2Y21A

The mechanisms of hamp-mediated signaling in transmembrane receptors - the a291v mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
52
structure length
52
Chain Sequence
ITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKVAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The mechanisms of HAMP-mediated signaling in transmembrane receptors.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Membrane protein
molecule keywords HAMP
total genus 21
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.500 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2y21A00
4I5SA 2Y0TA 2Y20A 2Y0QA 2L7IA 2Y21A 2L7HA
chains in the Genus database with same CATH superfamily
4AKGA 1VG5A 2GQFA 4DUYM 5KQDA 1CUKA 3AOEC 1NY6A 3GPPA 5ITXE 2LBCA 5EXSA 3BXWA 5IWAM 2V1UA 2L7HA 4MH0E 5BR8M 2CHVA 3KP0E 1L2CA 1DGBA 2R65A 1EFUB 2BWEA 2R6FA 3DOAA 4LJAA 4MGIE 1LTMA 2ZAOA 4NSOB 2UXDM 3PXGA 4CGYB 1IXRC 2KZUA 2LTUA 3B89A 3J80S 1QDRA 3H4MA 3HGIA 3SBJA 1XC8A 3TWKA 3TWLA 2E5LM 2M60A 2QCUA 1G8PA 2R46A 5E26A 4B3SM 5FTJA 4MGKE 2DZOB 2L2DA 3M6AA 3GPUA 3GRYA 1VEJA 4LGYA 2B3TA 3GLHB 3KOYE 4IJEA 3FUXA 4DV0M 2VIIA 4DR1M 4YY3M 1HT2E 2APLA 2QPAA 1IY2A 4X62M 4DV1M 3OTOM 4R71A 2JUJA 3FE3A 5EQTA 2RRUA 2Y0TA 1GJSA 3UJNA 1IY0A 4X65M 3QYBA 4Z8XA 2DXIA 2DWNA 1PJJA 3HY5A 2JY6B 2JY8A 4GMQA 4Y28F 3VLFB 4DV7M 2FFJA 3GLFA 2XGNA 3AL0C 2L09A 3KS4A 4QNMA 5ITXA 2XFSA 2N35A 2X8AA 3GPYA 4B7GA 2JWSA 2Y0QA 3U6SA 2D7HA 5ITQA 2QHOB 4LRSA 2KW0A 2CP8A 2L7IA 1OAOC 4WW0A 2KHHA 1OFHA 3I01M 4FCWA 5JI2E 3GPXA 1NVMA 1VDLA 3HHWA 4DR2M 1V34A 1OJLA 4PDGA 1XMQM 1KSFX 2OOBA 3AFHA 1PJTA 4G4QA 3U6LA 3HU1A 4B3MM 1IY1A 2WSFF 3Q8XA 4LF5M 4FWHA 1W5SA 4L16A 4GIPA 4D80A 1ZV1A 2J7OA 1NHWC 2HKJA 1MX0A 3HKPA 3IECA 3SASA 1I94M 3HJQA 2ZTDA 3I51A 1OQYA 1R2YA 3GRVA 3B74A 2Z7JA 2LHCA 1SXJC 4GEWA 2VF7A 2J7NA 1XXHB 1PJIA 2VDBB 3U61A 4KHPM 1G4AE 3KP1E 4JI2M 5EP2A 1IBMM 1IQPA 4JN6A 2CE7A 3FUUA 4NRWA 5LMUM 1OTRA 4FCTA 1TF0B 2WSEF 4IBFA 4OVZA 2CUZA 2EKFA 1WR1B 4AW4A 3VK7A 2G8LA 2DAGA 1OFIA 2LNHC 1SG9A 4UN2B 3LVWA 5BPVA 3GQ4A 3GLFE 2F5SA 2RKOA 3I4YA 1XHBA 1N78A 4DUZM 4DR7M 3U60A 1DGGA 4L15A 3L26A 2DZLA 3T15A 1PRBA 3KDSE 4ITQA 1Z5AA 1IXZA 2VQFM 2I7PA 5EXPA 3L29A 1Y8GA 4R3DA 3TPZA 1DGFA 3A45A 4LZJA 3HHYA 1I4WA 1WXQA 1VQ1A 3L28A 4WURA 4B7FA 4GRIA 2CRUA 3HWSA 4DR6M 1GABA 1QAMA 2K0BX 5H37D 3UMMA 3L27A 3CGWA 4FWDA 4G6ZA 2D7GA 2H1RA 1HNWM 2LVPC 4IBJA 3V76A 4X64M 2QBYB 2LXEA 2MROB 3KFUG 1NNUC 5LMNM 4AI6A 2XSZD 1PJSA 2LVQD 4MGZE 5JI3E 2XZFA 1QAQA 3FYDA 3L2AA 3Q8GA 3LW5F 3E21A 3GLHE 3U5ZA 2L6OA 3L25A 1T3TA 1Q39A 3PNYA 2DAIA 4DV4M 2X49A 2EO2A 3ILKA 2F5QA 2FE8A 1DO0A 3A42A 4XGIA 2DNAA 4LFBM 3VKHA 2G5GX 4IJFA 5ITTA 1HR0M 4JYAM 3JAMS 1BVSA 3U6MA 1WIVA 4QOSA 5E6JA 4AKIA 1NSFA 2FS1A 5DYIA 3W0FA 1J09A 1E9RA 2XLJA 4F1IA 4NXNM 4L8RC 2KEBA 1OKSA 2QQ8A 3ZCBB 4JI6M 2WZJA 2OOAA 2ZM6M 3GLGE 3MK6A 3AKZA 5DFLA 4TUWA 1LV7A 2O01F 5KQ8A 3W68A 4FVMA 3FUWA 4AKHA 3FTDA 3CF2A 5L8RF 1Z6TA 4LCBA 2XEPA 4LJ7A 3J81S 1R5LA 4DV2M 2QENA 1W5TA 4RF1A 3TWMA 2GNOA 1TR8A 4DBGB 2CWBA 1D0LA 3E4RA 1JR3D 5DYGA 3THGA 2C96A 2LH0A 2KA6B 2LVOC 2MR9A 3GLHA 3QAUA 3U6DA 2QBYA 1P3QQ 5IT9S 2Z4RA 3GO8A 3VDUA 4XBOA 1IN7A 2CV0A 2DWLA 4GHAA 2KDLA 2HWJA 1IN5A 3IG8A 2F5OA 5IREB 2VF8A 4R7GA 1N33M 3RGSA 1ZQ9A 2EKKA 1QYRA 4FD2A 4IBKA 4NC6A 5ITRA 2V6ZM 3KSXA 2R44A 4HLQA 3K9OA 1DGHA 1VEKA 4LF9M 1AUAA 2JNHA 2ZBKB 4GKKM 3GLGB 4HEOA 4IBDA 1ZMVA 5KPZA 3M7GA 4REZA 4NXMM 1HJPA 4OX9M 2KNZA 5FTKA 2KRKA 2C5RA 1TH2A 3MJ5A 1XNQM 3PNVA 2JP7A 3FUVA 1E94E 3K92A 3HHZA 1YE9A 4G4OA 1GO5A 1IM2A 1R4GA 4PD2A 2QNJA 