4JYAM

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jyaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jyaM02
3SAVA 3GPPA 4DR6M 4DV4M 1NNJA 3GQ3A 2VQFM 1IBLM 1Z5BA 4B3MM 4JYAM 3U6QA 3SASA 3JAMS 1HNZM 2Q2EB 4YHHM 4LF7M 4DV1M 4DR1M 3U6CA 3U6PA 4DUZM 2F5SA 1IBMM 1L2DA 4DR2M 5LMNM 4DR5M 4LF8M 1L2CA 1PJJA 1XC8A 3GP1A 4G4QA 3GO8A 1L1TA 2HHHM 5A2QS 4X66M 2F5OA 4JI3M 5ITTA 4G4NA 3T1YM 1N32M 4PD2A 4G4OA 3U6LA 4NRVA 3J81S 2UXDM 3GPXA 3TWKA 2F5PA 1R2ZA 4KHPM 2OPFA 1R2YA 2F4VM 4JI5M 4X64M 1N36M 3U6OA 2F5QA 1N33M 4DV5M 5ITXA 4DR7M 3U6SA 1HNXM 4NXMM 4JI1M 3U6MA 1L2BA 4DR4M 4X65M 3SARA 4K0KM 3U6DA 4GKKM 1Q3BA 4YY3M 2UUBM 4LF6M 5ITQA 4LFBM 3TWLA 3SAWA 1FJGM 4B3RM 5BR8M 3SATA 4X62M 4OX9M 1Q3CA 5IT9S 1HNWM 3J80S 2VQEM 5ITXE 1IBKM 2UUAM 2ZBKB 4DV0M 1PJIA 4JI4M 2UXBM 1EE8A 5IWAM 1L1ZA 4JI7M 1TDHA 4DR3M 4JV5M 3DOAA 4DV2M 1XNQM 3GPYA 1N34M 1XNRM 1MU5A 4AQYM 4NXNM 2XZUA 4PDGA 3VK8A 1XMOM 4MB7A 1XMQM 1PM5A 2F5NA 2HKJA 4LF9M 5ITRA 4DUYM 4B3SM 1MX0A 3JR4A 5ITUA 3A45A 4ITQA 1K3XA 3TWMA 4DV6M 3GQ5A 4LF4M 3A46A 3J7AS 2UUCM 1Z5CA 3JR5A 5ITYA 3VK7A 4DV3M 1K82A 2OQ4A 1Z5AA 4CISA 4DV7M 2EA0A 3SBJA 4GKJM 4LFAM 3A42A 5LMUM 2XZFA 4JI0M 1I94M 1Z59A 4JI8M 5FLXS 1KFVA 1K3WA 4NRWA 3GPUA 3SAUA 4B3TM 1HR0M 3W0FA 4PDIA 1J5EM 4LF5M 3T1HM 3OTOM 4JI2M 3U6EA 2UU9M 4LFCM 2E5LM 4JI6M 3C58A 4G4RA 1Q39A 2UXCM 1TDZA 4PCZA 2ZM6M 3GQ4A
chains in the Genus database with same CATH superfamily
1WXQA 1V92A 2KDLA 4DV4M 1NJFA 2VQFM 4M9ZA 1TF0B 2JXNA 3GLFA 3U6QA 1GLNA 2CUZA 2FOIC 1SXJA 2I7NA 2A5YB 3J2PB 3U60B 2M5ZA 2Q2EB 4FWDA 4FVMA 2MJ5B 2R62A 3A98B 1TH2A 4DR1M 3U6CA 4M0DA 4QOZC 2N35A 3GRVA 4MM3B 1AUAA 1V33A 5LMNM 1DO2A 1ZQ9A 2JY5A 1TGUA 2L7IA 4F1IA 2Z8YM 1WJ7A 2JUJA 2LVOC 3LQQA 3CTWB 3GO8A 2O01F 1TH3A 1QAMA 1X37A 1DGHA 3Q8XA 4X66M 3AKZA 2CV0A 4QOSA 3RFWA 4GC5A 5ITTA 5F3WA 2R44A 3FUUA 4PD2A 2HAKA 1JR3D 2QENA 2UXDM 2D7HA 3TWKA 1E9SA 1R2ZA 4HEOA 3L2AA 3GRYA 2MROB 2R18A 3HKPA 4JI5M 4XGIA 4XK8F 2F5QA 1D0KA 4LG2A 2C96A 4DV5M 1XXHB 3B89A 7CATA 1GJTA 4IBDA 1OJLA 2L4EA 4FCVA 3HHZA 2RKOA 4DR4M 1E9RA 3UMMA 2V1CA 4K0KM 2DHYA 3U6DA 4GKKM 4FD2A 3K2LA 3D8LA 4NSRA 3L26A 2DWLA 4LF6M 3MMPA 4LFBM 3TWLA 1VEKA 1FJGM 2XSZA 4B3RM 2C99A 4RKUF 4HLQA 1IN5A 3SATA 2FS1A 4LGMA 2RGHA 2DENA 1VQ1A 2VQEM 2XFSA 5ITXE 4L4UA 3W67A 2YFQA 3KOWE 2X8AA 2LVQD 1EE8A 1ZMVA 3LW5F 3THGA 4WURA 1TDHA 4JI7M 3HJQA 2MGWA 2KHHA 2R65A 2QQ8A 3VKGA 2CWBA 2Y21A 4NXNM 2XZUA 2Z4SA 5DFLA 2GNOA 1QQWA 1P3QQ 2MH8A 3PFIA 3WHLA 1XMOM 1XMQM 1PM5A 2F5NA 5ITRA 3T38A 2D7GA 3KOXE 3B7NA 3TQSA 2G3QA 3JR4A 4AKGA 3A45A 4DV6M 2WSEF 3UK6A 1IM2A 3SHFA 4LF4M 3FRHA 3GRRA 4CGYB 1IXSA 2X4AA 2LNHC 2GQFA 1NSFA 4AG5A 3J7BA 2Y20A 2KEBA 4FWHA 4CISA 2JY7A 2DWMA 2R46A 3SC3A 5LMUM 3GLIE 2FNAA 3GLHA 4M9SA 4JI0M 3C9PA 2XZFA 2O25A 2BJWA 3AL0C 3T15A 4KODA 2C9OA 3SAUA 3NWLA 2KA6B 2JWSA 1J5EM 3I4VA 2CV1A 3GLFE 3M6AA 1TH4A 5L8RF 3UJNA 2VIIA 3C58A 5EQTA 3KXEC 1JB0F 1NY6A 2LVPC 1QAQA 3FTCA 1HQCA 4I8OA 5FSWA 1TDZA 2ZM6M 1QDRA 3GQ4A 3U5ZA 5KPZA 1NNJA 1IBLM 4LZZA 3KP0E 1UFZA 2K47A 3SASA 2AHMA 3JAMS 3DFZA 3CGWA 1HNZM 1NO1A 3U61A 2HCBA 2L09A 4QNMA 3FD9A 1J09A 2LVAA 3CF2A 4CIZA 4YHHM 4LF7M 4DV1M 1OIPA 2LXEA 4LF8M 4DUZM 1PJTA 2F5SA 3KVWA 4DR5M 1XXHA 5FTJA 1D0MA 3SHGB 1GJSA 1YE9A 1UM8A 2V6ZM 4W5WA 5IZ7D 3PNYA 2OOAA 4CHTB 4G4QA 1L1TA 3NBXX 4NL4H 3I01M 1WGLA 2F5OA 2BNKA 4MGIE 1HQYE 3DA1A 1ORYB 2I7PA 2QPAA 3T1YM 4R3DA 1J7KA 4G4OA 2R45A 4NRVA 4GITA 1FNNA 2ZAOA 3D8BA 5H37D 4QHTA 3E21A 3GPXA 3KP1E 4FWGA 4II7A 1OKSA 1T43A 4DBGB 3B9PA 1G8PA 2OPFA 1R2YA 1G4AE 3KW6A 2OOBA 3GLGA 4MGYE 5EXSA 1NY5A 2VF8A 4DR7M 4B08A 1HNXM 2XEPA 4NXMM 1Y8GA 4JI1M 3U6MA 3KS8A 3M7GA 4LJ9A 2KZUA 4JXJA 1G3IA 1R5LA 2JY6B 4AZFA 2QHOB 4YY3M 2KRKA 1TR8A 5ITQA 5KQ8A 3KFUG 2VF7A 2XGNA 3KSJA 3LCUA 2R4JA 1F4IA 5BR8M 4MGHA 2KNAA 3L27A 4X62M 1Z6TA 2DAIA 4REZA 1HNWM 3J80S 4IIWA 1VG5A 1YSYA 3FRIA 4I5SA 4GHAA 1NNUC 3SFZA 4JI4M 2UXBM 