4B3TM

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3tM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3tM02
1N34M 4DV2M 3W0FA 1J5EM 3SARA 4JYAM 1XMOM 1K82A 4LF6M 4DV1M 3GQ3A 4LF4M 3GQ4A 1N36M 1Z5BA 3U6SA 4DV4M 2F4VM 4JI2M 2UXCM 2F5SA 4LF5M 3GPYA 2F5PA 4GKJM 4X64M 4X65M 5ITQA 1K3WA 4PDIA 4B3RM 2VQEM 3SAVA 5IT9S 2HKJA 3J80S 3SASA 4LFBM 5ITXA 3TWKA 1HNXM 4G4OA 4YHHM 3SAWA 2ZM6M 2F5NA 1NNJA 1HNZM 4LF7M 5A2QS 1Z5CA 2F5QA 1L2BA 4JI3M 3J81S 4NRWA 3TWMA 3U6OA 4YY3M 4JI5M 2UUAM 1TDHA 1N32M 2OQ4A 4CISA 4X66M 2ZBKB 4DR6M 4AQYM 4DR4M 1MU5A 4GKKM 5FLXS 3U6PA 3GPPA 4PDGA 1MX0A 4B3SM 4DUZM 3A45A 4DV5M 3U6CA 4OX9M 1Q3BA 2XZFA 1Z59A 3U6QA 4MB7A 3GQ5A 4NXNM 4JI7M 1XNRM 1N33M 4JI6M 4JI8M 4JI1M 3A46A 1PM5A 1HNWM 2VQFM 4DV7M 4DR3M 1Q3CA 1IBKM 3GPXA 1K3XA 3A42A 1L2CA 4X62M 4KHPM 1XNQM 2EA0A 2XZUA 4DR1M 3JAMS 2UXBM 1Z5AA 1EE8A 5ITYA 3JR4A 5LMNM 4LF8M 5ITTA 3U6LA 3SBJA 1L2DA 2E5LM 4ITQA 3VK8A 3U6MA 2HHHM 1I94M 4B3TM 4DR7M 3U6EA 4DV6M 5ITXE 3SATA 4NXMM 5ITRA 1PJIA 1FJGM 2UUBM 1XMQM 4G4NA 4DV3M 4DV0M 3U6DA 3TWLA 1PJJA 1IBMM 3GP1A 4G4QA 3T1HM 4LFCM 2F5OA 2Q2EB 4PCZA 4B3MM 2UXDM 1L1ZA 2UU9M 3VK7A 3T1YM 1XC8A 3SAUA 3J7AS 4G4RA 1L1TA 3C58A 4JV5M 4DR5M 3DOAA 1IBLM 2OPFA 5IWAM 3JR5A 3GPUA 4DR2M 1HR0M 4LFAM 1R2YA 4JI4M 4NRVA 1Q39A 3GO8A 4PD2A 1R2ZA 4DUYM 4JI0M 2UUCM 4K0KM 5LMUM 4LF9M 1KFVA 5ITUA 3OTOM 5BR8M 1TDZA
chains in the Genus database with same CATH superfamily
4IBBA 3FUVA 2WSEF 2DHRA 2CUZA 1C7YA 3B89A 2QSFX 3SARA 3ZC7B 4L78A 4DV1M 4LF6M 4R71A 1OIZA 1T43A 3UGJA 4LF4M 3KOYE 1Z5BA 5KPZA 3GPYA 2F5PA 1TF0B 4X64M 1D0LA 5ITQA 4TUWA 2JY8A 1AIPC 1W5SA 3HJQA 3J80S 1NY5A 2K0BX 4PT5A 3FUWA 5EXTA 1HNXM 1IM2A 1IN6A 4G4OA 4DR7M 3V76A 4P16A 2JWSA 4BLCA 1YUBA 2F5NA 5IREB 3GLIE 2BJWA 2Z8YM 3WHLA 4JI3M 4CJ6A 5JI3E 3J81S 1L2BA 4NRWA 1YSYA 3TWMA 1D2NA 4IBFA 2UUAM 3EIHA 4R7GA 2ZBKB 4G3OA 4XK8F 1WR1B 3DZDA 3K92A 4EIWA 1LV7A 3GPPA 3LVVA 3ZCBB 1IN8A 2XFSA 3A45A 3FUUA 3HWSA 3U6CA 2CV1A 3BOSA 1JR3E 3L2AA 4LRTA 3U6QA 2EKKA 4MB7A 4MGIE 2BWEA 4NXNM 3GQ5A 5E6JA 4IBJA 1N33M 4QHTA 4CHTB 4JI6M 2XSZD 3I4VA 4JI8M 7CATA 3A46A 2ERCA 1AUAA 1VEJA 1IBKM 2L4FA 3TQSA 1K3XA 1HQYE 5IZ7D 3MMPA 1L2CA 2VF8A 1DGHA 1Z6TA 4NC6A 1XNQM 3JAMS 1QYRA 5ITYA 3SFZA 4ANRA 2GNOA 4LF8M 5C1BA 2CE7A 1WJ7A 4KLNA 3W68A 2E5LM 4AW4A 3VK8A 4B3TM 1I94M 2Z4SA 5EXXA 3QYBA 4IJEA 3E21A 1DGFA 3RGSA 2QHOB 4NOOB 4G4NA 1DGBA 2QCUA 3RE8A 3PNYA 1PJSA 2W82A 1NJFA 1IY1A 3GP1A 4KODA 4G4QA 4AKIA 3KOXE 4MGYE 1NHWC 4WURA 3U60B 1PJQA 3TPZA 1QANA 4PCZA 4LCBA 1MN3A 3GRYA 2K6BA 2JY5A 2OO9A 3L28A 2C99A 4L8RC 4FCVA 2ZTDA 2ZAOA 4FW9A 4IIWA 3SAUA 3J7AS 3B74A 1DGHB 1XWIA 8CATA 1LTMA 4G4RA 4JV5M 2WZJA 1OJLA 3LCUA 5KPTA 2FFJA 1ZMUA 4XGIA 5C18A 4GC9A 3HY5A 5IWAM 3JR5A 1Q02A 3B9PA 1J7KA 1R2YA 3B7QA 2AHMA 3U5ZB 1Q39A 1GABA 3L26A 1TTEA 2QZ4A 3SHFA 3LCVB 1OTRA 2D7EA 2KNAA 1R2ZA 1NHGC 4L6V6 1XXHE 2CEAA 2EO2A 3J2PB 3AOEA 4F2LA 1KFVA 3OTOM 3PVSA 2R45A 4M0WA 2BWBA 4FCTA 4OU7A 3KS8A 3QAUA 1OKSA 2ZTCA 2C9CA 4KO8A 3AOEC 2I7PA 2KXEA 4ZPXA 1K82A 2JA2A 2R0IA 1QUTA 4JN6A 5DFLA 2L2DA 1F4IA 1NV8A 1SXJA 2MJ5B 5DYIA 1JB0F 1YE9A 1SG9A 2DVWB 3C9PA 4MGHA 3TE6A 1G59A 4B3RM 2H5XA 2LVOC 2VQEM 4GHLA 4LJAA 3PXGA 2HKJA 3NWLA 4AG6A 3SASA 2DAEA 4MGZE 3SMSA 5ITXA 3TWKA 1A5TA 3GLHA 3J7BA 5BPVA 4YHHM 3VKGA 1G4AE 4HEOA 3IG8A 4D82A 1NNJA 2X8AA 1NY6A 2WSCF 1IFYA 2LBCA 4W5WA 4FWHA 2ZANA 2KRUA 3K2LA 1S3SA 1TGUA 4YY3M 3D8LA 4CISA 4X66M 2J5YA 3HX3A 2FS1A 4AQYM 3ZQJA 1MU5A 4GKKM 4PDGA 1MX0A 1SXJB 3RGPA 2DZNB 3MJ5A 1E9RA 2CV2A 1GJSA 4AI6A 2QNJA 1N77A 1MJGM 3AL0C 3DA1A 4MM3B 1NVMA 2HL7A 5KPRA 4JI1M 3GLHB 4AG5A 3FYDA 1HNWM 4HLQA 1Y8GA 2X49A 1VEGA 3K9PA 2LTUA 5KQ8A 1Q3CA 2G3QA 1JR3D 1IN7A 4DBGB 2KZSA 1TH4A 1X37A 3E46A 4IBEA 2EA0A 1G41A 3C3DA 4DR1M 1EE8A 2EKFA 2QPAA 2B3TA 3AV0A 2DAGA 3CF2A 1E94E 1IXZA 1OIPA 1ZQ9A 2DWZB 4LY6A 2DWLA 2HHHM 3UJNA 2QBYA 1IN4A 1V92A 4DV6M 2BJVA 2KNZA 2Y0QA 3Q8XA 