1K3XA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with brominated-dna
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
253
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*GP*GP*CP*(BRU)P*(BRU)P*CP*AP*(BRU)P*CP*CP*(BRU)P*GP*G)
total genus 84
structure length 253
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3xA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3xA01
2EA0A 1XMOM 1EE8A 2UUAM 3A42A 1K82A 4G4QA 1Z5CA 1Z5AA 1XNRM 3U6OA 5ITYA 1PM5A 4JI2M 3SATA 4DR3M 1XNQM 2F5NA 3GPPA 4G4RA 4NRWA 3TWMA 4GKJM 4NXMM 1PJIA 5ITTA 2E5LM 2Q2EB 4DR7M 4DV2M 4JI5M 1L2BA 1Z5BA 3VK8A 4B3RM 2HKJA 3J7AS 4B3SM 4B3MM 1K3XA 4DR1M 1NNJA 3A45A 3OTOM 4NXNM 4JI1M 5FLXS 2UXCM 3U6QA 4LFAM 2XZFA 2UXDM 3W0FA 4LF8M 4JI0M 1KFVA 2UUCM 3J81S 2XZUA 1Q39A 1XMQM 2F4VM 3GPXA 3GO8A 1HNZM 3SAUA 5IWAM 4NRVA 1HNXM 2OPFA 4ITQA 3GP1A 4DV4M 3SBJA 1MU5A 5LMUM 3C58A 3U6DA 1N32M 4JV5M 1TDHA 4PDIA 4DUYM 4G4OA 1K3WA 2OQ4A 2UUBM 3GQ5A 4DV3M 3GQ4A 4B3TM 5LMNM 4X62M 3J80S 4DR4M 4DR2M 5BR8M 1PJJA 2UXBM 4YY3M 4LF9M 4DR5M 3U6MA 4DR6M 4DV0M 3JR5A 2F5QA 5ITXA 4DV1M 4DV6M 4PCZA 3VK7A 4PD2A 1HNWM 3SAVA 1Z59A 2HHHM 4CISA 1J5EM 4LF4M 1HR0M 4LFCM 4K0KM 5A2QS 3T1YM 3T1HM 1XC8A 4JI4M 1N33M 4OX9M 4JI3M 3JR4A 4PDGA 1N34M 3SARA 4LF7M 4AQYM 5ITUA 4X66M 1L2DA 4JI8M 3GPUA 2ZBKB 3U6CA 3DOAA 3U6LA 4LF6M 1L1ZA 3U6EA 4LF5M 4YHHM 4DV7M 4LFBM 2F5OA 4GKKM 4DV5M 3TWKA 1I94M 5ITRA 4X65M 1TDZA 4X64M 3GQ3A 3GPYA 4DUZM 2F5SA 5ITQA 5IT9S 4JI6M 1Q3CA 2F5PA 1N36M 2VQFM 3U6PA 1R2YA 4KHPM 2ZM6M 4JYAM 1R2ZA 1L1TA 3SASA 1L2CA 2VQEM 1Q3BA 5ITXE 4G4NA 4JI7M 2UU9M 1FJGM 3SAWA 3TWLA 1IBMM 1MX0A 3U6SA 3A46A 1IBLM 3JAMS 4MB7A 1IBKM
chains in the Genus database with same CATH superfamily
1XMOM 2DZNB 3MJ5A 1JQJC 1H6UA 3PFIA 2RGOA 3GLFA 5ITYA 4BB9A 1TH3A 2YFQA 4DR3M 3M0EA 4OU7A 1XNQM 3WHKA 4FVMA 3E46A 3UK6A 3TWMA 3ZH9B 1C7YA 3VKHA 3VKGA 3SYKA 2R44A 1E9RA 1YUBA 2N35A 1Z5BA 4B7GA 3K9PA 4DV2M 1QDTA 4B3RM 4IBGA 2DVWB 4P16A 1D0MA 4B3MM 3EIHA 4DR1M 2QSFX 3QYBA 3KVWA 3OTOM 2QBYB 1ZQ9A 2MJ5B 5FLXS 4BLCA 3LCVB 4QNRA 4OVZB 2D7EA 2UXDM 2R65A 3RFWA 3BXWA 4LF8M 2KHHA 4GITA 3UGJA 3K1JA 2KNAA 5FSWA 1TH4A 3U60B 2EO2A 4OVZA 2O01F 2R0IA 3GO8A 2OPFA 4CHTB 1OFIA 3LVWA 1VDDA 4DV4M 1TF0B 5LMUM 4M9SA 2H5XA 1QAQA 2R6FA 3VDUA 4REZA 4JV5M 3AJIB 4DUYM 1QAOA 4G4OA 3H4JA 2VF8A 5KQDA 5KPZA 1K3WA 2OOAA 1C1KA 2UUBM 3SMSA 1UM8A 4HL4A 4X62M 1SXJC 2R18A 3U5ZB 4XBOA 4DR2M 1OKSA 5DYGA 4LZJA 5BR8M 3W0LB 1R5LA 3FUXA 1DO0A 3JR5A 3MK6A 1IN7A 3T15A 3KOXE 3VK7A 4LGYA 4PD2A 3I51A 2QENA 3Q8GA 3U61A 2XLJA 4P17A 4CISA 1J5EM 4LF4M 1IN4A 3HHWA 3FTCA 1FNNA 1N33M 4M0WA 2Z3XA 1AIPC 1OAOC 2KDLA 4OX9M 3KOWE 4M0DA 2DAGA 4GC5A 4JI3M 3ZQJA 4I4LA 1L8QA 2WSEF 3K9OA 3M7GA 2XEPA 4LF7M 1D0LA 1NO1A 3FUWA 4L6V6 4GIPA 2BWBA 2X4AA 1VEGA 2ZAOA 3U6CA 2DAEA 2CUZA 2CHQA 4LF6M 1NNUC 3HY5A 4W5WA 2CWBA 3GLIA 1WXQA 1X37A 3KOZE 2KZSA 4YHHM 4B7HA 2F5OA 4UN2B 3HGIA 2JNHA 2LNHC 1TDZA 4X64M 2V6ZM 2K47A 1GL6A 5ITQA 2DAMA 2GNOA 2LVPC 4IBJA 4LJ6A 3U6PA 3PXGA 1QVRA 2FE8A 3LCUA 2G8LA 3B89A 2DHYA 4AG5A 4G4NA 1MN3A 3CGWA 4RKUF 2UU9M 5F3WA 4RF0A 1IXSA 4MGIE 2R4JA 1XXHB 4LCBA 1IN8A 2JY8A 3B7NA 3GLIB 1MX0A 2K9DA 4LZZA 3HZJA 1IBMM 3A46A 1OFHA 2V1UA 3JAMS 2FOIC 1JB0F 3HU2A 2MGWA 3ZCBB 2XFSA 2HCBA 8CATA 3THGA 2CHGA 3LQRA 2UUAM 2LXEA 3CTWB 1BVSA 3GLFB 3FD9A 3J2PB 4IBFA 1Z5AA 5FTJA 3RGPA 4LY6A 1MJGM 2Y21A 3FRIA 3TQSA 1IXZA 2D7HA 3C9PA 3L2AA 4NSOB 1G4AE 1NVMA 2J7NA 1D2NA 4R7GA 2D7GA 4G4RA 1G41A 5E6JA 4MGHA 3RE8A 3NBIA 4CJ6A 1OIZA 1XB2B 3GLHB 2Q2EB 2AHMA 3SHGB 4JI5M 3LW5F 2VF7A 4IBKA 2RRUA 2CRUA 2DAIA 1L2BA 2HKJA 3J7AS 4B3SM 2FS1A 1K3XA 1NHWC 1T6OA 2A5YB 5DNYA 1IY0A 2CHVA 2YNMD 3FTDA 1N78A 3GLHA 3LMMA 4NXNM 2WSCF 1JR3E 4MGYE 3FTEA 1NY6A 1QYRA 3PNVA 2K6BA 3W0FA 2ZTDA 4D81A 3DZDA 2JY5A 1PJTA 1KFVA 1DGFA 3SFZA 3R8FA 4Y28F 2XZUA 2C9CA 3M6AA 4BBAA 2XF3A 2C99A 4R71A 3V76A 2Y0QA 3SAUA 1HNXM 3QYEA 1EIJA 4ITQA 2ERCA 3GP1A 1YSYA 1XXHE 4M9ZA 7CATA 