1K3XA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with brominated-dna
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
253
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords 5'-D(*GP*GP*CP*(BRU)P*(BRU)P*CP*AP*(BRU)P*CP*CP*(BRU)P*GP*G)
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 253
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3xA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3xA01
1R2ZA 3SARA 4LF6M 2F5OA 4LF9M 1L2BA 4X66M 5ITUA 3SASA 3U6QA 5ITTA 3GPPA 1K3XA 2UUAM 5ITXE 4B3MM 1XNRM 3VK8A 5BR8M 3GPXA 2E5LM 3U6MA 1IBMM 4CISA 2OQ4A 5LMNM 1Z5AA 1R2YA 1KFVA 4X62M 5A2QS 1J5EM 3JR5A 5FLXS 3T1YM 4X64M 1MU5A 1N34M 2UU9M 3TWKA 1Q3BA 4JV5M 2EA0A 4LFBM 4OX9M 4LFCM 4GKJM 1MX0A 1N36M 3SATA 3U6DA 4PCZA 4LF7M 3C58A 1XMOM 4LF4M 4G4RA 4NXNM 1HNZM 4DV5M 4MB7A 1XC8A 4B3TM 4DR7M 3SAWA 2UUCM 5IT9S 1XNQM 3W0FA 4LFAM 4DV0M 1NNJA 3A45A 4JI0M 2UXCM 1TDZA 4AQYM 4YHHM 3U6SA 1L2DA 3TWMA 1FJGM 2ZBKB 4KHPM 3OTOM 3GQ4A 1N32M 4G4QA 1K82A 4DR1M 4JI2M 2F4VM 2ZM6M 3SAUA 4LF8M 2UUBM 1XMQM 4NRVA 4DR5M 4NXMM 4DR3M 4JI1M 4DV6M 1I94M 5ITXA 2HHHM 4JYAM 2VQFM 4G4NA 4PDGA 3J7AS 4DR6M 5ITRA 1Z59A 3J81S 3J80S 1Q39A 4DR2M 4YY3M 4LF5M 5ITQA 1L1TA 2XZFA 1L2CA 2VQEM 2OPFA 3U6LA 1Z5BA 1K3WA 2HKJA 3GPYA 3JR4A 3A46A 4K0KM 4DV1M 1PJJA 3U6PA 3DOAA 2XZUA 4DUZM 3GO8A 3GPUA 3A42A 2F5NA 3U6EA 1N33M 1HR0M 2UXBM 4JI4M 4B3RM 4X65M 1IBKM 4JI8M 4GKKM 5ITYA 3GQ3A 4JI6M 3JAMS 4G4OA 1Z5CA 3U6CA 4PD2A 2F5SA 4DV3M 4B3SM 2UXDM 3TWLA 4DV7M 3T1HM 4JI3M 1PJIA 1TDHA 3VK7A 3GP1A 4DUYM 4PDIA 4DR4M 1HNXM 4JI5M 5LMUM 3SAVA 1Q3CA 4ITQA 1EE8A 5IWAM 3GQ5A 1HNWM 3U6OA 2F5QA 4NRWA 3SBJA 2Q2EB 1L1ZA 4DV4M 4JI7M 1IBLM 4DV2M 1PM5A 2F5PA
chains in the Genus database with same CATH superfamily
3B7NA 3SARA 4MM3B 4AG5A 2KA6B 3TL4X 2DZLA 1PJTA 1XXHB 3KP0E 2DZOB 4X66M 5ITUA 3SASA 4KO8A 1SXJC 2C98A 2LVAA 2UUAM 1KSFX 3VK8A 2LVNC 4AKIA 1SXJD 5LMNM 2DAGA 2JY7A 1L8QA 3KDSE 4EIWA 2R65A 3QYBA 2HL7A 4GIPA 1DGBA 3LVWA 3KOYE 4GITA 3JR5A 1OTRA 4M0WA 2XGNA 3TWKA 1Q3BA 2CFOA 2EA0A 3FUUA 4LFBM 4LG2A 4ZPXA 1TH2A 3VLFB 4GKJM 2O25A 1MX0A 2DENA 2L2DA 1N36M 2CEAA 2VIIA 4PCZA 4QNMA 2G8LA 1XMOM 3U60B 1Q02A 2LVOC 1OFIA 1HNZM 1QUTA 2KHHA 1WR1B 3KOWE 3FTFA 1JR3A 2EUCA 2UUCM 5FSWA 3W0FA 1NNJA 2JY6B 2P5TA 2RKOA 3EIEA 1QANA 3FRHA 2KNZA 1ZAEA 1HJPA 3FD9A 4MGYE 3KS8A 2YQZA 4AKHA 1E94E 1PJQA 3BOSA 3U6SA 4QHSA 3KW6A 4AKGA 4FVMA 3GQ4A 3ZH9B 3HGIA 4G4QA 1K82A 3HU3A 1OAIA 2JZ0A 1W5SA 2APLA 2XH9A 3HHXA 5EXTA 3PNVA 4AZFA 5C18A 2ZM6M 3SAUA 1XMQM 2F4VM 1PJSA 4CIZA 4DR5M 2QBYA 1ZQ9A 3U61B 2VQFM 1ZV1A 5EP1A 1WHCA 2FFJA 2BJVA 3J7AS 4DR6M 1J09A 2YR0A 1Z59A 3GRYA 5DFLA 1DO2A 2DNAA 4LRTA 2FNAA 5KO3A 2CV2A 3IG5A 1QZMA 3FTDA 1J7KA 1QZEA 3E46A 3JR4A 4XGIA 2L4FA 4DV1M 3WHKA 3DOAA 1C1KA 1XB2B 5DYGA 2NQ8C 4DUZM 4Y28F 1D0KA 3PVSA 3A42A 3U6EA 1N33M 1R6BX 4XBOA 3L27A 4HEOA 4JI8M 1IBKM 3AV0A 1GO5A 2MH8A 4GEWA 3GQ3A 2R4JA 4PD2A 2F5SA 1IXSA 3SHFA 3GLIE 1AUAA 4D80A 2MJ5B 2X8AA 4JI3M 1EFUB 1PGYA 1NY6A 3K1JA 4FCTA 1PJIA 2BJWA 3AJIB 4IBKA 4DR4M 1P3QQ 3B89A 4IJFA 3RFWA 5FTNA 2QQ8A 4ITQA 3KS4A 1EE8A 3L29A 5IWAM 4JN6A 3FYCA 3AOGA 2DAKA 2Q2EB 2Y0QA 1ZMVA 3E4RA 2FOIC 3HHYA 4DV2M 1GL6A 3H4MA 2F5PA 3HJ8A 4TUWA 3FTCA 1CUKA 3IHPA 1DV0A 1IY1A 4LF9M 2O5RA 2JA2A 2ZANA 4LY6A 1L2BA 3J7BA 2Z3XA 1QDRA 4IBIA 3HJSA 4G6ZA 2DI0A 5E26A 2HAKA 3MMPA 5ITTA 4FWHA 4IBDA 4NSOB 3KXEC 1TR8A 3HU1A 4B3MM 1XNRM 3LMMA 5BR8M 3GPXA 1E9RA 4L6V6 3U6MA 2XSZD 2OQ4A 1IBMM 1Z5AA 2CHGA 3NBIA 4X62M 4KODA 2EKKA 1GJTA 4IJEA 1SXJB 4M0DA 2OO9A 3C3EA 3K9OA 1LTMA 2ZTCA 7CATA 4F1IA 1V33A 2D7HA 3KSJA 3MJ5A 4L15A 2Z4RA 3T1YM 1RU3A 4QNRA 3KOXE 2BNKA 4X64M 3A98B 3GLIA 2UU9M 3R8FA 2JNHA 4OX9M 1NHWC 1G3IA 1UFZA 1NO1A 5C1BA 2R4EA 1VEGA 3HHWA 3U5ZA 3SATA 4DBGB 4LF7M 2A5YB 2J7OA 5JI2E 1IFYA 3C58A 4P16A 4WURA 3GRUA 5EP3A 2BWEA 2EKFA 3E21A 3SAWA 2CUZA 1IXSB 1NY5A 4D82A 3T38A 3A45A 2UXCM 2O01F 3W0LB 1R5LA 1L2DA 4RF0A 4I5SA 3FYDA 3IG8A 3GLHE 3OTOM 