4L6V6 2D7EA 1DGBA 1HJPA 2P5TA 2L7HA 4GRIA 1PJQA 1XNQM 5C18A 4LCBA 3GPYA 3R8FA 3AFHA 1MU5A 1NHGC 2ZTCA 4AQYM 1T3TA 1LV7A 1PJSA 2M60A 2K6BA 2J7NA 3H4MA 1WR1B 3BBZA 1NVMA 3MJ5A 1N78A 1GO5A 1L8QA 1MX0A 1OFHA 2WSFF 4ITQA 3GQ5A 2YNMD 3RE8A 4F2LA 3GLHE 4JN6A 2KNZA 3NBIA 3VKHA 1KSFX 1SXJD 3EIEA 2CRUA 1IY2A 2VDBB 4LJ4A 3C3EA 2EO2A 3HZJA 3UZUA 2CHVA 1OAOC 4OVZA 4FW9A 5EP1A 3KOYE 1C7YA 3J27B 5EP4A 1G71A 2BJVA 1I94M 1Z59A 2HL7A 4LY6A 4D82A 1IXZA 1DO0A 5KPTA 4IJFA 4ZPXA 3GPUA 2FH0A 5E26A 1ZMWA 2K9DA 2Z4RA 4B3TM 2EUCA 3GLIB 1V34A 3RGPA 4HL4A 4NC6A 1S3SA 5IREB 3W0FA 4R71A 4LF5M 3FTFA 2ZTDA 4IBFA 2JP7A 4WW0A 4LJ5A 1I4WA 4LRTA 3I4YA 4AKIA 3HU1A 3T6PA 4GMQA 2OO9A 2KRUA 3I51A 3TE6A 2XH9A 2UXCM 1NV8A 1BVSA 3GLFB 2R4EA 2Y0TA 4PCZA 3B7ZA 4DR6M 3LMMA 3SMPA 3HGIA 1SXJB 1Z5BA 4B3MM 1VEGA 3VDUA 3IHPA 4L78A 1JQJC 1ZMUA 2MR9A 3U60A 4CJ6A 3U6PA 3FTDA 5FTNA 1IBMM 2DI0A 4DR2M 1N77A 1NJGA 2G5GX 3K9OA 1IN7A 3LVVA 2XSZD 1DGHB 3CF6E 1XC8A 1PJJA 4Y28F 4L8RC 2H1RA 2C5RA 1DGGA 4IBIA 2CHGA 2DNAA 3E4RA 3VDPA 5A2QS 4B7FA 2R6FA 2JA2A 4G4NA 3M0EA 1GL6A 1SXJE 3E46A 3IECA 5EP3A 3W68A 3U6LA 4GIPA 3QWLA 2J7OA 1WIVA 1VEJA 3CF0A 4BLCA 3KDSE 4FCWA 3SYKA 3L28A 4B7HA 1OIZA 2F5PA 4Z6YA 4LJAA 1HT1E 5KQDA 2F4VM 3WHKA 2ZANA 1XWIA 3QYBA 4X64M 1N36M 1OTRA 4BBAA 1IFYA 3HY5A 4IBKA 3AJIB 5ITXA 1IQPA 2Y0QA 3TL4X 3HJSA 3SYLA 3K8ZA 3FYDA 2RGOA 4IBEA 2CFOA 1HT2E 1Q3BA 4BB9A 2UUBM 3AOEC 2KZSA 3E9SA 1OQYA 2LWXA 4IBCA 4M9XA 1D0LA 3L29A 4MH0E 5EXPA 1QDTA 4WP2A 3SAWA 3L25A 2C9CA 3BXWA 2XLJA 1A5TA 3LCVB 5IT9S 3HJ8A 1IBKM 2DAGA 2ZBKB 1VDLA 2RRUA 3B74A 4LZJA 5DYIA 1JR3A 1XHBA 1LTMA 1R6BX 2FE8A 4L16A 4QHSA 4UN2B 3ILKA 5EXTA 5GKNA 1OAIA 4DV2M 2DAEA 4DR3M 1MN3A 1QVRA 2DZLA 2K0BX 3HX3A 4Q7JA 3MHVC 2JY8A 1KYIA 3FE3A 4IJEA 4B7GA 2QBYB 5JI2E 4M0WA 5E6JA 2DHRA 1RU3A 1TTEA 4S12A 2EKFA 4LGYA 4D80A 3GLIA 4QNRA 4RNAA 4DUYM 4GEWA 3LQRA 1K3XA 2L6OA 1AIPC 3HU3A 4IBGA 3R9XB 4IBBA 4D81A 1C1KA 3J7AS 4GH9A 2DXIA 2EJSA 4AI6A 1IXRC 1Z5CA 4I81A 3JR5A 3VK7A 2FFJA 2L4FA 3K92A 4DV3M 2CHQA 1Z5AA 4DV7M 4AG6A 2EA0A 2DZOB 3GLHB 3K1JA 3SBJA 4GKJM 4LFAM 3A42A 3Q8GA 3V76A 4JI8M 4LRSA 5FLXS 2DWNA 4P16A 2DWZB 4NRWA 1E94E 2JZ1A 2CEAA 3B7QA 2DVWB 3HHWA 2QSFX 3OTOM 1GABA 1QUTA 4P17A 3HHYA 4LJ6A 1IN8A 1CUKA 2C98A 3DZDA 3FUXA 2E5LM 4JI6M 4TUWA 3U5ZB 1VDDA 3C3DA 3SAVA 3GPPA 4JYAM 3PXGA 3GQ3A 3KOZE 4A3VB 5KPRA 3U61B 2JZ0A 2LVNC 2CE7A 2DKLA 3I04M 4AW4A 3FUWA 3IG8A 4KT0F 4L15A 3KS4A 1QZEA 1NV9A 1L1ZA 1DGFA 1L2DA 3W0LB 2QZ4A 1L2CA 3GP1A 1IN4A 2HHHM 1GL7A 5EJCA 1PGYA 4XBOA 5EXXA 2HWJA 2YR0A 4EIWA 4JI3M 3VLFB 1EIJA 4MGZE 2LHCA 2Z7JA 2DAKA 3AOEA 5EP2A 3FYCA 3HHXA 1N32M 2WSCF 1ZV1A 2H5XA 3EIHA 3AOGA 3J81S 2QNJA 1YLAA 3QAUA 4FCTA 1DV0A 1SXJC 4KHPM 3KSXA 3GLGB 1XXHE 3IG5A 3RGSA 3K9PA 2O5RA 3U6OA 1N75A 1N33M 1SG9A 2XFTA 4PT5A 8CATA 1Q02A 2LBCA 1ZAEA 5DYGA 3UGJA 3FUTA 2KXEA 2QBYA 3U6SA 3VFDA 4GC9A 2WZJA 5FTMA 1L2BA 3F92A 2APLA 3HU2A 2CP8A 3ZH9B 4X65M 2QCUA 3SARA 4G3OA 4G6ZA 4AKHA 1W5TA 1R4GA 2X49A 2W82A 1JR3E 1WGNA 2B3TA 2BWBA 3AV0A 3FUVA 3FTEA 1D2NA 1H6UA 2JNHA 3GLGE 2V1UA 1Q3CA 4OX9M 1XB2B 3GRUA 1QANA 2UUAM 2G8LA 4DV0M 3LVWA 1PJIA 3PNVA 4MGKE 5IWAM 1IY0A 1EFUB 5C1BA 3HWSA 1OFIA 2L2DA 4JV5M 3DOAA 2Z3XA 1QYRA 4I4LA 4GHLA 2LHGA 1N34M 1XNRM 3QYEA 4RF1A 4PDGA 4RF0A 1IN6A 4MB7A 3VK8A 5KO3A 4OU7A 1QZMA 2HKJA 2ZAMA 1QUSA 2KW0A 4LF9M 1GVNA 1NHWC 3ZC7B 2EKKA 4NSOB 4B3SM 3MK6A 2CV2A 2BWEA 5FTLA 1E32A 5ITUA 3TWMA 1MJGM 2XF3A 3H4JA 4LJ8A 2LH0A 3FKEA 2YQZA 4R7GA 5JI3E 3A46A 2UUCM 2QP9X 5ITYA 4NOOB 4OVZB 2OQ4A 1K82A 1QAOA 1G41A 1GKIA 4KLNA 2ERCA 1WHCA 1R7RA 2KNVA 2LTUA 1KFVA 1K3WA 1PRBA 2J5YA 1G59A 2DZNB 1HR0M 4PDIA 4ANRA 3T1HM 2R0IA 4JI2M 3ZCBB 3U6EA 1T6OA 2DAMA 3PVSA 1W5SA 2UU9M 4LJ7A 4LFCM 3BOSA 1IY1A 1IXSB 4Z8XA 3TPZA 4IBJA 2NQ8C 5BPVA 1YUBA 4KO8A 3SMSA 4OW0A 4G4RA 5FTKA 1Q39A 3ZQJA 5DNYA
chains in the Genus database with same CATH topology
