2Y21A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
ITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The mechanisms of HAMP-mediated signaling in transmembrane receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
molecule keywords HAMP
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y21A00
2Y20A 4I5SA 2Y21A 2Y0TA 2Y0QA 2L7IA 2L7HA
chains in the Genus database with same CATH superfamily
4CGYB 3U6QA 1LV7A 2EO2A 2R65A 1ZAEA 4IBIA 4LJ4A 4D82A 2FH0A 2C9OA 3HJQA 1IBKM 2O5RA 4X64M 2JP7A 3SC3A 2D7EA 1OAOC 2QZ4A 5IZ7D 5JI3E 4GC9A 4DR6M 2AHMA 1PRBA 1IM2A 3TWKA 2DAGA 2JWSA 2HKJA 1XXHB 2LTUA 1E9RA 5EP3A 3TL4X 4ANRA 2C5RA 5F3WA 1Q3CA 4OX9M 4GKJM 4I81A 4LGMA 3SAUA 2F5QA 1QUSA 1T3TA 2LVAA 3KP0E 1SXJB 3KDSE 4OVZA 3GLHB 1K82A 1IY1A 2X8AA 2R46A 3HJSA 1P3QQ 3IHPA 2DXIA 3AFHA 4GHAA 4IJFA 2VIIA 2DI0A 3GRYA 4UN2B 2VQEM 5ITTA 3FTFA 3U6LA 2ZAOA 3J81S 4KLNA 1OAIA 1D2NA 3FUUA 3J7BA 3FRIA 3TPZA 2WSEF 4WP2A 1WR1B 4K0KM 5FTKA 1GO5A 2DZNB 3CGWA 1QYRA 1NJGA 3HHWA 3KOZE 4HLQA 4B7HA 3GLIB 3GLGE 2WSCF 1I94M 2KNZA 3VLFB 1UFZA 3K2LA 4CHTB 2K0BX 2Z8YM 2L4EA 4RNAA 2DAIA 4IBCA 5LMNM 2ZTCA 2LWXA 2C96A 4G3OA 3KOYE 2KNVA 3C9PA 1Z59A 5E26A 2Q2EB 3FTEA 3MHVC 2MGWA 2CRUA 4M9ZA 2YFQA 3SYKA 2R44A 3J2PB 1SXJD 1DGFA 4FCTA 3ZQJA 1HNWM 2UXDM 2EUCA 2JY7A 4LJ8A 3T6PA 1C1KA 1GVNA 1Z6TA 2FFJA 2LVNC 3KOWE 2K47A 2KNAA 5EJCA 3FTCA 3RE8A 1GJTA 4X62M 1TDZA 1WHCA 3FD9A 4LJ6A 2JY6B 2YQZA 2RGHA 1FNNA 4AW4A 3E4RA 2G5GX 2CWBA 3E9SA 3T38A 1XNQM 1N33M 4Z6YA 1W5TA 1N77A 3J80S 3TWMA 4DUYM 4LF5M 2H5XA 1J09A 2KRKA 1AUAA 1PGYA 1Y8GA 4R7GA 2DHYA 4L78A 5EXXA 3VFDA 1AIPC 2R6FA 4HEOA 4M9SA 2RRUA 4OVZB 3WHLA 4PDGA 5KO3A 3ZC7B 3CF6E 1Z5BA 3UMMA 3GP1A 3W68A 2F5SA 3LVVA 3R9XB 3L27A 2F5PA 3LCUA 2Z7JA 3IG5A 4AI6A 1SXJC 1XWIA 2KRUA 3M6AA 1QDTA 3RFWA 3JAMS 3GLFB 3KFUG 1Q02A 4NSRA 1DGGA 4I5SA 2XGNA 2HL7A 2Y21A 2JZ1A 4KO8A 4QOZC 2JNHA 3NWLA 5GKNA 1V92A 2X49A 3K9PA 4IIWA 1CUKA 1HT1E 1Q39A 4DR4M 3A42A 2QHOB 3L25A 1X37A 5E6JA 1JR3D 1VDLA 1GL7A 3I01M 3GQ5A 3FYDA 3AOEC 3NBIA 1ZQ9A 2KZSA 3GLHE 5KPRA 1VEJA 1NNUC 4IBGA 2OPFA 3U6PA 3D8LA 2QBYA 1HR0M 1GABA 4D80A 3AJIB 3T1HM 1J5EM 1VEKA 1DGBA 1XB2B 2C98A 1QZEA 3J7AS 5EXPA 5IT9S 2OQ4A 3GQ3A 1HQYE 2R18A 4GIPA 1H6UA 4I4LA 4XGIA 2L09A 4LG2A 1N34M 2LVOC 2Y20A 1HQCA 4G6ZA 2OOBA 4II7A 4F2LA 3SAWA 1IBLM 3KSJA 4BBAA 4G4RA 2CV2A 1N32M 4D81A 1JR3A 2H1RA 4JI2M 4LFBM 3LQQA 3SAVA 4GMQA 4LZZA 8CATA 3CF2A 2I7PA 4G4OA 1IN7A 4FWHA 4QOSA 4LF4M 2J5YA 5C18A 3L28A 2JZ0A 4DV4M 3UGJA 3E21A 2BJVA 2O01F 4JI5M 5BR8M 4GITA 2R62A 4WURA 1NY5A 2L7HA 3U61B 5A2QS 5EP2A 4P17A 1WGNA 2BWEA 2QBYB 1E32A 3LVWA 3GQ4A 2UUAM 2P5TA 3THGA 3HJ8A 5C1BA 2G8LA 2X4AA 4DR2M 4CISA 4MGHA 3SHFA 1SXJA 1R6BX 5ITXE 1OJLA 1ZMWA 3LCVB 1EFUB 3FYCA 3ZCBB 4RF1A 1IXSA 2QCUA 1UM8A 4QNMA 1NO1A 3DZDA 5KQ8A 3KVWA 2DAKA 4RF0A 3SHGB 3SMPA 2D7GA 1L1TA 2UUBM 3Q8GA 3I04M 3VK8A 4S12A 3QAUA 4FCVA 4R3DA 4LF6M 4IBDA 1IFYA 3AOEA 2I7NA 2CHQA 3GLGB 3LQRA 2KDLA 5H37D 1KYIA 4HL4A 1MX0A 1BVSA 4FWDA 3GPUA 1QAMA 1VDDA 2F5NA 3TQSA 1JB0F 4DUZM 2LHCA 2DVWB 2ZM6M 4DV5M 1QQWA 3LW5F 1PJSA 4L6V6 3SFZA 2L7IA 1IY2A 2VF7A 4X65M 4B3MM 4TUWA 1KFVA 1DGHB 2M60A 4KODA 2XZUA 3KS8A 1QDRA 4MGYE 4IBJA 4NOOB 3C3EA 1WGLA 3B7QA 3U6OA 3HU1A 3L29A 1G4AE 1NY6A 1EIJA 3U6SA 2QENA 2MH8A 2O25A 3HHYA 1OFHA 4DBGB 4PT5A 1L2CA 1MN3A 1R4GA 1HNZM 1TH2A 5FTJA 4LFCM 1R5LA 2CEAA 4JI0M 1DV0A 2FNAA 2KEBA 1D0KA 4Y28F 4EIWA 4GKKM 3L2AA 2KW0A 3JR4A 3HHZA 1DGHA 3B74A 4FD2A 2Y0TA 4DR1M 2FS1A 4DR3M 3U5ZA 3F92A 3AOGA 1VEGA 4G4QA 4MGZE 1K3WA 4DR5M 2HHHM 4L4UA 