4JYAM

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 23
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4jyaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4jyaM02
1J5EM 4NRWA 2UXCM 4DV6M 3T1YM 1L2BA 3JAMS 4X64M 1Z5CA 4LFBM 5BR8M 4DV3M 2E5LM 1R2ZA 2F5QA 3GPUA 1NNJA 4GKJM 1KFVA 4B3RM 4DR1M 2ZM6M 4X66M 4DV7M 4JI5M 4YY3M 4LF4M 2VQEM 4DR3M 1Z5BA 2UXBM 2HHHM 4PDIA 5FLXS 1IBMM 1PJIA 5ITUA 4JI8M 3U6SA 2XZFA 2F4VM 1EE8A 3JR4A 4PD2A 3U6QA 2F5NA 1L2CA 5ITXE 3W0FA 1IBLM 5ITTA 2UUCM 2UXDM 3DOAA 1L1TA 4PCZA 3SATA 4X65M 3GP1A 4G4QA 2UUAM 1N33M 3U6CA 3TWKA 5ITXA 4G4NA 4B3SM 3SBJA 1N32M 2Q2EB 4NXMM 4MB7A 3C58A 4ITQA 3GPPA 1HNWM 3GPYA 1L1ZA 3J80S 4AQYM 3GQ5A 1K3WA 4X62M 1XC8A 1XNRM 1XNQM 4GKKM 1Q3BA 3OTOM 4DR7M 4JI3M 3GQ4A 2UU9M 3GPXA 4LF9M 4DR6M 2F5OA 4DV0M 1MU5A 3U6PA 3TWMA 1TDZA 1PJJA 4JV5M 2UUBM 4NRVA 3SAUA 3SAVA 4JI0M 3J81S 1I94M 3SARA 4NXNM 4LF7M 3SAWA 3JR5A 4K0KM 4G4RA 3VK8A 5LMNM 5ITYA 1HR0M 4LF8M 1XMQM 4JI1M 1Q3CA 1XMOM 4JI6M 3TWLA 3A42A 4KHPM 2ZBKB 1TDHA 4JI2M 1MX0A 1IBKM 4DR2M 3A46A 1HNZM 1N34M 1R2YA 4LF6M 3U6DA 4OX9M 4YHHM 5LMUM 4B3MM 1N36M 1K82A 3T1HM 4DV1M 1Q39A 4B3TM 5IT9S 3SASA 4G4OA 3GO8A 1HNXM 4LF5M 4DR5M 4DR4M 1FJGM 4DV4M 5ITQA 2F5SA 3GQ3A 4PDGA 2XZUA 1PM5A 3U6LA 3J7AS 5IWAM 2VQFM 4DV5M 3U6OA 4LFCM 1Z5AA 4DV2M 4CISA 3U6MA 1L2DA 4DUYM 5A2QS 4DUZM 4JYAM 2OPFA 2F5PA 3U6EA 2HKJA 1Z59A 1K3XA 4JI4M 5ITRA 4JI7M 3A45A 3VK7A 4LFAM 2EA0A 2OQ4A
chains in the Genus database with same CATH superfamily
2L09A 1J5EM 4NRWA 4RF1A 2XSZA 2DI0A 4CJ6A 3ZC7B 3GLFE 4DV6M 3JAMS 1Z5CA 3HWSA 4AG6A 5BR8M 3RGSA 3M0EA 3HJQA 5KPZA 2E5LM 1NNJA 2Z7JA 3J7BA 3FUWA 3L25A 1IXSA 2X49A 4W5WA 2CWBA 2KNZA 1RU3A 3KP0E 1TTEA 1PGYA 4NL4H 2VIIA 3ILKA 3GLGA 4YY3M 2LVNC 3EIEA 4IBIA 3SC3A 4LF4M 4FWGA 2JZ1A 3HU1A 2UXBM 1GLNA 3IHPA 4HL4A 2I7PA 3VDPA 2CFOA 4MGIE 3HHZA 3GLGB 2J7OA 2DZOB 2EUCA 4A3VB 4WP2A 1Y8GA 4GIPA 2LBCA 3DFZA 3E46A 3HX3A 4ZPXA 1ZV1A 1JB0F 2OO9A 5FTLA 3ZCBB 2OOBA 4NOOB 4B08A 4X65M 4CGYB 1DO0A 3KP1E 2Z3XA 1ZMWA 1DGBA 5IREB 5FTJA 3J27B 4LJ9A 4MB7A 2HCBA 1SXJD 2L2DA 4XK8F 2V1UA 2KA6B 3QAUA 4Q7JA 1AIPC 3GPPA 1D0MA 2RKOA 3GPYA 1L1ZA 5JI2E 1R7RA 3KW6A 4I81A 5DYGA 3TQSA 1Q3BA 3TE6A 1NJGA 4L16A 3GQ4A 1CUKA 3B89A 2LTUA 4AKIA 1MU5A 2RGHA 2X8AA 1EFUB 3TWMA 1X37A 5FSWA 4IBKA 3FYCA 3PVSA 2CV2A 1DO2A 1KYIA 5EXXA 3UJNA 4M0DA 4CIZA 1TF0B 2QP9X 3SARA 4NXNM 1VEGA 4L78A 3W68A 3JR5A 1OQYA 4P17A 4LF7M 3J2PB 3QYEA 4QNMA 3VK8A 1HR0M 2DHRA 1DGHA 1XMQM 2CHVA 2LVQD 4IBCA 2L4FA 2FH0A 3T38A 2KZUA 4IBEA 1GJTA 3AL0C 3A42A 3BOSA 4FW9A 3U60B 4KHPM 1KSFX 2X4AA 4QNRA 1MX0A 3KDSE 2DAEA 4DR2M 1HNZM 1N34M 2C9CA 3C3EA 4B3MM 3T1HM 4RF0A 3GLGE 2H1RA 1Q39A 2M5ZA 5KO3A 4IBJA 3C9PA 3GLHA 4G4OA 5IT9S 2CEAA 2CHQA 4IBFA 1FJGM 4DV4M 3RE8A 2DENA 3KOZE 1XXHA 1FNNA 2WZJA 3TPZA 1QZEA 3GLHB 3SMSA 2YNMD 1TGUA 2QHOB 4L6V6 5C1BA 2JY5A 4DV5M 3U6LA 3U6OA 1Z5AA 4R7GA 3CGWA 3T6PA 1TH4A 2JA2A 4AZFA 1XXHB 1OFHA 2MGWA 1QANA 2Z4RA 2F5PA 1QDRA 1R5LA 2JY8A 3I4VA 3U6EA 3L2AA 4JI4M 4JI7M 2R0IA 3CTWB 4LFAM 1IY0A 2FE8A 1ZAEA 1V34A 3CF2A 3L29A 4XBOA 1GABA 4FVMA 4M9ZA 1QDTA 3FRIA 1IY2A 4X64M 1Q02A 3T1YM 1L2BA 3LVWA 1SXJA 2YQZA 1IN6A 3DA1A 4DV3M 2F5QA 1R2ZA 2APLA 2XH9A 3GPUA 3U61A 1LTMA 2BWBA 3FE3A 4MGYE 1YSYA 3LVVA 4R3DA 4X66M 2O5RA 2QCUA 4QOZC 1IFYA 2L6OA 1VEJA 3LMMA 2P5TA 4QOSA 4AW4A 3UK6A 2EKFA 3B74A 1IXZA 4DR3M 3U61B 1Z6TA 1IXRC 1OFIA 2NQ8C 2KNAA 2CP8A 4MGKE 3GRRA 3H4MA 1TR8A 4MM3B 3WHKA 4EIWA 3U6SA 2XZFA 2C5RA 3HJSA 1G3IA 3UZUA 4PD2A 1C1KA 3I01M 1TH3A 1R4GA 2EJSA 1DGGA 3KSXA 3W0FA 3GLIA 3PNYA 1ZMVA 4GMQA 3H4JA 5EXPA 3FUXA 2DAGA 4UN2B 3DOAA 3B9PA 1L1TA 3Q8GA 2D7EA 2HWJA 4G3OA 3NBXX 2UUAM 3U6CA 2R46A 1V33A 3LCUA 5ITXA 3TWKA 1N32M 4AKGA 1MN3A 3GLHE 3B7ZA 5GKNA 3C58A 4ITQA 3D8LA 3GQ5A 1K3WA 3AOEA 4FWDA 1XC8A 1G59A 1XXHE 2XGNA 3DZDA 1IXSB 2BNKA 1G4AE 2MR9A 2K47A 4DR7M 4JI3M 3GPXA 3FUTA 1J09A 4LF9M 3W0LB 1OKSA 3B7QA 3HKPA 4DV0M 