2Y21A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
ITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HAMP
publication title The mechanisms of HAMP-mediated signaling in transmembrane receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y21A00
2Y20A 2Y0TA 2L7HA 2L7IA 2Y0QA 4I5SA 2Y21A
chains in the Genus database with same CATH superfamily
4KT0F 4REZA 1LTMA 4GKJM 2JXNA 2BWEA 4JV5M 2DXIA 1PGYA 1H6UA 4NSRA 4LGYA 3TE6A 3U6PA 4JI5M 2F5PA 4HL4A 2DHYA 3F92A 4L16A 3K2LA 1TR8A 4NXNM 2HCBA 1GVNA 2ZM6M 2G3QA 2APLA 2EO2A 3HHZA 3SARA 4G4OA 2KHHA 3W0FA 3HKPA 1G41A 1P3QQ 1E9RA 1DO0A 2JY8A 2XFSA 3NWLA 4LGMA 1ZMVA 4BLCA 5F3WA 1R5LA 1L2CA 3U6DA 3W68A 1MU5A 3GLIE 3NBIA 3UK6A 3LQRA 1TF0B 4S12A 5ITYA 5JI2E 4IBJA 2VQEM 4F1IA 1DGBA 2O25A 3T6PA 1NNJA 4OU7A 1SXJD 3WHKA 1D2NA 1ZMWA 2J7OA 3J80S 5KQDA 3K1JA 3MJ5A 1S3SA 2CV2A 2X49A 2LVPC 2UUAM 5DYGA 1EFUB 4WW0A 4NXMM 2KW0A 1V34A 1Z5BA 1G8PA 2G8LA 3FTDA 1D0LA 2CE7A 2XZFA 4FWHA 3UGJA 5FTMA 2F4VM 3R9XB 1EE8A 1N33M 3GRRA 3LW5F 2E5LM 4Z6YA 3HHYA 1Q3CA 2LHCA 2JZ1A 2C9OA 2FOIC 3CF6E 4NSOB 1J7KA 3E4RA 3TPZA 1AIPC 4QHSA 2V1UA 2ZAOA 2GNOA 4F2LA 1N34M 1R6BX 3MHVC 3T1HM 4X65M 2ZBKB 2UXBM 2R44A 4X66M 2CWBA 4UN2B 3W0LB 3U6LA 4B7GA 3SYKA 3GPYA 4JI7M 1QZEA 1ZV1A 1DO2A 2W82A 4LF4M 2OPFA 2LVOC 3GLGE 2DAIA 5EP1A 2O5RA 2XEPA 1OJLA 3FTCA 3KP0E 2R18A 1GABA 1SXJA 2Y0QA 2KDLA 4LRTA 4B7HA 3TQSA 1NY5A 1IFYA 4AI6A 3AKZA 5EXXA 2OOBA 4B3MM 1FJGM 3L28A 1SXJB 4JXJA 2BJWA 1ZQ9A 2R0IA 2LVNC 3KSJA 5ITUA 3GLHA 3I4YA 3QYEA 2MGWA 2LVAA 1XHBA 3U6OA 3EIEA 2C5RA 1HNXM 1TH3A 3CF2A 1N75A 2VF7A 1JR3E 4XGIA 1DGFA 3GLHB 4IBEA 3I01M 3KS4A 1QYRA 4LRSA 4P17A 1IY1A 2L4FA 3SASA 2XGNA 1G3IA 2OOAA 2Z8YM 5IWAM 1D0KA 5C1BA 1XWIA 1XMQM 1WIVA 2N35A 2O01F 3C3DA 1HJPA 5H37D 3K92A 3B7NA 2R6FA 3KSXA 2K47A 2WSCF 4LF6M 4I81A 5EQTA 3FYDA 1WGLA 1IN5A 2C98A 1YLAA 2DHRA 2XSZA 4IBFA 4DR4M 2ZANA 1WR1B 3IG5A 1W5TA 3NBXX 3I4VA 2UUBM 4OVZA 3W67A 1QDRA 2QNJA 3L2AA 1QUSA 2C99A 2XZUA 2XH9A 2JY5A 4L78A 4Y28F 1TH4A 4OVZB 4DV7M 4BBAA 2RGOA 4DV5M 2VDBB 4MGIE 3FUXA 1PJQA 1W5SA 5E26A 4R7GA 1IN7A 1VEKA 3UZUA 5GKNA 1Q3BA 1VDDA 1QAQA 1JQJC 1TTEA 2FE8A 4FWDA 5KPZA 4DV0M 4FCVA 4XBOA 1ZAEA 3A98B 1QZMA 4R71A 1Z59A 1V33A 2QP9X 2DWZB 4OW0A 4ANRA 4IJEA 1N78A 2DAKA 2R45A 2J5YA 3UJNA 4AZFA 4K0KM 1NJFA 1N32M 1XXHE 3SMSA 2C96A 3J27B 1VEJA 2LNHC 4CIZA 1E94E 3GRYA 2CP8A 1GL7A 2J7NA 4GH9A 4AQYM 1L2BA 3FYCA 4G4QA 1IY0A 2FFJA 3VDUA 4G3OA 1UFZA 1Q02A 3SMPA 1G4AE 3H4MA 4DV1M 3FKEA 1V92A 2H5XA 2HAKA 1OKSA 3GLFA 3VKHA 3KOZE 4FCWA 1NNUC 3EIHA 4NL4H 4B7FA 4GHAA 3KW6A 2LWXA 1J09A 4G4RA 1NSFA 2R46A 2C9CA 4JI2M 5ITTA 3AV0A 3GLFB 2ERCA 2EUCA 4LFAM 4DV3M 3FRIA 4LJ5A 4RF1A 1NV8A 4DR7M 3SAUA 4JI1M 3J7AS 4GHLA 3FTEA 2H1RA 1I94M 2D7GA 4MM3B 3VK8A 3SATA 5LMNM 1VEGA 3LCVB 2R4JA 1IXSB 4IBKA 4JI4M 2RGHA 2RRUA 1QANA 1L8QA 2KA6B 4I8OA 2D7EA 4AW4A 4AKHA 3RGPA 5L8RF 4IBDA 3HJSA 3VLFB 2L2DA 1G71A 1OAOC 2BNKA 3HU2A 2K6BA 4IBGA 3GLIA 4FD2A 2WSEF 3GRUA 3HJQA 1ORYB 5EP3A 5JI3E 1SG9A 3GLIB 1NHGC 1UM8A 4LZZA 2WSFF 2LH0A 4FWGA 4RF0A 4M9ZA 3WHLA 1K3XA 3Q8XA 1VQ1A 2DZNB 3B9PA 3GPUA 1G59A 3CGWA 1PRBA 3VFDA 4LJAA 3E46A 4NRWA 1TGUA 2JY7A 3KXEC 1SXJC 4KODA 4DV2M 1DGHB 3U60B 2L09A 1NY6A 1X37A 3UMMA 1Z5CA 4M0DA 2D7HA 5FTLA 3A46A 2QBYB 1IXZA 2R4EA 4L8RC 3R8FA 1HT2E 4ITQA 1JR3D 4IBBA 2NQ8C 2HKJA 4QOZC 4IJFA 2EKFA 4II7A 4MH0E 2CHVA 4IIWA 2CV0A 4Z8XA 3PFIA 3VDPA 2JA2A 3AFHA 1R2ZA 1K82A 1XNRM 2YNMD 1EIJA 3VKGA 4OX9M 1K3WA 2YQZA 3DZDA 2B3TA 2EJSA 1R7RA 3PNYA 3GLGA 3AOEC 4M9XA 5EXPA 2QENA 3I51A 4GC9A 2QPAA 