2Y21A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
b'ITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HAMP
publication title The mechanisms of HAMP-mediated signaling in transmembrane receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y21A00
2Y0TA 2L7HA 2Y21A 2Y0QA 2Y20A 4I5SA 2L7IA
chains in the Genus database with same CATH superfamily
3TWMA 1N75A 1LTMA 4B3MM 4EIWA 3GLIB 4RKUF 1IN8A 2WZJA 2ERCA 1VG5A 1DGGA 1TTEA 5FSWA 1XMQM 5KPTA 4LF4M 3MJ5A 4FCVA 1OKSA 2NQ8C 5LMNM 1AIPC 1IXRC 3IG5A 2C96A 3NWLA 2CV0A 1PJQA 3ILKA 3SYKA 3AOGA 5IT9S 2UU9M 2F4VM 3UK6A 3GLHE 4JI5M 3AOEC 2QCUA 4D82A 4IJEA 4NL4H 3BOSA 3BBZA 1E9RA 1CUKA 3U6MA 2G3QA 3KW6A 1DO0A 3CF6E 2Y20A 5FTNA 2KZUA 2OOBA 1XB2B 3F92A 1GLNA 2QP9X 4AG5A 2DZNB 2XGNA 1XMOM 2DWMA 4R71A 2L09A 3FE3A 1SXJC 1PJIA 3DFZA 3KOYE 3U61A 3VK8A 3FTDA 1IXSB 1QANA 1XHBA 3E9SA 3HU2A 1YLAA 2FFJA 3HHWA 3LCUA 4B7FA 3SYLA 1G41A 2QQ8A 4OVZA 2CV2A 3L28A 4XBOA 5DFLA 3ZH9B 4K0KM 4LFBM 2CWBA 3PFIA 1GKIA 4IBFA 1NJGA 4M0WA 2DWZB 3FUVA 1OQYA 1IY0A 3FYCA 1R6BX 4BBAA 1SXJD 3W68A 3U6PA 3NBXX 4IBDA 1S3SA 1BVSA 4DBGB 1OFIA 2JY5A 3GLFA 1ZQ9A 2Y0TA 2C9OA 3IHPA 2X4AA 5C1BA 3GP1A 1GJTA 3L2AA 1J5EM 4DR7M 4CIZA 4XK8F 2D7GA 2L4FA 4WW0A 3Q8XA 2LXEA 1TDHA 1VDDA 5EXPA 1PGYA 4JI0M 1SXJA 4DUZM 3KP1E 2WSFF 4X65M 1L1ZA 4X62M 3EIEA 4KO8A 2M5ZA 3QWLA 3EIHA 2OQ4A 2J5YA 4LZJA 5EXXA 1C7YA 3KS4A 4JI7M 1NO1A 2DAIA 4NOOB 2LVNC 2V1UA 1TF0B 2DENA 5L8RF 2JNHA 3UZUA 2O5RA 5EP2A 2JY6B 4GEWA 3U5ZA 3SARA 2X49A 4NXMM 2I7PA 3B7NA 3KSXA 2XFTA 4IBIA 3UJNA 1QUSA 1NSFA 1D2NA 4FD2A 4AI6A 4MB7A 2OOAA 1XWIA 3AKZA 4CISA 3GLGA 5EQTA 2EO2A 4B7GA 3J27B 4JI6M 2JP7A 3AV0A 3VDPA 2CV1A 2YFQA 1WJ7A 2BJVA 3I04M 5FTMA 2RKOA 2QZ4A 4YHHM 2VQEM 1Q3CA 4FCTA 4KODA 2JZ0A 1G3IA 2DNAA 1F4IA 1NV9A 3LMMA 4WURA 1R2YA 1W5TA 2CHQA 2DZLA 1HJPA 1GABA 4MH0E 1K82A 5ITUA 1NY6A 3C9PA 3WHLA 1D0MA 3GQ3A 4CGYB 2UXBM 1HNZM 1IY1A 2MGWA 3V76A 3PNVA 2DKLA 4OVZB 1FJGM 2GNOA 3SAWA 1WR1B 3U6CA 4KLNA 1H6UA 1G71A 1QAMA 4DV2M 4D80A 4DR1M 2APLA 1VEJA 2ZAMA 4L16A 1Q02A 1IN5A 3GQ4A 4DR6M 3DA1A 1TH3A 2FE8A 2OO9A 2KW0A 5DYIA 4WP2A 3GLFB 3U6DA 2WSCF 3U6LA 1JR3D 3TPZA 2YR0A 1DGHA 4DR5M 2DHRA 1L2CA 2DAGA 2O25A 3E4RA 4LY6A 2RGHA 1IM2A 3TE6A 4TUWA 1SXJB 1T3TA 2JA2A 3JAMS 2XEPA 2Y0QA 4B3TM 4I81A 4M9ZA 2YQZA 1OAOC 1PJSA 4REZA 3J7AS 3GLFE 1L2BA 4JI4M 1MU5A 1JR3A 4D81A 4DV7M 3HHZA 1J09A 2K6BA 3FYDA 1MX0A 3HHXA 4LGYA 3T1HM 3U5ZB 3SASA 3CGWA 3E21A 3M6AA 4MM3B 3UGJA 1SXJE 4FWHA 4LF9M 4CHTB 2CEAA 4LRSA 1D0KA 3GQ5A 2N35A 3GLIE 4LF7M 2CHGA 5ITQA 5EP1A 2XH9A 4HL4A 3GLGB 1R4GA 3B74A 3ZCBB 2R62A 2KDLA 3DZDA 3PXGA 2V6ZM 2DI0A 3HX3A 1JB0F 2QSFX 1XNRM 2FNAA 1IQPA 2A5YB 2P5TA 2R46A 2KNVA 4Z8XA 1E94E 1EFUB 4FVMA 2HWJA 2KZSA 3GLGE 4IBJA 1XC8A 2CRUA 1HR0M 1P3QQ 3SBJA 5KO3A 3R8FA 1VEKA 3GRUA 3FRIA 1QZMA 3M7GA 1L1TA 4DV3M 1GVNA 2G5GX 3IECA 7CATA 1Z6TA 4L15A 4LZZA 2R0IA 3LCVB 2VDBB 4GITA 2LVAA 3M0EA 1Q39A 5FTJA 1QQWA 1NHGC 4MGZE 4Q7JA 3B7QA 4W5WA 4JI1M 2XFSA 3U6EA 4R3DA 4RNAA 4S12A 4LJ8A 5IREB 1ZV1A 1IY2A 3D8LA 1NVMA 1NHWC 2FH0A 2ZANA 4L78A 2R18A 4DUYM 2F5QA 1OIZA 1NNUC 3LVVA 2UUCM 1N32M 3SAUA 2UUBM 1DGHB 1OIPA 2D7EA 2DAEA 4RF1A 4KHPM 1IN4A 3I51A 3KOWE 1VQ1A 1Z5CA 3DOAA 3I4YA 5EP3A 1OFHA 1ZMWA 1HQCA 4KT0F 4DV6M 3LQQA 2DWNA 4YY3M 1R5LA 2DAMA 3SFZA 3SMSA 4X64M 4JI8M 3I01M 2K9DA 4AQYM 5KQDA 2Z7JA 4IBCA 5FTKA 3W0FA 2M60A 4LJ9A 4CJ6A 1ZAEA 2LVQD 4NRVA 3A42A 1IN6A 1X37A 1I4WA 5ITRA 3SATA 4IBKA 2O01F 1DV0A 1T43A 3GLHA 2Y21A 1GL6A 5JI3E 2KXEA 3J81S 2KRUA 3TL4X 2RGOA 2HCBA 4JXJA 1QVRA 1EE8A 3VDUA 