4B3MM

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3mM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3mM02
5ITXE 4DUYM 3DOAA 1PJJA 3GQ3A 1MU5A 5ITXA 4PDGA 4YHHM 3U6SA 4YY3M 1Z5AA 2F4VM 2OQ4A 1Z59A 4X65M 3SARA 4MB7A 4PDIA 4DV6M 1PM5A 3TWLA 1IBKM 3TWKA 3J80S 2F5QA 5IWAM 4PCZA 3C58A 4LF6M 1MX0A 3SATA 1N36M 5ITQA 4LF4M 4JI4M 4LF7M 4DR7M 3GPUA 4DV1M 2ZM6M 1R2ZA 4OX9M 5LMNM 3SBJA 4G4OA 3U6LA 2F5PA 1L2BA 4LFCM 3GP1A 4K0KM 2UXDM 3SASA 4B3SM 4NRWA 3GPYA 1XNQM 3TWMA 1K3XA 4JI3M 4DV0M 1FJGM 4JI2M 4CISA 3JR4A 1I94M 3VK7A 1J5EM 4LF9M 2OPFA 3U6MA 1KFVA 4JV5M 4X62M 2UUCM 1L2CA 4AQYM 1HNXM 4B3TM 4JI6M 1HNZM 4GKKM 4X66M 1N34M 4LFAM 3T1YM 5A2QS 3U6DA 3GO8A 2F5OA 4DR2M 1R2YA 2Q2EB 1HR0M 1NNJA 4JI1M 4DR1M 2UXBM 1N32M 4DR6M 1XMOM 4LF5M 1IBLM 3VK8A 3GQ4A 3J81S 2VQEM 1Q3BA 4NXMM 3A45A 4NRVA 2UUBM 2UXCM 4DR3M 2E5LM 5ITYA 2UUAM 1L1TA 1K3WA 4LFBM 4G4QA 4JI8M 2HKJA 4DV2M 2F5NA 4DUZM 1XNRM 3U6PA 3GPPA 2UU9M 1L1ZA 3SAVA 3U6QA 3SAWA 4DR5M 5BR8M 1N33M 3GPXA 3A46A 4DV3M 4JI7M 1Z5CA 3U6CA 1HNWM 3T1HM 3U6EA 3W0FA 3JR5A 2HHHM 3J7AS 4JYAM 1Z5BA 1Q39A 4JI5M 4KHPM 1TDZA 1XMQM 3A42A 4DV7M 4PD2A 4ITQA 4B3RM 4GKJM 1Q3CA 4DV5M 5IT9S 5ITRA 4DR4M 2ZBKB 5LMUM 3JAMS 4G4RA 3U6OA 4B3MM 4NXNM 1XC8A 3SAUA 5ITTA 4X64M 4G4NA 1TDHA 5ITUA 2EA0A 4DV4M 2VQFM 2F5SA 4LF8M 1EE8A 1L2DA 2XZUA 3GQ5A 1K82A 5FLXS 1IBMM 1PJIA 2XZFA 3OTOM 4JI0M
chains in the Genus database with same CATH superfamily
2DVWB 3T6PA 4DUYM 2YFQA 2CWBA 1MU5A 5F3WA 2MR9A 4PDGA 1G4AE 4Z8XA 2C5RA 1J09A 3VLFB 2O5RA 2YR0A 1Z59A 4PT5A 4X65M 2ERCA 3HY5A 3SARA 3PVSA 3KXEC 3SYLA 1YSYA 3HKPA 4XGIA 1OKSA 3KP0E 2F5QA 2BWEA 5EXPA 2CV2A 1SXJB 2Z7JA 2WZJA 3B7ZA 4LJ6A 4QNRA 2QQ8A 1IN5A 4LGYA 1N36M 4WURA 4LF7M 1IXSB 4DV1M 3AOEA 3D8BA 2EKFA 2HWJA 4OX9M 1V92A 3U6LA 3WHKA 2QENA 3HX3A 4UN2B 4LFCM 4AZFA 2KNZA 4NRWA 1R4GA 2ZAOA 1N75A 3TL4X 3GPYA 3SHFA 3C3DA 2RGOA 5FTJA 2JA2A 2VF8A 1ZQ9A 3KOWE 2LVNC 4RF1A 1G3IA 1VDLA 4EIWA 3JR4A 1E9RA 3C3EA 2RGHA 4A3VB 3GLHB 4JXJA 3U6MA 1KFVA 4X62M 2K0BX 1TH4A 2UUCM 3FUXA 3HJ8A 4GH9A 4B3TM 1QAQA 1EFUB 1PJTA 2DNAA 1JB0F 2JP7A 5A2QS 4AKIA 3GLIB 2F5OA 2FOIC 3HGIA 4IBIA 4DR2M 1JQJC 1HR0M 1QDTA 1VDDA 3FE3A 2KNAA 4AG5A 4JI1M 1OJLA 1IN4A 1IXRC 3HZJA 2Z8YM 4LF5M 4S12A 3SHGB 1IXZA 2VQEM 1NVMA 4Q7JA 1IY1A 4NXMM 4M9ZA 1PRBA 1NY6A 3M0EA 4B7FA 3E46A 5ITYA 3TE6A 2O25A 2UUAM 5EP4A 1TR8A 1VG5A 2JUJA 4LFBM 4MGYE 1XNRM 4DUZM 4LRTA 2CEAA 2L6OA 3L25A 2L09A 3KP1E 2XH9A 1G71A 3MJ5A 3KOXE 4AKHA 5IZ7D 2W82A 1N33M 5FTLA 1GLNA 3I4VA 2X49A 4R3DA 2FNAA 2BWBA 2A5YB 2JXNA 1V34A 5JI2E 8CATA 4IBEA 1Q39A 4JI5M 2ZAMA 3E4RA 2DZOB 2L2DA 3CF0A 3TPZA 3A42A 3ZCBB 1D0LA 3FTFA 4LY6A 1ORYB 2KDLA 2R6FA 2OOBA 3ZC7B 1TTEA 3LQRA 4DR4M 3VDPA 1LTMA 3LCVB 1RU3A 2KNVA 4B3RM 4NXNM 1XC8A 2MGWA 2XSZA 4BBAA 2RRUA 2XGNA 5EJCA 3U5ZB 1F4IA 2JZ1A 1XB2B 3QYEA 5DYGA 5ITUA 3GLGE 1HQYE 4DV4M 5KQ8A 2Y0TA 4CJ6A 2LVPC 2KXEA 4FWGA 4G6ZA 4OVZA 1NSFA 2R4JA 4ZPXA 2XZUA 1L2DA 2FE8A 4KO8A 3LQQA 4M9SA 2R65A 1D2NA 4LJ5A 4LG2A 3IG5A 1XHBA 2EKKA 3GQ3A 2BNKA 2I7PA 3U6SA 1PGYA 2F4VM 2LWXA 2OQ4A 2J7NA 1YUBA 4MB7A 1Y8GA 3SMSA 4DV6M 1D0KA 4GC9A 1IY2A 3TWLA 2HAKA 2R0IA 4IIWA 3J2PB 4L16A 2X4AA 5E26A 5BPVA 5IWAM 4IBGA 1R7RA 3KSJA 4Z6YA 3RE8A 1QUTA 3AKZA 3FRHA 2Z4SA 1MX0A 4WW0A 3NBXX 3GRVA 3H4MA 3TQSA 3GPUA 2ZM6M 2R4EA 1V33A 2QCUA 2R18A 3RFWA 4K0KM 3B7QA 2KA6B 4FW9A 2LVOC 3FD9A 4B3SM 3BOSA 3FYDA 1IN7A 3KDSE 3GLGB 1HJPA 1SXJA 2X8AA 1K3XA 3FTEA 3KS8A 4CGYB 4DV0M 2QBYA 1KYIA 4JI2M 2XF3A 3LCUA 2JY8A 3GLHE 1T3TA 3MMPA 1SXJD 2Z4RA 4JV5M 1L2CA 4QOSA 4P16A 4JI6M 3CTWB 4X66M 1QYRA 3T1YM 2P5TA 4WP2A 4Y28F 1JR3E 4GHLA 1NNJA 2ZTCA 2KRUA 2GQFA 5GKNA 3W67A 2B3TA 3B89A 1XMOM 3GLFB 3VK8A 2DWMA 3J81S 2DZLA 2ZANA 2L7IA 3GLHA 3GRYA 4NSRA 3WHLA 4NRVA 3K9OA 3SC3A 1IXSA 5EP2A 2JZ0A 1XXHB 1DGFA 1OTRA 1T43A 4G4QA 1QVRA 4B7HA 2C99A 2K6BA 2F5NA 3HHXA 3AFHA 4B7GA 2CP8A 4MGKE 1IM2A 7CATA 1HQCA 1PJQA 5FSWA 3SAVA 