1WXQA 4DV4M 1NJFA 2VQFM 4M9ZA 3GLFA 3U6QA 1GLNA 2CUZA 2FOIC 1SXJA 2I7NA 2A5YB 3J2PB 3U60B 2M5ZA 2Q2EB 4FWDA 4FVMA 2R62A 3A98B 1TH2A 4DR1M 3U6CA 4M0DA 4QOZC 3GRVA 4MM3B 5LMNM 1DO2A 1ZQ9A 1TGUA 2L7IA 3LQQA 3CTWB 3GO8A 1TH3A 1QAMA 1X37A 1DGHA 3Q8XA 4X66M 3AKZA 2CV0A 4QOSA 3RFWA 4GC5A 5ITTA 5F3WA 3FUUA 4PD2A 1JR3D 2QENA 2UXDM 2D7HA 3TWKA 1E9SA 1R2ZA 3L2AA 3GRYA 3HKPA 2R18A 4JI5M 4XGIA 2F5QA 4LG2A 2C96A 4DV5M 1XXHB 7CATA 4IBDA 1OJLA 4FCVA 3HHZA 2RKOA 4DR4M 1E9RA 3UMMA 2V1CA 4K0KM 3U6DA 4GKKM 4FD2A 3K2LA 3D8LA 4NSRA 3L26A 2DWLA 4LF6M 4LFBM 3TWLA 1FJGM 2XSZA 4B3RM 2C99A 4HLQA 1IN5A 3SATA 4LGMA 2RGHA 2VQEM 2XFSA 5ITXE 4L4UA 2YFQA 3KOWE 2X8AA 1EE8A 3THGA 4WURA 1TDHA 4JI7M 3HJQA 2R65A 3VKGA 2Y21A 4NXNM 2XZUA 2Z4SA 1XMOM 3PFIA 1QQWA 3WHLA 1XMQM 1PM5A 2F5NA 5ITRA 3T38A 2D7GA 3KOXE 3TQSA 3JR4A 4AKGA 3A45A 4DV6M 3UK6A 1IM2A 3SHFA 4LF4M 3GRRA 4CGYB 2X4AA 2LNHC 1NSFA 4AG5A 3J7BA 2Y20A 2KEBA 4FWHA 4CISA 2DWMA 2R46A 3SC3A 5LMUM 2XZFA 2FNAA 3GLHA 4M9SA 4JI0M 2BJWA 3AL0C 3T15A 4KODA 2C9OA 3SAUA 3NWLA 2KA6B 1J5EM 3I4VA 2CV1A 3M6AA 1TH4A 3UJNA 2VIIA 3C58A 5EQTA 3KXEC 1NY6A 1QAQA 3FTCA 1HQCA 4I8OA 5FSWA 1TDZA 2ZM6M 3GQ4A 3U5ZA 5KPZA 1NNJA 1IBLM 4LZZA 3KP0E 2K47A 3SASA 2AHMA 3JAMS 3DFZA 1HNZM 3U61A 2HCBA 2L09A 4QNMA 3FD9A 1J09A 3CF2A 4YHHM 4LF7M 4DV1M 2LXEA 4LF8M 4DUZM 2F5SA 3KVWA 4DR5M 1XXHA 5FTJA 3SHGB 1YE9A 1UM8A 2V6ZM 4W5WA 5IZ7D 3PNYA 4CHTB 4G4QA 1L1TA 4NL4H 2F5OA 2BNKA 4MGIE 1HQYE 3DA1A 1ORYB 2I7PA 2QPAA 3T1YM 4R3DA 1J7KA 4G4OA 2R45A 4NRVA 4GITA 1FNNA 2ZAOA 3D8BA 5H37D 4QHTA 3GPXA 3KP1E 4FWGA 4II7A 2OPFA 1R2YA 3B9PA 1G8PA 1G4AE 3KW6A 3GLGA 4MGYE 5EXSA 1NY5A 4DR7M 4B08A 1HNXM 2XEPA 4NXMM 4JI1M 3U6MA 3KS8A 3M7GA 4LJ9A 2KZUA 4JXJA 1G3IA 4AZFA 4YY3M 2KRKA 5ITQA 5KQ8A 3KFUG 2XGNA 3KSJA 2R4JA 5BR8M 4MGHA 3L27A 4X62M 1Z6TA 4REZA 1HNWM 3J80S 4IIWA 1YSYA 4I5SA 4GHAA 1NNUC 3SFZA 4JI4M 2UXBM 2D7EA 1DGBA 2P5TA 2L7HA 4GRIA 1XNQM 5C18A 4LCBA 3GPYA 3R8FA 3AFHA 1MU5A 1NHGC 4AQYM 1T3TA 1LV7A 2M60A 2J7NA 3H4MA 1NVMA 3MJ5A 1N78A 1L8QA 1MX0A 1OFHA 4ITQA 3GQ5A 2YNMD 3RE8A 4JN6A 3NBIA 3VKHA 1KSFX 1SXJD 3EIEA 4LJ4A 1IY2A 2EO2A 3UZUA 2CHVA 4OVZA 4FW9A 5EP1A 3KOYE 3J27B 5EP4A 2BJVA 1I94M 1Z59A 2HL7A 4LY6A 4D82A 1IXZA 1DO0A 5KPTA 4IJFA 4ZPXA 3GPUA 5E26A 2Z4RA 4B3TM 2EUCA 3GLIB 3RGPA 3W0FA 4HL4A 5IREB 1S3SA 4LF5M 3FTFA 4IBFA 4WW0A 4LJ5A 1I4WA 4LRTA 3I4YA 4AKIA 3HU1A 4GMQA 2KRUA 3I51A 3TE6A 2XH9A 2UXCM 3GLFB 2Y0TA 2R4EA 4PCZA 4DR6M 3LMMA 3SMPA 3HGIA 1SXJB 1Z5BA 4B3MM 3VDUA 4L78A 1JQJC 3U60A 3U6PA 3FTDA 5FTNA 1IBMM 4DR2M 1N77A 1NJGA 2G5GX 1IN7A 3LVVA 2XSZD 1DGHB 3CF6E 1XC8A 1PJJA 4L8RC 2H1RA 2C5RA 1DGGA 4IBIA 2CHGA 3E4RA 3VDPA 5A2QS 4B7FA 2JA2A 4G4NA 3M0EA 1GL6A 1SXJE 5EP3A 3U6LA 4GIPA 3QWLA 2J7OA 3CF0A 4BLCA 3KDSE 4FCWA 3SYKA 3L28A 4B7HA 2F5PA 4Z6YA 4LJAA 1HT1E 5KQDA 2F4VM 3WHKA 2ZANA 1XWIA 4X64M 1N36M 4BBAA 4IBKA 3AJIB 5ITXA 1IQPA 2Y0QA 3TL4X 3HJSA 3SYLA 3K8ZA 3FYDA 2RGOA 4IBEA 2CFOA 1HT2E 1Q3BA 4BB9A 2UUBM 3AOEC 2KZSA 3E9SA 5EXPA 2LWXA 4IBCA 4M9XA 3L29A 4MH0E 3SAWA 3L25A 2C9CA 2XLJA 5IT9S 3HJ8A 1IBKM 2ZBKB 4LZJA 5DYIA 1JR3A 1XHBA 1R6BX 2FE8A 4L16A 4QHSA 5EXTA 5GKNA 3ILKA 4DV2M 4DR3M 1L1ZA 1QVRA 3MHVC 4IJEA 1KYIA 4B7GA 2QBYB 5JI2E 4M0WA 5E6JA 2DHRA 4S12A 4LGYA 3GLIA 4D80A 4QNRA 4RNAA 4DUYM 3LQRA 1K3XA 2L6OA 3HU3A 4IBGA 3R9XB 4IBBA 4D81A 1C1KA 3J7AS 4GH9A 2DXIA 4AI6A 1IXRC 1Z5CA 4I81A 3JR5A 3VK7A 2FFJA 3K92A 4DV3M 2CHQA 1Z5AA 4DV7M 4AG6A 2EA0A 2DZOB 3GLHB 3K1JA 3SBJA 4GKJM 4LFAM 3A42A 4JI8M 4LRSA 5FLXS 2DWNA 4P16A 2DWZB 4NRWA 1E94E 2CEAA 2DVWB 3HHWA 3OTOM 3HHYA 4LJ6A 1IN8A 2C98A 3DZDA 3FUXA 2E5LM 4JI6M 4TUWA 3U5ZB 1VDDA 3SAVA 3GPPA 4JYAM 3PXGA 3GQ3A 3KOZE 4A3VB 5KPRA 3U61B 2CE7A 4AW4A 3FUWA 3IG8A 4L15A 3KS4A 1DGFA 1L2DA 3W0LB 2QZ4A 1L2CA 3GP1A 1IN4A 2HHHM 1GL7A 5EJCA 4XBOA 5EXXA 2YR0A 4EIWA 4JI3M 3VLFB 4MGZE 2Z7JA 3AOEA 5EP2A 3FYCA 3HHXA 1N32M 3EIHA 3AOGA 3J81S 3QAUA 4FCTA 1SXJC 4KHPM 3KSXA 3GLGB 3IG5A 3RGSA 2O5RA 