4F2LA

Structure of a regulatory domain of ampk
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
61
structure length
61
Chain Sequence
b'SSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title Conserved regulatory elements in AMPK
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 17
structure length 61
sequence length 61
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4f2lA00
2OOBA 2JY8A 2LBCA 3B89A 3K9OA 1PGYA 1TTEA 2DENA 3MMPA 2DZLA 2O25A 1IXSA 1F4IA 5JI2E 4HEOA 1WIVA 1CUKA 2L2DA 3LCUA 1NV9A 2LVNC 2QNJA 2EKKA 1T43A 4F1IA 1IM2A 2CWBA 1V92A 4WP2A 2QSFX 1Q02A 3T6PA 1JR3E 3GLGE 2JY6B 1HJPA 1HT2E 1AIPC 1VDLA 3GLIE 3F92A 2MR9A 1OTRA 2MJ5B 5DFLA 3FRIA 2CP8A 2MGWA 1R4GA 1WR1B 2L4EA 1ZV1A 4GEWA 1WGLA 2KNAA 2JP7A 2JZ1A 1WGNA 3BBZA 3GLHE 2RRUA 1P3QQ 2KHHA 1DV0A 4Q7JA 2BWEA 2R0IA 2JUJA 1Y8GA 1XB2B 2HWJA 2OO9A 2HAKA 2DAIA 1VEGA 1VG5A 2ZTCA 4G3OA 2EJSA 1HT1E 1E94E 3FE3A 1YLAA 4DBGB 2DAEA 1GO5A 1ZMWA 3LCVB 1C7YA 1OKSA 1WHCA 1EFUB 1HQYE 1OAIA 2BWBA 3E21A 2K0BX 1XXHE 2EKFA 2JY7A 2DNAA 2ZTDA 2DKLA 1WJ7A 2WZJA 2K9DA 1TR8A 1MN3A 1SG9A 2LTUA 1OQYA 2L4FA 3GLFE 1VEKA 2B3TA 3FRHA 2LVOC 2DAKA 2JNHA 2LVPC 2MROB 3H4JA 2DI0A 2OOAA 2QHOB 2DAMA 2LVAA 1KYIA 1G41A 2G3QA 4F2LA 2KNZA 1VQ1A 1A5TA 1NV8A 1IFYA 2DHYA 3K9PA 4R71A 3IHPA 2KNVA 1ZMVA 1T6OA 1DO2A 2LVQD 2JY5A 2JZ0A 2DAGA 1QZEA 1ZMUA 3IECA 1G4AE 1DO0A 1UFZA 2H5XA 1VEJA 4UN2B 1BVSA 3E46A 1G3IA
chains in the Genus database with same CATH superfamily
3HHXA 2L6OA 2BNKA 3K9OA 1IY0A 4AKHA 3T15A 1NJFA 2DENA 3L28A 1SXJB 1F4IA 1Q3BA 3FUTA 1WIVA 2EA0A 1CUKA 4GMQA 4QNRA 4MM3B 2LVNC 3QYEA 5EP2A 4LF8M 3TWLA 2QNJA 2EKKA 1LV7A 1NY5A 4RKUF 3T1YM 1GJTA 2AHMA 4LJAA 1NNUC 3SFZA 4F1IA 3U61B 4P16A 4WP2A 3AOEC 1MX0A 1EE8A 1Z5BA 1QAQA 4XBOA 4YHHM 3GQ5A 3TWKA 4WW0A 3T6PA 3GLGE 2D7HA 1IN6A 3J7AS 2JY6B 1HJPA 3F92A 1XXHB 4D81A 4LCBA 4LF7M 4GHAA 1DGHA 5F3WA 1IN4A 3FRIA 2MGWA 2Z8YM 1ZV1A 4GEWA 1WGLA 1IXRC 2KNAA 1QZMA 3K8ZA 3C3DA 1JR3A 3BBZA 3GLHE 4DR1M 3HHWA 4LJ4A 2N35A 3Q8GA 3R8FA 1P3QQ 3GPXA 2Z7JA 4LF9M 3MHVC 1JB0F 4GRIA 2BWEA 2R0IA 1XB2B 3KS8A 2LWXA 3LVWA 2OO9A 4M0DA 2HAKA 3T1HM 4WURA 4IBEA 5FSWA 2QZ4A 5ITRA 3PNYA 4A3VB 1E94E 4IBFA 4REZA 3PVSA 1ORYB 4Z8XA 3HHYA 1GO5A 5JI3E 4X66M 3VDUA 1IBKM 5C18A 4AZFA 2ZBKB 4LGMA 3I4YA 5EJCA 1EFUB 3SAUA 3FTFA 2QPAA 1GJSA 2A5YB 4OW0A 4LRSA 2JY7A 3B7ZA 4B7FA 3U6OA 4JV5M 2DKLA 1WJ7A 5KQDA 5ITXA 2OQ4A 3GP1A 2KZUA 1SXJD 1OQYA 2L4FA 2CE7A 3GRVA 2R4EA 4KLNA 4LJ5A 4DUZM 4JI2M 1TDZA 1XMOM 3B9PA 2GQFA 3A42A 2JNHA 4M9ZA 1L2CA 2LVPC 3FTEA 2VF7A 3HKPA 1X37A 2OOAA 2FE8A 2DAMA 1K3WA 1N75A 5E6JA 5EXTA 1G41A 3TE6A 3KOZE 2V1CA 1OIPA 4L16A 1QVRA 2KNZA 3A45A 3W0FA 4BBAA 