4LF4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf4M02
1L2CA 3GO8A 3U6MA 4X62M 1L1ZA 2ZM6M 3VK8A 4GKKM 4K0KM 4X66M 1PJJA 2OQ4A 1XNRM 4LFAM 4JI3M 3GP1A 5A2QS 2VQFM 5ITYA 1PJIA 4DUYM 2UU9M 3T1HM 4JI7M 2F4VM 2F5SA 4YHHM 4DR1M 3SATA 1HNZM 4JI6M 4LFBM 2ZBKB 3A45A 1TDHA 3GPYA 1HNXM 1HR0M 4PCZA 1I94M 4X65M 2E5LM 2F5OA 4LF9M 4JI1M 1N32M 1Z5AA 1K3WA 4NXMM 3GPPA 1IBLM 4YY3M 3J7AS 4PD2A 4LF5M 1L1TA 4NRVA 1L2DA 4DR5M 1MU5A 1IBMM 2HHHM 3JR5A 3U6LA 5LMUM 4DV4M 4G4QA 4G4OA 3TWKA 4GKJM 3U6QA 3GQ5A 3W0FA 2EA0A 4NRWA 2UUAM 5ITUA 1Z59A 4DR3M 4DR2M 1Q3BA 3GQ3A 3U6OA 1TDZA 1N36M 5ITXE 4DV5M 1L2BA 4DV1M 5ITXA 4DV7M 2OPFA 1R2ZA 4B3MM 2XZFA 1R2YA 4JV5M 4X64M 4JI2M 4JI4M 3SAUA 4DV3M 5ITQA 4B3RM 4AQYM 4DR6M 2UXCM 4DV0M 1MX0A 5LMNM 2F5QA 3U6CA 4CISA 4ITQA 4DV2M 4KHPM 1N34M 1KFVA 3SAVA 3GPUA 3C58A 3T1YM 3U6EA 1Q3CA 4OX9M 2XZUA 5BR8M 4PDIA 4DUZM 1IBKM 1XC8A 5IT9S 3J81S 4JYAM 1NNJA 4LF7M 1XMOM 1K82A 4DV6M 3GPXA 4B3SM 4LF6M 2Q2EB 4G4RA 4DR4M 4DR7M 3DOAA 3SBJA 1Q39A 3A42A 1EE8A 2UUCM 2F5PA 3JAMS 4B3TM 1Z5BA 4LF4M 4NXNM 1XMQM 1XNQM 3A46A 3U6PA 2UUBM 2HKJA 1HNWM 4JI8M 3U6SA 4MB7A 4LFCM 4JI0M 4LF8M 3SARA 3JR4A 5FLXS 3SASA 4JI5M 3TWLA 1J5EM 5ITRA 5ITTA 1FJGM 3J80S 1N33M 3GQ4A 4G4NA 1PM5A 2UXDM 3OTOM 2F5NA 3TWMA 1K3XA 2UXBM 3U6DA 1Z5CA 4PDGA 3SAWA 3VK7A 5IWAM 2VQEM
chains in the Genus database with same CATH superfamily
1D0LA 4M9XA 1L1ZA 1BVSA 1E94E 2DHYA 3RE8A 2ZM6M 3VK8A 2Z7JA 4NSOB 3T6PA 4X66M 3KOZE 1IY0A 4K0KM 1W5SA 2DZLA 3FTFA 1XNRM 1J09A 4IBFA 1R6BX 4CIZA 4AW4A 1PJIA 2DVWB 1NV9A 1W5TA 2F5SA 3FTDA 1D0MA 4IBDA 5FTKA 2CE7A 1DGHA 5JI2E 2DWMA 2LH0A 4YHHM 4W5WA 2LWXA 4MGHA 3BOSA 1TDHA 4OW0A 1HNXM 3IECA 3CF0A 3D8BA 2MGWA 1ZMVA 2JA2A 3AOGA 4GH9A 2QBYB 2JY6B 1FNNA 1YE9A 1Z5AA 5DNYA 3GPPA 3LW5F 1K3WA 4WURA 1AUAA 4NRVA 2K0BX 3HZJA 3K9OA 1WHCA 3JR5A 3MK6A 3B74A 1NVMA 5E6JA 5EXTA 5LMUM 3AJIB 4IIWA 2Y0TA 4G4QA 3M7GA 4GKJM 1OIZA 2DAIA 3U6QA 3K1JA 3KS4A 2EA0A 1JR3E 2DI0A 3M0EA 2B3TA 2UUAM 2CRUA 3FD9A 1Y8GA 2QCUA 2QP9X 1RU3A 1YSYA 4DR2M 1D0KA 1Q3BA 3HU2A 3TPZA 3VKHA 2KA6B 3PNVA 1IN8A 2OPFA 1VEJA 3ILKA 1VQ1A 2XZFA 1QZEA 3BXWA 3HGIA 4LZJA 4JV5M 2XSZD 3PFIA 2CV2A 4NL4H 4Y28F 1TH2A 2D7GA 3I01M 5H37D 2I7NA 2A5YB 2ZTCA 1PGYA 2FFJA 3RFWA 2QENA 4Z6YA 2QSFX 3C3EA 3UMMA 2F5QA 3U6CA 1IM2A 3PXGA 4ITQA 1N34M 1KFVA 1JR3A 4IBIA 2D7EA 2VDBB 4IJFA 4QHSA 3C58A 1Q3CA 2X4AA 2DXIA 5FTJA 1OQYA 3L2AA 5BR8M 1OAOC 4L8RC 4FWDA 4DUZM 1IBKM 1HT2E 1N77A 2O25A 2L09A 2BJVA 3HU3A 3GLGB 1NJGA 4GC9A 1Z6TA 2RRUA 4FD2A 4LF6M 3K9PA 4G4RA 4DR4M 3CGWA 3DOAA 1UM8A 3GLHA 1SG9A 3SBJA 1HQYE 1NNUC 1IN4A 4R7GA 3GRRA 3FTEA 2C9CA 2BJWA 3U61B 2JP7A 3U5ZA 1T43A 2M60A 3I04M 4LF4M 2VF8A 3A46A 1F4IA 2UUBM 1NHWC 2R4EA 1G8PA 4XGIA 3TL4X 2WSCF 3UGJA 2DNAA 3TWLA 5ITTA 5FTLA 1FJGM 1LV7A 1DO2A 4ZPXA 2YFQA 2CP8A 3OTOM 1GJSA 1IQPA 1K3XA 3U6DA 1NJFA 4HEOA 3AOEC 4KO8A 1NHGC 3FUTA 4DBGB 4IBJA 3L25A 5BPVA 2EO2A 1IFYA 1OIPA 3HX3A 4AI6A 3GO8A 2BWBA 2JY7A 3GLHE 1R5LA 1G41A 3BBZA 2ZAOA 3MMPA 3A98B 4QNRA 1OFIA 5DFLA 3T38A 4MGIE 3KVWA 4KODA 3J2PB 5KPTA 2O01F 1PJJA 2G8LA 2OQ4A 4LFAM 4LJAA 3GP1A 1ZAEA 2VQFM 1OTRA 4DUYM 2CV0A 3T1HM 5L8RF 1XWIA 2DWZB 5EP1A 4DR1M 1IN6A 2R44A 3FE3A 4FCTA 4BB9A 3GLIA 3CTWB 2KNVA 4WP2A 4GRIA 4LJ6A 4LFBM 1ZMUA 2ERCA 3A45A 4MM3B 1HR0M 3Q8XA 1NV8A 2F5OA 2WSEF 1GJTA 4LF9M 4JI1M 1WJ7A 2V6ZM 3LMMA 1GVNA 2VIIA 3B7ZA 4NXMM 1N32M 3KOWE 2ZANA 4D82A 1VDLA 3E46A 3U60A 2J7OA 4RF0A 3H4MA 2HHHM 1V92A 3UK6A 1TH4A 3DA1A 3U6LA 4P16A 4B08A 2CUZA 4LRTA 4NOOB 3TWKA 2I7PA 3SYLA 4GHLA 1G71A 3GRVA 3R8FA 3RGSA 3GQ5A 1X37A 1YLAA 2FE8A 2RGHA 2ZAMA 5EXSA 4NRWA 3VDUA 3UZUA 4FCWA 5ITUA 2DZOB 2LHCA 1JB0F 4DR3M 3KFUG 2CHVA 3W68A 3GLIB 4DV5M 1N36M 1IXZA 1WIVA 1QAQA 3GLHB 3NBXX 4Q7JA 1QDTA 5EP2A 1E9RA 3HHWA 1ZQ9A 4B3MM 2C99A 7CATA 3MJ5A 3GRUA 3THGA 4JI2M 1NSFA 3HHZA 1SXJB 3SAUA 4DV3M 5KQ8A 4GIPA 4UN2B 4R3DA 4OVZB 2UXCM 2H5XA 1MX0A 5LMNM 3MHVC 4DV2M 