4B3TM

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3tM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3tM02
3U6CA 4DR6M 1XNQM 3GPXA 1Z59A 3GPPA 1PJIA 1HR0M 4DV5M 4DR4M 4G4QA 1L1ZA 1IBKM 4LFBM 3GO8A 3SATA 4JI5M 1XMOM 1XC8A 2HKJA 1XNRM 4NXNM 1R2YA 5FLXS 4PD2A 3GP1A 2UXDM 4JI0M 1J5EM 2F4VM 1Z5CA 4OX9M 1HNXM 3JR5A 1Q3BA 1IBMM 3C58A 3SBJA 4JI4M 2F5PA 4G4NA 2XZUA 4DUZM 3T1YM 2UXCM 3SAVA 4AQYM 4LF6M 3U6PA 2Q2EB 2VQEM 4LF9M 3JR4A 3TWLA 1PJJA 4NRVA 4DV1M 4KHPM 5IWAM 4X66M 1HNWM 4JI7M 5A2QS 2ZBKB 1K3WA 4DV3M 4B3MM 4LF4M 1EE8A 1MU5A 5ITQA 3U6MA 1XMQM 4JI1M 4B3SM 3JAMS 4DR5M 5ITYA 1KFVA 4X65M 3A42A 1Z5BA 4LFCM 4JI6M 4K0KM 5ITTA 2F5OA 3TWMA 4NRWA 1MX0A 4GKKM 2EA0A 1N34M 3J81S 3TWKA 3VK8A 3GQ5A 1TDZA 2E5LM 2XZFA 4JI3M 3A46A 4DV6M 3U6SA 4DV2M 4X64M 4G4OA 1FJGM 3J80S 4LF7M 3SAUA 5BR8M 3OTOM 4PDGA 4NXMM 3U6DA 4DV4M 1I94M 4DV7M 3DOAA 1Z5AA 4DR1M 3VK7A 3J7AS 4GKJM 5LMNM 2UXBM 2ZM6M 5LMUM 4JYAM 4JV5M 4DR7M 5ITXA 5ITXE 3SAWA 4CISA 2OPFA 4DR2M 3SASA 4B3TM 2UUAM 5ITRA 5ITUA 1L2CA 2VQFM 1N36M 1HNZM 4ITQA 1Q3CA 4X62M 2OQ4A 3A45A 4DR3M 1K3XA 4YY3M 4LF8M 1PM5A 1N32M 2HHHM 1TDHA 4PCZA 3U6QA 2UUCM 3W0FA 3GQ4A 3U6OA 1L1TA 4JI8M 4DV0M 4LF5M 2UUBM 4G4RA 2F5SA 3T1HM 1R2ZA 1L2BA 3GQ3A 1Q39A 2F5NA 2UU9M 4JI2M 4MB7A 3SARA 1NNJA 4LFAM 3GPUA 3GPYA 1L2DA 4PDIA 2F5QA 1IBLM 3U6EA 3U6LA 1N33M 4B3RM 5IT9S 1K82A 4YHHM 4DUYM
chains in the Genus database with same CATH superfamily
1R4GA 1Z59A 2LBCA 4DV5M 1OAOC 1L1ZA 5DYIA 1YLAA 1C1KA 1GKIA 3SATA 3R9XB 4AKIA 3UZUA 2KEBA 3C3EA 3LQQA 1Q02A 1VEGA 1IXSA 3GLIB 3Q8XA 3RE8A 4NXNM 3L27A 1R2YA 4CJ6A 1E32A 3FKEA 2ZTDA 4D82A 1OJLA 4L15A 3DZDA 1J5EM 4LJ8A 2XLJA 2FOIC 2ZAMA 1Z6TA 3KP1E 3NBXX 4LY6A 3JR5A 1UM8A 3M6AA 3UMMA 2LVOC 1E9RA 1QAMA 2D7EA 2DHYA 1NO1A 3AOEC 5DYGA 1DV0A 2J5YA 1A5TA 2F5PA 4REZA 4I5SA 3L29A 2GQFA 2M5ZA 1QYRA 2R4EA 4Z8XA 4GC9A 2MJ5B 3H4JA 2DI0A 3MJ5A 3U6PA 1BVSA 1NNUC 2L2DA 3TWLA 1L8QA 3HHXA 1ZMUA 4QNMA 4RKUF 4DV1M 2Y21A 3KOYE 4KHPM 4X66M 1HNWM 3DFZA 4JI7M 4FD2A 3KSXA 1R6BX 2BJVA 2CFOA 3IG8A 4GH9A 5ITQA 2CV2A 3LVWA 1D0MA 3PNYA 3JAMS 1G4AE 1XWIA 3AKZA 3HU1A 2K47A 4DR5M 2XH9A 2Z4RA 3U61A 1NY5A 2L4FA 3A42A 2X4AA 3D8BA 1KFVA 2DNAA 1IN8A 3HU2A 4LFCM 2F5OA 3TWMA 2CHGA 1GABA 4G3OA 2XGNA 3FUTA 3J81S 3VK8A 3FUWA 4JI3M 2EO2A 3A46A 3HX3A 2X8AA 5EP2A 4JXJA 2JY7A 4G4OA 4M9ZA 2ZANA 4QOSA 4LF7M 2BWBA 3IHPA 3TE6A 2APLA 2MROB 1R7RA 4GITA 4QHTA 3RGSA 3RGPA 3GLIE 1OFHA 3DOAA 1VEJA 3UGJA 2DZLA 2YR0A 3B7ZA 4G6ZA 5KO3A 2DENA 2QNJA 5FTNA 1YE9A 2P5TA 1NSFA 4IBFA 2V1UA 3WHKA 3UK6A 1NV8A 2VF8A 4B7GA 3SAWA 4JN6A 1WGNA 2LH0A 1IFYA 1SG9A 