4AG6A 2QSFX 1IBMM 3B89A 4X64M 5FLXS 2CUZA 2DWLA 4NOOB 4LG2A 3AOEA 1PJSA 3FUWA 5EJCA 2KXEA 1ZMUA 4L6V6 3SHGB 3GLGB 1HNWM 1IN8A 1C1KA 2Y0TA 3KOXE 1DGGA 3IHPA 1OFIA 3KDSE 4L15A 4DUYM 4PCZA 2JUJA 2DWNA 4DV6M 2FS1A 3LMMA 3QWLA 2VF8A 3ZH9B 3U6EA 4LJ4A 1MX0A 1MN3A 5EP4A 3TWMA 2HL7A 2JWSA 2Z4RA 4LJ7A 1QUTA 3M7GA 4FW9A 4QNMA 5KO3A 4DR2M 4LF7M 4QHTA 1JR3A 3THGA 4AKGA 1Z5AA 4JN6A 4DR3M 1OIZA 5ITQA 3JAMS 1T3TA 3J81S 3RE8A 2L7IA 1D0MA 2VIIA 1N36M 4LY6A 4MGKE 1HQYE 2X4AA 2YR0A 4JI0M 1C7YA 1KSFX 4LZJA 4HEOA 1QQWA 3K8ZA 1MJGM 2MROB 3BXWA 3AL0C 1IM2A 3PVSA 5KPTA 3HU1A 4JI3M 3SFZA 3KOYE 4GITA 3FD9A 1VDLA 1OFHA 1T43A 3L26A 5FTNA 3PXGA 4LF9M 2OO9A 1YSYA 4DR6M 3V76A 1WHCA 1GLNA 1XC8A 5DYIA 3SAWA 5FSWA 3HGIA 2ZAMA 5BPVA 2UU9M 3HJ8A 3K9PA 1GL6A 4FCTA 2KNVA 2EKKA 3BOSA 2HWJA 4NRVA 3M6AA 4X62M 2Y21A 1GKIA 4KLNA 1NHWC 2CRUA 2QHOB 1GO5A 1LV7A 1IY2A 4CJ6A 4PD2A 2M5ZA 4DV4M 3OTOM 3GPPA 4BB9A 2F5QA 1CUKA 3FUUA 3GRVA 4M0WA 3DOAA 1GJSA 5ITXA 4AG5A 2KRKA 4P16A 1RU3A 2JNHA 3SAVA 1N77A 5BR8M 2DVWB 2FNAA 1OIPA 3LCUA 4MGHA 1XXHB 5IT9S 1IXSA 3IECA 5IZ7D 4DR1M 4LJ8A 4GIPA 1FNNA 2LTUA 3HY5A 3U61B 1L2DA 1F4IA 1AUAA 3T15A 3U5ZA 4B3RM 4XK8F 2YFQA 4QNRA 3T38A 3SHFA 4A3VB 2R62A 5LMUM 1J5EM 1HQCA 3SBJA 4JYAM 2JZ0A 2LHGA 4QOSA 4B08A 2CFOA 3U5ZB 1PJIA 3KP1E 4RKUF 1VG5A 5FTKA 3JR5A 3I04M 2QCUA 3MMPA 4WP2A 3A45A 1IQPA 3FE3A 2L4EA 3HZJA 1E9SA 3J2PB 4B3TM 4D80A 4KHPM 3C9PA 3CTWB 3FRHA 3U6CA 1QAMA 2DWMA 1QDTA 3B74A 3ZQJA 2CV1A 3PNVA 3LQQA 4W5WA 2UUCM 2Z3XA 1DV0A 4D81A 2KNAA 3U60A 1DGHA 2AHMA 3LVVA 3DA1A 3KFUG 3RFWA 4PDIA 2QBYA 2K9DA 2UXCM 2LVQD 1NV9A 4LJ6A 2QZ4A 2KEBA 1Q39A 4Q7JA 2MR9A 2XLJA 5IREB 3M0EA 2MH8A 4CGYB 4R3DA 4MB7A 4D82A 2L7HA 1NO1A 3HWSA 2LBCA 4IBIA 5A2QS 1SXJE 1IN4A 1IXRC 1TDZA 5EXTA 2UXDM 3VK7A 2FH0A 3K9OA 3L27A 4DR5M 3D8BA 2F5NA 3FUVA 4EIWA 3HHWA 4PT5A 1TH2A 1IBLM 3C3EA 2BWBA 3DFZA 1R4GA 3B7ZA 1OQYA 2R65A 2F5OA 4DBGB 2DNAA 3ILKA 2JP7A 3GQ5A 1XMOM 2K0BX 2X8AA 3JR4A 4HLQA 3GQ3A 3GLHE 1XB2B 4LF5M 2LXEA 3B7QA 3U6MA 2HHHM 1E32A 2A5YB 5DNYA 3KOWE 5FTJA 2DENA 3SYLA 4JI8M 1GJTA 3AJIB 3J7BA 1OAIA 2CHGA 4TUWA 2XSZD 5EP2A 3L29A 5C18A 1Y8GA 2WZJA 4IBCA 2JY6B 2DAGA 3D8LA 2DZOB 2DKLA 4I5SA 4PDGA 2VQFM 4G6ZA 4GC5A 4M9SA 4CISA 1HNZM 4LJ9A 3AOGA 3CF0A 2V1CA 4AKIA 3SC3A 4DUZM 2DAEA 3E9SA 2EA0A 5DFLA 1I4WA 3FUTA 4FVMA 3TWLA 3HU3A 1HT1E 1QVRA 4WURA 1YUBA 3H4JA 4I4LA 5EXSA 3GP1A 5KQ8A 1XNQM 3KS8A 1KFVA 1JB0F 2DI0A 2XF3A 2Z7JA 4GRIA 3TWKA 2L6OA 2MJ5B 1TDHA 1PJJA 2KZSA 2KRUA 3LVWA 4B3SM 4JI6M 1A5TA 2V6ZM 4RNAA 1WJ7A 4ZPXA 1Z6TA 1IN6A 2Y20A 3U6SA 2ZTDA 4GEWA 4MGYE 3HHXA 1YE9A 2CEAA 3KVWA 1R2YA 1L1ZA 3T1YM 2XFTA 2DZLA 4CHTB 1QAOA 3L25A 1PJTA 8CATA 5ITRA 1BVSA 1L1TA 1WGNA 2DAMA 3E21A 2KZUA 2RKOA 2GQFA 1NJGA 3TL4X 2G5GX 4KO8A 3FTFA 3ZCBB 4YHHM 4LFCM 1KYIA 2Z4SA 7CATA 4LFBM 4MGZE 2CHQA 3HX3A 3BBZA 2KNZA 3C58A 4LCBA 3U6QA 1WXQA 3A42A 5KPRA 1IBKM 2Q2EB 2P5TA 2ZTCA 3QYBA 3Q8GA 4GKKM 2OQ4A 1OTRA 1PM5A 3RGSA 3GPXA 4NC6A 1HR0M 3GO8A 2I7PA 3GLFE 1T6OA 2M60A 1XXHA 4LF8M 3IG8A 5ITXE 4G4NA 4YY3M 3U61A 2QQ8A 1NVMA 4GMQA 3MK6A 3QAUA 3ZC7B 4L4UA 2F5SA 2BJVA 5E6JA 2I7NA 3GQ4A
chains in the Genus database with same CATH topology