4NXMM 5ITRA 4M0DA 4FD2A 2J7OA 1G8PA 1XMQM 4GITA 2KW0A 1OQYA 3GLGE 4DV3M 1N78A 3KVWA 2XFTA 2HCBA 3GRVA 3TWLA 1PJJA 4I81A 3T1HM 1IBMM 3KW6A 2F5OA 2Q2EB 2UU9M 5DYGA 2LVPC 2ZAMA 2R4JA 3SMPA 1R7RA 4LZZA 3AKZA 1DO2A 3HU2A 5EP4A 2D7HA 4Z6YA 1XC8A 4LGYA 1QAQA 2LH0A 3MHVC 2I7NA 1R5LA 4GHAA 1WXQA 2KDLA 3GLFE 4CGYB 3ZH9B 4RF1A 1E9SA 2V6ZM 4BB9A 3GLIA 2CV0A 1OFIA 1NV9A 3UK6A 1HR0M 3FKEA 4MH0E 3AFHA 4LFAM 1D0KA 2QBYB 4JI4M 2JZ1A 3FE3A 4NRVA 2MR9A 2YQZA 2DWNA 2L4EA 3KDSE 1G71A 3SHGB 1OFHA 5F3WA 5FSWA 4GIPA 2NQ8C 4QHSA 4AZFA 1KSFX 3GRUA 1JR3A 4GEWA 4HL4A 3B7ZA 3D8BA 5ITUA 3H4JA 2CHQA 2H1RA 1TH3A 1VEKA 3HU3A 1V34A 5FTNA 2M5ZA 1V33A 2DNAA 3W0FA 1VG5A 4WP2A 4DV2M 3KSXA 3FTFA 4JYAM 4M9ZA 4AKHA 3KP1E 1XMOM 3VKHA 1DV0A 2DI0A 3BXWA 3GLIB 3LMMA 3I01M 1I4WA 1NNUC 2Y0TA 3U6SA 4A3VB 1IXRC 4DV4M 2DZOB 4JI2M 4Q7JA 1HT1E 4MGKE 3E9SA 2C5RA 4IJFA 4GKJM 3I04M 4X65M 1J09A 1K3WA 4Y28F 5IT9S 1PGYA 2XSZA 2Y21A 1QUSA 1WIVA 2P5TA 1QAOA 2G8LA 4GH9A 1H6UA 2GQFA 3I51A 5FTLA 3SAWA 4I8OA 4LG2A 4LF7M 5A2QS 2YR0A 3AOGA 1Z5CA 2R65A 3C3EA 3W67A 4KT0F 3HHYA 5L8RF 2XGNA 4IBKA 4WW0A 3U6OA 4JI5M 1N32M 3DFZA 4LJ8A 2XH9A 3FYCA 2R46A 4L15A 4DR4M 4LJ7A 3WHKA 2DXIA 1IN5A 3H4MA 4DV5M 3BBZA 3KOWE 2LNHC 2KZUA 4NSRA 1Z59A 2XZFA 1GL7A 1GJTA 4JI7M 1XNRM 2JY7A 2C96A 2RRUA 3QYEA 1P3QQ 3IHPA 1PM5A 1W5TA 3HHWA 2J7NA 1TH2A 2Z3XA 4L4UA 2VQFM 2FOIC 3J27B 1HQCA 5DNYA 4DV7M 4DR3M 3CGWA 2DAKA 3CTWB 3A42A 3QWLA 4I5SA 4X62M 4KHPM 1XXHA 1R4GA 3FRIA 3IG5A 2CFOA 2XZUA 4I4LA 1Z5AA 2C9OA 5ITTA 1FNNA 3KP0E 3U6LA 1L2DA 2FNAA 3HJ8A 2L7IA 4IBDA 1R6BX 4LJ9A 2Z4RA 1CUKA 1OAOC 4M9SA 3HKPA 1UM8A 1WGLA 3U6EA 1VDLA 2MGWA 2G5GX 3SATA 1D0MA 3PNVA 4LJ5A 1PJIA 3U61A 2JZ0A 5FTJA 2O25A 1EIJA 4Z8XA 3T15A 3PFIA 2R18A 1IY2A 1WHCA 3VDUA 1ZV1A 3RFWA 2RKOA 3HGIA 4D80A 2V1UA 2UXDM 1L1ZA 1YLAA 2LHCA 3VK7A 4FWDA 3KFUG 1GO5A 3LVWA 4LJ6A 4NSOB 2QP9X 2DHYA 1IXSA 2LXEA 2D7GA 2QENA 2O01F 3TL4X 1XXHB 4BBAA 1L1TA 3C58A 3UMMA 3K9OA 2EUCA 2DZLA 2JP7A 1RU3A 2LVAA 1IBLM 2VF7A 4DR2M 5EQTA 1GLNA 5H37D 1QZEA 3U61B 3GO8A 1QQWA 5FTMA 4DUYM 4F1IA 3LQQA 2KRKA 4FVMA 5E26A 2R4EA 2KHHA 4LJ4A 4B7HA 1JQJC 1QVRA 2VDBB 1GKIA 4REZA 4GRIA 3K1JA 1HT2E 5BR8M 2L09A 1IXSB 2EJSA 1N34M 1J5EM 4RF0A 4LRSA 3F92A 2MROB 3FUXA 2A5YB 2KA6B 1DO0A 4OW0A 2JXNA 3AJIB 2DAIA 3GQ3A 2YNMD 3GQ4A 1N36M 3LQRA 2F4VM 2LVNC 3FTDA 1TR8A 4LGMA 2UXCM 2F5SA 4LF5M 3NBXX 5EP2A 2BNKA 1OAIA 1VDDA 1G3IA 4PDIA 2CHVA 3SAVA 5JI2E 2CHGA 1QAMA 3U60A 2R44A 3FTEA 3EIEA 3HHXA 1XHBA 1QDTA 2WSFF 1QDRA 2Z7JA 2KEBA 3B7NA 3HU1A 4XBOA 2ZM6M 3GLGA 2L7HA 1HNZM 4CIZA 4R3DA 4AKGA 2R6FA 2C98A 2APLA 2F5QA 5EXPA 2OOBA 1N75A 4LZJA 1VQ1A 3FRHA 1GVNA 3T6PA 4D81A 1NJGA 4IBIA 2K9DA 2HAKA 1TDHA 3W0LB 2XEPA 4B7GA 2JY6B 2MH8A 5EJCA 2OQ4A 4DR6M 1ZAEA 3KOZE 5FLXS 3U6PA 4L16A 4GC5A 1IY0A 4B3SM 4DUZM 1SXJD 3GLFA 3KSJA 4OX9M 5EP1A 1Q3BA 3R9XB 1PRBA 1DGGA 3L25A 2V1CA 3E4RA 2YFQA 4B7FA 2CWBA 2XF3A 1NO1A 1ZMWA 3CF6E 5KQDA 3Q8GA 2N35A 3GLGB 3VFDA 5EP3A 5GKNA 3GPXA 1QZMA 4LFBM 1L8QA 3KXEC 1T6OA 3THGA 1SXJE 4RNAA 3I4YA 4QOZC 2JUJA 4IBCA 2UXBM 2CRUA 3JR4A 5LMNM 1GL6A 2LHGA 2OOAA 3ILKA 3K8ZA 1C1KA 3HZJA 3SBJA 4ITQA 4RKUF 1BVSA 4IBGA 3U6MA 2Y20A 5ITXE 1ORYB 2QQ8A 3GLHE 5FTKA 1PJTA 1FJGM 3GLFB 3KS4A 2O5RA 1KYIA 3CF0A 4OVZA 2DKLA 2UUBM 3UZUA 4DV0M 3U6DA 1XB2B 2X4AA 4JXJA 2DWMA 4NL4H 4LFCM 4II7A 2LWXA 2XLJA 1NSFA 3SC3A 4QOSA 2VIIA 4B3MM 1EFUB 1HJPA 3GRRA 1ZMVA 3T1YM 1IQPA 3U5ZA 3VDPA 4FCWA 2FH0A 2DENA 4QNRA 2R62A 4G6ZA 3T38A 4DR5M 3LW5F 3FTCA 3DOAA 3A98B 4M9XA 3SYKA 3HJSA 2LVQD 2OPFA 2FE8A 3GPUA 3SYLA 2HWJA 3L29A 2RGHA 2RGOA 3HHZA 4UN2B 4OVZB 2CP8A 4PD2A 2K47A 4QNMA 3FUTA 4GMQA 1T3TA 1WGNA 1SXJC 3NBIA 4JI0M 3M0EA 3M7GA 4P17A 5KO3A 2UUCM 4K0KM 1UFZA 5EXSA 5LMUM 1E32A 2JNHA 4B08A 4FWGA 4LF9M 2L6OA 3L27A 3VLFB 2M60A 3IECA 4S12A 2KNVA 1TDZA 3FD9A 2DAMA 3MK6A 3R8FA 3M6AA
chains in the Genus database with same CATH topology
