2NQ8C

Malarial enoyl acyl acp reductase bound with inh-nad adduct
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Enoyl-acyl carrier reductase
publication title X-ray structural analysis of Plasmodium falciparum enoyl acyl carrier protein reductase as a pathway toward the optimization of triclosan antimalarial efficacy
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 15
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2nq8C00
1NNUC 1NHGC 1NHWC 2NQ8C 2FOIC
chains in the Genus database with same CATH superfamily
2R6FA 2LH0A 4RF1A 1VEJA 4L6V6 7CATA 1XMOM 2LTUA 4LRTA 1DGFA 2N35A 5EJCA 2CV2A 4TUWA 3T38A 2LVPC 2JZ0A 4IBKA 2KDLA 2D7EA 3GLGB 1TR8A 2K9DA 2DWNA 1XXHE 4JI2M 3VK7A 3L26A 3U6DA 3UMMA 1G41A 3W0FA 3FYDA 2F5SA 3K9PA 4XBOA 4GKJM 2L7HA 1HQYE 1ZMVA 2QP9X 3DZDA 4DV0M 2YFQA 3SAVA 1IXZA 3HJ8A 2I7PA 1SXJE 5ITXE 1V33A 4LJ5A 3T6PA 5L8RF 1J7KA 3L27A 3I01M 1IN6A 1PGYA 3U6SA 4GC5A 4GKKM 4LGMA 4MH0E 4ITQA 2VDBB 4QHSA 3H4MA 4LF4M 4B7HA 2DAMA 1Q3BA 5C1BA 2QZ4A 5BR8M 1J5EM 5H37D 1C1KA 2Q2EB 4KLNA 3SFZA 4DR4M 3RE8A 4L78A 2VQEM 5EXPA 2KW0A 2EKFA 2NQ8C 1N36M 1V34A 2JP7A 2DAIA 3AOEC 3THGA 1X37A 1QUTA 3CTWB 4F1IA 2UXBM 4ZPXA 4HLQA 4I81A 3U6EA 4LJ6A 4WW0A 5E26A 5FTMA 5EXSA 4G3OA 2WZJA 3KOWE 3MHVC 3HX3A 1GLNA 2R65A 1Q3CA 4GIPA 4L16A 5KPRA 4OX9M 2XZUA 2Y20A 3CF2A 3TWLA 4IBFA 1D0KA 3VKHA 2UUBM 1ZV1A 3EIHA 3W0LB 3QAUA 3SASA 3E9SA 4AKHA 4AKGA 4GEWA 3J27B 4Z8XA 3SMPA 4EIWA 4FW9A 4JI3M 3GLIB 1CUKA 3KSXA 3UZUA 1QDTA 4IBBA 1GJSA 3FUUA 3BBZA 3MMPA 3NBXX 3W68A 4B3RM 1JR3D 2CRUA 4IBGA 3GLGA 1EE8A 1IN4A 4MGIE 3SHFA 1XMQM 4LFCM 1IN7A 2DVWB 4JI0M 1ZAEA 3GPYA 4KHPM 4OVZB 1DGHA 3FTEA 2F5QA 1OFIA 1QYRA 3FKEA 3K9OA 3RGSA 4R7GA 3KDSE 2F5OA 2EKKA 4LJ9A 1OIPA 3GLHB 2RGOA 4GHAA 2XFSA 1WIVA 1NVMA 2L4EA 2FOIC 2LVOC 2ZAOA 1NY6A 1QZEA 1I4WA 2L2DA 5FTKA 2R4EA 4FWGA 4NOOB 3UK6A 3VDPA 2F5PA 4JI6M 2X8AA 2J5YA 1L2CA 4JI1M 2CE7A 2FNAA 1TDHA 1OFHA 3LMMA 3U6QA 3ZC7B 1QZMA 1QDRA 1QAOA 1R7RA 2JUJA 3L28A 3LVVA 1TH2A 1N32M 4G4OA 4Q7JA 4YHHM 2JA2A 2K6BA 3HZJA 2KNVA 1E9RA 2DXIA 1YSYA 2FH0A 3AKZA 1L8QA 1IY2A 3ZCBB 2QHOB 1R4GA 4LF8M 2D7HA 2UUAM 1TGUA 3PNVA 3HHZA 3HJSA 5IWAM 2UXDM 3C58A 3U6MA 2UU9M 1P3QQ 3GRVA 2FFJA 4X62M 3JR4A 1NV8A 2LXEA 2ZTCA 1S3SA 2ERCA 4QOZC 1WR1B 3IECA 4FCTA 2KHHA 2DNAA 3GLFB 1IM2A 4QHTA 3GLIA 4S12A 1F4IA 2QENA 1AUAA 3FYCA 3GP1A 4DV3M 3CF0A 3U6OA 3CF6E 3B74A 3GRUA 4FWHA 1HNWM 5BPVA 3T15A 4NXMM 2DWLA 4M9XA 4JI8M 3SAWA 3I4VA 3GQ3A 3KVWA 3FE3A 4FD2A 2L6OA 4LY6A 4IBEA 1FNNA 2ZTDA 4LF7M 3W67A 2CV1A 1TF0B 3E46A 4Z6YA 3HHWA 2CUZA 3GLHA 3ILKA 3L29A 1R5LA 2G3QA 1Z5CA 3HWSA 1NJFA 2R62A 3JAMS 4W5WA 1E94E 3B7NA 3LW5F 1YUBA 1AIPC 4P16A 1R2ZA 3J2PB 1MU5A 3FUWA 2B3TA 1N75A 4G4NA 3T1HM 2EJSA 4G4QA 2OO9A 4A3VB 1QANA 1DGHB 4X65M 3A46A 2R44A 4KODA 4M0DA 3KS4A 4CIZA 1K82A 1XXHB 4LJ8A 1OAOC 1IFYA 2LVNC 3K1JA 2MGWA 4WP2A 3RFWA 4I8OA 2C5RA 5IZ7D 3KW6A 1SXJB 5FTNA 3DA1A 3M7GA 1TTEA 2C98A 2JWSA 3B89A 1PJQA 4LJ4A 5KPTA 4UN2B 1NY5A 1NHWC 2DHRA 1T3TA 3WHLA 3M0EA 2JZ1A 2FS1A 1N78A 1Z5BA 2DAKA 2ZANA 3B7QA 3B9PA 3VK8A 1J09A 1G8PA 1NJGA 4D81A 2Z7JA 2MJ5B 4IBIA 2L7IA 2KEBA 2APLA 5LMNM 1SG9A 4REZA 1ZQ9A 4II7A 3GLFA 1L2BA 2MH8A 2D7GA 3JR5A 3I4YA 3KFUG 3GRYA 5DYGA 4AI6A 4B3SM 1OAIA 5KO3A 1OTRA 5GKNA 2JY6B 3T1YM 3PXGA 3DFZA 3C9PA 4DR6M 3AFHA 2JY5A 2DZOB 4GH9A 3BOSA 3A98B 4I5SA 4OW0A 3QYBA 1E32A 4RKUF 2LWXA 1TH4A 2VF7A 5EXXA 2X49A 2G8LA 2W82A 2KZSA 3KOYE 1JQJC 2JXNA 3U6PA 4AKIA 5KPZA 4BLCA 3UGJA 2R0IA 4IBDA 2WSCF 4HL4A 4IIWA 4F2LA 1DGBA 2GQFA 4B3TM 1ZMWA 2BJWA 2YQZA 2BWBA 4ANRA 1JR3E 1VEKA 