4JYAM

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jyaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jyaM02
3GPXA 2VQEM 4LF8M 1Q3BA 2UUCM 3JR5A 4CISA 1Z59A 2XZFA 1HNZM 4JYAM 1R2ZA 5FLXS 1Q39A 1I94M 4JI1M 4ITQA 4JI8M 5ITXE 3SAWA 3U6CA 1IBLM 4JI2M 4DV6M 1FJGM 4GKJM 3TWKA 4KHPM 2UXDM 2UU9M 3U6EA 4X64M 4NXMM 4DV2M 5ITYA 4JI3M 3GQ5A 3A42A 5BR8M 3U6PA 4PCZA 2F5NA 1PJJA 1L1ZA 4LF9M 4G4RA 5IWAM 4DR4M 2HHHM 3U6QA 3J81S 1MX0A 3A45A 3U6LA 1TDHA 1R2YA 1J5EM 4LF5M 1XMOM 1KFVA 2UUBM 1Z5AA 4AQYM 4GKKM 4DUYM 4LF4M 4JV5M 3GPUA 3U6MA 3VK7A 3A46A 5LMNM 3OTOM 1Z5CA 3JAMS 4X65M 4G4NA 4JI6M 3GQ4A 2EA0A 4DUZM 4B3RM 4DR6M 3DOAA 3J80S 3TWLA 1NNJA 4DV0M 2Q2EB 1L2DA 4LFCM 4JI7M 4B3MM 4DR7M 4B3TM 4DV1M 4LFAM 5ITXA 1TDZA 1K3XA 3SARA 2UXCM 4DR1M 4DV4M 5ITTA 4NRWA 2UUAM 2F5PA 3SATA 2F5OA 1HNWM 3T1YM 1PM5A 5ITRA 4G4QA 3U6SA 4DR5M 3T1HM 1K3WA 1N32M 3U6DA 1XNRM 1XNQM 3SAUA 2F5SA 3C58A 3GQ3A 4DV7M 4PDIA 2F5QA 1EE8A 1MU5A 1N34M 3J7AS 1Z5BA 1Q3CA 1L1TA 2XZUA 4OX9M 3SBJA 3SASA 4K0KM 4PD2A 3GP1A 3W0FA 4DV5M 4X62M 2OPFA 4YY3M 1N33M 4MB7A 5LMUM 1K82A 2UXBM 2ZBKB 4DV3M 4LF6M 1L2BA 5ITQA 3GO8A 1PJIA 3TWMA 4NXNM 2OQ4A 4B3SM 3U6OA 1XMQM 3GPPA 3JR4A 4YHHM 1L2CA 4G4OA 3VK8A 1HR0M 2E5LM 4DR3M 4X66M 4JI4M 2F4VM 4JI0M 4DR2M 3GPYA 4LF7M 2VQFM 2ZM6M 1N36M 3SAVA 1HNXM 4JI5M 5A2QS 1IBMM 4LFBM 5IT9S 2HKJA 5ITUA 1XC8A 1IBKM 4PDGA 4NRVA
chains in the Genus database with same CATH superfamily
4LF8M 2DZNB 3I01M 2UUCM 1WR1B 2CE7A 4EIWA 4AI6A 1Z59A 2EO2A 1ZMUA 2VIIA 4ITQA 4IBIA 1FJGM 4I81A 4CHTB 3LW5F 3KVWA 4MM3B 4OVZB 4M9XA 4MGKE 3K2LA 4LJ6A 5C18A 4X64M 1GKIA 2LBCA 3U6EA 4NXMM 1VDLA 2M5ZA 3PNVA 4FW9A 1E94E 3AL0C 2F5NA 1PJJA 2H5XA 2QP9X 2GNOA 2JZ1A 3I4YA 1N77A 4LG2A 2VF7A 1QAQA 4XK8F 3J2PB 2XGNA 2K9DA 4GMQA 3K9PA 2HHHM 3AJIB 4FCWA 4AG5A 3KFUG 3A98B 1MX0A 3A45A 2KHHA 4W5WA 1FNNA 2C98A 3I51A 1OTRA 2X4AA 4IBBA 1HT1E 1XMOM 5EXTA 1KFVA 3GLGB 4DUYM 2R45A 4JV5M 1G71A 2K6BA 5JI3E 2LVAA 1IQPA 3FTCA 2KXEA 3PVSA 4PT5A 2K47A 3E46A 2XSZD 3KSJA 2DKLA 3FUXA 1Z5CA 3HHXA 4LJ9A 5EP1A 3GLGE 3FUWA 4MGZE 2DWMA 4D80A 3HKPA 2KZUA 2CHVA 4JI6M 2QHOB 2EA0A 2QQ8A 4DUZM 3U61B 1Z6TA 4Z8XA 1QZMA 3GLFE 3U5ZB 3KP1E 4LGMA 1JB0F 1HQYE 4L6V6 3TL4X 3TWLA 4BB9A 4LJAA 2XFTA 4NSRA 2H1RA 1OJLA 2V1CA 3M0EA 1D0MA 2K0BX 2WZJA 4I4LA 2HAKA 1GL7A 2JNHA 3WHKA 3SARA 2GQFA 4HL4A 2UXCM 1SG9A 2L4FA 1PRBA 1Q02A 2F5PA 3M7GA 4CJ6A 1IN6A 4LRSA 3T1HM 3U6DA 5EP4A 2O01F 1XNQM 4QNMA 3GQ3A 2EKKA 1DGHB 1YSYA 3VDUA 4QHSA 2DAKA 1N34M 4XGIA 2X49A 1Z5BA 1Q3CA 2DAGA 2DAMA 3KW6A 4M9SA 4FCTA 2RGHA 3KOWE 3SASA 2EJSA 1IN5A 1QDRA 3MMPA 3GP1A 3W0FA 4IBDA 1F4IA 4GHLA 3Q8XA 2QPAA 2UXBM 2XFSA 3EIEA 2YNMD 5EXXA 5F3WA 1DV0A 1OAOC 4AKHA 3W68A 4LF6M 3L29A 3PNYA 2ZAOA 3QYBA 4G6ZA 3GO8A 3UK6A 4TUWA 3I4VA 4M9ZA 1NHGC 2JY5A 1ZMVA 3FUUA 3TE6A 5H37D 4NXNM 3UZUA 4B3SM 3QWLA 3GLGA 1SXJD 4MGHA 3T6PA 1GVNA 2ZTDA 1LTMA 3I04M 1UFZA 1AUAA 3GPPA 4L78A 1PJQA 1XWIA 1L2CA 1G3IA 3K92A 2E5LM 3GLFA 4FD2A 4DR3M 2QBYB 3VFDA 1XXHB 5C1BA 1GABA 2KA6B 1HQCA 4DR2M 3GPYA 2DENA 4WW0A 1OIZA 1DGGA 5KPZA 1ZMWA 2ZM6M 3SAVA 2FE8A 2J7OA 1E9RA 2HKJA 3IHPA 1XC8A 1IBKM 3FD9A 1XXHE 2MROB 1Y8GA 2HWJA 3QYEA 3HX3A 3GPXA 1Q3BA 2DVWB 1VG5A 2QSFX 3GRUA 1IY2A 1TR8A 2Y20A 3RGPA 1IXSB 3AKZA 4JYAM 1NY5A 4UN2B 2FH0A 4OU7A 4WURA 4JI2M 1IXRC 3F92A 4GKJM 4FWHA 3TWKA 3GLIB 2UXDM 2DWNA 4HLQA 4DV2M 2LVPC 2Y0TA 3KS4A 1IY0A 4JI3M 3GQ5A 3A42A 4F1IA 3RFWA 1MJGM 3FKEA 3LVWA 4PCZA 2I7PA 4GH9A 4IIWA 4LF9M 2HL7A 1SXJB 3THGA 3R8FA 1I4WA 2C9OA 5FTNA 5DFLA 4M0DA 3U6QA 2D7GA 2X8AA 2KNVA 3SHGB 3J81S 3AOEC 3B9PA 3C3EA 3U6LA 1SXJE 3H4JA 4GC9A 3TPZA 1R2YA 2CV1A 4FCVA 4LF5M 3FTEA 2ERCA 4B08A 2UUBM 1Z5AA 3IG8A 4IBJA 2CFOA 4LF4M 3KP0E 2CWBA 4S12A 1WGLA 3GPUA 3RE8A 3VK7A 3SFZA 3DA1A 3GRVA 2HCBA 3SYLA 1WGNA 2MJ5B 3VLFB 1GJTA 2RKOA 3L27A 4BBAA 4IBFA 3SHFA 1G59A 4QHTA 3GQ4A 4AZFA 1CUKA 2B3TA 2D7EA 2RGOA 3U60A 4Y28F 1XXHA 1JR3D 2C96A 5DNYA 