2NQ8C

Malarial enoyl acyl acp reductase bound with inh-nad adduct
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Enoyl-acyl carrier reductase
publication title X-ray structural analysis of Plasmodium falciparum enoyl acyl carrier protein reductase as a pathway toward the optimization of triclosan antimalarial efficacy
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 15
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2nq8C00
2NQ8C 2FOIC 1NHWC 1NHGC 1NNUC
chains in the Genus database with same CATH superfamily
4GKJM 2V6ZM 2YR0A 1OIZA 1IN5A 3J80S 3I51A 3KP1E 1IXRC 1XXHE 3J7BA 3U6DA 1OKSA 1NNJA 1Q3BA 1V33A 3VK7A 1PJIA 4MGKE 2C98A 1SXJE 2DZLA 4LGYA 3U6CA 2W82A 2O01F 2H1RA 3M6AA 1NHGC 2D7EA 2KNZA 4JI3M 5DNYA 4RF1A 4MGHA 2Z8YM 5LMNM 3QYEA 2XEPA 4XK8F 3B9PA 3SMSA 4LG2A 3L27A 4M9SA 1H6UA 2KRKA 5EXTA 4PCZA 1G3IA 1TH3A 3UGJA 3SBJA 1JR3A 4DR5M 4OVZA 2QBYB 2LWXA 2DNAA 4L78A 3HY5A 3IHPA 2L7HA 2M5ZA 2CV0A 3UJNA 4GHAA 3AL0C 3CGWA 2VF7A 4DUYM 4M0WA 3W68A 2HAKA 2WSEF 4RKUF 3LW5F 2R45A 4BBAA 1IFYA 2KHHA 3SMPA 3RGPA 3K92A 2D7GA 3RFWA 4LGMA 2MH8A 5FTMA 1D0KA 5KPZA 2LTUA 1OQYA 1PJJA 3KSXA 4GKKM 4ANRA 1E9SA 2R6FA 2C9OA 1MJGM 3I4YA 3FD9A 3KP0E 5FTNA 3GPUA 3SAUA 1TF0B 4LRSA 1OFIA 2BWEA 1ZMVA 4Y28F 3SAWA 3FKEA 2X4AA 5LMUM 1AUAA 1T6OA 2MR9A 1TTEA 3B7ZA 1GVNA 2K0BX 3AJIB 1VDLA 1LV7A 1TH2A 4R71A 3CTWB 4DR1M 4JXJA 3GP1A 2XLJA 4LJAA 3VFDA 3M7GA 3J7AS 3UZUA 4DV5M 5FTKA 3SARA 3PXGA 2YFQA 4CJ6A 4JI0M 2VIIA 2OOBA 3KS4A 3GPYA 3FUWA 1Z6TA 4GIPA 1L1TA 2R46A 4LJ6A 1JQJC 1TR8A 1SXJA 1HT1E 2FOIC 5ITXE 1IM2A 3R8FA 2I7NA 2R4EA 3RGSA 3BBZA 1W5SA 2XH9A 4GITA 3K2LA 3B7QA 2C96A 4FCVA 2RKOA 3I04M 3A46A 1L1ZA 3GRRA 3KXEC 3U6QA 2D7HA 2CE7A 5EP4A 4K0KM 5IWAM 2FS1A 4NXNM 1GL7A 1DGFA 3LVVA 4JI7M 1QDRA 2ZBKB 5EXXA 3U61B 1DO0A 5IZ7D 4PD2A 4B7GA 1L2BA 1F4IA 2ZANA 3ZH9B 2L2DA 2CV2A 2XFTA 4HEOA 4I4LA 3JAMS 5DYIA 2F4VM 2Z7JA 3H4MA 1I94M 1DV0A 2KZUA 2F5PA 1EIJA 3JR4A 1UM8A 3GRUA 2QP9X 4LFCM 2K9DA 4QHTA 1HT2E 1IY0A 3TWLA 4M9XA 1IBMM 1W5TA 2EJSA 1SXJC 4NOOB 2EUCA 2XZUA 4OW0A 3L25A 3Q8GA 2LVPC 4AZFA 3FRIA 1VEJA 3FYDA 1R2YA 1WIVA 1IY2A 1JR3D 1XWIA 1ZAEA 2QBYA 2DXIA 4ZPXA 3D8BA 2CEAA 4KODA 5L8RF 1EFUB 1XXHB 2KNAA 2P5TA 4M0DA 1G8PA 4B7FA 4KO8A 4B7HA 3AFHA 2DAKA 1PGYA 2JY8A 5DYGA 2DVWB 1XB2B 3HHZA 2Z4RA 1X37A 2C99A 1AIPC 4L8RC 1NVMA 4MGZE 1HQCA 1YSYA 4DV1M 1Z59A 1XHBA 3C9PA 2BJVA 4LJ7A 2ZAOA 4QOZC 2JP7A 2KW0A 2DHRA 2FNAA 3I01M 3KOZE 4BLCA 4FWDA 3FYCA 3FUUA 2RGOA 1NV8A 4FCWA 4DR2M 2LVAA 4M9ZA 4G4QA 2J7NA 1GL6A 1GKIA 3IG8A 2XGNA 3HHXA 7CATA 2DAGA 4GHLA 1HNXM 1WGLA 2GNOA 1WHCA 4W5WA 5FLXS 3VKGA 2XF3A 3PNYA 2H5XA 3U6OA 1N77A 3T1HM 3FTEA 1Z5CA 2QCUA 1Q3CA 4MB7A 4A3VB 1YE9A 3HJSA 1GLNA 4LZJA 1IXZA 1SXJD 4D81A 4X62M 4B08A 3TWKA 4YHHM 3U60B 3CF0A 3TWMA 3E46A 2HL7A 4JN6A 2L6OA 2QQ8A 2MGWA 1IN4A 2JUJA 4NSOB 2DWZB 3RE8A 3GLFB 2LHCA 2V1CA 4LJ4A 1N34M 1G4AE 3KW6A 2JY6B 4BB9A 4AQYM 4AW4A 4CGYB 1PRBA 3LCVB 2ZM6M 4JV5M 4AI6A 3U61A 1NY5A 2ERCA 3I4VA 2O25A 2CP8A 3HZJA 4IBCA 3ILKA 3TL4X 3L26A 2DAEA 4D80A 4JI1M 4G3OA 1KYIA 1OJLA 3U6LA 2QENA 3H4JA 3KOXE 1E94E 1VQ1A 3DFZA 3E4RA 3Q8XA 3GQ4A 4KHPM 4AKGA 1UFZA 3KS8A 3FUXA 1D2NA 1I4WA 4FCTA 3GLFE 3C58A 3E21A 3VDUA 1C1KA 4GRIA 4LF8M 2JA2A 4LJ5A 3IECA 1OAIA 1WJ7A 4LZZA 2DWNA 1OFHA 3T38A 3E9SA 1DO2A 3U6EA 4GH9A 1J5EM 1V34A 1IQPA 3C3EA 2HHHM 4IIWA 4LJ9A 2X8AA 1QAQA 1XXHA 1WXQA 2KZSA 2XSZA 5IT9S 5ITRA 4Z8XA 5KPTA 2CV1A 1VEKA 2UUBM 4IBGA 4WW0A 2YQZA 4I81A 5JI2E 3EIHA 2ZTDA 4HL4A 2J5YA 3NBIA 2HKJA 3AV0A 2FFJA 5DFLA 2KDLA 3HHYA 3ZQJA 5JI3E 2LVNC 4R7GA 