4NL4H 2CWBA 4LGYA 4DR2M 3FRHA 5IREB 4OVZA 2DAIA 3R8FA 5DFLA 2ZAOA 4L6V6 2VQFM 3K9PA 3I4VA 1DGGA 1N77A 3HGIA 3EIEA 1G3IA 1J7KA 1WIVA 2DHRA 2HHHM 3SHFA 1TH4A 2WSCF 2UUCM 4EIWA 2DWZB 2WZJA 3B7QA 3GQ4A 3KFUG 3VKGA 2X49A 2BWEA 2KDLA 5EXXA 1X37A 1MJGM 4HLQA 4IBKA 3FUVA 1QUSA 3HJQA 1XXHB 1L2BA 1I4WA 4P16A 4LGMA 2F5NA 4JI2M 4MB7A 4L8RC 2NQ8C 2R4JA 4LRSA 1GLNA 4PDIA 4AG5A 2LNHC 3K2LA 4L4UA 5EXSA 3U6EA 4CHTB 2HAKA 4L78A 3QWLA 1K82A 3K9OA 3L28A 4IBEA 4MGHA 3KW6A 1SXJC 1ZAEA 4LJ4A 4DR6M 4NOOB 3GLFE 3C3DA 1XHBA 4IBCA 5E6JA 5L8RF 3BOSA 4LZZA 4G4QA 1W5SA 4PT5A 2DWNA 2ERCA 4MH0E 1YSYA 2LWXA 1HQCA 1QAQA 2LVPC 3T15A 2FNAA 3L25A 2K9DA 4CGYB 2L4EA 1AUAA 4A3VB 4PD2A 2CE7A 2LVNC 3IECA 1WJ7A 2F4VM 4QOZC 3B89A 4D80A 3FUUA 2VF7A 3FTFA 4AKHA 1VDDA 2D7GA 2I7PA 2RGHA 3RFWA 2FS1A 2WSFF 3HJSA 2CUZA 4NC6A 2MGWA 3KSJA 4IJFA 4ANRA 3KS8A 4G4NA 4MM3B 3K92A 2LHGA 2C98A 3LCUA 3SAVA 2CHQA 4LF9M 3FE3A 2Q2EB 4WW0A 2EJSA 3JR4A 4M0DA 4M0WA 4IJEA 1PJJA 1PJSA 3B74A 3DA1A 1KSFX 3KOXE 3L2AA 4NRVA 1G8PA 1IY0A 4IBJA 1AIPC 5A2QS 2EKKA 1QZMA 2M60A 3THGA 2QBYA 5FSWA 3SHGB 1DGBA 3WHLA 2QHOB 2Y20A 3PXGA 3U6MA 2JUJA 1ORYB 4GEWA 1NJFA 3QYBA 3U60A 1PJTA 4LG2A 1QDTA 2QSFX 4X65M 4K0KM 1Z5BA 2KXEA 4ZPXA 2MR9A 4M9SA 3KS4A 1CUKA 3UJNA 1EFUB 2L7HA 1MX0A 4RF1A 2RKOA 2C96A 2D7HA 2Y0TA 2EA0A 1OIPA 2FH0A 3NBIA 3GLHE 4AZFA 5C1BA 1N34M 4QHSA 1EIJA 2DXIA 1G59A 5BPVA 3GLFB 2CP8A 1IXZA 1HJPA 1H6UA 1OKSA 2QCUA 1OIZA 1TTEA 2R44A 3J80S 1ZMVA 3SAUA 4LJ6A 2BJWA 4F1IA 5BR8M 2G8LA 1P3QQ 4NXMM 1I94M 4DV4M 3KP0E 1VQ1A 3VK7A 3J7AS 4GKJM 3HY5A 4KT0F 2JY5A 2V1CA 1SXJD 2KRKA 1SXJE 3PVSA 2RRUA 1GO5A 2XFTA 4JYAM 4JV5M 5FTJA 1XXHA 1JR3D 1UFZA 2KZUA 5ITXA 5ITXE 2OO9A 3E46A 3I4YA 4AW4A 2J7OA 1G41A 1V92A 3HHZA 5ITUA 4IBIA 1N36M 5EP1A 3HHWA 4ITQA 1T6OA 1Q3CA 3E9SA 1QUTA 2KZSA 3A45A 2YFQA 2KA6B 3SMPA 3HWSA 4LF8M 3ZCBB 1QQWA 2JWSA 3U6QA 3GRVA 4UN2B 2KNVA 3QAUA 4MGZE 1L1TA 4DV0M 1WHCA 3HZJA 4JI8M 3LCVB 1WGLA 2LVAA 2G3QA 2UUBM 2LTUA 3LW5F 3T1HM 1Q39A 2DAMA 2QPAA 4LZJA 2R62A 3V76A 2ZTCA 4Q7JA 3GLHB 3KOZE 3GPUA 3GPYA 4IIWA 2KNZA 5KQ8A 1T3TA 3BBZA 1E94E 3CF6E 3PNVA 5JI2E 2XSZA 2DAKA 3FD9A 1N33M 3CTWB 1JR3E 4P17A 2KRUA 3FYDA 3B9PA 4DUYM 2R46A 3SYLA 1JQJC 3GPXA 4XK8F 3AOEA 4AG6A 8CATA 3GPPA 3I04M 1RU3A 2CV0A 4MGIE 4NSRA 3J7BA 4FW9A 1NV9A 2J7NA 1ZV1A 1R5LA 2HKJA 3KOWE 3ZC7B 5FTLA 5FTMA 2QENA 3U61B 4OU7A 4FCWA 1VDLA 3VKHA 3FTDA 1IN4A 3GP1A 1GVNA 3M7GA 2R18A 2C9OA 3J27B 4FWHA 5DNYA 1Z5CA 3GLHA 2G5GX 2R0IA 2OOBA 1Q3BA 3M0EA 2JY8A 3GLGE 2Z3XA 2LHCA 3C58A 1IY2A 3SBJA 1Y8GA 4JI4M 5KQDA 1DGHB 2JNHA 2B3TA 1PRBA 4R7GA 2N35A 3T1YM 4NSOB 2R45A 