3L25A 4DR6M 4DBGB 3DOAA 4Z6YA 2LXEA 3PFIA 2WSEF 1XHBA 1WJ7A 1QDTA 5FTJA 4DV0M 1L2DA 4B3MM 1A5TA 4JI7M 4LFCM 2CV2A 4DV1M 3FUVA 1K3XA 1XB2B 2CRUA 3PXGA 4DR1M 4KLNA 4DV4M 1JQJC 4I5SA 5DYIA 2CHQA 1SXJC 1TH2A 3LCVB 3UGJA 4R71A 3SATA 1HNWM 3ZQJA 4G4QA 2YFQA 2DI0A 3LCUA 3W0LB 4DR5M 2LNHC 2BJWA 2CP8A 2KNZA 3U6SA 4NOOB 2R62A 3SAUA 2F5SA 3C58A 1G8PA 4JXJA 1J09A 5JI2E 3C9PA 1T43A 1MU5A 2EKFA 2XEPA 2O5RA 3J7AS 4L16A 2JP7A 3FRHA 4IBCA 1NVMA 3HZJA 4K0KM 3KOYE 4IBEA 1SXJA 4DV5M 3TQSA 3B7QA 4REZA 1N33M 4GIPA 4D81A 1K82A 1W5SA 5FTLA 3IG5A 3NBIA 4D82A 5EXPA 1OQYA 2LVOC 5EQTA 2FFJA 5EXSA 2L6OA 3TWMA 1TH3A 2Y21A 2OQ4A 2QENA 1XMQM 1PJSA 2L7HA 3HHWA 3JR4A 1JR3E 1OFIA 4FWGA 1C7YA 4OVZA 3E4RA 1VEJA 4X66M 2L2DA 2RRUA 2F4VM 2G5GX 2J5YA 1ZQ9A 1NSFA 3NWLA 4LF7M 1IM2A 4NL4H 3AV0A 1IBMM 2Z3XA 2Z7JA 5EP2A 2BJVA 5KQDA 4QOSA 1N75A 3UJNA 2V1UA 2KRKA 3DFZA 4B7FA 4F2LA 3JR5A 1HJPA 2XZFA 3L2AA 1I94M 1Q39A 3HHYA 5KO3A 5ITXE 3SAWA 3U6CA 3R9XB 1TH4A 5FTMA 4KHPM 3CF0A 1N78A 1VDDA 4R7GA 2VDBB 5BR8M 1AIPC 2C99A 2DZLA 1T6OA 4QOZC 4IBKA 4RNAA 2DHRA 2FNAA 4G4RA 1PJTA 3HJ8A 1GO5A 1MN3A 5IWAM 1ORYB 2BWBA 4LY6A 3AOGA 1NV8A 3U61A 1GL6A 3U5ZA 2R65A 3ZC7B 1HT2E 1TDHA 2ZANA 1R4GA 4AQYM 4GKKM 4IBGA 2LVQD 1DO0A 3B74A 4P16A 4RKUF 1JR3A 1T3TA 5E6JA 3J7BA 4JN6A 3U6MA 2Y0QA 2FOIC 4LCBA 4LJ5A 2APLA 2R18A 3HWSA 1V34A 5LMNM 5EP3A 3OTOM 3W67A 2OOBA 3JAMS 2KEBA 4KT0F 3HU3A 2ZTCA 3HGIA 2MR9A 2R46A 3GLIE 1DGHA 2L09A 4B3RM 4GHAA 1C1KA 3AFHA 3E21A 2LVNC 4LRTA 3SMPA 3FRIA 2DXIA 3BXWA 2L4EA 3WHLA 1IY1A 3J80S 1R5LA 2DWZB 4I8OA 1NNJA 2Q2EB 4HEOA 4DR7M 1P3QQ 2XSZA 2FS1A 2XF3A 4KO8A 4Q7JA 4LFAM 5ITXA 2KW0A 1NY6A 4OW0A 2OO9A 2Z8YM 3QAUA 4GRIA 4XBOA 4NRWA 3GRRA 4WP2A 3ZCBB 3T1YM 2JY7A 1PM5A 4AKIA 1QUTA 2JWSA 1N32M 2L7IA 1XNRM 3CF2A 3FE3A 2CUZA 1V33A 1QANA 1YLAA 4DV7M 2BWEA 1QYRA 3CF6E 1EE8A 1QAOA 5DYGA 3AOEA 5FSWA 2W82A 2XZUA 2NQ8C 4OX9M 4GC5A 3SBJA 4AG6A 3HJSA 3D8BA 2QCUA 1TF0B 2DZOB 3K1JA 2QBYA 3GRYA 4X62M 1VQ1A 4MB7A 5LMUM 4GITA 1DGFA 1GLNA 3KS8A 3LVVA 1QQWA 1IN4A 3B7NA 4MGIE 5ITQA 1L2BA 3VKGA 1OAIA 3B89A 1OFHA 4CGYB 1OIPA 2R0IA 3U6OA 1IXSA 3C3DA 1WXQA 3D8LA 3L26A 3H4MA 3K8ZA 2R6FA 3KOZE 4G4OA 1HR0M 2DHYA 3GLIA 4P17A 2LWXA 5E26A 2A5YB 1RU3A 3KDSE 1WIVA 4JI0M 3BBZA 2MH8A 1W5TA 2KRUA 2VQFM 4NC6A 4L8RC 2G8LA 1EIJA 4LFBM 5IT9S 2LTUA 2G3QA 2ZAMA 3L28A 3KSXA 3LQRA 2LH0A 5EJCA 4LGYA 2CV0A 2QZ4A 3KXEC 4LJ4A 4B7HA 3FUTA 4PDGA 2VQEM 2YQZA 8CATA 3HU1A 4IJEA 3MK6A 1QUSA 4CISA 1HNZM 3B7ZA 3E9SA 4IJFA 2I7NA 5FLXS 1NJGA 1R2ZA 2R4JA 4JI8M 4JI1M 1NHWC 1KSFX 1IBLM 1QVRA 2R44A 3GLHB 3GLFB 4LZZA 4DV6M 2UU9M 2JA2A 3SYKA 1E9SA 5ITYA 5KPTA 1ZV1A 2CEAA 3U6PA 3K9OA 3KOXE 1L1ZA 2M60A 1BVSA 3CTWB 3GLHE 3NBXX 3ILKA 4MH0E 2V6ZM 5KQ8A 4DR4M 3FTFA 4FVMA 4A3VB 5BPVA 1TTEA 1IN8A 2XLJA 1J5EM 3HJQA 1IFYA 1GJSA 2C9CA 2JY6B 3FYCA 3MJ5A 1YUBA 2JUJA 4R3DA 1D0LA 2JZ0A 1IXZA 2N35A 5IREB 4BLCA 4LJ8A 2KDLA 3IECA 3A46A 5IZ7D 3HU2A 1DO2A 3V76A 4G3OA 4LJ7A 1IN7A 2CHGA 2KNAA 4X65M 3HHZA 3SC3A 4G4NA 2XH9A 2WSCF 1E32A 4LZJA 2LHGA 4MGYE 4CIZA 5GKNA 2OOAA 4L15A 4B3TM 4II7A 1WHCA 5FTKA 1TDZA 1QZEA 3FYDA 1EFUB 5ITTA 2UUAM 5L8RF 2DWLA 2QNJA 1D0KA 2F5OA 1S3SA 5ITRA 4NSOB 1YE9A 1K3WA 3UMMA 1UM8A 1KYIA 1G41A 3GLHA 3U60B 4PDIA 2F5QA 4QNRA 3J27B 1G4AE 2MGWA 4B7GA 1L1TA 2BNKA 2JY8A 2KZSA 3M6AA 4M0WA 1TGUA 3RGSA 3DZDA 3MHVC 3LQQA 3CGWA 4RF0A 4AW4A 4PD2A 4RF1A 3BOSA 4L4UA 1NV9A 1DGBA 2OPFA 1J7KA 2YR0A 7CATA 4YY3M 1ZAEA 4AKGA 1L8QA 2AHMA 2Z4RA 2DNAA 1QAMA 2ZBKB 2JXNA 4DV3M 1D2NA 2Z4SA 4FWDA 2D7HA 4KODA 1VEGA 2WSFF 3HY5A 2R4EA 1OKSA 3SMSA 2DAEA 3EIHA 3FTDA 3T38A 1PJIA 1H6UA 1X37A 1VEKA 2C5RA 4ZPXA 3ZH9B 3Q8GA 4GEWA 2J7NA 4ANRA 3VKHA 4YHHM 2EUCA 3VK8A 5KPRA 2P5TA 4JI4M 1NJFA 1PGYA 1R7RA 2DAIA 2LHCA 2O25A 3T15A 1N36M 1LV7A 1HNXM 1NNUC 4JI5M 5A2QS 1V92A 3LMMA 5ITUA 2VF8A 4NRVA 1R6BX 1NO1A 3VDPA
chains in the Genus database with same CATH topology
