4B3TM

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3tM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3tM02
2XZUA 3JAMS 3U6EA 1J5EM 3GPYA 4DV7M 5ITXE 3GPPA 1Z5CA 4NRVA 3SBJA 3T1HM 4AQYM 1N33M 3A46A 2E5LM 1NNJA 5ITRA 1PJIA 4JI2M 3DOAA 4DV0M 4DV6M 3SAUA 4DR7M 4X66M 4NXNM 1Z5BA 2F4VM 2EA0A 5LMUM 5LMNM 2F5NA 1KFVA 4JI3M 2UXDM 4DR5M 1PJJA 4DV2M 4JI6M 3C58A 3J7AS 1HR0M 3JR4A 4K0KM 3VK7A 1IBKM 3A45A 3U6QA 5ITQA 3U6OA 4JI7M 4G4QA 3GQ5A 1N32M 3W0FA 4B3SM 4PD2A 1MX0A 4PDIA 2ZM6M 1XNQM 3U6MA 1IBMM 3A42A 4LF6M 4KHPM 3J80S 3GQ4A 3U6PA 2HKJA 4ITQA 3U6SA 4PCZA 1K82A 4G4RA 5IWAM 3T1YM 4G4OA 1HNZM 4DV3M 3TWLA 4B3TM 1PM5A 1R2ZA 1XMOM 3U6DA 3GPUA 1K3WA 3SARA 1Q3BA 1TDHA 1Q39A 3GQ3A 5FLXS 4JI5M 4NRWA 3GPXA 2VQFM 4X62M 3JR5A 1IBLM 4LF4M 2ZBKB 4B3MM 4DR6M 3TWKA 4YHHM 1Q3CA 3U6LA 3TWMA 5ITTA 1XNRM 1R2YA 1Z5AA 4LF9M 2UXBM 5ITYA 1N36M 4LF8M 4DR3M 1XMQM 1I94M 4LFCM 2UUBM 5BR8M 2UUCM 2OPFA 4NXMM 3SAVA 1TDZA 4DUZM 4DR1M 2F5PA 2F5OA 3GP1A 2UUAM 1L2BA 1K3XA 2F5QA 2Q2EB 1MU5A 3J81S 5A2QS 4YY3M 1L1ZA 1HNXM 2XZFA 4GKKM 4DV1M 2HHHM 4JV5M 2UU9M 1XC8A 1L2DA 4B3RM 2UXCM 5ITXA 2VQEM 1N34M 4G4NA 3SATA 4LF5M 2OQ4A 3U6CA 3SASA 4JI4M 1Z59A 4JI8M 4DV4M 1L1TA 1HNWM 4LFAM 4MB7A 1EE8A 5ITUA 4X64M 4DUYM 1FJGM 2F5SA 4DR4M 4OX9M 4X65M 4CISA 4PDGA 1L2CA 4DV5M 4LFBM 4JI1M 3GO8A 4DR2M 4JI0M 4GKJM 3VK8A 5IT9S 3SAWA 4LF7M 4JYAM 3OTOM
chains in the Genus database with same CATH superfamily
2XZUA 3Q8GA 3B9PA 3K8ZA 4QNRA 4GH9A 3B7NA 1WXQA 2YNMD 3GPYA 4KO8A 1IN7A 1NSFA 2VDBB 2L4EA 2YQZA 1IN6A 2L6OA 4Q7JA 3M0EA 4D82A 3RFWA 1PJIA 3U61B 2KA6B 4CHTB 2JY6B 4DV0M 4LG2A 2CE7A 2LHCA 3SAUA 3FTFA 3KFUG 2EA0A 5LMNM 4S12A 4FD2A 4JI3M 2C5RA 3EIEA 4DR5M 4R3DA 4GHLA 1D0LA 1HJPA 2VF8A 3J7AS 3VFDA 4FVMA 1E94E 4B08A 1IXZA 2DHYA 3AOEC 4LRTA 4MH0E 2JY7A 1L8QA 1IBKM 2G5GX 3U6QA 4JI7M 5ITQA 1WIVA 1N32M 4BLCA 3V76A 2JZ0A 1MX0A 4GRIA 3VKGA 1WHCA 1PGYA 4LY6A 4QHSA 1VDDA 1WR1B 2R65A 2CUZA 2CFOA 3RE8A 4D81A 1D0MA 2K47A 3GLHE 5EXTA 3SFZA 3ZC7B 1GL6A 5H37D 5JI2E 1G3IA 1IY2A 4M9ZA 2JWSA 5EP3A 3HZJA 1K82A 3GLIE 4G4RA 2KRUA 2H5XA 3K9PA 4B3TM 7CATA 3U6DA 4MGKE 1YSYA 1Q02A 1UFZA 1DGHB 2X8AA 3SARA 1Q3BA 3UK6A 1T43A 2BWEA 1DGGA 3GPXA 2CHVA 2KNZA 1S3SA 2VQFM 1GJSA 3IG5A 3B74A 3WHLA 2BJVA 3D8BA 4LF4M 1JR3D 3TWKA 2WSCF 3U6LA 1XNRM 3ZCBB 1Z5AA 1SXJB 1G8PA 5ITYA 5E26A 5C1BA 2JUJA 1VEJA 2KHHA 3KVWA 2Z3XA 3PNYA 2I7PA 5DNYA 1XWIA 3J27B 4LFCM 1YUBA 3A98B 5BR8M 4F2LA 2X49A 2GQFA 2OPFA 4FCVA 4L6V6 1IQPA 3SAVA 4NXMM 4DUZM 2WZJA 2BJWA 3E4RA 3GP1A 3AV0A 3KP0E 4ANRA 2F5QA 2QBYB 2CWBA 2Q2EB 1MU5A 1QZMA 2C9CA 1L1ZA 1HQCA 2LTUA 4GKKM 3K92A 2DAKA 4DV1M 2UU9M 2DWLA 3U60A 3GLGB 4RF0A 5KQ8A 1TGUA 2VF7A 4GC5A 2L7IA 1L2DA 1QDTA 5EXXA 2DWZB 1WJ7A 2C9OA 2Z4SA 3LW5F 5C18A 4L8RC 3HU2A 3U5ZB 3R9XB 4G4NA 2N35A 1IM2A 1QZEA 3KSJA 2KXEA 1Z59A 2O25A 3KS4A 3SYLA 4I81A 3FTDA 5F3WA 2K0BX 4OVZB 1NNUC 1FJGM 1E32A 1ZMVA 2K6BA 3VDPA 3GLHA 4HEOA 1WGLA 2P5TA 4MGIE 4LFBM 2LH0A 3B89A 3T38A 3VK8A 5FTKA 4AG6A 1CUKA 3PFIA 5IT9S 1H6UA 2LVAA 3LVVA 4JYAM 3FE3A 3L25A 2C98A 4OVZA 2ZAOA 4R71A 5FTNA 1QYRA 1J5EM 3GPPA 1Z5CA 1N33M 3GRVA 2R0IA 2R45A 3GLFE 2MROB 3B7QA 3LCUA 3AKZA 4GIPA 1F4IA 1R5LA 2WSEF 4NXNM 2F4VM 3FRIA 1NJFA 1KFVA 1ZMUA 2DAIA 2FH0A 2OOBA 4KODA 2LVNC 4DV2M 1PJJA 4JI6M 3KW6A 5FTLA 2LVOC 5EP1A 5EXSA 3ILKA 1HR0M 4K0KM 5KPTA 2XGNA 3MMPA 2CEAA 4PD2A 2O5RA 2ZM6M 1XNQM 1C1KA 2RRUA 3CF6E 4Z8XA 1QANA 1DO2A 5JI3E 1MN3A 1IBMM 1IN4A 2M5ZA 4LF6M 2EUCA 3J80S 2K9DA 1QAOA 3AL0C 2HKJA 2CV2A 2FNAA 4M9SA 3ZH9B 2QQ8A 1OQYA 1G59A 3VLFB 4JXJA 1TTEA 2DXIA 3U6SA 4ITQA 4PCZA 2I7NA 3HU3A 2R6FA 3GRYA 3FTEA 1XXHA 3T1YM 1HNZM 2LBCA 2FE8A 4WW0A 3TWLA 3IECA 1R2ZA 2DZLA 3M6AA 1N77A 2A5YB 5EXPA 4NRWA 3GQ3A 2DHRA 1NY5A 4AI6A 1D0KA 5KPRA 1NJGA 3HU1A 1FNNA 1KSFX 2AHMA 2W82A 3AOGA 3GLGE 5BPVA 1GABA 2KZUA 1V34A 2Y21A 4DR6M 1E9RA 1XB2B 1N75A 5ITTA 4IBKA 2CV1A 1R2YA 2MGWA 3RGPA 2EJSA 3IHPA 4PT5A 