1SXJD 2O5RA 2K47A 4I5SA 2EUCA 1J7KA 4BLCA 1IN6A 1OIPA 3FYCA 1D2NA 1HNXM 1SXJB 1EIJA 3F92A 4JI5M 4CHTB 1YUBA 2DAEA 1VDDA 2RGOA 4GKJM 1FJGM 1WGNA 1GL7A 3K9PA 3TL4X 4LF8M 4JI1M 1D0MA 3NBXX 4L6V6 3PVSA 5KO3A 1V33A 2LVNC 2P5TA 3TQSA 4DR5M 1G3IA 1GLNA 2R4EA 3D8LA 3LCVB 3SYLA 2F5NA 4B3TM 1Z5BA 2M5ZA 2V1CA 1N34M 3SC3A 4ANRA 2H5XA 3D8BA 4NL4H 4I81A 1H6UA 1TDHA 3LVVA 4GH9A 4CIZA 1K3XA 3HX3A 3IG5A 3B7ZA 2UU9M 2DVWB 3C9PA 2BJVA 4LF6M 2JZ0A 1UM8A 2QP9X 3VFDA 3C3EA 1KYIA 4W5WA 3GLFB 4G4RA 4PT5A 2Z4SA 3GQ3A 1IFYA 1K82A 1WHCA 3J2PB 3UK6A 2UXBM 2RGHA 4NSRA 4M0WA 3U6CA 3U5ZB 2R18A 3BBZA 3GRUA 4LJ9A 1UFZA 3DZDA 3KXEC 3J27B 5FTNA 4IBIA 4CJ6A 1T43A 4F2LA 1G41A 1XMOM 2DHYA 2Q2EB 1QAOA 2UUAM 2BWBA 3C58A 1OAIA 4I4LA 2XF3A 1G59A 1GL6A 4EIWA 5KPRA 3VKGA 4P16A 2ZTCA 4L4UA 4G3OA 3KW6A 2MGWA 4RKUF 4X66M 3FTCA 4LJ5A 1C7YA 1JR3E 1ZMUA 1HT1E 4B08A 1IN8A 2CFOA 1IXSB 2I7NA 1PGYA 3GQ5A 1N32M 3R8FA 2CV1A 5EXXA 1XB2B 8CATA 4WP2A 3AV0A 3U6QA 5EP1A 3KS8A 2QZ4A 1QANA 3HU3A 1HQYE 3MMPA 1X37A 4AZFA 1OIZA 1WGLA 5DNYA 4LF4M 1QUSA 2D7EA 1R6BX 2ERCA 3CF0A 2KNAA 3FUTA 5EXTA 1NNJA 3FRHA 3K8ZA 1R2ZA 3LMMA 4HL4A 4KO8A 1ZAEA 3SHGB 4IBBA 1QUTA 5FTMA 3FTFA 2WSCF 4KODA 3SFZA 1DV0A 1SXJE 2Z8YM 2DENA 1L8QA 3HU2A 2EA0A 3MHVC 4M9ZA 1A5TA 3AJIB 3SYKA 1JQJC 1TGUA 3QYEA 3JR4A 1QVRA 2DKLA 2EJSA 5ITUA 7CATA 3DA1A 1N77A 1SXJA 1F4IA 4LRTA 5C1BA 4AQYM 2FOIC 3KOWE 1PJQA 3BOSA 3T1HM 2OPFA 1FNNA 4DV3M 3RFWA 4D82A 3K1JA 4NRVA 4G4NA 2YQZA 3R9XB 2JZ1A 2YNMD 3VDPA 1D0KA 3FKEA 3M0EA 4AG6A 4M9SA 1N36M 5FLXS 1TH3A 4OW0A 4KT0F 4PDIA 2CV2A 3B7NA 3SHFA 3UGJA 2Z3XA 3LQQA 2FH0A 2JY5A 4BBAA 2C99A 2L4EA 2LWXA 3U60B 3J7BA 2C9OA 1HNZM 1JR3A 1QZMA 4L78A 2Y20A 3GLIA 1NO1A 3SMSA 2CHGA 3T1YM 1Z59A 1C1KA 2DI0A 2LHGA 4NOOB 3GLIB 4JV5M 4OVZB 1N75A 2KXEA 2R45A 4Z6YA 1TH4A 4GHLA 3CTWB 4Q7JA 1L1TA 2OO9A 1QDTA 3RGPA 3UZUA 3U61B 2K9DA 1QQWA 1XXHA 4DR4M 4MM3B 3PFIA 3WHKA 1HQCA 1DO2A 5A2QS 2HAKA 4IBCA 3T6PA 1GVNA 4PCZA 2DHRA 4RNAA 3SAUA 3SAWA 2F4VM 3A98B 4K0KM 1PM5A 4DR3M 3RE8A 1NHGC 4JXJA 2LVAA 1XXHE 1YSYA 2DWMA 4JI0M 4LGMA 4LJ4A 2AHMA 1V92A 4QNRA 4FWGA 3NBIA 1TDZA 4CISA 4B7HA 4QOZC 3U6PA 4LFCM 2JA2A 1R7RA 1Q3BA 5EJCA 2DAKA 1ORYB 2HCBA 2XFTA 2YR0A 4DV5M 3WHLA 4GC9A 3GLGA 1XNRM 4QHSA 3K2LA 5KPTA 3U6OA 2ZAMA 3HHXA 2L4FA 3HZJA 5FSWA 1J5EM 4FW9A 1NJFA 1E9SA 2NQ8C 1IBKM 2HL7A 2KZSA 1JB0F 1G71A 1AIPC 4JI8M 3SMPA 1NJGA 1NV9A 1T6OA 1Q3CA 5EP3A 1Q02A 2C9CA 3CF6E 3C3DA 3LQRA 2W82A 2R4JA 2BJWA 3FRIA 1IBLM 2DWZB 2XSZA 3VK8A 2MJ5B 2A5YB 4D81A 2ZANA 1YLAA 1K3WA 4LJ8A 1S3SA 4LZZA 2DAMA 4IBGA 4KLNA 2FNAA 1Z5CA 1TTEA 2JY7A 4MGYE 4JI7M 1GJTA 1NV8A 3B7QA 2G3QA 3DFZA 4MB7A 4BB9A 4DV6M 2CHQA 2O25A 2JXNA 3AOEA 3ZQJA 2K6BA 3HJSA 4I8OA 2KRUA 1L1ZA 3I4VA 4GC5A 2UXCM 1VEGA 2DZNB 1EE8A 3SATA 3LCUA 1E32A 1ZMWA 2XH9A 4FCVA 1IN4A 5ITYA 3U6EA 4B3RM 1KFVA 3KOXE 4P17A 1L2DA 2C98A 4LG2A 3TE6A 3GP1A 2F5PA 5F3WA 1XWIA 3HJ8A 3I04M 4LJ6A 4XK8F 1QZEA 3ZC7B 3NWLA 5IZ7D 2UUBM 4JI4M 2MH8A 3FD9A 4M0DA 4M9XA 3GRRA 1WJ7A 4S12A 3KVWA 3E9SA 1NY5A 3KOZE 3H4JA 1L2BA 4GITA 3EIEA 4QHTA 4II7A 3W67A 5FTLA 2YFQA 3KSJA 4YHHM 1MU5A 2KNVA 1GKIA 4IBEA 2BNKA 2HHHM 2UUCM 2CEAA 3ZH9B 4OU7A 3E46A 2J5YA 4JI3M 3A46A 5GKNA 4IIWA 4AG5A 1MN3A 2OQ4A 2VQEM 1RU3A 3EIHA 2QSFX 3QWLA 3W0LB 1MJGM 3SAVA 1DGHB 2R0IA 3B9PA 3IHPA 4LFAM 4LF7M 5C18A 2Y21A 3SARA 3J7AS 1IXSA 4RF0A 5EP4A 2R62A 3T38A 3JR5A 3AOGA 3GLIE 4A3VB 4ZPXA 4MGHA 3FTEA 2XZUA 2X4AA 4LY6A
chains in the Genus database with same CATH topology