4LF8M 2DZNB 2UUCM 2CE7A 4EIWA 4AI6A 1Z59A 2EO2A 2VIIA 4ITQA 4IBIA 1FJGM 4I81A 4CHTB 3KVWA 4MM3B 4OVZB 4M9XA 4MGKE 3K2LA 4LJ6A 5C18A 4X64M 1GKIA 3U6EA 4NXMM 2M5ZA 3PNVA 4FW9A 1E94E 3AL0C 2F5NA 1PJJA 2QP9X 3I4YA 1N77A 4LG2A 1QAQA 3J2PB 2XGNA 4GMQA 2HHHM 3KFUG 3AJIB 4FCWA 4AG5A 3A98B 1MX0A 3A45A 4W5WA 1FNNA 2C98A 3I51A 2X4AA 4IBBA 1HT1E 1XMOM 5EXTA 1KFVA 3GLGB 4DUYM 2R45A 4JV5M 5JI3E 1IQPA 3FTCA 2KXEA 3PVSA 4PT5A 2K47A 2XSZD 3KSJA 3FUXA 5EP1A 1Z5CA 3HHXA 4LJ9A 3FUWA 4MGZE 2DWMA 4D80A 3HKPA 2KZUA 2CHVA 4JI6M 2EA0A 4DUZM 3U61B 1Z6TA 4Z8XA 1QZMA 3U5ZB 3KP1E 4LGMA 1HQYE 3TL4X 3TWLA 4BB9A 4LJAA 2XFTA 4NSRA 2H1RA 1OJLA 2V1CA 3M0EA 3SARA 4I4LA 2UXCM 1GL7A 3WHKA 4HL4A 2F5PA 3M7GA 1IN6A 4LRSA 3T1HM 3U6DA 5EP4A 1XNQM 4QNMA 3GQ3A 1DGHB 1YSYA 3VDUA 4QHSA 1N34M 4XGIA 2X49A 1Z5BA 1Q3CA 3KW6A 4M9SA 4FCTA 2RGHA 3KOWE 3SASA 1IN5A 3GP1A 3W0FA 4IBDA 4GHLA 3Q8XA 2QPAA 2UXBM 2XFSA 3EIEA 2YNMD 5EXXA 5F3WA 4AKHA 4LF6M 3L29A 3PNYA 2ZAOA 4G6ZA 3GO8A 3UK6A 4TUWA 3I4VA 4M9ZA 1NHGC 3FUUA 3TE6A 5H37D 4NXNM 3UZUA 4B3SM 3QWLA 3GLGA 1SXJD 4MGHA 1GVNA 3GPPA 4L78A 1XWIA 1L2CA 1G3IA 3K92A 2E5LM 3GLFA 4FD2A 4DR3M 2QBYB 3VFDA 1XXHB 5C1BA 2KA6B 1HQCA 4DR2M 3GPYA 4WW0A 5KPZA 1DGGA 2ZM6M 3SAVA 2FE8A 2J7OA 1E9RA 2HKJA 1XC8A 1IBKM 3FD9A 3GPXA 1Q3BA 2DVWB 3GRUA 1IY2A 3RGPA 2Y20A 3AKZA 1IXSB 4JYAM 1NY5A 4OU7A 4WURA 4JI2M 1IXRC 4GKJM 4FWHA 3TWKA 3GLIB 2UXDM 2DWNA 4HLQA 4DV2M 3KS4A 2Y0TA 4JI3M 1IY0A 3GQ5A 3A42A 3RFWA 3FKEA 3LVWA 4PCZA 2I7PA 4GH9A 4IIWA 4LF9M 2HL7A 1SXJB 3THGA 3R8FA 1I4WA 2C9OA 5FTNA 4M0DA 3U6QA 2D7GA 2X8AA 3SHGB 3J81S 3AOEC 3B9PA 3U6LA 1SXJE 4GC9A 3TPZA 1R2YA 4LF5M 2CV1A 4FCVA 3FTEA 2ERCA 4B08A 2UUBM 1Z5AA 3IG8A 4IBJA 2CFOA 4LF4M 3KP0E 4S12A 3GPUA 3RE8A 3VK7A 3SFZA 3DA1A 3GRVA 2HCBA 3SYLA 3VLFB 2RKOA 3L27A 4BBAA 4IBFA 3SHFA 1G59A 4QHTA 3GQ4A 4AZFA 2D7EA 2RGOA 3U60A 1XXHA 1JR3D 2C96A 5DNYA 3L25A 4DR6M 3DOAA 4Z6YA 2LXEA 3PFIA 1XHBA 5FTJA 4DV0M 1L2DA 4JI7M 4B3MM 4LFCM 2CV2A 4DV1M 3FUVA 1K3XA 3PXGA 4DR1M 4KLNA 4DV4M 1JQJC 4I5SA 5DYIA 2CHQA 1SXJC 1TH2A 3UGJA 3SATA 1HNWM 4G4QA 2YFQA 3W0LB 4DR5M 3U6SA 2LNHC 2BJWA 4NOOB 2R62A 3SAUA 2F5SA 3C58A 1G8PA 4JXJA 1J09A 5JI2E 1MU5A 2XEPA 3J7AS 2O5RA 4L16A 4IBCA 1NVMA 4K0KM 3KOYE 4IBEA 1SXJA 4DV5M 3TQSA 4REZA 1N33M 4GIPA 4D81A 1K82A 1W5SA 5FTLA 3IG5A 3NBIA 4D82A 5EXPA 5EQTA 2FFJA 5EXSA 2L6OA 3TWMA 1TH3A 2Y21A 2OQ4A 2QENA 1XMQM 2L7HA 3HHWA 3JR4A 4FWGA 1OFIA 4OVZA 3E4RA 4X66M 2F4VM 2G5GX 1ZQ9A 1NSFA 3NWLA 4LF7M 1IM2A 4NL4H 3AV0A 1IBMM 2Z3XA 2Z7JA 5EP2A 2BJVA 5KQDA 4QOSA 1N75A 3UJNA 2V1UA 2KRKA 3DFZA 4B7FA 3JR5A 2XZFA 3L2AA 1I94M 1Q39A 3HHYA 5KO3A 5ITXE 3SAWA 3U6CA 3R9XB 1TH4A 5FTMA 4KHPM 3CF0A 1N78A 1VDDA 4R7GA 5BR8M 2C99A 4QOZC 4IBKA 4RNAA 2DHRA 2FNAA 4G4RA 3HJ8A 5IWAM 1ORYB 4LY6A 3AOGA 3U61A 1GL6A 3U5ZA 2R65A 3ZC7B 1HT2E 1TDHA 2ZANA 4AQYM 4GKKM 4IBGA 1DO0A 4P16A 1JR3A 1T3TA 5E6JA 3J7BA 4JN6A 3U6MA 2Y0QA 2FOIC 4LCBA 4LJ5A 2R18A 3HWSA 5LMNM 5EP3A 3OTOM 3JAMS 2KEBA 3HU3A 3HGIA 2R46A 4GHAA 1DGHA 2L09A 4B3RM 1C1KA 3AFHA 3SMPA 2DXIA 4LRTA 3WHLA 1IY1A 3J80S 2DWZB 4I8OA 1NNJA 2Q2EB 4DR7M 2XSZA 2XF3A 4KO8A 4LFAM 5ITXA 1NY6A 2KW0A 4OW0A 4XBOA 4GRIA 3QAUA 4NRWA 3GRRA 3ZCBB 3T1YM 1PM5A 4AKIA 1N32M 2L7IA 1XNRM 3CF2A 2CUZA 1QANA 4DV7M 1QYRA 3CF6E 1EE8A 1QAOA 5DYGA 3AOEA 5FSWA 2W82A 2XZUA 2NQ8C 4OX9M 4GC5A 3SBJA 4AG6A 3HJSA 3D8BA 2QCUA 2DZOB 3K1JA 2QBYA 3GRYA 4X62M 4MB7A 5LMUM 4GITA 1DGFA 1GLNA 3KS8A 3LVVA 1QQWA 1IN4A 4MGIE 5ITQA 1L2BA 3VKGA 1OFHA 4CGYB 3U6OA 1WXQA 3D8LA 3L26A 3H4MA 3K8ZA 3KOZE 4G4OA 1HR0M 3GLIA 2LWXA 5E26A 2A5YB 3KDSE 4JI0M 1W5TA 2KRUA 2VQFM 4L8RC 2G8LA 4LFBM 5IT9S 2ZAMA 3L28A 3KSXA 3LQRA 2LH0A 5EJCA 4LGYA 2CV0A 2QZ4A 3KXEC 4LJ4A 4B7HA 3FUTA 4PDGA 2VQEM 2YQZA 8CATA 3HU1A 4IJEA 3MK6A 4CISA 1HNZM 4IJFA 3E9SA 1R2ZA 2I7NA 5FLXS 1NJGA 4JI1M 2R4JA 4JI8M 1NHWC 1KSFX 1IBLM 1QVRA 4DV6M 3GLHB 3GLFB 4LZZA 2UU9M 2JA2A 3SYKA 1E9SA 5ITYA 5KPTA 2CEAA 3U6PA 3KOXE 1L1ZA 2M60A 3CTWB 