4LF4M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf4M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf4M02
3GQ3A 5ITXE 4B3SM 3JAMS 3A42A 4CISA 3SAUA 2HKJA 3W0FA 4ITQA 3SAVA 1TDZA 4LF6M 3GPPA 4LFBM 1MX0A 4B3TM 1IBKM 4LFCM 1TDHA 1N34M 5IWAM 1N36M 1N33M 4DR5M 4NXNM 4JI1M 4JI5M 4LF7M 1Z5BA 1PM5A 3SARA 5LMNM 5LMUM 2ZBKB 3J7AS 1HNXM 1IBMM 1XMQM 1R2ZA 1IBLM 2UUAM 4NRWA 3C58A 3U6MA 3U6PA 2VQFM 4GKKM 4NRVA 4K0KM 1PJIA 4B3RM 3T1HM 2EA0A 4LF9M 4JYAM 5ITQA 3GP1A 4B3MM 1KFVA 4KHPM 1EE8A 4DR6M 4DR7M 4DV1M 5A2QS 5IT9S 4DR4M 4G4OA 4PDGA 3GO8A 3TWLA 4DV5M 4DUYM 2UXBM 3J81S 5ITRA 5ITYA 3SASA 4JI2M 4DV2M 1L2BA 2VQEM 1HNZM 5ITXA 3U6SA 1PJJA 2UXCM 4DV4M 1HR0M 2F5NA 3GQ5A 3JR4A 1L2DA 1L2CA 1XNQM 4LF5M 4JI3M 3U6OA 1L1TA 3OTOM 1Q3CA 4DUZM 3GPYA 1HNWM 4GKJM 4X66M 1Z5AA 2XZFA 4PDIA 2UU9M 3J80S 3VK8A 4YY3M 4YHHM 2Q2EB 4PCZA 2UUCM 1K3XA 3U6EA 3U6CA 1R2YA 3U6QA 1L1ZA 4MB7A 5ITTA 1Q39A 5FLXS 1Z59A 3SATA 4DR2M 3U6LA 2F4VM 4DV0M 2F5QA 4JI7M 4NXMM 4DV7M 4LF8M 3JR5A 3A46A 4DR3M 3GPXA 1J5EM 3A45A 4DV3M 1Q3BA 2XZUA 4DR1M 3VK7A 1MU5A 1Z5CA 2HHHM 4JI6M 4OX9M 2OPFA 1K3WA 2E5LM 2UUBM 3DOAA 4G4NA 3T1YM 3SAWA 3SBJA 1FJGM 1XC8A 5BR8M 4G4RA 1XNRM 2ZM6M 4DV6M 1I94M 2F5PA 4X65M 4JV5M 4LFAM 3GPUA 2OQ4A 2F5OA 2UXDM 4PD2A 4AQYM 1XMOM 4JI0M 4X64M 2F5SA 1N32M 1NNJA 1K82A 4X62M 3U6DA 5ITUA 4JI4M 3TWMA 3TWKA 4G4QA 4JI8M 4LF4M 3GQ4A
chains in the Genus database with same CATH superfamily
2DAMA 4B3SM 1OFIA 2XFTA 4AKGA 2K6BA 3A42A 3ZCBB 2KNZA 3PVSA 4LF6M 1MX0A 4M0DA 4B3TM 4HEOA 1TDHA 3KW6A 4IBGA 4I8OA 1N36M 4S12A 3SMPA 1OTRA 3PNVA 2WSFF 2DZLA 1PRBA 5EQTA 2KHHA 3CF0A 2X8AA 4EIWA 4RKUF 3UK6A 4JI1M 1PM5A 2KA6B 1GJTA 3GLGE 5KPZA 2W82A 2M5ZA 4MGIE 2FOIC 5C1BA 2J7OA 2H5XA 4KT0F 1GABA 3C9PA 2N35A 2UUAM 3AKZA 3H4MA 3K2LA 2QHOB 3B9PA 3GLHE 4G6ZA 4GC5A 2DAGA 2VF8A 2JNHA 3FUTA 4BBAA 3FRIA 1PJIA 4IBEA 4LZZA 4LF9M 2GQFA 1KFVA 1XB2B 2Y0QA 4DR7M 1S3SA 1TTEA 4DV1M 5A2QS 5IT9S 2VIIA 4GHLA 4DR4M 4WP2A 4G4OA 4XBOA 1QZMA 3TWLA 3Q8GA 3FYDA 2UXBM 4IBJA 1XHBA 4AI6A 1Z6TA 2MR9A 1TH4A 1NVMA 3GLFB 1YE9A 2CFOA 3D8LA 1HNZM 4FWGA 1WGLA 2FE8A 2R62A 3U5ZB 4AKHA 4AG6A 1HR0M 3M6AA 2CUZA 1XNQM 2JZ0A 4LGMA 4NC6A 1Q3CA 1JR3D 4QHSA 1QANA 2ZTCA 2KNAA 2R46A 4OVZB 2XF3A 3H4JA 3VK8A 4RF0A 4YHHM 2BWBA 1D0KA 5KQDA 1MN3A 2BWEA 4GIPA 3WHKA 2QNJA 1PGYA 3U5ZA 4QNRA 1Q39A 1IN4A 1ZMWA 2C9OA 1DGHB 2KRUA 2ZAMA 3C3EA 3EIHA 4F1IA 3U6LA 4KLNA 2DAIA 4B7FA 1OKSA 2BJWA 5E26A 3L28A 4DV7M 2QBYB 2KEBA 4I5SA 4LF8M 2HWJA 2XSZD 1IN5A 2C9CA 2HCBA 4L78A 5KPRA 3GPXA 2AHMA 3SYLA 2XZUA 3LCUA 4LY6A 2KXEA 4KO8A 4DR1M 3VK7A 1IFYA 3ILKA 3J2PB 2JUJA 4QOZC 1IXZA 3E9SA 2D7HA 5EJCA 2UUBM 2KZUA 1DGHA 3SAWA 3D8BA 3I04M 1V33A 2DWMA 4LRTA 4R3DA 1FJGM 4P16A 3TL4X 4G4RA 2QBYA 1XNRM 1ZV1A 2ZM6M 2C5RA 3VLFB 2OO9A 3M0EA 4RF1A 1F4IA 1R6BX 1IQPA 2DKLA 2O25A 1NSFA 1IY0A 2WSCF 4PD2A 1N32M 2H1RA 2XGNA 3HJ8A 3NBIA 2RKOA 4G3OA 5DFLA 3U6DA 4NOOB 1J09A 1QAOA 4MM3B 4JI4M 2MJ5B 4IBCA 1VDDA 1WR1B 4LF4M 1WJ7A 3U60A 2QPAA 3JAMS 2WSEF 4L4UA 1UM8A 3PFIA 2CV0A 2DI0A 3MJ5A 4CISA 2HKJA 3GRVA 3A98B 1T3TA 1LTMA 3I4YA 3VKHA 2MROB 1DO0A 1N34M 3QAUA 4FWHA 2QZ4A 1C7YA 3B7NA 2C98A 4MGHA 3SMSA 1HT2E 1XXHB 2LXEA 1LV7A 2JXNA 3KVWA 5EP4A 1QDRA 3GLFE 1N77A 3J7AS 4Z8XA 1HNXM 1DGGA 1IBMM 1WHCA 1V34A 1XMQM 2K9DA 1MJGM 2Z7JA 2I7NA 3QYEA 4M9SA 3C58A 3I01M 1OFHA 4IBFA 2I7PA 5FTNA 2VQFM 3W67A 4K0KM 2DHYA 5IZ7D 3UMMA 1YLAA 3AJIB 3DZDA 3GP1A 4NL4H 1X37A 4B3MM 1WXQA 3GLIB 1EE8A 1XXHA 1C1KA 3HJSA 5F3WA 4DR6M 3QWLA 3UZUA 4IJEA 1D0LA 4XK8F 3VDPA 3IHPA 3IG8A 3GO8A 3L25A 1VQ1A 4DV5M 3UGJA 2L6OA 5ITRA 3SASA 3FTEA 3TPZA 3SFZA 3SHFA 2O01F 3W0LB 4II7A 1JB0F 3U6SA 1QUSA 2LNHC 3EIEA 3FUXA 3MK6A 3QYBA 4LG2A 3FUVA 2F5NA 3JR4A 1L2DA 4LF5M 3KS4A 3GRYA 4D80A 4GC9A 1FNNA 3GLIA 1GJSA 1T43A 3HX3A 3IG5A 4AW4A 1QQWA 4Z6YA 3HGIA 3WHLA 5EP1A 2CV2A 2DXIA 1CUKA 1OJLA 2DAKA 2OOAA 2WZJA 3L27A 4I4LA 5H37D 4KODA 4LJ8A 2J5YA 5FTJA 4OU7A 