1IM2A 4R71A 2W82A 4KLNA 2OOAA 4KO8A 5IWAM 1D0KA 4AI6A 3HU3A 4MGYE 1GL7A 1K3WA 4DV3M 2JA2A 4B7FA 4LF4M 1MU5A 1QDRA 2LXEA 5FTKA 3ZQJA 3LMMA 2JZ1A 4IBBA 4JI1M 5EP3A 1NHWC 4B3SM 5F3WA 2H5XA 5JI3E 4GRIA 5ITYA 1JB0F 4JI6M 4OW0A 1D2NA 5ITTA 3VLFB 4BLCA 4NRWA 4LRTA 1IN7A 3D8LA 3TWKA 2JZ0A 3GQ5A 1TDZA 4S12A 4DV6M 4I8OA 4GC5A 1NJGA 2HWJA 4DV2M 4X64M 3K1JA 3ZH9B 5EJCA 3OTOM 1T43A 3U6DA 2I7NA 4DR1M 5C18A 1S3SA 5EXTA 2AHMA 4IBGA 2UXBM 4I4LA 1N78A 3HJ8A 3GLGA 1IN5A 4IBDA 2QP9X 3U5ZB 1NVMA 3U5ZA 2JXNA 1TGUA 7CATA 1VEKA 3GLGB 3HKPA 1WXQA 2QBYB 1QVRA 4B3TM 2K0BX 1OTRA 1L2CA 1GJTA 3L26A 3TQSA 1HNZM 1F4IA 4XBOA 1PJQA 4X62M 1W5TA 1OFIA 1IXSB 4YY3M 2Y0QA 4RF0A 1PM5A 2JY6B 3KXEC 3PFIA 1TH3A 3I51A 3SC3A 4PCZA 1N32M 1N75A 2C99A 4LJAA 3W0FA 2YNMD 4R3DA 2EUCA 3AFHA 3U6OA 3AL0C 5E26A 3FYCA 3MK6A 1FNNA 4RNAA 3CF0A 4LF5M 3F92A 4G4RA 2L7IA 1R2ZA 3GQ3A 2DZNB 3TL4X 3W67A 1HT1E 1IY1A 1D0LA 3SARA 1XXHE 3E21A 3J2PB 4LFAM 4BB9A 3GRUA 3CGWA 3I01M 3U6LA 1IXRC 2DAGA 5IT9S 3FRIA 2Z8YM 4YHHM 1TF0B 2XFSA 3FUXA 2O5RA 3SMSA 3LVVA 2QZ4A 1C7YA 3U6CA 1G71A 4HL4A 3VFDA 1XNQM 2KNAA 5EXPA 1PJIA 1HR0M 4GIPA 4DR4M 1V33A 3KDSE 1SXJB 4FWGA 4LJ5A 1DGHA 2VDBB 1IBKM 4LFBM 3GO8A 2HCBA 4FVMA 4WURA 3W0LB 4JI5M 1ZQ9A 1HT2E 3AOGA 1XMOM 1KYIA 4Z6YA 3MHVC 1XC8A 1XNRM 5FLXS 2UXDM 4JI0M 2DWMA 4B3MM 3FTEA 2DAEA 2R6FA 4OX9M 1HNXM 3C9PA 3H4MA 1IBMM 2MH8A 5KPZA 2DZOB 4TUWA 2XF3A 1HQYE 1WR1B 2H1RA 4LJ7A 5KPTA 3A98B 2DWLA 2JP7A 1QAOA 2XZUA 3T38A 4DUZM 2C9CA 2UXCM 1PGYA 4AQYM 4LF6M 2VQEM 2DKLA 3K8ZA 3BXWA 2CRUA 4XGIA 5EQTA 3W68A 1YUBA 2LVQD 4B7HA 4OVZB 4WP2A 2ZBKB 2CEAA 4B08A 2DVWB 1EE8A 3AV0A 3NWLA 1DGFA 1V34A 1XMQM 5GKNA 2RGOA 4GHLA 4F2LA 1DO0A 3EIHA 5H37D 3VDUA 2BNKA 2FFJA 4GKKM 4KODA 2CV1A 3E4RA 4MGKE 1E9SA 2VIIA 2L6OA 2YQZA 1NY6A 3VDPA 2XEPA 2XZFA 2WSEF 2E5LM 2Z7JA 2Z4SA 3U6SA 1FJGM 1OQYA 1IN6A 2O25A 3GRYA 3KVWA 4PDGA 4M9XA 2V6ZM 2EKFA 2FE8A 1J09A 1Z5AA 4DV7M 4AKGA 5LMNM 1LV7A 1TH2A 2ZM6M 2GNOA 4QNRA 1GJSA 1GL6A 2CHVA 4FCTA 1TR8A 5LMUM 2L09A 4W5WA 4DR7M 3IG5A 3B7NA 3CF2A 4CISA 4FWDA 4L16A 4GHAA 2OPFA 3SASA 2C5RA 1XB2B 5ITRA 1QZEA 2R65A 2UUAM 3LQRA 3SYKA 3Q8GA 2OQ4A 4DR3M 2O01F 2XSZD 1K3XA 4II7A 4Y28F 4LJ9A 4DBGB 1NHGC 3GLFA 1TDHA 2QQ8A 3TPZA 1LTMA 1SXJA 2KHHA 1QANA 3FTCA 4GMQA 1ZMWA 5KPRA 4LCBA 1IQPA 1JR3A 1MN3A 3QYEA 2F5SA 3AJIB 2UU9M 5IZ7D 3SFZA 4FCVA 3U60B 3ILKA 3T6PA 4BBAA 1NNJA 2HL7A 1L2DA 4HEOA 2F5QA 1DO2A 1VG5A 3MMPA 1OAIA 4D81A 2KW0A 1IBLM 5EP4A 3HHYA 3GRRA 4B3RM 4I81A 4CIZA 2A5YB 2K6BA 3GLIA
chains in the Genus database with same CATH topology
