2NQ8C

Malarial enoyl acyl acp reductase bound with inh-nad adduct
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structural analysis of Plasmodium falciparum enoyl acyl carrier protein reductase as a pathway toward the optimization of triclosan antimalarial efficacy
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Enoyl-acyl carrier reductase
total genus 15
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2nq8C00
2FOIC 1NHWC 2NQ8C 1NNUC 1NHGC
chains in the Genus database with same CATH superfamily
3I4YA 4G4NA 2Y21A 4LFAM 3SAUA 1ZMWA 2DAGA 2XSZA 3T1YM 2V1UA 4NL4H 1YUBA 3FUUA 2R4EA 3GQ4A 3T6PA 2L09A 1XNQM 4IBGA 2CP8A 1NVMA 5IWAM 1OQYA 1HQCA 3NBIA 4FD2A 4DV5M 4LG2A 1T43A 3GLFA 1YE9A 1P3QQ 2L2DA 3HGIA 4PDIA 2QQ8A 3B74A 3DOAA 2LVNC 5H37D 2RGHA 1VEGA 1K3XA 2APLA 3PNVA 3M6AA 2KXEA 2VQEM 2CWBA 4CIZA 2ZM6M 1PM5A 2BWBA 4MB7A 2JY5A 3BXWA 1G3IA 1QVRA 4LJ7A 3M0EA 4XGIA 2C9OA 1PJIA 1QDTA 1OFHA 5EP3A 4OU7A 2DWLA 5DYIA 1VG5A 1DGHB 1IBLM 4GHAA 1Q02A 1CUKA 1HT1E 2KNZA 3DA1A 3L2AA 4FCVA 4Y28F 3GRYA 3GLFB 4DV2M 1IY0A 1TDZA 1HQYE 3B89A 3WHKA 2QNJA 3SAVA 1S3SA 2M60A 3LQRA 5L8RF 1N34M 1MU5A 2R4JA 2KNVA 8CATA 3U5ZA 1L2BA 2D7GA 3SMSA 2KEBA 3MK6A 4IIWA 2C99A 3THGA 3FE3A 3E9SA 2B3TA 1HNZM 4G4OA 1OJLA 1L1ZA 1PJSA 1QZEA 1Z59A 2EKKA 2LHCA 1R5LA 5EJCA 1G71A 2FNAA 3A45A 1YSYA 3FUXA 4DV3M 1YLAA 4LJ4A 4LF5M 4B08A 3GO8A 4L15A 1Z5CA 2D7EA 3FTDA 1DO2A 1JR3A 2XGNA 2CHQA 2X49A 3J27B 4CGYB 3GQ3A 1IXZA 1TGUA 2WSCF 2ZTDA 3PVSA 4JXJA 3JR5A 2XSZD 1Z5BA 1QAMA 1QUTA 2K0BX 3GPPA 3U6LA 4NOOB 2LVOC 4M9ZA 4GEWA 1NJGA 4NSOB 3MJ5A 5EP2A 4YHHM 3GRVA 3ZCBB 3AKZA 2G8LA 3SFZA 3CF2A 1N75A 2V6ZM 2XFTA 3GPYA 2VDBB 4NRWA 3L25A 4L78A 1GABA 2JZ1A 4FVMA 2CUZA 3DZDA 5ITUA 1A5TA 3HX3A 5DYGA 1ZQ9A 2LH0A 2Q2EB 1DGBA 3L26A 4DUYM 2OQ4A 1K3WA 4P16A 4KT0F 4DUZM 3GLGA 5EXXA 2R45A 5KO3A 1D0MA 4L6V6 2X4AA 3KW6A 4D80A 3U6DA 2C98A 3Q8XA 2WSEF 4X62M 2QHOB 2XFSA 4OW0A 2CRUA 5F3WA 1XMQM 3PNYA 1NO1A 2OPFA 1NY5A 3HJSA 4DR7M 3UGJA 3K8ZA 2F5NA 1IN6A 3KOYE 5BR8M 2VF8A 4S12A 3W68A 3UMMA 1GJSA 2DHRA 1ZV1A 1QAQA 3AOEA 2HCBA 4M9XA 1N36M 1OAOC 4PDGA 4AQYM 3Q8GA 1D0KA 1DGFA 1D0LA 1HJPA 2C9CA 5FTLA 3HJQA 5ITXE 3GLGE 2UUAM 2G5GX 3HHYA 1D2NA 1GKIA 2OOAA 3HU1A 2BJWA 5FTJA 3K9OA 2I7NA 2MGWA 4KLNA 3LVWA 4NSRA 1GL6A 4GIPA 5KPTA 1BVSA 4JI3M 1HNWM 2QENA 4UN2B 3W0LB 2OOBA 2DZLA 3GRUA 3ZH9B 2CV0A 4BBAA 4JI5M 4IBFA 1IN7A 4GHLA 1TF0B 2XF3A 2L7IA 3K1JA 1IN8A 3L28A 4F2LA 2GQFA 3SHGB 3T15A 3VDUA 3U6MA 2R44A 4MH0E 1HNXM 5C18A 4B3RM 2DZNB 5E26A 3W67A 4DR4M 1TH2A 3K92A 2K47A 5ITQA 5ITRA 4F1IA 2FS1A 4MGIE 4II7A 2FH0A 4OVZA 1Q39A 2WZJA 1PJJA 3FKEA 1VEJA 4M9SA 4W5WA 4L16A 5C1BA 3WHLA 1IN5A 3NWLA 3T1HM 4PD2A 1J7KA 2KZUA 3GLFE 2XH9A 4JI0M 2VF7A 3C9PA 4GH9A 2LXEA 4M0DA 4DR1M 2QBYB 4FCWA 1OFIA 2X8AA 2YNMD 3GRRA 3GLHE 1Z6TA 1GVNA 3GLHB 4GKJM 4DBGB 1V34A 3MHVC 1KSFX 3IG8A 4LFCM 3EIEA 3J81S 4DR5M 2XZFA 3SC3A 2FE8A 4L4UA 4REZA 1OIZA 2FFJA 4MGKE 3FYCA 3AFHA 4IBJA 4X65M 3SBJA 1N32M 1N78A 1Q3BA 4QHSA 2Z8YM 4B3TM 3GLGB 2HKJA 4B7HA 3PFIA 3LVVA 3MMPA 4RKUF 3RGSA 3U6OA 1OAIA 1IY1A 4G6ZA 3BBZA 3U60A 2W82A 5IZ7D 3KFUG 3T38A 4MGHA 2D7HA 2MROB 2R6FA 2KRUA 3HY5A 4LJ6A 3JAMS 1HR0M 4IBCA 2JZ0A 3AOGA 2CE7A 4LF7M 4NXNM 4AG6A 3TQSA 4HLQA 2MR9A 3K9PA 4X66M 2XLJA 1I94M 3CTWB 3I01M 4G4QA 3HHZA 2R62A 5EXSA 1V92A 5EP4A 1SXJA 3A98B 2XZUA 2BNKA 1PJQA 3CF0A 2ZBKB 3KP0E 2HAKA 2ZANA 2Z4SA 3CF6E 1SXJB 4QOSA 3HKPA 1DO0A 2V1CA 3BOSA 4AG5A 2J7OA 3K2LA 3U6EA 3HWSA 3B7QA 4JN6A 2R65A 1ZAEA 3IECA 1JR3D 2JY7A 4D81A 4NRVA 1T6OA 1WIVA 1G8PA 3U5ZB 1MX0A 3SYLA 