4F2LA

Structure of a regulatory domain of ampk
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
61
structure length
61
Chain Sequence
SSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title Conserved regulatory elements in AMPK
pubmed doi rcsb
source organism Rattus norvegicus
total genus 17
structure length 61
sequence length 61
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4f2lA00
2LVQD 2MGWA 2LVOC 1Q02A 1G3IA 2QSFX 1MN3A 1WJ7A 2KNZA 1VG5A 2BWBA 2DAKA 2DZLA 1OTRA 1T43A 2CP8A 2KNAA 4R71A 2H5XA 3FRHA 2JUJA 3GLFE 5JI2E 2QHOB 2R0IA 2L4EA 2LVNC 2ZTDA 3F92A 1R4GA 2DKLA 1NV8A 1T6OA 3GLGE 1DO0A 4WP2A 3GLIE 4DBGB 2JY8A 1AIPC 1UFZA 1QZEA 2JNHA 3FRIA 2JZ1A 4HEOA 2MJ5B 2RRUA 1ZMVA 1SG9A 1OKSA 1DO2A 1VEGA 3E21A 1ZMWA 1OQYA 4F2LA 2MR9A 3IECA 2BWEA 2WZJA 3K9OA 2HWJA 1TR8A 1Y8GA 1WGLA 2HAKA 5DFLA 2ZTCA 1WIVA 1V92A 2JZ0A 2KHHA 2K9DA 2QNJA 2DAIA 1HQYE 2OOAA 3IHPA 1ZMUA 2LTUA 2DNAA 2G3QA 1VEKA 3GLHE 1PGYA 3T6PA 1BVSA 1VQ1A 2DHYA 1A5TA 2JY6B 1VEJA 4GEWA 4F1IA 2EKKA 2L4FA 2JY5A 2EJSA 2LBCA 3FE3A 2O25A 1C7YA 2JP7A 1HT1E 2KNVA 2MROB 3LCUA 3H4JA 1HJPA 1IFYA 3K9PA 2CWBA 1GO5A 1EFUB 2K0BX 1F4IA 1KYIA 1CUKA 2OOBA 1WGNA 1JR3E 3MMPA 2B3TA 1WHCA 3B89A 3BBZA 2LVAA 4Q7JA 1YLAA 1ZV1A 1HT2E 4UN2B 1E94E 1DV0A 2OO9A 2L2DA 2LVPC 1NV9A 2JY7A 2EKFA 1IM2A 1WR1B 1P3QQ 2DENA 2DAEA 2DAGA 3LCVB 1IXSA 1OAIA 2DI0A 1G4AE 1G41A 1TTEA 1VDLA 3E46A 4G3OA 2DAMA 1XB2B 1XXHE
chains in the Genus database with same CATH superfamily
2DXIA 1N32M 1DGFA 4Y28F 4JI5M 1XXHA 3KXEC 3W67A 7CATA 4M9ZA 2LXEA 2KNZA 2DAKA 4IBGA 4NXMM 1OTRA 4L4UA 3GQ5A 1KSFX 2CHQA 3A42A 3FD9A 3TL4X 4DV0M 3FRHA 1DGBA 2QBYB 2L7HA 3TWKA 4PCZA 1HNXM 3HU3A 2C96A 1XMOM 2BNKA 5EQTA 3HHYA 3SARA 2ZAOA 3HX3A 2M60A 4ITQA 3KOXE 1IBKM 4NRWA 2VF7A 2CV2A 2V1UA 2P5TA 1T3TA 1ZAEA 3HU1A 4WP2A 4G4QA 4XGIA 4G4NA 1PM5A 3B74A 2XH9A 1QZEA 3BXWA 4ANRA 2JNHA 2MJ5B 2RRUA 3BOSA 1L2BA 1TDHA 1NHWC 4DR4M 1OKSA 4FW9A 4YY3M 1IBLM 3UGJA 4F2LA 3T1HM 5FSWA 2WZJA 5KQ8A 3KSJA 2BJVA 3I04M 4R3DA 1FNNA 3NWLA 5C1BA 5DFLA 5EP3A 2Z4SA 2ZTCA 4S12A 4LF9M 3AL0C 1V92A 5KQDA 2JZ0A 4LCBA 4FWDA 4CGYB 3PFIA 5L8RF 1V33A 3U60B 3U61B 5FTNA 2UU9M 2G5GX 4EIWA 2XFSA 3DOAA 5EP4A 4LRTA 3QYBA 5IREB 4MGYE 4CHTB 2N35A 2VQEM 3SASA 5ITQA 5IT9S 4LJAA 5EXPA 3FTDA 1Z5CA 3PNVA 4I81A 1LV7A 3T6PA 4GKJM 4RF1A 4GMQA 5FTKA 4OVZA 3CF2A 3SAVA 4GEWA 4F1IA 1GABA 3FUUA 5FTJA 4KHPM 1PJSA 2DWLA 2CFOA 2GNOA 2LBCA 2XSZA 4TUWA 1H6UA 1W5TA 1J5EM 4CIZA 2F5NA 2RKOA 1K3XA 3I01M 3H4JA 1HJPA 1MJGM 3GO8A 4IJFA 4MGIE 1MU5A 4KLNA 4B3MM 5BPVA 4LF6M 1PJJA 5ITRA 4QOZC 1QUSA 4DR1M 1IXRC 3KS4A 4AW4A 4JI4M 3H4MA 2R65A 2UUAM 2Y20A 1PRBA 1IN5A 1YSYA 4GHAA 4FWHA 4QOSA 3HU2A 