1Z59A 4DV5M 1L1ZA 5DYIA 1C1KA 1GKIA 3SATA 3R9XB 4AKIA 3UZUA 2KEBA 3LQQA 3GLIB 3Q8XA 3RE8A 4NXNM 3L27A 1R2YA 1E32A 3FKEA 4D82A 1OJLA 4L15A 3DZDA 1J5EM 4LJ8A 2XLJA 2FOIC 2ZAMA 1Z6TA 3KP1E 4LY6A 3JR5A 1UM8A 3M6AA 3UMMA 1E9RA 1QAMA 2D7EA 3AOEC 5DYGA 2F5PA 4REZA 4I5SA 3L29A 2M5ZA 1QYRA 2R4EA 4Z8XA 4GC9A 3U6PA 3MJ5A 1NNUC 3TWLA 1L8QA 3HHXA 4QNMA 4DV1M 2Y21A 3KOYE 4KHPM 4X66M 1HNWM 3DFZA 4JI7M 4FD2A 3KSXA 1R6BX 2BJVA 2CFOA 3IG8A 4GH9A 5ITQA 2CV2A 3LVWA 3PNYA 3JAMS 1G4AE 1XWIA 3AKZA 3HU1A 2K47A 4DR5M 2XH9A 2Z4RA 3U61A 1NY5A 3A42A 3D8BA 2X4AA 1KFVA 4LFCM 1IN8A 3HU2A 2F5OA 3TWMA 2CHGA 2XGNA 3FUTA 3J81S 3VK8A 3FUWA 4JI3M 2EO2A 3A46A 2X8AA 5EP2A 4JXJA 4G4OA 4M9ZA 2ZANA 4QOSA 4LF7M 3TE6A 1R7RA 4GITA 4QHTA 3RGSA 3RGPA 1OFHA 3DOAA 3UGJA 4G6ZA 2YR0A 5KO3A 5FTNA 1YE9A 2P5TA 1NSFA 4IBFA 2V1UA 3WHKA 3UK6A 4B7GA 3SAWA 4JN6A 2LH0A 4NL4H 4LGYA 4DR2M 5IREB 4OVZA 3R8FA 2ZAOA 2VQFM 3I4VA 1DGGA 1N77A 3HGIA 3EIEA 1G3IA 1J7KA 2DHRA 2HHHM 3SHFA 1TH4A 2UUCM 4EIWA 2DWZB 3GQ4A 3KFUG 3VKGA 2X49A 5EXXA 1X37A 4HLQA 4IBKA 3FUVA 3HJQA 1XXHB 1L2BA 1I4WA 4P16A 4LGMA 2F5NA 4JI2M 4MB7A 4L8RC 2NQ8C 2R4JA 4LRSA 1GLNA 4PDIA 4AG5A 2LNHC 3K2LA 4L4UA 5EXSA 3U6EA 4CHTB 4L78A 3QWLA 1K82A 3L28A 4MGHA 4IBEA 3KW6A 1SXJC 1ZAEA 4LJ4A 4DR6M 4NOOB 1XHBA 4IBCA 5E6JA 3BOSA 4LZZA 4G4QA 1W5SA 4PT5A 2DWNA 2ERCA 4MH0E 1YSYA 2LWXA 1HQCA 1QAQA 3T15A 2FNAA 3L25A 4CGYB 4A3VB 4PD2A 2CE7A 4QOZC 2F4VM 4D80A 3FUUA 3FTFA 4AKHA 1VDDA 2D7GA 2I7PA 2RGHA 3RFWA 3HJSA 2CUZA 3KSJA 4IJFA 3KS8A 4G4NA 4MM3B 3K92A 2C98A 3SAVA 2CHQA 4LF9M 4WW0A 2Q2EB 3JR4A 4M0DA 4M0WA 4IJEA 1PJJA 3DA1A 3KOXE 3L2AA 1KSFX 4NRVA 1G8PA 1IY0A 4IBJA 5A2QS 1QZMA 2M60A 3THGA 2QBYA 5FSWA 3SHGB 1DGBA 3WHLA 3U6MA 2Y20A 3PXGA 4B3MM 1ORYB 1NJFA 3U60A 4LG2A 4X65M 4K0KM 1Z5BA 2KXEA 4ZPXA 4M9SA 3KS4A 3UJNA 2L7HA 4RF1A 1MX0A 2RKOA 2C96A 2D7HA 2Y0TA 2EA0A 3NBIA 5C1BA 1N34M 4AZFA 4QHSA 2DXIA 1G59A 5BPVA 3GLFB 1IXZA 1H6UA 2QCUA 3J80S 3SAUA 4LJ6A 2BJWA 5BR8M 4NXMM 2G8LA 1I94M 4DV4M 3KP0E 3VK7A 3J7AS 4GKJM 2V1CA 1SXJD 2KRKA 1SXJE 3PVSA 2XFTA 4JYAM 4JV5M 5FTJA 1XXHA 1JR3D 2KZUA 5ITXA 5ITXE 3I4YA 4AW4A 2J7OA 1G41A 3HHZA 5ITUA 4IBIA 1N36M 5EP1A 3HHWA 4ITQA 1Q3CA 3E9SA 2KZSA 3A45A 2YFQA 2KA6B 3SMPA 3HWSA 4LF8M 3ZCBB 1QQWA 3U6QA 3GRVA 3QAUA 4MGZE 1L1TA 4DV0M 4JI8M 2UUBM 3T1HM 1Q39A 2QPAA 4LZJA 2R62A 3GLHB 3KOZE 3GPUA 3GPYA 4IIWA 5KQ8A 1T3TA 3CF6E 1E94E 3PNVA 5JI2E 2XSZA 3FD9A 1N33M 3CTWB 2KRUA 3FYDA 3B9PA 4DUYM 2R46A 3SYLA 1JQJC 3GPXA 3AOEA 4AG6A 8CATA 3GPPA 2CV0A 4MGIE 4NSRA 3J7BA 4FW9A 2J7NA 3KOWE 2HKJA 3ZC7B 5FTLA 3U61B 5FTMA 2QENA 4OU7A 4FCWA 3VKHA 3FTDA 1IN4A 3GP1A 1GVNA 3M7GA 2R18A 2C9OA 3J27B 4FWHA 