4B3TM

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3tM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3tM02
4NRVA 1L2CA 4JI0M 4DR2M 2F5QA 4DR1M 4LF9M 3U6SA 4B3MM 4JV5M 4DV0M 1IBKM 4YY3M 5ITXE 1K3WA 4DV5M 1TDHA 4G4RA 4DUYM 2HHHM 4GKJM 1Z5AA 1MU5A 4LF7M 4PDGA 1HNZM 3W0FA 4DV1M 4ITQA 3JR5A 1N32M 4NXMM 1Q3BA 4G4NA 3SASA 1IBLM 4JI1M 4CISA 3J80S 4B3SM 1R2YA 3SAVA 4PDIA 4X62M 1K82A 5ITXA 4DV7M 3DOAA 2XZFA 4G4QA 3VK7A 2UXDM 3JAMS 4NRWA 3T1YM 2F4VM 3U6EA 1L1TA 1NNJA 3SATA 3TWKA 1EE8A 5IT9S 3VK8A 1Z5BA 3U6LA 4DV2M 4AQYM 2HKJA 1L1ZA 1R2ZA 1L2BA 2F5OA 4JI7M 1XNQM 1Z5CA 4PD2A 1XNRM 3J81S 4JI5M 1IBMM 1PJIA 1J5EM 4DV4M 2F5PA 3GPPA 2ZM6M 4DR3M 4JI2M 5IWAM 2OPFA 4DR6M 3GQ4A 4X64M 3SARA 5ITQA 2XZUA 3A46A 4DR4M 4LFBM 1XMQM 4PCZA 3JR4A 2UUBM 1TDZA 1N34M 3C58A 1FJGM 4B3RM 4MB7A 2UXCM 4G4OA 3OTOM 1KFVA 1HNWM 5ITYA 5ITUA 2VQFM 1Q39A 5LMNM 4JI6M 4X66M 5ITTA 2UUAM 2UU9M 1MX0A 3GQ3A 1Z59A 1PM5A 4K0KM 4DR7M 5LMUM 5FLXS 4LF4M 3SAUA 2VQEM 3TWLA 5A2QS 3U6QA 4LF8M 4NXNM 5ITRA 2ZBKB 3GPUA 5BR8M 1K3XA 4LF5M 4DR5M 2F5NA 4JI4M 4LFAM 2EA0A 4DV3M 3U6PA 1L2DA 2UUCM 4DUZM 4JI8M 3GPYA 3U6CA 2E5LM 3J7AS 4YHHM 4GKKM 4DV6M 4LFCM 2OQ4A 3GQ5A 4LF6M 3GO8A 3A45A 4X65M 3U6OA 4OX9M 1XC8A 3U6DA 3GP1A 2F5SA 3A42A 1I94M 1HNXM 3GPXA 4JYAM 1N36M 2UXBM 3TWMA 3T1HM 1PJJA 4JI3M 1Q3CA 3SBJA 4KHPM 2Q2EB 3U6MA 4B3TM 3SAWA 1HR0M 1XMOM 1N33M
chains in the Genus database with same CATH superfamily
4NRVA 1WGNA 3MK6A 3C9PA 1HT2E 1FNNA 2Y0QA 3FYCA 4DR2M 2F5QA 4DR1M 4LJAA 4PT5A 4LF9M 3DZDA 2LHGA 2LWXA 3GLHE 1IBKM 4CJ6A 2DWMA 2K47A 2L09A 5FTKA 3AOGA 2GNOA 4I4LA 1OFIA 5EJCA 3I51A 1R6BX 4DV5M 1V34A 2HHHM 4GKJM 2KRUA 2I7NA 3SYLA 1HQCA 1AIPC 4LJ7A 1HNZM 4DV1M 3U61A 2HCBA 4LGYA 2EUCA 3FTEA 1IXZA 1DO2A 1UM8A 1TR8A 2JY7A 4OU7A 1NHWC 1YSYA 2WSEF 5DYGA 3J80S 1W5SA 3D8LA 1EIJA 2BJWA 2OO9A 2LTUA 2Y21A 4G6ZA 2H1RA 3GLHA 4DV7M 3R9XB 2X49A 3KP0E 3KSJA 1IN7A 2XEPA 4G4QA 2XZFA 1T3TA 3VK7A 1N77A 2UXDM 2L6OA 3WHKA 3T1YM 2KW0A 2R4JA 3L2AA 3FD9A 1Y8GA 4IBGA 4RNAA 2RGOA 5EP1A 3SATA 4L16A 3PXGA 5FSWA 1EE8A 1PRBA 3HJQA 5FTNA 1Z5BA 3GLIB 3VK8A 4AQYM 1XNQM 5IT9S 1NSFA 5FTLA 1OFHA 1IXSA 1L2BA 1Z5CA 4R3DA 4M9XA 1XNRM 4B7FA 3J81S 4JI5M 1XHBA 3PVSA 3QYBA 3TL4X 2QBYA 1KYIA 1J5EM 1JQJC 3TQSA 3IG5A 4MGIE 1IN4A 3AKZA 1XB2B 3GPPA 4JI2M 2XLJA 3IHPA 4DR6M 1SXJB 4L15A 5EP3A 2KDLA 4LZZA 2R18A 4LJ6A 4CHTB 3U60A 3E21A 4G3OA 1ZMWA 2CFOA 2CHGA 2CP8A 5EXPA 1OQYA 4B3RM 4S12A 4A3VB 4MB7A 1YUBA 3VDUA 2MGWA 4JXJA 2K6BA 3QWLA 2X4AA 3T6PA 5ITYA 3QAUA 2DXIA 4OVZB 3KOWE 2R65A 2XFSA 4OW0A 2AHMA 4JI6M 2L7HA 4QNMA 3GQ3A 1HQYE 3HKPA 3L26A 2LVOC 3U6QA 3B7QA 5DYIA 3GLFE 3GRVA 2LNHC 3FKEA 4MGYE 2J7OA 4NC6A 1XXHE 1XWIA 1Z6TA 1G41A 3HZJA 5EXTA 1VDLA 2F5NA 2KEBA 4B7GA 3HY5A 4L78A 3U6PA 1NHGC 3VKGA 1OJLA 1L2DA 1D2NA 3GLGB 4D80A 4FWHA 3J27B 4R71A 3UJNA 3AL0C 3E9SA 2FH0A 3GQ5A 1VG5A 3U6OA 1NO1A 4AKHA 2F5SA 3HHYA 1XXHA 2YR0A 2XGNA 1YLAA 3A42A 3LCVB 2JXNA 4EIWA 1P3QQ 3AJIB 1WJ7A 1PJJA 3W68A 2ZANA 4L4UA 4JI3M 4NSRA 1E32A 4KODA 3U6MA 3CF2A 2C5RA 4M0WA 1F4IA 1VEKA 1GL6A 3FUVA 1IY2A 4JI0M 2DWNA 2CRUA 2R0IA 1NJGA 4II7A 4HLQA 2YFQA 3TE6A 4B3MM 4YY3M 2O25A 3FYDA 4MM3B 1TDHA 2D7GA 3SHFA 1Z5AA 7CATA 1R5LA 2X8AA 4REZA 4LF7M 1TH2A 5FTJA 4ITQA 3KVWA 1QUSA 3J2PB 4MH0E 3ZH9B 1N75A 3JR5A 1N32M 1IBLM 2QQ8A 1NV8A 4M0DA 4CISA 2LVPC 2VIIA 4GHAA 4QOZC 1DGHA 3KSXA 2APLA 3SAVA 1QVRA 1N33M 3NWLA 4X62M 4KO8A 2KA6B 3DOAA 2V1CA 1TF0B 1T6OA 4I8OA 4W5WA 3GLFB 4LGMA 3JAMS 3CTWB 4NRWA 3C3DA 4AZFA 3H4JA 2HKJA 4LZJA 2XF3A 1BVSA 1E9SA 1IN6A 3R8FA 5JI3E 1G3IA 4BB9A 4FWDA 3FUXA 1SXJC 2D7EA 3FTDA 3PFIA 1D0MA 1GLNA 4LJ4A 1G59A 1OKSA 2ZTDA 5BPVA 2ZM6M 3I04M 5IWAM 1DGGA 2DZNB 3GQ4A 4X64M 2LXEA 3A46A 1EFUB 2JWSA 2CWBA 5F3WA 2CV1A 1J7KA 2C99A 2DZOB 3VLFB 3HHWA 2UUBM 2LBCA 5EXXA 1G4AE 2YQZA 4RKUF 4AW4A 4D81A 1MN3A 3L29A 1KFVA 2LH0A 2LVAA 2JNHA 2KZUA 2L2DA 5KPZA 5KQ8A 2WSCF 3HHXA 1G71A 1PM5A 4GC9A 