3TWMA 2H5XA 2DZNB 4KHPM 2R0IA 4JI2M 2DAMA 2QSFX 4GMQA 4LF8M 2HWJA 2C9CA 3L2AA 2VDBB 4NRVA 1WXQA 3KOZE 4NXMM 2LWXA 1XHBA 1I94M 3HX3A 1OJLA 3MHVC 2HHHM 1TH3A 1YSYA 3D8LA 1X37A 2DHRA 2I7NA 4MGKE 1TF0B 4NL4H 5EP4A 3I01M 3ILKA 3J80S 4DR2M 1IY0A 4LF5M 2LXEA 2CWBA 2D7EA 2QP9X 3KVWA 2MR9A 4FW9A 5FTJA 5L8RF 2OPFA 1QAQA 1OAOC 2QCUA 3U6LA 4I81A 3Q8XA 4K0KM 2ERCA 2XSZA 2I7PA 2FS1A 1PJJA 5H37D 3U6PA 2XZUA 5JI3E 3LCVB 2JZ1A 2VF8A 2XF3A 3B74A 3PNYA 1OIPA 4D81A 4GC9A 1HR0M 2UXBM 1WIVA 5DYIA 4PT5A 4JI4M 4B3RM 1N75A 5EXPA 1G41A 3UZUA 2YFQA 3U5ZB 3LW5F 4JI6M 1IM2A 2YNMD 4IIWA 3JAMS 4F2LA 4FCVA 3GLHA 3AFHA 2XLJA 2UXDM 3PXGA 3VDUA 4R3DA 2KNVA 3AOEC 2X49A 4CGYB 3R9XB 1EIJA 1DGHA 1XXHE 1OIZA 1HNXM 2L4EA 5LMUM 1G8PA 1UM8A 5KQ8A 4MGHA 3SYKA 4GH9A 1IN4A 4LGYA 3AKZA 4LJ4A 1HNWM 1MN3A 5FTMA 3U6OA 2KEBA 1VQ1A 5BPVA 1NSFA 4I8OA 4HL4A 3FUWA 1L1ZA 3BXWA 5GKNA 4DV4M 2WSFF 1PM5A 3GRVA 5KPTA 1VDLA 1R2ZA 1MJGM 1PRBA 3SC3A 4BLCA 4LF6M 2F5OA 2XFTA 2C9OA 1VG5A 2H1RA 3THGA 3T15A 1TH4A 3U6QA 3VKGA 3GPPA 1GVNA 4FWGA 4RF1A 5DNYA 2DWMA 5ITXE 2LNHC 3GLGE 2C99A 2MGWA 3SYLA 8CATA 3HHZA 1TTEA 4OVZA 2V1CA 2CE7A 5E6JA 2KW0A 3VDPA 2Z4SA 1JQJC 4LGMA 5FLXS 2QENA 1IXZA 1VEKA 1MU5A 1YLAA 1N34M 4R7GA 2QHOB 4I4LA 4JV5M 1T43A 1S3SA 2FH0A 2X4AA 4LJ8A 4LFCM 5EJCA 3TQSA 1D0MA 3KSXA 2QBYB 1XXHA 3K8ZA 3C3DA 1F4IA 1DO0A 3RGSA 3QAUA 2DWNA 2QNJA 4NOOB 4G4RA 3FKEA 1XWIA 1QDTA 2V1UA 1YUBA 2KZUA 2M5ZA 3PFIA 3SMPA 3RGPA 4LJ7A 4B3TM 5IT9S 2Y21A 1XNQM 4LFAM 2N35A 4DV0M 3KFUG 4JI0M 2JUJA 3HU2A 2J7NA 1TDZA 1NNUC 4AG6A 4A3VB 3AOEA 4YHHM 4UN2B 1NV8A 4RNAA 2ZBKB 2DAEA 2OOBA 1G59A 2L7HA 2ZAMA 3UK6A 1N32M 4IBBA 1FNNA 2R6FA 3DA1A 4FWDA 4DR1M 4OU7A 1QYRA 3UJNA 4OW0A 2R45A 1E9SA 3BBZA 4G3OA 2CP8A 4DR3M 1H6UA 2KNAA 1WJ7A 2KRUA 4DV6M 5ITXA 3I4VA 4JYAM 4G4NA 1OFHA 3Q8GA 3E9SA 4LJ6A 4PDGA 4LZJA 3GLGA 3HWSA 3U60A 4GC5A 5ITRA 2BWBA 2CV0A 3NWLA 3J81S 4GHLA 2DWLA 1BVSA 1Q39A 2DHYA 3QWLA 1HQYE 4MGZE 3L28A 2K0BX 4GRIA 1V92A 4YY3M 2XZFA 2GNOA 4BB9A 3FUXA 1L1TA 1L2CA 3L25A 3CF6E 4IBGA 1E32A 4LJ5A 1R4GA 1Z5BA 2K9DA 2C96A 3GPYA 2KZSA 4GHAA 1QAOA 4L8RC 2JXNA 3AL0C 1ORYB 3CGWA 4B7GA 1IN8A 3FE3A 4M9SA 4ANRA 4CJ6A 5KQDA 2G5GX 4WP2A 3GO8A 3GPUA 2L09A 4MGIE 1TGUA 3J27B 4GKKM 1QVRA 1QQWA 5IREB 2R18A 2DAIA 5F3WA 2R62A 2ZAOA 4WW0A 1C7YA 1Z5CA 3SFZA 4REZA 2Z8YM 1NJFA 2LVPC 1HQCA 2RRUA 1N78A 3I4YA 1GLNA 3TWLA 4DV7M 1N77A 3K9PA 2JWSA 3GLFE 1TDHA 1QAMA 1IQPA 4DUYM 3CF2A 2DXIA 3HJQA 4JI5M 3LQQA 1Q3CA 2LBCA 3GQ5A 1G4AE 3B7ZA 5EXSA 1T3TA 2XEPA 3FRIA 4NRWA 1I4WA 3B7QA 1W5TA 3LQRA 4IBJA 4L78A 3SBJA 2CHVA 3EIHA 1IBLM 1SXJE 3GLIB 2LH0A 2QZ4A 4LCBA 3FTEA 4P17A 3GLGB 1D2NA 4B7HA 3RE8A 3IECA 1WGNA 3CF0A 2G3QA 2JY8A 4Q7JA 3ZCBB 2C5RA 1HT1E 4MH0E 1WGLA 2CRUA 4KLNA 4S12A 1K3XA 3HKPA 1KYIA 1YE9A 2XFSA 3FUVA 3CTWB 4AW4A 2E5LM 4CISA 3K92A 2WSCF 1R2YA 1LV7A 1SG9A 2LTUA 3FUTA 5A2QS 1J5EM 1KFVA 3SMSA 1NJGA 4HLQA 1V34A 3V76A 1JB0F 3M0EA 2CV1A 5EXXA 2JP7A 4XK8F 5KPRA 1AIPC 4QOZC 4BBAA 4NC6A 3GLFA 3W68A 3HZJA 2VF7A 4M9XA 3DZDA 5EP2A 3U6DA 1IN6A 2M60A 4LF4M 3UMMA 3QYEA 4FD2A 4NXNM 4AI6A 4W5WA 4MB7A 3TPZA 4R71A 2V6ZM 5FTLA 4DV5M 1XC8A 4DR7M 5FTKA 2CHQA 4LRSA 3I51A 3C9PA 1NHGC 2LHGA 4B7FA 1SXJA 1IN7A 2DVWB 2LHCA 4JXJA 4AQYM 4M9ZA 4B08A 1FJGM 5IZ7D 2K47A 3J2PB 1R7RA 2OOAA 3D8BA 3I04M 2Z7JA 2UUBM 2Y20A 1Y8GA 3SHGB 1OKSA 1Z6TA 2EJSA 4JI1M 2L7IA 3GRRA 1DGGA 4LJAA 1GABA 3TE6A 1GJSA 2RGOA 1IXRC 2HCBA 1NV9A 2KDLA 4CHTB 3HY5A 3DFZA 1QUSA 2EO2A 3ZC7B 2GQFA 4KT0F 5ITQA 4FCWA 2VQEM 4L16A 3GLHB 4Z6YA 2Y0TA 2B3TA 3UGJA 2L6OA 3MK6A 1OQYA 1K3WA 2HKJA 4II7A 4LJ9A 2K6BA 1NVMA 2J5YA 2MROB 4QOSA 3A46A 5KPZA 1DGHB 3M6AA 4RKUF 3H4JA 2ZTDA 2R46A 3M7GA 3T6PA 2F5NA 2QPAA 2W82A 4IBFA 3F92A 4IBEA 4IBCA 4X65M 3GLFB 1T6OA 3L26A 2RGHA 5ITYA 3NBXX 3LCUA 1VDDA 2AHMA 2KXEA 4G4OA 1DGFA 2LVQD 4Z8XA 3B9PA 3LVVA 2JY5A 1JR3D 3U6CA 4DV3M 4B3SM 1G71A 3VKHA 2DWZB 3ZQJA 3T1HM 3WHLA 1A5TA 4NSRA 4L4UA 2FE8A 1ZMUA 2WZJA 3VK7A 3GP1A 1D0LA 4PDIA 3KP1E 3SAVA 3VFDA 1GL7A 1ZMWA 2KRKA 2WSEF 4LZZA 2F5QA 4OVZB 1HT2E 1JR3E 1GKIA 1IY2A 1VEJA 5EQTA 2DKLA 4JI7M 1IN5A 3U61A 3W67A 2R44A 4QHTA 3K2LA 2D7GA