4JI4M 3FTFA 1GJTA 3HHXA 2UXCM 3AOEC 2KRKA 2EO2A 2R18A 2CHGA 3M7GA 2LVQD 2O5RA 4LRSA 1L2CA 4QHTA 2F5SA 4DV0M 2O01F 4DV4M 4X64M 4LZZA 3I04M 4IBBA 2UUCM 4BLCA 2DI0A 2KZSA 4KHPM 2CV1A 2QPAA 3HJ8A 4IBKA 1TH4A 4B3SM 2NQ8C 2DAMA 3QYEA 4DR6M 5FTKA 1MJGM 3H4JA 3FTEA 2FOIC 3SMPA 1E9RA 4LJ5A 5JI2E 1KFVA 1XWIA 1IXSB 4HL4A 1DGGA 2BWEA 4I8OA 3HZJA 2JA2A 1IXRC 2K6BA 2H1RA 3FYDA 1XMOM 1GL7A 5E6JA 3GPXA 2RRUA 3ILKA 1TH3A 4GRIA 4IBIA 2JY6B 3RGPA 2ZTCA 3C3DA 3LMMA 4JI1M 3KP1E 4I5SA 3FD9A 1PRBA 1VEKA 4MM3B 4I81A 1EFUB 1Q3CA 2WSFF 2H5XA 3HU2A 2F5PA 3B7ZA 3FTCA 1NSFA 3R9XB 3GLIE 4AI6A 3A42A 2L4FA 2HHHM 2CFOA 1SXJD 4R7GA 1TDHA 1IXSA 2J7NA 5EQTA 3U6SA 3UZUA 4BB9A 5DFLA 4AZFA 1KYIA 5FSWA 1QYRA 4QNRA 1AUAA 1UM8A 5EXPA 1DV0A 1JQJC 2JNHA 1R4GA 4A3VB 4CHTB 3SATA 1J09A 2XEPA 3E46A 1XC8A 3LCVB 2C5RA 4KO8A 4AKGA 1QQWA 1VDDA 5DNYA 1IM2A 1WGLA 3LQQA 2YFQA 2DWNA 1JR3E 1E9SA 1Z5AA 2JY8A 3QYBA 2J5YA 4KODA 3W0FA 2Z3XA 1MN3A 3A46A 2UU9M 4JI2M 3J2PB 4LF4M 1Y8GA 1ZMVA 1WXQA 3QWLA 2JWSA 2HL7A 3U61B 5FLXS 3B7NA 4I4LA 4P17A 3FUTA 3RFWA 3IHPA 1E94E 4D82A 4GKKM 1L8QA 2L7HA 4G4RA 4JI7M 1PGYA 1VDLA 3U6QA 1T3TA 2DAIA 4FWHA 1DGHA 3RE8A 3VK7A 5LMNM 3SHFA 3JR4A 5BPVA 1QAOA 1XB2B 3CGWA 4CJ6A 3HU3A 2KNAA 3B9PA 4Q7JA 4AKHA 1ZMUA 3SAWA 3R8FA 5ITYA 5KPRA 2Y20A 3NBXX 1H6UA 1C1KA 3KSXA 2UXDM 3FUWA 2EJSA 5LMUM 4DR3M 3AV0A 3TWMA 4G3OA 4ZPXA 4MGYE 1QUSA 2A5YB 2DVWB 3H4MA 3SASA 3FRHA 1SG9A 4AW4A 5A2QS 2KDLA 2O25A 1L1TA 2VQFM 2K9DA 3LCUA 1G59A 3GQ5A 3KS8A 2DWMA 3VDPA 2RGOA 3E4RA 4OVZB 2OO9A 4LF8M 3VKGA 1G4AE 2R46A 1LTMA 1PJTA 4FWDA 4LRTA 4WW0A 3VFDA 3VLFB 5KQDA 5ITTA 4LF6M 5EXTA 1XNRM 1ORYB 2KW0A 4K0KM 3KS4A 1J5EM 2C96A 3PXGA 3KOZE 2KHHA 1QZMA 4L8RC 3TPZA 4HEOA 4LF9M 2VIIA 2ZAOA 3I51A 2DXIA 4B3MM 3UJNA 1WJ7A 2M5ZA 4M0WA 1OKSA 4PCZA 2R0IA 1HT2E 2EUCA 5IREB 1G41A 4YY3M 7CATA 2ERCA 4LZJA 4R3DA 5ITXA 3F92A 5FTNA 2CV2A 3C58A 2F5QA 2L4EA 1IQPA 1XXHE 3C3EA 3AJIB 2E5LM 4WP2A 2LBCA 3E21A 3U61A 1AIPC 1IN4A 3KVWA 2F4VM 2P5TA 4IBDA 3FRIA 2DENA 2QP9X 2EKFA 2ZAMA 5KPZA 4JI8M 1OTRA 1IY2A 1NNUC 1WR1B 4MGZE 3EIHA 2LVPC 1RU3A 3V76A 2QCUA 4Z6YA 3OTOM 1L2DA 1NHWC 3U6CA 1N33M 1IBMM 3D8LA 2GNOA 1R6BX 4LJ9A 3UK6A 1C7YA 4QNMA 4DV7M 1W5SA 4B7FA 3GLIB 4XBOA 2LTUA 4JI6M 2UXBM 3KSJA 1F4IA 2N35A 5EP1A 1V33A 4JYAM 2Y0TA 1QANA 1TR8A 1NV9A 2JXNA 3GLHA 1IFYA 1WGNA 4FW9A 1GLNA 2DHYA 3SYKA 3TE6A 3J7AS 1UFZA 4ITQA 3I4VA 2G3QA 2Y0QA 3ZQJA 5GKNA 2DWZB 4LJAA 4R71A 1IBKM 4LJ8A 1K82A 4TUWA 1QDRA 4PT5A 2CHVA 2LVAA 1XHBA 2DZOB 4LGYA 3U60B 1R2ZA 4CISA 1EE8A 1R7RA 2Z7JA 1FNNA 4GC9A 1EIJA 5JI3E 5KQ8A 3VKHA 2YR0A 5IT9S 3HHWA 3LW5F 2CEAA 2MJ5B 1NJFA 2DKLA 2DNAA 2KA6B 3VK8A 1FJGM 2LWXA 2I7PA 1JB0F 4DV6M 2QZ4A 3DFZA 4GC5A 4GMQA 1W5TA 1XXHB 2LHGA 1SXJC 1NNJA 4XK8F 4Z8XA 3QAUA 4LCBA 2QSFX 3GLIA 1R2YA 2MH8A 4DR2M 4RF0A 2YQZA 4IJFA 2Z4RA 2F5OA 3D8BA 3IG5A 4IJEA 4QOZC 2HWJA 2RKOA 3AL0C 4NC6A 4LY6A 3GP1A 1NV8A 1NHGC 2DAKA 1N77A 2DAEA 3KXEC 3J80S 3ZC7B 1LV7A 5FTMA 3GPUA 2QBYA 4B7GA 4AKIA 1OIPA 3KOXE 4IBEA 3SARA 1E32A 4RF1A 1SXJE 3KDSE 2JUJA 4LGMA 4JV5M 2LNHC 2L6OA 3L27A 1I4WA 3TWKA 4DV1M 3TWLA 4FCTA 2EA0A 2JP7A 1TTEA 1NY6A 1GO5A 2AHMA 4RNAA 1X37A 2BJVA 3J7BA 4NXMM 1VQ1A 1WHCA 4LFBM 4WURA 3FUVA 4GITA 1XXHA 3L29A 4EIWA 4ANRA 4FWGA 4OX9M 3TL4X 3KOWE 3U6PA 2UUBM
chains in the Genus database with same CATH topology
