1K3XA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with brominated-dna
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
253
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*(BRU)P*(BRU)P*CP*AP*(BRU)P*CP*CP*(BRU)P*GP*G)
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 84
structure length 253
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3xA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3xA01
4DV4M 3GO8A 1MU5A 4G4NA 1IBLM 3J7AS 1PM5A 3JR5A 4X62M 4NXNM 3GPUA 5LMNM 3GQ3A 3VK8A 3A42A 2EA0A 1K82A 1PJJA 1NNJA 4JI8M 3JR4A 2HHHM 4JYAM 5ITRA 4B3TM 1Q3BA 3TWMA 1XC8A 4JI3M 4MB7A 3J81S 3A45A 2F4VM 1Q39A 1L2DA 4DR2M 5ITQA 4AQYM 3T1YM 1IBKM 4PCZA 3GQ5A 1I94M 4LFBM 4DR4M 3OTOM 4DV1M 4DR5M 4CISA 4JI2M 4DV6M 2Q2EB 1N33M 2UXDM 5IWAM 3U6SA 4KHPM 3U6EA 2UUAM 4PD2A 4DR3M 4B3RM 3SAWA 1HNXM 3GPPA 1TDHA 4NXMM 4GKJM 2UXCM 1R2ZA 4DUZM 4LF4M 3SARA 2F5PA 1K3WA 4JI5M 5FLXS 1FJGM 1MX0A 4JI0M 2F5SA 4DUYM 4NRVA 4DV7M 4YHHM 4DR1M 2OQ4A 2UUCM 3DOAA 1XMOM 4X66M 1L1TA 3U6CA 2ZBKB 4K0KM 1XNRM 1EE8A 3T1HM 4X65M 5BR8M 3GPXA 3A46A 4G4RA 3SATA 2ZM6M 2F5OA 2XZUA 1R2YA 5LMUM 3GPYA 3SBJA 1Z5AA 5ITUA 2OPFA 5ITXA 2UU9M 3TWKA 3U6DA 4JV5M 1Q3CA 4JI6M 3SAUA 3U6PA 4DR6M 1HNZM 1N34M 1Z5CA 4DV0M 3U6LA 2HKJA 4LF8M 4JI1M 4LF6M 2VQFM 4X64M 4LFAM 1IBMM 2E5LM 3SASA 4ITQA 4DV3M 4PDGA 1Z59A 1HR0M 2F5QA 3J80S 3W0FA 4JI7M 4LF9M 4G4QA 3C58A 1KFVA 1PJIA 5ITYA 4B3MM 2UUBM 4DR7M 3JAMS 4DV2M 1L2BA 4YY3M 1Z5BA 4B3SM 1L2CA 1J5EM 3GP1A 5ITTA 1HNWM 5IT9S 1N32M 3U6MA 3SAVA 3VK7A 4DV5M 1TDZA 1L1ZA 2UXBM 4LFCM 4LF7M 1K3XA 2VQEM 1XMQM 4LF5M 3U6QA 4G4OA 4OX9M 4NRWA 4PDIA 2XZFA 2F5NA 3U6OA 3TWLA 1XNQM 5A2QS 1N36M 5ITXE 3GQ4A 4GKKM 4JI4M
chains in the Genus database with same CATH superfamily
3SMPA 1ZMVA 4LG2A 2DNAA 1J7KA 1HJPA 3JR5A 2J5YA 5BPVA 5LMNM 3I04M 3GPUA 3A42A 2LBCA 1L8QA 2LVPC 2HHHM 4MGKE 1XHBA 3GRVA 2EO2A 3UJNA 4ZPXA 2K6BA 1SXJC 1IY1A 1UM8A 2FNAA 1NJGA 2Y0QA 3NBXX 4JN6A 3LQQA 5EJCA 2RRUA 2MJ5B 3L2AA 3A45A 5JI2E 4Z6YA 2QSFX 1DGFA 4DR2M 1WHCA 3C3DA 4BLCA 2QNJA 1GJTA 4KO8A 1NV9A 3J27B 4HEOA 1PRBA 1VEKA 3T1YM 2DWNA 3V76A 3TQSA 3THGA 4DR4M 2DI0A 3HHWA 1BVSA 4CISA 1AIPC 4DV6M 3FTFA 1LTMA 1QANA 3L28A 4M0DA 4KHPM 4G3OA 1VQ1A 1T6OA 2DAMA 2UUAM 4B3RM 4XGIA 4R3DA 2DZOB 2M5ZA 1G3IA 1HNXM 2OO9A 1OAIA 3IHPA 2GNOA 1RU3A 1SXJA 3D8BA 1NJFA 3MHVC 4B7FA 3LMMA 2QENA 3W0LB 1NHWC 1QZMA 3FUTA 2DHYA 2Y20A 4OW0A 2L4FA 4OU7A 4IBKA 2A5YB 3T15A 1HQCA 4QHSA 2XSZD 4LJ6A 1FJGM 3SYKA 1MX0A 2D7GA 4LJ7A 2XEPA 4YHHM 5FTNA 4RF0A 4W5WA 3HU3A 4LJ5A 1TH3A 4AKIA 3IG5A 3MMPA 1ZV1A 3QWLA 3B7NA 4L16A 3WHLA 4CJ6A 1V92A 3MJ5A 2HCBA 2DAIA 2FS1A 2HL7A 2Z8YM 3KVWA 4GITA 3GPXA 1NSFA 4G4RA 2ZM6M 4F1IA 1XB2B 4NC6A 3SMSA 5LMUM 2Y21A 3C9PA 3FTEA 1JQJC 1Z5AA 2OPFA 2JY7A 1DO0A 2MROB 1QDTA 3HJQA 4G6ZA 4L6V6 3UZUA 4F2LA 5DFLA 4I5SA 2ERCA 3SAUA 1WR1B 3U61B 3CF2A 1N78A 1Z5CA 1CUKA 4M9ZA 2HKJA 2JY6B 4B7GA 1QYRA 5FSWA 3SC3A 4LF6M 4LFAM 4GMQA 1HQYE 1QUSA 2KXEA 4AKHA 3CGWA 1VEJA 4LF9M 2VF7A 2C98A 1WGLA 1KFVA 2MGWA 2G5GX 3HX3A 5JI3E 5KPZA 3JAMS 4DR7M 4GHLA 1DO2A 4YY3M 1R7RA 3D8LA 4LGMA 1J5EM 1GJSA 4D81A 3K1JA 4LRTA 4HLQA 2ZANA 1TDZA 4DV5M 3ILKA 5KPRA 2UXBM 4LFCM 2Z4RA 4FCVA 2R45A 4CIZA 3FYCA 3KOYE 1K3XA 3U61A 1E94E 3ZH9B 1JR3A 3K2LA 1XMQM 4LF5M 1G59A 5EP4A 3FRHA 2F5NA 2KNAA 2QQ8A 1IN6A 1D2NA 2DHRA 2Z4SA 2G3QA 2CV1A 3I4VA 3GLIE 4G4NA 1MU5A 2LVAA 3J7AS 5EP3A 4AKGA 1PM5A 1TGUA 1QUTA 2BJWA 3GQ3A 4WURA 3VK8A 1WGNA 1XXHA 2N35A 2ZAOA 4FCTA 1PJJA 2HAKA 3TPZA 1K82A 2EKKA 1IN4A 4M9SA 4KLNA 2NQ8C 1G8PA 4JYAM 2DAEA 2CV2A 1XWIA 3B74A 2WSEF 4XK8F 5ITRA 3GLIB 2DWMA 4B3TM 4XBOA 1X37A 3LCUA 2L09A 4OVZB 4Q7JA 1XC8A 1IN7A 1GO5A 3FE3A 4MB7A 3Q8XA 2V1UA 1Q39A 4MGZE 1L2DA 1IM2A 2BJVA 2KZSA 5EXTA 1IN5A 4EIWA 1ORYB 3AOEC 3FUVA 4FVMA 1C7YA 3GLHB 4GC5A 3GLGA 2I7PA 2O01F 3J2PB 2JZ0A 4DR5M 4L78A 2Z3XA 4DR3M 1TH2A 3KOXE 2KDLA 3GLFB 1DV0A 3J7BA 1DGHB 2DZLA 2XF3A 1PGYA 4M9XA 4GKJM 2KW0A 4QHTA 1R2ZA 