2NQ8C

Malarial enoyl acyl acp reductase bound with inh-nad adduct
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structural analysis of Plasmodium falciparum enoyl acyl carrier protein reductase as a pathway toward the optimization of triclosan antimalarial efficacy
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Enoyl-acyl carrier reductase
total genus 15
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2nq8C00
1NHWC 1NHGC 1NNUC 2NQ8C 2FOIC
chains in the Genus database with same CATH superfamily
1VDLA 4DUZM 1IN8A 1L2DA 4FD2A 2Z4RA 4MB7A 2FS1A 3TE6A 3UK6A 1ZAEA 4X65M 3CGWA 4RKUF 3HGIA 4LY6A 1G71A 5FSWA 2L7IA 1IY0A 1OIZA 3PNVA 5ITXA 3TWMA 2R65A 4IBJA 4GEWA 1R4GA 3JR5A 2GNOA 3GLFB 2QZ4A 2XSZA 4CIZA 2LVAA 3B89A 4I8OA 4DV7M 1XXHA 3FTFA 1T43A 4CGYB 2R62A 1CUKA 3C58A 1Q3BA 2O01F 4R3DA 1IXZA 1TF0B 3W0FA 1IBLM 2JXNA 4LGYA 1HJPA 2C9OA 4A3VB 1K3WA 2EO2A 3AOEA 3KSXA 4XGIA 4YY3M 3SYKA 3WHKA 2H5XA 2JZ0A 2D7HA 1OTRA 1X37A 4PDIA 2DI0A 3B7NA 1HQYE 1XMOM 3KOWE 2DHYA 5KPZA 1ZMUA 4DR5M 4LGMA 4JI7M 2H1RA 4FCTA 1G4AE 3AJIB 5EP2A 2O25A 1F4IA 3AFHA 4LZZA 5L8RF 1ORYB 3KOZE 2R44A 1K82A 2HWJA 1V33A 1OKSA 4IBGA 3U6CA 4LFBM 1H6UA 3IECA 4OVZB 2EKFA 2Y0QA 3NWLA 4IBDA 4B7HA 1WJ7A 2L7HA 1GJTA 1VDDA 1WXQA 1Z6TA 2OPFA 3GPUA 5DYIA 4IIWA 2M5ZA 1GL6A 1YSYA 2CV0A 3J81S 1KSFX 2HHHM 2Q2EB 1L2BA 2HAKA 1NJFA 4MM3B 1TH4A 2CEAA 1J7KA 3LVWA 2WZJA 4NOOB 2UUAM 3KS8A 4DR7M 1A5TA 3A46A 1G41A 1QZEA 2YNMD 3CF2A 3L28A 1HT1E 2Y21A 2DAIA 2QENA 3DA1A 1PGYA 4IJFA 1RU3A 1YLAA 3M6AA 1QZMA 3Q8XA 3RGSA 4F2LA 4TUWA 1E9SA 3AKZA 1K3XA 2JY7A 4FW9A 4MGYE 4BBAA 4X62M 4CISA 4AKIA 1JR3A 3GLHA 1QAQA 2OQ4A 4DR1M 2JY5A 3SC3A 1GLNA 3HU2A 3FE3A 4QHSA 3QWLA 5EQTA 4IBFA 2JNHA 4NXMM 1NHGC 3KOYE 1I4WA 3THGA 5DYGA 2XZUA 1Q02A 2B3TA 1IFYA 3BOSA 3U6LA 1PJQA 3GLIE 2YFQA 2AHMA 2JA2A 3HJQA 3E46A 1N36M 4AKGA 1KYIA 3M0EA 2F5QA 2KW0A 4B3TM 2F5PA 3HHXA 4NRVA 2JP7A 1XMQM 5EP4A 2KNZA 1NNJA 3T38A 2ZAMA 2QBYA 2K9DA 2UU9M 2VF7A 4FWGA 1MN3A 5E26A 3RFWA 4LF5M 2JUJA 4QHTA 1V92A 3GQ5A 3ZCBB 2M60A 2QPAA 3FUVA 2V1UA 2DENA 2I7PA 4D82A 2BWEA 1NO1A 1TDHA 2KXEA 3UMMA 3VKHA 3EIEA 2FE8A 4G4NA 2L2DA 4DV0M 1SXJB 3I4VA 1NVMA 1L2CA 4XBOA 3HX3A 4DV2M 2MJ5B 4UN2B 3GLGA 3U60B 1NJGA 3TPZA 1UFZA 2DNAA 4B3MM 3VKGA 4LRSA 2C98A 3KFUG 1L1TA 5FTNA 2C5RA 1HNWM 2E5LM 2R18A 2V1CA 2DZOB 4S12A 2ZBKB 2WSEF 1NV8A 2MH8A 4D80A 3E4RA 2F5OA 3NBIA 4ITQA 3GRVA 3D8LA 2BNKA 2LVPC 4LF9M 1XNRM 3W67A 4D81A 3T15A 4HEOA 1L1ZA 3HHZA 4JXJA 4PD2A 1GKIA 2Z7JA 3VDPA 1JR3E 2Y0TA 2QQ8A 2XZFA 4PCZA 2J7NA 4P17A 2UUBM 1JR3D 2QSFX 3TQSA 2F5NA 3I01M 4JI6M 2DZNB 4NRWA 5DFLA 1E94E 4P16A 4JI1M 3SHFA 4BLCA 2DAGA 2FH0A 1JB0F 1J09A 4XK8F 3GRRA 2Y20A 2J7OA 2CFOA 1QANA 1OIPA 3AOGA 3GLIA 3D8BA 3K1JA 3B74A 3C3EA 1QDTA 2KNVA 2KRKA 3HU1A 3SATA 1D0KA 4KO8A 1D2NA 3SASA 1IQPA 3GLFE 2VF8A 4RF1A 1NY5A 4MH0E 4L4UA 8CATA 4LJ8A 3HWSA 2LHCA 1PJTA 2EA0A 2XFTA 2ZANA 3LMMA 3DOAA 3GPXA 3U6DA 3V76A 1QUSA 3TWKA 2EJSA 2LNHC 4AW4A 3HHWA 3L29A 3SMPA 2UUCM 1QVRA 1WR1B 3W68A 4B3SM 4LRTA 4DV5M 3HHYA 3GLGE 5JI2E 3J80S 1TR8A 1YUBA 2CRUA 4OW0A 1VQ1A 1Y8GA 3LQRA 3ILKA 3VLFB 1YE9A 5EXTA 2D7EA 4Q7JA 3U6OA 4HLQA 2O5RA 2KZUA 2JY8A 4LFAM 1MJGM 2V6ZM 3FUXA 4AG6A 1TDZA 2R4JA 5IWAM 3SAWA 4I81A 1DO0A 4QNMA 1XC8A 2G5GX 3GQ4A 1EFUB 5FTMA 4GHLA 4FVMA 3JR4A 3FTEA 1TH3A 3IG8A 2L09A 4II7A 3U6SA 2UXBM 2DXIA 2DVWB 1IXSB 1GL7A 2N35A 4KLNA 2BJVA 4QNRA 3GO8A 4CJ6A 1PM5A 4M0WA 5GKNA 4FCVA 1D0MA 2R0IA 3IHPA 5ITQA 3GLHE 1HNZM 2KEBA 3R9XB 4G3OA 1PJSA 1Q39A 2CP8A 1IY2A 4JI5M 4KODA 2D7GA 2APLA 1DGFA 1FNNA 3KP0E 