2WZJA 1ZMWA 1PJQA 4XGIA 1GKIA 3T6PA 1QZMA 3QAUA 3W68A 4B08A 1R4GA 3LVVA 4CIZA 1QAMA 3GRRA 4MGZE 3GQ4A 3FYDA 2FH0A 5FTKA 1HJPA 1XXHA 4FCWA 3KS4A 1Y8GA 2YR0A 5EXXA 3L27A 1WR1B 1PJJA 2QCUA 2JZ0A 4DR5M 3I04M 2L09A 1QUSA 4Z8XA 4L8RC 4LGMA 3MHVC 3VLFB 1VEJA 2ZANA 4PCZA 2FNAA 5JI3E 4DV1M 3AL0C 2M5ZA 3F92A 5KPRA 4JI4M 4KT0F 2JZ1A 2C9OA 2NQ8C 3JR4A 1DGHB 1G59A 2L4FA 1GLNA 1WGLA 2EKFA 2LHCA 5EP4A 5FTNA 2BWEA 4L78A 5KQ8A 1L2DA 3ILKA 3HHYA 2ZBKB 1QDRA 5EXSA 3E9SA 4FW9A 2DWMA 2OO9A 2XH9A 4FD2A 2L7IA 5IREB 1R6BX 1NV8A 3B7QA 1J7KA 3HJQA 3FYCA 2EUCA 4F2LA 4IJFA 1Q02A 2XGNA 3FE3A 1V34A 1V33A 5EP2A 1I94M 1IY2A 4DUZM 1ZMUA 3KSXA 2F5SA 3FUVA 1OIPA 4G3OA 2DAKA 3VFDA 1VEKA 2VQFM 1OQYA 2ZM6M 1SXJA 2KNVA 2KRUA 5DYIA 1L2CA 3AV0A 2VQEM 3A98B 2P5TA 1Q3BA 2EKKA 3PNYA 2X49A 4KO8A 2B3TA 3VDPA 3FRHA 3ZC7B 1FJGM 4D82A 4GMQA 4NOOB 3W67A 4LJ7A 2QBYA 3HKPA 4F1IA 4ANRA 4NC6A 4IBEA 2HL7A 4EIWA 5C18A 4LG2A 3U6SA 2BJVA 1T3TA 2CFOA 4MB7A 2DZLA 5EXPA 3KXEC 4DBGB 3C3DA 3BOSA 2RKOA 3A42A 5GKNA 4G4QA 1K82A 2CE7A 1NY5A 4LRSA 4FCTA 4GH9A 4JN6A 4RNAA 2VIIA 4JI2M 1GJSA 1IN5A 5FTLA 4MH0E 5DFLA 3L25A 5H37D 1S3SA 4NXMM 1JR3A 1PJIA 2DXIA 2DWLA 5ITTA 2E5LM 1WIVA 3HU3A 1DGGA 4AZFA 1GABA 1TTEA 3U5ZA 3VK8A 1DV0A 1OTRA 3GLGA 2JUJA 1GVNA 4QOZC 3H4MA 4GHLA 5C1BA 2QQ8A 4LJ9A 4AKGA 3A45A 4AG6A 3D8BA 1ZAEA 4GEWA 2APLA 3B7ZA 1YE9A 1NSFA 3FUTA 3U6QA 4LFAM 3GLGB 3Q8XA 4B7FA 4LJ4A 1CUKA 1IM2A 1QZEA 4LJ8A 3SC3A 1PRBA 3B9PA 4JI0M 4QHSA 3K92A 2UUCM 3J81S 4LJ5A 1TR8A 2QZ4A 1QANA 4KLNA 1XMQM 1ZV1A 2KEBA 1DGBA 1NJFA 3IECA 4AKHA 3J27B 1KYIA 3UJNA 3CF0A 5IWAM 2LHGA 4CGYB 4I8OA 2C5RA 1SXJB 5L8RF 3KDSE 3IG5A 3C58A 5EQTA 3GLFE 3TPZA 1TDHA 2Z4SA 2H1RA 2X8AA 1IY1A 2JWSA 3GRVA 2LVQD 1QQWA 5LMNM 2DI0A 3IG8A 2HWJA 4DR4M 2KZUA 1SXJD 4S12A 4AKIA 2UXBM 2DENA 2CV2A 3U6MA 2R62A 2M60A 2L6OA 4DR6M 3AFHA 2F5QA 4DV6M 2MROB 1RU3A 4L4UA 2G5GX 3SAVA 3J7BA 1IFYA 2WSFF 1HR0M 4M9XA 4LFCM 3GRYA 1XC8A 3CF6E 4QHTA 1NHGC 4Q7JA 1N34M 2JP7A 1IXSB 3SARA 2BNKA 4WP2A 1WJ7A 1E94E 1PJSA 4AQYM 5BPVA 4JI8M 1XHBA 3GLGE 3DOAA 3HHXA 2LVOC 5JI2E 3U6LA 5FTMA 1L1ZA 3U6EA 2RGHA 2R4EA 3QWLA 4HEOA 2DZOB 2BJWA 4DV7M 3U60A 4QNMA 4LF5M 4LFBM 1NV9A 3E4RA 3RGSA 1OJLA 2KXEA 2LH0A 3KP0E 2Z7JA 3TWKA 4GKKM 2VDBB 2J7OA 3B74A 1W5TA 4IBBA 5ITRA 4X65M 2DKLA 3AOEC 1R7RA 4QOSA 3GPYA 1G3IA 3AOGA 4NL4H 5IT9S 4IBDA 1HQCA 2F5PA 2LVNC 2Y0TA 1R2YA 1R2ZA 4I81A 3KP1E 2FFJA 3LQQA 4GHAA 3FUUA 5ITXE 3KS8A 2L2DA 4II7A 2LWXA 4JI7M 4AI6A 4XK8F 3U61B 1TGUA 2CEAA 3SAWA 1W5SA 1VG5A 3TWLA 1GJTA 4OW0A 1A5TA 4HLQA 1IBLM 1N77A 3L28A 2LVAA 3E21A 2EA0A 1IN6A 3I4YA 1EE8A 1Z5CA 2CP8A 4A3VB 3SHFA 4Z6YA 1XNRM 3U6OA 1PM5A 1F4IA 1TH2A 5EJCA 3L26A 3TE6A 3SATA 4R3DA 2HAKA 1V92A 2F5NA 3GPPA 3NWLA 4NRWA 2Y20A 3HU1A 4GKJM 1G8PA 2L7HA 2R45A 4DR7M 1IQPA 5IZ7D 3L29A 3NBXX 1HT2E 2LBCA 4D80A 2I7PA 2C96A 2Z8YM 2XFTA 2YQZA 1NNJA 1XWIA 4FWDA 3WHLA 3AOEA 2EJSA 1JR3D 1E32A 4MM3B 4WW0A 4JXJA 3DA1A 4JI1M 2G3QA 3GLIE 1G71A 3GLHE 2UXCM 5EP3A 1HQYE 3SYLA 2LTUA 3K8ZA 2I7NA 2XZFA 1GO5A 1HT1E 3KSJA 1NJGA 1LV7A 2C98A 2W82A 1AUAA 1Q39A 2F4VM 3GPXA 3EIEA 2Z4RA 1HNZM 2DWNA 2ZAMA 2QP9X 4IJEA 4NRVA 4ZPXA 3HX3A 3SBJA 3IHPA 1MU5A 4L16A 2O25A 3C3EA 3U6DA 1P3QQ 1YLAA 2KA6B 3KOYE 1J09A 3KW6A 2JY7A 4PT5A 4AW4A 4PDIA 1N32M 3SMPA 2OQ4A 3HJ8A 1DO2A 3K2LA 5EP1A 3GQ5A 4DV3M 3T38A 4B3TM 3CF2A 2CV0A 1KSFX 1OAIA 1Z6TA 2R46A 3HWSA 4FWGA 4IIWA 3J80S 5KO3A 1SXJE 4FCVA 1SG9A 1IXRC 4YY3M 4LJAA 4LF9M 2JA2A 4GRIA 3MMPA 5E26A 3I4VA 4FWHA 4DV0M 2V1CA 4G6ZA 1T43A 5ITXA 4IBCA 2XSZA 1HNWM 3I01M 1Z59A 2HHHM 4LRTA 3FTFA 3FKEA 1VDLA 2XSZD 4K0KM 5A2QS 1QUTA 1D0KA 3T1HM 3T1YM 5EXTA 1VQ1A 2JY6B 2ZTCA 4MGKE 2GQFA 1E9SA 4PDGA 4NSRA 1I4WA 1N75A 4GC9A 4WURA 2KW0A 3D8LA 5ITUA 4X66M 3GPUA 2DHRA 2QPAA 5KPTA 2CV1A 2KRKA 1LTMA 2QHOB 3R9XB 2L4EA 3BBZA 4DV5M 1EFUB 1GL7A 3PVSA 1WHCA 2MR9A 3TL4X 3DFZA 2DNAA 3GQ3A 1ORYB 3GRUA 2DWZB 4L15A 1WGNA 3UMMA 4IBIA 4JI6M 3KFUG 1Q3CA 1N36M 4KHPM 4JYAM 1L1TA 3SASA 3AKZA 2MH8A 2QNJA 1ZMVA 1UFZA 1PGYA 3UZUA 3HHZA 4I5SA 4TUWA 2JXNA 2K0BX 4KODA 3HJSA 2O5RA 2KNZA 2OOBA 2J5YA 1IBKM 4RF1A 1DGHA
