4DV6M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv6M02
2HKJA 4JI8M 2ZM6M 2Q2EB 4DV2M 1I94M 3J7AS 4DR6M 4LFCM 2ZBKB 3TWLA 1PM5A 4PDIA 3U6MA 3U6OA 3SARA 4YY3M 1K3WA 3C58A 4LF6M 2UUCM 4PDGA 1IBMM 4PCZA 4DV0M 3JAMS 4NXNM 3TWKA 4X64M 1Z5AA 4LFBM 3OTOM 4JI1M 4ITQA 4B3RM 3SASA 1Q3BA 4DR7M 5ITXA 4LF7M 3SAUA 1Z59A 4GKJM 3GO8A 2E5LM 5FLXS 4DV6M 1L1ZA 3SATA 3VK7A 4DV7M 2F5SA 3GPXA 5BR8M 3SAWA 2UXBM 3A46A 3T1YM 4DV1M 4NRVA 1N36M 4DUYM 1Z5CA 4DUZM 2UU9M 4JYAM 4JI0M 1R2YA 3SBJA 5A2QS 1XNQM 4NRWA 4JI7M 4G4RA 1HNXM 5LMUM 2OPFA 1XC8A 1PJJA 1TDHA 1K82A 2OQ4A 4JI4M 4NXMM 3J81S 1IBKM 3GQ4A 1IBLM 3GP1A 1L2CA 1N33M 4JI6M 1XMOM 4X65M 1L2DA 3A45A 5IWAM 4LF5M 4B3SM 5IT9S 1FJGM 5ITYA 1L2BA 1XNRM 3U6DA 2HHHM 3U6EA 1TDZA 4DR3M 3U6SA 4PD2A 3T1HM 3JR5A 4B3MM 2F5PA 5ITTA 3U6QA 4AQYM 5ITXE 2UXDM 3DOAA 2XZUA 2UUBM 2XZFA 1N34M 1K3XA 1HNZM 4X66M 3J80S 4JI5M 3U6LA 1Q3CA 3SAVA 3GQ3A 4LFAM 4DV3M 1HR0M 4LF9M 4DR4M 2UUAM 5ITRA 1N32M 4DR2M 2VQFM 2F4VM 4GKKM 5ITUA 4JV5M 3GPYA 4CISA 4X62M 1R2ZA 1J5EM 1NNJA 3GPUA 4YHHM 3JR4A 4DR1M 3W0FA 4G4NA 2F5NA 2UXCM 3GPPA 2EA0A 1XMQM 4LF4M 1Z5BA 4JI3M 3VK8A 1Q39A 4JI2M 4KHPM 1EE8A 4DR5M 1KFVA 4DV4M 3U6PA 4LF8M 4K0KM 2VQEM 3A42A 5LMNM 3U6CA 1L1TA 2F5OA 1MU5A 4MB7A 5ITQA 2F5QA 4DV5M 1PJIA 1HNWM 4B3TM 3GQ5A 3TWMA 4OX9M 4G4QA 1MX0A 4G4OA
chains in the Genus database with same CATH superfamily
1XXHB 3NWLA 4FWDA 5EXPA 4JI8M 3L2AA 2K9DA 1ZMVA 3HWSA 3I4YA 4DV2M 2RKOA 7CATA 5L8RF 3J7AS 4LRSA 2DHRA 4LFCM 3Q8XA 2G8LA 4A3VB 2DWMA 3U6OA 4GC9A 2J5YA 5DYIA 2CV2A 3C58A 2G3QA 2OOBA 4IBCA 4PDGA 3SMPA 3IECA 1NV8A 3TL4X 2YQZA 5DYGA 1R4GA 3C9PA 3HJQA 3JAMS 3L28A 1W5TA 4I8OA 3TWKA 5KQDA 2X4AA 2XEPA 2LXEA 2JNHA 4B7GA 3SHFA 1IXRC 5KPTA 1ZV1A 4GRIA 1QAQA 1R5LA 3SAUA 2BJWA 4GKJM 4MGZE 5FLXS 4DV6M 4IBEA 1T6OA 1L1ZA 3VK7A 2VIIA 4FWGA 4L16A 2XFTA 2F5SA 5BR8M 3SAWA 1VEKA 2YR0A 4XK8F 2UXBM 2JP7A 3T1YM 1YSYA 1PJSA 1IXSB 1WHCA 3KOYE 4IJFA 2C96A 3THGA 1E94E 4DUZM 2C5RA 1SXJB 2ZTCA 3GLHE 3QYEA 3T15A 4LJ8A 1Z6TA 2JY6B 4NRWA 2R4JA 5LMUM 2FNAA 4L15A 4FCWA 3SYLA 4BLCA 2K6BA 2MJ5B 1V33A 1FNNA 3RGPA 4AZFA 3CF6E 1G71A 2XSZA 3KSJA 4LCBA 4MM3B 1XXHE 5FTNA 4NSRA 5FTKA 3GQ4A 1NHWC 1L2DA 1QZEA 1C7YA 3E46A 4B3SM 4LJ4A 3FUVA 3FTEA 5ITYA 5IREB 1XNRM 2LVAA 3LCUA 2R18A 1IQPA 1NSFA 3U6EA 2GQFA 3BXWA 2FE8A 4AKGA 5ITTA 1AUAA 2QENA 2A5YB 3QAUA 3VDUA 5ITXE 3E21A 3DOAA 2XSZD 4QNMA 2Z3XA 1DO0A 1NVMA 4KT0F 2XZFA 2UUBM 3U5ZA 4QOZC 4X66M 1NNUC 1UFZA 3HZJA 3LQRA 1R6BX 2B3TA 2R6FA 2LVPC 3H4JA 4DV3M 1HR0M 2QZ4A 4M0DA 4QOSA 3R9XB 5FTLA 1E9RA 2Y0QA 2F4VM 2HWJA 4GKKM 1ZMWA 1F4IA 3B9PA 1IN4A 3GPYA 4CISA 3RGSA 3RE8A 4LRTA 1J5EM 1TR8A 3GPUA 3JR4A 2R65A 3HGIA 1IY0A 4NSOB 3T38A 4G4NA 1E9SA 1SXJC 2VF8A 2EA0A 1XMQM 2UXCM 4JI3M 1SG9A 1Q39A 2CWBA 3DZDA 2CV1A 4S12A 3J7BA 2DZNB 2Z8YM 4DR5M 1KFVA 4DV4M 4QHSA 4G6ZA 1Y8GA 4Y28F 1SXJE 4QHTA 4CHTB 4LF8M 4Z6YA 2LNHC 2KNZA 4P17A 2LVNC 1GLNA 1DGHB 5JI3E 1PJIA 1HNWM 1QAOA 2KHHA 1MX0A 4G4OA 4R71A 2HKJA 4UN2B 2ZM6M 3B7QA 2DAMA 4KLNA 3BOSA 4M9XA 1I94M 4RF1A 5EP4A 3NBXX 3UZUA 1G8PA 4PDIA 3L25A 2QBYB 1GVNA 3FRHA 1G4AE 2N35A 4YY3M 1K3WA 1IXZA 2EUCA 2FOIC 1OIPA 1A5TA 3ZH9B 1GKIA 2H1RA 1OKSA 2KZUA 1Z5AA 4PT5A 4LFBM 3W67A 1T3TA 4GIPA 3GLGA 2DNAA 4B3RM 1Q3BA 3KXEC 4FCVA 4LJ9A 4LZZA 4MGHA 4Z8XA 4GITA 4D81A 3GO8A 3U5ZB 2E5LM 5BPVA 3SATA 3D8BA 4DV7M 3FTCA 2DZLA 4HEOA 3AOGA 3UJNA 1MJGM 1QZMA 2QP9X 1TGUA 2I7NA 3KFUG 2MR9A 4KODA 3PFIA 4L78A 4DV1M 2LBCA 3SYKA 4NRVA 1N36M 4RNAA 4LY6A 1OTRA 4ZPXA 1GL6A 2D7HA 2UU9M 4JYAM 4JI0M 1R2YA 1DGGA 3Q8GA 2QHOB 5A2QS 4JI7M 2HAKA 5C1BA 4LG2A 1HNXM 3U61A 3KOWE 4RKUF 1ORYB 2WSFF 2OQ4A 1K82A 4JI4M 4NXMM 4AKIA 1IBKM 3U60A 1KSFX 1OFHA 4JI6M 4GMQA 4LJ5A 3VFDA 4GH9A 1QAMA 3A45A 5IWAM 1NY5A 4NOOB 2DAGA 4FD2A 3HX3A 3U6DA 4LGMA 4L4UA 1GABA 2W82A 3CTWB 4XGIA 4GEWA 1GO5A 3U6SA 3GLFB 3T1HM 1KYIA 3EIEA 3KW6A 1X37A 3U6QA 2BNKA 4F1IA 3HHWA 2LHCA 4MGYE 2V1UA 3HU1A 