4B3MM

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3mM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3mM02
4YHHM 3TWKA 3GQ3A 3SAWA 4LF8M 4PD2A 1R2ZA 1IBMM 4ITQA 2UXCM 2XZUA 1Z5AA 3T1HM 4JI2M 4PDIA 1MU5A 4X62M 3TWMA 1XNRM 4DV2M 3U6SA 1K3XA 1FJGM 4DR6M 3TWLA 1K82A 1PJIA 4G4OA 2HHHM 5ITRA 1L1TA 5ITUA 4DV5M 4DV7M 3SAVA 5IWAM 1L1ZA 4NXNM 3T1YM 4B3TM 2ZM6M 4PCZA 3SBJA 2HKJA 5ITYA 1Z5BA 5ITXE 1HNWM 4JI8M 3GQ4A 1NNJA 4LF4M 3J80S 3GP1A 2XZFA 4DV1M 3VK8A 4B3RM 1PJJA 3OTOM 4DUYM 4JI4M 1IBLM 3A42A 4LFCM 4LFBM 1XMQM 2UUBM 3SATA 1MX0A 4LF6M 2F5QA 3JR5A 4GKKM 4YY3M 3VK7A 4JI5M 1IBKM 5BR8M 1HR0M 3U6EA 5A2QS 4JI6M 4DR3M 1N34M 5ITXA 4K0KM 4NRVA 2VQEM 2VQFM 4DR7M 3DOAA 4JYAM 2UUCM 5LMNM 1Z5CA 1XC8A 4JI1M 4LF5M 2OPFA 4LF7M 4LF9M 4JI3M 4PDGA 4NXMM 4DUZM 4X65M 2EA0A 4DV6M 1I94M 3GPPA 4CISA 1Q39A 5IT9S 3GO8A 3U6OA 1L2BA 3U6DA 4JI0M 4G4RA 1HNZM 3J81S 3SARA 2UXBM 4DV0M 1K3WA 4DV4M 3JAMS 4AQYM 3W0FA 3A46A 4X64M 1KFVA 3GQ5A 4G4NA 4DV3M 1N32M 3U6CA 2OQ4A 5ITTA 3GPUA 3U6LA 3GPYA 4DR2M 4JV5M 3U6PA 1R2YA 1L2CA 4DR5M 4GKJM 4G4QA 3J7AS 1L2DA 4NRWA 3U6QA 2UXDM 1Q3BA 5ITQA 3U6MA 1XMOM 1J5EM 1N33M 4X66M 3SAUA 4DR4M 2F5PA 1EE8A 3A45A 4B3MM 3SASA 4B3SM 1Q3CA 1Z59A 3JR4A 1PM5A 1TDHA 2ZBKB 4OX9M 1TDZA 4LFAM 1HNXM 2F4VM 5FLXS 2Q2EB 4MB7A 3C58A 2UU9M 2UUAM 1XNQM 2E5LM 2F5OA 4JI7M 3GPXA 4DR1M 2F5SA 5LMUM 4KHPM 2F5NA 1N36M
chains in the Genus database with same CATH superfamily
2ZTCA 3GLGA 3GQ3A 2KRUA 3RGSA 2APLA 4LF8M 1IBMM 1ORYB 2UXCM 4LJ5A 1WGLA 2L2DA 3T1HM 3IHPA 5EXXA 4FWHA 4PDIA 3HHZA 4NOOB 1CUKA 2DWNA 3E21A 1XNRM 2DZLA 2MH8A 2QP9X 3I4YA 4I81A 4DR6M 4LJ8A 2JZ1A 3HY5A 3AFHA 3A98B 5DNYA 2RGOA 3I01M 2R46A 2CHVA 2ERCA 5ITRA 1DGGA 3BXWA 3BBZA 1OFHA 2CWBA 2HCBA 3K2LA 3QYBA 2LBCA 1N77A 4NXNM 4B3TM 2CHQA 4CJ6A 2ZM6M 2H1RA 4RF1A 3FUUA 1A5TA 2YQZA 4WW0A 1TH4A 2HWJA 2ZTDA 4MGYE 3J80S 2BWBA 1YE9A 4AI6A 3FTEA 1GABA 1GO5A 3B7NA 1PJJA 3OTOM 4M0DA 4IBJA 4F2LA 4G6ZA 4FWGA 1D2NA 3HX3A 4OW0A 2KZSA 1JQJC 2KHHA 4LF6M 2LVPC 4LZJA 3SMPA 3JR5A 3FD9A 2DAEA 2LVNC 2YR0A 3DFZA 1D0LA 2JY8A 4CGYB 2VDBB 1IBKM 1NVMA 4IJEA 3K1JA 1AUAA 1SXJC 1EFUB 5KPRA 1G8PA 4NRVA 1EIJA 4IBKA 2VF7A 4W5WA 2KZUA 2K6BA 2UUCM 4LF5M 1TTEA 1GJTA 3LQRA 2L7HA 3TL4X 4PDGA 3U5ZB 2ZANA 2Z8YM 3U61A 3PVSA 3LW5F 1MN3A 4MH0E 1NHGC 3FYCA 4CISA 2DWZB 2JNHA 4AG6A 3GRYA 3KSXA 3KOYE 3FUXA 4G4RA 1Y8GA 1ZMUA 2CV1A 4R3DA 3Q8GA 3AJIB 2RGHA 2NQ8C 2EKFA 1K3WA 3HWSA 3ZH9B 4A3VB 3GRVA 3KS8A 3A46A 1NSFA 2JP7A 5EXSA 3SHGB 1HJPA 1WJ7A 3J7BA 4P16A 1G4AE 4DV3M 8CATA 3U61B 5ITTA 3GPUA 3GPYA 3U6PA 3D8BA 2V6ZM 2VIIA 2EUCA 1L2CA 1SXJE 1WGNA 2K47A 4IBFA 2L6OA 4KODA 4LRSA 3FKEA 2HAKA 1DGFA 1OAIA 3GLGE 1N33M 3FRIA 1QUTA 3SHFA 4M9XA 3J2PB 3HHYA 3HKPA 1KYIA 4OVZA 1EE8A 1UM8A 2F5PA 4B3MM 1Q3CA 1Z59A 2O01F 3U60A 1TDHA 1TDZA 3T6PA 1PJQA 2J5YA 1C7YA 4NSOB 3NBXX 2FE8A 2LHGA 2WSFF 3L25A 3IG8A 5EXPA 1YLAA 1YUBA 2R62A 2XGNA 3MHVC 4DR1M 4JN6A 4JYAM 2R0IA 4CHTB 4YHHM 3TWKA 2BNKA 4PT5A 4AKGA 1NNUC 3U60B 3PFIA 3MMPA 1R4GA 1Z5AA 2LVAA 2XSZD 5EP3A 3ZCBB 2XF3A 2DWLA 4LG2A 1OIZA 1DV0A 2C9CA 2FNAA 2MR9A 1GL7A 2LNHC 1WHCA 1K82A 2X4AA 2KEBA 2V1CA 1GJSA 1NJGA 1L1TA 1TGUA 5ITUA 4G3OA 4Z8XA 2CV0A 4DV5M 2EKKA 3E46A 1L1ZA 2BJWA 4XBOA 1SXJA 4GMQA 5DYGA 4AZFA 4PCZA 2Z7JA 2H5XA 3SBJA 4BLCA 1Z5BA 3LCUA 5ITYA 2KRKA 3AOEA 3GQ4A 1NNJA 4LF4M 3PNVA 4GHLA 4FD2A 2CFOA 4B3RM 3VLFB 4I4LA 2R65A 3ZQJA 4JI4M 2D7HA 3VDPA 3KOXE 2DVWB 3SYLA 1IBLM 4L8RC 1XHBA 4Z6YA 2J7NA 4S12A 1G59A 2Z4SA 1MX0A 4BBAA 2X49A 2CUZA 5EP1A 1SXJB 4LY6A 2F5QA 3QWLA 5FTKA 2Z3XA 4IJFA 2DI0A 2D7GA 2XEPA 3VKHA 3GLGB 1PRBA 1C1KA 1NJFA 2DZOB 1OIPA 2J7OA 5FTJA 3ZC7B 4AG5A 3UJNA 4GHAA 3FUWA 3AV0A 3DOAA 3CTWB 1JB0F 1XC8A 1Z5CA 1VEGA 2G3QA 2I7NA 2OPFA 4JI1M 3DZDA 3C3DA 3C9PA 2C98A 3LVVA 4M0WA 4DV6M 1R5LA 4REZA 2DXIA 1Q39A 3KS4A 1L2BA 1XXHA 1QDRA 1P3QQ 4GITA 2M60A 4JI0M 4B7GA 1HNZM 2GNOA 3LCVB 2UXBM 3FUVA 2EO2A 4FCWA 1UFZA 1W5SA 