chains in the Genus database with same CATH topology
1XMOM 2DZNB 3MJ5A 1JQJC 1H6UA 3PFIA 2RGOA 3GLFA 5ITYA 4BB9A 1TH3A 2YFQA 4DR3M 3M0EA 4OU7A 1XNQM 3WHKA 4FVMA 3UK6A 3TWMA 3ZH9B 3VKHA 3VKGA 3SYKA 1E9RA 1YUBA 4B7GA 1Z5BA 4DV2M 4B3RM 4IBGA 2DVWB 4P16A 4B3MM 3EIHA 4DR1M 3KVWA 3OTOM 2QBYB 1ZQ9A 5FLXS 4BLCA 4QNRA 4OVZB 2D7EA 2UXDM 2R65A 3RFWA 4LF8M 4GITA 3UGJA 3K1JA 5FSWA 1TH4A 3U60B 2EO2A 4OVZA 3GO8A 2OPFA 4CHTB 1OFIA 3LVWA 1VDDA 4DV4M 5LMUM 4M9SA 1QAQA 3VDUA 4REZA 4JV5M 3AJIB 4DUYM 1QAOA 4G4OA 5KQDA 5KPZA 1K3WA 1C1KA 2UUBM 3SMSA 1UM8A 4HL4A 4X62M 1SXJC 2R18A 3U5ZB 4XBOA 4DR2M 5DYGA 4LZJA 5BR8M 3W0LB 3FUXA 1DO0A 3JR5A 3MK6A 1IN7A 3T15A 3KOXE 3VK7A 4LGYA 4PD2A 3I51A 2QENA 3U61A 2XLJA 4CISA 1J5EM 4LF4M 1IN4A 3HHWA 3FTCA 1FNNA 1N33M 4M0WA 2Z3XA 4OX9M 3KOWE 4M0DA 4GC5A 4JI3M 4I4LA 1L8QA 3M7GA 2XEPA 4LF7M 3FUWA 4GIPA 2X4AA 2ZAOA 3U6CA 2CUZA 2CHQA 4LF6M 1NNUC 4W5WA 3GLIA 1WXQA 1X37A 3KOZE 2KZSA 4YHHM 4B7HA 2F5OA 3HGIA 2LNHC 1TDZA 4X64M 2V6ZM 2K47A 1GL6A 5ITQA 4LJ6A 4IBJA 3U6PA 3PXGA 1QVRA 2FE8A 2G8LA 4AG5A 4G4NA 2UU9M 5F3WA 4RF0A 4MGIE 2R4JA 1XXHB 4LCBA 1IN8A 1IBMM 3GLIB 1MX0A 4LZZA 3A46A 1OFHA 2V1UA 3JAMS 2FOIC 3HU2A 3ZCBB 8CATA 2XFSA 2HCBA 3THGA 2CHGA 3LQRA 2UUAM 2LXEA 3CTWB 3GLFB 3FD9A 3J2PB 4IBFA 1Z5AA 5FTJA 3RGPA 4LY6A 2Y21A 3TQSA 1IXZA 2D7HA 3L2AA 4NSOB 1G4AE 1NVMA 2J7NA 1D2NA 4R7GA 2D7GA 4G4RA 1G41A 5E6JA 4MGHA 3RE8A 3NBIA 3GLHB 2Q2EB 2AHMA 3SHGB 4JI5M 1L2BA 4IBKA 2HKJA 3J7AS 4B3SM 1K3XA 1NHWC 5DNYA 2A5YB 1IY0A 2CHVA 2YNMD 3FTDA 1N78A 3GLHA 3LMMA 4NXNM 4MGYE 3FTEA 1NY6A 1QYRA 3PNVA 3W0FA 4D81A 3DZDA 1KFVA 1DGFA 3SFZA 3R8FA 2XZUA 2C9CA 3M6AA 4BBAA 2XF3A 2C99A 2Y0QA 3SAUA 1HNXM 4ITQA 2ERCA 3GP1A 1YSYA 4M9ZA 7CATA 4XGIA 1GKIA 1QZMA 3QAUA 4B08A 3LVVA 1QAMA 3GRRA 4MGZE 3GQ4A 3FYDA 5FTKA 1XXHA 4FCWA 3KS4A 2YR0A 5EXXA 3L27A 1PJJA 2QCUA 4DR5M 2L09A 4L8RC 4Z8XA 4LGMA 3MHVC 3VLFB 2ZANA 4PCZA 4DV1M 2FNAA 5JI3E 3AL0C 2M5ZA 5KPRA 4JI4M 2C9OA 2NQ8C 3JR4A 1DGHB 1G59A 1GLNA 5FTNA 5EP4A 4L78A 1L2DA 5KQ8A 3ILKA 3HHYA 2ZBKB 5EXSA 2DWMA 3E9SA 4FW9A 4FD2A 2XH9A 2L7IA 5IREB 1R6BX 1J7KA 3HJQA 3FYCA 2EUCA 4IJFA 2XGNA 5EP2A 1I94M 1IY2A 4DUZM 2F5SA 3KSXA 3FUVA 3VFDA 2VQFM 2ZM6M 1SXJA 2KRUA 5DYIA 1L2CA 3AV0A 2VQEM 3A98B 2P5TA 1Q3BA 3PNYA 2X49A 4KO8A 3VDPA 3ZC7B 1FJGM 4D82A 4GMQA 4NOOB 4LJ7A 2QBYA 3HKPA 5C18A 4IBEA 2HL7A 4EIWA 4LG2A 3U6SA 2BJVA 1T3TA 2CFOA 4MB7A 5EXPA 3KXEC 3BOSA 2RKOA 3A42A 5GKNA 4G4QA 1K82A 2CE7A 1NY5A 4LRSA 4FCTA 4GH9A 4JN6A 4RNAA 2VIIA 4JI2M 1IN5A 5FTLA 4MH0E 3L25A 5H37D 1S3SA 4NXMM 1JR3A 1PJIA 2DXIA 2DWLA 5ITTA 2E5LM 3HU3A 1DGGA 4AZFA 3U5ZA 3VK8A 3GLGA 4QOZC 1GVNA 3H4MA 4GHLA 5C1BA 4LJ9A 4AKGA 3A45A 4AG6A 3D8BA 1ZAEA 3FUTA 3U6QA 1YE9A 1NSFA 4LFAM 3GLGB 3Q8XA 4B7FA 4LJ4A 1IM2A 4LJ8A 3SC3A 3B9PA 4JI0M 4QHSA 3K92A 2UUCM 3J81S 4LJ5A 2QZ4A 1QANA 4KLNA 1XMQM 2KEBA 1DGBA 1NJFA 4AKHA 3J27B 1KYIA 3UJNA 3CF0A 5IWAM 4CGYB 4I8OA 2C5RA 1SXJB 3KDSE 3IG5A 3C58A 5EQTA 3TPZA 1TDHA 2Z4SA 2H1RA 2X8AA 1IY1A 3GRVA 1QQWA 5LMNM 3IG8A 4DR4M 2KZUA 1SXJD 4S12A 4AKIA 2UXBM 2CV2A 3U6MA 2R62A 2M60A 2L6OA 4DR6M 3AFHA 2F5QA 4DV6M 4L4UA 2G5GX 3SAVA 3J7BA 1HR0M 4M9XA 4LFCM 3GRYA 1XC8A 3CF6E 4QHTA 1NHGC 3SARA 1N34M 1IXSB 2BNKA 1E94E 4AQYM 5BPVA 4JI8M 1XHBA 3DOAA 3HHXA 5JI2E 3U6LA 5FTMA 1L1ZA 3U6EA 2RGHA 2R4EA 3QWLA 3U60A 2DZOB 2BJWA 4DV7M 4LF5M 4QNMA 4LFBM 3E4RA 3RGSA 1OJLA 2KXEA 2LH0A 3KP0E 2Z7JA 3TWKA 4GKKM 2J7OA 1W5TA 4IBBA 5ITRA 4X65M 3AOEC 1R7RA 4QOSA 3GPYA 1G3IA 3AOGA 4NL4H 5IT9S 4IBDA 1HQCA 2F5PA 2Y0TA 1R2YA 1R2ZA 4I81A 3KP1E 2FFJA 3LQQA 4GHAA 3FUUA 5ITXE 3KS8A 4II7A 2LWXA 4JI7M 4AI6A 3U61B 1TGUA 2CEAA 3SAWA 1W5SA 3TWLA 4OW0A 4HLQA 1IBLM 1N77A 3L28A 2EA0A 1IN6A 3I4YA 1EE8A 1Z5CA 4A3VB 3SHFA 4Z6YA 1XNRM 3U6OA 1PM5A 1TH2A 5EJCA 3L26A 3TE6A 3SATA 4R3DA 2F5NA 3GPPA 3NWLA 4NRWA 2Y20A 3HU1A 4GKJM 