3U6OA 1N75A 1N33M 2XFTA 4PT5A 8CATA 1ZAEA 5DYGA 3UGJA 3FUTA 2KXEA 2QBYA 3U6SA 3VFDA 4GC9A 5FTMA 1L2BA 3HU2A 3ZH9B 4X65M 2QCUA 3SARA 4G6ZA 4AKHA 1W5TA 2X49A 2W82A 3AV0A 3FUVA 3FTEA 1D2NA 1H6UA 2V1UA 1Q3CA 4OX9M 3GRUA 1QANA 2UUAM 2G8LA 4DV0M 3LVWA 1PJIA 3PNVA 4MGKE 5IWAM 1IY0A 5C1BA 3HWSA 1OFIA 4JV5M 3DOAA 2Z3XA 1QYRA 4I4LA 4GHLA 1N34M 1XNRM 4RF1A 4PDGA 4RF0A 1IN6A 4MB7A 3VK8A 5KO3A 4OU7A 1QZMA 2HKJA 2ZAMA 2KW0A 4LF9M 1GVNA 1NHWC 3ZC7B 4NSOB 4B3SM 3MK6A 2CV2A 5FTLA 1E32A 5ITUA 3TWMA 2XF3A 4LJ8A 2LH0A 3FKEA 2YQZA 4R7GA 5JI3E 3A46A 2UUCM 2QP9X 5ITYA 4NOOB 4OVZB 2OQ4A 1K82A 1QAOA 1G41A 1GKIA 4KLNA 2ERCA 1R7RA 1KFVA 1K3WA 1G59A 2DZNB 1HR0M 4PDIA 3T1HM 4JI2M 3ZCBB 3U6EA 3PVSA 1W5SA 2UU9M 4LJ7A 4LFCM 3BOSA 1IY1A 1IXSB 4Z8XA 3TPZA 4IBJA 2NQ8C 5BPVA 1YUBA 4KO8A 3SMSA 4OW0A 4G4RA 5FTKA 1Q39A 5DNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAV A;  3GPP A;  4DR6 M;  4DV4 M;  1NNJ A;  3GQ3 A;  2VQF M;  1IBL M;  1Z5B A;  4B3M M;  4JYA M;  3U6Q A;  3SAS A;  3JAM S;  1HNZ M;  2Q2E B;  4YHH M;  4LF7 M;  4DV1 M;  4DR1 M;  3U6C A;  3U6P A;  4DUZ M;  2F5S A;  1IBM M;  1L2D A;  4DR2 M;  5LMN M;  4DR5 M;  4LF8 M;  1L2C A;  1PJJ A;  1XC8 A;  3GP1 A;  4G4Q A;  3GO8 A;  1L1T A;  2HHH M;  5A2Q S;  4X66 M;  2F5O A;  4JI3 M;  5ITT A;  4G4N A;  3T1Y M;  1N32 M;  4PD2 A;  4G4O A;  3U6L A;  4NRV A;  3J81 S;  2UXD M;  3GPX A;  3TWK A;  2F5P A;  1R2Z A;  4KHP M;  2OPF A;  1R2Y A;  2F4V M;  4JI5 M;  4X64 M;  1N36 M;  3U6O A;  2F5Q A;  1N33 M;  4DV5 M;  5ITX A;  4DR7 M;  3U6S A;  1HNX M;  4NXM M;  4JI1 M;  3U6M A;  1L2B A;  4DR4 M;  4X65 M;  3SAR A;  4K0K M;  3U6D A;  4GKK M;  1Q3B A;  4YY3 M;  2UUB M;  4LF6 M;  5ITQ A;  4LFB M;  3TWL A;  3SAW A;  1FJG M;  4B3R M;  5BR8 M;  3SAT A;  4X62 M;  4OX9 M;  1Q3C A;  5IT9 S;  1HNW M;  3J80 S;  2VQE M;  5ITX E;  1IBK M;  2UUA M;  2ZBK B;  4DV0 M;  1PJI A;  4JI4 M;  2UXB M;  1EE8 A;  5IWA M;  1L1Z A;  4JI7 M;  1TDH A;  4DR3 M;  4JV5 M;  3DOA A;  4DV2 M;  1XNQ M;  3GPY A;  1N34 M;  1XNR M;  1MU5 A;  4AQY M;  4NXN M;  2XZU A;  4PDG A;  3VK8 A;  1XMO M;  4MB7 A;  1XMQ M;  1PM5 A;  2F5N A;  2HKJ A;  4LF9 M;  5ITR A;  4DUY M;  4B3S M;  1MX0 A;  3JR4 A;  5ITU A;  3A45 A;  4ITQ A;  1K3X A;  3TWM A;  4DV6 M;  3GQ5 A;  4LF4 M;  3A46 A;  3J7A S;  2UUC M;  1Z5C A;  3JR5 A;  5ITY A;  3VK7 A;  4DV3 M;  1K82 A;  2OQ4 A;  1Z5A A;  4CIS A;  4DV7 M;  2EA0 A;  3SBJ A;  4GKJ M;  4LFA M;  3A42 A;  5LMU M;  2XZF A;  4JI0 M;  1I94 M;  1Z59 A;  4JI8 M;  5FLX S;  1KFV A;  1K3W A;  4NRW A;  3GPU A;  3SAU A;  4B3T M;  1HR0 M;  3W0F A;  4PDI A;  1J5E M;  4LF5 M;  3T1H M;  3OTO M;  4JI2 M;  3U6E A;  2UU9 M;  4LFC M;  2E5L M;  4JI6 M;  3C58 A;  4G4R A;  1Q39 A;  2UXC M;  1TDZ A;  4PCZ A;  2ZM6 M;  3GQ4 A; 
#chains in the Genus database with same CATH topology
 1WXQ A;  1V92 A;  2KDL A;  4DV4 M;  1NJF A;  2VQF M;  4M9Z A;  1TF0 B;  2JXN A;  3GLF A;  3U6Q A;  1GLN A;  2CUZ A;  2FOI C;  1SXJ A;  2I7N A;  2A5Y B;  3J2P B;  3U60 B;  2M5Z A;  2Q2E B;  4FWD A;  4FVM A;  2MJ5 B;  2R62 A;  3A98 B;  1TH2 A;  4DR1 M;  3U6C A;  4M0D A;  4QOZ C;  2N35 A;  3GRV A;  4MM3 B;  1AUA A;  1V33 A;  5LMN M;  1DO2 A;  1ZQ9 A;  2JY5 A;  1TGU A;  2L7I A;  4F1I A;  2Z8Y M;  1WJ7 A;  2JUJ A;  2LVO C;  3LQQ A;  3CTW B;  3GO8 A;  2O01 F;  1TH3 A;  1QAM A;  1X37 A;  1DGH A;  3Q8X A;  4X66 M;  3AKZ A;  2CV0 A;  4QOS A;  3RFW A;  4GC5 A;  5ITT A;  5F3W A;  2R44 A;  3FUU A;  4PD2 A;  2HAK A;  1JR3 D;  2QEN A;  2UXD M;  2D7H A;  3TWK A;  1E9S A;  1R2Z A;  4HEO A;  3L2A A;  3GRY A;  2MRO B;  2R18 A;  3HKP A;  4JI5 M;  4XGI A;  4XK8 F;  2F5Q A;  1D0K A;  4LG2 A;  2C96 A;  4DV5 M;  1XXH B;  3B89 A;  7CAT A;  1GJT A;  4IBD A;  1OJL A;  2L4E A;  4FCV A;  3HHZ A;  2RKO A;  4DR4 M;  1E9R A;  3UMM A;  2V1C A;  4K0K M;  2DHY A;  3U6D A;  4GKK M;  4FD2 A;  3K2L A;  3D8L A;  4NSR A;  3L26 A;  2DWL A;  