4IBBA 3FUVA 2DHRA 2CUZA 3SARA 3ZC7B 4L78A 4DV1M 4LF6M 3UGJA 4LF4M 3KOYE 1Z5BA 5KPZA 3GPYA 2F5PA 4X64M 5ITQA 4TUWA 1W5SA 3HJQA 3J80S 1NY5A 4PT5A 3FUWA 5EXTA 1HNXM 1IM2A 1IN6A 4G4OA 4P16A 4BLCA 1YUBA 2F5NA 5IREB 2BJWA 3WHLA 4JI3M 3J81S 5JI3E 1L2BA 4NRWA 1YSYA 3TWMA 1D2NA 4IBFA 2UUAM 3EIHA 4R7GA 2ZBKB 3DZDA 3K92A 4EIWA 1LV7A 3GPPA 3LVVA 3ZCBB 1IN8A 2XFSA 3A45A 3FUUA 3HWSA 3U6CA 2CV1A 3BOSA 3L2AA 4LRTA 3U6QA 4MB7A 4MGIE 4NXNM 3GQ5A 5E6JA 4IBJA 1N33M 4QHTA 4CHTB 4JI6M 2XSZD 3I4VA 4JI8M 7CATA 3A46A 2ERCA 1IBKM 3TQSA 1K3XA 1HQYE 5IZ7D 1L2CA 1DGHA 1Z6TA 1XNQM 3JAMS 1QYRA 5ITYA 3SFZA 4LF8M 5C1BA 2CE7A 4KLNA 2E5LM 4AW4A 3VK8A 4B3TM 1I94M 2Z4SA 5EXXA 4IJEA 1DGFA 3RGSA 4NOOB 4G4NA 1DGBA 2QCUA 3RE8A 3PNYA 2W82A 1NJFA 1IY1A 3GP1A 4KODA 4G4QA 4AKIA 3KOXE 4MGYE 1NHWC 4WURA 3U60B 3TPZA 1QANA 4PCZA 4LCBA 3GRYA 3L28A 4L8RC 2C99A 4FCVA 2ZAOA 4FW9A 4IIWA 3SAUA 3J7AS 1DGHB 1XWIA 8CATA 4G4RA 4JV5M 1OJLA 5KPTA 2FFJA 5C18A 4XGIA 4GC9A 5IWAM 3JR5A 3B9PA 1J7KA 1R2YA 2AHMA 3U5ZB 1Q39A 3L26A 2QZ4A 3SHFA 2D7EA 1R2ZA 1NHGC 2CEAA 2EO2A 3J2PB 3AOEA 1KFVA 3OTOM 3PVSA 2R45A 4M0WA 4FCTA 4OU7A 3KS8A 3QAUA 2C9CA 4KO8A 3AOEC 2I7PA 2KXEA 4ZPXA 1K82A 2JA2A 4JN6A 1SXJA 5DYIA 1YE9A 2DVWB 4MGHA 3TE6A 1G59A 4B3RM 4GHLA 2VQEM 4LJAA 3PXGA 2HKJA 3NWLA 4AG6A 3SASA 4LFBM 4MGZE 3SMSA 5ITXA 3TWKA 5BPVA 3GLHA 3J7BA 4YHHM 3VKGA 1G4AE 3IG8A 4D82A 1NNJA 2X8AA 1NY6A 4W5WA 4FWHA 2ZANA 2KRUA 3K2LA 1S3SA 1TGUA 4YY3M 3D8LA 4CISA 4X66M 4AQYM 4GKKM 1MU5A 4PDGA 1MX0A 1SXJB 3RGPA 2DZNB 3MJ5A 1E9RA 2CV2A 4AI6A 1N77A 3AL0C 3DA1A 4MM3B 1NVMA 2HL7A 5KPRA 4JI1M 3GLHB 4AG5A 3FYDA 1HNWM 4HLQA 2X49A 5KQ8A 1Q3CA 1JR3D 1IN7A 1TH4A 2KZSA 1X37A 4IBEA 2EA0A 1G41A 4DR1M 1EE8A 2QPAA 3AV0A 3CF2A 1E94E 1IXZA 1ZQ9A 2DWZB 4LY6A 2DWLA 2HHHM 3UJNA 2QBYA 1IN4A 4DV6M 2BJVA 2Y0QA 3Q8XA 4NXMM 5ITRA 4M0DA 4FD2A 2J7OA 1G8PA 1XMQM 4GITA 2KW0A 4DV3M 1N78A 3KVWA 2XFTA 2HCBA 3GRVA 3TWLA 1PJJA 4I81A 3T1HM 1IBMM 3KW6A 2F5OA 2Q2EB 2UU9M 5DYGA 2ZAMA 3SMPA 2R4JA 1R7RA 4LZZA 3AKZA 1DO2A 3HU2A 5EP4A 2D7HA 4Z6YA 1XC8A 4LGYA 1QAQA 2LH0A 3MHVC 2I7NA 4GHAA 1WXQA 4CGYB 3ZH9B 4RF1A 1E9SA 2V6ZM 4BB9A 3GLIA 2CV0A 1OFIA 3UK6A 1HR0M 3FKEA 4MH0E 3AFHA 4LFAM 2QBYB 4JI4M 4NRVA 2YQZA 2DWNA 3KDSE 3SHGB 1OFHA 5F3WA 5FSWA 4GIPA 2NQ8C 4QHSA 4AZFA 1KSFX 3GRUA 1JR3A 4HL4A 5ITUA 3D8BA 2CHQA 2H1RA 1TH3A 3HU3A 5FTNA 2M5ZA 4DV2M 3W0FA 3FTFA 3KSXA 4JYAM 4M9ZA 4AKHA 3KP1E 1XMOM 3VKHA 3GLIB 3LMMA 1I4WA 1NNUC 2Y0TA 3U6SA 4A3VB 1IXRC 4DV4M 2DZOB 4JI2M 1HT1E 4MGKE 3E9SA 2C5RA 4IJFA 4GKJM 4X65M 1J09A 1K3WA 5IT9S 2XSZA 2Y21A 2P5TA 1QAOA 2G8LA 4GH9A 1H6UA 3I51A 5FTLA 3SAWA 4I8OA 4LG2A 4LF7M 5A2QS 2YR0A 3AOGA 1Z5CA 2R65A 3HHYA 2XGNA 4IBKA 4WW0A 3U6OA 4JI5M 1N32M 3DFZA 4LJ8A 2XH9A 3FYCA 2R46A 4L15A 4DR4M 4LJ7A 3WHKA 2DXIA 1IN5A 3H4MA 4DV5M 3KOWE 2LNHC 2KZUA 4NSRA 1Z59A 2XZFA 1GL7A 4JI7M 1XNRM 2C96A 1PM5A 1W5TA 3HHWA 2J7NA 1TH2A 2Z3XA 4L4UA 2VQFM 2FOIC 3J27B 1HQCA 5DNYA 4DV7M 4DR3M 3CTWB 3A42A 3QWLA 4I5SA 4X62M 4KHPM 1XXHA 3IG5A 2CFOA 2XZUA 4I4LA 1Z5AA 2C9OA 5ITTA 3KP0E 1FNNA 3U6LA 1L2DA 2FNAA 3HJ8A 2L7IA 4IBDA 1R6BX 4LJ9A 2Z4RA 4M9SA 4DR7M 3HKPA 1UM8A 3U6EA 3SATA 2G5GX 3PNVA 4LJ5A 1PJIA 3U61A 5FTJA 4Z8XA 3T15A 3PFIA 2R18A 1IY2A 3VDUA 3RFWA 2RKOA 3HGIA 4D80A 2V1UA 2UXDM 1L1ZA 3KFUG 3VK7A 4FWDA 3LVWA 4LJ6A 4NSOB 2QP9X 2LXEA 2D7GA 2QENA 3TL4X 1XXHB 4BBAA 1L1TA 3C58A 3UMMA 2EUCA 1IBLM 4DR2M 5EQTA 1GLNA 5H37D 3U61B 3GO8A 1QQWA 5FTMA 4DUYM 3LQQA 2KRKA 4FVMA 5E26A 2R4EA 4LJ4A 4B7HA 1JQJC 1QVRA 1GKIA 4REZA 4GRIA 3K1JA 1HT2E 5BR8M 2L09A 1IXSB 1N34M 1J5EM 4RF0A 4LRSA 3FUXA 2A5YB 2KA6B 1DO0A 4OW0A 3AJIB 3GQ3A 2YNMD 3GQ4A 1N36M 3LQRA 2F4VM 3FTDA 4LGMA 2UXCM 2F5SA 4LF5M 5EP2A 2BNKA 1VDDA 1G3IA 4PDIA 2CHVA 3SAVA 5JI2E 2CHGA 1QAMA 3U60A 3FTEA 3EIEA 3HHXA 1XHBA 2Z7JA 2KEBA 3HU1A 4XBOA 2ZM6M 3GLGA 2L7HA 1HNZM 4R3DA 4AKGA 2C98A 2F5QA 5EXPA 1N75A 4LZJA 1GVNA 4D81A 1NJGA 4IBIA 3W0LB 1TDHA 4B7GA 2XEPA 2OQ4A 5EJCA 4DR6M 1ZAEA 