4B3MM

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3mM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3mM02
5A2QS 3SATA 1Q39A 1Q3CA 3SASA 1N36M 4LFCM 1IBMM 5IT9S 2VQFM 4DV6M 2UU9M 2UUCM 1IBKM 4G4RA 3GPYA 3TWMA 2F5QA 3C58A 1TDZA 5ITXE 2HHHM 4JI1M 4JI3M 4YHHM 1J5EM 1Q3BA 4JI8M 4DR3M 4B3MM 3OTOM 1XNQM 4CISA 1FJGM 4JI6M 1HNWM 5ITRA 4PD2A 4YY3M 5BR8M 5IWAM 3U6QA 3GQ4A 1MX0A 1L1TA 4LFAM 4G4QA 3U6CA 1MU5A 2HKJA 1KFVA 2F5OA 2UXDM 1L2DA 4DV2M 4AQYM 1Z5CA 5ITYA 1K3XA 4DUZM 1IBLM 2UXCM 1Z59A 2F5SA 2Q2EB 3U6DA 2ZBKB 4JI4M 4DR2M 1Z5AA 2EA0A 4DR6M 4X62M 3T1YM 4GKJM 4JI5M 3GPUA 4NRWA 4B3RM 4X65M 4JI0M 1PJIA 4DV3M 3SBJA 2UUAM 5LMUM 5ITQA 3U6OA 2F4VM 4PCZA 2OPFA 4LF8M 4KHPM 1EE8A 3GO8A 3J80S 1PJJA 4PDIA 3U6SA 4GKKM 5ITTA 4JV5M 4MB7A 4DR1M 3T1HM 1L2BA 3SAWA 1Z5BA 1I94M 2UUBM 3SAVA 3GPPA 2XZFA 4JI2M 4JYAM 2UXBM 4NXNM 1N33M 3GPXA 1HNZM 5FLXS 4LF9M 4K0KM 1XMQM 4LF6M 4NXMM 3A45A 4DR4M 3GQ3A 1L1ZA 3U6LA 3U6MA 1HR0M 3TWKA 4LF7M 3SARA 3J7AS 3U6PA 3J81S 3DOAA 1R2YA 4LFBM 1XMOM 4DV1M 4JI7M 3U6EA 5LMNM 4DR5M 1K3WA 5ITUA 4LF5M 4DV4M 1N34M 4NRVA 1TDHA 2F5NA 3JAMS 1HNXM 4DR7M 2VQEM 4DV7M 4PDGA 4B3TM 4LF4M 3GQ5A 4DV0M 1R2ZA 4G4OA 2OQ4A 4X64M 4ITQA 3A46A 3SAUA 4X66M 4DV5M 4OX9M 4G4NA 2ZM6M 1L2CA 1XC8A 2XZUA 1N32M 3GP1A 3JR4A 1PM5A 3TWLA 1NNJA 3VK8A 3VK7A 5ITXA 4B3SM 1XNRM 2E5LM 1K82A 3JR5A 2F5PA 3A42A 3W0FA 4DUYM
chains in the Genus database with same CATH superfamily
1HT1E 4R7GA 4GHLA 2L7HA 4Z6YA 3D8BA 4TUWA 3AOEA 1RU3A 2XF3A 2RGOA 5JI2E 2XGNA 3FYCA 4D82A 2MH8A 2VQFM 2R0IA 3LQRA 3SMSA 3GLIB 2KNVA 3KXEC 4MGKE 4Y28F 1GJTA 4RF0A 3I01M 2KZUA 2OOBA 3TWMA 3FTEA 1OTRA 2L4EA 2R45A 3C58A 1TDZA 3K9PA 2JY6B 5ITXE 3KSJA 2LXEA 2HHHM 1HQCA 1OAOC 3C9PA 4YHHM 3TQSA 4OU7A 4JI8M 1VDLA 2MJ5B 2A5YB 4LY6A 2DAEA 3K9OA 4GMQA 2LHCA 3IG8A 4CISA 1FJGM 3GLIA 2C9CA 3C3EA 3L28A 1HNWM 5ITRA 2EJSA 1XXHE 2Z7JA 2CHQA 3U6QA 3UZUA 4G4QA 3U6CA 4LJ7A 2F5OA 1KFVA 2JNHA 1HQYE 2UXDM 4DV2M 4AQYM 2D7HA 3HJSA 4NC6A 2C5RA 2KA6B 3KS4A 1K3XA 4AKIA 3T6PA 2JP7A 1A5TA 4AKGA 2Q2EB 2CP8A 3KP0E 1Z6TA 1HT2E 2EKFA 1CUKA 2G3QA 4DR6M 1G8PA 1EFUB 3SC3A 1TF0B 4X62M 3L26A 3HKPA 4MH0E 3T1YM 4GKJM 5C18A 2D7EA 2BNKA 4B3RM 3FD9A 2XSZA 5KPZA 3RE8A 1W5SA 4OVZB 4D81A 2DNAA 2K47A 3CF2A 3HJQA 5JI3E 1I4WA 2JY8A 4HL4A 3KFUG 2KXEA 4LJ5A 3HGIA 3B9PA 4PCZA 5IREB 1EE8A 1OKSA 4XK8F 3GO8A 3J80S 3GLFB 1IXZA 4JV5M 2I7PA 3T1HM 3GLHE 4QNRA 1Z5BA 1XB2B 2C99A 4OW0A 3VFDA 5EP1A 2V6ZM 4UN2B 3W67A 3TE6A 4I81A 2UXBM 5DYGA 2R18A 4OVZA 3GPXA 4IJEA 1HNZM 1TGUA 4LF9M 1N33M 2BWBA 2QP9X 4LJAA 1QYRA 1NSFA 2R6FA 2ZTCA 4PT5A 1TTEA 4NXMM 4AKHA 3HU3A 2APLA 4LFBM 3FUXA 1V34A 2W82A 2OOAA 3DOAA 2JA2A 3FKEA 4FWGA 3GLFA 1R2YA 4FWHA 1C7YA 2DHRA 1SXJD 1WGNA 2FS1A 4DV1M 7CATA 1OIPA 5LMNM 1DGGA 4LG2A 1WXQA 1YUBA 3SMPA 5E6JA 3KP1E 4CGYB 2MR9A 3GLGE 4NL4H 1E9SA 2F5NA 4WURA 1TH2A 2Z8YM 4G6ZA 4ZPXA 4LF4M 4DV0M 3MMPA 4MGZE 3E46A 4KODA 3I51A 3PVSA 2DWLA 3CF6E 4LRTA 2OQ4A 1DO2A 1LV7A 3A46A 3B7QA 4X66M 3VKGA 4DV5M 3E21A 3SYLA 4OX9M 2LWXA 3VLFB 4G4NA 3VKHA 2R4EA 4FCVA 1XC8A 3CGWA 5EP2A 3THGA 5DYIA 5KQ8A 2XZUA 2RGHA 1PM5A 3VK8A 3VK7A 2DAIA 4B3SM 3CTWB 5IZ7D 1XNRM 2LNHC 1TR8A 3AOEC 3FRHA 4M9ZA 2GNOA 3RFWA 2R65A 4LJ8A 1UFZA 1N75A 1IN7A 2KRUA 1IY2A 1Q3CA 3T15A 3SASA 4FCWA 4RKUF 1WJ7A 1NJFA 2ZTDA 3IECA 2Y0TA 2UU9M 5EP3A 2UUCM 3LMMA 1BVSA 2KRKA 2F5QA 3PFIA 3NBXX 5FTKA 3AV0A 4HEOA 3V76A 4JI1M 3F92A 4JI3M 3GLIE 1QAOA 1Q3BA 4HLQA 3KSXA 1ORYB 2P5TA 4LJ9A 1NHGC 3FUVA 2JWSA 5KPTA 3M0EA 2XLJA 4JI6M 2H5XA 4PD2A 5IWAM 1E9RA 1E32A 3UMMA 2OO9A 1DO0A 4LCBA 2X8AA 2XH9A 3RGPA 4LZJA 2JY7A 1QZMA 4DUZM 1QAMA 1IBLM 2UXCM 2ZAMA 1Z59A 3AL0C 3U6DA 4QNMA 2WSCF 2ZBKB 2H1RA 5KPRA 2V1UA 4QHTA 3Q8XA 2O5RA 1JR3E 4JI5M 2G5GX 4L78A 2DAKA 3DFZA 4JI0M 4L8RC 1H6UA 4RF1A 4RNAA 2KHHA 2LHGA 1IFYA 2CV0A 1VQ1A 3E4RA 3ZH9B 2UUAM 2CEAA 4ANRA 3J27B 5ITQA 1ZAEA 2YR0A 2J5YA 2LVAA 2EUCA 2QQ8A 3KDSE 2VF8A 4Q7JA 2R46A 