5DNYA 1Z5CA 3GLHA 2G5GX 1Q3BA 3M0EA 2Z3XA 3C58A 1IY2A 3SBJA 4JI4M 5KQDA 1DGHB 4R7GA 3T1YM 4NSOB 2R45A 1IM2A 2W82A 4KLNA 4KO8A 5IWAM 4AI6A 3HU3A 4MGYE 1GL7A 1K3WA 4DV3M 2JA2A 4B7FA 4LF4M 1MU5A 5FTKA 2LXEA 3LMMA 4IBBA 4JI1M 5EP3A 1NHWC 4B3SM 5F3WA 5JI3E 4GRIA 5ITYA 4JI6M 4OW0A 1D2NA 5ITTA 3VLFB 4BLCA 4NRWA 4LRTA 1IN7A 3D8LA 3TWKA 3GQ5A 1TDZA 4S12A 4DV6M 4I8OA 4GC5A 1NJGA 4DV2M 4X64M 3K1JA 3ZH9B 5EJCA 3OTOM 3U6DA 2I7NA 4DR1M 5C18A 1S3SA 5EXTA 2AHMA 4IBGA 2UXBM 4I4LA 1N78A 3HJ8A 3GLGA 1IN5A 4IBDA 2QP9X 3U5ZB 1NVMA 3U5ZA 1TGUA 7CATA 3GLGB 3HKPA 1WXQA 2QBYB 1QVRA 4B3TM 1L2CA 3L26A 3TQSA 1HNZM 4XBOA 4X62M 1W5TA 1OFIA 1IXSB 4YY3M 2Y0QA 4RF0A 1PM5A 3KXEC 3PFIA 1N32M 1TH3A 3I51A 3SC3A 4PCZA 1N75A 2C99A 4LJAA 3W0FA 2YNMD 4R3DA 2EUCA 3AFHA 3U6OA 3AL0C 5E26A 3FYCA 3MK6A 1FNNA 4RNAA 3CF0A 4LF5M 4G4RA 2L7IA 1R2ZA 3GQ3A 2DZNB 3TL4X 1HT1E 1IY1A 3SARA 3J2PB 4LFAM 4BB9A 3GRUA 3U6LA 1IXRC 5IT9S 4YHHM 3FUXA 2XFSA 2O5RA 3SMSA 3LVVA 2QZ4A 3U6CA 4HL4A 3VFDA 1XNQM 5EXPA 1PJIA 1HR0M 4GIPA 4DR4M 3KDSE 1SXJB 4FWGA 4LJ5A 1DGHA 1IBKM 4LFBM 3GO8A 2HCBA 4FVMA 4WURA 3W0LB 4JI5M 1ZQ9A 1HT2E 3AOGA 1XMOM 1KYIA 4Z6YA 3MHVC 1XC8A 1XNRM 5FLXS 2UXDM 4JI0M 2DWMA 3FTEA 4OX9M 1HNXM 3H4MA 1IBMM 5KPZA 2DZOB 4TUWA 2XF3A 1HQYE 2H1RA 4LJ7A 5KPTA 3A98B 2DWLA 1QAOA 2XZUA 3T38A 4DUZM 2C9CA 2UXCM 4AQYM 4LF6M 2VQEM 3K8ZA 4XGIA 5EQTA 1YUBA 4B7HA 4OVZB 2ZBKB 2CEAA 4B08A 2DVWB 1EE8A 3AV0A 3NWLA 1DGFA 1XMQM 5GKNA 2RGOA 4GHLA 1DO0A 3EIHA 5H37D 3VDUA 2BNKA 2FFJA 4GKKM 4KODA 2CV1A 3E4RA 4MGKE 1E9SA 2VIIA 2L6OA 2YQZA 1NY6A 3VDPA 2XEPA 2XZFA 2E5LM 2Z7JA 2Z4SA 3U6SA 1FJGM 1IN6A 3GRYA 3KVWA 4PDGA 4M9XA 2V6ZM 2FE8A 4DV7M 1J09A 1Z5AA 4AKGA 5LMNM 1LV7A 1TH2A 2ZM6M 4QNRA 1GL6A 2CHVA 4FCTA 5LMUM 2L09A 4W5WA 4DR7M 3IG5A 4CISA 3CF2A 4FWDA 4L16A 4GHAA 2OPFA 3SASA 2C5RA 5ITRA 2UUAM 2R65A 3LQRA 3SYKA 2OQ4A 4DR3M 2XSZD 1K3XA 4II7A 4LJ9A 1NHGC 3GLFA 1TDHA 3TPZA 1SXJA 1QANA 3FTCA 4GMQA 5KPRA 4LCBA 1IQPA 1JR3A 2F5SA 3AJIB 2UU9M 5IZ7D 3SFZA 4FCVA 3U60B 3ILKA 4BBAA 1NNJA 2HL7A 1L2DA 2F5QA 1DO2A 4D81A 2KW0A 1IBLM 5EP4A 3HHYA 3GRRA 4B3RM 4I81A 2A5YB 3GLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6C A;  4DR6 M;  1XNQ M;  3GPX A;  1Z59 A;  3GPP A;  1PJI A;  1HR0 M;  4DV5 M;  4DR4 M;  4G4Q A;  1L1Z A;  1IBK M;  4LFB M;  3GO8 A;  3SAT A;  4JI5 M;  1XMO M;  1XC8 A;  2HKJ A;  1XNR M;  4NXN M;  1R2Y A;  5FLX S;  4PD2 A;  3GP1 A;  2UXD M;  4JI0 M;  1J5E M;  2F4V M;  1Z5C A;  4OX9 M;  1HNX M;  3JR5 A;  1Q3B A;  1IBM M;  3C58 A;  3SBJ A;  4JI4 M;  2F5P A;  4G4N A;  2XZU A;  4DUZ M;  3T1Y M;  2UXC M;  3SAV A;  4AQY