2V6ZM 3QYEA 4AZFA 1QUTA 1OIZA 4JI7M 2JY8A 2CFOA 1G3IA 3PVSA 3IG8A 5KQDA 3NBXX 4DV3M 3E46A 3I51A 3GPXA 1L8QA 3GLFE 3H4MA 5KPTA 1HNXM 1TH4A 3MJ5A 2DNAA 2MROB 2R4EA 4IBEA 4GRIA 4LY6A 1G71A 3K92A 3U60B 3GLFA 4QHSA 3CF0A 4LJ9A 5FSWA 5L8RF 1JQJC 1EE8A 2LVPC 2F4VM 2BNKA 4IBKA 5EQTA 4JI1M 1TTEA 4PD2A 2QNJA 2FOIC 2JUJA 1D0LA 1Z5CA 4AQYM 1TDHA 2C99A 4DV0M 4YY3M 4CIZA 2DAEA 1Q3BA 1XXHA 2WZJA 4OW0A 3EIEA 2EA0A 1XMQM 2L2DA 4AKGA 2QPAA 3K9OA 2RKOA 3TWLA 1R2YA 5ITRA 2XFTA 4LJ7A 2JY5A 4BLCA 3GPPA 3SASA 1F4IA 4JI3M 4GEWA 4PDIA 1NJFA 2ZBKB 3V76A 1WIVA 1YSYA 3FRHA 4B7FA 3GLIE 3VKHA 5FLXS 1MU5A 3PXGA 3D8BA 1G59A 2LVQD 1D0MA 3CTWB 2Z4SA 1GL6A 1PM5A 4JI8M 2HAKA 1OFIA 1PJIA 1L1ZA 3U6DA 4M0WA 3HHXA 2HWJA 3PNVA 2UU9M 4B7GA 2UUCM 4DR7M 4JI4M 1WJ7A 2APLA 4M0DA 4ZPXA 1XXHE 4Z8XA 1VG5A 2A5YB 4NL4H 1OQYA 5ITYA 2Y0QA 3KOXE 3DOAA 3H4JA 2J7OA 2Z3XA 3VDUA 4X66M 2QSFX 3GLIA 2LBCA 1MJGM 5DYIA 2MR9A 4CJ6A 2XSZD 3SBJA 4LJAA 1NSFA 3UZUA 2EKKA 1GKIA 2LHGA 2N35A 3HWSA 3PFIA 2LH0A 3B9PA 3L26A 1IN5A 4P16A 2NQ8C 4XK8F 1QAQA 2LXEA 4LCBA 2BJWA 4LJ5A 3W67A 3KSXA 2EJSA 4ITQA 1N78A 3DFZA 2OO9A 3Q8XA 4WW0A 4MGKE 3MMPA 3W0FA 1K3XA 1QVRA 2ZTDA 1IXZA 4FVMA 1YE9A 4LRTA 1ZV1A 2DZOB 2Z4RA 3GRVA 3ZH9B 3JR5A 4PCZA 2DWZB 3KXEC 2GQFA 1A5TA 2XFSA 4DV7M 1L2DA 4JI6M 2KZUA 1DO0A 2V1CA 4I8OA 2L4FA 2CE7A 2XSZA 2DZLA 2J7NA 2QP9X 5EP1A 3QWLA 4REZA 1T6OA 3HZJA 1IY0A 3PNYA 4FCWA 3RGPA 1E94E 3TE6A 1Z5AA 1TR8A 3BXWA 1XHBA 1TF0B 4BB9A 3R8FA 3UK6A 2XH9A 3SARA 3GRUA 5DFLA 3HU3A 5DNYA 1FJGM 1V34A 4GC5A 2DENA 2W82A 2EKFA 3GRRA 4B08A 2K6BA 3QYBA 5ITXA 1KSFX 1OTRA 4AKHA 2C9CA 4GHLA 5IREB 2ERCA 2L6OA 3FUVA 1SG9A 1ZMVA 2CUZA 3FUXA 5EP4A 4JXJA 5EXSA 4B3TM 4YHHM 4AKIA 3AV0A 2CHGA 4DV6M 3K8ZA 3M7GA 5LMUM 1G41A 2YR0A 5ITQA 3T1YM 2K9DA 3J27B 1NNJA 1G8PA 3FKEA 3RGSA 4FW9A 2CV0A 1PJTA 3A45A 2DAMA 2YNMD 4L16A 2VF8A 4Q7JA 3I4VA 1OKSA 5BPVA 3LMMA 3HGIA 3BOSA 4IBFA 2UXBM 1N75A 2JXNA 4MM3B 2DHRA 1W5SA 3HU2A 4L15A 4LF9M 7CATA 1QAOA 3W0LB 3KS4A 1HT2E 4LZJA 3A46A 1QZMA 2M5ZA 5EXTA 1IXSB 4LGYA 4LF8M 3GO8A 4W5WA 5DYGA 1LTMA 2WSFF 5FTLA 1V33A 4QNRA 2JA2A 4DV1M 1OIPA 1SXJE 3UJNA 1NVMA 3KW6A 3KP1E 5FTMA 4DV2M 1C7YA 2E5LM 3GLGA 4JV5M 4NC6A 4OU7A 3HX3A 1IN4A 3GPYA 1T43A 2KXEA 1ORYB 2R0IA 4A3VB 4B3SM 2CP8A 3M0EA 1HJPA 2XLJA 1TGUA 1YLAA 2R45A 4AG6A 3FTDA 1WXQA 4M9XA 3HKPA 3U61A 3IECA 2GNOA 1L2BA 3C58A 2R4JA 2XZFA 1R2ZA 1IXRC 1ZMUA 1IN6A 1R7RA 4MGIE 3GLHA 2DWLA 1PJJA 3B7ZA 1IQPA 3VDPA 4AG5A 4IJEA 1DO2A 3C3DA 3MK6A 4MB7A 4L8RC 3FUTA 1N36M 4B3RM 4GH9A 3U6MA 1XMOM 1NV9A 2KHHA 2ZANA 4XBOA 2RGOA 1VQ1A 4KHPM 3A98B 5ITUA 4NXNM 3SMSA 1XNRM 3AKZA 3ILKA 2BWBA 2CHVA 3B7NA 3I4YA 4NRVA 3FE3A 2G3QA 3T15A 4F1IA 4G4NA 2HCBA 4NRWA 4LRSA 4JYAM 5KPZA 2QQ8A 1YUBA 1E9SA 1JR3E 4JN6A 2V1UA 4LFAM 1GJSA 3BBZA 3OTOM 2VDBB 1S3SA 2VQFM 3U5ZB 1QANA 4NXMM 3DA1A 3SATA 3FUWA 1NV8A 1NHWC 3HY5A 2B3TA 3U6CA 1PJQA 3VK7A 2OOAA 4MH0E 1GLNA 2DWMA 4KT0F 1IBMM 5FTNA 1RU3A 1TH3A 2XF3A 3U60A 2LNHC 1J7KA 2D7HA 2ZAMA 3K1JA 4R71A 1IN8A 2CV1A 4RKUF 2UXCM 3VKGA 4IBBA 3U6EA 4NSOB 5JI2E 2MJ5B 3EIHA 5IWAM 2DWNA 3B89A 4LF7M 2KA6B 2XEPA 4FWGA 1XC8A 1NHGC 2FE8A 4QHTA 2F5OA 1I4WA 3AL0C 3WHKA 2DKLA 3SYLA
chains in the Genus database with same CATH topology