2YNMD 2L4EA 4MH0E 4P17A 2JWSA 2DWMA 2KEBA 3NBXX 4II7A 2AHMA 1E32A 3QWLA 1GABA 2CHQA 2LBCA 1XMOM 2G3QA 1A5TA 3MMPA 2G8LA 1Q02A 1V92A 1WGNA 3HU3A 3TE6A 1G59A 2JXNA 1L2DA 3KVWA 4R3DA 1E9RA 4DV3M 1PM5A 1N33M 3GLIE 1GJSA 2LXEA 4MGYE 3WHKA 2K6BA 2F5QA 4DV6M 1QQWA 2FH0A 5E26A 1CUKA 3J27B 1RU3A 4G6ZA 4REZA 1QAMA 1Y8GA 2R62A 3NWLA 2QNJA 3GQ5A 1IBKM 4B3SM 4JI6M 1XNRM 5EXPA 3ZC7B 2HWJA 3FUTA 4IBFA 4LJ8A 4B3TM 4LFAM 1ZMUA 4B3RM 4G4NA 2APLA 1NO1A 2UXDM 2DI0A 1EE8A 2N35A 1IY1A 1NNUC 5C18A 3K1JA 3V76A 1KSFX 5EP1A 3PNVA 2A5YB 1ZV1A 4DR4M 4RNAA 1XNQM 3FE3A 2OPFA 1R6BX 2UUAM 5BR8M 1IN8A 3U60A 2QZ4A 2NQ8C 3LVWA 5EXSA 4LFBM 4DR7M 3SC3A 2CFOA 1MU5A 2VDBB 2C9CA 3QAUA 5KQ8A 3GLFA 4XGIA 1K3WA 2KNVA 1JR3E 4QNMA 2UU9M 3A45A 3IG5A 1DGHB 2DENA 2FE8A 2BNKA 3MK6A 1N75A 4GEWA 4LRTA 3DZDA 1K3XA 3B89A 3W67A 1VG5A 5A2QS 4JI2M 1ZQ9A 3HJQA 2RRUA 3GRVA 1IBLM 3GLGB 4WP2A 2VQFM 5IREB 4ITQA 1QVRA 1NHWC 4GMQA 1XMQM 5ITYA 4AKIA 5EQTA 1DGGA 2MJ5B 3T1YM 3GLHB 3C3DA 1VEGA 3KOWE 5KPRA 4DV0M 3OTOM 4LF5M 1OTRA 1PJQA 5ITXA 2Y20A 4NSRA 1IN6A 2JNHA 1N36M 1KFVA 1OIPA 2QPAA 2WZJA 5FTLA 1ORYB 2C5RA 2O5RA 1K82A 1TGUA 1S3SA 1GJTA 4QNRA 2R18A 3SHFA 3AOEA 4NRVA 1D0LA 1HR0M 3L28A 3TPZA 2QHOB 1QUTA 2R4JA 4FW9A 3GLGE 3GLIA 1GO5A 3VKHA 1QUSA 5FTJA 3L2AA 4RF0A 3THGA 3GLHE 2MROB 4IBDA 4IJEA 2Z4SA 4LF7M 5EP3A 4X65M 3U6SA 3HJ8A 3A42A 1N32M 4EIWA 3CF6E 3L29A 1TH4A 4FWHA 2DWLA 3JR5A 1R5LA 4CISA 1Q39A 2L4FA 3SYKA 1NSFA 4G4RA 1LTMA 4JI4M 5EP2A 1FNNA 2JZ1A 4MM3B 8CATA 2DZNB 4QOSA 3FTFA 4L6V6 1J09A 2CWBA 4S12A 4Z6YA 1L2CA 3B7NA 2BJWA 2DHYA 2R44A 4OX9M 3FRHA 1R2ZA 4IBKA 2ZTCA 2X49A 3KDSE 3K9PA 4LF6M 2LNHC 2CUZA 1MX0A 4L15A 3TQSA 4YY3M 3HU1A 4FD2A 3KFUG 3T6PA 2EKFA 3U5ZB 3A98B 2Y21A 4DV4M 3AOEC 2Y0QA 1IN7A 2DAIA 2L7IA 3U6PA 3DA1A 4DR3M 3GPXA 1IXSB 2CHVA 1T43A 1HJPA 3WHLA 1QDTA 2Y0TA 2WSFF 1QYRA 3HU2A 1SG9A 3SFZA 2E5LM 3CF2A 4DV7M 2Q2EB 4AG6A 4I8OA 2VF8A 3AKZA 4JYAM 3HWSA 3BOSA 1NJFA 2HCBA 4MGIE 5EJCA 2UXBM 5F3WA 3GPPA 1YLAA 1PJSA 3VDPA 2V1UA 3M0EA 3SASA 3QYBA 1G41A 4IBEA 4P16A 1NV9A 2CRUA 3GLIB 4LF9M 3R9XB 2I7PA 2KA6B 3HHWA 4PDGA 1NY6A 2B3TA 4KT0F 4G4OA 1DGHA 4IBBA 4DR6M 2DKLA 1Z5AA 3PVSA 4FWGA 3W0FA 5KQDA 2K47A 4PT5A 3HGIA 3DOAA 2QSFX 2Z3XA 5GKNA 3GLGA 3SAVA 4GC9A 2GQFA 1XC8A 3J81S 1VDDA 2J7OA 3LMMA 1HNZM 3AOGA 2ZAMA 4IBJA 4LF4M 2F5SA 4NL4H 3W0LB 1NJGA 2JY7A 3GLHA 2LVOC 3SHGB 2KRUA 4NXMM 1TDZA 4TUWA 5ITQA 2OO9A 4IJFA 4LCBA 3FTCA 4B3MM 1R4GA 4QHSA 4HLQA 4F1IA 1PJTA 4DV2M 3MHVC 1MN3A 3ZCBB 3UMMA 3SATA 4OU7A 4NC6A 1QZMA 4GC5A 2DAMA 4WURA 3EIEA 4F2LA 5C1BA 1HNWM 1QAOA 2XZFA 4OVZB 3GO8A 4L4UA 2KXEA 2VQEM 1FJGM 3SYLA 4JI5M 4XBOA 1HQYE 2LH0A 5FSWA 3VK8A 1WR1B 4DBGB 4D82A 5BPVA 2F5NA 3F92A 4NRWA 4DUZM 3KSJA 2XFSA 1P3QQ 4KLNA 4X64M 2UXCM 3VLFB 1DGBA 4FVMA 3UK6A 3GQ3A 2F5OA 2UUCM 2EO2A 3U6MA 1QANA 1Z5BA 2JZ0A 2L09A 4IBIA 5H37D 3K9OA 3T15A 5KO3A 2M60A 3GRYA 5ITUA 3K8ZA 2LVQD 2EA0A 3BXWA 2G5GX 4Q7JA 5E6JA 1JB0F 2BWBA 1T3TA 3HX3A 4JI8M 1OAOC 4X66M 4AKHA 3U5ZA 1BVSA 3LQRA 2WSCF 3LQQA 2JY5A 1IXSA 1J7KA 3MJ5A 2R65A 1YUBA 2RGHA 1C7YA 4CHTB 4I5SA 1G71A 1TDHA 1N78A 3HKPA 1QZEA 2OOAA 2EKKA 1R7RA 4L16A 4UN2B 3FTDA 3FUVA 3PFIA 1SXJB 2LHGA 3KOYE 3J2PB 2CHGA 2DZOB 1L8QA 5ITTA 3B74A 1D0MA 3D8LA 2XSZD 4CIZA 1ZMWA 2OQ4A 4LY6A 3LCUA 4AG5A 2R0IA 4PDIA
chains in the Genus database with same CATH topology