4RF1A 3GRUA 4GH9A 4FD2A 3W68A 3DA1A 1GL7A 1WJ7A 2RKOA 3PXGA 4HL4A 2F5PA 2J7OA 1DGGA 2CFOA 3W67A 1KSFX 2FE8A 4LZZA 2LHGA 3AOEA 2KEBA 4I4LA 1HT2E 1TH4A 2R44A 3NWLA 4KT0F 4LJ8A 4JI0M 2DENA 4BB9A 1MJGM 3GLHA 2UUCM 1VG5A 3HY5A 4AZFA 5EXSA 1OAOC 3HJSA 2JA2A 2X8AA 2J7NA 4LGYA 1L1TA 2ZBKB 2VDBB 1R5LA 1T3TA 3PVSA 3HWSA 1QQWA 4WP2A 3T1HM 3A46A 2DXIA 3DFZA 1NO1A 3HKPA 7CATA 1DGHA 3VDPA 3GPYA 2K0BX 3EIHA 5ITUA 2G8LA 2R0IA 1TR8A 3TWKA 2QZ4A 3RGPA 3K92A 5DNYA 4D82A 3H4JA 1Q3CA 2LVQD 3TE6A 2FFJA 3RE8A 4DV0M 2E5LM 2R46A 3SASA 2YR0A 5GKNA 4AW4A 4DV3M 2JUJA 1PJTA 3J80S 1H6UA 1EIJA 4G4QA 2FH0A 5EP2A 4AI6A 5ITYA 4B3MM 3ZC7B 2CHGA 4DV2M 1OJLA 1LV7A 2R65A 3U5ZB 4IJEA 1L2CA 4IBFA 5IT9S 5FTKA 1E9RA 1QAOA 2VIIA 2V6ZM 3HJ8A 3B9PA 3M7GA 2XLJA 1FNNA 1GLNA 2EUCA 4NRWA 4PDIA 1ZMWA 5DYIA 1OFIA 2XZFA 2GQFA 3BXWA 3CTWB 1QZEA 3TWLA 2XFSA 1NVMA 3LCVB 4P17A 5A2QS 2JXNA 5ITXE 1JB0F 4JI4M 1IQPA 3FTCA 3GO8A 4DV4M 5E26A 4KODA 1N77A 2D7HA 4NXNM 2X4AA 4UN2B 2WSFF 1NNJA 2MR9A 4JI8M 2XSZA 3JR4A 3K9PA 3ZQJA 2RGOA 4JXJA 4LY6A 3B7ZA 2VF8A 3LW5F 1F4IA 2KNZA 1Q3BA 4IBIA 3IECA 2L6OA 4REZA 3TWMA 4JI3M 1E32A 3FKEA 2CE7A 1G71A 3BBZA 3CF0A 2ZTDA 5ITQA 1ZQ9A 4AQYM 5F3WA 4PCZA 3GQ5A 4R7GA 2JNHA 3UMMA 1KYIA 1G41A 1Q02A 3B7QA 3BOSA 4S12A 1VDLA 4B08A 2BWBA 1DGBA 4JI2M 2KNVA 2WSCF 3HU1A 2UXDM 4QOSA 1QAQA 3PNYA 4D80A 3H4MA 1I4WA 5IWAM 2W82A 4QNRA 4PD2A 1YE9A 1IXRC 3AJIB 5DYGA 1OFHA 2DAKA 3GPPA 3M0EA 1TDHA 1R4GA 2UXCM 2OOAA 4FWHA 3GLGE 4ANRA 4DUZM 4PT5A 3E46A 5L8RF 3UK6A 3SARA 2QBYB 4MH0E 3U60B 1K3WA 3I01M 2KRUA 3M6AA 2CHVA 3QAUA 3SHGB 5FLXS 4JI5M 4FWGA 2DKLA 2F5SA 2QP9X 1W5SA 4IBDA 4NRVA 2APLA 4DV7M 3KFUG 1J09A 4GEWA 4GHAA 1OTRA 5IREB 3VDUA 4TUWA 4LJ9A 3E9SA 2WZJA 3U6CA 3WHKA 2R62A 4NSOB 1XNRM 2MH8A 5BR8M 3ZCBB 5C1BA 4NOOB 2Y0TA 4P16A 3SATA 2F5OA 1QVRA 2BNKA 1R2YA 1TTEA 3KSXA 1UFZA 3K8ZA 4IBEA 2UU9M 3U6DA 4JV5M 5IZ7D 2QBYA 2LHCA 3GLIA 4L15A 4OVZA 4DR6M 4NSRA 1V34A 1NY5A 3U6LA 1SXJD 1SG9A 4LF8M 3AFHA 2C9OA 1ZMUA 2D7EA 5C18A 2HWJA 4X64M 1E9SA 2LVNC 4ITQA 4RKUF 2LTUA 1Z59A 3FD9A 1SXJE 3B89A 1P3QQ 2LXEA 2Z7JA 2ZTCA 2K9DA 3K9OA 1NY6A 1PJIA 2UUBM 1IFYA 2P5TA 4LZJA 1L2BA 2CHQA 3T38A 1Z5BA 3GLFA 3QYEA 3KXEC 1W5TA 2H5XA 5ITTA 1HNWM 5EQTA 1SXJB 3SHFA 3KP1E 5FTMA 4GC9A 2ZAMA 4IIWA 3HU2A 4A3VB 5FTJA 3E21A 4GRIA 3LVWA 3VFDA 2M60A 4LRSA 1R6BX 3U6QA 3LVVA 4OX9M 1IXSB 1WXQA 3EIEA 3VLFB 1N32M 1OQYA 3KS8A 3U6OA 2C96A 2L7HA 3C3EA 3F92A 1S3SA 3CF6E 4CGYB 1EFUB 3GQ4A 3UGJA 1NHGC 3AKZA 1IBLM 1D0LA 1IXZA 2JY8A 4X62M 2KHHA 3FRIA 2EJSA 2JWSA 3PNVA 1T43A 2EA0A 2O25A 3TL4X 2CUZA 4CHTB 3GRRA 3HGIA 1MN3A 1OIPA 3FYDA 4MGIE 3PFIA 4FW9A 5E6JA 3KOWE 3L29A 4Y28F 2L2DA 4BBAA 2X49A 5KQDA 1IXSA 3J81S 4LJ4A 3KSJA 2F4VM 4Z8XA 2LNHC 2JZ1A 2C5RA 3Q8GA 1VEGA 2FOIC 1Y8GA 3A98B 3KS4A 4I81A 2XH9A 1ZAEA 4M0WA 4LJAA 1IBKM 1JR3D 3KP0E 1I94M 4LFBM 2R6FA 1Z6TA 3QYBA 3OTOM 5FTLA 1YLAA 4DV1M 4IBBA 4MGHA 1N33M 2K47A 2Q2EB 1OKSA 2R4JA 2H1RA 1JR3E 3AOGA 4RNAA 5EXPA 3U6SA 3R8FA 5EXXA 3U6EA 4II7A 1NV8A 3U5ZA 3SAWA 1GVNA 4FWDA 3L26A 4NXMM 3FUXA 1VDDA 3RFWA 1TF0B 2QPAA 2CV0A 4LF4M 2R4EA 3AV0A 5KO3A 2EKFA 4MM3B 3KW6A 4IBJA 1C1KA 2R18A 5KQ8A 3FUUA 4DUYM 1G4AE 2L7IA 1XXHE 4DR1M 2OQ4A 4L8RC 4QNMA 4IBCA 3DOAA 1XMOM 4X66M 3L25A 3SFZA 3DZDA 4K0KM 1QDRA 4WW0A 2CRUA 2LWXA 1EE8A 1WIVA 2KRKA 2LVOC 3HZJA 4X65M 3IG8A 3T6PA 3MK6A 1GL6A 1GKIA 2CWBA 1XXHB 2YNMD 3NBIA 1NNUC 2XZUA 2QHOB 3SBJA 4AG5A 8CATA 2LH0A 4L4UA 5ITXA 4R71A 2L4EA 4IJFA 4JI6M 3LQRA 3U6PA 1AUAA 3AL0C 1YSYA 1HNZM 2KA6B 1N34M 2XGNA 2V1CA 1N75A 2DAGA 3KOZE 2C99A 3KDSE 3L27A 4JI1M 1A5TA 2YFQA 5KPTA 2VQFM 1IBMM 3I51A 2I7NA 4PDGA 1V33A 4MGYE 1HR0M 2F5QA 1IY2A 4JI7M 3W0FA 1IY0A 3RGSA 3GLGB 3FUWA 3R9XB 4AG6A 3HHYA 2B3TA 3E4RA 3I4YA 1IN8A 3C58A 2DZNB 2JY5A 2DWZB 2CP8A 1QAMA 2KZUA 1OIZA 2C9CA 5H37D 4B3SM 2BWEA 3GP1A 1PJQA 2XFTA 2AHMA 3GLHE 3VKHA 1PJSA 3HHZA 2YQZA 4FCWA 2CEAA 3U6MA 3SAVA 2OOBA 3VK7A 1L1ZA 1D0KA 3GRYA 4LF7M 3VKGA 3U60A 2VQEM 5EP1A 1YUBA 4G4OA 2DVWB 4LCBA 4GIPA 2JP7A 2O5RA 3GLFE 3SYLA 3FTDA 4DBGB 4IBGA 1GABA 4QOZC 1XNQM 2DWLA 4NL4H 1D0MA 2QCUA 2RGHA 4I8OA 3HHXA 1N36M 4GKKM 4B7HA 1HT1E