4CGYB 3U6QA 1LV7A 2EO2A 2R65A 1ZAEA 4IBIA 4LJ4A 4D82A 1IBKM 2C9OA 3HJQA 2O5RA 4X64M 3SC3A 2D7EA 2QZ4A 5IZ7D 5JI3E 4GC9A 4DR6M 2AHMA 1IM2A 3TWKA 2HKJA 1XXHB 5EP3A 1E9RA 3TL4X 2C5RA 5F3WA 1Q3CA 4OX9M 4GKJM 4I81A 4LGMA 3SAUA 2F5QA 1T3TA 3KP0E 1SXJB 3KDSE 4OVZA 3GLHB 1K82A 1IY1A 2X8AA 2R46A 3HJSA 2DXIA 3AFHA 4GHAA 4IJFA 2VIIA 3GRYA 2VQEM 5ITTA 3FTFA 3U6LA 2ZAOA 3J81S 4KLNA 1D2NA 3FUUA 3J7BA 3TPZA 4K0KM 5FTKA 2DZNB 1QYRA 1NJGA 3HHWA 3KOZE 4HLQA 4B7HA 3GLIB 1I94M 3VLFB 3K2LA 4CHTB 4RNAA 4IBCA 5LMNM 2LWXA 2C96A 3KOYE 1Z59A 5E26A 2Q2EB 3FTEA 3MHVC 4M9ZA 2YFQA 3SYKA 3J2PB 1HNWM 1SXJD 1DGFA 4FCTA 2UXDM 2EUCA 4LJ8A 1C1KA 3KOWE 1GVNA 1Z6TA 2FFJA 2K47A 5EJCA 3FTCA 3RE8A 4X62M 1TDZA 3FD9A 4LJ6A 2YQZA 2RGHA 1FNNA 4AW4A 3E4RA 2G5GX 3E9SA 3T38A 1XNQM 1N33M 4Z6YA 1W5TA 1N77A 3J80S 3TWMA 4DUYM 4LF5M 1J09A 2KRKA 1N34M 4R7GA 4L78A 3VFDA 5EXXA 3WHLA 4OVZB 5KO3A 4M9SA 4LFBM 3UMMA 4PDGA 3GP1A 3ZC7B 3CF6E 1Z5BA 2F5SA 3LVVA 3R9XB 3L27A 2F5PA 2Z7JA 3IG5A 4AI6A 1SXJC 1XWIA 2KRUA 3M6AA 3GLFB 3RFWA 3JAMS 3KFUG 4NSRA 1DGGA 4I5SA 2XGNA 2HL7A 2Y21A 4KO8A 4QOZC 3NWLA 5GKNA 2X49A 4IIWA 1HT1E 1Q39A 4DR4M 3A42A 3L25A 1X37A 5E6JA 1JR3D 1GL7A 3GQ5A 3FYDA 3AOEC 3NBIA 1ZQ9A 2KZSA 5KPRA 1NNUC 4IBGA 2OPFA 3U6PA 3D8LA 2QBYA 1HR0M 4D80A 3AJIB 3T1HM 1J5EM 1DGBA 2C98A 3J7AS 5IT9S 5EXPA 2OQ4A 3GQ3A 1HQYE 2R18A 4GIPA 1H6UA 4I4LA 4XGIA 2L09A 4LG2A 4G6ZA 2Y20A 1HQCA 4II7A 1IBLM 3SAWA 3KSJA 4BBAA 4G4RA 2CV2A 1N32M 4D81A 1JR3A 2H1RA 4JI2M 3LQQA 3SAVA 4GMQA 4LZZA 8CATA 3CF2A 2I7PA 4G4OA 1IN7A 4FWHA 4QOSA 4LF4M 5C18A 3L28A 4DV4M 3UGJA 2BJVA 4JI5M 5BR8M 4GITA 2R62A 4WURA 1NY5A 2L7HA 3U61B 5A2QS 5EP2A 2QBYB 1E32A 3LVWA 3GQ4A 2UUAM 2P5TA 3THGA 3HJ8A 5C1BA 2G8LA 2X4AA 4DR2M 4CISA 4MGHA 3SHFA 1SXJA 1R6BX 5ITXE 1OJLA 3FYCA 3ZCBB 4RF1A 2QCUA 1UM8A 4QNMA 3DZDA 5KQ8A 3KVWA 1L1TA 4RF0A 3SHGB 3SMPA 2D7GA 2UUBM 3VK8A 4S12A 3QAUA 4FCVA 4R3DA 4LF6M 4IBDA 3AOEA 2I7NA 2CHQA 3GLGB 3LQRA 5H37D 1KYIA 4HL4A 1MX0A 4FWDA 3GPUA 2F5NA 1QAMA 1VDDA 3TQSA 4DUZM 2DVWB 2ZM6M 4DV5M 1QQWA 3SFZA 4X65M 2L7IA 1IY2A 4B3MM 4TUWA 1KFVA 1DGHB 2M60A 4KODA 2XZUA 3KS8A 4MGYE 4IBJA 4NOOB 3U6OA 3HU1A 3L29A 1G4AE 1NY6A 3U6SA 2QENA 3HHYA 1OFHA 4PT5A 1L2CA 1HNZM 1TH2A 5FTJA 4LFCM 2CEAA 4JI0M 2FNAA 2KEBA 4EIWA 4GKKM 3L2AA 2KW0A 3JR4A 3HHZA 1DGHA 4FD2A 2Y0TA 4DR1M 4DR3M 3U5ZA 3AOGA 4G4QA 4MGZE 1K3WA 4DR5M 2HHHM 4L4UA 2V6ZM 4AZFA 4JI7M 2CFOA 1G3IA 3PVSA 3IG8A 5KQDA 4DV3M 3I51A 3GPXA 1L8QA 3H4MA 5KPTA 1HNXM 1TH4A 3MJ5A 4LY6A 4IBEA 2R4EA 4GRIA 3K92A 3U60B 3GLFA 4QHSA 3CF0A 4LJ9A 5FSWA 1JQJC 1EE8A 2F4VM 2BNKA 4IBKA 5EQTA 4JI1M 4PD2A 2FOIC 1Z5CA 4AQYM 1TDHA 2C99A 4DV0M 4YY3M 1Q3BA 1XXHA 4OW0A 3EIEA 2EA0A 1XMQM 4AKGA 2QPAA 3TWLA 2RKOA 1R2YA 5ITRA 2XFTA 4LJ7A 3GPPA 4BLCA 3SASA 4JI3M 4PDIA 1NJFA 2ZBKB 1YSYA 3VKHA 4B7FA 5FLXS 1MU5A 3PXGA 3D8BA 1G59A 3CTWB 2Z4SA 1GL6A 1PM5A 4JI8M 1OFIA 1PJIA 1L1ZA 3U6DA 4M0WA 3HHXA 2UU9M 3PNVA 2UUCM 4B7GA 4DR7M 4JI4M 4M0DA 4ZPXA 4Z8XA 2A5YB 4NL4H 5ITYA 2Y0QA 3KOXE 3DOAA 2Z3XA 2J7OA 3VDUA 4X66M 3GLIA 5DYIA 2XSZD 3SBJA 4LJAA 1NSFA 3UZUA 3PFIA 1GKIA 3HWSA 3L26A 2LH0A 3B9PA 1IN5A 4P16A 2NQ8C 1QAQA 2LXEA 4LCBA 2BJWA 4LJ5A 3KSXA 4ITQA 1N78A 3DFZA 3Q8XA 4WW0A 4MGKE 1K3XA 3W0FA 1QVRA 1IXZA 4FVMA 1YE9A 4LRTA 2DZOB 2Z4RA 3GRVA 3ZH9B 3JR5A 4PCZA 2DWZB 3KXEC 4DV7M 1L2DA 2XFSA 4JI6M 2KZUA 1DO0A 2V1CA 4I8OA 2XSZA 2CE7A 2J7NA 2QP9X 5EP1A 3QWLA 4REZA 1IY0A 3PNYA 4FCWA 3RGPA 1E94E 3TE6A 1Z5AA 1XHBA 4BB9A 3R8FA 3UK6A 2XH9A 3SARA 3GRUA 3HU3A 5DNYA 1FJGM 4GC5A 2W82A 3GRRA 4B08A 5ITXA 1KSFX 4AKHA 2C9CA 4GHLA 5IREB 2ERCA 2L6OA 3FUVA 2CUZA 5EP4A 3FUXA 5EXSA 4JXJA 4B3TM 4AKIA 4YHHM 3AV0A 2CHGA 4DV6M 3K8ZA 3M7GA 5LMUM 1G41A 2YR0A 5ITQA 3T1YM 3J27B 1NNJA 1G8PA 3FKEA 3RGSA 4FW9A 2CV0A 3A45A 2YNMD 4L16A 3I4VA 5BPVA 3LMMA 3HGIA 3BOSA 4IBFA 2UXBM 1N75A 4MM3B 2DHRA 1W5SA 3HU2A 4L15A 4LF9M 7CATA 1QAOA 3W0LB 3KS4A 1HT2E 4LZJA 3A46A 