1K3XA

Crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with brominated-dna
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
253
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*(BRU)P*(BRU)P*CP*AP*(BRU)P*CP*CP*(BRU)P*GP*G)
publication title Structural analysis of an Escherichia coli endonuclease VIII covalent reaction intermediate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 84
structure length 253
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2001-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1k3xA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 1k3xA01
4PD2A 1IBKM 4OX9M 3GO8A 4B3RM 5LMNM 2F5OA 3SARA 4YHHM 1MU5A 2UUCM 1FJGM 4G4QA 4DUZM 1IBMM 2F5QA 5ITXA 3W0FA 4DR7M 4DR1M 1L1ZA 3U6LA 3VK8A 4PDGA 3GQ4A 3JAMS 4JYAM 4JI5M 3A45A 4MB7A 4DR2M 3TWKA 1NNJA 1HNZM 4DUYM 4JI6M 3SATA 2ZBKB 5ITXE 1J5EM 3J80S 4X65M 4JV5M 4CISA 1Z5BA 4X64M 4DV0M 2HKJA 2F4VM 2UXBM 2EA0A 4G4RA 4JI0M 3A42A 5IWAM 4JI2M 1N33M 2HHHM 1I94M 4NXMM 4DV5M 2UUAM 3J81S 4B3TM 4GKJM 5IT9S 1N34M 4DV6M 1Z5AA 5BR8M 1L2CA 4LF6M 1HNWM 1Q3CA 1KFVA 1L1TA 5FLXS 3U6EA 4B3SM 4GKKM 4X66M 2OPFA 4DV3M 2UXCM 3JR4A 2F5SA 3U6MA 4DR4M 3U6CA 1K3XA 4ITQA 4LFBM 3OTOM 3SAUA 1TDHA 4DV7M 4B3MM 2Q2EB 3J7AS 3U6OA 3GQ5A 3U6DA 1K82A 4K0KM 1HR0M 3SAWA 1EE8A 3JR5A 2VQFM 5ITRA 3T1YM 5ITTA 4LFCM 4NRWA 3SASA 4PDIA 2XZUA 3TWLA 1R2YA 3A46A 4LF4M 2UUBM 2E5LM 3TWMA 1Z5CA 4NRVA 4LF9M 4DV2M 5A2QS 5ITQA 4DV4M 4DV1M 1L2BA 3U6SA 3SAVA 1PJJA 1XNQM 3GPXA 3DOAA 4DR5M 1K3WA 3GPUA 3C58A 1XMOM 4X62M 2F5PA 1PJIA 3GQ3A 1N36M 1Q3BA 2VQEM 4DR3M 3GPPA 3U6PA 1HNXM 4YY3M 4LF5M 5ITYA 1IBLM 1R2ZA 5LMUM 1L2DA 3T1HM 1XNRM 4LF7M 4JI7M 4LFAM 4LF8M 3GP1A 2XZFA 2UXDM 1PM5A 4JI3M 3GPYA 1Q39A 2UU9M 4KHPM 3VK7A 1MX0A 4PCZA 3U6QA 1TDZA 1Z59A 4AQYM 2F5NA 1XC8A 4NXNM 4JI1M 5ITUA 4JI8M 1XMQM 4DR6M 3SBJA 4JI4M 4G4OA 4G4NA 2OQ4A 1N32M 2ZM6M
chains in the Genus database with same CATH superfamily
1DO0A 4B3RM 5LMNM 3SHFA 1IM2A 2QBYB 4I81A 1LV7A 3K92A 2UUCM 4FWHA 2HL7A 2Z4RA 3L29A 4M0DA 2O25A 5C18A 2F5QA 1BVSA 1ZMWA 4A3VB 3I4YA 3HX3A 1NY5A 4EIWA 3BXWA 1T3TA 3U5ZB 1L1ZA 4PDGA 2YR0A 4JXJA 2V6ZM 3AOEA 1DV0A 5BPVA 2EKFA 1GABA 4JYAM 2R0IA 4B7FA 3TWKA 2H1RA 3SATA 4JN6A 2KNAA 2QPAA 2QSFX 1J5EM 1NV8A 2K47A 4JV5M 2RKOA 2VF8A 5FTNA 2N35A 1Z5BA 4X64M 2EA0A 5DFLA 1PJTA 2VDBB 1SXJA 1WR1B 3RGSA 5IWAM 4JI2M 1N33M 5IZ7D 3E21A 2HHHM 4DV5M 4B3TM 1V34A 2J7OA 3ZC7B 3HHWA 4W5WA 2DHRA 2OOBA 4GKJM 1NSFA 1ZMUA 2BJVA 1G3IA 4LRSA 5BR8M 1L2CA 2R46A 2WSCF 3IHPA 3GLIA 2OPFA 3PNYA 2MR9A 3U6MA 2XFSA 2DWLA 4DR4M 1OKSA 1OAOC 2LVAA 2QZ4A 1DO2A 8CATA 3GRYA 1PJQA 1R4GA 1HT2E 3HJ8A 3I04M 3D8BA 2L7HA 3W67A 4Z6YA 3J7AS 2CP8A 1K82A 3VKGA 2CE7A 4AKHA 4IJEA 4MM3B 4BBAA 4K0KM 3UK6A 4OW0A 3GLIB 2GNOA 4BLCA 2X49A 1EE8A 3CTWB 4IBFA 4WW0A 3JR5A 5ITRA 3HU3A 1IY0A 5JI3E 3SHGB 1NV9A 4NSOB 1TF0B 2CHGA 2OOAA 4QNMA 2R6FA 3SASA 4LFCM 2XZUA 4QOZC 4B08A 3A46A 3B74A 4LJAA 4LF4M 1JB0F 2KXEA 4L16A 3I4VA 4Q7JA 1Z5CA 3L28A 3IG8A 2L2DA 1EFUB 2CHVA 4S12A 3MJ5A 1QDRA 2V1CA 3U6SA 3KOZE 2DAMA 2MGWA 1PJJA 2O01F 5GKNA 1R7RA 2FE8A 3DOAA 4DR5M 4WURA 1GJSA 3ZH9B 3FE3A 3KXEC 2FFJA 3UMMA 4X62M 4B7HA 4CIZA 3VLFB 2VQEM 1IN7A 1G71A 4FW9A 3GPPA 1GL7A 3U6PA 2J5YA 4YY3M 4LF5M 1G59A 7CATA 1VEGA 1R2ZA 1NY6A 2R4JA 3PNVA 3RGPA 2WSFF 3AKZA 1XNRM 1PJSA 2CHQA 3E9SA 2BJWA 3AOGA 2C9OA 2Y0QA 3GLGA 2DXIA 3CF6E 3LW5F 3B89A 1XXHE 2C96A 4IBBA 4L78A 4CHTB 1OIPA 3AJIB 3VK7A 3QAUA 4II7A 2KRKA 2CV2A 1IXSB 3VDUA 3C9PA 2KRUA 2QNJA 1OFIA 3AOEC 3FTEA 3HU1A 1XMQM 1WJ7A 2DZOB 2OQ4A 2ZTDA 4PD2A 1IBKM 4YHHM 2DAKA 3HGIA 2LNHC 4AG6A 3KP1E 2B3TA 3HY5A 2HAKA 4G4QA 1OIZA 4HLQA 1IBMM 4IBIA 2GQFA 3PFIA 1S3SA 2C99A 2G3QA 4HL4A 1TH4A 3FRHA 1QVRA 4RF1A 4DR7M 1SXJC 2CUZA 1PGYA 1ORYB 1R6BX 2DVWB 4LJ4A 3U6LA 3FD9A 3FTCA 3KVWA 2CFOA 3HWSA 2R45A 3A45A 1NHWC 3NBIA 2QBYA 1GJTA 1HNZM 3KSJA 4KO8A 5ITXE 4R71A 2LTUA 4TUWA 4ANRA 4LGYA 4AG5A 5KO3A 3QYEA 4CISA 5EXTA 3B7NA 1IN4A 2EJSA 2LH0A 2D7GA 3U5ZA 