1G8PA 2L7HA 2R45A 4DR7M 1IQPA 5IZ7D 3L29A 1HT2E 4D80A 2I7PA 2C96A 2XFTA 2YQZA 1NNJA 1XWIA 4FWDA 3WHLA 3AOEA 1JR3D 1E32A 4MM3B 4WW0A 4JXJA 3DA1A 4JI1M 2UXCM 5EP3A 1HQYE 3SYLA 3K8ZA 2I7NA 2XZFA 1HT1E 3KSJA 1NJGA 1LV7A 2C98A 2W82A 1Q39A 2F4VM 3GPXA 3EIEA 2Z4RA 1HNZM 2DWNA 2ZAMA 2QP9X 4IJEA 4NRVA 4ZPXA 3SBJA 1MU5A 4L16A 3U6DA 3KOYE 2KA6B 3KW6A 1J09A 1N32M 4PT5A 4AW4A 4PDIA 3SMPA 2OQ4A 3HJ8A 1DO2A 3K2LA 5EP1A 3GQ5A 4DV3M 3T38A 4B3TM 3CF2A 2CV0A 1KSFX 1Z6TA 2R46A 3HWSA 4FWGA 4IIWA 3J80S 5KO3A 1SXJE 4FCVA 1IXRC 4YY3M 4LJAA 4LF9M 2JA2A 4GRIA 5E26A 3I4VA 4FWHA 4DV0M 2V1CA 4G6ZA 5ITXA 4IBCA 2XSZA 1HNWM 1Z59A 2HHHM 4LRTA 3FTFA 3FKEA 2XSZD 4K0KM 5A2QS 3T1YM 3T1HM 5EXTA 4MGKE 1E9SA 4PDGA 4NSRA 1I4WA 1N75A 4GC9A 4WURA 2KW0A 3D8LA 5ITUA 4X66M 3GPUA 2DHRA 2QPAA 5KPTA 2CV1A 2KRKA 3R9XB 4DV5M 1GL7A 3PVSA 3TL4X 3DFZA 3GQ3A 1ORYB 3GRUA 2DWZB 4L15A 3UMMA 4IBIA 4JI6M 3KFUG 1Q3CA 1N36M 4KHPM 4JYAM 1L1TA 3SASA 3AKZA 3UZUA 3HHZA 4I5SA 4TUWA 4KODA 3HJSA 2O5RA 1IBKM 4RF1A 1DGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA0 A;  1XMO M;  1EE8 A;  2UUA M;  3A42 A;  1K82 A;  4G4Q A;  1Z5C A;  1Z5A A;  1XNR M;  3U6O A;  5ITY A;  1PM5 A;  4JI2 M;  3SAT A;  4DR3 M;  1XNQ M;  2F5N A;  3GPP A;  4G4R A;  4NRW A;  3TWM A;  4GKJ M;  4NXM M;  1PJI A;  5ITT A;  2E5L M;  2Q2E B;  4DR7 M;  4DV2 M;  4JI5 M;  1L2B A;  1Z5B A;  3VK8 A;  4B3R M;  2HKJ A;  3J7A S;  4B3S M;  4B3M M;  1K3X A;  4DR1 M;  1NNJ A;  3A45 A;  3OTO M;  4NXN M;  4JI1 M;  5FLX S;  2UXC M;  3U6Q A;  4LFA M;  2XZF A;  2UXD M;  3W0F A;  4LF8 M;  4JI0 M;  1KFV A;  2UUC M;  3J81 S;  2XZU A;  1Q39 A;  1XMQ M;  2F4V M;  3GPX A;  3GO8 A;  1HNZ M;  3SAU A;  5IWA M;  4NRV A;  1HNX M;  2OPF A;  4ITQ A;  3GP1 A;  4DV4 M;  3SBJ A;  1MU5 A;  5LMU M;  3C58 A;  3U6D A;  1N32 M;  4JV5 M;  1TDH A;  4PDI A;  4DUY M;  4G4O A;  1K3W A;  2OQ4 A;  2UUB M;  3GQ5 A;  4DV3 M;  3GQ4 A;  4B3T M;  5LMN M;  4X62 M;  3J80 S;  4DR4 M;  4DR2 M;  5BR8 M;  1PJJ A;  2UXB M;  4YY3 M;  4LF9 M;  4DR5 M;  3U6M A;  4DR6 M;  4DV0 M;  3JR5 A;  2F5Q A;  5ITX A;  4DV1 M;  4DV6 M;  4PCZ A;  3VK7 A;  4PD2 A;  1HNW M;  3SAV A;  1Z59 A;  2HHH M;  4CIS A;  1J5E M;  4LF4 M;  1HR0 M;  4LFC M;  4K0K M;  5A2Q S;  3T1Y M;  3T1H M;  1XC8 A;  4JI4 M;  1N33 M;  4OX9 M;  4JI3 M;  3JR4 A;  4PDG A;  1N34 M;  3SAR A;  4LF7 M;  4AQY M;  5ITU A;  4X66 M;  1L2D A;  4JI8 M;  3GPU A;  2ZBK B;  3U6C A;  3DOA A;  3U6L A;  4LF6 M;  1L1Z A;  3U6E A;  4LF5 M;  4YHH M;  4DV7 M;  4LFB M;  2F5O A;  4GKK M;  4DV5 M;  3TWK A;  1I94 M;  5ITR A;  4X65 M;  1TDZ A;  4X64 M;  3GQ3 A;  3GPY A;  4DUZ M;  2F5S A;  5ITQ A;  5IT9 S;  4JI6 M;  1Q3C A;  2F5P A;  1N36 M;  2VQF M;  3U6P A;  1R2Y A;  4KHP M;  2ZM6 M;  4JYA M;  1R2Z A;  1L1T A;  3SAS A;  1L2C A;  2VQE M;  1Q3B A;  5ITX E;  4G4N A;  4JI7 M;  2UU9 M;  1FJG M;  3SAW A;  3TWL A;  1IBM M;  1MX0 A;  3U6S A;  3A46 A;  1IBL M;  3JAM S;  4MB7 A;  1IBK M; 
#chains in the Genus database with same CATH topology
 1XMO M;  2DZN B;  3MJ5 A;  1JQJ C;  1H6U A;  3PFI A;  2RGO A;  3GLF A;  5ITY A;  4BB9 A;  1TH3 A;  2YFQ A;  4DR3 M;  3M0E A;  4OU7 A;  1XNQ M;  3WHK A;  4FVM A;  3E46 A;  3UK6 A;  3TWM A;  3ZH9 B;  1C7Y A;  3VKH A;  3VKG A;  3SYK A;  2R44 A;  1E9R A;  1YUB A;  2N35 A;  1Z5B A;  4B7G A;  3K9P A;  4DV2 M;  1QDT A;  4B3R M;  4IBG A;  2DVW B;  4P16 A;  1D0M A;  4B3M M;  3EIH A;  4DR1 M;  2QSF X;  3QYB A;  3KVW A;  3OTO M;  2QBY B;  1ZQ9 A;  2MJ5 B;  5FLX S;  4BLC A;  3LCV B;  4QNR A;  4OVZ B;  2D7E A;  2UXD M;  2R65 A;  3RFW A;  3BXW A;  4LF8 M;  2KHH A;  4GIT A;  3UGJ A;  3K1J A;  2KNA A;  5FSW A;  1TH4 A;  3U60 B;  2EO2 A;  4OVZ A;  2O01 F;  2R0I A;  3GO8 A;  2OPF A;  4CHT B;  1OFI A;  3LVW A;  1VDD A;  4DV4 M;  1TF0 B;  5LMU M;  4M9S A;  2H5X A;  1QAQ A;  2R6F A;  3VDU A;  4REZ A;  4JV5 M;  3AJI B;  4DUY M;  1QAO A;  4G4O A;  3H4J A;  2VF8 A;  5KQD A;  5KPZ A;  1K3W