3I4YA 4G4NA 2Y21A 4LFAM 3SAUA 2XSZA 3T1YM 2V1UA 4NL4H 1YUBA 3FUUA 2R4EA 3GQ4A 1XNQM 2L09A 4IBGA 1NVMA 5IWAM 1HQCA 3NBIA 4FD2A 4DV5M 4LG2A 3GLFA 1YE9A 3HGIA 4PDIA 3DOAA 5H37D 2RGHA 1K3XA 3PNVA 3M6AA 2KXEA 2VQEM 2ZM6M 1PM5A 4MB7A 1G3IA 1QVRA 4LJ7A 3M0EA 4XGIA 2C9OA 1PJIA 1OFHA 5EP3A 4OU7A 2DWLA 5DYIA 1DGHB 1IBLM 4GHAA 1HT1E 3DA1A 3L2AA 4FCVA 3GLFB 3GRYA 4DV2M 1IY0A 1TDZA 1HQYE 3WHKA 3SAVA 1S3SA 2M60A 3LQRA 1N34M 1MU5A 2R4JA 8CATA 3U5ZA 1L2BA 2D7GA 3SMSA 2KEBA 3MK6A 4IIWA 2C99A 3THGA 3E9SA 1HNZM 4G4OA 1OJLA 1L1ZA 1Z59A 5EJCA 2FNAA 3A45A 1YSYA 3FUXA 4DV3M 4LJ4A 4LF5M 4B08A 3GO8A 4L15A 1Z5CA 2D7EA 3FTDA 1DO2A 1JR3A 2XGNA 2CHQA 2X49A 3J27B 4CGYB 3GQ3A 1IXZA 1TGUA 3PVSA 4JXJA 3JR5A 2XSZD 1Z5BA 1QAMA 3GPPA 3U6LA 4NOOB 4M9ZA 1NJGA 4NSOB 3MJ5A 5EP2A 4YHHM 3GRVA 3ZCBB 3AKZA 2G8LA 3SFZA 3CF2A 1N75A 2V6ZM 2XFTA 3GPYA 4NRWA 3L25A 4L78A 4FVMA 2CUZA 3DZDA 5ITUA 5DYGA 1ZQ9A 2LH0A 2Q2EB 1DGBA 3L26A 4DUYM 2OQ4A 1K3WA 4P16A 4DUZM 3GLGA 5EXXA 2R45A 5KO3A 2X4AA 3KW6A 4D80A 3U6DA 2C98A 3Q8XA 4X62M 2XFSA 4OW0A 5F3WA 1XMQM 3PNYA 2OPFA 1NY5A 3HJSA 4DR7M 3UGJA 3K8ZA 2F5NA 1IN6A 3KOYE 5BR8M 4S12A 3UMMA 2DHRA 3AOEA 1QAQA 4M9XA 2HCBA 1N36M 4PDGA 4AQYM 2C9CA 1DGFA 5FTLA 2UUAM 5ITXE 3HJQA 2G5GX 3HHYA 1D2NA 1GKIA 3HU1A 2BJWA 5FTJA 2I7NA 4KLNA 3LVWA 4NSRA 1GL6A 4GIPA 5KPTA 4JI3M 1HNWM 2QENA 3W0LB 3ZH9B 2CV0A 3GRUA 4JI5M 4BBAA 4GHLA 4IBFA 1IN7A 2XF3A 3K1JA 2L7IA 3L28A 1IN8A 3SHGB 3T15A 3VDUA 3U6MA 4MH0E 1HNXM 5C18A 4B3RM 2DZNB 5E26A 4DR4M 1TH2A 3K92A 2K47A 5ITQA 5ITRA 4MGIE 4II7A 4OVZA 1Q39A 1PJJA 3FKEA 4M9SA 4W5WA 4L16A 5C1BA 3WHLA 1IN5A 3NWLA 3T1HM 4PD2A 1J7KA 2KZUA 2XH9A 4JI0M 4M0DA 4GH9A 2LXEA 4DR1M 2QBYB 4FCWA 1OFIA 2X8AA 2YNMD 3GRRA 1Z6TA 1GVNA 3GLHB 4GKJM 3MHVC 1KSFX 3IG8A 4LFCM 3EIEA 3J81S 4DR5M 2XZFA 3SC3A 2FE8A 4L4UA 4REZA 2FFJA 4MGKE 3FYCA 3AFHA 4IBJA 4X65M 3SBJA 1N32M 1N78A 1Q3BA 4QHSA 4B3TM 3GLGB 2HKJA 4B7HA 3PFIA 3LVVA 3RGSA 3U6OA 1IY1A 4G6ZA 3U60A 2W82A 5IZ7D 3KFUG 3T38A 4MGHA 2D7HA 2KRUA 4LJ6A 3JAMS 1HR0M 4IBCA 3AOGA 2CE7A 4LF7M 4NXNM 4AG6A 3TQSA 4HLQA 4X66M 2XLJA 1I94M 3CTWB 4G4QA 3HHZA 2R62A 5EXSA 5EP4A 1SXJA 3A98B 2XZUA 2BNKA 3CF0A 2ZBKB 3KP0E 2ZANA 2Z4SA 3CF6E 1SXJB 4QOSA 3HKPA 1DO0A 2V1CA 3BOSA 4AG5A 2J7OA 3K2LA 3U6EA 3HWSA 4JN6A 2R65A 1ZAEA 1JR3D 4D81A 4NRVA 1G8PA 3U5ZB 1MX0A 3SYLA 4JI4M 3FTFA 3HHXA 2UXCM 3AOEC 2KRKA 2EO2A 2R18A 2CHGA 3M7GA 4LRSA 2O5RA 1L2CA 4QHTA 2F5SA 4DV0M 4DV4M 4X64M 4LZZA 2UUCM 4IBBA 4BLCA 2KZSA 4KHPM 2CV1A 2QPAA 3HJ8A 4IBKA 1TH4A 4B3SM 2NQ8C 4DR6M 5FTKA 3FTEA 2FOIC 3SMPA 1E9RA 4LJ5A 5JI2E 1KFVA 1XWIA 1IXSB 4HL4A 1DGGA 4I8OA 2JA2A 1IXRC 2H1RA 3FYDA 1XMOM 1GL7A 5E6JA 3GPXA 3ILKA 1TH3A 4GRIA 4IBIA 3RGPA 3LMMA 4JI1M 3KP1E 4I5SA 3FD9A 4MM3B 4I81A 1Q3CA 3HU2A 2F5PA 3R9XB 3FTCA 1NSFA 4AI6A 3A42A 2HHHM 2CFOA 1SXJD 4R7GA 1TDHA 2J7NA 5EQTA 3U6SA 3UZUA 4BB9A 4AZFA 1KYIA 5FSWA 1QYRA 4QNRA 1UM8A 5EXPA 1JQJC 4A3VB 4CHTB 3SATA 1J09A 2XEPA 1XC8A 2C5RA 4KO8A 4AKGA 1QQWA 1VDDA 5DNYA 1IM2A 3LQQA 2YFQA 2DWNA 4KODA 1E9SA 1Z5AA 2Z3XA 4JI2M 3W0FA 3A46A 2UU9M 4LF4M 3J2PB 1WXQA 3QWLA 3U61B 2HL7A 5FLXS 4I4LA 3FUTA 3RFWA 4D82A 1E94E 4GKKM 1L8QA 2L7HA 4G4RA 4JI7M 3U6QA 1T3TA 4FWHA 1DGHA 3RE8A 3VK7A 5LMNM 3SHFA 3JR4A 5BPVA 1QAOA 3HU3A 3B9PA 4AKHA 3SAWA 3R8FA 5ITYA 5KPRA 2Y20A 3KSXA 1H6UA 1C1KA 2UXDM 3FUWA 5LMUM 4DR3M 3AV0A 3TWMA 4ZPXA 4MGYE 2A5YB 2DVWB 3H4MA 3SASA 4AW4A 5A2QS 1L1TA 2VQFM 1G59A 3GQ5A 3KS8A 2DWMA 3VDPA 2RGOA 3E4RA 4OVZB 4LF8M 3VKGA 1G4AE 2R46A 4FWDA 4LRTA 4WW0A 3VFDA 3VLFB 5KQDA 5ITTA 4LF6M 5EXTA 1XNRM 1ORYB 2KW0A 4K0KM 3KS4A 1J5EM 2C96A 3PXGA 3KOZE 1QZMA 4L8RC 3TPZA 4LF9M 2VIIA 2ZAOA 3I51A 2DXIA 4B3MM 3UJNA 2M5ZA 4M0WA 4PCZA 1HT2E 2EUCA 5IREB 1G41A 4YY3M 7CATA 2ERCA 4LZJA 4R3DA 5ITXA 5FTNA 2CV2A 3C58A 2F5QA 1IQPA 3AJIB 2E5LM 3U61A 1IN4A 3KVWA 2F4VM 2P5TA 