2UU9M 2DHYA 4KHPM 2EUCA 2KNVA 2CHQA 3E4RA 4B3MM 1DO2A 1L8QA 5EP3A 4GHLA 2JY5A 3B74A 2LXEA 3KOXE 4QNMA 3FTDA 1QZEA 4LGYA 2UXBM 1XXHA 3IECA 4B3SM 3VKGA 1G71A 1E9RA 3FTCA 2R62A 1D2NA 4W5WA 2D7EA 2QENA 1DGBA 1UFZA 3OTOM 4LJ6A 4LFAM 5ITYA 3U6MA 2JY8A 4QOSA 2LH0A 2WSCF 4HL4A 4IBGA 4G4QA 4LY6A 3FUXA 3VDPA 4FCVA 2DVWB 3B7QA 1PJSA 1H6UA 4L4UA 5H37D 1G8PA 2L2DA 3LCUA 4CIZA 4DR5M 4G6ZA 4CISA 5KO3A 3HJQA 2C98A 3SATA 3I4VA 2DXIA 3NBXX 1T43A 3J27B 3Q8XA 3GPUA 3FUUA 2Y0QA 2VF8A 2KA6B 1V92A 2MH8A 3KOWE 1N36M 2QSFX 4CHTB 2LHCA 1Q02A 1IN7A 1E32A 3H4MA 3DOAA 4IBCA 4PDGA 1EIJA 2Y21A 1TDHA 1R2YA 1DGGA 2MR9A 2YNMD 2Q2EB 4PCZA 2MJ5B 3CF6E 2CP8A 2UXDM 1R4GA 2KDLA 3SMSA 3L2AA 2L4EA 2V6ZM 4B7GA 2F5SA 2JZ1A 4G4RA 2L7IA 4AKIA 3U60B 4KODA 2CV0A 2ZAMA 1C1KA 4B7HA 1ZQ9A 1SXJE 4NRWA 2KHHA 2GNOA 1QAMA 2VDBB 4LFBM 5EXPA 1RU3A 2L09A 1TH3A 3A46A 3UJNA 1J7KA 2DAIA 3HX3A 3GQ4A 1KFVA 1Z59A 4X65M 3J80S 3TPZA 4G3OA 1JR3D 1IN5A 4X64M 1SXJC 1YLAA 2KW0A 1TH4A 4P17A 1PJJA 1N78A 5L8RF 3T38A 3BOSA 1QUTA 4GITA 7CATA 3V76A 1YSYA 2G8LA 1C7YA 1OKSA 2R4JA 4NOOB 4OX9M 3HZJA 1OAOC 2K0BX 3JR5A 1XXHE 4ANRA 4LJ8A 4JI4M 3QAUA 1YUBA 2ZTDA 2F5PA 1IXZA 3W68A 4B3RM 1J09A 1TR8A 1SG9A 3ZQJA 2Z3XA 4JN6A 1V33A 4IBIA 2J7NA 4AG6A 4DV6M 4DR3M 3UK6A 4FCTA 2WSFF 2RGHA 4I8OA 3AL0C 2LVOC 4BB9A 5KPRA 2XEPA 2M60A 3U6PA 4LG2A 1L1TA 3H4JA 2VIIA 1NNJA 2Y20A 2M5ZA 2QHOB 3RGPA 4MGYE 4NRVA 2G5GX 3HGIA 2G3QA 5FTJA 1YE9A 1N32M 3M0EA 2C96A 1PRBA 1NV8A 2LHGA 8CATA 4GKJM 3RGSA 3GO8A 2D7GA 4R71A 3FUVA 2W82A 4FWHA 1XHBA 3QYBA 5FLXS 4FW9A 2QBYA 2XGNA 4NXNM 4LF4M 2UXCM 2O5RA 2XF3A 1FNNA 5IT9S 2F5OA 2QQ8A 1L1ZA 3GPPA 4BLCA 3KOYE 2DAGA 1MU5A 3HY5A 3SARA 4GH9A 2WSEF 2JXNA 1NHWC 3IG5A 3GLIB 1G59A 4IJFA 1ZAEA 5ITQA 4NL4H 3M7GA 2CV2A 5EP4A 4X62M 3C9PA 1GKIA 1V34A 1BVSA 4IIWA 2LNHC 1G3IA 1Q39A 4JI0M 2K47A 1Z6TA 3WHLA 3U60A 2DWMA 2F5QA 1R6BX 3B89A 4OVZB 1AUAA 3QWLA 4NC6A 5BR8M 3AFHA 1KSFX 3B7NA 3VKHA 4LFCM 3GRUA 3R9XB 2O25A 3HJ8A 1MJGM 4JXJA 3SYLA 1N77A 3CF2A 1HR0M 4RNAA 4ZPXA 4IBKA 4B3TM 4EIWA 2XSZA 4OU7A 3KDSE 5FTLA 1S3SA 2I7NA 4LJ9A 2CWBA 1L2DA 4MH0E 4IBJA 2Z4SA 2NQ8C 3LQRA 2HL7A 4PT5A 2UUCM 1XC8A 4CGYB 1JR3E 2DHRA 4DV3M 1K3XA 3HU3A 1PJIA 2HCBA 4JYAM 1HT2E 3HWSA 3K1JA 1HQCA 2CUZA 2CRUA 1NSFA 4LZZA 4TUWA 3ZC7B 4GKKM 2DWNA 1R5LA 3LW5F 5FTMA 4G4NA 4QOZC 3KXEC 3JR4A 1WGNA 3GLFB 1IY1A 1FJGM 1I4WA 5ITUA 1TH2A 4HLQA 2J7OA 5C1BA 2KRKA 3UZUA 1IQPA 4JI7M 4IBDA 2DZNB 5E26A 4L8RC 2F4VM 2JUJA 4MGZE 3NWLA 2QBYB 2H1RA 4LF5M 4XGIA 1VG5A 2ZTCA 3THGA 3AKZA 3GLHA 5KPTA 3U6EA 2EJSA 5ITXE 3FE3A 4DBGB 3ZCBB 2EO2A 2YFQA 4R7GA 3VLFB 3U6SA 1D0KA 2R65A 3CTWB 3LCVB 4I5SA 3W0LB 4NXMM 1HNWM 5DYIA 1WHCA 2FFJA 1D0LA 1OAIA 3WHKA 4L78A 