4REZA 4GKJM 4JV5M 2DXIA 1H6UA 4NSRA 4LGYA 3TE6A 3U6PA 4JI5M 2F5PA 4HL4A 4L16A 3K2LA 4NXNM 2HCBA 1GVNA 2ZM6M 2EO2A 3HHZA 3SARA 4G4OA 3W0FA 3HKPA 1G41A 1E9RA 1DO0A 2XFSA 3NWLA 4BLCA 4LGMA 5F3WA 1L2CA 3U6DA 1MU5A 3NBIA 3UK6A 3LQRA 4S12A 5ITYA 5JI2E 4IBJA 2VQEM 1DGBA 1NNJA 4OU7A 1SXJD 3WHKA 1D2NA 2J7OA 3J80S 5KQDA 3K1JA 3MJ5A 1S3SA 2CV2A 2X49A 2UUAM 5DYGA 4WW0A 4NXMM 2KW0A 1Z5BA 1G8PA 2G8LA 3FTDA 2CE7A 2XZFA 4FWHA 3UGJA 5FTMA 2F4VM 3R9XB 1EE8A 1N33M 3GRRA 2E5LM 4Z6YA 3HHYA 1Q3CA 3CF6E 3TPZA 2C9OA 2FOIC 4NSOB 1J7KA 3E4RA 2V1UA 4QHSA 2ZAOA 1N34M 1R6BX 3MHVC 3T1HM 4X65M 2ZBKB 2UXBM 4X66M 3W0LB 3U6LA 4B7GA 3SYKA 3GPYA 4JI7M 1DO2A 2W82A 4LF4M 2OPFA 5EP1A 2XEPA 2O5RA 3KP0E 1OJLA 3FTCA 2R18A 1SXJA 2Y0QA 4LRTA 4B7HA 3TQSA 1NY5A 4AI6A 3AKZA 5EXXA 4B3MM 1FJGM 3L28A 1SXJB 4JXJA 2BJWA 1ZQ9A 3KSJA 5ITUA 3GLHA 3I4YA 1XHBA 3U6OA 3EIEA 2C5RA 1HNXM 1TH3A 3CF2A 1N75A 4XGIA 1DGFA 3GLHB 4IBEA 3KS4A 1QYRA 4LRSA 1IY1A 3SASA 2XGNA 1G3IA 5IWAM 5C1BA 1XWIA 1XMQM 5H37D 3K92A 3KSXA 2K47A 4LF6M 4I81A 5EQTA 3FYDA 1IN5A 2C98A 2DHRA 2XSZA 4IBFA 4DR4M 2ZANA 3IG5A 1W5TA 2UUBM 3I4VA 4OVZA 3L2AA 2C99A 2XZUA 2XH9A 4L78A 1TH4A 4OVZB 4DV7M 4BBAA 2RGOA 4DV5M 4MGIE 3FUXA 1W5SA 5E26A 4R7GA 1IN7A 3UZUA 5GKNA 1Q3BA 1VDDA 1QAQA 1JQJC 2FE8A 4FWDA 5KPZA 4DV0M 4FCVA 4XBOA 1ZAEA 3A98B 1QZMA 1Z59A 2QP9X 2DWZB 4OW0A 1N78A 4IJEA 2R45A 3UJNA 4AZFA 4K0KM 1NJFA 1N32M 3SMSA 2C96A 3J27B 2LNHC 1E94E 3GRYA 1L2BA 1GL7A 2J7NA 4GH9A 4AQYM 3FYCA 4G4QA 1IY0A 2FFJA 3VDUA 3SMPA 1G4AE 3H4MA 4DV1M 3FKEA 3GLFA 3VKHA 3KOZE 4FCWA 1NNUC 3EIHA 4NL4H 4B7FA 4GHAA 3KW6A 2LWXA 1J09A 4G4RA 1NSFA 2R46A 2C9CA 4JI2M 5ITTA 3AV0A 3GLFB 2ERCA 2EUCA 4LFAM 4DV3M 4LJ5A 4RF1A 4DR7M 3SAUA 4JI1M 3J7AS 4GHLA 3FTEA 2H1RA 1I94M 2D7GA 4MM3B 3VK8A 3SATA 5LMNM 2R4JA 1IXSB 4IBKA 4JI4M 2RGHA 1QANA 1L8QA 2KA6B 4I8OA 2D7EA 4AW4A 4AKHA 3RGPA 4IBDA 3HJSA 3VLFB 2BNKA 3HU2A 4IBGA 3GLIA 4FD2A 3GRUA 3HJQA 1ORYB 5EP3A 5JI3E 3GLIB 1NHGC 1UM8A 4LZZA 2LH0A 4FWGA 4RF0A 4M9ZA 3WHLA 1K3XA 3Q8XA 2DZNB 3B9PA 3GPUA 1G59A 3VFDA 4LJAA 4NRWA 1TGUA 3KXEC 4KODA 1SXJC 4DV2M 3U60B 1DGHB 2L09A 1NY6A 1X37A 3UMMA 1Z5CA 4M0DA 2D7HA 5FTLA 3A46A 2QBYB 1IXZA 2R4EA 4L8RC 3R8FA 1HT2E 4ITQA 1JR3D 4IBBA 2NQ8C 2HKJA 4QOZC 4IJFA 4II7A 4MH0E 2CHVA 4IIWA 2CV0A 4Z8XA 3PFIA 3VDPA 2JA2A 3AFHA 1R2ZA 1K82A 1XNRM 2YNMD 3VKGA 4OX9M 1K3WA 2YQZA 3DZDA 1R7RA 3PNYA 3GLGA 3AOEC 4M9XA 5EXPA 2QENA 3I51A 4GC9A 2QPAA 4AG6A 1IBMM 4X64M 2DWLA 5FLXS 2CUZA 4LG2A 4NOOB 3AOEA 3FUWA 5EJCA 2KXEA 3SHGB 3GLGB 1HNWM 1IN8A 1C1KA 2Y0TA 3KOXE 1DGGA 1OFIA 3KDSE 4L15A 4DUYM 4PCZA 2DWNA 4DV6M 3LMMA 3QWLA 3ZH9B 3U6EA 4LJ4A 1MX0A 5EP4A 3TWMA 2HL7A 2Z4RA 4LJ7A 5KO3A 3M7GA 4LF7M 4FW9A 4QNMA 4DR2M 4QHTA 1JR3A 3THGA 4AKGA 1Z5AA 4JN6A 4DR3M 5ITQA 3JAMS 1T3TA 3J81S 3RE8A 2L7IA 2VIIA 1N36M 4LY6A 4MGKE 1HQYE 2X4AA 2YR0A 4JI0M 1KSFX 4LZJA 1QQWA 3K8ZA 3AL0C 1IM2A 3PVSA 5KPTA 3HU1A 4JI3M 3SFZA 3KOYE 4GITA 3FD9A 1OFHA 3L26A 5FTNA 3PXGA 4LF9M 1YSYA 4DR6M 1GLNA 1XC8A 5DYIA 3SAWA 5FSWA 3HGIA 2ZAMA 5BPVA 2UU9M 3HJ8A 1GL6A 4FCTA 3BOSA 4X62M 4NRVA 3M6AA 2Y21A 1GKIA 4KLNA 1NHWC 1LV7A 1IY2A 4PD2A 2M5ZA 4DV4M 3OTOM 3GPPA 4BB9A 2F5QA 3FUUA 3GRVA 4M0WA 3DOAA 5ITXA 4AG5A 2KRKA 4P16A 3SAVA 1N77A 5BR8M 2DVWB 2FNAA 4MGHA 1XXHB 5IT9S 5IZ7D 4DR1M 3U61B 4LJ8A 4GIPA 1FNNA 1L2DA 3T15A 3U5ZA 4B3RM 2YFQA 4QNRA 3T38A 3SHFA 4A3VB 2R62A 5LMUM 1J5EM 1HQCA 3SBJA 4JYAM 4QOSA 4B08A 3U5ZB 2CFOA 1PJIA 3KP1E 5FTKA 3JR5A 2QCUA 3A45A 1IQPA 1E9SA 3J2PB 4B3TM 4D80A 4KHPM 3CTWB 3U6CA 1QAMA 2DWMA 2CV1A 3PNVA 3LQQA 4W5WA 2UUCM 2Z3XA 4D81A 3U60A 1DGHA 2AHMA 3LVVA 3DA1A 3KFUG 3RFWA 4PDIA 2QBYA 2UXCM 4LJ6A 2QZ4A 2KEBA 1Q39A 2XLJA 5IREB 3M0EA 4CGYB 4R3DA 4MB7A 4D82A 2L7HA 3HWSA 4IBIA 5A2QS 1SXJE 1IN4A 1IXRC 1TDZA 5EXTA 2UXDM 3VK7A 3L27A 4DR5M 3D8BA 2F5NA 3FUVA 4EIWA 3HHWA 4PT5A 1TH2A 1IBLM 3DFZA 2F5OA 2R65A 3ILKA 1XMOM 3GQ5A 2X8AA 3JR4A 4HLQA 3GQ3A 4LF5M 2LXEA 3U6MA 2HHHM 1E32A 2A5YB 