4B3MM

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3mM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3mM02
3U6OA 3SAWA 4DV0M 5ITTA 2F5PA 4MB7A 4JI3M 4X65M 1J5EM 1L2BA 5IT9S 4PDIA 1HNWM 1XNRM 4KHPM 4JI0M 3U6QA 3SASA 2UUBM 1K3WA 3GQ4A 3JR5A 3GO8A 3A46A 1MX0A 1K3XA 1XMQM 3SARA 3TWMA 4YY3M 4K0KM 4GKJM 1N33M 3J7AS 2OPFA 4G4QA 3T1HM 1PJJA 4NRWA 1Z5AA 3U6LA 1MU5A 4DR5M 3U6MA 4PCZA 4G4RA 1L1ZA 4DV7M 3GPXA 3JAMS 4DUYM 4DR4M 3W0FA 5IWAM 3SBJA 2UUAM 4G4OA 5ITUA 1IBKM 1Q3BA 4LF9M 4LFAM 4LF8M 4OX9M 3T1YM 3U6EA 4JI4M 5ITQA 4X66M 2UXBM 2UXCM 2HHHM 3GP1A 4LF7M 4B3MM 3J81S 4G4NA 3U6DA 4X62M 2F5QA 2F5SA 3GQ3A 4B3TM 3TWKA 1HNXM 1TDZA 2F5OA 3J80S 3GQ5A 4DV3M 4JI8M 3A45A 4LF6M 4DR6M 5FLXS 4ITQA 1L2DA 2UUCM 2ZM6M 1Z5BA 1HNZM 2E5LM 4JI2M 4DUZM 4NXNM 1XMOM 4JI1M 4JV5M 3SAUA 1KFVA 4NXMM 3GPYA 3GPPA 3TWLA 4JI6M 1FJGM 5LMNM 4PD2A 4LF5M 3VK7A 5ITRA 4DR3M 4LF4M 1XC8A 2VQEM 4JYAM 1PM5A 2VQFM 4B3RM 1TDHA 1N34M 1L1TA 3JR4A 5ITXE 3A42A 2Q2EB 2HKJA 4LFBM 3VK8A 4DV5M 5LMUM 2OQ4A 4DV6M 4AQYM 1IBMM 4JI7M 4JI5M 3SAVA 2UXDM 5ITYA 4DR7M 5A2QS 3U6PA 2F4VM 4B3SM 2ZBKB 3DOAA 1N36M 1HR0M 4DV2M 5ITXA 1EE8A 1K82A 5BR8M 1Z5CA 1N32M 1I94M 1IBLM 2EA0A 4LFCM 4NRVA 4YHHM 2XZUA 4DR2M 1PJIA 3GPUA 4DR1M 1Z59A 1Q39A 4PDGA 4CISA 1R2ZA 1NNJA 4X64M 4DV4M 1Q3CA 3U6SA 1XNQM 4DV1M 4GKKM 3U6CA 1R2YA 3SATA 3OTOM 3C58A 1L2CA 2UU9M 2F5NA 2XZFA
chains in the Genus database with same CATH superfamily
3L28A 1J7KA 5ITTA 4XK8F 4X65M 1J5EM 1SXJA 4B7HA 3K8ZA 4M9XA 1XNRM 4JI0M 3U6QA 2XH9A 3PFIA 2B3TA 3LCVB 4NSRA 3M0EA 3SARA 3QYBA 1WJ7A 4GKJM 2L7HA 3AJIB 2OPFA 4M0DA 4LJ9A 3U6LA 1MU5A 2JZ1A 3VKGA 2I7NA 5E6JA 4L78A 5EP2A 3U61B 4GIPA 4G4RA 4DV7M 3GPXA 3JAMS 1IXRC 4OVZA 2CV0A 2CFOA 2FH0A 3B9PA 1UFZA 3NWLA 2UUAM 4G4OA 1IBKM 1Q3BA 3U61A 2DWLA 2LHCA 2G3QA 4LF8M 3C9PA 2JY8A 4JI4M 5ITQA 2WSFF 2UXBM 2UXCM 2Y21A 3AOEA 1OAOC 1V33A 2QHOB 4PT5A 3PNVA 4IBGA 1ZV1A 2CWBA 3MJ5A 1IY1A 4X62M 3U6DA 4LG2A 2Z4SA 1ZQ9A 3VKHA 3FUUA 3FUVA 1E9RA 3PXGA 4P16A 1QAOA 2F5OA 3J80S 3VDUA 2XFTA 3FE3A 2P5TA 3T6PA 4ITQA 1F4IA 3H4JA 2UUCM 3MMPA 3HHYA 3HZJA 2ZM6M 2E5LM 3IG5A 2CE7A 3SYKA 2DZNB 2R18A 3U60A 4LZJA 5EXTA 1XXHE 4LY6A 3U5ZA 1KFVA 2BJWA 3B7NA 7CATA 3GPYA 1Y8GA 1GVNA 5LMNM 5FTKA 3HJSA 3VK7A 4BLCA 3E9SA 1VDLA 3H4MA 2LHGA 2DAMA 5EXPA 2GNOA 4MGIE 1P3QQ 1ORYB 2BNKA 1NHWC 2V1UA 3GRYA 3FKEA 1L8QA 2Q2EB 4LFBM 1IFYA 1DGHA 2R4JA 4DV6M 1UM8A 4AQYM 2DZOB 1D0LA 1VDDA 1TF0B 2M60A 5GKNA 2UXDM 1FNNA 1RU3A 1TH4A 2JUJA 1WGLA 2KHHA 3SMSA 5IREB 2CEAA 2DENA 4LJ5A 2EO2A 3DFZA 3MK6A 3KFUG 1GL7A 3KXEC 4OVZB 4AG5A 4LJ4A 5F3WA 3T15A 2EKFA 2R6FA 1NHGC 3I01M 5ITXA 1Z5CA 5BR8M 1N32M 1IBLM 1BVSA 3QAUA 2EA0A 4LFCM 1QAMA 3HU1A 3FTDA 3KOWE 2KZSA 3LW5F 1E9SA 1WR1B 1PJIA 2R46A 4I5SA 1R4GA 2YFQA 2DHYA 4D82A 4IBEA 1G4AE 4PDGA 2K47A 3GLFE 4X64M 2ZAMA 4KODA 1Q3CA 2DXIA 5DNYA 2KRUA 2QBYA 2VDBB 1QYRA 4LRTA 1ZMVA 3FRHA 2DWMA 5C18A 3IG8A 3J2PB 4GMQA 1AIPC 1I4WA 3K9PA 3V76A 3OTOM 4DBGB 3HU2A 3ZQJA 1V92A 1SXJE 2HAKA 4FWHA 1ZMUA 5DFLA 3I4YA 5EXXA 3CF0A 3RGPA 3GLFA 4DV0M 1GJSA 4JI3M 3FYDA 1R7RA 2J7OA 4PDIA 3UK6A 5KPRA 4FWGA 3SASA 1QAQA 3NBXX 1NJFA 3GQ4A 2L7IA 2EJSA 1T6OA 4IBKA 2FS1A 2DAEA 2YNMD 1XMQM 1IXSB 2WSCF 3AFHA 3TWMA 4YY3M 3BOSA 3GLHB 4RNAA 2XLJA 4LRSA 4MGZE 3J27B 2HWJA 2W82A 4GITA 4QHTA 4NRWA 2V6ZM 1DO2A 4AW4A 4FWDA 2R0IA 3AV0A 1PJTA 5IWAM 2LVPC 5BPVA 1T3TA 2LTUA 4KO8A 5ITUA 4QOZC 4TUWA 2D7HA 1PRBA 4LFAM 1OQYA 4OX9M 2DAIA 3KW6A 3I04M 4R71A 2HHHM 1J09A 2FOIC 3GRRA 3GP1A 3AOGA 2JY6B 3LVVA 2ZTCA 3GQ3A 3NBIA 3EIHA 4FCVA 3CF2A 1NJGA 4QNRA 4Y28F 3TWKA 3A98B 3GQ5A 4DV3M 4DR6M 2JNHA 1XXHA 1EFUB 1TH3A 2Y0TA 2Y20A 5KPTA 1PJSA 4DUZM 1MJGM 4JI1M 1QANA 2YQZA 3BXWA 5DYGA 3TWLA 3GLFB 2O5RA 1FJGM 4PD2A 3L2AA 2XSZA 1QUSA 1IXZA 1OIZA 1Z6TA 2HCBA 3CTWB 1TGUA 1HJPA 4LF4M 4JYAM 2MROB 1NSFA 2CP8A 1PGYA 1NY6A 4Q7JA 1SXJC 4WW0A 2VQFM 1PM5A 1N34M 4B3RM 3E46A 2KXEA 4KLNA 5ITXE 5FTMA 5EXSA 