1QZMA 2M5ZA 5EXTA 1IXSB 4LGYA 4LF8M 3GO8A 4W5WA 5DYGA 5FTLA 4QNRA 2JA2A 4DV1M 1SXJE 3UJNA 1NVMA 3KW6A 3KP1E 5FTMA 4DV2M 2E5LM 3GLGA 4JV5M 4OU7A 1IN4A 3GPYA 2KXEA 1ORYB 4A3VB 4B3SM 3M0EA 2XLJA 1TGUA 4AG6A 2R45A 3FTDA 1WXQA 4M9XA 3HKPA 3U61A 1L2BA 3C58A 2R4JA 2XZFA 1R2ZA 1IXRC 1IN6A 1R7RA 4MGIE 3GLHA 2DWLA 1PJJA 1IQPA 3VDPA 4AG5A 4IJEA 1DO2A 3MK6A 4MB7A 4L8RC 3FUTA 1N36M 4B3RM 4GH9A 3U6MA 1XMOM 2ZANA 4XBOA 2RGOA 4KHPM 3A98B 5ITUA 4NXNM 3SMSA 1XNRM 3AKZA 3ILKA 3I4YA 2CHVA 4NRVA 4JYAM 4G4NA 2HCBA 4NRWA 4LRSA 5KPZA 1YUBA 1E9SA 4JN6A 2V1UA 4LFAM 3OTOM 1S3SA 2VQFM 3U5ZB 1QANA 4NXMM 3DA1A 3SATA 3FUWA 1NHWC 3U6CA 3VK7A 4MH0E 1GLNA 2DWMA 1IBMM 5FTNA 1TH3A 2XF3A 3U60A 2LNHC 1J7KA 2D7HA 2ZAMA 3K1JA 2CV1A 1IN8A 2UXCM 3VKGA 4IBBA 3U6EA 4NSOB 5JI2E 5IWAM 3EIHA 2DWNA 4LF7M 2KA6B 2XEPA 4FWGA 1XC8A 1NHGC 2FE8A 4QHTA 2F5OA 1I4WA 3AL0C 3WHKA 3T15A 3SYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y20 A;  4I5S A;  2Y21 A;  2Y0T A;  2Y0Q A;  2L7I A;  2L7H A; 
#chains in the Genus database with same CATH topology
 4CGY B;  3U6Q A;  1LV7 A;  2EO2 A;  2R65 A;  1ZAE A;  4IBI A;  4LJ4 A;  4D82 A;  2FH0 A;  2C9O A;  3HJQ A;  1IBK M;  2O5R A;  4X64 M;  2JP7 A;  3SC3 A;  2D7E A;  1OAO C;  2QZ4 A;  5IZ7 D;  5JI3 E;  4GC9 A;  4DR6 M;  2AHM A;  1PRB A;  1IM2 A;  3TWK A;  2DAG A;  2JWS A;  2HKJ A;  1XXH B;  2LTU A;  1E9R A;  5EP3 A;  3TL4 X;  4ANR A;  2C5R A;  5F3W A;  1Q3C A;  4OX9 M;  4GKJ M;  4I81 A;  4LGM A;  3SAU A;  2F5Q A;  1QUS A;  1T3T A;  2LVA A;  3KP0 E;  1SXJ B;  3KDS E;  4OVZ A;  3GLH B;  1K82 A;  1IY1 A;  2X8A A;  2R46 A;  3HJS A;  1P3Q Q;  3IHP A;  2DXI A;  3AFH A;  4GHA A;  4IJF A;  2VII A;  2DI0 A;  3GRY A;  4UN2 B;  2VQE M;  5ITT A;  3FTF A;  3U6L A;  2ZAO A;  3J81 S;  4KLN A;  1OAI A;  1D2N A;  3FUU A;  3J7B A;  3FRI A;  3TPZ A;  2WSE F;  4WP2 A;  1WR1 B;  4K0K M;  5FTK A;  1GO5 A;  2DZN B;  3CGW A;  1QYR A;  1NJG A;  3HHW A;  3KOZ E;  4HLQ A;  4B7H A;  3GLI B;  3GLG E;  2WSC F;  1I94 M;  2KNZ A;  3VLF B;  1UFZ A;  3K2L A;  4CHT B;  2K0B X;  2Z8Y M;  2L4E A;  4RNA A;  2DAI A;  4IBC A;  5LMN M;  2ZTC A;  2LWX A;  2C96 A;  4G3O A;  3KOY E;  2KNV A;  3C9P A;  1Z59 A;  5E26 A;  2Q2E B;  3FTE A;  3MHV C;  2MGW A;  2CRU A;  4M9Z A;  2YFQ A;  3SYK A;  2R44 A;  3J2P B;  1SXJ D;  1DGF A;  4FCT A;  3ZQJ A;  1HNW M;  2UXD M;  2EUC A;  2JY7 A;  4LJ8 A;  3T6P A;  1C1K A;  1GVN A;  1Z6T A;  2FFJ A;  2LVN C;  3KOW E;  2K47 A;  2KNA A;  5EJC A;  3FTC A;  3RE8 A;  1GJT A;  4X62 M;  1TDZ A;  1WHC A;  3FD9 A;  4LJ6 A;  2JY6 B;  2YQZ A;  2RGH A;  1FNN A;  4AW4 A;  3E4R A;  2G5G X;  2CWB A;  3E9S A;  3T38 A;  1XNQ M;  1N33 M;  4Z6Y A;  1W5T A;  1N77 A;  3J80 S;  3TWM A;  4DUY M;  4LF5 M;  2H5X A;  1J09 A;  2KRK A;  1AUA A;  1PGY A;  1Y8G A;  4R7G A;  2DHY A;  4L78 A;  5EXX A;  3VFD A;  1AIP C;  2R6F A;  4HEO A;  4M9S A;  2RRU A;  4OVZ B;  3WHL A;  4PDG A;  5KO3 A;  3ZC7 B;  3CF6 E;  1Z5B A;  3UMM A;  3GP1 A;  3W68 A;  2F5S A;  3LVV A;  3R9X B;  3L27 A;  2F5P A;  3LCU A;  2Z7J A;  3IG5 A;  4AI6 A;  1SXJ C;  1XWI A;  2KRU A;  3M6A A;  1QDT A;  3RFW A;  3JAM S;  3GLF B;  3KFU G;  1Q02 A;  4NSR A;  1DGG A;  4I5S A;  2XGN A;  2HL7 A;  2Y21 A;  2JZ1 A;  4KO8 A;  4QOZ C;  2JNH A;  3NWL A;  5GKN A;  1V92 A;  2X49 A;  3K9P A;  4IIW A;  1CUK A;  1HT1 E;  1Q39 A;  4DR4 M;  3A42 A;  2QHO B;  3L25 A;  1X37 A;  5E6J A;  1JR3 D;  1VDL A;  1GL7 A;  3I01 M;  3GQ5 A;  3FYD A;  3AOE C;  3NBI A;  1ZQ9 A;  2KZS A;  3GLH E;  5KPR A;  1VEJ A;  1NNU C;  4IBG A;  