chains in the Genus database with same CATH topology
3SARA 4MM3B 4AG5A 2KA6B 3TL4X 1XXHB 3KP0E 2DZOB 4X66M 5ITUA 3SASA 4KO8A 1SXJC 2C98A 2UUAM 1KSFX 3VK8A 4AKIA 1SXJD 5LMNM 1L8QA 3KDSE 4EIWA 2R65A 2HL7A 4GIPA 1DGBA 3LVWA 3KOYE 4GITA 3JR5A 4M0WA 2XGNA 3TWKA 1Q3BA 2CFOA 2EA0A 3FUUA 4LFBM 4LG2A 4ZPXA 1TH2A 3VLFB 4GKJM 1MX0A 1N36M 2CEAA 2VIIA 4PCZA 4QNMA 2G8LA 1XMOM 3U60B 1OFIA 1HNZM 3KOWE 3FTFA 1JR3A 2EUCA 2UUCM 5FSWA 3W0FA 1NNJA 2P5TA 2RKOA 3EIEA 1QANA 1ZAEA 3KS8A 3FD9A 4MGYE 2YQZA 4AKHA 1E94E 3BOSA 3U6SA 4QHSA 3KW6A 4AKGA 4FVMA 3GQ4A 3ZH9B 3HGIA 4G4QA 1K82A 3HU3A 5EXTA 3HHXA 1W5SA 4AZFA 2XH9A 5C18A 2ZM6M 3PNVA 3SAUA 2F4VM 1XMQM 4DR5M 2QBYA 1ZQ9A 3U61B 2VQFM 5EP1A 2FFJA 2BJVA 3J7AS 4DR6M 1J09A 2YR0A 1Z59A 3GRYA 1DO2A 4LRTA 2FNAA 5KO3A 2CV2A 3IG5A 1QZMA 3FTDA 1J7KA 3JR4A 4XGIA 4DV1M 3WHKA 3DOAA 1C1KA 5DYGA 2NQ8C 4DUZM 3PVSA 3A42A 3U6EA 1N33M 1R6BX 4XBOA 3L27A 4JI8M 1IBKM 3AV0A 3GQ3A 2R4JA 4PD2A 2F5SA 3SHFA 4D80A 2X8AA 4JI3M 4FCTA 1NY6A 3K1JA 1PJIA 2BJWA 3AJIB 4IBKA 4DR4M 4IJFA 3RFWA 5FTNA 4ITQA 3KS4A 1EE8A 3L29A 5IWAM 4JN6A 3FYCA 3AOGA 2Q2EB 2Y0QA 3E4RA 2FOIC 3HHYA 4DV2M 1GL6A 3H4MA 2F5PA 3HJ8A 4TUWA 3FTCA 1IY1A 4LF9M 2O5RA 2JA2A 2ZANA 4LY6A 1L2BA 3J7BA 2Z3XA 4IBIA 3HJSA 4G6ZA 5E26A 5ITTA 4FWHA 4IBDA 4NSOB 3KXEC 3HU1A 4B3MM 1XNRM 3LMMA 5BR8M 3GPXA 1E9RA 3U6MA 1IBMM 2XSZD 2OQ4A 1Z5AA 2CHGA 3NBIA 4X62M 4KODA 4IJEA 1SXJB 4M0DA 7CATA 2D7HA 3KSJA 3MJ5A 4L15A 2Z4RA 3T1YM 4QNRA 4X64M 3KOXE 2BNKA 3A98B 3GLIA 2UU9M 3R8FA 4OX9M 1NHWC 1G3IA 5C1BA 2R4EA 3HHWA 3U5ZA 3SATA 4LF7M 2A5YB 2J7OA 5JI2E 3C58A 4P16A 4WURA 3GRUA 5EP3A 3SAWA 2CUZA 1IXSB 1NY5A 4D82A 3T38A 3A45A 2UXCM 3W0LB 1L2DA 4RF0A 4I5SA 3FYDA 3IG8A 3TWMA 3OTOM 4KHPM 2DZNB 4JI2M 4GMQA 4LF8M 3L2AA 2C9CA 4NRVA 1WXQA 3KOZE 4NXMM 1XHBA 2LWXA 1I94M 2HHHM 1OJLA 3MHVC 1TH3A 1YSYA 3D8LA 1X37A 2DHRA 2I7NA 4MGKE 5EP4A 4NL4H 3ILKA 3J80S 4DR2M 1IY0A 4LF5M 2LXEA 2D7EA 2QP9X 3KVWA 4FW9A 5FTJA 2OPFA 1QAQA 2QCUA 3U6LA 4I81A 3Q8XA 4K0KM 2ERCA 2XSZA 2I7PA 1PJJA 5H37D 3U6PA 2XZUA 5JI3E 2XF3A 3PNYA 4D81A 4GC9A 1HR0M 2UXBM 5DYIA 4PT5A 4JI4M 4B3RM 1N75A 5EXPA 1G41A 3UZUA 2YFQA 3U5ZB 4JI6M 1IM2A 2YNMD 4IIWA 3JAMS 4FCVA 3GLHA 3AFHA 2XLJA 2UXDM 3PXGA 3VDUA 4R3DA 3AOEC 2X49A 4CGYB 3R9XB 1DGHA 1HNXM 5LMUM 1G8PA 1UM8A 5KQ8A 4MGHA 3SYKA 4GH9A 1IN4A 4LGYA 3AKZA 4LJ4A 1HNWM 5FTMA 3U6OA 2KEBA 5BPVA 1NSFA 4I8OA 4HL4A 3FUWA 1L1ZA 5GKNA 4DV4M 1PM5A 3GRVA 5KPTA 1R2ZA 4LF6M 3SC3A 4BLCA 2F5OA 2XFTA 2C9OA 2H1RA 3THGA 3T15A 1TH4A 3U6QA 3VKGA 3GPPA 1GVNA 4FWGA 4RF1A 5DNYA 2DWMA 5ITXE 2LNHC 2C99A 3SYLA 8CATA 3HHZA 4OVZA 2V1CA 2CE7A 5E6JA 2KW0A 3VDPA 2Z4SA 1JQJC 4LGMA 5FLXS 2QENA 1IXZA 1MU5A 1N34M 4R7GA 4I4LA 4JV5M 1S3SA 2X4AA 4LJ8A 4LFCM 5EJCA 3TQSA 3KSXA 2QBYB 1XXHA 3K8ZA 1DO0A 3RGSA 3QAUA 2DWNA 4NOOB 4G4RA 3FKEA 1XWIA 2V1UA 1YUBA 2KZUA 2M5ZA 3PFIA 3SMPA 3RGPA 4LJ7A 4B3TM 5IT9S 2Y21A 1XNQM 4LFAM 4DV0M 3KFUG 4JI0M 3HU2A 2J7NA 1TDZA 1NNUC 4AG6A 4A3VB 3AOEA 4YHHM 1G59A 4RNAA 2ZBKB 1N32M 2L7HA 2ZAMA 3UK6A 4IBBA 1FNNA 3DA1A 4FWDA 4DR1M 4OU7A 1QYRA 3UJNA 4OW0A 2R45A 1E9SA 4DR3M 1H6UA 2KRUA 4DV6M 5ITXA 3I4VA 4JYAM 4G4NA 1OFHA 3GLGA 3E9SA 4LJ6A 4PDGA 4LZJA 2CV0A 3HWSA 3U60A 4GC5A 5ITRA 3NWLA 3J81S 4GHLA 2DWLA 1Q39A 3QWLA 1HQYE 4MGZE 3L28A 4GRIA 4YY3M 1L2CA 1L1TA 2XZFA 4BB9A 3L25A 3FUXA 3CF6E 4IBGA 1E32A 4LJ5A 1Z5BA 2C96A 3GPYA 2KZSA 4GHAA 1QAOA 4L8RC 3AL0C 1ORYB 4B7GA 1IN8A 4M9SA 5KQDA 3GO8A 3GPUA 2G5GX 2L09A 4MGIE 1TGUA 3J27B 4GKKM 1QVRA 1QQWA 5IREB 2R18A 5F3WA 2R62A 2ZAOA 4WW0A 1Z5CA 3SFZA 4REZA 1NJFA 1HQCA 1N78A 3I4YA 1GLNA 3TWLA 4DV7M 1N77A 1TDHA 1QAMA 1IQPA 4DUYM 3CF2A 2DXIA 3HJQA 4JI5M 3LQQA 1Q3CA 3GQ5A 1G4AE 5EXSA 1T3TA 2XEPA 4NRWA 1I4WA 1W5TA 3LQRA 4IBJA 4L78A 3SBJA 2CHVA 3EIHA 1IBLM 1SXJE 3GLIB 2LH0A 2QZ4A 4LCBA 3FTEA 3GLGB 1D2NA 