3WHKA 5ITTA 1PJJA 4DR1M 4GKKM 3SAVA 2XZFA 2Y21A 3J7BA 2CHVA 2CE7A 4B7FA 2CUZA 4FD2A 3GLFE 3LVVA 3GRYA 2QSFX 4FCTA 1YLAA 2LVQD 3FUWA 4K0KM 1G41A 1JQJC 1SXJB 1GL6A 4IIWA 3GQ3A 1QUSA 1L1ZA 1HR0M 4LF7M 3SARA 2R62A 3U6PA 5DFLA 4NSOB 3VDPA 1OIZA 2DAMA 4JI7M 3DA1A 3K2LA 4LRSA 2WZJA 2G8LA 1VG5A 2L7IA 2BJVA 2Z3XA 3KW6A 4LF5M 1PGYA 1GLNA 5EXPA 4DV4M 3HZJA 1OAIA 4NRVA 3ZCBB 1TDHA 2Z4RA 2VDBB 3U60A 5FTMA 2WSFF 1SXJA 1QDTA 4PDGA 5EXSA 4B3TM 1QVRA 3GQ5A 1IN8A 4M0WA 2JXNA 1NNUC 3SHGB 4GITA 3KOWE 3AJIB 4M9XA 4M9SA 3QYEA 3SHFA 4ITQA 2XFTA 3DZDA 3L25A 2DENA 2KW0A 5H37D 1T3TA 1IM2A 1GVNA 2YFQA 2ZM6M 5KO3A 1XXHB 2FNAA 3MHVC 2DVWB 3IG5A 4IBJA 4LZZA 3SYKA 3Q8GA 3JR4A 1NNJA 1T6OA 2R44A 5ITXA 2E5LM 3LQQA 2ZANA 2C96A 4NOOB 4JN6A 1DGBA 1WHCA 3FUTA 1QAQA 2HWJA 2L4FA 5A2QS 2DZLA 4LJ6A 1XWIA 4REZA 1NHWC 1NJGA 2CRUA 3AOGA 1KSFX 1N36M 1XXHA 4LFCM 2CV1A 1D2NA 4DV6M 4L4UA 4GC9A 4KT0F 5EJCA 1N78A 3PNVA 2JUJA 2YNMD 2XFSA 2LVPC 2Y20A 3LCVB 3GPYA 1ZV1A 4LGMA 3KS8A 1VEKA 4D80A 1V33A 4QOZC 1R4GA 1D0KA 2LVNC 3C3DA 4FVMA 2DHYA 4JXJA 2VF7A 1PJSA 1IXRC 3HU1A 3LVWA 4L15A 1J5EM 1J09A 2B3TA 5E26A 3L27A 4DR3M 4B3MM 1KYIA 4S12A 2QBYA 4CIZA 4MGIE 3UJNA 2AHMA 4IBCA 5EP4A 1S3SA 2V1CA 5EQTA 2ERCA 3VDUA 5BR8M 4YY3M 3KOXE 3TL4X 1NY5A 2KZSA 4P17A 1MX0A 2YQZA 1L1TA 4LFAM 2BWEA 3FYDA 2DKLA 4AG5A 3U61B 1VDDA 2CWBA 3B89A 1GJSA 1G4AE 2QHOB 3HHXA 2C98A 2F5SA 2RRUA 8CATA 2FE8A 4MGYE 4DR2M 3KOZE 5FTLA 4A3VB 4CJ6A 4CHTB 4I5SA 2EA0A 3A98B 1WGLA 5EXTA 2C9OA 4NRWA 1QDRA 3GRUA 2CHGA 1PJIA 2QCUA 3U61A 3BBZA 1WIVA 1IY1A 4NSRA 4II7A 4F2LA 2F4VM 2OPFA 1G59A 2L09A 3H4JA 4IJFA 3H4MA 5L8RF 2JZ1A 3U6SA 1T43A 2J7OA 4MB7A 3R9XB 1X37A 1IN4A 1L2BA 3SAWA 2KNAA 2WSEF 1I94M 2UUBM 4AI6A 2DZNB 3GPPA 4JI2M 2RKOA 3R8FA 2DXIA 4NXNM 4BB9A 2LVOC 3FE3A 5FLXS 3FTFA 3QWLA 3W68A 1GKIA 4DBGB 4LF6M 4WP2A 3I4VA 4MM3B 1LTMA 2KEBA 1VEGA 3MJ5A 3NWLA 3D8LA 2Z4SA 4I4LA 4EIWA 3U6MA 3J7AS 4BLCA 3W0LB 2LTUA 1IQPA 1XMOM 4MGHA 3T38A 2QPAA 3U6EA 3B7NA 3AFHA 1GABA 4DR5M 1OQYA 2M5ZA 1QANA 4G3OA 1SXJE 1SXJC 5ITUA 1TH3A 1P3QQ 3HWSA 1N34M 2K0BX 2Y0QA 3FTDA 4IBFA 4XBOA 1WR1B 2VQEM 5FTJA 4DV7M 5DNYA 3K92A 3EIEA 1R2ZA 2FOIC 2VIIA 2N35A 2FH0A 3HHWA 4G4OA 1F4IA 3LW5F 3SAUA 3KVWA 1SG9A 3J2PB 1V92A 3U60B 3B74A 2O01F 1AIPC 2QZ4A 1GL7A 2NQ8C 4IBDA 1L2CA 2MROB 1N32M 1UM8A 4AW4A 4W5WA 1VEJA 2HCBA 3QAUA 2K9DA 3IHPA 3K8ZA 4FW9A 4IBGA 1N77A 4R3DA 1K82A 3JR5A 2JY5A 2F5PA 3L2AA 3FUUA 4GC5A 5GKNA 2BJWA 2HL7A 1XHBA 2CFOA 1AUAA 4AG6A 1QQWA 3HHYA 3SATA 1Q39A 3WHLA 4GHAA 1MN3A 1Q02A 1ZMWA 1IBMM 5IT9S 1PJQA 1G71A 4WW0A 2JZ0A 3M6AA 1IBKM 5C1BA 4G4RA 1PJTA 1IY0A 1QUTA 1J7KA 1E94E 3HX3A 3ILKA 4R71A 4GEWA 2LBCA 4L6V6 3CF0A 1DGFA 2X49A 3M7GA 4B08A 1G3IA 3E9SA 1QZEA 2DWMA 2DZOB 1JR3A 5FSWA 3GRVA 3ZC7B 2QENA 3OTOM 4LJ4A 3PXGA 4KO8A 1ZMUA 3K1JA 3GQ4A 3RGSA 4IBEA 4XGIA 3KOYE 1XNQM 1MU5A 2HKJA 1L2DA 2K6BA 1Z5CA 1NVMA 5ITYA 2QBYB 1DGHB 2XSZD 4Z8XA 3TPZA 4GRIA 4DUYM 3HJ8A 1D0MA 5F3WA 1JR3D 1IN6A 3L29A 4JI4M 1Z5AA 3HHZA 1OJLA 4IBKA 3UK6A 2O25A 4GIPA 3GPUA 1YE9A 3NBIA 4X65M 2DWNA 2CV2A 4F1IA 3I4YA 3PNYA 4M0DA 5EXXA 4DV3M 1DGHA 2KNZA 3GLHB 3SBJA 1EIJA 5LMUM 3U6OA 4LF8M 2R4JA 2EKKA 4KHPM 3SFZA 1TH4A 4PDIA 1R6BX 1GO5A 2HAKA 2QNJA 3HY5A 1PRBA 1OFHA 3BOSA 4QOSA 4JYAM 4QHSA 1FNNA 4BBAA 1XMQM 4DR4M 1W5TA 3A45A 3GLHA 2L6OA 4LGYA 3U5ZB 1IN5A 4B7GA 1ZMVA 3UGJA 2EO2A 3U6LA 3QYBA 2DAGA 1NO1A 1R7RA 3HU2A 3TWKA 3J81S 4GH9A 5KQDA 3GLGB 1IXSB 5BPVA 1MJGM 4IBBA 1Y8GA 1D0LA 2XEPA 3LCUA 4AZFA 1K3WA 3AKZA 1NV8A 1R5LA 3I04M 2KDLA 3JAMS 1HNXM 4DR7M 3U5ZA 4IBIA 2DI0A 1HJPA 1YSYA 2FFJA 3MK6A 4P16A 2ZAOA 2MGWA 3BXWA 1DV0A 1JB0F 4KLNA 3GLGA 3GRRA 1IXSA 2LH0A 2X4AA 1C1KA 1ZQ9A 2L2DA 4I8OA 4L16A 2J7NA 3FRIA 4X64M 2DWZB 3ZQJA 3B7ZA 5FTNA 1NV9A 3EIHA 2GQFA 1L8QA 3GP1A 3TWLA 4B7HA 2D7GA 2I7NA 4FWDA 3FTCA 3A42A 3W0FA 2M60A 1NY6A 1OFIA
chains in the Genus database with same CATH topology