2J5YA 2OOAA 4HLQA 4FCVA 1AIPC 2KZUA 1C1KA 4DR5M 2XFTA 3UK6A 1LV7A 4NSOB 4R7GA 4JI7M 1Z5CA 1IN6A 1HNWM 3IHPA 3T1HM 2UU9M 4I8OA 3U6EA 3H4JA 4OW0A 5DNYA 3T38A 2R46A 3JR5A 3GLFA 2WSFF 1NNUC 1S3SA 2R45A 1R5LA 2DXIA 3J7AS 4IBDA 4FWHA 1I4WA 1Z5BA 4II7A 5C1BA 1OQYA 3GLFE 1D0MA 2H1RA 2Y20A 4QHSA 5EXSA 2J7OA 4PD2A 3UMMA 1XMQM 1WR1B 3IECA 3PNVA 3SYKA 3EIHA 1Q3CA 3C9PA 1C7YA 3B9PA 2YNMD 4RF0A 2ZBKB 3U6OA 2LTUA 2KRKA 1T6OA 4GEWA 4P17A 4HEOA 1NJGA 1P3QQ 1E32A 3GRUA 3J27B 1ZMWA 3K9PA 4LZZA 3AOEC 4KLNA 4G4NA 2H5XA 2QHOB 3UZUA 2VQFM 3W0LB 1GKIA 4AKGA 2HCBA 3SMPA 2NQ8C 3GLGA 3LVVA 3W68A 1WJ7A 2LNHC 2C96A 2CUZA 3V76A 3DOAA 1H6UA 3FYCA 3I04M 2JNHA 5JI3E 2D7GA 5ITXA 4YHHM 4GRIA 4YY3M 2DAIA 3Q8GA 3PNYA 3KS4A 1NO1A 3FUWA 4PDIA 2QPAA 4XK8F 2DAEA 3DFZA 1W5TA 3UGJA 2QNJA 5DFLA 1IBKM 2CRUA 3TWKA 4GIPA 4PCZA 5FTKA 3C58A 4D81A 4XBOA 4LF6M 1AUAA 2XLJA 1HT1E 4M0WA 3GLIA 5ITQA 2CV0A 4LF4M 2I7NA 3CGWA 1TH3A 2AHMA 4MH0E 2V1UA 1UFZA 1GL7A 3KW6A 4GMQA 4JI4M 1YE9A 3K2LA 1TH2A 4D80A 1R2ZA 1UM8A 3SBJA 4G4OA 1WXQA 2F5PA 1L2BA 1WGLA 3GP1A 3GRRA 5EXXA 3DZDA 2EUCA 3B74A 4F2LA 4GC5A 2EO2A 3TWMA 3I51A 2Y21A 1GVNA 2C98A 3FKEA 2XEPA 1FJGM 2GNOA 2QSFX 1OIZA 5EP3A 1DGBA 4RNAA 4MGHA 1I94M 2BJVA 4L8RC 2QZ4A 1ZMUA 4GITA 4AQYM 1HNXM 4GKKM 4AI6A 3BBZA 1N34M 4LFAM 1QQWA 2R44A 3I4YA 3U6DA 2Q2EB 1QZEA 3K1JA 4DR1M 3E9SA 1N32M 2UXBM 3L2AA 3F92A 2R62A 3ZH9B 4DR6M 1R6BX 2OO9A 4TUWA 3GQ4A 3CF2A 3U61B 3HJQA 2JY7A 3KSXA 3A45A 1XWIA 1DGGA 4FCTA 2UXCM 1GO5A 3HWSA 2K9DA 2DENA 3HU1A 1L1TA 2KW0A 1ZV1A 2HKJA 4DV2M 3QWLA 3U6PA 2MROB 1N77A 4IJFA 1J7KA 3U60B 4W5WA 3DA1A 3M6AA 3U5ZA 2QBYB 4IBKA 5BR8M 1OAOC 1W5SA 1WIVA 2L4EA 4GHAA 1ZMVA 3GPXA 1N78A 5C18A 1IQPA 3AJIB 2MJ5B 2LBCA 3T15A 1MN3A 2G5GX 3W0FA 4AW4A 1OFIA 1Z6TA 1QANA 2HHHM 4QOZC 3VFDA 5IREB 4LGMA 3R8FA 2DWLA 4OU7A 4HL4A 4JYAM 3KOYE 2CHVA 4LJAA 4R71A 1OIPA 4AG6A 3K8ZA 4GKJM 4L4UA 3CF6E 2DHYA 2CV1A 4NC6A 1DV0A 1HT2E 5KPRA 4FD2A 5IT9S 5ITRA 4IBBA 2FFJA 4KT0F 5LMUM 4OVZB 3JAMS 4L6V6 1L8QA 2VDBB 1JR3A 3SAUA 2K47A 1E9SA 4M9XA 1PJSA 1NHGC 5FTNA 5ITTA 4X64M 2LH0A 3LMMA 4IBCA 4QNMA 2APLA 3HHWA 3HU3A 3L26A 2F5SA 4LF8M 1SG9A 4LRSA 2VF7A 3MK6A 4DBGB 2M60A 3AOGA 3FUVA 5FLXS 1K82A 1IBMM 2M5ZA 3VDUA 2XZFA 1XXHE 3J7BA 2VIIA 2KZSA 1NHWC 4JI0M 2D7EA 1WGNA 5ITXE 1SXJE 5EP1A 1PJJA 3KFUG 4IBFA 2HL7A 1QAOA 3AL0C 2DKLA 5E6JA 2LXEA 4MGIE 1GJSA 1DGHA 2L4FA 4MM3B 4LJ7A 1Z5AA 1IY0A 4I4LA 3LW5F 1NY5A 3EIEA 2XFSA 3LVWA 1PM5A 2C9CA 2N35A 2JY6B 3RGPA 3VKHA 1WHCA 4LZJA 3J80S 5L8RF 2JWSA 4NL4H 1G59A 3FUTA 2G3QA 1FNNA 3L27A 1GJTA 3SATA 3SFZA 1GL6A 3K92A 1G41A 1QDRA 1QUSA 1VEGA 1OAIA 2MH8A 4I5SA 4IBJA 3NBIA 4DR7M 3IG8A 4KODA 3A98B 5LMNM 3R9XB 1Q02A 1OFHA 1CUKA 1E94E 2UXDM 2YQZA 3SASA 3HU2A 1NJFA 4L78A 4LJ9A 1XNQM 2KHHA 2C9OA 1VEJA 4JI3M 4JN6A 1QZMA 2XSZD 2RKOA 4REZA 3UJNA 1A5TA 3NWLA 4CISA 4B08A 2EJSA 3VK7A 1J5EM 4LF9M 1EIJA 2Y0QA 2OPFA 3U61A 4LCBA 3BXWA 1HNZM 1KSFX 3I01M 2DI0A 2DZNB 4BLCA 2LVAA 4RKUF 1IFYA 3GO8A 2O01F 3PXGA 1R2YA 3QYBA 1VEKA 5FTMA 3KVWA 2Z3XA 2DWZB 1TGUA 4LJ4A 3U60A 1DO2A 3VKGA 2DAGA 1IBLM 3L29A 1Q3BA 2V6ZM 2DAMA 1XXHA 2FS1A 2V1CA 3ZQJA 5EQTA 4BB9A 2UUBM 2CHQA 4DR3M 2E5LM 4M0DA 2D7HA 1K3WA 1GABA 4JI8M 2DWNA 1YLAA 2WSCF 1IN8A 3M7GA 5EXTA 3GPPA 2G8LA 2WSEF 3FUUA 1L1ZA 1MJGM 1TF0B 2FH0A 3U6QA 1BVSA 3AV0A 2LHGA 4IJEA 3SAWA 4ANRA 5KO3A 3MHVC 3GLIE 3A46A 4DV3M 3U6CA 4LJ8A 1ZAEA 3THGA 4FWDA 4I81A 3PFIA 3HHYA 1DO0A 3Q8XA 5H37D 3L28A 3RGSA 3QAUA 4KHPM 4CHTB 5KPZA 1TDZA 2KEBA 4ITQA 3E21A 1NV8A 3HHZA 4DV7M 1JR3D 2DHRA 1QAMA 3FTDA 4L15A 4D82A 3FRIA 4DV5M 3KOZE 2DAKA 5KQDA 1X37A 2CFOA 5KPTA 4G4RA 4B3MM 1VQ1A 2CE7A 2LHCA 3D8LA 4QHTA 1G8PA 2JY5A 4MGZE 4FVMA 5DYIA 1DGHB 1TDHA 2EA0A 1NV9A 2ZTDA 1SXJC 1EE8A 2QP9X 4CIZA 3HJSA 3GQ5A 3FTCA 4F1IA 4FCWA 2BJWA 3B7NA 2L7HA 3ILKA 1PJIA 4G3OA 4NOOB 2LVQD 3OTOM 2CHGA
chains in the Genus database with same CATH topology