4B7HA 3RE8A 2C5RA 3CF0A 3ZCBB 1HT1E 4MH0E 4KLNA 4S12A 1K3XA 3HKPA 1KYIA 1YE9A 2XFSA 3FUVA 3CTWB 4AW4A 2E5LM 4CISA 3K92A 1R2YA 1LV7A 5A2QS 3FUTA 1KFVA 1J5EM 3SMSA 1NJGA 4HLQA 3M0EA 2CV1A 5EXXA 5KPRA 4QOZC 4BBAA 3GLFA 4M9XA 3DZDA 5EP2A 3U6DA 1IN6A 2M60A 4LF4M 3UMMA 4NXNM 4FD2A 4AI6A 4W5WA 4MB7A 3TPZA 5FTLA 2V6ZM 4DV5M 1XC8A 4DR7M 5FTKA 2CHQA 4LRSA 3I51A 1NHGC 4B7FA 1SXJA 1IN7A 2DVWB 4JXJA 4AQYM 4M9ZA 4B08A 1FJGM 5IZ7D 2K47A 3J2PB 1R7RA 3D8BA 2UUBM 2Z7JA 2Y20A 3SHGB 1Z6TA 4JI1M 2L7IA 3GRRA 1DGGA 4LJAA 3TE6A 2RGOA 1IXRC 2HCBA 4CHTB 3DFZA 3ZC7B 2EO2A 5ITQA 4FCWA 2VQEM 4L16A 3GLHB 4Z6YA 2Y0TA 3UGJA 2L6OA 3MK6A 1K3WA 2HKJA 4II7A 4LJ9A 3A46A 1NVMA 4QOSA 5KPZA 1DGHB 3M6AA 2R46A 3M7GA 2F5NA 2QPAA 2W82A 4IBFA 4IBEA 4IBCA 4X65M 3GLFB 3L26A 2RGHA 5ITYA 1VDDA 2AHMA 2KXEA 4G4OA 1DGFA 4Z8XA 3B9PA 3LVVA 3U6CA 1JR3D 4DV3M 4B3SM 3VKHA 2DWZB 3T1HM 3WHLA 4NSRA 4L4UA 2FE8A 3VK7A 3GP1A 4PDIA 3KP1E 3SAVA 3VFDA 1GL7A 2KRKA 4LZZA 2F5QA 4OVZB 1HT2E 1GKIA 1IY2A 5EQTA 4JI7M 1IN5A 3U61A 4QHTA 3K2LA 2D7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R2Z A;  3SAR A;  4LF6 M;  2F5O A;  4LF9 M;  1L2B A;  4X66 M;  5ITU A;  3SAS A;  3U6Q A;  5ITT A;  3GPP A;  1K3X A;  2UUA M;  5ITX E;  4B3M M;  1XNR M;  3VK8 A;  5BR8 M;  3GPX A;  2E5L M;  3U6M A;  1IBM M;  4CIS A;  2OQ4 A;  5LMN M;  1Z5A A;  1R2Y A;  1KFV A;  4X62 M;  5A2Q S;  1J5E M;  3JR5 A;  5FLX S;  3T1Y M;  4X64 M;  1MU5 A;  1N34 M;  2UU9 M;  3TWK A;  1Q3B A;  4JV5 M;  2EA0 A;  4LFB M;  4OX9 M;  4LFC M;  4GKJ M;  1MX0 A;  1N36 M;  3SAT A;  3U6D A;  4PCZ A;  4LF7 M;  3C58 A;  1XMO M;  4LF4 M;  4G4R A;  4NXN M;  1HNZ M;  4DV5 M;  4MB7 A;  1XC8 A;  4B3T M;  4DR7 M;  3SAW A;  2UUC M;  5IT9 S;  1XNQ M;  3W0F A;  4LFA M;  4DV0 M;  1NNJ A;  3A45 A;  4JI0 M;  2UXC M;  1TDZ A;  4AQY M;  4YHH M;  3U6S A;  1L2D A;  3TWM A;  1FJG M;  2ZBK B;  4KHP M;  3OTO M;  3GQ4 A;  1N32 M;  4G4Q A;  1K82 A;  4DR1 M;  4JI2 M;  2F4V M;  2ZM6 M;  3SAU A;  4LF8 M;  2UUB M;  1XMQ M;  4NRV A;  4DR5 M;  4NXM M;  4DR3 M;  4JI1 M;  4DV6 M;  1I94 M;  5ITX A;  2HHH M;  4JYA M;  2VQF M;  4G4N A;  4PDG A;  3J7A S;  4DR6 M;  5ITR A;  1Z59 A;  3J81 S;  3J80 S;  1Q39 A;  4DR2 M;  4YY3 M;  4LF5 M;  5ITQ A;  1L1T A;  2XZF A;  1L2C A;  2VQE M;  2OPF A;  3U6L A;  1Z5B A;  1K3W A;  2HKJ A;  3GPY A;  3JR4 A;  3A46 A;  4K0K M;  4DV1 M;  1PJJ A;  3U6P A;  3DOA A;  2XZU A;  4DUZ M;  3GO8 A;  3GPU A;  3A42 A;  2F5N A;  3U6E A;  1N33 M;  1HR0 M;  2UXB M;  4JI4 M;  4B3R M;  4X65 M;  1IBK M;  4JI8 M;  4GKK M;  5ITY A;  3GQ3 A;  4JI6 M;  3JAM S;  4G4O A;  1Z5C A;  3U6C A;  4PD2 A;  2F5S A;  4DV3 M;  4B3S M;  2UXD M;  3TWL A;  4DV7 M;  3T1H M;  4JI3 M;  1PJI A;  1TDH A;  3VK7 A;  3GP1 A;  4DUY M;  4PDI A;  4DR4 M;  1HNX M;  4JI5 M;  5LMU M;  3SAV A;  1Q3C A;  4ITQ A;  1EE8 A;  5IWA M;  3GQ5 A;  1HNW M;  3U6O A;  2F5Q A;  4NRW A;  3SBJ A;  2Q2E B;  1L1Z A;  4DV4 M;  4JI7 M;  1IBL M;  4DV2 M;  1PM5 A;  2F5P A; 
#chains in the Genus database with same CATH topology
 3B7N A;  3SAR A;  4MM3 B;  4AG5 A;  2KA6 B;  3TL4 X;  2DZL A;  1PJT A;  1XXH B;  3KP0 E;  2DZO B;  4X66 M;  5ITU A;  3SAS A;  4KO8 A;  1SXJ C;  2C98 A;  2LVA A;  2UUA M;  1KSF X;  3VK8 A;  2LVN C;  4AKI A;  1SXJ D;  5LMN M;  2DAG A;  2JY7 A;  1L8Q A;  3KDS E;  4EIW A;  2R65 A;  3QYB A;  2HL7 A;  4GIP A;  1DGB A;  3LVW A;  3KOY E;  4GIT A;  3JR5 A;  1OTR A;  4M0W A;  2XGN A;  3TWK A;  1Q3B A;  2CFO A;  2EA0 A;  3FUU A;  4LFB M;  4LG2 A;  4ZPX A;  1TH2 A;  3VLF B;  4GKJ M;  2O25 A;  1MX0 A;  2DEN A;  2L2D A;  1N36 M;  2CEA A;  2VII A;  4PCZ A;  4QNM A;  2G8L A;  1XMO M;  3U60 B;  1Q02 A;  2LVO C;  1OFI A;  1HNZ M;  1QUT A;  2KHH A;  1WR1 B;  3KOW E;  3FTF A;  1JR3 A;  2EUC A;  2UUC M;  5FSW A;  3W0F A;  1NNJ A;  2JY6 B;  2P5T A;  2RKO A;  3EIE A;  1QAN A;  3FRH A;  2KNZ A;  1ZAE A;  1HJP A;  3FD9 A;  4MGY E;  3KS8 A;  2YQZ A;  4AKH A;  1E94 E;  1PJQ A;  