1XXHA 1Z59A 2XFTA 2DAGA 4DV7M 1HT1E 4DV6M 5F3WA 3KP0E 4D82A 1FJGM 1GVNA 2CHVA 3FUVA 1I94M 3AV0A 4LFAM 3LQQA 3SC3A 1SXJA 5ITXA 4JI5M 3NWLA 4DV5M 1OIZA 3IG8A 3E21A 1NNUC 3Q8XA 2OOAA 1Q02A 1UFZA 3FRHA 2XGNA 3HU2A 5ITRA 5A2QS 1MN3A 3LCVB 1NO1A 2P5TA 3I51A 2WSFF 4MM3B 3K8ZA 3HJQA 1N34M 2O25A 2QSFX 1LTMA 2CEAA 4MGZE 3A45A 3AOGA 2KNZA 2XSZD 4K0KM 1E9SA 2CHQA 3FUXA 3HU1A 4M9SA 3BXWA 2VQFM 3KS8A 2LHCA 3HKPA 4JYAM 3SYLA 4PD2A 4RNAA 4CGYB 4NRWA 2R46A 4LGYA 1IXSB 4B08A 4GHLA 3OTOM 2DI0A 2M60A 3GPXA 3U61B 4DV4M 4BBAA 2JY7A 2LHGA 5FLXS 3VLFB 2QBYB 3TL4X 4R71A 4MGKE 1GL7A 3IHPA 2YR0A 1L1TA 5E6JA 1YLAA 2HAKA 2X4AA 4MB7A 4AQYM 3L25A 4FWDA 3U6CA 2O01F 2RGHA 2DAEA 3UJNA 1JB0F 3H4JA 2CHGA 3U60B 1A5TA 2EO2A 2VF8A 4LJ7A 3TPZA 4DUYM 3J7BA 4NXNM 2E5LM 2BJVA 4QNMA 3KXEC 1WGNA 3KSJA 3FUTA 3VDUA 3K92A 1OQYA 4NL4H 3GQ4A 1PJTA 3AOEA 2CP8A 2DZNB 3DOAA 1HT2E 4IJEA 4BB9A 4R3DA 2QQ8A 2LNHC 4QNRA 2OQ4A 1HJPA 5EQTA 2QPAA 3HU3A 1WJ7A 1D0LA 2R18A 3J7AS 4L8RC 3SAUA 4XGIA 2R4JA 1XHBA 1VQ1A 3KOZE 2M5ZA 4NRVA 1H6UA 1PJIA 2ZBKB 3MK6A 5DNYA 1C7YA 1IXRC 2HCBA 1TDZA 1HQCA 1V92A 3TWKA 3B7ZA 3LQRA 5IREB 2C99A 4B7FA 1NNJA 5ITTA 2F5NA 5EP4A 1MX0A 2DZLA 2O5RA 5ITUA 4LZZA 3FTFA 3J81S 3AL0C 1Z6TA 1KYIA 2XSZA 3TE6A 2C9CA 2RKOA 4GC9A 1RU3A 1VEGA 5ITYA 2CWBA 2KXEA 2L4FA 4B7GA 3FTDA 3A42A 4MGHA 4X64M 1PM5A 2DWMA 2RRUA 4AZFA 1IY1A 2KNAA 2XH9A 1QQWA 3MJ5A 1SXJD 4DR5M 2BWEA 5EP1A 5KQ8A 1XNRM 2XZFA 1IXSA 3HHYA 3U61A 1D0MA 3GQ5A 1MJGM 3Q8GA 2Z3XA 4RF0A 2QBYA 1EFUB 3TWMA 2QNJA 2L09A 4IJFA 2J7NA 3TQSA 2HKJA 5DYIA 1Z5AA 1L2DA 2LBCA 3U5ZB 1L1ZA 2QCUA 4M0WA 5DFLA 3ZQJA 5JI3E 1W5TA 1XWIA 2GNOA 3D8LA 1EIJA 2DWZB 3HGIA 3SMSA 2OPFA 2Z4RA 3U60A 1XC8A 1OKSA 1GABA 4YY3M 1WGLA 1R6BX 2V6ZM 4FCWA 2XF3A 1GL6A 1K3WA 4M9ZA 4DV1M 1NHGC 4I4LA 4PT5A 4JI7M 3PNYA 1D2NA 2I7NA 2JNHA 2FE8A 1G3IA 2VIIA 2EUCA 3C3DA 1KSFX 3F92A 3L2AA 3WHKA 5FTLA 1QUSA 4CHTB 3C3EA 5FTJA 1DGGA 2WSEF 1G71A 3GRRA 3K2LA 4JV5M 1K3XA 2BNKA 3GPPA 3AJIB 4DR2M 1NSFA 3M6AA 3KP1E 5FSWA 1T43A 1NV9A 5C18A 2H5XA 2UXCM 2YNMD 3GLIE 4FVMA 2V1CA 2J7OA 3LVWA 4LJAA 2HHHM 5KQDA 3QWLA 3D8BA 4P17A 1HR0M 1QAQA 3V76A 2C96A 1QAMA 2KRUA 4L4UA 2Y0TA 3KOXE 1IBMM 3PVSA 2K0BX 3SYKA 3EIEA 4L15A 3FRIA 2CFOA 2V1UA 3GPUA 1IBKM 4D80A 4AG5A 4LG2A 4B3MM 3LCUA 4OU7A 3GLHE 1IN5A 8CATA 4G6ZA 5EXTA 1XB2B 2DKLA 1G4AE 3QYEA 2MROB 2K47A 4GITA 2MR9A 1YE9A 1IBLM 1HNZM 4LF5M 4DR3M 1HNXM 2G5GX 3ZH9B 4AW4A 2HL7A 2CV0A 1DO2A 4LZJA 3U5ZA 3HY5A 3SBJA 1IY0A 4LFBM 1BVSA 4GMQA 3VFDA 2LVQD 3FD9A 4DR7M 4LF6M 2C9OA 4FCVA 1XNQM 1KFVA 4KT0F 1UM8A 2H1RA 2R45A 3CGWA 2KRKA 4AG6A 4CJ6A 1WHCA 2DENA 3NBIA 4LCBA 1VDDA 4JXJA 1VDLA 1G59A 4WURA 2Z4SA 2HWJA 1PJSA 2Z8YM 5IT9S 3I04M 1GJTA 3HHXA 5EP2A 1QVRA 1GKIA 2UUCM 4PCZA 3VKGA 1ORYB 1PRBA 4X66M 2EA0A 1R2YA 4DBGB 4XK8F 3SHGB 3RGPA 1GO5A 4GRIA 1IQPA 1DO0A 3GO8A 4DV2M 4NSOB 3SARA 1DV0A 4G4RA 1N77A 1W5SA 4PDIA 3GLFE 4NSRA 2ZAMA 1Q39A 1PJJA 5LMUM 4LF9M 2F4VM 4PDGA 3J80S 1OJLA 4LRSA 1JR3A 3E4RA 5JI2E 3IG5A 2A5YB 2DHYA 2XEPA 4DR1M 3U6LA 2KA6B 1N33M 1IN8A 4JN6A 2AHMA 4KO8A 1VG5A 4HEOA 2XLJA 4JI4M 3R9XB 4MGYE 4NC6A 5ITQA 3R8FA 2JY8A 3SATA 1WXQA 1ZMUA 3PFIA 1TH3A 2LVAA 5EP3A 1SXJC 1Y8GA 3FTCA 4OVZA 2KZUA 4IBJA 2Y21A 4IBCA 4QOSA 4Y28F 1T6OA 2ZM6M 4CISA 2OOBA 2Y0QA 1LV7A 3GLGE 4DUZM
chains in the Genus database with same CATH topology