4LF6 M;  3MMP A;  4LFB M;  3TWL A;  1VEK A;  1FJG M;  2XSZ A;  4B3R M;  2C99 A;  4RKU F;  4HLQ A;  1IN5 A;  3SAT A;  2FS1 A;  4LGM A;  2RGH A;  2DEN A;  1VQ1 A;  2VQE M;  2XFS A;  5ITX E;  4L4U A;  3W67 A;  2YFQ A;  3KOW E;  2X8A A;  2LVQ D;  1EE8 A;  1ZMV A;  3LW5 F;  3THG A;  4WUR A;  1TDH A;  4JI7 M;  3HJQ A;  2MGW A;  2KHH A;  2R65 A;  2QQ8 A;  3VKG A;  2CWB A;  2Y21 A;  4NXN M;  2XZU A;  2Z4S A;  5DFL A;  2GNO A;  1QQW A;  1P3Q Q;  2MH8 A;  3PFI A;  3WHL A;  1XMO M;  1XMQ M;  1PM5 A;  2F5N A;  5ITR A;  3T38 A;  2D7G A;  3KOX E;  3B7N A;  3TQS A;  2G3Q A;  3JR4 A;  4AKG A;  3A45 A;  4DV6 M;  2WSE F;  3UK6 A;  1IM2 A;  3SHF A;  4LF4 M;  3FRH A;  3GRR A;  4CGY B;  1IXS A;  2X4A A;  2LNH C;  2GQF A;  1NSF A;  4AG5 A;  3J7B A;  2Y20 A;  2KEB A;  4FWH A;  4CIS A;  2JY7 A;  2DWM A;  2R46 A;  3SC3 A;  5LMU M;  3GLI E;  2FNA A;  3GLH A;  4M9S A;  4JI0 M;  3C9P A;  2XZF A;  2O25 A;  2BJW A;  3AL0 C;  3T15 A;  4KOD A;  2C9O A;  3SAU A;  3NWL A;  2KA6 B;  2JWS A;  1J5E M;  3I4V A;  2CV1 A;  3GLF E;  3M6A A;  1TH4 A;  5L8R F;  3UJN A;  2VII A;  3C58 A;  5EQT A;  3KXE C;  1JB0 F;  1NY6 A;  2LVP C;  1QAQ A;  3FTC A;  1HQC A;  4I8O A;  5FSW A;  1TDZ A;  2ZM6 M;  1QDR A;  3GQ4 A;  3U5Z A;  5KPZ A;  1NNJ A;  1IBL M;  4LZZ A;  3KP0 E;  1UFZ A;  2K47 A;  3SAS A;  2AHM A;  3JAM S;  3DFZ A;  3CGW A;  1HNZ M;  1NO1 A;  3U61 A;  2HCB A;  2L09 A;  4QNM A;  3FD9 A;  1J09 A;  2LVA A;  3CF2 A;  4CIZ A;  4YHH M;  4LF7 M;  4DV1 M;  1OIP A;  2LXE A;  4LF8 M;  4DUZ M;  1PJT A;  2F5S A;  3KVW A;  4DR5 M;  1XXH A;  5FTJ A;  1D0M A;  3SHG B;  1GJS A;  1YE9 A;  1UM8 A;  2V6Z M;  4W5W A;  5IZ7 D;  3PNY A;  2OOA A;  4CHT B;  4G4Q A;  1L1T A;  3NBX X;  4NL4 H;  3I01 M;  1WGL A;  2F5O A;  2BNK A;  4MGI E;  1HQY E;  3DA1 A;  1ORY B;  2I7P A;  2QPA A;  3T1Y M;  4R3D A;  1J7K A;  4G4O A;  2R45 A;  4NRV A;  4GIT A;  1FNN A;  2ZAO A;  3D8B A;  5H37 D;  4QHT A;  3E21 A;  3GPX A;  3KP1 E;  4FWG A;  4II7 A;  1OKS A;  1T43 A;  4DBG B;  3B9P A;  1G8P A;  2OPF A;  1R2Y A;  1G4A E;  3KW6 A;  2OOB A;  3GLG A;  4MGY E;  5EXS A;  1NY5 A;  2VF8 A;  4DR7 M;  4B08 A;  1HNX M;  2XEP A;  4NXM M;  1Y8G A;  4JI1 M;  3U6M A;  3KS8 A;  3M7G A;  4LJ9 A;  2KZU A;  4JXJ A;  1G3I A;  1R5L A;  2JY6 B;  4AZF A;  2QHO B;  4YY3 M;  2KRK A;  1TR8 A;  5ITQ A;  5KQ8 A;  3KFU G;  2VF7 A;  2XGN A;  3KSJ A;  3LCU A;  2R4J A;  1F4I A;  5BR8 M;  4MGH A;  2KNA A;  3L27 A;  4X62 M;  1Z6T A;  2DAI A;  4REZ A;  1HNW M;  3J80 S;  4IIW A;  1VG5 A;  1YSY A;  3FRI A;  4I5S A;  4GHA A;  1NNU C;  3SFZ A;  4JI4 M;  2UXB M;  4L6V 6;  2D7E A;  1DGB A;  1HJP A;  2P5T A;  2L7H A;  4GRI A;  1PJQ A;  1XNQ M;  5C18 A;  4LCB A;  3GPY A;  3R8F A;  3AFH A;  1MU5 A;  1NHG C;  2ZTC A;  4AQY M;  1T3T A;  1LV7 A;  1PJS A;  2M60 A;  2K6B A;  2J7N A;  3H4M A;  1WR1 B;  3BBZ A;  1NVM A;  3MJ5 A;  1N78 A;  1GO5 A;  1L8Q A;  1MX0 A;  1OFH A;  2WSF F;  4ITQ A;  3GQ5 A;  2YNM D;  3RE8 A;  4F2L A;  3GLH E;  4JN6 A;  2KNZ A;  3NBI A;  3VKH A;  1KSF X;  1SXJ D;  3EIE A;  2CRU A;  1IY2 A;  2VDB B;  4LJ4 A;  3C3E A;  2EO2 A;  3HZJ A;  3UZU A;  2CHV A;  1OAO C;  4OVZ A;  4FW9 A;  5EP1 A;  3KOY E;  1C7Y A;  3J27 B;  5EP4 A;  1G71 A;  2BJV A;  1I94 M;  1Z59 A;  2HL7 A;  4LY6 A;  4D82 A;  1IXZ A;  1DO0 A;  5KPT A;  4IJF A;  4ZPX A;  3GPU A;  2FH0 A;  5E26 A;  1ZMW A;  2K9D A;  2Z4R A;  4B3T M;  2EUC A;  3GLI B;  1V34 A;  3RGP A;  4HL4 A;  4NC6 A;  1S3S A;  5IRE B;  3W0F A;  4R71 A;  4LF5 M;  3FTF A;  2ZTD A;  4IBF A;  2JP7 A;  4WW0 A;  4LJ5 A;  1I4W A;  4LRT A;  3I4Y A;  4AKI A;  3HU1 A;  3T6P A;  4GMQ A;  2OO9 A;  2KRU A;  3I51 A;  3TE6 A;  2XH9 A;  2UXC M;  1NV8 A;  1BVS A;  3GLF B;  2R4E A;  2Y0T A;  4PCZ A;  3B7Z A;  4DR6 M;  3LMM A;  3SMP A;  3HGI A;  1SXJ B;  1Z5B A;  4B3M M;  1VEG A;  3VDU A;  3IHP A;  4L78 A;  1JQJ C;  1ZMU A;  2MR9 A;  3U60 A;  