1NHWC 1IXRC 4XK8F 1OTRA 3U5ZA 2V6ZM 1I94M 3PVSA 3DZDA 1VQ1A 1HT2E 1J09A 2QZ4A 4NOOB 2UUAM 1Y8GA 3GLIA 2EKFA 3FUVA 3I04M 3TPZA 4YY3M 1GO5A 2KW0A 1BVSA 5GKNA 2HHHM 4IBIA 4JV5M 1ZV1A 2DENA 4L4UA 3MK6A 2XLJA 4LGYA 2C96A 4P17A 5EP4A 2C99A 2H1RA 1WGNA 2M60A 4B3RM 1IFYA 3L29A 2RGOA 4LF5M 1I4WA 1R7RA 1T6OA 2ERCA 3W68A 3SASA 4JI4M 2O01F 3LQRA 3TL4X 4LJAA 4JI8M 2UXCM 1NV8A 4LFAM 5ITUA 1EE8A 4DUYM 1W5TA 4IBFA 3SHFA 1LV7A 1L2CA 4QOZC 1PJQA 2DAMA 4Z6YA 1OAIA 1TF0B 2CHQA 4JI1M 4LJ6A 1TH4A 2D7EA 3I4YA 5EP2A 1G71A 4LZZA 3UZUA 4JN6A 3I4VA 4LF7M 3OTOM 2R46A 3JAMS 3U6EA 3AFHA 2EKKA 3C9PA 4GHAA 5ITXE 3FUTA 4QOSA 3K9OA 4NRVA 4AQYM 2DWMA 3FYCA 1DGFA 3W67A 2E5LM 1XXHE 1EFUB 1Z6TA 1QUTA 1OIPA 3DOAA 4CJ6A 3R8FA 5FTJA 1EIJA 2GNOA 4DV6M 2EO2A 2G8LA 1VEKA 2F5NA 5KPZA 2KNAA 4OU7A 3GLFB 4LJ9A 2XH9A 2UXDM 2Z8YM 3QYBA 4FW9A 2HWJA 4M0DA 3L28A 2DI0A 4AKIA 2R4JA 3I01M 1GKIA 3VK7A 2KDLA 3L2AA 3A45A 1XXHB 3RGSA 3U6OA 3FUXA 4G4QA 3GQ5A 2JP7A 2JY5A 3FTCA 4B3SM 4XGIA 1T3TA 1QAQA 3GLHB 1OIZA 3SMPA 4B7FA 3U6MA 3A42A 3QWLA 1N78A 3EIHA 5IZ7D 2L7HA 2LHGA 3FD9A 4WURA 3ZQJA 1DO0A 1GLNA 2QNJA 5DYGA 2L2DA 1G41A 4CIZA 3AOEA 2QPAA 2LVPC 3KDSE 5IWAM 1IXSA 4II7A 4DV3M 1IY1A 2B3TA 4IJFA 2Y0QA 3GLIB 1VDLA 1PM5A 4LCBA 4MM3B 4HLQA 1GL7A 1JR3E 2LNHC 3GPUA 2OO9A 4JI5M 1Q39A 2BWBA 3WHKA 3K1JA 1DV0A 1AIPC 4D80A 1IY0A 4OW0A 2DZNB 1IN8A 5DYIA 1PRBA 1QAMA 4FCTA 3JR5A 1IBLM 1HQYE 4FWGA 1QDRA 2CRUA 2FS1A 4ZPXA 1LTMA 1Q3CA 2R18A 4YHHM 5FSWA 1RU3A 3KXEC 3M7GA 3MHVC 3MJ5A 3GRUA 2UXBM 2JNHA 4MGYE 4DBGB 3HY5A 4HL4A 1XMQM 1SXJE 2MR9A 2UUBM 1GVNA 4R7GA 5KQDA 2KEBA 2X4AA 2UUCM 4L16A 2QBYA 3LCVB 1TDZA 2ZAMA 4DR1M 2F5PA 1NO1A 1NV9A 2DAGA 4KLNA 4LZJA 4F1IA 1JQJC 3LVWA 1OFIA 2FOIC 1A5TA 4IBJA 4G6ZA 1HNXM 2D7GA 2XZFA 2D7HA 3KOWE 4NC6A 3HHYA 4AZFA 4IJEA 4GITA 4M9XA 2Z7JA 2DKLA 3Q8XA 3HJ8A 4AKGA 1XC8A 4IBBA 2DVWB 2QCUA 2VQEM 2HL7A 1YE9A 3BXWA 3PNVA 3HX3A 4TUWA 3KOZE 2OQ4A 2WSFF 4FWDA 3U6CA 1GJTA 3H4JA 1SXJA 5FTMA 4DV4M 1SXJC 1UM8A 1HNWM 3E21A 4EIWA 2CP8A 4DR4M 2F5SA 4XBOA 4OX9M 4X65M 4CISA 2G3QA 4PDGA 3L26A 4DV5M 4BB9A 2ZTCA 1IN5A 4L15A 4AW4A 4BBAA 3GO8A 3KSXA 3DA1A 3LQQA 3CF2A 4GEWA 4FWHA 4M0WA 2CHGA 2LWXA 3F92A 3SAWA 1L1TA 1V92A 3SYKA 1AUAA 3DFZA 1OJLA 3L27A 1PJTA 3FUWA 3W0LB 1OKSA 4DV7M 1ORYB 3SBJA 3T1HM 4LJ5A 2XF3A 3THGA 1R4GA 3T15A 4LJ7A 3KOYE 2ZTDA 4UN2B 3A46A 2XSZA 2QHOB 3H4MA 5EQTA 1ZQ9A 4IBCA 5ITRA 1NNJA 4JI2M 3FYDA 4I4LA 3FRHA 3PXGA 4DR7M 3C3EA 4X66M 1Z5BA 1R6BX 3E46A 3CF0A 5LMUM 4MGZE 3QAUA 4IBEA 3HHZA 2RKOA 4IBDA 2V1CA 3B7ZA 4A3VB 2KNVA 3HHXA 2DNAA 2Z4RA 3LMMA 3C58A 1P3QQ 3SMSA 3JR4A 3HGIA 1NHGC 4P16A 1XHBA 1X37A 4GMQA 8CATA 4AKHA 2YR0A 3HWSA 3NBXX 4REZA 4LJ8A 3W0FA 4RNAA 3TQSA 1SG9A 4PDIA 2MJ5B 1NY6A 4L78A 4B7HA 3J2PB 3NBIA 3HJSA 2HAKA 3U61A 4KHPM 1W5SA 3VDUA 3GQ4A 3U6PA 4MGHA 1OFHA 1NVMA 1C7YA 3GRRA 2YFQA 4IBGA 2MH8A 3GLGA 4RF1A 4I8OA 3HJQA 2DAEA 2LVQD 2JXNA 2J7NA 3D8LA 3AJIB 4G4OA 2APLA 5E6JA 2KRKA 2JY8A 1QVRA 1TH2A 3CTWB 3J7BA 1XMOM 3FKEA 3QYEA 1K3WA 1IXSB 1TDHA 2V1UA 5FLXS 1VEGA 4CGYB 4X62M 2CV0A 2ZBKB 2RGHA 2QENA 3E9SA 4I5SA 4B3MM 5DFLA 3TWMA 2VIIA 4LF9M 2QP9X 3CGWA 1QQWA 4WP2A 1N36M 1YLAA 4LF8M 2BNKA 4DR3M 4B7GA 4Y28F 1SXJD 5KO3A 4QHTA 3TE6A 1ZAEA 3NWLA 2R4EA 4G3OA 5EJCA 2KZSA 2XEPA 3BBZA 1DGBA 3U60B 3HKPA 3HHWA 3I51A 1ZMWA 1E9SA 2F5OA 2LXEA 3UMMA 1L2BA 2Y0TA 1K3XA 1QUSA 1TH3A 3J81S 4GC9A 4FCWA 4NSRA 1DGHA 3SHGB 5A2QS 3KOXE 3IG8A 3T6PA 2ZANA 1D2NA 1JR3A 2J7OA 2OOAA 2NQ8C 2R44A 3BOSA 2HCBA 2XFSA 4LGMA 3KS8A 3UGJA 4AG5A 3GLFA 5L8RF 1J7KA 1HT1E 5ITXA 3VKHA 2DZOB 1N34M 1PJSA 3SATA 3K2LA 2FFJA 2QSFX 2XSZD 4KT0F 1TR8A 1JB0F 4NL4H 2J5YA 3KP1E 1OAOC 3C3DA 3FUUA 4MB7A 2L4FA 4IIWA 4X64M 2DWNA 4LJ4A 4LRSA 1V33A 5IREB 4RKUF 2JZ1A 1MJGM 2L09A 2XFTA 4W5WA 3UJNA 2JA2A 4DR2M 1KYIA 2R62A 4JI0M 4GKJM 4NSOB 1VG5A 4QNMA 3SC3A 1G4AE 2Y20A
chains in the Genus database with same CATH topology