1XMOM 2LH0A 4RF1A 7CATA 4LRTA 1DGFA 5EJCA 2CV2A 4TUWA 3T38A 4IBKA 2D7EA 3GLGB 2DWNA 4JI2M 3VK7A 3L26A 3U6DA 3UMMA 1G41A 3W0FA 3FYDA 2F5SA 4XBOA 4GKJM 2L7HA 1HQYE 2QP9X 3DZDA 4DV0M 2YFQA 3SAVA 1IXZA 3HJ8A 2I7PA 1SXJE 5ITXE 4LJ5A 1J7KA 3L27A 1IN6A 3U6SA 4GC5A 4GKKM 4LGMA 4MH0E 4ITQA 4QHSA 3H4MA 4LF4M 4B7HA 1Q3BA 5C1BA 2QZ4A 5BR8M 1J5EM 5H37D 1C1KA 2Q2EB 4KLNA 3SFZA 4DR4M 3RE8A 4L78A 2VQEM 5EXPA 2KW0A 1N36M 2NQ8C 3AOEC 3THGA 1X37A 3CTWB 2UXBM 4ZPXA 4HLQA 4I81A 3U6EA 4LJ6A 4WW0A 5E26A 5FTMA 5EXSA 3KOWE 3MHVC 4L16A 1GLNA 2R65A 1Q3CA 4GIPA 5KPRA 4OX9M 1N78A 2XZUA 2Y20A 3CF2A 3TWLA 4IBFA 3VKHA 2UUBM 3W0LB 3EIHA 3SASA 3QAUA 3E9SA 4AKHA 4AKGA 3J27B 4Z8XA 3SMPA 4EIWA 4FW9A 4JI3M 3GLIB 3KSXA 3UZUA 4IBBA 3FUUA 4B3RM 1JR3D 4IBGA 3GLGA 1EE8A 1IN4A 4MGIE 3SHFA 1XMQM 4LFCM 1IN7A 2DVWB 4JI0M 1ZAEA 3GPYA 4KHPM 4OVZB 1DGHA 3FTEA 2F5QA 1OFIA 1QYRA 3FKEA 3RGSA 4R7GA 3KDSE 2F5OA 4LJ9A 3GLHB 2RGOA 4GHAA 2XFSA 2ZAOA 1NVMA 2FOIC 1NY6A 1I4WA 5FTKA 2R4EA 4FWGA 4NOOB 3UK6A 3VDPA 2F5PA 4JI6M 2X8AA 1L2CA 4JI1M 2CE7A 2FNAA 1TDHA 1OFHA 3LMMA 3U6QA 3ZC7B 1QZMA 3L28A 1QAOA 1R7RA 3LVVA 1TH2A 1N32M 4G4OA 4YHHM 2JA2A 1E9RA 2DXIA 1YSYA 3AKZA 1L8QA 1IY2A 3ZCBB 4LF8M 2D7HA 2UUAM 1TGUA 3PNVA 3HHZA 3HJSA 5IWAM 2UXDM 3C58A 3U6MA 2UU9M 3GRVA 2FFJA 4X62M 3JR4A 2LXEA 1S3SA 2ERCA 4QOZC 4FCTA 3GLFB 1IM2A 4QHTA 3GLIA 4S12A 2QENA 3FYCA 3GP1A 4DV3M 3CF0A 3U6OA 3CF6E 1HNWM 3GRUA 4FWHA 5BPVA 3T15A 4NXMM 2DWLA 4M9XA 4JI8M 3SAWA 3I4VA 3GQ3A 3KVWA 4FD2A 2L6OA 4LY6A 4IBEA 1FNNA 4LF7M 2CV1A 4Z6YA 3HHWA 2CUZA 3GLHA 3ILKA 3L29A 1Z5CA 3HWSA 1NJFA 2R62A 3JAMS 4W5WA 1E94E 4P16A 1YUBA 1R2ZA 3J2PB 1MU5A 3FUWA 1N75A 4G4NA 3T1HM 4G4QA 4A3VB 1QANA 1DGHB 4X65M 3A46A 4KODA 4M0DA 3KS4A 1K82A 1XXHB 4LJ8A 3K1JA 3RFWA 4I8OA 2C5RA 5IZ7D 3KW6A 1SXJB 5FTNA 3DA1A 3M7GA 2C98A 4LJ4A 5KPTA 1NY5A 1NHWC 2DHRA 1T3TA 3WHLA 3M0EA 1Z5BA 2ZANA 3B9PA 3VK8A 1J09A 1G8PA 1NJGA 4D81A 2Z7JA 4IBIA 2L7IA 2KEBA 5LMNM 4REZA 1ZQ9A 4II7A 3GLFA 1L2BA 2D7GA 3JR5A 3I4YA 3KFUG 3GRYA 5DYGA 4AI6A 4B3SM 5KO3A 5GKNA 3T1YM 3PXGA 3DFZA 4DR6M 3AFHA 2DZOB 4GH9A 3BOSA 3A98B 4I5SA 4OW0A 1E32A 2LWXA 1TH4A 5EXXA 2X49A 2G8LA 2W82A 2KZSA 3KOYE 1JQJC 3U6PA 4AKIA 5KPZA 4BLCA 3UGJA 4IBDA 4HL4A 4IIWA 1DGBA 4B3TM 2BJWA 2YQZA 1XXHA 1Z59A 2XFTA 4DV7M 1HT1E 4DV6M 5F3WA 3KP0E 4D82A 1FJGM 1GVNA 2CHVA 3FUVA 1I94M 3AV0A 4LFAM 3LQQA 3SC3A 1SXJA 5ITXA 4JI5M 3NWLA 4DV5M 3IG8A 1NNUC 3Q8XA 3HU2A 5ITRA 2XGNA 5A2QS 2P5TA 3I51A 4MM3B 3K8ZA 3HJQA 1N34M 2CEAA 4MGZE 3A45A 3AOGA 2XSZD 4K0KM 1E9SA 2CHQA 3FUXA 3HU1A 4M9SA 2VQFM 3KS8A 3HKPA 4JYAM 3SYLA 4PD2A 4RNAA 4CGYB 4NRWA 2R46A 4LGYA 1IXSB 4B08A 4GHLA 3OTOM 3U61B 2M60A 3GPXA 4DV4M 4BBAA 5FLXS 3VLFB 2QBYB 3TL4X 4MGKE 1GL7A 1L1TA 2YR0A 5E6JA 4MB7A 2X4AA 3L25A 4AQYM 4FWDA 3U6CA 2RGHA 3UJNA 2CHGA 3U60B 2E5LM 2EO2A 4LJ7A 3TPZA 4DUYM 3J7BA 4NXNM 2BJVA 4QNMA 3KXEC 3VDUA 3KSJA 3FUTA 3GQ4A 3K92A 4NL4H 3AOEA 2DZNB 3DOAA 1HT2E 4IJEA 4BB9A 4R3DA 2LNHC 4QNRA 2OQ4A 5EQTA 2QPAA 3HU3A 2R18A 3J7AS 4L8RC 3SAUA 4XGIA 2R4JA 1XHBA 3KOZE 2M5ZA 4NRVA 1H6UA 1PJIA 2ZBKB 3MK6A 5DNYA 1IXRC 2HCBA 1TDZA 1HQCA 3TWKA 5IREB 3LQRA 1NNJA 2C99A 4B7FA 5ITTA 2F5NA 5EP4A 1MX0A 2O5RA 5ITUA 4LZZA 3FTFA 3J81S 3AL0C 1Z6TA 1KYIA 2XSZA 3TE6A 2C9CA 2RKOA 4GC9A 5ITYA 2KXEA 4B7GA 3FTDA 3A42A 4MGHA 4X64M 1PM5A 2DWMA 4AZFA 1IY1A 2XH9A 1QQWA 3MJ5A 1SXJD 4DR5M 5EP1A 5KQ8A 1XNRM 2XZFA 3HHYA 3U61A 3GQ5A 2Z3XA 4RF0A 2QBYA 3TWMA 2L09A 4IJFA 2J7NA 3TQSA 2HKJA 5DYIA 1Z5AA 1L2DA 3U5ZB 1L1ZA 2QCUA 4M0WA 5JI3E 1W5TA 1XWIA 3D8LA 2DWZB 3HGIA 3SMSA 2OPFA 2Z4RA 3U60A 1XC8A 4YY3M 1R6BX 2V6ZM 4FCWA 2XF3A 1GL6A 1K3WA 4M9ZA 4DV1M 1NHGC 4I4LA 4PT5A 4JI7M 3PNYA 1D2NA 2I7NA 2FE8A 1G3IA 2VIIA 2EUCA 1KSFX 5FTLA 3L2AA 3WHKA 4CHTB 5FTJA 1DGGA 3GRRA 3K2LA 4JV5M 1K3XA 2BNKA 3GPPA 3AJIB 4DR2M 1NSFA 3M6AA 3KP1E 