4DV5M 5LMUM 2OQ4A 1SXJB 2L2DA 3FTFA 2VIIA 3LQQA 3SAVA 5ITYA 5KO3A 1JR3A 3U6PA 2C5RA 2OO9A 2K9DA 3WHKA 2K0BX 4RF0A 1N77A 2M5ZA 3MHVC 4LGYA 3IECA 2GQFA 4IBIA 3W68A 3UMMA 3R8FA 2D7EA 3R9XB 4W5WA 1IN8A 3L29A 2L4EA 2CRUA 3FUTA 4IBBA 1OTRA 4ANRA 2CHGA 2LVAA 3M6AA 5H37D 4NRVA 2BWBA 3K2LA 3C3EA 4YHHM 2XZUA 5EP1A 4LZZA 3AL0C 3FD9A 2JP7A 2L4FA 4DR1M 1Q39A 4CISA 3EIEA 1NV9A 2EUCA 1IM2A 3SFZA 1YUBA 2RGHA 1XNQM 4REZA 4DV1M 4I4LA 4JXJA 1C7YA 1DGGA 2D7GA 3DZDA 1QUTA 3Q8XA 4RKUF 3T38A 3SATA 1A5TA 1C1KA 3HGIA 2DVWB 4M0WA 3L27A 3PNYA 3C58A 5EP3A 4CHTB 4P17A 5FTJA 1OAIA 2MH8A 3SAWA 3GLHE 2F5PA 2LXEA 3WHLA 1L2BA 2DI0A 3HJ8A 4FVMA 3KS4A 3KS8A 4B08A 1VEGA 4GRIA 2R62A 1G59A 4FD2A 3JR5A 3FTEA 3L26A 1E32A 3KOYE 1MX0A 2WSEF 1K3XA 5IZ7D 1DGHB 5KQ8A 3GLGE 2ZTDA 4Z6YA 4K0KM 3TE6A 3GLIE 1N33M 5JI3E 3J7AS 2H1RA 2KNZA 4M9SA 3T1HM 3LQRA 4GC9A 3GLGA 1GKIA 1JR3D 3HU3A 4F1IA 4G3OA 4FW9A 4QOSA 1ZMWA 3U6MA 4PCZA 2MJ5B 1N78A 1QDRA 4GH9A 4R7GA 4GHAA 3W0FA 1GL6A 4AKHA 1VEKA 5C1BA 4LF9M 2DAKA 4D81A 2Z7JA 2KZUA 4JN6A 2Z4RA 4QNMA 3D8BA 3U6EA 2KNVA 1IQPA 4MGYE 5FTNA 1JB0F 3J81S 4G4NA 2YR0A 1G8PA 4EIWA 2CHQA 4IBJA 4LJ7A 1NY5A 1XWIA 2K6BA 4L8RC 4II7A 4B3TM 2QQ8A 4L16A 1HNXM 1JQJC 5E26A 2C98A 4B7GA 3W0LB 3ZH9B 8CATA 4L6V6 1H6UA 3TPZA 2DWNA 1X37A 3KP0E 1L2DA 2NQ8C 1G71A 3KVWA 1HNZM 1G3IA 4BBAA 4JI2M 3KDSE 2RGOA 2MR9A 2XEPA 4GEWA 3VFDA 4JV5M 3CF6E 3SAUA 3M7GA 4NXMM 3RE8A 2XSZD 3GPPA 4R3DA 3UZUA 4LJ6A 2JY7A 4JI6M 1OIPA 4AI6A 4LF5M 1GLNA 1R5LA 5ITRA 4AKGA 3B74A 1XC8A 4GC5A 2J7NA 4L4UA 2OOBA 2LVOC 1L1TA 4XGIA 4MH0E 2HKJA 2N35A 4RF1A 1LV7A 2BWEA 1IBMM 1GJTA 4JI7M 1XHBA 4JI5M 4HEOA 1GO5A 4LJAA 2KDLA 1OFHA 1VEJA 2F4VM 2CV1A 4FCWA 4B3SM 3FTCA 3DOAA 1VG5A 1YE9A 1YLAA 2DHRA 2G5GX 3GRUA 2ERCA 2R44A 3AKZA 1N36M 1HR0M 4IJEA 1HQYE 4DV2M 2O25A 1IY2A 2XFSA 3FUWA 3SC3A 4OW0A 1EE8A 1TH2A 2Y0QA 3GLGB 1AUAA 3HHXA 1I94M 2DAGA 1WHCA 2H5XA 1G41A 2ZAOA 5FSWA 4CGYB 4NL4H 2DZLA 1QZEA 3HY5A 3GRVA 1S3SA 3SYLA 2FFJA 2FNAA 3HX3A 3RGSA 4DR2M 2VF7A 2R45A 1SG9A 4MGKE 3QYEA 4LCBA 3GPUA 1Z59A 4L15A 5KQDA 4HL4A 1TR8A 4BB9A 1R2ZA 1GABA 2G8LA 4DV4M 1XXHB 4FCTA 3QWLA 2DKLA 1IN5A 4MGHA 2R4EA 2DNAA 2XF3A 2UU9M 2BJVA 3K9OA 2APLA 3VDPA 1IN6A 1NNUC 3U6OA 2KRKA 3GLIB 4MB7A 1D2NA 5IT9S 2QP9X 4WP2A 3UJNA 2CV2A 2V1CA 1HNWM 1CUKA 2Z3XA 4KHPM 4IBDA 3I4VA 2UUBM 3VLFB 1K3WA 3CGWA 2VF8A 3GO8A 4I81A 3GLIA 2CUZA 4NSOB 4Z8XA 3A46A 2X4AA 4CJ6A 5EP4A 2KW0A 4A3VB 2J5YA 1NO1A 1OJLA 4G4QA 4M9ZA 3GLHA 1PJJA 1DO0A 2LBCA 1KYIA 1Z5AA 2DWZB 2L6OA 4DR5M 4IJFA 1QDTA 1L1ZA 3KOXE 3Q8GA 2LVQD 5EJCA 4DUYM 4DR4M 1DGFA 3SBJA 1D0KA 3KSJA 3PVSA 4AKIA 1HT1E 4MM3B 1OKSA 2RRUA 2EKKA 2C99A 1QZMA 2XGNA 3RFWA 2I7PA 2LH0A 3T1YM 2Z8YM 4XBOA 4X66M 3HKPA 3E21A 4LF7M 4B3MM 4IIWA 3L25A 3KSXA 3LCUA 2X8AA 2KA6B 2RKOA 3HHWA 3ILKA 3LMMA 4S12A 3SHGB 2F5QA 2F5SA 2ZANA 3HJQA 2QSFX 1XB2B 2JXNA 1VQ1A 2KNAA 1TDZA 1LTMA 2QBYB 2HL7A 5JI2E 3SMPA 3W67A 3A45A 4G6ZA 2X49A 5FLXS 4JI8M 4IBFA 1KSFX 4LF6M 1PJQA 3HHZA 1Z5BA 4LGMA 3AOEC 4NXNM 4ZPXA 1XMOM 1E94E 1DGBA 4I8OA 4OU7A 4NC6A 1WIVA 3ZC7B 4HLQA 3U60B 2KEBA 2C96A 2QPAA 3B7ZA 1HT2E 4NOOB 2CHVA 2LWXA 2LVNC 5KPZA 1TTEA 4DR3M 2VQEM 1IXSA 2R65A 3TL4X 2JWSA 3UGJA 1TDHA 2MGWA 3FYCA 3JR4A 3A42A 1V34A 1NV8A 3SHFA 5FTLA 3VK8A 3HWSA 2O01F 2OOAA 1IN7A 4DR7M 4LJ8A 5A2QS 2C9CA 3IHPA 1Q02A 1DV0A 2QNJA 4UN2B 2ZBKB 4KT0F 4QHSA 2QENA 2JY5A 2JZ0A 2QCUA 1N75A 1MN3A 1IN4A 1QVRA 2AHMA 3C3DA 4WURA 1NVMA 3LVWA 3I51A 1YSYA 2WZJA 3B7QA 4AG6A 1K82A 1R6BX 1W5SA 3FRIA 4CIZA 3E4RA 1JR3E 1T43A 2JA2A 1WXQA 5EQTA 1HQCA 3TQSA 3THGA 4D80A 1D0MA 1IY0A 2QZ4A 1ZAEA 3D8LA 4F2LA 3J7BA 4IBCA 4AZFA 2A5YB 1NNJA 3ZCBB 3F92A 3K1JA 3K92A 3KP1E 5L8RF 3U6SA 3KOZE 1QQWA 2FE8A 3DA1A 4GHLA 3BBZA 4GKKM 1WGNA 3U6CA 1R2YA 1OFIA 2C9OA 4B7FA 2L09A 2LNHC 3FUXA 1SXJD 1L2CA 1EIJA 3B89A 1W5TA 2XZFA 2F5NA 3U5ZB 5DYIA
chains in the Genus database with same CATH topology