1HT1E 4R7GA 4GHLA 2L7HA 4Z6YA 3D8BA 4TUWA 3AOEA 2XF3A 2RGOA 5JI2E 2XGNA 3FYCA 4D82A 2VQFM 3LQRA 3SMSA 3GLIB 3KXEC 4MGKE 4RF0A 2KZUA 3TWMA 3FTEA 2R45A 3C58A 1TDZA 5ITXE 3KSJA 2LXEA 2HHHM 1HQCA 4YHHM 3TQSA 4OU7A 4JI8M 2A5YB 4LY6A 4GMQA 3IG8A 4CISA 1FJGM 1XNQM 3GLIA 2C9CA 3L28A 1HNWM 5ITRA 2Z7JA 3U6QA 2CHQA 3UZUA 4G4QA 3U6CA 4LJ7A 2F5OA 1KFVA 2UXDM 1HQYE 4DV2M 4AQYM 2D7HA 3HJSA 2C5RA 2KA6B 3KS4A 1K3XA 4AKIA 4AKGA 2Q2EB 3KP0E 1Z6TA 1HT2E 4DR6M 1G8PA 3SC3A 4X62M 3L26A 3T1YM 4GKJM 3HKPA 4MH0E 5C18A 2D7EA 2BNKA 4B3RM 3FD9A 2XSZA 5KPZA 3RE8A 1W5SA 4OVZB 4D81A 2K47A 3CF2A 3HJQA 5JI3E 3KFUG 1I4WA 4HL4A 2KXEA 4LJ5A 3HGIA 3B9PA 4PCZA 5IREB 1EE8A 3GO8A 3J80S 3GLFB 1IXZA 4JV5M 2I7PA 3T1HM 4QNRA 1Z5BA 2C99A 4OW0A 3VFDA 5EP1A 2V6ZM 3TE6A 4I81A 2UXBM 5DYGA 2R18A 4OVZA 3GPXA 4IJEA 1HNZM 1TGUA 4LF9M 1N33M 2QP9X 4LJAA 4NXMM 1QYRA 1NSFA 4PT5A 4AKHA 3HU3A 4LFBM 3FUXA 3GLFA 2W82A 3FKEA 3DOAA 2JA2A 4FWGA 1R2YA 4FWHA 2DHRA 1SXJD 4DV1M 7CATA 5LMNM 1DGGA 4LG2A 1WXQA 1YUBA 3SMPA 5E6JA 3KP1E 4CGYB 2F5NA 4NL4H 1E9SA 4WURA 1TH2A 4G6ZA 4ZPXA 4LF4M 4DV0M 4MGZE 4KODA 3I51A 3PVSA 2DWLA 3CF6E 4LRTA 2OQ4A 1DO2A 1LV7A 3A46A 4X66M 3VKGA 4DV5M 3SYLA 4OX9M 2LWXA 3VLFB 4G4NA 3VKHA 2R4EA 4FCVA 1XC8A 5EP2A 2XZUA 3THGA 5DYIA 5KQ8A 2RGHA 1PM5A 3VK8A 3VK7A 4B3SM 3CTWB 5IZ7D 1XNRM 2LNHC 3AOEC 4M9ZA 3RFWA 2R65A 4LJ8A 1N75A 1IN7A 2KRUA 1IY2A 1Q3CA 3T15A 3SASA 4FCWA 1NJFA 2Y0TA 2UU9M 5EP3A 2UUCM 3LMMA 2KRKA 2F5QA 3PFIA 5FTKA 3AV0A 4JI1M 4JI3M 1QAOA 1Q3BA 4HLQA 3KSXA 1ORYB 2P5TA 4LJ9A 1NHGC 3FUVA 5KPTA 3M0EA 2XLJA 4JI6M 4PD2A 5IWAM 1E9RA 1E32A 3UMMA 1DO0A 4LCBA 2X8AA 2XH9A 3RGPA 4LZJA 1QZMA 4DUZM 1QAMA 1IBLM 2UXCM 2ZAMA 1Z59A 3AL0C 3U6DA 4QNMA 2ZBKB 2H1RA 5KPRA 2V1UA 4QHTA 3Q8XA 2O5RA 4JI5M 2G5GX 4L78A 3DFZA 4JI0M 4L8RC 1H6UA 4RF1A 4RNAA 2CV0A 3E4RA 2UUAM 3ZH9B 2CEAA 3J27B 5ITQA 1ZAEA 2YR0A 3WHKA 2EUCA 1PJJA 3KDSE 4GKKM 2R46A 5ITTA 4DR1M 3SAVA 2XZFA 2Y21A 3J7BA 2CHVA 2CE7A 4B7FA 2CUZA 4FD2A 3LVVA 3GRYA 4K0KM 4FCTA 3FUWA 1G41A 1JQJC 1SXJB 1GL6A 4IIWA 3GQ3A 1L1ZA 1HR0M 4LF7M 3SARA 2R62A 3U6PA 4NSOB 3VDPA 4JI7M 3DA1A 3K2LA 4LRSA 2G8LA 2BJVA 2L7IA 2Z3XA 3KW6A 4LF5M 1GLNA 5EXPA 4DV4M 4NRVA 3ZCBB 1TDHA 2Z4RA 3U60A 5FTMA 1SXJA 4PDGA 5EXSA 4B3TM 1QVRA 3GQ5A 1IN8A 4M0WA 1NNUC 3SHGB 4GITA 3KOWE 3AJIB 4M9XA 4M9SA 3SHFA 4ITQA 2XFTA 3DZDA 3L25A 2KW0A 5H37D 1T3TA 1IM2A 1GVNA 2YFQA 2ZM6M 5KO3A 1XXHB 2FNAA 3MHVC 2DVWB 3IG5A 4IBJA 4LZZA 3SYKA 3JR4A 1NNJA 5ITXA 2E5LM 3LQQA 2ZANA 2C96A 4NOOB 4JN6A 1DGBA 3FUTA 1QAQA 5A2QS 4LJ6A 1XWIA 4REZA 1NHWC 1NJGA 3AOGA 1KSFX 1N36M 1XXHA 4LFCM 2CV1A 1D2NA 4DV6M 4L4UA 4GC9A 5EJCA 1N78A 3PNVA 2YNMD 2XFSA 2Y20A 3KS8A 3GPYA 4LGMA 4D80A 4QOZC 4FVMA 4JXJA 1IXRC 3HU1A 3LVWA 4L15A 1J5EM 1J09A 5E26A 3L27A 4DR3M 4B3MM 1KYIA 4S12A 2QBYA 4MGIE 3UJNA 2AHMA 4IBCA 5EP4A 1S3SA 2V1CA 5EQTA 2ERCA 3VDUA 5BR8M 4YY3M 3KOXE 3TL4X 1NY5A 2KZSA 1MX0A 2YQZA 1L1TA 4LFAM 3FYDA 4AG5A 3U61B 1VDDA 1G4AE 3HHXA 2C98A 2F5SA 8CATA 2FE8A 4MGYE 4DR2M 3KOZE 5FTLA 4A3VB 2EA0A 4CHTB 4I5SA 3A98B 5EXTA 2C9OA 4NRWA 3GRUA 2CHGA 1PJIA 2QCUA 3U61A 4NSRA 1IY1A 4II7A 2F4VM 2OPFA 1G59A 2L09A 4IJFA 3H4MA 3U6SA 2J7OA 4MB7A 3R9XB 1X37A 1IN4A 1L2BA 3SAWA 1I94M 2UUBM 4AI6A 2DZNB 3GPPA 4JI2M 2RKOA 3R8FA 2DXIA 4NXNM 4BB9A 5FLXS 3FTFA 3QWLA 1GKIA 4LF6M 3I4VA 4MM3B 2KEBA 3MJ5A 3NWLA 4I4LA 3D8LA 2Z4SA 4EIWA 3U6MA 3J7AS 4BLCA 3W0LB 1IQPA 1XMOM 4MGHA 3T38A 2QPAA 3U6EA 3AFHA 4DR5M 1QANA 2M5ZA 1SXJE 1SXJC 5ITUA 1TH3A 3HWSA 1N34M 2Y0QA 3FTDA 4IBFA 4XBOA 2VQEM 5FTJA 4DV7M 5DNYA 3K92A 3EIEA 1R2ZA 2FOIC 2VIIA 3HHWA 4G4OA 3SAUA 3KVWA 3J2PB 3U60B 2QZ4A 1GL7A 2NQ8C 4IBDA 1L2CA 1N32M 1UM8A 4AW4A 4W5WA 3QAUA 2HCBA 3K8ZA 4FW9A 4IBGA 1N77A 4R3DA 1K82A 3JR5A 2F5PA 3L2AA 3FUUA 4GC5A 5GKNA 2BJWA 2HL7A 1XHBA 2CFOA 4AG6A 1QQWA 3HHYA 3SATA 1Q39A 3WHLA 4GHAA 1IBMM 5IT9S 4WW0A 3M6AA 1IBKM 5C1BA 4G4RA 1IY0A 1J7KA 1E94E 3ILKA 3CF0A 1DGFA 2X49A 3M7GA 4B08A 1G3IA 3E9SA 2DWMA 2DZOB 1JR3A 