2Y21A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
ITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords HAMP
publication title The mechanisms of HAMP-mediated signaling in transmembrane receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y21A00
2Y20A 2Y0QA 4I5SA 2Y21A 2L7HA 2Y0TA 2L7IA
chains in the Genus database with same CATH superfamily
4I8OA 3FTEA 5IWAM 4L6V6 5KQ8A 4X65M 2EJSA 4DR1M 4AKIA 2DI0A 5DFLA 3U61B 1IXZA 1WJ7A 2BJVA 3RGPA 2XGNA 3A45A 3LVVA 3PXGA 2RRUA 4RF0A 4DBGB 3GLFE 1NJFA 2QP9X 5EXPA 3L25A 2C98A 3SHFA 3GLHE 3W67A 1XMOM 3PVSA 2OOAA 3FYDA 1XWIA 4KT0F 2C5RA 4QOZC 2CEAA 2XFTA 2F5NA 3HJSA 1C7YA 1E32A 5FLXS 4MGYE 1VDLA 2KRUA 2MROB 3CF6E 3U6OA 2K0BX 1JR3D 4B3SM 1XNRM 4G4NA 3AKZA 3U6SA 1IXRC 2J7NA 2VIIA 1T3TA 1JR3A 4LFCM 5FTJA 2W82A 2GNOA 3RE8A 2LVAA 4I81A 1EFUB 3AV0A 4GC9A 2H5XA 4JI2M 1X37A 3KVWA 1NV9A 2ZAOA 2UU9M 3D8LA 3GPUA 4MGKE 3DZDA 4IBKA 1XXHB 4R7GA 5ITXE 4IJFA 1NY6A 4B3TM 2UXCM 2ZM6M 4QHTA 3CTWB 1N34M 4WW0A 3Q8XA 4FWDA 4GC5A 3W0FA 3U5ZA 1IY0A 3KXEC 4A3VB 5KPRA 3KS8A 2XEPA 5EJCA 1UM8A 3KOWE 4K0KM 3HY5A 1BVSA 2LWXA 1V33A 1QAOA 4F2LA 1VDDA 1JB0F 2HAKA 3SMPA 5KPZA 1OTRA 2L4FA 1N33M 2CP8A 5EXXA 2J5YA 4OVZB 4I4LA 2QENA 3ZC7B 1K82A 4L78A 2BWBA 4Q7JA 3GPPA 1LV7A 1G71A 5JI2E 4JN6A 3IHPA 4R3DA 3J2PB 2L7IA 2KZSA 3W68A 3TWKA 4BB9A 3DFZA 2D7GA 3LQRA 2P5TA 3GPYA 2K47A 1GABA 3VKHA 1H6UA 2MJ5B 1XXHA 1YUBA 3ILKA 5FTNA 3TE6A 1KYIA 3PFIA 4M9ZA 1IBLM 2VF8A 2CUZA 2R4JA 4GHAA 4DUZM 5IREB 4DV2M 4JI5M 2Y20A 4G6ZA 1IN6A 3MJ5A 1W5SA 4B3MM 2CWBA 3GRUA 2D7HA 5KQDA 2Z8YM 4X64M 2XLJA 2RGHA 3AOEA 3TWLA 4PD2A 4LJ5A 4G4RA 4M0DA 3SASA 2V1CA 2C99A 1NSFA 2LNHC 2QQ8A 2ZBKB 1WXQA 3KFUG 1RU3A 1TDHA 3H4JA 3KOYE 2E5LM 1G4AE 4DV0M 2K9DA 1ZAEA 2LH0A 4LJ6A 1Q3BA 1NY5A 1SXJE 1VEJA 1D0MA 2OPFA 2WZJA 1Z5CA 5ITYA 4FWHA 4M9SA 1R2ZA 3HU3A 3E4RA 3Q8GA 1NV8A 3GLGB 3UMMA 2VQFM 1JR3E 2QSFX 2MR9A 2C9CA 1JQJC 3W0LB 2UUBM 4QNRA 4JI6M 2CE7A 1MJGM 4TUWA 3R9XB 4LJAA 3AL0C 4FVMA 3KS4A 4IBGA 1IY1A 3HKPA 4CGYB 5H37D 1QAMA 2A5YB 3VFDA 3WHLA 1HNXM 2M60A 3J7BA 4GKJM 1IM2A 4AKHA 2Z4RA 5EP1A 1J5EM 2ZANA 4AZFA 2UXBM 4M9XA 1NVMA 1QYRA 3LVWA 3SYLA 4AI6A 2CFOA 2HKJA 1L2CA 2CHGA 5DYIA 4OX9M 2L4EA 2G8LA 3U60A 2QZ4A 4GKKM 2X49A 2QHOB 4IBFA 3AOGA 4IIWA 4II7A 3JAMS 1P3QQ 1E94E 3U6LA 2R65A 4DR5M 2DWZB 1G3IA 1IN7A 1ZMUA 1W5TA 4JI1M 3TPZA 2JZ1A 3A46A 2KNZA 2DHYA 1PGYA 2Z4SA 3M0EA 5JI3E 3U5ZB 1OAOC 4DR7M 1WGNA 2Z7JA 3CF2A 2DAKA 3PNYA 4JYAM 3IG8A 3L28A 1NHWC 2L09A 1FNNA 1IQPA 3GLGA 2JNHA 4LFBM 2FH0A 3E46A 4CISA 1DGGA 1L2DA 4XBOA 3U6DA 2VF7A 4GEWA 1HR0M 2OOBA 1Q3CA 2HL7A 2YNMD 1OKSA 1XB2B 1XXHE 1GLNA 5FSWA 1WHCA 2FNAA 1OJLA 4LRSA 1FJGM 3J81S 4KO8A 3UZUA 2KA6B 4LF7M 1ZMVA 2F5PA 1R4GA 4FCTA 3WHKA 4PCZA 2XZFA 2UXDM 3GLIA 2BJWA 3GQ3A 2DAGA 2EKKA 3L27A 3JR4A 3FE3A 3R8FA 2DWNA 3UK6A 3U6CA 2DAIA 4LZZA 2DWMA 5DNYA 4NSRA 3SMSA 5BPVA 5FTLA 3LCUA 3B7QA 3FRHA 4LY6A 2HWJA 2YFQA 4IBCA 4G4QA 3FUXA 4BBAA 1ZQ9A 2KZUA 2Y0TA 3U6EA 1N36M 1D2NA 3UJNA 3HZJA 3HHZA 1VG5A 3LMMA 3VLFB 4B7HA 2R44A 1NO1A 2L7HA 2CV2A 3D8BA 1DO2A 3MMPA 3T15A 2X4AA 2X8AA 3KSXA 5ITQA 3LCVB 2F5OA 2JWSA 3QYEA 2JUJA 2MH8A 4KHPM 1D0LA 2DZOB 4LJ4A 1TH3A 3MHVC 2ZTDA 3L26A 4GHLA 1GJSA 4PDGA 2DAEA 3U6MA 2RKOA 5EXSA 2FE8A 1N75A 1ZV1A 2J7OA 3FYCA 4LJ9A 3HGIA 2DVWB 3HHXA 3F92A 2HCBA 4FW9A 4JI7M 2KXEA 1N77A 1I94M 3ZH9B 4G3OA 5C1BA 2O5RA 3L2AA 3QWLA 2EO2A 4GH9A 2JY6B 2EKFA 2XSZD 4S12A 4B7GA 1YLAA 4JXJA 4LFAM 2DENA 1T43A 2KNVA 3QAUA 2XSZA 3B7ZA 4P16A 3T38A 5KPTA 2HHHM 2D7EA 3BOSA 4ITQA 2CRUA 3K9OA 3KP1E 3J7AS 