;  2Q2E B;  3LMM A;  2L7H A;  3RFW A;  1J5E M;  3GPX A;  3HKP A;  1R6B X;  4NOO B;  4CIS A;  2DHR A;  4LRS A;  4LF8 M;  4FWH A;  3L26 A;  1XNR M;  2C5R A;  3PNV A;  4M9S A;  3LVV A;  3GRR A;  1IN4 A;  4OU7 A;  4IBG A;  1HNZ M;  3UK6 A;  3GRV A;  3L28 A;  1FJG M;  4MGK E;  4D82 A;  4G4Q A;  2XFT A;  3EIE A;  3CF6 E;  4QOS A;  4RNA A;  3U6M A;  4LF7 M;  2KXE A;  2XEP A;  2XFS A;  3AV0 A;  3VDP A;  3KOZ E;  3MK6 A;  4B3M M;  1NY6 A;  4KO8 A;  1YSY A;  4DV1 M;  4M9X A;  3U60 B;  3PXG A;  3SAS A;  1XC8 A;  1J7K A;  3CF2 A;  3U6O A;  4AKH A;  4DR2 M;  5H37 D;  1QZM A;  2XGN A;  3UMM A;  3VKH A;  1NHW C;  3KP1 E;  4IIW A;  2ZM6 M;  3SBJ A;  3FTE A;  3W0F A;  2RGO A;  1QAO A;  5F3W A;  3QWL A;  5ITR A;  1L8Q A;  3JAM S;  5EP4 A;  3GLH A;  3RE8 A;  3L29 A;  4NSR A;  3U5Z A;  2W82 A;  1NJF A;  3TWL A;  5E6J A;  4IBI A;  3AJI B;  4DV5 M;  4DV6 M;  4IBC A;  2C9O A;  5KPZ A;  4IBD A;  4BBA A;  1IXS B;  3T1H M;  3PNY A;  4S12 A;  4IBB A;  1X37 A;  1HQC A;  1E9S A;  3HHW A;  4GHA A;  5ITT A;  1DGH B;  1I94 M;  4X65 M;  2Z3X A;  1DGB A;  2F5Q A;  3ZCB B;  3TWM A;  2KEB A;  2Y0T A;  1GL7 A;  4NSO B;  3KVW A;  3D8L A;  1N33 M;  1W5T A;  4RF1 A;  4G6Z A;  4MGH A;  1Z5C A;  3VLF B;  2UXC M;  3AKZ A;  3M6A A;  4I81 A;  4GKJ M;  3UGJ A;  4LF9 M;  3DA1 A;  1IBM M;  2EA0 A;  2LWX A;  3GLF A;  2RKO A;  3C58 A;  4W5W A;  3GQ4 A;  4XBO A;  4GHL A;  5EXP A;  2FE8 A;  2YNM D;  2BJW A;  4JI3 M;  1NY5 A;  3JR5 A;  3GLH B;  4B7F A;  1TDH A;  1KFV A;  4KLN A;  3U5Z B;  3LQR A;  3U61 A;  4AG6 A;  2CUZ A;  3NWL A;  2XH9 A;  2F5O A;  3FTF A;  2L7I A;  5EJC A;  4GKK M;  3KOW E;  3PVS A;  2G8L A;  5FTK A;  3LQQ A;  4LJ9 A;  3A45 A;  2G5G X;  3MJ5 A;  5ITU A;  3ILK A;  2V1C A;  1HT1 E;  5KO3 A;  5A2Q S;  4OVZ A;  1L2B A;  4AW4 A;  3GQ3 A;  2HHH M;  1QAQ A;  2ZBK B;  4QHS A;  1KYI A;  2X49 A;  2UUA M;  1J09 A;  4X64 M;  5ITY A;  4FW9 A;  1E9R A;  3FKE A;  3ZH9 B;  3KSJ A;  3OTO M;  1R2Y A;  3IG8 A;  3HU1 A;  5KQD A;  5ITX E;  4YHH M;  3GPY A;  1NNU C;  1QYR A;  1Z6T A;  3M7G A;  5FTJ A;  1WXQ A;  4GMQ A;  2I7P A;  4FVM A;  3UZU A;  2E5L M;  5ITX A;  3L2A A;  5FTN A;  1TH3 A;  3VFD A;  1GL6 A;  3TQS A;  2YFQ A;  2M60 A;  2RGH A;  