3ZC7B 2CE7A 1C1KA 4WURA 1NY5A 3RFWA 5FLXS 1OAOC 3SAUA 2VQEM 1D0LA 3T38A 4CGYB 5A2QS 4GHLA 3PNYA 3B7NA 4IBCA 3KDSE 3LQRA 4NXNM 3WHLA 1IY1A 1DO0A 2FNAA 3KS4A 2QZ4A 3NBXX 4LF5M 3SMSA 4DR5M 5IREB 4LFAM 2EA0A 4P16A 4IIWA 3KOYE 3LVVA 1J09A 4DUZM 3C3EA 3EIEA 1QZEA 1A5TA 2KNVA 2DHRA 2Y0TA 4I5SA 4YHHM 4LFCM 3HGIA 4LG2A 3K2LA 4LF6M 3KS8A 4X65M 1ZQ9A 4KT0F 5JI2E 3BOSA 3AOEA 2JUJA 3GLHB 1I94M 1HNXM 1IY0A 1WR1B 2WSFF 1OIZA 2NQ8C 1WIVA 1N36M 2L7IA 2ZAMA 4XK8F 3KP1E 1TGUA 3E4RA 1Q3CA 4KLNA 4KHPM 4L6V6 2Q2EB 3F92A 5C18A 1GVNA 2Y20A 1H6UA 1PGYA 2CEAA 3SAWA 2ZTCA 3GRRA 1IXSB 4IBIA 2QSFX 1L2CA 1QANA 2QBYB 3E46A 3MMPA 2ZAOA 3UZUA 4DV0M 3LQQA 4FWGA 1K3WA 3FE3A 2FE8A 3L28A 2MROB 2VF7A 2Z4RA 2XSZD 5EQTA 3FTFA 2QPAA 1MU5A 4M9ZA 1ZMUA 3HU2A 1L8QA 4PDGA 1JB0F 2V6ZM 2DNAA 2HAKA 3U60B 4NXMM 2OOAA 4XBOA 3SASA 2JY8A 1VEJA 4GEWA 5GKNA 4B3SM 1R2YA 2QP9X 3HU3A 1GL7A 3B7ZA 2MJ5B 3GRYA 1K82A 5FTMA 3LW5F 1NVMA 3FTCA 3FRIA 1GKIA 2N35A 3I4YA 3J7BA 5DNYA 1VEGA 2F4VM 2W82A 1PJSA 3U6EA 1L1TA 3UK6A 3IG8A 4AKIA 4Q7JA 4Z6YA 4FCTA 2B3TA 1HJPA 4DV2M 1R2ZA 4IBKA 2FOIC 1OTRA 4D82A 2JY6B 3RGPA 2DAIA 4LCBA 1T43A 1V92A 2JP7A 2BNKA 1PJIA 1VQ1A 4LJ9A 4L8RC 2XSZA 1NV9A 4DR3M 3SC3A 2KZSA 4IBFA 1TH3A 3FUTA 2J5YA 1WHCA 1MJGM 3SARA 2XZUA 5EP4A 4DR4M 1SXJD 3GLIE 4LFBM 3MHVC 1XMQM 3B89A 1GO5A 2QCUA 2DAKA 1N34M 3NBIA 2MH8A 3C58A 1FJGM 2WZJA 2GQFA 1XXHB 2JZ1A 3DFZA 4IJFA 4G4OA 4NL4H 1TH4A 4LRSA 4NSOB 1HNWM 3Q8GA 5ITUA 5EXSA 2P5TA 2VQFM 3RE8A 5KO3A 1Q39A 2QNJA 4MGZE 5LMNM 2CUZA 4QOSA 2R44A 5ITTA 4WW0A 2EO2A 1DGFA 2UUAM 5IZ7D 1W5TA 4LRTA 3GLIA 2UU9M 4K0KM 1OIPA 5LMUM 3UGJA 4DR7M 2CHQA 1PJTA 2DWLA 1IM2A 4LF8M 2D7HA 2DAGA 3KW6A 2Z3XA 5ITRA 2ZBKB 3KFUG 3GPUA 4HL4A 1LTMA 2KXEA 5BR8M 3VDPA 1K3XA 3VKHA 2DWZB 4WP2A 1SXJA 2H5XA 1G8PA 1D0KA 2KNZA 3BBZA 3AV0A 3M6AA 4FD2A 3U6CA 3U5ZB 2RRUA 2E5LM 2V1UA 4GKKM 1TTEA 2DAEA 3GO8A 3A45A 3M7GA 1Q02A 3PNVA 1XC8A 3IECA 3LMMA 2JZ0A 1DGHB 3U6DA 3GP1A 3TPZA 2Z4SA 1QUTA 4FCWA 3FUUA 4QNRA 2ERCA 2YNMD 4FW9A 4JYAM 2R45A 4GH9A 1NJFA 1ZAEA 2L4FA 4HEOA 4OVZA 4ANRA 4AG5A 3TWMA 4Y28F 4GITA 2DENA 3ZQJA 2XH9A 3SBJA 1NY6A 3THGA 3UMMA 3GLGE 1CUKA 2DKLA 4R7GA 1C7YA 2J7NA 1WGLA 2JY5A 3K8ZA 3I01M 2RKOA 4IBJA 5DFLA 2LVNC 4IJEA 1QQWA 1OAIA 3DA1A 1RU3A 1GJSA 2RGHA 3I4VA 3U6SA 1R4GA 4JV5M 2R4EA 2XFTA 1DV0A 5ITXE 2KRKA 3U61B 1KSFX 1ZMVA 5KPTA 2C9OA 4G4RA 4DUYM 1QAMA 2G8LA 3BXWA 4QHTA 1UFZA 3GLGA 2R46A 1VDDA 3W0FA 3AFHA 2M60A 4AI6A 4I81A 1Q3BA 4G4NA 1E94E 2DZLA 2CV0A 4JI1M 4FVMA 4F2LA 1ORYB 4B7HA 3AOEC 3Q8XA 2BWBA 2R62A 3SMPA 1GJTA 4PDIA 4TUWA 5ITXA 2BWEA 1E9RA 4BLCA 1R7RA 5L8RF 1QAOA 2C98A 1N78A 4F1IA 3HJSA 2KHHA 2QENA 2R6FA 2EJSA 4LY6A 4GC5A 1NNJA 1IFYA 3TWKA 4GRIA 4B08A 1S3SA 1L1ZA 3U6LA 2F5OA 4JI7M 3K92A 3W0LB 2OOBA 4PD2A 2DAMA 2DVWB 2LHCA 3HX3A 3HJ8A 3ILKA 5E6JA 2K0BX 1IBMM 1QYRA 3ZCBB 5E26A 2A5YB 2CV2A 5KPRA 4DV4M 2F5PA 3FRHA 3L25A 3B74A 2EKKA 1QZMA 4RF1A 2KNAA 4GIPA 2DI0A 2OPFA 4JN6A 4Z8XA 2BJVA 5ITQA 2G3QA 5H37D 2FFJA 5EP2A 2K9DA 3CF0A 2C96A 3W67A 4PCZA 3KOZE 1LV7A 3D8BA 3JR4A 3K9OA 1TDZA 1GABA 2M5ZA 1YE9A 1IQPA 3A98B 4ZPXA 2UXCM 3OTOM 3FUWA 4MGHA 4XGIA 1NNUC 4DBGB 3GLFA 1JR3D 2VDBB 3SFZA 4M9SA 3H4MA 4X66M 5C1BA 3SHGB 1MX0A 1Z59A 1QAQA 1QDTA 3HWSA 3LCUA 3HHZA 3KXEC 3T15A 2G5GX 4GMQA 4LF4M 3TWLA 1DGBA 3CGWA 4BBAA 2DHYA 3HU1A 1ZV1A 1PJQA 1QDRA 3V76A 4QHSA 3SYKA 4LJ5A 2Z7JA 1HT1E 3KOXE 2O01F 3M0EA 4JI4M 1IXRC 1JR3E 2I7PA 4DV3M 4P17A 3VFDA 3LVWA 4AG6A 1IN5A 2UUCM 4JI8M 4IBEA 3CF6E 3GPYA 3J7AS 2C9CA 8CATA 4DV6M 2CHVA 2EKFA 2L4EA 2LVQD 2OQ4A 4OX9M 4FCVA 3EIHA 3RGSA 1V33A 1IN8A 2HL7A 4UN2B 3K9PA 3U5ZA 2VF8A 1SXJE 4NOOB 4RF0A 2HWJA 3GRUA 3GPXA 4CIZA 2UXBM 1JR3A 3B9PA 3QYEA 3T1HM 4AKGA 2QHOB 2Z8YM 3MJ5A 1WXQA 1AUAA 2FS1A 2O5RA 2JA2A 2MR9A 1I4WA 5KQDA 4IBBA 3L27A 4B3TM 1SG9A 4IBDA 4LJ8A 1X37A 1HR0M 1XMOM 4MGKE 3K1JA
chains in the Genus database with same CATH topology