3ILKA 4MH0E 2V6ZM 5KQ8A 4DR4M 3FTFA 4FVMA 4A3VB 5BPVA 1IN8A 2XLJA 1J5EM 3HJQA 2C9CA 3FYCA 3MJ5A 1YUBA 4R3DA 1IXZA 5IREB 4BLCA 4LJ8A 3A46A 5IZ7D 3HU2A 1DO2A 4LJ7A 1IN7A 2CHGA 4X65M 3HHZA 3SC3A 4G4NA 2XH9A 1E32A 4LZJA 4MGYE 5GKNA 4L15A 4B3TM 4II7A 5FTKA 1TDZA 3FYDA 5ITTA 2UUAM 2DWLA 2F5OA 1S3SA 5ITRA 4NSOB 1YE9A 1K3WA 3UMMA 1UM8A 1KYIA 1G41A 3GLHA 3U60B 4PDIA 2F5QA 4QNRA 3J27B 1G4AE 4B7GA 1L1TA 2BNKA 2KZSA 3M6AA 4M0WA 3RGSA 1TGUA 3DZDA 3MHVC 3LQQA 4RF0A 4AW4A 4PD2A 4RF1A 3BOSA 4L4UA 1DGBA 2OPFA 1J7KA 2YR0A 7CATA 4YY3M 1ZAEA 4AKGA 1L8QA 2AHMA 2Z4RA 1QAMA 2ZBKB 4DV3M 1D2NA 2Z4SA 4FWDA 2D7HA 4KODA 2R4EA 3SMSA 3T38A 1PJIA 3EIHA 3FTDA 1H6UA 1X37A 2C5RA 4ZPXA 3ZH9B 3VKHA 2J7NA 4YHHM 2EUCA 3VK8A 5KPRA 2P5TA 4JI4M 1NJFA 1R7RA 3T15A 1N36M 1LV7A 1HNXM 1NNUC 4JI5M 5A2QS 3LMMA 5ITUA 4NRVA 1R6BX 3VDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPX A;  2VQE M;  4LF8 M;  1Q3B A;  2UUC M;  3JR5 A;  4CIS A;  1Z59 A;  2XZF A;  1HNZ M;  4JYA M;  1R2Z A;  5FLX S;  1Q39 A;  1I94 M;  4JI1 M;  4ITQ A;  4JI8 M;  5ITX E;  3SAW A;  3U6C A;  1IBL M;  4JI2 M;  4DV6 M;  1FJG M;  4GKJ M;  3TWK A;  4KHP M;  2UXD M;  2UU9 M;  3U6E A;  4X64 M;  4NXM M;  4DV2 M;  5ITY A;  4JI3 M;  3GQ5 A;  3A42 A;  5BR8 M;  3U6P A;  4PCZ A;  2F5N A;  1PJJ A;  1L1Z A;  4LF9 M;  4G4R A;  5IWA M;  4DR4 M;  2HHH M;  3U6Q A;  3J81 S;  1MX0 A;  3A45 A;  3U6L A;  1TDH A;  1R2Y A;  1J5E M;  4LF5 M;  1XMO M;  1KFV A;  2UUB M;  1Z5A A;  4AQY M;  4GKK M;  4DUY M;  4LF4 M;  4JV5 M;  3GPU A;  3U6M A;  3VK7 A;  3A46 A;  5LMN M;  3OTO M;  1Z5C A;  3JAM S;  4X65 M;  4G4N A;  4JI6 M;  3GQ4 A;  2EA0 A;  4DUZ M;  4B3R M;  4DR6 M;  3DOA A;  3J80 S;  3TWL A;  1NNJ A;  4DV0 M;  2Q2E B;  1L2D A;  4LFC M;  4JI7 M;  4B3M M;  4DR7 M;  4B3T M;  4DV1 M;  4LFA M;  5ITX A;  1TDZ A;  1K3X A;  3SAR A;  2UXC M;  4DR1 M;  4DV4 M;  5ITT A;  4NRW A;  2UUA M;  2F5P A;  3SAT A;  2F5O A;  1HNW M;  3T1Y M;  1PM5 A;  5ITR A;  4G4Q A;  3U6S A;  4DR5 M;  3T1H M;  1K3W A;  1N32 M;  3U6D A;  1XNR M;  1XNQ M;  3SAU A;  2F5S A;  3C58 A;  3GQ3 A;  4DV7 M;  4PDI A;  2F5Q A;  1EE8 A;  1MU5 A;  1N34 M;  3J7A S;  1Z5B A;  1Q3C A;  1L1T A;  2XZU A;  4OX9 M;  3SBJ A;  3SAS A;  4K0K M;  4PD2 A;  3GP1 A;  3W0F A;  4DV5 M;  4X62 M;  2OPF A;  4YY3 M;  1N33 M;  4MB7 A;  5LMU M;  1K82 A;  2UXB M;  2ZBK B;  4DV3 M;  4LF6 M;  1L2B A;  5ITQ A;  3GO8 A;  1PJI A;  3TWM A;  4NXN M;  2OQ4 A;  4B3S M;  3U6O A;  1XMQ M;  3GPP A;  3JR4 A;  4YHH M;  1L2C A;  4G4O A;  3VK8 A;  1HR0 M;  2E5L M;  4DR3 M;  4X66 M;  4JI4 M;  2F4V M;  4JI0 M;  4DR2 M;  3GPY A;  4LF7 M;  2VQF M;  2ZM6 M;  1N36 M;  3SAV A;  1HNX M;  4JI5 M;  5A2Q S;  1IBM M;  4LFB M;  5IT9 S;  2HKJ A;  5ITU A;  1XC8 A;  1IBK M;  4PDG A;  4NRV A; 
#chains in the Genus database with same CATH topology
 4LF8 M;  2DZN B;  3I01 M;  2UUC M;  1WR1 B;  2CE7 A;  4EIW A;  4AI6 A;  1Z59 A;  2EO2 A;  1ZMU A;  2VII A;  4ITQ A;  4IBI A;  1FJG M;  4I81 A;  4CHT B;  3LW5 F;  3KVW A;  4MM3 B;  4OVZ B;  4M9X A;  4MGK E;  3K2L A;  4LJ6 A;  5C18 A;  4X64 M;  1GKI A;  2LBC A;  3U6E A;  4NXM M;  1VDL A;  2M5Z A;  3PNV A;  4FW9 A;  1E94 E;  3AL0 C;  2F5N A;  1PJJ A;  2H5X A;  2QP9 X;  2GNO A;  2JZ1 A;  3I4Y A;  1N77 A;  4LG2 A;  2VF7 A;  1QAQ A;  4XK8 F;  3J2P B;  2XGN A;  2K9D A;  4GMQ A;  3K9P A;  2HHH M;  3AJI B;  4FCW A;  4AG5 A;  3KFU G;  3A98 B;  1MX0 A;  3A45 A;  2KHH A;  4W5W A;  1FNN A;  2C98 A;  3I51 A;  1OTR A;  2X4A A;  4IBB A;  1HT1 E;  1XMO M;  5EXT A;  1KFV A;  3GLG B;  4DUY M;  2R45 A;  4JV5 M;  1G71 A;  2K6B A;  5JI3 E;  2LVA A;  1IQP A;  3FTC A;  2KXE A;  3PVS A;  4PT5 A;  2K47 A;  3E46 A;  2XSZ D;  3KSJ A;  2DKL A;  3FUX A;  1Z5C A;  3HHX A;  4LJ9 A;  5EP1 A;  3GLG E;  3FUW A;  4MGZ E;  2DWM A;  4D80 A;  3HKP A;  2KZU A;  2CHV A;  4JI6 M;  2QHO B;  2EA0 A;  2QQ8 A;  4DUZ M;  3U61 B;  1Z6T A;  4Z8X A;  