2JY7A 3MMPA 2QNJA 3FYCA 1N34M 3AJIB 1HNZM 3FD9A 3ILKA 4JI5M 3LW5F 3GRVA 2R4EA 4GHLA 5FSWA 3L27A 4DR4M 4P16A 2UUAM 1TTEA 2ERCA 2KA6B 4OU7A 2VQFM 2OO9A 1MN3A 2J7NA 3KP1E 3UGJA 5ITUA 4JV5M 2BJVA 3EIHA 1R2ZA 1QYRA 2KEBA 2HL7A 3FE3A 3FUTA 1NNJA 3K1JA 4YHHM 3GLIB 4DR1M 2EKKA 2JA2A 2APLA 3WHLA 3MK6A 4IBDA 3GLGB 3PNVA 1HT2E 2HCBA 3ZQJA 3GPPA 4LF4M 2DAIA 1W5SA 3VK8A 1G41A 3T6PA 2Z4SA 3CGWA 2DAKA 1D0MA 1VEGA 1V34A 3U6PA 2DAEA 5KQ8A 2FH0A 4MB7A 1IN7A 2WSEF 4IBKA 2CFOA 4BBAA 1NHGC 2MGWA 3D8LA 1IFYA 1NJGA 4B3TM 3TWMA 5KPRA 4OX9M 4G4QA 3HHZA 2DENA 2QSFX 1WGNA 2EO2A 2J7OA 2V1CA 4D82A 3A98B 2O01F 3GLHA 1HJPA 1OFIA 2CHVA 2KNVA 3FRIA 1J09A 4B08A 1WXQA 3FUUA 3W68A 3U61B 2LTUA 3K92A 3L26A 4DR6M 3K8ZA 4IJEA 1PM5A 3U6MA 3GLFE 4LJAA 4OVZA 1XXHA 3FKEA 3TPZA 3SFZA 4M9SA 4R7GA 2DXIA 1VEJA 4DV0M 1V92A 3IHPA 1D0LA 4AG5A 4X64M 2XGNA 1PJQA 3BBZA 4FVMA 4R3DA 4L8RC 4LJ6A 4DBGB 4CGYB 3HJSA 1LTMA 1IM2A 1Q02A 4JI1M 4ITQA 1DV0A 4DR7M 5ITXA 5EXSA 1NY6A 1QANA 2C98A 1L8QA 2RRUA 4WP2A 2RGHA 4IBGA 2FFJA 3I01M 4M0WA 4MH0E 3M7GA 3V76A 5C18A 3WHKA 3K9OA 3GLIE 1YUBA 4AKHA 1WGLA 3W0LB 4GHAA 3C3DA 3GLGE 2DKLA 3GRRA 5EP3A 5F3WA 1GL7A 2WZJA 2O25A 4AI6A 1TH3A 1QUTA 3PNYA 2EJSA 2CEAA 3SBJA 1XNQM 4NL4H 5KO3A 4G4RA 5KPZA 3B74A 2OPFA 1XC8A 1NO1A 1TDHA 5DFLA 2DWLA 2R44A 1IBLM 1ZAEA 3AOEA 5EJCA 3GP1A 1L2CA 1N33M 2FS1A 5EXXA 1ZQ9A 2O5RA 1JB0F 4IBFA 3AFHA 3CF2A 3TQSA 4D80A 2LVQD 1JR3A 2OOAA 4LF5M 4CJ6A 2K47A 5EXTA 1OAIA 1T43A 1L2BA 1EIJA 3AL0C 3LCVB 4Q7JA 4WURA 2CV0A 3F92A 4DR3M 1IN5A 4IBBA 4PD2A 4B3MM 1R7RA 5GKNA 2ZAMA 1DGFA 1IY2A 3DFZA 4KO8A 2DZOB 2RGOA 4GC5A 4I81A 2UXDM 2V6ZM 2CP8A 4M9ZA 1WJ7A 4JXJA 3IG8A 2ZTDA 1K3XA 2XFSA 3KSXA 4MGKE 1JR3D 1Q3CA 1HQYE 2LH0A 3SAVA 4ANRA 4LFAM 1QUSA 3DA1A 4LF9M 5ITRA 4RF0A 1N32M 3C3EA 3MHVC 1H6UA 2P5TA 2R0IA 2X8AA 2CE7A 3B7ZA 2Y0TA 2Z4RA 8CATA 3KOZE 4X62M 2L7HA 3LVVA 2GNOA 5E6JA 2K0BX 2LHGA 2LVOC 2M60A 4IBIA 2X49A 3NBIA 3W0FA 2Y21A 1DGBA 3PVSA 2LWXA 1WR1B 3KDSE 2XH9A 3L29A 3QYBA 2JUJA 2YFQA 1TF0B 1J7KA 4IBJA 2D7EA 3FTFA 4LZJA 4KHPM 3FUWA 5E26A 4K0KM 1L1TA 5LMNM 2XF3A 1YLAA 3HKPA 1MU5A 1N77A 3HY5A 2DWNA 2F5QA 4DV5M 3K2LA 1G3IA 1PRBA 1IY1A 3SHGB 4BB9A 4CIZA 4B7FA 2Q2EB 1GJTA 2QCUA 3SC3A 1C1KA 2KDLA 2MROB 3H4MA 2DVWB 5FTMA 1P3QQ 2ZBKB 1TH2A 4REZA 3TWLA 2R62A 2AHMA 1DGHA 1VG5A 2R46A 1NJFA 2JY8A 4JN6A 4EIWA 1EFUB 4MGIE 5JI2E 3SMSA 3SARA 1RU3A 3E9SA 1IN8A 3J27B 4LF6M 2UUCM 1IBMM 4PCZA 2NQ8C 1N78A 4NC6A 4NXNM 2XLJA 3GRUA 2JWSA 3LVWA 2L6OA 3K9PA 3OTOM 2JZ0A 2QBYA 3SASA 1D0KA 2YNMD 1AIPC 3LQQA 5IZ7D 4LF7M 1Z59A 2ZANA 1OJLA 5EP2A 1VDDA 3ZCBB 3GPXA 2KXEA 4I4LA 4QNRA 3M0EA 3RFWA 1QDTA 3KS8A 4IIWA 3A46A 2BWBA 4HL4A 3HU3A 2DWZB 3QWLA 1JQJC 1VQ1A 3PXGA 2EKFA 3U60B 1OIZA 4DUYM 1Z5CA 3B7NA 3AV0A 5DNYA 3HJ8A 4G3OA 2Z7JA 3KP0E 2CRUA 2ZAOA 3HHXA 3J2PB 3AKZA 1PJJA 2L4EA 2MH8A 4W5WA 1XB2B 2KW0A 3I4VA 3J81S 4LJ7A 3UK6A 3KS4A 3E4RA 1YE9A 2QQ8A 1XMOM 4X65M 1S3SA 2Y20A 1DO2A 2VF7A 5IT9S 3AOEC 4B7HA 3B89A 1CUKA 3VKGA 1LV7A 1PJTA 2L09A 1FJGM 2CHQA 2HHHM 2G5GX 3GRYA 1TDZA 4FCTA 2C99A 1BVSA 3JR5A 2F5PA 1IN6A 3FTDA 3MJ5A 4TUWA 4AQYM 3R8FA 1OAOC 1XHBA 2L4FA 3FUXA 1QDRA 2KNAA 3IG5A 2L2DA 2XZUA 3VKHA 4II7A 1JR3E 1G59A 2R45A 2C9OA 3J80S 2JZ1A 3U6LA 2KRKA 3UMMA 3GQ3A 1ZMUA 4LGYA 3VDPA 3GLFA 2M5ZA 2QPAA 2KZSA 2WSCF 2H5XA 3HU2A 1IXSA 1GJSA 4DR2M 4FWHA 2L7IA 4HLQA 4F2LA 2JY5A 2CHGA 2VDBB 3ZC7B 3KVWA 1SXJA 2DHYA 3I04M 1HT1E 5FTJA 5H37D 2JXNA 2CUZA 1HQCA 3CF0A 4WW0A 2DI0A 1E32A 2F5NA 1NV9A 3KOXE 1D2NA 2C9CA 1Z5BA 1WIVA 2I7PA 3M6AA 4L6V6 5EP1A 4AW4A 4JI2M 2D7GA 4FW9A 5EQTA 3HHYA 1EE8A 3GLHB 3VLFB 1QQWA 2KRUA 2VQEM 3A42A 3U6CA 4XBOA 1TH4A 3LMMA 4I5SA 3FYDA 2F5OA 1PGYA 3TE6A 2BWEA 5ITQA 3GLIA 1SXJD 4OW0A 1QVRA 1I4WA 3GQ5A 1XWIA 1UM8A 3I51A 1VDLA 1OQYA 4OVZB 1N75A 4AG6A
chains in the Genus database with same CATH topology