5FSWA 3GRVA 3ZC7B 2QENA 3OTOM 4LJ4A 3PXGA 4KO8A 3K1JA 3GQ4A 3RGSA 4IBEA 4XGIA 3KOYE 1MU5A 2HKJA 1L2DA 1Z5CA 1NVMA 5ITYA 2QBYB 1DGHB 2XSZD 4Z8XA 3TPZA 4GRIA 4DUYM 3HJ8A 5F3WA 1JR3D 1IN6A 3L29A 4JI4M 1Z5AA 3HHZA 1OJLA 4IBKA 3UK6A 4GIPA 3GPUA 1YE9A 3NBIA 4X65M 2DWNA 2CV2A 3I4YA 3PNYA 4M0DA 5EXXA 4DV3M 1DGHA 3GLHB 3SBJA 5LMUM 3U6OA 4LF8M 2R4JA 4KHPM 3SFZA 1TH4A 4PDIA 1R6BX 1OFHA 3BOSA 4QOSA 4JYAM 4QHSA 1FNNA 4BBAA 1XMQM 4DR4M 1W5TA 3A45A 3GLHA 2L6OA 4LGYA 3U5ZB 1IN5A 4B7GA 3UGJA 2EO2A 3U6LA 1R7RA 3HU2A 3TWKA 3J81S 4GH9A 5KQDA 3GLGB 1IXSB 5BPVA 4IBBA 1K3WA 2XEPA 4AZFA 3AKZA 3JAMS 1HNXM 4DR7M 3U5ZA 4IBIA 1YSYA 2FFJA 3MK6A 4P16A 2ZAOA 4KLNA 3GLGA 3GRRA 2X4AA 2LH0A 1C1KA 1ZQ9A 4I8OA 4L16A 2J7NA 4X64M 2DWZB 5FTNA 3EIHA 1L8QA 3GP1A 3TWLA 4B7HA 2D7GA 2I7NA 4FWDA 3FTCA 3A42A 3W0FA 2M60A 1NY6A 1OFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q S;  3SAT A;  1Q39 A;  1Q3C A;  3SAS A;  1N36 M;  4LFC M;  1IBM M;  5IT9 S;  2VQF M;  4DV6 M;  2UU9 M;  2UUC M;  1IBK M;  4G4R A;  3GPY A;  3TWM A;  2F5Q A;  3C58 A;  1TDZ A;  5ITX E;  2HHH M;  4JI1 M;  4JI3 M;  4YHH M;  1J5E M;  1Q3B A;  4JI8 M;  4DR3 M;  4B3M M;  3OTO M;  1XNQ M;  4CIS A;  1FJG M;  4JI6 M;  1HNW M;  5ITR A;  4PD2 A;  4YY3 M;  5BR8 M;  5IWA M;  3U6Q A;  3GQ4 A;  1MX0 A;  1L1T A;  4LFA M;  4G4Q A;  3U6C A;  1MU5 A;  2HKJ A;  1KFV A;  2F5O A;  2UXD M;  1L2D A;  4DV2 M;  4AQY M;  1Z5C A;  5ITY A;  1K3X A;  4DUZ M;  1IBL M;  2UXC M;  1Z59 A;  2F5S A;  2Q2E B;  3U6D A;  2ZBK B;  4JI4 M;  4DR2 M;  1Z5A A;  2EA0 A;  4DR6 M;  4X62 M;  3T1Y M;  4GKJ M;  4JI5 M;  3GPU A;  4NRW A;  4B3R M;  4X65 M;  4JI0 M;  1PJI A;  4DV3 M;  3SBJ A;  2UUA M;  5LMU M;  5ITQ A;  3U6O A;  2F4V M;  4PCZ A;  2OPF A;  4LF8 M;  4KHP M;  1EE8 A;  3GO8 A;  3J80 S;  1PJJ A;  4PDI A;  3U6S A;  4GKK M;  5ITT A;  4JV5 M;  4MB7 A;  4DR1 M;  3T1H M;  1L2B A;  3SAW A;  1Z5B A;  1I94 M;  2UUB M;  3SAV A;  3GPP A;  2XZF A;  4JI2 M;  4JYA M;  2UXB M;  4NXN M;  1N33 M;  3GPX A;  1HNZ M;  5FLX S;  4LF9 M;  4K0K M;  1XMQ M;  4LF6 M;  4NXM M;  3A45 A;  4DR4 M;  3GQ3 A;  1L1Z A;  3U6L A;  3U6M A;  1HR0 M;  3TWK A;  4LF7 M;  3SAR A;  3J7A S;  3U6P A;  3J81 S;  3DOA A;  1R2Y A;  4LFB M;  1XMO M;  4DV1 M;  4JI7 M;  3U6E A;  5LMN M;  4DR5 M;  1K3W A;  5ITU A;  4LF5 M;  4DV4 M;  1N34 M;  4NRV A;  1TDH A;  2F5N A;  3JAM S;  1HNX M;  4DR7 M;  2VQE M;  4DV7 M;  4PDG A;  4B3T M;  4LF4 M;  3GQ5 A;  4DV0 M;  1R2Z A;  4G4O A;  2OQ4 A;  4X64 M;  4ITQ A;  3A46 A;  3SAU A;  4X66 M;  4DV5 M;  4OX9 M;  4G4N A;  2ZM6 M;  1L2C A;  1XC8 A;  2XZU A;  1N32 M;  3GP1 A;  3JR4 A;  1PM5 A;  3TWL A;  1NNJ A;  3VK8 A;  3VK7 A;  5ITX A;  4B3S M;  1XNR M;  2E5L M;  1K82 A;  3JR5 A;  2F5P A;  3A42 A;  3W0F A;  4DUY M; 
#chains in the Genus database with same CATH topology
 1HT1 E;  4R7G A;  4GHL A;  2L7H A;  4Z6Y A;  3D8B A;  4TUW A;  3AOE A;  1RU3 A;  2XF3 A;  2RGO A;  5JI2 E;  2XGN A;  3FYC A;  4D82 A;  2MH8 A;  2VQF M;  2R0I A;  3LQR A;  3SMS A;  3GLI B;  2KNV A;  3KXE C;  4MGK E;  4Y28 F;  1GJT A;  4RF0 A;  3I01 M;  2KZU A;  2OOB A;  3TWM A;  3FTE A;  1OTR A;  2L4E A;  2R45 A;  3C58 A;  1TDZ A;  3K9P A;  2JY6 B;  5ITX E;  3KSJ A;  2LXE A;  2HHH M;  1HQC A;  1OAO C;  3C9P A;  4YHH M;  3TQS A;  4OU7 A;  4JI8 M;  1VDL A;  2MJ5 B;  2A5Y B;  4LY6 A;  2DAE A;  3K9O A;  4GMQ A;  2LHC A;  3IG8 A;  4CIS A;  1FJG M;  3GLI A;  2C9C A;  3C3E A;  3L28 A;  1HNW M;  5ITR A;  2EJS A;  1XXH E;  2Z7J A;  2CHQ A;  3U6Q A;  3UZU A;  4G4Q A;  3U6C A;  4LJ7 A;  2F5O A;  1KFV A;  2JNH A;  1HQY E;  2UXD M;  4DV2 M;  4AQY M;  2D7H A;  3HJS A;  4NC6 A;  2C5R A;  2KA6 B;  3KS4 A;  1K3X A;  4AKI A;  3T6P A;  2JP7 A;  1A5T A;  4AKG A;  2Q2E B;  2CP8 A;  3KP0 E;  1Z6T A;  1HT2 E;  2EKF A;  1CUK A;  2G3Q A;  4DR6 M;  1G8P A;  1EFU B;  3SC3 A;  1TF0 B;  4X62 M;  3L26 A;  3HKP A;  4MH0 E;  3T1Y M;  