4NRVA 3MK6A 1HT2E 1FNNA 2Y0QA 3FYCA 4DR2M 2F5QA 4DR1M 4LJAA 4PT5A 4LF9M 3DZDA 2LWXA 1IBKM 2DWMA 2K47A 2L09A 5FTKA 3AOGA 4I4LA 5EJCA 1OFIA 4DV5M 3I51A 1R6BX 2HHHM 4GKJM 2KRUA 2I7NA 3SYLA 1HQCA 4LJ7A 1HNZM 4DV1M 3U61A 2HCBA 4LGYA 2EUCA 3FTEA 1IXZA 1DO2A 1UM8A 4OU7A 1NHWC 1YSYA 5DYGA 3J80S 1W5SA 3D8LA 2BJWA 2Y21A 4G6ZA 2H1RA 3GLHA 4DV7M 3R9XB 2X49A 3KP0E 3KSJA 1IN7A 2XEPA 4G4QA 2XZFA 1T3TA 3VK7A 1N77A 2UXDM 2L6OA 3WHKA 3T1YM 2KW0A 2R4JA 3L2AA 3FD9A 4IBGA 4RNAA 2RGOA 5EP1A 3SATA 4L16A 3PXGA 5FSWA 1EE8A 3GLIB 3HJQA 5FTNA 1Z5BA 3VK8A 5IT9S 4AQYM 1XNQM 1NSFA 5FTLA 1OFHA 1L2BA 1Z5CA 4R3DA 4M9XA 1XNRM 4B7FA 3J81S 4JI5M 1XHBA 3PVSA 2QBYA 3TL4X 1KYIA 1J5EM 1JQJC 3TQSA 3IG5A 4MGIE 1IN4A 3AKZA 3GPPA 4JI2M 2XLJA 4DR6M 1SXJB 4L15A 5EP3A 4LZZA 2R18A 4LJ6A 4CHTB 3U60A 2CFOA 2CHGA 5EXPA 4B3RM 4S12A 4A3VB 4MB7A 1YUBA 3VDUA 4JXJA 3QWLA 2X4AA 5ITYA 3QAUA 2DXIA 4OVZB 3KOWE 2R65A 2XFSA 4OW0A 2AHMA 4JI6M 2L7HA 4QNMA 3GQ3A 1HQYE 3HKPA 3L26A 3U6QA 5DYIA 3GRVA 2LNHC 3FKEA 4MGYE 2J7OA 1XWIA 1Z6TA 1G41A 5EXTA 2F5NA 2KEBA 4B7GA 4L78A 3U6PA 1NHGC 3VKGA 1OJLA 1L2DA 1D2NA 3GLGB 4D80A 4FWHA 3J27B 3UJNA 3AL0C 3E9SA 3GQ5A 3U6OA 4AKHA 2F5SA 3HHYA 1XXHA 2YR0A 2XGNA 3A42A 4EIWA 3AJIB 1PJJA 2ZANA 4L4UA 4JI3M 4NSRA 1E32A 4KODA 3U6MA 3CF2A 2C5RA 4M0WA 1GL6A 3FUVA 1IY2A 4JI0M 2DWNA 1NJGA 4II7A 4HLQA 2YFQA 3TE6A 4B3MM 4YY3M 3FYDA 4MM3B 1TDHA 2D7GA 3SHFA 1Z5AA 7CATA 4REZA 2X8AA 4LF7M 1TH2A 5FTJA 4ITQA 3KVWA 3J2PB 4MH0E 3JR5A 3ZH9B 1N75A 1N32M 1IBLM 4M0DA 4CISA 2VIIA 4GHAA 4QOZC 1DGHA 3KSXA 3SAVA 1N33M 1QVRA 3NWLA 4X62M 4KO8A 2KA6B 3DOAA 2V1CA 4I8OA 4W5WA 3GLFB 4LGMA 3JAMS 3CTWB 4NRWA 4AZFA 2HKJA 4LZJA 2XF3A 1E9SA 1IN6A 3R8FA 5JI3E 1G3IA 4BB9A 4FWDA 3FUXA 1SXJC 2D7EA 3FTDA 3PFIA 1GLNA 4LJ4A 1G59A 5BPVA 2ZM6M 5IWAM 1DGGA 2DZNB 3GQ4A 4X64M 2LXEA 3A46A 5F3WA 2CV1A 1J7KA 2C99A 2DZOB 3VLFB 3HHWA 2UUBM 5EXXA 1G4AE 2YQZA 4AW4A 4D81A 3L29A 1KFVA 2LH0A 2KZUA 5KPZA 5KQ8A 3HHXA 1PM5A 4GC9A 3ZC7B 2CE7A 1C1KA 4WURA 1NY5A 3RFWA 5FLXS 3SAUA 2VQEM 3T38A 5A2QS 4CGYB 4GHLA 3PNYA 4IBCA 3KDSE 3LQRA 4NXNM 3WHLA 1IY1A 1DO0A 2FNAA 3KS4A 2QZ4A 4LF5M 3SMSA 4DR5M 5IREB 4LFAM 2EA0A 4P16A 4IIWA 3KOYE 3LVVA 1J09A 4DUZM 3EIEA 4I5SA 2Y0TA 2DHRA 4YHHM 4LG2A 4LFCM 3HGIA 3K2LA 4LF6M 3KS8A 4X65M 1ZQ9A 5JI2E 3BOSA 3AOEA 3GLHB 1I94M 1HNXM 1IY0A 1N36M 2NQ8C 2L7IA 2ZAMA 3KP1E 1TGUA 3E4RA 1Q3CA 4KLNA 4KHPM 2Q2EB 5C18A 1GVNA 2Y20A 1H6UA 2CEAA 3SAWA 3GRRA 1IXSB 4IBIA 1L2CA 1QANA 2QBYB 2ZAOA 3UZUA 4DV0M 3LQQA 4FWGA 1K3WA 2FE8A 3L28A 2Z4RA 3FTFA 2XSZD 5EQTA 2QPAA 1MU5A 4M9ZA 3HU2A 1L8QA 4PDGA 2V6ZM 3U60B 4NXMM 4XBOA 3SASA 5GKNA 4B3SM 1R2YA 2QP9X 3HU3A 1GL7A 3GRYA 1K82A 5FTMA 1NVMA 3FTCA 1GKIA 3I4YA 3J7BA 5DNYA 2F4VM 2W82A 3U6EA 1L1TA 3UK6A 3IG8A 4AKIA 4Z6YA 4FCTA 4DV2M 1R2ZA 4IBKA 2FOIC 4D82A 3RGPA 4LCBA 2BNKA 1PJIA 4LJ9A 4L8RC 2XSZA 4DR3M 3SC3A 2KZSA 4IBFA 1TH3A 3FUTA 3SARA 2XZUA 5EP4A 4DR4M 1SXJD 4LFBM 3MHVC 1XMQM 2QCUA 1N34M 3NBIA 3C58A 1FJGM 1XXHB 3DFZA 4IJFA 4G4OA 4NL4H 1TH4A 4LRSA 4NSOB 1HNWM 5ITUA 5EXSA 2P5TA 2VQFM 3RE8A 5KO3A 1Q39A 4MGZE 5LMNM 2CUZA 4QOSA 5ITTA 4WW0A 2EO2A 1DGFA 2UUAM 5IZ7D 1W5TA 4LRTA 3GLIA 2UU9M 4K0KM 4DR7M 5LMUM 3UGJA 2CHQA 2DWLA 1IM2A 4LF8M 2D7HA 3KW6A 2Z3XA 5ITRA 2ZBKB 3KFUG 3GPUA 4HL4A 2KXEA 5BR8M 3VDPA 1K3XA 3VKHA 2DWZB 1SXJA 1G8PA 3U6CA 3M6AA 3AV0A 4FD2A 2E5LM 3U5ZB 4GKKM 2V1UA 3GO8A 3A45A 3M7GA 3PNVA 1XC8A 3LMMA 1DGHB 3U6DA 3GP1A 3TPZA 2Z4SA 4FCWA 3FUUA 4QNRA 2ERCA 2YNMD 4FW9A 4JYAM 2R45A 4GH9A 1NJFA 1ZAEA 4OVZA 3TWMA 4AG5A 4GITA 2XH9A 3SBJA 1NY6A 3THGA 3UMMA 4R7GA 2J7NA 3K8ZA 2RKOA 4IBJA 4IJEA 1QQWA 3DA1A 2RGHA 3I4VA 3U6SA 4JV5M 2R4EA 2XFTA 5ITXE 2KRKA 3U61B 1KSFX 5KPTA 2C9OA 4G4RA 4DUYM 1QAMA 2G8LA 4QHTA 3GLGA 2R46A 1VDDA 3W0FA 3AFHA 2M60A 4AI6A 4I81A 1Q3BA 4G4NA 1E94E 2CV0A 4JI1M 4FVMA 1ORYB 4B7HA 3AOEC 3Q8XA 2R62A 3SMPA 4PDIA 4TUWA 5ITXA 4BLCA 1E9RA 1R7RA 1QAOA 2C98A 1N78A 3HJSA 2QENA 4LY6A 4GC5A 1NNJA 3TWKA 4GRIA 4B08A 