4DV0M 2JA2A 4G4RA 4FVMA 2FNAA 2JP7A 3MMPA 4JI0M 3SFZA 2RRUA 1YSYA 1J7KA 2APLA 2KEBA 2DWMA 2LWXA 1TR8A 3FYDA 3E4RA 1N34M 2LHCA 4WP2A 3J7BA 4KT0F 2HWJA 1L1TA 4GKKM 2UXCM 2LVNC 4FCTA 1NO1A 4DV3M 2L4FA 4MGIE 1H6UA 2XFTA 3OTOM 1F4IA 4F2LA 2R4EA 4DV7M 4B3MM 3CF2A 3FTDA 4D81A 2VIIA 1Q02A 2Q2EB 3FRIA 1ZQ9A 1T43A 2QP9X 3GQ5A 3U6DA 3GLFE 2QENA 1HR0M 2CRUA 2DWZB 1OFHA 4BB9A 2CEAA 2Z3XA 2VQFM 3I51A 1HQCA 3ZCBB 1D0LA 1NNUC 2NQ8C 3SMPA 3T1YM 3M7GA 2L6OA 4GH9A 4L4UA 3HZJA 5ITTA 2L09A 3C3DA 4PDIA 3TWLA 1R2YA 4IBDA 2L4EA 2JZ0A 2QCUA 1VEJA 2YQZA 2P5TA 3FUXA 4FWGA 1WXQA 4L6V6 5A2QS 4AKGA 3SMSA 2D7EA 1L2BA 1ZMVA 3ZQJA 4AKIA 2HCBA 1JR3E 3GLHB 4I4LA 1XNQM 3KDSE 3GPXA 3FKEA 4I5SA 1W5TA 5H37D 4IJFA 3GLGE 2KZUA 4IBJA 3GPUA 2X8AA 3C58A 1QZEA 2CV1A 2J7NA 1QZMA 2JY6B 5EJCA 3RFWA 4OU7A 2XSZA 1KSFX 3K2LA 1LTMA 2M5ZA 3M0EA 4MGZE 2LBCA 2R62A 1FNNA 4R3DA 2DWNA 4M9XA 3HU2A 3HHYA 4IIWA 2JUJA 4QHTA 1WGLA 5EXPA 2JWSA 3GPYA 2UU9M 3PVSA 4MGHA 1MX0A 1AUAA 2DENA 3AV0A 3U6QA 2C9CA 5DNYA 3UZUA 4AQYM 1XC8A 2CWBA 2W82A 3V76A 2LVPC 2ZANA 3FTFA 4DR6M 3FYCA 3SBJA 1UFZA 4G4OA 3QYBA 2DKLA 4LJ9A 2M60A 2ZM6M 1P3QQ 4I8OA 3LVWA 5C1BA 1VQ1A 1W5SA 3DZDA 4OX9M 2LHGA 1N78A 2H5XA 1QYRA 1IXSA 3L27A 1FJGM 1QUTA 3U61A 4DUZM 2O5RA 2RGHA 3HJQA 5FSWA 2DZNB 1V33A 3KS4A 4DR1M 4PT5A 4GIPA 3BOSA 4FWDA 1YE9A 4KLNA 1E32A 5EP1A 3LQQA 3M6AA 1VDLA 2KZSA 4DR2M 2KDLA 3TE6A 1NNJA 3U61B 3SYKA 4GITA 3FUTA 1TGUA 1HQYE 3ILKA 3J80S 3NBXX 2CV0A 2JY5A 2YNMD 3HHZA 2HKJA 4LG2A 3GRVA 1Y8GA 2LVQD 3FUVA 3H4JA 2L7IA 4DBGB 4QOSA 1R5LA 4IBGA 3W0LB 2UUAM 2I7PA 3J81S 4AZFA 1G4AE 1QAMA 4CGYB 4QHSA 5IT9S 1WGNA 1L8QA 1TTEA 1WHCA 2JNHA 4P17A 4DV6M 1GKIA 3D8LA 2AHMA 2Y21A 4MGKE 5DYGA 3UGJA 1KFVA 4LF6M 1HNWM 1XWIA 3U6EA 4M0WA 4X66M 4GHLA 1YUBA 3JR4A 1SXJE 1G8PA 1GL6A 4NL4H 2RGOA 3HKPA 5FTKA 3U6CA 4LFBM 1GVNA 1EIJA 1GO5A 1TDHA 1E9RA 5KQ8A 2XSZD 2DAEA 5DYIA 4FCVA 3U6OA 1QUSA 2Z4SA 4AW4A 3GLIE 4XGIA 4LZJA 4Z8XA 1ZAEA 2ZAMA 1QAQA 5KPRA 1NJFA 5IREB 3KS8A 1QANA 3B7QA 3BBZA 4LJ7A 2LVOC 3U60B 1D2NA 4NRWA 3DA1A 1ZV1A 2EO2A 2KNZA 4LJ5A 3H4MA 3LMMA 2UUBM 1IN8A 3T38A 3TWMA 2JY7A 4NRVA 4UN2B 3KFUG 2KW0A 4GEWA 4DV4M 4DV1M 4XK8F 3E46A 2BNKA 3FUWA 3SAVA 2Y20A 4LCBA 5E26A 3Q8XA 1VG5A 1XB2B 1K3WA 5EP2A 3KW6A 1NHGC 1NJGA 3J27B 1XMOM 1SG9A 4GRIA 3TQSA 3GQ3A 2XEPA 1PJIA 1N36M 3I01M 4MH0E 3VDPA 2FH0A 2WZJA 4DR3M 4KODA 5EXSA 1X37A 1XXHA 4F1IA 3L26A 1IXZA 2DAGA 2G8LA 2X4AA 3DFZA 3UJNA 1HNXM 2D7HA 2DHYA 4MGYE 1YLAA 3T1HM 3GLHA 5L8RF 4LF7M 3IG5A 4JI7M 3K9OA 4LFAM 4LF8M 3GP1A 2KHHA 1Z6TA 5KPTA 3Q8GA 3IECA 4IBKA 4P16A 3B7ZA 2MH8A 1MN3A 2FS1A 1XXHB 1Q39A 1C1KA 3THGA 4REZA 3QWLA 2R65A 2QHOB 1OQYA 3T15A 1JQJC 1WIVA 2KNVA 1TDZA 1Z59A 3T6PA 1DGGA 2KA6B 4GC5A 5EXXA 1IY2A 1VDDA 5EQTA 4JI8M 2JY8A 4FCWA 1JR3D 3FUUA 4G4NA 3KOXE 3LCVB 1N32M 4GHAA 3AFHA 3GO8A 1QQWA 3VFDA 2F5OA 3SARA 1MJGM 2A5YB 1MU5A 2WSEF 3F92A 3K9PA 2EUCA 4R7GA 3WHLA 5ITXA 1C7YA 4L15A 3W0FA 2ERCA 5EP3A 1IN6A 3VK8A 4RF0A 3GQ4A 1TH2A 2BWBA 2QQ8A 4NC6A 2JXNA 1SXJB 2G5GX 2Y0TA 4IBCA 4LY6A 3SC3A 1E94E 1G41A 4MB7A 3JAMS 4JI5M 3NWLA 1VEKA 4DUYM 5E6JA 4JI6M 2ZTCA 3GRRA 3B9PA 2EKKA 1D0MA 2ZBKB 3J2PB 2XLJA 4D82A 2MROB 1UM8A 3K8ZA 4G6ZA 4XBOA 4CJ6A 5KPZA 4X65M 3HHXA 4AI6A 2UXBM 2F4VM 1IQPA 2OO9A 1IY1A 1E9SA 1DGHA 2K0BX 2Z7JA 2XF3A 3A42A 1IFYA 1IXRC 2DZLA 1I94M 4NXMM 4GMQA 1OAIA 5FTLA 1I4WA 2R44A 2ZAOA 3EIEA 2I7NA 3WHKA 1Z5AA 3CGWA 3HJSA 2C5RA 1QAOA 3LQRA 3C3EA 1Q3CA 3GRUA 3GLFA 4M9SA 4RKUF 5FTMA 5FLXS 4B3SM 1HJPA 2F5SA 1DGHB 4NOOB 1QDTA 1K3XA 4ITQA 1OTRA 2C98A 3SAUA 2YFQA 5JI2E 2R18A 3KOWE 4RNAA 3CF0A 3L25A 3GLFB 2DNAA 4NSRA 3W68A 3LCUA 3SAWA 5F3WA 2BWEA 2XH9A 4Y28F 2DAIA 1JR3A 3K1JA 4L8RC 3KP0E 4LGMA 4LJ8A 4G3OA 4IBEA 2E5LM 1KYIA 4LF9M 4DV2M 3LVVA 3PXGA 5EP4A 1T6OA 5ITQA 4FD2A 4ZPXA 3GLHE 1V92A 1N77A 3VKHA 2JZ1A 1J09A 4B7GA 3R8FA 3U60A 3MK6A 4OVZA 1SXJD 4LRTA 2K9DA 3GLGB 3R9XB 1Q3BA 1HT1E 4D80A 1D0KA 4M9ZA 2VF7A 5ITYA 1IBLM 3RE8A 2FOIC 1DGFA 1NVMA 5LMUM 1L2DA 2Z8YM 5KQDA 4GC9A 3A98B 2XGNA 1RU3A 1PRBA 1XHBA 3L2AA 4OVZB 3SYLA 3TL4X 2XZFA 1A5TA 1N75A 3KSXA 5FTJA 1PM5A 2UXDM 1TH3A 1IN5A 4JI3M 4KHPM 2MJ5B 2K6BA 4LZZA 4PCZA 2F5PA 2DI0A 1CUKA 1GLNA 3KOYE 2F5NA 4NXNM 4JI1M 3AL0C 4HEOA 1DGBA 5ITUA 3MHVC 1OJLA 2LXEA 1AIPC 4LJ6A 2V1UA 3EIHA 4JI4M 4QNRA 3TPZA