4WP2A 1E9RA 1Z59A 1EE8A 1GJTA 2G5GX 5A2QS 3GQ5A 3DOAA 3U60B 4IBJA 4REZA 1MX0A 2JXNA 5IZ7D 2KRKA 3ZCBB 3T1HM 2ERCA 1QQWA 2LVNC 2ZAMA 5GKNA 3KOZE 2LTUA 5LMUM 1L1ZA 4P17A 4GIPA 5DYGA 5BR8M 3B89A 1HQYE 1F4IA 3E21A 3SAVA 1N78A 3NBIA 3TQSA 3J80S 3T1YM 3GO8A 3OTOM 3FTDA 4Z6YA 4RNAA 4HL4A 4ANRA 1HNWM 4MGZE 3I01M 4LRTA 2K6BA 1IN4A 2JA2A 3C3EA 1IXSB 3SARA 4NSOB 1YSYA 2FFJA 2R45A 4WURA 1J09A 4F1IA 3C58A 1G41A 4LF9M 4DUYM 2L6OA 4NXMM 1TH2A 4DR2M 3B9PA 1Z5AA 2QCUA 4YHHM 1AUAA 3KOXE 2KHHA 3HHWA 4D81A 1PJIA 3GLIB 2R18A 4Z8XA 1UFZA 2JP7A 3CF0A 4CIZA 1TDZA 4RKUF 4LJ8A 1HNZM 1AIPC 1IN5A 4FCWA 1KFVA 1DV0A 2F5SA 1Z6TA 4DV3M 2I7NA 3EIHA 2DKLA 2LHCA 5IT9S 4HEOA 4QHSA 2RGOA 3T6PA 1DGFA 4DV5M 2UUCM 4GRIA 1IFYA 2DZNB 4PDIA 1N32M 3I4YA 5L8RF 3I4VA 2CV0A 1SXJB 2V6ZM 4FWGA 2XFSA 1IN8A 4DV1M 3HJ8A 3K8ZA 1VQ1A 2BWEA 1TR8A 1HT1E 1IY2A 4XGIA 1YE9A 1WGLA 3FUUA 3FUTA 1KSFX 2KNAA 2QPAA 4B7FA 4B08A 3C3DA 2F5QA 3HX3A 3VDUA 3AJIB 3EIEA 3ZQJA 2YR0A 3HU2A 4DV4M 1IBKM 2BNKA 4JI4M 1R2YA 1IXSA 2CV1A 4UN2B 3M6AA 2R4EA 4QNMA 1DGHB 4DR6M 2LVPC 2CHVA 5E26A 3A42A 3GPXA 3SBJA 3K92A 4B3RM 2APLA 1G8PA 1ORYB 2JY8A 4X66M 4RF1A 3BBZA 3RFWA 3VDPA 2C9OA 2QNJA 3K9PA 4KODA 4L15A 1QAQA 3SATA 1TTEA 1ZMWA 2KDLA 1R7RA 1PRBA 4LCBA 1XHBA 5ITTA 4OU7A 2WSCF 2DWLA 2F4VM 2G3QA 2LXEA 4NRWA 1PM5A 1V92A 1L8QA 3V76A 3GRVA 2EA0A 1XNQM 1QUTA 3FUVA 2DZLA 4IJEA 1HJPA 2JY5A 1C1KA 4D82A 3RGSA 3KW6A 3SAWA 3HU1A 1SXJD 3BXWA 4MM3B 1LTMA 1E9SA 2OO9A 3GLFB 1SXJA 2DNAA 2LVQD 2I7PA 3FRIA 3GLHB 2GQFA 1PJTA 1QDRA 5E6JA 1PJQA 2FOIC 3KSJA 1QUSA 4FCVA 4FD2A 2KEBA 4Y28F 5EQTA 1L2BA 5EXTA 4LF6M 4LJ7A 1IBMM 4ZPXA 2XH9A 4KLNA 1R5LA 7CATA 1DGHA 1XC8A 1TGUA 5KO3A 5ITRA 3VKGA 1DGBA 1NNUC 3NBXX 1GL6A 4L8RC 5F3WA 4AQYM 1DO0A 4NOOB 4XK8F 3HWSA 5FTMA 2Z3XA 4JV5M 1QZEA 1Q02A 1SXJC 1TF0B 1WIVA 2CHQA 2R46A 1QVRA 2JZ0A 1NNJA 3U61A 4DV6M 4JI3M 1QZMA 1T6OA 1MU5A 3I04M 4MGIE 4M0WA 4NC6A 2VQEM 4OW0A 4AG5A 3UGJA 1OIPA 1VEGA 1PJJA 2UUAM 3SYKA 4LF8M 3MK6A 2WSFF 1I4WA 2R6FA 3KP0E 5EP2A 3JR5A 2QBYB 1V34A 2ZTCA 3GRYA 5LMNM 3FD9A 2VDBB 3GRRA 3AFHA 2DXIA 4AW4A 4D80A 4IBEA 2C96A 2LHGA 3QYBA 2O25A 4L4UA 2NQ8C 3GLFA 3L29A 2WSEF 1QANA 4NRVA 3GLHA 3FUWA 1K3XA 2N35A 4AKGA 1TH4A 5EP3A 4YY3M 2L2DA 1GO5A 2EUCA 1QDTA 3GLGE 4NL4H 2MGWA 3GP1A 3I51A 1XMQM 3TWMA 1Q39A 1NHGC 4QOSA 2Q2EB 8CATA 3THGA 4G4OA 1J7KA 3SAUA 3IECA 4IBIA 1OQYA 3B7NA 3SC3A 2LBCA 1MN3A 3LQQA 2OQ4A 1OIZA 3C9PA 3DA1A 4EIWA 4MH0E 1R6BX 1G59A 5ITXA 1VEKA 3GLIE 4I5SA 1HQCA 3LW5F 1NJGA 3IG5A 4W5WA 2XZUA 3VK8A 2KW0A 4LGYA 3K2LA 4NXNM 2QBYA 4DR4M 1OAIA 2XF3A 4LGMA 2V1UA 1D0KA 3FKEA 3B74A 4HLQA 5C18A 2R0IA 2DHRA 3H4MA 4X62M 4GMQA 4OVZA 4CHTB 3U6QA 2FS1A 4GITA 1CUKA 5ITUA 4JI8M 4LZJA 3VK7A 2B3TA 3FTFA 1OFIA 3NWLA 4DV7M 1A5TA 2H1RA 3HJQA 3SHGB 1Y8GA 2O01F 1S3SA 3AOEC 4L16A 4PT5A 4CJ6A 4MGHA 1GKIA 2M5ZA 4R71A 4LF4M 4MB7A 2DAMA 2AHMA 4BLCA 1HT2E 1GL7A 4LG2A 1EIJA 4JI0M 1OFHA 3M7GA 3SFZA 2LVOC 1K3WA 1PJSA 3CGWA 5EP4A 4LF5M 3K1JA 5FTKA 3U6PA 3GQ4A 3KDSE 2R62A 3E9SA 4AG6A 2Y0QA 2JY7A 4IBDA 1Z5BA 2YQZA 3PNVA 4IBBA 1WR1B 3FTCA 3J27B 2Y21A 4DR3M 3HHYA 3A98B 3TL4X 1SG9A 1L1TA 1GVNA
chains in the Genus database with same CATH topology