4DV0M 1T6OA 3UZUA 5JI2E 3GLFE 4AQYM 2JWSA 1Z6TA 4MGZE 2WZJA 5EP4A 1KFVA 2MJ5B 4G4NA 2BWEA 1N32M 3TE6A 2RKOA 2OQ4A 2O5RA 4LGYA 5IZ7D 1OAOC 2DHRA 2OOBA 3ILKA 4FWDA 4QHTA 1R2YA 2YFQA 4DR5M 3WHLA 1BVSA 4UN2B 3J7AS 1I4WA 3MJ5A 4FCTA 2XFTA 3AOEC 3FYDA 5IREB 4RKUF 2UXDM 1QYRA 1G71A 1IY0A 1IY1A 2Y21A 2DENA 5FSWA 2I7PA 1XMOM 1JR3A 4X66M 3Q8XA 1QVRA 1IY2A 4CIZA 1NY5A 4B3SM 4LJAA 2FH0A 3AL0C 4GEWA 4D81A 2K0BX 1PM5A 3KW6A 4XGIA 4LFAM 1HNXM 2L09A 1E9RA 1OFIA 4L16A 2UU9M 1E94E 2XFSA 2UUAM 3GLHA 3QAUA 2MGWA 3GPXA 3GLIA 1T3TA 3HJQA 3M0EA 2F5SA 2DAKA 3MK6A 5GKNA 2D7EA 2QHOB 4KO8A 1R2ZA 1DGBA 3L2AA 3UMMA 2RRUA 3FUTA 3E9SA 3K92A 2O25A 3J27B 1YSYA 2XZUA 4JI2M 1OJLA 1PJTA 1VQ1A 4IBGA 1MU5A 3BOSA 3TWMA 3SMSA 3V76A 2V1UA 3HU3A 2QBYA 1IXSA 5FTLA 2R4JA 4IBDA 4R7GA 3AOGA 2KDLA 4R71A 3U6SA 3W67A 3GLIB 3GLFA 2N35A 3TWLA 1K3XA 1FJGM 1PJIA 4G4OA 2HHHM 3L26A 1DGHA 3L28A 2VF8A 3HJ8A 4TUWA 1QANA 3SAVA 3H4MA 5IWAM 3IECA 1OKSA 1QDTA 4LJ7A 3KVWA 2HKJA 1QAQA 4AKHA 2QBYB 3SFZA 3RGPA 1TF0B 1WR1B 2LVQD 4OVZB 3SC3A 4JI8M 1ZMWA 2R4EA 4QOZC 1DO0A 3GLFB 4DV1M 3VK8A 3W0LB 4Y28F 2LXEA 3K8ZA 2CHGA 3FTCA 2R18A 2DAIA 2C9OA 5FTNA 2UUBM 1HQCA 3NWLA 1XXHE 3LQQA 2BJVA 2B3TA 3FRHA 3K9OA 4ANRA 3HU1A 4Q7JA 3U6EA 5A2QS 1VG5A 4JI6M 4B7HA 4LGMA 2OO9A 1GLNA 3F92A 1R7RA 3KOZE 5ITXA 1SG9A 4K0KM 2VQFM 1RU3A 1W5TA 2LH0A 4DR7M 1N78A 5F3WA 4FW9A 3DA1A 1H6UA 5LMNM 2LTUA 2A5YB 4IBBA 2QNJA 4LF7M 1KSFX 4LF9M 4JI3M 3SYKA 4NC6A 4GH9A 5BPVA 1G41A 2CE7A 5FTMA 2EA0A 4DUZM 1I94M 5IT9S 2G8LA 2OOAA 3U6OA 2KNZA 5KQDA 1QQWA 3U6DA 1HT1E 4M9ZA 1JR3E 3J81S 2DZNB 3K9PA 1GL6A 3SARA 1L8QA 1D0MA 4P17A 3EIEA 1S3SA 2JA2A 3PXGA 3JAMS 3UGJA 4DV4M 3FTDA 3T15A 3W0FA 4X64M 3KXEC 3CF0A 2XLJA 3PNYA 4L15A 4D80A 4L6V6 1N75A 1V34A 2X8AA 3U6CA 3U6LA 4LJ9A 5EP2A 4JV5M 2JUJA 3RE8A 3GLHE 1IXRC 4GKJM 1QUSA 3GLIE 4MM3B 4G4QA 3TPZA 1VEJA 4B08A 3U6QA 4DBGB 1IN5A 3U6MA 3B7QA 2DNAA 5KPTA 3CF2A 1XB2B 3HZJA 3A45A 5JI3E 3SASA 2R45A 3JR4A 3HHWA 1IFYA 1WXQA 4GIPA 4L78A 2P5TA 3KDSE 1VEKA 4MGHA 2CRUA 4ZPXA 4IBEA 3C58A 1IQPA 3KP0E 3VDUA 4RNAA 4OU7A 2E5LM 2F5OA 4JI7M 1XNQM 1QZEA 3B7ZA 4FCVA 3CGWA 2L7IA 5LMUM 3LVWA 3I04M 3VKGA 1SXJD 1XXHB 1ZAEA 3M7GA 2WSEF 3T38A 3SAWA 4PD2A 4ITQA 3R9XB 1IN6A 3CF6E 2ZAOA 1ZQ9A 3KSJA 1NO1A 4X62M 3AKZA 2DWMA 4L4UA 2FFJA 1WIVA 3H4JA 4HLQA 1NHWC 4BB9A 4IBIA 3TQSA 3EIHA 4DV2M 1DO2A 3IG5A 3U5ZA 1IM2A 2JY6B 1ZV1A 2L4EA 4M9SA 2QZ4A 1OQYA 4WURA 2K9DA 1NV8A 1GVNA 1Q02A 5L8RF 2DKLA 4DV7M 1NV9A 1IXZA 3T1YM 2KA6B 4LZZA 5ITXE 1HNWM 4QHSA 4LRTA 3R8FA 4AW4A 3B89A 1HQYE 2C5RA 2YNMD 4IIWA 3GP1A 2XZFA 4KLNA 2JZ0A 5E26A 2XSZA 1GKIA 1V92A 2EJSA 1E9SA 4I8OA 4MGIE 4NL4H 3KOWE 4GC9A 4KT0F 4DUYM 2Y0QA 2WSCF 1TH2A 4HEOA 3A42A 4LFCM 4LFBM 1XMQM 1QZMA 2R6FA 3SATA 3GLHB 5EJCA 2KW0A 4GKKM 3GRUA 4YY3M 1HT2E 3VK7A 3B74A 4JI5M 5C18A 1QAMA 2QCUA 3HU2A 5BR8M 1HR0M 4DR3M 1N34M 4XK8F 4HL4A 4MGKE 2QENA 3UK6A 3HHXA 3L29A 1G3IA 2R44A 2VQEM 3FTFA 1ZMVA 2CP8A 4QNRA 1IN8A 2FS1A 4NSRA 4EIWA 1IXSB 1PGYA 3KP1E 2FOIC 3HGIA 3L27A 4GRIA 1T43A 2DAGA 4NXMM 3D8LA 3I51A 3LMMA 4II7A 4X65M 1FNNA 2Y0TA 2KXEA 2ZAMA 3FE3A 2Y20A 7CATA 3GPPA 1AIPC 1DGHB 2JY5A 3C3EA 4JXJA 5E6JA 4QNMA 1VDDA 3GO8A 1QAOA 2M5ZA 1JR3D 3GRRA 2Z4RA 5EXTA 1R6BX 4AKIA 3VFDA 4FVMA 3KFUG 3W68A 1J09A 1D0KA 1LTMA 3HJSA 2CV2A 3E4RA 4I5SA 5DFLA 4IBCA 2C99A 5KQ8A 4D82A 3GQ5A 2QSFX 3M6AA 3B9PA 5H37D 3WHKA 2CEAA 2DAMA 4DR2M 2GQFA 5KO3A 4F1IA 1E32A 2LWXA 1L2DA 1NY6A 2C96A 2W82A 4NRWA 5EQTA 2L4FA 1TH3A 1F4IA 2QQ8A 1Q3BA 3QYEA 4QOSA 5C1BA 5ITQA 4LJ6A 1V33A 2LHCA 4B7FA 5KPZA 1J5EM 1VDLA 1IN7A 3SAUA 2QPAA 4DR4M 1OTRA 2KNVA 1XWIA 1PJSA 2KNAA 4RF0A 4LCBA 4WP2A 3RFWA 2JY7A 1J7KA 2AHMA 1IN4A 1LV7A 2ZBKB 3NBIA 4OX9M 2F4VM 1TR8A 5FLXS 2Q2EB 4GC5A 1MJGM 4MB7A 2XH9A 5DYIA 2LVOC 2MROB 3THGA 4LJ4A 1X37A 2HL7A 2G5GX 2DHYA 2JXNA 4KHPM 2F5NA 1N36M 3I4VA
chains in the Genus database with same CATH topology