3L28A 1J7KA 5ITTA 4X65M 1J5EM 1SXJA 4B7HA 3K8ZA 4M9XA 1XNRM 4JI0M 3U6QA 2XH9A 3PFIA 4NSRA 3M0EA 3SARA 4GKJM 2L7HA 3AJIB 2OPFA 4M0DA 4LJ9A 3U6LA 1MU5A 2I7NA 5E6JA 4L78A 5EP2A 3U61B 4GIPA 4G4RA 4DV7M 3GPXA 3JAMS 1IXRC 4OVZA 2CV0A 2CFOA 3B9PA 3NWLA 2UUAM 4G4OA 1IBKM 1Q3BA 3U61A 2DWLA 4LF8M 4JI4M 5ITQA 2UXCM 2UXBM 2Y21A 3AOEA 4PT5A 3PNVA 4IBGA 3MJ5A 3U6DA 4LG2A 1IY1A 4X62M 3VKHA 2Z4SA 1ZQ9A 3FUUA 3FUVA 1E9RA 3PXGA 4P16A 1QAOA 2F5OA 3J80S 3VDUA 2XFTA 2P5TA 4ITQA 2UUCM 3HHYA 2ZM6M 2E5LM 3IG5A 2CE7A 3SYKA 2DZNB 2R18A 3U60A 4LZJA 5EXTA 3U5ZA 4LY6A 1KFVA 2BJWA 3GPYA 7CATA 1GVNA 5LMNM 5FTKA 3HJSA 3VK7A 4BLCA 3E9SA 3H4MA 5EXPA 4MGIE 2V1UA 1ORYB 2BNKA 1NHWC 3GRYA 3FKEA 1L8QA 2Q2EB 4LFBM 1DGHA 2R4JA 4DV6M 1UM8A 4AQYM 2DZOB 1VDDA 2M60A 5GKNA 2UXDM 1FNNA 1TH4A 3SMSA 5IREB 2CEAA 4LJ5A 3KFUG 2EO2A 3DFZA 3MK6A 1GL7A 3KXEC 4OVZB 4AG5A 4LJ4A 5F3WA 3T15A 1NHGC 5ITXA 1Z5CA 5BR8M 1N32M 1IBLM 3QAUA 2EA0A 4LFCM 1QAMA 3HU1A 3FTDA 3KOWE 2KZSA 1E9SA 1PJIA 2R46A 4I5SA 2YFQA 4D82A 4IBEA 1G4AE 4PDGA 2K47A 4X64M 2ZAMA 4KODA 1Q3CA 2DXIA 5DNYA 2KRUA 2QBYA 1QYRA 4LRTA 2DWMA 5C18A 3IG8A 3J2PB 4GMQA 1I4WA 3OTOM 3HU2A 4FWHA 1SXJE 3I4YA 5EXXA 3CF0A 3RGPA 3GLFA 4DV0M 4JI3M 3FYDA 1R7RA 2J7OA 4PDIA 3UK6A 5KPRA 4FWGA 3SASA 1QAQA 1NJFA 3GQ4A 2L7IA 4IBKA 2YNMD 1XMQM 1IXSB 3AFHA 3TWMA 4YY3M 3BOSA 3GLHB 4RNAA 2XLJA 4LRSA 4MGZE 3J27B 4QHTA 2W82A 4GITA 4NRWA 2V6ZM 1DO2A 4AW4A 4FWDA 3AV0A 5IWAM 5BPVA 1T3TA 4QOZC 4KO8A 5ITUA 4TUWA 2D7HA 4LFAM 4OX9M 3KW6A 2HHHM 1J09A 2FOIC 3GRRA 3GP1A 3AOGA 3LVVA 3GQ3A 3NBIA 3EIHA 4FCVA 3CF2A 1NJGA 4QNRA 3TWKA 3A98B 3GQ5A 4DV3M 4DR6M 1XXHA 1TH3A 2Y0TA 2Y20A 5KPTA 4DUZM 4JI1M 1QANA 2YQZA 5DYGA 3TWLA 3GLFB 2O5RA 1FJGM 4PD2A 3L2AA 2XSZA 1IXZA 1Z6TA 2HCBA 3CTWB 1TGUA 4LF4M 4JYAM 1NSFA 1PM5A 2VQFM 1NY6A 4B3RM 1SXJC 4WW0A 1N34M 2KXEA 4KLNA 5ITXE 5FTMA 5EXSA 4DV5M 5LMUM 2OQ4A 1SXJB 3FTFA 2VIIA 3LQQA 3SAVA 5ITYA 5KO3A 1JR3A 3U6PA 2C5RA 3WHKA 4RF0A 1N77A 2M5ZA 3MHVC 4LGYA 4IBIA 3UMMA 3R8FA 3R9XB 2D7EA 4W5WA 1IN8A 3L29A 3FUTA 4IBBA 2CHGA 3M6AA 5H37D 4NRVA 3K2LA 4YHHM 2XZUA 5EP1A 4LZZA 3AL0C 3FD9A 4DR1M 1Q39A 4CISA 3EIEA 2EUCA 1IM2A 3SFZA 1YUBA 2RGHA 1XNQM 4REZA 4DV1M 4I4LA 4JXJA 1DGGA 2D7GA 3DZDA 3Q8XA 3T38A 3SATA 1C1KA 3HGIA 2DVWB 4M0WA 3L27A 3PNYA 3C58A 5EP3A 4CHTB 5FTJA 3SAWA 2F5PA 2LXEA 3WHLA 1L2BA 3HJ8A 4FVMA 3KS4A 3KS8A 4B08A 4GRIA 2R62A 1G59A 4FD2A 3JR5A 3FTEA 3L26A 1E32A 3KOYE 1MX0A 1K3XA 5IZ7D 1DGHB 5KQ8A 4Z6YA 4K0KM 3TE6A 1N33M 5JI3E 3J7AS 2H1RA 4M9SA 3T1HM 3LQRA 4GC9A 3GLGA 1GKIA 1JR3D 3HU3A 3U6MA 4QOSA 4FW9A 4PCZA 1N78A 4GH9A 4R7GA 4GHAA 3W0FA 1GL6A 4AKHA 5C1BA 4LF9M 4D81A 2Z7JA 2KZUA 4JN6A 2Z4RA 4QNMA 3D8BA 3U6EA 1IQPA 4MGYE 5FTNA 3J81S 4G4NA 2YR0A 1G8PA 4EIWA 2CHQA 4IBJA 4LJ7A 1NY5A 1XWIA 4L8RC 4II7A 4B3TM 4L16A 1HNXM 1JQJC 5E26A 2C98A 4B7GA 3W0LB 3ZH9B 8CATA 2DWNA 1H6UA 3TPZA 1X37A 3KP0E 1L2DA 2NQ8C 3KVWA 1HNZM 1G3IA 4BBAA 4JI2M 3KDSE 2RGOA 2XEPA 4JV5M 3VFDA 3CF6E 3SAUA 3M7GA 4NXMM 3RE8A 2XSZD 3GPPA 4R3DA 3UZUA 4LJ6A 4JI6M 4AI6A 4LF5M 1GLNA 5ITRA 4AKGA 1XC8A 4GC5A 2J7NA 4L4UA 1L1TA 4XGIA 4MH0E 2HKJA 4RF1A 1LV7A 1IBMM 4JI7M 1XHBA 4JI5M 4LJAA 1OFHA 2F4VM 2CV1A 4FCWA 4B3SM 3FTCA 3DOAA 1YE9A 3GRUA 2DHRA 2G5GX 3AKZA 2ERCA 1N36M 1HR0M 4IJEA 1HQYE 4DV2M 2XFSA 1IY2A 3FUWA 3SC3A 4OW0A 1EE8A 1TH2A 2Y0QA 3GLGB 3HHXA 1I94M 1G41A 2ZAOA 5FSWA 4CGYB 4NL4H 3GRVA 1S3SA 3SYLA 2FFJA 2FNAA 3RGSA 4DR2M 2R45A 4MGKE 3GPUA 4LCBA 1Z59A 4L15A 5KQDA 4HL4A 1R2ZA 4BB9A 2G8LA 4DV4M 1XXHB 4FCTA 3QWLA 1IN5A 4MGHA 2R4EA 2XF3A 2UU9M 2BJVA 3VDPA 1IN6A 1NNUC 3U6OA 2KRKA 3GLIB 4MB7A 1D2NA 5IT9S 2QP9X 3UJNA 2CV2A 2V1CA 1HNWM 2Z3XA 4KHPM 4IBDA 3I4VA 2UUBM 3VLFB 1K3WA 3GO8A 4I81A 3GLIA 2CUZA 4NSOB 4Z8XA 3A46A 2X4AA 5EP4A 2KW0A 4A3VB 1OJLA 4G4QA 1PJJA 4M9ZA 3GLHA 1DO0A 1KYIA 1Z5AA 2DWZB 2L6OA 4DR5M 4IJFA 1L1ZA 3KOXE 5EJCA 4DUYM 4DR4M 1DGFA 3SBJA 3PVSA 3KSJA 4AKIA 1HT1E 4MM3B 2C99A 1QZMA 2XGNA 3RFWA 2I7PA 2LH0A 3T1YM 4XBOA 