M;  4LF6 M;  3U6P A;  2Q2E B;  2VQE M;  4LF9 M;  3JR4 A;  3TWL A;  1PJJ A;  4NRV A;  4DV1 M;  4KHP M;  5IWA M;  4X66 M;  1HNW M;  4JI7 M;  5A2Q S;  2ZBK B;  1K3W A;  4DV3 M;  4B3M M;  4LF4 M;  1EE8 A;  1MU5 A;  5ITQ A;  3U6M A;  1XMQ M;  4JI1 M;  4B3S M;  3JAM S;  4DR5 M;  5ITY A;  1KFV A;  4X65 M;  3A42 A;  1Z5B A;  4LFC M;  4JI6 M;  4K0K M;  5ITT A;  2F5O A;  3TWM A;  4NRW A;  1MX0 A;  4GKK M;  2EA0 A;  1N34 M;  3J81 S;  3TWK A;  3VK8 A;  3GQ5 A;  1TDZ A;  2E5L M;  2XZF A;  4JI3 M;  3A46 A;  4DV6 M;  3U6S A;  4DV2 M;  4X64 M;  4G4O A;  1FJG M;  3J80 S;  4LF7 M;  3SAU A;  5BR8 M;  3OTO M;  4PDG A;  4NXM M;  3U6D A;  4DV4 M;  1I94 M;  4DV7 M;  3DOA A;  1Z5A A;  4DR1 M;  3VK7 A;  3J7A S;  4GKJ M;  5LMN M;  2UXB M;  2ZM6 M;  5LMU M;  4JYA M;  4JV5 M;  4DR7 M;  5ITX A;  5ITX E;  3SAW A;  4CIS A;  2OPF A;  4DR2 M;  3SAS A;  4B3T M;  2UUA M;  5ITR A;  5ITU A;  1L2C A;  2VQF M;  1N36 M;  1HNZ M;  4ITQ A;  1Q3C A;  4X62 M;  2OQ4 A;  3A45 A;  4DR3 M;  1K3X A;  4YY3 M;  4LF8 M;  1PM5 A;  1N32 M;  2HHH M;  1TDH A;  4PCZ A;  3U6Q A;  2UUC M;  3W0F A;  3GQ4 A;  3U6O A;  1L1T A;  4JI8 M;  4DV0 M;  4LF5 M;  2UUB M;  4G4R A;  2F5S A;  3T1H M;  1R2Z A;  1L2B A;  3GQ3 A;  1Q39 A;  2F5N A;  2UU9 M;  4JI2 M;  4MB7 A;  3SAR A;  1NNJ A;  4LFA M;  3GPU A;  3GPY A;  1L2D A;  4PDI A;  2F5Q A;  1IBL M;  3U6E A;  3U6L A;  1N33 M;  4B3R M;  5IT9 S;  1K82 A;  4YHH M;  4DUY M; 
#chains in the Genus database with same CATH topology
 1R4G A;  1Z59 A;  2LBC A;  4DV5 M;  1OAO C;  1L1Z A;  5DYI A;  1YLA A;  1C1K A;  1GKI A;  3SAT A;  3R9X B;  4AKI A;  3UZU A;  2KEB A;  3C3E A;  3LQQ A;  1Q02 A;  1VEG A;  1IXS A;  3GLI B;  3Q8X A;  3RE8 A;  4NXN M;  3L27 A;  1R2Y A;  4CJ6 A;  1E32 A;  3FKE A;  2ZTD A;  4D82 A;  1OJL A;  4L15 A;  3DZD A;  1J5E M;  4LJ8 A;  2XLJ A;  2FOI C;  2ZAM A;  1Z6T A;  3KP1 E;  3NBX X;  4LY6 A;  3JR5 A;  1UM8 A;  3M6A A;  3UMM A;  2LVO C;  1E9R A;  1QAM A;  2D7E A;  2DHY A;  1NO1 A;  3AOE C;  5DYG A;  1DV0 A;  2J5Y A;  1A5T A;  2F5P A;  4REZ A;  4I5S A;  3L29 A;  2GQF A;  2M5Z A;  1QYR A;  2R4E A;  4Z8X A;  4GC9 A;  2MJ5 B;  3H4J A;  2DI0 A;  3MJ5 A;  3U6P A;  1BVS A;  1NNU C;  2L2D A;  3TWL A;  1L8Q A;  3HHX A;  1ZMU A;  4QNM A;  4RKU F;  4DV1 M;  2Y21 A;  3KOY E;  4KHP M;  4X66 M;  1HNW M;  3DFZ A;  4JI7 M;  4FD2 A;  3KSX A;  1R6B X;  2BJV A;  2CFO A;  3IG8 A;  4GH9 A;  5ITQ A;  2CV2 A;  3LVW A;  1D0M A;  3PNY A;  3JAM S;  1G4A E;  1XWI A;  3AKZ A;  3HU1 A;  2K47 A;  4DR5 M;  2XH9 A;  2Z4R A;  3U61 A;  1NY5 A;  2L4F A;  3A42 A;  2X4A A;  3D8B