2DVWB 4DUYM 2YFQA 1MU5A 5F3WA 4PDGA 1G4AE 4Z8XA 2C5RA 1J09A 3VLFB 2O5RA 2YR0A 1Z59A 4PT5A 4X65M 2ERCA 3SARA 3PVSA 3KXEC 3SYLA 1YSYA 3HKPA 4XGIA 3KP0E 2F5QA 5EXPA 2CV2A 1SXJB 2Z7JA 4LJ6A 4QNRA 1IN5A 4LGYA 1N36M 4WURA 4LF7M 1IXSB 4DV1M 3AOEA 3D8BA 4OX9M 3U6LA 3WHKA 2QENA 4LFCM 4AZFA 4NRWA 2ZAOA 3GPYA 1N75A 3TL4X 3SHFA 2RGOA 5FTJA 2JA2A 1ZQ9A 3KOWE 4RF1A 1G3IA 4EIWA 3JR4A 1E9RA 2RGHA 4A3VB 3GLHB 4JXJA 3U6MA 1KFVA 4X62M 1TH4A 2UUCM 3FUXA 3HJ8A 4GH9A 4B3TM 1QAQA 5A2QS 4AKIA 3GLIB 2F5OA 2FOIC 3HGIA 4IBIA 4DR2M 1JQJC 1HR0M 1VDDA 4AG5A 4JI1M 1OJLA 1IN4A 1IXRC 4LF5M 4S12A 3SHGB 1IXZA 2VQEM 1NVMA 4NXMM 1IY1A 4M9ZA 3M0EA 1NY6A 4B7FA 3TE6A 5ITYA 2UUAM 5EP4A 4LFBM 4MGYE 1XNRM 4DUZM 4LRTA 2CEAA 2L6OA 3L25A 2L09A 3KP1E 2XH9A 3MJ5A 4AKHA 3KOXE 5IZ7D 2W82A 1N33M 5FTLA 1GLNA 3I4VA 2X49A 4R3DA 2FNAA 2A5YB 5JI2E 8CATA 4IBEA 1Q39A 4JI5M 2ZAMA 3E4RA 2DZOB 3CF0A 3TPZA 3A42A 3ZCBB 3FTFA 4LY6A 1ORYB 3ZC7B 3LQRA 4DR4M 3VDPA 4NXNM 1XC8A 2XSZA 4BBAA 2XGNA 5EJCA 3U5ZB 5DYGA 5ITUA 1HQYE 4DV4M 5KQ8A 2Y0TA 4OVZA 4FWGA 4G6ZA 2KXEA 4ZPXA 1NSFA 2R4JA 2XZUA 1L2DA 2FE8A 4KO8A 3LQQA 4M9SA 2R65A 1D2NA 4LJ5A 4LG2A 3IG5A 1XHBA 3GQ3A 2BNKA 2I7PA 3U6SA 2F4VM 2LWXA 2OQ4A 2J7NA 1YUBA 4MB7A 3SMSA 4DV6M 4GC9A 1IY2A 3TWLA 4IIWA 3J2PB 4L16A 2X4AA 5E26A 5BPVA 5IWAM 4IBGA 1R7RA 3KSJA 4Z6YA 3RE8A 3AKZA 2Z4SA 1MX0A 4WW0A 3GRVA 3H4MA 3TQSA 3GPUA 2ZM6M 2R4EA 2QCUA 2R18A 3RFWA 4K0KM 2KA6B 4FW9A 3FD9A 4B3SM 3BOSA 3FYDA 1IN7A 3KDSE 3GLGB 1K3XA 1SXJA 2X8AA 3FTEA 3KS8A 4CGYB 4DV0M 2QBYA 1KYIA 4JI2M 2XF3A 1T3TA 1SXJD 2Z4RA 4JV5M 1L2CA 4QOSA 4P16A 4JI6M 3CTWB 4X66M 1QYRA 3T1YM 2P5TA 4GHLA 1NNJA 2KRUA 5GKNA 1XMOM 3GLFB 3VK8A 2DWMA 3J81S 2ZANA 2L7IA 3GLHA 3GRYA 4NSRA 3WHLA 4NRVA 3SC3A 5EP2A 1XXHB 1DGFA 4G4QA 1QVRA 4B7HA 2C99A 2F5NA 3HHXA 3AFHA 4B7GA 4MGKE 1IM2A 7CATA 1HQCA 3SAVA 5FSWA 4HLQA 4FCVA 2KZUA 1C1KA 4DR5M 2XFTA 3UK6A 1LV7A 4NSOB 4R7GA 4JI7M 1Z5CA 1IN6A 1HNWM 3T1HM 4I8OA 3U6EA 4OW0A 5DNYA 3T38A 2R46A 3JR5A 3GLFA 1NNUC 1S3SA 2R45A 2DXIA 3J7AS 4IBDA 4FWHA 1I4WA 1Z5BA 4II7A 5C1BA 2H1RA 4QHSA 2Y20A 5EXSA 4PD2A 2J7OA 3UMMA 1XMQM 4B3RM 3SYKA 3PNVA 3EIHA 1Q3CA 3B9PA 2YNMD 4RF0A 2ZBKB 3U6OA 2KRKA 1NJGA 1E32A 3GRUA 3J27B 4G4NA 4LZZA 3AOEC 4KLNA 3UZUA 2VQFM 3W0LB 1GKIA 4AKGA 2HCBA 3SMPA 2NQ8C 3GLGA 3LVVA 2LNHC 2C96A 2CUZA 3DOAA 1H6UA 3FYCA 5JI3E 2D7GA 5ITXA 4YHHM 4GRIA 4YY3M 3PNYA 3KS4A 3FUWA 4PDIA 2QPAA 3DFZA 1W5TA 3UGJA 1IBKM 3TWKA 4GIPA 4PCZA 5FTKA 3C58A 4D81A 4XBOA 4LF6M 2XLJA 1HT1E 4M0WA 3GLIA 5ITQA 2CV0A 4LF4M 2I7NA 4MH0E 1TH3A 2AHMA 2V1UA 4GMQA 1GL7A 3KW6A 4JI4M 1YE9A 3K2LA 1TH2A 4D80A 1R2ZA 1UM8A 3SBJA 4G4OA 1WXQA 2F5PA 1L2BA 3GP1A 3GRRA 5EXXA 3DZDA 2EUCA 4GC5A 2EO2A 3TWMA 3I51A 2Y21A 1GVNA 2C98A 3FKEA 2XEPA 1FJGM 5EP3A 1DGBA 4RNAA 4MGHA 1I94M 2BJVA 4L8RC 2QZ4A 4GITA 4AQYM 1HNXM 4GKKM 4AI6A 1N34M 4LFAM 1QQWA 3I4YA 3U6DA 2Q2EB 3K1JA 4DR1M 3E9SA 1N32M 2UXBM 3L2AA 3ZH9B 2R62A 4DR6M 1R6BX 4TUWA 3GQ4A 3CF2A 3U61B 3HJQA 3KSXA 3A45A 1XWIA 1DGGA 4FCTA 2UXCM 3HWSA 3HU1A 1L1TA 2KW0A 2HKJA 4DV2M 3QWLA 3U6PA 1N77A 4IJFA 1J7KA 3U60B 4W5WA 3DA1A 3M6AA 3U5ZA 2QBYB 4IBKA 5BR8M 1W5SA 4GHAA 3GPXA 1N78A 5C18A 1IQPA 3AJIB 3T15A 2G5GX 3W0FA 4AW4A 1OFIA 1Z6TA 1QANA 2HHHM 4QOZC 3VFDA 5IREB 4LGMA 3R8FA 2DWLA 4OU7A 4HL4A 4JYAM 3KOYE 2CHVA 4LJAA 4AG6A 3K8ZA 4GKJM 4L4UA 3CF6E 2CV1A 1HT2E 5KPRA 4FD2A 5IT9S 5ITRA 4IBBA 2FFJA 5LMUM 4OVZB 3JAMS 1L8QA 1JR3A 3SAUA 2K47A 1E9SA 4M9XA 5FTNA 1NHGC 5ITTA 4X64M 2LH0A 3LMMA 4IBCA 4QNMA 3HHWA 2F5SA 3HU3A 3L26A 4LF8M 4LRSA 3MK6A 1K82A 2M60A 3AOGA 3FUVA 5FLXS 1IBMM 2M5ZA 3VDUA 2XZFA 3J7BA 2VIIA 2KZSA 1NHWC 4JI0M 2D7EA 5ITXE 1SXJE 5EP1A 1PJJA 3KFUG 4IBFA 2HL7A 1QAOA 3AL0C 5E6JA 2LXEA 4MGIE 1DGHA 4MM3B 4LJ7A 1Z5AA 1IY0A 4I4LA 1NY5A 3EIEA 2XFSA 3LVWA 1PM5A 2C9CA 3RGPA 3VKHA 4LZJA 3J80S 4NL4H 1G59A 3FUTA 1FNNA 3L27A 3SATA 3SFZA 1GL6A 3K92A 1G41A 4IBJA 4I5SA 4DR7M 3NBIA 3IG8A 4KODA 3A98B 5LMNM 3R9XB 1OFHA 2UXDM 1E94E 2YQZA 