4AKGA 4DUYM 5KQDA 3AOEC 1NY6A 3GPPA 5ITXE 5EXSA 5IWAM 2V1UA 2L7HA 4MH0E 5BR8M 2CHVA 3KP0E 1L2CA 1DGBA 2R65A 4LJAA 3DOAA 4MGIE 2ZAOA 4NSOB 2UXDM 3PXGA 4CGYB 1IXRC 2KZUA 3J80S 3H4MA 3HGIA 3SBJA 1XC8A 3TWKA 3TWLA 2E5LM 2M60A 2QCUA 1G8PA 2R46A 5E26A 4B3SM 5FTJA 4MGKE 2DZOB 3M6AA 3GPUA 3GRYA 4LGYA 3GLHB 3KOYE 4IJEA 3FUXA 4DV0M 2VIIA 4DR1M 4YY3M 1HT2E 2QPAA 1IY2A 4X62M 4DV1M 3OTOM 5EQTA 2Y0TA 3UJNA 1IY0A 4X65M 4Z8XA 2DXIA 2DWNA 1PJJA 4GMQA 3VLFB 4DV7M 2FFJA 3GLFA 2XGNA 3AL0C 2L09A 3KS4A 4QNMA 5ITXA 2XFSA 2X8AA 3GPYA 4B7GA 2Y0QA 3U6SA 2D7HA 5ITQA 4LRSA 2KW0A 2L7IA 4WW0A 1OFHA 5JI2E 4FCWA 3GPXA 4DR2M 3HHWA 1NVMA 1XMQM 1OJLA 4PDGA 1KSFX 3AFHA 4G4QA 3U6LA 3HU1A 4B3MM 1IY1A 3Q8XA 4LF5M 4FWHA 1W5SA 4L16A 4GIPA 4D80A 1NHWC 2HKJA 2J7OA 1MX0A 3HKPA 3SASA 1I94M 3HJQA 3I51A 1R2YA 3GRVA 2Z7JA 1SXJC 1PJIA 2J7NA 1XXHB 3U61A 4KHPM 1G4AE 3KP1E 4JI2M 5EP2A 1IBMM 1IQPA 4JN6A 2CE7A 3FUUA 4NRWA 5LMUM 4FCTA 4IBFA 4OVZA 2CUZA 4AW4A 3VK7A 2G8LA 1OFIA 2LNHC 3GQ4A 3LVWA 5BPVA 2F5SA 2RKOA 3I4YA 1XHBA 1N78A 4DUZM 4DR7M 3U60A 1DGGA 4L15A 3L26A 3T15A 3KDSE 4ITQA 1Z5AA 1IXZA 2VQFM 2I7PA 5EXPA 3L29A 4R3DA 3TPZA 1DGFA 3A45A 4LZJA 3HHYA 1I4WA 1WXQA 3L28A 4B7FA 4WURA 4GRIA 3HWSA 4DR6M 1QAMA 5H37D 3UMMA 3L27A 4G6ZA 4FWDA 2D7GA 2H1RA 1HNWM 4IBJA 4X64M 2QBYB 2LXEA 3KFUG 1NNUC 5LMNM 4AI6A 2XSZD 4MGZE 5JI3E 2XZFA 1QAQA 3FYDA 3L2AA 3U5ZA 2L6OA 3L25A 1T3TA 1Q39A 3PNYA 4DV4M 2X49A 2EO2A 3ILKA 2F5QA 2FE8A 1DO0A 3A42A 4XGIA 4LFBM 3VKHA 2G5GX 4IJFA 5ITTA 1HR0M 4JYAM 3JAMS 3U6MA 4QOSA 5E6JA 4AKIA 1NSFA 5DYIA 3W0FA 1J09A 1E9RA 2XLJA 4NXNM 4L8RC 2KEBA 3ZCBB 4JI6M 2ZM6M 3MK6A 3AKZA 4TUWA 1LV7A 5KQ8A 4FVMA 3FUWA 4AKHA 3FTDA 3CF2A 1Z6TA 4LCBA 2XEPA 4LJ7A 3J81S 4DV2M 2QENA 1W5TA 4RF1A 3TWMA 3E4RA 5DYGA 1JR3D 3THGA 2C96A 2LH0A 2KA6B 3QAUA 3U6DA 3GLHA 2QBYA 5IT9S 2Z4RA 3GO8A 3VDUA 4XBOA 1IN7A 2CV0A 2DWLA 4GHAA 2F5OA 1IN5A 3IG8A 1N33M 5IREB 4R7GA 3RGSA 1ZQ9A 1QYRA 4FD2A 4IBKA 5ITRA 2V6ZM 3KSXA 4HLQA 1DGHA 4LF9M 2ZBKB 4GKKM 3GLGB 4IBDA 5KPZA 3M7GA 4REZA 4NXMM 4OX9M 5FTKA 2KRKA 2C5RA 1TH2A 3MJ5A 1XNQM 3PNVA 3FUVA 1E94E 3K92A 3HHZA 1YE9A 4G4OA 1IM2A 4PD2A 1SXJD 2O5RA 2K47A 4I5SA 2EUCA 1J7KA 4BLCA 1IN6A 3FYCA 1D2NA 1HNXM 1SXJB 4JI5M 4CHTB 1YUBA 1VDDA 2RGOA 4GKJM 1FJGM 1GL7A 3TL4X 4LF8M 4JI1M 3PVSA 5KO3A 2P5TA 3TQSA 4DR5M 1G3IA 1GLNA 2R4EA 3D8LA 3SYLA 2F5NA 4B3TM 1Z5BA 2M5ZA 2V1CA 1N34M 3SC3A 3D8BA 4NL4H 4I81A 1H6UA 1TDHA 3LVVA 4GH9A 1K3XA 3IG5A 2UU9M 2DVWB 4LF6M 2BJVA 1UM8A 2QP9X 3VFDA 1KYIA 4W5WA 3GLFB 4G4RA 4PT5A 2Z4SA 3GQ3A 1K82A 3J2PB 3UK6A 2UXBM 2RGHA 4NSRA 4M0WA 3U6CA 3U5ZB 2R18A 3GRUA 4LJ9A 3DZDA 3KXEC 5FTNA 3J27B 4IBIA 1G41A 1XMOM 2Q2EB 1QAOA 2UUAM 3C58A 4I4LA 2XF3A 1G59A 1GL6A 4EIWA 5KPRA 3VKGA 4P16A 4L4UA 3KW6A 4X66M 3FTCA 4LJ5A 1HT1E 4B08A 1IN8A 2CFOA 1IXSB 2I7NA 3GQ5A 1N32M 3R8FA 2CV1A 5EXXA 8CATA 3U6QA 3AV0A 5EP1A 3KS8A 2QZ4A 1QANA 3HU3A 1HQYE 1X37A 4AZFA 5DNYA 4LF4M 2D7EA 1R6BX 2ERCA 3CF0A 5EXTA 3FUTA 1NNJA 3K8ZA 1R2ZA 3LMMA 4HL4A 4KO8A 1ZAEA 3SHGB 4IBBA 3FTFA 5FTMA 4KODA 3SFZA 1SXJE 3HU2A 1L8QA 2EA0A 3MHVC 4M9ZA 3AJIB 3SYKA 1JQJC 1TGUA 3JR4A 1QVRA 5ITUA 7CATA 3DA1A 1N77A 1SXJA 4LRTA 5C1BA 4AQYM 2FOIC 3KOWE 3BOSA 3T1HM 2OPFA 1FNNA 4DV3M 3RFWA 4D82A 3K1JA 4NRVA 4G4NA 2YQZA 3R9XB 2YNMD 3VDPA 3FKEA 3M0EA 4AG6A 4M9SA 1N36M 5FLXS 1TH3A 4OW0A 4PDIA 2CV2A 3SHFA 3UGJA 2Z3XA 3LQQA 4BBAA 2C99A 2LWXA 3U60B 3J7BA 2C9OA 1HNZM 1JR3A 1QZMA 4L78A 2Y20A 3GLIA 3SMSA 2CHGA 3T1YM 1Z59A 1C1KA 4NOOB 3GLIB 4JV5M 4OVZB 1N75A 2KXEA 2R45A 4Z6YA 1TH4A 4GHLA 3CTWB 1L1TA 3RGPA 3UZUA 3U61B 1QQWA 1XXHA 4DR4M 4MM3B 3PFIA 3WHKA 1HQCA 1DO2A 5A2QS 4IBCA 1GVNA 4PCZA 2DHRA 4RNAA 3SAUA 3SAWA 2F4VM 3A98B 4K0KM 1PM5A 4DR3M 3RE8A 1NHGC 4JXJA 1YSYA 