4AZFA 3HU1A 1PRBA 2K47A 2XSZA 2JZ1A 3SAVA 3LQRA 1WGNA 2KRUA 4RKUF 1VDDA 2XZUA 1R7RA 4PDIA 3VLFB 3TE6A 2L4EA 4MGKE 3ZQJA 1AIPC 2L6OA 1QAOA 5IT9S 1XXHA 2QNJA 1IN5A 4B3SM 4Z8XA 2M5ZA 3AOEA 3UJNA 3J7BA 2Q2EB 3HJSA 3QYEA 2BNKA 2LBCA 4LJ7A 4QHTA 3HJQA 3DFZA 5KO3A 1GL6A 1HQCA 2F5PA 2O5RA 4B3TM 1I4WA 1Z5BA 3LVWA 1E9SA 3T15A 5DYGA 3V76A 1KSFX 2JWSA 3U6PA 2KDLA 2HKJA 4I81A 1HNWM 2X8AA 4JI8M 1S3SA 1GLNA 5C1BA 1IXSB 4JI0M 4F2LA 2LTUA 1SXJE 2C9OA 2R45A 3JR4A 4JI5M 4QNMA 4EIWA 5KPRA 2HL7A 3R9XB 3C3DA 3J80S 1SXJD 1GABA 1J7KA 3GQ4A 4AG6A 4F1IA 3F92A 4FCVA 3KSXA 1EIJA 1XHBA 2DKLA 2C98A 3RGPA 1Z5CA 4PDGA 4L4UA 3SAWA 3HJ8A 3U6MA 4X62M 4GC5A 1OKSA 1DGHB 1N75A 3TQSA 2HAKA 2XH9A 4MGYE 3KOXE 3L28A 4XK8F 2L7IA 4GKKM 1HJPA 1CUKA 4KLNA 1IXRC 4IBCA 2RKOA 3KSJA 3LCVB 3KS8A 1YUBA 2DZNB 4IBKA 5ITYA 2P5TA 3IG8A 3AFHA 1H6UA 1WGLA 2UU9M 2KNAA 3W67A 5IZ7D 3FTCA 3KOYE 1DV0A 4LG2A 3NWLA 2R62A 4JI6M 3HY5A 2J5YA 2ZBKB 3GPYA 2KZSA 3QAUA 4PCZA 1I94M 2MROB 4GEWA 2E5LM 2RGOA 1V33A 3L29A 3QYBA 3FUUA 4YY3M 4PD2A 2EJSA 2Y20A 1L2DA 1ZV1A 1MU5A 3IHPA 4DR5M 1IBMM 4GHAA 1OFHA 5IREB 3L27A 2KXEA 1QDRA 5FTMA 2APLA 2R65A 1TF0B 3I4YA 2L2DA 3GLGE 2MR9A 3W0FA 4OU7A 4A3VB 2QBYA 3CF6E 1Z59A 2QHOB 4S12A 3GQ3A 3U6OA 1TDZA 3U61A 3PNYA 3GRYA 3NBIA 1L2BA 2XGNA 2XFSA 3HKPA 1XB2B 2LHGA 4DV7M 2BWEA 4FWHA 1MN3A 1G4AE 4GITA 4B7GA 4CGYB 1TH3A 2V1CA 3AKZA 2DENA 2LXEA 2XFTA 1V34A 3B7QA 4X64M 2CHGA 4RNAA 2Z8YM 1JQJC 3K8ZA 5GKNA 1TGUA 2OOAA 2NQ8C 1E32A 2L7HA 5E26A 2XEPA 3KP1E 2VF7A 4AQYM 2R6FA 5EP4A 4DV0M 2C96A 4CISA 3GLFB 4KHPM 4RF1A 1IY1A 1VEKA 1ZMWA 3Q8GA 2YNMD 2V1UA 3FYCA 3I4VA 5JI3E 2JXNA 3SHFA 3U6EA 3T1YM 4AKIA 3AL0C 2JY8A 4MH0E 2K6BA 4D80A 1XC8A 4LGYA 4JYAM 2MH8A 2R0IA 2CHQA 5KPZA 4LF7M 2JUJA 2Y0QA 3IG5A 2YQZA 2LVNC 4LGMA 5EJCA 3GPXA 1QZMA 1C1KA 1QVRA 2XLJA 1EFUB 2LVQD 2FH0A 3AV0A 4I5SA 4LZZA 2WZJA 1Q39A 3FUVA 2K9DA 1QYRA 3I51A 1QANA 3SHGB 4LJ5A 2UUCM 4HLQA 2QPAA 4JXJA 1P3QQ 2DHRA 1PJTA 1UFZA 3LCUA 4II7A 4OVZA 3QWLA 4NXNM 5FSWA 1XMQM 4LJ4A 3FUXA 2J7NA 4LFCM 1IXSA 5C18A 3SARA 4LF8M 4WW0A 5FLXS 3SASA 5FTNA 1DO0A 4M0WA 1J5EM 4MGZE 3EIEA 4PT5A 2QZ4A 2DAKA 1MJGM 1N33M 5EP3A 4G4NA 1XXHB 1NY6A 3GLFE 1D2NA 3TWMA 4JN6A 3WHKA 4IBBA 3VK7A 2VQEM 1HT1E 2R18A 2FS1A 1L2CA 3CF2A 4NC6A 4L6V6 2AHMA 3FRIA 2CFOA 3KW6A 2EUCA 1KYIA 2KNZA 4JI3M 5A2QS 3HHYA 3SC3A 3U60B 4AKHA 4FWGA 2GNOA 4JI7M 2H1RA 2F4VM 1A5TA 1N78A 4QOZC 3E9SA 2KEBA 3SATA 1HNZM 3WHLA 3W0LB 3VFDA 1R4GA 5EQTA 3LVVA 2LVOC 5EXPA 1SXJC 4X65M 1DGBA 8CATA 3LQQA 4R71A 2X49A 2KHHA 1OAIA 2JZ0A 4L78A 1IBLM 3J7AS 4LF5M 4REZA 1IY2A 1L1TA 2ZTDA 4P17A 3PVSA 3VKGA 4LRSA 1QAMA 4DV4M 4I8OA 3EIHA 1OJLA 4G4OA 4TUWA 2KW0A 2OO9A 1L8QA 2GQFA 1XXHE 4LJ9A 1NY5A 2WSFF 3SMPA 4IBEA 1GKIA 2D7HA 2L4FA 4AKGA 5EXXA 2DWNA 4M0DA 5ITXE 2CV1A 3H4JA 4DV1M 3C9PA 4QOSA 3HWSA 5ITXA 2W82A 3K92A 3FUWA 1R2ZA 4I4LA 3E21A 1R2YA 3M6AA 1TR8A 1JR3D 1NO1A 2CWBA 2MJ5B 4L16A 1PJQA 4JI4M 4AG5A 5F3WA 2Y21A 2JNHA 1T3TA 1QUSA 1SXJA 2OOBA 2LNHC 2N35A 5ITQA 3DZDA 2DWLA 1G59A 3B7NA 2DAMA 4B3RM 4DR6M 2FOIC 3U5ZB 3SYKA 2EKFA 1QUTA 4KT0F 4D81A 2KZUA 4IJEA 3ZCBB 2XF3A 2DAEA 4CJ6A 2YR0A 3ZH9B 2KRKA 2R4JA 3L26A 2Z4SA 2JY5A 3GPUA 3HHXA 1GL7A 1LTMA 3B89A 3SFZA 4OX9M 4HL4A 5KQDA 2G3QA 1WXQA 3KXEC 3FYDA 4LJ8A 2HWJA 1VG5A 3J81S 4M9ZA 1VEGA 3K2LA 2R46A 1NNJA 1XMOM 1K82A 4DV6M 2LVPC 4GMQA 4L15A 2HCBA 3B9PA 4LCBA 4DR7M 1WR1B 1IN7A 3SMSA 3A42A 1EE8A 4NSRA 3GLIE 1DGGA 2Z4RA 3FRHA 2Z3XA 3JAMS 2C5RA 3E4RA 4M9SA 1TTEA 2LVAA 3VDPA 3D8LA 1XNQM 1G3IA 4G6ZA 4BLCA 1DGFA 3U6SA 4IBGA 4MB7A 4BBAA 4CHTB 2DAGA 4XBOA 1Q02A 4FVMA 1T6OA 5ITRA 1GO5A 3KP0E 4FW9A 4G3OA 2CEAA 3GLGA 2G5GX 1C7YA 1PM5A 2UXDM 1QQWA 2F5NA 4ANRA 3J27B 1ORYB 5DYIA 4B7FA 4B7HA 2UXBM 2EKKA 3GLFA 1PJSA 5IWAM 4LY6A 3ZC7B 2FNAA 2QQ8A 3KDSE 3FKEA
chains in the Genus database with same CATH topology