3KOZE 5FLXS 3U6PA 4L16A 4GC5A 1IY0A 4B3SM 4DUZM 1SXJD 3GLFA 3KSJA 4OX9M 5EP1A 1Q3BA 3R9XB 1DGGA 3L25A 2V1CA 3E4RA 2YFQA 4B7FA 2XF3A 3CF6E 5KQDA 3GLGB 3VFDA 5EP3A 5GKNA 3GPXA 1QZMA 1L8QA 3KXEC 3THGA 1SXJE 4RNAA 3I4YA 4QOZC 4IBCA 2UXBM 3JR4A 5LMNM 1GL6A 3ILKA 3K8ZA 3SBJA 1C1KA 4ITQA 4IBGA 3U6MA 2Y20A 5ITXE 1ORYB 5FTKA 1FJGM 3GLFB 3KS4A 2O5RA 1KYIA 3CF0A 4OVZA 2UUBM 3UZUA 4DV0M 3U6DA 2X4AA 4JXJA 2DWMA 4NL4H 4LFCM 4II7A 2LWXA 2XLJA 1NSFA 3SC3A 4QOSA 2VIIA 4B3MM 3GRRA 3T1YM 1IQPA 3U5ZA 3VDPA 4FCWA 4QNRA 2R62A 4G6ZA 3T38A 4DR5M 3FTCA 3DOAA 3A98B 4M9XA 3SYKA 3HJSA 2OPFA 2FE8A 3GPUA 3SYLA 3L29A 2RGHA 2RGOA 3HHZA 4OVZB 4PD2A 2K47A 4QNMA 3FUTA 4GMQA 1T3TA 1SXJC 3NBIA 4JI0M 3M0EA 3M7GA 5KO3A 2UUCM 4K0KM 5EXSA 5LMUM 1E32A 4B08A 4FWGA 4LF9M 2L6OA 3L27A 3VLFB 2M60A 4S12A 1TDZA 3FD9A 3MK6A 3R8FA 3M6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 M;  4DV2 M;  3W0F A;  1J5E M;  3SAR A;  4JYA M;  1XMO M;  1K82 A;  4LF6 M;  4DV1 M;  3GQ3 A;  4LF4 M;  3GQ4 A;  1N36 M;  1Z5B A;  3U6S A;  4DV4 M;  2F4V M;  4JI2 M;  2UXC M;  2F5S A;  4LF5 M;  3GPY A;  2F5P A;  4GKJ M;  4X64 M;  4X65 M;  5ITQ A;  1K3W A;  4PDI A;  4B3R M;  2VQE M;  3SAV A;  5IT9 S;  2HKJ A;  3J80 S;  3SAS A;  4LFB M;  5ITX A;  3TWK A;  1HNX M;  4G4O A;  4YHH M;  3SAW A;  2ZM6 M;  2F5N A;  1NNJ A;  1HNZ M;  4LF7 M;  5A2Q S;  1Z5C A;  2F5Q A;  1L2B A;  4JI3 M;  3J81 S;  4NRW A;  3TWM A;  3U6O A;  4YY3 M;  4JI5 M;  2UUA M;  1TDH A;  1N32 M;  2OQ4 A;  4CIS A;  4X66 M;  2ZBK B;  4DR6 M;  4AQY M;  4DR4 M;  1MU5 A;  4GKK M;  5FLX S;  3U6P A;  3GPP A;  4PDG A;  1MX0 A;  4B3S M;  4DUZ M;  3A45 A;  4DV5 M;  3U6C A;  4OX9 M;  1Q3B A;  2XZF A;  1Z59 A;  3U6Q A;  4MB7 A;  3GQ5 A;  4NXN M;  4JI7 M;  1XNR M;  1N33 M;  4JI6 M;  4JI8 M;  4JI1 M;  3A46 A;  1PM5 A;  1HNW M;  2VQF M;  4DV7 M;  4DR3 M;  1Q3C A;  1IBK M;  3GPX A;  1K3X A;  3A42 A;  1L2C A;  4X62 M;  4KHP M;  1XNQ M;  2EA0 A;  2XZU A;  4DR1 M;  3JAM S;  2UXB M;  1Z5A A;  1EE8 A;  5ITY A;  3JR4 A;  5LMN M;  4LF8 M;  5ITT A;  3U6L A;  3SBJ A;  1L2D A;  2E5L M;  4ITQ A;  3VK8 A;  3U6M A;  2HHH M;  1I94 M;  4B3T M;  4DR7 M;  3U6E A;  4DV6 M;  5ITX E;  3SAT A;  4NXM M;  5ITR A;  1PJI A;  1FJG M;  2UUB M;  1XMQ M;  4G4N A;  4DV3 M;  4DV0 M;  3U6D A;  3TWL A;  1PJJ A;  1IBM M;  3GP1 A;  4G4Q A;  3T1H M;  4LFC M;  2F5O A;  2Q2E B;  4PCZ A;  4B3M M;  2UXD M;  1L1Z A;  2UU9 M;  3VK7 A;  3T1Y M;  1XC8 A;  3SAU A;  3J7A S;  4G4R A;  1L1T A;  3C58 A;  4JV5 M;  4DR5 M;  3DOA A;  1IBL M;  2OPF A;  5IWA M;  3JR5 A;  3GPU A;  4DR2 M;  1HR0 M;  4LFA M;  1R2Y A;  4JI4 M;  4NRV A;  1Q39 A;  3GO8 A;  4PD2 A;  1R2Z A;  4DUY M;  4JI0 M;  2UUC M;  4K0K M;  5LMU M;  4LF9 M;  1KFV A;  5ITU A;  3OTO M;  5BR8 M;  1TDZ A; 
#chains in the Genus database with same CATH topology
 4IBB A;  3FUV A;  2WSE F;  2DHR A;  2CUZ A;  1C7Y A;  3B89 A;  2QSF X;  3SAR A;  3ZC7 B;  4L78 A;  4DV1 M;  4LF6 M;  4R71 A;  1OIZ A;  1T43 A;  3UGJ A;  4LF4 M;  3KOY E;  1Z5B A;  5KPZ A;  3GPY A;  2F5P A;  1TF0 B;  4X64 M;  1D0L A;  5ITQ A;  4TUW A;  2JY8 A;  1AIP C;  1W5S A;  3HJQ A;  3J80 S;  1NY5 A;  2K0B X;  4PT5 A;  3FUW A;  5EXT A;  1HNX M;  1IM2 A;  1IN6 A;  4G4O A;  4DR7 M;  3V76 A;  4P16 A;  2JWS A;  4BLC A;  1YUB A;  2F5N A;  5IRE B;  3GLI E;  2BJW A;  2Z8Y M;  3WHL A;  4JI3 M;  4CJ6 A;  5JI3 E;  3J81 S;  1L2B A;  4NRW A;  1YSY A;  3TWM A;  1D2N A;  4IBF A;  2UUA M;  3EIH A;  4R7G A;  2ZBK B;  4G3O A;  4XK8 F;  1WR1 B;  3DZD A;  3K92 A;  4EIW A;  1LV7 A;  3GPP A;  3LVV A;  3ZCB B;  1IN8 A;  2XFS A;  3A45 A;  3FUU A;  3HWS A;  3U6C A;  2CV1 A;  3BOS A;  1JR3 E;  3L2A A;  4LRT A;  3U6Q A;  2EKK A;  4MB7 A;  4MGI E;  2BWE A;  4NXN M;  3GQ5 A;  5E6J A;  4IBJ A;  1N33 M;  4QHT A;  4CHT B;  4JI6 M;  2XSZ D;  3I4V A;  4JI8 M;  7CAT A;  3A46 A;  2ERC A;  1AUA A;  1VEJ A;  1IBK M;  2L4F A;  3TQS A;  