4F2LA

Structure of a regulatory domain of ampk
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
61
structure length
61
Chain Sequence
SSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title Conserved regulatory elements in AMPK
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 17
structure length 61
sequence length 61
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4f2lA00
1HT1E 1WR1B 3LCVB 4F2LA 2ZTCA 2DENA 1OAIA 1SG9A 1VQ1A 2DAEA 5DFLA 1ZV1A 2R0IA 3E21A 4R71A 2CWBA 1OQYA 2L2DA 1BVSA 2JY6B 1MN3A 1WIVA 2JY8A 2KNVA 1NV9A 2JY5A 3B89A 2WZJA 4Q7JA 2L4EA 1OKSA 2LVNC 2CP8A 1KYIA 1HT2E 2DAIA 1WGLA 2OOAA 4WP2A 1UFZA 3LCUA 1AIPC 1TR8A 2JY7A 2K0BX 3E46A 2JNHA 1TTEA 1VEJA 1R4GA 1IXSA 1A5TA 1EFUB 1DO2A 3H4JA 1HQYE 1ZMVA 1CUKA 1G41A 1VDLA 2OOBA 1PGYA 3IECA 2LVAA 2MR9A 1C7YA 2LTUA 2MJ5B 3K9OA 4DBGB 1WJ7A 2DHYA 1DO0A 1GO5A 2DZLA 2LVPC 4G3OA 2BWBA 2JZ0A 3BBZA 3T6PA 1WHCA 2LBCA 2ZTDA 1DV0A 1NV8A 2DKLA 3K9PA 2DAGA 2OO9A 1G3IA 1ZMUA 1F4IA 1T6OA 2EJSA 1G4AE 3FE3A 4F1IA 1Y8GA 2DI0A 3FRIA 1XXHE 1YLAA 2EKFA 1P3QQ 2RRUA 3GLHE 2HAKA 2KNAA 3MMPA 3GLIE 2BWEA 4GEWA 2MROB 3IHPA 2JP7A 1OTRA 1WGNA 2B3TA 2EKKA 2LVQD 1JR3E 2KNZA 2L4FA 3F92A 3FRHA 2QNJA 2QSFX 1VG5A 2DAKA 2G3QA 1ZMWA 1Q02A 2KHHA 2JZ1A 1HJPA 1IFYA 2MGWA 1VEGA 1V92A 5JI2E 2DNAA 2LVOC 2DAMA 2O25A 2K9DA 2HWJA 2H5XA 1IM2A 4UN2B 3GLGE 1E94E 3GLFE 1T43A 1VEKA 1QZEA 2JUJA 4HEOA 2QHOB 1XB2B
chains in the Genus database with same CATH superfamily
1HT1E 1R2ZA 4GMQA 4NL4H 1PJQA 3DFZA 4G4NA 2ZAOA 2R4JA 2XEPA 3I04M 5FTMA 3SFZA 1V33A 4X64M 4YHHM 2F5SA 4JI6M 3AFHA 3MJ5A 1VQ1A 5EJCA 4B7FA 3UMMA 1ZV1A 3WHKA 3R9XB 2C9OA 2KA6B 2R45A 1N75A 2YR0A 4L15A 4DV4M 1K3XA 1NHWC 3SARA 4R71A 1IQPA 1L8QA 4FD2A 3SHFA 1OJLA 2X49A 4FCVA 5ITRA 4RKUF 2L2DA 2K47A 1HNXM 3GPPA 4NSRA 2JY8A 1TH4A 2Z8YM 1NV9A 3AOEA 1D2NA 1RU3A 3VDPA 4L8RC 2L4EA 3HHXA 3NBIA 5EXXA 2CP8A 1KYIA 1HT2E 1TH2A 2DAIA 3J80S 5EP4A 2DZOB 3K8ZA 2W82A 2Z4SA 4PD2A 5KQ8A 1UFZA 5ITUA 5EXTA 4MB7A 1OFHA 3LCUA 3L25A 1AIPC 1TR8A 1H6UA 2KDLA 3QWLA 4KHPM 1TH3A 2AHMA 2LWXA 5EXSA 1IXSA 1A5TA 1DO2A 3H4JA 5DNYA 3EIHA 1N77A 2UUAM 2UU9M 2LHGA 1ZMVA 3FYDA 4KLNA 5ITXA 4CJ6A 3JR5A 3HHWA 4JXJA 3TQSA 3HU1A 4LG2A 1XXHB 3KSJA 3FTEA 3FTCA 2RKOA 3MHVC 4NXNM 4XBOA 3PVSA 4Z6YA 1QYRA 3GPXA 5GKNA 4LY6A 2F4VM 2LTUA 2MJ5B 1L2DA 2V6ZM 4B7HA 1XNRM 2GQFA 2XFTA 3HHYA 1WJ7A 3KW6A 1PM5A 4CISA 3T38A 2FS1A 3LVVA 3FTFA 1GO5A 1D0MA 1R6BX 4G3OA 2QP9X 3LMMA 2UXCM 3FKEA 3U5ZA 2XZUA 4PDIA 1NNUC 1OIZA 1SXJC 1W5SA 2HHHM 4WURA 4MGKE 1Z59A 1OAOC 2ZAMA 5EQTA 3FUWA 3J7AS 2Y0TA 4DV1M 3K9PA 1SXJE 4DR6M 3M6AA 2OO9A 5FTJA 1G3IA 3LW5F 2CHQA 2JA2A 2F5OA 1F4IA 2EJSA 3GQ4A 2KEBA 3GQ5A 