3U6CA 4MB7A 5ITTA 2L4FA 5FLXS 3SATA 3HKPA 1N75A 4DR2M 2F4VM 3HHWA 2DENA 2K47A 4IBBA 1J7KA 2L2DA 4DBGB 1OAOC 1YSYA 1GLNA 5BPVA 3KOWE 1QVRA 4LJ9A 3K8ZA 5EP3A 2D7GA 1L8QA 1QYRA 1QZEA 3DFZA 3VDUA 4IJFA 2X4AA 1MU5A 1P3QQ 3I4VA 2LVPC 4NSOB 4R7GA 3KFUG 3FD9A 3NWLA 4D82A 3L26A 4JI6M 4B7HA 3L29A 1QAQA 3M7GA 2OPFA 4OX9M 1N78A 2E5LM 4HL4A 3DOAA 3T1YM 1GKIA 2LVQD 3FRHA 1ZMVA 1IXSA 4ANRA 2Z3XA 3KS8A 1QDTA 1IM2A 4DV6M 1NHWC 3SHGB 3B74A 1I94M 3UJNA 3AOGA 3KXEC 3LCVB 1JR3A 1VDLA 2DZOB 4LJ6A 4FD2A 1G59A 4ZPXA 3LMMA 2LVAA 3K9PA 3B7QA 2VF7A 2OQ4A 1XMOM 4JI0M 3HHZA 3FE3A 1K82A 2BJVA 2RGHA 2ERCA 3TWKA 4JI8M 4IIWA 2L7IA 4NSRA 2KZSA 1A5TA 4GEWA 5EXTA 3HHYA 3GQ3A 7CATA 1VG5A 2LHCA 2XEPA 4LRSA 4M9ZA 1QAMA 1R5LA 2R4EA 4L16A 3W0FA 4ITQA 1R7RA 1TDZA 3VFDA 2DWNA 2R4JA 3FTFA 4LFBM 1DGBA 4F2LA 3U60B 1WIVA 4LZJA 1N33M 2LWXA 4RNAA 3KOYE 3B89A 1E94E 1SG9A 4NXNM 1AIPC 5FTMA 3GLGB 4LF7M 1Z5BA 3MMPA 3NBXX 2VDBB 4JXJA 3SARA 3LVVA 2YQZA 5LMUM 2ZBKB 2DAEA 2EO2A 4FVMA 4HLQA 2KRKA 1R2ZA 2NQ8C 1IBLM 4LJ7A 2B3TA 1G71A 4GMQA 2EUCA 1UFZA 3CF2A 2DVWB 4GKKM 1DV0A 4NRVA 2R0IA 3V76A 2A5YB 3GRRA 4WW0A 4BB9A 2LVOC 5ITQA 2X49A 2DWLA 3FUUA 1SXJB 2JA2A 5EXXA 4BLCA 1Q02A 3SC3A 1G8PA 3GLGA 4TUWA 2JY6B 1GL6A 2QCUA 4QOSA 4PDGA 3HU1A 3HWSA 1IN7A 1EFUB 5ITYA 3ZC7B 4JI2M 2LVNC 3ZH9B 4LJAA 4DV2M 4OW0A 2VQEM 1IN8A 3AL0C 5ITXA 1SXJC 2KDLA 3BBZA 1HT1E 4DV4M 1PJJA 1D0MA 4L8RC 1OIZA 3KSXA 3GQ5A 3GRUA 3KSJA 4FW9A 1L1TA 2HAKA 4IBIA 1SXJA 4MGZE 2CP8A 2QQ8A 3HHXA 1NNUC 2CWBA 4M9XA 3GPYA 1HNWM 4X66M 2UU9M 3J80S 2EKKA 1EIJA 2Z4RA 2DWZB 3AOEC 1W5TA 4AG5A 4FCWA 2L7HA 1Y8GA 4QHTA 4A3VB 4Q7JA 3J7BA 1QUTA 4PCZA 1OQYA 1K3XA 3U6EA 1TF0B 2FFJA 3AOEA 3U6QA 4GH9A 2Z8YM 3TE6A 2EKFA 2XFSA 3KOXE 2CHQA 5GKNA 5DNYA 2MH8A 4DV0M 2F5QA 2O5RA 4JI7M 2BNKA 1BVSA 2V1UA 4NXMM 1TGUA 4R71A 1DGFA 1V92A 3A46A 4DR3M 1IXRC 2R65A 2YFQA 4REZA 2G3QA 4DV3M 1NY5A 4GRIA 1TH2A 2CRUA 5KO3A 1G3IA 1Z5CA 4L15A 1ZAEA 2Y0TA 3C3DA 3KP1E 4XGIA 1K3WA 5DYIA 3RGPA 4B7GA 3MHVC 1VEKA 3LQQA 4G4NA 2KW0A 3SBJA 5C18A 2P5TA 2LTUA 5BR8M 3L2AA 1HQCA 2JY8A 2DHRA 4B08A 4CGYB 2F5PA 3R9XB 1ZQ9A 4JV5M 3GPUA 2OOBA 2F5OA 1IXSB 1NJGA 3FTDA 4AQYM 1RU3A 4UN2B 1NHGC 1OAIA 1VEGA 4JN6A 3R8FA 2MGWA 3RFWA 2Y20A 4CIZA 4WURA 2J7NA 3GQ4A 4QNMA 2XLJA 5FTLA 3HU3A 5ITXE 3KP0E 1G4AE 3SYKA 1IN6A 1KSFX 4MH0E 1DO2A 4W5WA 3SAUA 1I4WA 5DYGA 5JI3E 2ZANA 3SAVA 2FNAA 1SXJE 3GPPA 2DZNB 3E4RA 2C99A 2G8LA 2R44A 3E21A 1IBKM 4LFCM 5E6JA 1OIPA 2JY7A 3HY5A 1NJFA 5IWAM 4DR5M 4LJ4A 2QENA 3K92A 2RRUA 3AV0A 1TR8A 1WGNA 1IY1A 4JI5M 1AUAA 3FKEA 2V6ZM 1XXHE 3BOSA 1YUBA 3RGSA 5LMNM 3K9OA 3CGWA 3HU2A 3B7ZA 4D81A 4NRWA 2D7EA 2ZAOA 2FS1A 2L09A 3U6MA 3U6PA 2CHGA 3LW5F 2QSFX 2FH0A 2JY5A 5JI2E 2JZ1A 1ZMUA 1KYIA 2APLA 5IREB 1E9SA 3T1HM 3U61B 2EA0A 4B3RM 3PXGA 4MGKE 4JYAM 5L8RF 3THGA 2LH0A 4KHPM 4IBDA 3K1JA 3GLFA 3E46A 2RGOA 3T6PA 4M0WA 3GLIE 2CV1A 2LHGA 4CHTB 3T15A 5FTKA 3VKGA 1T6OA 4DUYM 1R4GA 3J81S 2R6FA 2XSZA 1ORYB 1L2BA 2CE7A 2UXCM 1E9RA 1GO5A 5FSWA 1TH3A 2EJSA 3AFHA 4FCTA 4OVZA 2HL7A 2JWSA 5KPTA 3U61A 4PT5A 1L2CA 4JI3M 3U6OA 3OTOM 3GLHB 3W68A 4DUZM 1VEJA 2CHVA 4GKJM 1D2NA 4Y28F 1HJPA 1Z5AA 1IY2A 2V1CA 3HZJA 4P17A 4PDIA 2XZFA 4MGYE 4YY3M 2Q2EB 3FTCA 4LGYA 2CEAA 2L4EA 2R18A 3KOZE 1PJTA 3PNYA 5EXSA 1HQYE 2UUCM 5EXPA 1G41A 1PJSA 1R2YA 1JQJC 4AZFA 2G5GX 3LQRA 3KDSE 1L1ZA 3IECA 4GHAA 1Z59A 3CF6E 3DA1A 3I51A 4FCVA 3TQSA 3LVWA 4L6V6 2GNOA 1E32A 3T38A 3GLHA 2K0BX 1XWIA 2QP9X 2XH9A 2LBCA 3FYCA 1PJQA 3FUWA 3JR5A 2KNVA 3CTWB 1J5EM 1H6UA 2YR0A 3A45A 4AKIA 2Y21A 1Q3BA 1JR3E 1GVNA 1NO1A 2HHHM 2JP7A 4IBKA 2YNMD 8CATA 5EP2A 3J27B 3HJQA 1SXJD 2C96A 1NV9A 1NV8A 4CJ6A 2DNAA 1NY6A 3RE8A 1XC8A 4GITA 1GL7A 2R45A 4FWDA 5KQ8A 3BXWA 3Q8XA 4X65M 2Z4SA 4LFAM 2UXDM 4LJ5A 3F92A 2F5SA 4X64M 2ZTDA 4I81A 1NNJA 4LCBA 4X62M 1W5SA 5ITUA 3ZQJA 3TWMA 4G4QA 2M60A
chains in the Genus database with same CATH topology