3SMPA 1R2ZA 1D0MA 2EKFA 4KT0F 4AW4A 1TGUA 4QHTA 3JAMS 4DV5M 2FS1A 2WZJA 3EIEA 3KVWA 4DR4M 2XH9A 3GRRA 1XMQM 4LRTA 2XFTA 2LTUA 4MGHA 4NSOB 3GLIA 2RKOA 3U6DA 4D80A 2UUBM 1VDDA 3KP1E 3FRHA 5ITTA 4S12A 2R6FA 4FVMA 3KW6A 4R3DA 4M9SA 3SC3A 2O01F 5IZ7D 2ZAOA 2I7PA 3MK6A 3AJIB 4KO8A 3M6AA 5A2QS 4OVZA 1PJQA 5EXXA 4Y28F 1IY2A 1NHGC 2ZANA 2XLJA 2LVAA 2C99A 4GC5A 3LMMA 3J2PB 4F2LA 1QDRA 1UM8A 1L2BA 1NY6A 1XNRM 2X8AA 4JI3M 3SASA 3ZH9B 4LJ7A 4DV7M 1WXQA 4DR7M 3IHPA 4JI8M 3GPYA 4JI1M 2Z4RA 3VK8A 1GL7A 2DWZB 1N34M 2JZ0A 3HU1A 4YY3M 3CGWA 4IJEA 1W5TA 3ILKA 3GLGB 1ZMUA 1NO1A 2BJVA 2VQFM 2CV1A 3KS4A 1Z5AA 1OFHA 3FYCA 4M0WA 1QQWA 3L29A 4CJ6A 4XK8F 1G4AE 3VFDA 1DO0A 2CFOA 3RFWA 1VEJA 4UN2B 3U6QA 4II7A 2RGOA 2OOBA 2LBCA 3DFZA 3GLFA 1XNQM 3U6CA 1J5EM 2KRUA 3GLHB 1PGYA 1IBLM 1HNXM 5KQ8A 1E9SA 1TTEA 3LQQA 3MMPA 2DZLA 1IXSA 3NBIA 3LVVA 4I4LA 5JI2E 5IWAM 4HEOA 5FTKA 4DV0M 1QUSA 4FWDA 1NV9A 5EQTA 3UGJA 2R45A 3PFIA 3FD9A 3AOGA 4QHSA 4MB7A 3U6LA 5FTNA 1R7RA 1IM2A 3MJ5A 2UUAM 3BXWA 3IG8A 4K0KM 2R18A 4PDIA 3L25A 1QDTA 5DNYA 3I51A 1PM5A 3SAVA 1AIPC 2K6BA 1VDLA 3GLIE 1I94M 2L7HA 2XSZD 1HNZM 1OIZA 1OTRA 2ZM6M 3E9SA 5DFLA 3U5ZA 3A98B 4DV1M 4I81A 3RE8A 4G4OA 3D8LA 3VK7A 3I04M 2Y0TA 1WR1B 5EXSA 3KFUG 2YR0A 1QANA 2JP7A 4MGIE 4DR2M 3TWMA 2FOIC 4DV4M 4FCWA 2KZSA 2RRUA 2XZUA 2C9OA 3GRYA 3HHZA 4AG5A 1DV0A 2J5YA 2R46A 2F5NA 4Q7JA 3I01M 3SBJA 3SHGB 1Y8GA 5BPVA 2HWJA 4LZJA 5KPZA 2OPFA 3HU2A 4M9XA 5GKNA 4NSRA 1VEGA 3DA1A 3AOEA 1IBMM 4RF0A 3FKEA 3HJSA 4FD2A 1HT1E 5LMUM 4D82A 2DAEA 1NJGA 3J7BA 1SXJA 1XWIA 3L27A 4DV2M 3K92A 1ZMWA 1HQYE 2BWBA 2APLA 3E21A 1K82A 4FWGA 1IN8A 3PNVA 1NVMA 5DYGA 3SAWA 4L15A 2DNAA 3GQ3A 3K2LA 4AQYM 1DGHB 3U61A 2V1UA 1GABA 3GLGA 2X4AA 2K9DA 4L6V6 1MN3A 4LF6M 2YQZA 3AV0A 3KP0E 1OFIA 3CF0A 3J81S 3GLFE 2HHHM 4AKGA 1VEKA 2CHVA 3KSJA 1W5SA 2B3TA 4Z6YA 1IXSB 2E5LM 4AI6A 3EIHA 2DAKA 5LMNM 4JI5M 1QYRA 3TQSA 1QAOA 2CEAA 1Q3CA 4ITQA 1GLNA 3C58A 2MROB 3C3EA 2QP9X 4GC9A 1PJTA 2BJWA 1LTMA 1N33M 2DI0A 2KEBA 4DUYM 2R44A 1TF0B 1DGFA 2ERCA 1KYIA 4DR6M 2JWSA 3SYKA 4GIPA 1VQ1A 1A5TA 2DZOB 3SHFA 1IFYA 3K9PA 1JQJC 1GVNA 2C9CA 2FNAA 2CHGA 4PD2A 4RF1A 4JI6M 1Z5CA 3TL4X 1ZMVA 3DZDA 1T6OA 3U5ZB 3W67A 2KXEA 2LVQD 4MGKE 2C5RA 3PXGA 2XFSA 5IREB 2QCUA 2X49A 3L26A 2HKJA 5EP1A 4B08A 2FH0A 3KSXA 2P5TA 2JA2A 4IBBA 3UMMA 3D8BA 1OJLA 2DWLA 1T3TA 2H5XA 2XZFA 3FYDA 3FUWA 3E46A 2VQEM 1GL6A
chains in the Genus database with same CATH topology