4X66M 3HKPA 4LF7M 4B3MM 4IIWA 3L25A 3KSXA 4S12A 2X8AA 2KA6B 2RKOA 3ILKA 3LMMA 3HHWA 3SHGB 2F5QA 3VKGA 2F5SA 2ZANA 3HJQA 1TDZA 2QBYB 2HL7A 5JI2E 3SMPA 4JI8M 3A45A 4G6ZA 2X49A 5FLXS 4LF6M 4IBFA 1KSFX 3HHZA 1Z5BA 4LGMA 3AOEC 4NXNM 4ZPXA 1XMOM 1E94E 1DGBA 4I8OA 4OU7A 3ZC7B 4HLQA 3U60B 2KEBA 2C96A 2QPAA 1HT2E 4NOOB 2CHVA 2LWXA 5KPZA 4DR3M 2VQEM 2R65A 3TL4X 3UGJA 1TDHA 3FYCA 3JR4A 3A42A 3SHFA 5FTLA 3VK8A 3HWSA 1IN7A 4DR7M 4LJ8A 5A2QS 2C9CA 2ZBKB 4QHSA 2QENA 2QCUA 1N75A 1QVRA 1IN4A 2AHMA 4WURA 1NVMA 3LVWA 3I51A 1YSYA 1K82A 4AG6A 1R6BX 1W5SA 3E4RA 2JA2A 1WXQA 5EQTA 1HQCA 3TQSA 3THGA 4D80A 2QZ4A 1IY0A 1ZAEA 3D8LA 3J7BA 4IBCA 4AZFA 2A5YB 1NNJA 3ZCBB 3K1JA 3K92A 3KP1E 3U6SA 3KOZE 1QQWA 2FE8A 3DA1A 4GHLA 4GKKM 3U6CA 1R2YA 1OFIA 2C9OA 4B7FA 2L09A 2LNHC 3FUXA 1SXJD 1L2CA 1W5TA 2XZFA 2F5NA 3U5ZB 5DYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6O A;  3SAW A;  4DV0 M;  5ITT A;  2F5P A;  4MB7 A;  4JI3 M;  4X65 M;  1J5E M;  1L2B A;  5IT9 S;  4PDI A;  1HNW M;  1XNR M;  4KHP M;  4JI0 M;  3U6Q A;  3SAS A;  2UUB M;  1K3W A;  3GQ4 A;  3JR5 A;  3GO8 A;  3A46 A;  1MX0 A;  1K3X A;  1XMQ M;  3SAR A;  3TWM A;  4YY3 M;  4K0K M;  4GKJ M;  1N33 M;  3J7A S;  2OPF A;  4G4Q A;  3T1H M;  1PJJ A;  4NRW A;  1Z5A A;  3U6L A;  1MU5 A;  4DR5 M;  3U6M A;  4PCZ A;  4G4R A;  1L1Z A;  4DV7 M;  3GPX A;  3JAM S;  4DUY M;  4DR4 M;  3W0F A;  5IWA M;  3SBJ A;  2UUA M;  4G4O A;  5ITU A;  1IBK M;  1Q3B A;  4LF9 M;  4LFA M;  4LF8 M;  4OX9 M;  3T1Y M;  3U6E A;  4JI4 M;  5ITQ A;  4X66 M;  2UXB M;  2UXC M;  2HHH M;  3GP1 A;  4LF7 M;  4B3M M;  3J81 S;  4G4N A;  3U6D A;  4X62 M;  2F5Q A;  2F5S A;  3GQ3 A;  4B3T M;  3TWK A;  1HNX M;  1TDZ A;  2F5O A;  3J80 S;  3GQ5 A;  4DV3 M;  4JI8 M;  3A45 A;  4LF6 M;  4DR6 M;  5FLX S;  4ITQ A;  1L2D A;  2UUC M;  2ZM6 M;  1Z5B A;  1HNZ M;  2E5L M;  4JI2 M;  4DUZ M;  4NXN M;  1XMO M;  4JI1 M;  4JV5 M;  3SAU A;  1KFV A;  4NXM M;  3GPY A;  3GPP A;  3TWL A;  4JI6 M;  1FJG M;  5LMN M;  4PD2 A;  4LF5 M;  3VK7 A;  5ITR A;  4DR3 M;  4LF4 M;  1XC8 A;  2VQE M;  4JYA M;  1PM5 A;  2VQF M;  4B3R M;  1TDH A;  1N34 M;  1L1T A;  3JR4 A;  5ITX E;  3A42 A;  2Q2E B;  2HKJ A;  4LFB M;  3VK8 A;  4DV5 M;  5LMU M;  2OQ4 A;  4DV6 M;  4AQY M;  1IBM M;  4JI7 M;  4JI5 M;  3SAV A;  2UXD M;  5ITY A;  4DR7 M;  5A2Q S;  3U6P A;  2F4V M;  4B3S M;  2ZBK B;  3DOA A;  1N36 M;  1HR0 M;  4DV2 M;  5ITX A;  1EE8 A;  1K82 A;  5BR8 M;  1Z5C A;  1N32 M;  1I94 M;  1IBL M;  2EA0 A;  4LFC M;  4NRV A;  4YHH M;  2XZU A;  4DR2 M;  1PJI A;  3GPU A;  4DR1 M;  1Z59 A;  1Q39 A;  4PDG A;  4CIS A;  1R2Z A;  1NNJ A;  4X64 M;  4DV4 M;  1Q3C A;  3U6S A;  1XNQ M;  4DV1 M;  4GKK M;  3U6C A;  1R2Y A;  3SAT A;  3OTO M;  3C58 A;  1L2C A;  2UU9 M;  2F5N A;  2XZF A; 
#chains in the Genus database with same CATH topology
 3L28 A;  1J7K A;  5ITT A;  4XK8 F;  4X65 M;  1J5E M;  1SXJ A;  4B7H A;  3K8Z A;  4M9X A;  1XNR M;  4JI0 M;  3U6Q A;  2XH9 A;  3PFI A;  2B3T A;  3LCV B;  4NSR A;  3M0E A;  3SAR A;  3QYB A;  1WJ7 A;  4GKJ M;  2L7H A;  3AJI B;  2OPF A;  4M0D A;  4LJ9 A;  3U6L A;  1MU5 A;  2JZ1 A;  3VKG A;  2I7N A;  5E6J A;  4L78 A;  5EP2 A;  3U61 B;  4GIP A;  4G4R A;  4DV7 M;  3GPX A;  3JAM S;  1IXR C;  4OVZ A;  2CV0 A;  2CFO A;  2FH0 A;  3B9P A;  1UFZ A;  3NWL A;  2UUA M;  4G4O A;  1IBK M;  1Q3B A;  3U61 A;  2DWL A;  2LHC A;  2G3Q A;  4LF8 M;  3C9P A;  2JY8 A;  4JI4 M;  5ITQ A;  2WSF F;  2UXB M;  2UXC M;  2Y21 A;  3AOE A;  1OAO C;  1V33 A;  2QHO B;  4PT5 A;  3PNV A;  4IBG A;  1ZV1 A;  2CWB A;  3MJ5 A;  1IY1 A;  4X62 M;  3U6D A;  4LG2 A;  2Z4S A;  1ZQ9 A;  3VKH A;  3FUU A;  3FUV A;  1E9R A;  3PXG A;  4P16 A;  1QAO A;  2F5O A;  3J80 S;  3VDU A;  2XFT A;  3FE3 A;  2P5T A;  3T6P A;  4ITQ A;  1F4I A;  3H4J A;  2UUC M;  3MMP A;  3HHY A;  3HZJ A;  2ZM6 M;  2E5L M;  3IG5 A;  2CE7 A;  3SYK A;  2DZN B;  2R18 A;  3U60 A;  4LZJ A;  