4B3SM 1OFIA 2XFTA 4AKGA 3A42A 3ZCBB 3PVSA 4LF6M 1MX0A 4M0DA 4B3TM 1TDHA 3KW6A 4IBGA 4I8OA 1N36M 4S12A 3SMPA 3PNVA 4EIWA 5EQTA 3CF0A 2X8AA 3UK6A 4JI1M 1PM5A 2KA6B 5KPZA 2W82A 2M5ZA 4MGIE 2FOIC 5C1BA 2J7OA 2UUAM 3AKZA 3H4MA 3K2LA 3B9PA 4G6ZA 4GC5A 3FUTA 4BBAA 1PJIA 4IBEA 4LZZA 4LF9M 1KFVA 2Y0QA 4DR7M 1S3SA 4DV1M 5A2QS 5IT9S 2VIIA 4GHLA 4DR4M 4G4OA 4XBOA 1QZMA 3TWLA 2UXBM 3FYDA 4IBJA 1XHBA 4AI6A 1Z6TA 1TH4A 1NVMA 3GLFB 1YE9A 2CFOA 3D8LA 1HNZM 4FWGA 2FE8A 2R62A 3U5ZB 4AKHA 4AG6A 1HR0M 3M6AA 2CUZA 1XNQM 4LGMA 1Q3CA 1JR3D 4QHSA 1QANA 2R46A 4OVZB 2XF3A 3VK8A 4RF0A 4YHHM 5KQDA 4GIPA 3WHKA 3U5ZA 4QNRA 1Q39A 1IN4A 2KRUA 2C9OA 1DGHB 2ZAMA 3EIHA 3U6LA 4KLNA 4B7FA 2BJWA 5E26A 3L28A 4DV7M 2QBYB 2KEBA 4I5SA 4LF8M 2XSZD 1IN5A 2C9CA 2HCBA 4L78A 5KPRA 3GPXA 2AHMA 3SYLA 2XZUA 4LY6A 2KXEA 4KO8A 4DR1M 3VK7A 3ILKA 3J2PB 4QOZC 1IXZA 3E9SA 2D7HA 5EJCA 2UUBM 2KZUA 1DGHA 3SAWA 3D8BA 2DWMA 4LRTA 4R3DA 1FJGM 4P16A 3TL4X 4G4RA 2QBYA 1XNRM 2ZM6M 2C5RA 3VLFB 3M0EA 4RF1A 1R6BX 1IQPA 1NSFA 1IY0A 4PD2A 1N32M 2H1RA 2XGNA 3HJ8A 3NBIA 2RKOA 3U6DA 4NOOB 1J09A 1QAOA 4MM3B 4JI4M 4IBCA 1VDDA 4LF4M 3U60A 2QPAA 3JAMS 4L4UA 1UM8A 3PFIA 2CV0A 4CISA 3MJ5A 2HKJA 3GRVA 3A98B 1T3TA 3I4YA 3VKHA 1DO0A 1N34M 3QAUA 4FWHA 2QZ4A 2C98A 4MGHA 3SMSA 1HT2E 1XXHB 2LXEA 1LV7A 3KVWA 5EP4A 1N77A 3J7AS 4Z8XA 1HNXM 1DGGA 1IBMM 1XMQM 2Z7JA 2I7NA 4M9SA 3C58A 1OFHA 4IBFA 2I7PA 5FTNA 2VQFM 4K0KM 5IZ7D 3UMMA 3AJIB 3DZDA 3GP1A 4NL4H 1X37A 4B3MM 1WXQA 3GLIB 1EE8A 1XXHA 1C1KA 3HJSA 5F3WA 4DR6M 3QWLA 3UZUA 4IJEA 3VDPA 3IG8A 3GO8A 3L25A 4DV5M 3UGJA 2L6OA 5ITRA 3SASA 3FTEA 3TPZA 3SFZA 3SHFA 3W0LB 4II7A 3U6SA 3MK6A 2LNHC 3EIEA 3FUXA 4LG2A 3FUVA 2F5NA 3JR4A 1L2DA 4LF5M 3KS4A 3GRYA 4D80A 4GC9A 1FNNA 3GLIA 3IG5A 4AW4A 1QQWA 4Z6YA 3HGIA 3WHLA 5EP1A 2CV2A 2DXIA 1OJLA 3L27A 4I4LA 5H37D 4KODA 4LJ8A 5FTJA 4OU7A 3U6CA 4MB7A 5ITTA 5FLXS 3SATA 3HKPA 1N75A 4DR2M 2F4VM 3HHWA 2K47A 4IBBA 1J7KA 1YSYA 1GLNA 5BPVA 3KOWE 1QVRA 4LJ9A 3K8ZA 5EP3A 2D7GA 1L8QA 1QYRA 3DFZA 3VDUA 4IJFA 2X4AA 1MU5A 3I4VA 4NSOB 4R7GA 3KFUG 3FD9A 3NWLA 4D82A 3L26A 4JI6M 4B7HA 3L29A 1QAQA 3M7GA 2OPFA 4OX9M 1N78A 2E5LM 4HL4A 3DOAA 3T1YM 1GKIA 2Z3XA 3KS8A 1IM2A 4DV6M 1NHWC 3SHGB 1I94M 3UJNA 3AOGA 3KXEC 1JR3A 2DZOB 2CV1A 4LJ6A 4FD2A 1G59A 4ZPXA 3LMMA 2OQ4A 1XMOM 4JI0M 3HHZA 1K82A 2BJVA 2RGHA 2ERCA 3TWKA 4JI8M 4IIWA 2L7IA 4NSRA 2KZSA 3HHYA 5EXTA 3GQ3A 7CATA 2XEPA 4LRSA 4M9ZA 1QAMA 2R4EA 4L16A 3W0FA 4ITQA 1R7RA 1TDZA 3VFDA 2DWNA 2R4JA 3FTFA 4LFBM 1DGBA 3U60B 4LZJA 1N33M 2LWXA 4RNAA 3KOYE 1E94E 4NXNM 5FTMA 3GLGB 4LF7M 1Z5BA 4JXJA 3SARA 3LVVA 2YQZA 5LMUM 2ZBKB 2EO2A 4FVMA 4HLQA 1R2ZA 2KRKA 1IBLM 2NQ8C 4LJ7A 4GMQA 2EUCA 3CF2A 2DVWB 4GKKM 4NRVA 2A5YB 3GRRA 4WW0A 4BB9A 5ITQA 2X49A 2DWLA 3FUUA 1SXJB 2JA2A 5EXXA 4BLCA 3SC3A 1G8PA 3GLGA 4TUWA 1GL6A 2QCUA 4QOSA 4PDGA 3HU1A 3HWSA 1IN7A 5ITYA 3ZC7B 4JI2M 3ZH9B 4LJAA 4DV2M 4OW0A 2VQEM 1IN8A 3AL0C 5ITXA 1SXJC 1PJJA 1HT1E 4DV4M 4L8RC 3KSXA 3GQ5A 3GRUA 3KSJA 4FW9A 1L1TA 4IBIA 1SXJA 4MGZE 3HHXA 1NNUC 3GPYA 4M9XA 1HNWM 4X66M 2UU9M 3J80S 2Z4RA 2DWZB 3AOEC 1W5TA 4AG5A 4FCWA 2L7HA 4QHTA 4A3VB 3J7BA 4PCZA 1K3XA 3U6EA 2FFJA 3AOEA 3U6QA 4GH9A 3TE6A 2XFSA 3KOXE 2CHQA 5GKNA 5DNYA 4DV0M 2F5QA 2O5RA 4JI7M 2BNKA 2V1UA 4NXMM 1TGUA 1DGFA 3A46A 4DR3M 1IXRC 2R65A 2YFQA 4REZA 4DV3M 1NY5A 4GRIA 1TH2A 5KO3A 1G3IA 1Z5CA 4L15A 1ZAEA 2Y0TA 3KP1E 4XGIA 1K3WA 5DYIA 3RGPA 4B7GA 3MHVC 3LQQA 4G4NA 2KW0A 3SBJA 5C18A 2P5TA 5BR8M 3L2AA 1HQCA 2DHRA 4B08A 4CGYB 2F5PA 3R9XB 1ZQ9A 4JV5M 3GPUA 2F5OA 1IXSB 1NJGA 3FTDA 4AQYM 1NHGC 4JN6A 3R8FA 3RFWA 2Y20A 4WURA 2J7NA 3GQ4A 4QNMA 2XLJA 5FTLA 3HU3A 5ITXE 3KP0E 1G4AE 3SYKA 1IN6A 1KSFX 4MH0E 1DO2A 4W5WA 3SAUA 1I4WA 5DYGA 5JI3E 2ZANA 3SAVA 2FNAA 1SXJE 3GPPA 2DZNB 3E4RA 2C99A 2G8LA 1IBKM 4LFCM 5E6JA 1NJFA 5IWAM 4DR5M 4LJ4A 2QENA 3K92A 3AV0A 1IY1A 4JI5M 3FKEA 3RGSA 2V6ZM 3BOSA 1YUBA 5LMNM 3HU2A 4D81A 4NRWA 2D7EA 2ZAOA 2L09A 3U6MA 3U6PA 2CHGA 5JI2E 1KYIA 