2OPF A;  3U6P A;  3D8L A;  2QBY A;  1HR0 M;  1GAB A;  4D80 A;  3AJI B;  3T1H M;  1J5E M;  1VEK A;  1DGB A;  1XB2 B;  2C98 A;  1QZE A;  3J7A S;  5EXP A;  5IT9 S;  2OQ4 A;  3GQ3 A;  1HQY E;  2R18 A;  4GIP A;  1H6U A;  4I4L A;  4XGI A;  2L09 A;  4LG2 A;  1N34 M;  2LVO C;  2Y20 A;  1HQC A;  4G6Z A;  2OOB A;  4II7 A;  4F2L A;  3SAW A;  1IBL M;  3KSJ A;  4BBA A;  4G4R A;  2CV2 A;  1N32 M;  4D81 A;  1JR3 A;  2H1R A;  4JI2 M;  4LFB M;  3LQQ A;  3SAV A;  4GMQ A;  4LZZ A;  8CAT A;  3CF2 A;  2I7P A;  4G4O A;  1IN7 A;  4FWH A;  4QOS A;  4LF4 M;  2J5Y A;  5C18 A;  3L28 A;  2JZ0 A;  4DV4 M;  3UGJ A;  3E21 A;  2BJV A;  2O01 F;  4JI5 M;  5BR8 M;  4GIT A;  2R62 A;  4WUR A;  1NY5 A;  2L7H A;  3U61 B;  5A2Q S;  5EP2 A;  4P17 A;  1WGN A;  2BWE A;  2QBY B;  1E32 A;  3LVW A;  3GQ4 A;  2UUA M;  2P5T A;  3THG A;  3HJ8 A;  5C1B A;  2G8L A;  2X4A A;  4DR2 M;  4CIS A;  4MGH A;  3SHF A;  1SXJ A;  1R6B X;  5ITX E;  1OJL A;  1ZMW A;  3LCV B;  1EFU B;  3FYC A;  3ZCB B;  4RF1 A;  1IXS A;  2QCU A;  1UM8 A;  4QNM A;  1NO1 A;  3DZD A;  5KQ8 A;  3KVW A;  2DAK A;  4RF0 A;  3SHG B;  3SMP A;  2D7G A;  1L1T A;  2UUB M;  3Q8G A;  3I04 M;  3VK8 A;  4S12 A;  3QAU A;  4FCV A;  4R3D A;  4LF6 M;  4IBD A;  1IFY A;  3AOE A;  2I7N A;  2CHQ A;  3GLG B;  3LQR A;  2KDL A;  5H37 D;  1KYI A;  4HL4 A;  1MX0 A;  1BVS A;  4FWD A;  3GPU A;  1QAM A;  1VDD A;  2F5N A;  3TQS A;  1JB0 F;  4DUZ M;  2LHC A;  2DVW B;  2ZM6 M;  4DV5 M;  1QQW A;  3LW5 F;  1PJS A;  4L6V 6;  3SFZ A;  2L7I A;  1IY2 A;  2VF7 A;  4X65 M;  4B3M M;  4TUW A;  1KFV A;  1DGH B;  2M60 A;  4KOD A;  2XZU A;  3KS8 A;  1QDR A;  4MGY E;  4IBJ A;  4NOO B;  3C3E A;  1WGL A;  3B7Q A;  3U6O A;  3HU1 A;  3L29 A;  1G4A E;  1NY6 A;  1EIJ A;  3U6S A;  2QEN A;  2MH8 A;  2O25 A;  3HHY A;  1OFH A;  4DBG B;  4PT5 A;  1L2C A;  1MN3 A;  1R4G A;  1HNZ M;  1TH2 A;  5FTJ A;  4LFC M;  1R5L A;  2CEA A;  4JI0 M;  1DV0 A;  2FNA A;  2KEB A;  1D0K A;  4Y28 F;  4EIW A;  4GKK M;  3L2A A;  2KW0 A;  3JR4 A;  3HHZ A;  1DGH A;  3B74 A;  4FD2 A;  2Y0T A;  4DR1 M;  2FS1 A;  4DR3 M;  3U5Z A;  3F92 A;  3AOG A;  1VEG A;  4G4Q A;  4MGZ E;  1K3W A;  4DR5 M;  2HHH M;  4L4U A;  2V6Z M;  3QYE A;  4AZF A;  1QUT A;  1OIZ A;  4JI7 M;  2JY8 A;  2CFO A;  1G3I A;  3PVS A;  3IG8 A;  5KQD A;  3NBX X;  4DV3 M;  3E46 A;  3I51 A;  3GPX A;  1L8Q A;  3GLF E;  3H4M A;  5KPT A;  1HNX M;  1TH4 A;  3MJ5 A;  2DNA A;  2MRO B;  2R4E A;  4IBE A;  4GRI A;  4LY6 A;  1G71 A;  3K92 A;  3U60 B;  3GLF A;  4QHS A;  3CF0 A;  4LJ9 A;  5FSW A;  5L8R F;  1JQJ C;  1EE8 A;  2LVP C;  2F4V M;  2BNK A;  4IBK A;  5EQT A;  4JI1 M;  1TTE A;  4PD2 A;  2QNJ A;  2FOI C;  2JUJ A;  1D0L A;  1Z5C A;  4AQY M;  1TDH A;  2C99 A;  4DV0 M;  4YY3 M;  4CIZ A;  2DAE A;  1Q3B A;  1XXH A;  2WZJ A;  4OW0 A;  3EIE A;  2EA0 A;  1XMQ M;  2L2D A;  4AKG A;  2QPA A;  3K9O A;  2RKO A;  3TWL A;  1R2Y A;  5ITR A;  2XFT A;  4LJ7 A;  2JY5 A;  4BLC A;  3GPP A;  3SAS A;  1F4I A;  4JI3 M;  4GEW A;  4PDI A;  1NJF A;  2ZBK B;  3V76 A;  1WIV A;  1YSY A;  3FRH A;  4B7F A;  3GLI E;  3VKH A;  5FLX S;  1MU5 A;  3PXG A;  3D8B A;  1G59 A;  2LVQ D;  1D0M A;  3CTW B;  2Z4S A;  1GL6 A;  1PM5 A;  4JI8 M;  2HAK A;  1OFI A;  1PJI A;  1L1Z A;  3U6D A;  4M0W A;  3HHX A;  2HWJ A;  3PNV A;  2UU9 M;  4B7G A;  2UUC M;  4DR7 M;  4JI4 M;  1WJ7 A;  2APL A;  4M0D A;  4ZPX A;  1XXH E;  4Z8X A;  1VG5 A;  2A5Y B;  4NL4 H;  1OQY A;  5ITY A;  2Y0Q A;  3KOX E;  3DOA A;  3H4J A;  2J7O A;  2Z3X A;  3VDU A;  4X66 M;  2QSF X;  3GLI A;  2LBC A;  1MJG M;  