4I8OA 3FTEA 5IWAM 5KQ8A 4X65M 4DR1M 4AKIA 3U61B 1IXZA 3RGPA 2BJVA 2XGNA 3A45A 3LVVA 3PXGA 4RF0A 1NJFA 2QP9X 5EXPA 3L25A 2C98A 3SHFA 1XMOM 3PVSA 3FYDA 1XWIA 2C5RA 4QOZC 2CEAA 2XFTA 2F5NA 3HJSA 1E32A 5FLXS 4MGYE 3CF6E 2KRUA 3U6OA 1JR3D 4B3SM 1XNRM 4G4NA 3AKZA 3U6SA 1IXRC 2J7NA 2VIIA 1T3TA 1JR3A 4LFCM 5FTJA 2W82A 3RE8A 4I81A 4JI2M 3AV0A 4GC9A 1X37A 3KVWA 2ZAOA 2UU9M 3D8LA 3GPUA 4MGKE 3DZDA 4IBKA 1XXHB 4R7GA 5ITXE 4IJFA 1NY6A 4B3TM 2UXCM 2ZM6M 4QHTA 3CTWB 1N34M 4WW0A 3Q8XA 4FWDA 4GC5A 3W0FA 3U5ZA 1IY0A 3KXEC 4A3VB 5KPRA 3KS8A 2XEPA 5EJCA 1UM8A 3KOWE 4K0KM 2LWXA 1QAOA 1VDDA 3SMPA 5KPZA 1N33M 5EXXA 4OVZB 4I4LA 2QENA 3ZC7B 1K82A 4L78A 3GPPA 1LV7A 5JI2E 4JN6A 4R3DA 3J2PB 2L7IA 2KZSA 3TWKA 4BB9A 3DFZA 2D7GA 3LQRA 2P5TA 3GPYA 2K47A 3VKHA 1H6UA 5FTNA 1XXHA 1YUBA 3ILKA 3TE6A 1KYIA 3PFIA 4M9ZA 1IBLM 2CUZA 2R4JA 4GHAA 4DUZM 5IREB 4DV2M 4JI5M 2Y20A 4G6ZA 1IN6A 3MJ5A 1W5SA 4B3MM 3GRUA 2D7HA 5KQDA 4X64M 2XLJA 2RGHA 3AOEA 3TWLA 4PD2A 4LJ5A 4G4RA 4M0DA 3SASA 2V1CA 2C99A 1NSFA 2LNHC 2ZBKB 1WXQA 3KFUG 1TDHA 3KOYE 2E5LM 1G4AE 4DV0M 1ZAEA 2LH0A 4LJ6A 1Q3BA 1NY5A 1SXJE 2OPFA 1R2ZA 1Z5CA 5ITYA 4FWHA 4M9SA 3HU3A 3E4RA 3GLGB 3UMMA 2VQFM 2UUBM 2C9CA 1JQJC 3W0LB 4QNRA 4JI6M 2CE7A 4TUWA 3R9XB 4LJAA 3AL0C 4FVMA 3KS4A 4IBGA 1IY1A 3HKPA 4CGYB 5H37D 1QAMA 2A5YB 3VFDA 3WHLA 1HNXM 2M60A 3J7BA 4GKJM 1IM2A 4AKHA 2Z4RA 5EP1A 1J5EM 2ZANA 4AZFA 2UXBM 4M9XA 1NVMA 1QYRA 3LVWA 3SYLA 4AI6A 2CFOA 2HKJA 1L2CA 2CHGA 5DYIA 4OX9M 2G8LA 3U60A 2QZ4A 4GKKM 2X49A 4IBFA 4IIWA 3AOGA 4II7A 3JAMS 1E94E 3U6LA 2R65A 4DR5M 2DWZB 1G3IA 1IN7A 4JI1M 1W5TA 3TPZA 3A46A 5JI3E 3M0EA 3U5ZB 2Z4SA 4DR7M 2Z7JA 3CF2A 4JYAM 3PNYA 3IG8A 3L28A 1NHWC 2L09A 1FNNA 1IQPA 3GLGA 4LFBM 4CISA 1DGGA 1L2DA 4XBOA 3U6DA 1HR0M 1Q3CA 2HL7A 2YNMD 1GLNA 5FSWA 2FNAA 4LRSA 1OJLA 1FJGM 3J81S 4KO8A 3UZUA 2KA6B 4LF7M 2F5PA 4FCTA 3WHKA 4PCZA 2XZFA 2UXDM 3GLIA 2BJWA 3GQ3A 3L27A 3JR4A 3R8FA 2DWNA 3UK6A 3U6CA 4LZZA 2DWMA 5DNYA 4NSRA 3SMSA 5BPVA 5FTLA 4LY6A 4G4QA 2YFQA 4IBCA 3FUXA 4BBAA 1ZQ9A 2KZUA 2Y0TA 3U6EA 1N36M 1D2NA 3UJNA 3HHZA 3VLFB 3LMMA 4B7HA 2L7HA 2CV2A 3D8BA 1DO2A 3T15A 2X4AA 2X8AA 3KSXA 5ITQA 2F5OA 4KHPM 2DZOB 4LJ4A 1TH3A 3MHVC 4GHLA 3L26A 4PDGA 3U6MA 2RKOA 5EXSA 2FE8A 1N75A 2J7OA 3FYCA 4LJ9A 3HGIA 2DVWB 3HHXA 2HCBA 4FW9A 4JI7M 2KXEA 1N77A 1I94M 3ZH9B 5C1BA 2O5RA 3L2AA 3QWLA 2EO2A 4GH9A 2XSZD 4S12A 4B7GA 4JXJA 4LFAM 3QAUA 4P16A 2XSZA 3T38A 5KPTA 3J7AS 2HHHM 2D7EA 3BOSA 4ITQA 3KP1E 1E9RA 1Z59A 1EE8A 2G5GX 5A2QS 3GQ5A 3DOAA 3U60B 4IBJA 4REZA 1MX0A 5IZ7D 2KRKA 3ZCBB 3T1HM 2ERCA 1QQWA 5GKNA 2ZAMA 5LMUM 3KOZE 1L1ZA 4GIPA 5DYGA 5BR8M 1HQYE 3SAVA 1N78A 3NBIA 3TQSA 3J80S 3T1YM 3GO8A 3OTOM 3FTDA 4Z6YA 4RNAA 4HL4A 1HNWM 4MGZE 4LRTA 1IN4A 2JA2A 3SARA 1IXSB 4NSOB 1YSYA 2FFJA 2R45A 4WURA 1J09A 3C58A 1G41A 4LF9M 4DUYM 2L6OA 4NXMM 1TH2A 4DR2M 3B9PA 1Z5AA 2QCUA 4YHHM 3KOXE 3HHWA 4D81A 1PJIA 3GLIB 2R18A 4Z8XA 1TDZA 3CF0A 4LJ8A 1HNZM 4FCWA 1IN5A 1KFVA 2F5SA 1Z6TA 4DV3M 2I7NA 3EIHA 5IT9S 4QHSA 2RGOA 1DGFA 4DV5M 2UUCM 4GRIA 2DZNB 4PDIA 1N32M 3I4YA 2CV0A 3I4VA 1SXJB 2V6ZM 4FWGA 2XFSA 1IN8A 4DV1M 3HJ8A 3K8ZA 1HT1E 1IY2A 4XGIA 1YE9A 3FUUA 3FUTA 2F5QA 1KSFX 2QPAA 4B7FA 4B08A 3VDUA 3AJIB 3EIEA 4DV4M 2YR0A 3HU2A 1IBKM 2BNKA 4JI4M 1R2YA 2CV1A 3M6AA 2R4EA 4QNMA 1DGHB 4DR6M 2CHVA 5E26A 3A42A 3GPXA 3SBJA 3K92A 4B3RM 1G8PA 1ORYB 4X66M 4RF1A 3RFWA 3VDPA 2C9OA 4KODA 4L15A 1QAQA 3SATA 1R7RA 5ITTA 4LCBA 1XHBA 4OU7A 2DWLA 2F4VM 2LXEA 4NRWA 1PM5A 1L8QA 3GRVA 2EA0A 1XNQM 3FUVA 4IJEA 1C1KA 4D82A 3RGSA 3KW6A 3SAWA 3HU1A 1SXJD 4MM3B 1E9SA 3GLFB 1SXJA 2I7PA 3GLHB 5E6JA 2FOIC 3KSJA 4FCVA 4FD2A 2KEBA 5EQTA 1L2BA 5EXTA 4LF6M 4LJ7A 1IBMM 4ZPXA 2XH9A 4KLNA 7CATA 1DGHA 1XC8A 1TGUA 5KO3A 5ITRA 3VKGA 1DGBA 1NNUC 1GL6A 4L8RC 5F3WA 4AQYM 1DO0A 4NOOB 3HWSA 5FTMA 2Z3XA 4JV5M 1SXJC 2CHQA 2R46A 1QVRA 1NNJA 3U61A 4DV6M 4JI3M 1QZMA 4MGIE 1MU5A 2VQEM 4M0WA 4OW0A 4AG5A 3UGJA 1PJJA 2UUAM 3SYKA 4LF8M 