4GKJM 2V6ZM 2YR0A 1IN5A 3J80S 3I51A 3KP1E 1IXRC 3J7BA 3U6DA 1NNJA 1Q3BA 3VK7A 1PJIA 4MGKE 2C98A 1SXJE 4LGYA 3U6CA 2W82A 2H1RA 3M6AA 1NHGC 2D7EA 4JI3M 5DNYA 4RF1A 4MGHA 5LMNM 2XEPA 3B9PA 3SMSA 4LG2A 3L27A 4M9SA 1H6UA 2KRKA 5EXTA 4PCZA 1G3IA 1TH3A 3UGJA 3SBJA 1JR3A 4DR5M 4OVZA 2QBYB 2LWXA 4L78A 2L7HA 2M5ZA 2CV0A 3UJNA 4GHAA 3AL0C 4DUYM 4M0WA 2R45A 4BBAA 3SMPA 3RGPA 3K92A 2D7GA 3RFWA 4LGMA 5FTMA 5KPZA 1PJJA 3KSXA 4GKKM 1E9SA 3I4YA 2C9OA 3KP0E 5FTNA 3FD9A 3GPUA 3SAUA 4LRSA 1OFIA 3SAWA 3FKEA 2X4AA 5LMUM 1GVNA 3AJIB 1LV7A 1TH2A 3CTWB 4DR1M 4JXJA 3GP1A 2XLJA 4LJAA 3VFDA 3M7GA 3J7AS 3UZUA 4DV5M 5FTKA 3SARA 3PXGA 2YFQA 4JI0M 2VIIA 3KS4A 3GPYA 3FUWA 1Z6TA 4GIPA 1L1TA 2R46A 4LJ6A 1JQJC 1SXJA 1HT1E 2FOIC 5ITXE 1IM2A 3R8FA 2I7NA 2R4EA 3RGSA 1W5SA 2XH9A 4GITA 3K2LA 2C96A 4FCVA 2RKOA 3A46A 1L1ZA 3GRRA 3KXEC 3U6QA 2D7HA 2CE7A 5EP4A 4K0KM 5IWAM 4NXNM 1GL7A 1DGFA 3LVVA 4JI7M 5EXXA 2ZBKB 3U61B 1DO0A 5IZ7D 4PD2A 4B7GA 1L2BA 2ZANA 3ZH9B 2CV2A 2XFTA 4I4LA 3JAMS 5DYIA 2F4VM 2Z7JA 3H4MA 1I94M 2KZUA 2F5PA 3JR4A 1UM8A 3GRUA 2QP9X 4LFCM 4QHTA 1HT2E 1IY0A 3TWLA 4M9XA 1IBMM 1W5TA 1SXJC 4NOOB 2EUCA 2XZUA 4OW0A 3L25A 4AZFA 3FYDA 1R2YA 1IY2A 1JR3D 1XWIA 1ZAEA 2QBYA 2DXIA 4ZPXA 3D8BA 2CEAA 4KODA 1XXHB 4B7FA 2P5TA 4B7HA 4M0DA 1G8PA 4KO8A 3AFHA 5DYGA 2DVWB 3HHZA 2Z4RA 1X37A 2C99A 4L8RC 1NVMA 4MGZE 1HQCA 1YSYA 4DV1M 1Z59A 1XHBA 2BJVA 4LJ7A 2ZAOA 4QOZC 2KW0A 4BLCA 2DHRA 2FNAA 3KOZE 4FWDA 3FYCA 3FUUA 2RGOA 4FCWA 4DR2M 4M9ZA 4G4QA 2J7NA 1GL6A 1GKIA 3IG8A 2XGNA 3HHXA 7CATA 4GHLA 1HNXM 4W5WA 3VKGA 5FLXS 2XF3A 3PNYA 3U6OA 1N77A 3T1HM 3FTEA 1Z5CA 2QCUA 1Q3CA 4MB7A 4A3VB 1YE9A 3HJSA 1GLNA 4LZJA 1IXZA 1SXJD 4D81A 4X62M 4B08A 3TWKA 4YHHM 3U60B 3CF0A 3TWMA 2HL7A 4JN6A 2L6OA 4NSOB 1IN4A 2DWZB 3RE8A 3GLFB 2V1CA 4LJ4A 1N34M 1G4AE 3KW6A 4BB9A 4AQYM 4AW4A 4CGYB 2ZM6M 4JV5M 4AI6A 3U61A 1NY5A 2ERCA 3I4VA 3TL4X 4IBCA 3ILKA 3L26A 4D80A 4JI1M 1KYIA 1OJLA 3U6LA 2QENA 3KOXE 1E94E 3DFZA 3E4RA 3Q8XA 3GQ4A 4KHPM 4AKGA 3KS8A 3FUXA 1D2NA 1I4WA 4FCTA 3C58A 3VDUA 1C1KA 4GRIA 4LF8M 2JA2A 4LJ5A 2DWNA 4LZZA 1OFHA 3T38A 3E9SA 1DO2A 3U6EA 4GH9A 1J5EM 1IQPA 2HHHM 4IIWA 4LJ9A 2X8AA 1QAQA 1XXHA 1WXQA 2KZSA 2XSZA 5IT9S 5ITRA 4Z8XA 5KPTA 2CV1A 2UUBM 4IBGA 4WW0A 2YQZA 4I81A 5JI2E 3EIHA 4HL4A 3NBIA 2HKJA 3AV0A 2FFJA 3HHYA 5JI3E 4R7GA 2YNMD 2DWMA 4MH0E 2KEBA 4II7A 2AHMA 1E32A 3QWLA 2CHQA 1XMOM 2G8LA 3HU3A 3TE6A 1G59A 1L2DA 3KVWA 4R3DA 1E9RA 4DV3M 1PM5A 1N33M 2LXEA 4MGYE 3WHKA 2F5QA 4DV6M 1QQWA 5E26A 3J27B 4G6ZA 4REZA 1QAMA 2R62A 3NWLA 3GQ5A 1IBKM 4B3SM 4JI6M 1XNRM 5EXPA 3ZC7B 3FUTA 4IBFA 4LJ8A 4B3TM 4B3RM 4LFAM 4G4NA 2UXDM 5C18A 1EE8A 1NNUC 1IY1A 3K1JA 1KSFX 5EP1A 3PNVA 2A5YB 4DR4M 4RNAA 1XNQM 2OPFA 1R6BX 2UUAM 5BR8M 1IN8A 3U60A 2QZ4A 2NQ8C 3LVWA 5EXSA 4LFBM 4DR7M 3SC3A 2CFOA 1MU5A 3GLFA 2C9CA 3QAUA 5KQ8A 4XGIA 1K3WA 4QNMA 2UU9M 3A45A 3IG5A 1DGHB 2FE8A 2BNKA 3MK6A 1N75A 4LRTA 3DZDA 1K3XA 4JI2M 5A2QS 1ZQ9A 3HJQA 3GRVA 1IBLM 3GLGB 2VQFM 5IREB 4ITQA 1QVRA 1NHWC 4GMQA 1XMQM 5ITYA 4AKIA 5EQTA 1DGGA 3T1YM 3GLHB 3KOWE 5KPRA 4DV0M 3OTOM 4LF5M 5ITXA 2Y20A 4NSRA 1IN6A 1KFVA 1N36M 2QPAA 5FTLA 1ORYB 2C5RA 2O5RA 1K82A 1TGUA 1S3SA 4QNRA 2R18A 3SHFA 3AOEA 4NRVA 1HR0M 3L28A 3TPZA 2R4JA 4FW9A 3GLIA 3VKHA 5FTJA 3L2AA 4RF0A 3THGA 4IBDA 4IJEA 2Z4SA 4LF7M 5EP3A 4X65M 3U6SA 3HJ8A 3A42A 1N32M 4EIWA 3CF6E 3L29A 1TH4A 4FWHA 2DWLA 3JR5A 4CISA 4JI4M 1Q39A 3SYKA 1N78A 1NSFA 4G4RA 5EP2A 1FNNA 4MM3B 8CATA 2DZNB 4QOSA 3FTFA 1J09A 4Z6YA 4S12A 1L2CA 2BJWA 4OX9M 1R2ZA 4IBKA 2X49A 3KDSE 4LF6M 2LNHC 2CUZA 1MX0A 4L15A 3TQSA 4YY3M 3HU1A 4FD2A 3KFUG 3U5ZB 3A98B 2Y21A 4DV4M 3AOEC 2Y0QA 1IN7A 2L7IA 3U6PA 3DA1A 4DR3M 3GPXA 1IXSB 2CHVA 3WHLA 2Y0TA 1QYRA 3HU2A 3SFZA 2E5LM 3CF2A 4DV7M 2Q2EB 4AG6A 4I8OA 3AKZA 4JYAM 3HWSA 3BOSA 1NJFA 2HCBA 4MGIE 5EJCA 2UXBM 5F3WA 3GPPA 