5DNYA 3KOWE 5FTJA 3SYLA 4JI8M 3AJIB 3J7BA 4TUWA 2CHGA 2XSZD 5EP2A 3L29A 5C18A 4IBCA 3D8LA 2DZOB 4CISA 4I5SA 4PDGA 2VQFM 4G6ZA 4GC5A 4M9SA 1HNZM 4LJ9A 3AOGA 3CF0A 2V1CA 4AKIA 3SC3A 4DUZM 3E9SA 2EA0A 1I4WA 3FUTA 4FVMA 3TWLA 3HU3A 1HT1E 1QVRA 4WURA 1YUBA 4I4LA 5EXSA 3GP1A 5KQ8A 1XNQM 3KS8A 1KFVA 2XF3A 2Z7JA 4GRIA 3TWKA 2L6OA 1TDHA 1PJJA 2KZSA 2KRUA 3LVWA 4B3SM 4JI6M 4RNAA 2V6ZM 4ZPXA 1Z6TA 1IN6A 2Y20A 3U6SA 4MGYE 3HHXA 1YE9A 2CEAA 3KVWA 1R2YA 1L1ZA 3T1YM 2XFTA 4CHTB 3L25A 1QAOA 8CATA 5ITRA 1L1TA 2KZUA 2RKOA 1NJGA 3TL4X 2G5GX 4KO8A 3FTFA 3ZCBB 4YHHM 4LFCM 1KYIA 2Z4SA 7CATA 4LFBM 4MGZE 2CHQA 3C58A 4LCBA 3U6QA 1WXQA 3A42A 5KPRA 1IBKM 2Q2EB 2P5TA 4GKKM 2OQ4A 1PM5A 3RGSA 3GPXA 1HR0M 3GO8A 2I7PA 2M60A 1XXHA 4LF8M 3IG8A 5ITXE 4G4NA 4YY3M 3U61A 1NVMA 4GMQA 3MK6A 3QAUA 3ZC7B 4L4UA 2F5SA 2BJVA 5E6JA 2I7NA 3GQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y20 A;  2Y0T A;  2L7H A;  2L7I A;  2Y0Q A;  4I5S A;  2Y21 A; 
#chains in the Genus database with same CATH topology
 4KT0 F;  4REZ A;  1LTM A;  4GKJ M;  2JXN A;  2BWE A;  4JV5 M;  2DXI A;  1PGY A;  1H6U A;  4NSR A;  4LGY A;  3TE6 A;  3U6P A;  4JI5 M;  2F5P A;  4HL4 A;  2DHY A;  3F92 A;  4L16 A;  3K2L A;  1TR8 A;  4NXN M;  2HCB A;  1GVN A;  2ZM6 M;  2G3Q A;  2APL A;  2EO2 A;  3HHZ A;  3SAR A;  4G4O A;  2KHH A;  3W0F A;  3HKP A;  1G41 A;  1P3Q Q;  1E9R A;  1DO0 A;  2JY8 A;  2XFS A;  3NWL A;  4LGM A;  1ZMV A;  4BLC A;  5F3W A;  1R5L A;  1L2C A;  3U6D A;  3W68 A;  1MU5 A;  3GLI E;  3NBI A;  3UK6 A;  3LQR A;  1TF0 B;  4S12 A;  5ITY A;  5JI2 E;  4IBJ A;  2VQE M;  4F1I A;  1DGB A;  2O25 A;  3T6P A;  1NNJ A;  4OU7 A;  1SXJ D;  3WHK A;  1D2N A;  1ZMW A;  2J7O A;  3J80 S;  5KQD A;  3K1J A;  3MJ5 A;  1S3S A;  2CV2 A;  2X49 A;  2LVP C;  2UUA M;  5DYG A;  1EFU B;  4WW0 A;  4NXM M;  2KW0 A;  1V34 A;  1Z5B A;  1G8P A;  2G8L A;  3FTD A;  1D0L A;  2CE7 A;  2XZF A;  4FWH A;  3UGJ A;  5FTM A;  2F4V M;  3R9X B;  1EE8 A;  1N33 M;  3GRR A;  3LW5 F;  2E5L M;  4Z6Y A;  3HHY A;  1Q3C A;  2LHC A;  2JZ1 A;  2C9O A;  2FOI C;  3CF6 E;  4NSO B;  1J7K A;  3E4R A;  3TPZ A;  1AIP C;  4QHS A;  2V1U A;  2ZAO A;  2GNO A;  4F2L A;  1N34 M;  1R6B X;  3MHV C;  3T1H M;  4X65 M;  2ZBK B;  2UXB M;  2R44 A;  4X66 M;  2CWB A;  4UN2 B;  3W0L B;  3U6L A;  4B7G A;  3SYK A;  3GPY A;  4JI7 M;  1QZE A;  1ZV1 A;  1DO2 A;  2W82 A;  4LF4 M;  2OPF A;  2LVO C;  3GLG E;  2DAI A;  5EP1 A;  2O5R A;  2XEP A;  1OJL A;  3FTC A;  3KP0 E;  2R18 A;  1GAB A;  1SXJ A;  2Y0Q A;  2KDL A;  4LRT A;  4B7H A;  3TQS A;  1NY5 A;  1IFY A;  4AI6 A;  3AKZ A;  5EXX A;  2OOB A;  4B3M M;  1FJG M;  3L28 A;  1SXJ B;  4JXJ A;  2BJW A;  1ZQ9 A;  2R0I A;  2LVN C;  3KSJ A;  5ITU A;  3GLH A;  3I4Y A;  3QYE A;  2MGW A;  2LVA A;  1XHB A;  3U6O A;  3EIE A;  2C5R A;  1HNX M;  1TH3 A;  3CF2 A;  1N75 A;  2VF7 A;  1JR3 E;  4XGI A;  1DGF A;  3GLH B;  4IBE A;  3I01 M;  3KS4 A;  1QYR A;  4LRS A;  4P17 A;  1IY1 A;  2L4F A;  3SAS A;  2XGN A;  1G3I A;  2OOA A;  2Z8Y M;  5IWA M;  1D0K A;  5C1B A;  1XWI A;  1XMQ M;  1WIV A;  2N35 A;  2O01 F;  3C3D A;  1HJP A;  5H37 D;  3K92 A;  3B7N A;  2R6F A;  3KSX A;  2K47 A;  2WSC F;  4LF6 M;  4I81 A;  5EQT A;  3FYD A;  1WGL A;  1IN5 A;  2C98 A;  1YLA A;  2DHR A;  2XSZ A;  4IBF A;  4DR4 M;  2ZAN A;  1WR1 B;  3IG5 A;  1W5T A;  3NBX X;  3I4V A;  2UUB M;  4OVZ A;  3W67 A;  1QDR A;  2QNJ A;  3L2A A;  1QUS A;  2C99 A;  2XZU A;  2XH9 A;  2JY5 A;  4L78 A;  4Y28 F;  1TH4 A;  4OVZ B;  4DV7 M;  4BBA A;  2RGO A;  4DV5 M;  2VDB B;  