2DNAA 2KHHA 1IY1A 4JV5M 3KS4A 1QZMA 3SAUA 1HJPA 2DWZB 1OAIA 4OW0A 2DZLA 4GC9A 4LJ8A 3AKZA 4NSOB 3J81S 1I94M 1T43A 2DWMA 4KO8A 3SAWA 1UFZA 1JR3D 4LGYA 3KXEC 4L15A 5LMNM 3IECA 5DNYA 4GITA 1QAOA 4JI1M 2XFSA 1SG9A 4IJEA 3R8FA 2KW0A 2WSCF 3L26A 4JI6M 2RRUA 3K8ZA 1TDHA 2FNAA 4KT0F 3U5ZA 4JI2M 3FKEA 8CATA 1IBKM 3HU2A 1AUAA 2DWNA 1GVNA 3U6DA 1SXJC 4LF6M 2FFJA 5EQTA 3SHGB 2G8LA 3MK6A 3U5ZB 3KFUG 1HNXM 2JP7A 4GH9A 3HY5A 3KVWA 4REZA 3I51A 2V6ZM 3NBIA 3FUVA 3UGJA 1N75A 1WHCA 1VG5A 3L27A 3GQ3A 4PDGA 2CV0A 2XZUA 2DAKA 1HT1E 2CHGA 3J7AS 2VQFM 5E6JA 4LFCM 1MJGM 3M6AA 2Z4SA 3HJ8A 3LCVB 2B3TA 2DKLA 1NY6A 5L8RF 1NJFA 2KDLA 3K1JA 4NSRA 2LNHC 1E32A 2R18A 4OU7A 1G41A 4B7HA 5ITRA 1DGHB 2QQ8A 2Y21A 4LY6A 2J5YA 1OIPA 2HL7A 1PJTA 1WR1B 4KLNA 4D80A 4D82A 4TUWA 1DV0A 4LG2A 3MHVC 1QYRA 1NVMA 3UMMA 1NO1A 1D0LA 3VLFB 3HU3A 4BB9A 4GHLA 4QHTA 2R44A 2J7NA 2QNJA 3E21A 3GRUA 2XSZD 3CF6E 3AOEC 2ZM6M 2LHCA 4PT5A 3K92A 3RGPA 3LW5F 3D8BA 3KS8A 1WXQA 2H5XA 4LRTA 4NC6A 1PRBA 5KPTA 1Z5BA 1GO5A 2HHHM 3WHLA 4PDIA 1GKIA 4JN6A 4LCBA 1IBMM 1PJIA 5ITUA 1T3TA 3T15A 2EO2A 4L8RC 2C96A 5EP2A 5FTNA 2F4VM 2F5NA 4MGHA 3RFWA 2JWSA 1OJLA 1JR3A 3A98B 2CE7A 1YE9A 2LVAA 3SYKA 5DFLA 2KRUA 3ZH9B 2LH0A 1HQYE 3THGA 1TH2A 3GP1A 3R9XB 4AKHA 1NV9A 2KRKA 1W5SA 1PJSA 1UM8A 4ANRA 1L8QA 3KOYE 3FUUA 4S12A 4WURA 4NXMM 4Y28F 1G71A 1SXJB 1VDLA 2ZANA 2MH8A 3GRYA 4Z6YA 5H37D 3GRVA 4AQYM 4X62M 2AHMA 1XNQM 2BJWA 4GKKM 2JNHA 1E9RA 2QENA 4LJ7A 2UU9M 4AI6A 4GRIA 1QAQA 2XFTA 3KSJA 3FRHA 3QYBA 3K9PA 1E94E 4DBGB 3K9OA 2DZNB 1TDZA 1PJJA 5F3WA 2UUBM 2JY7A 3SAVA 4LJAA 3AV0A 4I4LA 1NY5A 1NV8A 2LXEA 3GLIB 1NHGC 4G4RA 7CATA 2WSEF 1HQCA 1PJQA 1Q3CA 1XHBA 2KNVA 4RKUF 2QBYA 3TWLA 1WIVA 2LWXA 2YR0A 1IN7A 3A46A 1IQPA 2QSFX 2ZTCA 1R2YA 4YHHM 3HHYA 2DWLA 2QBYB 3CF0A 2R6FA 3IG5A 4I5SA 2KZSA 3SASA 3FTEA 2W82A 1ZQ9A 1YLAA 5EP1A 4IBBA 5JI3E 4LF5M 1IN4A 1VEKA 1P3QQ 3C3DA 2R62A 5ITQA 1W5TA 2F5SA 2L4EA 5IZ7D 5BPVA 4FD2A 4IBDA 1JQJC 2JY6B 3PXGA 1PM5A 1QAMA 2FS1A 2BJVA 4G6ZA 2EKKA 5FTMA 1QUTA 4DV2M 2V1CA 1JR3E 5DYIA 3U6MA 3TL4X 4DUYM 1XWIA 2CRUA 2A5YB 2K6BA 4CHTB 4JXJA 5A2QS 4DUZM 4JYAM 1A5TA 1QVRA 2OPFA 1SXJE 1OTRA 3AJIB 2ERCA 4IJFA 3F92A 5EJCA 2MROB 3A45A 3VK7A 2EA0A 2ZAMA 2OQ4A 3FTDA 4GC5A 4M0WA 3ZQJA 3FTFA 2UXCM 1IN8A 1BVSA 5KPRA 4LFBM 3BBZA 4MH0E 2DHYA 1J7KA 3HGIA 4LJ4A 2XLJA 5C18A 4GKJM 1VQ1A 3VKHA 1KFVA 5KQDA 1OAOC 2O25A 4DR1M 4LZZA 4AG5A 4B3RM 3AFHA 4IIWA 2L7HA 2N35A 2R65A 4DV7M 4JI5M 4LGMA 3LQRA 3VFDA 3GLIE 2VQEM 1HT2E 2JZ0A 4D81A 4LF8M 2G5GX 2LHGA 2RGOA 3AOGA 5FLXS 1C7YA 4JI8M 1G8PA 4BBAA 1GL7A 1NHWC 2BWEA 5EP3A 4M9SA 3PFIA 1EE8A 3JR4A 3U6QA 4L4UA 1L2CA 5ITXE 2DAIA 5EP4A 1IBLM 2HAKA 4P16A 2C99A 5ITTA 2KXEA 2XEPA 2UUCM 2UXDM 1XB2B 3IG8A 4Z8XA 4IBGA 2JXNA 4PCZA 3SATA 3NWLA 4LJ6A 3BXWA 3U60A 4G4QA 1WJ7A 3QWLA 2D7GA 1N33M 2XF3A 2QPAA 4G4NA 3K2LA 2LVPC 4B7GA 3SBJA 4B3SM 2Q2EB 4GHAA 5EXTA 2C98A 3B7NA 2CUZA 2R4EA 3GLFA 4BLCA 4B7FA 1IM2A 1HNWM 3HHXA 3J80S 1VDDA 2OOAA 4HLQA 1OIZA 1XNRM 2YFQA 3I04M 4LJ5A 3FYDA 2GQFA 2Y0QA 3PNVA 2JUJA 3OTOM 2VF7A 3GLFB 4OVZA 1LV7A 2DAMA 3KOXE 4KODA 4II7A 2F5OA 4DR6M 1F4IA 3U6PA 1IN5A 1DGFA 2O01F 3SFZA 1GJSA 3E9SA 2LVOC 2VF8A 3HHWA 4QHSA 4WW0A 1D2NA 4NRVA 3SYLA 2WSFF 3E4RA 4OVZB 4JI0M 1D0KA 2DVWB 3LQQA 4HEOA 5KQ8A 3SMPA 4R71A 1QUSA 4K0KM 4F2LA 3HZJA 3Q8XA 1N77A 5ITYA 2M60A 2FOIC 1QQWA 4FCTA 4LZJA 1XMOM 2K9DA 3I4YA 3SHFA 1NSFA 1V92A 3FD9A 2ZBKB 2I7NA 3L28A 4M9XA 4F1IA 1EIJA 2DXIA 4I8OA 4OX9M 2K0BX 5LMUM 3MJ5A 1T6OA 1R6BX 5FTKA 4GEWA 4XGIA 1N36M 4MGZE 1K82A 2CV1A 2G3QA 2Z8YM 4DV1M 4B3TM 4LRSA 2D7HA 3VKGA 3GO8A 1YUBA 4DR5M 1S3SA 4DR4M 5EXSA 5E26A 3FTCA 4FWHA 4RNAA 1I4WA 2R45A 2Y0TA 3M7GA 3EIHA 1E9SA 2L7IA 1ORYB 2KEBA 3VDUA 2GNOA 2QZ4A 5IWAM 3V76A 3KOWE 4CISA 2Y20A 1L2DA 2R4JA 1N78A 1NNUC 2MJ5B 1WGLA 1WGNA 2ZAOA 4FCWA 3MMPA 1ZMUA 1Z59A 2HKJA 2VDBB 4FCVA 3W67A 1GL6A 1K3XA 2ZTDA 2C9OA 1H6UA
chains in the Genus database with same CATH topology