2V1UA 3VDPA 3SASA 3M0EA 1G41A 4IBEA 4P16A 3GLIB 4LF9M 3R9XB 2I7PA 2KA6B 3HHWA 4PDGA 1NY6A 4G4OA 1DGHA 4IBBA 4DR6M 1Z5AA 3PVSA 4FWGA 3W0FA 5KQDA 2K47A 4PT5A 3HGIA 3DOAA 2Z3XA 5GKNA 3GLGA 3SAVA 4GC9A 1XC8A 3J81S 1VDDA 2J7OA 3LMMA 1HNZM 3AOGA 2ZAMA 4IBJA 4LF4M 2F5SA 4NL4H 3W0LB 1NJGA 3GLHA 3SHGB 4NXMM 2KRUA 1TDZA 4TUWA 5ITQA 4IJFA 4LCBA 3FTCA 4B3MM 4QHSA 4HLQA 4DV2M 3MHVC 3ZCBB 3UMMA 3SATA 4OU7A 1QZMA 4GC5A 4WURA 3EIEA 5C1BA 1HNWM 1QAOA 2XZFA 4OVZB 3GO8A 4L4UA 2KXEA 2VQEM 1FJGM 3SYLA 4JI5M 4XBOA 1HQYE 2LH0A 5FSWA 3VK8A 4D82A 5BPVA 2F5NA 4NRWA 4DUZM 3KSJA 2XFSA 4KLNA 4X64M 2UXCM 3VLFB 1DGBA 4FVMA 3UK6A 3GQ3A 2F5OA 2UUCM 2EO2A 3U6MA 1QANA 1Z5BA 4IBIA 2L09A 5H37D 3T15A 5KO3A 2M60A 3GRYA 5ITUA 3K8ZA 2EA0A 2G5GX 5E6JA 1T3TA 4JI8M 4X66M 4AKHA 3U5ZA 3LQRA 3LQQA 1J7KA 3MJ5A 2R65A 1YUBA 2RGHA 4CHTB 4I5SA 1TDHA 3HKPA 1R7RA 4L16A 3FTDA 3FUVA 3PFIA 1SXJB 3KOYE 3J2PB 2CHGA 2DZOB 1L8QA 5ITTA 3D8LA 2XSZD 2OQ4A 4LY6A 4AG5A 4PDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ8 C;  2FOI C;  1NHW C;  1NHG C;  1NNU C; 
#chains in the Genus database with same CATH topology
 4GKJ M;  2V6Z M;  2YR0 A;  1OIZ A;  1IN5 A;  3J80 S;  3I51 A;  3KP1 E;  1IXR C;  1XXH E;  3J7B A;  3U6D A;  1OKS A;  1NNJ A;  1Q3B A;  1V33 A;  3VK7 A;  1PJI A;  4MGK E;  2C98 A;  1SXJ E;  2DZL A;  4LGY A;  3U6C A;  2W82 A;  2O01 F;  2H1R A;  3M6A A;  1NHG C;  2D7E A;  2KNZ A;  4JI3 M;  5DNY A;  4RF1 A;  4MGH A;  2Z8Y M;  5LMN M;  3QYE A;  2XEP A;  4XK8 F;  3B9P A;  3SMS A;  4LG2 A;  3L27 A;  4M9S A;  1H6U A;  2KRK A;  5EXT A;  4PCZ A;  1G3I A;  1TH3 A;  3UGJ A;  3SBJ A;  1JR3 A;  4DR5 M;  4OVZ A;  2QBY B;  2LWX A;  2DNA A;  4L78 A;  3HY5 A;  3IHP A;  2L7H A;  2M5Z A;  2CV0 A;  3UJN A;  4GHA A;  3AL0 C;  3CGW A;  2VF7 A;  4DUY M;  4M0W A;  3W68 A;  2HAK A;  2WSE F;  4RKU F;  3LW5 F;  2R45 A;  4BBA A;  1IFY A;  2KHH A;  3SMP A;  3RGP A;  3K92 A;  2D7G A;  3RFW A;  4LGM A;  2MH8 A;  5FTM A;  1D0K A;  5KPZ A;  2LTU A;  1OQY A;  1PJJ A;  3KSX A;  4GKK M;  4ANR A;  1E9S A;  2R6F A;  2C9O A;  1MJG M;  3I4Y A;  3FD9 A;  3KP0 E;  5FTN A;  3GPU A;  3SAU A;  1TF0 B;  4LRS A;  1OFI A;  2BWE A;  1ZMV A;  4Y28 F;  3SAW A;  3FKE A;  2X4A A;  5LMU M;  1AUA A;  1T6O A;  2MR9 A;  1TTE A;  3B7Z A;  1GVN A;  2K0B X;  3AJI B;  1VDL A;  1LV7 A;  1TH2 A;  4R71 A;  3CTW B;  4DR1 M;  4JXJ A;  3GP1 A;  2XLJ A;  4LJA A;  3VFD A;  3M7G A;  3J7A S;  3UZU A;  4DV5 M;  5FTK A;  3SAR A;  3PXG A;  2YFQ A;  4CJ6 A;  4JI0 M;  2VII A;  2OOB A;  3KS4 A;  3GPY A;  3FUW A;  1Z6T A;  4GIP A;  1L1T A;  2R46 A;  4LJ6 A;  1JQJ C;  1TR8 A;  1SXJ A;  1HT1 E;  2FOI C;  5ITX E;  1IM2 A;  3R8F A;  2I7N A;  2R4E A;  3RGS A;  3BBZ A;  1W5S A;  2XH9 A;  4GIT A;  3K2L A;  3B7Q A;  2C96 A;  4FCV A;  2RKO A;  3I04 M;  3A46 A;  1L1Z A;  3GRR A;  3KXE C;  3U6Q A;  2D7H A;  2CE7 A;  5EP4 A;  4K0K M;  5IWA M;  2FS1 A;  4NXN M;  1GL7 A;  1DGF A;  3LVV A;  4JI7 M;  1QDR A;  2ZBK B;  5EXX A;  3U61 B;  1DO0 A;  5IZ7 D;  4PD2 A;  4B7G A;  1L2B A;  1F4I A;  2ZAN A;  3ZH9 B;  2L2D A;  2CV2 A;  2XFT A;  4HEO A;  4I4L A;  3JAM S;  5DYI A;  2F4V M;  2Z7J A;  3H4M A;  1I94 M;  1DV0 A;  2KZU A;  2F5P A;  1EIJ A;  3JR4 A;  1UM8 A;  3GRU A;  2QP9 X;  4LFC M;  2K9D A;  4QHT A;  1HT2 E;  1IY0 A;  3TWL A;  4M9X A;  1IBM M;  1W5T A;  2EJS A;  1SXJ C;  4NOO B;  2EUC A;  2XZU A;  4OW0 A;  3L25 A;  3Q8G A;  2LVP C;  4AZF A;  3FRI A;  1VEJ A;  3FYD A;  1R2Y A;  1WIV A;  1IY2 A;  1JR3 D;  1XWI A;  1ZAE A;  2QBY A;  2DXI A;  4ZPX A;  3D8B A;  2CEA