2OOBA 2JY8A 2LBCA 3B89A 3K9OA 1PGYA 1TTEA 2DENA 3MMPA 2DZLA 2O25A 1IXSA 1F4IA 5JI2E 4HEOA 1WIVA 1CUKA 2L2DA 3LCUA 1NV9A 2LVNC 2QNJA 2EKKA 1T43A 4F1IA 1IM2A 2CWBA 1V92A 4WP2A 2QSFX 1Q02A 3T6PA 1JR3E 3GLGE 2JY6B 1HJPA 1HT2E 1AIPC 1VDLA 3GLIE 3F92A 2MR9A 1OTRA 2MJ5B 5DFLA 3FRIA 2CP8A 2MGWA 1R4GA 1WR1B 2L4EA 1ZV1A 4GEWA 1WGLA 2KNAA 2JP7A 2JZ1A 1WGNA 3BBZA 3GLHE 2RRUA 1P3QQ 2KHHA 1DV0A 4Q7JA 2BWEA 2R0IA 2JUJA 1Y8GA 1XB2B 2HWJA 2OO9A 2HAKA 2DAIA 1VEGA 1VG5A 2ZTCA 4G3OA 2EJSA 1HT1E 1E94E 3FE3A 1YLAA 4DBGB 2DAEA 1GO5A 1ZMWA 3LCVB 1C7YA 1OKSA 1WHCA 1EFUB 1HQYE 1OAIA 2BWBA 3E21A 2K0BX 1XXHE 2EKFA 2JY7A 2DNAA 2ZTDA 2DKLA 1WJ7A 2WZJA 2K9DA 1TR8A 1MN3A 1SG9A 2LTUA 1OQYA 2L4FA 3GLFE 1VEKA 2B3TA 3FRHA 2LVOC 2DAKA 2JNHA 2LVPC 2MROB 3H4JA 2DI0A 2OOAA 2QHOB 2DAMA 2LVAA 1KYIA 1G41A 2G3QA 4F2LA 2KNZA 1VQ1A 1A5TA 1NV8A 1IFYA 2DHYA 3K9PA 4R71A 3IHPA 2KNVA 1ZMVA 1T6OA 1DO2A 2LVQD 2JY5A 2JZ0A 2DAGA 1QZEA 1ZMUA 3IECA 1G4AE 1DO0A 1UFZA 2H5XA 1VEJA 4UN2B 1BVSA 3E46A 1G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOB A;  2JY8 A;  2LBC A;  3B89 A;  3K9O A;  1PGY A;  1TTE A;  2DEN A;  3MMP A;  2DZL A;  2O25 A;  1IXS A;  1F4I A;  5JI2 E;  4HEO A;  1WIV A;  1CUK A;  2L2D A;  3LCU A;  1NV9 A;  2LVN C;  2QNJ A;  2EKK A;  1T43 A;  4F1I A;  1IM2 A;  2CWB A;  1V92 A;  4WP2 A;  2QSF X;  1Q02 A;  3T6P A;  1JR3 E;  3GLG E;  2JY6 B;  1HJP A;  1HT2 E;  1AIP C;  1VDL A;  3GLI E;  3F92 A;  2MR9 A;  1OTR A;  2MJ5 B;  5DFL A;  3FRI A;  2CP8 A;  2MGW A;  1R4G A;  1WR1 B;  2L4E A;  1ZV1 A;  4GEW A;  1WGL A;  2KNA A;  2JP7 A;  2JZ1 A;  1WGN A;  3BBZ A;  3GLH E;  2RRU A;  1P3Q Q;  2KHH A;  1DV0 A;  4Q7J A;  2BWE A;  2R0I A;  2JUJ A;  1Y8G A;  1XB2 B;  2HWJ A;  2OO9 A;  2HAK A;  2DAI A;  1VEG A;  1VG5 A;  2ZTC A;  4G3O A;  2EJS A;  1HT1 E;  1E94 E;  3FE3 A;  1YLA A;  4DBG B;  2DAE A;  1GO5 A;  1ZMW A;  3LCV B;  1C7Y A;  1OKS A;  1WHC A;  1EFU B;  1HQY E;  1OAI A;  2BWB A;  3E21 A;  2K0B X;  1XXH E;  2EKF A;  2JY7 A;  2DNA A;  2ZTD A;  2DKL A;  1WJ7 A;  2WZJ A;  2K9D A;  1TR8 A;  1MN3 A;  1SG9 A;  2LTU A;  1OQY A;  2L4F A;  3GLF E;  1VEK A;  2B3T A;  3FRH A;  2LVO C;  2DAK A;  2JNH A;  2LVP C;  2MRO B;  3H4J A;  2DI0 A;  2OOA A;  2QHO B;  2DAM A;  2LVA A;  1KYI A;  1G41 A;  2G3Q A;  4F2L A;  2KNZ A;  1VQ1 A;  1A5T A;  1NV8 A;  1IFY A;  2DHY A;  3K9P A;  4R71 A;  3IHP A;  2KNV A;  1ZMV A;  1T6O A;  1DO2 A;  2LVQ D;  2JY5 A;  2JZ0 A;  2DAG A;  1QZE A;  1ZMU A;  3IEC A;  1G4A E;  1DO0 A;  1UFZ A;  2H5X A;  1VEJ A;  4UN2 B;  1BVS A;  3E46 A;  1G3I A; 
#chains in the Genus database with same CATH topology