chains in the Genus database with same CATH topology
1DO0A 4B3RM 5LMNM 3SHFA 1IM2A 2QBYB 4I81A 1LV7A 3K92A 2UUCM 4FWHA 2HL7A 2Z4RA 3L29A 4M0DA 5C18A 2F5QA 4A3VB 3I4YA 1NY5A 4EIWA 1T3TA 3U5ZB 1L1ZA 4PDGA 2YR0A 4JXJA 2V6ZM 3AOEA 5BPVA 4JYAM 4B7FA 3TWKA 2H1RA 3SATA 4JN6A 2QPAA 1J5EM 2K47A 4JV5M 2RKOA 5FTNA 1Z5BA 4X64M 2EA0A 1SXJA 3RGSA 5IWAM 4JI2M 1N33M 5IZ7D 2HHHM 4DV5M 4B3TM 2J7OA 3ZC7B 3HHWA 4W5WA 2DHRA 4GKJM 1NSFA 2BJVA 1G3IA 4LRSA 5BR8M 1L2CA 2R46A 3GLIA 2OPFA 3PNYA 3U6MA 2XFSA 2DWLA 4DR4M 2QZ4A 1DO2A 8CATA 3GRYA 1HT2E 3HJ8A 3D8BA 2L7HA 4Z6YA 3J7AS 1K82A 3VKGA 2CE7A 4AKHA 4IJEA 4MM3B 4BBAA 4K0KM 3UK6A 4OW0A 3GLIB 4BLCA 2X49A 1EE8A 3CTWB 4IBFA 4WW0A 3JR5A 5ITRA 3HU3A 1IY0A 5JI3E 3SHGB 4NSOB 4QNMA 4LFCM 2CHGA 4QOZC 3SASA 2XZUA 4B08A 3A46A 4LJAA 4LF4M 2KXEA 4L16A 3I4VA 1Z5CA 3L28A 3IG8A 2CHVA 4S12A 3MJ5A 2V1CA 3U6SA 3KOZE 1PJJA 5GKNA 1R7RA 2FE8A 3DOAA 4DR5M 4WURA 3ZH9B 3KXEC 2FFJA 3UMMA 4X62M 4B7HA 3VLFB 2VQEM 1IN7A 4FW9A 3GPPA 1GL7A 3U6PA 4YY3M 4LF5M 1G59A 7CATA 1R2ZA 1NY6A 2R4JA 3PNVA 3RGPA 3AKZA 1XNRM 2CHQA 3E9SA 2BJWA 3AOGA 2C9OA 2Y0QA 3GLGA 2DXIA 3CF6E 4L78A 2C96A 4IBBA 4CHTB 3AJIB 3VK7A 3QAUA 4II7A 2KRKA 2CV2A 1IXSB 3VDUA 2KRUA 1OFIA 3AOEC 3FTEA 3HU1A 1XMQM 2DZOB 2OQ4A 4PD2A 1IBKM 4YHHM 3HGIA 2LNHC 4AG6A 3KP1E 4G4QA 4HLQA 1IBMM 4IBIA 3PFIA 1S3SA 2C99A 4HL4A 1TH4A 1QVRA 4RF1A 4DR7M 1SXJC 2CUZA 2DVWB 1ORYB 1R6BX 4LJ4A 3U6LA 3FD9A 3FTCA 3KVWA 2CFOA 3HWSA 2R45A 3A45A 1NHWC 3NBIA 2QBYA 1HNZM 3KSJA 4KO8A 5ITXE 4TUWA 5KO3A 4LGYA 4AG5A 4CISA 5EXTA 1IN4A 2LH0A 3U5ZA 2D7GA 4DV0M 2JA2A 4G4RA 4FVMA 2FNAA 4JI0M 3SFZA 1YSYA 1J7KA 2KEBA 2DWMA 2LWXA 3FYDA 3E4RA 1N34M 3J7BA 1L1TA 2UXCM 4GKKM 4FCTA 4DV3M 4MGIE 1H6UA 2XFTA 3OTOM 2R4EA 4DV7M 4B3MM 3CF2A 3FTDA 4D81A 2VIIA 2Q2EB 1ZQ9A 2QP9X 3GQ5A 3U6DA 2QENA 1HR0M 2DWZB 1OFHA 4BB9A 2CEAA 2Z3XA 2VQFM 3I51A 1HQCA 3ZCBB 1NNUC 2NQ8C 3SMPA 3T1YM 3M7GA 2L6OA 4GH9A 4L4UA 5ITTA 2L09A 4PDIA 3TWLA 1R2YA 4IBDA 2QCUA 2YQZA 3FUXA 2P5TA 4FWGA 1WXQA 5A2QS 4AKGA 3SMSA 2D7EA 1L2BA 4AKIA 2HCBA 4I4LA 3GLHB 1XNQM 3KDSE 3GPXA 3FKEA 4I5SA 1W5TA 5H37D 4IJFA 2KZUA 4IBJA 3GPUA 2X8AA 3C58A 2CV1A 2J7NA 1QZMA 4OU7A 5EJCA 3RFWA 2XSZA 1KSFX 3K2LA 4MGZE 2M5ZA 3M0EA 2R62A 1FNNA 4R3DA 2DWNA 4M9XA 3HU2A 3HHYA 4IIWA 4QHTA 5EXPA 3GPYA 2UU9M 3PVSA 4MGHA 1MX0A 3AV0A 3U6QA 2C9CA 5DNYA 3UZUA 4AQYM 1XC8A 2W82A 2ZANA 3FTFA 4DR6M 3FYCA 3SBJA 4G4OA 4LJ9A 2M60A 2ZM6M 4I8OA 3LVWA 5C1BA 3DZDA 1W5SA 4OX9M 1N78A 1QYRA 3L27A 1FJGM 3U61A 4DUZM 2O5RA 2RGHA 3HJQA 5FSWA 2DZNB 3KS4A 4DR1M 4PT5A 4GIPA 3BOSA 4FWDA 1YE9A 4KLNA 1E32A 5EP1A 3LQQA 3M6AA 2KZSA 4DR2M 3TE6A 1NNJA 3U61B 3SYKA 4GITA 3FUTA 1TGUA 1HQYE 3ILKA 3J80S 2CV0A 2YNMD 3HHZA 2HKJA 4LG2A 3GRVA 3FUVA 2L7IA 4QOSA 4IBGA 3W0LB 2UUAM 2I7PA 3J81S 4AZFA 1G4AE 1QAMA 4CGYB 4QHSA 5IT9S 1L8QA 4DV6M 1GKIA 3D8LA 2AHMA 2Y21A 4MGKE 5DYGA 3UGJA 1KFVA 4LF6M 1HNWM 1XWIA 3U6EA 4M0WA 4X66M 4GHLA 1YUBA 3JR4A 1SXJE 1G8PA 1GL6A 4NL4H 2RGOA 3HKPA 5FTKA 3U6CA 4LFBM 1GVNA 1TDHA 1E9RA 5KQ8A 2XSZD 5DYIA 4FCVA 3U6OA 2Z4SA 4AW4A 4XGIA 4LZJA 4Z8XA 1ZAEA 2ZAMA 1QAQA 5KPRA 1NJFA 5IREB 3KS8A 1QANA 4LJ7A 3U60B 1D2NA 4NRWA 3DA1A 2EO2A 4LJ5A 3H4MA 3LMMA 2UUBM 1IN8A 3T38A 3TWMA 4NRVA 3KFUG 2KW0A 4DV4M 4DV1M 2BNKA 3FUWA 3SAVA 2Y20A 4LCBA 5E26A 3Q8XA 1K3WA 5EP2A 3KW6A 1NHGC 1NJGA 3J27B 1XMOM 4GRIA 3TQSA 1PJIA 3GQ3A 2XEPA 1N36M 2F5PA 3VDPA 4MH0E 4DR3M 4KODA 5EXSA 1X37A 1XXHA 3L26A 1HNXM 1IXZA 2G8LA 2X4AA 3DFZA 3UJNA 2D7HA 4MGYE 3T1HM 3GLHA 4LF7M 3IG5A 4JI7M 4LFAM 4LF8M 3GP1A 1Z6TA 5KPTA 4IBKA 4P16A 1XXHB 1Q39A 1C1KA 3THGA 4REZA 3QWLA 2R65A 3T15A 1JQJC 1TDZA 1Z59A 1DGGA 2KA6B 4GC5A 5EXXA 1IY2A 1VDDA 5EQTA 4JI8M 4FCWA 1JR3D 3FUUA 