1S3SA 1L1ZA 3U6LA 2F5OA 4JI7M 3K92A 3W0LB 4PD2A 2DVWB 3ILKA 3HJ8A 5E6JA 1IBMM 1QYRA 3ZCBB 5E26A 2A5YB 2CV2A 5KPRA 4DV4M 2F5PA 3L25A 1QZMA 4RF1A 4GIPA 2OPFA 4JN6A 4Z8XA 2BJVA 5ITQA 5H37D 2FFJA 5EP2A 3CF0A 2C96A 4PCZA 3KOZE 1LV7A 3D8BA 3JR4A 1TDZA 2M5ZA 1YE9A 1IQPA 3A98B 4ZPXA 2UXCM 3OTOM 3FUWA 4MGHA 4XGIA 1NNUC 3GLFA 1JR3D 3SFZA 4M9SA 3H4MA 4X66M 5C1BA 3SHGB 1MX0A 1Z59A 1QAQA 3HWSA 3HHZA 3KXEC 3T15A 2G5GX 4GMQA 4LF4M 3TWLA 1DGBA 4BBAA 3HU1A 4QHSA 3SYKA 4LJ5A 2Z7JA 1HT1E 3KOXE 3M0EA 4JI4M 1IXRC 4DV3M 2I7PA 3VFDA 3LVWA 4AG6A 1IN5A 2UUCM 4JI8M 4IBEA 3CF6E 3GPYA 3J7AS 2C9CA 8CATA 4DV6M 2CHVA 2OQ4A 4OX9M 4FCVA 3EIHA 3RGSA 1IN8A 2HL7A 3U5ZA 4RF0A 1SXJE 4NOOB 3GRUA 3GPXA 2UXBM 1JR3A 3B9PA 3T1HM 4AKGA 3MJ5A 1WXQA 2O5RA 2JA2A 1I4WA 5KQDA 4IBBA 3L27A 4B3TM 4IBDA 1HR0M 4LJ8A 1X37A 1XMOM 4MGKE 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRV A;  1L2C A;  4JI0 M;  4DR2 M;  2F5Q A;  4DR1 M;  4LF9 M;  3U6S A;  4B3M M;  4JV5 M;  4DV0 M;  1IBK M;  4YY3 M;  5ITX E;  1K3W A;  4DV5 M;  1TDH A;  4G4R A;  4DUY M;  2HHH M;  4GKJ M;  1Z5A A;  1MU5 A;  4LF7 M;  4PDG A;  1HNZ M;  3W0F A;  4DV1 M;  4ITQ A;  3JR5 A;  1N32 M;  4NXM M;  1Q3B A;  4G4N A;  3SAS A;  1IBL M;  4JI1 M;  4CIS A;  3J80 S;  4B3S M;  1R2Y A;  3SAV A;  4PDI A;  4X62 M;  1K82 A;  5ITX A;  4DV7 M;  3DOA A;  2XZF A;  4G4Q A;  3VK7 A;  2UXD M;  3JAM S;  4NRW A;  3T1Y M;  2F4V M;  3U6E A;  1L1T A;  1NNJ A;  3SAT A;  3TWK A;  1EE8 A;  5IT9 S;  3VK8 A;  1Z5B A;  3U6L A;  4DV2 M;  4AQY M;  2HKJ A;  1L1Z A;  1R2Z A;  1L2B A;  2F5O A;  4JI7 M;  1XNQ M;  1Z5C A;  4PD2 A;  1XNR M;  3J81 S;  4JI5 M;  1IBM M;  1PJI A;  1J5E M;  4DV4 M;  2F5P A;  3GPP A;  2ZM6 M;  4DR3 M;  4JI2 M;  5IWA M;  2OPF A;  4DR6 M;  3GQ4 A;  4X64 M;  3SAR A;  5ITQ A;  2XZU A;  3A46 A;  4DR4 M;  4LFB M;  1XMQ M;  4PCZ A;  3JR4 A;  2UUB M;  1TDZ A;  1N34 M;  3C58 A;  1FJG M;  4B3R M;  4MB7 A;  2UXC M;  4G4O A;  3OTO M;  1KFV A;  1HNW M;  5ITY A;  5ITU A;  2VQF M;  1Q39 A;  5LMN M;  4JI6 M;  4X66 M;  5ITT A;  2UUA M;  2UU9 M;  1MX0 A;  3GQ3 A;  1Z59 A;  1PM5 A;  4K0K M;  4DR7 M;  5LMU M;  5FLX S;  4LF4 M;  3SAU A;  2VQE M;  3TWL A;  5A2Q S;  3U6Q A;  4LF8 M;  4NXN M;  5ITR A;  2ZBK B;  3GPU A;  5BR8 M;  1K3X A;  4LF5 M;  4DR5 M;  2F5N A;  4JI4 M;  4LFA M;  2EA0 A;  4DV3 M;  3U6P A;  1L2D A;  2UUC M;  4DUZ M;  4JI8 M;  3GPY A;  3U6C A;  2E5L M;  3J7A S;  4YHH M;  4GKK M;  4DV6 M;  4LFC M;  2OQ4 A;  3GQ5 A;  4LF6 M;  3GO8 A;  3A45 A;  4X65 M;  3U6O A;  4OX9 M;  1XC8 A;  3U6D A;  3GP1 A;  2F5S A;  3A42 A;  1I94 M;  1HNX M;  3GPX A;  4JYA M;  1N36 M;  2UXB M;  3TWM A;  3T1H M;  1PJJ A;  4JI3 M;  1Q3C A;  3SBJ A;  4KHP M;  2Q2E B;  3U6M A;  4B3T M;  3SAW A;  1HR0 M;  1XMO M;  1N33 M; 
#chains in the Genus database with same CATH topology
 4NRV A;  1WGN A;  3MK6 A;  3C9P A;  1HT2 E;  1FNN A;  2Y0Q A;  3FYC A;  4DR2 M;  2F5Q A;  4DR1 M;  4LJA A;  4PT5 A;  4LF9 M;  3DZD A;  2LHG A;  2LWX A;  3GLH E;  1IBK M;  4CJ6 A;  2DWM A;  2K47 A;  2L09 A;  5FTK A;  3AOG A;  2GNO A;  4I4L A;  1OFI A;  5EJC A;  3I51 A;  1R6B X;  4DV5 M;  1V34 A;  2HHH M;  4GKJ M;  2KRU A;  2I7N A;  3SYL A;  1HQC A;  1AIP C;  4LJ7 A;  1HNZ M;  4DV1 M;  3U61 A;  2HCB A;  4LGY A;  2EUC A;  3FTE A;  1IXZ A;  1DO2 A;  1UM8 A;  1TR8 A;  2JY7 A;  4OU7 A;  1NHW C;  1YSY A;  2WSE F;  5DYG A;  3J80 S;  1W5S A;  3D8L A;  1EIJ A;  2BJW A;  2OO9 A;  2LTU A;  2Y21 A;  4G6Z A;  2H1R A;  3GLH A;  4DV7 M;  3R9X B;  2X49 A;  3KP0 E;  3KSJ A;  1IN7 A;  2XEP A;  4G4Q A;  2XZF A;  1T3T A;  3VK7 A;  1N77 A;  2UXD M;  2L6O A;  3WHK A;  3T1Y M;  2KW0 A;  2R4J A;  3L2A A;  3FD9 A;  1Y8G A;  4IBG A;  4RNA A;  2RGO A;  5EP1 A;  3SAT A;  4L16 A;  3PXG A;  5FSW A;  1EE8 A;  1PRB A;  3HJQ A;  5FTN A;  1Z5B A;  3GLI B;  3VK8 A;  4AQY M;  1XNQ M;  5IT9 S;  1NSF A;  5FTL A;  1OFH A;  1IXS A;  1L2B A;  