4MGI E;  3FUX A;  1PJQ A;  1W5S A;  5E26 A;  4R7G A;  1IN7 A;  1VEK A;  3UZU A;  5GKN A;  1Q3B A;  1VDD A;  1QAQ A;  1JQJ C;  1TTE A;  2FE8 A;  4FWD A;  5KPZ A;  4DV0 M;  4FCV A;  4XBO A;  1ZAE A;  3A98 B;  1QZM A;  4R71 A;  1Z59 A;  1V33 A;  2QP9 X;  2DWZ B;  4OW0 A;  4ANR A;  4IJE A;  1N78 A;  2DAK A;  2R45 A;  2J5Y A;  3UJN A;  4AZF A;  4K0K M;  1NJF A;  1N32 M;  1XXH E;  3SMS A;  2C96 A;  3J27 B;  1VEJ A;  2LNH C;  4CIZ A;  1E94 E;  3GRY A;  2CP8 A;  1GL7 A;  2J7N A;  4GH9 A;  4AQY M;  1L2B A;  3FYC A;  4G4Q A;  1IY0 A;  2FFJ A;  3VDU A;  4G3O A;  1UFZ A;  1Q02 A;  3SMP A;  1G4A E;  3H4M A;  4DV1 M;  3FKE A;  1V92 A;  2H5X A;  2HAK A;  1OKS A;  3GLF A;  3VKH A;  3KOZ E;  4FCW A;  1NNU C;  3EIH A;  4NL4 H;  4B7F A;  4GHA A;  3KW6 A;  2LWX A;  1J09 A;  4G4R A;  1NSF A;  2R46 A;  2C9C A;  4JI2 M;  5ITT A;  3AV0 A;  3GLF B;  2ERC A;  2EUC A;  4LFA M;  4DV3 M;  3FRI A;  4LJ5 A;  4RF1 A;  1NV8 A;  4DR7 M;  3SAU A;  4JI1 M;  3J7A S;  4GHL A;  3FTE A;  2H1R A;  1I94 M;  2D7G A;  4MM3 B;  3VK8 A;  3SAT A;  5LMN M;  1VEG A;  3LCV B;  2R4J A;  1IXS B;  4IBK A;  4JI4 M;  2RGH A;  2RRU A;  1QAN A;  1L8Q A;  2KA6 B;  4I8O A;  2D7E A;  4AW4 A;  4AKH A;  3RGP A;  5L8R F;  4IBD A;  3HJS A;  3VLF B;  2L2D A;  1G71 A;  1OAO C;  2BNK A;  3HU2 A;  2K6B A;  4IBG A;  3GLI A;  4FD2 A;  2WSE F;  3GRU A;  3HJQ A;  1ORY B;  5EP3 A;  5JI3 E;  1SG9 A;  3GLI B;  1NHG C;  1UM8 A;  4LZZ A;  2WSF F;  2LH0 A;  4FWG A;  4RF0 A;  4M9Z A;  3WHL A;  1K3X A;  3Q8X A;  1VQ1 A;  2DZN B;  3B9P A;  3GPU A;  1G59 A;  3CGW A;  1PRB A;  3VFD A;  4LJA A;  3E46 A;  4NRW A;  1TGU A;  2JY7 A;  3KXE C;  1SXJ C;  4KOD A;  4DV2 M;  1DGH B;  3U60 B;  2L09 A;  1NY6 A;  1X37 A;  3UMM A;  1Z5C A;  4M0D A;  2D7H A;  5FTL A;  3A46 A;  2QBY B;  1IXZ A;  2R4E A;  4L8R C;  3R8F A;  1HT2 E;  4ITQ A;  1JR3 D;  4IBB A;  2NQ8 C;  2HKJ A;  4QOZ C;  4IJF A;  2EKF A;  4II7 A;  4MH0 E;  2CHV A;  4IIW A;  2CV0 A;  4Z8X A;  3PFI A;  3VDP A;  2JA2 A;  3AFH A;  1R2Z A;  1K82 A;  1XNR M;  2YNM D;  1EIJ A;  3VKG A;  4OX9 M;  1K3W A;  2YQZ A;  3DZD A;  2B3T A;  2EJS A;  1R7R A;  3PNY A;  3GLG A;  3AOE C;  4M9X A;  5EXP A;  2QEN A;  3I51 A;  4GC9 A;  2QPA A;  4AG6 A;  2QSF X;  1IBM M;  3B89 A;  4X64 M;  5FLX S;  2CUZ A;  2DWL A;  4NOO B;  4LG2 A;  3AOE A;  1PJS A;  3FUW A;  5EJC A;  2KXE A;  1ZMU A;  4L6V 6;  3SHG B;  3GLG B;  1HNW M;  1IN8 A;  1C1K A;  2Y0T A;  3KOX E;  1DGG A;  3IHP A;  1OFI A;  3KDS E;  4L15 A;  4DUY M;  4PCZ A;  2JUJ A;  2DWN A;  4DV6 M;  2FS1 A;  3LMM A;  3QWL A;  2VF8 A;  3ZH9 B;  3U6E A;  4LJ4 A;  1MX0 A;  1MN3 A;  5EP4 A;  3TWM A;  2HL7 A;  2JWS A;  2Z4R A;  4LJ7 A;  1QUT A;  3M7G A;  4FW9 A;  4QNM A;  5KO3 A;  4DR2 M;  4LF7 M;  4QHT A;  1JR3 A;  3THG A;  4AKG A;  1Z5A A;  4JN6 A;  4DR3 M;  1OIZ A;  5ITQ A;  3JAM S;  1T3T A;  3J81 S;  3RE8 A;  2L7I A;  1D0M A;  2VII A;  1N36 M;  4LY6 A;  4MGK E;  1HQY E;  2X4A A;  2YR0 A;  4JI0 M;  1C7Y A;  1KSF X;  4LZJ A;  4HEO A;  1QQW A;  3K8Z A;  1MJG M;  2MRO B;  3BXW A;  3AL0 C;  1IM2 A;  3PVS A;  5KPT A;  3HU1 A;  4JI3 M;  3SFZ A;  3KOY E;  4GIT A;  3FD9 A;  1VDL A;  1OFH A;  1T43 A;  3L26 A;  5FTN A;  3PXG A;  4LF9 M;  2OO9 A;  1YSY A;  4DR6 M;  3V76 A;  1WHC A;  1GLN A;  1XC8 A;  5DYI A;  3SAW A;  5FSW A;  3HGI A;  2ZAM A;  5BPV A;  2UU9 M;  3HJ8 A;  3K9P A;  1GL6 A;  4FCT A;  2KNV A;  2EKK A;  3BOS A;  2HWJ A;  4NRV A;  3M6A A;  4X62 M;  2Y21 A;  1GKI A;  4KLN A;  1NHW C;  2CRU A;  2QHO B;  1GO5 A;  1LV7 A;  