A;  2OOA A;  1C1K A;  2UUB M;  3SMS A;  1UM8 A;  4HL4 A;  4X62 M;  1SXJ C;  2R18 A;  3U5Z B;  4XBO A;  4DR2 M;  1OKS A;  5DYG A;  4LZJ A;  5BR8 M;  3W0L B;  1R5L A;  3FUX A;  1DO0 A;  3JR5 A;  3MK6 A;  1IN7 A;  3T15 A;  3KOX E;  3VK7 A;  4LGY A;  4PD2 A;  3I51 A;  2QEN A;  3Q8G A;  3U61 A;  2XLJ A;  4P17 A;  4CIS A;  1J5E M;  4LF4 M;  1IN4 A;  3HHW A;  3FTC A;  1FNN A;  1N33 M;  4M0W A;  2Z3X A;  1AIP C;  1OAO C;  2KDL A;  4OX9 M;  3KOW E;  4M0D A;  2DAG A;  4GC5 A;  4JI3 M;  3ZQJ A;  4I4L A;  1L8Q A;  2WSE F;  3K9O A;  3M7G A;  2XEP A;  4LF7 M;  1D0L A;  1NO1 A;  3FUW A;  4L6V 6;  4GIP A;  2BWB A;  2X4A A;  1VEG A;  2ZAO A;  3U6C A;  2DAE A;  2CUZ A;  2CHQ A;  4LF6 M;  1NNU C;  3HY5 A;  4W5W A;  2CWB A;  3GLI A;  1WXQ A;  1X37 A;  3KOZ E;  2KZS A;  4YHH M;  4B7H A;  2F5O A;  4UN2 B;  3HGI A;  2JNH A;  2LNH C;  1TDZ A;  4X64 M;  2V6Z M;  2K47 A;  1GL6 A;  5ITQ A;  2DAM A;  2GNO A;  2LVP C;  4IBJ A;  4LJ6 A;  3U6P A;  3PXG A;  1QVR A;  2FE8 A;  3LCU A;  2G8L A;  3B89 A;  2DHY A;  4AG5 A;  4G4N A;  1MN3 A;  3CGW A;  4RKU F;  2UU9 M;  5F3W A;  4RF0 A;  1IXS A;  4MGI E;  2R4J A;  1XXH B;  4LCB A;  1IN8 A;  2JY8 A;  3B7N A;  3GLI B;  1MX0 A;  2K9D A;  4LZZ A;  3HZJ A;  1IBM M;  3A46 A;  1OFH A;  2V1U A;  3JAM S;  2FOI C;  1JB0 F;  3HU2 A;  2MGW A;  3ZCB B;  2XFS A;  2HCB A;  8CAT A;  3THG A;  2CHG A;  3LQR A;  2UUA M;  2LXE A;  3CTW B;  1BVS A;  3GLF B;  3FD9 A;  3J2P B;  4IBF A;  1Z5A A;  5FTJ A;  3RGP A;  4LY6 A;  1MJG M;  2Y21 A;  3FRI A;  3TQS A;  1IXZ A;  2D7H A;  3C9P A;  3L2A A;  4NSO B;  1G4A E;  1NVM A;  2J7N A;  1D2N A;  4R7G A;  2D7G A;  4G4R A;  1G41 A;  5E6J A;  4MGH A;  3RE8 A;  3NBI A;  4CJ6 A;  1OIZ A;  1XB2 B;  3GLH B;  2Q2E B;  2AHM A;  3SHG B;  4JI5 M;  3LW5 F;  2VF7 A;  4IBK A;  2RRU A;  2CRU A;  2DAI A;  1L2B A;  2HKJ A;  3J7A S;  4B3S M;  2FS1 A;  1K3X A;  1NHW C;  1T6O A;  2A5Y B;  5DNY A;  1IY0 A;  2CHV A;  2YNM D;  3FTD A;  1N78 A;  3GLH A;  3LMM A;  4NXN M;  2WSC F;  1JR3 E;  4MGY E;  3FTE A;  1NY6 A;  1QYR A;  3PNV A;  2K6B A;  3W0F A;  2ZTD A;  4D81 A;  3DZD A;  2JY5 A;  1PJT A;  1KFV A;  1DGF A;  3SFZ A;  3R8F A;  4Y28 F;  2XZU A;  2C9C A;  3M6A A;  4BBA A;  2XF3 A;  2C99 A;  4R71 A;  3V76 A;  2Y0Q A;  3SAU A;  1HNX M;  3QYE A;  1EIJ A;  4ITQ A;  2ERC A;  3GP1 A;  1YSY A;  1XXH E;  4M9Z A;  7CAT A;  2WZJ A;  1ZMW A;  1PJQ A;  4XGI A;  1GKI A;  3T6P A;  1QZM A;  3QAU A;  3W68 A;  4B08 A;  1R4G A;  3LVV A;  4CIZ A;  1QAM A;  3GRR A;  4MGZ E;  3GQ4 A;  3FYD A;  2FH0 A;  5FTK A;  1HJP A;  1XXH A;  4FCW A;  3KS4 A;  1Y8G A;  2YR0 A;  5EXX A;  3L27 A;  1WR1 B;  1PJJ A;  2QCU A;  2JZ0 A;  4DR5 M;  3I04 M;  2L09 A;  1QUS A;  4Z8X A;  4L8R C;  4LGM A;  3MHV C;  3VLF B;  1VEJ A;  2ZAN A;  4PCZ A;  2FNA A;  5JI3 E;  4DV1 M;  3AL0 C;  2M5Z A;  3F92 A;  5KPR A;  4JI4 M;  4KT0 F;  2JZ1 A;  2C9O A;  2NQ8 C;  3JR4 A;  1DGH B;  1G59 A;  2L4F A;  1GLN A;  1WGL A;  2EKF A;  2LHC A;  5EP4 A;  5FTN A;  2BWE A;  4L78 A;  5KQ8 A;  1L2D A;  3ILK A;  3HHY A;  2ZBK B;  1QDR A;  5EXS A;  3E9S A;  4FW9 A;  2DWM A;  2OO9 A;  2XH9 A;  4FD2 A;  2L7I A;  5IRE B;  1R6B X;  1NV8 A;  3B7Q A;  1J7K A;  3HJQ A;  3FYC A;  2EUC A;  4F2L A;  4IJF A;  1Q02 A;  2XGN A;  3FE3 A;  1V34 A;  1V33 A;  5EP2 A;  1I94 M;  1IY2 A;  4DUZ M;  1ZMU A;  3KSX A;  2F5S A;  3FUV A;  1OIP A;  4G3O A;  2DAK A;  3VFD A;  1VEK A;  2VQF M;  1OQY A;  2ZM6 M;  1SXJ A;  2KNV A;  2KRU A;  5DYI A;  1L2C A;  3AV0 A;  2VQE M;  3A98 B;  2P5T A;  1Q3B A;  2EKK A;  3PNY A;  2X49 A;  4KO8 A;  2B3T A;  3VDP A;  3FRH A;  3ZC7 B;  1FJG M;  4D82 A;  4GMQ A;  4NOO B;  3W67 A;  4LJ7 A;  2QBY A;  3HKP A;  4F1I A;  4ANR A;  4NC6 A;  4IBE A;  2HL7 A;  4EIW A;  5C18 A;  4LG2 A;  3U6S A;  2BJV A;  1T3T A;  2CFO A;  4MB7 A;  2DZL A;  5EXP A;  3KXE C;  4DBG B;  3C3D A;  3BOS A;  2RKO A;  3A42 A;  5GKN A;  4G4Q A;  1K82 A;  2CE7 A;  1NY5 