3BOS A;  3U6S A;  4QHS A;  3KW6 A;  4AKG A;  4FVM A;  3GQ4 A;  3ZH9 B;  3HGI A;  4G4Q A;  1K82 A;  3HU3 A;  1OAI A;  2JZ0 A;  1W5S A;  2APL A;  2XH9 A;  3HHX A;  5EXT A;  3PNV A;  4AZF A;  5C18 A;  2ZM6 M;  3SAU A;  1XMQ M;  2F4V M;  1PJS A;  4CIZ A;  4DR5 M;  2QBY A;  1ZQ9 A;  3U61 B;  2VQF M;  1ZV1 A;  5EP1 A;  1WHC A;  2FFJ A;  2BJV A;  3J7A S;  4DR6 M;  1J09 A;  2YR0 A;  1Z59 A;  3GRY A;  5DFL A;  1DO2 A;  2DNA A;  4LRT A;  2FNA A;  5KO3 A;  2CV2 A;  3IG5 A;  1QZM A;  3FTD A;  1J7K A;  1QZE A;  3E46 A;  3JR4 A;  4XGI A;  2L4F A;  4DV1 M;  3WHK A;  3DOA A;  1C1K A;  1XB2 B;  5DYG A;  2NQ8 C;  4DUZ M;  4Y28 F;  1D0K A;  3PVS A;  3A42 A;  3U6E A;  1N33 M;  1R6B X;  4XBO A;  3L27 A;  4HEO A;  4JI8 M;  1IBK M;  3AV0 A;  1GO5 A;  2MH8 A;  4GEW A;  3GQ3 A;  2R4J A;  4PD2 A;  2F5S A;  1IXS A;  3SHF A;  3GLI E;  1AUA A;  4D80 A;  2MJ5 B;  2X8A A;  4JI3 M;  1EFU B;  1PGY A;  1NY6 A;  3K1J A;  4FCT A;  1PJI A;  2BJW A;  3AJI B;  4IBK A;  4DR4 M;  1P3Q Q;  3B89 A;  4IJF A;  3RFW A;  5FTN A;  2QQ8 A;  4ITQ A;  3KS4 A;  1EE8 A;  3L29 A;  5IWA M;  4JN6 A;  3FYC A;  3AOG A;  2DAK A;  2Q2E B;  2Y0Q A;  1ZMV A;  3E4R A;  2FOI C;  3HHY A;  4DV2 M;  1GL6 A;  3H4M A;  2F5P A;  3HJ8 A;  4TUW A;  3FTC A;  1CUK A;  3IHP A;  1DV0 A;  1IY1 A;  4LF9 M;  2O5R A;  2JA2 A;  2ZAN A;  4LY6 A;  1L2B A;  3J7B A;  2Z3X A;  1QDR A;  4IBI A;  3HJS A;  4G6Z A;  2DI0 A;  5E26 A;  2HAK A;  3MMP A;  5ITT A;  4FWH A;  4IBD A;  4NSO B;  3KXE C;  1TR8 A;  3HU1 A;  4B3M M;  1XNR M;  3LMM A;  5BR8 M;  3GPX A;  1E9R A;  4L6V 6;  3U6M A;  2XSZ D;  2OQ4 A;  1IBM M;  1Z5A A;  2CHG A;  3NBI A;  4X62 M;  4KOD A;  2EKK A;  1GJT A;  4IJE A;  1SXJ B;  4M0D A;  2OO9 A;  3C3E A;  3K9O A;  1LTM A;  2ZTC A;  7CAT A;  4F1I A;  1V33 A;  2D7H A;  3KSJ A;  3MJ5 A;  4L15 A;  2Z4R A;  3T1Y M;  1RU3 A;  4QNR A;  3KOX E;  2BNK A;  4X64 M;  3A98 B;  3GLI A;  2UU9 M;  3R8F A;  2JNH A;  4OX9 M;  1NHW C;  1G3I A;  1UFZ A;  1NO1 A;  5C1B A;  2R4E A;  1VEG A;  3HHW A;  3U5Z A;  3SAT A;  4DBG B;  4LF7 M;  2A5Y B;  2J7O A;  5JI2 E;  1IFY A;  3C58 A;  4P16 A;  4WUR A;  3GRU A;  5EP3 A;  2BWE A;  2EKF A;  3E21 A;  3SAW A;  2CUZ A;  1IXS B;  1NY5 A;  4D82 A;  3T38 A;  3A45 A;  2UXC M;  2O01 F;  3W0L B;  1R5L A;  1L2D A;  4RF0 A;  4I5S A;  3FYD A;  3IG8 A;  3GLH E;  3OTO M;  3TWM A;  2H5X A;  2DZN B;  4KHP M;  2R0I A;  4JI2 M;  2DAM A;  2QSF X;  4GMQ A;  4LF8 M;  2HWJ A;  2C9C A;  3L2A A;  2VDB B;  4NRV A;  1WXQ A;  3KOZ E;  4NXM M;  2LWX A;  1XHB A;  1I94 M;  3HX3 A;  1OJL A;  3MHV C;  2HHH M;  1TH3 A;  1YSY A;  3D8L A;  1X37 A;  2DHR A;  2I7N A;  4MGK E;  1TF0 B;  4NL4 H;  5EP4 A;  3I01 M;  3ILK A;  3J80 S;  4DR2 M;  1IY0 A;  4LF5 M;  2LXE A;  2CWB A;  2D7E A;  2QP9 X;  3KVW A;  2MR9 A;  4FW9 A;  5FTJ A;  5L8R F;  2OPF A;  1QAQ A;  1OAO C;  2QCU A;  3U6L A;  4I81 A;  3Q8X A;  4K0K M;  2ERC A;  2XSZ A;  2I7P A;  2FS1 A;  1PJJ A;  5H37 D;  3U6P A;  2XZU A;  5JI3 E;  3LCV B;  2JZ1 A;  2VF8 A;  2XF3 A;  3B74 A;  3PNY A;  1OIP A;  4D81 A;  4GC9 A;  1HR0 M;  2UXB M;  1WIV A;  5DYI A;  4PT5 A;  4JI4 M;  4B3R M;  1N75 A;  5EXP A;  1G41 A;  3UZU A;  2YFQ A;  3U5Z B;  3LW5 F;  4JI6 M;  1IM2 A;  2YNM D;  4IIW A;  3JAM S;  4F2L A;  4FCV A;  3GLH A;  3AFH A;  2XLJ A;  2UXD M;  3PXG A;  3VDU A;  4R3D A;  2KNV A;  3AOE C;  2X49 A;  4CGY B;  3R9X B;  1EIJ A;  1DGH A;  1XXH E;  1OIZ A;  1HNX M;  2L4E A;  5LMU M;  1G8P A;  1UM8 A;  5KQ8 A;  4MGH A;  3SYK A;  4GH9 A;  1IN4 A;  4LGY A;  3AKZ A;  4LJ4 A;  1HNW M;  1MN3 A;  5FTM A;  3U6O A;  2KEB A;  1VQ1 A;  5BPV A;  1NSF A;  4I8O A;  4HL4 A;  3FUW A;  1L1Z A;  3BXW A;  5GKN A;  4DV4 M;  2WSF F;  1PM5 A;  3GRV A;  5KPT A;  1VDL A;  1R2Z A;  1MJG M;  1PRB A;  3SC3 A;  4BLC A;  4LF6 M;  2F5O A;  2XFT A;  2C9O A;  1VG5 A;  2H1R A;  3THG A;  3T15 A;  1TH4 A;  3U6Q A;  3VKG A;  3GPP A;  1GVN A;  4FWG A;  4RF1 A;  5DNY A;  