2DWMA 4JI0M 4LGMA 4LJ4A 2AHMA 4QNRA 1TDZA 4FWGA 3NBIA 4CISA 4B7HA 4QOZC 3U6PA 4LFCM 2JA2A 1R7RA 1Q3BA 5EJCA 1ORYB 2HCBA 2XFTA 2YR0A 4DV5M 3WHLA 4GC9A 3GLGA 1XNRM 4QHSA 3K2LA 5KPTA 3U6OA 2ZAMA 3HHXA 5FSWA 1J5EM 4FW9A 1NJFA 1E9SA 2NQ8C 1IBKM 2HL7A 2KZSA 4JI8M 3SMPA 1NJGA 1Q3CA 5EP3A 2C9CA 3CF6E 3LQRA 2W82A 2R4JA 2BJWA 1IBLM 2DWZB 2XSZA 3VK8A 2A5YB 4D81A 2ZANA 1K3WA 4LJ8A 1S3SA 4LZZA 4IBGA 4KLNA 1Z5CA 2FNAA 4JI7M 4MGYE 3DFZA 4MB7A 4BB9A 4DV6M 2CHQA 3AOEA 3HJSA 4I8OA 2KRUA 1L1ZA 3I4VA 4GC5A 2UXCM 2DZNB 1EE8A 3SATA 1E32A 2XH9A 4FCVA 1IN4A 5ITYA 3U6EA 4B3RM 1KFVA 3KOXE 1L2DA 2C98A 4LG2A 3TE6A 3GP1A 2F5PA 5F3WA 1XWIA 3HJ8A 4LJ6A 3ZC7B 3NWLA 5IZ7D 2UUBM 4JI4M 3FD9A 4M0DA 4M9XA 3GRRA 4S12A 3KVWA 3E9SA 1NY5A 3KOZE 1L2BA 4GITA 3EIEA 4QHTA 4II7A 5FTLA 2YFQA 3KSJA 4YHHM 1MU5A 1GKIA 4IBEA 2BNKA 2HHHM 2UUCM 2CEAA 3ZH9B 4OU7A 4JI3M 3A46A 5GKNA 4IIWA 4AG5A 2OQ4A 2VQEM 3EIHA 3QWLA 3W0LB 3SAVA 1DGHB 3B9PA 4LFAM 4LF7M 5C18A 2Y21A 3SARA 3J7AS 4RF0A 5EP4A 2R62A 3T38A 3JR5A 3AOGA 4A3VB 4ZPXA 4MGHA 3FTEA 2XZUA 2X4AA 4LY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I5S A;  2Y0T A;  2Y20 A;  2Y0Q A;  2L7I A;  2Y21 A;  2L7H A; 
#chains in the Genus database with same CATH topology
 4AKG A;  1VG5 A;  2GQF A;  4DUY M;  5KQD A;  1CUK A;  3AOE C;  1NY6 A;  3GPP A;  5ITX E;  2LBC A;  5EXS A;  3BXW A;  5IWA M;  2V1U A;  2L7H A;  4MH0 E;  5BR8 M;  2CHV A;  3KP0 E;  1L2C A;  1DGB A;  2R65 A;  1EFU B;  2BWE A;  2R6F A;  3DOA A;  4LJA A;  4MGI E;  1LTM A;  2ZAO A;  4NSO B;  2UXD M;  3PXG A;  4CGY B;  1IXR C;  2KZU A;  2LTU A;  3B89 A;  3J80 S;  1QDR A;  3H4M A;  3HGI A;  3SBJ A;  1XC8 A;  3TWK A;  3TWL A;  2E5L M;  2M60 A;  2QCU A;  1G8P A;  2R46 A;  5E26 A;  4B3S M;  5FTJ A;  4MGK E;  2DZO B;  2L2D A;  3M6A A;  3GPU A;  3GRY A;  1VEJ A;  4LGY A;  2B3T A;  3GLH B;  3KOY E;  4IJE A;  3FUX A;  4DV0 M;  2VII A;  4DR1 M;  4YY3 M;  1HT2 E;  2APL A;  2QPA A;  1IY2 A;  4X62 M;  4DV1 M;  3OTO M;  4R71 A;  2JUJ A;  3FE3 A;  5EQT A;  2RRU A;  2Y0T A;  1GJS A;  3UJN A;  1IY0 A;  4X65 M;  3QYB A;  4Z8X A;  2DXI A;  2DWN A;  1PJJ A;  3HY5 A;  2JY6 B;  2JY8 A;  4GMQ A;  4Y28 F;  3VLF B;  4DV7 M;  2FFJ A;  3GLF A;  2XGN A;  3AL0 C;  2L09 A;  3KS4 A;  4QNM A;  5ITX A;  2XFS A;  2N35 A;  2X8A A;  3GPY A;  4B7G A;  2JWS A;  2Y0Q A;  3U6S A;  2D7H A;  5ITQ A;  2QHO B;  4LRS A;  2KW0 A;  2CP8 A;  2L7I A;  1OAO C;  4WW0 A;  2KHH A;  1OFH A;  3I01 M;  4FCW A;  5JI2 E;  3GPX A;  1NVM A;  1VDL A;  3HHW A;  4DR2 M;  1V34 A;  1OJL A;  4PDG A;  1XMQ M;  1KSF X;  2OOB A;  3AFH A;  1PJT A;  4G4Q A;  3U6L A;  3HU1 A;  4B3M M;  1IY1 A;  2WSF F;  3Q8X A;  4LF5 M;  4FWH A;  1W5S A;  4L16 A;  4GIP A;  4D80 A;  1ZV1 A;  2J7O A;  1NHW C;  2HKJ A;  1MX0 A;  3HKP A;  3IEC A;  3SAS A;  1I94 M;  3HJQ A;  2ZTD A;  3I51 A;  1OQY A;  1R2Y A;  3GRV A;  3B74 A;  2Z7J A;  2LHC A;  1SXJ C;  4GEW A;  2VF7 A;  2J7N A;  1XXH B;  1PJI A;  2VDB B;  3U61 A;  4KHP M;  1G4A E;  3KP1 E;  4JI2 M;  5EP2 A;  1IBM M;  1IQP A;  4JN6 A;  2CE7 A;  3FUU A;  4NRW A;  5LMU M;  1OTR A;  4FCT A;  1TF0 B;  2WSE F;  4IBF A;  4OVZ A;  2CUZ A;  2EKF A;  1WR1 B;  4AW4 A;  3VK7 A;  2G8L A;  2DAG A;  1OFI A;  2LNH C;  1SG9 A;  4UN2 B;  3LVW A;  5BPV A;  3GQ4 A;  3GLF E;  2F5S A;  2RKO A;  3I4Y A;  1XHB A;  1N78 A;  4DUZ M;  4DR7 M;  3U60 A;  1DGG A;  4L15 A;  3L26 A;  2DZL A;  3T15 A;  1PRB A;  3KDS E;  4ITQ A;  1Z5A A;  1IXZ A;  2VQF M;  2I7P A;  5EXP A;  3L29 A;  1Y8G A;  4R3D A;  3TPZ A;  1DGF A;  3A45 A;  4LZJ A;  3HHY A;  1I4W A;  1WXQ A;  