5EXT A;  1XXH E;  4LY6 A;  3U5Z A;  1KFV A;  2BJW A;  3B7N A;  7CAT A;  3GPY A;  1Y8G A;  1GVN A;  5LMN M;  5FTK A;  3HJS A;  3VK7 A;  4BLC A;  3E9S A;  1VDL A;  3H4M A;  2LHG A;  2DAM A;  5EXP A;  2GNO A;  4MGI E;  1P3Q Q;  1ORY B;  2BNK A;  1NHW C;  2V1U A;  3GRY A;  3FKE A;  1L8Q A;  2Q2E B;  4LFB M;  1IFY A;  1DGH A;  2R4J A;  4DV6 M;  1UM8 A;  4AQY M;  2DZO B;  1D0L A;  1VDD A;  1TF0 B;  2M60 A;  5GKN A;  2UXD M;  1FNN A;  1RU3 A;  1TH4 A;  2JUJ A;  1WGL A;  2KHH A;  3SMS A;  5IRE B;  2CEA A;  2DEN A;  4LJ5 A;  2EO2 A;  3DFZ A;  3MK6 A;  3KFU G;  1GL7 A;  3KXE C;  4OVZ B;  4AG5 A;  4LJ4 A;  5F3W A;  3T15 A;  2EKF A;  2R6F A;  1NHG C;  3I01 M;  5ITX A;  1Z5C A;  5BR8 M;  1N32 M;  1IBL M;  1BVS A;  3QAU A;  2EA0 A;  4LFC M;  1QAM A;  3HU1 A;  3FTD A;  3KOW E;  2KZS A;  3LW5 F;  1E9S A;  1WR1 B;  1PJI A;  2R46 A;  4I5S A;  1R4G A;  2YFQ A;  2DHY A;  4D82 A;  4IBE A;  1G4A E;  4PDG A;  2K47 A;  3GLF E;  4X64 M;  2ZAM A;  4KOD A;  1Q3C A;  2DXI A;  5DNY A;  2KRU A;  2QBY A;  2VDB B;  1QYR A;  4LRT A;  1ZMV A;  3FRH A;  2DWM A;  5C18 A;  3IG8 A;  3J2P B;  4GMQ A;  1AIP C;  1I4W A;  3K9P A;  3V76 A;  3OTO M;  4DBG B;  3HU2 A;  3ZQJ A;  1V92 A;  1SXJ E;  2HAK A;  4FWH A;  1ZMU A;  5DFL A;  3I4Y A;  5EXX A;  3CF0 A;  3RGP A;  3GLF A;  4DV0 M;  1GJS A;  4JI3 M;  3FYD A;  1R7R A;  2J7O A;  4PDI A;  3UK6 A;  5KPR A;  4FWG A;  3SAS A;  1QAQ A;  3NBX X;  1NJF A;  3GQ4 A;  2L7I A;  2EJS A;  1T6O A;  4IBK A;  2FS1 A;  2DAE A;  2YNM D;  1XMQ M;  1IXS B;  2WSC F;  3AFH A;  3TWM A;  4YY3 M;  3BOS A;  3GLH B;  4RNA A;  2XLJ A;  4LRS A;  4MGZ E;  3J27 B;  2HWJ A;  2W82 A;  4GIT A;  4QHT A;  4NRW A;  2V6Z M;  1DO2 A;  4AW4 A;  4FWD A;  2R0I A;  3AV0 A;  1PJT A;  5IWA M;  2LVP C;  5BPV A;  1T3T A;  2LTU A;  4KO8 A;  5ITU A;  4QOZ C;  4TUW A;  2D7H A;  1PRB A;  4LFA M;  1OQY A;  4OX9 M;  2DAI A;  3KW6 A;  3I04 M;  4R71 A;  2HHH M;  1J09 A;  2FOI C;  3GRR A;  3GP1 A;  3AOG A;  2JY6 B;  3LVV A;  2ZTC A;  3GQ3 A;  3NBI A;  3EIH A;  4FCV A;  3CF2 A;  1NJG A;  4QNR A;  4Y28 F;  3TWK A;  3A98 B;  3GQ5 A;  4DV3 M;  4DR6 M;  2JNH A;  1XXH A;  1EFU B;  1TH3 A;  2Y0T A;  2Y20 A;  5KPT A;  1PJS A;  4DUZ M;  1MJG M;  4JI1 M;  1QAN A;  2YQZ A;  3BXW A;  5DYG A;  3TWL A;  3GLF B;  2O5R A;  1FJG M;  4PD2 A;  3L2A A;  2XSZ A;  1QUS A;  1IXZ A;  1OIZ A;  1Z6T A;  2HCB A;  3CTW B;  1TGU A;  1HJP A;  4LF4 M;  4JYA M;  2MRO B;  1NSF A;  2CP8 A;  1PGY A;  1NY6 A;  4Q7J A;  1SXJ C;  4WW0 A;  2VQF M;  1PM5 A;  1N34 M;  4B3R M;  3E46 A;  2KXE A;  4KLN A;  5ITX E;  5FTM A;  5EXS A;  4DV5 M;  5LMU M;  2OQ4 A;  1SXJ B;  2L2D A;  3FTF A;  2VII A;  3LQQ A;  3SAV A;  5ITY A;  5KO3 A;  1JR3 A;  3U6P A;  2C5R A;  2OO9 A;  2K9D A;  3WHK A;  2K0B X;  4RF0 A;  1N77 A;  2M5Z A;  3MHV C;  4LGY A;  3IEC A;  2GQF A;  4IBI A;  3W68 A;  3UMM A;  3R8F A;  2D7E A;  3R9X B;  4W5W A;  1IN8 A;  3L29 A;  2L4E A;  2CRU A;  3FUT A;  4IBB A;  1OTR A;  4ANR A;  2CHG A;  2LVA A;  3M6A A;  5H37 D;  4NRV A;  2BWB A;  3K2L A;  3C3E A;  4YHH M;  2XZU A;  5EP1 A;  4LZZ A;  3AL0 C;  3FD9 A;  2JP7 A;  2L4F A;  4DR1 M;  1Q39 A;  4CIS A;  3EIE A;  1NV9 A;  2EUC A;  1IM2 A;  3SFZ A;  1YUB A;  2RGH A;  1XNQ M;  4REZ A;  4DV1 M;  4I4L A;  4JXJ A;  1C7Y A;  1DGG A;  2D7G A;  3DZD A;  1QUT A;  3Q8X A;  4RKU F;  3T38 A;  3SAT A;  1A5T A;  1C1K A;  3HGI A;  2DVW B;  4M0W A;  3L27 A;  3PNY A;  3C58 A;  5EP3 A;  4CHT B;  4P17 A;  5FTJ A;  1OAI A;  2MH8 A;  3SAW A;  3GLH E;  2F5P A;  2LXE A;  3WHL A;  1L2B A;  2DI0 A;  3HJ8 A;  4FVM A;  3KS4 A;  3KS8 A;  4B08 A;  1VEG A;  4GRI A;  2R62 A;  1G59 A;  4FD2 A;  3JR5 A;  3FTE A;  3L26 A;  1E32 A;  3KOY E;  1MX0 A;  2WSE F;  1K3X A;  5IZ7 D;  1DGH B;  5KQ8 A;  3GLG E;  2ZTD A;  4Z6Y A;  4K0K M;  3TE6 A;  3GLI E;  1N33 M;  5JI3 E;  3J7A S;  2H1R A;  2KNZ A;  4M9S A;  3T1H M;  3LQR A;  