3MK6A 3KP0E 1I4WA 5EP2A 3JR5A 2QBYB 3GRYA 5LMNM 3FD9A 3GRRA 3AFHA 2DXIA 4AW4A 4D80A 4IBEA 2C96A 3GLFA 4L4UA 2NQ8C 3L29A 1QANA 4NRVA 3GLHA 3FUWA 1K3XA 4AKGA 1TH4A 5EP3A 4YY3M 2EUCA 4NL4H 3GP1A 3I51A 1XMQM 3TWMA 1Q39A 1NHGC 4QOSA 2Q2EB 8CATA 3THGA 4G4OA 1J7KA 3SAUA 4IBIA 3SC3A 3LQQA 2OQ4A 3DA1A 4EIWA 4MH0E 1R6BX 1G59A 5ITXA 4I5SA 1HQCA 1NJGA 3IG5A 4W5WA 2XZUA 3VK8A 2KW0A 4LGYA 3K2LA 4NXNM 2QBYA 4DR4M 2XF3A 4LGMA 2V1UA 3FKEA 4HLQA 5C18A 3H4MA 2DHRA 4X62M 4GMQA 4OVZA 4CHTB 3U6QA 4GITA 5ITUA 4JI8M 4LZJA 3VK7A 3FTFA 1OFIA 3NWLA 4DV7M 2H1RA 3HJQA 3SHGB 1S3SA 3AOEC 4L16A 4PT5A 4MGHA 1GKIA 2M5ZA 4LF4M 4MB7A 2AHMA 4BLCA 1HT2E 1GL7A 4LG2A 4JI0M 1OFHA 3M7GA 3SFZA 1K3WA 5EP4A 4LF5M 3K1JA 5FTKA 3U6PA 3GQ4A 3KDSE 2R62A 3E9SA 4AG6A 2Y0QA 4IBDA 1Z5BA 2YQZA 3PNVA 4IBBA 3FTCA 3J27B 2Y21A 4DR3M 3HHYA 3A98B 3TL4X 1L1TA 1GVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y20 A;  2Y0Q A;  4I5S A;  2Y21 A;  2L7H A;  2Y0T A;  2L7I A; 
#chains in the Genus database with same CATH topology
 4I8O A;  3FTE A;  5IWA M;  4L6V 6;  5KQ8 A;  4X65 M;  2EJS A;  4DR1 M;  4AKI A;  2DI0 A;  5DFL A;  3U61 B;  1IXZ A;  1WJ7 A;  2BJV A;  3RGP A;  2XGN A;  3A45 A;  3LVV A;  3PXG A;  2RRU A;  4RF0 A;  4DBG B;  3GLF E;  1NJF A;  2QP9 X;  5EXP A;  3L25 A;  2C98 A;  3SHF A;  3GLH E;  3W67 A;  1XMO M;  3PVS A;  2OOA A;  3FYD A;  1XWI A;  4KT0 F;  2C5R A;  4QOZ C;  2CEA A;  2XFT A;  2F5N A;  3HJS A;  1C7Y A;  1E32 A;  5FLX S;  4MGY E;  1VDL A;  2KRU A;  2MRO B;  3CF6 E;  3U6O A;  2K0B X;  1JR3 D;  4B3S M;  1XNR M;  4G4N A;  3AKZ A;  3U6S A;  1IXR C;  2J7N A;  2VII A;  1T3T A;  1JR3 A;  4LFC M;  5FTJ A;  2W82 A;  2GNO A;  3RE8 A;  2LVA A;  4I81 A;  1EFU B;  3AV0 A;  4GC9 A;  2H5X A;  4JI2 M;  1X37 A;  3KVW A;  1NV9 A;  2ZAO A;  2UU9 M;  3D8L A;  3GPU A;  4MGK E;  3DZD A;  4IBK A;  1XXH B;  4R7G A;  5ITX E;  4IJF A;  1NY6 A;  4B3T M;  2UXC M;  2ZM6 M;  4QHT A;  3CTW B;  1N34 M;  4WW0 A;  3Q8X A;  4FWD A;  4GC5 A;  3W0F A;  3U5Z A;  1IY0 A;  3KXE C;  4A3V B;  5KPR A;  3KS8 A;  2XEP A;  5EJC A;  1UM8 A;  3KOW E;  4K0K M;  3HY5 A;  1BVS A;  2LWX A;  1V33 A;  1QAO A;  4F2L A;  1VDD A;  1JB0 F;  2HAK A;  3SMP A;  5KPZ A;  1OTR A;  2L4F A;  1N33 M;  2CP8 A;  5EXX A;  2J5Y A;  4OVZ B;  4I4L A;  2QEN A;  3ZC7 B;  1K82 A;  4L78 A;  2BWB A;  4Q7J A;  3GPP A;  1LV7 A;  1G71 A;  5JI2 E;  4JN6 A;  3IHP A;  4R3D A;  3J2P B;  2L7I A;  2KZS A;  3W68 A;  3TWK A;  4BB9 A;  3DFZ A;  2D7G A;  3LQR A;  2P5T A;  3GPY A;  2K47 A;  1GAB A;  3VKH A;  1H6U A;  2MJ5 B;  1XXH A;  1YUB A;  3ILK A;  5FTN A;  3TE6 A;  1KYI A;  3PFI A;  4M9Z A;  1IBL M;  2VF8 A;  2CUZ A;  2R4J A;  4GHA A;  4DUZ M;  5IRE B;  4DV2 M;  4JI5 M;  2Y20 A;  4G6Z A;  1IN6 A;  3MJ5 A;  1W5S A;  4B3M M;  2CWB A;  3GRU A;  2D7H A;  5KQD A;  2Z8Y M;  4X64 M;  2XLJ A;  2RGH A;  3AOE A;  3TWL A;  4PD2 A;  4LJ5 A;  4G4R A;  4M0D A;  3SAS A;  2V1C A;  2C99 A;  1NSF A;  2LNH C;  2QQ8 A;  2ZBK B;  1WXQ A;  3KFU G;  1RU3 A;  1TDH A;  3H4J A;  3KOY E;  2E5L M;  1G4A E;  4DV0 M;  2K9D A;  1ZAE A;  2LH0 A;  4LJ6 A;  1Q3B A;  1NY5 A;  1SXJ E;  1VEJ A;  1D0M A;  2OPF A;  2WZJ A;  1Z5C A;  5ITY A;  4FWH A;  4M9S A;  1R2Z A;  3HU3 A;  3E4R A;  3Q8G A;  1NV8 A;  3GLG B;  3UMM A;  2VQF M;  1JR3 E;  2QSF X;  2MR9 A;  2C9C A;  1JQJ C;  3W0L B;  2UUB M;  4QNR A;  4JI6 M;  2CE7 A;  1MJG M;  4TUW A;  3R9X B;  4LJA A;  3AL0 C;  4FVM A;  3KS4 A;  4IBG A;  1IY1 A;  3HKP A;  4CGY B;  5H37 D;  1QAM A;  2A5Y B;  3VFD A;  3WHL A;  1HNX M;  