4M9XA 1L1ZA 1E94E 2ZM6M 3RE8A 3VK8A 2Z7JA 4NSOB 4K0KM 4X66M 3KOZE 1IY0A 1W5SA 3FTFA 1XNRM 1J09A 4IBFA 1R6BX 4AW4A 1PJIA 2DVWB 1W5TA 2F5SA 3FTDA 4IBDA 5JI2E 5FTKA 2CE7A 1DGHA 2DWMA 2LH0A 4YHHM 4W5WA 2LWXA 4MGHA 3BOSA 1TDHA 4OW0A 1HNXM 3CF0A 3D8BA 3AOGA 2JA2A 4GH9A 2QBYB 1FNNA 1YE9A 1Z5AA 5DNYA 3GPPA 1K3WA 4WURA 4NRVA 3JR5A 3MK6A 1NVMA 5E6JA 5EXTA 5LMUM 3AJIB 4IIWA 2Y0TA 4G4QA 3M7GA 4GKJM 3U6QA 3K1JA 3KS4A 2EA0A 2UUAM 3M0EA 3FD9A 2QCUA 2QP9X 1YSYA 4DR2M 1Q3BA 3HU2A 3TPZA 3VKHA 2KA6B 3PNVA 1IN8A 2OPFA 3ILKA 2XZFA 3HGIA 4JV5M 4LZJA 2XSZD 3PFIA 2CV2A 4NL4H 1TH2A 2D7GA 5H37D 2I7NA 2A5YB 2FFJA 3RFWA 2QENA 4Z6YA 3UMMA 2F5QA 3U6CA 1IM2A 3PXGA 4ITQA 1N34M 1KFVA 1JR3A 4IBIA 2D7EA 4IJFA 4QHSA 3C58A 1Q3CA 2X4AA 2DXIA 5FTJA 3L2AA 5BR8M 4L8RC 4FWDA 4DUZM 1IBKM 1HT2E 1N77A 2L09A 2BJVA 3HU3A 3GLGB 1NJGA 4GC9A 1Z6TA 4FD2A 4LF6M 4G4RA 4DR4M 3DOAA 1UM8A 3GLHA 3SBJA 1HQYE 1NNUC 1IN4A 4R7GA 3GRRA 3FTEA 2C9CA 2BJWA 3U61B 3U5ZA 2M60A 4LF4M 3A46A 2UUBM 1NHWC 2R4EA 1G8PA 4XGIA 3TL4X 3UGJA 3TWLA 5ITTA 5FTLA 1FJGM 1LV7A 1DO2A 4ZPXA 2YFQA 3OTOM 1IQPA 1K3XA 3U6DA 1NJFA 3AOEC 4KO8A 1NHGC 3FUTA 4AI6A 4IBJA 3L25A 5BPVA 2EO2A 3GO8A 1G41A 2ZAOA 3A98B 4QNRA 1OFIA 3T38A 4MGIE 3KVWA 4KODA 3J2PB 5KPTA 1PJJA 2G8LA 2OQ4A 4LFAM 4LJAA 3GP1A 1ZAEA 2VQFM 4DUYM 2CV0A 3T1HM 1XWIA 2DWZB 5EP1A 4DR1M 1IN6A 4FCTA 3GLIA 3R8FA 4BB9A 3CTWB 4LFBM 4GRIA 4LJ6A 2ERCA 3A45A 4MM3B 1HR0M 3Q8XA 2F5OA 4LF9M 4JI1M 2V6ZM 3LMMA 1GVNA 2VIIA 4NXMM 1N32M 3KOWE 2ZANA 4D82A 3U60A 2J7OA 4RF0A 3H4MA 2HHHM 3UK6A 1TH4A 3DA1A 3U6LA 4P16A 4B08A 2CUZA 4LRTA 4NOOB 3TWKA 2I7PA 3SYLA 4GHLA 3GRVA 3RGSA 3GQ5A 1X37A 2FE8A 2RGHA 2ZAMA 5EXSA 4NRWA 3VDUA 3UZUA 4FCWA 5ITUA 2DZOB 4DR3M 3KFUG 2CHVA 3GLIB 4DV5M 1N36M 1IXZA 5EP2A 1QAQA 3GLHB 1E9RA 3HHWA 1ZQ9A 4B3MM 2C99A 7CATA 3MJ5A 3GRUA 3THGA 4JI2M 1NSFA 3HHZA 1SXJB 3SAUA 4DV3M 5KQ8A 4GIPA 4R3DA 4OVZB 2UXCM 1MX0A 5LMNM 3MHVC 4DV2M 4AZFA 3HU1A 2K47A 2XSZA 3SAVA 3LQRA 2KRUA 2XZUA 1VDDA 1R7RA 4PDIA 3VLFB 3TE6A 4MGKE 2L6OA 1QAOA 5IT9S 1XXHA 1IN5A 4B3SM 4Z8XA 2M5ZA 3AOEA 3UJNA 3J7BA 2Q2EB 3HJSA 4LJ7A 2BNKA 4QHTA 3HJQA 3DFZA 5KO3A 1GL6A 1HQCA 2F5PA 2O5RA 4B3TM 1I4WA 1Z5BA 3LVWA 1E9SA 3T15A 5DYGA 1KSFX 3U6PA 2HKJA 4I81A 1HNWM 2X8AA 4JI8M 1S3SA 1GLNA 5C1BA 1IXSB 4JI0M 2R45A 1SXJE 2C9OA 3JR4A 4JI5M 4QNMA 4EIWA 5KPRA 2HL7A 3R9XB 3J80S 1SXJD 1J7KA 3GQ4A 4AG6A 4FCVA 3KSXA 1XHBA 3RGPA 2C98A 1Z5CA 4PDGA 4L4UA 3SAWA 3HJ8A 3U6MA 4X62M 4GC5A 1DGHB 1N75A 3TQSA 4MGYE 2XH9A 4GKKM 3KOXE 3L28A 2L7IA 4KLNA 1IXRC 4IBCA 2RKOA 3KSJA 3KS8A 2DZNB 4IBKA 5ITYA 2P5TA 3IG8A 3AFHA 1H6UA 2UU9M 5IZ7D 3FTCA 3KOYE 4LG2A 3NWLA 2R62A 4JI6M 2ZBKB 3GPYA 2KZSA 3QAUA 4PCZA 1I94M 2E5LM 2RGOA 3L29A 3FUUA 4YY3M 4PD2A 2Y20A 1L2DA 4DR5M 1MU5A 1IBMM 4GHAA 1OFHA 5IREB 3L27A 2KXEA 5FTMA 2R65A 3I4YA 4OU7A 3W0FA 4A3VB 2QBYA 3CF6E 1Z59A 4S12A 3GQ3A 3U6OA 1TDZA 3U61A 3PNYA 3GRYA 3NBIA 1L2BA 2XGNA 2XFSA 3HKPA 4DV7M 4FWHA 4GITA 4B7GA 1G4AE 3AKZA 4CGYB 1TH3A 2V1CA 2LXEA 2XFTA 4X64M 2CHGA 4RNAA 3K8ZA 1JQJC 5GKNA 1TGUA 2NQ8C 1E32A 2L7HA 5E26A 2XEPA 3KP1E 4AQYM 5EP4A 4DV0M 2C96A 4CISA 3GLFB 4KHPM 4RF1A 1IY1A 2V1UA 2YNMD 3FYCA 3I4VA 5JI3E 3SHFA 3U6EA 3T1YM 4AKIA 3AL0C 4MH0E 4D80A 1XC8A 4LGYA 4JYAM 5KPZA 2CHQA 4LF7M 2Y0QA 3IG5A 2YQZA 4LGMA 5EJCA 3GPXA 1QZMA 1C1KA 1QVRA 2XLJA 3AV0A 4I5SA 4LZZA 3FUVA 1Q39A 3SHGB 3I51A 1QYRA 1QANA 2UUCM 4LJ5A 4HLQA 2QPAA 4JXJA 2DHRA 4II7A 4OVZA 3QWLA 4NXNM 5FSWA 1XMQM 4LJ4A 3FUXA 2J7NA 4LFCM 5C18A 4LF8M 3SARA 4WW0A 5FLXS 3SASA 5FTNA 1DO0A 4M0WA 1J5EM 4MGZE 3EIEA 4PT5A 2QZ4A 1N33M 5EP3A 4G4NA 1XXHB 1NY6A 3TWMA 1D2NA 4JN6A 3WHKA 4IBBA 3VK7A 2VQEM 1HT1E 2R18A 1L2CA 3CF2A 2AHMA 2CFOA 3KW6A 2EUCA 1KYIA 4JI3M 5A2QS 3HHYA 3SC3A 3U60B 4AKHA 4FWGA 2F4VM 4JI7M 2H1RA 1N78A 4QOZC 3E9SA 2KEBA 3SATA 1HNZM 3WHLA 3W0LB 3VFDA 5EQTA 3LVVA 5EXPA 1SXJC 4X65M 1DGBA 8CATA 3LQQA 2X49A 1IBLM 4L78A 3J7AS 4LF5M 4REZA 1IY2A 1L1TA 3PVSA 3VKGA 4LRSA 1QAMA 4DV4M 4I8OA 3EIHA 1OJLA 4G4OA 4TUWA 2KW0A 1L8QA 