3ZQJA 3ZCBB 2FE8A 1QAMA 3DA1A 3QWLA 4LJ8A 1ORYB 2G8LA 4DR2M 3KS8A 2HKJA 3SAWA 4Q7JA 3U5ZA 2X49A 2Y21A 3KOWE 1HT2E 4P17A 4LZZA 1QYRA 1PJIA 3FKEA 2YNMD 2EKFA 3L27A 4WW0A 1PJTA 4AZFA 1WR1B 1K82A 4JYAM 2R6FA 4PD2A 5ITYA 4ZPXA 4B3RM 3U6QA 2J5YA 2X4AA 4CISA 2HHHM 3FUVA 2O01F 3C9PA 2CV1A 3KOYE 1TH2A 2ZBKB 3Q8GA 1L1ZA 3GPUA 1J7KA 3FYCA 2BJWA 3GRVA 4AKIA 2Q2EB 1IXSA 2KRUA 5ITTA 4OVZB 2H1RA 4YHHM 3HHXA 5E6JA 4FVMA 3RGPA 3SYKA 2C9OA 4M0WA 1IN7A 2MGWA 2CUZA 1HR0M 1NJFA 2DZOB 5GKNA 2K6BA 3LW5F 3T38A 1WXQA 2UUBM 1Q02A 2CHGA 2LH0A 2QSFX 1HNZM 1VG5A 2BWBA 4DV4M 2CP8A 1T43A 3AV0A 3C58A 1FJGM 3PXGA 3C3DA 5ITXE 1Q3BA 4NSOB 3LMMA 2E5LM 4JXJA 5ITXA 2DZNB 2L4EA 4K0KM 3GQ3A 2Y0TA 4M9SA 4B3SM 4MM3B 4G4RA 1GLNA 2DKLA 2I7NA 2YFQA 3L2AA 3GRUA 2RGOA 3EIHA 5ITUA 2QZ4A 4DV6M 1GL7A 4MGHA 3LVWA 1DO0A 3GLIE 1C1KA 4LG2A 4DBGB 1D0MA 2JY8A 4D81A 1AIPC 1TGUA 4G4OA 4HEOA 4FD2A 4JI1M 2KRKA 3GLIA 1I4WA 1DO2A 3SYLA 3FUWA 3TQSA 1ZMWA 1OQYA 3VK7A 1GJTA 3FTCA 2BWEA 4GITA 1XC8A 3I4YA 4QHTA 1EIJA 2XZFA 4IBCA 2FH0A 1OFHA 1WIVA 3LQQA 2KHHA 2WSEF 2QNJA 3KVWA 4P16A 1IXSB 1NO1A 5C18A 4DR3M 2DAIA 2XF3A 2DWMA 1DGGA 4GKKM 1HQYE 3M6AA 2I7PA 2OOAA 4X65M 3GLGB 3T1YM 2LTUA 1NJGA 3AOEC 1DGHB 4MGZE 1VEKA 3J81S 2UXCM 3GLHE 4NC6A 1PGYA 1JR3D 3AJIB 1A5TA 2O5RA 4OW0A 1E9SA 4M9XA 1XWIA 5DNYA 1XMQM 3GLHA 5FLXS 2VIIA 3VKHA 4I5SA 4LJ5A 3RE8A 4LGMA 4AKGA 3WHKA 2MH8A 5H37D 1GJSA 3M0EA 2KNVA 1R2YA 1D2NA 4X64M 2EUCA 1GO5A 4LJ7A 3C3EA 3U6LA 4B7FA 4QNRA 1S3SA 4IIWA 4LJ6A 2R18A 5KPRA 3UMMA 2OOBA 4IJEA 1G71A 1E9RA 1WGNA 4RNAA 3AOGA 3GLIB 1UM8A 3FUTA 3GRRA 1QVRA 3GPPA 1NY6A 2WSFF 2B3TA 4NOOB 3B89A 3SATA 4OX9M 4DR7M 4RKUF 3SC3A 1ZV1A 1IN4A 1YUBA 2FFJA 4QHSA 1QQWA 1RU3A 2C9CA 3I51A 2LHCA 2KEBA 4JI8M 2OO9A 2L2DA 2JY7A 2OPFA 2R46A 1N33M 4X62M 1XHBA 3SHGB 3SAUA 4BBAA 3Q8XA 2DENA 2DAEA 4A3VB 1IN8A 2C99A 5LMUM 4GC5A 1SXJE 4LJ4A 1QUTA 1X37A 4LF8M 2FNAA 3GPXA 3KSXA 2KA6B 1SXJA 1G4AE 1TTEA 3K92A 4PT5A 3GLHB 1VDLA 4L8RC 2DAMA 4LF4M 2K47A 4JI3M 2RGHA 3M7GA 2QP9X 1OIZA 2C98A 3WHLA 1G3IA 1MN3A 1NVMA 1WJ7A 3TWMA 1NHGC 4IBFA 2LHGA 3CF0A 4R71A 1TDZA 2KNAA 3L29A 1GKIA 3HJQA 3IG5A 2QPAA 3FYDA 4HL4A 3HHWA 3GLFE 1L8QA 2F5PA 4FCTA 3L26A 2R0IA 3SHFA 3FUXA 3A46A 4DUYM 3GLFA 4HLQA 4JN6A 4NSRA 2L7IA 2F5OA 1R4GA 1NV8A 4R7GA 4L16A 1T6OA 2V1CA 4LZJA 3SMPA 5E26A 2DWZB 4IBJA 4L6V6 3VDPA 3GLGE 4DV3M 3KDSE 4KT0F 3TPZA 4B7HA 1UFZA 2UXDM 3FRIA 3THGA 2JZ1A 1J09A 5IWAM 3GPYA 3GLGA 1N78A 3J7AS 3KP1E 1IY1A 1SG9A 4LJ9A 4JV5M 1DGHA 1VEGA 2EO2A 1YE9A 2XFTA 2XSZD 3E21A 4D80A 2QENA 4Z6YA 2XGNA 3K2LA 3LVVA 5KPTA 3FTEA 3K9OA 1IN6A 4JI2M 1TR8A 4JI6M 1WGLA 2L09A 4IBKA 2HAKA 3A45A 1QAOA 4BLCA 2Z3XA 2LNHC 4DV1M 3I4VA 3D8LA 4IBDA 