1K3X A;  1HQY E;  5IZ7 D;  3MMP A;  1L2C A;  2VF8 A;  1DGH A;  1Z6T A;  4NC6 A;  1XNQ M;  3JAM S;  1QYR A;  5ITY A;  3SFZ A;  4ANR A;  2GNO A;  4LF8 M;  5C1B A;  2CE7 A;  1WJ7 A;  4KLN A;  3W68 A;  2E5L M;  4AW4 A;  3VK8 A;  4B3T M;  1I94 M;  2Z4S A;  5EXX A;  3QYB A;  4IJE A;  3E21 A;  1DGF A;  3RGS A;  2QHO B;  4NOO B;  4G4N A;  1DGB A;  2QCU A;  3RE8 A;  3PNY A;  1PJS A;  2W82 A;  1NJF A;  1IY1 A;  3GP1 A;  4KOD A;  4G4Q A;  4AKI A;  3KOX E;  4MGY E;  1NHW C;  4WUR A;  3U60 B;  1PJQ A;  3TPZ A;  1QAN A;  4PCZ A;  4LCB A;  1MN3 A;  3GRY A;  2K6B A;  2JY5 A;  2OO9 A;  3L28 A;  2C99 A;  4L8R C;  4FCV A;  2ZTD A;  2ZAO A;  4FW9 A;  4IIW A;  3SAU A;  3J7A S;  3B74 A;  1DGH B;  1XWI A;  8CAT A;  1LTM A;  4G4R A;  4JV5 M;  2WZJ A;  1OJL A;  3LCU A;  5KPT A;  2FFJ A;  1ZMU A;  4XGI A;  5C18 A;  4GC9 A;  3HY5 A;  5IWA M;  3JR5 A;  1Q02 A;  3B9P A;  1J7K A;  1R2Y A;  3B7Q A;  2AHM A;  3U5Z B;  1Q39 A;  1GAB A;  3L26 A;  1TTE A;  2QZ4 A;  3SHF A;  3LCV B;  1OTR A;  2D7E A;  2KNA A;  1R2Z A;  1NHG C;  4L6V 6;  1XXH E;  2CEA A;  2EO2 A;  3J2P B;  3AOE A;  4F2L A;  1KFV A;  3OTO M;  3PVS A;  2R45 A;  4M0W A;  2BWB A;  4FCT A;  4OU7 A;  3KS8 A;  3QAU A;  1OKS A;  2ZTC A;  2C9C A;  4KO8 A;  3AOE C;  2I7P A;  2KXE A;  4ZPX A;  1K82 A;  2JA2 A;  2R0I A;  1QUT A;  4JN6 A;  5DFL A;  2L2D A;  1F4I A;  1NV8 A;  1SXJ A;  2MJ5 B;  5DYI A;  1JB0 F;  1YE9 A;  1SG9 A;  2DVW B;  3C9P A;  4MGH A;  3TE6 A;  1G59 A;  4B3R M;  2H5X A;  2LVO C;  2VQE M;  4GHL A;  4LJA A;  3PXG A;  2HKJ A;  3NWL A;  4AG6 A;  3SAS A;  2DAE A;  4MGZ E;  3SMS A;  5ITX A;  3TWK A;  1A5T A;  3GLH A;  3J7B A;  5BPV A;  4YHH M;  3VKG A;  1G4A E;  4HEO A;  3IG8 A;  4D82 A;  1NNJ A;  2X8A A;  1NY6 A;  2WSC F;  1IFY A;  2LBC A;  4W5W A;  4FWH A;  2ZAN A;  2KRU A;  3K2L A;  1S3S A;  1TGU A;  4YY3 M;  3D8L A;  4CIS A;  4X66 M;  2J5Y A;  3HX3 A;  2FS1 A;  4AQY M;  3ZQJ A;  1MU5 A;  4GKK M;  4PDG A;  1MX0 A;  1SXJ B;  3RGP A;  2DZN B;  3MJ5 A;  1E9R A;  2CV2 A;  1GJS A;  4AI6 A;  2QNJ A;  1N77 A;  1MJG M;  3AL0 C;  3DA1 A;  4MM3 B;  1NVM A;  2HL7 A;  5KPR A;  4JI1 M;  3GLH B;  4AG5 A;  3FYD A;  1HNW M;  4HLQ A;  1Y8G A;  2X49 A;  1VEG A;  3K9P A;  2LTU A;  5KQ8 A;  1Q3C A;  2G3Q A;  1JR3 D;  1IN7 A;  4DBG B;  2KZS A;  1TH4 A;  1X37 A;  3E46 A;  4IBE A;  2EA0 A;  1G41 A;  3C3D A;  4DR1 M;  1EE8 A;  2EKF A;  2QPA A;  2B3T A;  3AV0 A;  2DAG A;  3CF2 A;  1E94 E;  1IXZ A;  1OIP A;  1ZQ9 A;  2DWZ B;  4LY6 A;  2DWL A;  2HHH M;  3UJN A;  2QBY A;  1IN4 A;  1V92 A;  4DV6 M;  2BJV A;  2KNZ A;  2Y0Q A;  3Q8X A;  4NXM M;  5ITR A;  4M0D A;  4FD2 A;  2J7O A;  1G8P A;  1XMQ M;  4GIT A;  2KW0 A;  1OQY A;  3GLG E;  4DV3 M;  1N78 A;  3KVW A;  2XFT A;  2HCB A;  3GRV A;  3TWL A;  1PJJ A;  4I81 A;  3T1H M;  1IBM M;  3KW6 A;  2F5O A;  2Q2E B;  2UU9 M;  5DYG A;  2LVP C;  2ZAM A;  2R4J A;  3SMP A;  1R7R A;  4LZZ A;  3AKZ A;  1DO2 A;  3HU2 A;  5EP4 A;  2D7H A;  4Z6Y A;  1XC8 A;  4LGY A;  1QAQ A;  2LH0 A;  3MHV C;  2I7N A;  1R5L A;  4GHA A;  1WXQ A;  2KDL A;  3GLF E;  4CGY B;  3ZH9 B;  4RF1 A;  1E9S A;  2V6Z M;  4BB9 A;  3GLI A;  2CV0 A;  1OFI A;  1NV9 A;  3UK6 A;  1HR0 M;  3FKE A;  4MH0 E;  3AFH A;  4LFA M;  1D0K A;  2QBY B;  4JI4 M;  2JZ1 A;  3FE3 A;  4NRV A;  2MR9 A;  2YQZ A;  2DWN A;  2L4E A;  3KDS E;  1G71 A;  3SHG B;  1OFH A;  5F3W A;  5FSW A;  4GIP A;  2NQ8 C;  4QHS A;  4AZF A;  1KSF X;  3GRU A;  1JR3 A;  4GEW A;  4HL4 A;  3B7Z A;  3D8B A;  5ITU A;  3H4J A;  2CHQ A;  2H1R A;  1TH3 A;  1VEK A;  3HU3 A;  1V34 A;  5FTN A;  2M5Z A;  1V33 A;  2DNA A;  3W0F A;  1VG5 A;  4WP2 A;  4DV2 M;  3KSX A;  3FTF A;  4JYA M;  4M9Z A;  4AKH A;  3KP1 E;  1XMO M;  3VKH A;  1DV0 A;  2DI0 A;  3BXW A;  3GLI B;  3LMM A;  3I01 M;  1I4W A;  1NNU C;  2Y0T A;  3U6S A;  4A3V B;  1IXR C;  4DV4 M;  2DZO B;  4JI2 M;  4Q7J A;  1HT1 E;  4MGK E;  3E9S A;  