2KHHA 3MJ5A 5ITXE 4DR2M 5ITTA 2DKLA 1DO2A 3U6PA 5ITUA 3MMPA 4F1IA 3A42A 5EXXA 5KO3A 3GLGB 3M7GA 3RGPA 4DV3M 3VK8A 4GC9A 1EIJA 4LCBA 1N77A 1VEKA 1OFHA 1WGLA 1XNQM 2C96A 5EJCA 1IM2A 2HKJA 5KQDA 4G4OA 2BJWA 3U60A 2F4VM 3HJ8A 3NBXX 3T1YM 4BB9A 2YQZA 2ZM6M 2R4EA 4Y28F 2QBYB 4IBIA 3GRYA 3EIHA 1NSFA 3KP1E 2BWBA 1Z59A 2Z8YM 3KS4A 4GITA 1ZQ9A 5E6JA 5KPRA 3UGJA 1VEGA 2RGHA 1W5SA 3B7ZA 4NC6A 3U6QA 3KXEC 1V34A 3L25A 4IBBA 4X64M 2GQFA 5BR8M 4DV1M 2P5TA 2KDLA 1XXHE 3C9PA 2DAKA 4K0KM 4GKJM 4YHHM 3CF6E 1NV9A 4G6ZA 1ZMWA 2HL7A 1PRBA 5FTJA 5C1BA 4AG5A 1MU5A 2ERCA 4GH9A 5LMNM 3VK7A 2L4FA 1LTMA 1R6BX 2LVOC 3HKPA 3Q8GA 2W82A 3KSJA 2JWSA 2DHRA 4OVZA 2LBCA 4OU7A 1GABA 3ZQJA 1HT2E 3FD9A 4EIWA 2X8AA 2X4AA 1TH2A 3OTOM 3AOEC 4LF4M 2RRUA 1XXHB 3UZUA 2I7NA 3AL0C 3L26A 4DR6M 1HNXM 3K9OA 1XB2B 3MK6A 4G4QA 1MX0A 2X49A 3U61A 3PFIA 3FYDA 3I4YA 2LTUA 3L2AA 1PJIA 4QOSA 3U6EA 2CHVA 2MR9A 5KQ8A 4NSRA 4G4RA 2XEPA 1IBKM 1OQYA 4LFCM 4JI8M 1LV7A 2YR0A 1QAOA 2C99A 1DGHB 4B7GA 3U5ZB 4Z8XA 4QOZC 4FWHA 3SYLA 3L27A 1Q3CA 5A2QS 1AUAA 3J27B 4AKHA 2CWBA 2VDBB 4L78A 4L8RC 4RF0A 1VG5A 2R46A 3PVSA 1ZV1A 3C3DA 1R2YA 4LJ5A 3WHLA 4IBKA 3FUWA 3SARA 4LG2A 4KHPM 1NHWC 2G8LA 2WSCF 3A98B 3KDSE 3SHGB 5FLXS 2VIIA 4GKKM 4PT5A 5FTLA 1Z5BA 4NSOB 2KNAA 2QNJA 2RGOA 1XHBA 3HY5A 1Z5AA 2FNAA 1D0LA 2L4EA 3GRUA 4GC5A 4W5WA 1GO5A 4MGHA 3UJNA 1R2ZA 3LCVB 1J5EM 1XWIA 4DR3M 1DGBA 1T6OA 2DWLA 2LVNC 2KRUA 1Z5CA 3HZJA 4R7GA 4IJEA 4NL4H 3R8FA 3E21A 4MGZE 3GPYA 3K8ZA 2CHGA 4B08A 2XGNA 1DV0A 4JYAM 2R45A 1G8PA 5ITYA 2VQEM 2OOBA 2LHGA 4L15A 5H37D 4LF7M 3J2PB 4FCWA 2FOIC 3HU3A 4REZA 3GPPA 5BPVA 5KPTA 3VFDA 3KVWA 3DZDA 2KZSA 2OOAA 1IN4A 2LXEA 5EXPA 4NXNM 2JZ1A 2J5YA 3FTDA 3A45A 3QYEA 2UXCM 2CE7A 4RNAA 4AQYM 4WW0A 4LJAA 2DAMA 2NQ8C 5DNYA 4DBGB 3E9SA 3BXWA 4HL4A 1TGUA 2K0BX 1N75A 2F5SA 1ZMVA 4I4LA 2G3QA 2XSZD 3FRHA 4LF6M 2XLJA 1EE8A 5C18A 1N32M 4CHTB 4LJ9A 4B3RM 3GP1A 3I51A 4MGIE 4LJ7A 4IBEA 3JAMS 2DWNA 1P3QQ 3T1HM 3J7AS 4LJ6A 4AI6A 3FYCA 2JY6B 1I94M 3J7BA 2ZTCA 5EXSA 3ZC7B 1N78A 1SG9A 1IY1A 3SFZA 3TL4X 1IBMM 1DGHA 3U5ZA 5F3WA 4WP2A 4JV5M 2DWZB 2XH9A 1SXJE 2A5YB 3QAUA 5EP1A 4WURA 3GLHB 2LH0A 2MROB 2RKOA 1QUTA 1AIPC 3K2LA 2DZLA 4L16A 1FJGM 3W0LB 1C7YA 2MGWA 3IG5A 2LVQD 1PJJA 2K6BA 4GMQA 3TWLA 1N34M 3U61B 1QDRA 1OAOC 2CV2A 2EKKA 4KT0F 4I5SA 4JN6A 4MGKE 3KW6A 1OFIA 4LZJA 3F92A 1R5LA 3B9PA 1E9RA 1TTEA 4FWDA 1SXJD 3PNYA 1IN6A 3CF0A 3T6PA 1WHCA 1QQWA 1L8QA 4LJ4A 4JI3M 3VDUA 3SAVA 4GHAA 3BBZA 3H4MA 3LCUA 3MHVC 3GLIB 3HJSA 3LW5F 2ZTDA 2DAEA 5IREB 1OAIA 4X66M 4B7FA 2Z4SA 2QP9X 2KA6B 1NY6A 4JI0M 3I04M 1OJLA 4IBCA 3LVVA 3GLFA 4L6V6 7CATA 4R71A 2XFSA 2CV1A 1QYRA 3CTWB 5ITRA 2WSFF 1T3TA 1WIVA 1G59A 2VQFM 3ZH9B 4DV4M 1VEJA 3FUTA 3K92A 1IXRC 1GJSA 3K9PA 1E32A 3SBJA 5FTKA 1QAMA 2EUCA 4GRIA 3FRIA 2OO9A 4M0DA 5JI3E 2Z3XA 2L6OA 1GVNA 2CUZA 1IN7A 2ZAOA 3RE8A 3FTCA 1C1KA 1W5TA 2HCBA 1DGGA 4M9SA 5LMUM 2C9CA 3SAUA 4DV6M 3U6MA 4DR4M 3LQQA 3FUUA 2XF3A 4PDGA 1R7RA 3GQ3A 1IN5A 1KFVA 1SXJA 4LF8M 3B7QA 4JI4M 3DFZA 3QYBA 4JI2M 1WGNA 5IT9S 2QHOB 5IZ7D 1SXJC 4OX9M 1HR0M 3AV0A 3H4JA 1S3SA 3SMSA 2K47A 2LWXA 2R6FA 1HQCA 1UM8A 4AZFA 4Z6YA 4DUYM 1N33M 1G3IA 5EP3A 2UXDM 2FFJA 4GIPA 4ZPXA 1IXSA 1JQJC 1BVSA 3FKEA 4M9XA 2QCUA 3PXGA 2DWMA 4ANRA 1NNUC 3KOXE 2CHQA 4M9ZA
chains in the Genus database with same CATH topology