5IREB 4B3RM 1E9SA 3T1HM 3U61B 2EA0A 3PXGA 4MGKE 4JYAM 3THGA 2LH0A 4KHPM 4IBDA 3K1JA 3GLFA 2RGOA 4M0WA 4CHTB 3T15A 5FTKA 3VKGA 4DUYM 3J81S 2XSZA 1ORYB 1L2BA 2CE7A 2UXCM 1E9RA 5FSWA 1TH3A 3AFHA 4FCTA 4OVZA 2HL7A 3U61A 5KPTA 4PT5A 1L2CA 4JI3M 3U6OA 3OTOM 3GLHB 4DUZM 2CHVA 4GKJM 1D2NA 1Z5AA 2V1CA 1IY2A 4PDIA 2XZFA 4MGYE 4YY3M 2Q2EB 3FTCA 4LGYA 2CEAA 2R18A 3KOZE 3PNYA 5EXSA 1HQYE 2UUCM 5EXPA 1G41A 1R2YA 1JQJC 4AZFA 2G5GX 3LQRA 3KDSE 1L1ZA 4GHAA 1Z59A 3CF6E 3DA1A 3I51A 4FCVA 3TQSA 3LVWA 1E32A 3T38A 3GLHA 1XWIA 2QP9X 2XH9A 3FYCA 3FUWA 3JR5A 3CTWB 1J5EM 1H6UA 2YR0A 3A45A 4AKIA 2Y21A 1Q3BA 1GVNA 2HHHM 4IBKA 2YNMD 8CATA 5EP2A 3J27B 3HJQA 1SXJD 2C96A 1NY6A 3RE8A 1XC8A 4GITA 1GL7A 2R45A 4FWDA 5KQ8A 3Q8XA 4X65M 2Z4SA 4LFAM 2UXDM 4LJ5A 2F5SA 4X64M 4I81A 1NNJA 4LCBA 4X62M 1W5SA 5ITUA 3TWMA 4G4QA 2M60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ3 A;  5ITX E;  4B3S M;  3JAM S;  3A42 A;  4CIS A;  3SAU A;  2HKJ A;  3W0F A;  4ITQ A;  3SAV A;  1TDZ A;  4LF6 M;  3GPP A;  4LFB M;  1MX0 A;  4B3T M;  1IBK M;  4LFC M;  1TDH A;  1N34 M;  5IWA M;  1N36 M;  1N33 M;  4DR5 M;  4NXN M;  4JI1 M;  4JI5 M;  4LF7 M;  1Z5B A;  1PM5 A;  3SAR A;  5LMN M;  5LMU M;  2ZBK B;  3J7A S;  1HNX M;  1IBM M;  1XMQ M;  1R2Z A;  1IBL M;  2UUA M;  4NRW A;  3C58 A;  3U6M A;  3U6P A;  2VQF M;  4GKK M;  4NRV A;  4K0K M;  1PJI A;  4B3R M;  3T1H M;  2EA0 A;  4LF9 M;  4JYA M;  5ITQ A;  3GP1 A;  4B3M M;  1KFV A;  4KHP M;  1EE8 A;  4DR6 M;  4DR7 M;  4DV1 M;  5A2Q S;  5IT9 S;  4DR4 M;  4G4O A;  4PDG A;  3GO8 A;  3TWL A;  4DV5 M;  4DUY M;  2UXB M;  3J81 S;  5ITR A;  5ITY A;  3SAS A;  4JI2 M;  4DV2 M;  1L2B A;  2VQE M;  1HNZ M;  5ITX A;  3U6S A;  1PJJ A;  2UXC M;  4DV4 M;  1HR0 M;  2F5N A;  3GQ5 A;  3JR4 A;  1L2D A;  1L2C A;  1XNQ M;  4LF5 M;  4JI3 M;  3U6O A;  1L1T A;  3OTO M;  1Q3C A;  4DUZ M;  3GPY A;  1HNW M;  4GKJ M;  4X66 M;  1Z5A A;  2XZF A;  4PDI A;  2UU9 M;  3J80 S;  3VK8 A;  4YY3 M;  4YHH M;  2Q2E B;  4PCZ A;  2UUC M;  1K3X A;  3U6E A;  3U6C A;  1R2Y A;  3U6Q A;  1L1Z A;  4MB7 A;  5ITT A;  1Q39 A;  5FLX S;  1Z59 A;  3SAT A;  4DR2 M;  3U6L A;  2F4V M;  4DV0 M;  2F5Q A;  4JI7 M;  4NXM M;  4DV7 M;  4LF8 M;  3JR5 A;  3A46 A;  4DR3 M;  3GPX A;  1J5E M;  3A45 A;  4DV3 M;  1Q3B A;  2XZU A;  4DR1 M;  3VK7 A;  1MU5 A;  1Z5C A;  2HHH M;  4JI6 M;  4OX9 M;  2OPF A;  1K3W A;  2E5L M;  2UUB M;  3DOA A;  4G4N A;  3T1Y M;  3SAW A;  3SBJ A;  1FJG M;  1XC8 A;  5BR8 M;  4G4R A;  1XNR M;  2ZM6 M;  4DV6 M;  1I94 M;  2F5P A;  4X65 M;  4JV5 M;  4LFA M;  3GPU A;  2OQ4 A;  2F5O A;  2UXD M;  4PD2 A;  4AQY M;  1XMO M;  4JI0 M;  4X64 M;  2F5S A;  1N32 M;  1NNJ A;  1K82 A;  4X62 M;  3U6D A;  5ITU A;  4JI4 M;  3TWM A;  3TWK A;  4G4Q A;  4JI8 M;  4LF4 M;  3GQ4 A; 
#chains in the Genus database with same CATH topology
 2DAM A;  4B3S M;  1OFI A;  2XFT A;  4AKG A;  2K6B A;  3A42 A;  3ZCB B;  2KNZ A;  3PVS A;  4LF6 M;  1MX0 A;  4M0D A;  4B3T M;  4HEO A;  1TDH A;  3KW6 A;  4IBG A;  4I8O A;  1N36 M;  4S12 A;  3SMP A;  1OTR A;  3PNV A;  2WSF F;  2DZL A;  1PRB A;  5EQT A;  2KHH A;  3CF0 A;  2X8A A;  4EIW A;  4RKU F;  3UK6 A;  4JI1 M;  1PM5 A;  2KA6 B;  1GJT A;  3GLG E;  5KPZ A;  2W82 A;  2M5Z A;  4MGI E;  2FOI C;  5C1B A;  2J7O A;  2H5X A;  4KT0 F;  1GAB A;  3C9P A;  2N35 A;  2UUA M;  3AKZ A;  3H4M A;  3K2L A;  2QHO B;  3B9P A;  3GLH E;  4G6Z A;  4GC5 A;  2DAG A;  2VF8 A;  2JNH A;  3FUT A;  4BBA A;  3FRI A;  1PJI A;  4IBE A;  4LZZ A;  4LF9 M;  2GQF A;  1KFV A;  1XB2 B;  2Y0Q A;  4DR7 M;  1S3S A;  1TTE A;  4DV1 M;  5A2Q S;  5IT9 S;  2VII A;  4GHL A;  4DR4 M;  4WP2 A;  4G4O A;  4XBO A;  1QZM A;  3TWL A;  3Q8G A;  3FYD A;  2UXB M;  4IBJ A;  1XHB A;  4AI6 A;  1Z6T A;  2MR9 A;  1TH4 A;  1NVM A;  3GLF B;  1YE9 A;  2CFO A;  3D8L A;  1HNZ M;  4FWG A;  1WGL A;  2FE8 A;  2R62 A;  3U5Z B;  4AKH A;  4AG6 A;  1HR0 M;  3M6A A;  2CUZ A;  