4B08A 3AKZA 2ZANA 2K9DA 4RF0A 3W68A 4LFAM 3RGSA 1SXJB 4FWGA 4DV5M 1IXZA 2APLA 2CHVA 1XNQM 2CE7A 3JR4A 1V34A 4PDGA 5IZ7D 2F5QA 2DNAA 2G3QA 1QDRA 2R4JA 3B7NA 3U6EA 5DYIA 3HJ8A 3TE6A 4AQYM 1N36M 1VQ1A 2YR0A 2DHYA 3KFUG 2JY6B 2R44A 2UUCM 3PNYA 3K8ZA 4MGKE 4LGYA 4GH9A 4LFBM 4I4LA 2L4FA 2JY5A 1TH3A 3HHZA 4IBBA 3FE3A 2GQFA 1C7YA 2JP7A 4IBEA 3LCUA 3KP0E 1Q3CA 4LY6A 1QDTA 2JXNA 2ZM6M 2D7GA 3HJSA 3GLFB 1IFYA 2CWBA 4W5WA 3T15A 3U6SA 5EXTA 1KYIA 3EIEA 4PDIA 2F5SA 3J2PB 4DV2M 1OIPA 1Z5BA 3VDUA 3DFZA 1LTMA 3K1JA 4AKHA 1GVNA 1GL6A 4L78A 2QCUA 1IY0A 3HY5A 3MMPA 3W0LB 3UJNA 2FS1A 1PJQA 2R45A 4WURA 3A98B 2ZAMA 2LVAA 3DZDA 3QAUA 1IY2A 2XEPA 1JQJC 4M0DA 3OTOM 2JWSA 2KZSA 4UN2B 1NNUC 1L2CA 4QNMA 1E94E 1DV0A 4XK8F 1HNWM 2L6OA 3SMSA 2YQZA 2QQ8A 1IM2A 5A2QS 2DVWB 1TH4A 4D82A 1P3QQ 3MJ5A 3U6OA 4JI0M 2XZUA 2DAGA 3ZC7B 1KFVA 3LCVB 1D0LA 4CJ6A 1N34M 3NBIA 4KO8A 2C5RA 3R9XB 3D8BA 1OAIA 4NL4H 5EXSA 4Z8XA 3PVSA 1G41A 3HWSA 4GRIA 4AG6A 1QAQA 5KPZA 4REZA 2KDLA 2LVQD 3IG8A 3U6CA 1OFIA 3JAMS 2LVOC 3SBJA 1L2DA 2Y0QA 1R2ZA 2DZLA 3CGWA 1VDDA 3B7ZA 2H5XA 5DYGA 5FTMA 2VF8A 3VLFB 2JUJA 5LMNM 3J80S 4FCVA 1IBMM 5JI2E 1EE8A 2QHOB 3HKPA 2X8AA 3B7QA 1N77A 2M5ZA 2LVNC 1QZMA 2ZTDA 4DV7M 3W0FA 3F92A 4G3OA 4I8OA 3KW6A 2A5YB 3E9SA 1XXHB 1Z6TA 3KOZE 4L15A 2Z7JA 1ZMVA 2CRUA 4GC9A 3J7BA 3HZJA 5F3WA 2MR9A 3IECA 1ZQ9A 2HWJA 4MH0E 1Z5AA 1Y8GA 4X66M 3U6DA 1QANA 2NQ8C 2HL7A 5EJCA 1NSFA 3MK6A 4B7GA 1K3WA 1IQPA 4LFCM 3ILKA 5EP2A 1HQCA 4LF5M 2F4VM 2AHMA 2FOIC 4NRVA 3TWLA 4MB7A 3NBXX 3IHPA 1ZMUA 2KXEA 4GHLA 1D0KA 1XNRM 3CF6E 2EA0A 2R4EA 3UZUA 1BVSA 1R5LA 1R6BX 5JI3E 2Z4RA 1G59A 4JI7M 3VFDA 1L1TA 4XBOA 1VEJA 2UXBM 1JB0F 1I94M 1G8PA 4DR6M 2CEAA 4IBIA 3U6PA 2EKKA 2D7HA 2WSCF 2HCBA 2J7OA 2EJSA 4KODA 2DWNA 3FTFA 2O25A 2CV0A 1TF0B 1HT1E 2MROB 3ZH9B 4LF7M 5EP1A 3AOEA 2VDBB 3GQ4A 3K9PA 3CTWB 1EFUB 1Q39A 3B9PA 1OJLA 2W82A 2K0BX 1NNJA 2R62A 2QBYA 1F4IA 3GRYA 4G6ZA 3MHVC 1CUKA 4AG5A 1SXJD 2V6ZM 5EXXA 2DHRA 3JR5A 2KW0A 3AFHA 1JR3E 3HGIA 3E4RA 3L25A 4BB9A 3QYEA 5BR8M 1N75A 3VKGA 4DUZM 8CATA 2J7NA 1WHCA 3BBZA 4FCWA 2ERCA 4OU7A 5FTLA 1JR3A 1YLAA 2Z8YM 3U6MA 1SXJC 2JA2A 3L28A 2VQFM 2LVPC 1NV9A 3LQRA 3GP1A 4B3TM 2OQ4A 1W5SA 3J27B 2LWXA 1R7RA 4II7A 1Z59A 3V76A 3SFZA 1OAOC 3UK6A 4AI6A 4DR5M 1MX0A 5KO3A 3VK8A 4LRSA 2D7EA 3U60A 2DI0A 3U61A 1AUAA 3RFWA 3U5ZB 3R8FA 4NXNM 2XLJA 1E32A 2KZUA 3E46A 1NY5A 4GIPA 1XB2B 1XXHE
chains in the Genus database with same CATH topology