4DUZM 1IN8A 1L2DA 4FD2A 2Z4RA 4MB7A 3TE6A 3UK6A 1ZAEA 4X65M 3HGIA 4LY6A 5FSWA 2L7IA 1IY0A 3PNVA 5ITXA 3TWMA 2R65A 4IBJA 3JR5A 3GLFB 2QZ4A 2XSZA 4I8OA 4DV7M 1XXHA 3FTFA 4CGYB 2R62A 3C58A 1Q3BA 4R3DA 1IXZA 3W0FA 1IBLM 4LGYA 2C9OA 4A3VB 1K3WA 2EO2A 3AOEA 3KSXA 4XGIA 4YY3M 3SYKA 3WHKA 2D7HA 1X37A 4PDIA 1XMOM 1HQYE 3KOWE 5KPZA 4DR5M 4LGMA 4JI7M 4FCTA 2H1RA 1G4AE 3AJIB 5EP2A 3AFHA 4LZZA 1ORYB 3KOZE 1K82A 4IBGA 3U6CA 4LFBM 1H6UA 4OVZB 2Y0QA 3NWLA 4IBDA 4B7HA 2L7HA 1VDDA 1WXQA 1Z6TA 2OPFA 3GPUA 5DYIA 4IIWA 2M5ZA 1GL6A 1YSYA 2CV0A 3J81S 1KSFX 2HHHM 2Q2EB 1L2BA 1NJFA 4MM3B 1TH4A 2CEAA 1J7KA 3LVWA 4NOOB 4DR7M 2UUAM 3KS8A 3A46A 1G41A 2YNMD 3CF2A 3L28A 1HT1E 2Y21A 2QENA 3DA1A 4IJFA 3M6AA 1QZMA 3Q8XA 3RGSA 4TUWA 1E9SA 3AKZA 1K3XA 4FW9A 4MGYE 4BBAA 4X62M 4AKIA 1JR3A 3GLHA 1QAQA 2OQ4A 4DR1M 3SC3A 1GLNA 3HU2A 4QHSA 3QWLA 5EQTA 4IBFA 4NXMM 1NHGC 3KOYE 1I4WA 3THGA 5DYGA 2XZUA 3BOSA 3U6LA 2YFQA 2AHMA 2JA2A 3HJQA 1N36M 4AKGA 1KYIA 3M0EA 2F5QA 2KW0A 4B3TM 2F5PA 3HHXA 4NRVA 1NNJA 1XMQM 5EP4A 3T38A 2ZAMA 2UU9M 5E26A 4FWGA 3RFWA 4LF5M 4QHTA 3GQ5A 3ZCBB 2M60A 2QPAA 3FUVA 2V1UA 2I7PA 3VKHA 4D82A 2KXEA 1TDHA 3UMMA 3EIEA 2FE8A 4G4NA 4DV0M 1SXJB 3I4VA 1NVMA 1L2CA 4XBOA 4DV2M 3GLGA 3U60B 1NJGA 3TPZA 4B3MM 3VKGA 4LRSA 2C98A 3KFUG 1L1TA 5FTNA 2C5RA 1HNWM 2E5LM 2R18A 2V1CA 2DZOB 4S12A 2ZBKB 4D80A 3E4RA 2F5OA 3NBIA 4ITQA 3GRVA 3D8LA 2BNKA 4LF9M 1XNRM 4D81A 3T15A 1L1ZA 3HHZA 4JXJA 4PD2A 1GKIA 2Z7JA 3VDPA 2Y0TA 2XZFA 4PCZA 2J7NA 4JI6M 2UUBM 1JR3D 2F5NA 3TQSA 2DZNB 4NRWA 1E94E 4P16A 4JI1M 3SHFA 4BLCA 1J09A 3GRRA 2Y20A 2J7OA 2CFOA 1QANA 3AOGA 3GLIA 3D8BA 3K1JA 2KRKA 3HU1A 3SATA 4KO8A 1D2NA 3SASA 1IQPA 4RF1A 1NY5A 4MH0E 4L4UA 8CATA 4LJ8A 3HWSA 2EA0A 2XFTA 2ZANA 3LMMA 3DOAA 3GPXA 3U6DA 3TWKA 2LNHC 4AW4A 3HHWA 3L29A 3SMPA 2UUCM 1QVRA 4B3SM 4LRTA 4DV5M 3HHYA 5JI2E 3J80S 1YUBA 4OW0A 3LQRA 3ILKA 3VLFB 1YE9A 5EXTA 2D7EA 3U6OA 4HLQA 2O5RA 2KZUA 4LFAM 2V6ZM 3FUXA 4AG6A 1TDZA 2R4JA 5IWAM 3SAWA 4I81A 1DO0A 4QNMA 1XC8A 2G5GX 3GQ4A 5FTMA 4GHLA 4FVMA 3JR4A 3FTEA 1TH3A 3IG8A 2L09A 4II7A 3U6SA 2UXBM 2DXIA 2DVWB 1IXSB 1GL7A 4KLNA 2BJVA 4QNRA 3GO8A 1PM5A 4M0WA 5GKNA 4FCVA 5ITQA 1HNZM 2KEBA 3R9XB 1Q39A 1IY2A 4JI5M 4KODA 2D7GA 1DGFA 3KP0E 3MJ5A 1FNNA 5ITXE 4DR2M 5ITTA 1DO2A 3U6PA 5ITUA 3GLGB 3U60A 3A42A 5EXXA 5KO3A 4DV3M 3M7GA 3RGPA 3VK8A 4GC9A 4LCBA 1N77A 1OFHA 1XNQM 2C96A 5EJCA 1IM2A 2HKJA 5KQDA 4G4OA 2BJWA 2F4VM 3HJ8A 3T1YM 4BB9A 2YQZA 2ZM6M 2R4EA 2QBYB 4IBIA 3GRYA 3EIHA 1NSFA 3KP1E 3KS4A 1Z59A 4GITA 5E6JA 5KPRA 1ZQ9A 3UGJA 4CISA 2RGHA 1W5SA 3U6QA 3L25A 3KXEC 4IBBA 4X64M 5BR8M 4DV1M 2P5TA 4GKJM 4K0KM 4YHHM 3CF6E 4G6ZA 2HL7A 5FTJA 5C1BA 4AG5A 4GH9A 1MU5A 2ERCA 5LMNM 3VK7A 1R6BX 3HKPA 2W82A 3KSJA 2DHRA 4OVZA 4OU7A 1HT2E 3FD9A 4EIWA 2X8AA 2X4AA 1TH2A 3OTOM 3AOEC 4LF4M 3AL0C 1XXHB 3UZUA 2I7NA 3L26A 4DR6M 1HNXM 3MK6A 4G4QA 1MX0A 2X49A 3U61A 3PFIA 3FYDA 3I4YA 3L2AA 1PJIA 4QOSA 3U6EA 2CHVA 5KQ8A 4NSRA 4G4RA 2XEPA 1IBKM 4LFCM 4JI8M 1LV7A 2YR0A 1QAOA 2C99A 1DGHB 4B7GA 3U5ZB 4Z8XA 4QOZC 4FWHA 3SYLA 3L27A 1Q3CA 5A2QS 3J27B 4AKHA 4L78A 4L8RC 4RF0A 2R46A 3PVSA 1R2YA 4LJ5A 3WHLA 4IBKA 3FUWA 3SARA 4LG2A 4KHPM 1NHWC 3KDSE 2G8LA 3A98B 3SHGB 5FLXS 2VIIA 4GKKM 4PT5A 5FTLA 1Z5BA 4NSOB 2RGOA 1XHBA 1Z5AA 2FNAA 3GRUA 4GC5A 4W5WA 4MGHA 3UJNA 1R2ZA 1J5EM 1XWIA 4DR3M 1DGBA 2DWLA 2KRUA 1Z5CA 4R7GA 4IJEA 4NL4H 3R8FA 4MGZE 3GPYA 3K8ZA 2CHGA 4B08A 2XGNA 4JYAM 2R45A 1G8PA 5ITYA 2VQEM 5H37D 4L15A 4LF7M 3J2PB 4FCWA 2FOIC 3HU3A 4REZA 3GPPA 5BPVA 5KPTA 3VFDA 3KVWA 3DZDA 2KZSA 1IN4A 2LXEA 5EXPA 4NXNM 3FTDA 3A45A 2UXCM 2CE7A 4RNAA 4AQYM 4WW0A 4LJAA 2NQ8C 5DNYA 3E9SA 4HL4A 1TGUA 1N75A 2F5SA 4I4LA 2XSZD 4LF6M 2XLJA 1EE8A 5C18A 1N32M 4CHTB 4LJ9A 4B3RM 3GP1A 3I51A 4MGIE 4LJ7A 4IBEA 3JAMS 2DWNA 3T1HM 4AI6A 3J7AS 4LJ6A 3FYCA 1I94M 3J7BA 5EXSA 3ZC7B 