4GKJ M;  5C18 A;  2D7E A;  2BNK A;  4B3R M;  3FD9 A;  2XSZ A;  5KPZ A;  3RE8 A;  1W5S A;  4OVZ B;  4D81 A;  2DNA A;  2K47 A;  3CF2 A;  3HJQ A;  5JI3 E;  1I4W A;  2JY8 A;  4HL4 A;  3KFU G;  2KXE A;  4LJ5 A;  3HGI A;  3B9P A;  4PCZ A;  5IRE B;  1EE8 A;  1OKS A;  4XK8 F;  3GO8 A;  3J80 S;  3GLF B;  1IXZ A;  4JV5 M;  2I7P A;  3T1H M;  3GLH E;  4QNR A;  1Z5B A;  1XB2 B;  2C99 A;  4OW0 A;  3VFD A;  5EP1 A;  2V6Z M;  4UN2 B;  3W67 A;  3TE6 A;  4I81 A;  2UXB M;  5DYG A;  2R18 A;  4OVZ A;  3GPX A;  4IJE A;  1HNZ M;  1TGU A;  4LF9 M;  1N33 M;  2BWB A;  2QP9 X;  4LJA A;  1QYR A;  1NSF A;  2R6F A;  2ZTC A;  4PT5 A;  1TTE A;  4NXM M;  4AKH A;  3HU3 A;  2APL A;  4LFB M;  3FUX A;  1V34 A;  2W82 A;  2OOA A;  3DOA A;  2JA2 A;  3FKE A;  4FWG A;  3GLF A;  1R2Y A;  4FWH A;  1C7Y A;  2DHR A;  1SXJ D;  1WGN A;  2FS1 A;  4DV1 M;  7CAT A;  1OIP A;  5LMN M;  1DGG A;  4LG2 A;  1WXQ A;  1YUB A;  3SMP A;  5E6J A;  3KP1 E;  4CGY B;  2MR9 A;  3GLG E;  4NL4 H;  1E9S A;  2F5N A;  4WUR A;  1TH2 A;  2Z8Y M;  4G6Z A;  4ZPX A;  4LF4 M;  4DV0 M;  3MMP A;  4MGZ E;  3E46 A;  4KOD A;  3I51 A;  3PVS A;  2DWL A;  3CF6 E;  4LRT A;  2OQ4 A;  1DO2 A;  1LV7 A;  3A46 A;  3B7Q A;  4X66 M;  3VKG A;  4DV5 M;  3E21 A;  3SYL A;  4OX9 M;  2LWX A;  3VLF B;  4G4N A;  3VKH A;  2R4E A;  4FCV A;  1XC8 A;  3CGW A;  5EP2 A;  3THG A;  5DYI A;  5KQ8 A;  2XZU A;  2RGH A;  1PM5 A;  3VK8 A;  3VK7 A;  2DAI A;  4B3S M;  3CTW B;  5IZ7 D;  1XNR M;  2LNH C;  1TR8 A;  3AOE C;  3FRH A;  4M9Z A;  2GNO A;  3RFW A;  2R65 A;  4LJ8 A;  1UFZ A;  1N75 A;  1IN7 A;  2KRU A;  1IY2 A;  1Q3C A;  3T15 A;  3SAS A;  4FCW A;  4RKU F;  1WJ7 A;  1NJF A;  2ZTD A;  3IEC A;  2Y0T A;  2UU9 M;  5EP3 A;  2UUC M;  3LMM A;  1BVS A;  2KRK A;  2F5Q A;  3PFI A;  3NBX X;  5FTK A;  3AV0 A;  4HEO A;  3V76 A;  4JI1 M;  3F92 A;  4JI3 M;  3GLI E;  1QAO A;  1Q3B A;  4HLQ A;  3KSX A;  1ORY B;  2P5T A;  4LJ9 A;  1NHG C;  3FUV A;  2JWS A;  5KPT A;  3M0E A;  2XLJ A;  4JI6 M;  2H5X A;  4PD2 A;  5IWA M;  1E9R A;  1E32 A;  3UMM A;  2OO9 A;  1DO0 A;  4LCB A;  2X8A A;  2XH9 A;  3RGP A;  4LZJ A;  2JY7 A;  1QZM A;  4DUZ M;  1QAM A;  1IBL M;  2UXC M;  2ZAM A;  1Z59 A;  3AL0 C;  3U6D A;  4QNM A;  2WSC F;  2ZBK B;  2H1R A;  5KPR A;  2V1U A;  4QHT A;  3Q8X A;  2O5R A;  1JR3 E;  4JI5 M;  2G5G X;  4L78 A;  2DAK A;  3DFZ A;  4JI0 M;  4L8R C;  1H6U A;  4RF1 A;  4RNA A;  2KHH A;  2LHG A;  1IFY A;  2CV0 A;  1VQ1 A;  3E4R A;  3ZH9 B;  2UUA M;  2CEA A;  4ANR A;  3J27 B;  5ITQ A;  1ZAE A;  2YR0 A;  2J5Y A;  2LVA A;  2EUC A;  2QQ8 A;  3KDS E;  2VF8 A;  4Q7J A;  2R46 A;  3WHK A;  5ITT A;  1PJJ A;  4DR1 M;  4GKK M;  3SAV A;  2XZF A;  2Y21 A;  3J7B A;  2CHV A;  2CE7 A;  4B7F A;  2CUZ A;  4FD2 A;  3GLF E;  3LVV A;  3GRY A;  2QSF X;  4FCT A;  1YLA A;  2LVQ D;  3FUW A;  4K0K M;  1G41 A;  1JQJ C;  1SXJ B;  1GL6 A;  4IIW A;  3GQ3 A;  1QUS A;  1L1Z A;  1HR0 M;  4LF7 M;  3SAR A;  2R62 A;  3U6P A;  5DFL A;  4NSO B;  3VDP A;  1OIZ A;  2DAM A;  4JI7 M;  3DA1 A;  3K2L A;  4LRS A;  2WZJ A;  2G8L A;  1VG5 A;  2L7I A;  2BJV A;  2Z3X A;  3KW6 A;  4LF5 M;  1PGY A;  1GLN A;  5EXP A;  4DV4 M;  3HZJ A;  1OAI A;  4NRV A;  3ZCB B;  1TDH A;  2Z4R A;  2VDB B;  3U60 A;  5FTM A;  2WSF F;  1SXJ A;  1QDT A;  4PDG A;  5EXS A;  4B3T M;  1QVR A;  3GQ5 A;  1IN8 A;  4M0W A;  2JXN A;  1NNU C;  3SHG B;  4GIT A;  3KOW E;  3AJI B;  4M9X A;  4M9S A;  3QYE A;  3SHF A;  4ITQ A;  2XFT A;  3DZD A;  3L25 A;  2DEN A;  2KW0 A;  5H37 D;  1T3T A;  1IM2 A;  1GVN A;  2YFQ A;  2ZM6 M;  5KO3 A;  1XXH B;  2FNA A;  3MHV C;  2DVW B;  3IG5 A;  4IBJ A;  4LZZ A;  3SYK A;  3Q8G A;  3JR4 A;  1NNJ A;  1T6O A;  2R44 A;  5ITX A;  2E5L M;  3LQQ A;  2ZAN A;  2C96 A;  4NOO B;  4JN6 A;  1DGB A;  1WHC A;  3FUT A;  1QAQ A;  2HWJ A;  2L4F A;  5A2Q S;  2DZL A;  4LJ6 A;  1XWI A;  4REZ A;  1NHW C;  1NJG A;  2CRU A;  3AOG A;  1KSF X;  1N36 M;  