2DWM A;  5ITX E;  2LNH C;  3GLG E;  2C99 A;  2MGW A;  3SYL A;  8CAT A;  3HHZ A;  1TTE A;  4OVZ A;  2V1C A;  2CE7 A;  5E6J A;  2KW0 A;  3VDP A;  2Z4S A;  1JQJ C;  4LGM A;  5FLX S;  2QEN A;  1IXZ A;  1VEK A;  1MU5 A;  1YLA A;  1N34 M;  4R7G A;  2QHO B;  4I4L A;  4JV5 M;  1T43 A;  1S3S A;  2FH0 A;  2X4A A;  4LJ8 A;  4LFC M;  5EJC A;  3TQS A;  1D0M A;  3KSX A;  2QBY B;  1XXH A;  3K8Z A;  3C3D A;  1F4I A;  1DO0 A;  3RGS A;  3QAU A;  2DWN A;  2QNJ A;  4NOO B;  4G4R A;  3FKE A;  1XWI A;  1QDT A;  2V1U A;  1YUB A;  2KZU A;  2M5Z A;  3PFI A;  3SMP A;  3RGP A;  4LJ7 A;  4B3T M;  5IT9 S;  2Y21 A;  1XNQ M;  4LFA M;  2N35 A;  4DV0 M;  3KFU G;  4JI0 M;  2JUJ A;  3HU2 A;  2J7N A;  1TDZ A;  1NNU C;  4AG6 A;  4A3V B;  3AOE A;  4YHH M;  4UN2 B;  1NV8 A;  4RNA A;  2ZBK B;  2DAE A;  2OOB A;  1G59 A;  2L7H A;  2ZAM A;  3UK6 A;  1N32 M;  4IBB A;  1FNN A;  2R6F A;  3DA1 A;  4FWD A;  4DR1 M;  4OU7 A;  1QYR A;  3UJN A;  4OW0 A;  2R45 A;  1E9S A;  3BBZ A;  4G3O A;  2CP8 A;  4DR3 M;  1H6U A;  2KNA A;  1WJ7 A;  2KRU A;  4DV6 M;  5ITX A;  3I4V A;  4JYA M;  4G4N A;  1OFH A;  3Q8G A;  3E9S A;  4LJ6 A;  4PDG A;  4LZJ A;  3GLG A;  3HWS A;  3U60 A;  4GC5 A;  5ITR A;  2BWB A;  2CV0 A;  3NWL A;  3J81 S;  4GHL A;  2DWL A;  1BVS A;  1Q39 A;  2DHY A;  3QWL A;  1HQY E;  4MGZ E;  3L28 A;  2K0B X;  4GRI A;  1V92 A;  4YY3 M;  2XZF A;  2GNO A;  4BB9 A;  3FUX A;  1L1T A;  1L2C A;  3L25 A;  3CF6 E;  4IBG A;  1E32 A;  4LJ5 A;  1R4G A;  1Z5B A;  2K9D A;  2C96 A;  3GPY A;  2KZS A;  4GHA A;  1QAO A;  4L8R C;  2JXN A;  3AL0 C;  1ORY B;  3CGW A;  4B7G A;  1IN8 A;  3FE3 A;  4M9S A;  4ANR A;  4CJ6 A;  5KQD A;  2G5G X;  4WP2 A;  3GO8 A;  3GPU A;  2L09 A;  4MGI E;  1TGU A;  3J27 B;  4GKK M;  1QVR A;  1QQW A;  5IRE B;  2R18 A;  2DAI A;  5F3W A;  2R62 A;  2ZAO A;  4WW0 A;  1C7Y A;  1Z5C A;  3SFZ A;  4REZ A;  2Z8Y M;  1NJF A;  2LVP C;  1HQC A;  2RRU A;  1N78 A;  3I4Y A;  1GLN A;  3TWL A;  4DV7 M;  1N77 A;  3K9P A;  2JWS A;  3GLF E;  1TDH A;  1QAM A;  1IQP A;  4DUY M;  3CF2 A;  2DXI A;  3HJQ A;  4JI5 M;  3LQQ A;  1Q3C A;  2LBC A;  3GQ5 A;  1G4A E;  3B7Z A;  5EXS A;  1T3T A;  2XEP A;  3FRI A;  4NRW A;  1I4W A;  3B7Q A;  1W5T A;  3LQR A;  4IBJ A;  4L78 A;  3SBJ A;  2CHV A;  3EIH A;  1IBL M;  1SXJ E;  3GLI B;  2LH0 A;  2QZ4 A;  4LCB A;  3FTE A;  4P17 A;  3GLG B;  1D2N A;  4B7H A;  3RE8 A;  3IEC A;  1WGN A;  3CF0 A;  2G3Q A;  2JY8 A;  4Q7J A;  3ZCB B;  2C5R A;  1HT1 E;  4MH0 E;  1WGL A;  2CRU A;  4KLN A;  4S12 A;  1K3X A;  3HKP A;  1KYI A;  1YE9 A;  2XFS A;  3FUV A;  3CTW B;  4AW4 A;  2E5L M;  4CIS A;  3K92 A;  2WSC F;  1R2Y A;  1LV7 A;  1SG9 A;  2LTU A;  3FUT A;  5A2Q S;  1J5E M;  1KFV A;  3SMS A;  1NJG A;  4HLQ A;  1V34 A;  3V76 A;  1JB0 F;  3M0E A;  2CV1 A;  5EXX A;  2JP7 A;  4XK8 F;  5KPR A;  1AIP C;  4QOZ C;  4BBA A;  4NC6 A;  3GLF A;  3W68 A;  3HZJ A;  2VF7 A;  4M9X A;  3DZD A;  5EP2 A;  3U6D A;  1IN6 A;  2M60 A;  4LF4 M;  3UMM A;  3QYE A;  4FD2 A;  4NXN M;  4AI6 A;  4W5W A;  4MB7 A;  3TPZ A;  4R71 A;  2V6Z M;  5FTL A;  4DV5 M;  1XC8 A;  4DR7 M;  5FTK A;  2CHQ A;  4LRS A;  3I51 A;  3C9P A;  1NHG C;  2LHG A;  4B7F A;  1SXJ A;  1IN7 A;  2DVW B;  2LHC A;  4JXJ A;  4AQY M;  4M9Z A;  4B08 A;  1FJG M;  5IZ7 D;  2K47 A;  3J2P B;  1R7R A;  2OOA A;  3D8B A;  3I04 M;  2Z7J A;  2UUB M;  2Y20 A;  1Y8G A;  3SHG B;  1OKS A;  1Z6T A;  2EJS A;  4JI1 M;  2L7I A;  3GRR A;  1DGG A;  4LJA A;  1GAB A;  3TE6 A;  1GJS A;  2RGO A;  1IXR C;  2HCB A;  1NV9 A;  2KDL A;  4CHT B;  3HY5 A;  3DFZ A;  1QUS A;  2EO2 A;  3ZC7 B;  2GQF A;  4KT0 F;  5ITQ A;  4FCW A;  2VQE M;  4L16 A;  3GLH B;  4Z6Y A;  2Y0T A;  2B3T A;  3UGJ A;  2L6O A;  3MK6 A;  1OQY A;  1K3W A;  2HKJ A;  4II7 A;  4LJ9 A;  2K6B A;  1NVM A;  2J5Y A;  2MRO B;  4QOS A;  3A46 A;  5KPZ A;  1DGH B;  3M6A A;  4RKU F;  3H4J A;  2ZTD A;  2R46 A;  3M7G A;  3T6P A;  2F5N A;  2QPA A;  2W82 A;  4IBF A;  3F92 A;  