A;  4KOD A;  5L8R F;  1EFU B;  1XXH B;  2KNA A;  2P5T A;  4M0D A;  1G8P A;  4B7F A;  4KO8 A;  4B7H A;  3AFH A;  2DAK A;  1PGY A;  2JY8 A;  5DYG A;  2DVW B;  1XB2 B;  3HHZ A;  2Z4R A;  1X37 A;  2C99 A;  1AIP C;  4L8R C;  1NVM A;  4MGZ E;  1HQC A;  1YSY A;  4DV1 M;  1Z59 A;  1XHB A;  3C9P A;  2BJV A;  4LJ7 A;  2ZAO A;  4QOZ C;  2JP7 A;  2KW0 A;  2DHR A;  2FNA A;  3I01 M;  3KOZ E;  4BLC A;  4FWD A;  3FYC A;  3FUU A;  2RGO A;  1NV8 A;  4FCW A;  4DR2 M;  2LVA A;  4M9Z A;  4G4Q A;  2J7N A;  1GL6 A;  1GKI A;  3IG8 A;  2XGN A;  3HHX A;  7CAT A;  2DAG A;  4GHL A;  1HNX M;  1WGL A;  2GNO A;  1WHC A;  4W5W A;  5FLX S;  3VKG A;  2XF3 A;  3PNY A;  2H5X A;  3U6O A;  1N77 A;  3T1H M;  3FTE A;  1Z5C A;  2QCU A;  1Q3C A;  4MB7 A;  4A3V B;  1YE9 A;  3HJS A;  1GLN A;  4LZJ A;  1IXZ A;  1SXJ D;  4D81 A;  4X62 M;  4B08 A;  3TWK A;  4YHH M;  3U60 B;  3CF0 A;  3TWM A;  3E46 A;  2HL7 A;  4JN6 A;  2L6O A;  2QQ8 A;  2MGW A;  1IN4 A;  2JUJ A;  4NSO B;  2DWZ B;  3RE8 A;  3GLF B;  2LHC A;  2V1C A;  4LJ4 A;  1N34 M;  1G4A E;  3KW6 A;  2JY6 B;  4BB9 A;  4AQY M;  4AW4 A;  4CGY B;  1PRB A;  3LCV B;  2ZM6 M;  4JV5 M;  4AI6 A;  3U61 A;  1NY5 A;  2ERC A;  3I4V A;  2O25 A;  2CP8 A;  3HZJ A;  4IBC A;  3ILK A;  3TL4 X;  3L26 A;  2DAE A;  4D80 A;  4JI1 M;  4G3O A;  1KYI A;  1OJL A;  3U6L A;  2QEN A;  3H4J A;  3KOX E;  1E94 E;  1VQ1 A;  3DFZ A;  3E4R A;  3Q8X A;  3GQ4 A;  4KHP M;  4AKG A;  1UFZ A;  3KS8 A;  3FUX A;  1D2N A;  1I4W A;  4FCT A;  3GLF E;  3C58 A;  3E21 A;  3VDU A;  1C1K A;  4GRI A;  4LF8 M;  2JA2 A;  4LJ5 A;  3IEC A;  1OAI A;  1WJ7 A;  4LZZ A;  2DWN A;  1OFH A;  3T38 A;  3E9S A;  1DO2 A;  3U6E A;  4GH9 A;  1J5E M;  1V34 A;  1IQP A;  3C3E A;  2HHH M;  4IIW A;  4LJ9 A;  2X8A A;  1QAQ A;  1XXH A;  1WXQ A;  2KZS A;  2XSZ A;  5IT9 S;  5ITR A;  4Z8X A;  5KPT A;  2CV1 A;  1VEK A;  2UUB M;  4IBG A;  4WW0 A;  2YQZ A;  4I81 A;  5JI2 E;  3EIH A;  2ZTD A;  4HL4 A;  2J5Y A;  3NBI A;  2HKJ A;  3AV0 A;  2FFJ A;  5DFL A;  2KDL A;  3HHY A;  3ZQJ A;  5JI3 E;  2LVN C;  4R7G A;  2YNM D;  2L4E A;  4MH0 E;  4P17 A;  2JWS A;  2DWM A;  2KEB A;  3NBX X;  4II7 A;  2AHM A;  1E32 A;  3QWL A;  1GAB A;  2CHQ A;  2LBC A;  1XMO M;  2G3Q A;  1A5T A;  3MMP A;  2G8L A;  1Q02 A;  1V92 A;  1WGN A;  3HU3 A;  3TE6 A;  1G59 A;  2JXN A;  1L2D A;  3KVW A;  4R3D A;  1E9R A;  4DV3 M;  1PM5 A;  1N33 M;  3GLI E;  1GJS A;  2LXE A;  4MGY E;  3WHK A;  2K6B A;  2F5Q A;  4DV6 M;  1QQW A;  2FH0 A;  5E26 A;  1CUK A;  3J27 B;  1RU3 A;  4G6Z A;  4REZ A;  1QAM A;  1Y8G A;  2R62 A;  3NWL A;  2QNJ A;  3GQ5 A;  1IBK M;  4B3S M;  4JI6 M;  1XNR M;  5EXP A;  3ZC7 B;  2HWJ A;  3FUT A;  4IBF A;  4LJ8 A;  4B3T M;  4LFA M;  1ZMU A;  4B3R M;  4G4N A;  2APL A;  1NO1 A;  2UXD M;  2DI0 A;  1EE8 A;  2N35 A;  1IY1 A;  1NNU C;  5C18 A;  3K1J A;  3V76 A;  1KSF X;  5EP1 A;  3PNV A;  2A5Y B;  1ZV1 A;  4DR4 M;  4RNA A;  1XNQ M;  3FE3 A;  2OPF A;  1R6B X;  2UUA M;  5BR8 M;  1IN8 A;  3U60 A;  2QZ4 A;  2NQ8 C;  3LVW A;  5EXS A;  4LFB M;  4DR7 M;  3SC3 A;  2CFO A;  1MU5 A;  2VDB B;  2C9C A;  3QAU A;  5KQ8 A;  3GLF A;  4XGI A;  1K3W A;  2KNV A;  1JR3 E;  4QNM A;  2UU9 M;  3A45 A;  3IG5 A;  1DGH B;  2DEN A;  2FE8 A;  2BNK A;  3MK6 A;  1N75 A;  4GEW A;  4LRT A;  3DZD A;  1K3X A;  3B89 A;  3W67 A;  1VG5 A;  5A2Q S;  4JI2 M;  1ZQ9 A;  3HJQ A;  2RRU A;  3GRV A;  1IBL M;  3GLG B;  4WP2 A;  2VQF M;  5IRE B;  4ITQ A;  1QVR A;  1NHW C;  4GMQ A;  1XMQ M;  5ITY A;  4AKI A;  5EQT A;  1DGG A;  2MJ5 B;  3T1Y M;  3GLH B;  3C3D A;  1VEG A;  3KOW