4G4NA 3KOXE 1N32M 4GHAA 3AFHA 3GO8A 1QQWA 3VFDA 2F5OA 3SARA 2A5YB 1MU5A 2EUCA 4R7GA 3WHLA 5ITXA 4L15A 3W0FA 2ERCA 5EP3A 1IN6A 3VK8A 4RF0A 3GQ4A 1TH2A 1SXJB 2G5GX 2Y0TA 4IBCA 4LY6A 3SC3A 1E94E 1G41A 4MB7A 3JAMS 4JI5M 3NWLA 4DUYM 5E6JA 4JI6M 3GRRA 3B9PA 2ZBKB 3J2PB 2XLJA 4D82A 1UM8A 3K8ZA 4G6ZA 4XBOA 5KPZA 4X65M 3HHXA 4AI6A 2UXBM 2F4VM 1IQPA 1IY1A 1E9SA 1DGHA 2Z7JA 2XF3A 3A42A 1IXRC 1I94M 4NXMM 4GMQA 5FTLA 1I4WA 2ZAOA 3EIEA 2I7NA 3WHKA 1Z5AA 3HJSA 2C5RA 1QAOA 3LQRA 1Q3CA 3GRUA 3GLFA 4M9SA 5FTMA 5FLXS 4B3SM 2F5SA 1DGHB 4NOOB 4ITQA 1K3XA 2C98A 3SAUA 2YFQA 5JI2E 2R18A 3KOWE 4RNAA 3CF0A 3L25A 3GLFB 4NSRA 3SAWA 5F3WA 2XH9A 1JR3A 3K1JA 4L8RC 3KP0E 4LGMA 4LJ8A 4IBEA 2E5LM 1KYIA 4LF9M 4DV2M 3LVVA 3PXGA 5EP4A 5ITQA 4FD2A 4ZPXA 1N77A 3VKHA 1J09A 4B7GA 3R8FA 3U60A 3MK6A 4OVZA 1SXJD 4LRTA 3GLGB 3R9XB 1Q3BA 1HT1E 4D80A 4M9ZA 5ITYA 1IBLM 3RE8A 2FOIC 1DGFA 1NVMA 5LMUM 1L2DA 5KQDA 4GC9A 3A98B 2XGNA 1XHBA 4OVZB 3L2AA 3SYLA 3TL4X 2XZFA 5FTJA 1N75A 3KSXA 2UXDM 1PM5A 1TH3A 1IN5A 4JI3M 4KHPM 4LZZA 4PCZA 1GLNA 3KOYE 2F5NA 4NXNM 4JI1M 3AL0C 1DGBA 5ITUA 3MHVC 1OJLA 2LXEA 4LJ6A 2V1UA 4JI4M 3EIHA 4QNRA 3TPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD2 A;  1IBK M;  4OX9 M;  3GO8 A;  4B3R M;  5LMN M;  2F5O A;  3SAR A;  4YHH M;  1MU5 A;  2UUC M;  1FJG M;  4G4Q A;  4DUZ M;  1IBM M;  2F5Q A;  5ITX A;  3W0F A;  4DR7 M;  4DR1 M;  1L1Z A;  3U6L A;  3VK8 A;  4PDG A;  3GQ4 A;  3JAM S;  4JYA M;  4JI5 M;  3A45 A;  4MB7 A;  4DR2 M;  3TWK A;  1NNJ A;  1HNZ M;  4DUY M;  4JI6 M;  3SAT A;  2ZBK B;  5ITX E;  1J5E M;  3J80 S;  4X65 M;  4JV5 M;  4CIS A;  1Z5B A;  4X64 M;  4DV0 M;  2HKJ A;  2F4V M;  2UXB M;  2EA0 A;  4G4R A;  4JI0 M;  3A42 A;  5IWA M;  4JI2 M;  1N33 M;  2HHH M;  1I94 M;  4NXM M;  4DV5 M;  2UUA M;  3J81 S;  4B3T M;  4GKJ M;  5IT9 S;  1N34 M;  4DV6 M;  1Z5A A;  5BR8 M;  1L2C A;  4LF6 M;  1HNW M;  1Q3C A;  1KFV A;  1L1T A;  5FLX S;  3U6E A;  4B3S M;  4GKK M;  4X66 M;  2OPF A;  4DV3 M;  2UXC M;  3JR4 A;  2F5S A;  3U6M A;  4DR4 M;  3U6C A;  1K3X A;  4ITQ A;  4LFB M;  3OTO M;  3SAU A;  1TDH A;  4DV7 M;  4B3M M;  2Q2E B;  3J7A S;  3U6O A;  3GQ5 A;  3U6D A;  1K82 A;  4K0K M;  1HR0 M;  3SAW A;  1EE8 A;  3JR5 A;  2VQF M;  5ITR A;  3T1Y M;  5ITT A;  4LFC M;  4NRW A;  3SAS A;  4PDI A;  2XZU A;  3TWL A;  1R2Y A;  3A46 A;  4LF4 M;  2UUB M;  2E5L M;  3TWM A;  1Z5C A;  4NRV A;  4LF9 M;  4DV2 M;  5A2Q S;  5ITQ A;  4DV4 M;  4DV1 M;  1L2B A;  3U6S A;  3SAV A;  1PJJ A;  1XNQ M;  3GPX A;  3DOA A;  4DR5 M;  1K3W A;  3GPU A;  3C58 A;  1XMO M;  4X62 M;  2F5P A;  1PJI A;  3GQ3 A;  1N36 M;  1Q3B A;  2VQE M;  4DR3 M;  3GPP A;  3U6P A;  1HNX M;  4YY3 M;  4LF5 M;  5ITY A;  1IBL M;  1R2Z A;  5LMU M;  1L2D A;  3T1H M;  1XNR M;  4LF7 M;  4JI7 M;  4LFA M;  4LF8 M;  3GP1 A;  2XZF A;  2UXD M;  1PM5 A;  4JI3 M;  3GPY A;  1Q39 A;  2UU9 M;  4KHP M;  3VK7 A;  1MX0 A;  4PCZ A;  3U6Q A;  1TDZ A;  1Z59 A;  4AQY M;  2F5N A;  1XC8 A;  4NXN M;  4JI1 M;  5ITU A;  4JI8 M;  1XMQ M;  4DR6 M;  3SBJ A;  4JI4 M;  4G4O A;  4G4N A;  2OQ4 A;  1N32 M;  2ZM6 M; 
#chains in the Genus database with same CATH topology
 1DO0 A;  4B3R M;  5LMN M;  3SHF A;  1IM2 A;  2QBY B;  4I81 A;  1LV7 A;  3K92 A;  2UUC M;  4FWH A;  2HL7 A;  2Z4R A;  3L29 A;  4M0D A;  2O25 A;  5C18 A;  2F5Q A;  1BVS A;  1ZMW A;  4A3V B;  3I4Y A;  3HX3 A;  1NY5 A;  4EIW A;  3BXW A;  1T3T A;  3U5Z B;  1L1Z A;  4PDG A;  2YR0 A;  4JXJ A;  2V6Z M;  3AOE A;  1DV0 A;  5BPV A;  2EKF A;  1GAB A;  4JYA M;  2R0I A;  4B7F A;  3TWK A;  2H1R A;  3SAT A;  4JN6 A;  2KNA A;  2QPA A;  2QSF X;  1J5E M;  1NV8 A;  2K47 A;  4JV5 M;  2RKO A;  2VF8 A;  5FTN A;  2N35 A;  1Z5B A;  4X64 M;  2EA0 A;  5DFL A;  1PJT A;  2VDB B;  1SXJ A;  1WR1 B;  3RGS A;  5IWA M;  4JI2 M;  1N33 M;  5IZ7 D;  3E21 A;  2HHH M;  4DV5 M;  4B3T M;  1V34 A;  2J7O A;  3ZC7 B;  3HHW A;  4W5W A;  2DHR A;  2OOB A;  4GKJ M;  1NSF A;  1ZMU A;  2BJV A;  1G3I A;  4LRS A;  