A;  4LRS A;  4FCT A;  4GH9 A;  4JN6 A;  4RNA A;  2VII A;  4JI2 M;  1GJS A;  1IN5 A;  5FTL A;  4MH0 E;  5DFL A;  3L25 A;  5H37 D;  1S3S A;  4NXM M;  1JR3 A;  1PJI A;  2DXI A;  2DWL A;  5ITT A;  2E5L M;  1WIV A;  3HU3 A;  1DGG A;  4AZF A;  1GAB A;  1TTE A;  3U5Z A;  3VK8 A;  1DV0 A;  1OTR A;  3GLG A;  2JUJ A;  1GVN A;  4QOZ C;  3H4M A;  4GHL A;  5C1B A;  2QQ8 A;  4LJ9 A;  4AKG A;  3A45 A;  4AG6 A;  3D8B A;  1ZAE A;  4GEW A;  2APL A;  3B7Z A;  1YE9 A;  1NSF A;  3FUT A;  3U6Q A;  4LFA M;  3GLG B;  3Q8X A;  4B7F A;  4LJ4 A;  1CUK A;  1IM2 A;  1QZE A;  4LJ8 A;  3SC3 A;  1PRB A;  3B9P A;  4JI0 M;  4QHS A;  3K92 A;  2UUC M;  3J81 S;  4LJ5 A;  1TR8 A;  2QZ4 A;  1QAN A;  4KLN A;  1XMQ M;  1ZV1 A;  2KEB A;  1DGB A;  1NJF A;  3IEC A;  4AKH A;  3J27 B;  1KYI A;  3UJN A;  3CF0 A;  5IWA M;  2LHG A;  4CGY B;  4I8O A;  2C5R A;  1SXJ B;  5L8R F;  3KDS E;  3IG5 A;  3C58 A;  5EQT A;  3GLF E;  3TPZ A;  1TDH A;  2Z4S A;  2H1R A;  2X8A A;  1IY1 A;  2JWS A;  3GRV A;  2LVQ D;  1QQW A;  5LMN M;  2DI0 A;  3IG8 A;  2HWJ A;  4DR4 M;  2KZU A;  1SXJ D;  4S12 A;  4AKI A;  2UXB M;  2DEN A;  2CV2 A;  3U6M A;  2R62 A;  2M60 A;  2L6O A;  4DR6 M;  3AFH A;  2F5Q A;  4DV6 M;  2MRO B;  1RU3 A;  4L4U A;  2G5G X;  3SAV A;  3J7B A;  1IFY A;  2WSF F;  1HR0 M;  4M9X A;  4LFC M;  3GRY A;  1XC8 A;  3CF6 E;  4QHT A;  1NHG C;  4Q7J A;  1N34 M;  2JP7 A;  1IXS B;  3SAR A;  2BNK A;  4WP2 A;  1WJ7 A;  1E94 E;  1PJS A;  4AQY M;  5BPV A;  4JI8 M;  1XHB A;  3GLG E;  3DOA A;  3HHX A;  2LVO C;  5JI2 E;  3U6L A;  5FTM A;  1L1Z A;  3U6E A;  2RGH A;  2R4E A;  3QWL A;  4HEO A;  2DZO B;  2BJW A;  4DV7 M;  3U60 A;  4QNM A;  4LF5 M;  4LFB M;  1NV9 A;  3E4R A;  3RGS A;  1OJL A;  2KXE A;  2LH0 A;  3KP0 E;  2Z7J A;  3TWK A;  4GKK M;  2VDB B;  2J7O A;  3B74 A;  1W5T A;  4IBB A;  5ITR A;  4X65 M;  2DKL A;  3AOE C;  1R7R A;  4QOS A;  3GPY A;  1G3I A;  3AOG A;  4NL4 H;  5IT9 S;  4IBD A;  1HQC A;  2F5P A;  2LVN C;  2Y0T A;  1R2Y A;  1R2Z A;  4I81 A;  3KP1 E;  2FFJ A;  3LQQ A;  4GHA A;  3FUU A;  5ITX E;  3KS8 A;  2L2D A;  4II7 A;  2LWX A;  4JI7 M;  4AI6 A;  4XK8 F;  3U61 B;  1TGU A;  2CEA A;  3SAW A;  1W5S A;  1VG5 A;  3TWL A;  1GJT A;  4OW0 A;  1A5T A;  4HLQ A;  1IBL M;  1N77 A;  3L28 A;  2LVA A;  3E21 A;  2EA0 A;  1IN6 A;  3I4Y A;  1EE8 A;  1Z5C A;  2CP8 A;  4A3V B;  3SHF A;  4Z6Y A;  1XNR M;  3U6O A;  1PM5 A;  1F4I A;  1TH2 A;  5EJC A;  3L26 A;  3TE6 A;  3SAT A;  4R3D A;  2HAK A;  1V92 A;  2F5N A;  3GPP A;  3NWL A;  4NRW A;  2Y20 A;  3HU1 A;  4GKJ M;  1G8P A;  2L7H A;  2R45 A;  4DR7 M;  1IQP A;  5IZ7 D;  3L29 A;  3NBX X;  1HT2 E;  2LBC A;  4D80 A;  2I7P A;  2C96 A;  2Z8Y M;  2XFT A;  2YQZ A;  1NNJ A;  1XWI A;  4FWD A;  3WHL A;  3AOE A;  2EJS A;  1JR3 D;  1E32 A;  4MM3 B;  4WW0 A;  4JXJ A;  3DA1 A;  4JI1 M;  2G3Q A;  3GLI E;  1G71 A;  3GLH E;  2UXC M;  5EP3 A;  1HQY E;  3SYL A;  2LTU A;  3K8Z A;  2I7N A;  2XZF A;  1GO5 A;  1HT1 E;  3KSJ A;  1NJG A;  1LV7 A;  2C98 A;  2W82 A;  1AUA A;  1Q39 A;  2F4V M;  3GPX A;  3EIE A;  2Z4R A;  1HNZ M;  2DWN A;  2ZAM A;  2QP9 X;  4IJE A;  4NRV A;  4ZPX A;  3HX3 A;  3SBJ A;  3IHP A;  1MU5 A;  4L16 A;  2O25 A;  3C3E A;  3U6D A;  1P3Q Q;  1YLA A;  2KA6 B;  3KOY E;  1J09 A;  3KW6 A;  2JY7 A;  4PT5 A;  4AW4 A;  4PDI A;  1N32 M;  3SMP A;  2OQ4 A;  3HJ8 A;  1DO2 A;  3K2L A;  5EP1 A;  3GQ5 A;  4DV3 M;  3T38 A;  4B3T M;  3CF2 A;  2CV0 A;  1KSF X;  1OAI A;  1Z6T A;  2R46 A;  3HWS A;  4FWG A;  4IIW A;  3J80 S;  5KO3 A;  1SXJ E;  4FCV A;  1SG9 A;  1IXR C;  4YY3 M;  4LJA A;  4LF9 M;  2JA2 A;  4GRI A;  3MMP A;  5E26 A;  3I4V A;  4FWH A;  4DV0 M;  2V1C A;  4G6Z A;  1T43 A;  5ITX A;  4IBC A;  2XSZ A;  1HNW M;  3I01 M;  1Z59 A;  2HHH M;  4LRT A;  3FTF A;  3FKE A;  1VDL A;  2XSZ D;  4K0K M;  5A2Q S;  1QUT A;  1D0K A;  3T1H M;  3T1Y M;  5EXT A;  1VQ1 A;  2JY6 B;  2ZTC A;  4MGK E;  2GQF A;  1E9S A;  4PDG A;  4NSR A;  1I4W A;  