3SASA 3HU2A 1NJFA 4L78A 4LJ9A 1XNQM 2C9OA 4JI3M 4JN6A 1QZMA 2XSZD 2RKOA 4REZA 3UJNA 3NWLA 4CISA 4B08A 3VK7A 1J5EM 4LF9M 2Y0QA 2OPFA 3U61A 4LCBA 1HNZM 1KSFX 2DZNB 4BLCA 3GO8A 3PXGA 1R2YA 5FTMA 3KVWA 2Z3XA 2DWZB 1TGUA 4LJ4A 3U60A 1DO2A 3VKGA 1IBLM 3L29A 1Q3BA 2V6ZM 1XXHA 2V1CA 4BB9A 5EQTA 2UUBM 2CHQA 4DR3M 2E5LM 4M0DA 2D7HA 1K3WA 4JI8M 2DWNA 1IN8A 3M7GA 5EXTA 3GPPA 2G8LA 1L1ZA 3FUUA 2UU9M 3U6QA 3AV0A 4IJEA 3SAWA 5KO3A 3MHVC 3A46A 4DV3M 3U6CA 4LJ8A 1ZAEA 3THGA 4FWDA 4I81A 3PFIA 3HHYA 1DO0A 3Q8XA 5H37D 3L28A 3RGSA 3QAUA 4KHPM 4CHTB 5KPZA 1TDZA 2KEBA 4ITQA 3HHZA 4DV7M 1JR3D 2DHRA 1QAMA 3FTDA 4L15A 4D82A 4DV5M 3KOZE 5KQDA 1X37A 2CFOA 5KPTA 4G4RA 4B3MM 2CE7A 3D8LA 4QHTA 1G8PA 4MGZE 4FVMA 5DYIA 1DGHB 1TDHA 2EA0A 1SXJC 1EE8A 2QP9X 3HJSA 3GQ5A 3FTCA 4FCWA 2BJWA 2L7HA 3ILKA 1PJIA 4NOOB 3OTOM 2CHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITX E;  4DUY M;  3DOA A;  1PJJ A;  3GQ3 A;  1MU5 A;  5ITX A;  4PDG A;  4YHH M;  3U6S A;  4YY3 M;  1Z5A A;  2F4V M;  2OQ4 A;  1Z59 A;  4X65 M;  3SAR A;  4MB7 A;  4PDI A;  4DV6 M;  1PM5 A;  3TWL A;  1IBK M;  3TWK A;  3J80 S;  2F5Q A;  5IWA M;  4PCZ A;  3C58 A;  4LF6 M;  1MX0 A;  3SAT A;  1N36 M;  5ITQ A;  4LF4 M;  4JI4 M;  4LF7 M;  4DR7 M;  3GPU A;  4DV1 M;  2ZM6 M;  1R2Z A;  4OX9 M;  5LMN M;  3SBJ A;  4G4O A;  3U6L A;  2F5P A;  1L2B A;  4LFC M;  3GP1 A;  4K0K M;  2UXD M;  3SAS A;  4B3S M;  4NRW A;  3GPY A;  1XNQ M;  3TWM A;  1K3X A;  4JI3 M;  4DV0 M;  1FJG M;  4JI2 M;  4CIS A;  3JR4 A;  1I94 M;  3VK7 A;  1J5E M;  4LF9 M;  2OPF A;  3U6M A;  1KFV A;  4JV5 M;  4X62 M;  2UUC M;  1L2C A;  4AQY M;  1HNX M;  4B3T M;  4JI6 M;  1HNZ M;  4GKK M;  4X66 M;  1N34 M;  4LFA M;  3T1Y M;  5A2Q S;  3U6D A;  3GO8 A;  2F5O A;  4DR2 M;  1R2Y A;  2Q2E B;  1HR0 M;  1NNJ A;  4JI1 M;  4DR1 M;  2UXB M;  1N32 M;  4DR6 M;  1XMO M;  4LF5 M;  1IBL M;  3VK8 A;  3GQ4 A;  3J81 S;  2VQE M;  1Q3B A;  4NXM M;  3A45 A;  4NRV A;  2UUB M;  2UXC M;  4DR3 M;  2E5L M;  5ITY A;  2UUA M;  1L1T A;  1K3W A;  4LFB M;  4G4Q A;  4JI8 M;  2HKJ A;  4DV2 M;  2F5N A;  4DUZ M;  1XNR M;  3U6P A;  3GPP A;  2UU9 M;  1L1Z A;  3SAV A;  3U6Q A;  3SAW A;  4DR5 M;  5BR8 M;  1N33 M;  3GPX A;  3A46 A;  4DV3 M;  4JI7 M;  1Z5C A;  3U6C A;  1HNW M;  3T1H M;  3U6E A;  3W0F A;  3JR5 A;  2HHH M;  3J7A S;  4JYA M;  1Z5B A;  1Q39 A;  4JI5 M;  4KHP M;  1TDZ A;  1XMQ M;  3A42 A;  4DV7 M;  4PD2 A;  4ITQ A;  4B3R M;  4GKJ M;  1Q3C A;  4DV5 M;  5IT9 S;  5ITR A;  4DR4 M;  2ZBK B;  5LMU M;  3JAM S;  4G4R A;  3U6O A;  4B3M M;  4NXN M;  1XC8 A;  3SAU A;  5ITT A;  4X64 M;  4G4N A;  1TDH A;  5ITU A;  2EA0 A;  4DV4 M;  2VQF M;  2F5S A;  4LF8 M;  1EE8 A;  1L2D A;  2XZU A;  3GQ5 A;  1K82 A;  5FLX S;  1IBM M;  1PJI A;  2XZF A;  3OTO M;  4JI0 M; 
#chains in the Genus database with same CATH topology
 2DVW B;  3T6P A;  4DUY M;  2YFQ A;  2CWB A;  1MU5 A;  5F3W A;  2MR9 A;  4PDG A;  1G4A E;  4Z8X A;  2C5R A;  1J09 A;  3VLF B;  2O5R A;  2YR0 A;  1Z59 A;  4PT5 A;  4X65 M;  2ERC A;  3HY5 A;  3SAR A;  3PVS A;  3KXE C;  3SYL A;  1YSY A;  3HKP A;  4XGI A;  1OKS A;  3KP0 E;  2F5Q A;  2BWE A;  5EXP A;  2CV2 A;  1SXJ B;  2Z7J A;  2WZJ A;  3B7Z A;  4LJ6 A;  4QNR A;  2QQ8 A;  1IN5 A;  4LGY A;  1N36 M;  4WUR A;  4LF7 M;  1IXS B;  4DV1 M;  3AOE A;  3D8B A;  2EKF A;  2HWJ A;  4OX9 M;  1V92 A;  3U6L A;  3WHK A;  2QEN A;  3HX3 A;  4UN2 B;  4LFC M;  4AZF A;  2KNZ A;  4NRW A;  1R4G A;  2ZAO A;  1N75 A;  3TL4 X;  3GPY A;  3SHF A;  3C3D A;  2RGO A;  5FTJ A;  2JA2 A;  2VF8 A;  1ZQ9 A;  3KOW E;  2LVN C;  4RF1 A;  1G3I A;  1VDL A;  4EIW A;  3JR4 A;  1E9R A;  3C3E A;  2RGH A;  4A3V B;  3GLH B;  4JXJ A;  3U6M A;  1KFV A;  4X62 M;  2K0B X;  1TH4 A;  2UUC M;  3FUX A;  3HJ8 A;  4GH9 A;  4B3T M;  1QAQ A;  1EFU B;  1PJT A;  2DNA A;  1JB0 F;  2JP7 A;  5A2Q S;  4AKI A;  3GLI B;  2F5O A;  2FOI C;  3HGI A;  4IBI A;  4DR2 M;  1JQJ C;  