3GLGA 3GQ3A 2KRUA 3RGSA 4LF8M 1IBMM 1ORYB 2UXCM 4LJ5A 3T1HM 5EXXA 4FWHA 4PDIA 3HHZA 4NOOB 2DWNA 1XNRM 2QP9X 3I4YA 4I81A 4DR6M 4LJ8A 3AFHA 3A98B 5DNYA 2RGOA 2R46A 2CHVA 2ERCA 5ITRA 1DGGA 1OFHA 3K2LA 2HCBA 1N77A 4NXNM 4B3TM 2CHQA 2ZM6M 2H1RA 4RF1A 3FUUA 2YQZA 4WW0A 1TH4A 4MGYE 3J80S 1YE9A 4AI6A 3FTEA 1PJJA 3OTOM 4M0DA 4IBJA 4G6ZA 4FWGA 1D2NA 4OW0A 2KZSA 1JQJC 4LF6M 4LZJA 3SMPA 3JR5A 3FD9A 2YR0A 3DFZA 4CGYB 1IBKM 1NVMA 4IJEA 3K1JA 1SXJC 5KPRA 1G8PA 4NRVA 4IBKA 4W5WA 2KZUA 2UUCM 4LF5M 3LQRA 2L7HA 3TL4X 4PDGA 3U5ZB 2ZANA 3U61A 3PVSA 4MH0E 1NHGC 3FYCA 4CISA 2DWZB 4AG6A 3GRYA 3KSXA 3KOYE 3FUXA 4G4RA 2CV1A 4R3DA 3AJIB 2RGHA 2NQ8C 1K3WA 3HWSA 3ZH9B 4A3VB 3GRVA 3KS8A 3A46A 1NSFA 3SHGB 5EXSA 3J7BA 4P16A 4DV3M 1G4AE 8CATA 3U61B 5ITTA 3GPUA 3GPYA 3U6PA 3D8BA 2V6ZM 2VIIA 2EUCA 1L2CA 1SXJE 2K47A 4IBFA 2L6OA 4KODA 4LRSA 3FKEA 1DGFA 1N33M 3SHFA 4M9XA 3J2PB 3HHYA 3HKPA 1KYIA 4OVZA 1EE8A 1UM8A 2F5PA 4B3MM 1Q3CA 1Z59A 3U60A 1TDHA 1TDZA 4NSOB 2FE8A 3L25A 3IG8A 5EXPA 1YUBA 2R62A 2XGNA 3MHVC 4DR1M 4JN6A 4JYAM 4CHTB 4YHHM 3TWKA 2BNKA 4PT5A 4AKGA 1NNUC 3U60B 3PFIA 1Z5AA 5EP3A 2XSZD 3ZCBB 2XF3A 2DWLA 4LG2A 2C9CA 2FNAA 1GL7A 2LNHC 1K82A 2X4AA 2KEBA 2V1CA 1NJGA 1L1TA 1TGUA 5ITUA 4Z8XA 2CV0A 4DV5M 1L1ZA 2BJWA 4XBOA 1SXJA 4GMQA 5DYGA 4AZFA 4PCZA 2Z7JA 3SBJA 4BLCA 1Z5BA 5ITYA 2KRKA 3AOEA 3GQ4A 1NNJA 4LF4M 3PNVA 4GHLA 4FD2A 2CFOA 4B3RM 3VLFB 4I4LA 2R65A 4JI4M 2D7HA 3VDPA 3KOXE 2DVWB 3SYLA 1IBLM 4L8RC 1XHBA 4Z6YA 2J7NA 4S12A 1G59A 2Z4SA 1MX0A 4BBAA 2X49A 2CUZA 5EP1A 1SXJB 4LY6A 2F5QA 3QWLA 5FTKA 2Z3XA 4IJFA 2D7GA 2XEPA 3VKHA 3GLGB 1C1KA 1NJFA 2DZOB 2J7OA 5FTJA 3ZC7B 4AG5A 3UJNA 4GHAA 3FUWA 3AV0A 3DOAA 3CTWB 1XC8A 1Z5CA 4JI1M 2I7NA 2OPFA 3DZDA 2C98A 3LVVA 4M0WA 4DV6M 4REZA 2DXIA 1Q39A 3KS4A 1L2BA 1XXHA 4GITA 2M60A 4JI0M 4B7GA 1HNZM 2UXBM 3FUVA 2EO2A 4FCWA 1W5SA 4DV0M 3UZUA 5JI2E 4AQYM 1Z6TA 4MGZE 5EP4A 1KFVA 4G4NA 1N32M 3TE6A 2RKOA 2OQ4A 2O5RA 4LGYA 5IZ7D 2DHRA 3ILKA 1R2YA 4FWDA 4QHTA 2YFQA 4DR5M 3WHLA 3J7AS 1I4WA 3MJ5A 4FCTA 2XFTA 3AOEC 3FYDA 5IREB 2UXDM 1QYRA 1IY0A 1IY1A 2Y21A 5FSWA 2I7PA 1XMOM 1JR3A 4X66M 3Q8XA 1QVRA 1IY2A 1NY5A 4B3SM 4LJAA 3AL0C 4D81A 1PM5A 3KW6A 4XGIA 4LFAM 1HNXM 2L09A 1E9RA 1OFIA 4L16A 2UU9M 1E94E 2XFSA 2UUAM 3GLHA 3QAUA 3GPXA 3GLIA 1T3TA 3HJQA 3M0EA 2F5SA 3MK6A 5GKNA 2D7EA 4KO8A 1R2ZA 1DGBA 3L2AA 3UMMA 3FUTA 3E9SA 3K92A 3J27B 2XZUA 1YSYA 4JI2M 1OJLA 4IBGA 1MU5A 3BOSA 3TWMA 3SMSA 2V1UA 3HU3A 2QBYA 5FTLA 2R4JA 4IBDA 4R7GA 3AOGA 3U6SA 1K3XA 1FJGM 3GLIB 3GLFA 3TWLA 1PJIA 4G4OA 2HHHM 3L26A 1DGHA 3L28A 3HJ8A 4TUWA 1QANA 3SAVA 3H4MA 5IWAM 4LJ7A 3KVWA 2HKJA 1QAQA 4AKHA 2QBYB 3SFZA 3RGPA 3SC3A 4JI8M 4OVZB 4QOZC 2R4EA 1DO0A 3GLFB 4DV1M 3VK8A 3W0LB 2LXEA 3K8ZA 2CHGA 3FTCA 2R18A 2C9OA 5FTNA 2UUBM 1HQCA 3NWLA 3LQQA 2BJVA 3HU1A 3U6EA 5A2QS 4JI6M 4B7HA 4LGMA 1GLNA 1R7RA 3KOZE 5ITXA 4K0KM 2VQFM 2LH0A 1W5TA 4DR7M 1N78A 5F3WA 4FW9A 3DA1A 1H6UA 5LMNM 4IBBA 2A5YB 4LF7M 4LF9M 1KSFX 4JI3M 3SYKA 4GH9A 5BPVA 1G41A 2CE7A 5FTMA 2EA0A 4DUZM 1I94M 5IT9S 2G8LA 3U6OA 5KQDA 1QQWA 3U6DA 1HT1E 4M9ZA 3J81S 2DZNB 1GL6A 3SARA 1L8QA 3EIEA 1S3SA 2JA2A 3PXGA 3JAMS 3UGJA 4DV4M 3FTDA 3T15A 3W0FA 4X64M 3KXEC 3CF0A 2XLJA 3PNYA 4L15A 4D80A 1N75A 3U6CA 2X8AA 3U6LA 4LJ9A 5EP2A 4JV5M 3RE8A 1IXRC 4GKJM 4G4QA 4MM3B 3TPZA 4B08A 3U6QA 1IN5A 3U6MA 5KPTA 3CF2A 3A45A 5JI3E 3SASA 2R45A 3JR4A 3HHWA 1WXQA 4GIPA 4L78A 2P5TA 3KDSE 4MGHA 4ZPXA 4IBEA 3C58A 1IQPA 3KP0E 3VDUA 4RNAA 4OU7A 2E5LM 2F5OA 4JI7M 1XNQM 4FCVA 2L7IA 5LMUM 3LVWA 3VKGA 1SXJD 1XXHB 1ZAEA 3M7GA 3T38A 3SAWA 4PD2A 4ITQA 3R9XB 1IN6A 3CF6E 2ZAOA 1ZQ9A 3KSJA 3AKZA 4X62M 2DWMA 4L4UA 2FFJA 4HLQA 1NHWC 4BB9A 4IBIA 3TQSA 3EIHA 4DV2M 1DO2A 3IG5A 3U5ZA 1IM2A 4M9SA 2QZ4A 4WURA 1GVNA 4DV7M 1IXZA 3T1YM 2KA6B 4LZZA 5ITXE 1HNWM 4QHSA 4LRTA 3R8FA 4AW4A 1HQYE 2C5RA 2YNMD 4IIWA 3GP1A 2XZFA 4KLNA 5E26A 2XSZA 1GKIA 4MGIE 1E9SA 4I8OA 4NL4H 3KOWE 4GC9A 4DUYM 2Y0QA 1TH2A 3A42A 4LFCM 4LFBM 1XMQM 