2JZ1A 4HEOA 3HHYA 4B7HA 3HWSA 1VDLA 5BPVA 1XNQM 3TWLA 3FTEA 3TQSA 1WXQA 5ITXA 2GQFA 2XF3A 1JR3E 3T1YM 1IBKM 1DO2A 4BLCA 3KFUG 4NC6A 3VKHA 2DXIA 4GHAA 3TWKA 1ORYB 5EXTA 2KHHA 2WSEF 2VF7A 4Y28F 4G6ZA 3E46A 4G3OA 2X8AA 2W82A 2L4EA 4AKIA 5FTLA 3KOZE 3J80S 2Z4SA 1PJTA 2JWSA 5ITYA 2HL7A 1K3XA 3GPYA 4I8OA 4JN6A 3W67A 4L4UA 1UM8A 4LF5M 1V34A 4IJFA 3RE8A 4BB9A 2BJWA 2KRKA 2VIIA 2C98A 3HY5A 4QHTA 3K8ZA 2F5OA 3GRVA 1FNNA 5C18A 5A2QS 4IBGA 4II7A 3K92A 2VQFM 3U6OA 4F2LA 2XZFA 4B3SM 4GIPA 3SHGB 8CATA 4JYAM 2KNZA 2JXNA 1HNWM 1V92A 1LV7A 4GKJM 3HKPA 1ZMVA 4P17A 3MK6A 3I4VA 3FUWA 4LG2A 2MH8A 1N33M 2G8LA 1DGFA 4PDGA 4LJ6A 1RU3A 2EUCA 3AJIB 3T38A 4ITQA 5FLXS 1A5TA 4QNMA 2KA6B 3ZQJA 4IBBA 2QBYA 4QNRA 2LHGA 3C58A 4IIWA 3A98B 4QOSA 2UUAM 3KS8A 3CF0A 2E5LM 1L2DA 2JY8A 4PDIA 2Z4RA 3HU1A 4P16A 4AG6A 4M9SA 1WHCA 2R44A 1NNJA 2JUJA 2ZBKB 4GHLA 2QNJA 2R6FA 4NSOB 1QAOA 1G59A 5JI2E 3GRRA 1YUBA 3VLFB 2MR9A 2OPFA 2HAKA 3J7BA 2LVPC 4LCBA 3NBIA 2Z8YM 3FUTA 4G4OA 3VK7A 1L8QA 1MJGM 5KPRA 3FTFA 2UXDM 4GKKM 3GLHB 1G4AE 1HT2E 1I94M 1IXZA 3ZC7B 4OW0A 1G8PA 3IG8A 2HKJA 4GH9A 4B08A 2XSZD 3KVWA 4G4QA 4AKHA 2XZUA 2XLJA 2R65A 2CFOA 1Z5AA 2H1RA 1WIVA 2LVOC 1QAQA 3KP0E 2JY7A 2QHOB 4LJ5A 2ZTCA 3A45A 2C5RA 3QAUA 3VKGA 3C3DA 4AKGA 1R7RA 2CUZA 4OU7A 5EJCA 4LRTA 2DZOB 1ZMUA 2L6OA 4LJAA 2HHHM 2BWEA 1AUAA 4AZFA 5GKNA 2XSZA 2FOIC 4ANRA 3U6QA 2LHCA 1N78A 1Q3BA 4MGKE 1TDZA 4MGIE 2K0BX 5IWAM 3KXEC 4NRWA 4L6V6 3LW5F 5ITXE 3BXWA 4LJ7A 1DGBA 3SMPA 2LNHC 2J7NA 1V33A 1J7KA 4GC9A 3FRHA 3AFHA 3T6PA 1XXHA 2BNKA 3FKEA 3JR5A 4G4NA 2F5PA 1YE9A 3U6SA 1WGLA 4I4LA 1IFYA 3D8BA 2KNAA 2R4EA 3B7ZA 3HJ8A 4AW4A 1IBLM 5IZ7D 4LFAM 3R9XB 3WHKA 1MN3A 3GPPA 3K9PA 4X66M 3OTOM 3U60A 1IBMM 2R4JA 2Z3XA 2LH0A 3K2LA 4LJ4A 1NV8A 1W5SA 2L2DA 3B9PA 5KQ8A 3FTCA 4QHSA 2F5NA 4JV5M 4UN2B 2CP8A 4L8RC 1SG9A 3L29A 4PT5A 1QDRA 3AOEA 1QUTA 3UMMA 2V1CA 3GPXA 2EJSA 3LVWA 2LWXA 2YNMD 2VF8A 3FD9A 3PNYA 2MROB 1D0LA 3K1JA 5KPZA 4DV5M 2DHYA 2L7HA 4G4RA 2QBYB 2B3TA 2DVWB 3CTWB 3KDSE 4JI2M 3L26A 1JQJC 2BWBA 2EKFA 2KEBA 3FUXA 1T6OA 1N34M 2H5XA 4F1IA 2Q2EB 2I7NA 3QYBA 3MMPA 3FUUA 4FW9A 3HJQA 3W0LB 5F3WA 3KOXE 2RRUA 1N77A 3GLIA 2EA0A 4LF6M 3MHVC 4I5SA 4M9XA 2EKKA 1HNXM 2FS1A 3RFWA 1WGNA 1GL7A 3Q8GA 3SC3A 3AL0C 1NJFA 3H4JA 1YSYA 3HJSA 2L7IA 5E26A 2ZM6M 3VFDA 4FWGA 4IBEA 1HQYE 2J7OA 3SAVA 3K9OA 4B3RM 3H4MA 4MGHA 1GO5A 4DV4M 1TGUA 4OX9M 1NY5A 2C99A 5DNYA 2LBCA 4DR2M 1VEGA 1PRBA 3GRYA 3HU3A 4NSRA 1PM5A 4DR3M 1KSFX 1KYIA 1TH4A 3A46A 4FWDA 4PCZA 3JR4A 4QOZC 1E32A 1QZEA 1IXSA 4JI3M 1HT1E 3GPUA 5LMUM 4NXNM 3CF2A 5EP4A 5E6JA 3RGPA 4LF8M 3T15A 5BR8M 4LFCM 3B89A 4FCWA 1Y8GA 1OAIA 3HGIA 4DR4M 1QYRA 4GRIA 2C9CA 1XXHB 4RF0A 3SHFA 3LQRA 1KFVA 5DYGA 4R7GA 3GO8A 2AHMA 3U61B 4MGYE 4GC5A 1C1KA 1OTRA 2MJ5B 3THGA 1UFZA 2F5SA 2CE7A 2DWLA 4M0DA 4XGIA 3L25A 2D7HA 2R45A 2CHVA 3U60B 1IN7A 2ZAOA 2LTUA 3PVSA 1Z59A 5ITTA 3QYEA 2DAKA 1K3WA 2K47A 4PD2A 3J2PB 2QENA 3C3EA 1XXHE 1TR8A 1R2ZA 1Z5BA 2ZTDA 1QDTA 4A3VB 1GJSA 1PJJA 1E9SA 4DV1M 2UXCM 5H37D 3HZJA 4DV0M 1OJLA 4GMQA 3L27A 1TH2A 3KSJA 1EIJA 5EXSA 3RGSA 4HLQA 4ZPXA 2QPAA 4Z6YA 1N36M 4LGMA
chains in the Genus database with same CATH topology