1XXH A;  4LFC M;  2CV1 A;  1D2N A;  4DV6 M;  4L4U A;  4GC9 A;  4KT0 F;  5EJC A;  1N78 A;  3PNV A;  2JUJ A;  2YNM D;  2XFS A;  2LVP C;  2Y20 A;  3LCV B;  3GPY A;  1ZV1 A;  4LGM A;  3KS8 A;  1VEK A;  4D80 A;  1V33 A;  4QOZ C;  1R4G A;  1D0K A;  2LVN C;  3C3D A;  4FVM A;  2DHY A;  4JXJ A;  2VF7 A;  1PJS A;  1IXR C;  3HU1 A;  3LVW A;  4L15 A;  1J5E M;  1J09 A;  2B3T A;  5E26 A;  3L27 A;  4DR3 M;  4B3M M;  1KYI A;  4S12 A;  2QBY A;  4CIZ A;  4MGI E;  3UJN A;  2AHM A;  4IBC A;  5EP4 A;  1S3S A;  2V1C A;  5EQT A;  2ERC A;  3VDU A;  5BR8 M;  4YY3 M;  3KOX E;  3TL4 X;  1NY5 A;  2KZS A;  4P17 A;  1MX0 A;  2YQZ A;  1L1T A;  4LFA M;  2BWE A;  3FYD A;  2DKL A;  4AG5 A;  3U61 B;  1VDD A;  2CWB A;  3B89 A;  1GJS A;  1G4A E;  2QHO B;  3HHX A;  2C98 A;  2F5S A;  2RRU A;  8CAT A;  2FE8 A;  4MGY E;  4DR2 M;  3KOZ E;  5FTL A;  4A3V B;  4CJ6 A;  4CHT B;  4I5S A;  2EA0 A;  3A98 B;  1WGL A;  5EXT A;  2C9O A;  4NRW A;  1QDR A;  3GRU A;  2CHG A;  1PJI A;  2QCU A;  3U61 A;  3BBZ A;  1WIV A;  1IY1 A;  4NSR A;  4II7 A;  4F2L A;  2F4V M;  2OPF A;  1G59 A;  2L09 A;  3H4J A;  4IJF A;  3H4M A;  5L8R F;  2JZ1 A;  3U6S A;  1T43 A;  2J7O A;  4MB7 A;  3R9X B;  1X37 A;  1IN4 A;  1L2B A;  3SAW A;  2KNA A;  2WSE F;  1I94 M;  2UUB M;  4AI6 A;  2DZN B;  3GPP A;  4JI2 M;  2RKO A;  3R8F A;  2DXI A;  4NXN M;  4BB9 A;  2LVO C;  3FE3 A;  5FLX S;  3FTF A;  3QWL A;  3W68 A;  1GKI A;  4DBG B;  4LF6 M;  4WP2 A;  3I4V A;  4MM3 B;  1LTM A;  2KEB A;  1VEG A;  3MJ5 A;  3NWL A;  3D8L A;  2Z4S A;  4I4L A;  4EIW A;  3U6M A;  3J7A S;  4BLC A;  3W0L B;  2LTU A;  1IQP A;  1XMO M;  4MGH A;  3T38 A;  2QPA A;  3U6E A;  3B7N A;  3AFH A;  1GAB A;  4DR5 M;  1OQY A;  2M5Z A;  1QAN A;  4G3O A;  1SXJ E;  1SXJ C;  5ITU A;  1TH3 A;  1P3Q Q;  3HWS A;  1N34 M;  2K0B X;  2Y0Q A;  3FTD A;  4IBF A;  4XBO A;  1WR1 B;  2VQE M;  5FTJ A;  4DV7 M;  5DNY A;  3K92 A;  3EIE A;  1R2Z A;  2FOI C;  2VII A;  2N35 A;  2FH0 A;  3HHW A;  4G4O A;  1F4I A;  3LW5 F;  3SAU A;  3KVW A;  1SG9 A;  3J2P B;  1V92 A;  3U60 B;  3B74 A;  2O01 F;  1AIP C;  2QZ4 A;  1GL7 A;  2NQ8 C;  4IBD A;  1L2C A;  2MRO B;  1N32 M;  1UM8 A;  4AW4 A;  4W5W A;  1VEJ A;  2HCB A;  3QAU A;  2K9D A;  3IHP A;  3K8Z A;  4FW9 A;  4IBG A;  1N77 A;  4R3D A;  1K82 A;  3JR5 A;  2JY5 A;  2F5P A;  3L2A A;  3FUU A;  4GC5 A;  5GKN A;  2BJW A;  2HL7 A;  1XHB A;  2CFO A;  1AUA A;  4AG6 A;  1QQW A;  3HHY A;  3SAT A;  1Q39 A;  3WHL A;  4GHA A;  1MN3 A;  1Q02 A;  1ZMW A;  1IBM M;  5IT9 S;  1PJQ A;  1G71 A;  4WW0 A;  2JZ0 A;  3M6A A;  1IBK M;  5C1B A;  4G4R A;  1PJT A;  1IY0 A;  1QUT A;  1J7K A;  1E94 E;  3HX3 A;  3ILK A;  4R71 A;  4GEW A;  2LBC A;  4L6V 6;  3CF0 A;  1DGF A;  2X49 A;  3M7G A;  4B08 A;  1G3I A;  3E9S A;  1QZE A;  2DWM A;  2DZO B;  1JR3 A;  5FSW A;  3GRV A;  3ZC7 B;  2QEN A;  3OTO M;  4LJ4 A;  3PXG A;  4KO8 A;  1ZMU A;  3K1J A;  3GQ4 A;  3RGS A;  4IBE A;  4XGI A;  3KOY E;  1XNQ M;  1MU5 A;  2HKJ A;  1L2D A;  2K6B A;  1Z5C A;  1NVM A;  5ITY A;  2QBY B;  1DGH B;  2XSZ D;  4Z8X A;  3TPZ A;  4GRI A;  4DUY M;  3HJ8 A;  1D0M A;  5F3W A;  1JR3 D;  1IN6 A;  3L29 A;  4JI4 M;  1Z5A A;  3HHZ A;  1OJL A;  4IBK A;  3UK6 A;  2O25 A;  4GIP A;  3GPU A;  1YE9 A;  3NBI A;  4X65 M;  2DWN A;  2CV2 A;  4F1I A;  3I4Y A;  3PNY A;  4M0D A;  5EXX A;  4DV3 M;  1DGH A;  2KNZ A;  3GLH B;  3SBJ A;  1EIJ A;  5LMU M;  3U6O A;  4LF8 M;  2R4J A;  2EKK A;  4KHP M;  3SFZ A;  1TH4 A;  4PDI A;  1R6B X;  1GO5 A;  2HAK A;  2QNJ A;  3HY5 A;  1PRB A;  1OFH A;  3BOS A;  4QOS A;  4JYA M;  4QHS A;  1FNN A;  4BBA A;  1XMQ M;  4DR4 M;  1W5T A;  3A45 A;  3GLH A;  2L6O A;  4LGY A;  3U5Z B;  1IN5 A;  4B7G A;  1ZMV A;  3UGJ A;  2EO2 A;  3U6L A;  3QYB A;  2DAG A;  1NO1 A;  1R7R A;  3HU2 A;  3TWK A;  3J81 S;  4GH9 A;  5KQD A;  3GLG B;  1IXS B;  5BPV A;  1MJG M;  4IBB A;  1Y8G A;  1D0L A;  2XEP A;  3LCU A;  4AZF A;  1K3W A;  3AKZ A;  1NV8 A;  1R5L A;  3I04 M;  2KDL A;  3JAM S;  1HNX M;  4DR7 M;  3U5Z A;  4IBI A;  2DI0 A;  1HJP A;  1YSY A;  2FFJ A;  3MK6 A;  4P16 A;  2ZAO A;  2MGW A;  3BXW A;  1DV0 A;  1JB0 F;  4KLN A;  3GLG A;  3GRR A;  1IXS A;  2LH0 A;  2X4A A;  1C1K A;  1ZQ9 A;  2L2D A;  4I8O A;  4L16 A;  2J7N A;  3FRI A;  4X64 M;  2DWZ B;  3ZQJ A;  3B7Z A;  5FTN A;  1NV9 A;  3EIH A;  2GQF A;  1L8Q A;  3GP1 A;  3TWL A;  4B7H A;  2D7G A;  2I7N A;  4FWD A;  3FTC A;  3A42 A;  3W0F A;  2M60 A;  1NY6 A;  1OFI A; 