1QZMA 3SATA 3GLHB 5EJCA 2KW0A 4GKKM 3GRUA 4YY3M 1HT2E 3VK7A 4JI5M 5C18A 1QAMA 2QCUA 3HU2A 5BR8M 1HR0M 4DR3M 1N34M 4HL4A 4MGKE 2QENA 3UK6A 3HHXA 3L29A 1G3IA 2VQEM 4QNRA 1IN8A 4NSRA 4EIWA 1IXSB 3KP1E 3L27A 2FOIC 3HGIA 4GRIA 4NXMM 3D8LA 3I51A 3LMMA 4II7A 4X65M 1FNNA 2Y0TA 2KXEA 2ZAMA 7CATA 2Y20A 3GPPA 1DGHB 5E6JA 4JXJA 3GO8A 3FTFA 4QNMA 1VDDA 1QAOA 2M5ZA 1JR3D 3GRRA 2Z4RA 5EXTA 1R6BX 4AKIA 3VFDA 4FVMA 3KFUG 1J09A 3HJSA 2CV2A 3E4RA 4I5SA 4IBCA 2C99A 5KQ8A 4D82A 3GQ5A 3M6AA 3B9PA 5H37D 3WHKA 2CEAA 4DR2M 5KO3A 1E32A 2LWXA 1L2DA 1NY6A 2C96A 2W82A 4NRWA 5EQTA 1TH3A 1Q3BA 5C1BA 4QOSA 5ITQA 4LJ6A 5KPZA 4B7FA 1J5EM 1IN7A 3SAUA 2QPAA 4DR4M 3RFWA 1XWIA 4RF0A 4LCBA 1J7KA 2AHMA 1IN4A 1LV7A 2ZBKB 3NBIA 4OX9M 2F4VM 5FLXS 2Q2EB 4GC5A 4MB7A 2XH9A 5DYIA 3THGA 4LJ4A 1X37A 2HL7A 2G5GX 4KHPM 2F5NA 1N36M 3I4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH M;  3TWK A;  3GQ3 A;  3SAW A;  4LF8 M;  4PD2 A;  1R2Z A;  1IBM M;  4ITQ A;  2UXC M;  2XZU A;  1Z5A A;  3T1H M;  4JI2 M;  4PDI A;  1MU5 A;  4X62 M;  3TWM A;  1XNR M;  4DV2 M;  3U6S A;  1K3X A;  1FJG M;  4DR6 M;  3TWL A;  1K82 A;  1PJI A;  4G4O A;  2HHH M;  5ITR A;  1L1T A;  5ITU A;  4DV5 M;  4DV7 M;  3SAV A;  5IWA M;  1L1Z A;  4NXN M;  3T1Y M;  4B3T M;  2ZM6 M;  4PCZ A;  3SBJ A;  2HKJ A;  5ITY A;  1Z5B A;  5ITX E;  1HNW M;  4JI8 M;  3GQ4 A;  1NNJ A;  4LF4 M;  3J80 S;  3GP1 A;  2XZF A;  4DV1 M;  3VK8 A;  4B3R M;  1PJJ A;  3OTO M;  4DUY M;  4JI4 M;  1IBL M;  3A42 A;  4LFC M;  4LFB M;  1XMQ M;  2UUB M;  3SAT A;  1MX0 A;  4LF6 M;  2F5Q A;  3JR5 A;  4GKK M;  4YY3 M;  3VK7 A;  4JI5 M;  1IBK M;  5BR8 M;  1HR0 M;  3U6E A;  5A2Q S;  4JI6 M;  4DR3 M;  1N34 M;  5ITX A;  4K0K M;  4NRV A;  2VQE M;  2VQF M;  4DR7 M;  3DOA A;  4JYA M;  2UUC M;  5LMN M;  1Z5C A;  1XC8 A;  4JI1 M;  4LF5 M;  2OPF A;  4LF7 M;  4LF9 M;  4JI3 M;  4PDG A;  4NXM M;  4DUZ M;  4X65 M;  2EA0 A;  4DV6 M;  1I94 M;  3GPP A;  4CIS A;  1Q39 A;  5IT9 S;  3GO8 A;  3U6O A;  1L2B A;  3U6D A;  4JI0 M;  4G4R A;  1HNZ M;  3J81 S;  3SAR A;  2UXB M;  4DV0 M;  1K3W A;  4DV4 M;  3JAM S;  4AQY M;  3W0F A;  3A46 A;  4X64 M;  1KFV A;  3GQ5 A;  4G4N A;  4DV3 M;  1N32 M;  3U6C A;  2OQ4 A;  5ITT A;  3GPU A;  3U6L A;  3GPY A;  4DR2 M;  4JV5 M;  3U6P A;  1R2Y A;  1L2C A;  4DR5 M;  4GKJ M;  4G4Q A;  3J7A S;  1L2D A;  4NRW A;  3U6Q A;  2UXD M;  1Q3B A;  5ITQ A;  3U6M A;  1XMO M;  1J5E M;  1N33 M;  4X66 M;  3SAU A;  4DR4 M;  2F5P A;  1EE8 A;  3A45 A;  4B3M M;  3SAS A;  4B3S M;  1Q3C A;  1Z59 A;  3JR4 A;  1PM5 A;  1TDH A;  2ZBK B;  4OX9 M;  1TDZ A;  4LFA M;  1HNX M;  2F4V M;  5FLX S;  2Q2E B;  4MB7 A;  3C58 A;  2UU9 M;  2UUA M;  1XNQ M;  2E5L M;  2F5O A;  4JI7 M;  3GPX A;  4DR1 M;  2F5S A;  5LMU M;  4KHP M;  2F5N A;  1N36 M; 
#chains in the Genus database with same CATH topology
 2ZTC A;  3GLG A;  3GQ3 A;  2KRU A;  3RGS A;  2APL A;  4LF8 M;  1IBM M;  1ORY B;  2UXC M;  4LJ5 A;  1WGL A;  2L2D A;  3T1H M;  3IHP A;  5EXX A;  4FWH A;  4PDI A;  3HHZ A;  4NOO B;  1CUK A;  2DWN A;  3E21 A;  1XNR M;  2DZL A;  2MH8 A;  2QP9 X;  3I4Y A;  4I81 A;  4DR6 M;  4LJ8 A;  2JZ1 A;  3HY5 A;  3AFH A;  3A98 B;  5DNY A;  2RGO A;  3I01 M;  2R46 A;  2CHV A;  2ERC A;  5ITR A;  1DGG A;  3BXW A;  3BBZ A;  1OFH A;  2CWB A;  2HCB A;  3K2L A;  3QYB A;  2LBC A;  1N77 A;  4NXN M;  4B3T M;  2CHQ A;  4CJ6 A;  2ZM6 M;  2H1R A;  4RF1 A;  3FUU A;  1A5T A;  2YQZ A;  4WW0 A;  1TH4 A;  2HWJ A;  2ZTD A;  4MGY E;  3J80 S;  2BWB A;  1YE9 A;  4AI6 A;  3FTE A;  1GAB A;  1GO5 A;  3B7N A;  1PJJ A;  3OTO M;  4M0D A;  4IBJ A;  4F2L A;  4G6Z A;  4FWG A;  1D2N A;  3HX3 A;  4OW0 A;  2KZS A;  1JQJ C;  2KHH A;  4LF6 M;  2LVP C;  4LZJ A;  3SMP A;  3JR5 A;  3FD9 A;  2DAE A;  2LVN C;  2YR0 A;  3DFZ A;  1D0L A;  2JY8 A;  4CGY B;  2VDB B;  1IBK M;  1NVM A;  4IJE A;  3K1J A;  1AUA A;  1SXJ C;  1EFU B;  5KPR A;  1G8P A;  4NRV A;  1EIJ A;  