3PNVA 1XWIA 1S3SA 3QYEA 1LTMA 1Y8GA 3SATA 3FRIA 3K1JA 1TGUA 5KQDA 2UXBM 2O01F 2H1RA 1PJJA 3BXWA 2KNAA 2XLJA 2BWEA 4JI2M 3U6SA 3CF0A 4LF7M 3HKPA 4LFCM 2JP7A 3UZUA 4L16A 3TWLA 3WHLA 1X37A 4S12A 2LVQD 3KDSE 1JR3E 2Z4RA 3KOXE 3J81S 3F92A 3RFWA 4AKGA 4B3RM 4JN6A 2QNJA 3HU2A 3GLGA 3GLFA 4JI1M 4DR4M 2KHHA 1QAMA 1HJPA 4GITA 4OVZA 1IFYA 2MGWA 1VEGA 2MH8A 3KOZE 2Y20A 4X66M 4ITQA 2HCBA 4LJ7A 4QNRA 2L09A 2H5XA 2LH0A 3RE8A 3RGPA 4UN2B 4I81A 3B7NA 2YFQA 1NVMA 3LVWA 1IBMM 1GJTA 1K82A 2JUJA 1VDDA 4IBKA 2QHOB 3JR4A 4DR2M 1XB2B 4DV5M 4JV5M 3TE6A 1IY1A 2DWNA 1WR1B 4DV6M 3J2PB 3QYBA 4FW9A 1TDZA 4XK8F 1OAIA 2WSEF 3W0FA 2KZUA 1QDRA 4IBGA 4M9XA 5FTKA 4TUWA 4LJ4A 3VK8A 2R0IA 2V1CA 3B74A 1HQCA 3DOAA 1I94M 2CWBA 4DV3M 4KT0F 2CHGA 4DV0M 3QAUA 1MN3A 3SAWA 1WIVA 2CRUA 1EE8A 4LGYA 5DYGA 3LQRA 1IXSB 1E9SA 2WZJA 2X4AA 2ZM6M 1SXJA 3THGA 3EIEA 4A3VB 2Z7JA 2LVNC 3AJIB 5F3WA 1L2CA 3FUTA 2K6BA 1WGLA 5LMUM 4WP2A 2D7EA 4FVMA 4NSOB 1WXQA 2V1UA 4XGIA 4BB9A 5KPRA 3GO8A 3HX3A 3E46A 3Q8XA 4IBFA 3GRVA 5IREB 4GKKM 3SBJA 3HHZA 2E5LM 1VEJA 1R7RA 4MH0E 3U6EA 1N34M 2KZSA 2KRUA 4JYAM 1IN7A 2YQZA 1HQYE 3DZDA 1J5EM 3U5ZB 1G41A 4FWDA 4G4QA 4LFBM 1VDLA 3I51A 1MU5A 4LF8M 4LF9M 1PGYA 1PJSA 3L2AA 4MGZE 3SYKA 1DGFA 3CF6E 4LCBA 1PRBA 5FTNA 4AKIA 1DGHA 3B9PA 3H4MA 1C7YA 3GQ3A 2ZBKB 2DWLA 4LRSA 3I4VA 2BJVA 4M0DA 2VIIA 4DBGB 1D0LA 3A42A 3AKZA 4D80A 3U61A 1R2YA 1XNQM 2DZLA 1NJGA 4GC5A 4G4OA 4IBJA 4LF6M 3BBZA 3T6PA 2Y21A 4AZFA 2APLA 2M60A 3T15A 1HR0M 4JI5M 1DV0A 3E4RA 1GJSA 3FUXA 4FCWA 5EP3A 3VFDA 2R6FA 2CV0A 2DAGA 2C98A 1DGGA 4LJ8A 3U6LA 1NNJA 1HNWM 2EO2A 2L6OA 1G4AE 3HGIA 3L29A 2QZ4A 2DXIA 1D0KA 4IBEA 3I4YA 2FNAA 2DI0A 3GLGB 1XXHE 2RRUA 3GLHE 1P3QQ 4MGIE 3GLFB 2QPAA 3GLIE 4B3TM 4OVZB 1FJGM 3IHPA 1K3WA 4K0KM 5IWAM 1SXJD 1WGNA 4GKJM 1R5LA 3L27A 1ORYB 1Z5CA 3SASA 2F5QA 4LJAA 2XGNA 2JWSA 3KFUG 2KNZA 2F5PA 1NY5A 1QAQA 3W68A 1IBKM 2FFJA 4AQYM 4Y28F 4M9SA 1C1KA 1QANA 2JZ1A 3HJQA 3PXGA 2CUZA 1FNNA 4LJ6A 5JI2E 2CE7A 3KOWE 1JR3D 2DAMA 2N35A 2O25A 3GRYA 4DV2M 5C1BA 1J7KA 4GIPA 1IM2A 2C5RA 3HWSA 2XSZD 3I01M 4EIWA 5LMNM 1L2BA 4CIZA 2JXNA 3FYCA 4DUYM 2D7GA 4QOZC 4DR5M 3V76A 4PT5A 4G4RA 1T3TA 1NSFA 4JI4M 3LCVB 5E6JA 1E32A 1QZMA 3SAVA 3C3DA 3KS8A 4G6ZA 1IN5A 1SXJB 3U6OA 1TF0B 3VK7A 1G59A 4JI7M 2DAEA 5DFLA 2VQFM 1QVRA 4KO8A 4LFAM 5FSWA 4DR1M 1XMOM 1GL6A 1NHGC 4I8OA 4JI0M 2A5YB 2Q2EB 3AOGA 5FLXS 3J7BA 5EXPA 2GNOA 4LF5M 2JY6B 2BNKA 2VF7A 3B7ZA 3C3EA 5ITQA 4FWGA 3K2LA 1JB0F 1TDHA 2KNVA 3B89A 2DWMA 3ZC7B 3T1YM 2KW0A 4P17A 4ZPXA 1Z5AA 1Z6TA 3AOEC 1AUAA 2C96A 1DGHB 2JY7A 2YNMD 3W67A 5EP1A 1TTEA 4AG6A 3VDUA 1GLNA 4I4LA 4NXMM 1EFUB 3U61B 3VKHA 2R65A 5KPZA 2XZFA 1L1TA 3AV0A 4IBBA 1NJFA 1XHBA 