1N78A 1IY1A 3SFZA 3TL4X 1IBMM 1DGHA 3U5ZA 5F3WA 4JV5M 2DWZB 2XH9A 1SXJE 2A5YB 3QAUA 5EP1A 4WURA 3GLHB 2LH0A 2RKOA 3K2LA 4L16A 1FJGM 3W0LB 3IG5A 1PJJA 4GMQA 3TWLA 1N34M 3U61B 2CV2A 4I5SA 4JN6A 4MGKE 3KW6A 1OFIA 4LZJA 3B9PA 1E9RA 4FWDA 1SXJD 3PNYA 1IN6A 3CF0A 3SAVA 1QQWA 1L8QA 4LJ4A 4JI3M 3VDUA 4GHAA 3MHVC 3H4MA 3GLIB 3HJSA 5IREB 4X66M 4B7FA 2Z4SA 2QP9X 2KA6B 1NY6A 4JI0M 1OJLA 4IBCA 3LVVA 3GLFA 7CATA 2XFSA 2CV1A 1QYRA 3CTWB 5ITRA 1T3TA 1G59A 2VQFM 3ZH9B 4DV4M 3FUTA 3K92A 1IXRC 3SBJA 1E32A 5FTKA 1QAMA 2EUCA 4GRIA 4M0DA 5JI3E 2Z3XA 2L6OA 1GVNA 2CUZA 1IN7A 2ZAOA 3RE8A 3FTCA 1C1KA 1W5TA 2HCBA 1DGGA 4M9SA 5LMUM 2C9CA 3SAUA 4DV6M 3U6MA 4DR4M 3LQQA 3FUUA 2XF3A 4PDGA 1R7RA 3GQ3A 1IN5A 1KFVA 1SXJA 4LF8M 4JI4M 3DFZA 4JI2M 5IT9S 5IZ7D 1SXJC 4OX9M 1HR0M 3AV0A 1S3SA 3SMSA 2K47A 2LWXA 2QBYA 1HQCA 1UM8A 4AZFA 4Z6YA 4DUYM 1N33M 1G3IA 5EP3A 2UXDM 2FFJA 4GIPA 4ZPXA 1JQJC 3FKEA 4M9XA 2QCUA 3PXGA 2DWMA 1NNUC 3KOXE 2CHQA 4M9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHW C;  1NHG C;  1NNU C;  2NQ8 C;  2FOI C; 
#chains in the Genus database with same CATH topology
 1VDL A;  4DUZ M;  1IN8 A;  1L2D A;  4FD2 A;  2Z4R A;  4MB7 A;  2FS1 A;  3TE6 A;  3UK6 A;  1ZAE A;  4X65 M;  3CGW A;  4RKU F;  3HGI A;  4LY6 A;  1G71 A;  5FSW A;  2L7I A;  1IY0 A;  1OIZ A;  3PNV A;  5ITX A;  3TWM A;  2R65 A;  4IBJ A;  4GEW A;  1R4G A;  3JR5 A;  2GNO A;  3GLF B;  2QZ4 A;  2XSZ A;  4CIZ A;  2LVA A;  3B89 A;  4I8O A;  4DV7 M;  1XXH A;  3FTF A;  1T43 A;  4CGY B;  2R62 A;  1CUK A;  3C58 A;  1Q3B A;  2O01 F;  4R3D A;  1IXZ A;  1TF0 B;  3W0F A;  1IBL M;  2JXN A;  4LGY A;  1HJP A;  2C9O A;  4A3V B;  1K3W A;  2EO2 A;  3AOE A;  3KSX A;  4XGI A;  4YY3 M;  3SYK A;  3WHK A;  2H5X A;  2JZ0 A;  2D7H A;  1OTR A;  1X37 A;  4PDI A;  2DI0 A;  3B7N A;  1HQY E;  1XMO M;  3KOW E;  2DHY A;  5KPZ A;  1ZMU A;  4DR5 M;  4LGM A;  4JI7 M;  2H1R A;  4FCT A;  1G4A E;  3AJI B;  5EP2 A;  2O25 A;  1F4I A;  3AFH A;  4LZZ A;  5L8R F;  1ORY B;  3KOZ E;  2R44 A;  1K82 A;  2HWJ A;  1V33 A;  1OKS A;  4IBG A;  3U6C A;  4LFB M;  1H6U A;  3IEC A;  4OVZ B;  2EKF A;  2Y0Q A;  3NWL A;  4IBD A;  4B7H A;  1WJ7 A;  2L7H A;  1GJT A;  1VDD A;  1WXQ A;  1Z6T A;  2OPF A;  3GPU A;  5DYI A;  4IIW A;  2M5Z A;  1GL6 A;  1YSY A;  2CV0 A;  3J81 S;  1KSF X;  2HHH M;  2Q2E B;  1L2B A;  2HAK A;  1NJF A;  4MM3 B;  1TH4 A;  2CEA A;  1J7K A;  3LVW A;  2WZJ A;  4NOO B;  2UUA M;  3KS8 A;  4DR7 M;  1A5T A;  3A46 A;  1G41 A;  1QZE A;  2YNM D;  3CF2 A;  3L28 A;  1HT1 E;  2Y21 A;  2DAI A;  2QEN A;  3DA1 A;  1PGY A;  4IJF A;  1RU3 A;  1YLA A;  3M6A A;  1QZM A;  3Q8X A;  3RGS A;  4F2L A;  4TUW A;  1E9S A;  3AKZ A;  1K3X A;  2JY7 A;  4FW9 A;  4MGY E;  4BBA A;  4X62 M;  4CIS A;  4AKI A;  1JR3 A;  3GLH A;  1QAQ A;  2OQ4 A;  4DR1 M;  2JY5 A;  3SC3 A;  1GLN A;  3HU2 A;  3FE3 A;  4QHS A;  3QWL A;  5EQT A;  4IBF A;  2JNH A;  4NXM M;  1NHG C;  3KOY E;  1I4W A;  3THG A;  5DYG A;  2XZU A;  1Q02 A;  2B3T A;  1IFY A;  3BOS A;  3U6L A;  1PJQ A;  3GLI E;  2YFQ A;  2AHM A;  2JA2 A;  3HJQ A;  3E46 A;  1N36 M;  4AKG A;  1KYI A;  3M0E A;  2F5Q A;  2KW0 A;  4B3T M;  2F5P A;  3HHX A;  4NRV A;  2JP7 A;  1XMQ M;  5EP4 A;  2KNZ A;  1NNJ A;  3T38 A;  2ZAM A;  2QBY A;  2K9D A;  2UU9 M;  2VF7 A;  4FWG A;  1MN3 A;  5E26 A;  3RFW A;  4LF5 M;  2JUJ A;  4QHT A;  1V92 A;  3GQ5 A;  3ZCB B;  2M60 A;  2QPA A;  3FUV A;  2V1U A;  2DEN A;  2I7P A;  4D82 A;  2BWE A;  1NO1 A;  1TDH A;  2KXE A;  3UMM A;  3VKH A;  3EIE A;  2FE8 A;  4G4N A;  2L2D A;  4DV0 M;  1SXJ B;  3I4V