2M60 A;  3J7B A;  4GKJ M;  1IM2 A;  4AKH A;  2Z4R A;  5EP1 A;  1J5E M;  2ZAN A;  4AZF A;  2UXB M;  4M9X A;  1NVM A;  1QYR A;  3LVW A;  3SYL A;  4AI6 A;  2CFO A;  2HKJ A;  1L2C A;  2CHG A;  5DYI A;  4OX9 M;  2L4E A;  2G8L A;  3U60 A;  2QZ4 A;  4GKK M;  2X49 A;  2QHO B;  4IBF A;  3AOG A;  4IIW A;  4II7 A;  3JAM S;  1P3Q Q;  1E94 E;  3U6L A;  2R65 A;  4DR5 M;  2DWZ B;  1G3I A;  1IN7 A;  1ZMU A;  1W5T A;  4JI1 M;  3TPZ A;  2JZ1 A;  3A46 A;  2KNZ A;  2DHY A;  1PGY A;  2Z4S A;  3M0E A;  5JI3 E;  3U5Z B;  1OAO C;  4DR7 M;  1WGN A;  2Z7J A;  3CF2 A;  2DAK A;  3PNY A;  4JYA M;  3IG8 A;  3L28 A;  1NHW C;  2L09 A;  1FNN A;  1IQP A;  3GLG A;  2JNH A;  4LFB M;  2FH0 A;  3E46 A;  4CIS A;  1DGG A;  1L2D A;  4XBO A;  3U6D A;  2VF7 A;  4GEW A;  1HR0 M;  2OOB A;  1Q3C A;  2HL7 A;  2YNM D;  1OKS A;  1XB2 B;  1XXH E;  1GLN A;  5FSW A;  1WHC A;  2FNA A;  1OJL A;  4LRS A;  1FJG M;  3J81 S;  4KO8 A;  3UZU A;  2KA6 B;  4LF7 M;  1ZMV A;  2F5P A;  1R4G A;  4FCT A;  3WHK A;  4PCZ A;  2XZF A;  2UXD M;  3GLI A;  2BJW A;  3GQ3 A;  2DAG A;  2EKK A;  3L27 A;  3JR4 A;  3FE3 A;  3R8F A;  2DWN A;  3UK6 A;  3U6C A;  2DAI A;  4LZZ A;  2DWM A;  5DNY A;  4NSR A;  3SMS A;  5BPV A;  5FTL A;  3LCU A;  3B7Q A;  3FRH A;  4LY6 A;  2HWJ A;  2YFQ A;  4IBC A;  4G4Q A;  3FUX A;  4BBA A;  1ZQ9 A;  2KZU A;  2Y0T A;  3U6E A;  1N36 M;  1D2N A;  3UJN A;  3HZJ A;  3HHZ A;  1VG5 A;  3LMM A;  3VLF B;  4B7H A;  2R44 A;  1NO1 A;  2L7H A;  2CV2 A;  3D8B A;  1DO2 A;  3MMP A;  3T15 A;  2X4A A;  2X8A A;  3KSX A;  5ITQ A;  3LCV B;  2F5O A;  2JWS A;  3QYE A;  2JUJ A;  2MH8 A;  4KHP M;  1D0L A;  2DZO B;  4LJ4 A;  1TH3 A;  3MHV C;  2ZTD A;  3L26 A;  4GHL A;  1GJS A;  4PDG A;  2DAE A;  3U6M A;  2RKO A;  5EXS A;  2FE8 A;  1N75 A;  1ZV1 A;  2J7O A;  3FYC A;  4LJ9 A;  3HGI A;  2DVW B;  3HHX A;  3F92 A;  2HCB A;  4FW9 A;  4JI7 M;  2KXE A;  1N77 A;  1I94 M;  3ZH9 B;  4G3O A;  5C1B A;  2O5R A;  3L2A A;  3QWL A;  2EO2 A;  4GH9 A;  2JY6 B;  2EKF A;  2XSZ D;  4S12 A;  4B7G A;  1YLA A;  4JXJ A;  4LFA M;  2DEN A;  1T43 A;  2KNV A;  3QAU A;  2XSZ A;  3B7Z A;  4P16 A;  3T38 A;  5KPT A;  2HHH M;  2D7E A;  3BOS A;  4ITQ A;  2CRU A;  3K9O A;  3KP1 E;  3J7A S;  4WP2 A;  1E9R A;  1Z59 A;  1EE8 A;  1GJT A;  2G5G X;  5A2Q S;  3GQ5 A;  3DOA A;  3U60 B;  4IBJ A;  4REZ A;  1MX0 A;  2JXN A;  5IZ7 D;  2KRK A;  3ZCB B;  3T1H M;  2ERC A;  1QQW A;  2LVN C;  2ZAM A;  5GKN A;  3KOZ E;  2LTU A;  5LMU M;  1L1Z A;  4P17 A;  4GIP A;  5DYG A;  5BR8 M;  3B89 A;  1HQY E;  1F4I A;  3E21 A;  3SAV A;  1N78 A;  3NBI A;  3TQS A;  3J80 S;  3T1Y M;  3GO8 A;  3OTO M;  3FTD A;  4Z6Y A;  4RNA A;  4HL4 A;  4ANR A;  1HNW M;  4MGZ E;  3I01 M;  4LRT A;  2K6B A;  1IN4 A;  2JA2 A;  3C3E A;  1IXS B;  3SAR A;  4NSO B;  1YSY A;  2FFJ A;  2R45 A;  4WUR A;  1J09 A;  4F1I A;  3C58 A;  1G41 A;  4LF9 M;  4DUY M;  2L6O A;  4NXM M;  1TH2 A;  4DR2 M;  3B9P A;  1Z5A A;  2QCU A;  4YHH M;  1AUA A;  3KOX E;  2KHH A;  3HHW A;  4D81 A;  1PJI A;  3GLI B;  2R18 A;  4Z8X A;  1UFZ A;  2JP7 A;  3CF0 A;  4CIZ A;  1TDZ A;  4RKU F;  4LJ8 A;  1HNZ M;  1AIP C;  1IN5 A;  4FCW A;  1KFV A;  1DV0 A;  2F5S A;  1Z6T A;  4DV3 M;  2I7N A;  3EIH A;  2DKL A;  2LHC A;  5IT9 S;  4HEO A;  4QHS A;  2RGO A;  3T6P A;  1DGF A;  4DV5 M;  2UUC M;  4GRI A;  1IFY A;  2DZN B;  4PDI A;  1N32 M;  3I4Y A;  5L8R F;  3I4V A;  2CV0 A;  1SXJ B;  2V6Z M;  4FWG A;  2XFS A;  1IN8 A;  4DV1 M;  3HJ8 A;  3K8Z A;  1VQ1 A;  2BWE A;  1TR8 A;  1HT1 E;  1IY2 A;  4XGI A;  1YE9 A;  1WGL A;  