4IJFA 2D7HA 2OOBA 4LZJA 4RNAA 4GHAA 1KSFX 4D81A 4HLQA 2EA0A 2MR9A 4X62M 4LF4M 1XMQM 4OU7A 5JI3E 1I4WA 3K9OA 1G71A 1Q3BA 3FUUA 2LHCA 1KFVA 2CV1A 3OTOM 5ITXE 2CEAA 3A45A 4DUZM 4MGYE 2JZ0A 5BR8M 2LNHC 3U6DA 2DHRA 2LBCA 3SMSA 1V34A 2ZTDA 1IY2A 4Z8XA 1NV8A 2DKLA 2L7IA 2I7PA 2CHVA 3HU3A 4YY3M 3FTDA 4HL4A 5ITYA 3E9SA 3KVWA 2FOIC 4OW0A 4AG5A 4DR7M 1PJIA 1N78A 4LRTA 3FE3A 5IZ7D 1IBLM 1JR3A 2XH9A 3BOSA 3NBXX 4IBDA 3GRUA 2DZNB 3MMPA 3PNYA 2XSZA 4LGMA 4NRVA 4GEWA 3ZQJA 2VDBB 2MROB 3ILKA 4QNMA 4GHLA 1Q39A 1QUTA 4ANRA 2R4EA 2B3TA 2RGOA 3CGWA 2C9CA 1IN8A 4OX9M 3KP1E 2QENA 2BJWA 4REZA 2I7NA 3U6MA 4PCZA 2G3QA 4GC9A 1JQJC 4W5WA 2DVWB 5BPVA 2XF3A 4X65M 1Q3CA 3HJSA 1N32M 1V92A 1GL7A 2DNAA 3AL0C 1GKIA 2LVOC 2QQ8A 4KODA 2QBYA 3TWMA 2Y0QA 3L28A 4QHSA 2LXEA 2VF8A 2DWZB 4JI3M 3GLGE 1N36M 1N33M 1E94E 3GLFE 3U60A 1T43A 3TL4X 3TPZA 3IG5A 2L7HA 3IG8A 1IXZA 1QZEA 1LV7A 3D8BA 4HEOA 2R62A 4MGHA 3SMPA 3KOYE 3ZCBB 2R44A 4D82A 2RGHA 4DV7M 4IIWA 2FE8A 2CFOA 2G8LA 1Z5BA 2R46A 3UGJA 3SC3A 4F2LA 2OQ4A 2ZTCA 2DENA 3TWKA 2X8AA 4IJEA 1SG9A 3U6CA 3Q8GA 4IBCA 3VLFB 4LZZA 3C58A 3E21A 3B7QA 3KS4A 4QOSA 1OQYA 3FD9A 4BBAA 3JAMS 3GLHB 4I5SA 4P16A 1BVSA 3GLIB 1QDTA 3KXEC 4FCTA 4II7A 3R8FA 2J7NA 3KP0E 5FTLA 2JY5A 1MX0A 2F5NA 4Q7JA 2G5GX 1OKSA 4QHTA 1QQWA 4GH9A 5C18A 3UJNA 4LJ5A 1EIJA 2UXDM 2OOAA 3GPUA 2J7OA 3GPYA 4CHTB 4FWHA 4B3MM 1XC8A 2K0BX 2JNHA 4B7GA 2QCUA 1G8PA 3A98B 3LQQA 1R4GA 8CATA 5E26A 3NWLA 1YE9A 2ZANA 2Z3XA 3HZJA 3U6QA 3DA1A 4MM3B 2UUCM 3CF2A 1CUKA 3SYLA 4RF0A 2KRKA 5ITTA 1E9RA 4AKHA 1OFIA 5IT9S 2WSCF 1NO1A 2C99A 3D8LA 3IECA 2LVAA 4CGYB 5KO3A 1OIPA 1GVNA 2KXEA 1DGBA 3HJ8A 4JI8M 2CV2A 4M9ZA 4NRWA 3PFIA 4B08A 4L6V6 5H37D 1DO0A 2DHYA 2LVPC 3U6PA 1IN6A 4PDGA 2HKJA 2BWBA 4NC6A 3RGSA 2EUCA 1WHCA 3ZH9B 1XXHA 3GLHA 5EP2A 2J5YA 4LJ9A 5L8RF 3GLIA 3K92A 3SHGB 1NY6A 3GP1A 1IXRC 1GABA 4RF1A 3FUVA 3M7GA 1ZMUA 1PJTA 1T6OA 4GRIA 4F1IA 5KPTA 2OPFA 4NOOB 1YLAA 2EKFA 3W0LB 1J09A 2HAKA 1W5TA 1YSYA 2FH0A 2O5RA 3SAUA 4AI6A 1IY0A 4IBIA 4L4UA 1OTRA 3A46A 5DYIA 4WW0A 2NQ8C 4R3DA 1QAOA 2QBYB 1UM8A 7CATA 2EKKA 1QUSA 4BLCA 2L4FA 3FRHA 4DR3M 3CTWB 3U60B 2UUBM 5A2QS 2HL7A 2ERCA 2QSFX 1MJGM 3MK6A 1VG5A 2DAKA 1ZMWA 1Q02A 4R7GA 2XFSA 3HY5A 2VQEM 4B3SM 3KSXA 3UK6A 1HNZM 3J27B 3GRRA 2K9DA 3L26A 2P5TA 2HWJA 3T1HM 1ZAEA 3C9PA 2WSFF 1L1ZA 3VKGA 3M0EA 1ZQ9A 4AW4A 4L78A 1VEKA 1YUBA 2M5ZA 4M0WA 1IN4A 2R18A
chains in the Genus database with same CATH topology