A;  1NVM A;  1L2C A;  4XBO A;  3HX3 A;  4DV2 M;  2MJ5 B;  4UN2 B;  3GLG A;  3U60 B;  1NJG A;  3TPZ A;  1UFZ A;  2DNA A;  4B3M M;  3VKG A;  4LRS A;  2C98 A;  3KFU G;  1L1T A;  5FTN A;  2C5R A;  1HNW M;  2E5L M;  2R18 A;  2V1C A;  2DZO B;  4S12 A;  2ZBK B;  2WSE F;  1NV8 A;  2MH8 A;  4D80 A;  3E4R A;  2F5O A;  3NBI A;  4ITQ A;  3GRV A;  3D8L A;  2BNK A;  2LVP C;  4LF9 M;  1XNR M;  3W67 A;  4D81 A;  3T15 A;  4HEO A;  1L1Z A;  3HHZ A;  4JXJ A;  4PD2 A;  1GKI A;  2Z7J A;  3VDP A;  1JR3 E;  2Y0T A;  2QQ8 A;  2XZF A;  4PCZ A;  2J7N A;  4P17 A;  2UUB M;  1JR3 D;  2QSF X;  3TQS A;  2F5N A;  3I01 M;  4JI6 M;  2DZN B;  4NRW A;  5DFL A;  1E94 E;  4P16 A;  4JI1 M;  3SHF A;  4BLC A;  2DAG A;  2FH0 A;  1JB0 F;  1J09 A;  4XK8 F;  3GRR A;  2Y20 A;  2J7O A;  2CFO A;  1QAN A;  1OIP A;  3AOG A;  3GLI A;  3D8B A;  3K1J A;  3B74 A;  3C3E A;  1QDT A;  2KNV A;  2KRK A;  3HU1 A;  3SAT A;  1D0K A;  4KO8 A;  1D2N A;  3SAS A;  1IQP A;  3GLF E;  2VF8 A;  4RF1 A;  1NY5 A;  4MH0 E;  4L4U A;  8CAT A;  4LJ8 A;  3HWS A;  2LHC A;  1PJT A;  2EA0 A;  2XFT A;  2ZAN A;  3LMM A;  3DOA A;  3GPX A;  3U6D A;  3V76 A;  1QUS A;  3TWK A;  2EJS A;  2LNH C;  4AW4 A;  3HHW A;  3L29 A;  3SMP A;  2UUC M;  1QVR A;  1WR1 B;  3W68 A;  4B3S M;  4LRT A;  4DV5 M;  3HHY A;  3GLG E;  5JI2 E;  3J80 S;  1TR8 A;  1YUB A;  2CRU A;  4OW0 A;  1VQ1 A;  1Y8G A;  3LQR A;  3ILK A;  3VLF B;  1YE9 A;  5EXT A;  2D7E A;  4Q7J A;  3U6O A;  4HLQ A;  2O5R A;  2KZU A;  2JY8 A;  4LFA M;  1MJG M;  2V6Z M;  3FUX A;  4AG6 A;  1TDZ A;  2R4J A;  5IWA M;  3SAW A;  4I81 A;  1DO0 A;  4QNM A;  1XC8 A;  2G5G X;  3GQ4 A;  1EFU B;  5FTM A;  4GHL A;  4FVM A;  3JR4 A;  3FTE A;  1TH3 A;  3IG8 A;  2L09 A;  4II7 A;  3U6S A;  2UXB M;  2DXI A;  2DVW B;  1IXS B;  1GL7 A;  2N35 A;  4KLN A;  2BJV A;  4QNR A;  3GO8 A;  4CJ6 A;  1PM5 A;  4M0W A;  5GKN A;  4FCV A;  1D0M A;  2R0I A;  3IHP A;  5ITQ A;  3GLH E;  1HNZ M;  2KEB A;  3R9X B;  4G3O A;  1PJS A;  1Q39 A;  2CP8 A;  1IY2 A;  4JI5 M;  4KOD A;  2D7G A;  2APL A;  1DGF A;  1FNN A;  3KP0 E;  2KHH A;  3MJ5 A;  5ITX E;  4DR2 M;  5ITT A;  2DKL A;  1DO2 A;  3U6P A;  5ITU A;  3MMP A;  4F1I A;  3A42 A;  5EXX A;  5KO3 A;  3GLG B;  3M7G A;  3RGP A;  4DV3 M;  3VK8 A;  4GC9 A;  1EIJ A;  4LCB A;  1N77 A;  1VEK A;  1OFH A;  1WGL A;  1XNQ M;  2C96 A;  5EJC A;  1IM2 A;  2HKJ A;  5KQD A;  4G4O A;  2BJW A;  3U60 A;  2F4V M;  3HJ8 A;  3NBX X;  3T1Y M;  4BB9 A;  2YQZ A;  2ZM6 M;  2R4E A;  4Y28 F;  2QBY B;  4IBI A;  3GRY A;  3EIH A;  1NSF A;  3KP1 E;  2BWB A;  1Z59 A;  2Z8Y M;  3KS4 A;  4GIT A;  1ZQ9 A;  5E6J A;  5KPR A;  3UGJ A;  1VEG A;  2RGH A;  1W5S A;  3B7Z A;  4NC6 A;  3U6Q A;  3KXE C;  1V34 A;  3L25 A;  4IBB A;  4X64 M;  2GQF A;  5BR8 M;  4DV1 M;  2P5T A;  2KDL A;  1XXH E;  3C9P A;  2DAK A;  4K0K M;  4GKJ M;  4YHH M;  3CF6 E;  1NV9 A;  4G6Z A;  1ZMW A;  2HL7 A;  1PRB A;  5FTJ A;  5C1B A;  4AG5 A;  1MU5 A;  2ERC A;  4GH9 A;  5LMN M;  3VK7 A;  2L4F A;  1LTM A;  1R6B X;  2LVO C;  3HKP A;  3Q8G A;  2W82 A;  3KSJ A;  2JWS A;  2DHR A;  4OVZ A;  2LBC A;  4OU7 A;  1GAB A;  3ZQJ A;  1HT2 E;  3FD9 A;  4EIW A;  2X8A A;  2X4A A;  1TH2 A;  3OTO M;  3AOE C;  4LF4 M;  2RRU A;  1XXH B;  3UZU A;  2I7N A;  3AL0 C;  3L26 A;  4DR6 M;  1HNX M;  3K9O A;  1XB2 B;  3MK6 A;  4G4Q A;  1MX0 A;  2X49 A;  3U61 A;  3PFI A;  3FYD A;  3I4Y A;  2LTU A;  3L2A A;  1PJI A;  4QOS A;  3U6E A;  2CHV A;  2MR9 A;  5KQ8 A;  4NSR A;  4G4R A;  2XEP A;  1IBK M;  1OQY A;  4LFC M;  4JI8 M;  1LV7 A;  2YR0 A;  1QAO A;  2C99 A;  