chains in the Genus database with same CATH topology
3SMPA 4LG2A 1J7KA 3JR5A 5BPVA 5LMNM 3GPUA 3A42A 1L8QA 2HHHM 4MGKE 1XHBA 3GRVA 2EO2A 3UJNA 4ZPXA 1SXJC 1IY1A 1UM8A 2FNAA 1NJGA 2Y0QA 4JN6A 5EJCA 3LQQA 3L2AA 3A45A 5JI2E 4Z6YA 1DGFA 4DR2M 4BLCA 4KO8A 3J27B 3T1YM 2DWNA 3TQSA 3THGA 4DR4M 3HHWA 4CISA 4DV6M 3FTFA 1QANA 3L28A 4M0DA 4KHPM 2UUAM 4B3RM 4XGIA 4R3DA 2DZOB 2M5ZA 1G3IA 1HNXM 1SXJA 3D8BA 1NJFA 3MHVC 4B7FA 3LMMA 2QENA 3W0LB 1NHWC 1QZMA 3FUTA 2Y20A 4OW0A 4OU7A 4IBKA 2A5YB 3T15A 1HQCA 4QHSA 2XSZD 4LJ6A 1FJGM 3SYKA 1MX0A 2D7GA 4LJ7A 2XEPA 4YHHM 5FTNA 4RF0A 4W5WA 3HU3A 4LJ5A 1TH3A 4AKIA 3IG5A 3QWLA 4L16A 3WHLA 3MJ5A 2HCBA 3KVWA 2HL7A 4GITA 3GPXA 1NSFA 4G4RA 2ZM6M 3SMSA 5LMUM 2Y21A 3FTEA 1JQJC 1Z5AA 2OPFA 1DO0A 3HJQA 4G6ZA 3UZUA 3SAUA 4I5SA 2ERCA 3U61B 3CF2A 1N78A 1Z5CA 4M9ZA 2HKJA 4B7GA 1QYRA 5FSWA 3SC3A 4LF6M 4LFAM 4GMQA 1HQYE 2KXEA 4AKHA 4LF9M 2C98A 1KFVA 2G5GX 5KPZA 5JI3E 4DR7M 3JAMS 4GHLA 1DO2A 4YY3M 1R7RA 3D8LA 4LGMA 1J5EM 4D81A 3K1JA 4LRTA 4HLQA 2ZANA 1TDZA 4DV5M 3ILKA 5KPRA 2UXBM 4LFCM 2Z4RA 4FCVA 2R45A 3FYCA 3KOYE 1K3XA 3U61A 1E94E 3ZH9B 1JR3A 3K2LA 1XMQM 4LF5M 1G59A 5EP4A 2F5NA 1IN6A 1D2NA 2DHRA 2Z4SA 2CV1A 3I4VA 3J7AS 4G4NA 1MU5A 5EP3A 4AKGA 1PM5A 1TGUA 2BJWA 3GQ3A 4WURA 3VK8A 1XXHA 2ZAOA 4FCTA 1PJJA 1K82A 3TPZA 1IN4A 4M9SA 4KLNA 2NQ8C 1G8PA 4JYAM 2CV2A 1XWIA 3GLIB 5ITRA 2DWMA 4B3TM 4XBOA 1X37A 4OVZB 2L09A 1XC8A 1IN7A 4MB7A 3Q8XA 2V1UA 1Q39A 4MGZE 1L2DA 1IM2A 2BJVA 2KZSA 5EXTA 1IN5A 4EIWA 1ORYB 3AOEC 3FUVA 4FVMA 3GLHB 4GC5A 3GLGA 2I7PA 3J2PB 4DR5M 4L78A 2Z3XA 4DR3M 1TH2A 3KOXE 3GLFB 3J7BA 1DGHB 2XF3A 4M9XA 4GKJM 2KW0A 4QHTA 1R2ZA 4RF1A 3GRUA 4GH9A 4FD2A 3DA1A 1GL7A 2RKOA 3PXGA 4HL4A 2F5PA 2J7OA 1DGGA 2CFOA 1KSFX 2FE8A 4LZZA 3AOEA 2KEBA 4I4LA 1HT2E 1TH4A 4JI0M 3NWLA 4LJ8A 4BB9A 3GLHA 2UUCM 4AZFA 5EXSA 3HJSA 2JA2A 2X8AA 2J7NA 4LGYA 1L1TA 2ZBKB 3PVSA 1T3TA 3HWSA 1QQWA 3T1HM 3A46A 2DXIA 3DFZA 3HKPA 7CATA 1DGHA 3VDPA 3GPYA 3EIHA 5ITUA 2G8LA 3TWKA 2QZ4A 3RGPA 3K92A 5DNYA 4D82A 1Q3CA 3TE6A 2FFJA 3RE8A 4DV0M 2E5LM 2R46A 3SASA 2YR0A 5GKNA 4AW4A 4DV3M 3J80S 1H6UA 4G4QA 5EP2A 4AI6A 5ITYA 4B3MM 3ZC7B 2CHGA 4DV2M 1OJLA 1LV7A 2R65A 3U5ZB 4IJEA 1L2CA 4IBFA 5IT9S 5FTKA 1E9RA 1QAOA 2VIIA 2V6ZM 3HJ8A 3B9PA 3M7GA 2XLJA 1FNNA 1GLNA 2EUCA 4NRWA 4PDIA 5DYIA 1OFIA 2XZFA 3CTWB 3TWLA 2XFSA 1NVMA 5A2QS 5ITXE 4JI4M 1IQPA 3FTCA 3GO8A 4DV4M 5E26A 4KODA 1N77A 2D7HA 4NXNM 2X4AA 1NNJA 4JI8M 2XSZA 3JR4A 2RGOA 4JXJA 4LY6A 1Q3BA 4IBIA 3TWMA 2L6OA 4REZA 4JI3M 1E32A 3FKEA 2CE7A 3CF0A 5ITQA 1ZQ9A 4AQYM 5F3WA 4PCZA 3GQ5A 4R7GA 3UMMA 1KYIA 1G41A 3BOSA 4S12A 4B08A 4JI2M 1DGBA 3HU1A 2UXDM 4QOSA 1QAQA 3PNYA 4D80A 3H4MA 1I4WA 5IWAM 2W82A 4QNRA 4PD2A 1YE9A 1IXRC 3AJIB 5DYGA 1OFHA 3GPPA 3M0EA 1TDHA 2UXCM 4FWHA 4DUZM 4PT5A 3UK6A 3SARA 2QBYB 4MH0E 3U60B 1K3WA 2KRUA 3M6AA 2CHVA 3QAUA 3SHGB 5FLXS 4JI5M 4FWGA 2F5SA 2QP9X 1W5SA 4IBDA 4NRVA 4DV7M 3KFUG 1J09A 4GHAA 5IREB 3VDUA 4TUWA 4LJ9A 3E9SA 3U6CA 3WHKA 2R62A 4NSOB 1XNRM 5BR8M 3ZCBB 5C1BA 4NOOB 2Y0TA 4P16A 3SATA 2F5OA 1QVRA 2BNKA 1R2YA 3KSXA 3K8ZA 4IBEA 2UU9M 3U6DA 4JV5M 5IZ7D 2QBYA 3GLIA 4L15A 4OVZA 4DR6M 4NSRA 1NY5A 3U6LA 1SXJD 4LF8M 3AFHA 2C9OA 2D7EA 5C18A 4X64M 1E9SA 4ITQA 1Z59A 3FD9A 1SXJE 2LXEA 2Z7JA 1NY6A 1PJIA 2UUBM 2P5TA 4LZJA 1L2BA 2CHQA 3T38A 1Z5BA 3GLFA 3KXEC 1W5TA 5ITTA 1HNWM 5EQTA 1SXJB 3SHFA 3KP1E 5FTMA 4GC9A 2ZAMA 4IIWA 3HU2A 4A3VB 5FTJA 4GRIA 3VFDA 3LVWA 3U6QA 2M60A 4LRSA 1R6BX 4OX9M 3LVVA 1IXSB 1WXQA 3EIEA 3VLFB 3KS8A 3U6OA 2C96A 2L7HA 1S3SA 3CF6E 4CGYB 3GQ4A 3UGJA 1NHGC 3AKZA 1IBLM 1IXZA 4X62M 3PNVA 2EA0A 3TL4X 2CUZA 4CHTB 3GRRA 3HGIA 3FYDA 4MGIE 3PFIA 4FW9A 5E6JA 3KOWE 3L29A 4BBAA 2X49A 5KQDA 3J81S 4LJ4A 3KSJA 2F4VM 4Z8XA 2LNHC 2C5RA 2FOIC 3A98B 3KS4A 4I81A 2XH9A 1ZAEA 4M0WA 4LJAA 1IBKM 1JR3D 3KP0E 1I94M 