1XXHB 3NWLA 4FWDA 5EXPA 4JI8M 3L2AA 3HWSA 3I4YA 4DV2M 2RKOA 7CATA 3J7AS 4LRSA 2DHRA 4LFCM 3Q8XA 2G8LA 4A3VB 2DWMA 3U6OA 4GC9A 5DYIA 2CV2A 3C58A 4IBCA 4PDGA 3SMPA 3TL4X 2YQZA 5DYGA 3HJQA 3JAMS 3L28A 1W5TA 4I8OA 3TWKA 5KQDA 2X4AA 2XEPA 2LXEA 4B7GA 3SHFA 1IXRC 5KPTA 4GRIA 1QAQA 3SAUA 2BJWA 4GKJM 4MGZE 5FLXS 4DV6M 4IBEA 1L1ZA 3VK7A 2VIIA 4FWGA 4L16A 2XFTA 2F5SA 5BR8M 3SAWA 2YR0A 2UXBM 3T1YM 1YSYA 1IXSB 3KOYE 4IJFA 2C96A 3THGA 1E94E 4DUZM 2C5RA 1SXJB 3T15A 4LJ8A 1Z6TA 4NRWA 2R4JA 5LMUM 2FNAA 4L15A 4FCWA 3SYLA 4BLCA 1FNNA 3RGPA 4AZFA 3CF6E 2XSZA 3KSJA 4LCBA 4MM3B 5FTNA 3GQ4A 5FTKA 4NSRA 1NHWC 1L2DA 4B3SM 4LJ4A 3FUVA 3FTEA 5ITYA 5IREB 1XNRM 3U6EA 2R18A 1IQPA 1NSFA 2FE8A 4AKGA 5ITTA 2QENA 2A5YB 3QAUA 3VDUA 5ITXE 3DOAA 2XSZD 4QNMA 2Z3XA 1DO0A 1NVMA 2XZFA 2UUBM 3U5ZA 4QOZC 4X66M 1NNUC 3LQRA 1R6BX 4DV3M 1HR0M 2QZ4A 4M0DA 4QOSA 3R9XB 5FTLA 1E9RA 2Y0QA 2F4VM 4GKKM 3B9PA 1IN4A 3GPYA 4CISA 3RGSA 3RE8A 4LRTA 1J5EM 3GPUA 3JR4A 2R65A 3HGIA 1IY0A 4NSOB 3T38A 4G4NA 1E9SA 1SXJC 2EA0A 2UXCM 1XMQM 4JI3M 1Q39A 3DZDA 2CV1A 4S12A 3J7BA 2DZNB 4DR5M 1KFVA 4DV4M 4QHSA 4G6ZA 4LF8M 1SXJE 4QHTA 4CHTB 4Z6YA 2LNHC 1GLNA 1DGHB 5JI3E 1PJIA 1HNWM 1QAOA 1MX0A 4G4OA 2HKJA 2ZM6M 4KLNA 3BOSA 4M9XA 1I94M 4RF1A 5EP4A 3UZUA 1G8PA 4PDIA 3L25A 2QBYB 1GVNA 1G4AE 4YY3M 1K3WA 1IXZA 2EUCA 2FOIC 3ZH9B 1GKIA 2H1RA 2KZUA 1Z5AA 4PT5A 4LFBM 1T3TA 4GIPA 3GLGA 4B3RM 1Q3BA 3KXEC 4FCVA 4LJ9A 4LZZA 4MGHA 4Z8XA 4GITA 4D81A 3GO8A 3U5ZB 2E5LM 5BPVA 3SATA 3D8BA 4DV7M 3FTCA 3AOGA 3UJNA 1QZMA 2QP9X 1TGUA 2I7NA 3KFUG 4KODA 3PFIA 4L78A 4DV1M 3SYKA 4NRVA 1N36M 4RNAA 4LY6A 4ZPXA 1GL6A 2D7HA 2UU9M 4JYAM 4JI0M 1R2YA 1DGGA 5A2QS 4JI7M 5C1BA 4LG2A 1HNXM 3U61A 3KOWE 1ORYB 1K82A 2OQ4A 4JI4M 4NXMM 4AKIA 1IBKM 3U60A 1KSFX 1OFHA 4JI6M 4GMQA 4LJ5A 3VFDA 4GH9A 1QAMA 3A45A 5IWAM 1NY5A 4NOOB 4FD2A 3U6DA 4LGMA 4L4UA 2W82A 3CTWB 4XGIA 3U6SA 3GLFB 3T1HM 1KYIA 3EIEA 3KW6A 1X37A 3U6QA 2BNKA 3HHWA 4MGYE 2V1UA 3HU1A 3FYCA 1N34M 3AJIB 1HNZM 3FD9A 3ILKA 4JI5M 3GRVA 2R4EA 4GHLA 5FSWA 3L27A 4DR4M 4P16A 2UUAM 2ERCA 2KA6B 4OU7A 2VQFM 3UGJA 2J7NA 3KP1E 5ITUA 4JV5M 2BJVA 3EIHA 1R2ZA 1QYRA 2KEBA 2HL7A 3FUTA 1NNJA 3K1JA 4YHHM 3GLIB 4DR1M 2JA2A 3WHLA 3MK6A 4IBDA 3GLGB 3PNVA 1HT2E 2HCBA 3GPPA 4LF4M 1W5SA 3VK8A 1G41A 2Z4SA 3U6PA 5KQ8A 4MB7A 1IN7A 4IBKA 2CFOA 4BBAA 1NHGC 3D8LA 1NJGA 4B3TM 3TWMA 5KPRA 4OX9M 4G4QA 3HHZA 4D82A 2EO2A 2J7OA 2V1CA 3A98B 3GLHA 1OFIA 2CHVA 1J09A 4B08A 1WXQA 3FUUA 3U61B 3K92A 3L26A 4DR6M 3K8ZA 4IJEA 1PM5A 3U6MA 4LJAA 4OVZA 1XXHA 3FKEA 3TPZA 3SFZA 4M9SA 4R7GA 2DXIA 4DV0M 4AG5A 4X64M 2XGNA 4FVMA 4R3DA 4L8RC 4LJ6A 4CGYB 3HJSA 1IM2A 4JI1M 4ITQA 4DR7M 5ITXA 5EXSA 1NY6A 1QANA 2C98A 1L8QA 2RGHA 4IBGA 2FFJA 4M0WA 4MH0E 3M7GA 5C18A 3WHKA 1YUBA 4AKHA 4GHAA 3W0LB 3GRRA 5EP3A 5F3WA 1GL7A 4AI6A 1TH3A 3PNYA 2CEAA 3SBJA 1XNQM 4NL4H 5KO3A 4G4RA 5KPZA 2OPFA 1XC8A 1TDHA 2DWLA 1IBLM 1ZAEA 3AOEA 5EJCA 3GP1A 1L2CA 1N33M 5EXXA 1ZQ9A 2O5RA 4IBFA 3AFHA 3CF2A 3TQSA 4D80A 1JR3A 4LF5M 2K47A 5EXTA 1L2BA 3AL0C 4WURA 2CV0A 4DR3M 1IN5A 4IBBA 4PD2A 4B3MM 1R7RA 5GKNA 2ZAMA 1DGFA 1IY2A 3DFZA 4KO8A 2DZOB 2RGOA 4GC5A 4I81A 2UXDM 2V6ZM 4M9ZA 4JXJA 3IG8A 1K3XA 2XFSA 3KSXA 4MGKE 1JR3D 1Q3CA 1HQYE 2LH0A 3SAVA 4LFAM 3DA1A 4LF9M 5ITRA 4RF0A 1N32M 3MHVC 1H6UA 2P5TA 2X8AA 2CE7A 2Y0TA 2Z4RA 8CATA 3KOZE 4X62M 2L7HA 3LVVA 5E6JA 2M60A 4IBIA 2X49A 3NBIA 3W0FA 2Y21A 1DGBA 3PVSA 3KDSE 2LWXA 3L29A 2XH9A 2YFQA 1J7KA 4IBJA 2D7EA 3FTFA 4LZJA 4KHPM 3FUWA 5E26A 4K0KM 1L1TA 5LMNM 2XF3A 3HKPA 1MU5A 1N77A 2DWNA 2F5QA 4DV5M 3K2LA 1G3IA 1IY1A 3SHGB 4BB9A 4B7FA 2Q2EB 2QCUA 3SC3A 1C1KA 3H4MA 2DVWB 5FTMA 2ZBKB 1TH2A 4REZA 3TWLA 2R62A 2AHMA 1DGHA 2R46A 1NJFA 4JN6A 4EIWA 4MGIE 5JI2E 3SARA 3SMSA 3E9SA 1IN8A 3J27B 4LF6M 2UUCM 1IBMM 4PCZA 2NQ8C 1N78A 4NXNM 2XLJA 3GRUA 3LVWA 2L6OA 3OTOM 2QBYA 3SASA 2YNMD 3LQQA 5IZ7D 4LF7M 1Z59A 2ZANA 1OJLA 5EP2A 1VDDA 3ZCBB 3GPXA 2KXEA 4I4LA 4QNRA 3M0EA 3RFWA 3KS8A 4IIWA 3A46A 4HL4A 3HU3A 2DWZB 3QWLA 1JQJC 3PXGA 3U60B 