E;  5KPR A;  4DV0 M;  3OTO M;  4LF5 M;  1OTR A;  1PJQ A;  5ITX A;  2Y20 A;  4NSR A;  1IN6 A;  2JNH A;  1N36 M;  1KFV A;  1OIP A;  2QPA A;  2WZJ A;  5FTL A;  1ORY B;  2C5R A;  2O5R A;  1K82 A;  1TGU A;  1S3S A;  1GJT A;  4QNR A;  2R18 A;  3SHF A;  3AOE A;  4NRV A;  1D0L A;  1HR0 M;  3L28 A;  3TPZ A;  2QHO B;  1QUT A;  2R4J A;  4FW9 A;  3GLG E;  3GLI A;  1GO5 A;  3VKH A;  1QUS A;  5FTJ A;  3L2A A;  4RF0 A;  3THG A;  3GLH E;  2MRO B;  4IBD A;  4IJE A;  2Z4S A;  4LF7 M;  5EP3 A;  4X65 M;  3U6S A;  3HJ8 A;  3A42 A;  1N32 M;  4EIW A;  3CF6 E;  3L29 A;  1TH4 A;  4FWH A;  2DWL A;  3JR5 A;  1R5L A;  4CIS A;  1Q39 A;  2L4F A;  3SYK A;  1NSF A;  4G4R A;  1LTM A;  4JI4 M;  5EP2 A;  1FNN A;  2JZ1 A;  4MM3 B;  8CAT A;  2DZN B;  4QOS A;  3FTF A;  4L6V 6;  1J09 A;  2CWB A;  4S12 A;  4Z6Y A;  1L2C A;  3B7N A;  2BJW A;  2DHY A;  2R44 A;  4OX9 M;  3FRH A;  1R2Z A;  4IBK A;  2ZTC A;  2X49 A;  3KDS E;  3K9P A;  4LF6 M;  2LNH C;  2CUZ A;  1MX0 A;  4L15 A;  3TQS A;  4YY3 M;  3HU1 A;  4FD2 A;  3KFU G;  3T6P A;  2EKF A;  3U5Z B;  3A98 B;  2Y21 A;  4DV4 M;  3AOE C;  2Y0Q A;  1IN7 A;  2DAI A;  2L7I A;  3U6P A;  3DA1 A;  4DR3 M;  3GPX A;  1IXS B;  2CHV A;  1T43 A;  1HJP A;  3WHL A;  1QDT A;  2Y0T A;  2WSF F;  1QYR A;  3HU2 A;  1SG9 A;  3SFZ A;  2E5L M;  3CF2 A;  4DV7 M;  2Q2E B;  4AG6 A;  4I8O A;  2VF8 A;  3AKZ A;  4JYA M;  3HWS A;  3BOS A;  1NJF A;  2HCB A;  4MGI E;  5EJC A;  2UXB M;  5F3W A;  3GPP A;  1YLA A;  1PJS A;  3VDP A;  2V1U A;  3M0E A;  3SAS A;  3QYB A;  1G41 A;  4IBE A;  4P16 A;  1NV9 A;  2CRU A;  3GLI B;  4LF9 M;  3R9X B;  2I7P A;  2KA6 B;  3HHW A;  4PDG A;  1NY6 A;  2B3T A;  4KT0 F;  4G4O A;  1DGH A;  4IBB A;  4DR6 M;  2DKL A;  1Z5A A;  3PVS A;  4FWG A;  3W0F A;  5KQD A;  2K47 A;  4PT5 A;  3HGI A;  3DOA A;  2QSF X;  2Z3X A;  5GKN A;  3GLG A;  3SAV A;  4GC9 A;  2GQF A;  1XC8 A;  3J81 S;  1VDD A;  2J7O A;  3LMM A;  1HNZ M;  3AOG A;  2ZAM A;  4IBJ A;  4LF4 M;  2F5S A;  4NL4 H;  3W0L B;  1NJG A;  2JY7 A;  3GLH A;  2LVO C;  3SHG B;  2KRU A;  4NXM M;  1TDZ A;  4TUW A;  5ITQ A;  2OO9 A;  4IJF A;  4LCB A;  3FTC A;  4B3M M;  1R4G A;  4QHS A;  4HLQ A;  4F1I A;  1PJT A;  4DV2 M;  3MHV C;  1MN3 A;  3ZCB B;  3UMM A;  3SAT A;  4OU7 A;  4NC6 A;  1QZM A;  4GC5 A;  2DAM A;  4WUR A;  3EIE A;  4F2L A;  5C1B A;  1HNW M;  1QAO A;  2XZF A;  4OVZ B;  3GO8 A;  4L4U A;  2KXE A;  2VQE M;  1FJG M;  3SYL A;  4JI5 M;  4XBO A;  1HQY E;  2LH0 A;  5FSW A;  3VK8 A;  1WR1 B;  4DBG B;  4D82 A;  5BPV A;  2F5N A;  3F92 A;  4NRW A;  4DUZ M;  3KSJ A;  2XFS A;  1P3Q Q;  4KLN A;  4X64 M;  2UXC M;  3VLF B;  1DGB A;  4FVM A;  3UK6 A;  3GQ3 A;  2F5O A;  2UUC M;  2EO2 A;  3U6M A;  1QAN A;  1Z5B A;  2JZ0 A;  2L09 A;  4IBI A;  5H37 D;  3K9O A;  3T15 A;  5KO3 A;  2M60 A;  3GRY A;  5ITU A;  3K8Z A;  2LVQ D;  2EA0 A;  3BXW A;  2G5G X;  4Q7J A;  5E6J A;  1JB0 F;  2BWB A;  1T3T A;  3HX3 A;  4JI8 M;  1OAO C;  4X66 M;  4AKH A;  3U5Z A;  1BVS A;  3LQR A;  2WSC F;  3LQQ A;  2JY5 A;  1IXS A;  1J7K A;  3MJ5 A;  2R65 A;  1YUB A;  2RGH A;  1C7Y A;  4CHT B;  4I5S A;  1G71 A;  1TDH A;  1N78 A;  3HKP A;  1QZE A;  2OOA A;  2EKK A;  1R7R A;  4L16 A;  4UN2 B;  3FTD A;  3FUV A;  3PFI A;  1SXJ B;  2LHG A;  3KOY E;  3J2P B;  2CHG A;  2DZO B;  1L8Q A;  5ITT A;  3B74 A;  1D0M A;  3D8L A;  2XSZ D;  4CIZ A;  1ZMW A;  2OQ4 A;  4LY6 A;  3LCU A;  4AG5 A;  2R0I A;  4PDI A; 
#chains in the Genus database with same CATH homology