1HR0 M;  1QDT A;  1VDD A;  3FE3 A;  2KNA A;  4AG5 A;  4JI1 M;  1OJL A;  1IN4 A;  1IXR C;  3HZJ A;  2Z8Y M;  4LF5 M;  4S12 A;  3SHG B;  1IXZ A;  2VQE M;  1NVM A;  4Q7J A;  1IY1 A;  4NXM M;  4M9Z A;  1PRB A;  1NY6 A;  3M0E A;  4B7F A;  3E46 A;  5ITY A;  3TE6 A;  2O25 A;  2UUA M;  5EP4 A;  1TR8 A;  1VG5 A;  2JUJ A;  4LFB M;  4MGY E;  1XNR M;  4DUZ M;  4LRT A;  2CEA A;  2L6O A;  3L25 A;  2L09 A;  3KP1 E;  2XH9 A;  1G71 A;  3MJ5 A;  3KOX E;  4AKH A;  5IZ7 D;  2W82 A;  1N33 M;  5FTL A;  1GLN A;  3I4V A;  2X49 A;  4R3D A;  2FNA A;  2BWB A;  2A5Y B;  2JXN A;  1V34 A;  5JI2 E;  8CAT A;  4IBE A;  1Q39 A;  4JI5 M;  2ZAM A;  3E4R A;  2DZO B;  2L2D A;  3CF0 A;  3TPZ A;  3A42 A;  3ZCB B;  1D0L A;  3FTF A;  4LY6 A;  1ORY B;  2KDL A;  2R6F A;  2OOB A;  3ZC7 B;  1TTE A;  3LQR A;  4DR4 M;  3VDP A;  1LTM A;  3LCV B;  1RU3 A;  2KNV A;  4B3R M;  4NXN M;  1XC8 A;  2MGW A;  2XSZ A;  4BBA A;  2RRU A;  2XGN A;  5EJC A;  3U5Z B;  1F4I A;  2JZ1 A;  1XB2 B;  3QYE A;  5DYG A;  5ITU A;  3GLG E;  1HQY E;  4DV4 M;  5KQ8 A;  2Y0T A;  4CJ6 A;  2LVP C;  2KXE A;  4FWG A;  4G6Z A;  4OVZ A;  1NSF A;  2R4J A;  4ZPX A;  2XZU A;  1L2D A;  2FE8 A;  4KO8 A;  3LQQ A;  4M9S A;  2R65 A;  1D2N A;  4LJ5 A;  4LG2 A;  3IG5 A;  1XHB A;  2EKK A;  3GQ3 A;  2BNK A;  2I7P A;  3U6S A;  1PGY A;  2F4V M;  2LWX A;  2OQ4 A;  2J7N A;  1YUB A;  4MB7 A;  1Y8G A;  3SMS A;  4DV6 M;  1D0K A;  4GC9 A;  1IY2 A;  3TWL A;  2HAK A;  2R0I A;  4IIW A;  3J2P B;  4L16 A;  2X4A A;  5E26 A;  5BPV A;  5IWA M;  4IBG A;  1R7R A;  3KSJ A;  4Z6Y A;  3RE8 A;  1QUT A;  3AKZ A;  3FRH A;  2Z4S A;  1MX0 A;  4WW0 A;  3NBX X;  3GRV A;  3H4M A;  3TQS A;  3GPU A;  2ZM6 M;  2R4E A;  1V33 A;  2QCU A;  2R18 A;  3RFW A;  4K0K M;  3B7Q A;  2KA6 B;  4FW9 A;  2LVO C;  3FD9 A;  4B3S M;  3BOS A;  3FYD A;  1IN7 A;  3KDS E;  3GLG B;  1HJP A;  1SXJ A;  2X8A A;  1K3X A;  3FTE A;  3KS8 A;  4CGY B;  4DV0 M;  2QBY A;  1KYI A;  4JI2 M;  2XF3 A;  3LCU A;  2JY8 A;  3GLH E;  1T3T A;  3MMP A;  1SXJ D;  2Z4R A;  4JV5 M;  1L2C A;  4QOS A;  4P16 A;  4JI6 M;  3CTW B;  4X66 M;  1QYR A;  3T1Y M;  2P5T A;  4WP2 A;  4Y28 F;  1JR3 E;  4GHL A;  1NNJ A;  2ZTC A;  2KRU A;  2GQF A;  5GKN A;  3W67 A;  2B3T A;  3B89 A;  1XMO M;  3GLF B;  3VK8 A;  2DWM A;  3J81 S;  2DZL A;  2ZAN A;  2L7I A;  3GLH A;  3GRY A;  4NSR A;  3WHL A;  4NRV A;  3K9O A;  3SC3 A;  1IXS A;  5EP2 A;  2JZ0 A;  1XXH B;  1DGF A;  1OTR A;  1T43 A;  4G4Q A;  1QVR A;  4B7H A;  2C99 A;  2K6B A;  2F5N A;  3HHX A;  3AFH A;  4B7G A;  2CP8 A;  4MGK E;  1IM2 A;  7CAT A;  1HQC A;  1PJQ A;  5FSW A;  3SAV A;  2J5Y A;  2OOA A;  4HLQ A;  4FCV A;  1AIP C;  2KZU A;  1C1K A;  4DR5 M;  2XFT A;  3UK6 A;  1LV7 A;  4NSO B;  4R7G A;  4JI7 M;  1Z5C A;  1IN6 A;  1HNW M;  3IHP A;  3T1H M;  2UU9 M;  4I8O A;  3U6E A;  3H4J A;  4OW0 A;  5DNY A;  3T38 A;  2R46 A;  3JR5 A;  3GLF A;  2WSF F;  1NNU C;  1S3S A;  2R45 A;  1R5L A;  2DXI A;  3J7A S;  4IBD A;  4FWH A;  1I4W A;  1Z5B A;  4II7 A;  5C1B A;  1OQY A;  3GLF E;  1D0M A;  2H1R A;  2Y20 A;  4QHS A;  5EXS A;  2J7O A;  4PD2 A;  3UMM A;  1XMQ M;  1WR1 B;  3IEC A;  3PNV A;  3SYK A;  3EIH A;  1Q3C A;  3C9P A;  1C7Y A;  3B9P A;  2YNM D;  4RF0 A;  2ZBK B;  3U6O A;  2LTU A;  2KRK A;  1T6O A;  4GEW A;  4P17 A;  4HEO A;  1NJG A;  1P3Q Q;  1E32 A;  3GRU A;  3J27 B;  1ZMW A;  3K9P A;  4LZZ A;  3AOE C;  4KLN A;  4G4N A;  2H5X A;  2QHO B;  3UZU A;  2VQF M;  3W0L B;  1GKI A;  4AKG A;  2HCB A;  3SMP A;  2NQ8 C;  3GLG A;  3LVV A;  3W68 A;  1WJ7 A;  2LNH C;  2C96 A;  2CUZ A;  3V76 A;  3DOA A;  1H6U A;  3FYC A;  3I04 M;  2JNH A;  5JI3 E;  2D7G A;  5ITX A;  4YHH M;  4GRI A;  4YY3 M;  2DAI A;  3Q8G A;  3PNY A;  3KS4 A;  1NO1 A;  3FUW A;  4PDI A;  2QPA A;  4XK8 F;  2DAE A;  3DFZ A;  1W5T A;  3UGJ A;  2QNJ A;  5DFL A;  1IBK M;  2CRU A;  3TWK A;  4GIP A;  4PCZ A;  5FTK A;  3C58 A;  4D81 A;  4XBO A;  