1QZM A;  3GLF E;  3U5Z B;  3KP1 E;  4LGM A;  1JB0 F;  1HQY E;  4L6V 6;  3TL4 X;  3TWL A;  4BB9 A;  4LJA A;  2XFT A;  4NSR A;  2H1R A;  1OJL A;  2V1C A;  3M0E A;  1D0M A;  2K0B X;  2WZJ A;  4I4L A;  2HAK A;  1GL7 A;  2JNH A;  3WHK A;  3SAR A;  2GQF A;  4HL4 A;  2UXC M;  1SG9 A;  2L4F A;  1PRB A;  1Q02 A;  2F5P A;  3M7G A;  4CJ6 A;  1IN6 A;  4LRS A;  3T1H M;  3U6D A;  5EP4 A;  2O01 F;  1XNQ M;  4QNM A;  3GQ3 A;  2EKK A;  1DGH B;  1YSY A;  3VDU A;  4QHS A;  2DAK A;  1N34 M;  4XGI A;  2X49 A;  1Z5B A;  1Q3C A;  2DAG A;  2DAM A;  3KW6 A;  4M9S A;  4FCT A;  2RGH A;  3KOW E;  3SAS A;  2EJS A;  1IN5 A;  1QDR A;  3MMP A;  3GP1 A;  3W0F A;  4IBD A;  1F4I A;  4GHL A;  3Q8X A;  2QPA A;  2UXB M;  2XFS A;  3EIE A;  2YNM D;  5EXX A;  5F3W A;  1DV0 A;  1OAO C;  4AKH A;  3W68 A;  4LF6 M;  3L29 A;  3PNY A;  2ZAO A;  3QYB A;  4G6Z A;  3GO8 A;  3UK6 A;  4TUW A;  3I4V A;  4M9Z A;  1NHG C;  2JY5 A;  1ZMV A;  3FUU A;  3TE6 A;  5H37 D;  4NXN M;  3UZU A;  4B3S M;  3QWL A;  3GLG A;  1SXJ D;  4MGH A;  3T6P A;  1GVN A;  2ZTD A;  1LTM A;  3I04 M;  1UFZ A;  1AUA A;  3GPP A;  4L78 A;  1PJQ A;  1XWI A;  1L2C A;  1G3I A;  3K92 A;  2E5L M;  3GLF A;  4FD2 A;  4DR3 M;  2QBY B;  3VFD A;  1XXH B;  5C1B A;  1GAB A;  2KA6 B;  1HQC A;  4DR2 M;  3GPY A;  2DEN A;  4WW0 A;  1OIZ A;  1DGG A;  5KPZ A;  1ZMW A;  2ZM6 M;  3SAV A;  2FE8 A;  2J7O A;  1E9R A;  2HKJ A;  3IHP A;  1XC8 A;  1IBK M;  3FD9 A;  1XXH E;  2MRO B;  1Y8G A;  2HWJ A;  3QYE A;  3HX3 A;  3GPX A;  1Q3B A;  2DVW B;  1VG5 A;  2QSF X;  3GRU A;  1IY2 A;  1TR8 A;  2Y20 A;  3RGP A;  1IXS B;  3AKZ A;  4JYA M;  1NY5 A;  4UN2 B;  2FH0 A;  4OU7 A;  4WUR A;  4JI2 M;  1IXR C;  3F92 A;  4GKJ M;  4FWH A;  3TWK A;  3GLI B;  2UXD M;  2DWN A;  4HLQ A;  4DV2 M;  2LVP C;  2Y0T A;  3KS4 A;  1IY0 A;  4JI3 M;  3GQ5 A;  3A42 A;  4F1I A;  3RFW A;  1MJG M;  3FKE A;  3LVW A;  4PCZ A;  2I7P A;  4GH9 A;  4IIW A;  4LF9 M;  2HL7 A;  1SXJ B;  3THG A;  3R8F A;  1I4W A;  2C9O A;  5FTN A;  5DFL A;  4M0D A;  3U6Q A;  2D7G A;  2X8A A;  2KNV A;  3SHG B;  3J81 S;  3AOE C;  3B9P A;  3C3E A;  3U6L A;  1SXJ E;  3H4J A;  4GC9 A;  3TPZ A;  1R2Y A;  2CV1 A;  4FCV A;  4LF5 M;  3FTE A;  2ERC A;  4B08 A;  2UUB M;  1Z5A A;  3IG8 A;  4IBJ A;  2CFO A;  4LF4 M;  3KP0 E;  2CWB A;  4S12 A;  1WGL A;  3GPU A;  3RE8 A;  3VK7 A;  3SFZ A;  3DA1 A;  3GRV A;  2HCB A;  3SYL A;  1WGN A;  2MJ5 B;  3VLF B;  1GJT A;  2RKO A;  3L27 A;  4BBA A;  4IBF A;  3SHF A;  1G59 A;  4QHT A;  3GQ4 A;  4AZF A;  1CUK A;  2B3T A;  2D7E A;  2RGO A;  3U60 A;  4Y28 F;  1XXH A;  1JR3 D;  2C96 A;  5DNY A;  3L25 A;  4DR6 M;  4DBG B;  3DOA A;  4Z6Y A;  2LXE A;  3PFI A;  2WSE F;  1XHB A;  1WJ7 A;  1QDT A;  5FTJ A;  4DV0 M;  1L2D A;  4B3M M;  1A5T A;  4JI7 M;  4LFC M;  2CV2 A;  4DV1 M;  3FUV A;  1K3X A;  1XB2 B;  2CRU A;  3PXG A;  4DR1 M;  4KLN A;  4DV4 M;  1JQJ C;  4I5S A;  5DYI A;  2CHQ A;  1SXJ C;  1TH2 A;  3LCV B;  3UGJ A;  4R71 A;  3SAT A;  1HNW M;  3ZQJ A;  4G4Q A;  2YFQ A;  2DI0 A;  3LCU A;  3W0L B;  4DR5 M;  2LNH C;  2BJW A;  2CP8 A;  2KNZ A;  3U6S A;  4NOO B;  2R62 A;  3SAU A;  2F5S A;  3C58 A;  1G8P A;  4JXJ A;  1J09 A;  5JI2 E;  3C9P A;  1T43 A;  1MU5 A;  2EKF A;  2XEP A;  2O5R A;  3J7A S;  4L16 A;  2JP7 A;  3FRH A;  4IBC A;  1NVM A;  3HZJ A;  4K0K M;  3KOY E;  4IBE A;  1SXJ A;  4DV5 M;  3TQS A;  3B7Q A;  4REZ A;  1N33 M;  4GIP A;  4D81 A;  1K82 A;  1W5S A;  5FTL A;  3IG5 A;  3NBI A;  4D82 A;  5EXP A;  1OQY A;  2LVO C;  5EQT A;  2FFJ A;  5EXS A;  2L6O A;  3TWM A;  1TH3 A;  2Y21 A;  2OQ4 A;  2QEN A;  1XMQ M;  1PJS A;  2L7H A;  3HHW A;  3JR4 A;  1JR3 E;  1OFI A;  4FWG A;  1C7Y A;  4OVZ A;  3E4R A;  1VEJ A;  4X66 M;  2L2D A;  2RRU A;  2F4V M;  2G5G X;  2J5Y A;  1ZQ9 A;  1NSF A;  3NWL A;  4LF7 M;  1IM2 A;  4NL4 H;  3AV0 A;  1IBM M;  2Z3X A;  2Z7J A;  5EP2 A;  2BJV A;  5KQD A;  4QOS A;  1N75 A;  3UJN A;  