2LVQD 2MGWA 2LVOC 1Q02A 1G3IA 2QSFX 1MN3A 1WJ7A 2KNZA 1VG5A 2BWBA 2DAKA 2DZLA 1OTRA 1T43A 2CP8A 2KNAA 4R71A 2H5XA 3FRHA 2JUJA 3GLFE 5JI2E 2QHOB 2R0IA 2L4EA 2LVNC 2ZTDA 3F92A 1R4GA 2DKLA 1NV8A 1T6OA 3GLGE 1DO0A 4WP2A 3GLIE 4DBGB 2JY8A 1AIPC 1UFZA 1QZEA 2JNHA 3FRIA 2JZ1A 4HEOA 2MJ5B 2RRUA 1ZMVA 1SG9A 1OKSA 1DO2A 1VEGA 3E21A 1ZMWA 1OQYA 4F2LA 2MR9A 3IECA 2BWEA 2WZJA 3K9OA 2HWJA 1TR8A 1Y8GA 1WGLA 2HAKA 5DFLA 2ZTCA 1WIVA 1V92A 2JZ0A 2KHHA 2K9DA 2QNJA 2DAIA 1HQYE 2OOAA 3IHPA 1ZMUA 2LTUA 2DNAA 2G3QA 1VEKA 3GLHE 1PGYA 3T6PA 1BVSA 1VQ1A 2DHYA 1A5TA 2JY6B 1VEJA 4GEWA 4F1IA 2EKKA 2L4FA 2JY5A 2EJSA 2LBCA 3FE3A 2O25A 1C7YA 2JP7A 1HT1E 2KNVA 2MROB 3LCUA 3H4JA 1HJPA 1IFYA 3K9PA 2CWBA 1GO5A 1EFUB 2K0BX 1F4IA 1KYIA 1CUKA 2OOBA 1WGNA 1JR3E 3MMPA 2B3TA 1WHCA 3B89A 3BBZA 2LVAA 4Q7JA 1YLAA 1ZV1A 1HT2E 4UN2B 1E94E 1DV0A 2OO9A 2L2DA 2LVPC 1NV9A 2JY7A 2EKFA 1IM2A 1WR1B 1P3QQ 2DENA 2DAEA 2DAGA 3LCVB 1IXSA 1OAIA 2DI0A 1G4AE 1G41A 1TTEA 1VDLA 3E46A 4G3OA 2DAMA 1XB2B 1XXHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVQ D;  2MGW A;  2LVO C;  1Q02 A;  1G3I A;  2QSF X;  1MN3 A;  1WJ7 A;  2KNZ A;  1VG5 A;  2BWB A;  2DAK A;  2DZL A;  1OTR A;  1T43 A;  2CP8 A;  2KNA A;  4R71 A;  2H5X A;  3FRH A;  2JUJ A;  3GLF E;  5JI2 E;  2QHO B;  2R0I A;  2L4E A;  2LVN C;  2ZTD A;  3F92 A;  1R4G A;  2DKL A;  1NV8 A;  1T6O A;  3GLG E;  1DO0 A;  4WP2 A;  3GLI E;  4DBG B;  2JY8 A;  1AIP C;  1UFZ A;  1QZE A;  2JNH A;  3FRI A;  2JZ1 A;  4HEO A;  2MJ5 B;  2RRU A;  1ZMV A;  1SG9 A;  1OKS A;  1DO2 A;  1VEG A;  3E21 A;  1ZMW A;  1OQY A;  4F2L A;  2MR9 A;  3IEC A;  2BWE A;  2WZJ A;  3K9O A;  2HWJ A;  1TR8 A;  1Y8G A;  1WGL A;  2HAK A;  5DFL A;  2ZTC A;  1WIV A;  1V92 A;  2JZ0 A;  2KHH A;  2K9D A;  2QNJ A;  2DAI A;  1HQY E;  2OOA A;  3IHP A;  1ZMU A;  2LTU A;  2DNA A;  2G3Q A;  1VEK A;  3GLH E;  1PGY A;  3T6P A;  1BVS A;  1VQ1 A;  2DHY A;  1A5T A;  2JY6 B;  1VEJ A;  4GEW A;  4F1I A;  2EKK A;  2L4F A;  2JY5 A;  2EJS A;  2LBC A;  3FE3 A;  2O25 A;  1C7Y A;  2JP7 A;  1HT1 E;  2KNV A;  2MRO B;  3LCU A;  3H4J A;  1HJP A;  1IFY A;  3K9P A;  2CWB A;  1GO5 A;  1EFU B;  2K0B X;  1F4I A;  1KYI A;  1CUK A;  2OOB A;  1WGN A;  1JR3 E;  3MMP A;  2B3T A;  1WHC A;  3B89 A;  3BBZ A;  2LVA A;  4Q7J A;  1YLA A;  1ZV1 A;  1HT2 E;  4UN2 B;  1E94 E;  1DV0 A;  2OO9 A;  2L2D A;  2LVP C;  1NV9 A;  2JY7 A;  2EKF A;  1IM2 A;  1WR1 B;  1P3Q Q;  2DEN A;  2DAE A;  2DAG A;  3LCV B;  1IXS A;  1OAI A;  2DI0 A;  1G4A E;  1G41 A;  1TTE A;  1VDL A;  3E46 A;  4G3O A;  2DAM A;  1XB2 B;  1XXH E; 
#chains in the Genus database with same CATH topology