4IBK A;  2VF7 A;  4W5W A;  2KZU A;  2K6B A;  2UUC M;  4LF5 M;  1TTE A;  1GJT A;  3LQR A;  2L7H A;  3TL4 X;  4PDG A;  3U5Z B;  2ZAN A;  2Z8Y M;  3U61 A;  3PVS A;  3LW5 F;  1MN3 A;  4MH0 E;  1NHG C;  3FYC A;  4CIS A;  2DWZ B;  2JNH A;  4AG6 A;  3GRY A;  3KSX A;  3KOY E;  3FUX A;  4G4R A;  1Y8G A;  1ZMU A;  2CV1 A;  4R3D A;  3Q8G A;  3AJI B;  2RGH A;  2NQ8 C;  2EKF A;  1K3W A;  3HWS A;  3ZH9 B;  4A3V B;  3GRV A;  3KS8 A;  3A46 A;  1NSF A;  2JP7 A;  5EXS A;  3SHG B;  1HJP A;  1WJ7 A;  3J7B A;  4P16 A;  1G4A E;  4DV3 M;  8CAT A;  3U61 B;  5ITT A;  3GPU A;  3GPY A;  3U6P A;  3D8B A;  2V6Z M;  2VII A;  2EUC A;  1L2C A;  1SXJ E;  1WGN A;  2K47 A;  4IBF A;  2L6O A;  4KOD A;  4LRS A;  3FKE A;  2HAK A;  1DGF A;  1OAI A;  3GLG E;  1N33 M;  3FRI A;  1QUT A;  3SHF A;  4M9X A;  3J2P B;  3HHY A;  3HKP A;  1KYI A;  4OVZ A;  1EE8 A;  1UM8 A;  2F5P A;  4B3M M;  1Q3C A;  1Z59 A;  2O01 F;  3U60 A;  1TDH A;  1TDZ A;  3T6P A;  1PJQ A;  2J5Y A;  1C7Y A;  4NSO B;  3NBX X;  2FE8 A;  2LHG A;  2WSF F;  3L25 A;  3IG8 A;  5EXP A;  1YLA A;  1YUB A;  2R62 A;  2XGN A;  3MHV C;  4DR1 M;  4JN6 A;  4JYA M;  2R0I A;  4CHT B;  4YHH M;  3TWK A;  2BNK A;  4PT5 A;  4AKG A;  1NNU C;  3U60 B;  3PFI A;  3MMP A;  1R4G A;  1Z5A A;  2LVA A;  2XSZ D;  5EP3 A;  3ZCB B;  2XF3 A;  2DWL A;  4LG2 A;  1OIZ A;  1DV0 A;  2C9C A;  2FNA A;  2MR9 A;  1GL7 A;  2LNH C;  1WHC A;  1K82 A;  2X4A A;  2KEB A;  2V1C A;  1GJS A;  1NJG A;  1L1T A;  1TGU A;  5ITU A;  4G3O A;  4Z8X A;  2CV0 A;  4DV5 M;  2EKK A;  3E46 A;  1L1Z A;  2BJW A;  4XBO A;  1SXJ A;  4GMQ A;  5DYG A;  4AZF A;  4PCZ A;  2Z7J A;  2H5X A;  3SBJ A;  4BLC A;  1Z5B A;  3LCU A;  5ITY A;  2KRK A;  3AOE A;  3GQ4 A;  1NNJ A;  4LF4 M;  3PNV A;  4GHL A;  4FD2 A;  2CFO A;  4B3R M;  3VLF B;  4I4L A;  2R65 A;  3ZQJ A;  4JI4 M;  2D7H A;  3VDP A;  3KOX E;  2DVW B;  3SYL A;  1IBL M;  4L8R C;  1XHB A;  4Z6Y A;  2J7N A;  4S12 A;  1G59 A;  2Z4S A;  1MX0 A;  4BBA A;  2X49 A;  2CUZ A;  5EP1 A;  1SXJ B;  4LY6 A;  2F5Q A;  3QWL A;  5FTK A;  2Z3X A;  4IJF A;  2DI0 A;  2D7G A;  2XEP A;  3VKH A;  3GLG B;  1PRB A;  1C1K A;  1NJF A;  2DZO B;  1OIP A;  2J7O A;  5FTJ A;  3ZC7 B;  4AG5 A;  3UJN A;  4GHA A;  3FUW A;  3AV0 A;  3DOA A;  3CTW B;  1JB0 F;  1XC8 A;  1Z5C A;  1VEG A;  2G3Q A;  2I7N A;  2OPF A;  4JI1 M;  3DZD A;  3C3D A;  3C9P A;  2C98 A;  3LVV A;  4M0W A;  4DV6 M;  1R5L A;  4REZ A;  2DXI A;  1Q39 A;  3KS4 A;  1L2B A;  1XXH A;  1QDR A;  1P3Q Q;  4GIT A;  2M60 A;  4JI0 M;  4B7G A;  1HNZ M;  2GNO A;  3LCV B;  2UXB M;  3FUV A;  2EO2 A;  4FCW A;  1UFZ A;  1W5S A;  4DV0 M;  1T6O A;  3UZU A;  5JI2 E;  3GLF E;  4AQY M;  2JWS A;  1Z6T A;  4MGZ E;  2WZJ A;  5EP4 A;  1KFV A;  2MJ5 B;  4G4N A;  2BWE A;  1N32 M;  3TE6 A;  2RKO A;  2OQ4 A;  2O5R A;  4LGY A;  5IZ7 D;  1OAO C;  2DHR A;  2OOB A;  3ILK A;  4FWD A;  4QHT A;  1R2Y A;  2YFQ A;  4DR5 M;  3WHL A;  1BVS A;  4UN2 B;  3J7A S;  1I4W A;  3MJ5 A;  4FCT A;  2XFT A;  3AOE C;  3FYD A;  5IRE B;  4RKU F;  2UXD M;  1QYR A;  1G71 A;  1IY0 A;  1IY1 A;  2Y21 A;  2DEN A;  5FSW A;  2I7P A;  1XMO M;  1JR3 A;  4X66 M;  3Q8X A;  1QVR A;  1IY2 A;  4CIZ A;  1NY5 A;  4B3S M;  4LJA A;  2FH0 A;  3AL0 C;  4GEW A;  4D81 A;  2K0B X;  1PM5 A;  3KW6 A;  4XGI A;  4LFA M;  1HNX M;  2L09 A;  1E9R A;  1OFI A;  4L16 A;  2UU9 M;  1E94 E;  2XFS A;  2UUA M;  3GLH A;  3QAU A;  2MGW A;  3GPX A;  3GLI A;  1T3T A;  3HJQ A;  3M0E A;  2F5S A;  2DAK A;  3MK6 A;  5GKN A;  2D7E A;  2QHO B;  4KO8 A;  1R2Z A;  1DGB A;  3L2A A;  3UMM A;  2RRU A;  3FUT A;  3E9S A;  3K92 A;  2O25 A;  3J27 B;  1YSY A;  2XZU A;  4JI2 M;  1OJL A;  1PJT A;  1VQ1 A;  4IBG A;  1MU5 A;  3BOS A;  3TWM A;  3SMS A;  3V76 A;  2V1U A;  3HU3 A;  2QBY A;  1IXS A;  5FTL A;  2R4J A;  4IBD A;  4R7G A;  3AOG A;  2KDL A;  4R71 A;  3U6S A;  3W67 A;  3GLI B;  3GLF A;  2N35 A;  3TWL A;  1K3X A;  1FJG M;  