4DUYM 1Z5CA 3AV0A 5DNYA 3HJ8A 2Z7JA 3KP0E 2ZAOA 3HHXA 3J2PB 3AKZA 1PJJA 4W5WA 2KW0A 3I4VA 3J81S 4LJ7A 3UK6A 3KS4A 3E4RA 1YE9A 1XMOM 4X65M 1S3SA 2Y20A 1DO2A 5IT9S 3AOEC 4B7HA 3VKGA 1LV7A 2L09A 1FJGM 2CHQA 2HHHM 2G5GX 3GRYA 1TDZA 4FCTA 2C99A 3JR5A 2F5PA 1IN6A 3FTDA 3MJ5A 4TUWA 4AQYM 3R8FA 1XHBA 3FUXA 3IG5A 2XZUA 3VKHA 4II7A 1G59A 2R45A 2C9OA 3J80S 3U6LA 2KRKA 3UMMA 3GQ3A 4LGYA 3VDPA 3GLFA 2M5ZA 2QPAA 2KZSA 3HU2A 4DR2M 4FWHA 2L7IA 4HLQA 2CHGA 3ZC7B 3KVWA 1SXJA 1HT1E 5FTJA 5H37D 2CUZA 1HQCA 3CF0A 4WW0A 1E32A 2F5NA 3KOXE 1D2NA 2C9CA 1Z5BA 2I7PA 3M6AA 5EP1A 4AW4A 4JI2M 2D7GA 4FW9A 5EQTA 3HHYA 1EE8A 3GLHB 3VLFB 1QQWA 2KRUA 2VQEM 3A42A 3U6CA 4XBOA 1TH4A 3LMMA 4I5SA 3FYDA 2F5OA 3TE6A 5ITQA 3GLIA 1SXJD 4OW0A 1QVRA 1I4WA 3GQ5A 1XWIA 1UM8A 3I51A 4OVZB 1N75A 4AG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKJ A;  4JI8 M;  2ZM6 M;  2Q2E B;  4DV2 M;  1I94 M;  3J7A S;  4DR6 M;  4LFC M;  2ZBK B;  3TWL A;  1PM5 A;  4PDI A;  3U6M A;  3U6O A;  3SAR A;  4YY3 M;  1K3W A;  3C58 A;  4LF6 M;  2UUC M;  4PDG A;  1IBM M;  4PCZ A;  4DV0 M;  3JAM S;  4NXN M;  3TWK A;  4X64 M;  1Z5A A;  4LFB M;  3OTO M;  4JI1 M;  4ITQ A;  4B3R M;  3SAS A;  1Q3B A;  4DR7 M;  5ITX A;  4LF7 M;  3SAU A;  1Z59 A;  4GKJ M;  3GO8 A;  2E5L M;  5FLX S;  4DV6 M;  1L1Z A;  3SAT A;  3VK7 A;  4DV7 M;  2F5S A;  3GPX A;  5BR8 M;  3SAW A;  2UXB M;  3A46 A;  3T1Y M;  4DV1 M;  4NRV A;  1N36 M;  4DUY M;  1Z5C A;  4DUZ M;  2UU9 M;  4JYA M;  4JI0 M;  1R2Y A;  3SBJ A;  5A2Q S;  1XNQ M;  4NRW A;  4JI7 M;  4G4R A;  1HNX M;  5LMU M;  2OPF A;  1XC8 A;  1PJJ A;  1TDH A;  1K82 A;  2OQ4 A;  4JI4 M;  4NXM M;  3J81 S;  1IBK M;  3GQ4 A;  1IBL M;  3GP1 A;  1L2C A;  1N33 M;  4JI6 M;  1XMO M;  4X65 M;  1L2D A;  3A45 A;  5IWA M;  4LF5 M;  4B3S M;  5IT9 S;  1FJG M;  5ITY A;  1L2B A;  1XNR M;  3U6D A;  2HHH M;  3U6E A;  1TDZ A;  4DR3 M;  3U6S A;  4PD2 A;  3T1H M;  3JR5 A;  4B3M M;  2F5P A;  5ITT A;  3U6Q A;  4AQY M;  5ITX E;  2UXD M;  3DOA A;  2XZU A;  2UUB M;  2XZF A;  1N34 M;  1K3X A;  1HNZ M;  4X66 M;  3J80 S;  4JI5 M;  3U6L A;  1Q3C A;  3SAV A;  3GQ3 A;  4LFA M;  4DV3 M;  1HR0 M;  4LF9 M;  4DR4 M;  2UUA M;  5ITR A;  1N32 M;  4DR2 M;  2VQF M;  2F4V M;  4GKK M;  5ITU A;  4JV5 M;  3GPY A;  4CIS A;  4X62 M;  1R2Z A;  1J5E M;  1NNJ A;  3GPU A;  4YHH M;  3JR4 A;  4DR1 M;  3W0F A;  4G4N A;  2F5N A;  2UXC M;  3GPP A;  2EA0 A;  1XMQ M;  4LF4 M;  1Z5B A;  4JI3 M;  3VK8 A;  1Q39 A;  4JI2 M;  4KHP M;  1EE8 A;  4DR5 M;  1KFV A;  4DV4 M;  3U6P A;  4LF8 M;  4K0K M;  2VQE M;  3A42 A;  5LMN M;  3U6C A;  1L1T A;  2F5O A;  1MU5 A;  4MB7 A;  5ITQ A;  2F5Q A;  4DV5 M;  1PJI A;  1HNW M;  4B3T M;  3GQ5 A;  3TWM A;  4OX9 M;  4G4Q A;  1MX0 A;  4G4O A; 
#chains in the Genus database with same CATH topology
 1XXH B;  3NWL A;  4FWD A;  5EXP A;  4JI8 M;  3L2A A;  2K9D A;  1ZMV A;  3HWS A;  3I4Y A;  4DV2 M;  2RKO A;  7CAT A;  5L8R F;  3J7A S;  4LRS A;  2DHR A;  4LFC M;  3Q8X A;  2G8L A;  4A3V B;  2DWM A;  3U6O A;  4GC9 A;  2J5Y A;  5DYI A;  2CV2 A;  3C58 A;  2G3Q A;  2OOB A;  4IBC A;  4PDG A;  3SMP A;  3IEC A;  1NV8 A;  3TL4 X;  2YQZ A;  5DYG A;  1R4G A;  3C9P A;  3HJQ A;  3JAM S;  3L28 A;  1W5T A;  4I8O A;  3TWK A;  5KQD A;  2X4A A;  2XEP A;  2LXE A;  2JNH A;  4B7G A;  3SHF A;  1IXR C;  5KPT A;  1ZV1 A;  4GRI A;  1QAQ A;  1R5L A;  3SAU A;  2BJW A;  4GKJ M;  4MGZ E;  5FLX S;  4DV6 M;  4IBE A;  1T6O A;  1L1Z A;  3VK7 A;  2VII A;  4FWG A;  4L16 A;  2XFT A;  2F5S A;  5BR8 M;  3SAW A;  1VEK A;  2YR0 A;  4XK8 F;  2UXB M;  2JP7 A;  3T1Y M;  1YSY A;  1PJS A;  1IXS B;  1WHC A;  3KOY E;  4IJF A;  2C96 A;  3THG A;  1E94 E;  4DUZ M;  2C5R A;  1SXJ B;  2ZTC A;  3GLH E;  3QYE A;  3T15 A;  4LJ8 A;  1Z6T A;  2JY6 B;  4NRW A;  2R4J A;  5LMU M;  2FNA A;  4L15 A;  4FCW A;  3SYL A;  4BLC A;  2K6B A;  2MJ5 B;  1V33 A;  1FNN A;  3RGP A;  4AZF A;  3CF6 E;  