1HT1E 1WR1B 3LCVB 4F2LA 2ZTCA 2DENA 1OAIA 1SG9A 1VQ1A 2DAEA 5DFLA 1ZV1A 2R0IA 3E21A 4R71A 2CWBA 1OQYA 2L2DA 1BVSA 2JY6B 1MN3A 1WIVA 2JY8A 2KNVA 1NV9A 2JY5A 3B89A 2WZJA 4Q7JA 2L4EA 1OKSA 2LVNC 2CP8A 1KYIA 1HT2E 2DAIA 1WGLA 2OOAA 4WP2A 1UFZA 3LCUA 1AIPC 1TR8A 2JY7A 2K0BX 3E46A 2JNHA 1TTEA 1VEJA 1R4GA 1IXSA 1A5TA 1EFUB 1DO2A 3H4JA 1HQYE 1ZMVA 1CUKA 1G41A 1VDLA 2OOBA 1PGYA 3IECA 2LVAA 2MR9A 1C7YA 2LTUA 2MJ5B 3K9OA 4DBGB 1WJ7A 2DHYA 1DO0A 1GO5A 2DZLA 2LVPC 4G3OA 2BWBA 2JZ0A 3BBZA 3T6PA 1WHCA 2LBCA 2ZTDA 1DV0A 1NV8A 2DKLA 3K9PA 2DAGA 2OO9A 1G3IA 1ZMUA 1F4IA 1T6OA 2EJSA 1G4AE 3FE3A 4F1IA 1Y8GA 2DI0A 3FRIA 1XXHE 1YLAA 2EKFA 1P3QQ 2RRUA 3GLHE 2HAKA 2KNAA 3MMPA 3GLIE 2BWEA 4GEWA 2MROB 3IHPA 2JP7A 1OTRA 1WGNA 2B3TA 2EKKA 2LVQD 1JR3E 2KNZA 2L4FA 3F92A 3FRHA 2QNJA 2QSFX 1VG5A 2DAKA 2G3QA 1ZMWA 1Q02A 2KHHA 2JZ1A 1HJPA 1IFYA 2MGWA 1VEGA 1V92A 5JI2E 2DNAA 2LVOC 2DAMA 2O25A 2K9DA 2HWJA 2H5XA 1IM2A 4UN2B 3GLGE 1E94E 3GLFE 1T43A 1VEKA 1QZEA 2JUJA 4HEOA 2QHOB 1XB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HT1 E;  1WR1 B;  3LCV B;  4F2L A;  2ZTC A;  2DEN A;  1OAI A;  1SG9 A;  1VQ1 A;  2DAE A;  5DFL A;  1ZV1 A;  2R0I A;  3E21 A;  4R71 A;  2CWB A;  1OQY A;  2L2D A;  1BVS A;  2JY6 B;  1MN3 A;  1WIV A;  2JY8 A;  2KNV A;  1NV9 A;  2JY5 A;  3B89 A;  2WZJ A;  4Q7J A;  2L4E A;  1OKS A;  2LVN C;  2CP8 A;  1KYI A;  1HT2 E;  2DAI A;  1WGL A;  2OOA A;  4WP2 A;  1UFZ A;  3LCU A;  1AIP C;  1TR8 A;  2JY7 A;  2K0B X;  3E46 A;  2JNH A;  1TTE A;  1VEJ A;  1R4G A;  1IXS A;  1A5T A;  1EFU B;  1DO2 A;  3H4J A;  1HQY E;  1ZMV A;  1CUK A;  1G41 A;  1VDL A;  2OOB A;  1PGY A;  3IEC A;  2LVA A;  2MR9 A;  1C7Y A;  2LTU A;  2MJ5 B;  3K9O A;  4DBG B;  1WJ7 A;  2DHY A;  1DO0 A;  1GO5 A;  2DZL A;  2LVP C;  4G3O A;  2BWB A;  2JZ0 A;  3BBZ A;  3T6P A;  1WHC A;  2LBC A;  2ZTD A;  1DV0 A;  1NV8 A;  2DKL A;  3K9P A;  2DAG A;  2OO9 A;  1G3I A;  1ZMU A;  1F4I A;  1T6O A;  2EJS A;  1G4A E;  3FE3 A;  4F1I A;  1Y8G A;  2DI0 A;  3FRI A;  1XXH E;  1YLA A;  2EKF A;  1P3Q Q;  2RRU A;  3GLH E;  2HAK A;  2KNA A;  3MMP A;  3GLI E;  2BWE A;  4GEW A;  2MRO B;  3IHP A;  2JP7 A;  1OTR A;  1WGN A;  2B3T A;  2EKK A;  2LVQ D;  1JR3 E;  2KNZ A;  2L4F A;  3F92 A;  3FRH A;  2QNJ A;  2QSF X;  1VG5 A;  2DAK A;  2G3Q A;  1ZMW A;  1Q02 A;  2KHH A;  2JZ1 A;  1HJP A;  1IFY A;  2MGW A;  1VEG A;  1V92 A;  5JI2 E;  2DNA A;  2LVO C;  2DAM A;  2O25 A;  2K9D A;  2HWJ A;  2H5X A;  1IM2 A;  4UN2 B;  3GLG E;  1E94 E;  3GLF E;  1T43 A;  1VEK A;  1QZE A;  2JUJ A;  4HEO A;  2QHO B;  1XB2 B; 
#chains in the Genus database with same CATH topology
 1HT1 E;  1R2Z A;  4GMQ A;  4NL4 H;  1PJQ A;  3DFZ A;  4G4N A;  2ZAO A;  2R4J A;  2XEP A;  3I04 M;  5FTM A;  3SFZ A;  1V33 A;  4X64 M;  4YHH M;  2F5S A;  4JI6 M;  3AFH A;  3MJ5 A;  1VQ1 A;  5EJC A;  4B7F A;  3UMM A;  1ZV1 A;  3WHK A;  3R9X B;  2C9O A;  2KA6 B;  2R45 A;  1N75 A;  2YR0 A;  4L15 A;  4DV4 M;  1K3X A;  1NHW C;  3SAR A;  4R71 A;  1IQP A;  1L8Q A;  4FD2 A;  3SHF A;  1OJL A;  2X49 A;  4FCV A;  5ITR A;  4RKU F;  2L2D A;  2K47 A;  1HNX M;  3GPP A;  4NSR A;  2JY8 A;  1TH4 A;  2Z8Y M;  1NV9 A;  3AOE A;  1D2N A;  1RU3 A;  3VDP A;  4L8R C;  2L4E A;  3HHX A;  3NBI A;  5EXX A;  2CP8 A;  1KYI A;  1HT2 E;  1TH2 A;  2DAI A;  3J80 S;  5EP4 A;  2DZO B;  3K8Z A;  2W82 A;  2Z4S A;  4PD2 A;  5KQ8 A;  1UFZ A;  5ITU A;  5EXT A;  4MB7 A;  1OFH A;  3LCU A;  3L25 A;  1AIP C;  1TR8 A;  1H6U A;  2KDL A;  3QWL A;  4KHP M;  1TH3 A;  2AHM A;  2LWX A;  5EXS A;  1IXS A;  1A5T A;  1DO2 A;  3H4J A;  5DNY A;  3EIH A;  1N77 A;  2UUA M;  2UU9 M;  2LHG A;  1ZMV A;  3FYD A;  4KLN A;  5ITX A;  4CJ6 A;  3JR5 A;  3HHW A;  4JXJ A;  3TQS A;  3HU1 A;  4LG2 A;  1XXH B;  3KSJ A;  3FTE A;  3FTC A;  2RKO A;  3MHV C;  4NXN M;  4XBO A;  3PVS A;  4Z6Y A;  1QYR A;  3GPX A;  5GKN A;  4LY6 A;  2F4V M;  2LTU A;  2MJ5 B;  1L2D A;  2V6Z M;  4B7H A;  1XNR M;  2GQF A;  2XFT A;  3HHY A;  1WJ7 A;  3KW6 A;  1PM5 A;  4CIS A;  3T38 A;  2FS1 A;  3LVV A;  3FTF A;  1GO5 A;  1D0M A;  1R6B X;  4G3O A;  2QP9 X;  3LMM A;  2UXC M;  3FKE A;  3U5Z A;  2XZU A;  4PDI A;  1NNU C;  1OIZ A;  1SXJ C;  1W5S A;  2HHH M;  4WUR A;  4MGK E;  1Z59 A;  1OAO C;  2ZAM A;  5EQT A;  3FUW A;  3J7A S;  2Y0T A;  4DV1 M;  3K9P A;  1SXJ E;  4DR6 M;  3M6A A;  2OO9 A;  5FTJ A;  1G3I A;  3LW5 F;  2CHQ A;  2JA2 A;  2F5O A;  1F4I A;  2EJS A;  3GQ4 A;  2KEB A;  3GQ5 A;  3PNV A;  1XWI A;  1S3S A;  3QYE A;  1LTM A;  1Y8G A;  3SAT A;  3FRI A;  3K1J A;  1TGU A;  5KQD A;  2UXB M;  2O01 F;  2H1R A;  1PJJ A;  3BXW A;  2KNA A;  2XLJ A;  2BWE A;  4JI2 M;  3U6S A;  3CF0 A;  4LF7 M;  3HKP A;  4LFC M;  2JP7 A;  3UZU A;  4L16 A;  3TWL A;  3WHL A;  1X37 A;  4S12 A;  2LVQ D;  3KDS E;  1JR3 E;  2Z4R A;  3KOX E;  3J81 S;  3F92 A;  3RFW A;  4AKG A;  4B3R M;  4JN6 A;  2QNJ A;  3HU2 A;  3GLG A;  3GLF A;  4JI1 M;  4DR4 M;  2KHH A;  1QAM A;  1HJP A;  4GIT A;  4OVZ A;  1IFY A;  2MGW A;  1VEG A;  2MH8 A;  3KOZ E;  2Y20 A;  4X66 M;  4ITQ A;  2HCB A;  4LJ7 A;  4QNR A;  2L09 A;  2H5X A;  2LH0 A;  3RE8 A;  3RGP A;  4UN2 B;  4I81 A;  3B7N A;  2YFQ A;  1NVM A;  3LVW A;  1IBM M;  1GJT A;  1K82 A;  2JUJ A;  1VDD A;  4IBK A;  2QHO B;  3JR4 A;  4DR2 M;  1XB2 B;  4DV5 M;  4JV5 M;  3TE6 A;  1IY1 A;  2DWN A;  1WR1 B;  4DV6 M;  3J2P B;  3QYB A;  4FW9 A;  1TDZ A;  4XK8 F;  1OAI A;  2WSE F;  3W0F A;  2KZU A;  1QDR A;  4IBG A;  4M9X A;  5FTK A;  4TUW A;  4LJ4 A;  3VK8 A;  2R0I A;  2V1C A;  3B74 A;  1HQC A;  3DOA A;  1I94 M;  2CWB A;  4DV3 M;  4KT0 F;  2CHG A;  4DV0 M;  3QAU A;  1MN3 A;  3SAW A;  1WIV A;  2CRU