1VQ1 A;  3L28 A;  4WUR A;  4B7F A;  4GRI A;  2CRU A;  3HWS A;  4DR6 M;  1GAB A;  1QAM A;  2K0B X;  5H37 D;  3UMM A;  3L27 A;  3CGW A;  4FWD A;  4G6Z A;  2D7G A;  2H1R A;  1HNW M;  2LVP C;  4IBJ A;  3V76 A;  4X64 M;  2QBY B;  2LXE A;  2MRO B;  3KFU G;  1NNU C;  5LMN M;  4AI6 A;  2XSZ D;  1PJS A;  2LVQ D;  4MGZ E;  5JI3 E;  2XZF A;  1QAQ A;  3FYD A;  3L2A A;  3Q8G A;  3LW5 F;  3E21 A;  3GLH E;  3U5Z A;  2L6O A;  3L25 A;  1T3T A;  1Q39 A;  3PNY A;  2DAI A;  4DV4 M;  2X49 A;  2EO2 A;  3ILK A;  2F5Q A;  2FE8 A;  1DO0 A;  3A42 A;  4XGI A;  2DNA A;  4LFB M;  3VKH A;  2G5G X;  4IJF A;  5ITT A;  1HR0 M;  4JYA M;  3JAM S;  1BVS A;  3U6M A;  1WIV A;  4QOS A;  5E6J A;  4AKI A;  1NSF A;  2FS1 A;  5DYI A;  3W0F A;  1J09 A;  1E9R A;  2XLJ A;  4F1I A;  4NXN M;  4L8R C;  2KEB A;  1OKS A;  2QQ8 A;  3ZCB B;  4JI6 M;  2WZJ A;  2OOA A;  2ZM6 M;  3GLG E;  3MK6 A;  3AKZ A;  5DFL A;  4TUW A;  1LV7 A;  2O01 F;  5KQ8 A;  3W68 A;  4FVM A;  3FUW A;  4AKH A;  3FTD A;  3CF2 A;  5L8R F;  1Z6T A;  4LCB A;  2XEP A;  4LJ7 A;  3J81 S;  1R5L A;  4DV2 M;  2QEN A;  1W5T A;  4RF1 A;  3TWM A;  2GNO A;  1TR8 A;  4DBG B;  2CWB A;  1D0L A;  3E4R A;  1JR3 D;  5DYG A;  3THG A;  2C96 A;  2LH0 A;  2KA6 B;  2LVO C;  2MR9 A;  3GLH A;  3QAU A;  3U6D A;  2QBY A;  1P3Q Q;  5IT9 S;  2Z4R A;  3GO8 A;  3VDU A;  4XBO A;  1IN7 A;  2CV0 A;  2DWL A;  4GHA A;  2KDL A;  2HWJ A;  1IN5 A;  3IG8 A;  2F5O A;  5IRE B;  2VF8 A;  4R7G A;  1N33 M;  3RGS A;  1ZQ9 A;  2EKK A;  1QYR A;  4FD2 A;  4IBK A;  4NC6 A;  5ITR A;  2V6Z M;  3KSX A;  2R44 A;  4HLQ A;  3K9O A;  1DGH A;  1VEK A;  4LF9 M;  1AUA A;  2JNH A;  2ZBK B;  4GKK M;  3GLG B;  4HEO A;  4IBD A;  1ZMV A;  5KPZ A;  3M7G A;  4REZ A;  4NXM M;  1HJP A;  4OX9 M;  2KNZ A;  5FTK A;  2KRK A;  2C5R A;  1TH2 A;  3MJ5 A;  1XNQ M;  3PNV A;  2JP7 A;  3FUV A;  1E94 E;  3K92 A;  3HHZ A;  1YE9 A;  4G4O A;  1GO5 A;  1IM2 A;  1R4G A;  4PD2 A;  2QNJ A;  1SXJ D;  2O5R A;  2K47 A;  4I5S A;  2EUC A;  1J7K A;  4BLC A;  1IN6 A;  1OIP A;  3FYC A;  1D2N A;  1HNX M;  1SXJ B;  1EIJ A;  3F92 A;  4JI5 M;  4CHT B;  1YUB A;  2DAE A;  1VDD A;  2RGO A;  4GKJ M;  1FJG M;  1WGN A;  1GL7 A;  3K9P A;  3TL4 X;  4LF8 M;  4JI1 M;  1D0M A;  3NBX X;  4L6V 6;  3PVS A;  5KO3 A;  1V33 A;  2LVN C;  2P5T A;  3TQS A;  4DR5 M;  1G3I A;  1GLN A;  2R4E A;  3D8L A;  3LCV B;  3SYL A;  2F5N A;  4B3T M;  1Z5B A;  2M5Z A;  2V1C A;  1N34 M;  3SC3 A;  4ANR A;  2H5X A;  3D8B A;  4NL4 H;  4I81 A;  1H6U A;  1TDH A;  3LVV A;  4GH9 A;  4CIZ A;  1K3X A;  3HX3 A;  3IG5 A;  3B7Z A;  2UU9 M;  2DVW B;  3C9P A;  2BJV A;  4LF6 M;  2JZ0 A;  1UM8 A;  2QP9 X;  3VFD A;  3C3E A;  1KYI A;  4W5W A;  3GLF B;  4G4R A;  4PT5 A;  2Z4S A;  3GQ3 A;  1IFY A;  1K82 A;  1WHC A;  3J2P B;  3UK6 A;  2UXB M;  2RGH A;  4NSR A;  4M0W A;  3U6C A;  3U5Z B;  2R18 A;  3BBZ A;  3GRU A;  4LJ9 A;  1UFZ A;  3DZD A;  3KXE C;  3J27 B;  5FTN A;  4IBI A;  4CJ6 A;  1T43 A;  4F2L A;  1G41 A;  1XMO M;  2DHY A;  2Q2E B;  1QAO A;  2UUA M;  2BWB A;  3C58 A;  1OAI A;  4I4L A;  2XF3 A;  1G59 A;  1GL6 A;  4EIW A;  5KPR A;  3VKG A;  4P16 A;  2ZTC A;  4L4U A;  4G3O A;  3KW6 A;  2MGW A;  4RKU F;  4X66 M;  3FTC A;  4LJ5 A;  1C7Y A;  1JR3 E;  1ZMU A;  1HT1 E;  4B08 A;  1IN8 A;  2CFO A;  1IXS B;  2I7N A;  1PGY A;  3GQ5 A;  1N32 M;  3R8F A;  2CV1 A;  5EXX A;  1XB2 B;  8CAT A;  4WP2 A;  3AV0 A;  3U6Q A;  5EP1 A;  3KS8 A;  2QZ4 A;  1QAN A;  3HU3 A;  1HQY E;  3MMP A;  1X37 A;  4AZF A;  1OIZ A;  1WGL A;  5DNY A;  4LF4 M;  1QUS A;  2D7E A;  1R6B X;  2ERC A;  3CF0 A;  2KNA A;  3FUT