1G71 A;  2XSZ A;  3KSJ A;  4LCB A;  4MM3 B;  1XXH E;  5FTN A;  4NSR A;  5FTK A;  3GQ4 A;  1NHW C;  1L2D A;  1QZE A;  1C7Y A;  3E46 A;  4B3S M;  4LJ4 A;  3FUV A;  3FTE A;  5ITY A;  5IRE B;  1XNR M;  2LVA A;  3LCU A;  2R18 A;  1IQP A;  1NSF A;  3U6E A;  2GQF A;  3BXW A;  2FE8 A;  4AKG A;  5ITT A;  1AUA A;  2QEN A;  2A5Y B;  3QAU A;  3VDU A;  5ITX E;  3E21 A;  3DOA A;  2XSZ D;  4QNM A;  2Z3X A;  1DO0 A;  1NVM A;  4KT0 F;  2XZF A;  2UUB M;  3U5Z A;  4QOZ C;  4X66 M;  1NNU C;  1UFZ A;  3HZJ A;  3LQR A;  1R6B X;  2B3T A;  2R6F A;  2LVP C;  3H4J A;  4DV3 M;  1HR0 M;  2QZ4 A;  4M0D A;  4QOS A;  3R9X B;  5FTL A;  1E9R A;  2Y0Q A;  2F4V M;  2HWJ A;  4GKK M;  1ZMW A;  1F4I A;  3B9P A;  1IN4 A;  3GPY A;  4CIS A;  3RGS A;  3RE8 A;  4LRT A;  1J5E M;  1TR8 A;  3GPU A;  3JR4 A;  2R65 A;  3HGI A;  1IY0 A;  4NSO B;  3T38 A;  4G4N A;  1E9S A;  1SXJ C;  2VF8 A;  2EA0 A;  1XMQ M;  2UXC M;  4JI3 M;  1SG9 A;  1Q39 A;  2CWB A;  3DZD A;  2CV1 A;  4S12 A;  3J7B A;  2DZN B;  2Z8Y M;  4DR5 M;  1KFV A;  4DV4 M;  4QHS A;  4G6Z A;  1Y8G A;  4Y28 F;  1SXJ E;  4QHT A;  4CHT B;  4LF8 M;  4Z6Y A;  2LNH C;  2KNZ A;  4P17 A;  2LVN C;  1GLN A;  1DGH B;  5JI3 E;  1PJI A;  1HNW M;  1QAO A;  2KHH A;  1MX0 A;  4G4O A;  4R71 A;  2HKJ A;  4UN2 B;  2ZM6 M;  3B7Q A;  2DAM A;  4KLN A;  3BOS A;  4M9X A;  1I94 M;  4RF1 A;  5EP4 A;  3NBX X;  3UZU A;  1G8P A;  4PDI A;  3L25 A;  2QBY B;  1GVN A;  3FRH A;  1G4A E;  2N35 A;  4YY3 M;  1K3W A;  1IXZ A;  2EUC A;  2FOI C;  1OIP A;  1A5T A;  3ZH9 B;  1GKI A;  2H1R A;  1OKS A;  2KZU A;  1Z5A A;  4PT5 A;  4LFB M;  3W67 A;  1T3T A;  4GIP A;  3GLG A;  2DNA A;  4B3R M;  1Q3B A;  3KXE C;  4FCV A;  4LJ9 A;  4LZZ A;  4MGH A;  4Z8X A;  4GIT A;  4D81 A;  3GO8 A;  3U5Z B;  2E5L M;  5BPV A;  3SAT A;  3D8B A;  4DV7 M;  3FTC A;  2DZL A;  4HEO A;  3AOG A;  3UJN A;  1MJG M;  1QZM A;  2QP9 X;  1TGU A;  2I7N A;  3KFU G;  2MR9 A;  4KOD A;  3PFI A;  4L78 A;  4DV1 M;  2LBC A;  3SYK A;  4NRV A;  1N36 M;  4RNA A;  4LY6 A;  1OTR A;  4ZPX A;  1GL6 A;  2D7H A;  2UU9 M;  4JYA M;  4JI0 M;  1R2Y A;  1DGG A;  3Q8G A;  2QHO B;  5A2Q S;  4JI7 M;  2HAK A;  5C1B A;  4LG2 A;  1HNX M;  3U61 A;  3KOW E;  4RKU F;  1ORY B;  2WSF F;  2OQ4 A;  1K82 A;  4JI4 M;  4NXM M;  4AKI A;  1IBK M;  3U60 A;  1KSF X;  1OFH A;  4JI6 M;  4GMQ A;  4LJ5 A;  3VFD A;  4GH9 A;  1QAM A;  3A45 A;  5IWA M;  1NY5 A;  4NOO B;  2DAG A;  4FD2 A;  3HX3 A;  3U6D A;  4LGM A;  4L4U A;  1GAB A;  2W82 A;  3CTW B;  4XGI A;  4GEW A;  1GO5 A;  3U6S A;  3GLF B;  3T1H M;  1KYI A;  3EIE A;  3KW6 A;  1X37 A;  3U6Q A;  2BNK A;  4F1I A;  3HHW A;  2LHC A;  4MGY E;  2V1U A;  3HU1 A;  2JY7 A;  3MMP A;  2QNJ A;  3FYC A;  1N34 M;  3AJI B;  1HNZ M;  3FD9 A;  3ILK A;  4JI5 M;  3LW5 F;  3GRV A;  2R4E A;  4GHL A;  5FSW A;  3L27 A;  4DR4 M;  4P16 A;  2UUA M;  1TTE A;  2ERC A;  2KA6 B;  4OU7 A;  2VQF M;  2OO9 A;  1MN3 A;  2J7N A;  3KP1 E;  3UGJ A;  5ITU A;  4JV5 M;  2BJV A;  3EIH A;  1R2Z A;  1QYR A;  2KEB A;  2HL7 A;  3FE3 A;  3FUT A;  1NNJ A;  3K1J A;  4YHH M;  3GLI B;  4DR1 M;  2EKK A;  2JA2 A;  2APL A;  3WHL A;  3MK6 A;  4IBD A;  3GLG B;  3PNV A;  1HT2 E;  2HCB A;  3ZQJ A;  3GPP A;  4LF4 M;  2DAI A;  1W5S A;  3VK8 A;  1G41 A;  3T6P A;  2Z4S A;  3CGW A;  2DAK A;  1D0M A;  1VEG A;  1V34 A;  3U6P A;  2DAE A;  5KQ8 A;  2FH0 A;  4MB7 A;  1IN7 A;  2WSE F;  4IBK A;  2CFO A;  4BBA A;  1NHG C;  2MGW A;  3D8L A;  1IFY A;  1NJG A;  4B3T M;  3TWM A;  5KPR A;  4OX9 M;  4G4Q A;  3HHZ A;  2DEN A;  2QSF X;  1WGN A;  2EO2 A;  2J7O A;  2V1C A;  4D82 A;  3A98 B;  2O01 F;  3GLH A;  1HJP A;  1OFI A;  2CHV A;  2KNV A;  3FRI A;  1J09 A;  4B08 A;  1WXQ A;  3FUU A;  3W68 A;  3U61 B;  2LTU A;  3K92 A;  3L26 A;  4DR6 M;  3K8Z A;  4IJE A;  1PM5 A;  3U6M A;  3GLF E;  4LJA A;  4OVZ A;  1XXH A;  3FKE A;  3TPZ A;  3SFZ A;  4M9S A;  4R7G A;  2DXI A;  1VEJ A;  4DV0 