5FSWA 5C18A 2UXCM 2YNMD 4FVMA 2V1CA 2J7OA 3LVWA 4LJAA 2HHHM 5KQDA 3QWLA 3D8BA 1HR0M 1QAQA 2C96A 1QAMA 2KRUA 4L4UA 2Y0TA 3KOXE 1IBMM 3PVSA 3SYKA 3EIEA 4L15A 2CFOA 2V1UA 3GPUA 1IBKM 4D80A 4AG5A 4LG2A 4B3MM 4OU7A 1IN5A 8CATA 4G6ZA 5EXTA 1G4AE 2K47A 4GITA 1IBLM 1YE9A 1HNZM 4LF5M 4DR3M 1HNXM 2G5GX 3ZH9B 4AW4A 2HL7A 2CV0A 1DO2A 4LZJA 3U5ZA 3SBJA 1IY0A 4LFBM 4GMQA 3VFDA 3FD9A 4DR7M 4LF6M 2C9OA 4FCVA 1XNQM 1KFVA 1UM8A 2H1RA 2R45A 2KRKA 4AG6A 3NBIA 4LCBA 1VDDA 4JXJA 1G59A 4WURA 2Z4SA 5IT9S 3HHXA 5EP2A 1QVRA 1GKIA 2UUCM 4PCZA 3VKGA 1ORYB 4X66M 1R2YA 2EA0A 3SHGB 3RGPA 4GRIA 1IQPA 1DO0A 3GO8A 4DV2M 4NSOB 3SARA 4G4RA 1N77A 1W5SA 4PDIA 4NSRA 2ZAMA 1Q39A 1PJJA 5LMUM 4LF9M 2F4VM 4PDGA 3J80S 1OJLA 4LRSA 1JR3A 3E4RA 5JI2E 3IG5A 2A5YB 2XEPA 4DR1M 3U6LA 1N33M 2KA6B 1IN8A 4JN6A 2AHMA 4KO8A 4JI4M 2XLJA 3R9XB 4MGYE 5ITQA 3R8FA 3SATA 1WXQA 3PFIA 1TH3A 5EP3A 1SXJC 3FTCA 4OVZA 2KZUA 4IBJA 2Y21A 4IBCA 4QOSA 2ZM6M 4CISA 2Y0QA 1LV7A 4DUZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNU C;  1NHG C;  1NHW C;  2NQ8 C;  2FOI C; 
#chains in the Genus database with same CATH topology
 2R6F A;  2LH0 A;  4RF1 A;  1VEJ A;  4L6V 6;  7CAT A;  1XMO M;  2LTU A;  4LRT A;  1DGF A;  2N35 A;  5EJC A;  2CV2 A;  4TUW A;  3T38 A;  2LVP C;  2JZ0 A;  4IBK A;  2KDL A;  2D7E A;  3GLG B;  1TR8 A;  2K9D A;  2DWN A;  1XXH E;  4JI2 M;  3VK7 A;  3L26 A;  3U6D A;  3UMM A;  1G41 A;  3W0F A;  3FYD A;  2F5S A;  3K9P A;  4XBO A;  4GKJ M;  2L7H A;  1HQY E;  1ZMV A;  2QP9 X;  3DZD A;  4DV0 M;  2YFQ A;  3SAV A;  1IXZ A;  3HJ8 A;  2I7P A;  1SXJ E;  5ITX E;  1V33 A;  4LJ5 A;  3T6P A;  5L8R F;  1J7K A;  3L27 A;  3I01 M;  1IN6 A;  1PGY A;  3U6S A;  4GC5 A;  4GKK M;  4LGM A;  4MH0 E;  4ITQ A;  2VDB B;  4QHS A;  3H4M A;  4LF4 M;  4B7H A;  2DAM A;  1Q3B A;  5C1B A;  2QZ4 A;  5BR8 M;  1J5E M;  5H37 D;  1C1K A;  2Q2E B;  4KLN A;  3SFZ A;  4DR4 M;  3RE8 A;  4L78 A;  2VQE M;  5EXP A;  2KW0 A;  2EKF A;  2NQ8 C;  1N36 M;  1V34 A;  2JP7 A;  2DAI A;  3AOE C;  3THG A;  1X37 A;  1QUT A;  3CTW B;  4F1I A;  2UXB M;  4ZPX A;  4HLQ A;  4I81 A;  3U6E A;  4LJ6 A;  4WW0 A;  5E26 A;  5FTM A;  5EXS A;  4G3O A;  2WZJ A;  3KOW E;  3MHV C;  3HX3 A;  1GLN A;  2R65 A;  1Q3C A;  4GIP A;  4L16 A;  5KPR A;  4OX9 M;  2XZU A;  2Y20 A;  3CF2 A;  3TWL A;  4IBF A;  1D0K A;  3VKH A;  2UUB M;  1ZV1 A;  3EIH A;  3W0L B;  3QAU A;  3SAS A;  3E9S A;  4AKH A;  4AKG A;  4GEW A;  3J27 B;  4Z8X A;  3SMP A;  4EIW A;  4FW9 A;  4JI3 M;  3GLI B;  1CUK A;  3KSX A;  3UZU A;  1QDT A;  4IBB A;  1GJS A;  3FUU A;  3BBZ A;  3MMP A;  3NBX X;  3W68 A;  4B3R M;  1JR3 D;  2CRU A;  4IBG A;  3GLG A;  1EE8 A;  1IN4 A;  4MGI E;  3SHF A;  1XMQ M;  4LFC M;  1IN7 A;  2DVW B;  4JI0 M;  1ZAE A;  3GPY A;  4KHP M;  4OVZ B;  1DGH A;  3FTE A;  2F5Q A;  1OFI A;  1QYR A;  3FKE A;  3K9O A;  3RGS A;  4R7G A;  3KDS E;  2F5O A;  2EKK A;  4LJ9 A;  1OIP A;  3GLH B;  2RGO A;  4GHA A;  2XFS A;  1WIV A;  1NVM A;  2L4E A;  2FOI C;  2LVO C;  2ZAO A;  1NY6 A;  1QZE A;  1I4W A;  2L2D A;  5FTK A;  2R4E A;  4FWG A;  4NOO B;  3UK6 A;  3VDP A;  2F5P A;  4JI6 M;  2X8A A;  2J5Y A;  1L2C A;  4JI1 M;  2CE7 A;  2FNA A;  1TDH A;  1OFH A;  3LMM A;  3U6Q A;  3ZC7 B;  1QZM A;  1QDR A;  1QAO A;  1R7R A;  2JUJ A;  3L28 A;  3LVV A;  1TH2 A;  1N32 M;  4G4O A;  4Q7J A;  4YHH M;  2JA2 A;  2K6B A;  3HZJ A;  2KNV A;  1E9R A;  2DXI A;  1YSY A;  2FH0 A;  3AKZ A;  1L8Q A;  1IY2 A;  3ZCB B;  2QHO B;  1R4G A;  4LF8 M;  2D7H A;  2UUA M;  1TGU A;  3PNV A;  3HHZ A;  3HJS A;  5IWA M;  2UXD M;  3C58 