2V1U A;  2KRK A;  3DFZ A;  4B7F A;  4F2L A;  3JR5 A;  1HJP A;  2XZF A;  3L2A A;  1I94 M;  1Q39 A;  3HHY A;  5KO3 A;  5ITX E;  3SAW A;  3U6C A;  3R9X B;  1TH4 A;  5FTM A;  4KHP M;  3CF0 A;  1N78 A;  1VDD A;  4R7G A;  2VDB B;  5BR8 M;  1AIP C;  2C99 A;  2DZL A;  1T6O A;  4QOZ C;  4IBK A;  4RNA A;  2DHR A;  2FNA A;  4G4R A;  1PJT A;  3HJ8 A;  1GO5 A;  1MN3 A;  5IWA M;  1ORY B;  2BWB A;  4LY6 A;  3AOG A;  1NV8 A;  3U61 A;  1GL6 A;  3U5Z A;  2R65 A;  3ZC7 B;  1HT2 E;  1TDH A;  2ZAN A;  1R4G A;  4AQY M;  4GKK M;  4IBG A;  2LVQ D;  1DO0 A;  3B74 A;  4P16 A;  4RKU F;  1JR3 A;  1T3T A;  5E6J A;  3J7B A;  4JN6 A;  3U6M A;  2Y0Q A;  2FOI C;  4LCB A;  4LJ5 A;  2APL A;  2R18 A;  3HWS A;  1V34 A;  5LMN M;  5EP3 A;  3OTO M;  3W67 A;  2OOB A;  3JAM S;  2KEB A;  4KT0 F;  3HU3 A;  2ZTC A;  3HGI A;  2MR9 A;  2R46 A;  3GLI E;  1DGH A;  2L09 A;  4B3R M;  4GHA A;  1C1K A;  3AFH A;  3E21 A;  2LVN C;  4LRT A;  3SMP A;  3FRI A;  2DXI A;  3BXW A;  2L4E A;  3WHL A;  1IY1 A;  3J80 S;  1R5L A;  2DWZ B;  4I8O A;  1NNJ A;  2Q2E B;  4HEO A;  4DR7 M;  1P3Q Q;  2XSZ A;  2FS1 A;  2XF3 A;  4KO8 A;  4Q7J A;  4LFA M;  5ITX A;  2KW0 A;  1NY6 A;  4OW0 A;  2OO9 A;  2Z8Y M;  3QAU A;  4GRI A;  4XBO A;  4NRW A;  3GRR A;  4WP2 A;  3ZCB B;  3T1Y M;  2JY7 A;  1PM5 A;  4AKI A;  1QUT A;  2JWS A;  1N32 M;  2L7I A;  1XNR M;  3CF2 A;  3FE3 A;  2CUZ A;  1V33 A;  1QAN A;  1YLA A;  4DV7 M;  2BWE A;  1QYR A;  3CF6 E;  1EE8 A;  1QAO A;  5DYG A;  3AOE A;  5FSW A;  2W82 A;  2XZU A;  2NQ8 C;  4OX9 M;  4GC5 A;  3SBJ A;  4AG6 A;  3HJS A;  3D8B A;  2QCU A;  1TF0 B;  2DZO B;  3K1J A;  2QBY A;  3GRY A;  4X62 M;  1VQ1 A;  4MB7 A;  5LMU M;  4GIT A;  1DGF A;  1GLN A;  3KS8 A;  3LVV A;  1QQW A;  1IN4 A;  3B7N A;  4MGI E;  5ITQ A;  1L2B A;  3VKG A;  1OAI A;  3B89 A;  1OFH A;  4CGY B;  1OIP A;  2R0I A;  3U6O A;  1IXS A;  3C3D A;  1WXQ A;  3D8L A;  3L26 A;  3H4M A;  3K8Z A;  2R6F A;  3KOZ E;  4G4O A;  1HR0 M;  2DHY A;  3GLI A;  4P17 A;  2LWX A;  5E26 A;  2A5Y B;  1RU3 A;  3KDS E;  1WIV A;  4JI0 M;  3BBZ A;  2MH8 A;  1W5T A;  2KRU A;  2VQF M;  4NC6 A;  4L8R C;  2G8L A;  1EIJ A;  4LFB M;  5IT9 S;  2LTU A;  2G3Q A;  2ZAM A;  3L28 A;  3KSX A;  3LQR A;  2LH0 A;  5EJC A;  4LGY A;  2CV0 A;  2QZ4 A;  3KXE C;  4LJ4 A;  4B7H A;  3FUT A;  4PDG A;  2VQE M;  2YQZ A;  8CAT A;  3HU1 A;  4IJE A;  3MK6 A;  1QUS A;  4CIS A;  1HNZ M;  3B7Z A;  3E9S A;  4IJF A;  2I7N A;  5FLX S;  1NJG A;  1R2Z A;  2R4J A;  4JI8 M;  4JI1 M;  1NHW C;  1KSF X;  1IBL M;  1QVR A;  2R44 A;  3GLH B;  3GLF B;  4LZZ A;  4DV6 M;  2UU9 M;  2JA2 A;  3SYK A;  1E9S A;  5ITY A;  5KPT A;  1ZV1 A;  2CEA A;  3U6P A;  3K9O A;  3KOX E;  1L1Z A;  2M60 A;  1BVS A;  3CTW B;  3GLH E;  3NBX X;  3ILK A;  4MH0 E;  2V6Z M;  5KQ8 A;  4DR4 M;  3FTF A;  4FVM A;  4A3V B;  5BPV A;  1TTE A;  1IN8 A;  2XLJ A;  1J5E M;  3HJQ A;  1IFY A;  1GJS A;  2C9C A;  2JY6 B;  3FYC A;  3MJ5 A;  1YUB A;  2JUJ A;  4R3D A;  1D0L A;  2JZ0 A;  1IXZ A;  2N35 A;  5IRE B;  4BLC A;  4LJ8 A;  2KDL A;  3IEC A;  3A46 A;  5IZ7 D;  3HU2 A;  1DO2 A;  3V76 A;  4G3O A;  4LJ7 A;  1IN7 A;  2CHG A;  2KNA A;  4X65 M;  3HHZ A;  3SC3 A;  4G4N A;  2XH9 A;  2WSC F;  1E32 A;  4LZJ A;  2LHG A;  4MGY E;  4CIZ A;  5GKN A;  2OOA A;  4L15 A;  4B3T M;  4II7 A;  1WHC A;  5FTK A;  1TDZ A;  1QZE A;  3FYD A;  1EFU B;  5ITT A;  2UUA M;  5L8R F;  2DWL A;  2QNJ A;  1D0K A;  2F5O A;  1S3S A;  5ITR A;  4NSO B;  1YE9 A;  1K3W A;  3UMM A;  1UM8 A;  1KYI A;  1G41 A;  3GLH A;  3U60 B;  4PDI A;  2F5Q A;  4QNR A;  3J27 B;  1G4A E;  2MGW A;  4B7G A;  1L1T A;  2BNK A;  2JY8 A;  2KZS A;  3M6A A;  4M0W A;  1TGU A;  3RGS A;  3DZD A;  3MHV C;  3LQQ A;  3CGW A;  4RF0 A;  4AW4 A;  4PD2 A;  4RF1 A;  3BOS A;  4L4U A;  1NV9 A;  1DGB A;  2OPF A;  1J7K A;  2YR0 A;  7CAT A;  4YY3 M;  1ZAE A;  4AKG A;  1L8Q A;  2AHM A;  2Z4R A;  2DNA A;  1QAM A;  2ZBK B;  2JXN A;  4DV3 M;  1D2N A;  2Z4S A;  4FWD A;  2D7H A;  4KOD A;  1VEG A;  2WSF F;  3HY5 A;  2R4E A;  1OKS A;  3SMS A;  2DAE A;  3EIH A;  3FTD A;  3T38 A;  1PJI A;  1H6U A;  1X37 A;  1VEK A;  2C5R A;  4ZPX A;  3ZH9 B;  3Q8G A;  4GEW A;  2J7N A;  4ANR A;  3VKH A;  4YHH M;  2EUC A;  3VK8 A;  5KPR A;  2P5T A;  4JI4 M;  1NJF A;  1PGY A;  1R7R A;  2DAI A;  2LHC A;  2O25 A;  3T15 A;  1N36 M;  1LV7 A;  1HNX M;  1NNU C;  4JI5 M;  5A2Q S;  1V92 A;  3LMM A;  5ITU A;  2VF8 A;  4NRV A;  1R6B X;  1NO1 A;  3VDP A; 