5DYI A;  2MR9 A;  4CJ6 A;  2XSZ D;  3SBJ A;  4LJA A;  1NSF A;  3UZU A;  2EKK A;  1GKI A;  2LHG A;  2N35 A;  3HWS A;  3PFI A;  2LH0 A;  3B9P A;  3L26 A;  1IN5 A;  4P16 A;  2NQ8 C;  4XK8 F;  1QAQ A;  2LXE A;  4LCB A;  2BJW A;  4LJ5 A;  3W67 A;  3KSX A;  2EJS A;  4ITQ A;  1N78 A;  3DFZ A;  2OO9 A;  3Q8X A;  4WW0 A;  4MGK E;  3MMP A;  3W0F A;  1K3X A;  1QVR A;  2ZTD A;  1IXZ A;  4FVM A;  1YE9 A;  4LRT A;  1ZV1 A;  2DZO B;  2Z4R A;  3GRV A;  3ZH9 B;  3JR5 A;  4PCZ A;  2DWZ B;  3KXE C;  2GQF A;  1A5T A;  2XFS A;  4DV7 M;  1L2D A;  4JI6 M;  2KZU A;  1DO0 A;  2V1C A;  4I8O A;  2L4F A;  2CE7 A;  2XSZ A;  2DZL A;  2J7N A;  2QP9 X;  5EP1 A;  3QWL A;  4REZ A;  1T6O A;  3HZJ A;  1IY0 A;  3PNY A;  4FCW A;  3RGP A;  1E94 E;  3TE6 A;  1Z5A A;  1TR8 A;  3BXW A;  1XHB A;  1TF0 B;  4BB9 A;  3R8F A;  3UK6 A;  2XH9 A;  3SAR A;  3GRU A;  5DFL A;  3HU3 A;  5DNY A;  1FJG M;  1V34 A;  4GC5 A;  2DEN A;  2W82 A;  2EKF A;  3GRR A;  4B08 A;  2K6B A;  3QYB A;  5ITX A;  1KSF X;  1OTR A;  4AKH A;  2C9C A;  4GHL A;  5IRE B;  2ERC A;  2L6O A;  3FUV A;  1SG9 A;  1ZMV A;  2CUZ A;  3FUX A;  5EP4 A;  4JXJ A;  5EXS A;  4B3T M;  4YHH M;  4AKI A;  3AV0 A;  2CHG A;  4DV6 M;  3K8Z A;  3M7G A;  5LMU M;  1G41 A;  2YR0 A;  5ITQ A;  3T1Y M;  2K9D A;  3J27 B;  1NNJ A;  1G8P A;  3FKE A;  3RGS A;  4FW9 A;  2CV0 A;  1PJT A;  3A45 A;  2DAM A;  2YNM D;  4L16 A;  2VF8 A;  4Q7J A;  3I4V A;  1OKS A;  5BPV A;  3LMM A;  3HGI A;  3BOS A;  4IBF A;  2UXB M;  1N75 A;  2JXN A;  4MM3 B;  2DHR A;  1W5S A;  3HU2 A;  4L15 A;  4LF9 M;  7CAT A;  1QAO A;  3W0L B;  3KS4 A;  1HT2 E;  4LZJ A;  3A46 A;  1QZM A;  2M5Z A;  5EXT A;  1IXS B;  4LGY A;  4LF8 M;  3GO8 A;  4W5W A;  5DYG A;  1LTM A;  2WSF F;  5FTL A;  1V33 A;  4QNR A;  2JA2 A;  4DV1 M;  1OIP A;  1SXJ E;  3UJN A;  1NVM A;  3KW6 A;  3KP1 E;  5FTM A;  4DV2 M;  1C7Y A;  2E5L M;  3GLG A;  4JV5 M;  4NC6 A;  4OU7 A;  3HX3 A;  1IN4 A;  3GPY A;  1T43 A;  2KXE A;  1ORY B;  2R0I A;  4A3V B;  4B3S M;  2CP8 A;  3M0E A;  1HJP A;  2XLJ A;  1TGU A;  1YLA A;  2R45 A;  4AG6 A;  3FTD A;  1WXQ A;  4M9X A;  3HKP A;  3U61 A;  3IEC A;  2GNO A;  1L2B A;  3C58 A;  2R4J A;  2XZF A;  1R2Z A;  1IXR C;  1ZMU A;  1IN6 A;  1R7R A;  4MGI E;  3GLH A;  2DWL A;  1PJJ A;  3B7Z A;  1IQP A;  3VDP A;  4AG5 A;  4IJE A;  1DO2 A;  3C3D A;  3MK6 A;  4MB7 A;  4L8R C;  3FUT A;  1N36 M;  4B3R M;  4GH9 A;  3U6M A;  1XMO M;  1NV9 A;  2KHH A;  2ZAN A;  4XBO A;  2RGO A;  1VQ1 A;  4KHP M;  3A98 B;  5ITU A;  4NXN M;  3SMS A;  1XNR M;  3AKZ A;  3ILK A;  2BWB A;  2CHV A;  3B7N A;  3I4Y A;  4NRV A;  3FE3 A;  2G3Q A;  3T15 A;  4F1I A;  4G4N A;  2HCB A;  4NRW A;  4LRS A;  4JYA M;  5KPZ A;  2QQ8 A;  1YUB A;  1E9S A;  1JR3 E;  4JN6 A;  2V1U A;  4LFA M;  1GJS A;  3BBZ A;  3OTO M;  2VDB B;  1S3S A;  2VQF M;  3U5Z B;  1QAN A;  4NXM M;  3DA1 A;  3SAT A;  3FUW A;  1NV8 A;  1NHW C;  3HY5 A;  2B3T A;  3U6C A;  1PJQ A;  3VK7 A;  2OOA A;  4MH0 E;  1GLN A;  2DWM A;  4KT0 F;  1IBM M;  5FTN A;  1RU3 A;  1TH3 A;  2XF3 A;  3U60 A;  2LNH C;  1J7K A;  2D7H A;  2ZAM A;  3K1J A;  4R71 A;  1IN8 A;  2CV1 A;  4RKU F;  2UXC M;  3VKG A;  4IBB A;  3U6E A;  4NSO B;  5JI2 E;  2MJ5 B;  3EIH A;  5IWA M;  2DWN A;  3B89 A;  4LF7 M;  2KA6 B;  2XEP A;  4FWG A;  1XC8 A;  1NHG C;  2FE8 A;  4QHT A;  2F5O A;  1I4W A;  3AL0 C;  3WHK A;  2DKL A;  3SYL A; 
#chains in the Genus database with same CATH homology