4LFBM 1Z6TA 3OTOM 5FTLA 4DV1M 4IBBA 4MGHA 1N33M 2K47A 2Q2EB 2R4JA 2H1RA 3AOGA 4RNAA 5EXPA 3U6SA 3R8FA 5EXXA 3U6EA 4II7A 3U5ZA 3SAWA 1GVNA 4FWDA 3L26A 4NXMM 3FUXA 1VDDA 3RFWA 2QPAA 2CV0A 4LF4M 2R4EA 3AV0A 5KO3A 4MM3B 3KW6A 4IBJA 1C1KA 2R18A 5KQ8A 3FUUA 4DUYM 1G4AE 2L7IA 4DR1M 2OQ4A 4L8RC 4QNMA 4IBCA 3DOAA 1XMOM 4X66M 3L25A 3SFZA 3DZDA 4K0KM 4WW0A 2LWXA 1EE8A 2KRKA 4X65M 3IG8A 3MK6A 1GL6A 1GKIA 1XXHB 2YNMD 3NBIA 1NNUC 2XZUA 3SBJA 4AG5A 8CATA 2LH0A 4L4UA 5ITXA 4IJFA 4JI6M 3LQRA 3U6PA 3AL0C 1YSYA 1HNZM 2KA6B 1N34M 2XGNA 2V1CA 1N75A 3KOZE 2C99A 3KDSE 3L27A 4JI1M 2YFQA 2VQFM 5KPTA 1IBMM 3I51A 2I7NA 4PDGA 4MGYE 1HR0M 2F5QA 1IY2A 4JI7M 3W0FA 1IY0A 3RGSA 3GLGB 3FUWA 3R9XB 4AG6A 3HHYA 3E4RA 3I4YA 1IN8A 3C58A 2DZNB 2DWZB 1QAMA 2KZUA 5H37D 2C9CA 4B3SM 3GP1A 2XFTA 2AHMA 3VKHA 3HHZA 1N32M 2YQZA 4FCWA 2CEAA 3U6MA 3SAVA 3VK7A 1L1ZA 3GRYA 4LF7M 3VKGA 3U60A 2VQEM 5EP1A 1YUBA 4G4OA 2DVWB 4LCBA 4GIPA 2O5RA 3SYLA 3FTDA 4IBGA 4QOZC 1XNQM 2DWLA 4NL4H 2QCUA 2RGHA 4I8OA 1N36M 3HHXA 4GKKM 4B7HA 1HT1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 M;  3GO8 A;  1MU5 A;  4G4N A;  1IBL M;  3J7A S;  1PM5 A;  3JR5 A;  4X62 M;  4NXN M;  3GPU A;  5LMN M;  3GQ3 A;  3VK8 A;  3A42 A;  2EA0 A;  1K82 A;  1PJJ A;  1NNJ A;  4JI8 M;  3JR4 A;  2HHH M;  4JYA M;  5ITR A;  4B3T M;  1Q3B A;  3TWM A;  1XC8 A;  4JI3 M;  4MB7 A;  3J81 S;  3A45 A;  2F4V M;  1Q39 A;  1L2D A;  4DR2 M;  5ITQ A;  4AQY M;  3T1Y M;  1IBK M;  4PCZ A;  3GQ5 A;  1I94 M;  4LFB M;  4DR4 M;  3OTO M;  4DV1 M;  4DR5 M;  4CIS A;  4JI2 M;  4DV6 M;  2Q2E B;  1N33 M;  2UXD M;  5IWA M;  3U6S A;  4KHP M;  3U6E A;  2UUA M;  4PD2 A;  4DR3 M;  4B3R M;  3SAW A;  1HNX M;  3GPP A;  1TDH A;  4NXM M;  4GKJ M;  2UXC M;  1R2Z A;  4DUZ M;  4LF4 M;  3SAR A;  2F5P A;  1K3W A;  4JI5 M;  5FLX S;  1FJG M;  1MX0 A;  4JI0 M;  2F5S A;  4DUY M;  4NRV A;  4DV7 M;  4YHH M;  4DR1 M;  2OQ4 A;  2UUC M;  3DOA A;  1XMO M;  4X66 M;  1L1T A;  3U6C A;  2ZBK B;  4K0K M;  1XNR M;  1EE8 A;  3T1H M;  4X65 M;  5BR8 M;  3GPX A;  3A46 A;  4G4R A;  3SAT A;  2ZM6 M;  2F5O A;  2XZU A;  1R2Y A;  5LMU M;  3GPY A;  3SBJ A;  1Z5A A;  5ITU A;  2OPF A;  5ITX A;  2UU9 M;  3TWK A;  3U6D A;  4JV5 M;  1Q3C A;  4JI6 M;  3SAU A;  3U6P A;  4DR6 M;  1HNZ M;  1N34 M;  1Z5C A;  4DV0 M;  3U6L A;  2HKJ A;  4LF8 M;  4JI1 M;  4LF6 M;  2VQF M;  4X64 M;  4LFA M;  1IBM M;  2E5L M;  3SAS A;  4ITQ A;  4DV3 M;  4PDG A;  1Z59 A;  1HR0 M;  2F5Q A;  3J80 S;  3W0F A;  4JI7 M;  4LF9 M;  4G4Q A;  3C58 A;  1KFV A;  1PJI A;  5ITY A;  4B3M M;  2UUB M;  4DR7 M;  3JAM S;  4DV2 M;  1L2B A;  4YY3 M;  1Z5B A;  4B3S M;  1L2C A;  1J5E M;  3GP1 A;  5ITT A;  1HNW M;  5IT9 S;  1N32 M;  3U6M A;  3SAV A;  3VK7 A;  4DV5 M;  1TDZ A;  1L1Z A;  2UXB M;  4LFC M;  4LF7 M;  1K3X A;  2VQE M;  1XMQ M;  4LF5 M;  3U6Q A;  4G4O A;  4OX9 M;  4NRW A;  4PDI A;  2XZF A;  2F5N A;  3U6O A;  3TWL A;  1XNQ M;  5A2Q S;  1N36 M;  5ITX E;  3GQ4 A;  4GKK M;  4JI4 M; 
#chains in the Genus database with same CATH topology
 3SMP A;  1ZMV A;  4LG2 A;  2DNA A;  1J7K A;  1HJP A;  3JR5 A;  2J5Y A;  5BPV A;  5LMN M;  3I04 M;  3GPU A;  3A42 A;  2LBC A;  1L8Q A;  2LVP C;  2HHH M;  4MGK E;  1XHB A;  3GRV A;  2EO2 A;  3UJN A;  4ZPX A;  2K6B A;  1SXJ C;  1IY1 A;  1UM8 A;  2FNA A;  1NJG A;  2Y0Q A;  3NBX X;  4JN6 A;  3LQQ A;  5EJC A;  2RRU A;  2MJ5 B;  3L2A A;  3A45 A;  5JI2 E;  4Z6Y A;  2QSF X;  1DGF A;  4DR2 M;  1WHC A;  3C3D A;  4BLC A;  2QNJ A;  1GJT A;  4KO8 A;  1NV9 A;  3J27 B;  4HEO A;  1PRB A;  1VEK A;  3T1Y M;  2DWN A;  3V76 A;  3TQS A;  3THG A;  4DR4 M;  2DI0 A;  3HHW A;  1BVS A;  4CIS A;  1AIP C;  4DV6 M;  3FTF A;  1LTM A;  1QAN A;  3L28 A;  4M0D A;  4KHP M;  4G3O A;  1VQ1 A;  1T6O A;  2DAM A;  2UUA M;  4B3R M;  4XGI A;  4R3D A;  2DZO B;  2M5Z A;  1G3I A;  1HNX M;  2OO9 A;  1OAI A;  3IHP A;  2GNO A;  1RU3 A;  1SXJ A;  3D8B A;  1NJF A;  3MHV C;  4B7F A;  3LMM A;  2QEN A;  