2L09A 1J5EM 4NRWA 4RF1A 2XSZA 4DV6M 3ZC7B 3JAMS 1Z5CA 3HWSA 4AG6A 5BR8M 3RGSA 3M0EA 3HJQA 5KPZA 2E5LM 1NNJA 2Z7JA 3J7BA 3FUWA 3L25A 2X49A 4W5WA 3KP0E 4NL4H 2VIIA 3ILKA 3GLGA 4YY3M 3EIEA 4IBIA 3SC3A 4LF4M 4FWGA 3HU1A 2UXBM 1GLNA 4HL4A 2I7PA 3VDPA 2CFOA 4MGIE 3HHZA 3GLGB 2J7OA 2DZOB 2EUCA 4A3VB 4GIPA 3DFZA 4ZPXA 5FTLA 3ZCBB 4NOOB 4B08A 4X65M 4CGYB 1DO0A 3KP1E 2Z3XA 1DGBA 5IREB 5FTJA 3J27B 4LJ9A 4MB7A 2HCBA 1SXJD 2V1UA 2KA6B 3QAUA 3GPPA 3GPYA 2RKOA 1L1ZA 5JI2E 1R7RA 3KW6A 4I81A 5DYGA 3TQSA 1Q3BA 3TE6A 1NJGA 4L16A 3GQ4A 4AKIA 1MU5A 2RGHA 2X8AA 3TWMA 1X37A 5FSWA 4IBKA 3FYCA 3PVSA 2CV2A 1DO2A 1KYIA 5EXXA 3UJNA 4M0DA 2QP9X 3SARA 4NXNM 4LF7M 4L78A 3JR5A 3J2PB 4QNMA 3VK8A 1HR0M 4LF8M 2DHRA 1DGHA 1XMQM 2CHVA 4IBCA 3T38A 2KZUA 4IBEA 3AL0C 3A42A 3BOSA 4FW9A 3U60B 4KHPM 1KSFX 2X4AA 4QNRA 1MX0A 3KDSE 4DR2M 1HNZM 1N34M 2C9CA 4B3MM 3T1HM 4RF0A 2H1RA 1Q39A 2M5ZA 5KO3A 4IBJA 4G4OA 3GLHA 5IT9S 2CEAA 2CHQA 4IBFA 1FJGM 4DV4M 3RE8A 3KOZE 1XXHA 1FNNA 3TPZA 3GLHB 3SMSA 2YNMD 1TGUA 5C1BA 3U6LA 4DV5M 3U6OA 1Z5AA 4R7GA 1TH4A 2JA2A 4AZFA 1XXHB 1OFHA 1QANA 2Z4RA 2F5PA 3U6EA 3I4VA 3L2AA 4JI4M 4JI7M 3CTWB 4LFAM 1IY0A 2FE8A 1ZAEA 3CF2A 3L29A 4XBOA 4FVMA 4M9ZA 3T1YM 1L2BA 1IY2A 4X64M 3LVWA 1SXJA 2YQZA 1IN6A 3DA1A 4DV3M 2F5QA 1R2ZA 2XH9A 3GPUA 3U61A 4MGYE 1YSYA 3LVVA 4R3DA 4X66M 2O5RA 2QCUA 4QOZC 2L6OA 3LMMA 2P5TA 4QOSA 4AW4A 3UK6A 4DR3M 3U61B 1IXZA 1Z6TA 1IXRC 1OFIA 2NQ8C 4MGKE 3U6SA 3GRRA 3H4MA 4MM3B 3WHKA 2C5RA 4EIWA 2XZFA 3HJSA 1G3IA 3UZUA 4PD2A 1C1KA 1TH3A 3KSXA 1DGGA 3W0FA 3GLIA 3PNYA 4GMQA 5EXPA 3FUXA 3DOAA 3B9PA 1L1TA 2D7EA 2UUAM 3U6CA 2R46A 5ITXA 3TWKA 1N32M 4AKGA 5GKNA 3C58A 4ITQA 3D8LA 3GQ5A 1K3WA 3AOEA 4FWDA 1XC8A 1G59A 2XGNA 3DZDA 1IXSB 2BNKA 1G4AE 2K47A 4DR7M 4JI3M 3GPXA 3FUTA 1J09A 4LF9M 3W0LB 3HKPA 4DV0M 1IY1A 4JV5M 3KS4A 1QZMA 3SAUA 2DWZB 4OW0A 4GC9A 4LJ8A 3AKZA 4NSOB 3J81S 1I94M 2DWMA 4KO8A 3SAWA 4LGYA 1JR3D 3KXEC 4L15A 5LMNM 5DNYA 4GITA 1QAOA 4JI1M 2XFSA 4IJEA 3R8FA 2KW0A 3L26A 4JI6M 3K8ZA 1TDHA 2FNAA 3U5ZA 4JI2M 3FKEA 8CATA 1IBKM 3HU2A 2DWNA 1GVNA 3U6DA 1SXJC 4LF6M 2FFJA 5EQTA 3SHGB 2G8LA 3MK6A 3U5ZB 3KFUG 1HNXM 4GH9A 3KVWA 4REZA 3I51A 2V6ZM 3NBIA 3FUVA 3UGJA 1N75A 3L27A 2CV0A 3GQ3A 4PDGA 2XZUA 1HT1E 2CHGA 3J7AS 2VQFM 5E6JA 4LFCM 3M6AA 2Z4SA 3HJ8A 1NY6A 1NJFA 3K1JA 4NSRA 2LNHC 1E32A 2R18A 4OU7A 1G41A 4B7HA 5ITRA 1DGHB 2Y21A 4LY6A 2HL7A 4KLNA 4D80A 4D82A 4TUWA 4LG2A 3MHVC 1QYRA 1NVMA 3UMMA 3VLFB 3HU3A 4BB9A 4GHLA 4QHTA 2J7NA 3GRUA 2XSZD 3CF6E 3AOEC 2ZM6M 4PT5A 3K92A 3RGPA 3D8BA 3KS8A 1WXQA 4LRTA 5KPTA 1Z5BA 2HHHM 3WHLA 4PDIA 1GKIA 4JN6A 4LCBA 1IBMM 1PJIA 5ITUA 1T3TA 3T15A 2EO2A 4L8RC 2C96A 5EP2A 5FTNA 2F4VM 2F5NA 4MGHA 3RFWA 1OJLA 1JR3A 3A98B 2CE7A 1YE9A 3SYKA 2KRUA 3ZH9B 2LH0A 1HQYE 3THGA 1TH2A 3GP1A 3R9XB 4AKHA 2KRKA 1W5SA 1UM8A 1L8QA 3KOYE 3FUUA 4S12A 4WURA 4NXMM 1SXJB 2ZANA 3GRYA 4Z6YA 5H37D 3GRVA 4AQYM 4X62M 2AHMA 1XNQM 2BJWA 4GKKM 1E9RA 2QENA 4LJ7A 2UU9M 4AI6A 4GRIA 1QAQA 2XFTA 3KSJA 1E94E 2DZNB 1TDZA 1PJJA 5F3WA 2UUBM 3SAVA 4LJAA 3AV0A 4I4LA 1NY5A 2LXEA 3GLIB 1NHGC 4G4RA 7CATA 1HQCA 1Q3CA 1XHBA 2QBYA 3TWLA 2LWXA 2YR0A 1IN7A 3A46A 1IQPA 1R2YA 4YHHM 3HHYA 2DWLA 2QBYB 3CF0A 3IG5A 4I5SA 2KZSA 3SASA 3FTEA 2W82A 1ZQ9A 5EP1A 4IBBA 5JI3E 4LF5M 1IN4A 2R62A 5ITQA 1W5TA 2F5SA 5IZ7D 5BPVA 4FD2A 4IBDA 1JQJC 1PM5A 3PXGA 1QAMA 4G6ZA 2BJVA 5FTMA 4DV2M 2V1CA 3U6MA 5DYIA 3TL4X 4DUYM 1XWIA 2A5YB 4CHTB 4JXJA 5A2QS 4DUZM 4JYAM 1QVRA 2OPFA 1SXJE 3AJIB 2ERCA 4IJFA 5EJCA 3A45A 3VK7A 2EA0A 2ZAMA 2OQ4A 3FTDA 4GC5A 4M0WA 3FTFA 2UXCM 1IN8A 5KPRA 4LFBM 4MH0E 1J7KA 3HGIA 4LJ4A 2XLJA 5C18A 4GKJM 3VKHA 1KFVA 5KQDA 4DR1M 4B3RM 4LZZA 4AG5A 3AFHA 4IIWA 2L7HA 2R65A 4DV7M 4JI5M 4LGMA 3LQRA 3VFDA 2VQEM 1HT2E 4D81A 2G5GX 5FLXS 2RGOA 3AOGA 4JI8M 1G8PA 4BBAA 1GL7A 1NHWC 5EP3A 4M9SA 3PFIA 1EE8A 3JR4A 3U6QA 4L4UA 1L2CA 5ITXE 5EP4A 1IBLM 4P16A 2C99A 5ITTA 2KXEA 2XEPA 2UUCM 2UXDM 3IG8A 