1PJI A;  4G4O A;  2HHH M;  3L26 A;  1DGH A;  3L28 A;  2VF8 A;  3HJ8 A;  4TUW A;  1QAN A;  3SAV A;  3H4M A;  5IWA M;  3IEC A;  1OKS A;  1QDT A;  4LJ7 A;  3KVW A;  2HKJ A;  1QAQ A;  4AKH A;  2QBY B;  3SFZ A;  3RGP A;  1TF0 B;  1WR1 B;  2LVQ D;  4OVZ B;  3SC3 A;  4JI8 M;  1ZMW A;  2R4E A;  4QOZ C;  1DO0 A;  3GLF B;  4DV1 M;  3VK8 A;  3W0L B;  4Y28 F;  2LXE A;  3K8Z A;  2CHG A;  3FTC A;  2R18 A;  2DAI A;  2C9O A;  5FTN A;  2UUB M;  1HQC A;  3NWL A;  1XXH E;  3LQQ A;  2BJV A;  2B3T A;  3FRH A;  3K9O A;  4ANR A;  3HU1 A;  4Q7J A;  3U6E A;  5A2Q S;  1VG5 A;  4JI6 M;  4B7H A;  4LGM A;  2OO9 A;  1GLN A;  3F92 A;  1R7R A;  3KOZ E;  5ITX A;  1SG9 A;  4K0K M;  2VQF M;  1RU3 A;  1W5T A;  2LH0 A;  4DR7 M;  1N78 A;  5F3W A;  4FW9 A;  3DA1 A;  1H6U A;  5LMN M;  2LTU A;  2A5Y B;  4IBB A;  2QNJ A;  4LF7 M;  1KSF X;  4LF9 M;  4JI3 M;  3SYK A;  4NC6 A;  4GH9 A;  5BPV A;  1G41 A;  2CE7 A;  5FTM A;  2EA0 A;  4DUZ M;  1I94 M;  5IT9 S;  2G8L A;  2OOA A;  3U6O A;  2KNZ A;  5KQD A;  1QQW A;  3U6D A;  1HT1 E;  4M9Z A;  1JR3 E;  3J81 S;  2DZN B;  3K9P A;  1GL6 A;  3SAR A;  1L8Q A;  1D0M A;  4P17 A;  3EIE A;  1S3S A;  2JA2 A;  3PXG A;  3JAM S;  3UGJ A;  4DV4 M;  3FTD A;  3T15 A;  3W0F A;  4X64 M;  3KXE C;  3CF0 A;  2XLJ A;  3PNY A;  4L15 A;  4D80 A;  4L6V 6;  1N75 A;  1V34 A;  2X8A A;  3U6C A;  3U6L A;  4LJ9 A;  5EP2 A;  4JV5 M;  2JUJ A;  3RE8 A;  3GLH E;  1IXR C;  4GKJ M;  1QUS A;  3GLI E;  4MM3 B;  4G4Q A;  3TPZ A;  1VEJ A;  4B08 A;  3U6Q A;  4DBG B;  1IN5 A;  3U6M A;  3B7Q A;  2DNA A;  5KPT A;  3CF2 A;  1XB2 B;  3HZJ A;  3A45 A;  5JI3 E;  3SAS A;  2R45 A;  3JR4 A;  3HHW A;  1IFY A;  1WXQ A;  4GIP A;  4L78 A;  2P5T A;  3KDS E;  1VEK A;  4MGH A;  2CRU A;  4ZPX A;  4IBE A;  3C58 A;  1IQP A;  3KP0 E;  3VDU A;  4RNA A;  4OU7 A;  2E5L M;  2F5O A;  4JI7 M;  1XNQ M;  1QZE A;  3B7Z A;  4FCV A;  3CGW A;  2L7I A;  5LMU M;  3LVW A;  3I04 M;  3VKG A;  1SXJ D;  1XXH B;  1ZAE A;  3M7G A;  2WSE F;  3T38 A;  3SAW A;  4PD2 A;  4ITQ A;  3R9X B;  1IN6 A;  3CF6 E;  2ZAO A;  1ZQ9 A;  3KSJ A;  1NO1 A;  4X62 M;  3AKZ A;  2DWM A;  4L4U A;  2FFJ A;  1WIV A;  3H4J A;  4HLQ A;  1NHW C;  4BB9 A;  4IBI A;  3TQS A;  3EIH A;  4DV2 M;  1DO2 A;  3IG5 A;  3U5Z A;  1IM2 A;  2JY6 B;  1ZV1 A;  2L4E A;  4M9S A;  2QZ4 A;  1OQY A;  4WUR A;  2K9D A;  1NV8 A;  1GVN A;  1Q02 A;  5L8R F;  2DKL A;  4DV7 M;  1NV9 A;  1IXZ A;  3T1Y M;  2KA6 B;  4LZZ A;  5ITX E;  1HNW M;  4QHS A;  4LRT A;  3R8F A;  4AW4 A;  3B89 A;  1HQY E;  2C5R A;  2YNM D;  4IIW A;  3GP1 A;  2XZF A;  4KLN A;  2JZ0 A;  5E26 A;  2XSZ A;  1GKI A;  1V92 A;  2EJS A;  1E9S A;  4I8O A;  4MGI E;  4NL4 H;  3KOW E;  4GC9 A;  4KT0 F;  4DUY M;  2Y0Q A;  2WSC F;  1TH2 A;  4HEO A;  3A42 A;  4LFC M;  4LFB M;  1XMQ M;  1QZM A;  2R6F A;  3SAT A;  3GLH B;  5EJC A;  2KW0 A;  4GKK M;  3GRU A;  4YY3 M;  1HT2 E;  3VK7 A;  3B74 A;  4JI5 M;  5C18 A;  1QAM A;  2QCU A;  3HU2 A;  5BR8 M;  1HR0 M;  4DR3 M;  1N34 M;  4XK8 F;  4HL4 A;  4MGK E;  2QEN A;  3UK6 A;  3HHX A;  3L29 A;  1G3I A;  2R44 A;  2VQE M;  3FTF A;  1ZMV A;  2CP8 A;  4QNR A;  1IN8 A;  2FS1 A;  4NSR A;  4EIW A;  1IXS B;  1PGY A;  3KP1 E;  2FOI C;  3HGI A;  3L27 A;  4GRI A;  1T43 A;  2DAG A;  4NXM M;  3D8L A;  3I51 A;  3LMM A;  4II7 A;  4X65 M;  1FNN A;  2Y0T A;  2KXE A;  2ZAM A;  3FE3 A;  2Y20 A;  7CAT A;  3GPP A;  1AIP C;  1DGH B;  2JY5 A;  3C3E A;  4JXJ A;  5E6J A;  4QNM A;  1VDD A;  3GO8 A;  1QAO A;  2M5Z A;  1JR3 D;  3GRR A;  2Z4R A;  5EXT A;  1R6B X;  4AKI A;  3VFD A;  4FVM A;  3KFU G;  3W68 A;  1J09 A;  1D0K A;  1LTM A;  3HJS A;  2CV2 A;  3E4R A;  4I5S A;  5DFL A;  4IBC A;  2C99 A;  5KQ8 A;  4D82 A;  3GQ5 A;  2QSF X;  3M6A A;  3B9P A;  5H37 D;  3WHK A;  2CEA A;  2DAM A;  4DR2 M;  2GQF A;  5KO3 A;  4F1I A;  1E32 A;  2LWX A;  1L2D A;  1NY6 A;  2C96 A;  2W82 A;  4NRW A;  5EQT A;  2L4F A;  1TH3 A;  1F4I A;  2QQ8 A;  1Q3B A;  3QYE A;  4QOS A;  5C1B A;  5ITQ A;  4LJ6 A;  1V33 A;  2LHC A;  4B7F A;  5KPZ A;  1J5E M;  1VDL A;  1IN7 A;  3SAU A;  2QPA A;  4DR4 M;  1OTR A;  2KNV A;  1XWI A;  1PJS A;  2KNA A;  4RF0 A;  4LCB A;  4WP2 A;  3RFW A;  2JY7 A;  1J7K A;  2AHM A;  1IN4 A;  1LV7 A;  2ZBK B;  3NBI A;  4OX9 M;  2F4V M;  1TR8 A;  5FLX S;  2Q2E B;  4GC5 A;  1MJG M;  4MB7 A;  2XH9 A;  5DYI A;  2LVO C;  2MRO B;  3THG A;  4LJ4 A;  1X37 A;  2HL7 A;  2G5G X;  2DHY A;  2JXN A;  4KHP M;  2F5N A;  1N36 M;  3I4V A; 