A;  1KFV A;  2DNA A;  1IN8 A;  3HU2 A;  4LFC M;  2F5O A;  3TWM A;  2CHG A;  1GAB A;  4G3O A;  2XGN A;  3FUT A;  3J81 S;  3VK8 A;  3FUW A;  4JI3 M;  2EO2 A;  3A46 A;  3HX3 A;  2X8A A;  5EP2 A;  4JXJ A;  2JY7 A;  4G4O A;  4M9Z A;  2ZAN A;  4QOS A;  4LF7 M;  2BWB A;  3IHP A;  3TE6 A;  2APL A;  2MRO B;  1R7R A;  4GIT A;  4QHT A;  3RGS A;  3RGP A;  3GLI E;  1OFH A;  3DOA A;  1VEJ A;  3UGJ A;  2DZL A;  2YR0 A;  3B7Z A;  4G6Z A;  5KO3 A;  2DEN A;  2QNJ A;  5FTN A;  1YE9 A;  2P5T A;  1NSF A;  4IBF A;  2V1U A;  3WHK A;  3UK6 A;  1NV8 A;  2VF8 A;  4B7G A;  3SAW A;  4JN6 A;  1WGN A;  2LH0 A;  1IFY A;  1SG9 A;  4NL4 H;  2CWB A;  4LGY A;  4DR2 M;  3FRH A;  5IRE B;  4OVZ A;  2DAI A;  3R8F A;  5DFL A;  2ZAO A;  4L6V 6;  2VQF M;  3K9P A;  3I4V A;  1DGG A;  1N77 A;  3HGI A;  3EIE A;  1G3I A;  1J7K A;  1WIV A;  2DHR A;  2HHH M;  3SHF A;  1TH4 A;  2WSC F;  2UUC M;  4EIW A;  2DWZ B;  2WZJ A;  3B7Q A;  3GQ4 A;  3KFU G;  3VKG A;  2X49 A;  2BWE A;  2KDL A;  5EXX A;  1X37 A;  1MJG M;  4HLQ A;  4IBK A;  3FUV A;  1QUS A;  3HJQ A;  1XXH B;  1L2B A;  1I4W A;  4P16 A;  4LGM A;  2F5N A;  4JI2 M;  4MB7 A;  4L8R C;  2NQ8 C;  2R4J A;  4LRS A;  1GLN A;  4PDI A;  4AG5 A;  2LNH C;  3K2L A;  4L4U A;  5EXS A;  3U6E A;  4CHT B;  2HAK A;  4L78 A;  3QWL A;  1K82 A;  3K9O A;  3L28 A;  4IBE A;  4MGH A;  3KW6 A;  1SXJ C;  1ZAE A;  4LJ4 A;  4DR6 M;  4NOO B;  3GLF E;  3C3D A;  1XHB A;  4IBC A;  5E6J A;  5L8R F;  3BOS A;  4LZZ A;  4G4Q A;  1W5S A;  4PT5 A;  2DWN A;  2ERC A;  4MH0 E;  1YSY A;  2LWX A;  1HQC A;  1QAQ A;  2LVP C;  3T15 A;  2FNA A;  3L25 A;  2K9D A;  4CGY B;  2L4E A;  1AUA A;  4A3V B;  4PD2 A;  2CE7 A;  2LVN C;  3IEC A;  1WJ7 A;  2F4V M;  4QOZ C;  3B89 A;  4D80 A;  3FUU A;  2VF7 A;  3FTF A;  4AKH A;  1VDD A;  2D7G A;  2I7P A;  2RGH A;  3RFW A;  2FS1 A;  2WSF F;  3HJS A;  2CUZ A;  4NC6 A;  2MGW A;  3KSJ A;  4IJF A;  4ANR A;  3KS8 A;  4G4N A;  4MM3 B;  3K92 A;  2LHG A;  2C98 A;  3LCU A;  3SAV A;  2CHQ A;  4LF9 M;  3FE3 A;  2Q2E B;  4WW0 A;  2EJS A;  3JR4 A;  4M0D A;  4M0W A;  4IJE A;  1PJJ A;  1PJS A;  3B74 A;  3DA1 A;  1KSF X;  3KOX E;  3L2A A;  4NRV A;  1G8P A;  1IY0 A;  4IBJ A;  1AIP C;  5A2Q S;  2EKK A;  1QZM A;  2M60 A;  3THG A;  2QBY A;  5FSW A;  3SHG B;  1DGB A;  3WHL A;  2QHO B;  2Y20 A;  3PXG A;  3U6M A;  2JUJ A;  1ORY B;  4GEW A;  1NJF A;  3QYB A;  3U60 A;  1PJT A;  4LG2 A;  1QDT A;  2QSF X;  4X65 M;  4K0K M;  1Z5B A;  2KXE A;  4ZPX A;  2MR9 A;  4M9S A;  3KS4 A;  1CUK A;  3UJN A;  1EFU B;  2L7H A;  1MX0 A;  4RF1 A;  2RKO A;  2C96 A;  2D7H A;  2Y0T A;  2EA0 A;  