1IY2 A;  4CJ6 A;  4PD2 A;  2M5Z A;  4DV4 M;  3OTO M;  3GPP A;  4BB9 A;  2F5Q A;  1CUK A;  3FUU A;  3GRV A;  4M0W A;  3DOA A;  1GJS A;  5ITX A;  4AG5 A;  2KRK A;  4P16 A;  1RU3 A;  2JNH A;  3SAV A;  1N77 A;  5BR8 M;  2DVW B;  2FNA A;  1OIP A;  3LCU A;  4MGH A;  1XXH B;  5IT9 S;  1IXS A;  3IEC A;  5IZ7 D;  4DR1 M;  4LJ8 A;  4GIP A;  1FNN A;  2LTU A;  3HY5 A;  3U61 B;  1L2D A;  1F4I A;  1AUA A;  3T15 A;  3U5Z A;  4B3R M;  4XK8 F;  2YFQ A;  4QNR A;  3T38 A;  3SHF A;  4A3V B;  2R62 A;  5LMU M;  1J5E M;  1HQC A;  3SBJ A;  4JYA M;  2JZ0 A;  2LHG A;  4QOS A;  4B08 A;  2CFO A;  3U5Z B;  1PJI A;  3KP1 E;  4RKU F;  1VG5 A;  5FTK A;  3JR5 A;  3I04 M;  2QCU A;  3MMP A;  4WP2 A;  3A45 A;  1IQP A;  3FE3 A;  2L4E A;  3HZJ A;  1E9S A;  3J2P B;  4B3T M;  4D80 A;  4KHP M;  3C9P A;  3CTW B;  3FRH A;  3U6C A;  1QAM A;  2DWM A;  1QDT A;  3B74 A;  3ZQJ A;  2CV1 A;  3PNV A;  3LQQ A;  4W5W A;  2UUC M;  2Z3X A;  1DV0 A;  4D81 A;  2KNA A;  3U60 A;  1DGH A;  2AHM A;  3LVV A;  3DA1 A;  3KFU G;  3RFW A;  4PDI A;  2QBY A;  2K9D A;  2UXC M;  2LVQ D;  1NV9 A;  4LJ6 A;  2QZ4 A;  2KEB A;  1Q39 A;  4Q7J A;  2MR9 A;  2XLJ A;  5IRE B;  3M0E A;  2MH8 A;  4CGY B;  4R3D A;  4MB7 A;  4D82 A;  2L7H A;  1NO1 A;  3HWS A;  2LBC A;  4IBI A;  5A2Q S;  1SXJ E;  1IN4 A;  1IXR C;  1TDZ A;  5EXT A;  2UXD M;  3VK7 A;  2FH0 A;  3K9O A;  3L27 A;  4DR5 M;  3D8B A;  2F5N A;  3FUV A;  4EIW A;  3HHW A;  4PT5 A;  1TH2 A;  1IBL M;  3C3E A;  2BWB A;  3DFZ A;  1R4G A;  3B7Z A;  1OQY A;  2R65 A;  2F5O A;  4DBG B;  2DNA A;  3ILK A;  2JP7 A;  3GQ5 A;  1XMO M;  2K0B X;  2X8A A;  3JR4 A;  4HLQ A;  3GQ3 A;  3GLH E;  1XB2 B;  4LF5 M;  2LXE A;  3B7Q A;  3U6M A;  2HHH M;  1E32 A;  2A5Y B;  5DNY A;  3KOW E;  5FTJ A;  2DEN A;  3SYL A;  4JI8 M;  1GJT A;  3AJI B;  3J7B A;  1OAI A;  2CHG A;  4TUW A;  2XSZ D;  5EP2 A;  3L29 A;  5C18 A;  1Y8G A;  2WZJ A;  4IBC A;  2JY6 B;  2DAG A;  3D8L A;  2DZO B;  2DKL A;  4I5S A;  4PDG A;  2VQF M;  4G6Z A;  4GC5 A;  4M9S A;  4CIS A;  1HNZ M;  4LJ9 A;  3AOG A;  3CF0 A;  2V1C A;  4AKI A;  3SC3 A;  4DUZ M;  2DAE A;  3E9S A;  2EA0 A;  5DFL A;  1I4W A;  3FUT A;  4FVM A;  3TWL A;  3HU3 A;  1HT1 E;  1QVR A;  4WUR A;  1YUB A;  3H4J A;  4I4L A;  5EXS A;  3GP1 A;  5KQ8 A;  1XNQ M;  3KS8 A;  1KFV A;  1JB0 F;  2DI0 A;  2XF3 A;  2Z7J A;  4GRI A;  3TWK A;  2L6O A;  2MJ5 B;  1TDH A;  1PJJ A;  2KZS A;  2KRU A;  3LVW A;  4B3S M;  4JI6 M;  1A5T A;  2V6Z M;  4RNA A;  1WJ7 A;  4ZPX A;  1Z6T A;  1IN6 A;  2Y20 A;  3U6S A;  2ZTD A;  4GEW A;  4MGY E;  3HHX A;  1YE9 A;  2CEA A;  3KVW A;  1R2Y A;  1L1Z A;  3T1Y M;  2XFT A;  2DZL A;  4CHT B;  1QAO A;  3L25 A;  1PJT A;  8CAT A;  5ITR A;  1BVS A;  1L1T A;  1WGN A;  2DAM A;  3E21 A;  2KZU A;  2RKO A;  2GQF A;  1NJG A;  3TL4 X;  2G5G X;  4KO8 A;  3FTF A;  3ZCB B;  4YHH M;  4LFC M;  1KYI A;  2Z4S A;  7CAT A;  4LFB M;  4MGZ E;  2CHQ A;  3HX3 A;  3BBZ A;  2KNZ A;  3C58 A;  4LCB A;  3U6Q A;  1WXQ A;  3A42 A;  5KPR A;  1IBK M;  2Q2E B;  2P5T A;  2ZTC A;  3QYB A;  3Q8G A;  4GKK M;  2OQ4 A;  1OTR A;  1PM5 A;  3RGS A;  3GPX A;  4NC6 A;  1HR0 M;  3GO8 A;  2I7P A;  3GLF E;  1T6O A;  2M60 A;  1XXH A;  4LF8 M;  3IG8 A;  5ITX E;  4G4N A;  4YY3 M;  3U61 A;  2QQ8 A;  1NVM A;  4GMQ A;  3MK6 A;  3QAU A;  3ZC7 B;  4L4U A;  2F5S A;  2BJV A;  5E6J A;  2I7N A;  3GQ4 A; 
#chains in the Genus database with same CATH homology