#chains in the Genus database with same CATH homology
 3GLG A;  3GQ3 A;  2KRU A;  3RGS A;  4LF8 M;  1IBM M;  1ORY B;  2UXC M;  4LJ5 A;  3T1H M;  5EXX A;  4FWH A;  4PDI A;  3HHZ A;  4NOO B;  2DWN A;  1XNR M;  2QP9 X;  3I4Y A;  4I81 A;  4DR6 M;  4LJ8 A;  3AFH A;  3A98 B;  5DNY A;  2RGO A;  2R46 A;  2CHV A;  2ERC A;  5ITR A;  1DGG A;  1OFH A;  3K2L A;  2HCB A;  1N77 A;  4NXN M;  4B3T M;  2CHQ A;  2ZM6 M;  2H1R A;  4RF1 A;  3FUU A;  2YQZ A;  4WW0 A;  1TH4 A;  4MGY E;  3J80 S;  1YE9 A;  4AI6 A;  3FTE A;  1PJJ A;  3OTO M;  4M0D A;  4IBJ A;  4G6Z A;  4FWG A;  1D2N A;  4OW0 A;  2KZS A;  1JQJ C;  4LF6 M;  4LZJ A;  3SMP A;  3JR5 A;  3FD9 A;  2YR0 A;  3DFZ A;  4CGY B;  1IBK M;  1NVM A;  4IJE A;  3K1J A;  1SXJ C;  5KPR A;  1G8P A;  4NRV A;  4IBK A;  4W5W A;  2KZU A;  2UUC M;  4LF5 M;  3LQR A;  2L7H A;  3TL4 X;  4PDG A;  3U5Z B;  2ZAN A;  3U61 A;  3PVS A;  4MH0 E;  1NHG C;  3FYC A;  4CIS A;  2DWZ B;  4AG6 A;  3GRY A;  3KSX A;  3KOY E;  3FUX A;  4G4R A;  2CV1 A;  4R3D A;  3AJI B;  2RGH A;  2NQ8 C;  1K3W A;  3HWS A;  3ZH9 B;  4A3V B;  3GRV A;  3KS8 A;  3A46 A;  1NSF A;  3SHG B;  5EXS A;  3J7B A;  4P16 A;  4DV3 M;  1G4A E;  8CAT A;  3U61 B;  5ITT A;  3GPU A;  3GPY A;  3U6P A;  3D8B A;  2V6Z M;  2VII A;  2EUC A;  1L2C A;  1SXJ E;  2K47 A;  4IBF A;  2L6O A;  4KOD A;  4LRS A;  3FKE A;  1DGF A;  1N33 M;  3SHF A;  4M9X A;  3J2P B;  3HHY A;  3HKP A;  1KYI A;  4OVZ A;  1EE8 A;  1UM8 A;  2F5P A;  4B3M M;  1Q3C A;  1Z59 A;  3U60 A;  1TDH A;  1TDZ A;  4NSO B;  2FE8 A;  3L25 A;  3IG8 A;  5EXP A;  1YUB A;  2R62 A;  2XGN A;  3MHV C;  4DR1 M;  4JN6 A;  4JYA M;  4CHT B;  4YHH M;  3TWK A;  2BNK A;  4PT5 A;  4AKG A;  1NNU C;  3U60 B;  3PFI A;  1Z5A A;  5EP3 A;  2XSZ D;  3ZCB B;  2XF3 A;  2DWL A;  4LG2 A;  2C9C A;  2FNA A;  1GL7 A;  2LNH C;  1K82 A;  2X4A A;  2KEB A;  2V1C A;  1NJG A;  1L1T A;  1TGU A;  5ITU A;  4Z8X A;  2CV0 A;  4DV5 M;  1L1Z A;  2BJW A;  4XBO A;  1SXJ A;  4GMQ A;  5DYG A;  4AZF A;  4PCZ A;  2Z7J A;  3SBJ A;  4BLC A;  1Z5B A;  5ITY A;  2KRK A;  3AOE A;  3GQ4 A;  1NNJ A;  4LF4 M;  3PNV A;  4GHL A;  4FD2 A;  2CFO A;  4B3R M;  3VLF B;  4I4L A;  2R65 A;  4JI4 M;  2D7H A;  3VDP A;  3KOX E;  2DVW B;  3SYL A;  1IBL M;  4L8R C;  1XHB A;  4Z6Y A;  2J7N A;  4S12 A;  1G59 A;  2Z4S A;  1MX0 A;  4BBA A;  2X49 A;  2CUZ A;  5EP1 A;  1SXJ B;  4LY6 A;  2F5Q A;  3QWL A;  5FTK A;  2Z3X A;  4IJF A;  2D7G A;  2XEP A;  3VKH A;  3GLG B;  1C1K A;  1NJF A;  2DZO B;  2J7O A;  5FTJ A;  3ZC7 B;  4AG5 A;  3UJN A;  4GHA A;  3FUW A;  3AV0 A;  3DOA A;  3CTW B;  1XC8 A;  1Z5C A;  4JI1 M;  2I7N A;  2OPF A;  3DZD A;  2C98 A;  3LVV A;  4M0W A;  4DV6 M;  4REZ A;  2DXI A;  1Q39 A;  3KS4 A;  1L2B A;  1XXH A;  4GIT A;  2M60 A;  4JI0 M;  4B7G A;  1HNZ M;  2UXB M;  3FUV A;  2EO2 A;  4FCW A;  1W5S A;  4DV0 M;  3UZU A;  5JI2 E;  4AQY M;  1Z6T A;  4MGZ E;  5EP4 A;  1KFV A;  4G4N A;  1N32 M;  3TE6 A;  2RKO A;  2OQ4 A;  2O5R A;  4LGY A;  5IZ7 D;  2DHR A;  3ILK A;  1R2Y A;  4FWD A;  4QHT A;  2YFQ A;  4DR5 M;  3WHL A;  3J7A S;  1I4W A;  3MJ5 A;  4FCT A;  2XFT A;  3AOE C;  3FYD A;  5IRE B;  2UXD M;  1QYR A;  1IY0 A;  1IY1 A;  2Y21 A;  5FSW A;  2I7P A;  1XMO M;  1JR3 A;  4X66 M;  3Q8X A;  1QVR A;  1IY2 A;  1NY5 A;  4B3S M;  4LJA A;  3AL0 C;  4D81 A;  1PM5 A;  3KW6 A;  4XGI A;  4LFA M;  1HNX M;  2L09 A;  1E9R