4Z8XA 4IBGA 4PCZA 3SATA 3NWLA 4LJ6A 3U60A 4G4QA 3QWLA 2D7GA 1N33M 2XF3A 2QPAA 4G4NA 3K2LA 4B7GA 4B3SM 3SBJA 4GHAA 2Q2EB 5EXTA 2C98A 2CUZA 2R4EA 3GLFA 4BLCA 4B7FA 1IM2A 1HNWM 3HHXA 3J80S 1VDDA 4HLQA 1XNRM 2YFQA 4LJ5A 3FYDA 2Y0QA 3PNVA 3OTOM 3GLFB 4OVZA 1LV7A 3KOXE 4KODA 4II7A 2F5OA 4DR6M 3U6PA 1IN5A 1DGFA 3SFZA 3E9SA 3HHWA 4QHSA 4WW0A 1D2NA 4NRVA 3SYLA 3E4RA 4OVZB 4JI0M 2DVWB 3LQQA 5KQ8A 3SMPA 4K0KM 3Q8XA 1N77A 5ITYA 2M60A 2FOIC 1QQWA 4FCTA 4LZJA 1XMOM 3I4YA 3SHFA 1NSFA 3FD9A 2ZBKB 2I7NA 3L28A 4M9XA 2DXIA 4I8OA 4OX9M 5LMUM 3MJ5A 5FTKA 1R6BX 2CV1A 1N36M 4XGIA 1K82A 4MGZE 4DV1M 4B3TM 4LRSA 2D7HA 3VKGA 3GO8A 1YUBA 4DR5M 1S3SA 4DR4M 5EXSA 5E26A 3FTCA 4FWHA 4RNAA 1I4WA 2R45A 2Y0TA 3M7GA 3EIHA 1E9SA 1ORYB 2L7IA 2KEBA 3VDUA 2QZ4A 5IWAM 3KOWE 4CISA 2Y20A 1L2DA 2R4JA 1N78A 1NNUC 2ZAOA 4FCWA 2HKJA 1Z59A 4FCVA 1K3XA 1GL6A 2C9OA 1H6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E M;  4NRW A;  2UXC M;  4DV6 M;  3T1Y M;  1L2B A;  3JAM S;  4X64 M;  1Z5C A;  4LFB M;  5BR8 M;  4DV3 M;  2E5L M;  1R2Z A;  2F5Q A;  3GPU A;  1NNJ A;  4GKJ M;  1KFV A;  4B3R M;  4DR1 M;  2ZM6 M;  4X66 M;  4DV7 M;  4JI5 M;  4YY3 M;  4LF4 M;  2VQE M;  4DR3 M;  1Z5B A;  2UXB M;  2HHH M;  4PDI A;  5FLX S;  1IBM M;  1PJI A;  5ITU A;  4JI8 M;  3U6S A;  2XZF A;  2F4V M;  1EE8 A;  3JR4 A;  4PD2 A;  3U6Q A;  2F5N A;  1L2C A;  5ITX E;  3W0F A;  1IBL M;  5ITT A;  2UUC M;  2UXD M;  3DOA A;  1L1T A;  4PCZ A;  3SAT A;  4X65 M;  3GP1 A;  4G4Q A;  2UUA M;  1N33 M;  3U6C A;  3TWK A;  5ITX A;  4G4N A;  4B3S M;  3SBJ A;  1N32 M;  2Q2E B;  4NXM M;  4MB7 A;  3C58 A;  4ITQ A;  3GPP A;  1HNW M;  3GPY A;  1L1Z A;  3J80 S;  4AQY M;  3GQ5 A;  1K3W A;  4X62 M;  1XC8 A;  1XNR M;  1XNQ M;  4GKK M;  1Q3B A;  3OTO M;  4DR7 M;  4JI3 M;  3GQ4 A;  2UU9 M;  3GPX A;  4LF9 M;  4DR6 M;  2F5O A;  4DV0 M;  1MU5 A;  3U6P A;  3TWM A;  1TDZ A;  1PJJ A;  4JV5 M;  2UUB M;  4NRV A;  3SAU A;  3SAV A;  4JI0 M;  3J81 S;  1I94 M;  3SAR A;  4NXN M;  4LF7 M;  3SAW A;  3JR5 A;  4K0K M;  4G4R A;  3VK8 A;  5LMN M;  5ITY A;  1HR0 M;  4LF8 M;  1XMQ M;  4JI1 M;  1Q3C A;  1XMO M;  4JI6 M;  3TWL A;  3A42 A;  4KHP M;  2ZBK B;  1TDH A;  4JI2 M;  1MX0 A;  1IBK M;  4DR2 M;  3A46 A;  1HNZ M;  1N34 M;  1R2Y A;  4LF6 M;  3U6D A;  4OX9 M;  4YHH M;  5LMU M;  4B3M M;  1N36 M;  1K82 A;  3T1H M;  4DV1 M;  1Q39 A;  4B3T M;  5IT9 S;  3SAS A;  4G4O A;  3GO8 A;  1HNX M;  4LF5 M;  4DR5 M;  4DR4 M;  1FJG M;  4DV4 M;  5ITQ A;  2F5S A;  3GQ3 A;  4PDG A;  2XZU A;  1PM5 A;  3U6L A;  3J7A S;  5IWA M;  2VQF M;  4DV5 M;  3U6O A;  4LFC M;  1Z5A A;  4DV2 M;  4CIS A;  3U6M A;  1L2D A;  4DUY M;  5A2Q S;  4DUZ M;  4JYA M;  2OPF A;  2F5P A;  3U6E A;  2HKJ A;  1Z59 A;  1K3X A;  4JI4 M;  5ITR A;  4JI7 M;  3A45 A;  3VK7 A;  4LFA M;  2EA0 A;  2OQ4 A; 
#chains in the Genus database with same CATH topology
 2L09 A;  1J5E M;  4NRW A;  4RF1 A;  2XSZ A;  2DI0 A;  4CJ6 A;  3ZC7 B;  3GLF E;  4DV6 M;  3JAM S;  1Z5C A;  3HWS A;  4AG6 A;  5BR8 M;  3RGS A;  3M0E A;  3HJQ A;  5KPZ A;  2E5L M;  1NNJ A;  2Z7J A;  3J7B A;  3FUW A;  3L25 A;  1IXS A;  2X49 A;  4W5W A;  2CWB A;  2KNZ A;  1RU3 A;  3KP0 E;  1TTE A;  1PGY A;  4NL4 H;  2VII A;  3ILK A;  3GLG A;  4YY3 M;  2LVN C;  3EIE A;  4IBI A;  3SC3 A;  4LF4 M;  4FWG A;  2JZ1 A;  3HU1 A;  2UXB M;  1GLN A;  3IHP A;  4HL4 A;  2I7P A;  3VDP A;  2CFO A;  4MGI E;  3HHZ A;  3GLG B;  2J7O A;  2DZO B;  2EUC A;  4A3V B;  4WP2 A;  1Y8G A;  4GIP A;  2LBC A;  3DFZ A;  3E46 A;  3HX3 A;  4ZPX A;  1ZV1 A;  1JB0 F;  2OO9 A;  5FTL A;  3ZCB B;  2OOB A;  4NOO B;  4B08 A;  4X65 M;  4CGY B;  1DO0 A;  3KP1 E;  2Z3X A;  1ZMW A;  1DGB A;  5IRE B;  5FTJ A;  3J27 B;  4LJ9 A;  4MB7 A;  2HCB A;  1SXJ D;  2L2D A;  4XK8 F;  2V1U A;  2KA6 B;  3QAU A;  4Q7J A;  1AIP C;  3GPP A;  1D0M A;  2RKO A;  3GPY A;  1L1Z A;  5JI2 E;  1R7R A;  3KW6 A;  4I81 A;  5DYG A;  3TQS A;  1Q3B