4IBDA 2QP9X 2ZAMA 4JI8M 5KPZA 1IY2A 1NNUC 4MGZE 3EIHA 2QCUA 4Z6YA 3OTOM 1L2DA 1NHWC 3U6CA 1N33M 1IBMM 3D8LA 4LJ9A 1R6BX 3UK6A 4QNMA 4DV7M 1W5SA 4B7FA 3GLIB 4XBOA 4JI6M 2UXBM 3KSJA 5EP1A 4JYAM 2Y0TA 1QANA 3GLHA 4FW9A 1GLNA 3SYKA 3TE6A 3J7AS 4ITQA 3I4VA 2Y0QA 5GKNA 2DWZB 4LJAA 1IBKM 4LJ8A 1K82A 4TUWA 4PT5A 2CHVA 1XHBA 2DZOB 4LGYA 3U60B 1R2ZA 4CISA 1EE8A 1R7RA 2Z7JA 1FNNA 4GC9A 5JI3E 5KQ8A 3VKHA 2YR0A 5IT9S 3HHWA 2CEAA 1NJFA 2KA6B 3VK8A 1FJGM 2LWXA 2I7PA 4DV6M 2QZ4A 4GC5A 3DFZA 4GMQA 1W5TA 1XXHB 1NNJA 1SXJC 4Z8XA 3QAUA 4LCBA 3GLIA 1R2YA 4DR2M 4RF0A 2YQZA 4IJFA 2Z4RA 2F5OA 3D8BA 3IG5A 4IJEA 4QOZC 2RKOA 3AL0C 4LY6A 3GP1A 1NHGC 1N77A 3J80S 3KXEC 3ZC7B 1LV7A 5FTMA 3GPUA 2QBYA 4B7GA 4AKIA 3KOXE 4IBEA 3SARA 1E32A 4RF1A 1SXJE 3KDSE 4LGMA 4JV5M 2LNHC 2L6OA 3L27A 1I4WA 3TWKA 4DV1M 3TWLA 4FCTA 2EA0A 1NY6A 2AHMA 4RNAA 1X37A 2BJVA 3J7BA 4NXMM 4LFBM 4WURA 3FUVA 4GITA 1XXHA 3L29A 4EIWA 4FWGA 4OX9M 3TL4X 3KOWE 3U6PA 2UUBM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOI C;  1NHW C;  2NQ8 C;  1NNU C;  1NHG C; 
#chains in the Genus database with same CATH topology
 3I4Y A;  4G4N A;  2Y21 A;  4LFA M;  3SAU A;  1ZMW A;  2DAG A;  2XSZ A;  3T1Y M;  2V1U A;  4NL4 H;  1YUB A;  3FUU A;  2R4E A;  3GQ4 A;  3T6P A;  2L09 A;  1XNQ M;  4IBG A;  2CP8 A;  1NVM A;  5IWA M;  1OQY A;  1HQC A;  3NBI A;  4FD2 A;  4DV5 M;  4LG2 A;  1T43 A;  3GLF A;  1YE9 A;  1P3Q Q;  2L2D A;  3HGI A;  4PDI A;  2QQ8 A;  3B74 A;  3DOA A;  2LVN C;  5H37 D;  2RGH A;  1VEG A;  1K3X A;  2APL A;  3PNV A;  3M6A A;  2KXE A;  2VQE M;  2CWB A;  4CIZ A;  2ZM6 M;  1PM5 A;  2BWB A;  4MB7 A;  2JY5 A;  3BXW A;  1G3I A;  1QVR A;  4LJ7 A;  3M0E A;  4XGI A;  2C9O A;  1PJI A;  1QDT A;  1OFH A;  5EP3 A;  4OU7 A;  2DWL A;  5DYI A;  1VG5 A;  1DGH B;  1IBL M;  4GHA A;  1Q02 A;  1CUK A;  1HT1 E;  2KNZ A;  3DA1 A;  3L2A A;  4FCV A;  4Y28 F;  3GRY A;  3GLF B;  4DV2 M;  1IY0 A;  1TDZ A;  1HQY E;  3B89 A;  3WHK A;  2QNJ A;  3SAV A;  1S3S A;  2M60 A;  3LQR A;  5L8R F;  1N34 M;  1MU5 A;  2R4J A;  2KNV A;  8CAT A;  3U5Z A;  1L2B A;  2D7G A;  3SMS A;  2KEB A;  3MK6 A;  4IIW A;  2C99 A;  3THG A;  3FE3 A;  3E9S A;  2B3T A;  1HNZ M;  4G4O A;  1OJL A;  1L1Z A;  1PJS A;  1QZE A;  1Z59 A;  2EKK A;  2LHC A;  1R5L A;  5EJC A;  1G71 A;  2FNA A;  3A45 A;  1YSY A;  3FUX A;  4DV3 M;  1YLA A;  4LJ4 A;  4LF5 M;  4B08 A;  3GO8 A;  4L15 A;  1Z5C A;  2D7E A;  3FTD A;  1DO2 A;  1JR3 A;  2XGN A;  2CHQ A;  2X49 A;  3J27 B;  4CGY B;  3GQ3 A;  1IXZ A;  1TGU A;  2WSC F;  2ZTD A;  3PVS A;  4JXJ A;  3JR5 A;  2XSZ D;  1Z5B A;  1QAM A;  1QUT A;  2K0B X;  3GPP A;  3U6L A;  4NOO B;  2LVO C;  4M9Z A;  4GEW A;  1NJG A;  4NSO B;  3MJ5 A;  5EP2 A;  4YHH M;  3GRV A;  3ZCB B;  3AKZ A;  2G8L A;  3SFZ A;  3CF2 A;  1N75 A;  2V6Z M;  2XFT A;  3GPY A;  2VDB B;  4NRW A;  3L25 A;  4L78 A;  1GAB A;  2JZ1 A;  4FVM A;  2CUZ A;  3DZD A;  5ITU A;  1A5T A;  3HX3 A;  5DYG A;  1ZQ9 A;  2LH0 A;  2Q2E B;  1DGB A;  3L26 A;  4DUY M;  2OQ4 A;  1K3W A;  4P16 A;  4KT0 F;  4DUZ M;  3GLG A;  5EXX A;  2R45 A;  5KO3 A;  1D0M A;  4L6V 6;  2X4A A;  3KW6 A;  4D80 A;  3U6D A;  2C98 A;  3Q8X A;  2WSE F;  4X62 M;  2QHO B;  2XFS A;  4OW0 A;  2CRU A;  5F3W A;  1XMQ M;  3PNY A;  1NO1 A;  2OPF A;  1NY5 A;  3HJS A;  4DR7 M;  3UGJ A;  3K8Z A;  2F5N A;  1IN6 A;  3KOY E;  5BR8 M;  2VF8 A;  4S12 A;  3W68 A;  3UMM A;  1GJS A;  2DHR A;  1ZV1 A;  1QAQ A;  3AOE A;  2HCB A;  4M9X A;  1N36 M;  1OAO C;  4PDG A;  4AQY M;  3Q8G A;  1D0K A;  1DGF A;  1D0L A;  1HJP A;  2C9C A;  5FTL A;  3HJQ A;  5ITX E;  3GLG E;  2UUA M;  2G5G X;  3HHY A;  1D2N A;  1GKI A;  2OOA A;  3HU1 A;  2BJW A;  5FTJ A;  3K9O A;  2I7N A;  2MGW A;  4KLN A;  3LVW A;  4NSR A;  1GL6 A;  4GIP A;  5KPT A;  1BVS A;  4JI3 M;  1HNW M;  2QEN A;  4UN2 B;  3W0L B;  2OOB A;  2DZL A;  3GRU A;  3ZH9 B;  2CV0 A;  4BBA A;  4JI5 M;  4IBF A;  1IN7 A;  4GHL A;  1TF0 B;  2XF3 A;  2L7I A;  3K1J A;  1IN8 A;  3L28 A;  4F2L A;  2GQF A;  3SHG B;  3T15 A;  3VDU A;  3U6M A;  2R44 A;  4MH0 E;  1HNX M;  5C18 A;  4B3R M;  2DZN B;  5E26 A;  3W67 A;  4DR4 M;  1TH2 A;  3K92 A;  2K47 A;  5ITQ A;  5ITR A;  4F1I A;  2FS1 A;  4MGI E;  4II7 A;  2FH0 A;  4OVZ A;  1Q39 A;  2WZJ A;  1PJJ A;  3FKE A;  1VEJ A;  4M9S A;  4W5W A;  4L16 A;  5C1B A;  3WHL A;  1IN5 A;  3NWL A;  3T1H M;  4PD2 A;  1J7K A;  2KZU A;  3GLF E;  2XH9 A;  4JI0 M;  2VF7 A;  3C9P A;  4GH9 A;  2LXE A;  4M0D A;  4DR1 M;  2QBY B;  4FCW A;  1OFI A;  2X8A A;  2YNM D;  3GRR A;  3GLH E;  1Z6T A;  1GVN A;  3GLH B;  4GKJ M;  4DBG B;  1V34 A;  3MHV C;  1KSF X;  3IG8 A;  4LFC M;  3EIE A;  3J81 S;  4DR5 M;  2XZF A;  3SC3 A;  2FE8 A;  4L4U A;  4REZ A;  1OIZ A;  2FFJ A;  4MGK E;  3FYC A;  3AFH A;  4IBJ A;  4X65 M;  3SBJ A;  1N32 M;  1N78 A;  1Q3B A;  4QHS A;  2Z8Y M;  4B3T M;  3GLG B;  2HKJ A;  4B7H A;  3PFI A;  3LVV A;  3MMP A;  4RKU F;  3RGS A;  3U6O A;  1OAI A;  1IY1 A;  4G6Z A;  3BBZ A;  3U60 A;  2W82 A;  5IZ7 D;  3KFU G;  3T38 A;  4MGH A;  2D7H A;  2MRO B;  2R6F A;  2KRU A;  3HY5 A;  4LJ6 A;  3JAM S;  1HR0 M;  4IBC A;  2JZ0 A;  3AOG A;  2CE7 A;  4LF7 M;  4NXN M;  4AG6 A;  3TQS A;  4HLQ A;  2MR9 A;  3K9P A;  4X66 M;  2XLJ A;  1I94 M;  3CTW B;  3I01 M;  4G4Q A;  3HHZ A;  2R62 A;  5EXS A;  1V92 A;  5EP4 A;  1SXJ A;  3A98 B;  2XZU A;  2BNK A;  1PJQ A;  3CF0 A;  2ZBK B;  3KP0 E;  2HAK A;  2ZAN A;  2Z4S A;  3CF6 E;  1SXJ B;  4QOS A;  3HKP A;  1DO0 A;  2V1C A;  3BOS A;  4AG5 A;  2J7O A;  3K2L A;  3U6E A;  3HWS A;  3B7Q A;  4JN6 A;  2R65 A;  1ZAE A;  3IEC A;  1JR3 D;  2JY7 A;  4D81 A;  4NRV A;  1T6O A;  1WIV A;  1G8P A;  3U5Z B;  1MX0 A;  3SYL A;  4JI4 M;  3FTF A;  1GJT A;  3HHX A;  2UXC M;  3AOE C;  2KRK A;  2EO2 A;  2R18 A;  2CHG A;  3M7G A;  2LVQ D;  2O5R A;  4LRS A;  1L2C A;  4QHT A;  2F5S A;  4DV0 M;  2O01 F;  4DV4 M;  4X64 M;  4LZZ A;  3I04 M;  4IBB A;  2UUC M;  4BLC A;  2DI0 A;  2KZS A;  4KHP M;  2CV1 A;  2QPA A;  3HJ8 A;  4IBK A;  1TH4 A;  4B3S M;  2NQ8 C;  2DAM A;  3QYE A;  4DR6 M;  5FTK A;  1MJG M;  3H4J A;  3FTE A;  2FOI C;  3SMP A;  1E9R A;  4LJ5 A;  5JI2 E;  1KFV A;  1XWI A;  1IXS B;  4HL4 A;  1DGG A;  2BWE A;  4I8O A;  3HZJ A;  2JA2 A;  1IXR C;  2K6B A;  2H1R A;  3FYD A;  1XMO M;  1GL7 A;  5E6J A;  3GPX A;  2RRU A;  3ILK A;  1TH3 A;  4GRI A;  4IBI A;  2JY6 B;  3RGP A;  2ZTC A;  3C3D A;  3LMM A;  4JI1 M;  3KP1 E;  4I5S A;  3FD9 A;  1PRB A;  1VEK A;  4MM3 B;  4I81 A;  1EFU B;  1Q3C A;  2WSF F;  2H5X A;  3HU2 A;  2F5P A;  3B7Z A;  3FTC A;  1NSF A;  3R9X B;  3GLI E;  4AI6 A;  3A42 A;  2L4F A;  2HHH M;  2CFO A;  1SXJ D;  4R7G A;  1TDH A;  1IXS A;  2J7N A;  5EQT A;  3U6S A;  3UZU A;  4BB9 A;  5DFL A;  4AZF A;  1KYI A;  5FSW A;  1QYR A;  4QNR A;  1AUA A;  1UM8 A;  5EXP A;  1DV0 A;  1JQJ C;  2JNH A;  1R4G A;  4A3V B;  4CHT B;  3SAT A;  1J09 A;  2XEP A;  3E46 A;  1XC8 A;  3LCV B;  2C5R A;  4KO8 A;  4AKG A;  1QQW A;  1VDD A;  5DNY A;  1IM2 A;  1WGL A;  3LQQ A;  2YFQ A;  2DWN A;  1JR3 E;  1E9S A;  1Z5A A;  2JY8 A;  3QYB A;  2J5Y A;  4KOD A;  3W0F A;  2Z3X A;  1MN3 A;  3A46 A;  2UU9 M;  4JI2 M;  3J2P B;  4LF4 M;  1Y8G A;  1ZMV