4LF6 M;  1AUA A;  2XLJ A;  1HT1 E;  4M0W A;  3GLI A;  5ITQ A;  2CV0 A;  4LF4 M;  2I7N A;  3CGW A;  1TH3 A;  2AHM A;  4MH0 E;  2V1U A;  1UFZ A;  1GL7 A;  3KW6 A;  4GMQ A;  4JI4 M;  1YE9 A;  3K2L A;  1TH2 A;  4D80 A;  1R2Z A;  1UM8 A;  3SBJ A;  4G4O A;  1WXQ A;  2F5P A;  1L2B A;  1WGL A;  3GP1 A;  3GRR A;  5EXX A;  3DZD A;  2EUC A;  3B74 A;  4F2L A;  4GC5 A;  2EO2 A;  3TWM A;  3I51 A;  2Y21 A;  1GVN A;  2C98 A;  3FKE A;  2XEP A;  1FJG M;  2GNO A;  2QSF X;  1OIZ A;  5EP3 A;  1DGB A;  4RNA A;  4MGH A;  1I94 M;  2BJV A;  4L8R C;  2QZ4 A;  1ZMU A;  4GIT A;  4AQY M;  1HNX M;  4GKK M;  4AI6 A;  3BBZ A;  1N34 M;  4LFA M;  1QQW A;  2R44 A;  3I4Y A;  3U6D A;  2Q2E B;  1QZE A;  3K1J A;  4DR1 M;  3E9S A;  1N32 M;  2UXB M;  3L2A A;  3F92 A;  2R62 A;  3ZH9 B;  4DR6 M;  1R6B X;  2OO9 A;  4TUW A;  3GQ4 A;  3CF2 A;  3U61 B;  3HJQ A;  2JY7 A;  3KSX A;  3A45 A;  1XWI A;  1DGG A;  4FCT A;  2UXC M;  1GO5 A;  3HWS A;  2K9D A;  2DEN A;  3HU1 A;  1L1T A;  2KW0 A;  1ZV1 A;  2HKJ A;  4DV2 M;  3QWL A;  3U6P A;  2MRO B;  1N77 A;  4IJF A;  1J7K A;  3U60 B;  4W5W A;  3DA1 A;  3M6A A;  3U5Z A;  2QBY B;  4IBK A;  5BR8 M;  1OAO C;  1W5S A;  1WIV A;  2L4E A;  4GHA A;  1ZMV A;  3GPX A;  1N78 A;  5C18 A;  1IQP A;  3AJI B;  2MJ5 B;  2LBC A;  3T15 A;  1MN3 A;  2G5G X;  3W0F A;  4AW4 A;  1OFI A;  1Z6T A;  1QAN A;  2HHH M;  4QOZ C;  3VFD A;  5IRE B;  4LGM A;  3R8F A;  2DWL A;  4OU7 A;  4HL4 A;  4JYA M;  3KOY E;  2CHV A;  4LJA A;  4R71 A;  1OIP A;  4AG6 A;  3K8Z A;  4GKJ M;  4L4U A;  3CF6 E;  2DHY A;  2CV1 A;  4NC6 A;  1DV0 A;  1HT2 E;  5KPR A;  4FD2 A;  5IT9 S;  5ITR A;  4IBB A;  2FFJ A;  4KT0 F;  5LMU M;  4OVZ B;  3JAM S;  4L6V 6;  1L8Q A;  2VDB B;  1JR3 A;  3SAU A;  2K47 A;  1E9S A;  4M9X A;  1PJS A;  1NHG C;  5FTN A;  5ITT A;  4X64 M;  2LH0 A;  3LMM A;  4IBC A;  4QNM A;  2APL A;  3HHW A;  3HU3 A;  3L26 A;  2F5S A;  4LF8 M;  1SG9 A;  4LRS A;  2VF7 A;  3MK6 A;  4DBG B;  2M60 A;  3AOG A;  3FUV A;  5FLX S;  1K82 A;  1IBM M;  2M5Z A;  3VDU A;  2XZF A;  1XXH E;  3J7B A;  2VII A;  2KZS A;  1NHW C;  4JI0 M;  2D7E A;  1WGN A;  5ITX E;  1SXJ E;  5EP1 A;  1PJJ A;  3KFU G;  4IBF A;  2HL7 A;  1QAO A;  3AL0 C;  2DKL A;  5E6J A;  2LXE A;  4MGI E;  1GJS A;  1DGH A;  2L4F A;  4MM3 B;  4LJ7 A;  1Z5A A;  1IY0 A;  4I4L A;  3LW5 F;  1NY5 A;  3EIE A;  2XFS A;  3LVW A;  1PM5 A;  2C9C A;  2N35 A;  2JY6 B;  3RGP A;  3VKH A;  1WHC A;  4LZJ A;  3J80 S;  5L8R F;  2JWS A;  4NL4 H;  1G59 A;  3FUT A;  2G3Q A;  1FNN A;  3L27 A;  1GJT A;  3SAT A;  3SFZ A;  1GL6 A;  3K92 A;  1G41 A;  1QDR A;  1QUS A;  1VEG A;  1OAI A;  2MH8 A;  4I5S A;  4IBJ A;  3NBI A;  4DR7 M;  3IG8 A;  4KOD A;  3A98 B;  5LMN M;  3R9X B;  1Q02 A;  1OFH A;  1CUK A;  1E94 E;  2UXD M;  2YQZ A;  3SAS A;  3HU2 A;  1NJF A;  4L78 A;  4LJ9 A;  1XNQ M;  2KHH A;  2C9O A;  1VEJ A;  4JI3 M;  4JN6 A;  1QZM A;  2XSZ D;  2RKO A;  4REZ A;  3UJN A;  1A5T A;  3NWL A;  4CIS A;  4B08 A;  2EJS A;  3VK7 A;  1J5E M;  4LF9 M;  1EIJ A;  2Y0Q A;  2OPF A;  3U61 A;  4LCB A;  3BXW A;  1HNZ M;  1KSF X;  3I01 M;  2DI0 A;  2DZN B;  4BLC A;  2LVA A;  4RKU F;  1IFY A;  3GO8 A;  2O01 F;  3PXG A;  1R2Y A;  3QYB A;  1VEK A;  5FTM A;  3KVW A;  2Z3X A;  2DWZ B;  1TGU A;  4LJ4 A;  3U60 A;  1DO2 A;  3VKG A;  2DAG A;  1IBL M;  3L29 A;  1Q3B A;  2V6Z M;  2DAM A;  1XXH A;  2FS1 A;  2V1C A;  3ZQJ A;  5EQT A;  4BB9 A;  2UUB M;  2CHQ A;  4DR3 M;  2E5L M;  4M0D A;  2D7H A;  1K3W A;  1GAB A;  4JI8 M;  2DWN A;  1YLA A;  2WSC F;  1IN8 A;  3M7G A;  5EXT A;  3GPP A;  2G8L A;  2WSE F;  3FUU A;  1L1Z A;  1MJG M;  1TF0 B;  2FH0 A;  3U6Q A;  1BVS A;  3AV0 A;  2LHG A;  4IJE A;  3SAW A;  4ANR A;  5KO3 A;  3MHV C;  3GLI E;  3A46 A;  4DV3 M;  3U6C A;  4LJ8 A;  1ZAE A;  3THG A;  4FWD A;  4I81 A;  3PFI A;  3HHY A;  1DO0 A;  3Q8X A;  5H37 D;  3L28 A;  3RGS A;  3QAU A;  4KHP M;  4CHT B;  5KPZ A;  1TDZ A;  2KEB A;  4ITQ A;  3E21 A;  1NV8 A;  3HHZ A;  4DV7 M;  1JR3 D;  2DHR A;  1QAM A;  3FTD A;  4L15 A;  4D82 A;  3FRI A;  4DV5 M;  3KOZ E;  2DAK A;  5KQD A;  1X37 A;  2CFO A;  5KPT A;  4G4R A;  4B3M M;  1VQ1 A;  2CE7 A;  2LHC A;  3D8L A;  4QHT A;  1G8P A;  2JY5 A;  4MGZ E;  4FVM A;  5DYI A;  1DGH B;  1TDH A;  2EA0 A;  1NV9 A;  2ZTD A;  1SXJ C;  1EE8 A;  2QP9 X;  4CIZ A;  3HJS A;  3GQ5 A;  3FTC A;  4F1I A;  4FCW A;  2BJW A;  3B7N A;  2L7H A;  3ILK A;  1PJI A;  4G3O A;  4NOO B;  2LVQ D;  3OTO M;  2CHG A; 