2XZUA 4QNRA 3B9PA 3K8ZA 4GH9A 1WXQA 2YNMD 3GPYA 4KO8A 1IN7A 1NSFA 2YQZA 1IN6A 2L6OA 3M0EA 4D82A 3RFWA 1PJIA 3U61B 2KA6B 4CHTB 4DV0M 4LG2A 3FTFA 2CE7A 3KFUG 3SAUA 2EA0A 5LMNM 4S12A 4FD2A 4JI3M 2C5RA 3EIEA 4DR5M 4R3DA 4GHLA 3J7AS 3VFDA 4FVMA 1E94E 4B08A 1IXZA 4MH0E 3AOEC 4LRTA 1IBKM 1L8QA 2G5GX 3U6QA 4JI7M 5ITQA 1N32M 4BLCA 1MX0A 4GRIA 3VKGA 4LY6A 4QHSA 1VDDA 3RE8A 2R65A 2CUZA 2CFOA 4D81A 3SFZA 2K47A 5EXTA 3ZC7B 1GL6A 5H37D 5JI2E 1G3IA 1IY2A 4M9ZA 5EP3A 1K82A 4G4RA 2KRUA 4B3TM 7CATA 3U6DA 4MGKE 1YSYA 2X8AA 1DGHB 3SARA 1Q3BA 3UK6A 1DGGA 3GPXA 2CHVA 2VQFM 1S3SA 3IG5A 3WHLA 2BJVA 3D8BA 4LF4M 1JR3D 3TWKA 3U6LA 1XNRM 3ZCBB 1Z5AA 1SXJB 1G8PA 5ITYA 5E26A 5C1BA 3KVWA 2Z3XA 3PNYA 2I7PA 5DNYA 1XWIA 3J27B 4LFCM 1YUBA 3A98B 5BR8M 2X49A 2OPFA 4FCVA 4NXMM 1IQPA 3SAVA 4DUZM 2BJWA 3E4RA 3GP1A 3AV0A 3KP0E 2QBYB 2F5QA 2Q2EB 1MU5A 1QZMA 2C9CA 1L1ZA 1HQCA 4GKKM 3K92A 4DV1M 2UU9M 2DWLA 3U60A 3GLGB 4RF0A 5KQ8A 1TGUA 4GC5A 2L7IA 1L2DA 5EXXA 5C18A 2DWZB 2Z4SA 2C9OA 4L8RC 3R9XB 2UXCM 3HU2A 3U5ZB 4G4NA 1IM2A 3KSJA 2KXEA 1Z59A 3KS4A 3SYLA 4I81A 3FTDA 5F3WA 4OVZB 1NNUC 1FJGM 1E32A 3VDPA 3GLHA 4MGIE 2P5TA 4LFBM 2LH0A 3T38A 3VK8A 5FTKA 4AG6A 3PFIA 5IT9S 1H6UA 3LVVA 4JYAM 3L25A 2C98A 4OVZA 2ZAOA 5FTNA 1QYRA 1J5EM 3GPPA 1Z5CA 1N33M 3GRVA 2R45A 3AKZA 4GIPA 4NXNM 2F4VM 1NJFA 1KFVA 4KODA 1PJJA 4DV2M 4JI6M 3KW6A 5FTLA 5EP1A 5EXSA 3ILKA 1HR0M 4K0KM 5KPTA 2XGNA 2CEAA 4PD2A 2O5RA 2ZM6M 1XNQM 1C1KA 3CF6E 4Z8XA 5JI3E 1QANA 1DO2A 1IBMM 1IN4A 2M5ZA 4LF6M 2EUCA 3J80S 3AL0C 1QAOA 2HKJA 2CV2A 2FNAA 4M9SA 3ZH9B 1G59A 3VLFB 4JXJA 2DXIA 4ITQA 3U6SA 4PCZA 2I7NA 3HU3A 3GRYA 3FTEA 1XXHA 3T1YM 1HNZM 2FE8A 4WW0A 3TWLA 1R2ZA 3M6AA 1N77A 2A5YB 5EXPA 4NRWA 3GQ3A 2DHRA 1NY5A 4AI6A 5KPRA 1NJGA 3HU1A 1FNNA 1KSFX 2AHMA 2W82A 3AOGA 5BPVA 2KZUA 2Y21A 4DR6M 1E9RA 1N75A 5ITTA 4IBKA 2CV1A 1R2YA 3RGPA 4PT5A 1NHWC 1IXRC 3U5ZA 2V6ZM 1I94M 3PVSA 3DZDA 1HT2E 1J09A 2QZ4A 4NOOB 2UUAM 3GLIA 3FUVA 3TPZA 4YY3M 2KW0A 5GKNA 2HHHM 4IBIA 4JV5M 2XLJA 4L4UA 3MK6A 4LGYA 2C96A 5EP4A 2C99A 2H1RA 4B3RM 2M60A 3L29A 2RGOA 4LF5M 1I4WA 1R7RA 2ERCA 3SASA 4JI4M 3LQRA 3TL4X 4LJAA 4JI8M 4LFAM 5ITUA 1EE8A 4DUYM 1W5TA 4IBFA 3SHFA 1LV7A 1L2CA 4QOZC 4Z6YA 2CHQA 4JI1M 4LJ6A 1TH4A 2D7EA 3I4YA 5EP2A 4LZZA 3UZUA 4JN6A 3I4VA 4LF7M 3OTOM 2R46A 3JAMS 3U6EA 3AFHA 4GHAA 5ITXE 3FUTA 4QOSA 4NRVA 4AQYM 2DWMA 3FYCA 1DGFA 2E5LM 1Z6TA 3DOAA 3R8FA 5FTJA 4DV6M 2EO2A 2G8LA 2F5NA 5KPZA 3GLFB 4OU7A 4LJ9A 2XH9A 2UXDM 4FW9A 4M0DA 3L28A 4AKIA 2R4JA 1GKIA 3VK7A 3L2AA 3A45A 1XXHB 3RGSA 3U6OA 3FUXA 4G4QA 3GQ5A 3FTCA 4B3SM 4XGIA 1T3TA 1QAQA 3GLHB 3SMPA 3U6MA 4B7FA 3A42A 3QWLA 1N78A 3EIHA 5IZ7D 2L7HA 3FD9A 4WURA 1DO0A 1GLNA 5DYGA 1G41A 3AOEA 2QPAA 3KDSE 5IWAM 4II7A 4DV3M 1IY1A 4IJFA 2Y0QA 3GLIB 1PM5A 4LCBA 4MM3B 4HLQA 1GL7A 3GPUA 2LNHC 4JI5M 1Q39A 3WHKA 3K1JA 4D80A 1IY0A 4OW0A 2DZNB 1IN8A 5DYIA 1QAMA 4FCTA 3JR5A 1IBLM 1HQYE 4FWGA 4ZPXA 4YHHM 1Q3CA 2R18A 5FSWA 3KXEC 3M7GA 3MHVC 3MJ5A 3GRUA 2UXBM 4MGYE 4HL4A 1XMQM 1SXJE 2UUBM 1GVNA 4R7GA 5KQDA 2KEBA 2X4AA 2UUCM 4L16A 2QBYA 1TDZA 2ZAMA 4DR1M 2F5PA 4KLNA 4LZJA 1JQJC 3LVWA 1OFIA 2FOIC 4IBJA 4G6ZA 1HNXM 2D7GA 2XZFA 2D7HA 3KOWE 3HHYA 4AZFA 4IJEA 4GITA 4M9XA 2Z7JA 3Q8XA 3HJ8A 4AKGA 1XC8A 4IBBA 2DVWB 2QCUA 2VQEM 2HL7A 1YE9A 3PNVA 4TUWA 3KOZE 2OQ4A 4FWDA 3U6CA 1SXJA 5FTMA 4DV4M 1SXJC 1UM8A 1HNWM 4EIWA 4DR4M 2F5SA 4XBOA 4OX9M 4X65M 4CISA 4PDGA 3L26A 4DV5M 4BB9A 1IN5A 4L15A 4AW4A 4BBAA 3GO8A 3KSXA 3DA1A 3LQQA 3CF2A 4FWHA 4M0WA 2CHGA 2LWXA 3SAWA 1L1TA 3SYKA 3DFZA 1OJLA 3L27A 3W0LB 3FUWA 4DV7M 1ORYB 3SBJA 3T1HM 4LJ5A 2XF3A 3THGA 3T15A 4LJ7A 3KOYE 3A46A 2XSZA 5EQTA 3H4MA 1NNJA 1ZQ9A 4IBCA 5ITRA 4JI2M 3FYDA 4I4LA 3PXGA 4DR7M 4X66M 1Z5BA 1R6BX 3CF0A 5LMUM 4MGZE 3QAUA 4IBEA 3HHZA 2RKOA 4IBDA 2V1CA 4A3VB 3HHXA 2Z4RA 3LMMA 3C58A 3SMSA 3JR4A 3HGIA 1NHGC 4P16A 1XHBA 1X37A 4GMQA 8CATA 4AKHA 2YR0A 3HWSA 4REZA 4LJ8A 3W0FA 4RNAA 3TQSA 4PDIA 1NY6A 4L78A 4B7HA 3J2PB 3NBIA 