2C5R A;  4IJF A;  4GKJ M;  3I04 M;  4X65 M;  1J09 A;  1K3W A;  4Y28 F;  5IT9 S;  1PGY A;  2XSZ A;  2Y21 A;  1QUS A;  1WIV A;  2P5T A;  1QAO A;  2G8L A;  4GH9 A;  1H6U A;  2GQF A;  3I51 A;  5FTL A;  3SAW A;  4I8O A;  4LG2 A;  4LF7 M;  5A2Q S;  2YR0 A;  3AOG A;  1Z5C A;  2R65 A;  3C3E A;  3W67 A;  4KT0 F;  3HHY A;  5L8R F;  2XGN A;  4IBK A;  4WW0 A;  3U6O A;  4JI5 M;  1N32 M;  3DFZ A;  4LJ8 A;  2XH9 A;  3FYC A;  2R46 A;  4L15 A;  4DR4 M;  4LJ7 A;  3WHK A;  2DXI A;  1IN5 A;  3H4M A;  4DV5 M;  3BBZ A;  3KOW E;  2LNH C;  2KZU A;  4NSR A;  1Z59 A;  2XZF A;  1GL7 A;  1GJT A;  4JI7 M;  1XNR M;  2JY7 A;  2C96 A;  2RRU A;  3QYE A;  1P3Q Q;  3IHP A;  1PM5 A;  1W5T A;  3HHW A;  2J7N A;  1TH2 A;  2Z3X A;  4L4U A;  2VQF M;  2FOI C;  3J27 B;  1HQC A;  5DNY A;  4DV7 M;  4DR3 M;  3CGW A;  2DAK A;  3CTW B;  3A42 A;  3QWL A;  4I5S A;  4X62 M;  4KHP M;  1XXH A;  1R4G A;  3FRI A;  3IG5 A;  2CFO A;  2XZU A;  4I4L A;  1Z5A A;  2C9O A;  5ITT A;  1FNN A;  3KP0 E;  3U6L A;  1L2D A;  2FNA A;  3HJ8 A;  2L7I A;  4IBD A;  1R6B X;  4LJ9 A;  2Z4R A;  1CUK A;  1OAO C;  4M9S A;  3HKP A;  1UM8 A;  1WGL A;  3U6E A;  1VDL A;  2MGW A;  2G5G X;  3SAT A;  1D0M A;  3PNV A;  4LJ5 A;  1PJI A;  3U61 A;  2JZ0 A;  5FTJ A;  2O25 A;  1EIJ A;  4Z8X A;  3T15 A;  3PFI A;  2R18 A;  1IY2 A;  1WHC A;  3VDU A;  1ZV1 A;  3RFW A;  2RKO A;  3HGI A;  4D80 A;  2V1U A;  2UXD M;  1L1Z A;  1YLA A;  2LHC A;  3VK7 A;  4FWD A;  3KFU G;  1GO5 A;  3LVW A;  4LJ6 A;  4NSO B;  2QP9 X;  2DHY A;  1IXS A;  2LXE A;  2D7G A;  2QEN A;  2O01 F;  3TL4 X;  1XXH B;  4BBA A;  1L1T A;  3C58 A;  3UMM A;  3K9O A;  2EUC A;  2DZL A;  2JP7 A;  1RU3 A;  2LVA A;  1IBL M;  2VF7 A;  4DR2 M;  5EQT A;  1GLN A;  5H37 D;  1QZE A;  3U61 B;  3GO8 A;  1QQW A;  5FTM A;  4DUY M;  4F1I A;  3LQQ A;  2KRK A;  4FVM A;  5E26 A;  2R4E A;  2KHH A;  4LJ4 A;  4B7H A;  1JQJ C;  1QVR A;  2VDB B;  1GKI A;  4REZ A;  4GRI A;  3K1J A;  1HT2 E;  5BR8 M;  2L09 A;  1IXS B;  2EJS A;  1N34 M;  1J5E M;  4RF0 A;  4LRS A;  3F92 A;  2MRO B;  3FUX A;  2A5Y B;  2KA6 B;  1DO0 A;  4OW0 A;  2JXN A;  3AJI B;  2DAI A;  3GQ3 A;  2YNM D;  3GQ4 A;  1N36 M;  3LQR A;  2F4V M;  2LVN C;  3FTD A;  1TR8 A;  4LGM A;  2UXC M;  2F5S A;  4LF5 M;  3NBX X;  5EP2 A;  2BNK A;  1OAI A;  1VDD A;  1G3I A;  4PDI A;  2CHV A;  3SAV A;  5JI2 E;  2CHG A;  1QAM A;  3U60 A;  2R44 A;  3FTE A;  3EIE A;  3HHX A;  1XHB A;  1QDT A;  2WSF F;  1QDR A;  2Z7J A;  2KEB A;  3B7N A;  3HU1 A;  4XBO A;  2ZM6 M;  3GLG A;  2L7H A;  1HNZ M;  4CIZ A;  4R3D A;  4AKG A;  2R6F A;  2C98 A;  2APL A;  2F5Q A;  5EXP A;  2OOB A;  1N75 A;  4LZJ A;  1VQ1 A;  3FRH A;  1GVN A;  3T6P A;  4D81 A;  1NJG A;  4IBI A;  2K9D A;  2HAK A;  1TDH A;  3W0L B;  2XEP A;  4B7G A;  2JY6 B;  2MH8 A;  5EJC A;  2OQ4 A;  4DR6 M;  1ZAE A;  3KOZ E;  5FLX S;  3U6P A;  4L16 A;  4GC5 A;  1IY0 A;  4B3S M;  4DUZ M;  1SXJ D;  3GLF A;  3KSJ A;  4OX9 M;  5EP1 A;  1Q3B A;  3R9X B;  1PRB A;  1DGG A;  3L25 A;  2V1C A;  3E4R A;  2YFQ A;  4B7F A;  2CWB A;  2XF3 A;  1NO1 A;  1ZMW A;  3CF6 E;  5KQD A;  3Q8G A;  2N35 A;  3GLG B;  3VFD A;  5EP3 A;  5GKN A;  3GPX A;  1QZM A;  4LFB M;  1L8Q A;  3KXE C;  1T6O A;  3THG A;  1SXJ E;  4RNA A;  3I4Y A;  4QOZ C;  2JUJ A;  4IBC A;  2UXB M;  2CRU A;  3JR4 A;  5LMN M;  1GL6 A;  2LHG A;  2OOA A;  3ILK A;  3K8Z A;  1C1K A;  3HZJ A;  3SBJ A;  4ITQ A;  4RKU F;  1BVS A;  4IBG A;  3U6M A;  2Y20 A;  5ITX E;  1ORY B;  2QQ8 A;  3GLH E;  5FTK A;  1PJT A;  1FJG M;  3GLF B;  3KS4 A;  2O5R A;  1KYI A;  3CF0 A;  4OVZ A;  2DKL A;  2UUB M;  3UZU A;  4DV0 M;  3U6D A;  1XB2 B;  2X4A A;  4JXJ A;  2DWM A;  4NL4 H;  4LFC M;  4II7 A;  2LWX A;  2XLJ A;  1NSF A;  3SC3 A;  4QOS A;  2VII A;  4B3M M;  1EFU B;  1HJP A;  3GRR A;  1ZMV A;  3T1Y M;  1IQP A;  3U5Z A;  3VDP A;  4FCW A;  2FH0 A;  2DEN A;  4QNR A;  2R62 A;  4G6Z A;  3T38 A;  4DR5 M;  3LW5 F;  3FTC A;  3DOA A;  3A98 B;  4M9X A;  3SYK A;  3HJS A;  2LVQ D;  2OPF A;  2FE8 A;  3GPU A;  3SYL A;  2HWJ A;  3L29 A;  2RGH A;  2RGO A;  3HHZ A;  4UN2 B;  4OVZ B;  2CP8 A;  4PD2 A;  2K47 A;  4QNM A;  3FUT A;  4GMQ A;  1T3T A;  1WGN A;  1SXJ C;  3NBI A;  4JI0 M;  3M0E A;  3M7G A;  4P17 A;  5KO3 A;  2UUC M;  4K0K M;  1UFZ A;  5EXS A;  5LMU M;  1E32 A;  2JNH A;  4B08 A;  4FWG A;  4LF9 M;  2L6O A;  3L27 A;  3VLF B;  2M60 A;  3IEC A;  4S12 A;  2KNV A;  1TDZ A;  3FD9 A;  2DAM A;  3MK6 A;  3R8F A;  3M6A A; 