3TWMA 1N75A 4B3MM 4EIWA 3GLIB 1IN8A 2ERCA 1DGGA 5FSWA 1XMQM 4LF4M 5KPTA 3MJ5A 4FCVA 2NQ8C 5LMNM 3IG5A 1IXRC 3NWLA 2C96A 2CV0A 3ILKA 3SYKA 3AOGA 5IT9S 2UU9M 2F4VM 3UK6A 4JI5M 3AOEC 2QCUA 4D82A 4IJEA 4NL4H 3BOSA 1E9RA 3U6MA 3KW6A 1DO0A 3CF6E 2Y20A 5FTNA 2KZUA 1GLNA 2QP9X 4AG5A 2DZNB 2XGNA 1XMOM 2DWMA 2L09A 1SXJC 1PJIA 3DFZA 3KOYE 3U61A 3VK8A 3FTDA 1IXSB 1QANA 1XHBA 3E9SA 3HU2A 2FFJA 3HHWA 4B7FA 3SYLA 1G41A 4OVZA 2CV2A 4LFBM 3L28A 4XBOA 3ZH9B 4K0KM 3PFIA 1GKIA 4IBFA 1NJGA 4M0WA 2DWZB 3FUVA 1IY0A 3FYCA 1R6BX 4BBAA 1SXJD 3U6PA 4IBDA 1S3SA 1OFIA 3GLFA 1ZQ9A 2Y0TA 2C9OA 2X4AA 5C1BA 3GP1A 1J5EM 3L2AA 4DR7M 2D7GA 4WW0A 3Q8XA 2LXEA 1TDHA 1VDDA 5EXPA 4JI0M 1L1ZA 1SXJA 4DUZM 3KP1E 4X65M 4X62M 3EIEA 4KO8A 2M5ZA 3QWLA 3EIHA 2OQ4A 4LZJA 5EXXA 3KS4A 4JI7M 4NOOB 2V1UA 3UZUA 2O5RA 5EP2A 3U5ZA 3SARA 2X49A 4NXMM 2I7PA 3KSXA 2XFTA 4IBIA 3UJNA 1NSFA 1D2NA 4FD2A 4AI6A 4MB7A 1XWIA 3AKZA 4CISA 3GLGA 5EQTA 2EO2A 4B7GA 3J27B 4JI6M 3AV0A 3VDPA 2CV1A 2YFQA 2BJVA 5FTMA 2RKOA 2QZ4A 4YHHM 2VQEM 1Q3CA 4FCTA 4KODA 1G3IA 3LMMA 4WURA 1R2YA 1W5TA 2CHQA 4MH0E 1K82A 5ITUA 1NY6A 3WHLA 3GQ3A 4CGYB 2UXBM 1HNZM 1IY1A 3PNVA 4OVZB 1FJGM 3SAWA 3U6CA 4KLNA 1H6UA 1QAMA 4DV2M 4D80A 4DR1M 2ZAMA 4L16A 1IN5A 3GQ4A 4DR6M 3DA1A 1TH3A 2FE8A 2KW0A 5DYIA 3GLFB 3U6DA 3U6LA 1JR3D 3TPZA 2YR0A 1DGHA 4DR5M 2DHRA 1L2CA 3E4RA 4LY6A 2RGHA 1IM2A 3TE6A 4TUWA 1SXJB 1T3TA 2JA2A 3JAMS 2XEPA 2Y0QA 4B3TM 4I81A 4M9ZA 2YQZA 4REZA 3J7AS 1L2BA 4JI4M 1MU5A 1JR3A 4D81A 4DV7M 3HHZA 1J09A 3FYDA 1MX0A 3HHXA 4LGYA 3T1HM 3U5ZB 3SASA 3M6AA 4MM3B 3UGJA 1SXJE 4FWHA 4LF9M 4CHTB 2CEAA 4LRSA 3GQ5A 4LF7M 2CHGA 5ITQA 5EP1A 2XH9A 4HL4A 3GLGB 3ZCBB 2R62A 3DZDA 3PXGA 2V6ZM 1XNRM 2FNAA 1IQPA 2A5YB 2P5TA 2R46A 4Z8XA 1E94E 4FVMA 2KZSA 4IBJA 1XC8A 1HR0M 3SBJA 5KO3A 3R8FA 3GRUA 1L1TA 1QZMA 3M7GA 4DV3M 1GVNA 2G5GX 7CATA 1Z6TA 4L15A 4LZZA 4GITA 3M0EA 1Q39A 5FTJA 1QQWA 1NHGC 4MGZE 4W5WA 4JI1M 2XFSA 3U6EA 4R3DA 4RNAA 4S12A 4LJ8A 5IREB 1IY2A 3D8LA 1NVMA 1NHWC 2ZANA 4L78A 2R18A 4DUYM 2F5QA 2UUCM 1NNUC 3LVVA 1N32M 3SAUA 2UUBM 1DGHB 2D7EA 4RF1A 4KHPM 1IN4A 3I51A 3KOWE 3I4YA 1Z5CA 3DOAA 5EP3A 1OFHA 4DV6M 1HQCA 3LQQA 2DWNA 4YY3M 3SFZA 3SMSA 4X64M 4JI8M 4AQYM 5KQDA 2Z7JA 4IBCA 5FTKA 3W0FA 2M60A 4LJ9A 1ZAEA 4NRVA 3A42A 1IN6A 1X37A 1I4WA 5ITRA 3SATA 4IBKA 3GLHA 2Y21A 1GL6A 5JI3E 2KXEA 3J81S 2KRUA 3TL4X 2RGOA 2HCBA 4JXJA 1QVRA 1EE8A 3VDUA 4B7HA 3HHYA 5BPVA 3HWSA 1XNQM 3TWLA 3TQSA 1WXQA 5ITXA 2XF3A 3T1YM 1IBKM 1DO2A 4BLCA 3KFUG 3VKHA 2DXIA 4GHAA 3TWKA 1ORYB 5EXTA 4G6ZA 2X8AA 2W82A 4AKIA 5FTLA 3KOZE 3J80S 2Z4SA 5ITYA 2HL7A 1K3XA 3GPYA 4I8OA 4JN6A 4LF5M 4L4UA 1UM8A 4BB9A 4IJFA 3RE8A 2BJWA 2KRKA 2VIIA 2C98A 4QHTA 3K8ZA 2F5OA 3GRVA 1FNNA 5C18A 5A2QS 4IBGA 4II7A 3K92A 2VQFM 3U6OA 2XZFA 4B3SM 4GIPA 3SHGB 8CATA 4JYAM 1HNWM 1LV7A 4GKJM 3HKPA 1N33M 3MK6A 3I4VA 3FUWA 4LG2A 2G8LA 1DGFA 4PDGA 4LJ6A 2EUCA 3AJIB 3T38A 4ITQA 5FLXS 4QNMA 2KA6B 4IBBA 2QBYA 4QNRA 3C58A 2UUAM 4IIWA 3A98B 4QOSA 3KS8A 3CF0A 2E5LM 1L2DA 4PDIA 2Z4RA 3HU1A 4P16A 4AG6A 4M9SA 1NNJA 2ZBKB 4GHLA 4NSOB 1QAOA 1G59A 5JI2E 3GRRA 1YUBA 3VLFB 2OPFA 3VK7A 3J7BA 4LCBA 3NBIA 3FUTA 4G4OA 1L8QA 5KPRA 3FTFA 2UXDM 4GKKM 3GLHB 1G4AE 1HT2E 1I94M 1IXZA 3ZC7B 4OW0A 1G8PA 3IG8A 2HKJA 4GH9A 4B08A 2XSZD 3KVWA 4G4QA 4AKHA 2XZUA 2XLJA 2R65A 2CFOA 1Z5AA 2H1RA 1QAQA 3KP0E 3VKGA 4LJ5A 3A45A 2C5RA 3QAUA 4AKGA 1R7RA 2CUZA 4OU7A 5EJCA 4LRTA 2DZOB 2L6OA 4LJAA 2HHHM 4AZFA 5GKNA 2XSZA 2FOIC 1N78A 3U6QA 1Q3BA 4MGKE 1TDZA 4MGIE 5IWAM 3KXEC 4NRWA 5ITXE 4LJ7A 1DGBA 3SMPA 2LNHC 2J7NA 1J7KA 4GC9A 3AFHA 4G4NA 1XXHA 2BNKA 3FKEA 3JR5A 2F5PA 1YE9A 3U6SA 4I4LA 3D8BA 2R4EA 4AW4A 3HJ8A 1IBLM 5IZ7D 4LFAM 3R9XB 3WHKA 3GPPA 4X66M 3OTOM 3U60A 1IBMM 2R4JA 2Z3XA 2LH0A 3K2LA 4LJ4A 1W5SA 3B9PA 5KQ8A 3FTCA 4QHSA 2F5NA 4JV5M 4L8RC 3L29A 4PT5A 3AOEA 3UMMA 2V1CA 3GPXA 3LVWA 2LWXA 2YNMD 3FD9A 3PNYA 5KPZA 4G4RA 4DV5M 3K1JA 2QBYB 3FTEA 2L7HA 2DVWB 3CTWB 4JI2M 3KDSE 3L26A 