4GC9 A;  3GLG A;  1GKI A;  1JR3 D;  3HU3 A;  4F1I A;  4G3O A;  4FW9 A;  4QOS A;  1ZMW A;  3U6M A;  4PCZ A;  2MJ5 B;  1N78 A;  1QDR A;  4GH9 A;  4R7G A;  4GHA A;  3W0F A;  1GL6 A;  4AKH A;  1VEK A;  5C1B A;  4LF9 M;  2DAK A;  4D81 A;  2Z7J A;  2KZU A;  4JN6 A;  2Z4R A;  4QNM A;  3D8B A;  3U6E A;  2KNV A;  1IQP A;  4MGY E;  5FTN A;  1JB0 F;  3J81 S;  4G4N A;  2YR0 A;  1G8P A;  4EIW A;  2CHQ A;  4IBJ A;  4LJ7 A;  1NY5 A;  1XWI A;  2K6B A;  4L8R C;  4II7 A;  4B3T M;  2QQ8 A;  4L16 A;  1HNX M;  1JQJ C;  5E26 A;  2C98 A;  4B7G A;  3W0L B;  3ZH9 B;  8CAT A;  4L6V 6;  1H6U A;  3TPZ A;  2DWN A;  1X37 A;  3KP0 E;  1L2D A;  2NQ8 C;  1G71 A;  3KVW A;  1HNZ M;  1G3I A;  4BBA A;  4JI2 M;  3KDS E;  2RGO A;  2MR9 A;  2XEP A;  4GEW A;  3VFD A;  4JV5 M;  3CF6 E;  3SAU A;  3M7G A;  4NXM M;  3RE8 A;  2XSZ D;  3GPP A;  4R3D A;  3UZU A;  4LJ6 A;  2JY7 A;  4JI6 M;  1OIP A;  4AI6 A;  4LF5 M;  1GLN A;  1R5L A;  5ITR A;  4AKG A;  3B74 A;  1XC8 A;  4GC5 A;  2J7N A;  4L4U A;  2OOB A;  2LVO C;  1L1T A;  4XGI A;  4MH0 E;  2HKJ A;  2N35 A;  4RF1 A;  1LV7 A;  2BWE A;  1IBM M;  1GJT A;  4JI7 M;  1XHB A;  4JI5 M;  4HEO A;  1GO5 A;  4LJA A;  2KDL A;  1OFH A;  1VEJ A;  2F4V M;  2CV1 A;  4FCW A;  4B3S M;  3FTC A;  3DOA A;  1VG5 A;  1YE9 A;  1YLA A;  2DHR A;  2G5G X;  3GRU A;  2ERC A;  2R44 A;  3AKZ A;  1N36 M;  1HR0 M;  4IJE A;  1HQY E;  4DV2 M;  2O25 A;  1IY2 A;  2XFS A;  3FUW A;  3SC3 A;  4OW0 A;  1EE8 A;  1TH2 A;  2Y0Q A;  3GLG B;  1AUA A;  3HHX A;  1I94 M;  2DAG A;  1WHC A;  2H5X A;  1G41 A;  2ZAO A;  5FSW A;  4CGY B;  4NL4 H;  2DZL A;  1QZE A;  3HY5 A;  3GRV A;  1S3S A;  3SYL A;  2FFJ A;  2FNA A;  3HX3 A;  3RGS A;  4DR2 M;  2VF7 A;  2R45 A;  1SG9 A;  4MGK E;  3QYE A;  4LCB A;  3GPU A;  1Z59 A;  4L15 A;  5KQD A;  4HL4 A;  1TR8 A;  4BB9 A;  1R2Z A;  1GAB A;  2G8L A;  4DV4 M;  1XXH B;  4FCT A;  3QWL A;  2DKL A;  1IN5 A;  4MGH A;  2R4E A;  2DNA A;  2XF3 A;  2UU9 M;  2BJV A;  3K9O A;  2APL A;  3VDP A;  1IN6 A;  1NNU C;  3U6O A;  2KRK A;  3GLI B;  4MB7 A;  1D2N A;  5IT9 S;  2QP9 X;  4WP2 A;  3UJN A;  2CV2 A;  2V1C A;  1HNW M;  1CUK A;  2Z3X A;  4KHP M;  4IBD A;  3I4V A;  2UUB M;  3VLF B;  1K3W A;  3CGW A;  2VF8 A;  3GO8 A;  4I81 A;  3GLI A;  2CUZ A;  4NSO B;  4Z8X A;  3A46 A;  2X4A A;  4CJ6 A;  5EP4 A;  2KW0 A;  4A3V B;  2J5Y A;  1NO1 A;  1OJL A;  4G4Q A;  4M9Z A;  3GLH A;  1PJJ A;  1DO0 A;  2LBC A;  1KYI A;  1Z5A A;  2DWZ B;  2L6O A;  4DR5 M;  4IJF A;  1QDT A;  1L1Z A;  3KOX E;  3Q8G A;  2LVQ D;  5EJC A;  4DUY M;  4DR4 M;  1DGF A;  3SBJ A;  1D0K A;  3KSJ A;  3PVS A;  4AKI A;  1HT1 E;  4MM3 B;  1OKS A;  2RRU A;  2EKK A;  2C99 A;  1QZM A;  2XGN A;  3RFW A;  2I7P A;  2LH0 A;  3T1Y M;  2Z8Y M;  4XBO A;  4X66 M;  3HKP A;  3E21 A;  4LF7 M;  4B3M M;  4IIW A;  3L25 A;  3KSX A;  3LCU A;  2X8A A;  2KA6 B;  2RKO A;  3HHW A;  3ILK A;  3LMM A;  4S12 A;  3SHG B;  2F5Q A;  2F5S A;  2ZAN A;  3HJQ A;  2QSF X;  1XB2 B;  2JXN A;  1VQ1 A;  2KNA A;  1TDZ A;  1LTM A;  2QBY B;  2HL7 A;  5JI2 E;  3SMP A;  3W67 A;  3A45 A;  4G6Z A;  2X49 A;  5FLX S;  4JI8 M;  4IBF A;  1KSF X;  4LF6 M;  1PJQ A;  3HHZ A;  1Z5B A;  4LGM A;  3AOE C;  4NXN M;  4ZPX A;  1XMO M;  1E94 E;  1DGB A;  4I8O A;  4OU7 A;  4NC6 A;  1WIV A;  3ZC7 B;  4HLQ A;  3U60 B;  2KEB A;  2C96 A;  2QPA A;  3B7Z A;  1HT2 E;  4NOO B;  2CHV A;  2LWX A;  2LVN C;  5KPZ A;  1TTE A;  4DR3 M;  2VQE M;  1IXS A;  2R65 A;  3TL4 X;  2JWS A;  3UGJ A;  1TDH A;  2MGW A;  3FYC A;  3JR4 A;  3A42 A;  1V34 A;  1NV8 A;  3SHF A;  5FTL A;  3VK8 A;  3HWS A;  2O01 F;  2OOA A;  1IN7 A;  4DR7 M;  4LJ8 A;  5A2Q S;  2C9C A;  3IHP A;  1Q02 A;  1DV0 A;  2QNJ A;  4UN2 B;  2ZBK B;  4KT0 F;  4QHS A;  2QEN A;  2JY5 A;  2JZ0 A;  2QCU A;  1N75 A;  1MN3 A;  1IN4 A;  1QVR A;  2AHM A;  3C3D A;  4WUR A;  1NVM A;  3LVW A;  3I51 A;  1YSY A;  2WZJ A;  3B7Q A;  4AG6 A;  1K82 A;  1R6B X;  1W5S A;  3FRI A;  4CIZ A;  3E4R A;  1JR3 E;  1T43 A;  2JA2 A;  1WXQ A;  5EQT A;  1HQC A;  3TQS A;  3THG A;  4D80 A;  1D0M A;  1IY0 A;  2QZ4 A;  1ZAE A;  3D8L A;  4F2L A;  3J7B A;  4IBC A;  4AZF A;  2A5Y B;  1NNJ A;  3ZCB B;  3F92 A;  3K1J A;  3K92 A;  3KP1 E;  5L8R F;  3U6S A;  3KOZ E;  1QQW A;  2FE8 A;  3DA1 A;  4GHL A;  3BBZ A;  4GKK M;  1WGN A;  3U6C A;  1R2Y A;  1OFI A;  2C9O A;  4B7F A;  2L09 A;  2LNH C;  3FUX A;  1SXJ D;  1L2C A;  1EIJ A;  3B89 A;  1W5T A;  2XZF A;  2F5N A;  3U5Z B;  5DYI A; 