A;  3U6M A;  2UU9 M;  1P3Q Q;  3GRV A;  2FFJ A;  4X62 M;  3JR4 A;  1NV8 A;  2LXE A;  2ZTC A;  1S3S A;  2ERC A;  4QOZ C;  1WR1 B;  3IEC A;  4FCT A;  2KHH A;  2DNA A;  3GLF B;  1IM2 A;  4QHT A;  3GLI A;  4S12 A;  1F4I A;  2QEN A;  1AUA A;  3FYC A;  3GP1 A;  4DV3 M;  3CF0 A;  3U6O A;  3CF6 E;  3B74 A;  3GRU A;  4FWH A;  1HNW M;  5BPV A;  3T15 A;  4NXM M;  2DWL A;  4M9X A;  4JI8 M;  3SAW A;  3I4V A;  3GQ3 A;  3KVW A;  3FE3 A;  4FD2 A;  2L6O A;  4LY6 A;  4IBE A;  1FNN A;  2ZTD A;  4LF7 M;  3W67 A;  2CV1 A;  1TF0 B;  3E46 A;  4Z6Y A;  3HHW A;  2CUZ A;  3GLH A;  3ILK A;  3L29 A;  1R5L A;  2G3Q A;  1Z5C A;  3HWS A;  1NJF A;  2R62 A;  3JAM S;  4W5W A;  1E94 E;  3B7N A;  3LW5 F;  1YUB A;  1AIP C;  4P16 A;  1R2Z A;  3J2P B;  1MU5 A;  3FUW A;  2B3T A;  1N75 A;  4G4N A;  3T1H M;  2EJS A;  4G4Q A;  2OO9 A;  4A3V B;  1QAN A;  1DGH B;  4X65 M;  3A46 A;  2R44 A;  4KOD A;  4M0D A;  3KS4 A;  4CIZ A;  1K82 A;  1XXH B;  4LJ8 A;  1OAO C;  1IFY A;  2LVN C;  3K1J A;  2MGW A;  4WP2 A;  3RFW A;  4I8O A;  2C5R A;  5IZ7 D;  3KW6 A;  1SXJ B;  5FTN A;  3DA1 A;  3M7G A;  1TTE A;  2C98 A;  2JWS A;  3B89 A;  1PJQ A;  4LJ4 A;  5KPT A;  4UN2 B;  1NY5 A;  1NHW C;  2DHR A;  1T3T A;  3WHL A;  3M0E A;  2JZ1 A;  2FS1 A;  1N78 A;  1Z5B A;  2DAK A;  2ZAN A;  3B7Q A;  3B9P A;  3VK8 A;  1J09 A;  1G8P A;  1NJG A;  4D81 A;  2Z7J A;  2MJ5 B;  4IBI A;  2L7I A;  2KEB A;  2APL A;  5LMN M;  1SG9 A;  4REZ A;  1ZQ9 A;  4II7 A;  3GLF A;  1L2B A;  2MH8 A;  2D7G A;  3JR5 A;  3I4Y A;  3KFU G;  3GRY A;  5DYG A;  4AI6 A;  4B3S M;  1OAI A;  5KO3 A;  1OTR A;  5GKN A;  2JY6 B;  3T1Y M;  3PXG A;  3DFZ A;  3C9P A;  4DR6 M;  3AFH A;  2JY5 A;  2DZO B;  4GH9 A;  3BOS A;  3A98 B;  4I5S A;  4OW0 A;  3QYB A;  1E32 A;  4RKU F;  2LWX A;  1TH4 A;  2VF7 A;  5EXX A;  2X49 A;  2G8L A;  2W82 A;  2KZS A;  3KOY E;  1JQJ C;  2JXN A;  3U6P A;  4AKI A;  5KPZ A;  4BLC A;  3UGJ A;  2R0I A;  4IBD A;  2WSC F;  4HL4 A;  4IIW A;  4F2L A;  1DGB A;  2GQF A;  4B3T M;  1ZMW A;  2BJW A;  2YQZ A;  2BWB A;  4ANR A;  1JR3 E;  1VEK A;  1XXH A;  1Z59 A;  2XFT A;  2DAG A;  4DV7 M;  1HT1 E;  4DV6 M;  5F3W A;  3KP0 E;  4D82 A;  1FJG M;  1GVN A;  2CHV A;  3FUV A;  1I94 M;  3AV0 A;  4LFA M;  3LQQ A;  3SC3 A;  1SXJ A;  5ITX A;  4JI5 M;  3NWL A;  4DV5 M;  1OIZ A;  3IG8 A;  3E21 A;  1NNU C;  3Q8X A;  2OOA A;  1Q02 A;  1UFZ A;  3FRH A;  2XGN A;  3HU2 A;  5ITR A;  5A2Q S;  1MN3 A;  3LCV B;  1NO1 A;  2P5T A;  3I51 A;  2WSF F;  4MM3 B;  3K8Z A;  3HJQ A;  1N34 M;  2O25 A;  2QSF X;  1LTM A;  2CEA A;  4MGZ E;  3A45 A;  3AOG A;  2KNZ A;  2XSZ D;  4K0K M;  1E9S A;  2CHQ A;  3FUX A;  3HU1 A;  4M9S A;  3BXW A;  2VQF M;  3KS8 A;  2LHC A;  3HKP A;  4JYA M;  3SYL A;  4PD2 A;  4RNA A;  4CGY B;  4NRW A;  2R46 A;  4LGY A;  1IXS B;  4B08 A;  4GHL A;  3OTO M;  2DI0 A;  2M60 A;  3GPX A;  3U61 B;  4DV4 M;  4BBA A;  2JY7 A;  2LHG A;  5FLX S;  3VLF B;  2QBY B;  3TL4 X;  4R71 A;  4MGK E;  1GL7 A;  3IHP A;  2YR0 A;  1L1T A;  5E6J A;  1YLA A;  2HAK A;  2X4A A;  4MB7 A;  4AQY M;  3L25 A;  4FWD A;  3U6C A;  2O01 F;  2RGH A;  2DAE A;  3UJN A;  1JB0 F;  3H4J A;  2CHG A;  3U60 B;  1A5T A;  2EO2 A;  2VF8 A;  4LJ7 A;  3TPZ A;  4DUY M;  3J7B A;  4NXN M;  2E5L M;  2BJV A;  4QNM A;  3KXE C;  1WGN A;  3KSJ A;  3FUT A;  3VDU A;  3K92 A;  1OQY A;  4NL4 H;  3GQ4 A;  1PJT A;  3AOE A;  2CP8 A;  2DZN B;  3DOA A;  1HT2 E;  4IJE A;  4BB9 A;  4R3D A;  2QQ8 A;  2LNH C;  4QNR A;  2OQ4 A;  1HJP A;  5EQT A;  2QPA A;  3HU3 A;  1WJ7 A;  1D0L A;  2R18 A;  3J7A S;  4L8R C;  3SAU