A;  3TE6 A;  1NJG A;  4L16 A;  3GQ4 A;  1CUK A;  3B89 A;  2LTU A;  4AKI A;  1MU5 A;  2RGH A;  2X8A A;  1EFU B;  3TWM A;  1X37 A;  5FSW A;  4IBK A;  3FYC A;  3PVS A;  2CV2 A;  1DO2 A;  1KYI A;  5EXX A;  3UJN A;  4M0D A;  4CIZ A;  1TF0 B;  2QP9 X;  3SAR A;  4NXN M;  1VEG A;  4L78 A;  3W68 A;  3JR5 A;  1OQY A;  4P17 A;  4LF7 M;  3J2P B;  3QYE A;  4QNM A;  3VK8 A;  1HR0 M;  2DHR A;  1DGH A;  1XMQ M;  2CHV A;  2LVQ D;  4IBC A;  2L4F A;  2FH0 A;  3T38 A;  2KZU A;  4IBE A;  1GJT A;  3AL0 C;  3A42 A;  3BOS A;  4FW9 A;  3U60 B;  4KHP M;  1KSF X;  2X4A A;  4QNR A;  1MX0 A;  3KDS E;  2DAE A;  4DR2 M;  1HNZ M;  1N34 M;  2C9C A;  3C3E A;  4B3M M;  3T1H M;  4RF0 A;  3GLG E;  2H1R A;  1Q39 A;  2M5Z A;  5KO3 A;  4IBJ A;  3C9P A;  3GLH A;  4G4O A;  5IT9 S;  2CEA A;  2CHQ A;  4IBF A;  1FJG M;  4DV4 M;  3RE8 A;  2DEN A;  3KOZ E;  1XXH A;  1FNN A;  2WZJ A;  3TPZ A;  1QZE A;  3GLH B;  3SMS A;  2YNM D;  1TGU A;  2QHO B;  4L6V 6;  5C1B A;  2JY5 A;  4DV5 M;  3U6L A;  3U6O A;  1Z5A A;  4R7G A;  3CGW A;  3T6P A;  1TH4 A;  2JA2 A;  4AZF A;  1XXH B;  1OFH A;  2MGW A;  1QAN A;  2Z4R A;  2F5P A;  1QDR A;  1R5L A;  2JY8 A;  3I4V A;  3U6E A;  3L2A A;  4JI4 M;  4JI7 M;  2R0I A;  3CTW B;  4LFA M;  1IY0 A;  2FE8 A;  1ZAE A;  1V34 A;  3CF2 A;  3L29 A;  4XBO A;  1GAB A;  4FVM A;  4M9Z A;  1QDT A;  3FRI A;  1IY2 A;  4X64 M;  1Q02 A;  3T1Y M;  1L2B A;  3LVW A;  1SXJ A;  2YQZ A;  1IN6 A;  3DA1 A;  4DV3 M;  2F5Q A;  1R2Z A;  2APL A;  2XH9 A;  3GPU A;  3U61 A;  1LTM A;  2BWB A;  3FE3 A;  4MGY E;  1YSY A;  3LVV A;  4R3D A;  4X66 M;  2O5R A;  2QCU A;  4QOZ C;  1IFY A;  2L6O A;  1VEJ A;  3LMM A;  2P5T A;  4QOS A;  4AW4 A;  3UK6 A;  2EKF A;  3B74 A;  1IXZ A;  4DR3 M;  3U61 B;  1Z6T A;  1IXR C;  1OFI A;  2NQ8 C;  2KNA A;  2CP8 A;  4MGK E;  3GRR A;  3H4M A;  1TR8 A;  4MM3 B;  3WHK A;  4EIW A;  3U6S A;  2XZF A;  2C5R A;  3HJS A;  1G3I A;  3UZU A;  4PD2 A;  1C1K A;  3I01 M;  1TH3 A;  1R4G A;  2EJS A;  1DGG A;  3KSX A;  3W0F A;  3GLI A;  3PNY A;  1ZMV A;  4GMQ A;  3H4J A;  5EXP A;  3FUX A;  2DAG A;  4UN2 B;  3DOA A;  3B9P A;  1L1T A;  3Q8G A;  2D7E A;  2HWJ A;  4G3O A;  3NBX X;  2UUA M;  3U6C A;  2R46 A;  1V33 A;  3LCU A;  5ITX A;  3TWK A;  1N32 M;  4AKG A;  1MN3 A;  3GLH E;  3B7Z A;  5GKN A;  3C58 A;  4ITQ A;  3D8L A;  3GQ5 A;  1K3W A;  3AOE A;  4FWD A;  1XC8 A;  1G59 A;  1XXH E;  2XGN A;  3DZD A;  1IXS B;  2BNK A;  1G4A E;  2MR9 A;  2K47 A;  4DR7 M;  4JI3 M;  3GPX A;  3FUT A;  1J09 A;  4LF9 M;  3W0L B;  1OKS A;  3B7Q A;  3HKP A;  4DV0 M;  2DNA A;  2KHH A;  1IY1 A;  4JV5 M;  3KS4 A;  1QZM A;  3SAU A;  1HJP A;  2DWZ B;  1OAI A;  4OW0 A;  2DZL A;  4GC9 A;  4LJ8 A;  3AKZ A;  4NSO B;  3J81 S;  1I94 M;  1T43 A;  2DWM A;  4KO8 A;  3SAW A;  1UFZ A;  1JR3 D;  4LGY A;  3KXE C;  4L15 A;  5LMN M;  3IEC A;  5DNY A;  4GIT A;  1QAO A;  4JI1 M;  2XFS A;  1SG9 A;  4IJE A;  3R8F A;  2KW0 A;  2WSC F;  3L26 A;  4JI6 M;  2RRU A;  3K8Z A;  1TDH A;  2FNA A;  4KT0 F;  3U5Z A;  4JI2 M;  3FKE A;  8CAT A;  1IBK M;  3HU2 A;  1AUA A;  2DWN A;  1GVN A;  3U6D A;  1SXJ C;  4LF6 M;  2FFJ A;  5EQT A;  3SHG B;  2G8L A;  3MK6 A;  3U5Z B;  3KFU G;  1HNX M;  2JP7 A;  4GH9 A;  3HY5 A;  3KVW A;  4REZ A;  3I51 A;  2V6Z M;  3NBI A;  3FUV A;  3UGJ A;  1N75 A;  1WHC A;  1VG5 A;  3L27 A;  3GQ3 A;  4PDG A;  2CV0 A;  2XZU A;  2DAK A;  1HT1 E;  2CHG A;  3J7A S;  2VQF M;  5E6J A;  4LFC M;  1MJG M;  3M6A A;  2Z4S A;  3HJ8 A;  3LCV B;  2B3T A;  2DKL A;  1NY6 A;  5L8R F;  1NJF A;  2KDL A;  3K1J A;  4NSR A;  2LNH C;  1E32 A;  2R18 A;  4OU7 A;  1G41 A;  4B7H A;  5ITR A;  1DGH B;  2QQ8 A;  2Y21 A;  4LY6 A;  2J5Y A;  1OIP A;  2HL7 A;  1PJT A;  1WR1 B;  4KLN A;  4D80 A;  4D82 A;  4TUW A;  1DV0 A;  4LG2 A;  3MHV C;  1QYR A;  1NVM A;  3UMM A;  1NO1 A;  1D0L A;  3VLF B;  3HU3 A;  4BB9 A;  4GHL A;  4QHT A;  2R44 A;  2J7N A;  2QNJ A;  3E21 A;  3GRU A;  2XSZ D;  3CF6 E;  3AOE C;  2ZM6 M;  2LHC A;  4PT5 A;  3K92 A;  3RGP A;  3LW5 F;  3D8B A;  3KS8 A;  1WXQ A;  2H5X A;  4LRT A;  4NC6 A;  1PRB A;  5KPT A;  1Z5B A;  1GO5 A;  2HHH M;  3WHL A;  4PDI A;  1GKI A;  4JN6 A;  4LCB A;  1IBM M;  1PJI A;  5ITU A;  1T3T A;  3T15 A;  2EO2 A;  4L8R C;  2C96 A;  5EP2 A;  5FTN A;  2F4V M;  2F5N A;  4MGH A;  3RFW A;  2JWS A;  1OJL A;  1JR3 A;  3A98 B;  2CE7 A;  1YE9 A;  2LVA A;  3SYK A;  5DFL A;  2KRU A;  3ZH9 B;  2LH0 A;  1HQY E;  3THG A;  1TH2 A;  3GP1 A;  3R9X B;  4AKH A;  1NV9 A;  2KRK A;  1W5S A;  1PJS A;  1UM8 A;  4ANR A;  1L8Q A;  3KOY E;  3FUU A;  4S12 A;  4WUR A;  4NXM M;  4Y28 F;  1G71 A;  1SXJ B;  1VDL A;  2ZAN A;  2MH8 A;  3GRY A;  4Z6Y A;  5H37 D;  3GRV A;  4AQY M;  4X62 M;  2AHM A;  1XNQ M;  2BJW A;  4GKK M;  2JNH A;  1E9R A;  2QEN A;  4LJ7 A;  2UU9 M;  4AI6 A;  4GRI A;  1QAQ A;  2XFT A;  3KSJ A;  3FRH A;  3QYB A;  3K9P A;  1E94 E;  4DBG B;  3K9O A;  2DZN B;  1TDZ A;  1PJJ A;  5F3W A;  2UUB M;  2JY7 A;  3SAV A;  4LJA A;  3AV0 A;  4I4L A;  1NY5 A;  1NV8 A;  2LXE A;  3GLI B;  1NHG C;  4G4R A;  7CAT A;  2WSE F;  1HQC A;  1PJQ A;  1Q3C A;  1XHB A;  2KNV A;  4RKU F;  2QBY A;  3TWL A;  1WIV A;  2LWX A;  2YR0 A;  1IN7 A;  3A46 A;  1IQP A;  2QSF X;  2ZTC A;  1R2Y A;  4YHH M;  3HHY A;  2DWL A;  2QBY B;  3CF0 A;  2R6F A;  3IG5 A;  4I5S A;  2KZS A;  3SAS A;  3FTE A;  2W82 A;  1ZQ9 A;  1YLA A;  5EP1 A;  4IBB A;  5JI3 E;  4LF5 M;  1IN4 A;  1VEK A;  1P3Q Q;  3C3D A;  2R62 A;  5ITQ A;  1W5T A;  2F5S A;  2L4E A;  5IZ7 D;  5BPV A;  4FD2 A;  4IBD A;  1JQJ C;  2JY6 B;  3PXG A;  1PM5 A;  1QAM A;  2FS1 A;  2BJV A;  4G6Z A;  2EKK A;  5FTM A;  1QUT A;  4DV2 M;  2V1C A;  1JR3 E;  5DYI A;  3U6M A;  3TL4 X;  4DUY M;  1XWI A;  2CRU A;  2A5Y B;  2K6B A;  4CHT B;  4JXJ A;  5A2Q S;  4DUZ M;  4JYA M;  1A5T A;  1QVR A;  2OPF A;  1SXJ E;  1OTR A;  3AJI B;  2ERC A;  4IJF A;  3F92 A;  5EJC A;  2MRO B;  3A45 A;  3VK7 A;  2EA0 A;  2ZAM A;  2OQ4 A;  3FTD A;  4GC5 A;  4M0W A;  3ZQJ A;  3FTF A;  2UXC M;  1IN8 A;  1BVS A;  5KPR A;  4LFB M;  3BBZ A;  4MH0 E;  2DHY A;  1J7K A;  3HGI A;  4LJ4 A;  2XLJ A;  5C18 A;  4GKJ M;  1VQ1 A;  3VKH A;  1KFV A;  5KQD A;  1OAO C;  2O25 A;  4DR1 M;  4LZZ A;  4AG5 A;  4B3R M;  3AFH A;  4IIW A;  2L7H A;  2N35 A;  2R65 A;  4DV7 M;  4JI5 M;  4LGM A;  3LQR A;  3VFD A;  3GLI E;  2VQE M;  1HT2 E;  2JZ0 A;  4D81 A;  4LF8 M;  2G5G X;  2LHG A;  2RGO A;  3AOG A;  5FLX S;  1C7Y A;  4JI8 M;  1G8P A;  4BBA A;  1GL7 A;  1NHW C;  2BWE A;  5EP3 A;  4M9S A;  3PFI A;  1EE8 A;  3JR4 A;  3U6Q A;  4L4U A;  1L2C A;  5ITX E;  2DAI A;  5EP4 A;  1IBL M;  2HAK A;  4P16 A;  2C99 A;  5ITT A;  2KXE A;  2XEP A;  2UUC M;  2UXD M;  1XB2 B;  3IG8 A;  4Z8X A;  4IBG A;  2JXN A;  4PCZ A;  3SAT A;  3NWL A;  4LJ6 A;  3BXW A;  3U60 A;  4G4Q A;  1WJ7 A;  3QWL A;  2D7G A;  1N33 M;  2XF3 A;  2QPA A;  4G4N A;  3K2L A;  2LVP C;  4B7G A;  3SBJ A;  4B3S M;  2Q2E B;  4GHA A;  5EXT A;  2C98 A;  3B7N A;  2CUZ A;  2R4E A;  3GLF A;  4BLC A;  4B7F A;  1IM2 A;  1HNW M;  3HHX A;  3J80 S;  1VDD A;  2OOA A;  4HLQ A;  1OIZ A;  1XNR M;  2YFQ A;  3I04 M;  4LJ5 A;  3FYD A;  2GQF A;  2Y0Q A;  3PNV A;  2JUJ A;  3OTO M;  2VF7 A;  3GLF B;  4OVZ A;  1LV7 A;  2DAM A;  3KOX E;  4KOD A;  4II7 A;  2F5O A;  4DR6 M;  1F4I A;  3U6P A;  1IN5 A;  1DGF A;  2O01 F;  3SFZ A;  1GJS A;  3E9S A;  2LVO C;  2VF8 A;  3HHW A;  4QHS A;  4WW0 A;  1D2N A;  4NRV A;  3SYL A;  2WSF F;  3E4R A;  4OVZ B;  4JI0 M;  1D0K A;  2DVW B;  3LQQ A;  4HEO A;  5KQ8 A;  3SMP A;  4R71 A;  1QUS A;  4K0K M;  4F2L A;  3HZJ A;  3Q8X A;  1N77 A;  5ITY A;  2M60 A;  2FOI C;  1QQW A;  4FCT A;  4LZJ A;  1XMO M;  2K9D A;  3I4Y A;  3SHF A;  1NSF A;  1V92 A;  3FD9 A;  2ZBK B;  2I7N A;  3L28 A;  4M9X A;  4F1I A;  1EIJ A;  2DXI A;  4I8O A;  4OX9 M;  2K0B X;  5LMU M;  3MJ5 A;  1T6O A;  1R6B X;  5FTK A;  4GEW A;  4XGI A;  1N36 M;  4MGZ E;  1K82 A;  2CV1 A;  2G3Q A;  2Z8Y M;  4DV1 M;  4B3T M;  4LRS A;  2D7H A;  3VKG A;  3GO8 A;  1YUB A;  4DR5 M;  1S3S A;  4DR4 M;  5EXS A;  5E26 A;  3FTC A;  4FWH A;  4RNA A;  1I4W A;  2R45 A;  2Y0T A;  3M7G A;  3EIH A;  1E9S A;  2L7I A;  1ORY B;  2KEB A;  3VDU A;  2GNO A;  2QZ4 A;  5IWA M;  3V76 A;  3KOW E;  4CIS A;  2Y20 A;  1L2D A;  2R4J A;  1N78 A;  1NNU C;  2MJ5 B;  1WGL A;  1WGN A;  2ZAO A;  4FCW A;  3MMP A;  1ZMU A;  1Z59 A;  2HKJ A;  2VDB B;  4FCV A;  3W67 A;  1GL6 A;  1K3X A;  2ZTD A;  2C9O A;  1H6U A; 