1N75 A;  4GC9 A;  4WUR A;  2KW0 A;  3D8L A;  5ITU A;  4X66 M;  3GPU A;  2DHR A;  2QPA A;  5KPT A;  2CV1 A;  2KRK A;  1LTM A;  2QHO B;  3R9X B;  2L4E A;  3BBZ A;  4DV5 M;  1EFU B;  1GL7 A;  3PVS A;  1WHC A;  2MR9 A;  3TL4 X;  3DFZ A;  2DNA A;  3GQ3 A;  1ORY B;  3GRU A;  2DWZ B;  4L15 A;  1WGN A;  3UMM A;  4IBI A;  4JI6 M;  3KFU G;  1Q3C A;  1N36 M;  4KHP M;  4JYA M;  1L1T A;  3SAS A;  3AKZ A;  2MH8 A;  2QNJ A;  1ZMV A;  1UFZ A;  1PGY A;  3UZU A;  3HHZ A;  4I5S A;  4TUW A;  2JXN A;  2K0B X;  4KOD A;  3HJS A;  2O5R A;  2KNZ A;  2OOB A;  2J5Y A;  1IBK M;  4RF1 A;  1DGH A; 
#chains in the Genus database with same CATH homology
 1XMO M;  2DZN B;  3MJ5 A;  1JQJ C;  1H6U A;  3PFI A;  2RGO A;  3GLF A;  5ITY A;  4BB9 A;  1TH3 A;  2YFQ A;  4DR3 M;  3M0E A;  4OU7 A;  1XNQ M;  3WHK A;  4FVM A;  3UK6 A;  3TWM A;  3ZH9 B;  3VKH A;  3VKG A;  3SYK A;  1E9R A;  1YUB A;  4B7G A;  1Z5B A;  4DV2 M;  4B3R M;  4IBG A;  2DVW B;  4P16 A;  4B3M M;  3EIH A;  4DR1 M;  3KVW A;  3OTO M;  2QBY B;  1ZQ9 A;  5FLX S;  4BLC A;  4QNR A;  4OVZ B;  2D7E A;  2UXD M;  2R65 A;  3RFW A;  4LF8 M;  4GIT A;  3UGJ A;  3K1J A;  5FSW A;  1TH4 A;  3U60 B;  2EO2 A;  4OVZ A;  3GO8 A;  2OPF A;  4CHT B;  1OFI A;  3LVW A;  1VDD A;  4DV4 M;  5LMU M;  4M9S A;  1QAQ A;  3VDU A;  4REZ A;  4JV5 M;  3AJI B;  4DUY M;  1QAO A;  4G4O A;  5KQD A;  5KPZ A;  1K3W A;  1C1K A;  2UUB M;  3SMS A;  1UM8 A;  4HL4 A;  4X62 M;  1SXJ C;  2R18 A;  3U5Z B;  4XBO A;  4DR2 M;  5DYG A;  4LZJ A;  5BR8 M;  3W0L B;  3FUX A;  1DO0 A;  3JR5 A;  3MK6 A;  1IN7 A;  3T15 A;  3KOX E;  3VK7 A;  4LGY A;  4PD2 A;  3I51 A;  2QEN A;  3U61 A;  2XLJ A;  4CIS A;  1J5E M;  4LF4 M;  1IN4 A;  3HHW A;  3FTC A;  1FNN A;  1N33 M;  4M0W A;  2Z3X A;  4OX9 M;  3KOW E;  4M0D A;  4GC5 A;  4JI3 M;  4I4L A;  1L8Q A;  3M7G A;  2XEP A;  4LF7 M;  3FUW A;  4GIP A;  2X4A A;  2ZAO A;  3U6C A;  2CUZ A;  2CHQ A;  4LF6 M;  1NNU C;  4W5W A;  3GLI A;  1WXQ A;  1X37 A;  3KOZ E;  2KZS A;  4YHH M;  4B7H A;  2F5O A;  3HGI A;  2LNH C;  1TDZ A;  4X64 M;  2V6Z M;  2K47 A;  1GL6 A;  5ITQ A;  4LJ6 A;  4IBJ A;  3U6P A;  3PXG A;  1QVR A;  2FE8 A;  2G8L A;  4AG5 A;  4G4N A;  2UU9 M;  5F3W A;  4RF0 A;  4MGI E;  2R4J A;  1XXH B;  4LCB A;  1IN8 A;  1IBM M;  3GLI B;  1MX0 A;  4LZZ A;  3A46 A;  1OFH A;  2V1U A;  3JAM S;  2FOI C;  3HU2 A;  3ZCB B;  8CAT A;  2XFS A;  2HCB A;  3THG A;  2CHG A;  3LQR A;  2UUA M;  2LXE A;  3CTW B;  3GLF B;  3FD9 A;  3J2P B;  4IBF A;  1Z5A A;  5FTJ A;  3RGP A;  4LY6 A;  2Y21 A;  3TQS A;  1IXZ A;  2D7H A;  3L2A A;  4NSO B;  1G4A E;  1NVM A;  2J7N A;  1D2N A;  4R7G A;  2D7G A;  4G4R A;  1G41 A;  5E6J A;  4MGH A;  3RE8 A;  3NBI A;  3GLH B;  2Q2E B;  2AHM A;  3SHG B;  4JI5 M;  1L2B A;  4IBK A;  2HKJ A;  3J7A S;  4B3S M;  1K3X A;  1NHW C;  5DNY A;  2A5Y B;  1IY0 A;  2CHV A;  2YNM D;  3FTD A;  1N78 A;  3GLH A;  3LMM A;  4NXN M;  4MGY E;  3FTE A;  1NY6 A;  1QYR A;  3PNV A;  3W0F A;  4D81 A;  3DZD A;  1KFV A;  1DGF A;  3SFZ A;  3R8F A;  2XZU A;  2C9C A;  3M6A A;  4BBA A;  2XF3 A;  2C99 A;  2Y0Q A;  3SAU A;  1HNX M;  4ITQ A;  2ERC A;  3GP1 A;  1YSY A;  4M9Z A;  7CAT A;  4XGI A;  1GKI A;  1QZM A;  3QAU A;  4B08 A;  3LVV A;  1QAM A;  3GRR A;  4MGZ E;  3GQ4 A;  3FYD A;  5FTK A;  1XXH A;  4FCW A;  3KS4 A;  2YR0 A;  5EXX A;  3L27 A;  1PJJ A;  2QCU A;  4DR5 M;  2L09 A;  4L8R C;  4Z8X A;  4LGM A;  3MHV C;  3VLF B;  2ZAN A;  4PCZ A;  4DV1 M;  2FNA A;  5JI3 E;  3AL0 C;  2M5Z A;  5KPR A;  4JI4 M;  2C9O A;  2NQ8 C;  3JR4 A;  1DGH B;  1G59 A;  1GLN A;  5FTN A;  5EP4 A;  4L78 A;  1L2D A;  5KQ8 A;  3ILK A;  3HHY A;  2ZBK B;  5EXS A;  2DWM A;  3E9S A;  4FW9 A;  4FD2 A;  2XH9 A;  2L7I A;  5IRE B;  1R6B X;  1J7K A;  3HJQ A;  3FYC A;  2EUC A;  4IJF A;  2XGN A;  5EP2 A;  1I94 M;  1IY2 A;  4DUZ M;  2F5S A;  3KSX A;  3FUV A;  3VFD A;  2VQF M;  2ZM6 M;  1SXJ A;  2KRU A;  5DYI A;  1L2C A;  3AV0 A;  2VQE M;  3A98 B;  