A;  4XGI A;  2R4J A;  1XHB A;  1VQ1 A;  3KOZ E;  2M5Z A;  4NRV A;  1H6U A;  1PJI A;  2ZBK B;  3MK6 A;  5DNY A;  1C7Y A;  1IXR C;  2HCB A;  1TDZ A;  1HQC A;  1V92 A;  3TWK A;  3B7Z A;  3LQR A;  5IRE B;  2C99 A;  4B7F A;  1NNJ A;  5ITT A;  2F5N A;  5EP4 A;  1MX0 A;  2DZL A;  2O5R A;  5ITU A;  4LZZ A;  3FTF A;  3J81 S;  3AL0 C;  1Z6T A;  1KYI A;  2XSZ A;  3TE6 A;  2C9C A;  2RKO A;  4GC9 A;  1RU3 A;  1VEG A;  5ITY A;  2CWB A;  2KXE A;  2L4F A;  4B7G A;  3FTD A;  3A42 A;  4MGH A;  4X64 M;  1PM5 A;  2DWM A;  2RRU A;  4AZF A;  1IY1 A;  2KNA A;  2XH9 A;  1QQW A;  3MJ5 A;  1SXJ D;  4DR5 M;  2BWE A;  5EP1 A;  5KQ8 A;  1XNR M;  2XZF A;  1IXS A;  3HHY A;  3U61 A;  1D0M A;  3GQ5 A;  1MJG M;  3Q8G A;  2Z3X A;  4RF0 A;  2QBY A;  1EFU B;  3TWM A;  2QNJ A;  2L09 A;  4IJF A;  2J7N A;  3TQS A;  2HKJ A;  5DYI A;  1Z5A A;  1L2D A;  2LBC A;  3U5Z B;  1L1Z A;  2QCU A;  4M0W A;  5DFL A;  3ZQJ A;  5JI3 E;  1W5T A;  1XWI A;  2GNO A;  3D8L A;  1EIJ A;  2DWZ B;  3HGI A;  3SMS A;  2OPF A;  2Z4R A;  3U60 A;  1XC8 A;  1OKS A;  1GAB A;  4YY3 M;  1WGL A;  1R6B X;  2V6Z M;  4FCW A;  2XF3 A;  1GL6 A;  1K3W A;  4M9Z A;  4DV1 M;  1NHG C;  4I4L A;  4PT5 A;  4JI7 M;  3PNY A;  1D2N A;  2I7N A;  2JNH A;  2FE8 A;  1G3I A;  2VII A;  2EUC A;  3C3D A;  1KSF X;  3F92 A;  3L2A A;  3WHK A;  5FTL A;  1QUS A;  4CHT B;  3C3E A;  5FTJ A;  1DGG A;  2WSE F;  1G71 A;  3GRR A;  3K2L A;  4JV5 M;  1K3X A;  2BNK A;  3GPP A;  3AJI B;  4DR2 M;  1NSF A;  3M6A A;  3KP1 E;  5FSW A;  1T43 A;  1NV9 A;  5C18 A;  2H5X A;  2UXC M;  2YNM D;  3GLI E;  4FVM A;  2V1C A;  2J7O A;  3LVW A;  4LJA A;  2HHH M;  5KQD A;  3QWL A;  3D8B A;  4P17 A;  1HR0 M;  1QAQ A;  3V76 A;  2C96 A;  1QAM A;  2KRU A;  4L4U A;  2Y0T A;  3KOX E;  1IBM M;  3PVS A;  2K0B X;  3SYK A;  3EIE A;  4L15 A;  3FRI A;  2CFO A;  2V1U A;  3GPU A;  1IBK M;  4D80 A;  4AG5 A;  4LG2 A;  4B3M M;  3LCU A;  4OU7 A;  3GLH E;  1IN5 A;  8CAT A;  4G6Z A;  5EXT A;  1XB2 B;  2DKL A;  1G4A E;  3QYE A;  2MRO B;  2K47 A;  4GIT A;  2MR9 A;  1YE9 A;  1IBL M;  1HNZ M;  4LF5 M;  4DR3 M;  1HNX M;  2G5G X;  3ZH9 B;  4AW4 A;  2HL7 A;  2CV0 A;  1DO2 A;  4LZJ A;  3U5Z A;  3HY5 A;  3SBJ A;  1IY0 A;  4LFB M;  1BVS A;  4GMQ A;  3VFD A;  2LVQ D;  3FD9 A;  4DR7 M;  4LF6 M;  2C9O A;  4FCV A;  1XNQ M;  1KFV A;  4KT0 F;  1UM8 A;  2H1R A;  2R45 A;  3CGW A;  2KRK A;  4AG6 A;  4CJ6 A;  1WHC A;  2DEN A;  3NBI A;  4LCB A;  1VDD A;  4JXJ A;  1VDL A;  1G59 A;  4WUR A;  2Z4S A;  2HWJ A;  1PJS A;  2Z8Y M;  5IT9 S;  3I04 M;  1GJT A;  3HHX A;  5EP2 A;  1QVR A;  1GKI A;  2UUC M;  4PCZ A;  3VKG A;  1ORY B;  1PRB A;  4X66 M;  2EA0 A;  1R2Y A;  4DBG B;  4XK8 F;  3SHG B;  3RGP A;  1GO5 A;  4GRI A;  1IQP A;  1DO0 A;  3GO8 A;  4DV2 M;  4NSO B;  3SAR A;  1DV0 A;  4G4R A;  1N77 A;  1W5S A;  4PDI A;  3GLF E;  4NSR A;  2ZAM A;  1Q39 A;  1PJJ A;  5LMU M;  4LF9 M;  2F4V M;  4PDG A;  3J80 S;  1OJL A;  4LRS A;  1JR3 A;  3E4R A;  5JI2 E;  3IG5 A;  2A5Y B;  2DHY A;  2XEP A;  4DR1 M;  3U6L A;  2KA6 B;  1N33 M;  1IN8 A;  4JN6 A;  2AHM A;  4KO8 A;  1VG5 A;  4HEO A;  2XLJ A;  4JI4 M;  3R9X B;  4MGY E;  4NC6 A;  5ITQ A;  3R8F A;  2JY8 A;  3SAT A;  1WXQ A;  1ZMU A;  3PFI A;  1TH3 A;  2LVA A;  5EP3 A;  1SXJ C;  1Y8G A;  3FTC A;  4OVZ A;  2KZU A;  4IBJ A;  2Y21 A;  4IBC A;  4QOS A;  4Y28 F;  1T6O A;  2ZM6 M;  4CIS A;  2OOB A;  2Y0Q A;  1LV7 A;  3GLG E;  4DUZ M; 
#chains in the Genus database with same CATH homology