4LJ9A 1NY5A 3SMPA 4IBEA 1GKIA 2D7HA 4AKGA 5EXXA 2DWNA 4M0DA 5ITXE 2CV1A 4DV1M 4QOSA 3HWSA 5ITXA 2W82A 3K92A 3FUWA 1R2ZA 4I4LA 1R2YA 3M6AA 1JR3D 4L16A 4JI4M 4AG5A 5F3WA 2Y21A 1T3TA 1SXJA 5ITQA 2LNHC 3DZDA 2DWLA 1G59A 4B3RM 4DR6M 2FOIC 3U5ZB 3SYKA 4D81A 2KZUA 4IJEA 3ZCBB 2XF3A 2YR0A 3ZH9B 2KRKA 2R4JA 3L26A 2Z4SA 3GPUA 3HHXA 1GL7A 3SFZA 4OX9M 4HL4A 5KQDA 1WXQA 3KXEC 3FYDA 4LJ8A 3J81S 4M9ZA 3K2LA 1NNJA 2R46A 1XMOM 1K82A 4DV6M 4GMQA 4L15A 2HCBA 3B9PA 4LCBA 4DR7M 1IN7A 3SMSA 3A42A 1EE8A 4NSRA 1DGGA 2Z4RA 2Z3XA 3JAMS 2C5RA 3E4RA 4M9SA 3VDPA 3D8LA 1XNQM 1G3IA 4G6ZA 4BLCA 1DGFA 3U6SA 4IBGA 4MB7A 4BBAA 4CHTB 4XBOA 4FVMA 5ITRA 3KP0E 4FW9A 2CEAA 3GLGA 2G5GX 2UXDM 1PM5A 1QQWA 2F5NA 3J27B 1ORYB 5DYIA 4B7FA 4B7HA 2UXBM 3GLFA 5IWAM 4LY6A 3ZC7B 2FNAA 1YUBA 3KDSE 3FKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2C A;  3GO8 A;  3U6M A;  4X62 M;  1L1Z A;  2ZM6 M;  3VK8 A;  4GKK M;  4K0K M;  4X66 M;  1PJJ A;  2OQ4 A;  1XNR M;  4LFA M;  4JI3 M;  3GP1 A;  5A2Q S;  2VQF M;  5ITY A;  1PJI A;  4DUY M;  2UU9 M;  3T1H M;  4JI7 M;  2F4V M;  2F5S A;  4YHH M;  4DR1 M;  3SAT A;  1HNZ M;  4JI6 M;  4LFB M;  2ZBK B;  3A45 A;  1TDH A;  3GPY A;  1HNX M;  1HR0 M;  4PCZ A;  1I94 M;  4X65 M;  2E5L M;  2F5O A;  4LF9 M;  4JI1 M;  1N32 M;  1Z5A A;  1K3W A;  4NXM M;  3GPP A;  1IBL M;  4YY3 M;  3J7A S;  4PD2 A;  4LF5 M;  1L1T A;  4NRV A;  1L2D A;  4DR5 M;  1MU5 A;  1IBM M;  2HHH M;  3JR5 A;  3U6L A;  5LMU M;  4DV4 M;  4G4Q A;  4G4O A;  3TWK A;  4GKJ M;  3U6Q A;  3GQ5 A;  3W0F A;  2EA0 A;  4NRW A;  2UUA M;  5ITU A;  1Z59 A;  4DR3 M;  4DR2 M;  1Q3B A;  3GQ3 A;  3U6O A;  1TDZ A;  1N36 M;  5ITX E;  4DV5 M;  1L2B A;  4DV1 M;  5ITX A;  4DV7 M;  2OPF A;  1R2Z A;  4B3M M;  2XZF A;  1R2Y A;  4JV5 M;  4X64 M;  4JI2 M;  4JI4 M;  3SAU A;  4DV3 M;  5ITQ A;  4B3R M;  4AQY M;  4DR6 M;  2UXC M;  4DV0 M;  1MX0 A;  5LMN M;  2F5Q A;  3U6C A;  4CIS A;  4ITQ A;  4DV2 M;  4KHP M;  1N34 M;  1KFV A;  3SAV A;  3GPU A;  3C58 A;  3T1Y M;  3U6E A;  1Q3C A;  4OX9 M;  2XZU A;  5BR8 M;  4PDI A;  4DUZ M;  1IBK M;  1XC8 A;  5IT9 S;  3J81 S;  4JYA M;  1NNJ A;  4LF7 M;  1XMO M;  1K82 A;  4DV6 M;  3GPX A;  4B3S M;  4LF6 M;  2Q2E B;  4G4R A;  4DR4 M;  4DR7 M;  3DOA A;  3SBJ A;  1Q39 A;  3A42 A;  1EE8 A;  2UUC M;  2F5P A;  3JAM S;  4B3T M;  1Z5B A;  4LF4 M;  4NXN M;  1XMQ M;  1XNQ M;  3A46 A;  3U6P A;  2UUB M;  2HKJ A;  1HNW M;  4JI8 M;  3U6S A;  4MB7 A;  4LFC M;  4JI0 M;  4LF8 M;  3SAR A;  3JR4 A;  5FLX S;  3SAS A;  4JI5 M;  3TWL A;  1J5E M;  5ITR A;  5ITT A;  1FJG M;  3J80 S;  1N33 M;  3GQ4 A;  4G4N A;  1PM5 A;  2UXD M;  3OTO M;  2F5N A;  3TWM A;  1K3X A;  2UXB M;  3U6D A;  1Z5C A;  4PDG A;  3SAW A;  3VK7 A;  5IWA M;  2VQE M; 
#chains in the Genus database with same CATH topology
 1D0L A;  4M9X A;  1L1Z A;  1BVS A;  1E94 E;  2DHY A;  3RE8 A;  2ZM6 M;  3VK8 A;  2Z7J A;  4NSO B;  3T6P A;  4X66 M;  3KOZ E;  1IY0 A;  4K0K M;  1W5S A;  2DZL A;  3FTF A;  1XNR M;  1J09 A;  4IBF A;  1R6B X;  4CIZ A;  4AW4 A;  1PJI A;  2DVW B;  1NV9 A;  1W5T A;  2F5S A;  3FTD A;  1D0M A;  4IBD A;  5FTK A;  2CE7 A;  1DGH A;  5JI2 E;  2DWM A;  2LH0 A;  4YHH M;  4W5W A;  2LWX A;  4MGH A;  3BOS A;  1TDH A;  4OW0 A;  1HNX M;  3IEC A;  3CF0 A;  3D8B A;  2MGW A;  1ZMV A;  2JA2 A;  3AOG A;  4GH9 A;  2QBY B;  2JY6 B;  1FNN A;  1YE9 A;  1Z5A A;  5DNY A;  3GPP A;  3LW5 F;  1K3W A;  4WUR A;  1AUA A;  4NRV A;  2K0B X;  3HZJ A;  3K9O A;  1WHC A;  3JR5 A;  3MK6 A;  3B74 A;  1NVM A;  5E6J A;  5EXT A;  5LMU M;  3AJI B;  4IIW A;  2Y0T A;  4G4Q A;  3M7G A;  4GKJ M;  1OIZ A;  2DAI A;  3U6Q A;  3K1J A;  3KS4 A;  2EA0 A;  1JR3 E;  2DI0 A;  3M0E A;  2B3T A;  2UUA M;  2CRU A;  3FD9 A;  1Y8G A;  2QCU A;  2QP9 X;  1RU3 A;  1YSY A;  4DR2 M;  1D0K A;  1Q3B A;  3HU2 A;  3TPZ A;  3VKH A;  2KA6 B;  3PNV A;  1IN8 A;  2OPF A;  1VEJ A;  3ILK A;  1VQ1 A;  2XZF A;  