1Z5C A;  4R3D A;  4M9X A;  1XNR M;  4B7F A;  3J81 S;  4JI5 M;  1XHB A;  3PVS A;  3QYB A;  3TL4 X;  2QBY A;  1KYI A;  1J5E M;  1JQJ C;  3TQS A;  3IG5 A;  4MGI E;  1IN4 A;  3AKZ A;  1XB2 B;  3GPP A;  4JI2 M;  2XLJ A;  3IHP A;  4DR6 M;  1SXJ B;  4L15 A;  5EP3 A;  2KDL A;  4LZZ A;  2R18 A;  4LJ6 A;  4CHT B;  3U60 A;  3E21 A;  4G3O A;  1ZMW A;  2CFO A;  2CHG A;  2CP8 A;  5EXP A;  1OQY A;  4B3R M;  4S12 A;  4A3V B;  4MB7 A;  1YUB A;  3VDU A;  2MGW A;  4JXJ A;  2K6B A;  3QWL A;  2X4A A;  3T6P A;  5ITY A;  3QAU A;  2DXI A;  4OVZ B;  3KOW E;  2R65 A;  2XFS A;  4OW0 A;  2AHM A;  4JI6 M;  2L7H A;  4QNM A;  3GQ3 A;  1HQY E;  3HKP A;  3L26 A;  2LVO C;  3U6Q A;  3B7Q A;  5DYI A;  3GLF E;  3GRV A;  2LNH C;  3FKE A;  4MGY E;  2J7O A;  4NC6 A;  1XXH E;  1XWI A;  1Z6T A;  1G41 A;  3HZJ A;  5EXT A;  1VDL A;  2F5N A;  2KEB A;  4B7G A;  3HY5 A;  4L78 A;  3U6P A;  1NHG C;  3VKG A;  1OJL A;  1L2D A;  1D2N A;  3GLG B;  4D80 A;  4FWH A;  3J27 B;  4R71 A;  3UJN A;  3AL0 C;  3E9S A;  2FH0 A;  3GQ5 A;  1VG5 A;  3U6O A;  1NO1 A;  4AKH A;  2F5S A;  3HHY A;  1XXH A;  2YR0 A;  2XGN A;  1YLA A;  3A42 A;  3LCV B;  2JXN A;  4EIW A;  1P3Q Q;  3AJI B;  1WJ7 A;  1PJJ A;  3W68 A;  2ZAN A;  4L4U A;  4JI3 M;  4NSR A;  1E32 A;  4KOD A;  3U6M A;  3CF2 A;  2C5R A;  4M0W A;  1F4I A;  1VEK A;  1GL6 A;  3FUV A;  1IY2 A;  4JI0 M;  2DWN A;  2CRU A;  2R0I A;  1NJG A;  4II7 A;  4HLQ A;  2YFQ A;  3TE6 A;  4B3M M;  4YY3 M;  2O25 A;  3FYD A;  4MM3 B;  1TDH A;  2D7G A;  3SHF A;  1Z5A A;  7CAT A;  1R5L A;  2X8A A;  4REZ A;  4LF7 M;  1TH2 A;  5FTJ A;  4ITQ A;  3KVW A;  1QUS A;  3J2P B;  4MH0 E;  3ZH9 B;  1N75 A;  3JR5 A;  1N32 M;  1IBL M;  2QQ8 A;  1NV8 A;  4M0D A;  4CIS A;  2LVP C;  2VII A;  4GHA A;  4QOZ C;  1DGH A;  3KSX A;  2APL A;  3SAV A;  1QVR A;  1N33 M;  3NWL A;  4X62 M;  4KO8 A;  2KA6 B;  3DOA A;  2V1C A;  1TF0 B;  1T6O A;  4I8O A;  4W5W A;  3GLF B;  4LGM A;  3JAM S;  3CTW B;  4NRW A;  3C3D A;  4AZF A;  3H4J A;  2HKJ A;  4LZJ A;  2XF3 A;  1BVS A;  1E9S A;  1IN6 A;  3R8F A;  5JI3 E;  1G3I A;  4BB9 A;  4FWD A;  3FUX A;  1SXJ C;  2D7E A;  3FTD A;  3PFI A;  1D0M A;  1GLN A;  4LJ4 A;  1G59 A;  1OKS A;  2ZTD A;  5BPV A;  2ZM6 M;  3I04 M;  5IWA M;  1DGG A;  2DZN B;  3GQ4 A;  4X64 M;  2LXE A;  3A46 A;  1EFU B;  2JWS A;  2CWB A;  5F3W A;  2CV1 A;  1J7K A;  2C99 A;  2DZO B;  3VLF B;  3HHW A;  2UUB M;  2LBC A;  5EXX A;  1G4A E;  2YQZ A;  4RKU F;  4AW4 A;  4D81 A;  1MN3 A;  3L29 A;  1KFV A;  2LH0 A;  2LVA A;  2JNH A;  2KZU A;  2L2D A;  5KPZ A;  5KQ8 A;  2WSC F;  3HHX A;  1G71 A;  1PM5 A;  4GC9 A;  3ZC7 B;  2CE7 A;  1C1K A;  4WUR A;  1NY5 A;  3RFW A;  5FLX S;  1OAO C;  3SAU A;  2VQE M;  1D0L A;  3T38 A;  4CGY B;  5A2Q S;  4GHL A;  3PNY A;  3B7N A;  4IBC A;  3KDS E;  3LQR A;  4NXN M;  3WHL A;  1IY1 A;  1DO0 A;  2FNA A;  3KS4 A;  2QZ4 A;  3NBX X;  4LF5 M;  3SMS A;  4DR5 M;  5IRE B;  4LFA M;  2EA0 A;  4P16 A;  4IIW A;  3KOY E;  3LVV A;  1J09 A;  4DUZ M;  3C3E A;  3EIE A;  1QZE A;  1A5T A;  2KNV A;  2DHR A;  2Y0T A;  4I5S A;  4YHH M;  4LFC M;  3HGI A;  4LG2 A;  3K2L A;  4LF6 M;  3KS8 A;  4X65 M;  1ZQ9 A;  4KT0 F;  5JI2 E;  3BOS A;  3AOE A;  2JUJ A;  3GLH B;  1I94 M;  1HNX M;  1IY0 A;  1WR1 B;  2WSF F;  1OIZ A;  2NQ8 C;  1WIV A;  1N36 M;  2L7I A;  2ZAM A;  4XK8 F;  3KP1 E;  1TGU A;  3E4R A;  1Q3C A;  4KLN A;  4KHP M;  4L6V 6;  2Q2E B;  3F92 A;  5C18 A;  1GVN A;  2Y20 A;  1H6U A;  1PGY A;  2CEA A;  3SAW A;  2ZTC A;  3GRR A;  1IXS B;  4IBI A;  2QSF X;  1L2C A;  1QAN A;  2QBY B;  3E46 A;  3MMP A;  2ZAO A;  3UZU A;  4DV0 M;  3LQQ A;  4FWG A;  1K3W A;  3FE3 A;  2FE8 A;  3L28 A;  2MRO B;  2VF7 A;  2Z4R A;  2XSZ D;  5EQT A;  3FTF A;  2QPA A;  1MU5 A;  4M9Z A;  1ZMU A;  3HU2 A;  1L8Q A;  4PDG A;  1JB0 F;  2V6Z M;  2DNA A;  2HAK A;  3U60 B;  4NXM M;  2OOA A;  4XBO A;  3SAS A;  2JY8 A;  1VEJ A;  4GEW A;  5GKN