#chains in the Genus database with same CATH homology
 4IBB A;  3FUV A;  2DHR A;  2CUZ A;  3SAR A;  3ZC7 B;  4L78 A;  4DV1 M;  4LF6 M;  3UGJ A;  4LF4 M;  3KOY E;  1Z5B A;  5KPZ A;  3GPY A;  2F5P A;  4X64 M;  5ITQ A;  4TUW A;  1W5S A;  3HJQ A;  3J80 S;  1NY5 A;  4PT5 A;  3FUW A;  5EXT A;  1HNX M;  1IM2 A;  1IN6 A;  4G4O A;  4P16 A;  4BLC A;  1YUB A;  2F5N A;  5IRE B;  2BJW A;  3WHL A;  4JI3 M;  3J81 S;  5JI3 E;  1L2B A;  4NRW A;  1YSY A;  3TWM A;  1D2N A;  4IBF A;  2UUA M;  3EIH A;  4R7G A;  2ZBK B;  3DZD A;  3K92 A;  4EIW A;  1LV7 A;  3GPP A;  3LVV A;  3ZCB B;  1IN8 A;  2XFS A;  3A45 A;  3FUU A;  3HWS A;  3U6C A;  2CV1 A;  3BOS A;  3L2A A;  4LRT A;  3U6Q A;  4MB7 A;  4MGI E;  4NXN M;  3GQ5 A;  5E6J A;  4IBJ A;  1N33 M;  4QHT A;  4CHT B;  4JI6 M;  2XSZ D;  3I4V A;  4JI8 M;  7CAT A;  3A46 A;  2ERC A;  1IBK M;  3TQS A;  1K3X A;  1HQY E;  5IZ7 D;  1L2C A;  1DGH A;  1Z6T A;  1XNQ M;  3JAM S;  1QYR A;  5ITY A;  3SFZ A;  4LF8 M;  5C1B A;  2CE7 A;  4KLN A;  2E5L M;  4AW4 A;  3VK8 A;  4B3T M;  1I94 M;  2Z4S A;  5EXX A;  4IJE A;  1DGF A;  3RGS A;  4NOO B;  4G4N A;  1DGB A;  2QCU A;  3RE8 A;  3PNY A;  2W82 A;  1NJF A;  1IY1 A;  3GP1 A;  4KOD A;  4G4Q A;  4AKI A;  3KOX E;  4MGY E;  1NHW C;  4WUR A;  3U60 B;  3TPZ A;  1QAN A;  4PCZ A;  4LCB A;  3GRY A;  3L28 A;  4L8R C;  2C99 A;  4FCV A;  2ZAO A;  4FW9 A;  4IIW A;  3SAU A;  3J7A S;  1DGH B;  1XWI A;  8CAT A;  4G4R A;  4JV5 M;  1OJL A;  5KPT A;  2FFJ A;  5C18 A;  4XGI A;  4GC9 A;  5IWA M;  3JR5 A;  3B9P A;  1J7K A;  1R2Y A;  2AHM A;  3U5Z B;  1Q39 A;  3L26 A;  2QZ4 A;  3SHF A;  2D7E A;  1R2Z A;  1NHG C;  2CEA A;  2EO2 A;  3J2P B;  3AOE A;  1KFV A;  3OTO M;  3PVS A;  2R45 A;  4M0W A;  4FCT A;  4OU7 A;  3KS8 A;  3QAU A;  2C9C A;  4KO8 A;  3AOE C;  2I7P A;  2KXE A;  4ZPX A;  1K82 A;  2JA2 A;  4JN6 A;  1SXJ A;  5DYI A;  1YE9 A;  2DVW B;  4MGH A;  3TE6 A;  1G59 A;  4B3R M;  4GHL A;  2VQE M;  4LJA A;  3PXG A;  2HKJ A;  3NWL A;  4AG6 A;  3SAS A;  4LFB M;  4MGZ E;  3SMS A;  5ITX A;  3TWK A;  5BPV A;  3GLH A;  3J7B A;  4YHH M;  3VKG A;  1G4A E;  3IG8 A;  4D82 A;  1NNJ A;  2X8A A;  1NY6 A;  4W5W A;  4FWH A;  2ZAN A;  2KRU A;  3K2L A;  1S3S A;  1TGU A;  4YY3 M;  3D8L A;  4CIS A;  4X66 M;  4AQY M;  4GKK M;  1MU5 A;  4PDG A;  1MX0 A;  1SXJ B;  3RGP A;  2DZN B;  3MJ5 A;  1E9R A;  2CV2 A;  4AI6 A;  1N77 A;  3AL0 C;  3DA1 A;  4MM3 B;  1NVM A;  2HL7 A;  5KPR A;  4JI1 M;  3GLH B;  4AG5 A;  3FYD A;  1HNW M;  4HLQ A;  2X49 A;  5KQ8 A;  1Q3C A;  1JR3 D;  1IN7 A;  1TH4 A;  2KZS A;  1X37 A;  4IBE A;  2EA0 A;  1G41 A;  4DR1 M;  1EE8 A;  2QPA A;  3AV0 A;  3CF2 A;  1E94 E;  1IXZ A;  1ZQ9 A;  2DWZ B;  4LY6 A;  2DWL A;  2HHH M;  3UJN A;  2QBY A;  1IN4 A;  4DV6 M;  2BJV A;  2Y0Q A;  3Q8X A;  4NXM M;  5ITR A;  4M0D A;  4FD2 A;  2J7O A;  1G8P A;  1XMQ M;  4GIT A;  2KW0 A;  4DV3 M;  1N78 A;  3KVW A;  2XFT A;  2HCB A;  3GRV A;  3TWL A;  1PJJ A;  4I81 A;  3T1H M;  1IBM M;  3KW6 A;  2F5O A;  2Q2E B;  2UU9 M;  5DYG A;  2ZAM A;  3SMP A;  2R4J A;  1R7R A;  4LZZ A;  3AKZ A;  1DO2 A;  3HU2 A;  5EP4 A;  2D7H A;  4Z6Y A;  1XC8 A;  4LGY A;  1QAQ A;  2LH0 A;  3MHV C;  2I7N A;  4GHA A;  1WXQ A;  4CGY B;  3ZH9 B;  4RF1 A;  1E9S A;  2V6Z M;  4BB9 A;  3GLI A;  2CV0 A;  1OFI A;  3UK6 A;  1HR0 M;  3FKE A;  4MH0 E;  3AFH A;  4LFA M;  2QBY B;  4JI4 M;  4NRV