 3HHX A;  2L6O A;  2BNK A;  3K9O A;  1IY0 A;  4AKH A;  3T15 A;  1NJF A;  2DEN A;  3L28 A;  1SXJ B;  1F4I A;  1Q3B A;  3FUT A;  1WIV A;  2EA0 A;  1CUK A;  4GMQ A;  4QNR A;  4MM3 B;  2LVN C;  3QYE A;  5EP2 A;  4LF8 M;  3TWL A;  2QNJ A;  2EKK A;  1LV7 A;  1NY5 A;  4RKU F;  3T1Y M;  1GJT A;  2AHM A;  4LJA A;  1NNU C;  3SFZ A;  4F1I A;  3U61 B;  4P16 A;  4WP2 A;  3AOE C;  1MX0 A;  1EE8 A;  1Z5B A;  1QAQ A;  4XBO A;  4YHH M;  3GQ5 A;  3TWK A;  4WW0 A;  3T6P A;  3GLG E;  2D7H A;  1IN6 A;  3J7A S;  2JY6 B;  1HJP A;  3F92 A;  1XXH B;  4D81 A;  4LCB A;  4LF7 M;  4GHA A;  1DGH A;  5F3W A;  1IN4 A;  3FRI A;  2MGW A;  2Z8Y M;  1ZV1 A;  4GEW A;  1WGL A;  1IXR C;  2KNA A;  1QZM A;  3K8Z A;  3C3D A;  1JR3 A;  3BBZ A;  3GLH E;  4DR1 M;  3HHW A;  4LJ4 A;  2N35 A;  3Q8G A;  3R8F A;  1P3Q Q;  3GPX A;  2Z7J A;  4LF9 M;  3MHV C;  1JB0 F;  4GRI A;  2BWE A;  2R0I A;  1XB2 B;  3KS8 A;  2LWX A;  3LVW A;  2OO9 A;  4M0D A;  2HAK A;  3T1H M;  4WUR A;  4IBE A;  5FSW A;  2QZ4 A;  5ITR A;  3PNY A;  4A3V B;  1E94 E;  4IBF A;  4REZ A;  3PVS A;  1ORY B;  4Z8X A;  3HHY A;  1GO5 A;  5JI3 E;  4X66 M;  3VDU A;  1IBK M;  5C18 A;  4AZF A;  2ZBK B;  4LGM A;  3I4Y A;  5EJC A;  1EFU B;  3SAU A;  3FTF A;  2QPA A;  1GJS A;  2A5Y B;  4OW0 A;  4LRS A;  2JY7 A;  3B7Z A;  4B7F A;  3U6O A;  4JV5 M;  2DKL A;  1WJ7 A;  5KQD A;  5ITX A;  2OQ4 A;  3GP1 A;  2KZU A;  1SXJ D;  1OQY A;  2L4F A;  2CE7 A;  3GRV A;  2R4E A;  4KLN A;  4LJ5 A;  4DUZ M;  4JI2 M;  1TDZ A;  1XMO M;  3B9P A;  2GQF A;  3A42 A;  2JNH A;  4M9Z A;  1L2C A;  2LVP C;  3FTE A;  2VF7 A;  3HKP A;  1X37 A;  2OOA A;  2FE8 A;  2DAM A;  1K3W A;  1N75 A;  5E6J A;  5EXT A;  1G41 A;  3TE6 A;  3KOZ E;  2V1C A;  1OIP A;  4L16 A;  1QVR A;  2KNZ A;  3A45 A;  3W0F A;  4BBA A;  2UU9 M;  2DHY A;  4KHP M;  2EUC A;  2KNV A;  2CHQ A;  3E4R A;  4B3M M;  1DO2 A;  1L8Q A;  5EP3 A;  4GHL A;  2JY5 A;  3B74 A;  2LXE A;  3KOX E;  4QNM A;  3FTD A;  1QZE A;  4LGY A;  2UXB M;  1XXH A;  3IEC A;  4B3S M;  3VKG A;  1G71 A;  1E9R A;  3FTC A;  2R62 A;  1D2N A;  4W5W A;  2D7E A;  2QEN A;  1DGB A;  1UFZ A;  3OTO M;  4LJ6 A;  4LFA M;  5ITY A;  3U6M A;  2JY8 A;  4QOS A;  2LH0 A;  2WSC F;  4HL4 A;  4IBG A;  4G4Q A;  4LY6 A;  3FUX A;  3VDP A;  4FCV A;  2DVW B;  3B7Q A;  1PJS A;  1H6U A;  4L4U A;  5H37 D;  1G8P A;  2L2D A;  3LCU A;  4CIZ A;  4DR5 M;  4G6Z A;  4CIS A;  5KO3 A;  3HJQ A;  2C98 A;  3SAT A;  3I4V A;  2DXI A;  3NBX X;  1T43 A;  3J27 B;  3Q8X A;  3GPU A;  3FUU A;  2Y0Q A;  2VF8 A;  2KA6 B;  1V92 A;  2MH8 A;  3KOW E;  1N36 M;  2QSF X;  4CHT B;  2LHC A;  1Q02 A;  1IN7 A;  1E32 A;  3H4M A;  3DOA A;  4IBC A;  4PDG A;  1EIJ A;  2Y21 A;  1TDH A;  1R2Y A;  1DGG A;  2MR9 A;  2YNM D;  2Q2E B;  4PCZ A;  2MJ5 B;  3CF6 E;  2CP8 A;  2UXD M;  1R4G A;  2KDL A;  3SMS A;  3L2A A;  2L4E A;  2V6Z M;  4B7G A;  2F5S A;  2JZ1 A;  4G4R A;  2L7I A;  4AKI A;  3U60 B;  4KOD A;  2CV0 A;  2ZAM A;  1C1K A;  4B7H A;  1ZQ9 A;  