1JQJC 3FUXA 2KEBA 1N34M 2Q2EB 2I7NA 3FUUA 4FW9A 3HJQA 3W0LB 5F3WA 3KOXE 1N77A 3GLIA 2EA0A 4LF6M 3MHVC 4I5SA 4M9XA 1HNXM 3RFWA 1GL7A 3SC3A 3AL0C 1NJFA 1YSYA 3HJSA 2L7IA 5E26A 2ZM6M 3VFDA 4FWGA 4IBEA 1HQYE 2J7OA 3SAVA 4B3RM 3H4MA 4MGHA 4DV4M 1TGUA 4OX9M 1NY5A 2C99A 5DNYA 4DR2M 4NSRA 3GRYA 3HU3A 1PM5A 4DR3M 1KSFX 1KYIA 1TH4A 3A46A 4FWDA 4PCZA 3JR4A 4QOZC 1E32A 4JI3M 1HT1E 3GPUA 5LMUM 4NXNM 3CF2A 5EP4A 5E6JA 3RGPA 4LF8M 3T15A 5BR8M 4LFCM 4FCWA 3HGIA 4DR4M 1QYRA 4GRIA 2C9CA 1XXHB 4RF0A 3SHFA 3LQRA 1KFVA 5DYGA 4R7GA 3GO8A 2AHMA 3U61B 4MGYE 4GC5A 1C1KA 3THGA 2F5SA 2CE7A 2DWLA 4M0DA 4XGIA 3L25A 2D7HA 2R45A 2CHVA 3U60B 1IN7A 2ZAOA 3PVSA 5ITTA 1Z59A 1K3WA 2K47A 4PD2A 3J2PB 2QENA 1R2ZA 1Z5BA 4A3VB 1PJJA 1E9SA 4DV1M 2UXCM 5H37D 4DV0M 1OJLA 4GMQA 3L27A 1TH2A 3KSJA 5EXSA 3RGSA 4HLQA 4ZPXA 2QPAA 4Z6YA 1N36M 4LGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0T A;  2L7H A;  2Y21 A;  2Y0Q A;  2Y20 A;  4I5S A;  2L7I A; 
#chains in the Genus database with same CATH topology
 3TWM A;  1N75 A;  1LTM A;  4B3M M;  4EIW A;  3GLI B;  4RKU F;  1IN8 A;  2WZJ A;  2ERC A;  1VG5 A;  1DGG A;  1TTE A;  5FSW A;  1XMQ M;  5KPT A;  4LF4 M;  3MJ5 A;  4FCV A;  1OKS A;  2NQ8 C;  5LMN M;  1AIP C;  1IXR C;  3IG5 A;  2C96 A;  3NWL A;  2CV0 A;  1PJQ A;  3ILK A;  3SYK A;  3AOG A;  5IT9 S;  2UU9 M;  2F4V M;  3UK6 A;  3GLH E;  4JI5 M;  3AOE C;  2QCU A;  4D82 A;  4IJE A;  4NL4 H;  3BOS A;  3BBZ A;  1E9R A;  1CUK A;  3U6M A;  2G3Q A;  3KW6 A;  1DO0 A;  3CF6 E;  2Y20 A;  5FTN A;  2KZU A;  2OOB A;  1XB2 B;  3F92 A;  1GLN A;  2QP9 X;  4AG5 A;  2DZN B;  2XGN A;  1XMO M;  2DWM A;  4R71 A;  2L09 A;  3FE3 A;  1SXJ C;  1PJI A;  3DFZ A;  3KOY E;  3U61 A;  3VK8 A;  3FTD A;  1IXS B;  1QAN A;  1XHB A;  3E9S A;  3HU2 A;  1YLA A;  2FFJ A;  3HHW A;  3LCU A;  4B7F A;  3SYL A;  1G41 A;  2QQ8 A;  4OVZ A;  2CV2 A;  3L28 A;  4XBO A;  5DFL A;  3ZH9 B;  4K0K M;  4LFB M;  2CWB A;  3PFI A;  1GKI A;  4IBF A;  1NJG A;  4M0W A;  2DWZ B;  3FUV A;  1OQY A;  1IY0 A;  3FYC A;  1R6B X;  4BBA A;  1SXJ D;  3W68 A;  3U6P A;  3NBX X;  4IBD A;  1S3S A;  1BVS A;  4DBG B;  1OFI A;  2JY5 A;  3GLF A;  1ZQ9 A;  2Y0T A;  2C9O A;  3IHP A;  2X4A A;  5C1B A;  3GP1 A;  1GJT A;  3L2A A;  1J5E M;  4DR7 M;  4CIZ A;  4XK8 F;  2D7G A;  2L4F A;  4WW0 A;  3Q8X A;  2LXE A;  1TDH A;  1VDD A;  5EXP A;  1PGY A;  4JI0 M;  1SXJ A;  4DUZ M;  3KP1 E;  2WSF F;  4X65 M;  1L1Z A;  4X62 M;  3EIE A;  4KO8 A;  2M5Z A;  3QWL A;  3EIH A;  2OQ4 A;  2J5Y A;  4LZJ A;  5EXX A;  1C7Y A;  3KS4 A;  4JI7 M;  1NO1 A;  2DAI A;  4NOO B;  2LVN C;  2V1U A;  1TF0 B;  2DEN A;  5L8R F;  2JNH A;  3UZU A;  2O5R A;  5EP2 A;  2JY6 B;  4GEW A;  3U5Z A;  3SAR A;  2X49 A;  4NXM M;  2I7P A;  3B7N A;  3KSX A;  2XFT A;  4IBI A;  3UJN A;  1QUS A;  1NSF A;  1D2N A;  4FD2 A;  4AI6 A;  4MB7 A;  2OOA A;  1XWI A;  3AKZ A;  4CIS A;  3GLG A;  5EQT A;  2EO2 A;  4B7G A;  3J27 B;  4JI6 M;  2JP7 A;  3AV0 A;  3VDP A;  2CV1 A;  2YFQ A;  1WJ7 A;  2BJV A;  3I04 M;  5FTM A;  2RKO A;  2QZ4 A;  4YHH M;  2VQE M;  1Q3C A;  4FCT A;  4KOD A;  2JZ0 A;  1G3I A;  2DNA A;  1F4I A;  1NV9 A;  3LMM A;  4WUR A;  1R2Y A;  1W5T A;  2CHQ A;  2DZL A;  1HJP A;  1GAB A;  4MH0 E;  1K82 A;  5ITU A;  1NY6 A;  3C9P A;  3WHL A;  1D0M A;  3GQ3 A;  4CGY B;  2UXB M;  1HNZ M;  1IY1 A;  2MGW A;  3V76 A;  3PNV A;  2DKL A;  4OVZ B;  1FJG M;  2GNO A;  3SAW A;  1WR1 B;  3U6C A;  4KLN A;  1H6U A;  1G71 A;  1QAM A;  4DV2 M;  4D80 A;  4DR1 M;  2APL A;  1VEJ A;  2ZAM A;  4L16 A;  1Q02 A;  