 4REZ A;  4GKJ M;  4JV5 M;  2DXI A;  1H6U A;  4NSR A;  4LGY A;  3TE6 A;  3U6P A;  4JI5 M;  2F5P A;  4HL4 A;  4L16 A;  3K2L A;  4NXN M;  2HCB A;  1GVN A;  2ZM6 M;  2EO2 A;  3HHZ A;  3SAR A;  4G4O A;  3W0F A;  3HKP A;  1G41 A;  1E9R A;  1DO0 A;  2XFS A;  3NWL A;  4BLC A;  4LGM A;  5F3W A;  1L2C A;  3U6D A;  1MU5 A;  3NBI A;  3UK6 A;  3LQR A;  4S12 A;  5ITY A;  5JI2 E;  4IBJ A;  2VQE M;  1DGB A;  1NNJ A;  4OU7 A;  1SXJ D;  3WHK A;  1D2N A;  2J7O A;  3J80 S;  5KQD A;  3K1J A;  3MJ5 A;  1S3S A;  2CV2 A;  2X49 A;  2UUA M;  5DYG A;  4WW0 A;  4NXM M;  2KW0 A;  1Z5B A;  1G8P A;  2G8L A;  3FTD A;  2CE7 A;  2XZF A;  4FWH A;  3UGJ A;  5FTM A;  2F4V M;  3R9X B;  1EE8 A;  1N33 M;  3GRR A;  2E5L M;  4Z6Y A;  3HHY A;  1Q3C A;  3CF6 E;  3TPZ A;  2C9O A;  2FOI C;  4NSO B;  1J7K A;  3E4R A;  2V1U A;  4QHS A;  2ZAO A;  1N34 M;  1R6B X;  3MHV C;  3T1H M;  4X65 M;  2ZBK B;  2UXB M;  4X66 M;  3W0L B;  3U6L A;  4B7G A;  3SYK A;  3GPY A;  4JI7 M;  1DO2 A;  2W82 A;  4LF4 M;  2OPF A;  5EP1 A;  2XEP A;  2O5R A;  3KP0 E;  1OJL A;  3FTC A;  2R18 A;  1SXJ A;  2Y0Q A;  4LRT A;  4B7H A;  3TQS A;  1NY5 A;  4AI6 A;  3AKZ A;  5EXX A;  4B3M M;  1FJG M;  3L28 A;  1SXJ B;  4JXJ A;  2BJW A;  1ZQ9 A;  3KSJ A;  5ITU A;  3GLH A;  3I4Y A;  1XHB A;  3U6O A;  3EIE A;  2C5R A;  1HNX M;  1TH3 A;  3CF2 A;  1N75 A;  4XGI A;  1DGF A;  3GLH B;  4IBE A;  3KS4 A;  1QYR A;  4LRS A;  1IY1 A;  3SAS A;  2XGN A;  1G3I A;  5IWA M;  5C1B A;  1XWI A;  1XMQ M;  5H37 D;  3K92 A;  3KSX A;  2K47 A;  4LF6 M;  4I81 A;  5EQT A;  3FYD A;  1IN5 A;  2C98 A;  2DHR A;  2XSZ A;  4IBF A;  4DR4 M;  2ZAN A;  3IG5 A;  1W5T A;  2UUB M;  3I4V A;  4OVZ A;  3L2A A;  2C99 A;  2XZU A;  2XH9 A;  4L78 A;  1TH4 A;  4OVZ B;  4DV7 M;  4BBA A;  2RGO A;  4DV5 M;  4MGI E;  3FUX A;  1W5S A;  5E26 A;  4R7G A;  1IN7 A;  3UZU A;  5GKN A;  1Q3B A;  1VDD A;  1QAQ A;  1JQJ C;  2FE8 A;  4FWD A;  5KPZ A;  4DV0 M;  4FCV A;  4XBO A;  1ZAE A;  3A98 B;  1QZM A;  1Z59 A;  2QP9 X;  2DWZ B;  4OW0 A;  1N78 A;  4IJE A;  2R45 A;  3UJN A;  4AZF A;  4K0K M;  1NJF A;  1N32 M;  3SMS A;  2C96 A;  3J27 B;  2LNH C;  1E94 E;  3GRY A;  1L2B A;  1GL7 A;  2J7N A;  4GH9 A;  4AQY M;  3FYC A;  4G4Q A;  1IY0 A;  2FFJ A;  3VDU A;  3SMP A;  1G4A E;  3H4M A;  4DV1 M;  3FKE A;  3GLF A;  3VKH A;  3KOZ E;  4FCW A;  1NNU C;  3EIH A;  4NL4 H;  4B7F A;  4GHA A;  3KW6 A;  2LWX A;  1J09 A;  4G4R A;  1NSF A;  2R46 A;  2C9C A;  4JI2 M;  5ITT A;  3AV0 A;  3GLF B;  2ERC A;  2EUC A;  4LFA M;  4DV3 M;  4LJ5 A;  4RF1 A;  4DR7 M;  3SAU A;  4JI1 M;  3J7A S;  4GHL A;  3FTE A;  2H1R A;  1I94 M;  2D7G A;  4MM3 B;  3VK8 A;  3SAT A;  5LMN M;  2R4J A;  1IXS B;  4IBK A;  4JI4 M;  2RGH A;  1QAN A;  1L8Q A;  2KA6 B;  4I8O A;  2D7E A;  4AW4 A;  4AKH A;  3RGP A;  4IBD A;  3HJS A;  3VLF B;  2BNK A;  3HU2 A;  4IBG A;  3GLI A;  4FD2 A;  3GRU A;  3HJQ A;  1ORY B;  5EP3 A;  5JI3 E;  3GLI B;  1NHG C;  1UM8 A;  4LZZ A;  2LH0 A;  4FWG A;  4RF0 A;  4M9Z A;  3WHL A;  1K3X A;  3Q8X A;  2DZN B;  3B9P A;  3GPU A;  1G59 A;  3VFD A;  4LJA A;  4NRW A;  1TGU A;  3KXE C;  4KOD A;  1SXJ C;  4DV2 M;  3U60 B;  1DGH B;  2L09 A;  1NY6 A;  1X37 A;  3UMM A;  1Z5C A;  4M0D A;  2D7H A;  5FTL A;  3A46 A;  2QBY B;  1IXZ A;  2R4E A;  4L8R C;  3R8F A;  1HT2 E;  4ITQ A;  1JR3 D;  4IBB A;  2NQ8 C;  2HKJ A;  4QOZ C;  4IJF A;  4II7 A;  4MH0 E;  2CHV A;  4IIW A;  2CV0 A;  4Z8X A;  3PFI A;  3VDP A;  2JA2 A;  3AFH A;  1R2Z A;  1K82 A;  1XNR M;  2YNM D;  3VKG A;  4OX9 M;  1K3W A;  2YQZ A;  3DZD A;  1R7R A;  3PNY A;  3GLG A;  3AOE C;  4M9X A;  5EXP A;  2QEN A;  3I51 A;  4GC9 A;  2QPA A;  4AG6 A;  1IBM M;  4X64 M;  2DWL