1SXJ E;  4NRW A;  2KHH A;  2GNO A;  1QAM A;  2VDB B;  4LFB M;  5EXP A;  1RU3 A;  2L09 A;  1TH3 A;  3A46 A;  3UJN A;  1J7K A;  2DAI A;  3HX3 A;  3GQ4 A;  1KFV A;  1Z59 A;  4X65 M;  3J80 S;  3TPZ A;  4G3O A;  1JR3 D;  1IN5 A;  4X64 M;  1SXJ C;  1YLA A;  2KW0 A;  1TH4 A;  4P17 A;  1PJJ A;  1N78 A;  5L8R F;  3T38 A;  3BOS A;  1QUT A;  4GIT A;  7CAT A;  3V76 A;  1YSY A;  2G8L A;  1C7Y A;  1OKS A;  2R4J A;  4NOO B;  4OX9 M;  3HZJ A;  1OAO C;  2K0B X;  3JR5 A;  1XXH E;  4ANR A;  4LJ8 A;  4JI4 M;  3QAU A;  1YUB A;  2ZTD A;  2F5P A;  1IXZ A;  3W68 A;  4B3R M;  1J09 A;  1TR8 A;  1SG9 A;  3ZQJ A;  2Z3X A;  4JN6 A;  1V33 A;  4IBI A;  2J7N A;  4AG6 A;  4DV6 M;  4DR3 M;  3UK6 A;  4FCT A;  2WSF F;  2RGH A;  4I8O A;  3AL0 C;  2LVO C;  4BB9 A;  5KPR A;  2XEP A;  2M60 A;  3U6P A;  4LG2 A;  1L1T A;  3H4J A;  2VII A;  1NNJ A;  2Y20 A;  2M5Z A;  2QHO B;  3RGP A;  4MGY E;  4NRV A;  2G5G X;  3HGI A;  2G3Q A;  5FTJ A;  1YE9 A;  1N32 M;  3M0E A;  2C96 A;  1PRB A;  1NV8 A;  2LHG A;  8CAT A;  4GKJ M;  3RGS A;  3GO8 A;  2D7G A;  4R71 A;  3FUV A;  2W82 A;  4FWH A;  1XHB A;  3QYB A;  5FLX S;  4FW9 A;  2QBY A;  2XGN A;  4NXN M;  4LF4 M;  2UXC M;  2O5R A;  2XF3 A;  1FNN A;  5IT9 S;  2F5O A;  2QQ8 A;  1L1Z A;  3GPP A;  4BLC A;  3KOY E;  2DAG A;  1MU5 A;  3HY5 A;  3SAR A;  4GH9 A;  2WSE F;  2JXN A;  1NHW C;  3IG5 A;  3GLI B;  1G59 A;  4IJF A;  1ZAE A;  5ITQ A;  4NL4 H;  3M7G A;  2CV2 A;  5EP4 A;  4X62 M;  3C9P A;  1GKI A;  1V34 A;  1BVS A;  4IIW A;  2LNH C;  1G3I A;  1Q39 A;  4JI0 M;  2K47 A;  1Z6T A;  3WHL A;  3U60 A;  2DWM A;  2F5Q A;  1R6B X;  3B89 A;  4OVZ B;  1AUA A;  3QWL A;  4NC6 A;  5BR8 M;  3AFH A;  1KSF X;  3B7N A;  3VKH A;  4LFC M;  3GRU A;  3R9X B;  2O25 A;  3HJ8 A;  1MJG M;  4JXJ A;  3SYL A;  1N77 A;  3CF2 A;  1HR0 M;  4RNA A;  4ZPX A;  4IBK A;  4B3T M;  4EIW A;  2XSZ A;  4OU7 A;  3KDS E;  5FTL A;  1S3S A;  2I7N A;  4LJ9 A;  2CWB A;  1L2D A;  4MH0 E;  4IBJ A;  2Z4S A;  2NQ8 C;  3LQR A;  2HL7 A;  4PT5 A;  2UUC M;  1XC8 A;  4CGY B;  1JR3 E;  2DHR A;  4DV3 M;  1K3X A;  3HU3 A;  1PJI A;  2HCB A;  4JYA M;  1HT2 E;  3HWS A;  3K1J A;  1HQC A;  2CUZ A;  2CRU A;  1NSF A;  4LZZ A;  4TUW A;  3ZC7 B;  4GKK M;  2DWN A;  1R5L A;  3LW5 F;  5FTM A;  4G4N A;  4QOZ C;  3KXE C;  3JR4 A;  1WGN A;  3GLF B;  1IY1 A;  1FJG M;  1I4W A;  5ITU A;  1TH2 A;  4HLQ A;  2J7O A;  5C1B A;  2KRK A;  3UZU A;  1IQP A;  4JI7 M;  4IBD A;  2DZN B;  5E26 A;  4L8R C;  2F4V M;  2JUJ A;  4MGZ E;  3NWL A;  2QBY B;  2H1R A;  4LF5 M;  4XGI A;  1VG5 A;  2ZTC A;  3THG A;  3AKZ A;  3GLH A;  5KPT A;  3U6E A;  2EJS A;  5ITX E;  3FE3 A;  4DBG B;  3ZCB B;  2EO2 A;  2YFQ A;  4R7G