3HJSA 3U61A 4KHPM 1W5SA 3VDUA 3GQ4A 3U6PA 4MGHA 1OFHA 1NVMA 3GRRA 2YFQA 4IBGA 3GLGA 4RF1A 4I8OA 3HJQA 2J7NA 3D8LA 3AJIB 4G4OA 5E6JA 2KRKA 1XMOM 1QVRA 1TH2A 3CTWB 3J7BA 3FKEA 1K3WA 1IXSB 1TDHA 2V1UA 5FLXS 4CGYB 4X62M 2CV0A 2ZBKB 2RGHA 2QENA 3E9SA 4I5SA 4B3MM 3TWMA 2VIIA 4LF9M 2QP9X 1QQWA 1N36M 4LF8M 2BNKA 4DR3M 4B7GA 1SXJD 5KO3A 4QHTA 3TE6A 1ZAEA 3NWLA 2R4EA 5EJCA 2KZSA 2XEPA 3U60B 1DGBA 3HKPA 3HHWA 3I51A 1E9SA 2F5OA 2LXEA 3UMMA 1L2BA 2Y0TA 1K3XA 1TH3A 3J81S 4GC9A 4FCWA 4NSRA 1DGHA 3SHGB 5A2QS 3KOXE 3IG8A 2ZANA 1D2NA 1JR3A 2J7OA 2NQ8C 3BOSA 2HCBA 2XFSA 4LGMA 3KS8A 3UGJA 4AG5A 3GLFA 1J7KA 1HT1E 5ITXA 3VKHA 2DZOB 1N34M 3SATA 3K2LA 2FFJA 2XSZD 4NL4H 3KP1E 3FUUA 4MB7A 4IIWA 4X64M 2DWNA 4LJ4A 4LRSA 5IREB 2XFTA 2L09A 4W5WA 3UJNA 2JA2A 4DR2M 1KYIA 2R62A 4JI0M 4GKJM 4NSOB 4QNMA 3SC3A 1G4AE 2Y20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZU A;  3JAM S;  3U6E A;  1J5E M;  3GPY A;  4DV7 M;  5ITX E;  3GPP A;  1Z5C A;  4NRV A;  3SBJ A;  3T1H M;  4AQY M;  1N33 M;  3A46 A;  2E5L M;  1NNJ A;  5ITR A;  1PJI A;  4JI2 M;  3DOA A;  4DV0 M;  4DV6 M;  3SAU A;  4DR7 M;  4X66 M;  4NXN M;  1Z5B A;  2F4V M;  2EA0 A;  5LMU M;  5LMN M;  2F5N A;  1KFV A;  4JI3 M;  2UXD M;  4DR5 M;  1PJJ A;  4DV2 M;  4JI6 M;  3C58 A;  3J7A S;  1HR0 M;  3JR4 A;  4K0K M;  3VK7 A;  1IBK M;  3A45 A;  3U6Q A;  5ITQ A;  3U6O A;  4JI7 M;  4G4Q A;  3GQ5 A;  1N32 M;  3W0F A;  4B3S M;  4PD2 A;  1MX0 A;  4PDI A;  2ZM6 M;  1XNQ M;  3U6M A;  1IBM M;  3A42 A;  4LF6 M;  4KHP M;  3J80 S;  3GQ4 A;  3U6P A;  2HKJ A;  4ITQ A;  3U6S A;  4PCZ A;  1K82 A;  4G4R A;  5IWA M;  3T1Y M;  4G4O A;  1HNZ M;  4DV3 M;  3TWL A;  4B3T M;  1PM5 A;  1R2Z A;  1XMO M;  3U6D A;  3GPU A;  1K3W A;  3SAR A;  1Q3B A;  1TDH A;  1Q39 A;  3GQ3 A;  5FLX S;  4JI5 M;  4NRW A;  3GPX A;  2VQF M;  4X62 M;  3JR5 A;  1IBL M;  4LF4 M;  2ZBK B;  4B3M M;  4DR6 M;  3TWK A;  4YHH M;  1Q3C A;  3U6L A;  3TWM A;  5ITT A;  1XNR M;  1R2Y A;  1Z5A A;  4LF9 M;  2UXB M;  5ITY A;  1N36 M;  4LF8 M;  4DR3 M;  1XMQ M;  1I94 M;  4LFC M;  2UUB M;  5BR8 M;  2UUC M;  2OPF A;  4NXM M;  3SAV A;  1TDZ A;  4DUZ M;  4DR1 M;  2F5P A;  2F5O A;  3GP1 A;  2UUA M;  1L2B A;  1K3X A;  2F5Q A;  2Q2E B;  1MU5 A;  3J81 S;  5A2Q S;  4YY3 M;  1L1Z A;  1HNX M;  2XZF A;  4GKK M;  4DV1 M;  2HHH M;  4JV5 M;  2UU9 M;  1XC8 A;  1L2D A;  4B3R M;  2UXC M;  5ITX A;  2VQE M;  1N34 M;  4G4N A;  3SAT A;  4LF5 M;  2OQ4 A;  3U6C A;  3SAS A;  4JI4 M;  1Z59 A;  4JI8 M;  4DV4 M;  1L1T A;  1HNW M;  4LFA M;  4MB7 A;  1EE8 A;  5ITU A;  4X64 M;  4DUY M;  1FJG M;  2F5S A;  4DR4 M;  4OX9 M;  4X65 M;  4CIS A;  4PDG A;  1L2C A;  4DV5 M;  4LFB M;  4JI1 M;  3GO8 A;  4DR2 M;  4JI0 M;  4GKJ M;  3VK8 A;  5IT9 S;  3SAW A;  4LF7 M;  4JYA M;  3OTO M; 
#chains in the Genus database with same CATH topology
 2XZU A;  3Q8G A;  3B9P A;  3K8Z A;  4QNR A;  4GH9 A;  3B7N A;  1WXQ A;  2YNM D;  3GPY A;  4KO8 A;  1IN7 A;  1NSF A;  2VDB B;  2L4E A;  2YQZ A;  1IN6 A;  2L6O A;  4Q7J A;  3M0E A;  4D82 A;  3RFW A;  1PJI A;  3U61 B;  2KA6 B;  4CHT B;  2JY6 B;  4DV0 M;  4LG2 A;  2CE7 A;  2LHC A;  3SAU A;  3FTF A;  3KFU G;  2EA0 A;  5LMN M;  4S12 A;  4FD2 A;  4JI3 M;  2C5R A;  3EIE A;  4DR5 M;  4R3D A;  4GHL A;  1D0L A;  1HJP A;  2VF8 A;  3J7A S;  3VFD A;  4FVM A;  1E94 E;  4B08 A;  1IXZ A;  2DHY A;  3AOE C;  4LRT A;  4MH0 E;  2JY7 A;  1L8Q A;  1IBK M;  2G5G X;  3U6Q A;  4JI7 M;  5ITQ A;  1WIV A;  1N32 M;  4BLC A;  3V76 A;  2JZ0 A;  1MX0 A;  4GRI A;  3VKG A;  1WHC A;  1PGY A;  4LY6 A;  4QHS A;  1VDD A;  1WR1 B;  2R65 A;  2CUZ A;  2CFO A;  3RE8 A;  4D81 A;  1D0M A;  2K47 A;  3GLH E;  5EXT A;  3SFZ A;  3ZC7 B;  1GL6 A;  5H37 D;  5JI2 E;  1G3I A;  1IY2 A;  4M9Z A;  2JWS A;  5EP3 A;  3HZJ A;  1K82 A;  3GLI E;  4G4R A;  2KRU A;  2H5X A;  3K9P A;  4B3T M;  7CAT A;  3U6D A;  4MGK E;  1YSY A;  1Q02 A;  1UFZ A;  1DGH B;  2X8A A;  