4IBE A;  4IBC A;  4X65 M;  3GLF B;  1T6O A;  3L26 A;  2RGH A;  5ITY A;  3NBX X;  3LCU A;  1VDD A;  2AHM A;  2KXE A;  4G4O A;  1DGF A;  2LVQ D;  4Z8X A;  3B9P A;  3LVV A;  2JY5 A;  1JR3 D;  3U6C A;  4DV3 M;  4B3S M;  1G71 A;  3VKH A;  2DWZ B;  3ZQJ A;  3T1H M;  3WHL A;  1A5T A;  4NSR A;  4L4U A;  2FE8 A;  1ZMU A;  2WZJ A;  3VK7 A;  3GP1 A;  1D0L A;  4PDI A;  3KP1 E;  3SAV A;  3VFD A;  1GL7 A;  1ZMW A;  2KRK A;  2WSE F;  4LZZ A;  2F5Q A;  4OVZ B;  1HT2 E;  1JR3 E;  1GKI A;  1IY2 A;  1VEJ A;  5EQT A;  2DKL A;  4JI7 M;  1IN5 A;  3U61 A;  3W67 A;  2R44 A;  4QHT A;  3K2L A;  2D7G A; 
#chains in the Genus database with same CATH homology
 3SAR A;  4MM3 B;  4AG5 A;  2KA6 B;  3TL4 X;  1XXH B;  3KP0 E;  2DZO B;  4X66 M;  5ITU A;  3SAS A;  4KO8 A;  1SXJ C;  2C98 A;  2UUA M;  1KSF X;  3VK8 A;  4AKI A;  1SXJ D;  5LMN M;  1L8Q A;  3KDS E;  4EIW A;  2R65 A;  2HL7 A;  4GIP A;  1DGB A;  3LVW A;  3KOY E;  4GIT A;  3JR5 A;  4M0W A;  2XGN A;  3TWK A;  1Q3B A;  2CFO A;  2EA0 A;  3FUU A;  4LFB M;  4LG2 A;  4ZPX A;  1TH2 A;  3VLF B;  4GKJ M;  1MX0 A;  1N36 M;  2CEA A;  2VII A;  4PCZ A;  4QNM A;  2G8L A;  1XMO M;  3U60 B;  1OFI A;  1HNZ M;  3KOW E;  3FTF A;  1JR3 A;  2EUC A;  2UUC M;  5FSW A;  3W0F A;  1NNJ A;  2P5T A;  2RKO A;  3EIE A;  1QAN A;  1ZAE A;  3KS8 A;  3FD9 A;  4MGY E;  2YQZ A;  4AKH A;  1E94 E;  3BOS A;  3U6S A;  4QHS A;  3KW6 A;  4AKG A;  4FVM A;  3GQ4 A;  3ZH9 B;  3HGI A;  4G4Q A;  1K82 A;  3HU3 A;  5EXT A;  3HHX A;  1W5S A;  4AZF A;  2XH9 A;  5C18 A;  2ZM6 M;  3PNV A;  3SAU A;  2F4V M;  1XMQ M;  4DR5 M;  2QBY A;  1ZQ9 A;  3U61 B;  2VQF M;  5EP1 A;  2FFJ A;  2BJV A;  3J7A S;  4DR6 M;  1J09 A;  2YR0 A;  1Z59 A;  3GRY A;  1DO2 A;  4LRT A;  2FNA A;  5KO3 A;  2CV2 A;  3IG5 A;  1QZM A;  3FTD A;  1J7K A;  3JR4 A;  4XGI A;  4DV1 M;  3WHK A;  3DOA A;  1C1K A;  5DYG A;  2NQ8 C;  4DUZ M;  3PVS A;  3A42 A;  3U6E A;  1N33 M;  1R6B X;  4XBO A;  3L27 A;  4JI8 M;  1IBK M;  3AV0 A;  3GQ3 A;  2R4J A;  4PD2 A;  2F5S A;  3SHF A;  4D80 A;  2X8A A;  4JI3 M;  4FCT A;  1NY6 A;  3K1J A;  1PJI A;  2BJW A;  3AJI B;  4IBK A;  4DR4 M;  4IJF A;  3RFW A;  5FTN A;  4ITQ A;  3KS4 A;  1EE8 A;  3L29 A;  5IWA M;  4JN6 A;  3FYC A;  3AOG A;  2Q2E B;  2Y0Q A;  3E4R A;  2FOI C;  3HHY A;  4DV2 M;  1GL6 A;  3H4M A;  2F5P A;  3HJ8 A;  4TUW A;  3FTC A;  1IY1 A;  4LF9 M;  2O5R A;  2JA2 A;  2ZAN A;  4LY6 A;  1L2B A;  3J7B A;  2Z3X A;  4IBI A;  3HJS A;  4G6Z A;  5E26 A;  5ITT A;  4FWH A;  4IBD A;  4NSO B;  3KXE C;  3HU1 A;  4B3M M;  1XNR M;  3LMM A;  5BR8 M;  3GPX A;  1E9R A;  3U6M A;  1IBM M;  2XSZ D;  2OQ4 A;  1Z5A A;  2CHG A;  3NBI A;  4X62 M;  4KOD A;  4IJE A;  1SXJ B;  4M0D A;  7CAT A;  2D7H A;  3KSJ A;  3MJ5 A;  4L15 A;  2Z4R A;  3T1Y M;  4QNR A;  4X64 M;  3KOX E;  2BNK A;  3A98 B;  3GLI A;  2UU9 M;  3R8F A;  4OX9 M;  1NHW C;  1G3I A;  5C1B A;  2R4E A;  3HHW A;  3U5Z A;  3SAT A;  4LF7 M;  2A5Y B;  2J7O A;  5JI2 E;  3C58 A;  4P16 A;  4WUR A;  3GRU A;  5EP3 A;  3SAW A;  2CUZ A;  1IXS B;  1NY5 A;  4D82 A;  3T38 A;  3A45 A;  2UXC M;  3W0L B;  1L2D A;  4RF0 A;  4I5S A;  3FYD A;  3IG8 A;  3TWM A;  3OTO M;  4KHP M;  2DZN B;  4JI2 M;  4GMQ A;  4LF8 M;  3L2A A;  2C9C A;  4NRV A;  1WXQ A;  3KOZ E;  4NXM M;  1XHB A;  2LWX A;  1I94 M;  2HHH M;  1OJL A;  3MHV C;  1TH3 A;  1YSY A;  3D8L A;  1X37 A;  2DHR A;  2I7N A;  4MGK E;  5EP4 A;  4NL4 H;  3ILK A;  3J80 S;  4DR2 M;  1IY0 A;  4LF5 M;  2LXE A;  2D7E A;  2QP9 X;  3KVW A;  4FW9 A;  5FTJ A;  2OPF A;  1QAQ A;  2QCU A;  3U6L A;  4I81 A;  3Q8X A;  4K0K M;  2ERC A;  2XSZ A;  2I7P A;  1PJJ A;  5H37 D;  3U6P A;  2XZU A;  5JI3 E;  2XF3 A;  3PNY A;  4D81 A;  4GC9 A;  1HR0 M;  2UXB M;  5DYI A;  4PT5 A;  4JI4 M;  4B3R M;  1N75 A;  5EXP A;  1G41 A;  3UZU A;  2YFQ A;  3U5Z B;  4JI6 M;  1IM2 A;  2YNM D;  4IIW A;  3JAM S;  4FCV A;  3GLH A;  3AFH A;  2XLJ A;  2UXD M;  3PXG A;  3VDU A;  4R3D A;  3AOE C;  2X49 