 4CGY B;  3U6Q A;  1LV7 A;  2EO2 A;  2R65 A;  1ZAE A;  4IBI A;  4LJ4 A;  4D82 A;  1IBK M;  2C9O A;  3HJQ A;  2O5R A;  4X64 M;  3SC3 A;  2D7E A;  2QZ4 A;  5IZ7 D;  5JI3 E;  4GC9 A;  4DR6 M;  2AHM A;  1IM2 A;  3TWK A;  2HKJ A;  1XXH B;  5EP3 A;  1E9R A;  3TL4 X;  2C5R A;  5F3W A;  1Q3C A;  4OX9 M;  4GKJ M;  4I81 A;  4LGM A;  3SAU A;  2F5Q A;  1T3T A;  3KP0 E;  1SXJ B;  3KDS E;  4OVZ A;  3GLH B;  1K82 A;  1IY1 A;  2X8A A;  2R46 A;  3HJS A;  2DXI A;  3AFH A;  4GHA A;  4IJF A;  2VII A;  3GRY A;  2VQE M;  5ITT A;  3FTF A;  3U6L A;  2ZAO A;  3J81 S;  4KLN A;  1D2N A;  3FUU A;  3J7B A;  3TPZ A;  4K0K M;  5FTK A;  2DZN B;  1QYR A;  1NJG A;  3HHW A;  3KOZ E;  4HLQ A;  4B7H A;  3GLI B;  1I94 M;  3VLF B;  3K2L A;  4CHT B;  4RNA A;  4IBC A;  5LMN M;  2LWX A;  2C96 A;  3KOY E;  1Z59 A;  5E26 A;  2Q2E B;  3FTE A;  3MHV C;  4M9Z A;  2YFQ A;  3SYK A;  3J2P B;  1HNW M;  1SXJ D;  1DGF A;  4FCT A;  2UXD M;  2EUC A;  4LJ8 A;  1C1K A;  3KOW E;  1GVN A;  1Z6T A;  2FFJ A;  2K47 A;  5EJC A;  3FTC A;  3RE8 A;  4X62 M;  1TDZ A;  3FD9 A;  4LJ6 A;  2YQZ A;  2RGH A;  1FNN A;  4AW4 A;  3E4R A;  2G5G X;  3E9S A;  3T38 A;  1XNQ M;  1N33 M;  4Z6Y A;  1W5T A;  1N77 A;  3J80 S;  3TWM A;  4DUY M;  4LF5 M;  1J09 A;  2KRK A;  1N34 M;  4R7G A;  4L78 A;  3VFD A;  5EXX A;  3WHL A;  4OVZ B;  5KO3 A;  4M9S A;  4LFB M;  3UMM A;  4PDG A;  3GP1 A;  3ZC7 B;  3CF6 E;  1Z5B A;  2F5S A;  3LVV A;  3R9X B;  3L27 A;  2F5P A;  2Z7J A;  3IG5 A;  4AI6 A;  1SXJ C;  1XWI A;  2KRU A;  3M6A A;  3GLF B;  3RFW A;  3JAM S;  3KFU G;  4NSR A;  1DGG A;  4I5S A;  2XGN A;  2HL7 A;  2Y21 A;  4KO8 A;  4QOZ C;  3NWL A;  5GKN A;  2X49 A;  4IIW A;  1HT1 E;  1Q39 A;  4DR4 M;  3A42 A;  3L25 A;  1X37 A;  5E6J A;  1JR3 D;  1GL7 A;  3GQ5 A;  3FYD A;  3AOE C;  3NBI A;  1ZQ9 A;  2KZS A;  5KPR A;  1NNU C;  4IBG A;  2OPF A;  3U6P A;  3D8L A;  2QBY A;  1HR0 M;  4D80 A;  3AJI B;  3T1H M;  1J5E M;  1DGB A;  2C98 A;  3J7A S;  5IT9 S;  5EXP A;  2OQ4 A;  3GQ3 A;  1HQY E;  2R18 A;  4GIP A;  1H6U A;  4I4L A;  4XGI A;  2L09 A;  4LG2 A;  4G6Z A;  2Y20 A;  1HQC A;  4II7 A;  1IBL M;  3SAW A;  3KSJ A;  4BBA A;  4G4R A;  2CV2 A;  1N32 M;  4D81 A;  1JR3 A;  2H1R A;  4JI2 M;  3LQQ A;  3SAV A;  4GMQ A;  4LZZ A;  8CAT A;  3CF2 A;  2I7P A;  4G4O A;  1IN7 A;  4FWH A;  4QOS A;  4LF4 M;  5C18 A;  3L28 A;  4DV4 M;  3UGJ A;  2BJV A;  4JI5 M;  5BR8 M;  4GIT A;  2R62 A;  4WUR A;  1NY5 A;  2L7H A;  3U61 B;  5A2Q S;  5EP2 A;  2QBY B;  1E32 A;  3LVW A;  3GQ4 A;  2UUA M;  2P5T A;  3THG A;  3HJ8 A;  5C1B A;  2G8L A;  2X4A A;  4DR2 M;  4CIS A;  4MGH A;  3SHF A;  1SXJ A;  1R6B X;  5ITX E;  1OJL A;  3FYC A;  3ZCB B;  4RF1 A;  2QCU A;  1UM8 A;  4QNM A;  3DZD A;  5KQ8 A;  3KVW A;  1L1T A;  4RF0 A;  3SHG B;  3SMP A;  2D7G A;  2UUB M;  3VK8 A;  4S12 A;  3QAU A;  4FCV A;  4R3D A;  4LF6 M;  4IBD A;  3AOE A;  2I7N A;  2CHQ A;  3GLG B;  3LQR A;  5H37 D;  1KYI A;  4HL4 A;  1MX0 A;  4FWD A;  3GPU A;  2F5N A;  1QAM A;  1VDD A;  3TQS A;  4DUZ M;  2DVW B;  2ZM6 M;  4DV5 M;  1QQW A;  3SFZ A;  4X65 M;  2L7I A;  1IY2 A;  4B3M M;  4TUW A;  1KFV A;  1DGH B;  2M60 A;  4KOD A;  2XZU A;  3KS8 A;  4MGY E;  4IBJ A;  4NOO B;  3U6O A;  3HU1 A;  3L29 A;  1G4A E;  1NY6 A;  3U6S A;  2QEN A;  3HHY A;  1OFH A;  4PT5 A;  1L2C A;  1HNZ M;  1TH2 A;  5FTJ A;  4LFC M;  2CEA A;  4JI0 M;  2FNA A;  2KEB A;  4EIW A;  4GKK M;  3L2A A;  2KW0 A;  3JR4 A;  3HHZ A;  1DGH A;  4FD2 A;  2Y0T A;  4DR1 M;  4DR3 M;  3U5Z A;  3AOG A;  4G4Q A;  4MGZ E;  1K3W A;  4DR5 M;  2HHH M;  4L4U A;  2V6Z M;  4AZF A;  4JI7 M;  2CFO A;  1G3I A;  3PVS A;  3IG8 A;  5KQD A;  4DV3 M;  3I51 A;  3GPX A;  