#chains in the Genus database with same CATH homology
 3L28 A;  1J7K A;  5ITT A;  4X65 M;  1J5E M;  1SXJ A;  4B7H A;  3K8Z A;  4M9X A;  1XNR M;  4JI0 M;  3U6Q A;  2XH9 A;  3PFI A;  4NSR A;  3M0E A;  3SAR A;  4GKJ M;  2L7H A;  3AJI B;  2OPF A;  4M0D A;  4LJ9 A;  3U6L A;  1MU5 A;  2I7N A;  5E6J A;  4L78 A;  5EP2 A;  3U61 B;  4GIP A;  4G4R A;  4DV7 M;  3GPX A;  3JAM S;  1IXR C;  4OVZ A;  2CV0 A;  2CFO A;  3B9P A;  3NWL A;  2UUA M;  4G4O A;  1IBK M;  1Q3B A;  3U61 A;  2DWL A;  4LF8 M;  4JI4 M;  5ITQ A;  2UXC M;  2UXB M;  2Y21 A;  3AOE A;  4PT5 A;  3PNV A;  4IBG A;  3MJ5 A;  3U6D A;  4LG2 A;  1IY1 A;  4X62 M;  3VKH A;  2Z4S A;  1ZQ9 A;  3FUU A;  3FUV A;  1E9R A;  3PXG A;  4P16 A;  1QAO A;  2F5O A;  3J80 S;  3VDU A;  2XFT A;  2P5T A;  4ITQ A;  2UUC M;  3HHY A;  2ZM6 M;  2E5L M;  3IG5 A;  2CE7 A;  3SYK A;  2DZN B;  2R18 A;  3U60 A;  4LZJ A;  5EXT A;  3U5Z A;  4LY6 A;  1KFV A;  2BJW A;  3GPY A;  7CAT A;  1GVN A;  5LMN M;  5FTK A;  3HJS A;  3VK7 A;  4BLC A;  3E9S A;  3H4M A;  5EXP A;  4MGI E;  2V1U A;  1ORY B;  2BNK A;  1NHW C;  3GRY A;  3FKE A;  1L8Q A;  2Q2E B;  4LFB M;  1DGH A;  2R4J A;  4DV6 M;  1UM8 A;  4AQY M;  2DZO B;  1VDD A;  2M60 A;  5GKN A;  2UXD M;  1FNN A;  1TH4 A;  3SMS A;  5IRE B;  2CEA A;  4LJ5 A;  3KFU G;  2EO2 A;  3DFZ A;  3MK6 A;  1GL7 A;  3KXE C;  4OVZ B;  4AG5 A;  4LJ4 A;  5F3W A;  3T15 A;  1NHG C;  5ITX A;  1Z5C A;  5BR8 M;  1N32 M;  1IBL M;  3QAU A;  2EA0 A;  4LFC M;  1QAM A;  3HU1 A;  3FTD A;  3KOW E;  2KZS A;  1E9S A;  1PJI A;  2R46 A;  4I5S A;  2YFQ A;  4D82 A;  4IBE A;  1G4A E;  4PDG A;  2K47 A;  4X64 M;  2ZAM A;  4KOD A;  1Q3C A;  2DXI A;  5DNY A;  2KRU A;  2QBY A;  1QYR A;  4LRT A;  2DWM A;  5C18 A;  3IG8 A;  3J2P B;  4GMQ A;  1I4W A;  3OTO M;  3HU2 A;  4FWH A;  1SXJ E;  3I4Y A;  5EXX A;  3CF0 A;  3RGP A;  3GLF A;  4DV0 M;  4JI3 M;  3FYD A;  1R7R A;  2J7O A;  4PDI A;  3UK6 A;  5KPR A;  4FWG A;  3SAS A;  1QAQ A;  1NJF A;  3GQ4 A;  2L7I A;  4IBK A;  2YNM D;  1XMQ M;  1IXS B;  3AFH A;  3TWM A;  4YY3 M;  3BOS A;  3GLH B;  4RNA A;  2XLJ A;  4LRS A;  4MGZ E;  3J27 B;  4QHT A;  2W82 A;  4GIT A;  4NRW A;  2V6Z M;  1DO2 A;  4AW4 A;  4FWD A;  3AV0 A;  5IWA M;  5BPV A;  1T3T A;  4QOZ C;  4KO8 A;  5ITU A;  4TUW A;  2D7H A;  4LFA M;  4OX9 M;  3KW6 A;  2HHH M;  1J09 A;  2FOI C;  3GRR A;  3GP1 A;  3AOG A;  3LVV A;  3GQ3 A;  3NBI A;  3EIH A;  4FCV A;  3CF2 A;  1NJG A;  4QNR A;  3TWK A;  3A98 B;  3GQ5 A;  4DV3 M;  4DR6 M;  1XXH A;  1TH3 A;  2Y0T A;  2Y20 A;  5KPT A;  4DUZ M;  4JI1 M;  1QAN A;  2YQZ A;  5DYG A;  3TWL A;  3GLF B;  2O5R A;  1FJG M;  4PD2 A;  3L2A A;  2XSZ A;  1IXZ A;  1Z6T A;  2HCB A;  3CTW B;  1TGU A;  4LF4 M;  4JYA M;  1NSF A;  1PM5 A;  2VQF M;  1NY6 A;  4B3R M;  1SXJ C;  4WW0 A;  1N34 M;  2KXE A;  4KLN A;  5ITX E;  5FTM A;  5EXS A;  4DV5 M;  5LMU M;  2OQ4 A;  1SXJ B;  3FTF A;  2VII A;  3LQQ A;  3SAV A;  5ITY A;  5KO3 A;  1JR3 A;  3U6P A;  2C5R A;  3WHK A;  4RF0 A;  1N77 A;  2M5Z A;  3MHV C;  4LGY A;  4IBI A;  3UMM A;  3R8F A;  3R9X B;  2D7E A;  4W5W A;  1IN8 A;  3L29 A;  3FUT A;  4IBB A;  2CHG A;  3M6A A;  5H37 D;  4NRV A;  3K2L A;  4YHH M;  2XZU A;  5EP1 A;  4LZZ A;  3AL0 C;  3FD9 A;  4DR1 M;  1Q39 A;  4CIS A;  3EIE A;  2EUC A;  1IM2 A;  3SFZ A;  1YUB A;  2RGH A;  1XNQ M;  4REZ A;  4DV1 M;  4I4L A;  4JXJ A;  1DGG A;  2D7G