3SAR A;  1Q3B A;  3UK6 A;  1T43 A;  2BWE A;  1DGG A;  3GPX A;  2CHV A;  2KNZ A;  1S3S A;  2VQF M;  1GJS A;  3IG5 A;  3B74 A;  3WHL A;  2BJV A;  3D8B A;  4LF4 M;  1JR3 D;  3TWK A;  2WSC F;  3U6L A;  1XNR M;  3ZCB B;  1Z5A A;  1SXJ B;  1G8P A;  5ITY A;  5E26 A;  5C1B A;  2JUJ A;  1VEJ A;  2KHH A;  3KVW A;  2Z3X A;  3PNY A;  2I7P A;  5DNY A;  1XWI A;  3J27 B;  4LFC M;  1YUB A;  3A98 B;  5BR8 M;  4F2L A;  2X49 A;  2GQF A;  2OPF A;  4FCV A;  4L6V 6;  1IQP A;  3SAV A;  4NXM M;  4DUZ M;  2WZJ A;  2BJW A;  3E4R A;  3GP1 A;  3AV0 A;  3KP0 E;  4ANR A;  2F5Q A;  2QBY B;  2CWB A;  2Q2E B;  1MU5 A;  1QZM A;  2C9C A;  1L1Z A;  1HQC A;  2LTU A;  4GKK M;  3K92 A;  2DAK A;  4DV1 M;  2UU9 M;  2DWL A;  3U60 A;  3GLG B;  4RF0 A;  5KQ8 A;  1TGU A;  2VF7 A;  4GC5 A;  2L7I A;  1L2D A;  1QDT A;  5EXX A;  2DWZ B;  1WJ7 A;  2C9O A;  2Z4S A;  3LW5 F;  5C18 A;  4L8R C;  3HU2 A;  3U5Z B;  3R9X B;  4G4N A;  2N35 A;  1IM2 A;  1QZE A;  3KSJ A;  2KXE A;  1Z59 A;  2O25 A;  3KS4 A;  3SYL A;  4I81 A;  3FTD A;  5F3W A;  2K0B X;  4OVZ B;  1NNU C;  1FJG M;  1E32 A;  1ZMV A;  2K6B A;  3VDP A;  3GLH A;  4HEO A;  1WGL A;  2P5T A;  4MGI E;  4LFB M;  2LH0 A;  3B89 A;  3T38 A;  3VK8 A;  5FTK A;  4AG6 A;  1CUK A;  3PFI A;  5IT9 S;  1H6U A;  2LVA A;  3LVV A;  4JYA M;  3FE3 A;  3L25 A;  2C98 A;  4OVZ A;  2ZAO A;  4R71 A;  5FTN A;  1QYR A;  1J5E M;  3GPP A;  1Z5C A;  1N33 M;  3GRV A;  2R0I A;  2R45 A;  3GLF E;  2MRO B;  3B7Q A;  3LCU A;  3AKZ A;  4GIP A;  1F4I A;  1R5L A;  2WSE F;  4NXN M;  2F4V M;  3FRI A;  1NJF A;  1KFV A;  1ZMU A;  2DAI A;  2FH0 A;  2OOB A;  4KOD A;  2LVN C;  4DV2 M;  1PJJ A;  4JI6 M;  3KW6 A;  5FTL A;  2LVO C;  5EP1 A;  5EXS A;  3ILK A;  1HR0 M;  4K0K M;  5KPT A;  2XGN A;  3MMP A;  2CEA A;  4PD2 A;  2O5R A;  2ZM6 M;  1XNQ M;  1C1K A;  2RRU A;  3CF6 E;  4Z8X A;  1QAN A;  1DO2 A;  5JI3 E;  1MN3 A;  1IBM M;  1IN4 A;  2M5Z A;  4LF6 M;  2EUC A;  3J80 S;  2K9D A;  1QAO A;  3AL0 C;  2HKJ A;  2CV2 A;  2FNA A;  4M9S A;  3ZH9 B;  2QQ8 A;  1OQY A;  1G59 A;  3VLF B;  4JXJ A;  1TTE A;  2DXI A;  3U6S A;  4ITQ A;  4PCZ A;  2I7N A;  3HU3 A;  2R6F A;  3GRY A;  3FTE A;  1XXH A;  3T1Y M;  1HNZ M;  2LBC A;  2FE8 A;  4WW0 A;  3TWL A;  3IEC A;  1R2Z A;  2DZL A;  3M6A A;  1N77 A;  2A5Y B;  5EXP A;  4NRW A;  3GQ3 A;  2DHR A;  1NY5 A;  4AI6 A;  1D0K A;  5KPR A;  1NJG A;  3HU1 A;  1FNN A;  1KSF X;  2AHM A;  2W82 A;  3AOG A;  3GLG E;  5BPV A;  1GAB A;  2KZU A;  1V34 A;  2Y21 A;  4DR6 M;  1E9R A;  1XB2 B;  1N75 A;  5ITT A;  4IBK A;  2CV1 A;  1R2Y A;  2MGW A;  3RGP A;  2EJS A;  3IHP A;  4PT5 A;  1NHW C;  1IXR C;  4XK8 F;  1OTR A;  3U5Z A;  2V6Z M;  1I94 M;  3PVS A;  3DZD A;  1VQ1 A;  1HT2 E;  1J09 A;  2QZ4 A;  4NOO B;  2UUA M;  1Y8G A;  3GLI A;  2EKF A;  3FUV A;  3I04 M;  3TPZ A;  4YY3 M;  1GO5 A;  2KW0 A;  1BVS A;  5GKN A;  2HHH M;  4IBI A;  4JV5 M;  1ZV1 A;  2DEN A;  4L4U A;  3MK6 A;  2XLJ A;  4LGY A;  2C96 A;  4P17 A;  5EP4 A;  2C99 A;  2H1R A;  1WGN A;  2M60 A;  4B3R M;  1IFY A;  3L29 A;  2RGO A;  4LF5 M;  1I4W A;  1R7R A;  1T6O A;  2ERC A;  3W68 A;  3SAS A;  4JI4 M;  2O01 F;  3LQR A;  3TL4 X;  4LJA A;  4JI8 M;  2UXC M;  1NV8 A;  4LFA M;  5ITU A;  1EE8 A;  4DUY M;  1W5T A;  4IBF A;  3SHF A;  1LV7 A;  1L2C A;  4QOZ C;  1PJQ A;  2DAM A;  4Z6Y A;  1OAI A;  1TF0 B;  2CHQ A;  4JI1 M;  4LJ6 A;  1TH4 A;  2D7E A;  3I4Y A;  5EP2 A;  1G71 A;  4LZZ A;  3UZU A;  4JN6 A;  3I4V A;  4LF7 M;  3OTO M;  2R46 A;  3JAM S;  3U6E A;  3AFH A;  2EKK A;  3C9P A;  4GHA A;  5ITX E;  3FUT A;  4QOS A;  3K9O A;  4NRV A;  4AQY M;  2DWM A;  3FYC A;  1DGF A;  3W67 A;  2E5L M;  1XXH E;  1EFU B;  1Z6T A;  1QUT A;  1OIP A;  3DOA A;  4CJ6 A;  3R8F A;  5FTJ A;  1EIJ A;  2GNO A;  4DV6 M;  2EO2 A;  2G8L A;  1VEK A;  2F5N A;  5KPZ A;  2KNA A;  4OU7 A;  3GLF B;  4LJ9 A;  2XH9 A;  2UXD M;  2Z8Y M;  3QYB A;  4FW9 A;  2HWJ A;  4M0D A;  