M;  1V92 A;  3IHP A;  1D0L A;  4AG5 A;  4X64 M;  2XGN A;  1PJQ A;  3BBZ A;  4FVM A;  4R3D A;  4L8R C;  4LJ6 A;  4DBG B;  4CGY B;  3HJS A;  1LTM A;  1IM2 A;  1Q02 A;  4JI1 M;  4ITQ A;  1DV0 A;  4DR7 M;  5ITX A;  5EXS A;  1NY6 A;  1QAN A;  2C98 A;  1L8Q A;  2RRU A;  4WP2 A;  2RGH A;  4IBG A;  2FFJ A;  3I01 M;  4M0W A;  4MH0 E;  3M7G A;  3V76 A;  5C18 A;  3WHK A;  3K9O A;  3GLI E;  1YUB A;  4AKH A;  1WGL A;  3W0L B;  4GHA A;  3C3D A;  3GLG E;  2DKL A;  3GRR A;  5EP3 A;  5F3W A;  1GL7 A;  2WZJ A;  2O25 A;  4AI6 A;  1TH3 A;  1QUT A;  3PNY A;  2EJS A;  2CEA A;  3SBJ A;  1XNQ M;  4NL4 H;  5KO3 A;  4G4R A;  5KPZ A;  3B74 A;  2OPF A;  1XC8 A;  1NO1 A;  1TDH A;  5DFL A;  2DWL A;  2R44 A;  1IBL M;  1ZAE A;  3AOE A;  5EJC A;  3GP1 A;  1L2C A;  1N33 M;  2FS1 A;  5EXX A;  1ZQ9 A;  2O5R A;  1JB0 F;  4IBF A;  3AFH A;  3CF2 A;  3TQS A;  4D80 A;  2LVQ D;  1JR3 A;  2OOA A;  4LF5 M;  4CJ6 A;  2K47 A;  5EXT A;  1OAI A;  1T43 A;  1L2B A;  1EIJ A;  3AL0 C;  3LCV B;  4Q7J A;  4WUR A;  2CV0 A;  3F92 A;  4DR3 M;  1IN5 A;  4IBB A;  4PD2 A;  4B3M M;  1R7R A;  5GKN A;  2ZAM A;  1DGF A;  1IY2 A;  3DFZ A;  4KO8 A;  2DZO B;  2RGO A;  4GC5 A;  4I81 A;  2UXD M;  2V6Z M;  2CP8 A;  4M9Z A;  1WJ7 A;  4JXJ A;  3IG8 A;  2ZTD A;  1K3X A;  2XFS A;  3KSX A;  4MGK E;  1JR3 D;  1Q3C A;  1HQY E;  2LH0 A;  3SAV A;  4ANR A;  4LFA M;  1QUS A;  3DA1 A;  4LF9 M;  5ITR A;  4RF0 A;  1N32 M;  3C3E A;  3MHV C;  1H6U A;  2P5T A;  2R0I A;  2X8A A;  2CE7 A;  3B7Z A;  2Y0T A;  2Z4R A;  8CAT A;  3KOZ E;  4X62 M;  2L7H A;  3LVV A;  2GNO A;  5E6J A;  2K0B X;  2LHG A;  2LVO C;  2M60 A;  4IBI A;  2X49 A;  3NBI A;  3W0F A;  2Y21 A;  1DGB A;  3PVS A;  2LWX A;  1WR1 B;  3KDS E;  2XH9 A;  3L29 A;  3QYB A;  2JUJ A;  2YFQ A;  1TF0 B;  1J7K A;  4IBJ A;  2D7E A;  3FTF A;  4LZJ A;  4KHP M;  3FUW A;  5E26 A;  4K0K M;  1L1T A;  5LMN M;  2XF3 A;  1YLA A;  3HKP A;  1MU5 A;  1N77 A;  3HY5 A;  2DWN A;  2F5Q A;  4DV5 M;  3K2L A;  1G3I A;  1PRB A;  1IY1 A;  3SHG B;  4BB9 A;  4CIZ A;  4B7F A;  2Q2E B;  1GJT A;  2QCU A;  3SC3 A;  1C1K A;  2KDL A;  2MRO B;  3H4M A;  2DVW B;  5FTM A;  1P3Q Q;  2ZBK B;  1TH2 A;  4REZ A;  3TWL A;  2R62 A;  2AHM A;  1DGH A;  1VG5 A;  2R46 A;  1NJF A;  2JY8 A;  4JN6 A;  4EIW A;  1EFU B;  4MGI E;  5JI2 E;  3SMS A;  3SAR A;  1RU3 A;  3E9S A;  1IN8 A;  3J27 B;  4LF6 M;  2UUC M;  1IBM M;  4PCZ A;  2NQ8 C;  1N78 A;  4NC6 A;  4NXN M;  2XLJ A;  3GRU A;  2JWS A;  3LVW A;  2L6O A;  3K9P A;  3OTO M;  2JZ0 A;  2QBY A;  3SAS A;  1D0K A;  2YNM D;  1AIP C;  3LQQ A;  5IZ7 D;  4LF7 M;  1Z59 A;  2ZAN A;  1OJL A;  5EP2 A;  1VDD A;  3ZCB B;  3GPX A;  2KXE A;  4I4L A;  4QNR A;  3M0E A;  3RFW A;  1QDT A;  3KS8 A;  4IIW A;  3A46 A;  2BWB A;  4HL4 A;  3HU3 A;  2DWZ B;  3QWL A;  1JQJ C;  1VQ1 A;  3PXG A;  2EKF A;  3U60 B;  1OIZ A;  4DUY M;  1Z5C A;  3B7N A;  3AV0 A;  5DNY A;  3HJ8 A;  4G3O A;  2Z7J A;  3KP0 E;  2CRU A;  2ZAO A;  3HHX A;  3J2P B;  3AKZ A;  1PJJ A;  2L4E A;  2MH8 A;  4W5W A;  1XB2 B;  2KW0 A;  3I4V A;  3J81 S;  4LJ7 A;  3UK6 A;  3KS4 A;  3E4R A;  1YE9 A;  2QQ8 A;  1XMO M;  4X65 M;  1S3S A;  2Y20 A;  1DO2 A;  2VF7 A;  5IT9 S;  3AOE C;  4B7H A;  3B89 A;  1CUK A;  3VKG A;  1LV7 A;  1PJT A;  2L09 A;  1FJG M;  2CHQ A;  2HHH M;  2G5G X;  3GRY A;  1TDZ A;  4FCT A;  2C99 A;  1BVS A;  3JR5 A;  2F5P A;  1IN6 A;  3FTD A;  3MJ5 A;  4TUW A;  4AQY M;  3R8F A;  1OAO C;  1XHB A;  2L4F A;  3FUX A;  1QDR A;  2KNA A;  3IG5 A;  2L2D A;  2XZU A;  3VKH A;  4II7 A;  1JR3 E;  1G59 A;  2R45 A;  2C9O A;  3J80 S;  2JZ1 A;  3U6L A;  2KRK A;  3UMM A;  3GQ3 A;  1ZMU A;  4LGY A;  3VDP A;  3GLF A;  2M5Z A;  2QPA A;  2KZS A;  2WSC F;  2H5X A;  3HU2 A;  1IXS A;  1GJS A;  4DR2 M;  4FWH A;  2L7I A;  4HLQ A;  4F2L A;  2JY5 A;  2CHG A;  2VDB B;  3ZC7 B;  3KVW A;  1SXJ A;  2DHY A;  3I04 M;  1HT1 E;  5FTJ A;  5H37 D;  2JXN A;  2CUZ A;  1HQC A;  3CF0 A;  4WW0 A;  2DI0 A;  1E32 A;  2F5N A;  1NV9 A;  3KOX E;  1D2N A;  2C9C A;  1Z5B A;  1WIV A;  2I7P A;  3M6A A;  4L6V 6;  5EP1 A;  4AW4 A;  4JI2 M;  2D7G A;  4FW9 A;  5EQT A;  3HHY A;  1EE8 A;  3GLH B;  3VLF B;  1QQW A;  2KRU A;  2VQE M;  3A42 A;  3U6C A;  4XBO A;  1TH4 A;  3LMM A;  4I5S A;  3FYD A;  2F5O A;  1PGY A;  3TE6 A;  2BWE A;  5ITQ A;  3GLI A;  1SXJ D;  4OW0 A;  1QVR A;  1I4W A;  3GQ5 A;  1XWI A;  1UM8 A;  3I51 A;  1VDL A;  1OQY A;  4OVZ B;  1N75 A;  4AG6 A; 