 2DXI A;  1N32 M;  1DGF A;  4Y28 F;  4JI5 M;  1XXH A;  3KXE C;  3W67 A;  7CAT A;  4M9Z A;  2LXE A;  2KNZ A;  2DAK A;  4IBG A;  4NXM M;  1OTR A;  4L4U A;  3GQ5 A;  1KSF X;  2CHQ A;  3A42 A;  3FD9 A;  3TL4 X;  4DV0 M;  3FRH A;  1DGB A;  2QBY B;  2L7H A;  3TWK A;  4PCZ A;  1HNX M;  3HU3 A;  2C96 A;  1XMO M;  2BNK A;  5EQT A;  3HHY A;  3SAR A;  2ZAO A;  3HX3 A;  2M60 A;  4ITQ A;  3KOX E;  1IBK M;  4NRW A;  2VF7 A;  2CV2 A;  2V1U A;  2P5T A;  1T3T A;  1ZAE A;  3HU1 A;  4WP2 A;  4G4Q A;  4XGI A;  4G4N A;  1PM5 A;  3B74 A;  2XH9 A;  1QZE A;  3BXW A;  4ANR A;  2JNH A;  2MJ5 B;  2RRU A;  3BOS A;  1L2B A;  1TDH A;  1NHW C;  4DR4 M;  1OKS A;  4FW9 A;  4YY3 M;  1IBL M;  3UGJ A;  4F2L A;  3T1H M;  5FSW A;  2WZJ A;  5KQ8 A;  3KSJ A;  2BJV A;  3I04 M;  4R3D A;  1FNN A;  3NWL A;  5C1B A;  5DFL A;  5EP3 A;  2Z4S A;  2ZTC A;  4S12 A;  4LF9 M;  3AL0 C;  1V92 A;  5KQD A;  2JZ0 A;  4LCB A;  4FWD A;  4CGY B;  3PFI A;  5L8R F;  1V33 A;  3U60 B;  3U61 B;  5FTN A;  2UU9 M;  2G5G X;  4EIW A;  2XFS A;  3DOA A;  5EP4 A;  4LRT A;  3QYB A;  5IRE B;  4MGY E;  4CHT B;  2N35 A;  2VQE M;  3SAS A;  5ITQ A;  5IT9 S;  4LJA A;  5EXP A;  3FTD A;  1Z5C A;  3PNV A;  4I81 A;  1LV7 A;  3T6P A;  4GKJ M;  4RF1 A;  4GMQ A;  5FTK A;  4OVZ A;  3CF2 A;  3SAV A;  4GEW A;  4F1I A;  1GAB A;  3FUU A;  5FTJ A;  4KHP M;  1PJS A;  2DWL A;  2CFO A;  2GNO A;  2LBC A;  2XSZ A;  4TUW A;  1H6U A;  1W5T A;  1J5E M;  4CIZ A;  2F5N A;  2RKO A;  1K3X A;  3I01 M;  3H4J A;  1HJP A;  1MJG M;  3GO8 A;  4IJF A;  4MGI E;  1MU5 A;  4KLN A;  4B3M M;  5BPV A;  4LF6 M;  1PJJ A;  5ITR A;  4QOZ C;  1QUS A;  4DR1 M;  1IXR C;  3KS4 A;  4AW4 A;  4JI4 M;  3H4M A;  2R65 A;  2UUA M;  2Y20 A;  1PRB A;  1IN5 A;  1YSY A;  4GHA A;  4FWH A;  4QOS A;  3HU2 A;  3ZQJ A;  3ZCB B;  2FE8 A;  1QAM A;  3DA1 A;  3QWL A;  4LJ8 A;  1ORY B;  2G8L A;  4DR2 M;  3KS8 A;  2HKJ A;  3SAW A;  4Q7J A;  3U5Z A;  2X49 A;  2Y21 A;  3KOW E;  1HT2 E;  4P17 A;  4LZZ A;  1QYR A;  1PJI A;  3FKE A;  2YNM D;  2EKF A;  3L27 A;  4WW0 A;  1PJT A;  4AZF A;  1WR1 B;  1K82 A;  4JYA M;  2R6F A;  4PD2 A;  5ITY A;  4ZPX A;  4B3R M;  3U6Q A;  2J5Y A;  2X4A A;  4CIS A;  2HHH M;  3FUV A;  2O01 F;  3C9P A;  2CV1 A;  3KOY E;  1TH2 A;  2ZBK B;  3Q8G A;  1L1Z A;  3GPU A;  1J7K A;  3FYC A;  2BJW A;  3GRV A;  4AKI A;  2Q2E B;  1IXS A;  2KRU A;  5ITT A;  4OVZ B;  2H1R A;  4YHH M;  3HHX A;  5E6J A;  4FVM A;  3RGP A;  3SYK A;  2C9O A;  4M0W A;  1IN7 A;  2MGW A;  2CUZ A;  1HR0 M;  1NJF A;  2DZO B;  5GKN A;  2K6B A;  3LW5 F;  3T38 A;  1WXQ A;  2UUB M;  1Q02 A;  2CHG A;  2LH0 A;  2QSF X;  1HNZ M;  1VG5 A;  2BWB A;  4DV4 M;  2CP8 A;  1T43 A;  3AV0 A;  3C58 A;  1FJG M;  3PXG A;  3C3D A;  5ITX E;  1Q3B A;  4NSO B;  3LMM A;  2E5L M;  4JXJ A;  5ITX A;  2DZN B;  2L4E A;  4K0K M;  3GQ3 A;  2Y0T A;  4M9S A;  4B3S M;  4MM3 B;  4G4R A;  1GLN A;  2DKL A;  2I7N A;  2YFQ A;  3L2A A;  3GRU A;  2RGO A;  3EIH A;  5ITU A;  2QZ4 A;  