5BR8 M;  1L2C A;  2R46 A;  2WSC F;  3IHP A;  3GLI A;  2OPF A;  3PNY A;  2MR9 A;  3U6M A;  2XFS A;  2DWL A;  4DR4 M;  1OKS A;  1OAO C;  2LVA A;  2QZ4 A;  1DO2 A;  8CAT A;  3GRY A;  1PJQ A;  1R4G A;  1HT2 E;  3HJ8 A;  3I04 M;  3D8B A;  2L7H A;  3W67 A;  4Z6Y A;  3J7A S;  2CP8 A;  1K82 A;  3VKG A;  2CE7 A;  4AKH A;  4IJE A;  4MM3 B;  4BBA A;  4K0K M;  3UK6 A;  4OW0 A;  3GLI B;  2GNO A;  4BLC A;  2X49 A;  1EE8 A;  3CTW B;  4IBF A;  4WW0 A;  3JR5 A;  5ITR A;  3HU3 A;  1IY0 A;  5JI3 E;  3SHG B;  1NV9 A;  4NSO B;  1TF0 B;  2CHG A;  2OOA A;  4QNM A;  2R6F A;  3SAS A;  4LFC M;  2XZU A;  4QOZ C;  4B08 A;  3A46 A;  3B74 A;  4LJA A;  4LF4 M;  1JB0 F;  2KXE A;  4L16 A;  3I4V A;  4Q7J A;  1Z5C A;  3L28 A;  3IG8 A;  2L2D A;  1EFU B;  2CHV A;  4S12 A;  3MJ5 A;  1QDR A;  2V1C A;  3U6S A;  3KOZ E;  2DAM A;  2MGW A;  1PJJ A;  2O01 F;  5GKN A;  1R7R A;  2FE8 A;  3DOA A;  4DR5 M;  4WUR A;  1GJS A;  3ZH9 B;  3FE3 A;  3KXE C;  2FFJ A;  3UMM A;  4X62 M;  4B7H A;  4CIZ A;  3VLF B;  2VQE M;  1IN7 A;  1G71 A;  4FW9 A;  3GPP A;  1GL7 A;  3U6P A;  2J5Y A;  4YY3 M;  4LF5 M;  1G59 A;  7CAT A;  1VEG A;  1R2Z A;  1NY6 A;  2R4J A;  3PNV A;  3RGP A;  2WSF F;  3AKZ A;  1XNR M;  1PJS A;  2CHQ A;  3E9S A;  2BJW A;  3AOG A;  2C9O A;  2Y0Q A;  3GLG A;  2DXI A;  3CF6 E;  3LW5 F;  3B89 A;  1XXH E;  2C96 A;  4IBB A;  4L78 A;  4CHT B;  1OIP A;  3AJI B;  3VK7 A;  3QAU A;  4II7 A;  2KRK A;  2CV2 A;  1IXS B;  3VDU A;  3C9P A;  2KRU A;  2QNJ A;  1OFI A;  3AOE C;  3FTE A;  3HU1 A;  1XMQ M;  1WJ7 A;  2DZO B;  2OQ4 A;  2ZTD A;  4PD2 A;  1IBK M;  4YHH M;  2DAK A;  3HGI A;  2LNH C;  4AG6 A;  3KP1 E;  2B3T A;  3HY5 A;  2HAK A;  4G4Q A;  1OIZ A;  4HLQ A;  1IBM M;  4IBI A;  2GQF A;  3PFI A;  1S3S A;  2C99 A;  2G3Q A;  4HL4 A;  1TH4 A;  3FRH A;  1QVR A;  4RF1 A;  4DR7 M;  1SXJ C;  2CUZ A;  1PGY A;  1ORY B;  1R6B X;  2DVW B;  4LJ4 A;  3U6L A;  3FD9 A;  3FTC A;  3KVW A;  2CFO A;  3HWS A;  2R45 A;  3A45 A;  1NHW C;  3NBI A;  2QBY A;  1GJT A;  1HNZ M;  3KSJ A;  4KO8 A;  5ITX E;  4R71 A;  2LTU A;  4TUW A;  4ANR A;  4LGY A;  4AG5 A;  5KO3 A;  3QYE A;  4CIS A;  5EXT A;  3B7N A;  1IN4 A;  2EJS A;  2LH0 A;  2D7G A;  3U5Z A;  4DV0 M;  2JA2 A;  4G4R A;  4FVM A;  2FNA A;  2JP7 A;  3MMP A;  4JI0 M;  3SFZ A;  2RRU A;  1YSY A;  1J7K A;  2APL A;  2KEB A;  2DWM A;  2LWX A;  1TR8 A;  3FYD A;  3E4R A;  1N34 M;  2LHC A;  4WP2 A;  3J7B A;  4KT0 F;  2HWJ A;  1L1T A;  4GKK M;  2UXC M;  2LVN C;  4FCT A;  1NO1 A;  4DV3 M;  2L4F A;  4MGI E;  1H6U A;  2XFT A;  3OTO M;  1F4I A;  4F2L A;  2R4E A;  4DV7 M;  4B3M M;  3CF2 A;  3FTD A;  4D81 A;  2VII A;  1Q02 A;  2Q2E B;  3FRI A;  1ZQ9 A;  1T43 A;  2QP9 X;  3GQ5 A;  3U6D A;  3GLF E;  2QEN A;  1HR0 M;  2CRU A;  2DWZ B;  1OFH A;  4BB9 A;  2CEA A;  2Z3X A;  2VQF M;  3I51 A;  1HQC A;  3ZCB B;  1D0L A;  1NNU C;  2NQ8 C;  3SMP A;  3T1Y M;  3M7G A;  2L6O A;  4GH9 A;  4L4U A;  3HZJ A;  5ITT A;  2L09 A;  3C3D A;  4PDI A;  3TWL A;  1R2Y A;  4IBD A;  2L4E A;  2JZ0 A;  2QCU A;  1VEJ A;  2YQZ A;  2P5T A;  3FUX A;  4FWG A;  1WXQ A;  4L6V 6;  5A2Q S;  4AKG A;  3SMS A;  2D7E A;  1L2B A;  1ZMV A;  3ZQJ A;  4AKI A;  2HCB A;  1JR3 E;  3GLH B;  4I4L A;  1XNQ M;  3KDS E;  3GPX A;  3FKE A;  4I5S A;  1W5T A;  5H37 D;  4IJF A;  3GLG E;  2KZU A;  4IBJ A;  3GPU A;  2X8A A;  3C58 A;  1QZE A;  2CV1 A;  2J7N A;  1QZM A;  2JY6 B;  5EJC A;  3RFW A;  4OU7 A;  2XSZ A;  1KSF X;  3K2L A;  1LTM A;  2M5Z A;  3M0E A;  4MGZ E;  2LBC A;  2R62 A;  1FNN A;  4R3D A;  2DWN A;  4M9X A;  3HU2 A;  3HHY A;  4IIW A;  2JUJ A;  4QHT A;  1WGL A;  5EXP A;  2JWS A;  3GPY A;  2UU9 M;  3PVS A;  4MGH A;  1MX0 A;  1AUA A;  2DEN A;  3AV0 A;  3U6Q A;  2C9C A;  5DNY A;  3UZU A;  4AQY M;  1XC8 A;  2CWB A;  2W82 A;  3V76 A;  2LVP C;  2ZAN A;  3FTF A;  4DR6 M;  3FYC A;  3SBJ A;  1UFZ A;  4G4O A;  3QYB A;  2DKL A;  4LJ9 A;  2M60 A;  2ZM6 M;  1P3Q Q;  4I8O A;  3LVW A;  5C1B A;  1VQ1 A;  1W5S A;  3DZD