1QZE A;  3BXW A;  3HGI A;  4LZJ A;  4JV5 M;  2XSZ D;  3PFI A;  2CV2 A;  4NL4 H;  4Y28 F;  1TH2 A;  2D7G A;  3I01 M;  5H37 D;  2I7N A;  2A5Y B;  2ZTC A;  1PGY A;  2FFJ A;  3RFW A;  2QEN A;  4Z6Y A;  2QSF X;  3C3E A;  3UMM A;  2F5Q A;  3U6C A;  1IM2 A;  3PXG A;  4ITQ A;  1N34 M;  1KFV A;  1JR3 A;  4IBI A;  2D7E A;  2VDB B;  4IJF A;  4QHS A;  3C58 A;  1Q3C A;  2X4A A;  2DXI A;  5FTJ A;  1OQY A;  3L2A A;  5BR8 M;  1OAO C;  4L8R C;  4FWD A;  4DUZ M;  1IBK M;  1HT2 E;  1N77 A;  2O25 A;  2L09 A;  2BJV A;  3HU3 A;  3GLG B;  1NJG A;  4GC9 A;  1Z6T A;  2RRU A;  4FD2 A;  4LF6 M;  3K9P A;  4G4R A;  4DR4 M;  3CGW A;  3DOA A;  1UM8 A;  3GLH A;  1SG9 A;  3SBJ A;  1HQY E;  1NNU C;  1IN4 A;  4R7G A;  3GRR A;  3FTE A;  2C9C A;  2BJW A;  3U61 B;  2JP7 A;  3U5Z A;  1T43 A;  2M60 A;  3I04 M;  4LF4 M;  2VF8 A;  3A46 A;  1F4I A;  2UUB M;  1NHW C;  2R4E A;  1G8P A;  4XGI A;  3TL4 X;  2WSC F;  3UGJ A;  2DNA A;  3TWL A;  5ITT A;  5FTL A;  1FJG M;  1LV7 A;  1DO2 A;  4ZPX A;  2YFQ A;  2CP8 A;  3OTO M;  1GJS A;  1IQP A;  1K3X A;  3U6D A;  1NJF A;  4HEO A;  3AOE C;  4KO8 A;  1NHG C;  3FUT A;  4DBG B;  4IBJ A;  3L25 A;  5BPV A;  2EO2 A;  1IFY A;  1OIP A;  3HX3 A;  4AI6 A;  3GO8 A;  2BWB A;  2JY7 A;  3GLH E;  1R5L A;  1G41 A;  3BBZ A;  2ZAO A;  3MMP A;  3A98 B;  4QNR A;  1OFI A;  5DFL A;  3T38 A;  4MGI E;  3KVW A;  4KOD A;  3J2P B;  5KPT A;  2O01 F;  1PJJ A;  2G8L A;  2OQ4 A;  4LFA M;  4LJA A;  3GP1 A;  1ZAE A;  2VQF M;  1OTR A;  4DUY M;  2CV0 A;  3T1H M;  5L8R F;  1XWI A;  2DWZ B;  5EP1 A;  4DR1 M;  1IN6 A;  2R44 A;  3FE3 A;  4FCT A;  4BB9 A;  3GLI A;  3CTW B;  2KNV A;  4WP2 A;  4GRI A;  4LJ6 A;  4LFB M;  1ZMU A;  2ERC A;  3A45 A;  4MM3 B;  1HR0 M;  3Q8X A;  1NV8 A;  2F5O A;  2WSE F;  1GJT A;  4LF9 M;  4JI1 M;  1WJ7 A;  2V6Z M;  3LMM A;  1GVN A;  2VII A;  3B7Z A;  4NXM M;  1N32 M;  3KOW E;  2ZAN A;  4D82 A;  1VDL A;  3E46 A;  3U60 A;  2J7O A;  4RF0 A;  3H4M A;  2HHH M;  1V92 A;  3UK6 A;  1TH4 A;  3DA1 A;  3U6L A;  4P16 A;  4B08 A;  2CUZ A;  4LRT A;  4NOO B;  3TWK A;  2I7P A;  3SYL A;  4GHL A;  1G71 A;  3GRV A;  3R8F A;  3RGS A;  3GQ5 A;  1X37 A;  1YLA A;  2FE8 A;  2RGH A;  2ZAM A;  5EXS A;  4NRW A;  3VDU A;  3UZU A;  4FCW A;  5ITU A;  2DZO B;  2LHC A;  1JB0 F;  4DR3 M;  3KFU G;  2CHV A;  3W68 A;  3GLI B;  4DV5 M;  1N36 M;  1IXZ A;  1WIV A;  1QAQ A;  3GLH B;  3NBX X;  4Q7J A;  1QDT A;  5EP2 A;  1E9R A;  3HHW A;  1ZQ9 A;  4B3M M;  2C99 A;  7CAT A;  3MJ5 A;  3GRU A;  3THG A;  4JI2 M;  1NSF A;  3HHZ A;  1SXJ B;  3SAU A;  4DV3 M;  5KQ8 A;  4GIP A;  4UN2 B;  4R3D A;  4OVZ B;  2UXC M;  2H5X A;  1MX0 A;  5LMN M;  3MHV C;  4DV2 M;  4AZF A;  3HU1 A;  1PRB A;  2K47 A;  2XSZ A;  2JZ1 A;  3SAV A;  3LQR A;  1WGN A;  2KRU A;  4RKU F;  1VDD A;  2XZU A;  1R7R A;  4PDI A;  3VLF B;  3TE6 A;  2L4E A;  4MGK E;  3ZQJ A;  1AIP C;  2L6O A;  1QAO A;  5IT9 S;  1XXH A;  2QNJ A;  1IN5 A;  4B3S M;  4Z8X A;  2M5Z A;  3AOE A;  3UJN A;  3J7B A;  2Q2E B;  3HJS A;  3QYE A;  2BNK A;  2LBC A;  4LJ7 A;  4QHT A;  3HJQ A;  3DFZ A;  5KO3 A;  1GL6 A;  1HQC A;  2F5P A;  2O5R A;  4B3T M;  1I4W A;  1Z5B A;  3LVW A;  1E9S A;  3T15 A;  5DYG A;  3V76 A;  1KSF X;  2JWS A;  3U6P A;  2KDL A;  2HKJ A;  4I81 A;  1HNW M;  2X8A A;  4JI8 M;  1S3S A;  1GLN A;  5C1B A;  1IXS B;  4JI0 M;  4F2L A;  2LTU A;  1SXJ E;  2C9O A;  2R45 A;  3JR4 A;  4JI5 M;  4QNM A;  4EIW A;  5KPR A;  2HL7 A;  3R9X B;  3C3D A;  3J80 S;  1SXJ D;  1GAB A;  1J7K A;  3GQ4 A;  4AG6 A;  4F1I A;  3F92 A;  4FCV A;  3KSX A;  1EIJ A;  1XHB A;  2DKL A;  2C98 A;  3RGP A;  1Z5C A;  4PDG A;  4L4U A;  3SAW A;  3HJ8 A;  3U6M A;  4X62 M;  4GC5 A;  1OKS A;  1DGH B;  1N75 A;  3TQS A;  2HAK A;  2XH9 A;  4MGY E;  3KOX E;  3L28 A;  4XK8 F;  2L7I A;  4GKK M;  1HJP A;  1CUK A;  4KLN A;  1IXR C;  4IBC A;  2RKO A;  3KSJ A;  3LCV B;  3KS8 A;  1YUB A;  2DZN B;  4IBK A;  5ITY