4DV6 M;  1GL7 A;  4MGH A;  3LVW A;  1DO0 A;  3GLI E;  1C1K A;  4LG2 A;  4DBG B;  1D0M A;  2JY8 A;  4D81 A;  1AIP C;  1TGU A;  4G4O A;  4HEO A;  4FD2 A;  4JI1 M;  2KRK A;  3GLI A;  1I4W A;  1DO2 A;  3SYL A;  3FUW A;  3TQS A;  1ZMW A;  1OQY A;  3VK7 A;  1GJT A;  3FTC A;  2BWE A;  4GIT A;  1XC8 A;  3I4Y A;  4QHT A;  1EIJ A;  2XZF A;  4IBC A;  2FH0 A;  1OFH A;  1WIV A;  3LQQ A;  2KHH A;  2WSE F;  2QNJ A;  3KVW A;  4P16 A;  1IXS B;  1NO1 A;  5C18 A;  4DR3 M;  2DAI A;  2XF3 A;  2DWM A;  1DGG A;  4GKK M;  1HQY E;  3M6A A;  2I7P A;  2OOA A;  4X65 M;  3GLG B;  3T1Y M;  2LTU A;  1NJG A;  3AOE C;  1DGH B;  4MGZ E;  1VEK A;  3J81 S;  2UXC M;  3GLH E;  4NC6 A;  1PGY A;  1JR3 D;  3AJI B;  1A5T A;  2O5R A;  4OW0 A;  1E9S A;  4M9X A;  1XWI A;  5DNY A;  1XMQ M;  3GLH A;  5FLX S;  2VII A;  3VKH A;  4I5S A;  4LJ5 A;  3RE8 A;  4LGM A;  4AKG A;  3WHK A;  2MH8 A;  5H37 D;  1GJS A;  3M0E A;  2KNV A;  1R2Y A;  1D2N A;  4X64 M;  2EUC A;  1GO5 A;  4LJ7 A;  3C3E A;  3U6L A;  4B7F A;  4QNR A;  1S3S A;  4IIW A;  4LJ6 A;  2R18 A;  5KPR A;  3UMM A;  2OOB A;  4IJE A;  1G71 A;  1E9R A;  1WGN A;  4RNA A;  3AOG A;  3GLI B;  1UM8 A;  3FUT A;  3GRR A;  1QVR A;  3GPP A;  1NY6 A;  2WSF F;  2B3T A;  4NOO B;  3B89 A;  3SAT A;  4OX9 M;  4DR7 M;  4RKU F;  3SC3 A;  1ZV1 A;  1IN4 A;  1YUB A;  2FFJ A;  4QHS A;  1QQW A;  1RU3 A;  2C9C A;  3I51 A;  2LHC A;  2KEB A;  4JI8 M;  2OO9 A;  2L2D A;  2JY7 A;  2OPF A;  2R46 A;  1N33 M;  4X62 M;  1XHB A;  3SHG B;  3SAU A;  4BBA A;  3Q8X A;  2DEN A;  2DAE A;  4A3V B;  1IN8 A;  2C99 A;  5LMU M;  4GC5 A;  1SXJ E;  4LJ4 A;  1QUT A;  1X37 A;  4LF8 M;  2FNA A;  3GPX A;  3KSX A;  2KA6 B;  1SXJ A;  1G4A E;  1TTE A;  3K92 A;  4PT5 A;  3GLH B;  1VDL A;  4L8R C;  2DAM A;  4LF4 M;  2K47 A;  4JI3 M;  2RGH A;  3M7G A;  2QP9 X;  1OIZ A;  2C98 A;  3WHL A;  1G3I A;  1MN3 A;  1NVM A;  1WJ7 A;  3TWM A;  1NHG C;  4IBF A;  2LHG A;  3CF0 A;  4R71 A;  1TDZ A;  2KNA A;  3L29 A;  1GKI A;  3HJQ A;  3IG5 A;  2QPA A;  3FYD A;  4HL4 A;  3HHW A;  3GLF E;  1L8Q A;  2F5P A;  4FCT A;  3L26 A;  2R0I A;  3SHF A;  3FUX A;  3A46 A;  4DUY M;  3GLF A;  4HLQ A;  4JN6 A;  4NSR A;  2L7I A;  2F5O A;  1R4G A;  1NV8 A;  4R7G A;  4L16 A;  1T6O A;  2V1C A;  4LZJ A;  3SMP A;  5E26 A;  2DWZ B;  4IBJ A;  4L6V 6;  3VDP A;  3GLG E;  4DV3 M;  3KDS E;  4KT0 F;  3TPZ A;  4B7H A;  1UFZ A;  2UXD M;  3FRI A;  3THG A;  2JZ1 A;  1J09 A;  5IWA M;  3GPY A;  3GLG A;  1N78 A;  3J7A S;  3KP1 E;  1IY1 A;  1SG9 A;  4LJ9 A;  4JV5 M;  1DGH A;  1VEG A;  2EO2 A;  1YE9 A;  2XFT A;  2XSZ D;  3E21 A;  4D80 A;  2QEN A;  4Z6Y A;  2XGN A;  3K2L A;  3LVV A;  5KPT A;  3FTE A;  3K9O A;  1IN6 