1XNQ M;  2JZ0 A;  4LGM A;  4NC6 A;  1Q3C A;  1JR3 D;  4QHS A;  1QAN A;  2ZTC A;  2KNA A;  2R46 A;  4OVZ B;  2XF3 A;  3H4J A;  3VK8 A;  4RF0 A;  4YHH M;  2BWB A;  1D0K A;  5KQD A;  1MN3 A;  2BWE A;  4GIP A;  3WHK A;  2QNJ A;  1PGY A;  3U5Z A;  4QNR A;  1Q39 A;  1IN4 A;  1ZMW A;  2C9O A;  1DGH B;  2KRU A;  2ZAM A;  3C3E A;  3EIH A;  4F1I A;  3U6L A;  4KLN A;  2DAI A;  4B7F A;  1OKS A;  2BJW A;  5E26 A;  3L28 A;  4DV7 M;  2QBY B;  2KEB A;  4I5S A;  4LF8 M;  2HWJ A;  2XSZ D;  1IN5 A;  2C9C A;  2HCB A;  4L78 A;  5KPR A;  3GPX A;  2AHM A;  3SYL A;  2XZU A;  3LCU A;  4LY6 A;  2KXE A;  4KO8 A;  4DR1 M;  3VK7 A;  1IFY A;  3ILK A;  3J2P B;  2JUJ A;  4QOZ C;  1IXZ A;  3E9S A;  2D7H A;  5EJC A;  2UUB M;  2KZU A;  1DGH A;  3SAW A;  3D8B A;  3I04 M;  1V33 A;  2DWM A;  4LRT A;  4R3D A;  1FJG M;  4P16 A;  3TL4 X;  4G4R A;  2QBY A;  1XNR M;  1ZV1 A;  2ZM6 M;  2C5R A;  3VLF B;  2OO9 A;  3M0E A;  4RF1 A;  1F4I A;  1R6B X;  1IQP A;  2DKL A;  2O25 A;  1NSF A;  1IY0 A;  2WSC F;  4PD2 A;  1N32 M;  2H1R A;  2XGN A;  3HJ8 A;  3NBI A;  2RKO A;  4G3O A;  5DFL A;  3U6D A;  4NOO B;  1J09 A;  1QAO A;  4MM3 B;  4JI4 M;  2MJ5 B;  4IBC A;  1VDD A;  1WR1 B;  4LF4 M;  1WJ7 A;  3U60 A;  2QPA A;  3JAM S;  2WSE F;  4L4U A;  1UM8 A;  3PFI A;  2CV0 A;  2DI0 A;  3MJ5 A;  4CIS A;  2HKJ A;  3GRV A;  3A98 B;  1T3T A;  1LTM A;  3I4Y A;  3VKH A;  2MRO B;  1DO0 A;  1N34 M;  3QAU A;  4FWH A;  2QZ4 A;  1C7Y A;  3B7N A;  2C98 A;  4MGH A;  3SMS A;  1HT2 E;  1XXH B;  2LXE A;  1LV7 A;  2JXN A;  3KVW A;  5EP4 A;  1QDR A;  3GLF E;  1N77 A;  3J7A S;  4Z8X A;  1HNX M;  1DGG A;  1IBM M;  1WHC A;  1V34 A;  1XMQ M;  2K9D A;  1MJG M;  2Z7J A;  2I7N A;  3QYE A;  4M9S A;  3C58 A;  3I01 M;  1OFH A;  4IBF A;  2I7P A;  5FTN A;  2VQF M;  3W67 A;  4K0K M;  2DHY A;  5IZ7 D;  3UMM A;  1YLA A;  3AJI B;  3DZD A;  3GP1 A;  4NL4 H;  1X37 A;  4B3M M;  1WXQ A;  3GLI B;  1EE8 A;  1XXH A;  1C1K A;  3HJS A;  5F3W A;  4DR6 M;  3QWL A;  3UZU A;  4IJE A;  1D0L A;  4XK8 F;  3VDP A;  3IHP A;  3IG8 A;  3GO8 A;  3L25 A;  1VQ1 A;  4DV5 M;  3UGJ A;  2L6O A;  5ITR A;  3SAS A;  3FTE A;  3TPZ A;  3SFZ A;  3SHF A;  2O01 F;  3W0L B;  4II7 A;  1JB0 F;  3U6S A;  1QUS A;  2LNH C;  3EIE A;  3FUX A;  3MK6 A;  3QYB A;  4LG2 A;  3FUV A;  2F5N A;  3JR4 A;  1L2D A;  4LF5 M;  3KS4 A;  3GRY A;  4D80 A;  4GC9 A;  1FNN A;  3GLI A;  1GJS A;  1T43 A;  3HX3 A;  3IG5 A;  4AW4 A;  1QQW A;  4Z6Y A;  3HGI A;  3WHL A;  5EP1 A;  2CV2 A;  2DXI A;  1CUK A;  1OJL A;  2DAK A;  2OOA A;  2WZJ A;  3L27 A;  4I4L A;  5H37 D;  4KOD A;  4LJ8 A;  2J5Y A;  5FTJ A;  4OU7 A;  3U6C A;  4MB7 A;  5ITT A;  2L4F A;  5FLX S;  3SAT A;  3HKP A;  1N75 A;  4DR2 M;  2F4V M;  3HHW A;  2DEN A;  2K47 A;  4IBB A;  1J7K A;  2L2D A;  4DBG B;  1OAO C;  1YSY A;  1GLN A;  5BPV A;  3KOW E;  1QVR A;  4LJ9 A;  3K8Z A;  5EP3 A;  2D7G A;  1L8Q A;  1QYR A;  1QZE A;  3DFZ A;  3VDU A;  4IJF A;  2X4A A;  1MU5 A;  1P3Q Q;  3I4V A;  2LVP C;  4NSO B;  4R7G A;  3KFU G;  3FD9 A;  3NWL A;  4D82 A;  3L26 A;  4JI6 M;  4B7H A;  3L29 A;  1QAQ A;  3M7G A;  2OPF A;  4OX9 M;  1N78 A;  2E5L M;  4HL4 A;  3DOA A;  3T1Y M;  1GKI A;  2LVQ D;  3FRH A;  1ZMV A;  1IXS A;  4ANR A;  2Z3X A;  3KS8 A;  1QDT A;  1IM2 A;  4DV6 M;  1NHW C;  3SHG B;  3B74 A;  1I94 M;  3UJN A;  3AOG A;  3KXE C;  3LCV B;  1JR3 A;  1VDL A;  2DZO B;  4LJ6 A;  4FD2 A;  1G59 A;  4ZPX A;  3LMM A;  2LVA A;  3K9P A;  3B7Q A;  2VF7 A;  2OQ4 A;  1XMO M;  4JI0 M;  3HHZ A;  3FE3 A;  1K82 A;  2BJV A;  2RGH A;  2ERC A;  3TWK A;  4JI8 M;  4IIW A;  2L7I A;  4NSR A;  2KZS A;  1A5T A;  4GEW A;  5EXT A;  3HHY A;  3GQ3 A;  7CAT A;  1VG5 A;  2LHC A;  2XEP A;  4LRS A;  4M9Z A;  1QAM A;  1R5L A;  2R4E A;  4L16 A;  3W0F A;  4ITQ A;  1R7R A;  1TDZ A;  3VFD A;  2DWN A;  2R4J A;  3FTF A;  4LFB M;  1DGB A;  4F2L A;  3U60 B;  1WIV A;  4LZJ A;  1N33 M;  2LWX A;  4RNA A;  