#chains in the Genus database with same CATH homology
 2L09 A;  1J5E M;  4NRW A;  4RF1 A;  2XSZ A;  4DV6 M;  3ZC7 B;  3JAM S;  1Z5C A;  3HWS A;  4AG6 A;  5BR8 M;  3RGS A;  3M0E A;  3HJQ A;  5KPZ A;  2E5L M;  1NNJ A;  2Z7J A;  3J7B A;  3FUW A;  3L25 A;  2X49 A;  4W5W A;  3KP0 E;  4NL4 H;  2VII A;  3ILK A;  3GLG A;  4YY3 M;  3EIE A;  4IBI A;  3SC3 A;  4LF4 M;  4FWG A;  3HU1 A;  2UXB M;  1GLN A;  4HL4 A;  2I7P A;  3VDP A;  2CFO A;  4MGI E;  3HHZ A;  3GLG B;  2J7O A;  2DZO B;  2EUC A;  4A3V B;  4GIP A;  3DFZ A;  4ZPX A;  5FTL A;  3ZCB B;  4NOO B;  4B08 A;  4X65 M;  4CGY B;  1DO0 A;  3KP1 E;  2Z3X A;  1DGB A;  5IRE B;  5FTJ A;  3J27 B;  4LJ9 A;  4MB7 A;  2HCB A;  1SXJ D;  2V1U A;  2KA6 B;  3QAU A;  3GPP A;  3GPY A;  2RKO A;  1L1Z A;  5JI2 E;  1R7R A;  3KW6 A;  4I81 A;  5DYG A;  3TQS A;  1Q3B A;  3TE6 A;  1NJG A;  4L16 A;  3GQ4 A;  4AKI A;  1MU5 A;  2RGH A;  2X8A A;  3TWM A;  1X37 A;  5FSW A;  4IBK A;  3FYC A;  3PVS A;  2CV2 A;  1DO2 A;  1KYI A;  5EXX A;  3UJN A;  4M0D A;  2QP9 X;  3SAR A;  4NXN M;  4LF7 M;  4L78 A;  3JR5 A;  3J2P B;  4QNM A;  3VK8 A;  1HR0 M;  4LF8 M;  2DHR A;  1DGH A;  1XMQ M;  2CHV A;  4IBC A;  3T38 A;  2KZU A;  4IBE A;  3AL0 C;  3A42 A;  3BOS A;  4FW9 A;  3U60 B;  4KHP M;  1KSF X;  2X4A A;  4QNR A;  1MX0 A;  3KDS E;  4DR2 M;  1HNZ M;  1N34 M;  2C9C A;  4B3M M;  3T1H M;  4RF0 A;  2H1R A;  1Q39 A;  2M5Z A;  5KO3 A;  4IBJ A;  4G4O A;  3GLH A;  5IT9 S;  2CEA A;  2CHQ A;  4IBF A;  1FJG M;  4DV4 M;  3RE8 A;  3KOZ E;  1XXH A;  1FNN A;  3TPZ A;  3GLH B;  3SMS A;  2YNM D;  1TGU A;  5C1B A;  3U6L A;  4DV5 M;  3U6O A;  1Z5A A;  4R7G A;  1TH4 A;  2JA2 A;  4AZF A;  1XXH B;  1OFH A;  1QAN A;  2Z4R A;  2F5P A;  3U6E A;  3I4V A;  3L2A A;  4JI4 M;  4JI7 M;  3CTW B;  4LFA M;  1IY0 A;  2FE8 A;  1ZAE A;  3CF2 A;  3L29 A;  4XBO A;  4FVM A;  4M9Z A;  3T1Y M;  1L2B A;  1IY2 A;  4X64 M;  3LVW A;  1SXJ A;  2YQZ A;  1IN6 A;  3DA1 A;  4DV3 M;  2F5Q A;  1R2Z A;  2XH9 A;  3GPU A;  3U61 A;  4MGY E;  1YSY A;  3LVV A;  4R3D A;  4X66 M;  2O5R A;  2QCU A;  4QOZ C;  2L6O A;  3LMM A;  2P5T A;  4QOS A;  4AW4 A;  3UK6 A;  4DR3 M;  3U61 B;  1IXZ A;  1Z6T A;  1IXR C;  1OFI A;  2NQ8 C;  4MGK E;  3U6S A;  3GRR A;  3H4M A;  4MM3 B;  3WHK A;  2C5R A;  4EIW A;  2XZF A;  3HJS A;  1G3I A;  3UZU A;  4PD2 A;  1C1K A;  1TH3 A;  3KSX A;  1DGG A;  3W0F A;  3GLI A;  3PNY A;  4GMQ A;  5EXP A;  3FUX A;  3DOA A;  3B9P A;  1L1T A;  2D7E A;  2UUA M;  3U6C A;  2R46 A;  5ITX A;  3TWK A;  1N32 M;  4AKG A;  5GKN A;  3C58 A;  4ITQ A;  3D8L A;  3GQ5 A;  1K3W A;  3AOE A;  4FWD A;  1XC8 A;  1G59 A;  2XGN A;  3DZD A;  1IXS B;  2BNK A;  1G4A E;  2K47 A;  4DR7 M;  4JI3 M;  3GPX A;  3FUT A;  1J09 A;  4LF9 M;  3W0L B;  3HKP A;  4DV0 M;  1IY1 A;  4JV5 M;  3KS4 A;  1QZM A;  3SAU A;  2DWZ B;  4OW0 A;  4GC9 A;  4LJ8 A;  3AKZ A;  4NSO B;  3J81 S;  1I94 M;  2DWM A;  4KO8 A;  3SAW A;  4LGY A;  1JR3 D;  3KXE C;  4L15 A;  5LMN M;  5DNY A;  4GIT A;  1QAO A;  4JI1 M;  2XFS A;  4IJE A;  3R8F A;  2KW0 A;  3L26 A;  4JI6 M;  3K8Z A;  1TDH A;  2FNA A;  3U5Z A;  4JI2 M;  3FKE A;  8CAT A;  1IBK M;  3HU2 A;  2DWN A;  1GVN A;  3U6D A;  1SXJ C;  4LF6 M;  2FFJ A;  5EQT A;  3SHG B;  2G8L A;  3MK6 A;  3U5Z B;  3KFU G;  1HNX M;  4GH9 A;  3KVW A;  4REZ A;  3I51 A;  2V6Z M;  3NBI A;  3FUV A;  3UGJ A;  1N75 A;  3L27 A;  