3W0L B;  1NHW C;  1QZM A;  3FUT A;  2DHY A;  2Y20 A;  4OW0 A;  2L4F A;  4OU7 A;  4IBK A;  2A5Y B;  3T15 A;  1HQC A;  4QHS A;  2XSZ D;  4LJ6 A;  1FJG M;  3SYK A;  1MX0 A;  2D7G A;  4LJ7 A;  2XEP A;  4YHH M;  5FTN A;  4RF0 A;  4W5W A;  3HU3 A;  4LJ5 A;  1TH3 A;  4AKI A;  3IG5 A;  3MMP A;  1ZV1 A;  3QWL A;  3B7N A;  4L16 A;  3WHL A;  4CJ6 A;  1V92 A;  3MJ5 A;  2HCB A;  2DAI A;  2FS1 A;  2HL7 A;  2Z8Y M;  3KVW A;  4GIT A;  3GPX A;  1NSF A;  4G4R A;  2ZM6 M;  4F1I A;  1XB2 B;  4NC6 A;  3SMS A;  5LMU M;  2Y21 A;  3C9P A;  3FTE A;  1JQJ C;  1Z5A A;  2OPF A;  2JY7 A;  1DO0 A;  2MRO B;  1QDT A;  3HJQ A;  4G6Z A;  4L6V 6;  3UZU A;  4F2L A;  5DFL A;  4I5S A;  2ERC A;  3SAU A;  1WR1 B;  3U61 B;  3CF2 A;  1N78 A;  1Z5C A;  1CUK A;  4M9Z A;  2HKJ A;  2JY6 B;  4B7G A;  1QYR A;  5FSW A;  3SC3 A;  4LF6 M;  4LFA M;  4GMQ A;  1HQY E;  1QUS A;  2KXE A;  4AKH A;  3CGW A;  1VEJ A;  4LF9 M;  2VF7 A;  2C98 A;  1WGL A;  1KFV A;  2MGW A;  2G5G X;  3HX3 A;  5JI3 E;  5KPZ A;  3JAM S;  4DR7 M;  4GHL A;  1DO2 A;  4YY3 M;  1R7R A;  3D8L A;  4LGM A;  1J5E M;  1GJS A;  4D81 A;  3K1J A;  4LRT A;  4HLQ A;  2ZAN A;  1TDZ A;  4DV5 M;  3ILK A;  5KPR A;  2UXB M;  4LFC M;  2Z4R A;  4FCV A;  2R45 A;  4CIZ A;  3FYC A;  3KOY E;  1K3X A;  3U61 A;  1E94 E;  3ZH9 B;  1JR3 A;  3K2L A;  1XMQ M;  4LF5 M;  1G59 A;  5EP4 A;  3FRH A;  2F5N A;  2KNA A;  2QQ8 A;  1IN6 A;  1D2N A;  2DHR A;  2Z4S A;  2G3Q A;  2CV1 A;  3I4V A;  3GLI E;  4G4N A;  1MU5 A;  2LVA A;  3J7A S;  5EP3 A;  4AKG A;  1PM5 A;  1TGU A;  1QUT A;  2BJW A;  3GQ3 A;  4WUR A;  3VK8 A;  1WGN A;  1XXH A;  2N35 A;  2ZAO A;  4FCT A;  1PJJ A;  2HAK A;  3TPZ A;  1K82 A;  2EKK A;  1IN4 A;  4M9S A;  4KLN A;  2NQ8 C;  1G8P A;  4JYA M;  2DAE A;  2CV2 A;  1XWI A;  3B74 A;  2WSE F;  4XK8 F;  5ITR A;  3GLI B;  2DWM A;  4B3T M;  4XBO A;  1X37 A;  3LCU A;  2L09 A;  4OVZ B;  4Q7J A;  1XC8 A;  1IN7 A;  1GO5 A;  3FE3 A;  4MB7 A;  3Q8X A;  2V1U A;  1Q39 A;  4MGZ E;  1L2D A;  1IM2 A;  2BJV A;  2KZS A;  5EXT A;  1IN5 A;  4EIW A;  1ORY B;  3AOE C;  3FUV A;  4FVM A;  1C7Y A;  3GLH B;  4GC5 A;  3GLG A;  2I7P A;  2O01 F;  3J2P B;  2JZ0 A;  4DR5 M;  4L78 A;  2Z3X A;  4DR3 M;  1TH2 A;  3KOX E;  2KDL A;  3GLF B;  1DV0 A;  3J7B A;  1DGH B;  2DZL A;  2XF3 A;  1PGY A;  4M9X A;  4GKJ M;  2KW0 A;  4QHT A;  1R2Z A;  4RF1 A;  3GRU A;  4GH9 A;  4FD2 A;  3W68 A;  3DA1 A;  1GL7 A;  1WJ7 A;  2RKO A;  3PXG A;  4HL4 A;  2F5P A;  2J7O A;  1DGG A;  2CFO A;  3W67 A;  1KSF X;  2FE8 A;  4LZZ A;  2LHG A;  3AOE A;  2KEB A;  4I4L A;  1HT2 E;  1TH4 A;  2R44 A;  3NWL A;  4KT0 F;  4LJ8 A;  4JI0 M;  2DEN A;  4BB9 A;  1MJG M;  3GLH A;  2UUC M;  1VG5 A;  3HY5 A;  4AZF A;  5EXS A;  1OAO C;  3HJS A;  2JA2 A;  2X8A A;  2J7N A;  4LGY A;  1L1T A;  2ZBK B;  2VDB B;  1R5L A;  1T3T A;  3PVS A;  3HWS A;  1QQW A;  4WP2 A;  3T1H M;  3A46 A;  2DXI A;  3DFZ A;  1NO1 A;  3HKP A;  7CAT A;  1DGH A;  3VDP A;  3GPY A;  2K0B X;  3EIH A;  5ITU A;  2G8L A;  2R0I A;  1TR8 A;  3TWK A;  2QZ4 A;  3RGP A;  3K92 A;  5DNY A;  4D82 A;  3H4J A;  1Q3C A;  2LVQ D;  3TE6 A;  2FFJ A;  3RE8 A;  4DV0 M;  2E5L M;  2R46 A;  3SAS A;  2YR0 A;  5GKN A;  4AW4 A;  4DV3 M;  2JUJ A;  1PJT A;  3J80 S;  1H6U A;  1EIJ A;  4G4Q A;  2FH0 A;  5EP2 A;  4AI6 A;  5ITY A;  4B3M M;  3ZC7 B;  2CHG A;  4DV2 M;  1OJL A;  1LV7 A;  2R65 A;  3U5Z B;  4IJE A;  1L2C A;  4IBF A;  5IT9 S;  5FTK A;  1E9R A;  1QAO A;  2VII A;  2V6Z M;  3HJ8 A;  3B9P A;  3M7G A;  2XLJ A;  1FNN A;  1GLN A;  2EUC A;  4NRW A;  4PDI A;  1ZMW A;  5DYI A;  1OFI A;  2XZF A;  2GQF A;  3BXW A;  3CTW B;  1QZE A;  3TWL A;  2XFS A;  1NVM A;  3LCV B;  4P17 A;  5A2Q S;  2JXN A;  5ITX E;  1JB0 F;  4JI4 M;  1IQP A;  3FTC A;  3GO8 A;  4DV4 M;  5E26 A;  4KOD A;  1N77 A;  2D7H A;  4NXN M;  2X4A A;  4UN2 B;  2WSF F;  1NNJ A;  2MR9 A;  4JI8 M;  2XSZ A;  3JR4 A;  3K9P A;  3ZQJ A;  2RGO A;  4JXJ A;  4LY6 A;  3B7Z A;  2VF8 A;  