A;  1EE8 A;  4LGY A;  5DYG A;  3LQR A;  1IXS B;  1E9S A;  2WZJ A;  2X4A A;  2ZM6 M;  1SXJ A;  3THG A;  3EIE A;  4A3V B;  2Z7J A;  2LVN C;  3AJI B;  5F3W A;  1L2C A;  3FUT A;  2K6B A;  1WGL A;  5LMU M;  4WP2 A;  2D7E A;  4FVM A;  4NSO B;  1WXQ A;  2V1U A;  4XGI A;  4BB9 A;  5KPR A;  3GO8 A;  3HX3 A;  3E46 A;  3Q8X A;  4IBF A;  3GRV A;  5IRE B;  4GKK M;  3SBJ A;  3HHZ A;  2E5L M;  1VEJ A;  1R7R A;  4MH0 E;  3U6E A;  1N34 M;  2KZS A;  2KRU A;  4JYA M;  1IN7 A;  2YQZ A;  1HQY E;  3DZD A;  1J5E M;  3U5Z B;  1G41 A;  4FWD A;  4G4Q A;  4LFB M;  1VDL A;  3I51 A;  1MU5 A;  4LF8 M;  4LF9 M;  1PGY A;  1PJS A;  3L2A A;  4MGZ E;  3SYK A;  1DGF A;  3CF6 E;  4LCB A;  1PRB A;  5FTN A;  4AKI A;  1DGH A;  3B9P A;  3H4M A;  1C7Y A;  3GQ3 A;  2ZBK B;  2DWL A;  4LRS A;  3I4V A;  2BJV A;  4M0D A;  2VII A;  4DBG B;  1D0L A;  3A42 A;  3AKZ A;  4D80 A;  3U61 A;  1R2Y A;  1XNQ M;  2DZL A;  1NJG A;  4GC5 A;  4G4O A;  4IBJ A;  4LF6 M;  3BBZ A;  3T6P A;  2Y21 A;  4AZF A;  2APL A;  2M60 A;  3T15 A;  1HR0 M;  4JI5 M;  1DV0 A;  3E4R A;  1GJS A;  3FUX A;  4FCW A;  5EP3 A;  3VFD A;  2R6F A;  2CV0 A;  2DAG A;  2C98 A;  1DGG A;  4LJ8 A;  3U6L A;  1NNJ A;  1HNW M;  2EO2 A;  2L6O A;  1G4A E;  3HGI A;  3L29 A;  2QZ4 A;  2DXI A;  1D0K A;  4IBE A;  3I4Y A;  2FNA A;  2DI0 A;  3GLG B;  1XXH E;  2RRU A;  3GLH E;  1P3Q Q;  4MGI E;  3GLF B;  2QPA A;  3GLI E;  4B3T M;  4OVZ B;  1FJG M;  3IHP A;  1K3W A;  4K0K M;  5IWA M;  1SXJ D;  1WGN A;  4GKJ M;  1R5L A;  3L27 A;  1ORY B;  1Z5C A;  3SAS A;  2F5Q A;  4LJA A;  2XGN A;  2JWS A;  3KFU G;  2KNZ A;  2F5P A;  1NY5 A;  1QAQ A;  3W68 A;  1IBK M;  2FFJ A;  4AQY M;  4Y28 F;  4M9S A;  1C1K A;  1QAN A;  2JZ1 A;  3HJQ A;  3PXG A;  2CUZ A;  1FNN A;  4LJ6 A;  5JI2 E;  2CE7 A;  3KOW E;  1JR3 D;  2DAM A;  2N35 A;  2O25 A;  3GRY A;  4DV2 M;  5C1B A;  1J7K A;  4GIP A;  1IM2 A;  2C5R A;  3HWS A;  2XSZ D;  3I01 M;  4EIW A;  5LMN M;  1L2B A;  4CIZ A;  2JXN A;  3FYC A;  4DUY M;  2D7G A;  4QOZ C;  4DR5 M;  3V76 A;  4PT5 A;  4G4R A;  1T3T A;  1NSF A;  4JI4 M;  3LCV B;  5E6J A;  1E32 A;  1QZM A;  3SAV A;  3C3D A;  3KS8 A;  4G6Z A;  1IN5 A;  1SXJ B;  3U6O A;  1TF0 B;  3VK7 A;  1G59 A;  4JI7 M;  2DAE A;  5DFL A;  2VQF M;  1QVR A;  4KO8 A;  4LFA M;  5FSW A;  4DR1 M;  1XMO M;  1GL6 A;  1NHG C;  4I8O A;  4JI0 M;  2A5Y B;  2Q2E B;  3AOG A;  5FLX S;  3J7B A;  5EXP A;  2GNO A;  4LF5 M;  2JY6 B;  2BNK A;  2VF7 A;  3B7Z A;  3C3E A;  5ITQ A;  4FWG A;  3K2L A;  1JB0 F;  1TDH A;  2KNV A;  3B89 A;  2DWM A;  3ZC7 B;  3T1Y M;  2KW0 A;  4P17 A;  4ZPX A;  1Z5A A;  1Z6T A;  3AOE C;  1AUA A;  2C96 A;  1DGH B;  2JY7 A;  2YNM D;  3W67 A;  5EP1 