1IN5 A;  3GQ4 A;  4DR6 M;  3DA1 A;  1TH3 A;  2FE8 A;  2OO9 A;  2KW0 A;  5DYI A;  4WP2 A;  3GLF B;  3U6D A;  2WSC F;  3U6L A;  1JR3 D;  3TPZ A;  2YR0 A;  1DGH A;  4DR5 M;  2DHR A;  1L2C A;  2DAG A;  2O25 A;  3E4R A;  4LY6 A;  2RGH A;  1IM2 A;  3TE6 A;  4TUW A;  1SXJ B;  1T3T A;  2JA2 A;  3JAM S;  2XEP A;  2Y0Q A;  4B3T M;  4I81 A;  4M9Z A;  2YQZ A;  1OAO C;  1PJS A;  4REZ A;  3J7A S;  3GLF E;  1L2B A;  4JI4 M;  1MU5 A;  1JR3 A;  4D81 A;  4DV7 M;  3HHZ A;  1J09 A;  2K6B A;  3FYD A;  1MX0 A;  3HHX A;  4LGY A;  3T1H M;  3U5Z B;  3SAS A;  3CGW A;  3E21 A;  3M6A A;  4MM3 B;  3UGJ A;  1SXJ E;  4FWH A;  4LF9 M;  4CHT B;  2CEA A;  4LRS A;  1D0K A;  3GQ5 A;  2N35 A;  3GLI E;  4LF7 M;  2CHG A;  5ITQ A;  5EP1 A;  2XH9 A;  4HL4 A;  3GLG B;  1R4G A;  3B74 A;  3ZCB B;  2R62 A;  2KDL A;  3DZD A;  3PXG A;  2V6Z M;  2DI0 A;  3HX3 A;  1JB0 F;  2QSF X;  1XNR M;  2FNA A;  1IQP A;  2A5Y B;  2P5T A;  2R46 A;  2KNV A;  4Z8X A;  1E94 E;  1EFU B;  4FVM A;  2HWJ A;  2KZS A;  3GLG E;  4IBJ A;  1XC8 A;  2CRU A;  1HR0 M;  1P3Q Q;  3SBJ A;  5KO3 A;  3R8F A;  1VEK A;  3GRU A;  3FRI A;  1QZM A;  3M7G A;  1L1T A;  4DV3 M;  1GVN A;  2G5G X;  3IEC A;  7CAT A;  1Z6T A;  4L15 A;  4LZZ A;  2R0I A;  3LCV B;  2VDB B;  4GIT A;  2LVA A;  3M0E A;  1Q39 A;  5FTJ A;  1QQW A;  1NHG C;  4MGZ E;  4Q7J A;  3B7Q A;  4W5W A;  4JI1 M;  2XFS A;  3U6E A;  4R3D A;  4RNA A;  4S12 A;  4LJ8 A;  5IRE B;  1ZV1 A;  1IY2 A;  3D8L A;  1NVM A;  1NHW C;  2FH0 A;  2ZAN A;  4L78 A;  2R18 A;  4DUY M;  2F5Q A;  1OIZ A;  1NNU C;  3LVV A;  2UUC M;  1N32 M;  3SAU A;  2UUB M;  1DGH B;  1OIP A;  2D7E A;  2DAE A;  4RF1 A;  4KHP M;  1IN4 A;  3I51 A;  3KOW E;  1VQ1 A;  1Z5C A;  3DOA A;  3I4Y A;  5EP3 A;  1OFH A;  1ZMW A;  1HQC A;  4KT0 F;  4DV6 M;  3LQQ A;  2DWN A;  4YY3 M;  1R5L A;  2DAM A;  3SFZ A;  3SMS A;  4X64 M;  4JI8 M;  3I01 M;  2K9D A;  4AQY M;  5KQD A;  2Z7J A;  4IBC A;  5FTK A;  3W0F A;  2M60 A;  4LJ9 A;  4CJ6 A;  1ZAE A;  2LVQ D;  4NRV A;  3A42 A;  1IN6 A;  1X37 A;  1I4W A;  5ITR A;  3SAT A;  4IBK A;  2O01 F;  1DV0 A;  1T43 A;  3GLH A;  2Y21 A;  1GL6 A;  5JI3 E;  2KXE A;  3J81 S;  2KRU A;  3TL4 X;  2RGO A;  2HCB A;  4JXJ A;  1QVR A;  1EE8 A;  3VDU A;  2JZ1 A;  4HEO A;  3HHY A;  4B7H A;  3HWS A;  1VDL A;  5BPV A;  1XNQ M;  3TWL A;  3FTE A;  3TQS A;  1WXQ A;  5ITX A;  2GQF A;  2XF3 A;  1JR3 E;  3T1Y M;  1IBK M;  1DO2 A;  4BLC A;  3KFU G;  4NC6 A;  3VKH A;  2DXI A;  4GHA A;  3TWK A;  1ORY B;  5EXT A;  2KHH A;  2WSE F;  2VF7 A;  4Y28 F;  4G6Z A;  3E46 A;  4G3O A;  2X8A A;  2W82 A;  2L4E A;  4AKI A;  5FTL A;  3KOZ E;  3J80 S;  2Z4S A;  1PJT A;  2JWS A;  5ITY A;  2HL7 A;  1K3X A;  3GPY A;  4I8O A;  4JN6 A;  3W67 A;  4L4U A;  1UM8 A;  4LF5 M;  1V34 A;  4IJF A;  3RE8 A;  4BB9 A;  2BJW A;  2KRK A;  2VII A;  2C98 A;  3HY5 A;  4QHT A;  3K8Z A;  2F5O A;  3GRV A;  1FNN A;  5C18 A;  5A2Q S;  4IBG A;  4II7 A;  3K92 A;  2VQF M;  3U6O A;  4F2L A;  2XZF A;  4B3S M;  4GIP A;  3SHG B;  8CAT A;  4JYA M;  2KNZ A;  2JXN A;  1HNW M;  1V92 A;  1LV7 A;  4GKJ M;  3HKP A;  1ZMV A;  4P17 A;  3MK6 A;  3I4V A;  3FUW A;  4LG2 A;  2MH8 A;  1N33 M;  2G8L A;  1DGF A;  4PDG A;  4LJ6 A;  1RU3 A;  2EUC A;  3AJI B;  3T38 A;  4ITQ A;  5FLX S;  1A5T A;  4QNM A;  2KA6 B;  3ZQJ A;  4IBB A;  2QBY A;  4QNR A;  2LHG A;  3C58 A;  4IIW A;  3A98 B;  4QOS A;  2UUA M;  3KS8 A;  3CF0 A;  2E5L M;  1L2D A;  2JY8 A;  4PDI A;  2Z4R A;  3HU1 A;  4P16 A;  4AG6 A;  4M9S A;  1WHC A;  2R44 A;  1NNJ A;  2JUJ A;  2ZBK B;  4GHL A;  