3LW5 F;  1F4I A;  2KNZ A;  1Q3B A;  4IBI A;  3IEC A;  2L6O A;  4REZ A;  3TWM A;  4JI3 M;  1E32 A;  3FKE A;  2CE7 A;  1G71 A;  3BBZ A;  3CF0 A;  2ZTD A;  5ITQ A;  1ZQ9 A;  4AQY M;  5F3W A;  4PCZ A;  3GQ5 A;  4R7G A;  2JNH A;  3UMM A;  1KYI A;  1G41 A;  1Q02 A;  3B7Q A;  3BOS A;  4S12 A;  1VDL A;  4B08 A;  2BWB A;  1DGB A;  4JI2 M;  2KNV A;  2WSC F;  3HU1 A;  2UXD M;  4QOS A;  1QAQ A;  3PNY A;  4D80 A;  3H4M A;  1I4W A;  5IWA M;  2W82 A;  4QNR A;  4PD2 A;  1YE9 A;  1IXR C;  3AJI B;  5DYG A;  1OFH A;  2DAK A;  3GPP A;  3M0E A;  1TDH A;  1R4G A;  2UXC M;  2OOA A;  4FWH A;  3GLG E;  4ANR A;  4DUZ M;  4PT5 A;  3E46 A;  5L8R F;  3UK6 A;  3SAR A;  2QBY B;  4MH0 E;  3U60 B;  1K3W A;  3I01 M;  2KRU A;  3M6A A;  2CHV A;  3QAU A;  3SHG B;  5FLX S;  4JI5 M;  4FWG A;  2DKL A;  2F5S A;  2QP9 X;  1W5S A;  4IBD A;  4NRV A;  2APL A;  4DV7 M;  3KFU G;  1J09 A;  4GEW A;  4GHA A;  1OTR A;  5IRE B;  3VDU A;  4TUW A;  4LJ9 A;  3E9S A;  2WZJ A;  3U6C A;  3WHK A;  2R62 A;  4NSO B;  1XNR M;  2MH8 A;  5BR8 M;  3ZCB B;  5C1B A;  4NOO B;  2Y0T A;  4P16 A;  3SAT A;  2F5O A;  1QVR A;  2BNK A;  1R2Y A;  1TTE A;  3KSX A;  1UFZ A;  3K8Z A;  4IBE A;  2UU9 M;  3U6D A;  4JV5 M;  5IZ7 D;  2QBY A;  2LHC A;  3GLI A;  4L15 A;  4OVZ A;  4DR6 M;  4NSR A;  1V34 A;  1NY5 A;  3U6L A;  1SXJ D;  1SG9 A;  4LF8 M;  3AFH A;  2C9O A;  1ZMU A;  2D7E A;  5C18 A;  2HWJ A;  4X64 M;  1E9S A;  2LVN C;  4ITQ A;  4RKU F;  2LTU A;  1Z59 A;  3FD9 A;  1SXJ E;  3B89 A;  1P3Q Q;  2LXE A;  2Z7J A;  2ZTC A;  2K9D A;  3K9O A;  1NY6 A;  1PJI A;  2UUB M;  1IFY A;  2P5T A;  4LZJ A;  1L2B A;  2CHQ A;  3T38 A;  1Z5B A;  3GLF A;  3QYE A;  3KXE C;  1W5T A;  2H5X A;  5ITT A;  1HNW M;  5EQT A;  1SXJ B;  3SHF A;  3KP1 E;  5FTM A;  4GC9 A;  2ZAM A;  4IIW A;  3HU2 A;  4A3V B;  5FTJ A;  3E21 A;  4GRI A;  3LVW A;  3VFD A;  2M60 A;  4LRS A;  1R6B X;  3U6Q A;  3LVV A;  4OX9 M;  1IXS B;  1WXQ A;  3EIE A;  3VLF B;  1N32 M;  1OQY A;  3KS8 A;  3U6O A;  2C96 A;  2L7H A;  3C3E A;  3F92 A;  1S3S A;  3CF6 E;  4CGY B;  1EFU B;  3GQ4 A;  3UGJ A;  1NHG C;  3AKZ A;  1IBL M;  1D0L A;  1IXZ A;  2JY8 A;  4X62 M;  2KHH A;  3FRI A;  2EJS A;  2JWS A;  3PNV A;  1T43 A;  2EA0 A;  2O25 A;  3TL4 X;  2CUZ A;  4CHT B;  3GRR A;  3HGI A;  1MN3 A;  1OIP A;  3FYD A;  4MGI E;  3PFI A;  4FW9 A;  5E6J A;  3KOW E;  3L29 A;  4Y28 F;  2L2D A;  4BBA A;  2X49 A;  5KQD A;  1IXS A;  3J81 S;  4LJ4 A;  3KSJ A;  2F4V M;  4Z8X A;  2LNH C;  2JZ1 A;  2C5R A;  3Q8G A;  1VEG A;  2FOI C;  1Y8G A;  3A98 B;  3KS4 A;  4I81 A;  2XH9 A;  1ZAE A;  4M0W A;  4LJA A;  1IBK M;  1JR3 D;  3KP0 E;  1I94 M;  4LFB M;  2R6F A;  1Z6T A;  3QYB A;  3OTO M;  5FTL A;  1YLA A;  4DV1 M;  4IBB A;  4MGH A;  1N33 M;  2K47 A;  2Q2E B;  1OKS A;  2R4J A;  2H1R A;  1JR3 E;  3AOG A;  4RNA A;  5EXP A;  3U6S A;  3R8F A;  5EXX A;  3U6E A;  4II7 A;  1NV8 A;  3U5Z A;  3SAW A;  1GVN A;  4FWD A;  3L26 A;  4NXM M;  3FUX A;  1VDD A;  3RFW A;  1TF0 B;  2QPA A;  2CV0 A;  4LF4 M;  2R4E A;  3AV0 A;  5KO3 A;  2EKF A;  4MM3 B;  3KW6 A;  4IBJ A;  1C1K A;  2R18 A;  5KQ8 A;  3FUU A;  4DUY M;  1G4A E;  2L7I A;  1XXH E;  4DR1 M;  2OQ4 A;  4L8R C;  4QNM A;  4IBC A;  3DOA A;  1XMO M;  4X66 M;  3L25 A;  3SFZ A;  3DZD A;  4K0K M;  1QDR A;  4WW0 A;  2CRU A;  2LWX A;  1EE8 A;  1WIV A;  2KRK A;  2LVO C;  3HZJ A;  4X65 M;  3IG8 A;  3T6P A;  3MK6 A;  1GL6 A;  1GKI A;  2CWB A;  1XXH B;  2YNM D;  3NBI A;  1NNU C;  2XZU A;  2QHO B;  3SBJ A;  4AG5 A;  8CAT A;  2LH0 A;  4L4U A;  5ITX A;  4R71 A;  2L4E A;  4IJF A;  4JI6 M;  3LQR A;  3U6P A;  1AUA A;  3AL0 C;  1YSY A;  1HNZ M;  2KA6 B;  1N34 M;  2XGN A;  2V1C A;  1N75 A;  2DAG A;  3KOZ E;  2C99 A;  3KDS E;  3L27 A;  4JI1 M;  1A5T A;  2YFQ A;  5KPT A;  2VQF M;  1IBM M;  3I51 A;  2I7N A;  4PDG A;  1V33 A;  4MGY E;  1HR0 M;  2F5Q A;  1IY2 A;  4JI7 M;  3W0F A;  1IY0 A;  3RGS A;  3GLG B;  3FUW A;  3R9X B;  4AG6 A;  3HHY A;  2B3T