A;  1WXQ A;  3QWL A;  2JWS A;  2HL7 A;  3U61 B;  5FLX S;  3B7N A;  4I4L A;  4P17 A;  3FUT A;  3RFW A;  3IHP A;  1E94 E;  4D82 A;  4GKK M;  1L8Q A;  2L7H A;  4G4R A;  4JI7 M;  1PGY A;  1VDL A;  3U6Q A;  1T3T A;  2DAI A;  4FWH A;  1DGH A;  3RE8 A;  3VK7 A;  5LMN M;  3SHF A;  3JR4 A;  5BPV A;  1QAO A;  1XB2 B;  3CGW A;  4CJ6 A;  3HU3 A;  2KNA A;  3B9P A;  4Q7J A;  4AKH A;  1ZMU A;  3SAW A;  3R8F A;  5ITY A;  5KPR A;  2Y20 A;  3NBX X;  1H6U A;  1C1K A;  3KSX A;  2UXD M;  3FUW A;  2EJS A;  5LMU M;  4DR3 M;  3AV0 A;  3TWM A;  4G3O A;  4ZPX A;  4MGY E;  1QUS A;  2A5Y B;  2DVW B;  3H4M A;  3SAS A;  3FRH A;  1SG9 A;  4AW4 A;  5A2Q S;  2KDL A;  2O25 A;  1L1T A;  2VQF M;  2K9D A;  3LCU A;  1G59 A;  3GQ5 A;  3KS8 A;  2DWM A;  3VDP A;  2RGO A;  3E4R A;  4OVZ B;  2OO9 A;  4LF8 M;  3VKG A;  1G4A E;  2R46 A;  1LTM A;  1PJT A;  4FWD A;  4LRT A;  4WW0 A;  3VFD A;  3VLF B;  5KQD A;  5ITT A;  4LF6 M;  5EXT A;  1XNR M;  1ORY B;  2KW0 A;  4K0K M;  3KS4 A;  1J5E M;  2C96 A;  3PXG A;  3KOZ E;  2KHH A;  1QZM A;  4L8R C;  3TPZ A;  4HEO A;  4LF9 M;  2VII A;  2ZAO A;  3I51 A;  2DXI A;  4B3M M;  3UJN A;  1WJ7 A;  2M5Z A;  4M0W A;  1OKS A;  4PCZ A;  2R0I A;  1HT2 E;  2EUC A;  5IRE B;  1G41 A;  4YY3 M;  7CAT A;  2ERC A;  4LZJ A;  4R3D A;  5ITX A;  3F92 A;  5FTN A;  2CV2 A;  3C58 A;  2F5Q A;  2L4E A;  1IQP A;  1XXH E;  3C3E A;  3AJI B;  2E5L M;  4WP2 A;  2LBC A;  3E21 A;  3U61 A;  1AIP C;  1IN4 A;  3KVW A;  2F4V M;  2P5T A;  4IBD A;  3FRI A;  2DEN A;  2QP9 X;  2EKF A;  2ZAM A;  5KPZ A;  4JI8 M;  1OTR A;  1IY2 A;  1NNU C;  1WR1 B;  4MGZ E;  3EIH A;  2LVP C;  1RU3 A;  3V76 A;  2QCU A;  4Z6Y A;  3OTO M;  1L2D A;  1NHW C;  3U6C A;  1N33 M;  1IBM M;  3D8L A;  2GNO A;  1R6B X;  4LJ9 A;  3UK6 A;  1C7Y A;  4QNM A;  4DV7 M;  1W5S A;  4B7F A;  3GLI B;  4XBO A;  2LTU A;  4JI6 M;  2UXB M;  3KSJ A;  1F4I A;  2N35 A;  5EP1 A;  1V33 A;  4JYA M;  2Y0T A;  1QAN A;  1TR8 A;  1NV9 A;  2JXN A;  3GLH A;  1IFY A;  1WGN A;  4FW9 A;  1GLN A;  2DHY A;  3SYK A;  3TE6 A;  3J7A S;  1UFZ A;  4ITQ A;  3I4V A;  2G3Q A;  2Y0Q A;  3ZQJ A;  5GKN A;  2DWZ B;  4LJA A;  4R71 A;  1IBK M;  4LJ8 A;  1K82 A;  4TUW A;  1QDR A;  4PT5 A;  2CHV A;  2LVA A;  1XHB A;  2DZO B;  4LGY A;  3U60 B;  1R2Z A;  4CIS A;  1EE8 A;  1R7R A;  2Z7J A;  1FNN A;  4GC9 A;  1EIJ A;  5JI3 E;  5KQ8 A;  3VKH A;  2YR0 A;  5IT9 S;  3HHW A;  3LW5 F;  2CEA A;  2MJ5 B;  1NJF A;  2DKL A;  2DNA A;  2KA6 B;  3VK8 A;  1FJG M;  2LWX A;  2I7P A;  1JB0 F;  4DV6 M;  2QZ4 A;  3DFZ A;  4GC5 A;  4GMQ A;  1W5T A;  1XXH B;  2LHG A;  1SXJ C;  1NNJ A;  4XK8 F;  4Z8X A;  3QAU A;  4LCB A;  2QSF X;  3GLI A;  1R2Y A;  2MH8 A;  4DR2 M;  4RF0 A;  2YQZ A;  4IJF A;  2Z4R A;  2F5O A;  3D8B A;  3IG5 A;  4IJE A;  4QOZ C;  2HWJ A;  2RKO A;  3AL0 C;  4NC6 A;  4LY6 A;  3GP1 A;  1NV8 A;  1NHG C;  2DAK A;  1N77 A;  2DAE A;  3KXE C;  3J80 S;  3ZC7 B;  1LV7 A;  5FTM A;  3GPU A;  2QBY A;  4B7G A;  4AKI A;  1OIP A;  3KOX E;  4IBE A;  3SAR A;  1E32 A;  4RF1 A;  1SXJ E;  3KDS E;  2JUJ A;  4LGM A;  4JV5 M;  2LNH C;  2L6O A;  3L27 A;  1I4W A;  3TWK A;  4DV1 M;  3TWL A;  4FCT A;  2EA0 A;  2JP7 A;  1TTE A;  1NY6 A;  1GO5 A;  2AHM A;  4RNA A;  1X37 A;  2BJV A;  3J7B A;  4NXM M;  1VQ1 A;  1WHC A;  4LFB M;  4WUR A;  3FUV A;  4GIT A;  1XXH A;  3L29 A;  4EIW A;  4ANR A;  4FWG A;  4OX9 M;  3TL4 X;  3KOW E;  3U6P A;  2UUB M; 
#chains in the Genus database with same CATH homology