1L8Q A;  3H4M A;  5KPT A;  1HNX M;  1TH4 A;  3MJ5 A;  4LY6 A;  4IBE A;  2R4E A;  4GRI A;  3K92 A;  3U60 B;  3GLF A;  4QHS A;  3CF0 A;  4LJ9 A;  5FSW A;  1JQJ C;  1EE8 A;  2F4V M;  2BNK A;  4IBK A;  5EQT A;  4JI1 M;  4PD2 A;  2FOI C;  1Z5C A;  4AQY M;  1TDH A;  2C99 A;  4DV0 M;  4YY3 M;  1Q3B A;  1XXH A;  4OW0 A;  3EIE A;  2EA0 A;  1XMQ M;  4AKG A;  2QPA A;  3TWL A;  2RKO A;  1R2Y A;  5ITR A;  2XFT A;  4LJ7 A;  3GPP A;  4BLC A;  3SAS A;  4JI3 M;  4PDI A;  1NJF A;  2ZBK B;  1YSY A;  3VKH A;  4B7F A;  5FLX S;  1MU5 A;  3PXG A;  3D8B A;  1G59 A;  3CTW B;  2Z4S A;  1GL6 A;  1PM5 A;  4JI8 M;  1OFI A;  1PJI A;  1L1Z A;  3U6D A;  4M0W A;  3HHX A;  2UU9 M;  3PNV A;  2UUC M;  4B7G A;  4DR7 M;  4JI4 M;  4M0D A;  4ZPX A;  4Z8X A;  2A5Y B;  4NL4 H;  5ITY A;  2Y0Q A;  3KOX E;  3DOA A;  2Z3X A;  2J7O A;  3VDU A;  4X66 M;  3GLI A;  5DYI A;  2XSZ D;  3SBJ A;  4LJA A;  1NSF A;  3UZU A;  3PFI A;  1GKI A;  3HWS A;  3L26 A;  2LH0 A;  3B9P A;  1IN5 A;  4P16 A;  2NQ8 C;  1QAQ A;  2LXE A;  4LCB A;  2BJW A;  4LJ5 A;  3KSX A;  4ITQ A;  1N78 A;  3DFZ A;  3Q8X A;  4WW0 A;  4MGK E;  1K3X A;  3W0F A;  1QVR A;  1IXZ A;  4FVM A;  1YE9 A;  4LRT A;  2DZO B;  2Z4R A;  3GRV A;  3ZH9 B;  3JR5 A;  4PCZ A;  2DWZ B;  3KXE C;  4DV7 M;  1L2D A;  2XFS A;  4JI6 M;  2KZU A;  1DO0 A;  2V1C A;  4I8O A;  2XSZ A;  2CE7 A;  2J7N A;  2QP9 X;  5EP1 A;  3QWL A;  4REZ A;  1IY0 A;  3PNY A;  4FCW A;  3RGP A;  1E94 E;  3TE6 A;  1Z5A A;  1XHB A;  4BB9 A;  3R8F A;  3UK6 A;  2XH9 A;  3SAR A;  3GRU A;  3HU3 A;  5DNY A;  1FJG M;  4GC5 A;  2W82 A;  3GRR A;  4B08 A;  5ITX A;  1KSF X;  4AKH A;  2C9C A;  4GHL A;  5IRE B;  2ERC A;  2L6O A;  3FUV A;  2CUZ A;  5EP4 A;  3FUX A;  5EXS A;  4JXJ A;  4B3T M;  4AKI A;  4YHH M;  3AV0 A;  2CHG A;  4DV6 M;  3K8Z A;  3M7G A;  5LMU M;  1G41 A;  2YR0 A;  5ITQ A;  3T1Y M;  3J27 B;  1NNJ A;  1G8P A;  3FKE A;  3RGS A;  4FW9 A;  2CV0 A;  3A45 A;  2YNM D;  4L16 A;  3I4V A;  5BPV A;  3LMM A;  3HGI A;  3BOS A;  4IBF A;  2UXB M;  1N75 A;  4MM3 B;  2DHR A;  1W5S A;  3HU2 A;  4L15 A;  4LF9 M;  7CAT A;  1QAO A;  3W0L B;  3KS4 A;  1HT2 E;  4LZJ A;  3A46 A;  1QZM A;  2M5Z A;  5EXT A;  1IXS B;  4LGY A;  4LF8 M;  3GO8 A;  4W5W A;  5DYG A;  5FTL A;  4QNR A;  2JA2 A;  4DV1 M;  1SXJ E;  3UJN A;  1NVM A;  3KW6 A;  3KP1 E;  5FTM A;  4DV2 M;  2E5L M;  3GLG A;  4JV5 M;  4OU7 A;  1IN4 A;  3GPY A;  2KXE A;  1ORY B;  4A3V B;  4B3S M;  3M0E A;  2XLJ A;  1TGU A;  4AG6 A;  2R45 A;  3FTD A;  1WXQ A;  4M9X A;  3HKP A;  3U61 A;  1L2B A;  3C58 A;  2R4J A;  2XZF A;  1R2Z A;  1IXR C;  1IN6 A;  1R7R A;  4MGI E;  3GLH A;  2DWL A;  1PJJ A;  1IQP A;  3VDP A;  4AG5 A;  4IJE A;  1DO2 A;  3MK6 A;  4MB7 A;  4L8R C;  3FUT A;  1N36 M;  4B3R M;  4GH9 A;  3U6M A;  1XMO M;  2ZAN A;  4XBO A;  2RGO A;  4KHP M;  3A98 B;  5ITU A;  4NXN M;  3SMS A;  1XNR M;  3AKZ A;  3ILK A;  3I4Y A;  2CHV A;  4NRV A;  4JYA M;  4G4N A;  2HCB A;  4NRW A;  4LRS A;  5KPZ A;  1YUB A;  1E9S A;  4JN6 A;  2V1U A;  4LFA M;  3OTO M;  1S3S A;  2VQF M;  3U5Z B;  1QAN A;  4NXM M;  3DA1 A;  3SAT A;  3FUW A;  1NHW C;  3U6C A;  3VK7 A;  4MH0 E;  1GLN A;  2DWM A;  1IBM M;  5FTN A;  1TH3 A;  2XF3 A;  3U60 A;  2LNH C;  1J7K A;  2D7H A;  2ZAM A;  3K1J A;  2CV1 A;  1IN8 A;  2UXC M;  3VKG A;  4IBB A;  3U6E A;  4NSO B;  5JI2 E;  5IWA M;  3EIH A;  2DWN A;  4LF7 M;  2KA6 B;  2XEP A;  4FWG A;  1XC8 A;  1NHG C;  2FE8 A;  4QHT A;  2F5O A;  1I4W A;  3AL0 C;  3WHK A;  3T15 A;  3SYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...