4CJ6 A;  3U6P A;  3FTD A;  5FTN A;  1IBM M;  2DI0 A;  4DR2 M;  1N77 A;  1NJG A;  2G5G X;  3K9O A;  1IN7 A;  3LVV A;  2XSZ D;  1DGH B;  3CF6 E;  1XC8 A;  1PJJ A;  4Y28 F;  4L8R C;  2H1R A;  2C5R A;  1DGG A;  4IBI A;  2CHG A;  2DNA A;  3E4R A;  3VDP A;  5A2Q S;  4B7F A;  2R6F A;  2JA2 A;  4G4N A;  3M0E A;  1GL6 A;  1SXJ E;  3E46 A;  3IEC A;  5EP3 A;  3W68 A;  3U6L A;  4GIP A;  3QWL A;  2J7O A;  1WIV A;  1VEJ A;  3CF0 A;  4BLC A;  3KDS E;  4FCW A;  3SYK A;  3L28 A;  4B7H A;  1OIZ A;  2F5P A;  4Z6Y A;  4LJA A;  1HT1 E;  5KQD A;  2F4V M;  3WHK A;  2ZAN A;  1XWI A;  3QYB A;  4X64 M;  1N36 M;  1OTR A;  4BBA A;  1IFY A;  3HY5 A;  4IBK A;  3AJI B;  5ITX A;  1IQP A;  2Y0Q A;  3TL4 X;  3HJS A;  3SYL A;  3K8Z A;  3FYD A;  2RGO A;  4IBE A;  2CFO A;  1HT2 E;  1Q3B A;  4BB9 A;  2UUB M;  3AOE C;  2KZS A;  3E9S A;  1OQY A;  2LWX A;  4IBC A;  4M9X A;  1D0L A;  3L29 A;  4MH0 E;  5EXP A;  1QDT A;  4WP2 A;  3SAW A;  3L25 A;  2C9C A;  3BXW A;  2XLJ A;  1A5T A;  3LCV B;  5IT9 S;  3HJ8 A;  1IBK M;  2DAG A;  2ZBK B;  1VDL A;  2RRU A;  3B74 A;  4LZJ A;  5DYI A;  1JR3 A;  1XHB A;  1LTM A;  1R6B X;  2FE8 A;  4L16 A;  4QHS A;  4UN2 B;  3ILK A;  5EXT A;  5GKN A;  1OAI A;  4DV2 M;  2DAE A;  4DR3 M;  1MN3 A;  1QVR A;  2DZL A;  2K0B X;  3HX3 A;  4Q7J A;  3MHV C;  2JY8 A;  1KYI A;  3FE3 A;  4IJE A;  4B7G A;  2QBY B;  5JI2 E;  4M0W A;  5E6J A;  2DHR A;  1RU3 A;  1TTE A;  4S12 A;  2EKF A;  4LGY A;  4D80 A;  3GLI A;  4QNR A;  4RNA A;  4DUY M;  4GEW A;  3LQR A;  1K3X A;  2L6O A;  1AIP C;  3HU3 A;  4IBG A;  3R9X B;  4IBB A;  4D81 A;  1C1K A;  3J7A S;  4GH9 A;  2DXI A;  2EJS A;  4AI6 A;  1IXR C;  1Z5C A;  4I81 A;  3JR5 A;  3VK7 A;  2FFJ A;  2L4F A;  3K92 A;  4DV3 M;  2CHQ A;  1Z5A A;  4DV7 M;  4AG6 A;  2EA0 A;  2DZO B;  3GLH B;  3K1J A;  3SBJ A;  4GKJ M;  4LFA M;  3A42 A;  3Q8G A;  3V76 A;  4JI8 M;  4LRS A;  5FLX S;  2DWN A;  4P16 A;  2DWZ B;  4NRW A;  1E94 E;  2JZ1 A;  2CEA A;  3B7Q A;  2DVW B;  3HHW A;  2QSF X;  3OTO M;  1GAB A;  1QUT A;  4P17 A;  3HHY A;  4LJ6 A;  1IN8 A;  1CUK A;  2C98 A;  3DZD A;  3FUX A;  2E5L M;  4JI6 M;  4TUW A;  3U5Z B;  1VDD A;  3C3D A;  3SAV A;  3GPP A;  4JYA M;  3PXG A;  3GQ3 A;  3KOZ E;  4A3V B;  5KPR A;  3U61 B;  2JZ0 A;  2LVN C;  2CE7 A;  2DKL A;  3I04 M;  4AW4 A;  3FUW A;  3IG8 A;  4KT0 F;  4L15 A;  3KS4 A;  1QZE A;  1NV9 A;  1L1Z A;  1DGF A;  1L2D A;  3W0L B;  2QZ4 A;  1L2C A;  3GP1 A;  1IN4 A;  2HHH M;  1GL7 A;  5EJC A;  1PGY A;  4XBO A;  5EXX A;  2HWJ A;  2YR0 A;  4EIW A;  4JI3 M;  3VLF B;  1EIJ A;  4MGZ E;  2LHC A;  2Z7J A;  2DAK A;  3AOE A;  5EP2 A;  3FYC A;  3HHX A;  1N32 M;  2WSC F;  1ZV1 A;  2H5X A;  3EIH A;  3AOG A;  3J81 S;  2QNJ A;  1YLA A;  3QAU A;  4FCT A;  1DV0 A;  1SXJ C;  4KHP M;  3KSX A;  3GLG B;  1XXH E;  3IG5 A;  3RGS A;  3K9P A;  2O5R A;  3U6O A;  1N75 A;  1N33 M;  1SG9 A;  2XFT A;  4PT5 A;  8CAT A;  1Q02 A;  2LBC A;  1ZAE A;  5DYG A;  3UGJ A;  3FUT A;  2KXE A;  2QBY A;  3U6S A;  3VFD A;  4GC9 A;  2WZJ A;  5FTM A;  1L2B A;  3F92 A;  2APL A;  3HU2 A;  2CP8 A;  3ZH9 B;  4X65 M;  2QCU A;  3SAR A;  4G3O A;  4G6Z A;  4AKH A;  1W5T A;  1R4G A;  2X49 A;  2W82 A;  1JR3 E;  1WGN A;  2B3T A;  2BWB A;  3AV0 A;  3FUV A;  3FTE A;  1D2N A;  1H6U A;  2JNH A;  3GLG E;  2V1U A;  1Q3C A;  4OX9 M;  1XB2 B;  3GRU A;  1QAN A;  2UUA M;  2G8L A;  4DV0 M;  3LVW A;  1PJI A;  3PNV A;  4MGK E;  5IWA M;  1IY0 A;  1EFU B;  5C1B A;  3HWS A;  1OFI A;  2L2D A;  4JV5 M;  3DOA A;  2Z3X A;  1QYR A;  4I4L A;  4GHL A;  2LHG A;  1N34 M;  1XNR M;  3QYE A;  4RF1 A;  4PDG A;  4RF0 A;  1IN6 A;  4MB7 A;  3VK8 A;  5KO3 A;  4OU7 A;  1QZM A;  2HKJ A;  2ZAM A;  1QUS A;  2KW0 A;  4LF9 M;  1GVN A;  1NHW C;  3ZC7 B;  2EKK A;  4NSO B;  4B3S M;  3MK6 A;  2CV2 A;  2BWE A;  5FTL A;  1E32 A;  5ITU A;  3TWM A;  1MJG M;  2XF3 A;  3H4J A;  4LJ8 A;  2LH0 A;  3FKE A;  2YQZ A;  4R7G A;  5JI3 E;  3A46 A;  2UUC M;  2QP9 X;  5ITY A;  4NOO B;  4OVZ B;  2OQ4 A;  1K82 A;  1QAO A;  1G41 A;  1GKI A;  4KLN A;  2ERC A;  1WHC A;  1R7R A;  2KNV A;  2LTU A;  1KFV A;  1K3W A;  1PRB A;  2J5Y A;  1G59 A;  2DZN B;  1HR0 M;  4PDI A;  4ANR A;  3T1H M;  2R0I A;  4JI2 M;  3ZCB B;  3U6E A;  1T6O A;  2DAM A;  3PVS A;  1W5S A;  2UU9 M;  4LJ7 A;  4LFC M;  3BOS A;  1IY1 A;  1IXS B;  4Z8X A;  3TPZ A;  4IBJ A;  2NQ8 C;  5BPV A;  1YUB A;  4KO8 A;  3SMS A;  4OW0 A;  4G4R A;  5FTK A;  1Q39 A;  3ZQJ A;  5DNY A; 