A;  4CGY B;  3R9X B;  1DGH A;  1HNX M;  5LMU M;  1G8P A;  1UM8 A;  5KQ8 A;  4MGH A;  3SYK A;  4GH9 A;  1IN4 A;  4LGY A;  3AKZ A;  4LJ4 A;  1HNW M;  5FTM A;  3U6O A;  2KEB A;  5BPV A;  1NSF A;  4I8O A;  4HL4 A;  3FUW A;  1L1Z A;  5GKN A;  4DV4 M;  1PM5 A;  3GRV A;  5KPT A;  1R2Z A;  4LF6 M;  3SC3 A;  4BLC A;  2F5O A;  2XFT A;  2C9O A;  2H1R A;  3THG A;  3T15 A;  1TH4 A;  3U6Q A;  3VKG A;  3GPP A;  1GVN A;  4FWG A;  4RF1 A;  5DNY A;  2DWM A;  5ITX E;  2LNH C;  2C99 A;  3SYL A;  8CAT A;  3HHZ A;  4OVZ A;  2V1C A;  2CE7 A;  5E6J A;  2KW0 A;  3VDP A;  2Z4S A;  1JQJ C;  4LGM A;  5FLX S;  2QEN A;  1IXZ A;  1MU5 A;  1N34 M;  4R7G A;  4I4L A;  4JV5 M;  1S3S A;  2X4A A;  4LJ8 A;  4LFC M;  5EJC A;  3TQS A;  3KSX A;  2QBY B;  1XXH A;  3K8Z A;  1DO0 A;  3RGS A;  3QAU A;  2DWN A;  4NOO B;  4G4R A;  3FKE A;  1XWI A;  2V1U A;  1YUB A;  2KZU A;  2M5Z A;  3PFI A;  3SMP A;  3RGP A;  4LJ7 A;  4B3T M;  5IT9 S;  2Y21 A;  1XNQ M;  4LFA M;  4DV0 M;  3KFU G;  4JI0 M;  3HU2 A;  2J7N A;  1TDZ A;  1NNU C;  4AG6 A;  4A3V B;  3AOE A;  4YHH M;  1G59 A;  4RNA A;  2ZBK B;  1N32 M;  2L7H A;  2ZAM A;  3UK6 A;  4IBB A;  1FNN A;  3DA1 A;  4FWD A;  4DR1 M;  4OU7 A;  1QYR A;  3UJN A;  4OW0 A;  2R45 A;  1E9S A;  4DR3 M;  1H6U A;  2KRU A;  4DV6 M;  5ITX A;  3I4V A;  4JYA M;  4G4N A;  1OFH A;  3GLG A;  3E9S A;  4LJ6 A;  4PDG A;  4LZJ A;  2CV0 A;  3HWS A;  3U60 A;  4GC5 A;  5ITR A;  3NWL A;  3J81 S;  4GHL A;  2DWL A;  1Q39 A;  3QWL A;  1HQY E;  4MGZ E;  3L28 A;  4GRI A;  4YY3 M;  1L2C A;  1L1T A;  2XZF A;  4BB9 A;  3L25 A;  3FUX A;  3CF6 E;  4IBG A;  1E32 A;  4LJ5 A;  1Z5B A;  2C96 A;  3GPY A;  2KZS A;  4GHA A;  1QAO A;  4L8R C;  3AL0 C;  1ORY B;  4B7G A;  1IN8 A;  4M9S A;  5KQD A;  3GO8 A;  3GPU A;  2G5G X;  2L09 A;  4MGI E;  1TGU A;  3J27 B;  4GKK M;  1QVR A;  1QQW A;  5IRE B;  2R18 A;  5F3W A;  2R62 A;  2ZAO A;  4WW0 A;  1Z5C A;  3SFZ A;  4REZ A;  1NJF A;  1HQC A;  1N78 A;  3I4Y A;  1GLN A;  3TWL A;  4DV7 M;  1N77 A;  1TDH A;  1QAM A;  1IQP A;  4DUY M;  3CF2 A;  2DXI A;  3HJQ A;  4JI5 M;  3LQQ A;  1Q3C A;  3GQ5 A;  1G4A E;  5EXS A;  1T3T A;  2XEP A;  4NRW A;  1I4W A;  1W5T A;  3LQR A;  4IBJ A;  4L78 A;  3SBJ A;  2CHV A;  3EIH A;  1IBL M;  1SXJ E;  3GLI B;  2LH0 A;  2QZ4 A;  4LCB A;  3FTE A;  3GLG B;  1D2N A;  4B7H A;  3RE8 A;  2C5R A;  3CF0 A;  3ZCB B;  1HT1 E;  4MH0 E;  4KLN A;  4S12 A;  1K3X A;  3HKP A;  1KYI A;  1YE9 A;  2XFS A;  3FUV A;  3CTW B;  4AW4 A;  2E5L M;  4CIS A;  3K92 A;  1R2Y A;  1LV7 A;  5A2Q S;  3FUT A;  1KFV A;  1J5E M;  3SMS A;  1NJG A;  4HLQ A;  3M0E A;  2CV1 A;  5EXX A;  5KPR A;  4QOZ C;  4BBA A;  3GLF A;  4M9X A;  3DZD A;  5EP2 A;  3U6D A;  1IN6 A;  2M60 A;  4LF4 M;  3UMM A;  4NXN M;  4FD2 A;  4AI6 A;  4W5W A;  4MB7 A;  3TPZ A;  5FTL A;  2V6Z M;  4DV5 M;  1XC8 A;  4DR7 M;  5FTK A;  2CHQ A;  4LRS A;  3I51 A;  1NHG C;  4B7F A;  1SXJ A;  1IN7 A;  2DVW B;  4JXJ A;  4AQY M;  4M9Z A;  4B08 A;  1FJG M;  5IZ7 D;  2K47 A;  3J2P B;  1R7R A;  3D8B A;  2UUB M;  2Z7J A;  2Y20 A;  3SHG B;  1Z6T A;  4JI1 M;  2L7I A;  3GRR A;  1DGG A;  4LJA A;  3TE6 A;  2RGO A;  1IXR C;  2HCB A;  4CHT B;  3DFZ A;  3ZC7 B;  2EO2 A;  5ITQ A;  4FCW A;  2VQE M;  4L16 A;  3GLH B;  4Z6Y A;  2Y0T A;  3UGJ A;  2L6O A;  3MK6 A;  1K3W A;  2HKJ A;  4II7 A;  4LJ9 A;  3A46 A;  1NVM A;  4QOS A;  5KPZ A;  1DGH B;  3M6A A;  2R46 A;  3M7G A;  2F5N A;  2QPA A;  2W82 A;  4IBF A;  4IBE A;  4IBC A;  4X65 M;  3GLF B;  3L26 A;  2RGH A;  5ITY A;  1VDD A;  2AHM A;  2KXE A;  4G4O A;  1DGF A;  4Z8X A;  3B9P A;  3LVV A;  3U6C A;  1JR3 D;  4DV3 M;  4B3S M;  3VKH A;  2DWZ B;  3T1H M;  3WHL A;  4NSR A;  4L4U A;  2FE8 A;  3VK7 A;  3GP1 A;  4PDI A;  3KP1 E;  3SAV A;  3VFD A;  1GL7 A;  2KRK A;  4LZZ A;  2F5Q A;  4OVZ B;  1HT2 E;  1GKI A;  1IY2 A;  5EQT A;  4JI7 M;  1IN5 A;  3U61 A;  4QHT A;  3K2L A;  2D7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...