3L28 A;  2DI0 A;  4AKI A;  2R4J A;  3I01 M;  1GKI A;  3VK7 A;  2KDL A;  3L2A A;  3A45 A;  1XXH B;  3RGS A;  3U6O A;  3FUX A;  4G4Q A;  3GQ5 A;  2JP7 A;  2JY5 A;  3FTC A;  4B3S M;  4XGI A;  1T3T A;  1QAQ A;  3GLH B;  1OIZ A;  3SMP A;  4B7F A;  3U6M A;  3A42 A;  3QWL A;  1N78 A;  3EIH A;  5IZ7 D;  2L7H A;  2LHG A;  3FD9 A;  4WUR A;  3ZQJ A;  1DO0 A;  1GLN A;  2QNJ A;  5DYG A;  2L2D A;  1G41 A;  4CIZ A;  3AOE A;  2QPA A;  2LVP C;  3KDS E;  5IWA M;  1IXS A;  4II7 A;  4DV3 M;  1IY1 A;  2B3T A;  4IJF A;  2Y0Q A;  3GLI B;  1VDL A;  1PM5 A;  4LCB A;  4MM3 B;  4HLQ A;  1GL7 A;  1JR3 E;  2LNH C;  3GPU A;  2OO9 A;  4JI5 M;  1Q39 A;  2BWB A;  3WHK A;  3K1J A;  1DV0 A;  1AIP C;  4D80 A;  1IY0 A;  4OW0 A;  2DZN B;  1IN8 A;  5DYI A;  1PRB A;  1QAM A;  4FCT A;  3JR5 A;  1IBL M;  1HQY E;  4FWG A;  1QDR A;  2CRU A;  2FS1 A;  4ZPX A;  1LTM A;  1Q3C A;  2R18 A;  4YHH M;  5FSW A;  1RU3 A;  3KXE C;  3M7G A;  3MHV C;  3MJ5 A;  3GRU A;  2UXB M;  2JNH A;  4MGY E;  4DBG B;  3HY5 A;  4HL4 A;  1XMQ M;  1SXJ E;  2MR9 A;  2UUB M;  1GVN A;  4R7G A;  5KQD A;  2KEB A;  2X4A A;  2UUC M;  4L16 A;  2QBY A;  3LCV B;  1TDZ A;  2ZAM A;  4DR1 M;  2F5P A;  1NO1 A;  1NV9 A;  2DAG A;  4KLN A;  4LZJ A;  4F1I A;  1JQJ C;  3LVW A;  1OFI A;  2FOI C;  1A5T A;  4IBJ A;  4G6Z A;  1HNX M;  2D7G A;  2XZF A;  2D7H A;  3KOW E;  4NC6 A;  3HHY A;  4AZF A;  4IJE A;  4GIT A;  4M9X A;  2Z7J A;  2DKL A;  3Q8X A;  3HJ8 A;  4AKG A;  1XC8 A;  4IBB A;  2DVW B;  2QCU A;  2VQE M;  2HL7 A;  1YE9 A;  3BXW A;  3PNV A;  3HX3 A;  4TUW A;  3KOZ E;  2OQ4 A;  2WSF F;  4FWD A;  3U6C A;  1GJT A;  3H4J A;  1SXJ A;  5FTM A;  4DV4 M;  1SXJ C;  1UM8 A;  1HNW M;  3E21 A;  4EIW A;  2CP8 A;  4DR4 M;  2F5S A;  4XBO A;  4OX9 M;  4X65 M;  4CIS A;  2G3Q A;  4PDG A;  3L26 A;  4DV5 M;  4BB9 A;  2ZTC A;  1IN5 A;  4L15 A;  4AW4 A;  4BBA A;  3GO8 A;  3KSX A;  3DA1 A;  3LQQ A;  3CF2 A;  4GEW A;  4FWH A;  4M0W A;  2CHG A;  2LWX A;  3F92 A;  3SAW A;  1L1T A;  1V92 A;  3SYK A;  1AUA A;  3DFZ A;  1OJL A;  3L27 A;  1PJT A;  3FUW A;  3W0L B;  1OKS A;  4DV7 M;  1ORY B;  3SBJ A;  3T1H M;  4LJ5 A;  2XF3 A;  3THG A;  1R4G A;  3T15 A;  4LJ7 A;  3KOY E;  2ZTD A;  4UN2 B;  3A46 A;  2XSZ A;  2QHO B;  3H4M A;  5EQT A;  1ZQ9 A;  4IBC A;  5ITR A;  1NNJ A;  4JI2 M;  3FYD A;  4I4L A;  3FRH A;  3PXG A;  4DR7 M;  3C3E A;  4X66 M;  1Z5B A;  1R6B X;  3E46 A;  3CF0 A;  5LMU M;  4MGZ E;  3QAU A;  4IBE A;  3HHZ A;  2RKO A;  4IBD A;  2V1C A;  3B7Z A;  4A3V B;  2KNV A;  3HHX A;  2DNA A;  2Z4R A;  3LMM A;  3C58 A;  1P3Q Q;  3SMS A;  3JR4 A;  3HGI A;  1NHG C;  4P16 A;  1XHB A;  1X37 A;  4GMQ A;  8CAT A;  4AKH A;  2YR0 A;  3HWS A;  3NBX X;  4REZ A;  4LJ8 A;  3W0F A;  4RNA A;  3TQS A;  1SG9 A;  4PDI A;  2MJ5 B;  1NY6 A;  4L78 A;  4B7H A;  3J2P B;  3NBI A;  3HJS A;  2HAK A;  3U61 A;  4KHP M;  1W5S A;  3VDU A;  3GQ4 A;  3U6P A;  4MGH A;  1OFH A;  1NVM A;  1C7Y A;  3GRR A;  2YFQ A;  4IBG A;  2MH8 A;  3GLG A;  4RF1 A;  4I8O A;  3HJQ A;  2DAE A;  2LVQ D;  2JXN A;  2J7N A;  3D8L A;  3AJI B;  4G4O A;  2APL A;  5E6J A;  2KRK A;  2JY8 A;  1QVR A;  1TH2 A;  3CTW B;  3J7B A;  1XMO M;  3FKE A;  3QYE A;  1K3W A;  1IXS B;  1TDH A;  2V1U A;  5FLX S;  1VEG A;  4CGY B;  4X62 M;  2CV0 A;  2ZBK B;  2RGH A;  2QEN A;  3E9S A;  4I5S A;  4B3M M;  5DFL A;  3TWM A;  2VII A;  4LF9 M;  2QP9 X;  3CGW A;  1QQW A;  4WP2 A;  1N36 M;  1YLA A;  4LF8 M;  2BNK A;  4DR3 M;  4B7G A;  4Y28 F;  1SXJ D;  5KO3 A;  4QHT A;  3TE6 A;  1ZAE A;  3NWL A;  2R4E A;  4G3O A;  5EJC A;  2KZS A;  2XEP A;  3BBZ A;  1DGB A;  3U60 B;  3HKP A;  3HHW A;  3I51 A;  1ZMW A;  1E9S A;  2F5O A;  2LXE A;  3UMM A;  1L2B A;  2Y0T A;  1K3X A;  1QUS A;  1TH3 A;  3J81 S;  4GC9 A;  4FCW A;  4NSR A;  1DGH A;  3SHG B;  5A2Q S;  3KOX E;  3IG8 A;  3T6P A;  2ZAN A;  1D2N A;  1JR3 A;  2J7O A;  2OOA A;  2NQ8 C;  2R44 A;  3BOS A;  2HCB A;  2XFS A;  4LGM A;  3KS8 A;  3UGJ A;  4AG5 A;  3GLF A;  5L8R F;  1J7K A;  1HT1 E;  5ITX A;  3VKH A;  2DZO B;  1N34 M;  1PJS A;  3SAT A;  3K2L A;  2FFJ A;  2QSF X;  2XSZ D;  4KT0 F;  1TR8 A;  1JB0 F;  4NL4 H;  2J5Y A;  3KP1 E;  1OAO C;  3C3D A;  3FUU A;  4MB7 A;  2L4F A;  4IIW A;  4X64 M;  2DWN A;  4LJ4 A;  4LRS A;  1V33 A;  5IRE B;  4RKU F;  2JZ1 A;  1MJG M;  2L09 A;  2XFT A;  4W5W A;  3UJN A;  2JA2 A;  4DR2 M;  1KYI A;  2R62 A;  4JI0 M;  4GKJ M;  4NSO B;  1VG5 A;  4QNM A;  3SC3 A;  1G4A E;  2Y20 A; 