A;  3VLF B;  3U6S A;  1D0K A;  2R65 A;  3CTW B;  3LCV B;  4I5S A;  3W0L B;  4NXM M;  1HNW M;  5DYI A;  1WHC A;  2FFJ A;  1D0L A;  1OAI A;  3WHK A;  4L78 A;  3SMP A;  1R2Z A;  1D0M A;  2EKF A;  4KT0 F;  4AW4 A;  1TGU A;  4QHT A;  3JAM S;  4DV5 M;  2FS1 A;  2WZJ A;  3EIE A;  3KVW A;  4DR4 M;  2XH9 A;  3GRR A;  1XMQ M;  4LRT A;  2XFT A;  2LTU A;  4MGH A;  4NSO B;  3GLI A;  2RKO A;  3U6D A;  4D80 A;  2UUB M;  1VDD A;  3KP1 E;  3FRH A;  5ITT A;  4S12 A;  2R6F A;  4FVM A;  3KW6 A;  4R3D A;  4M9S A;  3SC3 A;  2O01 F;  5IZ7 D;  2ZAO A;  2I7P A;  3MK6 A;  3AJI B;  4KO8 A;  3M6A A;  5A2Q S;  4OVZ A;  1PJQ A;  5EXX A;  4Y28 F;  1IY2 A;  1NHG C;  2ZAN A;  2XLJ A;  2LVA A;  2C99 A;  4GC5 A;  3LMM A;  3J2P B;  4F2L A;  1QDR A;  1UM8 A;  1L2B A;  1NY6 A;  1XNR M;  2X8A A;  4JI3 M;  3SAS A;  3ZH9 B;  4LJ7 A;  4DV7 M;  1WXQ A;  4DR7 M;  3IHP A;  4JI8 M;  3GPY A;  4JI1 M;  2Z4R A;  3VK8 A;  1GL7 A;  2DWZ B;  1N34 M;  2JZ0 A;  3HU1 A;  4YY3 M;  3CGW A;  4IJE A;  1W5T A;  3ILK A;  3GLG B;  1ZMU A;  1NO1 A;  2BJV A;  2VQF M;  2CV1 A;  3KS4 A;  1Z5A A;  1OFH A;  3FYC A;  4M0W A;  1QQW A;  3L29 A;  4CJ6 A;  4XK8 F;  1G4A E;  3VFD A;  1DO0 A;  2CFO A;  3RFW A;  1VEJ A;  4UN2 B;  3U6Q A;  4II7 A;  2RGO A;  2OOB A;  2LBC A;  3DFZ A;  3GLF A;  1XNQ M;  3U6C A;  1J5E M;  2KRU A;  3GLH B;  1PGY A;  1IBL M;  1HNX M;  5KQ8 A;  1E9S A;  1TTE A;  3LQQ A;  3MMP A;  2DZL A;  1IXS A;  3NBI A;  3LVV A;  4I4L A;  5JI2 E;  5IWA M;  4HEO A;  5FTK A;  4DV0 M;  1QUS A;  4FWD A;  1NV9 A;  5EQT A;  3UGJ A;  2R45 A;  3PFI A;  3FD9 A;  3AOG A;  4QHS A;  4MB7 A;  3U6L A;  5FTN A;  1R7R A;  1IM2 A;  3MJ5 A;  2UUA M;  3BXW A;  3IG8 A;  4K0K M;  2R18 A;  4PDI A;  3L25 A;  1QDT A;  5DNY A;  3I51 A;  1PM5 A;  3SAV A;  1AIP C;  2K6B A;  1VDL A;  3GLI E;  1I94 M;  2L7H A;  2XSZ D;  1HNZ M;  1OIZ A;  1OTR A;  2ZM6 M;  3E9S A;  5DFL A;  3U5Z A;  3A98 B;  4DV1 M;  4I81 A;  3RE8 A;  4G4O A;  3D8L A;  3VK7 A;  3I04 M;  2Y0T A;  1WR1 B;  5EXS A;  3KFU G;  2YR0 A;  1QAN A;  2JP7 A;  4MGI E;  4DR2 M;  3TWM A;  2FOI C;  4DV4 M;  4FCW A;  2KZS A;  2RRU A;  2XZU A;  2C9O A;  3GRY A;  3HHZ A;  4AG5 A;  1DV0 A;  2J5Y A;  2R46 A;  2F5N A;  4Q7J A;  3I01 M;  3SBJ A;  3SHG B;  1Y8G A;  5BPV A;  2HWJ A;  4LZJ A;  5KPZ A;  2OPF A;  3HU2 A;  4M9X A;  5GKN A;  4NSR A;  1VEG A;  3DA1 A;  3AOE A;  1IBM M;  4RF0 A;  3FKE A;  3HJS A;  4FD2 A;  1HT1 E;  5LMU M;  4D82 A;  2DAE A;  1NJG A;  3J7B A;  1SXJ A;  1XWI A;  3L27 A;  4DV2 M;  3K92 A;  1ZMW A;  1HQY E;  2BWB A;  2APL A;  3E21 A;  1K82 A;  4FWG A;  1IN8 A;  3PNV A;  1NVM A;  5DYG A;  3SAW A;  4L15 A;  2DNA A;  3GQ3 A;  3K2L A;  