A;  4OX9 M;  2LHG A;  1N78 A;  2H5X A;  1QYR A;  1IXS A;  3L27 A;  1FJG M;  1QUT A;  3U61 A;  4DUZ M;  2O5R A;  2RGH A;  3HJQ A;  5FSW A;  2DZN B;  1V33 A;  3KS4 A;  4DR1 M;  4PT5 A;  4GIP A;  3BOS A;  4FWD A;  1YE9 A;  4KLN A;  1E32 A;  5EP1 A;  3LQQ A;  3M6A A;  1VDL A;  2KZS A;  4DR2 M;  2KDL A;  3TE6 A;  1NNJ A;  3U61 B;  3SYK A;  4GIT A;  3FUT A;  1TGU A;  1HQY E;  3ILK A;  3J80 S;  3NBX X;  2CV0 A;  2JY5 A;  2YNM D;  3HHZ A;  2HKJ A;  4LG2 A;  3GRV A;  1Y8G A;  2LVQ D;  3FUV A;  3H4J A;  2L7I A;  4DBG B;  4QOS A;  1R5L A;  4IBG A;  3W0L B;  2UUA M;  2I7P A;  3J81 S;  4AZF A;  1G4A E;  1QAM A;  4CGY B;  4QHS A;  5IT9 S;  1WGN A;  1L8Q A;  1TTE A;  1WHC A;  2JNH A;  4P17 A;  4DV6 M;  1GKI A;  3D8L A;  2AHM A;  2Y21 A;  4MGK E;  5DYG A;  3UGJ A;  1KFV A;  4LF6 M;  1HNW M;  1XWI A;  3U6E A;  4M0W A;  4X66 M;  4GHL A;  1YUB A;  3JR4 A;  1SXJ E;  1G8P A;  1GL6 A;  4NL4 H;  2RGO A;  3HKP A;  5FTK A;  3U6C A;  4LFB M;  1GVN A;  1EIJ A;  1GO5 A;  1TDH A;  1E9R A;  5KQ8 A;  2XSZ D;  2DAE A;  5DYI A;  4FCV A;  3U6O A;  1QUS A;  2Z4S A;  4AW4 A;  3GLI E;  4XGI A;  4LZJ A;  4Z8X A;  1ZAE A;  2ZAM A;  1QAQ A;  5KPR A;  1NJF A;  5IRE B;  3KS8 A;  1QAN A;  3B7Q A;  3BBZ A;  4LJ7 A;  2LVO C;  3U60 B;  1D2N A;  4NRW A;  3DA1 A;  1ZV1 A;  2EO2 A;  2KNZ A;  4LJ5 A;  3H4M A;  3LMM A;  2UUB M;  1IN8 A;  3T38 A;  3TWM A;  2JY7 A;  4NRV A;  4UN2 B;  3KFU G;  2KW0 A;  4GEW A;  4DV4 M;  4DV1 M;  4XK8 F;  3E46 A;  2BNK A;  3FUW A;  3SAV A;  2Y20 A;  4LCB A;  5E26 A;  3Q8X A;  1VG5 A;  1XB2 B;  1K3W A;  5EP2 A;  3KW6 A;  1NHG C;  1NJG A;  3J27 B;  1XMO M;  1SG9 A;  4GRI A;  3TQS A;  3GQ3 A;  2XEP A;  1PJI A;  1N36 M;  3I01 M;  4MH0 E;  3VDP A;  2FH0 A;  2WZJ A;  4DR3 M;  4KOD A;  5EXS A;  1X37 A;  1XXH A;  4F1I A;  3L26 A;  1IXZ A;  2DAG A;  2G8L A;  2X4A A;  3DFZ A;  3UJN A;  1HNX M;  2D7H A;  2DHY A;  4MGY E;  1YLA A;  3T1H M;  3GLH A;  5L8R F;  4LF7 M;  3IG5 A;  4JI7 M;  3K9O A;  4LFA M;  4LF8 M;  3GP1 A;  2KHH A;  1Z6T A;  5KPT A;  3Q8G A;  3IEC A;  4IBK A;  4P16 A;  3B7Z A;  2MH8 A;  1MN3 A;  2FS1 A;  1XXH B;  1Q39 A;  1C1K A;  3THG A;  4REZ A;  3QWL A;  2R65 A;  2QHO B;  1OQY A;  3T15 A;  1JQJ C;  1WIV A;  2KNV A;  1TDZ A;  1Z59 A;  3T6P A;  1DGG A;  2KA6 B;  4GC5 A;  5EXX A;  1IY2 A;  1VDD A;  5EQT A;  4JI8 M;  2JY8 A;  4FCW A;  1JR3 D;  3FUU A;  4G4N A;  3KOX E;  3LCV B;  1N32 M;  4GHA A;  3AFH A;  3GO8 A;  1QQW A;  3VFD A;  2F5O A;  3SAR A;  1MJG M;  2A5Y B;  1MU5 A;  2WSE F;  3F92 A;  3K9P A;  2EUC A;  4R7G A;  3WHL A;  5ITX A;  1C7Y A;  4L15 A;  3W0F A;  2ERC A;  5EP3 A;  1IN6 A;  3VK8 A;  4RF0 A;  3GQ4 A;  1TH2 A;  2BWB A;  2QQ8 A;  4NC6 A;  2JXN A;  1SXJ B;  2G5G X;  2Y0T A;  4IBC A;  4LY6 A;  3SC3 A;  1E94 E;  1G41 A;  4MB7 A;  3JAM S;  4JI5 M;  3NWL A;  1VEK A;  4DUY M;  5E6J A;  4JI6 M;  2ZTC A;  3GRR A;  3B9P A;  2EKK A;  1D0M A;  2ZBK B;  3J2P B;  2XLJ A;  4D82 A;  2MRO B;  1UM8 A;  3K8Z A;  4G6Z A;  4XBO A;  4CJ6 A;  5KPZ A;  4X65 M;  3HHX A;  4AI6 A;  2UXB M;  2F4V M;  1IQP A;  2OO9 A;  1IY1 A;  1E9S A;  1DGH A;  2K0B X;  2Z7J A;  2XF3 A;  3A42 A;  1IFY A;  1IXR C;  2DZL A;  1I94 M;  4NXM M;  4GMQ A;  1OAI A;  5FTL A;  1I4W A;  2R44 A;  2ZAO A;  3EIE A;  2I7N A;  3WHK A;  1Z5A A;  3CGW A;  3HJS A;  2C5R A;  1QAO A;  3LQR A;  3C3E A;  1Q3C A;  3GRU A;  3GLF A;  4M9S A;  4RKU F;  5FTM A;  5FLX S;  4B3S M;  1HJP A;  2F5S A;  1DGH B;  4NOO B;  1QDT A;  1K3X A;  4ITQ A;  1OTR A;  2C98 A;  3SAU A;  2YFQ A;  5JI2 E;  2R18 A;  3KOW E;  4RNA A;  3CF0 A;  3L25 A;  3GLF B;  2DNA A;  4NSR A;  3W68 A;  3LCU A;  3SAW A;  5F3W A;  2BWE A;  2XH9 A;  4Y28 F;  2DAI A;  1JR3 A;  3K1J A;  4L8R C;  3KP0 E;  4LGM A;  4LJ8 A;  4G3O A;  4IBE A;  2E5L M;  1KYI A;  4LF9 M;  4DV2 M;  3LVV A;  3PXG A;  5EP4 A;  1T6O A;  5ITQ A;  4FD2 A;  4ZPX A;  3GLH E;  1V92 A;  1N77 A;  3VKH A;  2JZ1 A;  1J09 A;  4B7G A;  3R8F A;  3U60 A;  3MK6 