 4GKJ M;  2V6Z M;  2YR0 A;  1IN5 A;  3J80 S;  3I51 A;  3KP1 E;  1IXR C;  3J7B A;  3U6D A;  1NNJ A;  1Q3B A;  3VK7 A;  1PJI A;  4MGK E;  2C98 A;  1SXJ E;  4LGY A;  3U6C A;  2W82 A;  2H1R A;  3M6A A;  1NHG C;  2D7E A;  4JI3 M;  5DNY A;  4RF1 A;  4MGH A;  5LMN M;  2XEP A;  3B9P A;  3SMS A;  4LG2 A;  3L27 A;  4M9S A;  1H6U A;  2KRK A;  5EXT A;  4PCZ A;  1G3I A;  1TH3 A;  3UGJ A;  3SBJ A;  1JR3 A;  4DR5 M;  4OVZ A;  2QBY B;  2LWX A;  4L78 A;  2L7H A;  2M5Z A;  2CV0 A;  3UJN A;  4GHA A;  3AL0 C;  4DUY M;  4M0W A;  2R45 A;  4BBA A;  3SMP A;  3RGP A;  3K92 A;  2D7G A;  3RFW A;  4LGM A;  5FTM A;  5KPZ A;  1PJJ A;  3KSX A;  4GKK M;  1E9S A;  3I4Y A;  2C9O A;  3KP0 E;  5FTN A;  3FD9 A;  3GPU A;  3SAU A;  4LRS A;  1OFI A;  3SAW A;  3FKE A;  2X4A A;  5LMU M;  1GVN A;  3AJI B;  1LV7 A;  1TH2 A;  3CTW B;  4DR1 M;  4JXJ A;  3GP1 A;  2XLJ A;  4LJA A;  3VFD A;  3M7G A;  3J7A S;  3UZU A;  4DV5 M;  5FTK A;  3SAR A;  3PXG A;  2YFQ A;  4JI0 M;  2VII A;  3KS4 A;  3GPY A;  3FUW A;  1Z6T A;  4GIP A;  1L1T A;  2R46 A;  4LJ6 A;  1JQJ C;  1SXJ A;  1HT1 E;  2FOI C;  5ITX E;  1IM2 A;  3R8F A;  2I7N A;  2R4E A;  3RGS A;  1W5S A;  2XH9 A;  4GIT A;  3K2L A;  2C96 A;  4FCV A;  2RKO A;  3A46 A;  1L1Z A;  3GRR A;  3KXE C;  3U6Q A;  2D7H A;  2CE7 A;  5EP4 A;  4K0K M;  5IWA M;  4NXN M;  1GL7 A;  1DGF A;  3LVV A;  4JI7 M;  5EXX A;  2ZBK B;  3U61 B;  1DO0 A;  5IZ7 D;  4PD2 A;  4B7G A;  1L2B A;  2ZAN A;  3ZH9 B;  2CV2 A;  2XFT A;  4I4L A;  3JAM S;  5DYI A;  2F4V M;  2Z7J A;  3H4M A;  1I94 M;  2KZU A;  2F5P A;  3JR4 A;  1UM8 A;  3GRU A;  2QP9 X;  4LFC M;  4QHT A;  1HT2 E;  1IY0 A;  3TWL A;  4M9X A;  1IBM M;  1W5T A;  1SXJ C;  4NOO B;  2EUC A;  2XZU A;  4OW0 A;  3L25 A;  4AZF A;  3FYD A;  1R2Y A;  1IY2 A;  1JR3 D;  1XWI A;  1ZAE A;  2QBY A;  2DXI A;  4ZPX A;  3D8B A;  2CEA A;  4KOD A;  1XXH B;  4B7F A;  2P5T A;  4B7H A;  4M0D A;  1G8P A;  4KO8 A;  3AFH A;  5DYG A;  2DVW B;  3HHZ A;  2Z4R A;  1X37 A;  2C99 A;  4L8R C;  1NVM A;  4MGZ E;  1HQC A;  1YSY A;  4DV1 M;  1Z59 A;  1XHB A;  2BJV A;  4LJ7 A;  2ZAO A;  4QOZ C;  2KW0 A;  4BLC A;  2DHR A;  2FNA A;  3KOZ E;  4FWD A;  3FYC A;  3FUU A;  2RGO A;  4FCW A;  4DR2 M;  4M9Z A;  4G4Q A;  2J7N A;  1GL6 A;  1GKI A;  3IG8 A;  2XGN A;  3HHX A;  7CAT A;  4GHL A;  1HNX M;  4W5W A;  3VKG A;  5FLX S;  2XF3 A;  3PNY A;  3U6O A;  1N77 A;  3T1H M;  3FTE A;  1Z5C A;  2QCU A;  1Q3C A;  4MB7 A;  4A3V B;  1YE9 A;  3HJS A;  1GLN A;  4LZJ A;  1IXZ A;  1SXJ D;  4D81 A;  4X62 M;  4B08 A;  3TWK A;  4YHH M;  3U60 B;  3CF0 A;  3TWM A;  2HL7 A;  4JN6 A;  2L6O A;  4NSO B;  1IN4 A;  2DWZ B;  3RE8 A;  3GLF B;  2V1C A;  4LJ4 A;  1N34 M;  1G4A E;  3KW6 A;  4BB9 A;  4AQY M;  4AW4 A;  4CGY B;  2ZM6 M;  4JV5 M;  4AI6 A;  3U61 A;  1NY5 A;  2ERC A;  3I4V A;  3TL4 X;  4IBC A;  3ILK A;  3L26 A;  4D80 A;  4JI1 M;  1KYI A;  1OJL A;  3U6L A;  2QEN A;  3KOX E;  1E94 E;  3DFZ A;  3E4R A;  3Q8X A;  3GQ4 A;  4KHP M;  4AKG A;  3KS8 A;  3FUX A;  1D2N A;  1I4W A;  4FCT A;  3C58 A;  3VDU A;  1C1K A;  4GRI A;  4LF8 M;  2JA2 A;  4LJ5 A;  2DWN A;  4LZZ A;  1OFH A;  3T38 A;  3E9S A;  1DO2 A;  3U6E A;  4GH9 A;  1J5E M;  1IQP A;  2HHH M;  4IIW A;  4LJ9 A;  2X8A A;  1QAQ A;  1XXH A;  1WXQ A;  2KZS A;  2XSZ A;  5IT9 S;  5ITR A;  4Z8X A;  5KPT A;  2CV1 A;  2UUB M;  4IBG A;  4WW0 A;  2YQZ A;  4I81 A;  5JI2 E;  3EIH A;  4HL4 A;  3NBI A;  2HKJ A;  3AV0 A;  2FFJ A;  3HHY A;  5JI3 E;  4R7G A;  2YNM D;  2DWM A;  4MH0 E;  2KEB A;  4II7 A;  2AHM A;  1E32 A;  3QWL A;  2CHQ A;  1XMO M;  2G8L A;  3HU3 A;  3TE6 A;  1G59 A;  1L2D A;  3KVW A;  4R3D A;  1E9R A;  4DV3 M;  1PM5 