A;  4JI2 M;  1TR8 A;  4JI6 M;  1WGL A;  2L09 A;  4IBK A;  2HAK A;  3A45 A;  1QAO A;  4BLC A;  2Z3X A;  2LNH C;  4DV1 M;  3I4V A;  3D8L A;  4IBD A;  4B08 A;  3AKZ A;  2ZAN A;  2K9D A;  4RF0 A;  3W68 A;  4LFA M;  3RGS A;  1SXJ B;  4FWG A;  4DV5 M;  1IXZ A;  2APL A;  2CHV A;  1XNQ M;  2CE7 A;  3JR4 A;  1V34 A;  4PDG A;  5IZ7 D;  2F5Q A;  2DNA A;  2G3Q A;  1QDR A;  2R4J A;  3B7N A;  3U6E A;  5DYI A;  3HJ8 A;  3TE6 A;  4AQY M;  1N36 M;  1VQ1 A;  2YR0 A;  2DHY A;  3KFU G;  2JY6 B;  2R44 A;  2UUC M;  3PNY A;  3K8Z A;  4MGK E;  4LGY A;  4GH9 A;  4LFB M;  4I4L A;  2L4F A;  2JY5 A;  1TH3 A;  3HHZ A;  4IBB A;  3FE3 A;  2GQF A;  1C7Y A;  2JP7 A;  4IBE A;  3LCU A;  3KP0 E;  1Q3C A;  4LY6 A;  1QDT A;  2JXN A;  2ZM6 M;  2D7G A;  3HJS A;  3GLF B;  1IFY A;  2CWB A;  4W5W A;  3T15 A;  3U6S A;  5EXT A;  1KYI A;  3EIE A;  4PDI A;  2F5S A;  3J2P B;  4DV2 M;  1OIP A;  1Z5B A;  3VDU A;  3DFZ A;  1LTM A;  3K1J A;  4AKH A;  1GVN A;  1GL6 A;  4L78 A;  2QCU A;  1IY0 A;  3HY5 A;  3MMP A;  3W0L B;  3UJN A;  2FS1 A;  1PJQ A;  2R45 A;  4WUR A;  3A98 B;  2ZAM A;  2LVA A;  3DZD A;  3QAU A;  1IY2 A;  2XEP A;  1JQJ C;  4M0D A;  3OTO M;  2JWS A;  2KZS A;  4UN2 B;  1NNU C;  1L2C A;  4QNM A;  1E94 E;  1DV0 A;  4XK8 F;  1HNW M;  2L6O A;  3SMS A;  2YQZ A;  2QQ8 A;  1IM2 A;  5A2Q S;  2DVW B;  1TH4 A;  4D82 A;  1P3Q Q;  3MJ5 A;  3U6O A;  4JI0 M;  2XZU A;  2DAG A;  3ZC7 B;  1KFV A;  3LCV B;  1D0L A;  4CJ6 A;  1N34 M;  3NBI A;  4KO8 A;  2C5R A;  3R9X B;  3D8B A;  1OAI A;  4NL4 H;  5EXS A;  4Z8X A;  3PVS A;  1G41 A;  3HWS A;  4GRI A;  4AG6 A;  1QAQ A;  5KPZ A;  4REZ A;  2KDL A;  2LVQ D;  3IG8 A;  3U6C A;  1OFI A;  3JAM S;  2LVO C;  3SBJ A;  1L2D A;  2Y0Q A;  1R2Z A;  2DZL A;  3CGW A;  1VDD A;  3B7Z A;  2H5X A;  5DYG A;  5FTM A;  2VF8 A;  3VLF B;  2JUJ A;  5LMN M;  3J80 S;  4FCV A;  1IBM M;  5JI2 E;  1EE8 A;  2QHO B;  3HKP A;  2X8A A;  3B7Q A;  1N77 A;  2M5Z A;  2LVN C;  1QZM A;  2ZTD A;  4DV7 M;  3W0F A;  3F92 A;  4G3O A;  4I8O A;  3KW6 A;  2A5Y B;  3E9S A;  1XXH B;  1Z6T A;  3KOZ E;  4L15 A;  2Z7J A;  1ZMV A;  2CRU A;  4GC9 A;  3J7B A;  3HZJ A;  5F3W A;  2MR9 A;  3IEC A;  1ZQ9 A;  2HWJ A;  4MH0 E;  1Z5A A;  1Y8G A;  4X66 M;  3U6D A;  1QAN A;  2NQ8 C;  2HL7 A;  5EJC A;  1NSF A;  3MK6 A;  4B7G A;  1K3W A;  1IQP A;  4LFC M;  3ILK A;  5EP2 A;  1HQC A;  4LF5 M;  2F4V M;  2AHM A;  2FOI C;  4NRV A;  3TWL A;  4MB7 A;  3NBX X;  3IHP A;  1ZMU A;  2KXE A;  4GHL A;  1D0K A;  1XNR M;  3CF6 E;  2EA0 A;  2R4E A;  3UZU A;  1BVS A;  1R5L A;  1R6B X;  5JI3 E;  2Z4R A;  1G59 A;  4JI7 M;  3VFD A;  1L1T A;  4XBO A;  1VEJ A;  2UXB M;  1JB0 F;  1I94 M;  1G8P A;  4DR6 M;  