A;  5EXT A;  1NNJ A;  3FRH A;  3K8Z A;  1R2Z A;  3LMM A;  4HL4 A;  4KO8 A;  1ZAE A;  3SHG B;  4IBB A;  1QUT A;  5FTM A;  3FTF A;  2WSC F;  4KOD A;  3SFZ A;  1DV0 A;  1SXJ E;  2Z8Y M;  2DEN A;  1L8Q A;  3HU2 A;  2EA0 A;  3MHV C;  4M9Z A;  1A5T A;  3AJI B;  3SYK A;  1JQJ C;  1TGU A;  3QYE A;  3JR4 A;  1QVR A;  2DKL A;  2EJS A;  5ITU A;  7CAT A;  3DA1 A;  1N77 A;  1SXJ A;  1F4I A;  4LRT A;  5C1B A;  4AQY M;  2FOI C;  3KOW E;  1PJQ A;  3BOS A;  3T1H M;  2OPF A;  1FNN A;  4DV3 M;  3RFW A;  4D82 A;  3K1J A;  4NRV A;  4G4N A;  2YQZ A;  3R9X B;  2JZ1 A;  2YNM D;  3VDP A;  1D0K A;  3FKE A;  3M0E A;  4AG6 A;  4M9S A;  1N36 M;  5FLX S;  1TH3 A;  4OW0 A;  4KT0 F;  4PDI A;  2CV2 A;  3B7N A;  3SHF A;  3UGJ A;  2Z3X A;  3LQQ A;  2FH0 A;  2JY5 A;  4BBA A;  2C99 A;  2L4E A;  2LWX A;  3U60 B;  3J7B A;  2C9O A;  1HNZ M;  1JR3 A;  1QZM A;  4L78 A;  2Y20 A;  3GLI A;  1NO1 A;  3SMS A;  2CHG A;  3T1Y M;  1Z59 A;  1C1K A;  2DI0 A;  2LHG A;  4NOO B;  3GLI B;  4JV5 M;  4OVZ B;  1N75 A;  2KXE A;  2R45 A;  4Z6Y A;  1TH4 A;  4GHL A;  3CTW B;  4Q7J A;  1L1T A;  2OO9 A;  1QDT A;  3RGP A;  3UZU A;  3U61 B;  2K9D A;  1QQW A;  1XXH A;  4DR4 M;  4MM3 B;  3PFI A;  3WHK A;  1HQC A;  1DO2 A;  5A2Q S;  2HAK A;  4IBC A;  3T6P A;  1GVN A;  4PCZ A;  2DHR A;  4RNA A;  3SAU A;  3SAW A;  2F4V M;  3A98 B;  4K0K M;  1PM5 A;  4DR3 M;  3RE8 A;  1NHG C;  4JXJ A;  2LVA A;  1XXH E;  1YSY A;  2DWM A;  4JI0 M;  4LGM A;  4LJ4 A;  2AHM A;  1V92 A;  4QNR A;  4FWG A;  3NBI A;  1TDZ A;  4CIS A;  4B7H A;  4QOZ C;  3U6P A;  4LFC M;  2JA2 A;  1R7R A;  1Q3B A;  5EJC A;  2DAK A;  1ORY B;  2HCB A;  2XFT A;  2YR0 A;  4DV5 M;  3WHL A;  4GC9 A;  3GLG A;  1XNR M;  4QHS A;  3K2L A;  5KPT A;  3U6O A;  2ZAM A;  3HHX A;  2L4F A;  3HZJ A;  5FSW A;  1J5E M;  4FW9 A;  1NJF A;  1E9S A;  2NQ8 C;  1IBK M;  2HL7 A;  2KZS A;  1JB0 F;  1G71 A;  1AIP C;  4JI8 M;  3SMP A;  1NJG A;  1NV9 A;  1T6O A;  1Q3C A;  5EP3 A;  1Q02 A;  2C9C A;  3CF6 E;  3C3D A;  3LQR A;  2W82 A;  2R4J A;  2BJW A;  3FRI A;  1IBL M;  2DWZ B;  2XSZ A;  3VK8 A;  2MJ5 B;  2A5Y B;  4D81 A;  2ZAN A;  1YLA A;  1K3W A;  4LJ8 A;  1S3S A;  4LZZ A;  2DAM A;  4IBG A;  4KLN A;  2FNA A;  1Z5C A;  1TTE A;  2JY7 A;  4MGY E;  4JI7 M;  1GJT A;  1NV8 A;  3B7Q A;  2G3Q A;  3DFZ A;  4MB7 A;  4BB9 A;  4DV6 M;  2CHQ A;  2O25 A;  2JXN A;  3AOE A;  3ZQJ A;  2K6B A;  3HJS A;  4I8O A;  2KRU A;  1L1Z A;  3I4V A;  4GC5 A;  2UXC M;  1VEG A;  2DZN B;  1EE8 A;  3SAT A;  3LCU A;  1E32 A;  1ZMW A;  2XH9 A;  4FCV A;  1IN4 A;  5ITY A;  3U6E A;  4B3R M;  1KFV A;  3KOX E;  4P17 A;  1L2D A;  2C98 A;  4LG2 A;  3TE6 A;  3GP1 A;  2F5P A;  5F3W A;  1XWI A;  3HJ8 A;  3I04 M;  4LJ6 A;  4XK8 F;  1QZE A;  3ZC7 B;  3NWL A;  5IZ7 D;  2UUB M;  4JI4 M;  2MH8 A;  3FD9 A;  4M0D A;  4M9X A;  3GRR A;  1WJ7 A;  4S12 A;  3KVW A;  3E9S A;  1NY5 A;  3KOZ E;  3H4J A;  1L2B A;  4GIT A;  3EIE A;  4QHT A;  4II7 A;  3W67 A;  5FTL A;  2YFQ A;  3KSJ A;  4YHH M;  1MU5 A;  2KNV A;  1GKI A;  4IBE A;  2BNK A;  2HHH M;  2UUC M;  2CEA A;  3ZH9 B;  4OU7 A;  3E46 A;  2J5Y A;  4JI3 M;  3A46 A;  5GKN A;  4IIW A;  4AG5 A;  1MN3 A;  2OQ4 A;  2VQE M;  1RU3 A;  3EIH A;  2QSF X;  3QWL A;  3W0L B;  1MJG M;  3SAV A;  1DGH B;  2R0I A;  3B9P A;  3IHP A;  4LFA M;  4LF7 M;  5C18 A;  2Y21 A;  3SAR A;  3J7A S;  1IXS A;  4RF0 A;  5EP4 A;  2R62 A;  3T38 A;  3JR5 A;  3AOG A;  3GLI E;  4A3V B;  4ZPX A;  4MGH A;  3FTE A;  2XZU A;  2X4A A;  4LY6 A; 
#chains in the Genus database with same CATH homology