A;  2YQZ A;  2DWN A;  3KDS E;  3SHG B;  1OFH A;  5F3W A;  5FSW A;  4GIP A;  2NQ8 C;  4QHS A;  4AZF A;  1KSF X;  3GRU A;  1JR3 A;  4HL4 A;  5ITU A;  3D8B A;  2CHQ A;  2H1R A;  1TH3 A;  3HU3 A;  5FTN A;  2M5Z A;  4DV2 M;  3W0F A;  3FTF A;  3KSX A;  4JYA M;  4M9Z A;  4AKH A;  3KP1 E;  1XMO M;  3VKH A;  3GLI B;  3LMM A;  1I4W A;  1NNU C;  2Y0T A;  3U6S A;  4A3V B;  1IXR C;  4DV4 M;  2DZO B;  4JI2 M;  1HT1 E;  4MGK E;  3E9S A;  2C5R A;  4IJF A;  4GKJ M;  4X65 M;  1J09 A;  1K3W A;  5IT9 S;  2XSZ A;  2Y21 A;  2P5T A;  1QAO A;  2G8L A;  4GH9 A;  1H6U A;  3I51 A;  5FTL A;  3SAW A;  4I8O A;  4LG2 A;  4LF7 M;  5A2Q S;  2YR0 A;  3AOG A;  1Z5C A;  2R65 A;  3HHY A;  2XGN A;  4IBK A;  4WW0 A;  3U6O A;  4JI5 M;  1N32 M;  3DFZ A;  4LJ8 A;  2XH9 A;  3FYC A;  2R46 A;  4L15 A;  4DR4 M;  4LJ7 A;  3WHK A;  2DXI A;  1IN5 A;  3H4M A;  4DV5 M;  3KOW E;  2LNH C;  2KZU A;  4NSR A;  1Z59 A;  2XZF A;  1GL7 A;  4JI7 M;  1XNR M;  2C96 A;  1PM5 A;  1W5T A;  3HHW A;  2J7N A;  1TH2 A;  2Z3X A;  4L4U A;  2VQF M;  2FOI C;  3J27 B;  1HQC A;  5DNY A;  4DV7 M;  4DR3 M;  3CTW B;  3A42 A;  3QWL A;  4I5S A;  4X62 M;  4KHP M;  1XXH A;  3IG5 A;  2CFO A;  2XZU A;  4I4L A;  1Z5A A;  2C9O A;  5ITT A;  3KP0 E;  1FNN A;  3U6L A;  1L2D A;  2FNA A;  3HJ8 A;  2L7I A;  4IBD A;  1R6B X;  4LJ9 A;  2Z4R A;  4M9S A;  4DR7 M;  3HKP A;  1UM8 A;  3U6E A;  3SAT A;  2G5G X;  3PNV A;  4LJ5 A;  1PJI A;  3U61 A;  5FTJ A;  4Z8X A;  3T15 A;  3PFI A;  2R18 A;  1IY2 A;  3VDU A;  3RFW A;  2RKO A;  3HGI A;  4D80 A;  2V1U A;  2UXD M;  1L1Z A;  3KFU G;  3VK7 A;  4FWD A;  3LVW A;  4LJ6 A;  4NSO B;  2QP9 X;  2LXE A;  2D7G A;  2QEN A;  3TL4 X;  1XXH B;  4BBA A;  1L1T A;  3C58 A;  3UMM A;  2EUC A;  1IBL M;  4DR2 M;  5EQT A;  1GLN A;  5H37 D;  3U61 B;  3GO8 A;  1QQW A;  5FTM A;  4DUY M;  3LQQ A;  2KRK A;  4FVM A;  5E26 A;  2R4E A;  4LJ4 A;  4B7H A;  1JQJ C;  1QVR A;  1GKI A;  4REZ A;  4GRI A;  3K1J A;  1HT2 E;  5BR8 M;  2L09 A;  1IXS B;  1N34 M;  1J5E M;  4RF0 A;  4LRS A;  3FUX A;  2A5Y B;  2KA6 B;  1DO0 A;  4OW0 A;  3AJI B;  3GQ3 A;  2YNM D;  3GQ4 A;  1N36 M;  3LQR A;  2F4V M;  3FTD A;  4LGM A;  2UXC M;  2F5S A;  4LF5 M;  5EP2 A;  2BNK A;  1VDD A;  1G3I A;  4PDI A;  2CHV A;  3SAV A;  5JI2 E;  2CHG A;  1QAM A;  3U60 A;  3FTE A;  3EIE A;  3HHX A;  1XHB A;  2Z7J A;  2KEB A;  3HU1 A;  4XBO A;  2ZM6 M;  3GLG A;  2L7H A;  1HNZ M;  4R3D A;  4AKG A;  2C98 A;  2F5Q A;  5EXP A;  1N75 A;  4LZJ A;  1GVN A;  4D81 A;  1NJG A;  4IBI A;  3W0L B;  1TDH A;  4B7G A;  2XEP A;  2OQ4 A;  5EJC A;  4DR6 M;  1ZAE A;  3KOZ E;  5FLX S;  3U6P A;  4L16 A;  4GC5 A;  1IY0 A;  4B3S M;  4DUZ M;  1SXJ D;  3GLF A;  3KSJ A;  4OX9 M;  5EP1 A;  1Q3B A;  3R9X B;  1DGG A;  3L25 A;  2V1C A;  3E4R A;  2YFQ A;  4B7F A;  2XF3 A;  3CF6 E;  5KQD A;  3GLG B;  3VFD A;  5EP3 A;  5GKN A;  3GPX A;  1QZM A;  1L8Q A;  3KXE C;  3THG A;  1SXJ E;  4RNA A;  3I4Y A;  4QOZ C;  4IBC A;  2UXB M;  3JR4 A;  5LMN M;  1GL6 A;  3ILK A;  3K8Z A;  3SBJ A;  1C1K A;  4ITQ A;  4IBG A;  3U6M A;  2Y20 A;  5ITX E;  1ORY B;  5FTK A;  1FJG M;  3GLF B;  3KS4 A;  2O5R A;  1KYI A;  3CF0 A;  4OVZ A;  2UUB M;  3UZU A;  4DV0 M;  3U6D A;  2X4A A;  4JXJ A;  2DWM A;  4NL4 H;  4LFC M;  4II7 A;  2LWX A;  2XLJ A;  1NSF A;  3SC3 A;  4QOS A;  2VII A;  4B3M M;  3GRR A;  3T1Y M;  1IQP A;  3U5Z A;  3VDP A;  4FCW A;  4QNR A;  2R62 A;  4G6Z A;  3T38 A;  4DR5 M;  3FTC A;  3DOA A;  3A98 B;  4M9X A;  3SYK A;  3HJS A;  2OPF A;  2FE8 A;  3GPU A;  3SYL A;  3L29 A;  2RGH A;  2RGO A;  3HHZ A;  4OVZ B;  4PD2 A;  2K47 A;  4QNM A;  3FUT A;  4GMQ A;  1T3T A;  1SXJ C;  3NBI A;  4JI0 M;  3M0E A;  3M7G A;  5KO3 A;  2UUC M;  4K0K M;  5EXS A;  5LMU M;  1E32 A;  4B08 A;  4FWG A;  4LF9 M;  2L6O A;  3L27 A;  3VLF B;  2M60 A;  4S12 A;  1TDZ A;  3FD9 A;  3MK6 A;  3R8F A;  3M6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...