 3I4Y A;  4G4N A;  2Y21 A;  4LFA M;  3SAU A;  2XSZ A;  3T1Y M;  2V1U A;  4NL4 H;  1YUB A;  3FUU A;  2R4E A;  3GQ4 A;  1XNQ M;  2L09 A;  4IBG A;  1NVM A;  5IWA M;  1HQC A;  3NBI A;  4FD2 A;  4DV5 M;  4LG2 A;  3GLF A;  1YE9 A;  3HGI A;  4PDI A;  3DOA A;  5H37 D;  2RGH A;  1K3X A;  3PNV A;  3M6A A;  2KXE A;  2VQE M;  2ZM6 M;  1PM5 A;  4MB7 A;  1G3I A;  1QVR A;  4LJ7 A;  3M0E A;  4XGI A;  2C9O A;  1PJI A;  1OFH A;  5EP3 A;  4OU7 A;  2DWL A;  5DYI A;  1DGH B;  1IBL M;  4GHA A;  1HT1 E;  3DA1 A;  3L2A A;  4FCV A;  3GLF B;  3GRY A;  4DV2 M;  1IY0 A;  1TDZ A;  1HQY E;  3WHK A;  3SAV A;  1S3S A;  2M60 A;  3LQR A;  1N34 M;  1MU5 A;  2R4J A;  8CAT A;  3U5Z A;  1L2B A;  2D7G A;  3SMS A;  2KEB A;  3MK6 A;  4IIW A;  2C99 A;  3THG A;  3E9S A;  1HNZ M;  4G4O A;  1OJL A;  1L1Z A;  1Z59 A;  5EJC A;  2FNA A;  3A45 A;  1YSY A;  3FUX A;  4DV3 M;  4LJ4 A;  4LF5 M;  4B08 A;  3GO8 A;  4L15 A;  1Z5C A;  2D7E A;  3FTD A;  1DO2 A;  1JR3 A;  2XGN A;  2CHQ A;  2X49 A;  3J27 B;  4CGY B;  3GQ3 A;  1IXZ A;  1TGU A;  3PVS A;  4JXJ A;  3JR5 A;  2XSZ D;  1Z5B A;  1QAM A;  3GPP A;  3U6L A;  4NOO B;  4M9Z A;  1NJG A;  4NSO B;  3MJ5 A;  5EP2 A;  4YHH M;  3GRV A;  3ZCB B;  3AKZ A;  2G8L A;  3SFZ A;  3CF2 A;  1N75 A;  2V6Z M;  2XFT A;  3GPY A;  4NRW A;  3L25 A;  4L78 A;  4FVM A;  2CUZ A;  3DZD A;  5ITU A;  5DYG A;  1ZQ9 A;  2LH0 A;  2Q2E B;  1DGB A;  3L26 A;  4DUY M;  2OQ4 A;  1K3W A;  4P16 A;  4DUZ M;  3GLG A;  5EXX A;  2R45 A;  5KO3 A;  2X4A A;  3KW6 A;  4D80 A;  3U6D A;  2C98 A;  3Q8X A;  4X62 M;  2XFS A;  4OW0 A;  5F3W A;  1XMQ M;  3PNY A;  2OPF A;  1NY5 A;  3HJS A;  4DR7 M;  3UGJ A;  3K8Z A;  2F5N A;  1IN6 A;  3KOY E;  5BR8 M;  4S12 A;  3UMM A;  2DHR A;  3AOE A;  1QAQ A;  4M9X A;  2HCB A;  1N36 M;  4PDG A;  4AQY M;  2C9C A;  1DGF A;  5FTL A;  2UUA M;  5ITX E;  3HJQ A;  2G5G X;  3HHY A;  1D2N A;  1GKI A;  3HU1 A;  2BJW A;  5FTJ A;  2I7N A;  4KLN A;  3LVW A;  4NSR A;  1GL6 A;  4GIP A;  5KPT A;  4JI3 M;  1HNW M;  2QEN A;  3W0L B;  3ZH9 B;  2CV0 A;  3GRU A;  4JI5 M;  4BBA A;  4GHL A;  4IBF A;  1IN7 A;  2XF3 A;  3K1J A;  2L7I A;  3L28 A;  1IN8 A;  3SHG B;  3T15 A;  3VDU A;  3U6M A;  4MH0 E;  1HNX M;  5C18 A;  4B3R M;  2DZN B;  5E26 A;  4DR4 M;  1TH2 A;  3K92 A;  2K47 A;  5ITQ A;  5ITR A;  4MGI E;  4II7 A;  4OVZ A;  1Q39 A;  1PJJ A;  3FKE A;  4M9S A;  4W5W A;  4L16 A;  5C1B A;  3WHL A;  1IN5 A;  3NWL A;  3T1H M;  4PD2 A;  1J7K A;  2KZU A;  2XH9 A;  4JI0 M;  4M0D A;  4GH9 A;  2LXE A;  4DR1 M;  2QBY B;  4FCW A;  1OFI A;  2X8A A;  2YNM D;  3GRR A;  1Z6T A;  1GVN A;  3GLH B;  4GKJ M;  3MHV C;  1KSF X;  3IG8 A;  4LFC M;  3EIE A;  3J81 S;  4DR5 M;  2XZF A;  3SC3 A;  2FE8 A;  4L4U A;  4REZ A;  2FFJ A;  4MGK E;  3FYC A;  3AFH A;  4IBJ A;  4X65 M;  3SBJ A;  1N32 M;  1N78 A;  1Q3B A;  4QHS A;  4B3T M;  3GLG B;  2HKJ A;  4B7H A;  3PFI A;  3LVV A;  3RGS A;  3U6O A;  1IY1 A;  4G6Z A;  3U60 A;  2W82 A;  5IZ7 D;  3KFU G;  3T38 A;  4MGH A;  2D7H A;  2KRU A;  4LJ6 A;  3JAM S;  1HR0 M;  4IBC A;  3AOG A;  2CE7 A;  4LF7 M;  4NXN M;  4AG6 A;  3TQS A;  4HLQ A;  4X66 M;  2XLJ A;  1I94 M;  3CTW B;  4G4Q A;  3HHZ A;  2R62 A;  5EXS A;  5EP4 A;  1SXJ A;  3A98 B;  2XZU A;  2BNK A;  3CF0 A;  2ZBK B;  3KP0 E;  2ZAN A;  2Z4S A;  3CF6 E;  1SXJ B;  4QOS A;  3HKP A;  1DO0 A;  2V1C A;  3BOS A;  4AG5 A;  2J7O A;  3K2L A;  3U6E A;  3HWS A;  4JN6 A;  2R65 A;  1ZAE A;  1JR3 D;  4D81 A;  4NRV A;  1G8P A;  3U5Z B;  1MX0 A;  3SYL A;  4JI4 M;  3FTF A;  3HHX A;  2UXC M;  3AOE C;  2KRK A;  2EO2 A;  2R18 A;  2CHG A;  3M7G A;  4LRS A;  2O5R A;  1L2C A;  4QHT A;  2F5S A;  4DV0 M;  4DV4 M;  4X64 M;  