 4AKG A;  4DUY M;  5KQD A;  3AOE C;  1NY6 A;  3GPP A;  5ITX E;  5EXS A;  5IWA M;  2V1U A;  2L7H A;  4MH0 E;  5BR8 M;  2CHV A;  3KP0 E;  1L2C A;  1DGB A;  2R65 A;  4LJA A;  3DOA A;  4MGI E;  2ZAO A;  4NSO B;  2UXD M;  3PXG A;  4CGY B;  1IXR C;  2KZU A;  3J80 S;  3H4M A;  3HGI A;  3SBJ A;  1XC8 A;  3TWK A;  3TWL A;  2E5L M;  2M60 A;  2QCU A;  1G8P A;  2R46 A;  5E26 A;  4B3S M;  5FTJ A;  4MGK E;  2DZO B;  3M6A A;  3GPU A;  3GRY A;  4LGY A;  3GLH B;  3KOY E;  4IJE A;  3FUX A;  4DV0 M;  2VII A;  4DR1 M;  4YY3 M;  1HT2 E;  2QPA A;  1IY2 A;  4X62 M;  4DV1 M;  3OTO M;  5EQT A;  2Y0T A;  3UJN A;  1IY0 A;  4X65 M;  4Z8X A;  2DXI A;  2DWN A;  1PJJ A;  4GMQ A;  3VLF B;  4DV7 M;  2FFJ A;  3GLF A;  2XGN A;  3AL0 C;  2L09 A;  3KS4 A;  4QNM A;  5ITX A;  2XFS A;  2X8A A;  3GPY A;  4B7G A;  2Y0Q A;  3U6S A;  2D7H A;  5ITQ A;  4LRS A;  2KW0 A;  2L7I A;  4WW0 A;  1OFH A;  5JI2 E;  4FCW A;  3GPX A;  4DR2 M;  3HHW A;  1NVM A;  1XMQ M;  1OJL A;  4PDG A;  1KSF X;  3AFH A;  4G4Q A;  3U6L A;  3HU1 A;  4B3M M;  1IY1 A;  3Q8X A;  4LF5 M;  4FWH A;  1W5S A;  4L16 A;  4GIP A;  4D80 A;  1NHW C;  2HKJ A;  2J7O A;  1MX0 A;  3HKP A;  3SAS A;  1I94 M;  3HJQ A;  3I51 A;  1R2Y A;  3GRV A;  2Z7J A;  1SXJ C;  1PJI A;  2J7N A;  1XXH B;  3U61 A;  4KHP M;  1G4A E;  3KP1 E;  4JI2 M;  5EP2 A;  1IBM M;  1IQP A;  4JN6 A;  2CE7 A;  3FUU A;  4NRW A;  5LMU M;  4FCT A;  4IBF A;  4OVZ A;  2CUZ A;  4AW4 A;  3VK7 A;  2G8L A;  1OFI A;  2LNH C;  3GQ4 A;  3LVW A;  5BPV A;  2F5S A;  2RKO A;  3I4Y A;  1XHB A;  1N78 A;  4DUZ M;  4DR7 M;  3U60 A;  1DGG A;  4L15 A;  3L26 A;  3T15 A;  3KDS E;  4ITQ A;  1Z5A A;  1IXZ A;  2VQF M;  2I7P A;  5EXP A;  3L29 A;  4R3D A;  3TPZ A;  1DGF A;  3A45 A;  4LZJ A;  3HHY A;  1I4W A;  1WXQ A;  3L28 A;  4B7F A;  4WUR A;  4GRI A;  3HWS A;  4DR6 M;  1QAM A;  5H37 D;  3UMM A;  3L27 A;  4G6Z A;  4FWD A;  2D7G A;  2H1R A;  1HNW M;  4IBJ A;  4X64 M;  2QBY B;  2LXE A;  3KFU G;  1NNU C;  5LMN M;  4AI6 A;  2XSZ D;  4MGZ E;  5JI3 E;  2XZF A;  1QAQ A;  3FYD A;  3L2A A;  3U5Z A;  2L6O A;  3L25 A;  1T3T A;  1Q39 A;  3PNY A;  4DV4 M;  2X49 A;  2EO2 A;  3ILK A;  2F5Q A;  2FE8 A;  1DO0 A;  3A42 A;  4XGI A;  4LFB M;  3VKH A;  2G5G X;  4IJF A;  5ITT A;  1HR0 M;  4JYA M;  3JAM S;  3U6M A;  4QOS A;  5E6J A;  4AKI A;  1NSF A;  5DYI A;  3W0F A;  1J09 A;  1E9R A;  2XLJ A;  4NXN M;  4L8R C;  2KEB A;  3ZCB B;  4JI6 M;  2ZM6 M;  3MK6 A;  3AKZ A;  4TUW A;  1LV7 A;  5KQ8 A;  4FVM A;  3FUW A;  4AKH A;  3FTD A;  3CF2 A;  1Z6T A;  4LCB A;  2XEP A;  4LJ7 A;  3J81 S;  4DV2 M;  2QEN A;  1W5T A;  4RF1 A;  3TWM A;  3E4R A;  5DYG A;  1JR3 D;  3THG A;  2C96 A;  2LH0 A;  2KA6 B;  3QAU A;  3U6D A;  3GLH A;  2QBY A;  5IT9 S;  2Z4R A;  3GO8 A;  3VDU A;  4XBO A;  1IN7 A;  2CV0 A;  2DWL A;  4GHA A;  2F5O A;  1IN5 A;  3IG8 A;  1N33 M;  5IRE B;  4R7G A;  3RGS A;  1ZQ9 A;  1QYR A;  4FD2 A;  4IBK A;  5ITR A;  2V6Z M;  3KSX A;  4HLQ A;  1DGH A;  4LF9 M;  2ZBK B;  4GKK M;  3GLG B;  4IBD A;  5KPZ A;  3M7G A;  4REZ A;  4NXM M;  4OX9 M;  5FTK A;  2KRK A;  2C5R A;  1TH2 A;  3MJ5 A;  1XNQ M;  3PNV A;  3FUV A;  1E94 E;  3K92 A;  3HHZ A;  1YE9 A;  4G4O A;  1IM2 A;  4PD2 A;  1SXJ D;  2O5R A;  2K47 A;  4I5S A;  2EUC A;  1J7K A;  4BLC A;  1IN6 A;  3FYC A;  1D2N A;  1HNX M;  1SXJ B;  4JI5 M;  4CHT B;  1YUB A;  1VDD A;  2RGO A;  4GKJ M;  1FJG M;  1GL7 A;  3TL4 X;  4LF8 M;  4JI1 M;  3PVS A;  5KO3 A;  2P5T A;  3TQS A;  4DR5 M;  1G3I A;  1GLN A;  2R4E A;  3D8L A;  3SYL A;  2F5N A;  4B3T M;  1Z5B A;  2M5Z A;  2V1C A;  1N34 M;  3SC3 A;  3D8B A;  4NL4 H;  4I81 A;  1H6U A;  1TDH A;  