A;  1TTE A;  4AG6 A;  3VDU A;  1GLN A;  4I4L A;  4NXM M;  1EFU B;  3U61 B;  3VKH A;  2R65 A;  5KPZ A;  2XZF A;  1L1T A;  3AV0 A;  4IBB A;  1NJF A;  1XHB A;  4IJF A;  2D7H A;  2OOB A;  4LZJ A;  4RNA A;  4GHA A;  1KSF X;  4D81 A;  4HLQ A;  2EA0 A;  2MR9 A;  4X62 M;  4LF4 M;  1XMQ M;  4OU7 A;  5JI3 E;  1I4W A;  3K9O A;  1G71 A;  1Q3B A;  3FUU A;  2LHC A;  1KFV A;  2CV1 A;  3OTO M;  5ITX E;  2CEA A;  3A45 A;  4DUZ M;  4MGY E;  2JZ0 A;  5BR8 M;  2LNH C;  3U6D A;  2DHR A;  2LBC A;  3SMS A;  1V34 A;  2ZTD A;  1IY2 A;  4Z8X A;  1NV8 A;  2DKL A;  2L7I A;  2I7P A;  2CHV A;  3HU3 A;  4YY3 M;  3FTD A;  4HL4 A;  5ITY A;  3E9S A;  3KVW A;  2FOI C;  4OW0 A;  4AG5 A;  4DR7 M;  1PJI A;  1N78 A;  4LRT A;  3FE3 A;  5IZ7 D;  1IBL M;  1JR3 A;  2XH9 A;  3BOS A;  3NBX X;  4IBD A;  3GRU A;  2DZN B;  3MMP A;  3PNY A;  2XSZ A;  4LGM A;  4NRV A;  4GEW A;  3ZQJ A;  2VDB B;  2MRO B;  3ILK A;  4QNM A;  4GHL A;  1Q39 A;  1QUT A;  4ANR A;  2R4E A;  2B3T A;  2RGO A;  3CGW A;  2C9C A;  1IN8 A;  4OX9 M;  3KP1 E;  2QEN A;  2BJW A;  4REZ A;  2I7N A;  3U6M A;  4PCZ A;  2G3Q A;  4GC9 A;  1JQJ C;  4W5W A;  2DVW B;  5BPV A;  2XF3 A;  4X65 M;  1Q3C A;  3HJS A;  1N32 M;  1V92 A;  1GL7 A;  2DNA A;  3AL0 C;  1GKI A;  2LVO C;  2QQ8 A;  4KOD A;  2QBY A;  3TWM A;  2Y0Q A;  3L28 A;  4QHS A;  2LXE A;  2VF8 A;  2DWZ B;  4JI3 M;  3GLG E;  1N36 M;  1N33 M;  1E94 E;  3GLF E;  3U60 A;  1T43 A;  3TL4 X;  3TPZ A;  3IG5 A;  2L7H A;  3IG8 A;  1IXZ A;  1QZE A;  1LV7 A;  3D8B A;  4HEO A;  2R62 A;  4MGH A;  3SMP A;  3KOY E;  3ZCB B;  2R44 A;  4D82 A;  2RGH A;  4DV7 M;  4IIW A;  2FE8 A;  2CFO A;  2G8L A;  1Z5B A;  2R46 A;  3UGJ A;  3SC3 A;  4F2L A;  2OQ4 A;  2ZTC A;  2DEN A;  3TWK A;  2X8A A;  4IJE A;  1SG9 A;  3U6C A;  3Q8G A;  4IBC A;  3VLF B;  4LZZ A;  3C58 A;  3E21 A;  3B7Q A;  3KS4 A;  4QOS A;  1OQY A;  3FD9 A;  4BBA A;  3JAM S;  3GLH B;  4I5S A;  4P16 A;  1BVS A;  3GLI B;  1QDT A;  3KXE C;  4FCT A;  4II7 A;  3R8F A;  2J7N A;  3KP0 E;  5FTL A;  2JY5 A;  1MX0 A;  2F5N A;  4Q7J A;  2G5G X;  1OKS A;  4QHT A;  1QQW A;  4GH9 A;  5C18 A;  3UJN A;  4LJ5 A;  1EIJ A;  2UXD M;  2OOA A;  3GPU A;  2J7O A;  3GPY A;  4CHT B;  4FWH A;  4B3M M;  1XC8 A;  2K0B X;  2JNH A;  4B7G A;  2QCU A;  1G8P A;  3A98 B;  3LQQ A;  1R4G A;  8CAT A;  5E26 A;  3NWL A;  1YE9 A;  2ZAN A;  2Z3X A;  3HZJ A;  3U6Q A;  3DA1 A;  4MM3 B;  2UUC M;  3CF2 A;  1CUK A;  3SYL A;  4RF0 A;  2KRK A;  5ITT A;  1E9R A;  4AKH A;  1OFI A;  5IT9 S;  2WSC F;  1NO1 A;  2C99 A;  3D8L A;  3IEC A;  2LVA A;  4CGY B;  5KO3 A;  1OIP A;  1GVN A;  2KXE A;  1DGB A;  3HJ8 A;  4JI8 M;  2CV2 A;  4M9Z A;  4NRW A;  3PFI A;  4B08 A;  