3KOY E;  3B89 A;  1E94 E;  1SG9 A;  4NXN M;  1AIP C;  5FTM A;  3GLG B;  4LF7 M;  1Z5B A;  3MMP A;  3NBX X;  2VDB B;  4JXJ A;  3SAR A;  3LVV A;  2YQZ A;  5LMU M;  2ZBK B;  2DAE A;  2EO2 A;  4FVM A;  4HLQ A;  2KRK A;  1R2Z A;  2NQ8 C;  1IBL M;  4LJ7 A;  2B3T A;  1G71 A;  4GMQ A;  2EUC A;  1UFZ A;  3CF2 A;  2DVW B;  4GKK M;  1DV0 A;  4NRV A;  2R0I A;  3V76 A;  2A5Y B;  3GRR A;  4WW0 A;  4BB9 A;  2LVO C;  5ITQ A;  2X49 A;  2DWL A;  3FUU A;  1SXJ B;  2JA2 A;  5EXX A;  4BLC A;  1Q02 A;  3SC3 A;  1G8P A;  3GLG A;  4TUW A;  2JY6 B;  1GL6 A;  2QCU A;  4QOS A;  4PDG A;  3HU1 A;  3HWS A;  1IN7 A;  1EFU B;  5ITY A;  3ZC7 B;  4JI2 M;  2LVN C;  3ZH9 B;  4LJA A;  4DV2 M;  4OW0 A;  2VQE M;  1IN8 A;  3AL0 C;  5ITX A;  1SXJ C;  2KDL A;  3BBZ A;  1HT1 E;  4DV4 M;  1PJJ A;  1D0M A;  4L8R C;  1OIZ A;  3KSX A;  3GQ5 A;  3GRU A;  3KSJ A;  4FW9 A;  1L1T A;  2HAK A;  4IBI A;  1SXJ A;  4MGZ E;  2CP8 A;  2QQ8 A;  3HHX A;  1NNU C;  2CWB A;  4M9X A;  3GPY A;  1HNW M;  4X66 M;  2UU9 M;  3J80 S;  2EKK A;  1EIJ A;  2Z4R A;  2DWZ B;  3AOE C;  1W5T A;  4AG5 A;  4FCW A;  2L7H A;  1Y8G A;  4QHT A;  4A3V B;  4Q7J A;  3J7B A;  1QUT A;  4PCZ A;  1OQY A;  1K3X A;  3U6E A;  1TF0 B;  2FFJ A;  3AOE A;  3U6Q A;  4GH9 A;  2Z8Y M;  3TE6 A;  2EKF A;  2XFS A;  3KOX E;  2CHQ A;  5GKN A;  5DNY A;  2MH8 A;  4DV0 M;  2F5Q A;  2O5R A;  4JI7 M;  2BNK A;  1BVS A;  2V1U A;  4NXM M;  1TGU A;  4R71 A;  1DGF A;  1V92 A;  3A46 A;  4DR3 M;  1IXR C;  2R65 A;  2YFQ A;  4REZ A;  2G3Q A;  4DV3 M;  1NY5 A;  4GRI A;  1TH2 A;  2CRU A;  5KO3 A;  1G3I A;  1Z5C A;  4L15 A;  1ZAE A;  2Y0T A;  3C3D A;  3KP1 E;  4XGI A;  1K3W A;  5DYI A;  3RGP A;  4B7G A;  3MHV C;  1VEK A;  3LQQ A;  4G4N A;  2KW0 A;  3SBJ A;  5C18 A;  2P5T A;  2LTU A;  5BR8 M;  3L2A A;  1HQC A;  2JY8 A;  2DHR A;  4B08 A;  4CGY B;  2F5P A;  3R9X B;  1ZQ9 A;  4JV5 M;  3GPU A;  2OOB A;  2F5O A;  1IXS B;  1NJG A;  3FTD A;  4AQY M;  1RU3 A;  4UN2 B;  1NHG C;  1OAI A;  1VEG A;  4JN6 A;  3R8F A;  2MGW A;  3RFW A;  2Y20 A;  4CIZ A;  4WUR A;  2J7N A;  3GQ4 A;  4QNM A;  2XLJ A;  5FTL A;  3HU3 A;  5ITX E;  3KP0 E;  1G4A E;  3SYK A;  1IN6 A;  1KSF X;  4MH0 E;  1DO2 A;  4W5W A;  3SAU A;  1I4W A;  5DYG A;  5JI3 E;  2ZAN A;  3SAV A;  2FNA A;  1SXJ E;  3GPP A;  2DZN B;  3E4R A;  2C99 A;  2G8L A;  2R44 A;  3E21 A;  1IBK M;  4LFC M;  5E6J A;  1OIP A;  2JY7 A;  3HY5 A;  1NJF A;  5IWA M;  4DR5 M;  4LJ4 A;  2QEN A;  3K92 A;  2RRU A;  3AV0 A;  1TR8 A;  1WGN A;  1IY1 A;  4JI5 M;  1AUA A;  3FKE A;  2V6Z M;  1XXH E;  3BOS A;  1YUB A;  3RGS A;  5LMN M;  3K9O A;  3CGW A;  3HU2 A;  3B7Z A;  4D81 A;  4NRW A;  2D7E A;  2ZAO A;  2FS1 A;  2L09 A;  3U6M A;  3U6P A;  2CHG A;  3LW5 F;  2QSF X;  2FH0 A;  2JY5 A;  5JI2 E;  2JZ1 A;  1ZMU A;  1KYI A;  2APL A;  5IRE B;  1E9S A;  3T1H M;  3U61 B;  2EA0 A;  4B3R M;  3PXG A;  4MGK E;  4JYA M;  5L8R F;  3THG A;  2LH0 A;  4KHP M;  4IBD A;  3K1J A;  3GLF A;  3E46 A;  2RGO A;  3T6P A;  4M0W A;  3GLI E;  2CV1 A;  2LHG A;  4CHT B;  3T15 A;  5FTK A;  3VKG A;  1T6O A;  4DUY M;  1R4G A;  3J81 S;  2R6F A;  2XSZ A;  1ORY B;  1L2B A;  2CE7 A;  2UXC M;  1E9R A;  1GO5 A;  5FSW A;  1TH3 A;  2EJS A;  3AFH A;  4FCT A;  4OVZ A;  2HL7 A;  2JWS A;  5KPT A;  3U61 A;  4PT5 A;  1L2C A;  4JI3 M;  3U6O A;  3OTO M;  3GLH B;  3W68 A;  4DUZ M;  1VEJ A;  2CHV A;  4GKJ M;  1D2N A;  4Y28 F;  1HJP A;  1Z5A A;  1IY2 A;  2V1C A;  3HZJ A;  4P17 A;  4PDI A;  2XZF A;  4MGY E;  4YY3 M;  2Q2E B;  3FTC A;  4LGY A;  2CEA A;  2L4E A;  2R18 A;  3KOZ E;  1PJT A;  3PNY A;  5EXS A;  1HQY E;  2UUC M;  5EXP A;  1G41 A;  1PJS A;  1R2Y A;  1JQJ C;  4AZF A;  2G5G X;  3LQR A;  3KDS E;  1L1Z A;  3IEC A;  4GHA A;  1Z59 A;  3CF6 E;  3DA1 A;  3I51 A;  4FCV A;  3TQS A;  3LVW A;  4L6V 6;  2GNO A;  1E32 A;  3T38 A;  3GLH A;  2K0B X;  1XWI A;  2QP9 X;  2XH9 A;  2LBC A;  3FYC A;  1PJQ A;  3FUW A;  3JR5 A;  2KNV A;  3CTW B;  1J5E M;  1H6U A;  2YR0 A;  3A45 A;  4AKI A;  2Y21 A;  1Q3B A;  1JR3 E;  1GVN A;  1NO1 A;  2HHH M;  2JP7 A;  4IBK A;  2YNM D;  8CAT A;  5EP2 A;  3J27 B;  3HJQ A;  1SXJ D;  2C96 A;  1NV9 A;  1NV8 A;  4CJ6 A;  2DNA A;  1NY6 A;  3RE8 A;  1XC8 A;  4GIT A;  1GL7 A;  2R45 A;  4FWD A;  5KQ8 A;  3BXW A;  3Q8X A;  4X65 M;  2Z4S A;  4LFA M;  2UXD M;  4LJ5 A;  3F92 A;  2F5S A;  4X64 M;  2ZTD A;  4I81 A;  1NNJ A;  4LCB A;  4X62 M;  1W5S A;  5ITU A;  3ZQJ A;  3TWM A;  4G4Q A;  2M60 A; 