A;  5FLX S;  2CUZ A;  4LG2 A;  4NOO B;  3AOE A;  3FUW A;  5EJC A;  2KXE A;  3SHG B;  3GLG B;  1HNW M;  1IN8 A;  1C1K A;  2Y0T A;  3KOX E;  1DGG A;  1OFI A;  3KDS E;  4L15 A;  4DUY M;  4PCZ A;  2DWN A;  4DV6 M;  3LMM A;  3QWL A;  3ZH9 B;  3U6E A;  4LJ4 A;  1MX0 A;  5EP4 A;  3TWM A;  2HL7 A;  2Z4R A;  4LJ7 A;  5KO3 A;  3M7G A;  4LF7 M;  4FW9 A;  4QNM A;  4DR2 M;  4QHT A;  1JR3 A;  3THG A;  4AKG A;  1Z5A A;  4JN6 A;  4DR3 M;  5ITQ A;  3JAM S;  1T3T A;  3J81 S;  3RE8 A;  2L7I A;  2VII A;  1N36 M;  4LY6 A;  4MGK E;  1HQY E;  2X4A A;  2YR0 A;  4JI0 M;  1KSF X;  4LZJ A;  1QQW A;  3K8Z A;  3AL0 C;  1IM2 A;  3PVS A;  5KPT A;  3HU1 A;  4JI3 M;  3SFZ A;  3KOY E;  4GIT A;  3FD9 A;  1OFH A;  3L26 A;  5FTN A;  3PXG A;  4LF9 M;  1YSY A;  4DR6 M;  1GLN A;  1XC8 A;  5DYI A;  3SAW A;  5FSW A;  3HGI A;  2ZAM A;  5BPV A;  2UU9 M;  3HJ8 A;  1GL6 A;  4FCT A;  3BOS A;  4X62 M;  4NRV A;  3M6A A;  2Y21 A;  1GKI A;  4KLN A;  1NHW C;  1LV7 A;  1IY2 A;  4PD2 A;  2M5Z A;  4DV4 M;  3OTO M;  3GPP A;  4BB9 A;  2F5Q A;  3FUU A;  3GRV A;  4M0W A;  3DOA A;  5ITX A;  4AG5 A;  2KRK A;  4P16 A;  3SAV A;  1N77 A;  5BR8 M;  2DVW B;  2FNA A;  4MGH A;  1XXH B;  5IT9 S;  5IZ7 D;  4DR1 M;  3U61 B;  4LJ8 A;  4GIP A;  1FNN A;  1L2D A;  3T15 A;  3U5Z A;  4B3R M;  2YFQ A;  4QNR A;  3T38 A;  3SHF A;  4A3V B;  2R62 A;  5LMU M;  1J5E M;  1HQC A;  3SBJ A;  4JYA M;  4QOS A;  4B08 A;  3U5Z B;  2CFO A;  1PJI A;  3KP1 E;  5FTK A;  3JR5 A;  2QCU A;  3A45 A;  1IQP A;  1E9S A;  3J2P B;  4B3T M;  4D80 A;  4KHP M;  3CTW B;  3U6C A;  1QAM A;  2DWM A;  2CV1 A;  3PNV A;  3LQQ A;  4W5W A;  2UUC M;  2Z3X A;  4D81 A;  3U60 A;  1DGH A;  2AHM A;  3LVV A;  3DA1 A;  3KFU G;  3RFW A;  4PDI A;  2QBY A;  2UXC M;  4LJ6 A;  2QZ4 A;  2KEB A;  1Q39 A;  2XLJ A;  5IRE B;  3M0E A;  4CGY B;  4R3D A;  4MB7 A;  4D82 A;  2L7H A;  3HWS A;  4IBI A;  5A2Q S;  1SXJ E;  1IN4 A;  1IXR C;  1TDZ A;  5EXT A;  2UXD M;  3VK7 A;  3L27 A;  4DR5 M;  3D8B A;  2F5N A;  3FUV A;  4EIW A;  3HHW A;  4PT5 A;  1TH2 A;  1IBL M;  3DFZ A;  2F5O A;  2R65 A;  3ILK A;  1XMO M;  3GQ5 A;  2X8A A;  3JR4 A;  4HLQ A;  3GQ3 A;  4LF5 M;  2LXE A;  3U6M A;  2HHH M;  1E32 A;  2A5Y B;  5DNY A;  3KOW E;  5FTJ A;  3SYL A;  4JI8 M;  3AJI B;  3J7B A;  4TUW A;  2CHG A;  2XSZ D;  5EP2 A;  3L29 A;  5C18 A;  4IBC A;  3D8L A;  2DZO B;  4CIS A;  4I5S A;  4PDG A;  2VQF M;  4G6Z A;  4GC5 A;  4M9S A;  1HNZ M;  4LJ9 A;  3AOG A;  3CF0 A;  2V1C A;  4AKI A;  3SC3 A;  4DUZ M;  3E9S A;  2EA0 A;  1I4W A;  3FUT A;  4FVM A;  3TWL A;  3HU3 A;  1HT1 E;  1QVR A;  4WUR A;  1YUB A;  4I4L A;  5EXS A;  3GP1 A;  5KQ8 A;  1XNQ M;  3KS8 A;  1KFV A;  2XF3 A;  2Z7J A;  4GRI A;  3TWK A;  2L6O A;  1TDH A;  1PJJ A;  2KZS A;  2KRU A;  3LVW A;  4B3S M;  4JI6 M;  4RNA A;  2V6Z M;  4ZPX A;  1Z6T A;  1IN6 A;  2Y20 A;  3U6S A;  4MGY E;  3HHX A;  1YE9 A;  2CEA A;  3KVW A;  1R2Y A;  1L1Z A;  3T1Y M;  2XFT A;  4CHT B;  3L25 A;  1QAO A;  8CAT A;  5ITR A;  1L1T A;  2KZU A;  2RKO A;  1NJG A;  3TL4 X;  2G5G X;  4KO8 A;  3FTF A;  3ZCB B;  4YHH M;  4LFC M;  1KYI A;  2Z4S A;  7CAT A;  4LFB M;  4MGZ E;  2CHQ A;  3C58 A;  4LCB A;  3U6Q A;  1WXQ A;  3A42 A;  5KPR A;  1IBK M;  2Q2E B;  2P5T A;  4GKK M;  2OQ4 A;  1PM5 A;  3RGS A;  3GPX A;  1HR0 M;  3GO8 A;  2I7P A;  2M60 A;  1XXH A;  4LF8 M;  3IG8 A;  5ITX E;  4G4N A;  4YY3 M;  3U61 A;  1NVM A;  4GMQ A;  3MK6 A;  3QAU A;  3ZC7 B;  4L4U A;  2F5S A;  2BJV A;  5E6J A;  2I7N A;  3GQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...