#chains in the Genus database with same CATH homology
 2XZU A;  4QNR A;  3B9P A;  3K8Z A;  4GH9 A;  1WXQ A;  2YNM D;  3GPY A;  4KO8 A;  1IN7 A;  1NSF A;  2YQZ A;  1IN6 A;  2L6O A;  3M0E A;  4D82 A;  3RFW A;  1PJI A;  3U61 B;  2KA6 B;  4CHT B;  4DV0 M;  4LG2 A;  3FTF A;  2CE7 A;  3KFU G;  3SAU A;  2EA0 A;  5LMN M;  4S12 A;  4FD2 A;  4JI3 M;  2C5R A;  3EIE A;  4DR5 M;  4R3D A;  4GHL A;  3J7A S;  3VFD A;  4FVM A;  1E94 E;  4B08 A;  1IXZ A;  4MH0 E;  3AOE C;  4LRT A;  1IBK M;  1L8Q A;  2G5G X;  3U6Q A;  4JI7 M;  5ITQ A;  1N32 M;  4BLC A;  1MX0 A;  4GRI A;  3VKG A;  4LY6 A;  4QHS A;  1VDD A;  3RE8 A;  2R65 A;  2CUZ A;  2CFO A;  4D81 A;  3SFZ A;  2K47 A;  5EXT A;  3ZC7 B;  1GL6 A;  5H37 D;  5JI2 E;  1G3I A;  1IY2 A;  4M9Z A;  5EP3 A;  1K82 A;  4G4R A;  2KRU A;  4B3T M;  7CAT A;  3U6D A;  4MGK E;  1YSY A;  2X8A A;  1DGH B;  3SAR A;  1Q3B A;  3UK6 A;  1DGG A;  3GPX A;  2CHV A;  2VQF M;  1S3S A;  3IG5 A;  3WHL A;  2BJV A;  3D8B A;  4LF4 M;  1JR3 D;  3TWK A;  3U6L A;  1XNR M;  3ZCB B;  1Z5A A;  1SXJ B;  1G8P A;  5ITY A;  5E26 A;  5C1B A;  3KVW A;  2Z3X A;  3PNY A;  2I7P A;  5DNY A;  1XWI A;  3J27 B;  4LFC M;  1YUB A;  3A98 B;  5BR8 M;  2X49 A;  2OPF A;  4FCV A;  4NXM M;  1IQP A;  3SAV A;  4DUZ M;  2BJW A;  3E4R A;  3GP1 A;  3AV0 A;  3KP0 E;  2QBY B;  2F5Q A;  2Q2E B;  1MU5 A;  1QZM A;  2C9C A;  1L1Z A;  1HQC A;  4GKK M;  3K92 A;  4DV1 M;  2UU9 M;  2DWL A;  3U60 A;  3GLG B;  4RF0 A;  5KQ8 A;  1TGU A;  4GC5 A;  2L7I A;  1L2D A;  5EXX A;  5C18 A;  2DWZ B;  2Z4S A;  2C9O A;  4L8R C;  3R9X B;  2UXC M;  3HU2 A;  3U5Z B;  4G4N A;  1IM2 A;  3KSJ A;  2KXE A;  1Z59 A;  3KS4 A;  3SYL A;  4I81 A;  3FTD A;  5F3W A;  4OVZ B;  1NNU C;  1FJG M;  1E32 A;  3VDP A;  3GLH A;  4MGI E;  2P5T A;  4LFB M;  2LH0 A;  3T38 A;  3VK8 A;  5FTK A;  4AG6 A;  3PFI A;  5IT9 S;  1H6U A;  3LVV A;  4JYA M;  3L25 A;  2C98 A;  4OVZ A;  2ZAO A;  5FTN A;  1QYR A;  1J5E M;  3GPP A;  1Z5C A;  1N33 M;  3GRV A;  2R45 A;  3AKZ A;  4GIP A;  4NXN M;  2F4V M;  1NJF A;  1KFV A;  4KOD A;  1PJJ A;  4DV2 M;  4JI6 M;  3KW6 A;  5FTL A;  5EP1 A;  5EXS A;  3ILK A;  1HR0 M;  4K0K M;  5KPT A;  2XGN A;  2CEA A;  4PD2 A;  2O5R A;  2ZM6 M;  1XNQ M;  1C1K A;  3CF6 E;  4Z8X A;  5JI3 E;  1QAN A;  1DO2 A;  1IBM M;  1IN4 A;  2M5Z A;  4LF6 M;  2EUC A;  3J80 S;  3AL0 C;  1QAO A;  2HKJ A;  2CV2 A;  2FNA A;  4M9S A;  3ZH9 B;  1G59 A;  3VLF B;  4JXJ A;  2DXI A;  4ITQ A;  3U6S A;  4PCZ A;  2I7N A;  3HU3 A;  3GRY A;  3FTE A;  1XXH A;  3T1Y M;  1HNZ M;  2FE8 A;  4WW0 A;  3TWL A;  1R2Z A;  3M6A A;  1N77 A;  2A5Y B;  5EXP A;  4NRW A;  3GQ3 A;  2DHR A;  1NY5 A;  4AI6 A;  5KPR A;  1NJG A;  3HU1 A;  1FNN A;  1KSF X;  2AHM A;  2W82 A;  3AOG A;  5BPV A;  2KZU A;  2Y21 A;  4DR6 M;  1E9R A;  1N75 A;  5ITT A;  4IBK A;  2CV1 A;  1R2Y A;  3RGP A;  4PT5 A;  1NHW C;  1IXR C;  3U5Z A;  2V6Z M;  1I94 M;  3PVS A;  3DZD A;  1HT2 E;  1J09 A;  2QZ4 A;  4NOO B;  2UUA M;  3GLI A;  3FUV A;  3TPZ A;  4YY3 M;  2KW0 A;  5GKN A;  2HHH M;  4IBI A;  4JV5 M;  2XLJ A;  4L4U A;  3MK6 A;  4LGY A;  2C96 A;  5EP4 A;  2C99 A;  2H1R A;  4B3R M;  2M60 A;  3L29 A;  2RGO A;  4LF5 M;  1I4W A;  1R7R A;  2ERC A;  3SAS A;  4JI4 M;  3LQR A;  3TL4 X;  4LJA A;  4JI8 M;  4LFA M;  5ITU A;  1EE8 A;  4DUY M;  1W5T A;  4IBF A;  3SHF A;  1LV7 A;  1L2C A;  4QOZ C;  4Z6Y A;  2CHQ A;  4JI1 M;  4LJ6 A;  1TH4 A;  2D7E A;  3I4Y A;  5EP2 A;  4LZZ A;  3UZU A;  4JN6 A;  3I4V A;  4LF7 M;  3OTO M;  2R46 A;  3JAM S;  3U6E A;  3AFH A;  4GHA A;  5ITX E;  3FUT A;  4QOS A;  4NRV A;  4AQY M;  2DWM A;  3FYC A;  1DGF A;  2E5L M;  1Z6T A;  3DOA A;  3R8F A;  5FTJ A;  4DV6 M;  2EO2 A;  2G8L A;  2F5N A;  5KPZ A;  3GLF B;  4OU7 A;  4LJ9 A;  2XH9 A;  2UXD M;  4FW9 A;  4M0D A;  3L28 A;  4AKI A;  2R4J A;  1GKI A;  3VK7 A;  3L2A A;  3A45 A;  1XXH B;  3RGS A;  3U6O A;  3FUX A;  4G4Q A;  3GQ5 A;  3FTC A;  4B3S M;  4XGI A;  1T3T A;  1QAQ A;  3GLH B;  3SMP A;  3U6M A;  4B7F A;  3A42 A;  3QWL A;  1N78 A;  3EIH A;  5IZ7 D;  2L7H A;  3FD9 A;  4WUR A;  1DO0 A;  1GLN A;  5DYG A;  1G41 A;  3AOE A;  2QPA A;  3KDS E;  5IWA M;  4II7 A;  4DV3 M;  1IY1 A;  4IJF A;  2Y0Q A;  3GLI B;  1PM5 A;  4LCB A;  4MM3 B;  4HLQ A;  1GL7 A;  3GPU A;  2LNH C;  4JI5 M;  1Q39 A;  3WHK A;  3K1J A;  4D80 A;  1IY0 A;  4OW0 A;  2DZN B;  1IN8 A;  5DYI A;  1QAM A;  4FCT A;  3JR5 A;  1IBL M;  1HQY E;  4FWG A;  4ZPX A;  4YHH M;  1Q3C A;  2R18 A;  5FSW A;  3KXE C;  3M7G A;  3MHV C;  3MJ5 A;  3GRU A;  2UXB M;  4MGY E;  4HL4 A;  1XMQ M;  1SXJ E;  2UUB M;  1GVN A;  4R7G A;  5KQD A;  2KEB A;  2X4A A;  2UUC M;  4L16 A;  2QBY A;  1TDZ A;  2ZAM A;  4DR1 M;  2F5P A;  4KLN A;  4LZJ A;  1JQJ C;  3LVW A;  1OFI A;  2FOI C;  4IBJ A;  4G6Z A;  1HNX M;  2D7G A;  2XZF A;  2D7H A;  3KOW E;  3HHY A;  4AZF A;  4IJE A;  4GIT A;  4M9X A;  2Z7J A;  3Q8X A;  3HJ8 A;  4AKG A;  1XC8 A;  4IBB A;  2DVW B;  2QCU A;  2VQE M;  2HL7 A;  1YE9 A;  3PNV A;  4TUW A;  3KOZ E;  2OQ4 A;  4FWD A;  3U6C A;  1SXJ A;  5FTM A;  4DV4 M;  1SXJ C;  1UM8 A;  1HNW M;  4EIW A;  4DR4 M;  2F5S A;  4XBO A;  4OX9 M;  4X65 M;  4CIS A;  4PDG A;  3L26 A;  4DV5 M;  4BB9 A;  1IN5 A;  4L15 A;  4AW4 A;  4BBA A;  3GO8 A;  3KSX A;  3DA1 A;  3LQQ A;  3CF2 A;  4FWH A;  4M0W A;  2CHG A;  2LWX A;  3SAW A;  1L1T A;  3SYK A;  3DFZ A;  1OJL A;  3L27 A;  3W0L B;  3FUW A;  4DV7 M;  1ORY B;  3SBJ A;  3T1H M;  4LJ5 A;  2XF3 A;  3THG A;  3T15 A;  4LJ7 A;  3KOY E;  3A46 A;  2XSZ A;  5EQT A;  3H4M A;  1NNJ A;  1ZQ9 A;  4IBC A;  5ITR A;  4JI2 M;  3FYD A;  4I4L A;  3PXG A;  4DR7 M;  4X66 M;  1Z5B A;  1R6B X;  3CF0 A;  5LMU M;  4MGZ E;  3QAU A;  4IBE A;  3HHZ A;  2RKO A;  4IBD A;  2V1C A;  4A3V B;  3HHX A;  2Z4R A;  3LMM A;  3C58 A;  3SMS A;  3JR4 A;  3HGI A;  1NHG C;  4P16 A;  1XHB A;  1X37 A;  4GMQ A;  8CAT A;  4AKH A;  2YR0 A;  3HWS A;  4REZ A;  4LJ8 A;  3W0F A;  4RNA A;  3TQS A;  4PDI A;  1NY6 A;  4L78 A;  4B7H A;  3J2P B;  3NBI A;  3HJS A;  3U61 A;  4KHP M;  1W5S A;  3VDU A;  3GQ4 A;  3U6P A;  4MGH A;  1OFH A;  1NVM A;  3GRR A;  2YFQ A;  4IBG A;  3GLG A;  4RF1 A;  4I8O A;  3HJQ A;  2J7N A;  3D8L A;  3AJI B;  4G4O A;  5E6J A;  2KRK A;  1XMO M;  1QVR A;  1TH2 A;  3CTW B;  3J7B A;  3FKE A;  1K3W A;  1IXS B;  1TDH A;  2V1U A;  5FLX S;  4CGY B;  4X62 M;  2CV0 A;  2ZBK B;  2RGH A;  2QEN A;  3E9S A;  4I5S A;  4B3M M;  3TWM A;  2VII A;  4LF9 M;  2QP9 X;  1QQW A;  1N36 M;  4LF8 M;  2BNK A;  4DR3 M;  4B7G A;  1SXJ D;  5KO3 A;  4QHT A;  3TE6 A;  1ZAE A;  3NWL A;  2R4E A;  5EJC A;  2KZS A;  2XEP A;  3U60 B;  1DGB A;  3HKP A;  3HHW A;  3I51 A;  1E9S A;  2F5O A;  2LXE A;  3UMM A;  1L2B A;  2Y0T A;  1K3X A;  1TH3 A;  3J81 S;  4GC9 A;  4FCW A;  4NSR A;  1DGH A;  3SHG B;  5A2Q S;  3KOX E;  3IG8 A;  2ZAN A;  1D2N A;  1JR3 A;  2J7O A;  2NQ8 C;  3BOS A;  2HCB A;  2XFS A;  4LGM A;  3KS8 A;  3UGJ A;  4AG5 A;  3GLF A;  1J7K A;  1HT1 E;  5ITX A;  3VKH A;  2DZO B;  1N34 M;  3SAT A;  3K2L A;  2FFJ A;  2XSZ D;  4NL4 H;  3KP1 E;  3FUU A;  4MB7 A;  4IIW A;  4X64 M;  2DWN A;  4LJ4 A;  4LRS A;  5IRE B;  2XFT A;  2L09 A;  4W5W A;  3UJN A;  2JA2 A;  4DR2 M;  1KYI A;  2R62 A;  4JI0 M;  4GKJ M;  4NSO B;  4QNM A;  3SC3 A;  1G4A E;  2Y20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...