3FUU A;  3FUT A;  1KSF X;  2KNA A;  2QPA A;  4B7F A;  4B08 A;  3C3D A;  2F5Q A;  3HX3 A;  3VDU A;  3AJI B;  3EIE A;  3ZQJ A;  2YR0 A;  3HU2 A;  4DV4 M;  1IBK M;  2BNK A;  4JI4 M;  1R2Y A;  1IXS A;  2CV1 A;  4UN2 B;  3M6A A;  2R4E A;  4QNM A;  1DGH B;  4DR6 M;  2LVP C;  2CHV A;  5E26 A;  3A42 A;  3GPX A;  3SBJ A;  3K92 A;  4B3R M;  2APL A;  1G8P A;  1ORY B;  2JY8 A;  4X66 M;  4RF1 A;  3BBZ A;  3RFW A;  3VDP A;  2C9O A;  2QNJ A;  3K9P A;  4KOD A;  4L15 A;  1QAQ A;  3SAT A;  1TTE A;  1ZMW A;  2KDL A;  1R7R A;  1PRB A;  4LCB A;  1XHB A;  5ITT A;  4OU7 A;  2WSC F;  2DWL A;  2F4V M;  2G3Q A;  2LXE A;  4NRW A;  1PM5 A;  1V92 A;  1L8Q A;  3V76 A;  3GRV A;  2EA0 A;  1XNQ M;  1QUT A;  3FUV A;  2DZL A;  4IJE A;  1HJP A;  2JY5 A;  1C1K A;  4D82 A;  3RGS A;  3KW6 A;  3SAW A;  3HU1 A;  1SXJ D;  3BXW A;  4MM3 B;  1LTM A;  1E9S A;  2OO9 A;  3GLF B;  1SXJ A;  2DNA A;  2LVQ D;  2I7P A;  3FRI A;  3GLH B;  2GQF A;  1PJT A;  1QDR A;  5E6J A;  1PJQ A;  2FOI C;  3KSJ A;  1QUS A;  4FCV A;  4FD2 A;  2KEB A;  4Y28 F;  5EQT A;  1L2B A;  5EXT A;  4LF6 M;  4LJ7 A;  1IBM M;  4ZPX A;  2XH9 A;  4KLN A;  1R5L A;  7CAT A;  1DGH A;  1XC8 A;  1TGU A;  5KO3 A;  5ITR A;  3VKG A;  1DGB A;  1NNU C;  3NBX X;  1GL6 A;  4L8R C;  5F3W A;  4AQY M;  1DO0 A;  4NOO B;  4XK8 F;  3HWS A;  5FTM A;  2Z3X A;  4JV5 M;  1QZE A;  1Q02 A;  1SXJ C;  1TF0 B;  1WIV A;  2CHQ A;  2R46 A;  1QVR A;  2JZ0 A;  1NNJ A;  3U61 A;  4DV6 M;  4JI3 M;  1QZM A;  1T6O A;  1MU5 A;  3I04 M;  4MGI E;  4M0W A;  4NC6 A;  2VQE M;  4OW0 A;  4AG5 A;  3UGJ A;  1OIP A;  1VEG A;  1PJJ A;  2UUA M;  3SYK A;  4LF8 M;  3MK6 A;  2WSF F;  1I4W A;  2R6F A;  3KP0 E;  5EP2 A;  3JR5 A;  2QBY B;  1V34 A;  2ZTC A;  3GRY A;  5LMN M;  3FD9 A;  2VDB B;  3GRR A;  3AFH A;  2DXI A;  4AW4 A;  4D80 A;  4IBE A;  2C96 A;  2LHG A;  3QYB A;  2O25 A;  4L4U A;  2NQ8 C;  3GLF A;  3L29 A;  2WSE F;  1QAN A;  4NRV A;  3GLH A;  3FUW A;  1K3X A;  2N35 A;  4AKG A;  1TH4 A;  5EP3 A;  4YY3 M;  2L2D A;  1GO5 A;  2EUC A;  1QDT A;  3GLG E;  4NL4 H;  2MGW A;  3GP1 A;  3I51 A;  1XMQ M;  3TWM A;  1Q39 A;  1NHG C;  4QOS A;  2Q2E B;  8CAT A;  3THG A;  4G4O A;  1J7K A;  3SAU A;  3IEC A;  4IBI A;  1OQY A;  3B7N A;  3SC3 A;  2LBC A;  1MN3 A;  3LQQ A;  2OQ4 A;  1OIZ A;  3C9P A;  3DA1 A;  4EIW A;  4MH0 E;  1R6B X;  1G59 A;  5ITX A;  1VEK A;  3GLI E;  4I5S A;  1HQC A;  3LW5 F;  1NJG A;  3IG5 A;  4W5W A;  2XZU A;  3VK8 A;  2KW0 A;  4LGY A;  3K2L A;  4NXN M;  2QBY A;  4DR4 M;  1OAI A;  2XF3 A;  4LGM A;  2V1U A;  1D0K A;  3FKE A;  3B74 A;  4HLQ A;  5C18 A;  2R0I A;  2DHR A;  3H4M A;  4X62 M;  4GMQ A;  4OVZ A;  4CHT B;  3U6Q A;  2FS1 A;  4GIT A;  1CUK A;  5ITU A;  4JI8 M;  4LZJ A;  3VK7 A;  2B3T A;  3FTF A;  1OFI A;  3NWL A;  4DV7 M;  1A5T A;  2H1R A;  3HJQ A;  3SHG B;  1Y8G A;  2O01 F;  1S3S A;  3AOE C;  4L16 A;  4PT5 A;  4CJ6 A;  4MGH A;  1GKI A;  2M5Z A;  4R71 A;  4LF4 M;  4MB7 A;  2DAM A;  2AHM A;  4BLC A;  1HT2 E;  1GL7 A;  4LG2 A;  1EIJ A;  4JI0 M;  1OFH A;  3M7G A;  3SFZ A;  2LVO C;  1K3W A;  1PJS A;  3CGW A;  5EP4 A;  4LF5 M;  3K1J A;  5FTK A;  3U6P A;  3GQ4 A;  3KDS E;  2R62 A;  3E9S A;  4AG6 A;  2Y0Q A;  2JY7 A;  4IBD A;  1Z5B A;  2YQZ A;  3PNV A;  4IBB A;  1WR1 B;  3FTC A;  3J27 B;  2Y21 A;  4DR3 M;  3HHY A;  3A98 B;  3TL4 X;  1SG9 A;  1L1T A;  1GVN A; 
#chains in the Genus database with same CATH homology