A;  4B3S M;  1R2Y A;  2QP9 X;  3HU3 A;  1GL7 A;  3B7Z A;  2MJ5 B;  3GRY A;  1K82 A;  5FTM A;  3LW5 F;  1NVM A;  3FTC A;  3FRI A;  1GKI A;  2N35 A;  3I4Y A;  3J7B A;  5DNY A;  1VEG A;  2F4V M;  2W82 A;  1PJS A;  3U6E A;  1L1T A;  3UK6 A;  3IG8 A;  4AKI A;  4Q7J A;  4Z6Y A;  4FCT A;  2B3T A;  1HJP A;  4DV2 M;  1R2Z A;  4IBK A;  2FOI C;  1OTR A;  4D82 A;  2JY6 B;  3RGP A;  2DAI A;  4LCB A;  1T43 A;  1V92 A;  2JP7 A;  2BNK A;  1PJI A;  1VQ1 A;  4LJ9 A;  4L8R C;  2XSZ A;  1NV9 A;  4DR3 M;  3SC3 A;  2KZS A;  4IBF A;  1TH3 A;  3FUT A;  2J5Y A;  1WHC A;  1MJG M;  3SAR A;  2XZU A;  5EP4 A;  4DR4 M;  1SXJ D;  3GLI E;  4LFB M;  3MHV C;  1XMQ M;  3B89 A;  1GO5 A;  2QCU A;  2DAK A;  1N34 M;  3NBI A;  2MH8 A;  3C58 A;  1FJG M;  2WZJ A;  2GQF A;  1XXH B;  2JZ1 A;  3DFZ A;  4IJF A;  4G4O A;  4NL4 H;  1TH4 A;  4LRS A;  4NSO B;  1HNW M;  3Q8G A;  5ITU A;  5EXS A;  2P5T A;  2VQF M;  3RE8 A;  5KO3 A;  1Q39 A;  2QNJ A;  4MGZ E;  5LMN M;  2CUZ A;  4QOS A;  2R44 A;  5ITT A;  4WW0 A;  2EO2 A;  1DGF A;  2UUA M;  5IZ7 D;  1W5T A;  4LRT A;  3GLI A;  2UU9 M;  4K0K M;  1OIP A;  5LMU M;  3UGJ A;  4DR7 M;  2CHQ A;  1PJT A;  2DWL A;  1IM2 A;  4LF8 M;  2D7H A;  2DAG A;  3KW6 A;  2Z3X A;  5ITR A;  2ZBK B;  3KFU G;  3GPU A;  4HL4 A;  1LTM A;  2KXE A;  5BR8 M;  3VDP A;  1K3X A;  3VKH A;  2DWZ B;  4WP2 A;  1SXJ A;  2H5X A;  1G8P A;  1D0K A;  2KNZ A;  3BBZ A;  3AV0 A;  3M6A A;  4FD2 A;  3U6C A;  3U5Z B;  2RRU A;  2E5L M;  2V1U A;  4GKK M;  1TTE A;  2DAE A;  3GO8 A;  3A45 A;  3M7G A;  1Q02 A;  3PNV A;  1XC8 A;  3IEC A;  3LMM A;  2JZ0 A;  1DGH B;  3U6D A;  3GP1 A;  3TPZ A;  2Z4S A;  1QUT A;  4FCW A;  3FUU A;  4QNR A;  2ERC A;  2YNM D;  4FW9 A;  4JYA M;  2R45 A;  4GH9 A;  1NJF A;  1ZAE A;  2L4F A;  4HEO A;  4OVZ A;  4ANR A;  4AG5 A;  3TWM A;  4Y28 F;  4GIT A;  2DEN A;  3ZQJ A;  2XH9 A;  3SBJ A;  1NY6 A;  3THG A;  3UMM A;  3GLG E;  1CUK A;  2DKL A;  4R7G A;  1C7Y A;  2J7N A;  1WGL A;  2JY5 A;  3K8Z A;  3I01 M;  2RKO A;  4IBJ A;  5DFL A;  2LVN C;  4IJE A;  1QQW A;  1OAI A;  3DA1 A;  1RU3 A;  1GJS A;  2RGH A;  3I4V A;  3U6S A;  1R4G A;  4JV5 M;  2R4E A;  2XFT A;  1DV0 A;  5ITX E;  2KRK A;  3U61 B;  1KSF X;  1ZMV A;  5KPT A;  2C9O A;  4G4R A;  4DUY M;  1QAM A;  2G8L A;  3BXW A;  4QHT A;  1UFZ A;  3GLG A;  2R46 A;  1VDD A;  3W0F A;  3AFH A;  2M60 A;  4AI6 A;  4I81 A;  1Q3B A;  4G4N A;  1E94 E;  2DZL A;  2CV0 A;  4JI1 M;  4FVM A;  4F2L A;  1ORY B;  4B7H A;  3AOE C;  3Q8X A;  2BWB A;  2R62 A;  3SMP A;  1GJT A;  4PDI A;  4TUW A;  5ITX A;  2BWE A;  1E9R A;  4BLC A;  1R7R A;  5L8R F;  1QAO A;  2C98 A;  1N78 A;  4F1I A;  3HJS A;  2KHH A;  2QEN A;  2R6F A;  2EJS A;  4LY6 A;  4GC5 A;  1NNJ A;  1IFY A;  3TWK A;  4GRI A;  4B08 A;  1S3S A;  1L1Z A;  3U6L A;  2F5O A;  4JI7 M;  3K92 A;  3W0L B;  2OOB A;  4PD2 A;  2DAM A;  2DVW B;  2LHC A;  3HX3 A;  3HJ8 A;  3ILK A;  5E6J A;  2K0B X;  1IBM M;  1QYR A;  3ZCB B;  5E26 A;  2A5Y B;  2CV2 A;  5KPR A;  4DV4 M;  2F5P A;  3FRH A;  3L25 A;  3B74 A;  2EKK A;  1QZM A;  4RF1 A;  2KNA A;  4GIP A;  2DI0 A;  2OPF A;  4JN6 A;  4Z8X A;  2BJV A;  5ITQ A;  2G3Q A;  5H37 D;  2FFJ A;  5EP2 A;  2K9D A;  3CF0 A;  2C96 A;  3W67 A;  4PCZ A;  3KOZ E;  1LV7 A;  3D8B A;  3JR4 A;  3K9O A;  1TDZ A;  1GAB A;  2M5Z A;  1YE9 A;  1IQP A;  3A98 B;  4ZPX A;  2UXC M;  3OTO M;  3FUW A;  4MGH A;  4XGI A;  1NNU C;  4DBG B;  3GLF A;  1JR3 D;  2VDB B;  3SFZ A;  4M9S A;  3H4M A;  4X66 M;  5C1B A;  3SHG B;  1MX0 A;  1Z59 A;  1QAQ A;  1QDT A;  3HWS A;  3LCU A;  3HHZ A;  3KXE C;  3T15 A;  2G5G X;  4GMQ A;  4LF4 M;  3TWL A;  1DGB A;  3CGW A;  4BBA A;  2DHY A;  3HU1 A;  1ZV1 A;  1PJQ A;  1QDR A;  3V76 A;  4QHS A;  3SYK A;  4LJ5 A;  2Z7J A;  1HT1 E;  3KOX E;  2O01 F;  3M0E A;  4JI4 M;  1IXR C;  1JR3 E;  2I7P A;  4DV3 M;  4P17 A;  3VFD A;  3LVW A;  4AG6 A;  1IN5 A;  2UUC M;  4JI8 M;  4IBE A;  3CF6 E;  3GPY A;  3J7A S;  2C9C A;  8CAT A;  4DV6 M;  2CHV A;  2EKF A;  2L4E A;  2LVQ D;  2OQ4 A;  4OX9 M;  4FCV A;  3EIH A;  3RGS A;  1V33 A;  1IN8 A;  2HL7 A;  4UN2 B;  3K9P A;  3U5Z A;  2VF8 A;  1SXJ E;  4NOO B;  4RF0 A;  2HWJ A;  3GRU A;  3GPX A;  4CIZ A;  2UXB M;  1JR3 A;  3B9P A;  3QYE A;  3T1H M;  4AKG A;  2QHO B;  2Z8Y M;  3MJ5 A;  1WXQ A;  1AUA A;  2FS1 A;  2O5R A;  2JA2 A;  2MR9 A;  1I4W A;  5KQD A;  4IBB A;  3L27 A;  4B3T M;  1SG9 A;  4IBD A;  4LJ8 A;  1X37 A;  1HR0 M;  1XMO M;  4MGK E;  3K1J A; 