A;  4OVZ A;  1SXJ D;  4LRT A;  2K9D A;  3GLG B;  3R9X B;  1Q3B A;  1HT1 E;  4D80 A;  1D0K A;  4M9Z A;  2VF7 A;  5ITY A;  1IBL M;  3RE8 A;  2FOI C;  1DGF A;  1NVM A;  5LMU M;  1L2D A;  2Z8Y M;  5KQD A;  4GC9 A;  3A98 B;  2XGN A;  1RU3 A;  1PRB A;  1XHB A;  3L2A A;  4OVZ B;  3SYL A;  3TL4 X;  2XZF A;  1A5T A;  1N75 A;  3KSX A;  5FTJ A;  1PM5 A;  2UXD M;  1TH3 A;  1IN5 A;  4JI3 M;  4KHP M;  2MJ5 B;  2K6B A;  4LZZ A;  4PCZ A;  2F5P A;  2DI0 A;  1CUK A;  1GLN A;  3KOY E;  2F5N A;  4NXN M;  4JI1 M;  3AL0 C;  4HEO A;  1DGB A;  5ITU A;  3MHV C;  1OJL A;  2LXE A;  1AIP C;  4LJ6 A;  2V1U A;  3EIH A;  4JI4 M;  4QNR A;  3TPZ A; 
#chains in the Genus database with same CATH homology
 1DO0 A;  4B3R M;  5LMN M;  3SHF A;  1IM2 A;  2QBY B;  4I81 A;  1LV7 A;  3K92 A;  2UUC M;  4FWH A;  2HL7 A;  2Z4R A;  3L29 A;  4M0D A;  5C18 A;  2F5Q A;  4A3V B;  3I4Y A;  1NY5 A;  4EIW A;  1T3T A;  3U5Z B;  1L1Z A;  4PDG A;  2YR0 A;  4JXJ A;  2V6Z M;  3AOE A;  5BPV A;  4JYA M;  4B7F A;  3TWK A;  2H1R A;  3SAT A;  4JN6 A;  2QPA A;  1J5E M;  2K47 A;  4JV5 M;  2RKO A;  5FTN A;  1Z5B A;  4X64 M;  2EA0 A;  1SXJ A;  3RGS A;  5IWA M;  4JI2 M;  1N33 M;  5IZ7 D;  2HHH M;  4DV5 M;  4B3T M;  2J7O A;  3ZC7 B;  3HHW A;  4W5W A;  2DHR A;  4GKJ M;  1NSF A;  2BJV A;  1G3I A;  4LRS A;  5BR8 M;  1L2C A;  2R46 A;  3GLI A;  2OPF A;  3PNY A;  3U6M A;  2XFS A;  2DWL A;  4DR4 M;  2QZ4 A;  1DO2 A;  8CAT A;  3GRY A;  1HT2 E;  3HJ8 A;  3D8B A;  2L7H A;  4Z6Y A;  3J7A S;  1K82 A;  3VKG A;  2CE7 A;  4AKH A;  4IJE A;  4MM3 B;  4BBA A;  4K0K M;  3UK6 A;  4OW0 A;  3GLI B;  4BLC A;  2X49 A;  1EE8 A;  3CTW B;  4IBF A;  4WW0 A;  3JR5 A;  5ITR A;  3HU3 A;  1IY0 A;  5JI3 E;  3SHG B;  4NSO B;  4QNM A;  4LFC M;  2CHG A;  4QOZ C;  3SAS A;  2XZU A;  4B08 A;  3A46 A;  4LJA A;  4LF4 M;  2KXE A;  4L16 A;  3I4V A;  1Z5C A;  3L28 A;  3IG8 A;  2CHV A;  4S12 A;  3MJ5 A;  2V1C A;  3U6S A;  3KOZ E;  1PJJ A;  5GKN A;  1R7R A;  2FE8 A;  3DOA A;  4DR5 M;  4WUR A;  3ZH9 B;  3KXE C;  2FFJ A;  3UMM A;  4X62 M;  4B7H A;  3VLF B;  2VQE M;  1IN7 A;  4FW9 A;  3GPP A;  1GL7 A;  3U6P A;  4YY3 M;  4LF5 M;  1G59 A;  7CAT A;  1R2Z A;  1NY6 A;  2R4J A;  3PNV A;  3RGP A;  3AKZ A;  1XNR M;  2CHQ A;  3E9S A;  2BJW A;  3AOG A;  2C9O A;  2Y0Q A;  3GLG A;  2DXI A;  3CF6 E;  4L78 A;  2C96 A;  4IBB A;  4CHT B;  3AJI B;  3VK7 A;  3QAU A;  4II7 A;  2KRK A;  2CV2 A;  1IXS B;  3VDU A;  2KRU A;  1OFI A;  3AOE C;  3FTE A;  3HU1 A;  1XMQ M;  2DZO B;  2OQ4 A;  4PD2 A;  1IBK M;  4YHH M;  3HGI A;  2LNH C;  4AG6 A;  3KP1 E;  4G4Q A;  4HLQ A;  1IBM M;  4IBI A;  3PFI A;  1S3S A;  2C99 A;  4HL4 A;  1TH4 A;  1QVR A;  4RF1 A;  4DR7 M;  1SXJ C;  2CUZ A;  2DVW B;  1ORY B;  1R6B X;  4LJ4 A;  3U6L A;  3FD9 A;  3FTC A;  3KVW A;  2CFO A;  3HWS A;  2R45 A;  3A45 A;  1NHW C;  3NBI A;  2QBY A;  1HNZ M;  3KSJ A;  4KO8 A;  5ITX E;  4TUW A;  5KO3 A;  4LGY A;  4AG5 A;  4CIS A;  5EXT A;  1IN4 A;  2LH0 A;  3U5Z A;  2D7G A;  4DV0 M;  2JA2 A;  4G4R A;  4FVM A;  2FNA A;  4JI0 M;  3SFZ A;  1YSY A;  1J7K A;  2KEB A;  2DWM A;  2LWX A;  3FYD A;  3E4R A;  1N34 M;  3J7B A;  1L1T A;  2UXC M;  4GKK M;  4FCT A;  4DV3 M;  4MGI E;  1H6U A;  2XFT A;  3OTO M;  2R4E A;  4DV7 M;  4B3M M;  3CF2 A;  3FTD A;  4D81 A;  2VII A;  2Q2E B;  1ZQ9 A;  2QP9 X;  3GQ5 A;  3U6D A;  2QEN A;  1HR0 M;  2DWZ B;  1OFH A;  4BB9 A;  2CEA A;  2Z3X A;  2VQF M;  3I51 A;  1HQC A;  3ZCB B;  1NNU C;  2NQ8 C;  3SMP A;  3T1Y M;  3M7G A;  2L6O A;  4GH9 A;  4L4U A;  5ITT A;  2L09 A;  4PDI A;  3TWL A;  1R2Y A;  4IBD A;  2QCU A;  2YQZ A;  3FUX A;  2P5T A;  4FWG A;  1WXQ A;  5A2Q S;  4AKG A;  3SMS A;  2D7E A;  1L2B A;  4AKI A;  2HCB A;  4I4L A;  3GLH B;  1XNQ M;  3KDS E;  3GPX A;  3FKE A;  4I5S A;  1W5T A;  5H37 D;  4IJF A;  2KZU A;  4IBJ A;  3GPU A;  2X8A A;  3C58 A;  2CV1 A;  2J7N A;  1QZM A;  4OU7 A;  5EJC A;  3RFW A;  2XSZ A;  1KSF X;  3K2L A;  4MGZ E;  2M5Z A;  3M0E A;  2R62 A;  