#chains in the Genus database with same CATH homology
 1WXQ A;  4DV4 M;  1NJF A;  2VQF M;  4M9Z A;  3GLF A;  3U6Q A;  1GLN A;  2CUZ A;  2FOI C;  1SXJ A;  2I7N A;  2A5Y B;  3J2P B;  3U60 B;  2M5Z A;  2Q2E B;  4FWD A;  4FVM A;  2R62 A;  3A98 B;  1TH2 A;  4DR1 M;  3U6C A;  4M0D A;  4QOZ C;  3GRV A;  4MM3 B;  5LMN M;  1DO2 A;  1ZQ9 A;  1TGU A;  2L7I A;  3LQQ A;  3CTW B;  3GO8 A;  1TH3 A;  1QAM A;  1X37 A;  1DGH A;  3Q8X A;  4X66 M;  3AKZ A;  2CV0 A;  4QOS A;  3RFW A;  4GC5 A;  5ITT A;  5F3W A;  3FUU A;  4PD2 A;  1JR3 D;  2QEN A;  2UXD M;  2D7H A;  3TWK A;  1E9S A;  1R2Z A;  3L2A A;  3GRY A;  3HKP A;  2R18 A;  4JI5 M;  4XGI A;  2F5Q A;  4LG2 A;  2C96 A;  4DV5 M;  1XXH B;  7CAT A;  4IBD A;  1OJL A;  4FCV A;  3HHZ A;  2RKO A;  4DR4 M;  1E9R A;  3UMM A;  2V1C A;  4K0K M;  3U6D A;  4GKK M;  4FD2 A;  3K2L A;  3D8L A;  4NSR A;  3L26 A;  2DWL A;  4LF6 M;  4LFB M;  3TWL A;  1FJG M;  2XSZ A;  4B3R M;  2C99 A;  4HLQ A;  1IN5 A;  3SAT A;  4LGM A;  2RGH A;  2VQE M;  2XFS A;  5ITX E;  4L4U A;  2YFQ A;  3KOW E;  2X8A A;  1EE8 A;  3THG A;  4WUR A;  1TDH A;  4JI7 M;  3HJQ A;  2R65 A;  3VKG A;  2Y21 A;  4NXN M;  2XZU A;  2Z4S A;  1XMO M;  3PFI A;  1QQW A;  3WHL A;  1XMQ M;  1PM5 A;  2F5N A;  5ITR A;  3T38 A;  2D7G A;  3KOX E;  3TQS A;  3JR4 A;  4AKG A;  3A45 A;  4DV6 M;  3UK6 A;  1IM2 A;  3SHF A;  4LF4 M;  3GRR A;  4CGY B;  2X4A A;  2LNH C;  1NSF A;  4AG5 A;  3J7B A;  2Y20 A;  2KEB A;  4FWH A;  4CIS A;  2DWM A;  2R46 A;  3SC3 A;  5LMU M;  2XZF A;  2FNA A;  3GLH A;  4M9S A;  4JI0 M;  2BJW A;  3AL0 C;  3T15 A;  4KOD A;  2C9O A;  3SAU A;  3NWL A;  2KA6 B;  1J5E M;  3I4V A;  2CV1 A;  3M6A A;  1TH4 A;  3UJN A;  2VII A;  3C58 A;  5EQT A;  3KXE C;  1NY6 A;  1QAQ A;  3FTC A;  1HQC A;  4I8O A;  5FSW A;  1TDZ A;  2ZM6 M;  3GQ4 A;  3U5Z A;  5KPZ A;  1NNJ A;  1IBL M;  4LZZ A;  3KP0 E;  2K47 A;  3SAS A;  2AHM A;  3JAM S;  3DFZ A;  1HNZ M;  3U61 A;  2HCB A;  2L09 A;  4QNM A;  3FD9 A;  1J09 A;  3CF2 A;  4YHH M;  4LF7 M;  4DV1 M;  2LXE A;  4LF8 M;  4DUZ M;  2F5S A;  3KVW A;  4DR5 M;  1XXH A;  5FTJ A;  3SHG B;  1YE9 A;  1UM8 A;  2V6Z M;  4W5W A;  5IZ7 D;  3PNY A;  4CHT B;  4G4Q A;  1L1T A;  4NL4 H;  2F5O A;  2BNK A;  4MGI E;  1HQY E;  3DA1 A;  1ORY B;  2I7P A;  2QPA A;  3T1Y M;  4R3D A;  1J7K A;  4G4O A;  2R45 A;  4NRV A;  4GIT A;  1FNN A;  2ZAO A;  3D8B A;  5H37 D;  4QHT A;  3GPX A;  3KP1 E;  4FWG A;  4II7 A;  2OPF A;  1R2Y A;  3B9P A;  1G8P A;  1G4A E;  3KW6 A;  3GLG A;  4MGY E;  5EXS A;  1NY5 A;  4DR7 M;  4B08 A;  1HNX M;  2XEP A;  4NXM M;  4JI1 M;  3U6M A;  3KS8 A;  3M7G A;  4LJ9 A;  2KZU A;  4JXJ A;  1G3I A;  4AZF A;  4YY3 M;  2KRK A;  5ITQ A;  5KQ8 A;  3KFU G;  2XGN A;  3KSJ A;  2R4J A;  5BR8 M;  4MGH A;  3L27 A;  4X62 M;  1Z6T A;  4REZ A;  1HNW M;  3J80 S;  4IIW A;  1YSY A;  4I5S A;  4GHA A;  1NNU C;  3SFZ A;  4JI4 M;  2UXB M;  2D7E A;  1DGB A;  2P5T A;  2L7H A;  4GRI A;  1XNQ M;  5C18 A;  4LCB A;  3GPY A;  3R8F A;  3AFH A;  1MU5 A;  1NHG C;  4AQY M;  1T3T A;  1LV7 A;  2M60 A;  2J7N A;  3H4M A;  1NVM A;  3MJ5 A;  1N78 A;  1L8Q A;  1MX0 A;  1OFH A;  4ITQ A;  3GQ5 A;  2YNM D;  3RE8 A;  4JN6 A;  3NBI A;  3VKH A;  1KSF X;  1SXJ D;  3EIE A;  4LJ4 A;  1IY2 A;  2EO2 A;  3UZU A;  2CHV A;  4OVZ A;  4FW9 A;  5EP1 A;  3KOY E;  3J27 B;  5EP4 A;  2BJV A;  1I94 M;  1Z59 A;  2HL7 A;  4LY6 