 4I8O A;  3FTE A;  5IWA M;  5KQ8 A;  4X65 M;  4DR1 M;  4AKI A;  3U61 B;  1IXZ A;  3RGP A;  2BJV A;  2XGN A;  3A45 A;  3LVV A;  3PXG A;  4RF0 A;  1NJF A;  2QP9 X;  5EXP A;  3L25 A;  2C98 A;  3SHF A;  1XMO M;  3PVS A;  3FYD A;  1XWI A;  2C5R A;  4QOZ C;  2CEA A;  2XFT A;  2F5N A;  3HJS A;  1E32 A;  5FLX S;  4MGY E;  3CF6 E;  2KRU A;  3U6O A;  1JR3 D;  4B3S M;  1XNR M;  4G4N A;  3AKZ A;  3U6S A;  1IXR C;  2J7N A;  2VII A;  1T3T A;  1JR3 A;  4LFC M;  5FTJ A;  2W82 A;  3RE8 A;  4I81 A;  4JI2 M;  3AV0 A;  4GC9 A;  1X37 A;  3KVW A;  2ZAO A;  2UU9 M;  3D8L A;  3GPU A;  4MGK E;  3DZD A;  4IBK A;  1XXH B;  4R7G A;  5ITX E;  4IJF A;  1NY6 A;  4B3T M;  2UXC M;  2ZM6 M;  4QHT A;  3CTW B;  1N34 M;  4WW0 A;  3Q8X A;  4FWD A;  4GC5 A;  3W0F A;  3U5Z A;  1IY0 A;  3KXE C;  4A3V B;  5KPR A;  3KS8 A;  2XEP A;  5EJC A;  1UM8 A;  3KOW E;  4K0K M;  2LWX A;  1QAO A;  1VDD A;  3SMP A;  5KPZ A;  1N33 M;  5EXX A;  4OVZ B;  4I4L A;  2QEN A;  3ZC7 B;  1K82 A;  4L78 A;  3GPP A;  1LV7 A;  5JI2 E;  4JN6 A;  4R3D A;  3J2P B;  2L7I A;  2KZS A;  3TWK A;  4BB9 A;  3DFZ A;  2D7G A;  3LQR A;  2P5T A;  3GPY A;  2K47 A;  3VKH A;  1H6U A;  5FTN A;  1XXH A;  1YUB A;  3ILK A;  3TE6 A;  1KYI A;  3PFI A;  4M9Z A;  1IBL M;  2CUZ A;  2R4J A;  4GHA A;  4DUZ M;  5IRE B;  4DV2 M;  4JI5 M;  2Y20 A;  4G6Z A;  1IN6 A;  3MJ5 A;  1W5S A;  4B3M M;  3GRU A;  2D7H A;  5KQD A;  4X64 M;  2XLJ A;  2RGH A;  3AOE A;  3TWL A;  4PD2 A;  4LJ5 A;  4G4R A;  4M0D A;  3SAS A;  2V1C A;  2C99 A;  1NSF A;  2LNH C;  2ZBK B;  1WXQ A;  3KFU G;  1TDH A;  3KOY E;  2E5L M;  1G4A E;  4DV0 M;  1ZAE A;  2LH0 A;  4LJ6 A;  1Q3B A;  1NY5 A;  1SXJ E;  2OPF A;  1R2Z A;  1Z5C A;  5ITY A;  4FWH A;  4M9S A;  3HU3 A;  3E4R A;  3GLG B;  3UMM A;  2VQF M;  2UUB M;  2C9C A;  1JQJ C;  3W0L B;  4QNR A;  4JI6 M;  2CE7 A;  4TUW A;  3R9X B;  4LJA A;  3AL0 C;  4FVM A;  3KS4 A;  4IBG A;  1IY1 A;  3HKP A;  4CGY B;  5H37 D;  1QAM A;  2A5Y B;  3VFD A;  3WHL A;  1HNX M;  2M60 A;  3J7B A;  4GKJ M;  1IM2 A;  4AKH A;  2Z4R A;  5EP1 A;  1J5E M;  2ZAN A;  4AZF A;  2UXB M;  4M9X A;  1NVM A;  1QYR A;  3LVW A;  3SYL A;  4AI6 A;  2CFO A;  2HKJ A;  1L2C A;  2CHG A;  5DYI A;  4OX9 M;  2G8L A;  3U60 A;  2QZ4 A;  4GKK M;  2X49 A;  4IBF A;  4IIW A;  3AOG A;  4II7 A;  3JAM S;  1E94 E;  3U6L A;  2R65 A;  4DR5 M;  2DWZ B;  1G3I A;  1IN7 A;  4JI1 M;  1W5T A;  3TPZ A;  3A46 A;  5JI3 E;  3M0E A;  3U5Z B;  2Z4S A;  4DR7 M;  2Z7J A;  3CF2 A;  4JYA M;  3PNY A;  3IG8 A;  3L28 A;  1NHW C;  2L09 A;  1FNN A;  1IQP A;  3GLG A;  4LFB M;  4CIS A;  1DGG A;  1L2D A;  4XBO A;  3U6D A;  1HR0 M;  1Q3C A;  2HL7 A;  2YNM D;  1GLN A;  5FSW A;  2FNA A;  4LRS A;  1OJL A;  1FJG M;  3J81 S;  4KO8 A;  3UZU A;  2KA6 B;  4LF7 M;  2F5P A;  4FCT A;  3WHK A;  4PCZ A;  2XZF A;  2UXD M;  3GLI A;  2BJW A;  3GQ3 A;  3L27 A;  3JR4 A;  3R8F A;  2DWN A;  3UK6 A;  3U6C A;  4LZZ A;  2DWM A;  5DNY A;  4NSR A;  3SMS A;  5BPV A;  5FTL A;  4LY6 A;  4G4Q A;  2YFQ A;  4IBC A;  3FUX A;  4BBA A;  1ZQ9 A;  2KZU A;  2Y0T A;  3U6E A;  1N36 M;  1D2N A;  3UJN A;  3HHZ A;  3VLF B;  3LMM A;  4B7H A;  2L7H A;  2CV2 A;  3D8B A;  1DO2 A;  3T15 A;  2X4A A;  2X8A A;  3KSX A;  5ITQ A;  2F5O A;  4KHP M;  2DZO B;  4LJ4 A;  1TH3 A;  3MHV C;  4GHL A;  3L26 A;  4PDG A;  3U6M A;  2RKO A;  5EXS A;  2FE8 A;  1N75 A;  2J7O A;  3FYC A;  4LJ9 A;  3HGI A;  2DVW B;  3HHX A;  2HCB A;  4FW9 A;  4JI7 M;  2KXE A;  1N77 A;  1I94 M;  3ZH9 B;  5C1B A;  2O5R A;  3L2A A;  3QWL A;  2EO2 A;  4GH9 A;  2XSZ D;  4S12 A;  4B7G A;  4JXJ A;  4LFA M;  3QAU A;  4P16 A;  2XSZ A;  3T38 A;  5KPT A;  3J7A S;  2HHH M;  2D7E A;  3BOS A;  4ITQ A;  3KP1 E;  1E9R A;  1Z59 A;  1EE8 A;  2G5G X;  5A2Q S;  3GQ5 A;  3DOA A;  3U60 B;  4IBJ A;  4REZ A;  1MX0 A;  5IZ7 D;  2KRK A;  3ZCB B;  3T1H M;  2ERC A;  1QQW A;  5GKN A;  2ZAM A;  5LMU M;  3KOZ E;  1L1Z A;  4GIP A;  5DYG A;  5BR8 M;  1HQY E;  3SAV A;  1N78 A;  3NBI A;  3TQS A;  3J80 S;  3T1Y M;  3GO8 A;  3OTO M;  3FTD A;  4Z6Y A;  4RNA A;  4HL4 A;  1HNW M;  4MGZ E;  4LRT A;  1IN4 A;  2JA2 A;  3SAR A;  1IXS B;  4NSO B;  1YSY A;  2FFJ A;  2R45 A;  4WUR A;  1J09 A;  3C58 A;  1G41 A;  4LF9 M;  4DUY M;  2L6O A;  4NXM M;  1TH2 A;  4DR2 M;  3B9P A;  1Z5A A;  2QCU A;  4YHH M;  3KOX E;  3HHW A;  4D81 A;  1PJI A;  3GLI B;  2R18 A;  4Z8X A;  1TDZ A;  3CF0 A;  4LJ8 A;  1HNZ M;  4FCW A;  1IN5 A;  1KFV A;  2F5S A;  1Z6T A;  4DV3 M;  2I7N A;  3EIH A;  5IT9 S;  4QHS A;  2RGO A;  1DGF A;  4DV5 M;  2UUC M;  4GRI A;  2DZN B;  4PDI A;  1N32 M;  3I4Y A;  2CV0 A;  3I4V A;  1SXJ B;  2V6Z M;  4FWG A;  2XFS A;  1IN8 A;  4DV1 M;  3HJ8 A;  3K8Z A;  1HT1 E;  1IY2 A;  4XGI A;  1YE9 A;  3FUU A;  3FUT A;  2F5Q A;  1KSF X;  2QPA A;  4B7F A;  4B08 A;  3VDU A;  3AJI B;  3EIE A;  4DV4 M;  2YR0 A;  3HU2 A;  1IBK M;  2BNK A;  4JI4 M;  1R2Y A;  2CV1 A;  3M6A A;  2R4E A;  4QNM A;  1DGH B;  4DR6 M;  2CHV A;  5E26 A;  3A42 A;  3GPX A;  3SBJ A;  3K92 A;  4B3R M;  1G8P A;  1ORY B;  4X66 M;  4RF1 A;  3RFW A;  3VDP A;  2C9O A;  4KOD A;  4L15 A;  1QAQ A;  3SAT A;  1R7R A;  5ITT A;  4LCB A;  1XHB A;  4OU7 A;  2DWL A;  2F4V M;  2LXE A;  4NRW A;  1PM5 A;  1L8Q A;  3GRV A;  2EA0 A;  1XNQ M;  3FUV A;  4IJE A;  1C1K A;  4D82 A;  3RGS A;  3KW6 A;  3SAW A;  3HU1 A;  1SXJ D;  4MM3 B;  1E9S A;  3GLF B;  1SXJ A;  2I7P A;  3GLH B;  5E6J A;  2FOI C;  3KSJ A;  4FCV A;  4FD2 A;  2KEB A;  5EQT A;  1L2B A;  5EXT A;  4LF6 M;  4LJ7 A;  1IBM M;  4ZPX A;  2XH9 A;  4KLN A;  7CAT A;  1DGH A;  1XC8 A;  1TGU A;  5KO3 A;  5ITR A;  3VKG A;  1DGB A;  1NNU C;  1GL6 A;  4L8R C;  5F3W A;  4AQY M;  1DO0 A;  4NOO B;  3HWS A;  5FTM A;  2Z3X A;  4JV5 M;  1SXJ C;  2CHQ A;  2R46 A;  1QVR A;  1NNJ A;  3U61 A;  4DV6 M;  4JI3 M;  1QZM A;  4MGI E;  1MU5 A;  2VQE M;  4M0W A;  4OW0 A;  4AG5 A;  3UGJ A;  1PJJ A;  2UUA M;  3SYK A;  4LF8 M;  3MK6 A;  3KP0 E;  1I4W A;  5EP2 A;  3JR5 A;  2QBY B;  3GRY A;  5LMN M;  3FD9 A;  3GRR A;  3AFH A;  2DXI A;  4AW4 A;  4D80 A;  4IBE A;  2C96 A;  3GLF A;  4L4U A;  2NQ8 C;  3L29 A;  1QAN A;  4NRV A;  3GLH A;  3FUW A;  1K3X A;  4AKG A;  1TH4 A;  5EP3 A;  4YY3 M;  2EUC A;  4NL4 H;  3GP1 A;  3I51 A;  1XMQ M;  3TWM A;  1Q39 A;  1NHG C;  4QOS A;  2Q2E B;  8CAT A;  3THG A;  4G4O A;  1J7K A;  3SAU A;  4IBI A;  3SC3 A;  3LQQ A;  2OQ4 A;  3DA1 A;  4EIW A;  4MH0 E;  1R6B X;  1G59 A;  5ITX A;  4I5S A;  1HQC A;  1NJG A;  3IG5 A;  4W5W A;  2XZU A;  3VK8 A;  2KW0 A;  4LGY A;  3K2L A;  4NXN M;  2QBY A;  4DR4 M;  2XF3 A;  4LGM A;  2V1U A;  3FKE A;  4HLQ A;  5C18 A;  3H4M A;  2DHR A;  4X62 M;  4GMQ A;  4OVZ A;  4CHT B;  3U6Q A;  4GIT A;  5ITU A;  4JI8 M;  4LZJ A;  3VK7 A;  3FTF A;  1OFI A;  3NWL A;  4DV7 M;  2H1R A;  3HJQ A;  3SHG B;  1S3S A;  3AOE C;  4L16 A;  4PT5 A;  4MGH A;  1GKI A;  2M5Z A;  4LF4 M;  4MB7 A;  2AHM A;  4BLC A;  1HT2 E;  1GL7 A;  4LG2 A;  4JI0 M;  1OFH A;  3M7G A;  3SFZ A;  1K3W A;  5EP4 A;  4LF5 M;  3K1J A;  5FTK A;  3U6P A;  3GQ4 A;  3KDS E;  2R62 A;  3E9S A;  4AG6 A;  2Y0Q A;  4IBD A;  1Z5B A;  2YQZ A;  3PNV A;  4IBB A;  3FTC A;  3J27 B;  2Y21 A;  4DR3 M;  3HHY A;  3A98 B;  3TL4 X;  1L1T A;  1GVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...