#chains in the Genus database with same CATH homology
 1HT1 E;  4R7G A;  4GHL A;  2L7H A;  4Z6Y A;  3D8B A;  4TUW A;  3AOE A;  2XF3 A;  2RGO A;  5JI2 E;  2XGN A;  3FYC A;  4D82 A;  2VQF M;  3LQR A;  3SMS A;  3GLI B;  3KXE C;  4MGK E;  4RF0 A;  2KZU A;  3TWM A;  3FTE A;  2R45 A;  3C58 A;  1TDZ A;  5ITX E;  3KSJ A;  2LXE A;  2HHH M;  1HQC A;  4YHH M;  3TQS A;  4OU7 A;  4JI8 M;  2A5Y B;  4LY6 A;  4GMQ A;  3IG8 A;  4CIS A;  1FJG M;  1XNQ M;  3GLI A;  2C9C A;  3L28 A;  1HNW M;  5ITR A;  2Z7J A;  3U6Q A;  2CHQ A;  3UZU A;  4G4Q A;  3U6C A;  4LJ7 A;  2F5O A;  1KFV A;  2UXD M;  1HQY E;  4DV2 M;  4AQY M;  2D7H A;  3HJS A;  2C5R A;  2KA6 B;  3KS4 A;  1K3X A;  4AKI A;  4AKG A;  2Q2E B;  3KP0 E;  1Z6T A;  1HT2 E;  4DR6 M;  1G8P A;  3SC3 A;  4X62 M;  3L26 A;  3T1Y M;  4GKJ M;  3HKP A;  4MH0 E;  5C18 A;  2D7E A;  2BNK A;  4B3R M;  3FD9 A;  2XSZ A;  5KPZ A;  3RE8 A;  1W5S A;  4OVZ B;  4D81 A;  2K47 A;  3CF2 A;  3HJQ A;  5JI3 E;  3KFU G;  1I4W A;  4HL4 A;  2KXE A;  4LJ5 A;  3HGI A;  3B9P A;  4PCZ A;  5IRE B;  1EE8 A;  3GO8 A;  3J80 S;  3GLF B;  1IXZ A;  4JV5 M;  2I7P A;  3T1H M;  4QNR A;  1Z5B A;  2C99 A;  4OW0 A;  3VFD A;  5EP1 A;  2V6Z M;  3TE6 A;  4I81 A;  2UXB M;  5DYG A;  2R18 A;  4OVZ A;  3GPX A;  4IJE A;  1HNZ M;  1TGU A;  4LF9 M;  1N33 M;  2QP9 X;  4LJA A;  4NXM M;  1QYR A;  1NSF A;  4PT5 A;  4AKH A;  3HU3 A;  4LFB M;  3FUX A;  3GLF A;  2W82 A;  3FKE A;  3DOA A;  2JA2 A;  4FWG A;  1R2Y A;  4FWH A;  2DHR A;  1SXJ D;  4DV1 M;  7CAT A;  5LMN M;  1DGG A;  4LG2 A;  1WXQ A;  1YUB A;  3SMP A;  5E6J A;  3KP1 E;  4CGY B;  2F5N A;  4NL4 H;  1E9S A;  4WUR A;  1TH2 A;  4G6Z A;  4ZPX A;  4LF4 M;  4DV0 M;  4MGZ E;  4KOD A;  3I51 A;  3PVS A;  2DWL A;  3CF6 E;  4LRT A;  2OQ4 A;  1DO2 A;  1LV7 A;  3A46 A;  4X66 M;  3VKG A;  4DV5 M;  3SYL A;  4OX9 M;  2LWX A;  3VLF B;  4G4N A;  3VKH A;  2R4E A;  4FCV A;  1XC8 A;  5EP2 A;  2XZU A;  3THG A;  5DYI A;  5KQ8 A;  2RGH A;  1PM5 A;  3VK8 A;  3VK7 A;  4B3S M;  3CTW B;  5IZ7 D;  1XNR M;  2LNH C;  3AOE C;  4M9Z A;  3RFW A;  2R65 A;  4LJ8 A;  1N75 A;  1IN7 A;  2KRU A;  1IY2 A;  1Q3C A;  3T15 A;  3SAS A;  4FCW A;  1NJF A;  2Y0T A;  2UU9 M;  5EP3 A;  2UUC M;  3LMM A;  2KRK A;  2F5Q A;  3PFI A;  5FTK A;  3AV0 A;  4JI1 M;  4JI3 M;  1QAO A;  1Q3B A;  4HLQ A;  3KSX A;  1ORY B;  2P5T A;  4LJ9 A;  1NHG C;  3FUV A;  5KPT A;  3M0E A;  2XLJ A;  4JI6 M;  4PD2 A;  5IWA M;  1E9R A;  1E32 A;  3UMM A;  1DO0 A;  4LCB A;  2X8A A;  2XH9 A;  3RGP A;  4LZJ A;  1QZM A;  4DUZ M;  1QAM A;  1IBL M;  2UXC M;  2ZAM A;  1Z59 A;  3AL0 C;  3U6D A;  4QNM A;  2ZBK B;  2H1R A;  5KPR A;  2V1U A;  4QHT A;  3Q8X A;  2O5R A;  4JI5 M;  2G5G X;  4L78 A;  3DFZ A;  4JI0 M;  4L8R C;  1H6U A;  4RF1 A;  4RNA A;  2CV0 A;  3E4R A;  2UUA M;  3ZH9 B;  2CEA A;  3J27 B;  5ITQ A;  1ZAE A;  2YR0 A;  3WHK A;  2EUC A;  1PJJ A;  3KDS E;  4GKK M;  2R46 A;  5ITT A;  4DR1 M;  3SAV A;  2XZF A;  2Y21 A;  3J7B A;  2CHV A;  2CE7 A;  4B7F A;  2CUZ A;  4FD2 A;  3LVV A;  3GRY A;  4K0K M;  4FCT A;  3FUW A;  1G41 A;  1JQJ C;  1SXJ B;  1GL6 A;  4IIW A;  3GQ3 A;  1L1Z A;  1HR0 M;  4LF7 M;  3SAR A;  2R62 A;  3U6P A;  4NSO B;  3VDP A;  4JI7 M;  3DA1 A;  3K2L A;  4LRS A;  2G8L A;  2BJV A;  2L7I A;  2Z3X A;  3KW6 A;  4LF5 M;  1GLN A;  5EXP A;  4DV4 M;  4NRV A;  3ZCB B;  1TDH A;  2Z4R A;  3U60 A;  5FTM