#chains in the Genus database with same CATH homology
 1XXH B;  3NWL A;  4FWD A;  5EXP A;  4JI8 M;  3L2A A;  3HWS A;  3I4Y A;  4DV2 M;  2RKO A;  7CAT A;  3J7A S;  4LRS A;  2DHR A;  4LFC M;  3Q8X A;  2G8L A;  4A3V B;  2DWM A;  3U6O A;  4GC9 A;  5DYI A;  2CV2 A;  3C58 A;  4IBC A;  4PDG A;  3SMP A;  3TL4 X;  2YQZ A;  5DYG A;  3HJQ A;  3JAM S;  3L28 A;  1W5T A;  4I8O A;  3TWK A;  5KQD A;  2X4A A;  2XEP A;  2LXE A;  4B7G A;  3SHF A;  1IXR C;  5KPT A;  4GRI A;  1QAQ A;  3SAU A;  2BJW A;  4GKJ M;  4MGZ E;  5FLX S;  4DV6 M;  4IBE A;  1L1Z A;  3VK7 A;  2VII A;  4FWG A;  4L16 A;  2XFT A;  2F5S A;  5BR8 M;  3SAW A;  2YR0 A;  2UXB M;  3T1Y M;  1YSY A;  1IXS B;  3KOY E;  4IJF A;  2C96 A;  3THG A;  1E94 E;  4DUZ M;  2C5R A;  1SXJ B;  3T15 A;  4LJ8 A;  1Z6T A;  4NRW A;  2R4J A;  5LMU M;  2FNA A;  4L15 A;  4FCW A;  3SYL A;  4BLC A;  1FNN A;  3RGP A;  4AZF A;  3CF6 E;  2XSZ A;  3KSJ A;  4LCB A;  4MM3 B;  5FTN A;  3GQ4 A;  5FTK A;  4NSR A;  1NHW C;  1L2D A;  4B3S M;  4LJ4 A;  3FUV A;  3FTE A;  5ITY A;  5IRE B;  1XNR M;  3U6E A;  2R18 A;  1IQP A;  1NSF A;  2FE8 A;  4AKG A;  5ITT A;  2QEN A;  2A5Y B;  3QAU A;  3VDU A;  5ITX E;  3DOA A;  2XSZ D;  4QNM A;  2Z3X A;  1DO0 A;  1NVM A;  2XZF A;  2UUB M;  3U5Z A;  4QOZ C;  4X66 M;  1NNU C;  3LQR A;  1R6B X;  4DV3 M;  1HR0 M;  2QZ4 A;  4M0D A;  4QOS A;  3R9X B;  5FTL A;  1E9R A;  2Y0Q A;  2F4V M;  4GKK M;  3B9P A;  1IN4 A;  3GPY A;  4CIS A;  3RGS A;  3RE8 A;  4LRT A;  1J5E M;  3GPU A;  3JR4 A;  2R65 A;  3HGI A;  1IY0 A;  4NSO B;  3T38 A;  4G4N A;  1E9S A;  1SXJ C;  2EA0 A;  2UXC M;  1XMQ M;  4JI3 M;  1Q39 A;  3DZD A;  2CV1 A;  4S12 A;  3J7B A;  2DZN B;  4DR5 M;  1KFV A;  4DV4 M;  4QHS A;  4G6Z A;  4LF8 M;  1SXJ E;  4QHT A;  4CHT B;  4Z6Y A;  2LNH C;  1GLN A;  1DGH B;  5JI3 E;  1PJI A;  1HNW M;  1QAO A;  1MX0 A;  4G4O A;  2HKJ A;  2ZM6 M;  4KLN A;  3BOS A;  4M9X A;  1I94 M;  4RF1 A;  5EP4 A;  3UZU A;  1G8P A;  4PDI A;  3L25 A;  2QBY B;  1GVN A;  1G4A E;  4YY3 M;  1K3W A;  1IXZ A;  2EUC A;  2FOI C;  3ZH9 B;  1GKI A;  2H1R A;  2KZU A;  1Z5A A;  4PT5 A;  4LFB M;  1T3T A;  4GIP A;  3GLG A;  4B3R M;  1Q3B A;  3KXE C;  4FCV A;  4LJ9 A;  4LZZ A;  4MGH A;  4Z8X A;  4GIT A;  4D81 A;  3GO8 A;  3U5Z B;  2E5L M;  5BPV A;  3SAT A;  3D8B A;  4DV7 M;  3FTC A;  3AOG A;  3UJN A;  1QZM A;  2QP9 X;  1TGU A;  2I7N A;  3KFU G;  4KOD A;  3PFI A;  4L78 A;  4DV1 M;  3SYK A;  4NRV A;  1N36 M;  4RNA A;  4LY6 A;  4ZPX A;  1GL6 A;  2D7H A;  2UU9 M;  4JYA M;  4JI0 M;  1R2Y A;  1DGG A;  5A2Q S;  4JI7 M;  5C1B A;  4LG2 A;  1HNX M;  3U61 A;  3KOW E;  1ORY B;  1K82 A;  2OQ4 A;  4JI4 M;  4NXM M;  4AKI A;  1IBK M;  3U60 A;  1KSF X;  1OFH A;  4JI6 M;  4GMQ A;  4LJ5 A;  3VFD A;  4GH9 A;  1QAM A;  3A45 A;  5IWA M;  1NY5 A;  4NOO B;  4FD2 A;  3U6D A;  4LGM A;  4L4U A;  2W82 A;  3CTW B;  4XGI A;  3U6S A;  3GLF B;  3T1H M;  1KYI A;  3EIE A;  3KW6 A;  1X37 A;  3U6Q A;  2BNK A;  3HHW A;  4MGY E;  2V1U A;  3HU1 A;  3FYC A;  1N34 M;  3AJI B;  1HNZ M;  3FD9 A;  3ILK A;  4JI5 M;  3GRV A;  2R4E A;  4GHL A;  5FSW A;  3L27 A;  4DR4 M;  4P16 A;  2UUA M;  2ERC A;  2KA6 B;  4OU7 A;  2VQF M;  3UGJ A;  2J7N A;  3KP1 E;  5ITU A;  4JV5 M;  2BJV A;  3EIH A;  1R2Z A;  1QYR A;  2KEB A;  2HL7 A;  3FUT A;  1NNJ A;  3K1J A;  4YHH M;  3GLI B;  4DR1 M;  2JA2 A;  3WHL A;  3MK6 A;  4IBD A;  3GLG