A;  2P5T A;  3IG8 A;  3AFH A;  1H6U A;  1WGL A;  2UU9 M;  2KNA A;  3W67 A;  5IZ7 D;  3FTC A;  3KOY E;  1DV0 A;  4LG2 A;  3NWL A;  2R62 A;  4JI6 M;  3HY5 A;  2J5Y A;  2ZBK B;  3GPY A;  2KZS A;  3QAU A;  4PCZ A;  1I94 M;  2MRO B;  4GEW A;  2E5L M;  2RGO A;  1V33 A;  3L29 A;  3QYB A;  3FUU A;  4YY3 M;  4PD2 A;  2EJS A;  2Y20 A;  1L2D A;  1ZV1 A;  1MU5 A;  3IHP A;  4DR5 M;  1IBM M;  4GHA A;  1OFH A;  5IRE B;  3L27 A;  2KXE A;  1QDR A;  5FTM A;  2APL A;  2R65 A;  1TF0 B;  3I4Y A;  2L2D A;  3GLG E;  2MR9 A;  3W0F A;  4OU7 A;  4A3V B;  2QBY A;  3CF6 E;  1Z59 A;  2QHO B;  4S12 A;  3GQ3 A;  3U6O A;  1TDZ A;  3U61 A;  3PNY A;  3GRY A;  3NBI A;  1L2B A;  2XGN A;  2XFS A;  3HKP A;  1XB2 B;  2LHG A;  4DV7 M;  2BWE A;  4FWH A;  1MN3 A;  1G4A E;  4GIT A;  4B7G A;  4CGY B;  1TH3 A;  2V1C A;  3AKZ A;  2DEN A;  2LXE A;  2XFT A;  1V34 A;  3B7Q A;  4X64 M;  2CHG A;  4RNA A;  2Z8Y M;  1JQJ C;  3K8Z A;  5GKN A;  1TGU A;  2OOA A;  2NQ8 C;  1E32 A;  2L7H A;  5E26 A;  2XEP A;  3KP1 E;  2VF7 A;  4AQY M;  2R6F A;  5EP4 A;  4DV0 M;  2C96 A;  4CIS A;  3GLF B;  4KHP M;  4RF1 A;  1IY1 A;  1VEK A;  1ZMW A;  3Q8G A;  2YNM D;  2V1U A;  3FYC A;  3I4V A;  5JI3 E;  2JXN A;  3SHF A;  3U6E A;  3T1Y M;  4AKI A;  3AL0 C;  2JY8 A;  4MH0 E;  2K6B A;  4D80 A;  1XC8 A;  4LGY A;  4JYA M;  2MH8 A;  2R0I A;  2CHQ A;  5KPZ A;  4LF7 M;  2JUJ A;  2Y0Q A;  3IG5 A;  2YQZ A;  2LVN C;  4LGM A;  5EJC A;  3GPX A;  1QZM A;  1C1K A;  1QVR A;  2XLJ A;  1EFU B;  2LVQ D;  2FH0 A;  3AV0 A;  4I5S A;  4LZZ A;  2WZJ A;  1Q39 A;  3FUV A;  2K9D A;  1QYR A;  3I51 A;  1QAN A;  3SHG B;  4LJ5 A;  2UUC M;  4HLQ A;  2QPA A;  4JXJ A;  1P3Q Q;  2DHR A;  1PJT A;  1UFZ A;  3LCU A;  4II7 A;  4OVZ A;  3QWL A;  4NXN M;  5FSW A;  1XMQ M;  4LJ4 A;  3FUX A;  2J7N A;  4LFC M;  1IXS A;  5C18 A;  3SAR A;  4LF8 M;  4WW0 A;  5FLX S;  3SAS A;  5FTN A;  1DO0 A;  4M0W A;  1J5E M;  4MGZ E;  3EIE A;  4PT5 A;  2QZ4 A;  2DAK A;  1MJG M;  1N33 M;  5EP3 A;  4G4N A;  1XXH B;  1NY6 A;  3GLF E;  1D2N A;  3TWM A;  4JN6 A;  3WHK A;  4IBB A;  3VK7 A;  2VQE M;  1HT1 E;  2R18 A;  2FS1 A;  1L2C A;  3CF2 A;  4NC6 A;  4L6V 6;  2AHM A;  3FRI A;  2CFO A;  3KW6 A;  2EUC A;  1KYI A;  2KNZ A;  4JI3 M;  5A2Q S;  3HHY A;  3SC3 A;  3U60 B;  4AKH A;  4FWG A;  2GNO A;  4JI7 M;  2H1R A;  2F4V M;  1A5T A;  1N78 A;  4QOZ C;  3E9S A;  2KEB A;  3SAT A;  1HNZ M;  3WHL A;  3W0L B;  3VFD A;  1R4G A;  5EQT A;  3LVV A;  2LVO C;  5EXP A;  1SXJ C;  4X65 M;  1DGB A;  8CAT A;  3LQQ A;  4R71 A;  2X49 A;  2KHH A;  1OAI A;  2JZ0 A;  4L78 A;  1IBL M;  3J7A S;  4LF5 M;  4REZ A;  1IY2 A;  1L1T A;  2ZTD A;  4P17 A;  3PVS A;  3VKG A;  4LRS A;  1QAM A;  4DV4 M;  4I8O A;  3EIH A;  1OJL A;  4G4O A;  4TUW A;  2KW0 A;  2OO9 A;  1L8Q A;  2GQF A;  1XXH E;  4LJ9 A;  1NY5 A;  2WSF F;  3SMP A;  4IBE A;  1GKI A;  2D7H A;  2L4F A;  4AKG A;  5EXX A;  2DWN A;  4M0D A;  5ITX E;  2CV1 A;  3H4J A;  4DV1 M;  3C9P A;  4QOS A;  3HWS A;  5ITX A;  2W82 A;  3K92 A;  3FUW A;  1R2Z A;  4I4L A;  3E21 A;  1R2Y A;  3M6A A;  1TR8 A;  1JR3 D;  1NO1 A;  2CWB A;  2MJ5 B;  4L16 A;  1PJQ A;  4JI4 M;  4AG5 A;  5F3W A;  2Y21 A;  2JNH A;  1T3T A;  1QUS A;  1SXJ A;  2OOB A;  2LNH C;  2N35 A;  5ITQ A;  3DZD A;  2DWL A;  1G59 A;  3B7N A;  2DAM A;  4B3R M;  4DR6 M;  2FOI C;  3U5Z B;  3SYK A;  2EKF A;  1QUT A;  4KT0 F;  4D81 A;  2KZU A;  4IJE A;  3ZCB B;  2XF3 A;  2DAE A;  4CJ6 A;  2YR0 A;  3ZH9 B;  2KRK A;  2R4J A;  3L26 A;  2Z4S A;  2JY5 A;  3GPU A;  3HHX A;  1GL7 A;  1LTM A;  3B89 A;  3SFZ A;  4OX9 M;  4HL4 A;  5KQD A;  2G3Q A;  1WXQ A;  3KXE C;  3FYD A;  4LJ8 A;  2HWJ A;  1VG5 A;  3J81 S;  4M9Z A;  1VEG A;  3K2L A;  2R46 A;  1NNJ A;  1XMO M;  1K82 A;  4DV6 M;  2LVP C;  4GMQ A;  4L15 A;  2HCB A;  3B9P A;  4LCB A;  4DR7 M;  1WR1 B;  1IN7 A;  3SMS A;  3A42 A;  1EE8 A;  4NSR A;  3GLI E;  1DGG A;  2Z4R A;  3FRH A;  2Z3X A;  3JAM S;  2C5R A;  3E4R A;  4M9S A;  1TTE A;  2LVA A;  3VDP A;  3D8L A;  1XNQ M;  1G3I A;  4G6Z A;  4BLC A;  1DGF A;  3U6S A;  4IBG A;  4MB7 A;  4BBA A;  4CHT B;  2DAG A;  4XBO A;  1Q02 A;  4FVM A;  1T6O A;  5ITR A;  1GO5 A;  3KP0 E;  4FW9 A;  4G3O A;  2CEA A;  3GLG A;  2G5G X;  1C7Y A;  1PM5 A;  2UXD M;  1QQW A;  2F5N A;  4ANR A;  3J27 B;  1ORY B;  5DYI A;  4B7F A;  4B7H A;  2UXB M;  2EKK A;  3GLF A;  1PJS A;  5IWA M;  4LY6 A;  3ZC7 B;  2FNA A;  2QQ8 A;  3KDS E;  3FKE A; 