#chains in the Genus database with same CATH homology
 4NRV A;  3MK6 A;  1HT2 E;  1FNN A;  2Y0Q A;  3FYC A;  4DR2 M;  2F5Q A;  4DR1 M;  4LJA A;  4PT5 A;  4LF9 M;  3DZD A;  2LWX A;  1IBK M;  2DWM A;  2K47 A;  2L09 A;  5FTK A;  3AOG A;  4I4L A;  5EJC A;  1OFI A;  4DV5 M;  3I51 A;  1R6B X;  2HHH M;  4GKJ M;  2KRU A;  2I7N A;  3SYL A;  1HQC A;  4LJ7 A;  1HNZ M;  4DV1 M;  3U61 A;  2HCB A;  4LGY A;  2EUC A;  3FTE A;  1IXZ A;  1DO2 A;  1UM8 A;  4OU7 A;  1NHW C;  1YSY A;  5DYG A;  3J80 S;  1W5S A;  3D8L A;  2BJW A;  2Y21 A;  4G6Z A;  2H1R A;  3GLH A;  4DV7 M;  3R9X B;  2X49 A;  3KP0 E;  3KSJ A;  1IN7 A;  2XEP A;  4G4Q A;  2XZF A;  1T3T A;  3VK7 A;  1N77 A;  2UXD M;  2L6O A;  3WHK A;  3T1Y M;  2KW0 A;  2R4J A;  3L2A A;  3FD9 A;  4IBG A;  4RNA A;  2RGO A;  5EP1 A;  3SAT A;  4L16 A;  3PXG A;  5FSW A;  1EE8 A;  3GLI B;  3HJQ A;  5FTN A;  1Z5B A;  3VK8 A;  5IT9 S;  4AQY M;  1XNQ M;  1NSF A;  5FTL A;  1OFH A;  1L2B A;  1Z5C A;  4R3D A;  4M9X A;  1XNR M;  4B7F A;  3J81 S;  4JI5 M;  1XHB A;  3PVS A;  2QBY A;  3TL4 X;  1KYI A;  1J5E M;  1JQJ C;  3TQS A;  3IG5 A;  4MGI E;  1IN4 A;  3AKZ A;  3GPP A;  4JI2 M;  2XLJ A;  4DR6 M;  1SXJ B;  4L15 A;  5EP3 A;  4LZZ A;  2R18 A;  4LJ6 A;  4CHT B;  3U60 A;  2CFO A;  2CHG A;  5EXP A;  4B3R M;  4S12 A;  4A3V B;  4MB7 A;  1YUB A;  3VDU A;  4JXJ A;  3QWL A;  2X4A A;  5ITY A;  3QAU A;  2DXI A;  4OVZ B;  3KOW E;  2R65 A;  2XFS A;  4OW0 A;  2AHM A;  4JI6 M;  2L7H A;  4QNM A;  3GQ3 A;  1HQY E;  3HKP A;  3L26 A;  3U6Q A;  5DYI A;  3GRV A;  2LNH C;  3FKE A;  4MGY E;  2J7O A;  1XWI A;  1Z6T A;  1G41 A;  5EXT A;  2F5N A;  2KEB A;  4B7G A;  4L78 A;  3U6P A;  1NHG C;  3VKG A;  1OJL A;  1L2D A;  1D2N A;  3GLG B;  4D80 A;  4FWH A;  3J27 B;  3UJN A;  3AL0 C;  3E9S A;  3GQ5 A;  3U6O A;  4AKH A;  2F5S A;  3HHY A;  1XXH A;  2YR0 A;  2XGN A;  3A42 A;  4EIW A;  3AJI B;  1PJJ A;  2ZAN A;  4L4U A;  4JI3 M;  4NSR A;  1E32 A;  4KOD A;  3U6M A;  3CF2 A;  2C5R A;  4M0W A;  1GL6 A;  3FUV A;  1IY2 A;  4JI0 M;  2DWN A;  1NJG A;  4II7 A;  4HLQ A;  2YFQ A;  3TE6 A;  4B3M M;  4YY3 M;  3FYD A;  4MM3 B;  1TDH A;  2D7G A;  3SHF A;  1Z5A A;  7CAT A;  4REZ A;  2X8A A;  4LF7 M;  1TH2 A;  5FTJ A;  4ITQ A;  3KVW A;  3J2P B;  4MH0 E;  3JR5 A;  3ZH9 B;  1N75 A;  1N32 M;  1IBL M;  4M0D A;  4CIS A;  2VII A;  4GHA A;  4QOZ C;  1DGH A;  3KSX A;  3SAV A;  1N33 M;  1QVR A;  3NWL A;  4X62 M;  4KO8 A;  2KA6 B;  3DOA A;  2V1C A;  4I8O A;  4W5W A;  3GLF B;  4LGM A;  3JAM S;  3CTW B;  4NRW A;  4AZF A;  2HKJ A;  4LZJ A;  2XF3 A;  1E9S A;  1IN6 A;  3R8F A;  5JI3 E;  1G3I A;  4BB9 A;  4FWD A;  3FUX A;  1SXJ C;  2D7E A;  3FTD A;  3PFI A;  1GLN A;  4LJ4 A;  1G59 A;  5BPV A;  2ZM6 M;  5IWA M;  1DGG A;  2DZN B;  3GQ4 A;  4X64 M;  2LXE A;  3A46 A;  5F3W A;  2CV1 A;  1J7K A;  2C99 A;  2DZO B;  3VLF B;  3HHW A;  2UUB M;  5EXX A;  1G4A E;  2YQZ A;  4AW4 A;  4D81 A;  3L29 A;  1KFV A;  2LH0 A;  2KZU A;  5KPZ A;  5KQ8 A;  3HHX A;  1PM5 A;  4GC9 A;  3ZC7 B;  2CE7 A;  1C1K A;  4WUR A;  1NY5 A;  3RFW A;  5FLX S;  3SAU A;  2VQE M;  3T38 A;  5A2Q S;  4CGY B;  4GHL A;  3PNY A;  4IBC A;  3KDS E;  3LQR A;  4NXN M;  3WHL A;  1IY1 A;  1DO0 A;  2FNA A;  3KS4 A;  2QZ4 A;  4LF5 M;  3SMS A;  4DR5 M;  5IRE B;  4LFA M;  2EA0 A;  4P16 A;  4IIW A;  3KOY E;  3LVV A;  1J09 A;  4DUZ M;  3EIE A;  4I5S A;  2Y0T A;  2DHR A;  4YHH M;  4LG2 A;  4LFC M;  3HGI A;  3K2L A;  4LF6 M;  3KS8 A;  4X65 M;  1ZQ9 A;  5JI2 E;  3BOS A;  3AOE A;  3GLH B;  1I94 M;  1HNX M;  1IY0 A;  1N36 M;  2NQ8 C;  2L7I A;  2ZAM A;  3KP1 E;  1TGU A;  3E4R A;  1Q3C A;  4KLN A;  4KHP M;  2Q2E B;  5C18 A;  1GVN A;  2Y20 A;  1H6U A;  2CEA A;  3SAW A;  3GRR A;  1IXS B;  4IBI A;  1L2C A;  1QAN A;  2QBY B;  2ZAO A;  3UZU A;  4DV0 M;  3LQQ A;  4FWG A;  1K3W A;  2FE8 A;  3L28 A;  2Z4R A;  3FTF A;  2XSZ D;  5EQT A;  2QPA A;  1MU5 A;  4M9Z A;  3HU2 A;  1L8Q A;  4PDG A;  2V6Z M;  3U60 B;  4NXM M;  4XBO A;  3SAS A;  5GKN A;  4B3S M;  1R2Y A;  2QP9 X;  3HU3 A;  1GL7 A;  3GRY A;  1K82 A;  5FTM A;  1NVM A;  3FTC A;  1GKI A;  3I4Y A;  3J7B A;  5DNY A;  2F4V M;  2W82 A;  3U6E A;  1L1T A;  3UK6 A;  3IG8 A;  4AKI A;  4Z6Y A;  4FCT A;  4DV2 M;  1R2Z A;  4IBK A;  2FOI C;  4D82 A;  3RGP A;  4LCB A;  2BNK A;  1PJI A;  4LJ9 A;  4L8R C;  2XSZ A;  4DR3 M;  3SC3 A;  2KZS A;  4IBF A;  1TH3 A;  3FUT A;  3SAR A;  2XZU A;  5EP4 A;  4DR4 M;  1SXJ D;  4LFB M;  3MHV C;  1XMQ M;  2QCU A;  1N34 M;  3NBI A;  3C58 A;  1FJG M;  1XXH B;  3DFZ A;  4IJF A;  4G4O A;  4NL4 H;  1TH4 A;  4LRS A;  4NSO B;  1HNW M;  5ITU A;  5EXS A;  2P5T A;  2VQF M;  3RE8 A;  5KO3 A;  1Q39 A;  4MGZ E;  5LMN M;  2CUZ A;  4QOS A;  5ITT A;  4WW0 A;  2EO2 A;  1DGF A;  2UUA M;  5IZ7 D;  1W5T A;  4LRT A;  3GLI A;  2UU9 M;  4K0K M;  4DR7 M;  5LMU M;  3UGJ A;  2CHQ A;  2DWL A;  1IM2 A;  4LF8 M;  2D7H A;  3KW6 A;  2Z3X A;  5ITR A;  2ZBK B;  3KFU G;  3GPU A;  4HL4 A;  2KXE A;  5BR8 M;  3VDP A;  1K3X A;  3VKH A;  2DWZ B;  1SXJ A;  1G8P A;  3U6C A;  3M6A A;  3AV0 A;  4FD2 A;  2E5L M;  3U5Z B;  4GKK M;  2V1U A;  3GO8 A;  3A45 A;  3M7G A;  3PNV A;  1XC8 A;  3LMM A;  1DGH B;  3U6D A;  3GP1 A;  3TPZ A;  2Z4S A;  4FCW A;  3FUU A;  4QNR A;  2ERC A;  2YNM D;  4FW9 A;  4JYA M;  2R45 A;  4GH9 A;  1NJF A;  1ZAE A;  4OVZ A;  3TWM A;  4AG5 A;  4GIT A;  2XH9 A;  3SBJ A;  1NY6 A;  3THG A;  3UMM A;  4R7G A;  2J7N A;  3K8Z A;  2RKO A;  4IBJ A;  4IJE A;  1QQW A;  3DA1 A;  2RGH A;  3I4V A;  3U6S A;  4JV5 M;  2R4E A;  2XFT A;  5ITX E;  2KRK A;  3U61 B;  1KSF X;  5KPT A;  2C9O A;  4G4R A;  4DUY M;  1QAM A;  2G8L A;  4QHT A;  3GLG A;  2R46 A;  1VDD A;  3W0F A;  3AFH A;  2M60 A;  4AI6 A;  4I81 A;  1Q3B A;  4G4N A;  1E94 E;  2CV0 A;  4JI1 M;  4FVM A;  1ORY B;  4B7H A;  3AOE C;  3Q8X A;  2R62 A;  3SMP A;  4PDI A;  4TUW A;  5ITX A;  4BLC A;  1E9R A;  1R7R A;  1QAO A;  2C98 A;  1N78 A;  3HJS A;  2QEN A;  4LY6 A;  4GC5 A;  1NNJ A;  3TWK A;  4GRI A;  4B08 A;  1S3S A;  1L1Z A;  3U6L A;  2F5O A;  4JI7 M;  3K92 A;  3W0L B;  4PD2 A;  2DVW B;  3ILK A;  3HJ8 A;  5E6J A;  1IBM M;  1QYR A;  3ZCB B;  5E26 A;  2A5Y B;  2CV2 A;  5KPR A;  4DV4 M;  2F5P A;  3L25 A;  1QZM A;  4RF1 A;  4GIP A;  2OPF A;  4JN6 A;  4Z8X A;  2BJV A;  5ITQ A;  5H37 D;  2FFJ A;  5EP2 A;  3CF0 A;  2C96 A;  4PCZ A;  3KOZ E;  1LV7 A;  3D8B A;  3JR4 A;  1TDZ A;  2M5Z A;  1YE9 A;  1IQP A;  3A98 B;  4ZPX A;  2UXC M;  3OTO M;  3FUW A;  4MGH A;  4XGI A;  1NNU C;  3GLF A;  1JR3 D;  3SFZ A;  4M9S A;  3H4M A;  4X66 M;  5C1B A;  3SHG B;  1MX0 A;  1Z59 A;  1QAQ A;  3HWS A;  3HHZ A;  3KXE C;  3T15 A;  2G5G X;  4GMQ A;  4LF4 M;  3TWL A;  1DGB A;  4BBA A;  3HU1 A;  4QHS A;  3SYK A;  4LJ5 A;  2Z7J A;  1HT1 E;  3KOX E;  3M0E A;  4JI4 M;  1IXR C;  4DV3 M;  2I7P A;  3VFD A;  3LVW A;  4AG6 A;  1IN5 A;  2UUC M;  4JI8 M;  4IBE A;  3CF6 E;  3GPY A;  3J7A S;  2C9C A;  8CAT A;  4DV6 M;  2CHV A;  2OQ4 A;  4OX9 M;  4FCV A;  3EIH A;  3RGS A;  1IN8 A;  2HL7 A;  3U5Z A;  4RF0 A;  1SXJ E;  4NOO B;  3GRU A;  3GPX A;  2UXB M;  1JR3 A;  3B9P A;  3T1H M;  4AKG A;  3MJ5 A;  1WXQ A;  2O5R A;  2JA2 A;  1I4W A;  5KQD A;  4IBB A;  3L27 A;  4B3T M;  4IBD A;  1HR0 M;  4LJ8 A;  1X37 A;  1XMO M;  4MGK E;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...