A;  3E4R A;  3I4Y A;  1IN8 A;  3C58 A;  2DZN B;  2JY5 A;  2DWZ B;  2CP8 A;  1QAM A;  2KZU A;  1OIZ A;  2C9C A;  5H37 D;  4B3S M;  2BWE A;  3GP1 A;  1PJQ A;  2XFT A;  2AHM A;  3GLH E;  3VKH A;  1PJS A;  3HHZ A;  2YQZ A;  4FCW A;  2CEA A;  3U6M A;  3SAV A;  2OOB A;  3VK7 A;  1L1Z A;  1D0K A;  3GRY A;  4LF7 M;  3VKG A;  3U60 A;  2VQE M;  5EP1 A;  1YUB A;  4G4O A;  2DVW B;  4LCB A;  4GIP A;  2JP7 A;  2O5R A;  3GLF E;  3SYL A;  3FTD A;  4DBG B;  4IBG A;  1GAB A;  4QOZ C;  1XNQ M;  2DWL A;  4NL4 H;  1D0M A;  2QCU A;  2RGH A;  4I8O A;  3HHX A;  1N36 M;  4GKK M;  4B7H A;  1HT1 E; 
#chains in the Genus database with same CATH homology
 3SMP A;  4LG2 A;  1J7K A;  3JR5 A;  5BPV A;  5LMN M;  3GPU A;  3A42 A;  1L8Q A;  2HHH M;  4MGK E;  1XHB A;  3GRV A;  2EO2 A;  3UJN A;  4ZPX A;  1SXJ C;  1IY1 A;  1UM8 A;  2FNA A;  1NJG A;  2Y0Q A;  4JN6 A;  5EJC A;  3LQQ A;  3L2A A;  3A45 A;  5JI2 E;  4Z6Y A;  1DGF A;  4DR2 M;  4BLC A;  4KO8 A;  3J27 B;  3T1Y M;  2DWN A;  3TQS A;  3THG A;  4DR4 M;  3HHW A;  4CIS A;  4DV6 M;  3FTF A;  1QAN A;  3L28 A;  4M0D A;  4KHP M;  2UUA M;  4B3R M;  4XGI A;  4R3D A;  2DZO B;  2M5Z A;  1G3I A;  1HNX M;  1SXJ A;  3D8B A;  1NJF A;  3MHV C;  4B7F A;  3LMM A;  2QEN A;  3W0L B;  1NHW C;  1QZM A;  3FUT A;  2Y20 A;  4OW0 A;  4OU7 A;  4IBK A;  2A5Y B;  3T15 A;  1HQC A;  4QHS A;  2XSZ D;  4LJ6 A;  1FJG M;  3SYK A;  1MX0 A;  2D7G A;  4LJ7 A;  2XEP A;  4YHH M;  5FTN A;  4RF0 A;  4W5W A;  3HU3 A;  4LJ5 A;  1TH3 A;  4AKI A;  3IG5 A;  3QWL A;  4L16 A;  3WHL A;  3MJ5 A;  2HCB A;  3KVW A;  2HL7 A;  4GIT A;  3GPX A;  1NSF A;  4G4R A;  2ZM6 M;  3SMS A;  5LMU M;  2Y21 A;  3FTE A;  1JQJ C;  1Z5A A;  2OPF A;  1DO0 A;  3HJQ A;  4G6Z A;  3UZU A;  3SAU A;  4I5S A;  2ERC A;  3U61 B;  3CF2 A;  1N78 A;  1Z5C A;  4M9Z A;  2HKJ A;  4B7G A;  1QYR A;  5FSW A;  3SC3 A;  4LF6 M;  4LFA M;  4GMQ A;  1HQY E;  2KXE A;  4AKH A;  4LF9 M;  2C98 A;  1KFV A;  2G5G X;  5KPZ A;  5JI3 E;  4DR7 M;  3JAM S;  4GHL A;  1DO2 A;  4YY3 M;  1R7R A;  3D8L A;  4LGM A;  1J5E M;  4D81 A;  3K1J A;  4LRT A;  4HLQ A;  2ZAN A;  1TDZ A;  4DV5 M;  3ILK A;  5KPR A;  2UXB M;  4LFC M;  2Z4R A;  4FCV A;  2R45 A;  3FYC A;  3KOY E;  1K3X A;  3U61 A;  1E94 E;  3ZH9 B;  1JR3 A;  3K2L A;  1XMQ M;  4LF5 M;  1G59 A;  5EP4 A;  2F5N A;  1IN6 A;  1D2N A;  2DHR A;  2Z4S A;  2CV1 A;  3I4V A;  3J7A S;  4G4N A;  1MU5 A;  5EP3 A;  4AKG A;  1PM5 A;  1TGU A;  2BJW A;  3GQ3 A;  4WUR A;  3VK8 A;  1XXH A;  2ZAO A;  4FCT A;  1PJJ A;  1K82 A;  3TPZ A;  1IN4 A;  4M9S A;  4KLN A;  2NQ8 C;  1G8P A;  4JYA M;  2CV2 A;  1XWI A;  3GLI B;  5ITR A;  2DWM A;  4B3T M;  4XBO A;  1X37 A;  4OVZ B;  2L09 A;  1XC8 A;  1IN7 A;  4MB7 A;  3Q8X A;  2V1U A;  1Q39 A;  4MGZ E;  1L2D A;  1IM2 A;  2BJV A;  2KZS A;  5EXT A;  1IN5 A;  4EIW A;  1ORY B;  3AOE C;  3FUV A;  4FVM A;  3GLH B;  4GC5 A;  3GLG A;  2I7P A;  3J2P B;  4DR5 M;  4L78 A;  2Z3X A;  4DR3 M;  1TH2 A;  3KOX E;  3GLF B;  3J7B A;  1DGH B;  2XF3 A;  4M9X A;  4GKJ M;  2KW0 A;  4QHT A;  1R2Z A;  4RF1 A;  3GRU A;  4GH9 A;  4FD2 A;  3DA1 A;  1GL7 A;  2RKO A;  3PXG A;  4HL4 A;  2F5P A;  2J7O A;  1DGG A;  2CFO A;  1KSF X;  2FE8 A;  4LZZ A;  3AOE A;  2KEB A;  4I4L A;  1HT2 E;  1TH4 A;  4JI0 M;  3NWL A;  4LJ8 A;  4BB9 A;  3GLH A;  2UUC M;  4AZF A;  5EXS A;  3HJS A;  2JA2 A;  2X8A A;  2J7N A;  4LGY A;  1L1T A;  2ZBK B;  3PVS A;  1T3T A;  3HWS A;  1QQW A;  3T1H M;  3A46 A;  2DXI A;  3DFZ A;  3HKP A;  7CAT A;  1DGH A;  3VDP A;  3GPY A;  3EIH A;  5ITU A;  2G8L A;  3TWK A;  2QZ4 A;  3RGP A;  3K92 A;  5DNY A;  4D82 A;  1Q3C A;  3TE6 A;  2FFJ A;  3RE8 A;  4DV0 M;  2E5L M;  2R46 A;  3SAS A;  2YR0 A;  5GKN A;  4AW4 A;  4DV3 M;  3J80 S;  1H6U A;  4G4Q A;  5EP2 A;  4AI6 A;  5ITY A;  4B3M M;  3ZC7 B;  2CHG A;  4DV2 M;  1OJL A;  1LV7 A;  2R65 A;  3U5Z B;  4IJE A;  1L2C A;  4IBF A;  5IT9 S;  5FTK A;  1E9R A;  1QAO A;  2VII A;  2V6Z M;  3HJ8 