4LZZ A;  2UUC M;  4IBB A;  4BLC A;  2KZS A;  4KHP M;  2CV1 A;  2QPA A;  3HJ8 A;  4IBK A;  1TH4 A;  4B3S M;  2NQ8 C;  4DR6 M;  5FTK A;  3FTE A;  2FOI C;  3SMP A;  1E9R A;  4LJ5 A;  5JI2 E;  1KFV A;  1XWI A;  1IXS B;  4HL4 A;  1DGG A;  4I8O A;  2JA2 A;  1IXR C;  2H1R A;  3FYD A;  1XMO M;  1GL7 A;  5E6J A;  3GPX A;  3ILK A;  1TH3 A;  4GRI A;  4IBI A;  3RGP A;  3LMM A;  4JI1 M;  3KP1 E;  4I5S A;  3FD9 A;  4MM3 B;  4I81 A;  1Q3C A;  3HU2 A;  2F5P A;  3R9X B;  3FTC A;  1NSF A;  4AI6 A;  3A42 A;  2HHH M;  2CFO A;  1SXJ D;  4R7G A;  1TDH A;  2J7N A;  5EQT A;  3U6S A;  3UZU A;  4BB9 A;  4AZF A;  1KYI A;  5FSW A;  1QYR A;  4QNR A;  1UM8 A;  5EXP A;  1JQJ C;  4A3V B;  4CHT B;  3SAT A;  1J09 A;  2XEP A;  1XC8 A;  2C5R A;  4KO8 A;  4AKG A;  1QQW A;  1VDD A;  5DNY A;  1IM2 A;  3LQQ A;  2YFQ A;  2DWN A;  4KOD A;  1E9S A;  1Z5A A;  2Z3X A;  4JI2 M;  3W0F A;  3A46 A;  2UU9 M;  4LF4 M;  3J2P B;  1WXQ A;  3QWL A;  3U61 B;  2HL7 A;  5FLX S;  4I4L A;  3FUT A;  3RFW A;  4D82 A;  1E94 E;  4GKK M;  1L8Q A;  2L7H A;  4G4R A;  4JI7 M;  3U6Q A;  1T3T A;  4FWH A;  1DGH A;  3RE8 A;  3VK7 A;  5LMN M;  3SHF A;  3JR4 A;  5BPV A;  1QAO A;  3HU3 A;  3B9P A;  4AKH A;  3SAW A;  3R8F A;  5ITY A;  5KPR A;  2Y20 A;  3KSX A;  1H6U A;  1C1K A;  2UXD M;  3FUW A;  5LMU M;  4DR3 M;  3AV0 A;  3TWM A;  4ZPX A;  4MGY E;  2A5Y B;  2DVW B;  3H4M A;  3SAS A;  4AW4 A;  5A2Q S;  1L1T A;  2VQF M;  1G59 A;  3GQ5 A;  3KS8 A;  2DWM A;  3VDP A;  2RGO A;  3E4R A;  4OVZ B;  4LF8 M;  3VKG A;  1G4A E;  2R46 A;  4FWD A;  4LRT A;  4WW0 A;  3VFD A;  3VLF B;  5KQD A;  5ITT A;  4LF6 M;  5EXT A;  1XNR M;  1ORY B;  2KW0 A;  4K0K M;  3KS4 A;  1J5E M;  2C96 A;  3PXG A;  3KOZ E;  1QZM A;  4L8R C;  3TPZ A;  4LF9 M;  2VII A;  2ZAO A;  3I51 A;  2DXI A;  4B3M M;  3UJN A;  2M5Z A;  4M0W A;  4PCZ A;  1HT2 E;  2EUC A;  5IRE B;  1G41 A;  4YY3 M;  7CAT A;  2ERC A;  4LZJ A;  4R3D A;  5ITX A;  5FTN A;  2CV2 A;  3C58 A;  2F5Q A;  1IQP A;  3AJI B;  2E5L M;  3U61 A;  1IN4 A;  3KVW A;  2F4V M;  2P5T A;  4IBD A;  2QP9 X;  2ZAM A;  4JI8 M;  5KPZ A;  1IY2 A;  1NNU C;  4MGZ E;  3EIH A;  2QCU A;  4Z6Y A;  3OTO M;  1L2D A;  1NHW C;  3U6C A;  1N33 M;  1IBM M;  3D8L A;  4LJ9 A;  1R6B X;  3UK6 A;  4QNM A;  4DV7 M;  1W5S A;  4B7F A;  3GLI B;  4XBO A;  4JI6 M;  2UXB M;  3KSJ A;  5EP1 A;  4JYA M;  2Y0T A;  1QAN A;  3GLH A;  4FW9 A;  1GLN A;  3SYK A;  3TE6 A;  3J7A S;  4ITQ A;  3I4V A;  2Y0Q A;  5GKN A;  2DWZ B;  4LJA A;  1IBK M;  4LJ8 A;  1K82 A;  4TUW A;  4PT5 A;  2CHV A;  1XHB A;  2DZO B;  4LGY A;  3U60 B;  1R2Z A;  4CIS A;  1EE8 A;  1R7R A;  2Z7J A;  1FNN A;  4GC9 A;  5JI3 E;  5KQ8 A;  3VKH A;  2YR0 A;  5IT9 S;  3HHW A;  2CEA A;  1NJF A;  2KA6 B;  3VK8 A;  1FJG M;  2LWX A;  2I7P A;  4DV6 M;  2QZ4 A;  4GC5 A;  3DFZ A;  4GMQ A;  1W5T A;  1XXH B;  1NNJ A;  1SXJ C;  4Z8X A;  3QAU A;  4LCB A;  3GLI A;  1R2Y A;  4DR2 M;  4RF0 A;  2YQZ A;  4IJF A;  2Z4R A;  2F5O A;  3D8B A;  3IG5 A;  4IJE A;  4QOZ C;  2RKO A;  3AL0 C;  4LY6 A;  3GP1 A;  1NHG C;  1N77 A;  3J80 S;  3KXE C;  3ZC7 B;  1LV7 A;  5FTM A;  3GPU A;  2QBY A;  4B7G A;  4AKI A;  3KOX E;  4IBE A;  3SAR A;  1E32 A;  4RF1 A;  1SXJ E;  3KDS E;  4LGM A;  4JV5 M;  2LNH C;  2L6O A;  3L27 A;  1I4W A;  3TWK A;  4DV1 M;  3TWL A;  4FCT A;  2EA0 A;  1NY6 A;  2AHM A;  4RNA A;  1X37 A;  2BJV A;  3J7B A;  4NXM M;  4LFB M;  4WUR A;  3FUV A;  4GIT A;  1XXH A;  3L29 A;  4EIW A;  4FWG A;  4OX9 M;  3TL4 X;  3KOW E;  3U6P A;  2UUB M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...