A;  3DZD A;  3Q8X A;  3T38 A;  3SAT A;  1C1K A;  3HGI A;  2DVW B;  4M0W A;  3L27 A;  3PNY A;  3C58 A;  5EP3 A;  4CHT B;  5FTJ A;  3SAW A;  2F5P A;  2LXE A;  3WHL A;  1L2B A;  3HJ8 A;  4FVM A;  3KS4 A;  3KS8 A;  4B08 A;  4GRI A;  2R62 A;  1G59 A;  4FD2 A;  3JR5 A;  3FTE A;  3L26 A;  1E32 A;  3KOY E;  1MX0 A;  1K3X A;  5IZ7 D;  1DGH B;  5KQ8 A;  4Z6Y A;  4K0K M;  3TE6 A;  1N33 M;  5JI3 E;  3J7A S;  2H1R A;  4M9S A;  3T1H M;  3LQR A;  4GC9 A;  3GLG A;  1GKI A;  1JR3 D;  3HU3 A;  3U6M A;  4QOS A;  4FW9 A;  4PCZ A;  1N78 A;  4GH9 A;  4R7G A;  4GHA A;  3W0F A;  1GL6 A;  4AKH A;  5C1B A;  4LF9 M;  4D81 A;  2Z7J A;  2KZU A;  4JN6 A;  2Z4R A;  4QNM A;  3D8B A;  3U6E A;  1IQP A;  4MGY E;  5FTN A;  3J81 S;  4G4N A;  2YR0 A;  1G8P A;  4EIW A;  2CHQ A;  4IBJ A;  4LJ7 A;  1NY5 A;  1XWI A;  4L8R C;  4II7 A;  4B3T M;  4L16 A;  1HNX M;  1JQJ C;  5E26 A;  2C98 A;  4B7G A;  3W0L B;  3ZH9 B;  8CAT A;  2DWN A;  1H6U A;  3TPZ A;  1X37 A;  3KP0 E;  1L2D A;  2NQ8 C;  3KVW A;  1HNZ M;  1G3I A;  4BBA A;  4JI2 M;  3KDS E;  2RGO A;  2XEP A;  4JV5 M;  3VFD A;  3CF6 E;  3SAU A;  3M7G A;  4NXM M;  3RE8 A;  2XSZ D;  3GPP A;  4R3D A;  3UZU A;  4LJ6 A;  4JI6 M;  4AI6 A;  4LF5 M;  1GLN A;  5ITR A;  4AKG A;  1XC8 A;  4GC5 A;  2J7N A;  4L4U A;  1L1T A;  4XGI A;  4MH0 E;  2HKJ A;  4RF1 A;  1LV7 A;  1IBM M;  4JI7 M;  1XHB A;  4JI5 M;  4LJA A;  1OFH A;  2F4V M;  2CV1 A;  4FCW A;  4B3S M;  3FTC A;  3DOA A;  1YE9 A;  3GRU A;  2DHR A;  2G5G X;  3AKZ A;  2ERC A;  1N36 M;  1HR0 M;  4IJE A;  1HQY E;  4DV2 M;  2XFS A;  1IY2 A;  3FUW A;  3SC3 A;  4OW0 A;  1EE8 A;  1TH2 A;  2Y0Q A;  3GLG B;  3HHX A;  1I94 M;  1G41 A;  2ZAO A;  5FSW A;  4CGY B;  4NL4 H;  3GRV A;  1S3S A;  3SYL A;  2FFJ A;  2FNA A;  3RGS A;  4DR2 M;  2R45 A;  4MGK E;  3GPU A;  4LCB A;  1Z59 A;  4L15 A;  5KQD A;  4HL4 A;  1R2Z A;  4BB9 A;  2G8L A;  4DV4 M;  1XXH B;  4FCT A;  3QWL A;  1IN5 A;  4MGH A;  2R4E A;  2XF3 A;  2UU9 M;  2BJV A;  3VDP A;  1IN6 A;  1NNU C;  3U6O A;  2KRK A;  3GLI B;  4MB7 A;  1D2N A;  5IT9 S;  2QP9 X;  3UJN A;  2CV2 A;  2V1C A;  1HNW M;  2Z3X A;  4KHP M;  4IBD A;  3I4V A;  2UUB M;  3VLF B;  1K3W A;  3GO8 A;  4I81 A;  3GLI A;  2CUZ A;  4NSO B;  4Z8X A;  3A46 A;  2X4A A;  5EP4 A;  2KW0 A;  4A3V B;  1OJL A;  4G4Q A;  1PJJ A;  4M9Z A;  3GLH A;  1DO0 A;  1KYI A;  1Z5A A;  2DWZ B;  2L6O A;  4DR5 M;  4IJF A;  1L1Z A;  3KOX E;  5EJC A;  4DUY M;  4DR4 M;  1DGF A;  3SBJ A;  3PVS A;  3KSJ A;  4AKI A;  1HT1 E;  4MM3 B;  2C99 A;  1QZM A;  2XGN A;  3RFW A;  2I7P A;  2LH0 A;  3T1Y M;  4XBO A;  4X66 M;  3HKP A;  4LF7 M;  4B3M M;  4IIW A;  3L25 A;  3KSX A;  4S12 A;  2X8A A;  2KA6 B;  2RKO A;  3ILK A;  3LMM A;  3HHW A;  3SHG B;  2F5Q A;  3VKG A;  2F5S A;  2ZAN A;  3HJQ A;  1TDZ A;  2QBY B;  2HL7 A;  5JI2 E;  3SMP A;  4JI8 M;  3A45 A;  4G6Z A;  2X49 A;  5FLX S;  4LF6 M;  4IBF A;  1KSF X;  3HHZ A;  1Z5B A;  4LGM A;  3AOE C;  4NXN M;  4ZPX A;  1XMO M;  1E94 E;  1DGB A;  4I8O A;  4OU7 A;  3ZC7 B;  4HLQ A;  3U60 B;  2KEB A;  2C96 A;  2QPA A;  1HT2 E;  4NOO B;  2CHV A;  2LWX A;  5KPZ A;  4DR3 M;  2VQE M;  2R65 A;  3TL4 X;  3UGJ A;  1TDH A;  3FYC A;  3JR4 A;  3A42 A;  3SHF A;  5FTL A;  3VK8 A;  3HWS A;  1IN7 A;  4DR7 M;  4LJ8 A;  5A2Q S;  2C9C A;  2ZBK B;  4QHS A;  2QEN A;  2QCU A;  1N75 A;  1QVR A;  1IN4 A;  2AHM A;  4WUR A;  1NVM A;  3LVW A;  3I51 A;  1YSY A;  1K82 A;  4AG6 A;  1R6B X;  1W5S A;  3E4R A;  2JA2 A;  1WXQ A;  5EQT A;  1HQC A;  3TQS A;  3THG A;  4D80 A;  2QZ4 A;  1IY0 A;  1ZAE A;  3D8L A;  3J7B A;  4IBC A;  4AZF A;  2A5Y B;  1NNJ A;  3ZCB B;  3K1J A;  3K92 A;  3KP1 E;  3U6S A;  3KOZ E;  1QQW A;  2FE8 A;  3DA1 A;  4GHL A;  4GKK M;  3U6C A;  1R2Y A;  1OFI A;  2C9O A;  4B7F A;  2L09 A;  2LNH C;  3FUX A;  1SXJ D;  1L2C A;  1W5T A;  2XZF A;  2F5N A;  3U5Z B;  5DYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...