 1XMO M;  2LH0 A;  4RF1 A;  7CAT A;  4LRT A;  1DGF A;  5EJC A;  2CV2 A;  4TUW A;  3T38 A;  4IBK A;  2D7E A;  3GLG B;  2DWN A;  4JI2 M;  3VK7 A;  3L26 A;  3U6D A;  3UMM A;  1G41 A;  3W0F A;  3FYD A;  2F5S A;  4XBO A;  4GKJ M;  2L7H A;  1HQY E;  2QP9 X;  3DZD A;  4DV0 M;  2YFQ A;  3SAV A;  1IXZ A;  3HJ8 A;  2I7P A;  1SXJ E;  5ITX E;  4LJ5 A;  1J7K A;  3L27 A;  1IN6 A;  3U6S A;  4GC5 A;  4GKK M;  4LGM A;  4MH0 E;  4ITQ A;  4QHS A;  3H4M A;  4LF4 M;  4B7H A;  1Q3B A;  5C1B A;  2QZ4 A;  5BR8 M;  1J5E M;  5H37 D;  1C1K A;  2Q2E B;  4KLN A;  3SFZ A;  4DR4 M;  3RE8 A;  4L78 A;  2VQE M;  5EXP A;  2KW0 A;  1N36 M;  2NQ8 C;  3AOE C;  3THG A;  1X37 A;  3CTW B;  2UXB M;  4ZPX A;  4HLQ A;  4I81 A;  3U6E A;  4LJ6 A;  4WW0 A;  5E26 A;  5FTM A;  5EXS A;  3KOW E;  3MHV C;  4L16 A;  1GLN A;  2R65 A;  1Q3C A;  4GIP A;  5KPR A;  4OX9 M;  1N78 A;  2XZU A;  2Y20 A;  3CF2 A;  3TWL A;  4IBF A;  3VKH A;  2UUB M;  3W0L B;  3EIH A;  3SAS A;  3QAU A;  3E9S A;  4AKH A;  4AKG A;  3J27 B;  4Z8X A;  3SMP A;  4EIW A;  4FW9 A;  4JI3 M;  3GLI B;  3KSX A;  3UZU A;  4IBB A;  3FUU A;  4B3R M;  1JR3 D;  4IBG A;  3GLG A;  1EE8 A;  1IN4 A;  4MGI E;  3SHF A;  1XMQ M;  4LFC M;  1IN7 A;  2DVW B;  4JI0 M;  1ZAE A;  3GPY A;  4KHP M;  4OVZ B;  1DGH A;  3FTE A;  2F5Q A;  1OFI A;  1QYR A;  3FKE A;  3RGS A;  4R7G A;  3KDS E;  2F5O A;  4LJ9 A;  3GLH B;  2RGO A;  4GHA A;  2XFS A;  2ZAO A;  1NVM A;  2FOI C;  1NY6 A;  1I4W A;  5FTK A;  2R4E A;  4FWG A;  4NOO B;  3UK6 A;  3VDP A;  2F5P A;  4JI6 M;  2X8A A;  1L2C A;  4JI1 M;  2CE7 A;  2FNA A;  1TDH A;  1OFH A;  3LMM A;  3U6Q A;  3ZC7 B;  1QZM A;  3L28 A;  1QAO A;  1R7R A;  3LVV A;  1TH2 A;  1N32 M;  4G4O A;  4YHH M;  2JA2 A;  1E9R A;  2DXI A;  1YSY A;  3AKZ A;  1L8Q A;  1IY2 A;  3ZCB B;  4LF8 M;  2D7H A;  2UUA M;  1TGU A;  3PNV A;  3HHZ A;  3HJS A;  5IWA M;  2UXD M;  3C58 A;  3U6M A;  2UU9 M;  3GRV A;  2FFJ A;  4X62 M;  3JR4 A;  2LXE A;  1S3S A;  2ERC A;  4QOZ C;  4FCT A;  3GLF B;  1IM2 A;  4QHT A;  3GLI A;  4S12 A;  2QEN A;  3FYC A;  3GP1 A;  4DV3 M;  3CF0 A;  3U6O A;  3CF6 E;  1HNW M;  3GRU A;  4FWH A;  5BPV A;  3T15 A;  4NXM M;  2DWL A;  4M9X A;  4JI8 M;  3SAW A;  3I4V A;  3GQ3 A;  3KVW A;  4FD2 A;  2L6O A;  4LY6 A;  4IBE A;  1FNN A;  4LF7 M;  2CV1 A;  4Z6Y A;  3HHW A;  2CUZ A;  3GLH A;  3ILK A;  3L29 A;  1Z5C A;  3HWS A;  1NJF A;  2R62 A;  3JAM S;  4W5W A;  1E94 E;  4P16 A;  1YUB A;  1R2Z A;  3J2P B;  1MU5 A;  3FUW A;  1N75 A;  4G4N A;  3T1H M;  4G4Q A;  4A3V B;  1QAN A;  1DGH B;  4X65 M;  3A46 A;  4KOD A;  4M0D A;  3KS4 A;  1K82 A;  1XXH B;  4LJ8 A;  3K1J A;  3RFW A;  4I8O A;  2C5R A;  5IZ7 D;  3KW6 A;  1SXJ B;  5FTN A;  3DA1 A;  3M7G A;  2C98 A;  4LJ4 A;  5KPT A;  1NY5 A;  1NHW C;  2DHR A;  1T3T A;  3WHL A;  3M0E A;  1Z5B A;  2ZAN A;  3B9P A;  3VK8 A;  1J09 A;  1G8P A;  1NJG A;  4D81 A;  2Z7J A;  4IBI A;  2L7I A;  2KEB A;  5LMN M;  4REZ A;  1ZQ9 A;  4II7 A;  3GLF A;  1L2B A;  2D7G A;  3JR5 A;  3I4Y A;  3KFU G;  3GRY A;  5DYG A;  4AI6 A;  4B3S M;  5KO3 A;  5GKN A;  3T1Y M;  3PXG A;  3DFZ A;  4DR6 M;  3AFH A;  2DZO B;  4GH9 A;  3BOS A;  3A98 B;  4I5S A;  4OW0 A;  1E32 A;  2LWX A;  1TH4 A;  5EXX A;  2X49 A;  2G8L A;  2W82 A;  2KZS A;  3KOY E;  1JQJ C;  3U6P A;  4AKI A;  5KPZ A;  4BLC A;  3UGJ A;  4IBD A;  4HL4 A;  4IIW A;  1DGB A;  4B3T M;  2BJW A;  2YQZ A;  1XXH A;  1Z59 A;  2XFT A;  4DV7 M;  1HT1 E;  4DV6 M;  5F3W A;  3KP0 E;  4D82 A;  1FJG M;  1GVN A;  2CHV A;  3FUV A;  1I94 M;  3AV0 A;  4LFA M;  3LQQ A;  3SC3 A;  1SXJ A;  5ITX A;  4JI5 M;  3NWL A;  4DV5 M;  3IG8 A;  1NNU C;  3Q8X A;  3HU2 A;  5ITR A;  2XGN