A;  3B9P A;  3M7G A;  2XLJ A;  1FNN A;  1GLN A;  2EUC A;  4NRW A;  4PDI A;  5DYI A;  1OFI A;  2XZF A;  3CTW B;  3TWL A;  2XFS A;  1NVM A;  5A2Q S;  5ITX E;  4JI4 M;  1IQP A;  3FTC A;  3GO8 A;  4DV4 M;  5E26 A;  4KOD A;  1N77 A;  2D7H A;  4NXN M;  2X4A A;  1NNJ A;  4JI8 M;  2XSZ A;  3JR4 A;  2RGO A;  4JXJ A;  4LY6 A;  1Q3B A;  4IBI A;  3TWM A;  2L6O A;  4REZ A;  4JI3 M;  1E32 A;  3FKE A;  2CE7 A;  3CF0 A;  5ITQ A;  1ZQ9 A;  4AQY M;  5F3W A;  4PCZ A;  3GQ5 A;  4R7G A;  3UMM A;  1KYI A;  1G41 A;  3BOS A;  4S12 A;  4B08 A;  4JI2 M;  1DGB A;  3HU1 A;  2UXD M;  4QOS A;  1QAQ A;  3PNY A;  4D80 A;  3H4M A;  1I4W A;  5IWA M;  2W82 A;  4QNR A;  4PD2 A;  1YE9 A;  1IXR C;  3AJI B;  5DYG A;  1OFH A;  3GPP A;  3M0E A;  1TDH A;  2UXC M;  4FWH A;  4DUZ M;  4PT5 A;  3UK6 A;  3SAR A;  2QBY B;  4MH0 E;  3U60 B;  1K3W A;  2KRU A;  3M6A A;  2CHV A;  3QAU A;  3SHG B;  5FLX S;  4JI5 M;  4FWG A;  2F5S A;  2QP9 X;  1W5S A;  4IBD A;  4NRV A;  4DV7 M;  3KFU G;  1J09 A;  4GHA A;  5IRE B;  3VDU A;  4TUW A;  4LJ9 A;  3E9S A;  3U6C A;  3WHK A;  2R62 A;  4NSO B;  1XNR M;  5BR8 M;  3ZCB B;  5C1B A;  4NOO B;  2Y0T A;  4P16 A;  3SAT A;  2F5O A;  1QVR A;  2BNK A;  1R2Y A;  3KSX A;  3K8Z A;  4IBE A;  2UU9 M;  3U6D A;  4JV5 M;  5IZ7 D;  2QBY A;  3GLI A;  4L15 A;  4OVZ A;  4DR6 M;  4NSR A;  1NY5 A;  3U6L A;  1SXJ D;  4LF8 M;  3AFH A;  2C9O A;  2D7E A;  5C18 A;  4X64 M;  1E9S A;  4ITQ A;  1Z59 A;  3FD9 A;  1SXJ E;  2LXE A;  2Z7J A;  1NY6 A;  1PJI A;  2UUB M;  2P5T A;  4LZJ A;  1L2B A;  2CHQ A;  3T38 A;  1Z5B A;  3GLF A;  3KXE C;  1W5T A;  5ITT A;  1HNW M;  5EQT A;  1SXJ B;  3SHF A;  3KP1 E;  5FTM A;  4GC9 A;  2ZAM A;  4IIW A;  3HU2 A;  4A3V B;  5FTJ A;  4GRI A;  3VFD A;  3LVW A;  3U6Q A;  2M60 A;  4LRS A;  1R6B X;  4OX9 M;  3LVV A;  1IXS B;  1WXQ A;  3EIE A;  3VLF B;  3KS8 A;  3U6O A;  2C96 A;  2L7H A;  1S3S A;  3CF6 E;  4CGY B;  3GQ4 A;  3UGJ A;  1NHG C;  3AKZ A;  1IBL M;  1IXZ A;  4X62 M;  3PNV A;  2EA0 A;  3TL4 X;  2CUZ A;  4CHT B;  3GRR A;  3HGI A;  3FYD A;  4MGI E;  3PFI A;  4FW9 A;  5E6J A;  3KOW E;  3L29 A;  4BBA A;  2X49 A;  5KQD A;  3J81 S;  4LJ4 A;  3KSJ A;  2F4V M;  4Z8X A;  2LNH C;  2C5R A;  2FOI C;  3A98 B;  3KS4 A;  4I81 A;  2XH9 A;  1ZAE A;  4M0W A;  4LJA A;  1IBK M;  1JR3 D;  3KP0 E;  1I94 M;  4LFB M;  1Z6T A;  3OTO M;  5FTL A;  4DV1 M;  4IBB A;  4MGH A;  1N33 M;  2K47 A;  2Q2E B;  2R4J A;  2H1R A;  3AOG A;  4RNA A;  5EXP A;  3U6S A;  3R8F A;  5EXX A;  3U6E A;  4II7 A;  3U5Z A;  3SAW A;  1GVN A;  4FWD A;  3L26 A;  4NXM M;  3FUX A;  1VDD A;  3RFW A;  2QPA A;  2CV0 A;  4LF4 M;  2R4E A;  3AV0 A;  5KO3 A;  4MM3 B;  3KW6 A;  4IBJ A;  1C1K A;  2R18 A;  5KQ8 A;  3FUU A;  4DUY M;  1G4A E;  2L7I A;  4DR1 M;  2OQ4 A;  4L8R C;  4QNM A;  4IBC A;  3DOA A;  1XMO M;  4X66 M;  3L25 A;  3SFZ A;  3DZD A;  4K0K M;  4WW0 A;  2LWX A;  1EE8 A;  2KRK A;  4X65 M;  3IG8 A;  3MK6 A;  1GL6 A;  1GKI A;  1XXH B;  2YNM D;  3NBI A;  1NNU C;  2XZU A;  3SBJ A;  4AG5 A;  8CAT A;  2LH0 A;  4L4U A;  5ITX A;  4IJF A;  4JI6 M;  3LQR A;  3U6P A;  3AL0 C;  1YSY A;  1HNZ M;  2KA6 B;  1N34 M;  2XGN A;  2V1C A;  1N75 A;  3KOZ E;  2C99 A;  3KDS E;  3L27 A;  4JI1 M;  2YFQ A;  2VQF M;  5KPT A;  1IBM M;  3I51 A;  2I7N A;  4PDG A;  4MGY E;  1HR0 M;  2F5Q A;  1IY2 A;  4JI7 M;  3W0F A;  1IY0 A;  3RGS A;  3GLG B;  3FUW A;  3R9X B;  4AG6 A;  3HHY A;  3E4R A;  3I4Y A;  1IN8 A;  3C58 A;  2DZN B;  2DWZ B;  1QAM A;  2KZU A;  5H37 D;  2C9C A;  4B3S M;  3GP1 A;  2XFT A;  2AHM A;  3VKH A;  3HHZ A;  1N32 M;  2YQZ A;  4FCW A;  2CEA A;  3U6M A;  3SAV A;  3VK7 A;  1L1Z A;  3GRY A;  4LF7 M;  3VKG A;  3U60 A;  2VQE M;  5EP1 A;  1YUB A;  4G4O A;  2DVW B;  4LCB A;  4GIP A;  2O5R A;  3SYL A;  3FTD A;  4IBG A;  4QOZ C;  1XNQ M;  2DWL A;  4NL4 H;  2QCU A;  2RGH A;  4I8O A;  1N36 M;  3HHX A;  4GKK M;  4B7H A;  1HT1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...