4L6V 6;  5H37 D;  1DO0 A;  2DHY A;  2LVP C;  3U6P A;  1IN6 A;  4PDG A;  2HKJ A;  2BWB A;  4NC6 A;  3RGS A;  2EUC A;  1WHC A;  3ZH9 B;  1XXH A;  3GLH A;  5EP2 A;  2J5Y A;  4LJ9 A;  5L8R F;  3GLI A;  3K92 A;  3SHG B;  1NY6 A;  3GP1 A;  1IXR C;  1GAB A;  4RF1 A;  3FUV A;  3M7G A;  1ZMU A;  1PJT A;  1T6O A;  4GRI A;  4F1I A;  5KPT A;  2OPF A;  4NOO B;  1YLA A;  2EKF A;  3W0L B;  1J09 A;  2HAK A;  1W5T A;  1YSY A;  2FH0 A;  2O5R A;  3SAU A;  4AI6 A;  1IY0 A;  4IBI A;  4L4U A;  1OTR A;  3A46 A;  5DYI A;  4WW0 A;  2NQ8 C;  4R3D A;  1QAO A;  2QBY B;  1UM8 A;  7CAT A;  2EKK A;  1QUS A;  4BLC A;  2L4F A;  3FRH A;  4DR3 M;  3CTW B;  3U60 B;  2UUB M;  5A2Q S;  2HL7 A;  2ERC A;  2QSF X;  1MJG M;  3MK6 A;  1VG5 A;  2DAK A;  1ZMW A;  1Q02 A;  4R7G A;  2XFS A;  3HY5 A;  2VQE M;  4B3S M;  3KSX A;  3UK6 A;  1HNZ M;  3J27 B;  3GRR A;  2K9D A;  3L26 A;  2P5T A;  2HWJ A;  3T1H M;  1ZAE A;  3C9P A;  2WSF F;  1L1Z A;  3VKG A;  3M0E A;  1ZQ9 A;  4AW4 A;  4L78 A;  1VEK A;  1YUB A;  2M5Z A;  4M0W A;  1IN4 A;  2R18 A; 
#chains in the Genus database with same CATH homology
 1HT1 E;  1WR1 B;  3LCV B;  4F2L A;  2ZTC A;  2DEN A;  1OAI A;  1SG9 A;  1VQ1 A;  2DAE A;  5DFL A;  1ZV1 A;  2R0I A;  3E21 A;  4R71 A;  2CWB A;  1OQY A;  2L2D A;  1BVS A;  2JY6 B;  1MN3 A;  1WIV A;  2JY8 A;  2KNV A;  1NV9 A;  2JY5 A;  3B89 A;  2WZJ A;  4Q7J A;  2L4E A;  1OKS A;  2LVN C;  2CP8 A;  1KYI A;  1HT2 E;  2DAI A;  1WGL A;  2OOA A;  4WP2 A;  1UFZ A;  3LCU A;  1AIP C;  1TR8 A;  2JY7 A;  2K0B X;  3E46 A;  2JNH A;  1TTE A;  1VEJ A;  1R4G A;  1IXS A;  1A5T A;  1EFU B;  1DO2 A;  3H4J A;  1HQY E;  1ZMV A;  1CUK A;  1G41 A;  1VDL A;  2OOB A;  1PGY A;  3IEC A;  2LVA A;  2MR9 A;  1C7Y A;  2LTU A;  2MJ5 B;  3K9O A;  4DBG B;  1WJ7 A;  2DHY A;  1DO0 A;  1GO5 A;  2DZL A;  2LVP C;  4G3O A;  2BWB A;  2JZ0 A;  3BBZ A;  3T6P A;  1WHC A;  2LBC A;  2ZTD A;  1DV0 A;  1NV8 A;  2DKL A;  3K9P A;  2DAG A;  2OO9 A;  1G3I A;  1ZMU A;  1F4I A;  1T6O A;  2EJS A;  1G4A E;  3FE3 A;  4F1I A;  1Y8G A;  2DI0 A;  3FRI A;  1XXH E;  1YLA A;  2EKF A;  1P3Q Q;  2RRU A;  3GLH E;  2HAK A;  2KNA A;  3MMP A;  3GLI E;  2BWE A;  4GEW A;  2MRO B;  3IHP A;  2JP7 A;  1OTR A;  1WGN A;  2B3T A;  2EKK A;  2LVQ D;  1JR3 E;  2KNZ A;  2L4F A;  3F92 A;  3FRH A;  2QNJ A;  2QSF X;  1VG5 A;  2DAK A;  2G3Q A;  1ZMW A;  1Q02 A;  2KHH A;  2JZ1 A;  1HJP A;  1IFY A;  2MGW A;  1VEG A;  1V92 A;  5JI2 E;  2DNA A;  2LVO C;  2DAM A;  2O25 A;  2K9D A;  2HWJ A;  2H5X A;  1IM2 A;  4UN2 B;  3GLG E;  1E94 E;  3GLF E;  1T43 A;  1VEK A;  1QZE A;  2JUJ A;  4HEO A;  2QHO B;  1XB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...