2CEA A;  4IBI A;  3U6P A;  2EKK A;  2D7H A;  2WSC F;  2HCB A;  2J7O A;  2EJS A;  4KOD A;  2DWN A;  3FTF A;  2O25 A;  2CV0 A;  1TF0 B;  1HT1 E;  2MRO B;  3ZH9 B;  4LF7 M;  5EP1 A;  3AOE A;  2VDB B;  3GQ4 A;  3K9P A;  3CTW B;  1EFU B;  1Q39 A;  3B9P A;  1OJL A;  2W82 A;  2K0B X;  1NNJ A;  2R62 A;  2QBY A;  1F4I A;  3GRY A;  4G6Z A;  3MHV C;  1CUK A;  4AG5 A;  1SXJ D;  2V6Z M;  5EXX A;  2DHR A;  3JR5 A;  2KW0 A;  3AFH A;  1JR3 E;  3HGI A;  3E4R A;  3L25 A;  4BB9 A;  3QYE A;  5BR8 M;  1N75 A;  3VKG A;  4DUZ M;  8CAT A;  2J7N A;  1WHC A;  3BBZ A;  4FCW A;  2ERC A;  4OU7 A;  5FTL A;  1JR3 A;  1YLA A;  2Z8Y M;  3U6M A;  1SXJ C;  2JA2 A;  3L28 A;  2VQF M;  2LVP C;  1NV9 A;  3LQR A;  3GP1 A;  4B3T M;  2OQ4 A;  1W5S A;  3J27 B;  2LWX A;  1R7R A;  4II7 A;  1Z59 A;  3V76 A;  3SFZ A;  1OAO C;  3UK6 A;  4AI6 A;  4DR5 M;  1MX0 A;  5KO3 A;  3VK8 A;  4LRS A;  2D7E A;  3U60 A;  2DI0 A;  3U61 A;  1AUA A;  3RFW A;  3U5Z B;  3R8F A;  4NXN M;  2XLJ A;  1E32 A;  2KZU A;  3E46 A;  1NY5 A;  4GIP A;  1XB2 B;  1XXH E; 
#chains in the Genus database with same CATH homology
 2LVQ D;  2MGW A;  2LVO C;  1Q02 A;  1G3I A;  2QSF X;  1MN3 A;  1WJ7 A;  2KNZ A;  1VG5 A;  2BWB A;  2DAK A;  2DZL A;  1OTR A;  1T43 A;  2CP8 A;  2KNA A;  4R71 A;  2H5X A;  3FRH A;  2JUJ A;  3GLF E;  5JI2 E;  2QHO B;  2R0I A;  2L4E A;  2LVN C;  2ZTD A;  3F92 A;  1R4G A;  2DKL A;  1NV8 A;  1T6O A;  3GLG E;  1DO0 A;  4WP2 A;  3GLI E;  4DBG B;  2JY8 A;  1AIP C;  1UFZ A;  1QZE A;  2JNH A;  3FRI A;  2JZ1 A;  4HEO A;  2MJ5 B;  2RRU A;  1ZMV A;  1SG9 A;  1OKS A;  1DO2 A;  1VEG A;  3E21 A;  1ZMW A;  1OQY A;  4F2L A;  2MR9 A;  3IEC A;  2BWE A;  2WZJ A;  3K9O A;  2HWJ A;  1TR8 A;  1Y8G A;  1WGL A;  2HAK A;  5DFL A;  2ZTC A;  1WIV A;  1V92 A;  2JZ0 A;  2KHH A;  2K9D A;  2QNJ A;  2DAI A;  1HQY E;  2OOA A;  3IHP A;  1ZMU A;  2LTU A;  2DNA A;  2G3Q A;  1VEK A;  3GLH E;  1PGY A;  3T6P A;  1BVS A;  1VQ1 A;  2DHY A;  1A5T A;  2JY6 B;  1VEJ A;  4GEW A;  4F1I A;  2EKK A;  2L4F A;  2JY5 A;  2EJS A;  2LBC A;  3FE3 A;  2O25 A;  1C7Y A;  2JP7 A;  1HT1 E;  2KNV A;  2MRO B;  3LCU A;  3H4J A;  1HJP A;  1IFY A;  3K9P A;  2CWB A;  1GO5 A;  1EFU B;  2K0B X;  1F4I A;  1KYI A;  1CUK A;  2OOB A;  1WGN A;  1JR3 E;  3MMP A;  2B3T A;  1WHC A;  3B89 A;  3BBZ A;  2LVA A;  4Q7J A;  1YLA A;  1ZV1 A;  1HT2 E;  4UN2 B;  1E94 E;  1DV0 A;  2OO9 A;  2L2D A;  2LVP C;  1NV9 A;  2JY7 A;  2EKF A;  1IM2 A;  1WR1 B;  1P3Q Q;  2DEN A;  2DAE A;  2DAG A;  3LCV B;  1IXS A;  1OAI A;  2DI0 A;  1G4A E;  1G41 A;  1TTE A;  1VDL A;  3E46 A;  4G3O A;  2DAM A;  1XB2 B;  1XXH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...