A;  1OFI A;  4L16 A;  2UU9 M;  1E94 E;  2XFS A;  2UUA M;  3GLH A;  3QAU A;  3GPX A;  3GLI A;  1T3T A;  3HJQ A;  3M0E A;  2F5S A;  3MK6 A;  5GKN A;  2D7E A;  4KO8 A;  1R2Z A;  1DGB A;  3L2A A;  3UMM A;  3FUT A;  3E9S A;  3K92 A;  3J27 B;  2XZU A;  1YSY A;  4JI2 M;  1OJL A;  4IBG A;  1MU5 A;  3BOS A;  3TWM A;  3SMS A;  2V1U A;  3HU3 A;  2QBY A;  5FTL A;  2R4J A;  4IBD A;  4R7G A;  3AOG A;  3U6S A;  1K3X A;  1FJG M;  3GLI B;  3GLF A;  3TWL A;  1PJI A;  4G4O A;  2HHH M;  3L26 A;  1DGH A;  3L28 A;  3HJ8 A;  4TUW A;  1QAN A;  3SAV A;  3H4M A;  5IWA M;  4LJ7 A;  3KVW A;  2HKJ A;  1QAQ A;  4AKH A;  2QBY B;  3SFZ A;  3RGP A;  3SC3 A;  4JI8 M;  4OVZ B;  4QOZ C;  2R4E A;  1DO0 A;  3GLF B;  4DV1 M;  3VK8 A;  3W0L B;  2LXE A;  3K8Z A;  2CHG A;  3FTC A;  2R18 A;  2C9O A;  5FTN A;  2UUB M;  1HQC A;  3NWL A;  3LQQ A;  2BJV A;  3HU1 A;  3U6E A;  5A2Q S;  4JI6 M;  4B7H A;  4LGM A;  1GLN A;  1R7R A;  3KOZ E;  5ITX A;  4K0K M;  2VQF M;  2LH0 A;  1W5T A;  4DR7 M;  1N78 A;  5F3W A;  4FW9 A;  3DA1 A;  1H6U A;  5LMN M;  4IBB A;  2A5Y B;  4LF7 M;  4LF9 M;  1KSF X;  4JI3 M;  3SYK A;  4GH9 A;  5BPV A;  1G41 A;  2CE7 A;  5FTM A;  2EA0 A;  4DUZ M;  1I94 M;  5IT9 S;  2G8L A;  3U6O A;  5KQD A;  1QQW A;  3U6D A;  1HT1 E;  4M9Z A;  3J81 S;  2DZN B;  1GL6 A;  3SAR A;  1L8Q A;  3EIE A;  1S3S A;  2JA2 A;  3PXG A;  3JAM S;  3UGJ A;  4DV4 M;  3FTD A;  3T15 A;  3W0F A;  4X64 M;  3KXE C;  3CF0 A;  2XLJ A;  3PNY A;  4L15 A;  4D80 A;  1N75 A;  3U6C A;  2X8A A;  3U6L A;  4LJ9 A;  5EP2 A;  4JV5 M;  3RE8 A;  1IXR C;  4GKJ M;  4G4Q A;  4MM3 B;  3TPZ A;  4B08 A;  3U6Q A;  1IN5 A;  3U6M A;  5KPT A;  3CF2 A;  3A45 A;  5JI3 E;  3SAS A;  2R45 A;  3JR4 A;  3HHW A;  1WXQ A;  4GIP A;  4L78 A;  2P5T A;  3KDS E;  4MGH A;  4ZPX A;  4IBE A;  3C58 A;  1IQP A;  3KP0 E;  3VDU A;  4RNA A;  4OU7 A;  2E5L M;  2F5O A;  4JI7 M;  1XNQ M;  4FCV A;  2L7I A;  5LMU M;  3LVW A;  3VKG A;  1SXJ D;  1XXH B;  1ZAE A;  3M7G A;  3T38 A;  3SAW A;  4PD2 A;  4ITQ A;  3R9X B;  1IN6 A;  3CF6 E;  2ZAO A;  1ZQ9 A;  3KSJ A;  3AKZ A;  4X62 M;  2DWM A;  4L4U A;  2FFJ A;  4HLQ A;  1NHW C;  4BB9 A;  4IBI A;  3TQS A;  3EIH A;  4DV2 M;  1DO2 A;  3IG5 A;  3U5Z A;  1IM2 A;  4M9S A;  2QZ4 A;  4WUR A;  1GVN A;  4DV7 M;  1IXZ A;  3T1Y M;  2KA6 B;  4LZZ A;  5ITX E;  1HNW M;  4QHS A;  4LRT A;  3R8F A;  4AW4 A;  1HQY E;  2C5R A;  2YNM D;  4IIW A;  3GP1 A;  2XZF A;  4KLN A;  5E26 A;  2XSZ A;  1GKI A;  4MGI E;  1E9S A;  4I8O A;  4NL4 H;  3KOW E;  4GC9 A;  4DUY M;  2Y0Q A;  1TH2 A;  3A42 A;  4LFC M;  4LFB M;  1XMQ M;  1QZM A;  3SAT A;  3GLH B;  5EJC A;  2KW0 A;  4GKK M;  3GRU A;  4YY3 M;  1HT2 E;  3VK7 A;  4JI5 M;  5C18 A;  1QAM A;  2QCU A;  3HU2 A;  5BR8 M;  1HR0 M;  4DR3 M;  1N34 M;  4HL4 A;  4MGK E;  2QEN A;  3UK6 A;  3HHX A;  3L29 A;  1G3I A;  2VQE M;  4QNR A;  1IN8 A;  4NSR A;  4EIW A;  1IXS B;  3KP1 E;  3L27 A;  2FOI C;  3HGI A;  4GRI A;  4NXM M;  3D8L A;  3I51 A;  3LMM A;  4II7 A;  4X65 M;  1FNN A;  2Y0T A;  2KXE A;  2ZAM A;  7CAT A;  2Y20 A;  3GPP A;  1DGH B;  5E6J A;  4JXJ A;  3GO8 A;  3FTF A;  4QNM A;  1VDD A;  1QAO A;  2M5Z A;  1JR3 D;  3GRR A;  2Z4R A;  5EXT A;  1R6B X;  4AKI A;  3VFD A;  4FVM A;  3KFU G;  1J09 A;  3HJS A;  2CV2 A;  3E4R A;  4I5S A;  4IBC A;  2C99 A;  5KQ8 A;  4D82 A;  3GQ5 A;  3M6A A;  3B9P A;  5H37 D;  3WHK A;  2CEA A;  4DR2 M;  5KO3 A;  1E32 A;  2LWX A;  1L2D A;  1NY6 A;  2C96 A;  2W82 A;  4NRW A;  5EQT A;  1TH3 A;  1Q3B A;  5C1B A;  4QOS A;  5ITQ A;  4LJ6 A;  5KPZ A;  4B7F A;  1J5E M;  1IN7 A;  3SAU A;  2QPA A;  4DR4 M;  3RFW A;  1XWI A;  4RF0 A;  4LCB A;  1J7K A;  2AHM A;  1IN4 A;  1LV7 A;  2ZBK B;  3NBI A;  4OX9 M;  2F4V M;  5FLX S;  2Q2E B;  4GC5 A;  4MB7 A;  2XH9 A;  5DYI A;  3THG A;  4LJ4 A;  1X37 A;  2HL7 A;  2G5G X;  4KHP M;  2F5N A;  1N36 M;  3I4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...