#chains in the Genus database with same CATH homology
 4LF8 M;  2DZN B;  2UUC M;  2CE7 A;  4EIW A;  4AI6 A;  1Z59 A;  2EO2 A;  2VII A;  4ITQ A;  4IBI A;  1FJG M;  4I81 A;  4CHT B;  3KVW A;  4MM3 B;  4OVZ B;  4M9X A;  4MGK E;  3K2L A;  4LJ6 A;  5C18 A;  4X64 M;  1GKI A;  3U6E A;  4NXM M;  2M5Z A;  3PNV A;  4FW9 A;  1E94 E;  3AL0 C;  2F5N A;  1PJJ A;  2QP9 X;  3I4Y A;  1N77 A;  4LG2 A;  1QAQ A;  3J2P B;  2XGN A;  4GMQ A;  2HHH M;  3KFU G;  3AJI B;  4FCW A;  4AG5 A;  3A98 B;  1MX0 A;  3A45 A;  4W5W A;  1FNN A;  2C98 A;  3I51 A;  2X4A A;  4IBB A;  1HT1 E;  1XMO M;  5EXT A;  1KFV A;  3GLG B;  4DUY M;  2R45 A;  4JV5 M;  5JI3 E;  1IQP A;  3FTC A;  2KXE A;  3PVS A;  4PT5 A;  2K47 A;  2XSZ D;  3KSJ A;  3FUX A;  5EP1 A;  1Z5C A;  3HHX A;  4LJ9 A;  3FUW A;  4MGZ E;  2DWM A;  4D80 A;  3HKP A;  2KZU A;  2CHV A;  4JI6 M;  2EA0 A;  4DUZ M;  3U61 B;  1Z6T A;  4Z8X A;  1QZM A;  3U5Z B;  3KP1 E;  4LGM A;  1HQY E;  3TL4 X;  3TWL A;  4BB9 A;  4LJA A;  2XFT A;  4NSR A;  2H1R A;  1OJL A;  2V1C A;  3M0E A;  3SAR A;  4I4L A;  2UXC M;  1GL7 A;  3WHK A;  4HL4 A;  2F5P A;  3M7G A;  1IN6 A;  4LRS A;  3T1H M;  3U6D A;  5EP4 A;  1XNQ M;  4QNM A;  3GQ3 A;  1DGH B;  1YSY A;  3VDU A;  4QHS A;  1N34 M;  4XGI A;  2X49 A;  1Z5B A;  1Q3C A;  3KW6 A;  4M9S A;  4FCT A;  2RGH A;  3KOW E;  3SAS A;  1IN5 A;  3GP1 A;  3W0F A;  4IBD A;  4GHL A;  3Q8X A;  2QPA A;  2UXB M;  2XFS A;  3EIE A;  2YNM D;  5EXX A;  5F3W A;  4AKH A;  4LF6 M;  3L29 A;  3PNY A;  2ZAO A;  4G6Z A;  3GO8 A;  3UK6 A;  4TUW A;  3I4V A;  4M9Z A;  1NHG C;  3FUU A;  3TE6 A;  5H37 D;  4NXN M;  3UZU A;  4B3S M;  3QWL A;  3GLG A;  1SXJ D;  4MGH A;  1GVN A;  3GPP A;  4L78 A;  1XWI A;  1L2C A;  1G3I A;  3K92 A;  2E5L M;  3GLF A;  4FD2 A;  4DR3 M;  2QBY B;  3VFD A;  1XXH B;  5C1B A;  2KA6 B;  1HQC A;  4DR2 M;  3GPY A;  4WW0 A;  5KPZ A;  1DGG A;  2ZM6 M;  3SAV A;  2FE8 A;  2J7O A;  1E9R A;  2HKJ A;  1XC8 A;  1IBK M;  3FD9 A;  3GPX A;  1Q3B A;  2DVW B;  3GRU A;  1IY2 A;  3RGP A;  2Y20 A;  3AKZ A;  1IXS B;  4JYA M;  1NY5 A;  4OU7 A;  4WUR A;  4JI2 M;  1IXR C;  4GKJ M;  4FWH A;  3TWK A;  3GLI B;  2UXD M;  2DWN A;  4HLQ A;  4DV2 M;  3KS4 A;  2Y0T A;  4JI3 M;  1IY0 A;  3GQ5 A;  3A42 A;  3RFW A;  3FKE A;  3LVW A;  4PCZ A;  2I7P A;  4GH9 A;  4IIW A;  4LF9 M;  2HL7 A;  1SXJ B;  3THG A;  3R8F A;  1I4W A;  2C9O A;  5FTN A;  4M0D A;  3U6Q A;  2D7G A;  2X8A A;  3SHG B;  3J81 S;  3AOE C;  3B9P A;  3U6L A;  1SXJ E;  4GC9 A;  3TPZ A;  1R2Y A;  4LF5 M;  2CV1 A;  4FCV A;  3FTE A;  2ERC A;  4B08 A;  2UUB M;  1Z5A A;  3IG8 A;  4IBJ A;  2CFO A;  4LF4 M;  3KP0 E;  4S12 A;  3GPU A;  3RE8 A;  3VK7 A;  3SFZ A;  3DA1 A;  3GRV A;  2HCB A;  3SYL A;  3VLF B;  2RKO A;  3L27 A;  4BBA A;  4IBF A;  3SHF A;  1G59 A;  4QHT A;  3GQ4 A;  4AZF A;  2D7E A;  2RGO A;  3U60 A;  1XXH A;  1JR3 D;  2C96 A;  5DNY A;  3L25 A;  4DR6 M;  3DOA A;  4Z6Y A;  2LXE A;  3PFI A;  1XHB A;  5FTJ A;  4DV0 M;  1L2D A;  4JI7 M;  4B3M M;  4LFC M;  2CV2 A;  4DV1 M;  3FUV A;  1K3X A;  3PXG A;  4DR1 M;  4KLN A;  4DV4 M;  1JQJ C;  4I5S A;  5DYI A;  2CHQ A;  1SXJ C;  1TH2 A;  3UGJ A;  3SAT A;  1HNW M;  4G4Q A;  2YFQ A;  3W0L B;  4DR5 M;  3U6S A;  2LNH C;  2BJW A;  4NOO B;  2R62 A;  3SAU A;  2F5S A;  3C58 A;  1G8P A;  4JXJ A;  1J09 A;  5JI2 E;  1MU5 A;  2XEP A;  3J7A S;  2O5R A;  4L16 A;  4IBC