A;  5A2Q S;  2P5T A;  3I51 A;  4MM3 B;  3K8Z A;  3HJQ A;  1N34 M;  2CEA A;  4MGZ E;  3A45 A;  3AOG A;  2XSZ D;  4K0K M;  1E9S A;  2CHQ A;  3FUX A;  3HU1 A;  4M9S A;  2VQF M;  3KS8 A;  3HKP A;  4JYA M;  3SYL A;  4PD2 A;  4RNA A;  4CGY B;  4NRW A;  2R46 A;  4LGY A;  1IXS B;  4B08 A;  4GHL A;  3OTO M;  3U61 B;  2M60 A;  3GPX A;  4DV4 M;  4BBA A;  5FLX S;  3VLF B;  2QBY B;  3TL4 X;  4MGK E;  1GL7 A;  1L1T A;  2YR0 A;  5E6J A;  4MB7 A;  2X4A A;  3L25 A;  4AQY M;  4FWD A;  3U6C A;  2RGH A;  3UJN A;  2CHG A;  3U60 B;  2E5L M;  2EO2 A;  4LJ7 A;  3TPZ A;  4DUY M;  3J7B A;  4NXN M;  2BJV A;  4QNM A;  3KXE C;  3VDU A;  3KSJ A;  3FUT A;  3GQ4 A;  3K92 A;  4NL4 H;  3AOE A;  2DZN B;  3DOA A;  1HT2 E;  4IJE A;  4BB9 A;  4R3D A;  2LNH C;  4QNR A;  2OQ4 A;  5EQT A;  2QPA A;  3HU3 A;  2R18 A;  3J7A S;  4L8R C;  3SAU A;  4XGI A;  2R4J A;  1XHB A;  3KOZ E;  2M5Z A;  4NRV A;  1H6U A;  1PJI A;  2ZBK B;  3MK6 A;  5DNY A;  1IXR C;  2HCB A;  1TDZ A;  1HQC A;  3TWK A;  5IRE B;  3LQR A;  1NNJ A;  2C99 A;  4B7F A;  5ITT A;  2F5N A;  5EP4 A;  1MX0 A;  2O5R A;  5ITU A;  4LZZ A;  3FTF A;  3J81 S;  3AL0 C;  1Z6T A;  1KYI A;  2XSZ A;  3TE6 A;  2C9C A;  2RKO A;  4GC9 A;  5ITY A;  2KXE A;  4B7G A;  3FTD A;  3A42 A;  4MGH A;  4X64 M;  1PM5 A;  2DWM A;  4AZF A;  1IY1 A;  2XH9 A;  1QQW A;  3MJ5 A;  1SXJ D;  4DR5 M;  5EP1 A;  5KQ8 A;  1XNR M;  2XZF A;  3HHY A;  3U61 A;  3GQ5 A;  2Z3X A;  4RF0 A;  2QBY A;  3TWM A;  2L09 A;  4IJF A;  2J7N A;  3TQS A;  2HKJ A;  5DYI A;  1Z5A A;  1L2D A;  3U5Z B;  1L1Z A;  2QCU A;  4M0W A;  5JI3 E;  1W5T A;  1XWI A;  3D8L A;  2DWZ B;  3HGI A;  3SMS A;  2OPF A;  2Z4R A;  3U60 A;  1XC8 A;  4YY3 M;  1R6B X;  2V6Z M;  4FCW A;  2XF3 A;  1GL6 A;  1K3W A;  4M9Z A;  4DV1 M;  1NHG C;  4I4L A;  4PT5 A;  4JI7 M;  3PNY A;  1D2N A;  2I7N A;  2FE8 A;  1G3I A;  2VII A;  2EUC A;  1KSF X;  5FTL A;  3L2A A;  3WHK A;  4CHT B;  5FTJ A;  1DGG A;  3GRR A;  3K2L A;  4JV5 M;  1K3X A;  2BNK A;  3GPP A;  3AJI B;  4DR2 M;  1NSF A;  3M6A A;  3KP1 E;  5FSW A;  5C18 A;  2UXC M;  2YNM D;  4FVM A;  2V1C A;  2J7O A;  3LVW A;  4LJA A;  2HHH M;  5KQD A;  3QWL A;  3D8B A;  1HR0 M;  1QAQ A;  2C96 A;  1QAM A;  2KRU A;  4L4U A;  2Y0T A;  3KOX E;  1IBM M;  3PVS A;  3SYK A;  3EIE A;  4L15 A;  2CFO A;  2V1U A;  3GPU A;  1IBK M;  4D80 A;  4AG5 A;  4LG2 A;  4B3M M;  4OU7 A;  1IN5 A;  8CAT A;  4G6Z A;  5EXT A;  1G4A E;  2K47 A;  4GIT A;  1IBL M;  1YE9 A;  1HNZ M;  4LF5 M;  4DR3 M;  1HNX M;  2G5G X;  3ZH9 B;  4AW4 A;  2HL7 A;  2CV0 A;  1DO2 A;  4LZJ A;  3U5Z A;  3SBJ A;  1IY0 A;  4LFB M;  4GMQ A;  3VFD A;  3FD9 A;  4DR7 M;  4LF6 M;  2C9O A;  4FCV A;  1XNQ M;  1KFV A;  1UM8 A;  2H1R A;  2R45 A;  2KRK A;  4AG6 A;  3NBI A;  4LCB A;  1VDD A;  4JXJ A;  1G59 A;  4WUR A;  2Z4S A;  5IT9 S;  3HHX A;  5EP2 A;  1QVR A;  1GKI A;  2UUC M;  4PCZ A;  3VKG A;  1ORY B;  4X66 M;  1R2Y A;  2EA0 A;  3SHG B;  3RGP A;  4GRI A;  1IQP A;  1DO0 A;  3GO8 A;  4DV2 M;  4NSO B;  3SAR A;  4G4R A;  1N77 A;  1W5S A;  4PDI A;  4NSR A;  2ZAM A;  1Q39 A;  1PJJ A;  5LMU M;  4LF9 M;  2F4V M;  4PDG A;  3J80 S;  1OJL A;  4LRS A;  1JR3 A;  3E4R A;  5JI2 E;  3IG5 A;  2A5Y B;  2XEP A;  4DR1 M;  3U6L A;  1N33 M;  2KA6 B;  1IN8 A;  4JN6 A;  2AHM A;  4KO8 A;  4JI4 M;  2XLJ A;  3R9X B;  4MGY E;  5ITQ A;  3R8F A;  3SAT A;  1WXQ A;  3PFI A;  1TH3 A;  5EP3 A;  1SXJ C;  3FTC A;  4OVZ A;  2KZU A;  4IBJ A;  2Y21 A;  4IBC A;  4QOS A;  2ZM6 M;  4CIS A;  2Y0Q A;  1LV7 A;  4DUZ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...