A;  1N33 M;  2LXE A;  4MGY E;  3WHK A;  2F5Q A;  4DV6 M;  1QQW A;  5E26 A;  3J27 B;  4G6Z A;  4REZ A;  1QAM A;  2R62 A;  3NWL A;  3GQ5 A;  1IBK M;  4B3S M;  4JI6 M;  1XNR M;  5EXP A;  3ZC7 B;  3FUT A;  4IBF A;  4LJ8 A;  4B3T M;  4B3R M;  4LFA M;  4G4N A;  2UXD M;  5C18 A;  1EE8 A;  1NNU C;  1IY1 A;  3K1J A;  1KSF X;  5EP1 A;  3PNV A;  2A5Y B;  4DR4 M;  4RNA A;  1XNQ M;  2OPF A;  1R6B X;  2UUA M;  5BR8 M;  1IN8 A;  3U60 A;  2QZ4 A;  2NQ8 C;  3LVW A;  5EXS A;  4LFB M;  4DR7 M;  3SC3 A;  2CFO A;  1MU5 A;  3GLF A;  2C9C A;  3QAU A;  5KQ8 A;  4XGI A;  1K3W A;  4QNM A;  2UU9 M;  3A45 A;  3IG5 A;  1DGH B;  2FE8 A;  2BNK A;  3MK6 A;  1N75 A;  4LRT A;  3DZD A;  1K3X A;  4JI2 M;  5A2Q S;  1ZQ9 A;  3HJQ A;  3GRV A;  1IBL M;  3GLG B;  2VQF M;  5IRE B;  4ITQ A;  1QVR A;  1NHW C;  4GMQ A;  1XMQ M;  5ITY A;  4AKI A;  5EQT A;  1DGG A;  3T1Y M;  3GLH B;  3KOW E;  5KPR A;  4DV0 M;  3OTO M;  4LF5 M;  5ITX A;  2Y20 A;  4NSR A;  1IN6 A;  1KFV A;  1N36 M;  2QPA A;  5FTL A;  1ORY B;  2C5R A;  2O5R A;  1K82 A;  1TGU A;  1S3S A;  4QNR A;  2R18 A;  3SHF A;  3AOE A;  4NRV A;  1HR0 M;  3L28 A;  3TPZ A;  2R4J A;  4FW9 A;  3GLI A;  3VKH A;  5FTJ A;  3L2A A;  4RF0 A;  3THG A;  4IBD A;  4IJE A;  2Z4S A;  4LF7 M;  5EP3 A;  4X65 M;  3U6S A;  3HJ8 A;  3A42 A;  1N32 M;  4EIW A;  3CF6 E;  3L29 A;  1TH4 A;  4FWH A;  2DWL A;  3JR5 A;  4CIS A;  4JI4 M;  1Q39 A;  3SYK A;  1N78 A;  1NSF A;  4G4R A;  5EP2 A;  1FNN A;  4MM3 B;  8CAT A;  2DZN B;  4QOS A;  3FTF A;  1J09 A;  4Z6Y A;  4S12 A;  1L2C A;  2BJW A;  4OX9 M;  1R2Z A;  4IBK A;  2X49 A;  3KDS E;  4LF6 M;  2LNH C;  2CUZ A;  1MX0 A;  4L15 A;  3TQS A;  4YY3 M;  3HU1 A;  4FD2 A;  3KFU G;  3U5Z B;  3A98 B;  2Y21 A;  4DV4 M;  3AOE C;  2Y0Q A;  1IN7 A;  2L7I A;  3U6P A;  3DA1 A;  4DR3 M;  3GPX A;  1IXS B;  2CHV A;  3WHL A;  2Y0T A;  1QYR A;  3HU2 A;  3SFZ A;  2E5L M;  3CF2 A;  4DV7 M;  2Q2E B;  4AG6 A;  4I8O A;  3AKZ A;  4JYA M;  3HWS A;  3BOS A;  1NJF A;  2HCB A;  4MGI E;  5EJC A;  2UXB M;  5F3W A;  3GPP A;  2V1U A;  3VDP A;  3SAS A;  3M0E A;  1G41 A;  4IBE A;  4P16 A;  3GLI B;  4LF9 M;  3R9X B;  2I7P A;  2KA6 B;  3HHW A;  4PDG A;  1NY6 A;  4G4O A;  1DGH A;  4IBB A;  4DR6 M;  1Z5A A;  3PVS A;  4FWG A;  3W0F A;  5KQD A;  2K47 A;  4PT5 A;  3HGI A;  3DOA A;  2Z3X A;  5GKN A;  3GLG A;  3SAV A;  4GC9 A;  1XC8 A;  3J81 S;  1VDD A;  2J7O A;  3LMM A;  1HNZ M;  3AOG A;  2ZAM A;  4IBJ A;  4LF4 M;  2F5S A;  4NL4 H;  3W0L B;  1NJG A;  3GLH A;  3SHG B;  4NXM M;  2KRU A;  1TDZ A;  4TUW A;  5ITQ A;  4IJF A;  4LCB A;  3FTC A;  4B3M M;  4QHS A;  4HLQ A;  4DV2 M;  3MHV C;  3ZCB B;  3UMM A;  3SAT A;  4OU7 A;  1QZM A;  4GC5 A;  4WUR A;  3EIE A;  5C1B A;  1HNW M;  1QAO A;  2XZF A;  4OVZ B;  3GO8 A;  4L4U A;  2KXE A;  2VQE M;  1FJG M;  3SYL A;  4JI5 M;  4XBO A;  1HQY E;  2LH0 A;  5FSW A;  3VK8 A;  4D82 A;  5BPV A;  2F5N A;  4NRW A;  4DUZ M;  3KSJ A;  2XFS A;  4KLN A;  4X64 M;  2UXC M;  3VLF B;  1DGB A;  4FVM A;  3UK6 A;  3GQ3 A;  2F5O A;  2UUC M;  2EO2 A;  3U6M A;  1QAN A;  1Z5B A;  4IBI A;  2L09 A;  5H37 D;  3T15 A;  5KO3 A;  2M60 A;  3GRY A;  5ITU A;  3K8Z A;  2EA0 A;  2G5G X;  5E6J A;  1T3T A;  4JI8 M;  4X66 M;  4AKH A;  3U5Z A;  3LQR A;  3LQQ A;  1J7K A;  3MJ5 A;  2R65 A;  1YUB A;  2RGH A;  4CHT B;  4I5S A;  1TDH A;  3HKP A;  1R7R A;  4L16 A;  3FTD A;  3FUV A;  3PFI A;  1SXJ B;  3KOY E;  3J2P B;  2CHG A;  2DZO B;  1L8Q A;  5ITT A;  3D8L A;  2XSZ D;  2OQ4 A;  4LY6 A;  4AG5 A;  4PDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...