4AQY M;  1DGH B;  3U61 A;  2V1U A;  1GAB A;  3GLG A;  2X4A A;  2K9D A;  4L6V 6;  1MN3 A;  4LF6 M;  2YQZ A;  3AV0 A;  3KP0 E;  1OFI A;  3CF0 A;  3J81 S;  3GLF E;  2HHH M;  4AKG A;  1VEK A;  2CHV A;  3KSJ A;  1W5S A;  2B3T A;  4Z6Y A;  1IXS B;  2E5L M;  4AI6 A;  3EIH A;  2DAK A;  5LMN M;  4JI5 M;  1QYR A;  3TQS A;  1QAO A;  2CEA A;  1Q3C A;  4ITQ A;  1GLN A;  3C58 A;  2MRO B;  3C3E A;  2QP9 X;  4GC9 A;  1PJT A;  2BJW A;  1LTM A;  1N33 M;  2DI0 A;  2KEB A;  4DUY M;  2R44 A;  1TF0 B;  1DGF A;  2ERC A;  1KYI A;  4DR6 M;  2JWS A;  3SYK A;  4GIP A;  1VQ1 A;  1A5T A;  2DZO B;  3SHF A;  1IFY A;  3K9P A;  1JQJ C;  1GVN A;  2C9C A;  2FNA A;  2CHG A;  4PD2 A;  4RF1 A;  4JI6 M;  1Z5C A;  3TL4 X;  1ZMV A;  3DZD A;  1T6O A;  3U5Z B;  3W67 A;  2KXE A;  2LVQ D;  4MGK E;  2C5R A;  3PXG A;  2XFS A;  5IRE B;  2QCU A;  2X49 A;  3L26 A;  2HKJ A;  5EP1 A;  4B08 A;  2FH0 A;  3KSX A;  2P5T A;  2JA2 A;  4IBB A;  3UMM A;  3D8B A;  1OJL A;  2DWL A;  1T3T A;  2H5X A;  2XZF A;  3FYD A;  3FUW A;  3E46 A;  2VQE M;  1GL6 A; 
#chains in the Genus database with same CATH homology
 2OOB A;  2JY8 A;  2LBC A;  3B89 A;  3K9O A;  1PGY A;  1TTE A;  2DEN A;  3MMP A;  2DZL A;  2O25 A;  1IXS A;  1F4I A;  5JI2 E;  4HEO A;  1WIV A;  1CUK A;  2L2D A;  3LCU A;  1NV9 A;  2LVN C;  2QNJ A;  2EKK A;  1T43 A;  4F1I A;  1IM2 A;  2CWB A;  1V92 A;  4WP2 A;  2QSF X;  1Q02 A;  3T6P A;  1JR3 E;  3GLG E;  2JY6 B;  1HJP A;  1HT2 E;  1AIP C;  1VDL A;  3GLI E;  3F92 A;  2MR9 A;  1OTR A;  2MJ5 B;  5DFL A;  3FRI A;  2CP8 A;  2MGW A;  1R4G A;  1WR1 B;  2L4E A;  1ZV1 A;  4GEW A;  1WGL A;  2KNA A;  2JP7 A;  2JZ1 A;  1WGN A;  3BBZ A;  3GLH E;  2RRU A;  1P3Q Q;  2KHH A;  1DV0 A;  4Q7J A;  2BWE A;  2R0I A;  2JUJ A;  1Y8G A;  1XB2 B;  2HWJ A;  2OO9 A;  2HAK A;  2DAI A;  1VEG A;  1VG5 A;  2ZTC A;  4G3O A;  2EJS A;  1HT1 E;  1E94 E;  3FE3 A;  1YLA A;  4DBG B;  2DAE A;  1GO5 A;  1ZMW A;  3LCV B;  1C7Y A;  1OKS A;  1WHC A;  1EFU B;  1HQY E;  1OAI A;  2BWB A;  3E21 A;  2K0B X;  1XXH E;  2EKF A;  2JY7 A;  2DNA A;  2ZTD A;  2DKL A;  1WJ7 A;  2WZJ A;  2K9D A;  1TR8 A;  1MN3 A;  1SG9 A;  2LTU A;  1OQY A;  2L4F A;  3GLF E;  1VEK A;  2B3T A;  3FRH A;  2LVO C;  2DAK A;  2JNH A;  2LVP C;  2MRO B;  3H4J A;  2DI0 A;  2OOA A;  2QHO B;  2DAM A;  2LVA A;  1KYI A;  1G41 A;  2G3Q A;  4F2L A;  2KNZ A;  1VQ1 A;  1A5T A;  1NV8 A;  1IFY A;  2DHY A;  3K9P A;  4R71 A;  3IHP A;  2KNV A;  1ZMV A;  1T6O A;  1DO2 A;  2LVQ D;  2JY5 A;  2JZ0 A;  2DAG A;  1QZE A;  1ZMU A;  3IEC A;  1G4A E;  1DO0 A;  1UFZ A;  2H5X A;  1VEJ A;  4UN2 B;  1BVS A;  3E46 A;  1G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...