1DGH B;  4B7G A;  3U5Z B;  4Z8X A;  4QOZ C;  4FWH A;  3SYL A;  3L27 A;  1Q3C A;  5A2Q S;  1AUA A;  3J27 B;  4AKH A;  2CWB A;  2VDB B;  4L78 A;  4L8R C;  4RF0 A;  1VG5 A;  2R46 A;  3PVS A;  1ZV1 A;  3C3D A;  1R2Y A;  4LJ5 A;  3WHL A;  4IBK A;  3FUW A;  3SAR A;  4LG2 A;  4KHP M;  1NHW C;  2G8L A;  2WSC F;  3A98 B;  3KDS E;  3SHG B;  5FLX S;  2VII A;  4GKK M;  4PT5 A;  5FTL A;  1Z5B A;  4NSO B;  2KNA A;  2QNJ A;  2RGO A;  1XHB A;  3HY5 A;  1Z5A A;  2FNA A;  1D0L A;  2L4E A;  3GRU A;  4GC5 A;  4W5W A;  1GO5 A;  4MGH A;  3UJN A;  1R2Z A;  3LCV B;  1J5E M;  1XWI A;  4DR3 M;  1DGB A;  1T6O A;  2DWL A;  2LVN C;  2KRU A;  1Z5C A;  3HZJ A;  4R7G A;  4IJE A;  4NL4 H;  3R8F A;  3E21 A;  4MGZ E;  3GPY A;  3K8Z A;  2CHG A;  4B08 A;  2XGN A;  1DV0 A;  4JYA M;  2R45 A;  1G8P A;  5ITY A;  2VQE M;  2OOB A;  2LHG A;  4L15 A;  5H37 D;  4LF7 M;  3J2P B;  4FCW A;  2FOI C;  3HU3 A;  4REZ A;  3GPP A;  5BPV A;  5KPT A;  3VFD A;  3KVW A;  3DZD A;  2KZS A;  2OOA A;  1IN4 A;  2LXE A;  5EXP A;  4NXN M;  2JZ1 A;  2J5Y A;  3FTD A;  3A45 A;  3QYE A;  2UXC M;  2CE7 A;  4RNA A;  4AQY M;  4WW0 A;  4LJA A;  2DAM A;  2NQ8 C;  5DNY A;  4DBG B;  3E9S A;  3BXW A;  4HL4 A;  1TGU A;  2K0B X;  1N75 A;  2F5S A;  1ZMV A;  4I4L A;  2G3Q A;  2XSZ D;  3FRH A;  4LF6 M;  2XLJ A;  1EE8 A;  5C18 A;  1N32 M;  4CHT B;  4LJ9 A;  4B3R M;  3GP1 A;  3I51 A;  4MGI E;  4LJ7 A;  4IBE A;  3JAM S;  2DWN A;  1P3Q Q;  3T1H M;  3J7A S;  4LJ6 A;  4AI6 A;  3FYC A;  2JY6 B;  1I94 M;  3J7B A;  2ZTC A;  5EXS A;  3ZC7 B;  1N78 A;  1SG9 A;  1IY1 A;  3SFZ A;  3TL4 X;  1IBM M;  1DGH A;  3U5Z A;  5F3W A;  4WP2 A;  4JV5 M;  2DWZ B;  2XH9 A;  1SXJ E;  2A5Y B;  3QAU A;  5EP1 A;  4WUR A;  3GLH B;  2LH0 A;  2MRO B;  2RKO A;  1QUT A;  1AIP C;  3K2L A;  2DZL A;  4L16 A;  1FJG M;  3W0L B;  1C7Y A;  2MGW A;  3IG5 A;  2LVQ D;  1PJJ A;  2K6B A;  4GMQ A;  3TWL A;  1N34 M;  3U61 B;  1QDR A;  1OAO C;  2CV2 A;  2EKK A;  4KT0 F;  4I5S A;  4JN6 A;  4MGK E;  3KW6 A;  1OFI A;  4LZJ A;  3F92 A;  1R5L A;  3B9P A;  1E9R A;  1TTE A;  4FWD A;  1SXJ D;  3PNY A;  1IN6 A;  3CF0 A;  3T6P A;  1WHC A;  1QQW A;  1L8Q A;  4LJ4 A;  4JI3 M;  3VDU A;  3SAV A;  4GHA A;  3BBZ A;  3H4M A;  3LCU A;  3MHV C;  3GLI B;  3HJS A;  3LW5 F;  2ZTD A;  2DAE A;  5IRE B;  1OAI A;  4X66 M;  4B7F A;  2Z4S A;  2QP9 X;  2KA6 B;  1NY6 A;  4JI0 M;  3I04 M;  1OJL A;  4IBC A;  3LVV A;  3GLF A;  4L6V 6;  7CAT A;  4R71 A;  2XFS A;  2CV1 A;  1QYR A;  3CTW B;  5ITR A;  2WSF F;  1T3T A;  1WIV A;  1G59 A;  2VQF M;  3ZH9 B;  4DV4 M;  1VEJ A;  3FUT A;  3K92 A;  1IXR C;  1GJS A;  3K9P A;  1E32 A;  3SBJ A;  5FTK A;  1QAM A;  2EUC A;  4GRI A;  3FRI A;  2OO9 A;  4M0D A;  5JI3 E;  2Z3X A;  2L6O A;  1GVN A;  2CUZ A;  1IN7 A;  2ZAO A;  3RE8 A;  3FTC A;  1C1K A;  1W5T A;  2HCB A;  1DGG A;  4M9S A;  5LMU M;  2C9C A;  3SAU A;  4DV6 M;  3U6M A;  4DR4 M;  3LQQ A;  3FUU A;  2XF3 A;  4PDG A;  1R7R A;  3GQ3 A;  1IN5 A;  1KFV A;  1SXJ A;  4LF8 M;  3B7Q A;  4JI4 M;  3DFZ A;  3QYB A;  4JI2 M;  1WGN A;  5IT9 S;  2QHO B;  5IZ7 D;  1SXJ C;  4OX9 M;  1HR0 M;  3AV0 A;  3H4J A;  1S3S A;  3SMS A;  2K47 A;  2LWX A;  2R6F A;  1HQC A;  1UM8 A;  4AZF A;  4Z6Y A;  4DUY M;  1N33 M;  1G3I A;  5EP3 A;  2UXD M;  2FFJ A;  4GIP A;  4ZPX A;  1IXS A;  1JQJ C;  1BVS A;  3FKE A;  4M9X A;  2QCU A;  3PXG A;  2DWM A;  4ANR A;  1NNU C;  3KOX E;  2CHQ A;  4M9Z A; 
#chains in the Genus database with same CATH homology