#chains in the Genus database with same CATH homology
 4M9X A;  1L1Z A;  1E94 E;  2ZM6 M;  3RE8 A;  3VK8 A;  2Z7J A;  4NSO B;  4K0K M;  4X66 M;  3KOZ E;  1IY0 A;  1W5S A;  3FTF A;  1XNR M;  1J09 A;  4IBF A;  1R6B X;  4AW4 A;  1PJI A;  2DVW B;  1W5T A;  2F5S A;  3FTD A;  4IBD A;  5JI2 E;  5FTK A;  2CE7 A;  1DGH A;  2DWM A;  2LH0 A;  4YHH M;  4W5W A;  2LWX A;  4MGH A;  3BOS A;  1TDH A;  4OW0 A;  1HNX M;  3CF0 A;  3D8B A;  3AOG A;  2JA2 A;  4GH9 A;  2QBY B;  1FNN A;  1YE9 A;  1Z5A A;  5DNY A;  3GPP A;  1K3W A;  4WUR A;  4NRV A;  3JR5 A;  3MK6 A;  1NVM A;  5E6J A;  5EXT A;  5LMU M;  3AJI B;  4IIW A;  2Y0T A;  4G4Q A;  3M7G A;  4GKJ M;  3U6Q A;  3K1J A;  3KS4 A;  2EA0 A;  2UUA M;  3M0E A;  3FD9 A;  2QCU A;  2QP9 X;  1YSY A;  4DR2 M;  1Q3B A;  3HU2 A;  3TPZ A;  3VKH A;  2KA6 B;  3PNV A;  1IN8 A;  2OPF A;  3ILK A;  2XZF A;  3HGI A;  4JV5 M;  4LZJ A;  2XSZ D;  3PFI A;  2CV2 A;  4NL4 H;  1TH2 A;  2D7G A;  5H37 D;  2I7N A;  2A5Y B;  2FFJ A;  3RFW A;  2QEN A;  4Z6Y A;  3UMM A;  2F5Q A;  3U6C A;  1IM2 A;  3PXG A;  4ITQ A;  1N34 M;  1KFV A;  1JR3 A;  4IBI A;  2D7E A;  4IJF A;  4QHS A;  3C58 A;  1Q3C A;  2X4A A;  2DXI A;  5FTJ A;  3L2A A;  5BR8 M;  4L8R C;  4FWD A;  4DUZ M;  1IBK M;  1HT2 E;  1N77 A;  2L09 A;  2BJV A;  3HU3 A;  3GLG B;  1NJG A;  4GC9 A;  1Z6T A;  4FD2 A;  4LF6 M;  4G4R A;  4DR4 M;  3DOA A;  1UM8 A;  3GLH A;  3SBJ A;  1HQY E;  1NNU C;  1IN4 A;  4R7G A;  3GRR A;  3FTE A;  2C9C A;  2BJW A;  3U61 B;  3U5Z A;  2M60 A;  4LF4 M;  3A46 A;  2UUB M;  1NHW C;  2R4E A;  1G8P A;  4XGI A;  3TL4 X;  3UGJ A;  3TWL A;  5ITT A;  5FTL A;  1FJG M;  1LV7 A;  1DO2 A;  4ZPX A;  2YFQ A;  3OTO M;  1IQP A;  1K3X A;  3U6D A;  1NJF A;  3AOE C;  4KO8 A;  1NHG C;  3FUT A;  4AI6 A;  4IBJ A;  3L25 A;  5BPV A;  2EO2 A;  3GO8 A;  1G41 A;  2ZAO A;  3A98 B;  4QNR A;  1OFI A;  3T38 A;  4MGI E;  3KVW A;  4KOD A;  3J2P B;  5KPT A;  1PJJ A;  2G8L A;  2OQ4 A;  4LFA M;  4LJA A;  3GP1 A;  1ZAE A;  2VQF M;  4DUY M;  2CV0 A;  3T1H M;  1XWI A;  2DWZ B;  5EP1 A;  4DR1 M;  1IN6 A;  4FCT A;  3GLI A;  3R8F A;  4BB9 A;  3CTW B;  4LFB M;  4GRI A;  4LJ6 A;  2ERC A;  3A45 A;  4MM3 B;  1HR0 M;  3Q8X A;  2F5O A;  4LF9 M;  4JI1 M;  2V6Z M;  3LMM A;  1GVN A;  2VII A;  4NXM M;  1N32 M;  3KOW E;  2ZAN A;  4D82 A;  3U60 A;  2J7O A;  4RF0 A;  3H4M A;  2HHH M;  3UK6 A;  1TH4 A;  3DA1 A;  3U6L A;  4P16 A;  4B08 A;  2CUZ A;  4LRT A;  4NOO B;  3TWK A;  2I7P A;  3SYL A;  4GHL A;  3GRV A;  3RGS A;  3GQ5 A;  1X37 A;  2FE8 A;  2RGH A;  2ZAM A;  5EXS A;  4NRW A;  3VDU A;  3UZU A;  4FCW A;  5ITU A;  2DZO B;  4DR3 M;  3KFU G;  2CHV A;  3GLI B;  4DV5 M;  1N36 M;  1IXZ A;  5EP2 A;  1QAQ A;  3GLH B;  1E9R A;  3HHW A;  1ZQ9 A;  4B3M M;  2C99 A;  7CAT A;  3MJ5 A;  3GRU A;  3THG A;  4JI2 M;  1NSF A;  3HHZ A;  1SXJ B;  3SAU A;  4DV3 M;  5KQ8 A;  4GIP A;  4R3D A;  4OVZ B;  2UXC M;  1MX0 A;  5LMN M;  3MHV C;  4DV2 M;  4AZF A;  3HU1 A;  2K47 A;  2XSZ A;  3SAV A;  3LQR A;  2KRU A;  2XZU A;  1VDD A;  1R7R A;  4PDI A;  3VLF B;  3TE6 A;  4MGK E;  2L6O A;  1QAO A;  5IT9 S;  1XXH A;  1IN5 A;  4B3S M;  4Z8X A;  2M5Z A;  3AOE A;  3UJN A;  3J7B A;  2Q2E B;  3HJS A;  4LJ7 A;  2BNK A;  4QHT A;  3HJQ A;  3DFZ A;  5KO3 A;  1GL6 A;  1HQC A;  2F5P A;  2O5R A;  4B3T M;  1I4W A;  1Z5B A;  3LVW A;  1E9S A;  3T15 A;  5DYG A;  1KSF X;  3U6P A;  2HKJ A;  4I81 A;  1HNW M;  2X8A A;  4JI8 M;  1S3S A;  1GLN A;  5C1B A;  1IXS B;  4JI0 M;  2R45 A;  1SXJ E;  2C9O A;  3JR4 A;  4JI5 M;  4QNM A;  4EIW A;  5KPR A;  2HL7 A;  3R9X B;  3J80 S;  1SXJ D;  1J7K A;  3GQ4 A;  4AG6 A;  4FCV A;  3KSX A;  1XHB A;  3RGP A;  2C98 A;  1Z5C A;  4PDG A;  4L4U A;  3SAW A;  3HJ8 A;  3U6M A;  4X62 M;  4GC5 A;  1DGH B;  1N75 A;  3TQS A;  4MGY E;  2XH9 A;  4GKK M;  3KOX E;  3L28 A;  2L7I A;  4KLN A;  1IXR C;  4IBC A;  2RKO A;  3KSJ A;  3KS8 A;  2DZN B;  4IBK A;  5ITY A;  2P5T A;  3IG8 A;  3AFH A;  1H6U A;  2UU9 M;  5IZ7 D;  3FTC A;  3KOY E;  4LG2 A;  3NWL A;  2R62 A;  4JI6 M;  2ZBK B;  3GPY A;  2KZS A;  3QAU A;  4PCZ A;  1I94 M;  2E5L M;  2RGO A;  3L29 A;  3FUU A;  4YY3 M;  4PD2 A;  2Y20 A;  1L2D A;  4DR5 M;  1MU5 A;  1IBM M;  4GHA A;  1OFH A;  5IRE B;  3L27 A;  2KXE A;  5FTM A;  2R65 A;  3I4Y A;  4OU7 A;  3W0F A;  4A3V B;  2QBY A;  3CF6 E;  1Z59 A;  4S12 A;  3GQ3 A;  3U6O A;  1TDZ A;  3U61 A;  3PNY A;  3GRY A;  3NBI A;  1L2B A;  2XGN A;  2XFS A;  3HKP A;  4DV7 M;  4FWH A;  4GIT A;  4B7G A;  1G4A E;  3AKZ A;  4CGY B;  1TH3 A;  2V1C A;  2LXE A;  2XFT A;  4X64 M;  2CHG A;  4RNA A;  3K8Z A;  1JQJ C;  5GKN A;  1TGU A;  2NQ8 C;  1E32 A;  2L7H A;  5E26 A;  2XEP A;  3KP1 E;  4AQY M;  5EP4 A;  4DV0 M;  2C96 A;  4CIS A;  3GLF B;  4KHP M;  4RF1 A;  1IY1 A;  2V1U A;  2YNM D;  3FYC A;  3I4V A;  5JI3 E;  3SHF A;  3U6E A;  3T1Y M;  4AKI A;  3AL0 C;  4MH0 E;  4D80 A;  1XC8 A;  4LGY A;  4JYA M;  5KPZ A;  2CHQ A;  4LF7 M;  2Y0Q A;  3IG5 A;  2YQZ A;  4LGM A;  5EJC A;  3GPX A;  1QZM A;  1C1K A;  1QVR A;  2XLJ A;  3AV0 A;  4I5S A;  4LZZ A;  3FUV A;  1Q39 A;  3SHG B;  3I51 A;  1QYR A;  1QAN A;  2UUC M;  4LJ5 A;  4HLQ A;  2QPA A;  4JXJ A;  2DHR A;  4II7 A;  4OVZ A;  3QWL A;  4NXN M;  5FSW A;  1XMQ M;  4LJ4 A;  3FUX A;  2J7N A;  4LFC M;  5C18 A;  4LF8 M;  3SAR A;  4WW0 A;  5FLX S;  3SAS A;  5FTN A;  1DO0 A;  4M0W A;  1J5E M;  4MGZ E;  3EIE A;  4PT5 A;  2QZ4 A;  1N33 M;  5EP3 A;  4G4N A;  1XXH B;  1NY6 A;  3TWM A;  1D2N A;  4JN6 A;  3WHK A;  4IBB A;  3VK7 A;  2VQE M;  1HT1 E;  2R18 A;  1L2C A;  3CF2 A;  2AHM A;  2CFO A;  3KW6 A;  2EUC A;  1KYI A;  4JI3 M;  5A2Q S;  3HHY A;  3SC3 A;  3U60 B;  4AKH A;  4FWG A;  2F4V M;  4JI7 M;  2H1R A;  1N78 A;  4QOZ C;  3E9S A;  2KEB A;  3SAT A;  1HNZ M;  3WHL A;  3W0L B;  3VFD A;  5EQT A;  3LVV A;  5EXP A;  1SXJ C;  4X65 M;  1DGB A;  8CAT A;  3LQQ A;  2X49 A;  1IBL M;  4L78 A;  3J7A S;  4LF5 M;  4REZ A;  1IY2 A;  1L1T A;  3PVS A;  3VKG A;  4LRS A;  1QAM A;  4DV4 M;  4I8O A;  3EIH A;  1OJL A;  4G4O A;  4TUW A;  2KW0 A;  1L8Q A;  4LJ9 A;  1NY5 A;  3SMP A;  4IBE A;  1GKI A;  2D7H A;  4AKG A;  5EXX A;  2DWN A;  4M0D A;  5ITX E;  2CV1 A;  4DV1 M;  4QOS A;  3HWS A;  5ITX A;  2W82 A;  3K92 A;  3FUW A;  1R2Z A;  4I4L A;  1R2Y A;  3M6A A;  1JR3 D;  4L16 A;  4JI4 M;  4AG5 A;  5F3W A;  2Y21 A;  1T3T A;  1SXJ A;  5ITQ A;  2LNH C;  3DZD A;  2DWL A;  1G59 A;  4B3R M;  4DR6 M;  2FOI C;  3U5Z B;  3SYK A;  4D81 A;  2KZU A;  4IJE A;  3ZCB B;  2XF3 A;  2YR0 A;  3ZH9 B;  2KRK A;  2R4J A;  3L26 A;  2Z4S A;  3GPU A;  3HHX A;  1GL7 A;  3SFZ A;  4OX9 M;  4HL4 A;  5KQD A;  1WXQ A;  3KXE C;  3FYD A;  4LJ8 A;  3J81 S;  4M9Z A;  3K2L A;  1NNJ A;  2R46 A;  1XMO M;  1K82 A;  4DV6 M;  4GMQ A;  4L15 A;  2HCB A;  3B9P A;  4LCB A;  4DR7 M;  1IN7 A;  3SMS A;  3A42 A;  1EE8 A;  4NSR A;  1DGG A;  2Z4R A;  2Z3X A;  3JAM S;  2C5R A;  3E4R A;  4M9S A;  3VDP A;  3D8L A;  1XNQ M;  1G3I A;  4G6Z A;  4BLC A;  1DGF A;  3U6S A;  4IBG A;  4MB7 A;  4BBA A;  4CHT B;  4XBO A;  4FVM A;  5ITR A;  3KP0 E;  4FW9 A;  2CEA A;  3GLG A;  2G5G X;  2UXD M;  1PM5 A;  1QQW A;  2F5N A;  3J27 B;  1ORY B;  5DYI A;  4B7F A;  4B7H A;  2UXB M;  3GLF A;  5IWA M;  4LY6 A;  3ZC7 B;  2FNA A;  1YUB A;  3KDS E;  3FKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...