3LVV A;  4GH9 A;  1K3X A;  3IG5 A;  2UU9 M;  2DVW B;  4LF6 M;  2BJV A;  1UM8 A;  2QP9 X;  3VFD A;  1KYI A;  4W5W A;  3GLF B;  4G4R A;  4PT5 A;  2Z4S A;  3GQ3 A;  1K82 A;  3J2P B;  3UK6 A;  2UXB M;  2RGH A;  4NSR A;  4M0W A;  3U6C A;  3U5Z B;  2R18 A;  3GRU A;  4LJ9 A;  3DZD A;  3KXE C;  5FTN A;  3J27 B;  4IBI A;  1G41 A;  1XMO M;  2Q2E B;  1QAO A;  2UUA M;  3C58 A;  4I4L A;  2XF3 A;  1G59 A;  1GL6 A;  4EIW A;  5KPR A;  3VKG A;  4P16 A;  4L4U A;  3KW6 A;  4X66 M;  3FTC A;  4LJ5 A;  1HT1 E;  4B08 A;  1IN8 A;  2CFO A;  1IXS B;  2I7N A;  3GQ5 A;  1N32 M;  3R8F A;  2CV1 A;  5EXX A;  8CAT A;  3U6Q A;  3AV0 A;  5EP1 A;  3KS8 A;  2QZ4 A;  1QAN A;  3HU3 A;  1HQY E;  1X37 A;  4AZF A;  5DNY A;  4LF4 M;  2D7E A;  1R6B X;  2ERC A;  3CF0 A;  5EXT A;  3FUT A;  1NNJ A;  3K8Z A;  1R2Z A;  3LMM A;  4HL4 A;  4KO8 A;  1ZAE A;  3SHG B;  4IBB A;  3FTF A;  5FTM A;  4KOD A;  3SFZ A;  1SXJ E;  3HU2 A;  1L8Q A;  2EA0 A;  3MHV C;  4M9Z A;  3AJI B;  3SYK A;  1JQJ C;  1TGU A;  3JR4 A;  1QVR A;  5ITU A;  7CAT A;  3DA1 A;  1N77 A;  1SXJ A;  4LRT A;  5C1B A;  4AQY M;  2FOI C;  3KOW E;  3BOS A;  3T1H M;  2OPF A;  1FNN A;  4DV3 M;  3RFW A;  4D82 A;  3K1J A;  4NRV A;  4G4N A;  2YQZ A;  3R9X B;  2YNM D;  3VDP A;  3FKE A;  3M0E A;  4AG6 A;  4M9S A;  1N36 M;  5FLX S;  1TH3 A;  4OW0 A;  4PDI A;  2CV2 A;  3SHF A;  3UGJ A;  2Z3X A;  3LQQ A;  4BBA A;  2C99 A;  2LWX A;  3U60 B;  3J7B A;  2C9O A;  1HNZ M;  1JR3 A;  1QZM A;  4L78 A;  2Y20 A;  3GLI A;  3SMS A;  2CHG A;  3T1Y M;  1Z59 A;  1C1K A;  4NOO B;  3GLI B;  4JV5 M;  4OVZ B;  1N75 A;  2KXE A;  2R45 A;  4Z6Y A;  1TH4 A;  4GHL A;  3CTW B;  1L1T A;  3RGP A;  3UZU A;  3U61 B;  1QQW A;  1XXH A;  4DR4 M;  4MM3 B;  3PFI A;  3WHK A;  1HQC A;  1DO2 A;  5A2Q S;  4IBC A;  1GVN A;  4PCZ A;  2DHR A;  4RNA A;  3SAU A;  3SAW A;  2F4V M;  3A98 B;  4K0K M;  1PM5 A;  4DR3 M;  3RE8 A;  1NHG C;  4JXJ A;  1YSY A;  2DWM A;  4JI0 M;  4LGM A;  4LJ4 A;  2AHM A;  4QNR A;  1TDZ A;  4FWG A;  3NBI A;  4CIS A;  4B7H A;  4QOZ C;  3U6P A;  4LFC M;  2JA2 A;  1R7R A;  1Q3B A;  5EJC A;  1ORY B;  2HCB A;  2XFT A;  2YR0 A;  4DV5 M;  3WHL A;  4GC9 A;  3GLG A;  1XNR M;  4QHS A;  3K2L A;  5KPT A;  3U6O A;  2ZAM A;  3HHX A;  5FSW A;  1J5E M;  4FW9 A;  1NJF A;  1E9S A;  2NQ8 C;  1IBK M;  2HL7 A;  2KZS A;  4JI8 M;  3SMP A;  1NJG A;  1Q3C A;  5EP3 A;  2C9C A;  3CF6 E;  3LQR A;  2W82 A;  2R4J A;  2BJW A;  1IBL M;  2DWZ B;  2XSZ A;  3VK8 A;  2A5Y B;  4D81 A;  2ZAN A;  1K3W A;  4LJ8 A;  1S3S A;  4LZZ A;  4IBG A;  4KLN A;  1Z5C A;  2FNA A;  4JI7 M;  4MGY E;  3DFZ A;  4MB7 A;  4BB9 A;  4DV6 M;  2CHQ A;  3AOE A;  3HJS A;  4I8O A;  2KRU A;  1L1Z A;  3I4V A;  4GC5 A;  2UXC M;  2DZN B;  1EE8 A;  3SAT A;  1E32 A;  2XH9 A;  4FCV A;  1IN4 A;  5ITY A;  3U6E A;  4B3R M;  1KFV A;  3KOX E;  1L2D A;  2C98 A;  4LG2 A;  3TE6 A;  3GP1 A;  2F5P A;  5F3W A;  1XWI A;  3HJ8 A;  4LJ6 A;  3ZC7 B;  3NWL A;  5IZ7 D;  2UUB M;  4JI4 M;  3FD9 A;  4M0D A;  4M9X A;  3GRR A;  4S12 A;  3KVW A;  3E9S A;  1NY5 A;  3KOZ E;  1L2B A;  4GIT A;  3EIE A;  4QHT A;  4II7 A;  5FTL A;  2YFQ A;  3KSJ A;  4YHH M;  1MU5 A;  1GKI A;  4IBE A;  2BNK A;  2HHH M;  2UUC M;  2CEA A;  3ZH9 B;  4OU7 A;  4JI3 M;  3A46 A;  5GKN A;  4IIW A;  4AG5 A;  2OQ4 A;  2VQE M;  3EIH A;  3QWL A;  3W0L B;  3SAV A;  1DGH B;  3B9P A;  4LFA M;  4LF7 M;  5C18 A;  2Y21 A;  3SAR A;  3J7A S;  4RF0 A;  5EP4 A;  2R62 A;  3T38 A;  3JR5 A;  3AOG A;  4A3V B;  4ZPX A;  4MGH A;  3FTE A;  2XZU A;  2X4A A;  4LY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...