 4DUZ M;  1IN8 A;  1L2D A;  4FD2 A;  2Z4R A;  4MB7 A;  3TE6 A;  3UK6 A;  1ZAE A;  4X65 M;  3HGI A;  4LY6 A;  5FSW A;  2L7I A;  1IY0 A;  3PNV A;  5ITX A;  3TWM A;  2R65 A;  4IBJ A;  3JR5 A;  3GLF B;  2QZ4 A;  2XSZ A;  4I8O A;  4DV7 M;  1XXH A;  3FTF A;  4CGY B;  2R62 A;  3C58 A;  1Q3B A;  4R3D A;  1IXZ A;  3W0F A;  1IBL M;  4LGY A;  2C9O A;  4A3V B;  1K3W A;  2EO2 A;  3AOE A;  3KSX A;  4XGI A;  4YY3 M;  3SYK A;  3WHK A;  2D7H A;  1X37 A;  4PDI A;  1XMO M;  1HQY E;  3KOW E;  5KPZ A;  4DR5 M;  4LGM A;  4JI7 M;  4FCT A;  2H1R A;  1G4A E;  3AJI B;  5EP2 A;  3AFH A;  4LZZ A;  1ORY B;  3KOZ E;  1K82 A;  4IBG A;  3U6C A;  4LFB M;  1H6U A;  4OVZ B;  2Y0Q A;  3NWL A;  4IBD A;  4B7H A;  2L7H A;  1VDD A;  1WXQ A;  1Z6T A;  2OPF A;  3GPU A;  5DYI A;  4IIW A;  2M5Z A;  1GL6 A;  1YSY A;  2CV0 A;  3J81 S;  1KSF X;  2HHH M;  2Q2E B;  1L2B A;  1NJF A;  4MM3 B;  1TH4 A;  2CEA A;  1J7K A;  3LVW A;  4NOO B;  4DR7 M;  2UUA M;  3KS8 A;  3A46 A;  1G41 A;  2YNM D;  3CF2 A;  3L28 A;  1HT1 E;  2Y21 A;  2QEN A;  3DA1 A;  4IJF A;  3M6A A;  1QZM A;  3Q8X A;  3RGS A;  4TUW A;  1E9S A;  3AKZ A;  1K3X A;  4FW9 A;  4MGY E;  4BBA A;  4X62 M;  4AKI A;  1JR3 A;  3GLH A;  1QAQ A;  2OQ4 A;  4DR1 M;  3SC3 A;  1GLN A;  3HU2 A;  4QHS A;  3QWL A;  5EQT A;  4IBF A;  4NXM M;  1NHG C;  3KOY E;  1I4W A;  3THG A;  5DYG A;  2XZU A;  3BOS A;  3U6L A;  2YFQ A;  2AHM A;  2JA2 A;  3HJQ A;  1N36 M;  4AKG A;  1KYI A;  3M0E A;  2F5Q A;  2KW0 A;  4B3T M;  2F5P A;  3HHX A;  4NRV A;  1NNJ A;  1XMQ M;  5EP4 A;  3T38 A;  2ZAM A;  2UU9 M;  5E26 A;  4FWG A;  3RFW A;  4LF5 M;  4QHT A;  3GQ5 A;  3ZCB B;  2M60 A;  2QPA A;  3FUV A;  2V1U A;  2I7P A;  3VKH A;  4D82 A;  2KXE A;  1TDH A;  3UMM A;  3EIE A;  2FE8 A;  4G4N A;  4DV0 M;  1SXJ B;  3I4V A;  1NVM A;  1L2C A;  4XBO A;  4DV2 M;  3GLG A;  3U60 B;  1NJG A;  3TPZ A;  4B3M M;  3VKG A;  4LRS A;  2C98 A;  3KFU G;  1L1T A;  5FTN A;  2C5R A;  1HNW M;  2E5L M;  2R18 A;  2V1C A;  2DZO B;  4S12 A;  2ZBK B;  4D80 A;  3E4R A;  2F5O A;  3NBI A;  4ITQ A;  3GRV A;  3D8L A;  2BNK A;  4LF9 M;  1XNR M;  4D81 A;  3T15 A;  1L1Z A;  3HHZ A;  4JXJ A;  4PD2 A;  1GKI A;  2Z7J A;  3VDP A;  2Y0T A;  2XZF A;  4PCZ A;  2J7N A;  4JI6 M;  2UUB M;  1JR3 D;  2F5N A;  3TQS A;  2DZN B;  4NRW A;  1E94 E;  4P16 A;  4JI1 M;  3SHF A;  4BLC A;  1J09 A;  3GRR A;  2Y20 A;  2J7O A;  2CFO A;  1QAN A;  3AOG A;  3GLI A;  3D8B A;  3K1J A;  2KRK A;  3HU1 A;  3SAT A;  4KO8 A;  1D2N A;  3SAS A;  1IQP A;  4RF1 A;  1NY5 A;  4MH0 E;  4L4U A;  8CAT A;  4LJ8 A;  3HWS A;  2EA0 A;  2XFT A;  2ZAN A;  3LMM A;  3DOA A;  3GPX A;  3U6D A;  3TWK A;  2LNH C;  4AW4 A;  3HHW A;  3L29 A;  3SMP A;  2UUC M;  1QVR A;  4B3S M;  4LRT A;  4DV5 M;  3HHY A;  5JI2 E;  3J80 S;  1YUB A;  4OW0 A;  3LQR A;  3ILK A;  3VLF B;  1YE9 A;  5EXT A;  2D7E A;  3U6O A;  4HLQ A;  2O5R A;  2KZU A;  4LFA M;  2V6Z M;  3FUX A;  4AG6 A;  1TDZ A;  2R4J A;  5IWA M;  3SAW A;  4I81 A;  1DO0 A;  4QNM A;  1XC8 A;  2G5G X;  3GQ4 A;  5FTM A;  4GHL A;  4FVM A;  3JR4 A;  3FTE A;  1TH3 A;  3IG8 A;  2L09 A;  4II7 A;  3U6S A;  2UXB M;  2DXI A;  2DVW B;  1IXS B;  1GL7 A;  4KLN A;  2BJV A;  4QNR A;  3GO8 A;  1PM5 A;  4M0W A;  5GKN A;  4FCV A;  5ITQ A;  1HNZ M;  2KEB A;  3R9X B;  1Q39 A;  1IY2 A;  4JI5 M;  4KOD A;  2D7G A;  1DGF A;  3KP0 E;  3MJ5 A;  1FNN A;  5ITX E;  4DR2 M;  5ITT A;  1DO2 A;  3U6P A;  5ITU A;  3GLG B;  3U60 A;  3A42 A;  5EXX A;  5KO3 A;  4DV3 M;  3M7G A;  3RGP A;  3VK8 A;  4GC9 A;  4LCB A;  1N77 A;  1OFH A;  1XNQ M;  2C96 A;  5EJC A;  1IM2 A;  2HKJ A;  5KQD A;  4G4O A;  2BJW A;  2F4V M;  3HJ8 A;  3T1Y M;  4BB9 