1ZAE A;  4GC5 A;  4FCT A;  1GLN A;  3VDU A;  4Z6Y A;  3FD9 A;  3T38 A;  4EIW A;  2XLJ A;  3GLF B;  1TH2 A;  2CE7 A;  2OPF A;  3HWS A;  3GLI A;  4DR6 M;  3H4M A;  4REZ A;  3KS8 A;  5C1B A;  3SYK A;  1IY1 A;  1G4A E;  3RGP A;  4JI2 M;  2CHG A;  1JR3 D;  3GRY A;  4PT5 A;  1SXJ C;  4AZF A;  1D2N A;  3U61 B;  5BR8 M;  3U6C A;  3J2P B;  3GPP A;  4LZZ A;  1DGH A;  4DV7 M;  1R7R A;  3SAU A;  1IN7 A;  4PDG A;  2XZU A;  2DVW B;  3K92 A;  4QHT A;  1IN8 A;  3GPU A;  1EE8 A;  3SMS A;  2ERC A;  4OVZ B;  2UUB M;  2UXD M;  5EP1 A;  2H1R A;  2R4E A;  2R65 A;  5EP3 A;  4B3R M;  3FYD A;  4MB7 A;  1XWI A;  4NXM M;  1IQP A;  5FLX S;  3HJ8 A;  3SAR A;  3AOG A;  1G8P A;  3KOY E;  2ZAO A;  3DOA A;  3KW6 A;  2DWZ B;  2CEA A;  4YY3 M;  4LJ7 A;  3VKG A;  4A3V B;  2YR0 A;  4LFC M;  4G4O A;  4JI4 M;  3U6P A;  4L8R C;  1DGF A;  1R2Z A;  1IXZ A;  1TGU A;  4IBK A;  2Y20 A;  1H6U A;  2ZAM A;  4AKG A;  1QQW A;  1IN5 A;  1HNX M;  3LVW A;  3U6S A;  5EQT A;  3CF0 A;  3E9S A;  3GLI B;  1YE9 A;  3AFH A;  1N34 M;  2DZO B;  2HCB A;  3AOE A;  2DXI A;  4GH9 A;  1SXJ D;  1N78 A;  4M9Z A;  1DO2 A;  1NNJ A;  2DWL A;  2UUC M;  5EXS A;  4QNR A;  2F5S A;  4FWD A;  4AG5 A;  3KS4 A;  4IBJ A;  5EXX A;  2XF3 A;  3GQ5 A;  2UXB M;  4D81 A;  3PFI A;  4GC9 A;  2QP9 X;  4NRV A;  4DV4 M;  4LFA M;  1NVM A;  3GP1 A;  4G4N A;  1KSF X;  1NHG C;  2OQ4 A;  4XGI A;  4IJE A;  3J27 B;  2FOI C;  3K1J A;  2R18 A;  4DUZ M;  3U6L A;  3FUX A;  2XSZ D;  4LCB A;  3EIH A;  4IJF A;  3FUT A;  5IZ7 D;  4LGM A;  3DFZ A;  1QAN A;  4TUW A;  2C9C A;  3HU3 A;  2Y21 A;  1IY2 A;  1UM8 A;  3E4R A;  4CHT B;  4DV3 M;  2EUC A;  2QEN A;  2D7G A;  4II7 A;  2R62 A;  1HR0 M;  4JXJ A;  1Z5A A;  1K3W A;  4LJA A;  4HL4 A;  1HT2 E;  4AQY M;  3MHV C;  4L4U A;  3R9X B;  4QOZ C;  3KSX A;  2LH0 A;  3SAV A;  3SAT A;  2C99 A;  1PJJ A;  3I51 A;  4LF4 M;  1N75 A;  2C98 A;  5KPR A;  1MU5 A;  3A98 B;  2Y0Q A;  2JA2 A;  1E94 E;  4LRT A;  4Z8X A;  2R4J A;  4M0D A;  4KOD A;  5ITQ A;  1N32 M;  1E32 A;  4ZPX A;  2LXE A;  2V6Z M;  4R3D A;  3FUW A;  1OFH A;  1W5S A;  5C18 A;  1XMQ M;  1ZQ9 A;  4RF0 A;  3K2L A;  2CV1 A;  3A46 A;  2C96 A;  4HLQ A;  4MGZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...