2P5T A;  1Q3B A;  3PNY A;  2X49 A;  4KO8 A;  3VDP A;  3ZC7 B;  1FJG M;  4D82 A;  4GMQ A;  4NOO B;  4LJ7 A;  2QBY A;  3HKP A;  5C18 A;  4IBE A;  2HL7 A;  4EIW A;  4LG2 A;  3U6S A;  2BJV A;  1T3T A;  2CFO A;  4MB7 A;  5EXP A;  3KXE C;  3BOS A;  2RKO A;  3A42 A;  5GKN A;  4G4Q A;  1K82 A;  2CE7 A;  1NY5 A;  4LRS A;  4FCT A;  4GH9 A;  4JN6 A;  4RNA A;  2VII A;  4JI2 M;  1IN5 A;  5FTL A;  4MH0 E;  3L25 A;  5H37 D;  1S3S A;  4NXM M;  1JR3 A;  1PJI A;  2DXI A;  2DWL A;  5ITT A;  2E5L M;  3HU3 A;  1DGG A;  4AZF A;  3U5Z A;  3VK8 A;  3GLG A;  4QOZ C;  1GVN A;  3H4M A;  4GHL A;  5C1B A;  4LJ9 A;  4AKG A;  3A45 A;  4AG6 A;  3D8B A;  1ZAE A;  3FUT A;  3U6Q A;  1YE9 A;  1NSF A;  4LFA M;  3GLG B;  3Q8X A;  4B7F A;  4LJ4 A;  1IM2 A;  4LJ8 A;  3SC3 A;  3B9P A;  4JI0 M;  4QHS A;  3K92 A;  2UUC M;  3J81 S;  4LJ5 A;  2QZ4 A;  1QAN A;  4KLN A;  1XMQ M;  2KEB A;  1DGB A;  1NJF A;  4AKH A;  3J27 B;  1KYI A;  3UJN A;  3CF0 A;  5IWA M;  4CGY B;  4I8O A;  2C5R A;  1SXJ B;  3KDS E;  3IG5 A;  3C58 A;  5EQT A;  3TPZ A;  1TDH A;  2Z4S A;  2H1R A;  2X8A A;  1IY1 A;  3GRV A;  1QQW A;  5LMN M;  3IG8 A;  4DR4 M;  2KZU A;  1SXJ D;  4S12 A;  4AKI A;  2UXB M;  2CV2 A;  3U6M A;  2R62 A;  2M60 A;  2L6O A;  4DR6 M;  3AFH A;  2F5Q A;  4DV6 M;  4L4U A;  2G5G X;  3SAV A;  3J7B A;  1HR0 M;  4M9X A;  4LFC M;  3GRY A;  1XC8 A;  3CF6 E;  4QHT A;  1NHG C;  3SAR A;  1N34 M;  1IXS B;  2BNK A;  1E94 E;  4AQY M;  5BPV A;  4JI8 M;  1XHB A;  3DOA A;  3HHX A;  5JI2 E;  3U6L A;  5FTM A;  1L1Z A;  3U6E A;  2RGH A;  2R4E A;  3QWL A;  3U60 A;  2DZO B;  2BJW A;  4DV7 M;  4LF5 M;  4QNM A;  4LFB M;  3E4R A;  3RGS A;  1OJL A;  2KXE A;  2LH0 A;  3KP0 E;  2Z7J A;  3TWK A;  4GKK M;  2J7O A;  1W5T A;  4IBB A;  5ITR A;  4X65 M;  3AOE C;  1R7R A;  4QOS A;  3GPY A;  1G3I A;  3AOG A;  4NL4 H;  5IT9 S;  4IBD A;  1HQC A;  2F5P A;  2Y0T A;  1R2Y A;  1R2Z A;  4I81 A;  3KP1 E;  2FFJ A;  3LQQ A;  4GHA A;  3FUU A;  5ITX E;  3KS8 A;  4II7 A;  2LWX A;  4JI7 M;  4AI6 A;  3U61 B;  1TGU A;  2CEA A;  3SAW A;  1W5S A;  3TWL A;  4OW0 A;  4HLQ A;  1IBL M;  1N77 A;  3L28 A;  2EA0 A;  1IN6 A;  3I4Y A;  1EE8 A;  1Z5C A;  4A3V B;  3SHF A;  4Z6Y A;  1XNR M;  3U6O A;  1PM5 A;  1TH2 A;  5EJC A;  3L26 A;  3TE6 A;  3SAT A;  4R3D A;  2F5N A;  3GPP A;  3NWL A;  4NRW A;  2Y20 A;  3HU1 A;  4GKJ M;  1G8P A;  2L7H A;  2R45 A;  4DR7 M;  1IQP A;  5IZ7 D;  3L29 A;  1HT2 E;  4D80 A;  2I7P A;  2C96 A;  2XFT A;  2YQZ A;  1NNJ A;  1XWI A;  4FWD A;  3WHL A;  3AOE A;  1JR3 D;  1E32 A;  4MM3 B;  4WW0 A;  4JXJ A;  3DA1 A;  4JI1 M;  2UXC M;  5EP3 A;  1HQY E;  3SYL A;  3K8Z A;  2I7N A;  2XZF A;  1HT1 E;  3KSJ A;  1NJG A;  1LV7 A;  2C98 A;  2W82 A;  1Q39 A;  2F4V M;  3GPX A;  3EIE A;  2Z4R A;  1HNZ M;  2DWN A;  2ZAM A;  2QP9 X;  4IJE A;  4NRV A;  4ZPX A;  3SBJ A;  1MU5 A;  4L16 A;  3U6D A;  3KOY E;  2KA6 B;  3KW6 A;  1J09 A;  1N32 M;  4PT5 A;  4AW4 A;  4PDI A;  3SMP A;  2OQ4 A;  3HJ8 A;  1DO2 A;  3K2L A;  5EP1 A;  3GQ5 A;  4DV3 M;  3T38 A;  4B3T M;  3CF2 A;  2CV0 A;  1KSF X;  1Z6T A;  2R46 A;  3HWS A;  4FWG A;  4IIW A;  3J80 S;  5KO3 A;  1SXJ E;  4FCV A;  1IXR C;  4YY3 M;  4LJA A;  4LF9 M;  2JA2 A;  4GRI A;  5E26 A;  3I4V A;  4FWH A;  4DV0 M;  2V1C A;  4G6Z A;  5ITX A;  4IBC A;  2XSZ A;  1HNW M;  1Z59 A;  2HHH M;  4LRT A;  3FTF A;  3FKE A;  2XSZ D;  4K0K M;  5A2Q S;  3T1Y M;  3T1H M;  5EXT A;  4MGK E;  1E9S A;  4PDG A;  4NSR A;  1I4W A;  1N75 A;  4GC9 A;  4WUR A;  2KW0 A;  3D8L A;  5ITU A;  4X66 M;  3GPU A;  2DHR A;  2QPA A;  5KPT A;  2CV1 A;  2KRK A;  3R9X B;  4DV5 M;  1GL7 A;  3PVS A;  3TL4 X;  3DFZ A;  3GQ3 A;  1ORY B;  3GRU A;  2DWZ B;  4L15 A;  3UMM A;  4IBI A;  4JI6 M;  3KFU G;  1Q3C A;  1N36 M;  4KHP M;  4JYA M;  1L1T A;  3SAS A;  3AKZ A;  3UZU A;  3HHZ A;  4I5S A;  4TUW A;  4KOD A;  3HJS A;  2O5R A;  1IBK M;  4RF1 A;  1DGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...