2QNJ A;  2R6F A;  4NSO B;  1QAO A;  1G59 A;  5JI2 E;  3GRR A;  1YUB A;  3VLF B;  2MR9 A;  2OPF A;  2HAK A;  3J7B A;  2LVP C;  4LCB A;  3NBI A;  2Z8Y M;  3FUT A;  4G4O A;  3VK7 A;  1L8Q A;  1MJG M;  5KPR A;  3FTF A;  2UXD M;  4GKK M;  3GLH B;  1G4A E;  1HT2 E;  1I94 M;  1IXZ A;  3ZC7 B;  4OW0 A;  1G8P A;  3IG8 A;  2HKJ A;  4GH9 A;  4B08 A;  2XSZ D;  3KVW A;  4G4Q A;  4AKH A;  2XZU A;  2XLJ A;  2R65 A;  2CFO A;  1Z5A A;  2H1R A;  1WIV A;  2LVO C;  1QAQ A;  3KP0 E;  2JY7 A;  2QHO B;  4LJ5 A;  2ZTC A;  3A45 A;  2C5R A;  3QAU A;  3VKG A;  3C3D A;  4AKG A;  1R7R A;  2CUZ A;  4OU7 A;  5EJC A;  4LRT A;  2DZO B;  1ZMU A;  2L6O A;  4LJA A;  2HHH M;  2BWE A;  1AUA A;  4AZF A;  5GKN A;  2XSZ A;  2FOI C;  4ANR A;  3U6Q A;  2LHC A;  1N78 A;  1Q3B A;  4MGK E;  1TDZ A;  4MGI E;  2K0B X;  5IWA M;  3KXE C;  4NRW A;  4L6V 6;  3LW5 F;  5ITX E;  3BXW A;  4LJ7 A;  1DGB A;  3SMP A;  2LNH C;  2J7N A;  1V33 A;  1J7K A;  4GC9 A;  3FRH A;  3AFH A;  3T6P A;  1XXH A;  2BNK A;  3FKE A;  3JR5 A;  4G4N A;  2F5P A;  1YE9 A;  3U6S A;  1WGL A;  4I4L A;  1IFY A;  3D8B A;  2KNA A;  2R4E A;  3B7Z A;  3HJ8 A;  4AW4 A;  1IBL M;  5IZ7 D;  4LFA M;  3R9X B;  3WHK A;  1MN3 A;  3GPP A;  3K9P A;  4X66 M;  3OTO M;  3U60 A;  1IBM M;  2R4J A;  2Z3X A;  2LH0 A;  3K2L A;  4LJ4 A;  1NV8 A;  1W5S A;  2L2D A;  3B9P A;  5KQ8 A;  3FTC A;  4QHS A;  2F5N A;  4JV5 M;  4UN2 B;  2CP8 A;  4L8R C;  1SG9 A;  3L29 A;  4PT5 A;  1QDR A;  3AOE A;  1QUT A;  3UMM A;  2V1C A;  3GPX A;  2EJS A;  3LVW A;  2LWX A;  2YNM D;  2VF8 A;  3FD9 A;  3PNY A;  2MRO B;  1D0L A;  3K1J A;  5KPZ A;  4DV5 M;  2DHY A;  2L7H A;  4G4R A;  2QBY B;  2B3T A;  2DVW B;  3CTW B;  3KDS E;  4JI2 M;  3L26 A;  1JQJ C;  2BWB A;  2EKF A;  2KEB A;  3FUX A;  1T6O A;  1N34 M;  2H5X A;  4F1I A;  2Q2E B;  2I7N A;  3QYB A;  3MMP A;  3FUU A;  4FW9 A;  3HJQ A;  3W0L B;  5F3W A;  3KOX E;  2RRU A;  1N77 A;  3GLI A;  2EA0 A;  4LF6 M;  3MHV C;  4I5S A;  4M9X A;  2EKK A;  1HNX M;  2FS1 A;  3RFW A;  1WGN A;  1GL7 A;  3Q8G A;  3SC3 A;  3AL0 C;  1NJF A;  3H4J A;  1YSY A;  3HJS A;  2L7I A;  5E26 A;  2ZM6 M;  3VFD A;  4FWG A;  4IBE A;  1HQY E;  2J7O A;  3SAV A;  3K9O A;  4B3R M;  3H4M A;  4MGH A;  1GO5 A;  4DV4 M;  1TGU A;  4OX9 M;  1NY5 A;  2C99 A;  5DNY A;  2LBC A;  4DR2 M;  1VEG A;  1PRB A;  3GRY A;  3HU3 A;  4NSR A;  1PM5 A;  4DR3 M;  1KSF X;  1KYI A;  1TH4 A;  3A46 A;  4FWD A;  4PCZ A;  3JR4 A;  4QOZ C;  1E32 A;  1QZE A;  1IXS A;  4JI3 M;  1HT1 E;  3GPU A;  5LMU M;  4NXN M;  3CF2 A;  5EP4 A;  5E6J A;  3RGP A;  4LF8 M;  3T15 A;  5BR8 M;  4LFC M;  3B89 A;  4FCW A;  1Y8G A;  1OAI A;  3HGI A;  4DR4 M;  1QYR A;  4GRI A;  2C9C A;  1XXH B;  4RF0 A;  3SHF A;  3LQR A;  1KFV A;  5DYG A;  4R7G A;  3GO8 A;  2AHM A;  3U61 B;  4MGY E;  4GC5 A;  1C1K A;  1OTR A;  2MJ5 B;  3THG A;  1UFZ A;  2F5S A;  2CE7 A;  2DWL A;  4M0D A;  4XGI A;  3L25 A;  2D7H A;  2R45 A;  2CHV A;  3U60 B;  1IN7 A;  2ZAO A;  2LTU A;  3PVS A;  1Z59 A;  5ITT A;  3QYE A;  2DAK A;  1K3W A;  2K47 A;  4PD2 A;  3J2P B;  2QEN A;  3C3E A;  1XXH E;  1TR8 A;  1R2Z A;  1Z5B A;  2ZTD A;  1QDT A;  4A3V B;  1GJS A;  1PJJ A;  1E9S A;  4DV1 M;  2UXC M;  5H37 D;  3HZJ A;  4DV0 M;  1OJL A;  4GMQ A;  3L27 A;  1TH2 A;  3KSJ A;  1EIJ A;  5EXS A;  3RGS A;  4HLQ A;  4ZPX A;  2QPA A;  4Z6Y A;  1N36 M;  4LGM A; 
#chains in the Genus database with same CATH homology
 3TWM A;  1N75 A;  4B3M M;  4EIW A;  3GLI B;  1IN8 A;  2ERC A;  1DGG A;  5FSW A;  1XMQ M;  4LF4 M;  5KPT A;  3MJ5 A;  4FCV A;  2NQ8 C;  5LMN M;  3IG5 A;  1IXR C;  3NWL A;  2C96 A;  2CV0 A;  3ILK A;  3SYK A;  3AOG A;  5IT9 S;  2UU9 M;  2F4V M;  3UK6 A;  4JI5 M;  3AOE C;  2QCU A;  4D82 A;  4IJE A;  4NL4 H;  3BOS A;  1E9R A;  3U6M A;  3KW6 A;  1DO0 A;  3CF6 E;  2Y20 A;  5FTN A;  2KZU A;  1GLN A;  2QP9 X;  4AG5 A;  2DZN B;  2XGN A;  1XMO M;  2DWM A;  2L09 A;  1SXJ C;  1PJI A;  3DFZ A;  3KOY E;  3U61 A;  3VK8 A;  3FTD A;  1IXS B;  1QAN A;  1XHB A;  3E9S A;  3HU2 A;  2FFJ A;  3HHW A;  4B7F A;  3SYL A;  1G41 A;  4OVZ A;  2CV2 A;  4LFB M;  3L28 A;  4XBO A;  3ZH9 B;  4K0K M;  3PFI A;  1GKI A;  4IBF A;  1NJG A;  4M0W A;  2DWZ B;  3FUV A;  1IY0 A;  3FYC A;  1R6B X;  4BBA A;  1SXJ D;  3U6P A;  4IBD A;  1S3S A;  1OFI A;  3GLF A;  1ZQ9 A;  2Y0T A;  2C9O A;  2X4A A;  5C1B A;  3GP1 A;  1J5E M;  3L2A A;  4DR7 M;  2D7G A;  4WW0 A;  3Q8X A;  2LXE A;  1TDH A;  1VDD A;  5EXP A;  4JI0 M;  1L1Z A;  1SXJ A;  4DUZ M;  3KP1 E;  4X65 M;  4X62 M;  3EIE A;  4KO8 A;  2M5Z A;  3QWL A;  3EIH A;  2OQ4 A;  4LZJ A;  5EXX A;  3KS4 A;  4JI7 M;  4NOO B;  2V1U A;  3UZU A;  2O5R A;  5EP2 A;  3U5Z A;  3SAR A;  2X49 A;  4NXM M;  2I7P A;  3KSX A;  2XFT A;  4IBI A;  3UJN A;  1NSF A;  1D2N A;  4FD2 A;  4AI6 A;  4MB7 A;  1XWI A;  3AKZ A;  4CIS A;  3GLG A;  5EQT A;  2EO2 A;  4B7G A;  3J27 B;  4JI6 M;  3AV0 A;  3VDP A;  2CV1 A;  2YFQ A;  2BJV A;  5FTM A;  2RKO A;  2QZ4 A;  4YHH M;  2VQE M;  1Q3C A;  4FCT A;  4KOD A;  1G3I A;  3LMM A;  4WUR A;  1R2Y A;  1W5T A;  2CHQ A;  4MH0 E;  1K82 A;  5ITU A;  1NY6 A;  3WHL A;  3GQ3 A;  4CGY B;  2UXB M;  1HNZ M;  1IY1 A;  3PNV A;  4OVZ B;  1FJG M;  3SAW A;  3U6C A;  4KLN A;  1H6U A;  1QAM A;  4DV2 M;  4D80 A;  4DR1 M;  2ZAM A;  4L16 A;  1IN5 A;  3GQ4 A;  4DR6 M;  3DA1 A;  1TH3 A;  2FE8 A;  2KW0 A;  5DYI A;  3GLF B;  3U6D A;  3U6L A;  1JR3 D;  3TPZ A;  2YR0 A;  1DGH A;  4DR5 M;  2DHR A;  1L2C A;  3E4R A;  4LY6 A;  2RGH A;  1IM2 A;  3TE6 A;  4TUW A;  1SXJ B;  1T3T A;  2JA2 A;  3JAM S;  2XEP A;  2Y0Q A;  4B3T M;  4I81 A;  4M9Z A;  2YQZ A;  4REZ A;  3J7A S;  1L2B A;  4JI4 M;  1MU5 A;  1JR3 A;  4D81 A;  4DV7 M;  3HHZ A;  1J09 A;  3FYD A;  1MX0 A;  3HHX A;  4LGY A;  3T1H M;  3U5Z B;  3SAS A;  3M6A A;  4MM3 B;  3UGJ A;  1SXJ E;  4FWH A;  4LF9 M;  4CHT B;  2CEA A;  4LRS A;  3GQ5 A;  4LF7 M;  2CHG A;  5ITQ A;  5EP1 A;  2XH9 A;  4HL4 A;  3GLG B;  3ZCB B;  2R62 A;  3DZD A;  3PXG A;  2V6Z M;  1XNR M;  2FNA A;  1IQP A;  2A5Y B;  2P5T A;  2R46 A;  4Z8X A;  1E94 E;  4FVM A;  2KZS A;  4IBJ A;  1XC8 A;  1HR0 M;  3SBJ A;  5KO3 A;  3R8F A;  3GRU A;  1L1T A;  1QZM A;  3M7G A;  4DV3 M;  1GVN A;  2G5G X;  7CAT A;  1Z6T A;  4L15 A;  4LZZ A;  4GIT A;  3M0E A;  1Q39 A;  5FTJ A;  1QQW A;  1NHG C;  4MGZ E;  4W5W A;  4JI1 M;  2XFS A;  3U6E A;  4R3D A;  4RNA A;  4S12 A;  4LJ8 A;  5IRE B;  1IY2 A;  3D8L A;  1NVM A;  1NHW C;  2ZAN A;  4L78 A;  2R18 A;  4DUY M;  2F5Q A;  2UUC M;  1NNU C;  3LVV A;  1N32 M;  3SAU A;  2UUB M;  1DGH B;  2D7E A;  4RF1 A;  4KHP M;  1IN4 A;  3I51 A;  3KOW E;  3I4Y A;  1Z5C A;  3DOA A;  5EP3 A;  1OFH A;  4DV6 M;  1HQC A;  3LQQ A;  2DWN A;  4YY3 M;  3SFZ A;  3SMS A;  4X64 M;  4JI8 M;  4AQY M;  5KQD A;  2Z7J A;  4IBC A;  5FTK A;  3W0F A;  2M60 A;  4LJ9 A;  1ZAE A;  4NRV A;  3A42 A;  1IN6 A;  1X37 A;  1I4W A;  5ITR A;  3SAT A;  4IBK A;  3GLH A;  2Y21 A;  1GL6 A;  5JI3 E;  2KXE A;  3J81 S;  2KRU A;  3TL4 X;  2RGO A;  2HCB A;  4JXJ A;  1QVR A;  1EE8 A;  3VDU A;  4B7H A;  3HHY A;  5BPV A;  3HWS A;  1XNQ M;  3TWL A;  3TQS A;  1WXQ A;  5ITX A;  2XF3 