B;  3PNV A;  1HT2 E;  2HCB A;  3GPP A;  4LF4 M;  1W5S A;  3VK8 A;  1G41 A;  2Z4S A;  3U6P A;  5KQ8 A;  4MB7 A;  1IN7 A;  4IBK A;  2CFO A;  4BBA A;  1NHG C;  3D8L A;  1NJG A;  4B3T M;  3TWM A;  5KPR A;  4OX9 M;  4G4Q A;  3HHZ A;  4D82 A;  2EO2 A;  2J7O A;  2V1C A;  3A98 B;  3GLH A;  1OFI A;  2CHV A;  1J09 A;  4B08 A;  1WXQ A;  3FUU A;  3U61 B;  3K92 A;  3L26 A;  4DR6 M;  3K8Z A;  4IJE A;  1PM5 A;  3U6M A;  4LJA A;  4OVZ A;  1XXH A;  3FKE A;  3TPZ A;  3SFZ A;  4M9S A;  4R7G A;  2DXI A;  4DV0 M;  4AG5 A;  4X64 M;  2XGN A;  4FVM A;  4R3D A;  4L8R C;  4LJ6 A;  4CGY B;  3HJS A;  1IM2 A;  4JI1 M;  4ITQ A;  4DR7 M;  5ITX A;  5EXS A;  1NY6 A;  1QAN A;  2C98 A;  1L8Q A;  2RGH A;  4IBG A;  2FFJ A;  4M0W A;  4MH0 E;  3M7G A;  5C18 A;  3WHK A;  1YUB A;  4AKH A;  4GHA A;  3W0L B;  3GRR A;  5EP3 A;  5F3W A;  1GL7 A;  4AI6 A;  1TH3 A;  3PNY A;  2CEA A;  3SBJ A;  1XNQ M;  4NL4 H;  5KO3 A;  4G4R A;  5KPZ A;  2OPF A;  1XC8 A;  1TDH A;  2DWL A;  1IBL M;  1ZAE A;  3AOE A;  5EJC A;  3GP1 A;  1L2C A;  1N33 M;  5EXX A;  1ZQ9 A;  2O5R A;  4IBF A;  3AFH A;  3CF2 A;  3TQS A;  4D80 A;  1JR3 A;  4LF5 M;  2K47 A;  5EXT A;  1L2B A;  3AL0 C;  4WUR A;  2CV0 A;  4DR3 M;  1IN5 A;  4IBB A;  4PD2 A;  4B3M M;  1R7R A;  5GKN A;  2ZAM A;  1DGF A;  1IY2 A;  3DFZ A;  4KO8 A;  2DZO B;  2RGO A;  4GC5 A;  4I81 A;  2UXD M;  2V6Z M;  4M9Z A;  4JXJ A;  3IG8 A;  1K3X A;  2XFS A;  3KSX A;  4MGK E;  1JR3 D;  1Q3C A;  1HQY E;  2LH0 A;  3SAV A;  4LFA M;  3DA1 A;  4LF9 M;  5ITR A;  4RF0 A;  1N32 M;  3MHV C;  1H6U A;  2P5T A;  2X8A A;  2CE7 A;  2Y0T A;  2Z4R A;  8CAT A;  3KOZ E;  4X62 M;  2L7H A;  3LVV A;  5E6J A;  2M60 A;  4IBI A;  2X49 A;  3NBI A;  3W0F A;  2Y21 A;  1DGB A;  3PVS A;  3KDS E;  2LWX A;  3L29 A;  2XH9 A;  2YFQ A;  1J7K A;  4IBJ A;  2D7E A;  3FTF A;  4LZJ A;  4KHP M;  3FUW A;  5E26 A;  4K0K M;  1L1T A;  5LMN M;  2XF3 A;  3HKP A;  1MU5 A;  1N77 A;  2DWN A;  2F5Q A;  4DV5 M;  3K2L A;  1G3I A;  1IY1 A;  3SHG B;  4BB9 A;  4B7F A;  2Q2E B;  2QCU A;  3SC3 A;  1C1K A;  3H4M A;  2DVW B;  5FTM A;  2ZBK B;  1TH2 A;  4REZ A;  3TWL A;  2R62 A;  2AHM A;  1DGH A;  2R46 A;  1NJF A;  4JN6 A;  4EIW A;  4MGI E;  5JI2 E;  3SAR A;  3SMS A;  3E9S A;  1IN8 A;  3J27 B;  4LF6 M;  2UUC M;  1IBM M;  4PCZ A;  2NQ8 C;  1N78 A;  4NXN M;  2XLJ A;  3GRU A;  3LVW A;  2L6O A;  3OTO M;  2QBY A;  3SAS A;  2YNM D;  3LQQ A;  5IZ7 D;  4LF7 M;  1Z59 A;  2ZAN A;  1OJL A;  5EP2 A;  1VDD A;  3ZCB B;  3GPX A;  2KXE A;  4I4L A;  4QNR A;  3M0E A;  3RFW A;  3KS8 A;  4IIW A;  3A46 A;  4HL4 A;  3HU3 A;  2DWZ B;  3QWL A;  1JQJ C;  3PXG A;  3U60 B;  4DUY M;  1Z5C A;  3AV0 A;  5DNY A;  3HJ8 A;  2Z7J A;  3KP0 E;  2ZAO A;  3HHX A;  3J2P B;  3AKZ A;  1PJJ A;  4W5W A;  2KW0 A;  3I4V A;  3J81 S;  4LJ7 A;  3UK6 A;  3KS4 A;  3E4R A;  1YE9 A;  1XMO M;  4X65 M;  1S3S A;  2Y20 A;  1DO2 A;  5IT9 S;  3AOE C;  4B7H A;  3VKG A;  1LV7 A;  2L09 A;  1FJG M;  2CHQ A;  2HHH M;  2G5G X;  3GRY A;  1TDZ A;  4FCT A;  2C99 A;  3JR5 A;  2F5P A;  1IN6 A;  3FTD A;  3MJ5 A;  4TUW A;  4AQY M;  3R8F A;  1XHB A;  3FUX A;  3IG5 A;  2XZU A;  3VKH A;  4II7 A;  1G59 A;  2R45 A;  2C9O A;  3J80 S;  3U6L A;  2KRK A;  3UMM A;  3GQ3 A;  4LGY A;  3VDP A;  3GLF A;  2M5Z A;  2QPA A;  2KZS A;  3HU2 A;  4DR2 M;  4FWH A;  2L7I A;  4HLQ A;  2CHG A;  3ZC7 B;  3KVW A;  1SXJ A;  1HT1 E;  5FTJ A;  5H37 D;  2CUZ A;  1HQC A;  3CF0 A;  4WW0 A;  1E32 A;  2F5N A;  3KOX E;  1D2N A;  2C9C A;  1Z5B A;  2I7P A;  3M6A A;  5EP1 A;  4AW4 A;  4JI2 M;  2D7G A;  4FW9 A;  5EQT A;  3HHY A;  1EE8 A;  3GLH B;  3VLF B;  1QQW A;  2KRU A;  2VQE M;  3A42 A;  3U6C A;  4XBO A;  1TH4 A;  3LMM A;  4I5S A;  3FYD A;  2F5O A;  3TE6 A;  5ITQ A;  3GLI A;  1SXJ D;  4OW0 A;  1QVR A;  1I4W A;  3GQ5 A;  1XWI A;  1UM8 A;  3I51 A;  4OVZ B;  1N75 A;  4AG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...