#chains in the Genus database with same CATH homology
 2DVW B;  4DUY M;  2YFQ A;  1MU5 A;  5F3W A;  4PDG A;  1G4A E;  4Z8X A;  2C5R A;  1J09 A;  3VLF B;  2O5R A;  2YR0 A;  1Z59 A;  4PT5 A;  4X65 M;  2ERC A;  3SAR A;  3PVS A;  3KXE C;  3SYL A;  1YSY A;  3HKP A;  4XGI A;  3KP0 E;  2F5Q A;  5EXP A;  2CV2 A;  1SXJ B;  2Z7J A;  4LJ6 A;  4QNR A;  1IN5 A;  4LGY A;  1N36 M;  4WUR A;  4LF7 M;  1IXS B;  4DV1 M;  3AOE A;  3D8B A;  4OX9 M;  3U6L A;  3WHK A;  2QEN A;  4LFC M;  4AZF A;  4NRW A;  2ZAO A;  3GPY A;  1N75 A;  3TL4 X;  3SHF A;  2RGO A;  5FTJ A;  2JA2 A;  1ZQ9 A;  3KOW E;  4RF1 A;  1G3I A;  4EIW A;  3JR4 A;  1E9R A;  2RGH A;  4A3V B;  3GLH B;  4JXJ A;  3U6M A;  1KFV A;  4X62 M;  1TH4 A;  2UUC M;  3FUX A;  3HJ8 A;  4GH9 A;  4B3T M;  1QAQ A;  5A2Q S;  4AKI A;  3GLI B;  2F5O A;  2FOI C;  3HGI A;  4IBI A;  4DR2 M;  1JQJ C;  1HR0 M;  1VDD A;  4AG5 A;  4JI1 M;  1OJL A;  1IN4 A;  1IXR C;  4LF5 M;  4S12 A;  3SHG B;  1IXZ A;  2VQE M;  1NVM A;  4NXM M;  1IY1 A;  4M9Z A;  3M0E A;  1NY6 A;  4B7F A;  3TE6 A;  5ITY A;  2UUA M;  5EP4 A;  4LFB M;  4MGY E;  1XNR M;  4DUZ M;  4LRT A;  2CEA A;  2L6O A;  3L25 A;  2L09 A;  3KP1 E;  2XH9 A;  3MJ5 A;  4AKH A;  3KOX E;  5IZ7 D;  2W82 A;  1N33 M;  5FTL A;  1GLN A;  3I4V A;  2X49 A;  4R3D A;  2FNA A;  2A5Y B;  5JI2 E;  8CAT A;  4IBE A;  1Q39 A;  4JI5 M;  2ZAM A;  3E4R A;  2DZO B;  3CF0 A;  3TPZ A;  3A42 A;  3ZCB B;  3FTF A;  4LY6 A;  1ORY B;  3ZC7 B;  3LQR A;  4DR4 M;  3VDP A;  4NXN M;  1XC8 A;  2XSZ A;  4BBA A;  2XGN A;  5EJC A;  3U5Z B;  5DYG A;  5ITU A;  1HQY E;  4DV4 M;  5KQ8 A;  2Y0T A;  4OVZ A;  4FWG A;  4G6Z A;  2KXE A;  4ZPX A;  1NSF A;  2R4J A;  2XZU A;  1L2D A;  2FE8 A;  4KO8 A;  3LQQ A;  4M9S A;  2R65 A;  1D2N A;  4LJ5 A;  4LG2 A;  3IG5 A;  1XHB A;  3GQ3 A;  2BNK A;  2I7P A;  3U6S A;  2F4V M;  2LWX A;  2OQ4 A;  2J7N A;  1YUB A;  4MB7 A;  3SMS A;  4DV6 M;  4GC9 A;  1IY2 A;  3TWL A;  4IIW A;  3J2P B;  4L16 A;  2X4A A;  5E26 A;  5BPV A;  5IWA M;  4IBG A;  1R7R A;  3KSJ A;  4Z6Y A;  3RE8 A;  3AKZ A;  2Z4S A;  1MX0 A;  4WW0 A;  3GRV A;  3H4M A;  3TQS A;  3GPU A;  2ZM6 M;  2R4E A;  2QCU A;  2R18 A;  3RFW A;  4K0K M;  2KA6 B;  4FW9 A;  3FD9 A;  4B3S M;  3BOS A;  3FYD A;  1IN7 A;  3KDS E;  3GLG B;  1K3X A;  1SXJ A;  2X8A A;  3FTE A;  3KS8 A;  4CGY B;  4DV0 M;  2QBY A;  1KYI A;  4JI2 M;  2XF3 A;  1T3T A;  1SXJ D;  2Z4R A;  4JV5 M;  1L2C A;  4QOS A;  4P16 A;  4JI6 M;  3CTW B;  4X66 M;  1QYR A;  3T1Y M;  2P5T A;  4GHL A;  1NNJ A;  2KRU A;  5GKN A;  1XMO M;  3GLF B;  3VK8 A;  2DWM A;  3J81 S;  2ZAN A;  2L7I A;  3GLH A;  3GRY A;  4NSR A;  3WHL A;  4NRV A;  3SC3 A;  5EP2 A;  1XXH B;  1DGF A;  4G4Q A;  1QVR A;  4B7H A;  2C99 A;  2F5N A;  3HHX A;  3AFH A;  4B7G A;  4MGK E;  1IM2 A;  7CAT A;  1HQC A;  3SAV A;  5FSW A;  4HLQ A;  4FCV A;  2KZU A;  1C1K A;  4DR5 M;  2XFT A;  3UK6 A;  1LV7 A;  4NSO B;  4R7G A;  4JI7 M;  1Z5C A;  1IN6 A;  1HNW M;  3T1H M;  4I8O A;  3U6E A;  4OW0 A;  5DNY A;  3T38 A;  2R46 A;  3JR5 A;  3GLF A;  1NNU C;  1S3S A;  2R45 A;  2DXI A;  3J7A S;  4IBD A;  4FWH A;  1I4W A;  1Z5B A;  4II7 A;  5C1B A;  2H1R A;  4QHS A;  2Y20 A;  5EXS A;  4PD2 A;  2J7O A;  3UMM A;  1XMQ M;  4B3R M;  3SYK A;  3PNV A;  3EIH A;  1Q3C A;  3B9P A;  2YNM D;  4RF0 A;  2ZBK B;  3U6O A;  2KRK A;  1NJG A;  1E32 A;  3GRU A;  3J27 B;  4G4N