A;  3T1Y M;  1IBK M;  1DO2 A;  4BLC A;  3KFU G;  3VKH A;  2DXI A;  4GHA A;  3TWK A;  1ORY B;  5EXT A;  4G6Z A;  2X8A A;  2W82 A;  4AKI A;  5FTL A;  3KOZ E;  3J80 S;  2Z4S A;  5ITY A;  2HL7 A;  1K3X A;  3GPY A;  4I8O A;  4JN6 A;  4LF5 M;  4L4U A;  1UM8 A;  4BB9 A;  4IJF A;  3RE8 A;  2BJW A;  2KRK A;  2VII A;  2C98 A;  4QHT A;  3K8Z A;  2F5O A;  3GRV A;  1FNN A;  5C18 A;  5A2Q S;  4IBG A;  4II7 A;  3K92 A;  2VQF M;  3U6O A;  2XZF A;  4B3S M;  4GIP A;  3SHG B;  8CAT A;  4JYA M;  1HNW M;  1LV7 A;  4GKJ M;  3HKP A;  1N33 M;  3MK6 A;  3I4V A;  3FUW A;  4LG2 A;  2G8L A;  1DGF A;  4PDG A;  4LJ6 A;  2EUC A;  3AJI B;  3T38 A;  4ITQ A;  5FLX S;  4QNM A;  2KA6 B;  4IBB A;  2QBY A;  4QNR A;  3C58 A;  2UUA M;  4IIW A;  3A98 B;  4QOS A;  3KS8 A;  3CF0 A;  2E5L M;  1L2D A;  4PDI A;  2Z4R A;  3HU1 A;  4P16 A;  4AG6 A;  4M9S A;  1NNJ A;  2ZBK B;  4GHL A;  4NSO B;  1QAO A;  1G59 A;  5JI2 E;  3GRR A;  1YUB A;  3VLF B;  2OPF A;  3VK7 A;  3J7B A;  4LCB A;  3NBI A;  3FUT A;  4G4O A;  1L8Q A;  5KPR A;  3FTF A;  2UXD M;  4GKK M;  3GLH B;  1G4A E;  1HT2 E;  1I94 M;  1IXZ A;  3ZC7 B;  4OW0 A;  1G8P A;  3IG8 A;  2HKJ A;  4GH9 A;  4B08 A;  2XSZ D;  3KVW A;  4G4Q A;  4AKH A;  2XZU A;  2XLJ A;  2R65 A;  2CFO A;  1Z5A A;  2H1R A;  1QAQ A;  3KP0 E;  3VKG A;  4LJ5 A;  3A45 A;  2C5R A;  3QAU A;  4AKG A;  1R7R A;  2CUZ A;  4OU7 A;  5EJC A;  4LRT A;  2DZO B;  2L6O A;  4LJA A;  2HHH M;  4AZF A;  5GKN A;  2XSZ A;  2FOI C;  1N78 A;  3U6Q A;  1Q3B A;  4MGK E;  1TDZ A;  4MGI E;  5IWA M;  3KXE C;  4NRW A;  5ITX E;  4LJ7 A;  1DGB A;  3SMP A;  2LNH C;  2J7N A;  1J7K A;  4GC9 A;  3AFH A;  4G4N A;  1XXH A;  2BNK A;  3FKE A;  3JR5 A;  2F5P A;  1YE9 A;  3U6S A;  4I4L A;  3D8B A;  2R4E A;  4AW4 A;  3HJ8 A;  1IBL M;  5IZ7 D;  4LFA M;  3R9X B;  3WHK A;  3GPP A;  4X66 M;  3OTO M;  3U60 A;  1IBM M;  2R4J A;  2Z3X A;  2LH0 A;  3K2L A;  4LJ4 A;  1W5S A;  3B9P A;  5KQ8 A;  3FTC A;  4QHS A;  2F5N A;  4JV5 M;  4L8R C;  3L29 A;  4PT5 A;  3AOE A;  3UMM A;  2V1C A;  3GPX A;  3LVW A;  2LWX A;  2YNM D;  3FD9 A;  3PNY A;  5KPZ A;  4G4R A;  4DV5 M;  3K1J A;  2QBY B;  3FTE A;  2L7H A;  2DVW B;  3CTW B;  4JI2 M;  3KDS E;  3L26 A;  1JQJ C;  3FUX A;  2KEB A;  1N34 M;  2Q2E B;  2I7N A;  3FUU A;  4FW9 A;  3HJQ A;  3W0L B;  5F3W A;  3KOX E;  1N77 A;  3GLI A;  2EA0 A;  4LF6 M;  3MHV C;  4I5S A;  4M9X A;  1HNX M;  3RFW A;  1GL7 A;  3SC3 A;  3AL0 C;  1NJF A;  1YSY A;  3HJS A;  2L7I A;  5E26 A;  2ZM6 M;  3VFD A;  4FWG A;  4IBE A;  1HQY E;  2J7O A;  3SAV A;  4B3R M;  3H4M A;  4MGH A;  4DV4 M;  1TGU A;  4OX9 M;  1NY5 A;  2C99 A;  5DNY A;  4DR2 M;  4NSR A;  3GRY A;  3HU3 A;  1PM5 A;  4DR3 M;  1KSF X;  1KYI A;  1TH4 A;  3A46 A;  4FWD A;  4PCZ A;  3JR4 A;  4QOZ C;  1E32 A;  4JI3 M;  1HT1 E;  3GPU A;  5LMU M;  4NXN M;  3CF2 A;  5EP4 A;  5E6J A;  3RGP A;  4LF8 M;  3T15 A;  5BR8 M;  4LFC M;  4FCW A;  3HGI A;  4DR4 M;  1QYR A;  4GRI A;  2C9C A;  1XXH B;  4RF0 A;  3SHF A;  3LQR A;  1KFV A;  5DYG A;  4R7G A;  3GO8 A;  2AHM A;  3U61 B;  4MGY E;  4GC5 A;  1C1K A;  3THG A;  2F5S A;  2CE7 A;  2DWL A;  4M0D A;  4XGI A;  3L25 A;  2D7H A;  2R45 A;  2CHV A;  3U60 B;  1IN7 A;  2ZAO A;  3PVS A;  5ITT A;  1Z59 A;  1K3W A;  2K47 A;  4PD2 A;  3J2P B;  2QEN A;  1R2Z A;  1Z5B A;  4A3V B;  1PJJ A;  1E9S A;  4DV1 M;  2UXC M;  5H37 D;  4DV0 M;  1OJL A;  4GMQ A;  3L27 A;  1TH2 A;  3KSJ A;  5EXS A;  3RGS A;  4HLQ A;  4ZPX A;  2QPA A;  4Z6Y A;  1N36 M;  4LGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...