A;  1SXJ A;  4PDG A;  5EXS A;  4B3T M;  1QVR A;  3GQ5 A;  1IN8 A;  4M0W A;  1NNU C;  3SHG B;  4GIT A;  3KOW E;  3AJI B;  4M9X A;  4M9S A;  3SHF A;  4ITQ A;  2XFT A;  3DZD A;  3L25 A;  2KW0 A;  5H37 D;  1T3T A;  1IM2 A;  1GVN A;  2YFQ A;  2ZM6 M;  5KO3 A;  1XXH B;  2FNA A;  3MHV C;  2DVW B;  3IG5 A;  4IBJ A;  4LZZ A;  3SYK A;  3JR4 A;  1NNJ A;  5ITX A;  2E5L M;  3LQQ A;  2ZAN A;  2C96 A;  4NOO B;  4JN6 A;  1DGB A;  3FUT A;  1QAQ A;  5A2Q S;  4LJ6 A;  1XWI A;  4REZ A;  1NHW C;  1NJG A;  3AOG A;  1KSF X;  1N36 M;  1XXH A;  4LFC M;  2CV1 A;  1D2N A;  4DV6 M;  4L4U A;  4GC9 A;  5EJC A;  1N78 A;  3PNV A;  2YNM D;  2XFS A;  2Y20 A;  3KS8 A;  3GPY A;  4LGM A;  4D80 A;  4QOZ C;  4FVM A;  4JXJ A;  1IXR C;  3HU1 A;  3LVW A;  4L15 A;  1J5E M;  1J09 A;  5E26 A;  3L27 A;  4DR3 M;  4B3M M;  1KYI A;  4S12 A;  2QBY A;  4MGI E;  3UJN A;  2AHM A;  4IBC A;  5EP4 A;  1S3S A;  2V1C A;  5EQT A;  2ERC A;  3VDU A;  5BR8 M;  4YY3 M;  3KOX E;  3TL4 X;  1NY5 A;  2KZS A;  1MX0 A;  2YQZ A;  1L1T A;  4LFA M;  3FYD A;  4AG5 A;  3U61 B;  1VDD A;  1G4A E;  3HHX A;  2C98 A;  2F5S A;  8CAT A;  2FE8 A;  4MGY E;  4DR2 M;  3KOZ E;  5FTL A;  4A3V B;  2EA0 A;  4CHT B;  4I5S A;  3A98 B;  5EXT A;  2C9O A;  4NRW A;  3GRU A;  2CHG A;  1PJI A;  2QCU A;  3U61 A;  4NSR A;  1IY1 A;  4II7 A;  2F4V M;  2OPF A;  1G59 A;  2L09 A;  4IJF A;  3H4M A;  3U6S A;  2J7O A;  4MB7 A;  3R9X B;  1X37 A;  1IN4 A;  1L2B A;  3SAW A;  1I94 M;  2UUB M;  4AI6 A;  2DZN B;  3GPP A;  4JI2 M;  2RKO A;  3R8F A;  2DXI A;  4NXN M;  4BB9 A;  5FLX S;  3FTF A;  3QWL A;  1GKI A;  4LF6 M;  3I4V A;  4MM3 B;  2KEB A;  3MJ5 A;  3NWL A;  4I4L A;  3D8L A;  2Z4S A;  4EIW A;  3U6M A;  3J7A S;  4BLC A;  3W0L B;  1IQP A;  1XMO M;  4MGH A;  3T38 A;  2QPA A;  3U6E A;  3AFH A;  4DR5 M;  1QAN A;  2M5Z A;  1SXJ E;  1SXJ C;  5ITU A;  1TH3 A;  3HWS A;  1N34 M;  2Y0Q A;  3FTD A;  4IBF A;  4XBO A;  2VQE M;  5FTJ A;  4DV7 M;  5DNY A;  3K92 A;  3EIE A;  1R2Z A;  2FOI C;  2VII A;  3HHW A;  4G4O A;  3SAU A;  3KVW A;  3J2P B;  3U60 B;  2QZ4 A;  1GL7 A;  2NQ8 C;  4IBD A;  1L2C A;  1N32 M;  1UM8 A;  4AW4 A;  4W5W A;  3QAU A;  2HCB A;  3K8Z A;  4FW9 A;  4IBG A;  1N77 A;  4R3D A;  1K82 A;  3JR5 A;  2F5P A;  3L2A A;  3FUU A;  4GC5 A;  5GKN A;  2BJW A;  2HL7 A;  1XHB A;  2CFO A;  4AG6 A;  1QQW A;  3HHY A;  3SAT A;  1Q39 A;  3WHL A;  4GHA A;  1IBM M;  5IT9 S;  4WW0 A;  3M6A A;  1IBK M;  5C1B A;  4G4R A;  1IY0 A;  1J7K A;  1E94 E;  3ILK A;  3CF0 A;  1DGF A;  2X49 A;  3M7G A;  4B08 A;  1G3I A;  3E9S A;  2DWM A;  2DZO B;  1JR3 A;  5FSW A;  3GRV A;  3ZC7 B;  2QEN A;  3OTO M;  4LJ4 A;  3PXG A;  4KO8 A;  3K1J A;  3GQ4 A;  3RGS A;  4IBE A;  4XGI A;  3KOY E;  1MU5 A;  2HKJ A;  1L2D A;  1Z5C A;  1NVM A;  5ITY A;  2QBY B;  1DGH B;  2XSZ D;  4Z8X A;  3TPZ A;  4GRI A;  4DUY M;  3HJ8 A;  5F3W A;  1JR3 D;  1IN6 A;  3L29 A;  4JI4 M;  1Z5A A;  3HHZ A;  1OJL A;  4IBK A;  3UK6 A;  4GIP A;  3GPU A;  1YE9 A;  3NBI A;  4X65 M;  2DWN A;  2CV2 A;  3I4Y A;  3PNY A;  4M0D A;  5EXX A;  4DV3 M;  1DGH A;  3GLH B;  3SBJ A;  5LMU M;  3U6O A;  4LF8 M;  2R4J A;  4KHP M;  3SFZ A;  1TH4 A;  4PDI A;  1R6B X;  1OFH A;  3BOS A;  4QOS A;  4JYA M;  4QHS A;  1FNN A;  4BBA A;  1XMQ M;  4DR4 M;  1W5T A;  3A45 A;  3GLH A;  2L6O A;  4LGY A;  3U5Z B;  1IN5 A;  4B7G A;  3UGJ A;  2EO2 A;  3U6L A;  1R7R A;  3HU2 A;  3TWK A;  3J81 S;  4GH9 A;  5KQD A;  3GLG B;  1IXS B;  5BPV A;  4IBB A;  1K3W A;  2XEP A;  4AZF A;  3AKZ A;  3JAM S;  1HNX M;  4DR7 M;  3U5Z A;  4IBI A;  1YSY A;  2FFJ A;  3MK6 A;  4P16 A;  2ZAO A;  4KLN A;  3GLG A;  3GRR A;  2X4A A;  2LH0 A;  1C1K A;  1ZQ9 A;  4I8O A;  4L16 A;  2J7N A;  4X64 M;  2DWZ B;  5FTN A;  3EIH A;  1L8Q A;  3GP1 A;  3TWL A;  4B7H A;  2D7G A;  2I7N A;  4FWD A;  3FTC A;  3A42 A;  3W0F A;  2M60 A;  1NY6 A;  1OFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...