A;  4LZZ A;  3AOE C;  4KLN A;  3UZU A;  2VQF M;  3W0L B;  1GKI A;  4AKG A;  2HCB A;  3SMP A;  2NQ8 C;  3GLG A;  3LVV A;  2LNH C;  2C96 A;  2CUZ A;  3DOA A;  1H6U A;  3FYC A;  5JI3 E;  2D7G A;  5ITX A;  4YHH M;  4GRI A;  4YY3 M;  3PNY A;  3KS4 A;  3FUW A;  4PDI A;  2QPA A;  3DFZ A;  1W5T A;  3UGJ A;  1IBK M;  3TWK A;  4GIP A;  4PCZ A;  5FTK A;  3C58 A;  4D81 A;  4XBO A;  4LF6 M;  2XLJ A;  1HT1 E;  4M0W A;  3GLI A;  5ITQ A;  2CV0 A;  4LF4 M;  2I7N A;  4MH0 E;  1TH3 A;  2AHM A;  2V1U A;  4GMQ A;  1GL7 A;  3KW6 A;  4JI4 M;  1YE9 A;  3K2L A;  1TH2 A;  4D80 A;  1R2Z A;  1UM8 A;  3SBJ A;  4G4O A;  1WXQ A;  2F5P A;  1L2B A;  3GP1 A;  3GRR A;  5EXX A;  3DZD A;  2EUC A;  4GC5 A;  2EO2 A;  3TWM A;  3I51 A;  2Y21 A;  1GVN A;  2C98 A;  3FKE A;  2XEP A;  1FJG M;  5EP3 A;  1DGB A;  4RNA A;  4MGH A;  1I94 M;  2BJV A;  4L8R C;  2QZ4 A;  4GIT A;  4AQY M;  1HNX M;  4GKK M;  4AI6 A;  1N34 M;  4LFA M;  1QQW A;  3I4Y A;  3U6D A;  2Q2E B;  3K1J A;  4DR1 M;  3E9S A;  1N32 M;  2UXB M;  3L2A A;  3ZH9 B;  2R62 A;  4DR6 M;  1R6B X;  4TUW A;  3GQ4 A;  3CF2 A;  3U61 B;  3HJQ A;  3KSX A;  3A45 A;  1XWI A;  1DGG A;  4FCT A;  2UXC M;  3HWS A;  3HU1 A;  1L1T A;  2KW0 A;  2HKJ A;  4DV2 M;  3QWL A;  3U6P A;  1N77 A;  4IJF A;  1J7K A;  3U60 B;  4W5W A;  3DA1 A;  3M6A A;  3U5Z A;  2QBY B;  4IBK A;  5BR8 M;  1W5S A;  4GHA A;  3GPX A;  1N78 A;  5C18 A;  1IQP A;  3AJI B;  3T15 A;  2G5G X;  3W0F A;  4AW4 A;  1OFI A;  1Z6T A;  1QAN A;  2HHH M;  4QOZ C;  3VFD A;  5IRE B;  4LGM A;  3R8F A;  2DWL A;  4OU7 A;  4HL4 A;  4JYA M;  3KOY E;  2CHV A;  4LJA A;  4AG6 A;  3K8Z A;  4GKJ M;  4L4U A;  3CF6 E;  2CV1 A;  1HT2 E;  5KPR A;  4FD2 A;  5IT9 S;  5ITR A;  4IBB A;  2FFJ A;  5LMU M;  4OVZ B;  3JAM S;  1L8Q A;  1JR3 A;  3SAU A;  2K47 A;  1E9S A;  4M9X A;  5FTN A;  1NHG C;  5ITT A;  4X64 M;  2LH0 A;  3LMM A;  4IBC A;  4QNM A;  3HHW A;  2F5S A;  3HU3 A;  3L26 A;  4LF8 M;  4LRS A;  3MK6 A;  1K82 A;  2M60 A;  3AOG A;  3FUV A;  5FLX S;  1IBM M;  2M5Z A;  3VDU A;  2XZF A;  3J7B A;  2VII A;  2KZS A;  1NHW C;  4JI0 M;  2D7E A;  5ITX E;  1SXJ E;  5EP1 A;  1PJJ A;  3KFU G;  4IBF A;  2HL7 A;  1QAO A;  3AL0 C;  5E6J A;  2LXE A;  4MGI E;  1DGH A;  4MM3 B;  4LJ7 A;  1Z5A A;  1IY0 A;  4I4L A;  1NY5 A;  3EIE A;  2XFS A;  3LVW A;  1PM5 A;  2C9C A;  3RGP A;  3VKH A;  4LZJ A;  3J80 S;  4NL4 H;  1G59 A;  3FUT A;  1FNN A;  3L27 A;  3SAT A;  3SFZ A;  1GL6 A;  3K92 A;  1G41 A;  4IBJ A;  4I5S A;  4DR7 M;  3NBI A;  3IG8 A;  4KOD A;  3A98 B;  5LMN M;  3R9X B;  1OFH A;  2UXD M;  1E94 E;  2YQZ A;  3SAS A;  3HU2 A;  1NJF A;  4L78 A;  4LJ9 A;  1XNQ M;  2C9O A;  4JI3 M;  4JN6 A;  1QZM A;  2XSZ D;  2RKO A;  4REZ A;  3UJN A;  3NWL A;  4CIS A;  4B08 A;  3VK7 A;  1J5E M;  4LF9 M;  2Y0Q A;  2OPF A;  3U61 A;  4LCB A;  1HNZ M;  1KSF X;  2DZN B;  4BLC A;  3GO8 A;  3PXG A;  1R2Y A;  5FTM A;  3KVW A;  2Z3X A;  2DWZ B;  1TGU A;  4LJ4 A;  3U60 A;  1DO2 A;  3VKG A;  1IBL M;  3L29 A;  1Q3B A;  2V6Z M;  1XXH A;  2V1C A;  4BB9 A;  5EQT A;  2UUB M;  2CHQ A;  4DR3 M;  2E5L M;  4M0D A;  2D7H A;  1K3W A;  4JI8 M;  2DWN A;  1IN8 A;  3M7G A;  5EXT A;  3GPP A;  2G8L A;  1L1Z A;  3FUU A;  2UU9 M;  3U6Q A;  3AV0 A;  4IJE A;  3SAW A;  5KO3 A;  3MHV C;  3A46 A;  4DV3 M;  3U6C A;  4LJ8 A;  1ZAE A;  3THG A;  4FWD A;  4I81 A;  3PFI A;  3HHY A;  1DO0 A;  3Q8X A;  5H37 D;  3L28 A;  3RGS A;  3QAU A;  4KHP M;  4CHT B;  5KPZ A;  1TDZ A;  2KEB A;  4ITQ A;  3HHZ A;  4DV7 M;  1JR3 D;  2DHR A;  1QAM A;  3FTD A;  4L15 A;  4D82 A;  4DV5 M;  3KOZ E;  5KQD A;  1X37 A;  2CFO A;  5KPT A;  4G4R A;  4B3M M;  2CE7 A;  3D8L A;  4QHT A;  1G8P A;  4MGZ E;  4FVM A;  5DYI A;  1DGH B;  1TDH A;  2EA0 A;  1SXJ C;  1EE8 A;  2QP9 X;  3HJS A;  3GQ5 A;  3FTC A;  4FCW A;  2BJW A;  2L7H A;  3ILK A;  1PJI A;  4NOO B;  3OTO M;  2CHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...