A;  1NVM A;  4K0K M;  3KOY E;  4IBE A;  1SXJ A;  4DV5 M;  3TQS A;  4REZ A;  1N33 M;  4GIP A;  4D81 A;  1K82 A;  1W5S A;  5FTL A;  3IG5 A;  3NBI A;  4D82 A;  5EXP A;  5EQT A;  2FFJ A;  5EXS A;  2L6O A;  3TWM A;  1TH3 A;  2Y21 A;  2OQ4 A;  2QEN A;  1XMQ M;  2L7H A;  3HHW A;  3JR4 A;  4FWG A;  1OFI A;  4OVZ A;  3E4R A;  4X66 M;  2F4V M;  2G5G X;  1ZQ9 A;  1NSF A;  3NWL A;  4LF7 M;  1IM2 A;  4NL4 H;  3AV0 A;  1IBM M;  2Z3X A;  2Z7J A;  5EP2 A;  2BJV A;  5KQD A;  4QOS A;  1N75 A;  3UJN A;  2V1U A;  2KRK A;  3DFZ A;  4B7F A;  3JR5 A;  2XZF A;  3L2A A;  1I94 M;  1Q39 A;  3HHY A;  5KO3 A;  5ITX E;  3SAW A;  3U6C A;  3R9X B;  1TH4 A;  5FTM A;  4KHP M;  3CF0 A;  1N78 A;  1VDD A;  4R7G A;  5BR8 M;  2C99 A;  4QOZ C;  4IBK A;  4RNA A;  2DHR A;  2FNA A;  4G4R A;  3HJ8 A;  5IWA M;  1ORY B;  4LY6 A;  3AOG A;  3U61 A;  1GL6 A;  3U5Z A;  2R65 A;  3ZC7 B;  1HT2 E;  1TDH A;  2ZAN A;  4AQY M;  4GKK M;  4IBG A;  1DO0 A;  4P16 A;  1JR3 A;  1T3T A;  5E6J A;  3J7B A;  4JN6 A;  3U6M A;  2Y0Q A;  2FOI C;  4LCB A;  4LJ5 A;  2R18 A;  3HWS A;  5LMN M;  5EP3 A;  3OTO M;  3JAM S;  2KEB A;  3HU3 A;  3HGI A;  2R46 A;  4GHA A;  1DGH A;  2L09 A;  4B3R M;  1C1K A;  3AFH A;  3SMP A;  2DXI A;  4LRT A;  3WHL A;  1IY1 A;  3J80 S;  2DWZ B;  4I8O A;  1NNJ A;  2Q2E B;  4DR7 M;  2XSZ A;  2XF3 A;  4KO8 A;  4LFA M;  5ITX A;  1NY6 A;  2KW0 A;  4OW0 A;  4XBO A;  4GRI A;  3QAU A;  4NRW A;  3GRR A;  3ZCB B;  3T1Y M;  1PM5 A;  4AKI A;  1N32 M;  2L7I A;  1XNR M;  3CF2 A;  2CUZ A;  1QAN A;  4DV7 M;  1QYR A;  3CF6 E;  1EE8 A;  1QAO A;  5DYG A;  3AOE A;  5FSW A;  2W82 A;  2XZU A;  2NQ8 C;  4OX9 M;  4GC5 A;  3SBJ A;  4AG6 A;  3HJS A;  3D8B A;  2QCU A;  2DZO B;  3K1J A;  2QBY A;  3GRY A;  4X62 M;  4MB7 A;  5LMU M;  4GIT A;  1DGF A;  1GLN A;  3KS8 A;  3LVV A;  1QQW A;  1IN4 A;  4MGI E;  5ITQ A;  1L2B A;  3VKG A;  1OFH A;  4CGY B;  3U6O A;  1WXQ A;  3D8L A;  3L26 A;  3H4M A;  3K8Z A;  3KOZ E;  4G4O A;  1HR0 M;  3GLI A;  2LWX A;  5E26 A;  2A5Y B;  3KDS E;  4JI0 M;  1W5T A;  2KRU A;  2VQF M;  4L8R C;  2G8L A;  4LFB M;  5IT9 S;  2ZAM A;  3L28 A;  3KSX A;  3LQR A;  2LH0 A;  5EJC A;  4LGY A;  2CV0 A;  2QZ4 A;  3KXE C;  4LJ4 A;  4B7H A;  3FUT A;  4PDG A;  2VQE M;  2YQZ A;  8CAT A;  3HU1 A;  4IJE A;  3MK6 A;  4CIS A;  1HNZ M;  4IJF A;  3E9S A;  1R2Z A;  2I7N A;  5FLX S;  1NJG A;  4JI1 M;  2R4J A;  4JI8 M;  1NHW C;  1KSF X;  1IBL M;  1QVR A;  4DV6 M;  3GLH B;  3GLF B;  4LZZ A;  2UU9 M;  2JA2 A;  3SYK A;  1E9S A;  5ITY A;  5KPT A;  2CEA A;  3U6P A;  3KOX E;  1L1Z A;  2M60 A;  3CTW B;  3ILK A;  4MH0 E;  2V6Z M;  5KQ8 A;  4DR4 M;  3FTF A;  4FVM A;  4A3V B;  5BPV A;  1IN8 A;  2XLJ A;  1J5E M;  3HJQ A;  2C9C A;  3FYC A;  3MJ5 A;  1YUB A;  4R3D A;  1IXZ A;  5IRE B;  4BLC A;  4LJ8 A;  3A46 A;  5IZ7 D;  3HU2 A;  1DO2 A;  4LJ7 A;  1IN7 A;  2CHG A;  4X65 M;  3HHZ A;  3SC3 A;  4G4N A;  2XH9 A;  1E32 A;  4LZJ A;  4MGY E;  5GKN A;  4L15 A;  4B3T M;  4II7 A;  5FTK A;  1TDZ A;  3FYD A;  5ITT A;  2UUA M;  2DWL A;  2F5O A;  1S3S A;  5ITR A;  4NSO B;  1YE9 A;  1K3W A;  3UMM A;  1UM8 A;  1KYI A;  1G41 A;  3GLH A;  3U60 B;  4PDI A;  2F5Q A;  4QNR A;  3J27 B;  1G4A E;  4B7G A;  1L1T A;  2BNK A;  2KZS A;  3M6A A;  4M0W A;  3RGS A;  1TGU A;  3DZD A;  3MHV C;  3LQQ A;  4RF0 A;  4AW4 A;  4PD2 A;  4RF1 A;  3BOS A;  4L4U A;  1DGB A;  2OPF A;  1J7K A;  2YR0 A;  7CAT A;  4YY3 M;  1ZAE A;  4AKG A;  1L8Q A;  2AHM A;  2Z4R A;  1QAM A;  2ZBK B;  4DV3 M;  1D2N A;  2Z4S A;  4FWD A;  2D7H A;  4KOD A;  2R4E A;  3SMS A;  3T38 A;  1PJI A;  3EIH A;  3FTD A;  1H6U A;  1X37 A;  2C5R A;  4ZPX A;  3ZH9 B;  3VKH A;  2J7N A;  4YHH M;  2EUC A;  3VK8 A;  5KPR A;  2P5T A;  4JI4 M;  1NJF A;  1R7R A;  3T15 A;  1N36 M;  1LV7 A;  1HNX M;  1NNU C;  4JI5 M;  5A2Q S;  3LMM A;  5ITU A;  4NRV A;  1R6B X;  3VDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...