A;  2YQZ A;  2ZM6 M;  2R4E A;  2QBY B;  4IBI A;  3GRY A;  3EIH A;  1NSF A;  3KP1 E;  3KS4 A;  1Z59 A;  4GIT A;  5E6J A;  5KPR A;  1ZQ9 A;  3UGJ A;  4CIS A;  2RGH A;  1W5S A;  3U6Q A;  3L25 A;  3KXE C;  4IBB A;  4X64 M;  5BR8 M;  4DV1 M;  2P5T A;  4GKJ M;  4K0K M;  4YHH M;  3CF6 E;  4G6Z A;  2HL7 A;  5FTJ A;  5C1B A;  4AG5 A;  4GH9 A;  1MU5 A;  2ERC A;  5LMN M;  3VK7 A;  1R6B X;  3HKP A;  2W82 A;  3KSJ A;  2DHR A;  4OVZ A;  4OU7 A;  1HT2 E;  3FD9 A;  4EIW A;  2X8A A;  2X4A A;  1TH2 A;  3OTO M;  3AOE C;  4LF4 M;  3AL0 C;  1XXH B;  3UZU A;  2I7N A;  3L26 A;  4DR6 M;  1HNX M;  3MK6 A;  4G4Q A;  1MX0 A;  2X49 A;  3U61 A;  3PFI A;  3FYD A;  3I4Y A;  3L2A A;  1PJI A;  4QOS A;  3U6E A;  2CHV A;  5KQ8 A;  4NSR A;  4G4R A;  2XEP A;  1IBK M;  4LFC M;  4JI8 M;  1LV7 A;  2YR0 A;  1QAO A;  2C99 A;  1DGH B;  4B7G A;  3U5Z B;  4Z8X A;  4QOZ C;  4FWH A;  3SYL A;  3L27 A;  1Q3C A;  5A2Q S;  3J27 B;  4AKH A;  4L78 A;  4L8R C;  4RF0 A;  2R46 A;  3PVS A;  1R2Y A;  4LJ5 A;  3WHL A;  4IBK A;  3FUW A;  3SAR A;  4LG2 A;  4KHP M;  1NHW C;  3KDS E;  2G8L A;  3A98 B;  3SHG B;  5FLX S;  2VII A;  4GKK M;  4PT5 A;  5FTL A;  1Z5B A;  4NSO B;  2RGO A;  1XHB A;  1Z5A A;  2FNA A;  3GRU A;  4GC5 A;  4W5W A;  4MGH A;  3UJN A;  1R2Z A;  1J5E M;  1XWI A;  4DR3 M;  1DGB A;  2DWL A;  2KRU A;  1Z5C A;  4R7G A;  4IJE A;  4NL4 H;  3R8F A;  4MGZ E;  3GPY A;  3K8Z A;  2CHG A;  4B08 A;  2XGN A;  4JYA M;  2R45 A;  1G8P A;  5ITY A;  2VQE M;  5H37 D;  4L15 A;  4LF7 M;  3J2P B;  4FCW A;  2FOI C;  3HU3 A;  4REZ A;  3GPP A;  5BPV A;  5KPT A;  3VFD A;  3KVW A;  3DZD A;  2KZS A;  1IN4 A;  2LXE A;  5EXP A;  4NXN M;  3FTD A;  3A45 A;  2UXC M;  2CE7 A;  4RNA A;  4AQY M;  4WW0 A;  4LJA A;  2NQ8 C;  5DNY A;  3E9S A;  4HL4 A;  1TGU A;  1N75 A;  2F5S A;  4I4L A;  2XSZ D;  4LF6 M;  2XLJ A;  1EE8 A;  5C18 A;  1N32 M;  4CHT B;  4LJ9 A;  4B3R M;  3GP1 A;  3I51 A;  4MGI E;  4LJ7 A;  4IBE A;  3JAM S;  2DWN A;  3T1H M;  4AI6 A;  3J7A S;  4LJ6 A;  3FYC A;  1I94 M;  3J7B A;  5EXS A;  3ZC7 B;  1N78 A;  1IY1 A;  3SFZ A;  3TL4 X;  1IBM M;  1DGH A;  3U5Z A;  5F3W A;  4JV5 M;  2DWZ B;  2XH9 A;  1SXJ E;  2A5Y B;  3QAU A;  5EP1 A;  4WUR A;  3GLH B;  2LH0 A;  2RKO A;  3K2L A;  4L16 A;  1FJG M;  3W0L B;  3IG5 A;  1PJJ A;  4GMQ A;  3TWL A;  1N34 M;  3U61 B;  2CV2 A;  4I5S A;  4JN6 A;  4MGK E;  3KW6 A;  1OFI A;  4LZJ A;  3B9P A;  1E9R A;  4FWD A;  1SXJ D;  3PNY A;  1IN6 A;  3CF0 A;  3SAV A;  1QQW A;  1L8Q A;  4LJ4 A;  4JI3 M;  3VDU A;  4GHA A;  3MHV C;  3H4M A;  3GLI B;  3HJS A;  5IRE B;  4X66 M;  4B7F A;  2Z4S A;  2QP9 X;  2KA6 B;  1NY6 A;  4JI0 M;  1OJL A;  4IBC A;  3LVV A;  3GLF A;  7CAT A;  2XFS A;  2CV1 A;  1QYR A;  3CTW B;  5ITR A;  1T3T A;  1G59 A;  2VQF M;  3ZH9 B;  4DV4 M;  3FUT A;  3K92 A;  1IXR C;  3SBJ A;  1E32 A;  5FTK A;  1QAM A;  2EUC A;  4GRI A;  4M0D A;  5JI3 E;  2Z3X A;  2L6O A;  1GVN A;  2CUZ A;  1IN7 A;  2ZAO A;  3RE8 A;  3FTC A;  1C1K A;  1W5T A;  2HCB A;  1DGG A;  4M9S A;  5LMU M;  2C9C A;  3SAU A;  4DV6 M;  3U6M A;  4DR4 M;  3LQQ A;  3FUU A;  2XF3 A;  4PDG A;  1R7R A;  3GQ3 A;  1IN5 A;  1KFV A;  1SXJ A;  4LF8 M;  4JI4 M;  3DFZ A;  4JI2 M;  5IT9 S;  5IZ7 D;  1SXJ C;  4OX9 M;  1HR0 M;  3AV0 A;  1S3S A;  3SMS A;  2K47 A;  2LWX A;  2QBY A;  1HQC A;  1UM8 A;  4AZF A;  4Z6Y A;  4DUY M;  1N33 M;  1G3I A;  5EP3 A;  2UXD M;  2FFJ A;  4GIP A;  4ZPX A;  1JQJ C;  3FKE A;  4M9X A;  2QCU A;  3PXG A;  2DWM A;  1NNU C;  3KOX E;  2CHQ A;  4M9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...