2CV0 A;  3GQ3 A;  4PDG A;  2XZU A;  1HT1 E;  2CHG A;  3J7A S;  2VQF M;  5E6J A;  4LFC M;  3M6A A;  2Z4S A;  3HJ8 A;  1NY6 A;  1NJF A;  3K1J A;  4NSR A;  2LNH C;  1E32 A;  2R18 A;  4OU7 A;  1G41 A;  4B7H A;  5ITR A;  1DGH B;  2Y21 A;  4LY6 A;  2HL7 A;  4KLN A;  4D80 A;  4D82 A;  4TUW A;  4LG2 A;  3MHV C;  1QYR A;  1NVM A;  3UMM A;  3VLF B;  3HU3 A;  4BB9 A;  4GHL A;  4QHT A;  2J7N A;  3GRU A;  2XSZ D;  3CF6 E;  3AOE C;  2ZM6 M;  4PT5 A;  3K92 A;  3RGP A;  3D8B A;  3KS8 A;  1WXQ A;  4LRT A;  5KPT A;  1Z5B A;  2HHH M;  3WHL A;  4PDI A;  1GKI A;  4JN6 A;  4LCB A;  1IBM M;  1PJI A;  5ITU A;  1T3T A;  3T15 A;  2EO2 A;  4L8R C;  2C96 A;  5EP2 A;  5FTN A;  2F4V M;  2F5N A;  4MGH A;  3RFW A;  1OJL A;  1JR3 A;  3A98 B;  2CE7 A;  1YE9 A;  3SYK A;  2KRU A;  3ZH9 B;  2LH0 A;  1HQY E;  3THG A;  1TH2 A;  3GP1 A;  3R9X B;  4AKH A;  2KRK A;  1W5S A;  1UM8 A;  1L8Q A;  3KOY E;  3FUU A;  4S12 A;  4WUR A;  4NXM M;  1SXJ B;  2ZAN A;  3GRY A;  4Z6Y A;  5H37 D;  3GRV A;  4AQY M;  4X62 M;  2AHM A;  1XNQ M;  2BJW A;  4GKK M;  1E9R A;  2QEN A;  4LJ7 A;  2UU9 M;  4AI6 A;  4GRI A;  1QAQ A;  2XFT A;  3KSJ A;  1E94 E;  2DZN B;  1TDZ A;  1PJJ A;  5F3W A;  2UUB M;  3SAV A;  4LJA A;  3AV0 A;  4I4L A;  1NY5 A;  2LXE A;  3GLI B;  1NHG C;  4G4R A;  7CAT A;  1HQC A;  1Q3C A;  1XHB A;  2QBY A;  3TWL A;  2LWX A;  2YR0 A;  1IN7 A;  3A46 A;  1IQP A;  1R2Y A;  4YHH M;  3HHY A;  2DWL A;  2QBY B;  3CF0 A;  3IG5 A;  4I5S A;  2KZS A;  3SAS A;  3FTE A;  2W82 A;  1ZQ9 A;  5EP1 A;  4IBB A;  5JI3 E;  4LF5 M;  1IN4 A;  2R62 A;  5ITQ A;  1W5T A;  2F5S A;  5IZ7 D;  5BPV A;  4FD2 A;  4IBD A;  1JQJ C;  1PM5 A;  3PXG A;  1QAM A;  4G6Z A;  2BJV A;  5FTM A;  4DV2 M;  2V1C A;  3U6M A;  5DYI A;  3TL4 X;  4DUY M;  1XWI A;  2A5Y B;  4CHT B;  4JXJ A;  5A2Q S;  4DUZ M;  4JYA M;  1QVR A;  2OPF A;  1SXJ E;  3AJI B;  2ERC A;  4IJF A;  5EJC A;  3A45 A;  3VK7 A;  2EA0 A;  2ZAM A;  2OQ4 A;  3FTD A;  4GC5 A;  4M0W A;  3FTF A;  2UXC M;  1IN8 A;  5KPR A;  4LFB M;  4MH0 E;  1J7K A;  3HGI A;  4LJ4 A;  2XLJ A;  5C18 A;  4GKJ M;  3VKH A;  1KFV A;  5KQD A;  4DR1 M;  4B3R M;  4LZZ A;  4AG5 A;  3AFH A;  4IIW A;  2L7H A;  2R65 A;  4DV7 M;  4JI5 M;  4LGM A;  3LQR A;  3VFD A;  2VQE M;  1HT2 E;  4D81 A;  2G5G X;  5FLX S;  2RGO A;  3AOG A;  4JI8 M;  1G8P A;  4BBA A;  1GL7 A;  1NHW C;  5EP3 A;  4M9S A;  3PFI A;  1EE8 A;  3JR4 A;  3U6Q A;  4L4U A;  1L2C A;  5ITX E;  5EP4 A;  1IBL M;  4P16 A;  2C99 A;  5ITT A;  2KXE A;  2XEP A;  2UUC M;  2UXD M;  3IG8 A;  4Z8X A;  4IBG A;  4PCZ A;  3SAT A;  3NWL A;  4LJ6 A;  3U60 A;  4G4Q A;  3QWL A;  2D7G A;  1N33 M;  2XF3 A;  2QPA A;  4G4N A;  3K2L A;  4B7G A;  4B3S M;  3SBJ A;  4GHA A;  2Q2E B;  5EXT A;  2C98 A;  2CUZ A;  2R4E A;  3GLF A;  4BLC A;  4B7F A;  1IM2 A;  1HNW M;  3HHX A;  3J80 S;  1VDD A;  4HLQ A;  1XNR M;  2YFQ A;  4LJ5 A;  3FYD A;  2Y0Q A;  3PNV A;  3OTO M;  3GLF B;  4OVZ A;  1LV7 A;  3KOX E;  4KOD A;  4II7 A;  2F5O A;  4DR6 M;  3U6P A;  1IN5 A;  1DGF A;  3SFZ A;  3E9S A;  3HHW A;  4QHS A;  4WW0 A;  1D2N A;  4NRV A;  3SYL A;  3E4R A;  4OVZ B;  4JI0 M;  2DVW B;  3LQQ A;  5KQ8 A;  3SMP A;  4K0K M;  3Q8X A;  1N77 A;  5ITY A;  2M60 A;  2FOI C;  1QQW A;  4FCT A;  4LZJ A;  1XMO M;  3I4Y A;  3SHF A;  1NSF A;  3FD9 A;  2ZBK B;  2I7N A;  3L28 A;  4M9X A;  2DXI A;  4I8O A;  4OX9 M;  5LMU M;  3MJ5 A;  5FTK A;  1R6B X;  2CV1 A;  1N36 M;  4XGI A;  1K82 A;  4MGZ E;  4DV1 M;  4B3T M;  4LRS A;  2D7H A;  3VKG A;  3GO8 A;  1YUB A;  4DR5 M;  1S3S A;  4DR4 M;  5EXS A;  5E26 A;  3FTC A;  4FWH A;  4RNA A;  1I4W A;  2R45 A;  2Y0T A;  3M7G A;  3EIH A;  1E9S A;  1ORY B;  2L7I A;  2KEB A;  3VDU A;  2QZ4 A;  5IWA M;  3KOW E;  4CIS A;  2Y20 A;  1L2D A;  2R4J A;  1N78 A;  1NNU C;  2ZAO A;  4FCW A;  2HKJ A;  1Z59 A;  4FCV A;  1K3X A;  1GL6 A;  2C9O A;  1H6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...