A;  4D82 A;  1IXZ A;  1DO0 A;  5KPT A;  4IJF A;  4ZPX A;  3GPU A;  5E26 A;  2Z4R A;  4B3T M;  2EUC A;  3GLI B;  3RGP A;  3W0F A;  4HL4 A;  5IRE B;  1S3S A;  4LF5 M;  3FTF A;  4IBF A;  4WW0 A;  4LJ5 A;  1I4W A;  4LRT A;  3I4Y A;  4AKI A;  3HU1 A;  4GMQ A;  2KRU A;  3I51 A;  3TE6 A;  2XH9 A;  2UXC M;  3GLF B;  2Y0T A;  2R4E A;  4PCZ A;  4DR6 M;  3LMM A;  3SMP A;  3HGI A;  1SXJ B;  1Z5B A;  4B3M M;  3VDU A;  4L78 A;  1JQJ C;  3U60 A;  3U6P A;  3FTD A;  5FTN A;  1IBM M;  4DR2 M;  1N77 A;  1NJG A;  2G5G X;  1IN7 A;  3LVV A;  2XSZ D;  1DGH B;  3CF6 E;  1XC8 A;  1PJJ A;  4L8R C;  2H1R A;  2C5R A;  1DGG A;  4IBI A;  2CHG A;  3E4R A;  3VDP A;  5A2Q S;  4B7F A;  2JA2 A;  4G4N A;  3M0E A;  1GL6 A;  1SXJ E;  5EP3 A;  3U6L A;  4GIP A;  3QWL A;  2J7O A;  3CF0 A;  4BLC A;  3KDS E;  4FCW A;  3SYK A;  3L28 A;  4B7H A;  2F5P A;  4Z6Y A;  4LJA A;  1HT1 E;  5KQD A;  2F4V M;  3WHK A;  2ZAN A;  1XWI A;  4X64 M;  1N36 M;  4BBA A;  4IBK A;  3AJI B;  5ITX A;  1IQP A;  2Y0Q A;  3TL4 X;  3HJS A;  3SYL A;  3K8Z A;  3FYD A;  2RGO A;  4IBE A;  2CFO A;  1HT2 E;  1Q3B A;  4BB9 A;  2UUB M;  3AOE C;  2KZS A;  3E9S A;  5EXP A;  2LWX A;  4IBC A;  4M9X A;  3L29 A;  4MH0 E;  3SAW A;  3L25 A;  2C9C A;  2XLJ A;  5IT9 S;  3HJ8 A;  1IBK M;  2ZBK B;  4LZJ A;  5DYI A;  1JR3 A;  1XHB A;  1R6B X;  2FE8 A;  4L16 A;  4QHS A;  5EXT A;  5GKN A;  3ILK A;  4DV2 M;  4DR3 M;  1L1Z A;  1QVR A;  3MHV C;  4IJE A;  1KYI A;  4B7G A;  2QBY B;  5JI2 E;  4M0W A;  5E6J A;  2DHR A;  4S12 A;  4LGY A;  3GLI A;  4D80 A;  4QNR A;  4RNA A;  4DUY M;  3LQR A;  1K3X A;  2L6O A;  3HU3 A;  4IBG A;  3R9X B;  4IBB A;  4D81 A;  1C1K A;  3J7A S;  4GH9 A;  2DXI A;  4AI6 A;  1IXR C;  1Z5C A;  4I81 A;  3JR5 A;  3VK7 A;  2FFJ A;  3K92 A;  4DV3 M;  2CHQ A;  1Z5A A;  4DV7 M;  4AG6 A;  2EA0 A;  2DZO B;  3GLH B;  3K1J A;  3SBJ A;  4GKJ M;  4LFA M;  3A42 A;  4JI8 M;  4LRS A;  5FLX S;  2DWN A;  4P16 A;  2DWZ B;  4NRW A;  1E94 E;  2CEA A;  2DVW B;  3HHW A;  3OTO M;  3HHY A;  4LJ6 A;  1IN8 A;  2C98 A;  3DZD A;  3FUX A;  2E5L M;  4JI6 M;  4TUW A;  3U5Z B;  1VDD A;  3SAV A;  3GPP A;  4JYA M;  3PXG A;  3GQ3 A;  3KOZ E;  4A3V B;  5KPR A;  3U61 B;  2CE7 A;  4AW4 A;  3FUW A;  3IG8 A;  4L15 A;  3KS4 A;  1DGF A;  1L2D A;  3W0L B;  2QZ4 A;  1L2C A;  3GP1 A;  1IN4 A;  2HHH M;  1GL7 A;  5EJC A;  4XBO A;  5EXX A;  2YR0 A;  4EIW A;  4JI3 M;  3VLF B;  4MGZ E;  2Z7J A;  3AOE A;  5EP2 A;  3FYC A;  3HHX A;  1N32 M;  3EIH A;  3AOG A;  3J81 S;  3QAU A;  4FCT A;  1SXJ C;  4KHP M;  3KSX A;  3GLG B;  3IG5 A;  3RGS A;  2O5R A;  3U6O A;  1N75 A;  1N33 M;  2XFT A;  4PT5 A;  8CAT A;  1ZAE A;  5DYG A;  3UGJ A;  3FUT A;  2KXE A;  2QBY A;  3U6S A;  3VFD A;  4GC9 A;  5FTM A;  1L2B A;  3HU2 A;  3ZH9 B;  4X65 M;  2QCU A;  3SAR A;  4G6Z A;  4AKH A;  1W5T A;  2X49 A;  2W82 A;  3AV0 A;  3FUV A;  3FTE A;  1D2N A;  1H6U A;  2V1U A;  1Q3C A;  4OX9 M;  3GRU A;  1QAN A;  2UUA M;  2G8L A;  4DV0 M;  3LVW A;  1PJI A;  3PNV A;  4MGK E;  5IWA M;  1IY0 A;  5C1B A;  3HWS A;  1OFI A;  4JV5 M;  3DOA A;  2Z3X A;  1QYR A;  4I4L A;  4GHL A;  1N34 M;  1XNR M;  4RF1 A;  4PDG A;  4RF0 A;  1IN6 A;  4MB7 A;  3VK8 A;  5KO3 A;  4OU7 A;  1QZM A;  2HKJ A;  2ZAM A;  2KW0 A;  4LF9 M;  1GVN A;  1NHW C;  3ZC7 B;  4NSO B;  4B3S M;  3MK6 A;  2CV2 A;  5FTL A;  1E32 A;  5ITU A;  3TWM A;  2XF3 A;  4LJ8 A;  2LH0 A;  3FKE A;  2YQZ A;  4R7G A;  5JI3 E;  3A46 A;  2UUC M;  2QP9 X;  5ITY A;  4NOO B;  4OVZ B;  2OQ4 A;  1K82 A;  1QAO A;  1G41 A;  1GKI A;  4KLN A;  2ERC A;  1R7R A;  1KFV A;  1K3W A;  1G59 A;  2DZN B;  1HR0 M;  4PDI A;  3T1H M;  4JI2 M;  3ZCB B;  3U6E A;  3PVS A;  1W5S A;  2UU9 M;  4LJ7 A;  4LFC M;  3BOS A;  1IY1 A;  1IXS B;  4Z8X A;  3TPZ A;  4IBJ A;  2NQ8 C;  5BPV A;  1YUB A;  4KO8 A;  3SMS A;  4OW0 A;  4G4R A;  5FTK A;  1Q39 A;  5DNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...