#chains in the Genus database with same CATH homology
 4B3S M;  1OFI A;  2XFT A;  4AKG A;  3A42 A;  3ZCB B;  3PVS A;  4LF6 M;  1MX0 A;  4M0D A;  4B3T M;  1TDH A;  3KW6 A;  4IBG A;  4I8O A;  1N36 M;  4S12 A;  3SMP A;  3PNV A;  4EIW A;  5EQT A;  3CF0 A;  2X8A A;  3UK6 A;  4JI1 M;  1PM5 A;  2KA6 B;  5KPZ A;  2W82 A;  2M5Z A;  4MGI E;  2FOI C;  5C1B A;  2J7O A;  2UUA M;  3AKZ A;  3H4M A;  3K2L A;  3B9P A;  4G6Z A;  4GC5 A;  3FUT A;  4BBA A;  1PJI A;  4IBE A;  4LZZ A;  4LF9 M;  1KFV A;  2Y0Q A;  4DR7 M;  1S3S A;  4DV1 M;  5A2Q S;  5IT9 S;  2VII A;  4GHL A;  4DR4 M;  4G4O A;  4XBO A;  1QZM A;  3TWL A;  2UXB M;  3FYD A;  4IBJ A;  1XHB A;  4AI6 A;  1Z6T A;  1TH4 A;  1NVM A;  3GLF B;  1YE9 A;  2CFO A;  3D8L A;  1HNZ M;  4FWG A;  2FE8 A;  2R62 A;  3U5Z B;  4AKH A;  4AG6 A;  1HR0 M;  3M6A A;  2CUZ A;  1XNQ M;  4LGM A;  1Q3C A;  1JR3 D;  4QHS A;  1QAN A;  2R46 A;  4OVZ B;  2XF3 A;  3VK8 A;  4RF0 A;  4YHH M;  5KQD A;  4GIP A;  3WHK A;  3U5Z A;  4QNR A;  1Q39 A;  1IN4 A;  2KRU A;  2C9O A;  1DGH B;  2ZAM A;  3EIH A;  3U6L A;  4KLN A;  4B7F A;  2BJW A;  5E26 A;  3L28 A;  4DV7 M;  2QBY B;  2KEB A;  4I5S A;  4LF8 M;  2XSZ D;  1IN5 A;  2C9C A;  2HCB A;  4L78 A;  5KPR A;  3GPX A;  2AHM A;  3SYL A;  2XZU A;  4LY6 A;  2KXE A;  4KO8 A;  4DR1 M;  3VK7 A;  3ILK A;  3J2P B;  4QOZ C;  1IXZ A;  3E9S A;  2D7H A;  5EJC A;  2UUB M;  2KZU A;  1DGH A;  3SAW A;  3D8B A;  2DWM A;  4LRT A;  4R3D A;  1FJG M;  4P16 A;  3TL4 X;  4G4R A;  2QBY A;  1XNR M;  2ZM6 M;  2C5R A;  3VLF B;  3M0E A;  4RF1 A;  1R6B X;  1IQP A;  1NSF A;  1IY0 A;  4PD2 A;  1N32 M;  2H1R A;  2XGN A;  3HJ8 A;  3NBI A;  2RKO A;  3U6D A;  4NOO B;  1J09 A;  1QAO A;  4MM3 B;  4JI4 M;  4IBC A;  1VDD A;  4LF4 M;  3U60 A;  2QPA A;  3JAM S;  4L4U A;  1UM8 A;  3PFI A;  2CV0 A;  4CIS A;  3MJ5 A;  2HKJ A;  3GRV A;  3A98 B;  1T3T A;  3I4Y A;  3VKH A;  1DO0 A;  1N34 M;  3QAU A;  4FWH A;  2QZ4 A;  2C98 A;  4MGH A;  3SMS A;  1HT2 E;  1XXH B;  2LXE A;  1LV7 A;  3KVW A;  5EP4 A;  1N77 A;  3J7A S;  4Z8X A;  1HNX M;  1DGG A;  1IBM M;  1XMQ M;  2Z7J A;  2I7N A;  4M9S A;  3C58 A;  1OFH A;  4IBF A;  2I7P A;  5FTN A;  2VQF M;  4K0K M;  5IZ7 D;  3UMM A;  3AJI B;  3DZD A;  3GP1 A;  4NL4 H;  1X37 A;  4B3M M;  1WXQ A;  3GLI B;  1EE8 A;  1XXH A;  1C1K A;  3HJS A;  5F3W A;  4DR6 M;  3QWL A;  3UZU A;  4IJE A;  3VDP A;  3IG8 A;  3GO8 A;  3L25 A;  4DV5 M;  3UGJ A;  2L6O A;  5ITR A;  3SAS A;  3FTE A;  3TPZ A;  3SFZ A;  3SHF A;  3W0L B;  4II7 A;  3U6S A;  3MK6 A;  2LNH C;  3EIE A;  3FUX A;  4LG2 A;  3FUV A;  2F5N A;  3JR4 A;  1L2D A;  4LF5 M;  3KS4 A;  3GRY A;  4D80 A;  4GC9 A;  1FNN A;  3GLI A;  3IG5 A;  4AW4 A;  1QQW A;  4Z6Y A;  3HGI A;  3WHL A;  5EP1 A;  2CV2 A;  2DXI A;  1OJL A;  3L27 A;  4I4L A;  5H37 D;  4KOD A;  4LJ8 A;  5FTJ A;  4OU7 A;  3U6C A;  4MB7 A;  5ITT A;  5FLX S;  3SAT A;  3HKP A;  1N75 A;  4DR2 M;  2F4V M;  3HHW A;  2K47 A;  4IBB A;  1J7K A;  1YSY A;  1GLN A;  5BPV A;  3KOW E;  1QVR A;  4LJ9 A;  3K8Z A;  5EP3 A;  2D7G A;  1L8Q A;  1QYR A;  3DFZ A;  3VDU A;  4IJF A;  2X4A A;  1MU5 A;  3I4V A;  4NSO B;  4R7G A;  3KFU G;  3FD9 A;  3NWL A;  4D82 A;  3L26 A;  4JI6 M;  4B7H A;  3L29 A;  1QAQ A;  3M7G A;  2OPF A;  4OX9 M;  1N78 A;  2E5L M;  4HL4 A;  3DOA A;  3T1Y M;  1GKI A;  2Z3X A;  3KS8 A;  1IM2 A;  4DV6 M;  1NHW C;  3SHG B;  1I94 M;  3UJN A;  3AOG A;  3KXE C;  1JR3 A;  2DZO B;  2CV1 A;  4LJ6 A;  4FD2 A;  1G59 A;  4ZPX A;  3LMM A;  2OQ4 A;  1XMO M;  4JI0 M;  3HHZ A;  1K82 A;  2BJV A;  2RGH A;  2ERC A;  3TWK A;  4JI8 M;  4IIW A;  2L7I A;  4NSR A;  2KZS A;  3HHY A;  5EXT A;  3GQ3 A;  7CAT A;  2XEP A;  4LRS A;  4M9Z A;  1QAM A;  2R4E A;  4L16 A;  3W0F A;  4ITQ A;  1R7R A;  1TDZ A;  3VFD A;  2DWN A;  2R4J A;  3FTF A;  4LFB M;  1DGB A;  3U60 B;  4LZJ A;  1N33 M;  2LWX A;  4RNA A;  3KOY E;  1E94 E;  4NXN M;  5FTM A;  3GLG B;  4LF7 M;  1Z5B A;  4JXJ A;  3SAR A;  3LVV A;  2YQZ A;  5LMU M;  2ZBK B;  2EO2 A;  4FVM A;  4HLQ A;  1R2Z A;  2KRK A;  1IBL M;  2NQ8 C;  4LJ7 A;  4GMQ A;  2EUC A;  3CF2 A;  2DVW B;  4GKK M;  4NRV A;  2A5Y B;  3GRR A;  4WW0 A;  4BB9 A;  5ITQ A;  2X49 A;  2DWL A;  3FUU A;  1SXJ B;  2JA2 A;  5EXX A;  4BLC A;  3SC3 A;  1G8P A;  3GLG A;  4TUW A;  1GL6 A;  2QCU A;  4QOS A;  4PDG A;  3HU1 A;  3HWS A;  1IN7 A;  5ITY A;  3ZC7 B;  4JI2 M;  3ZH9 B;  4LJA A;  4DV2 M;  4OW0 A;  2VQE M;  1IN8 A;  3AL0 C;  5ITX A;  1SXJ C;  1PJJ A;  1HT1 E;  4DV4 M;  4L8R C;  3KSX A;  3GQ5 A;  3GRU A;  3KSJ A;  4FW9 A;  1L1T A;  4IBI A;  1SXJ A;  4MGZ E;  3HHX A;  1NNU C;  3GPY A;  4M9X A;  1HNW M;  4X66 M;  2UU9 M;  3J80 S;  2Z4R A;  2DWZ B;  3AOE C;  1W5T A;  4AG5 A;  4FCW A;  2L7H A;  4QHT A;  4A3V B;  3J7B A;  4PCZ A;  1K3X A;  3U6E A;  2FFJ A;  3AOE A;  3U6Q A;  4GH9 A;  3TE6 A;  2XFS A;  3KOX E;  2CHQ A;  5GKN A;  5DNY A;  4DV0 M;  2F5Q A;  2O5R A;  4JI7 M;  2BNK A;  2V1U A;  4NXM M;  1TGU A;  1DGF A;  3A46 A;  4DR3 M;  1IXR C;  2R65 A;  2YFQ A;  4REZ A;  4DV3 M;  1NY5 A;  4GRI A;  1TH2 A;  5KO3 A;  1G3I A;  1Z5C A;  4L15 A;  1ZAE A;  2Y0T A;  3KP1 E;  4XGI A;  1K3W A;  5DYI A;  3RGP A;  4B7G A;  3MHV C;  3LQQ A;  4G4N A;  2KW0 A;  3SBJ A;  5C18 A;  2P5T A;  5BR8 M;  3L2A A;  1HQC A;  2DHR A;  4B08 A;  4CGY B;  2F5P A;  3R9X B;  1ZQ9 A;  4JV5 M;  3GPU A;  2F5O A;  1IXS B;  1NJG A;  3FTD A;  4AQY M;  1NHG C;  4JN6 A;  3R8F A;  3RFW A;  2Y20 A;  4WUR A;  2J7N A;  3GQ4 A;  4QNM A;  2XLJ A;  5FTL A;  3HU3 A;  5ITX E;  3KP0 E;  1G4A E;  3SYK A;  1IN6 A;  1KSF X;  4MH0 E;  1DO2 A;  4W5W A;  3SAU A;  1I4W A;  5DYG A;  5JI3 E;  2ZAN A;  3SAV A;  2FNA A;  1SXJ E;  3GPP A;  2DZN B;  3E4R A;  2C99 A;  2G8L A;  1IBK M;  4LFC M;  5E6J A;  1NJF A;  5IWA M;  4DR5 M;  4LJ4 A;  2QEN A;  3K92 A;  3AV0 A;  1IY1 A;  4JI5 M;  3FKE A;  3RGS A;  2V6Z M;  3BOS A;  1YUB A;  5LMN M;  3HU2 A;  4D81 A;  4NRW A;  2D7E A;  2ZAO A;  2L09 A;  3U6M A;  3U6P A;  2CHG A;  5JI2 E;  1KYI A;  5IRE B;  4B3R M;  1E9S A;  3T1H M;  3U61 B;  2EA0 A;  3PXG A;  4MGK E;  4JYA M;  3THG A;  2LH0 A;  4KHP M;  4IBD A;  3K1J A;  3GLF A;  2RGO A;  4M0W A;  4CHT B;  3T15 A;  5FTK A;  3VKG A;  4DUY M;  3J81 S;  2XSZ A;  1ORY B;  1L2B A;  2CE7 A;  2UXC M;  1E9R A;  5FSW A;  1TH3 A;  3AFH A;  4FCT A;  4OVZ A;  2HL7 A;  3U61 A;  5KPT A;  4PT5 A;  1L2C A;  4JI3 M;  3U6O A;  3OTO M;  3GLH B;  4DUZ M;  2CHV A;  4GKJ M;  1D2N A;  1Z5A A;  2V1C A;  1IY2 A;  4PDI A;  2XZF A;  4MGY E;  4YY3 M;  2Q2E B;  3FTC A;  4LGY A;  2CEA A;  2R18 A;  3KOZ E;  3PNY A;  5EXS A;  1HQY E;  2UUC M;  5EXP A;  1G41 A;  1R2Y A;  1JQJ C;  4AZF A;  2G5G X;  3LQR A;  3KDS E;  1L1Z A;  4GHA A;  1Z59 A;  3CF6 E;  3DA1 A;  3I51 A;  4FCV A;  3TQS A;  3LVW A;  1E32 A;  3T38 A;  3GLH A;  1XWI A;  2QP9 X;  2XH9 A;  3FYC A;  3FUW A;  3JR5 A;  3CTW B;  1J5E M;  1H6U A;  2YR0 A;  3A45 A;  4AKI A;  2Y21 A;  1Q3B A;  1GVN A;  2HHH M;  4IBK A;  2YNM D;  8CAT A;  5EP2 A;  3J27 B;  3HJQ A;  1SXJ D;  2C96 A;  1NY6 A;  3RE8 A;  1XC8 A;  4GIT A;  1GL7 A;  2R45 A;  4FWD A;  5KQ8 A;  3Q8X A;  4X65 M;  2Z4S A;  4LFA M;  2UXD M;  4LJ5 A;  2F5S A;  4X64 M;  4I81 A;  1NNJ A;  4LCB A;  4X62 M;  1W5S A;  5ITU A;  3TWM A;  4G4Q A;  2M60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...