1FNN A;  4R3D A;  2DWN A;  4M9X A;  3HU2 A;  3HHY A;  4IIW A;  4QHT A;  5EXP A;  3GPY A;  2UU9 M;  3PVS A;  4MGH A;  1MX0 A;  3AV0 A;  3U6Q A;  2C9C A;  5DNY A;  3UZU A;  4AQY M;  1XC8 A;  2W82 A;  2ZAN A;  3FTF A;  4DR6 M;  3FYC A;  3SBJ A;  4G4O A;  4LJ9 A;  2M60 A;  2ZM6 M;  4I8O A;  3LVW A;  5C1B A;  3DZD A;  1W5S A;  4OX9 M;  1N78 A;  1QYR A;  3L27 A;  1FJG M;  3U61 A;  4DUZ M;  2O5R A;  2RGH A;  3HJQ A;  5FSW A;  2DZN B;  3KS4 A;  4DR1 M;  4PT5 A;  4GIP A;  3BOS A;  4FWD A;  1YE9 A;  4KLN A;  1E32 A;  5EP1 A;  3LQQ A;  3M6A A;  2KZS A;  4DR2 M;  3TE6 A;  1NNJ A;  3U61 B;  3SYK A;  4GIT A;  3FUT A;  1TGU A;  1HQY E;  3ILK A;  3J80 S;  2CV0 A;  2YNM D;  3HHZ A;  2HKJ A;  4LG2 A;  3GRV A;  3FUV A;  2L7I A;  4QOS A;  4IBG A;  3W0L B;  2UUA M;  2I7P A;  3J81 S;  4AZF A;  1G4A E;  1QAM A;  4CGY B;  4QHS A;  5IT9 S;  1L8Q A;  4DV6 M;  1GKI A;  3D8L A;  2AHM A;  2Y21 A;  4MGK E;  5DYG A;  3UGJ A;  1KFV A;  4LF6 M;  1HNW M;  1XWI A;  3U6E A;  4M0W A;  4X66 M;  4GHL A;  1YUB A;  3JR4 A;  1SXJ E;  1G8P A;  1GL6 A;  4NL4 H;  2RGO A;  3HKP A;  5FTK A;  3U6C A;  4LFB M;  1GVN A;  1TDH A;  1E9R A;  5KQ8 A;  2XSZ D;  5DYI A;  4FCV A;  3U6O A;  2Z4S A;  4AW4 A;  4XGI A;  4LZJ A;  4Z8X A;  1ZAE A;  2ZAM A;  1QAQ A;  5KPR A;  1NJF A;  5IRE B;  3KS8 A;  1QAN A;  4LJ7 A;  3U60 B;  1D2N A;  4NRW A;  3DA1 A;  2EO2 A;  4LJ5 A;  3H4M A;  3LMM A;  2UUB M;  1IN8 A;  3T38 A;  3TWM A;  4NRV A;  3KFU G;  2KW0 A;  4DV4 M;  4DV1 M;  2BNK A;  3FUW A;  3SAV A;  2Y20 A;  4LCB A;  5E26 A;  3Q8X A;  1K3W A;  5EP2 A;  3KW6 A;  1NHG C;  1NJG A;  3J27 B;  1XMO M;  4GRI A;  3TQS A;  1PJI A;  3GQ3 A;  2XEP A;  1N36 M;  2F5P A;  3VDP A;  4MH0 E;  4DR3 M;  4KOD A;  5EXS A;  1X37 A;  1XXH A;  3L26 A;  1HNX M;  1IXZ A;  2G8L A;  2X4A A;  3DFZ A;  3UJN A;  2D7H A;  4MGY E;  3T1H M;  3GLH A;  4LF7 M;  3IG5 A;  4JI7 M;  4LFA M;  4LF8 M;  3GP1 A;  1Z6T A;  5KPT A;  4IBK A;  4P16 A;  1XXH B;  1Q39 A;  1C1K A;  3THG A;  4REZ A;  3QWL A;  2R65 A;  3T15 A;  1JQJ C;  1TDZ A;  1Z59 A;  1DGG A;  2KA6 B;  4GC5 A;  5EXX A;  1IY2 A;  1VDD A;  5EQT A;  4JI8 M;  4FCW A;  1JR3 D;  3FUU A;  4G4N A;  3KOX E;  1N32 M;  4GHA A;  3AFH A;  3GO8 A;  1QQW A;  3VFD A;  2F5O A;  3SAR A;  2A5Y B;  1MU5 A;  2EUC A;  4R7G A;  3WHL A;  5ITX A;  4L15 A;  3W0F A;  2ERC A;  5EP3 A;  1IN6 A;  3VK8 A;  4RF0 A;  3GQ4 A;  1TH2 A;  1SXJ B;  2G5G X;  2Y0T A;  4IBC A;  4LY6 A;  3SC3 A;  1E94 E;  1G41 A;  4MB7 A;  3JAM S;  4JI5 M;  3NWL A;  4DUY M;  5E6J A;  4JI6 M;  3GRR A;  3B9P A;  2ZBK B;  3J2P B;  2XLJ A;  4D82 A;  1UM8 A;  3K8Z A;  4G6Z A;  4XBO A;  5KPZ A;  4X65 M;  3HHX A;  4AI6 A;  2UXB M;  2F4V M;  1IQP A;  1IY1 A;  1E9S A;  1DGH A;  2Z7J A;  2XF3 A;  3A42 A;  1IXR C;  1I94 M;  4NXM M;  4GMQ A;  5FTL A;  1I4W A;  2ZAO A;  3EIE A;  2I7N A;  3WHK A;  1Z5A A;  3HJS A;  2C5R A;  1QAO A;  3LQR A;  1Q3C A;  3GRU A;  3GLF A;  4M9S A;  5FTM A;  5FLX S;  4B3S M;  2F5S A;  1DGH B;  4NOO B;  4ITQ A;  1K3X A;  2C98 A;  3SAU A;  2YFQ A;  5JI2 E;  2R18 A;  3KOW E;  4RNA A;  3CF0 A;  3L25 A;  3GLF B;  4NSR A;  3SAW A;  5F3W A;  2XH9 A;  1JR3 A;  3K1J A;  4L8R C;  3KP0 E;  4LGM A;  4LJ8 A;  4IBE A;  2E5L M;  1KYI A;  4LF9 M;  4DV2 M;  3LVV A;  3PXG A;  5EP4 A;  5ITQ A;  4FD2 A;  4ZPX A;  1N77 A;  3VKH A;  1J09 A;  4B7G A;  3R8F A;  3U60 A;  3MK6 A;  4OVZ A;  1SXJ D;  4LRT A;  3GLG B;  3R9X B;  1Q3B A;  1HT1 E;  4D80 A;  4M9Z A;  5ITY A;  1IBL M;  3RE8 A;  2FOI C;  1DGF A;  1NVM A;  5LMU M;  1L2D A;  5KQD A;  4GC9 A;  3A98 B;  2XGN A;  1XHB A;  4OVZ B;  3L2A A;  3SYL A;  3TL4 X;  2XZF A;  5FTJ A;  1N75 A;  3KSX A;  2UXD M;  1PM5 A;  1TH3 A;  1IN5 A;  4JI3 M;  4KHP M;  4LZZ A;  4PCZ A;  1GLN A;  3KOY E;  2F5N A;  4NXN M;  4JI1 M;  3AL0 C;  1DGB A;  5ITU A;  3MHV C;  1OJL A;  2LXE A;  4LJ6 A;  2V1U A;  4JI4 M;  3EIH A;  4QNR A;  3TPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...