1OIP A;  2FH0 A;  3NBI A;  3GLH E;  4AZF A;  5C1B A;  1N34 M;  4QHS A;  1EIJ A;  2DXI A;  1G59 A;  5BPV A;  3GLF B;  2CP8 A;  1IXZ A;  1HJP A;  1H6U A;  1OKS A;  2QCU A;  1OIZ A;  1TTE A;  2R44 A;  3J80 S;  1ZMV A;  3SAU A;  4LJ6 A;  2BJW A;  4F1I A;  5BR8 M;  2G8L A;  1P3Q Q;  4NXM M;  1I94 M;  4DV4 M;  3KP0 E;  1VQ1 A;  3VK7 A;  3J7A S;  4GKJ M;  3HY5 A;  4KT0 F;  2JY5 A;  2V1C A;  1SXJ D;  2KRK A;  1SXJ E;  3PVS A;  2RRU A;  1GO5 A;  2XFT A;  4JYA M;  4JV5 M;  5FTJ A;  1XXH A;  1JR3 D;  1UFZ A;  2KZU A;  5ITX A;  5ITX E;  2OO9 A;  3E46 A;  3I4Y A;  4AW4 A;  2J7O A;  1G41 A;  1V92 A;  3HHZ A;  5ITU A;  4IBI A;  1N36 M;  5EP1 A;  3HHW A;  4ITQ A;  1T6O A;  1Q3C A;  3E9S A;  1QUT A;  2KZS A;  3A45 A;  2YFQ A;  2KA6 B;  3SMP A;  3HWS A;  4LF8 M;  3ZCB B;  1QQW A;  2JWS A;  3U6Q A;  3GRV A;  4UN2 B;  2KNV A;  3QAU A;  4MGZ E;  1L1T A;  4DV0 M;  1WHC A;  3HZJ A;  4JI8 M;  3LCV B;  1WGL A;  2LVA A;  2G3Q A;  2UUB M;  2LTU A;  3LW5 F;  3T1H M;  1Q39 A;  2DAM A;  2QPA A;  4LZJ A;  2R62 A;  3V76 A;  2ZTC A;  4Q7J A;  3GLH B;  3KOZ E;  3GPU A;  3GPY A;  4IIW A;  2KNZ A;  5KQ8 A;  1T3T A;  3BBZ A;  1E94 E;  3CF6 E;  3PNV A;  5JI2 E;  2XSZ A;  2DAK A;  3FD9 A;  1N33 M;  3CTW B;  1JR3 E;  4P17 A;  2KRU A;  3FYD A;  3B9P A;  4DUY M;  2R46 A;  3SYL A;  1JQJ C;  3GPX A;  4XK8 F;  3AOE A;  4AG6 A;  8CAT A;  3GPP A;  3I04 M;  1RU3 A;  2CV0 A;  4MGI E;  4NSR A;  3J7B A;  4FW9 A;  1NV9 A;  2J7N A;  1ZV1 A;  1R5L A;  2HKJ A;  3KOW E;  3ZC7 B;  5FTL A;  5FTM A;  2QEN A;  3U61 B;  4OU7 A;  4FCW A;  1VDL A;  3VKH A;  3FTD A;  1IN4 A;  3GP1 A;  1GVN A;  3M7G A;  2R18 A;  2C9O A;  3J27 B;  4FWH A;  5DNY A;  1Z5C A;  3GLH A;  2G5G X;  2R0I A;  2OOB A;  1Q3B A;  3M0E A;  2JY8 A;  3GLG E;  2Z3X A;  2LHC A;  3C58 A;  1IY2 A;  3SBJ A;  1Y8G A;  4JI4 M;  5KQD A;  1DGH B;  2JNH A;  2B3T A;  1PRB A;  4R7G A;  2N35 A;  3T1Y M;  4NSO B;  2R45 A;  1IM2 A;  4R71 A;  2W82 A;  4KLN A;  2OOA A;  4KO8 A;  5IWA M;  1D0K A;  4AI6 A;  3HU3 A;  4MGY E;  1GL7 A;  1K3W A;  4DV3 M;  2JA2 A;  4B7F A;  4LF4 M;  1MU5 A;  1QDR A;  2LXE A;  5FTK A;  3ZQJ A;  3LMM A;  2JZ1 A;  4IBB A;  4JI1 M;  5EP3 A;  1NHW C;  4B3S M;  5F3W A;  2H5X A;  5JI3 E;  4GRI A;  5ITY A;  1JB0 F;  4JI6 M;  4OW0 A;  1D2N A;  5ITT A;  3VLF B;  4BLC A;  4NRW A;  4LRT A;  1IN7 A;  3D8L A;  3TWK A;  2JZ0 A;  3GQ5 A;  1TDZ A;  4S12 A;  4DV6 M;  4I8O A;  4GC5 A;  1NJG A;  2HWJ A;  4DV2 M;  4X64 M;  3K1J A;  3ZH9 B;  5EJC A;  3OTO M;  1T43 A;  3U6D A;  2I7N A;  4DR1 M;  5C18 A;  1S3S A;  5EXT A;  2AHM A;  4IBG A;  2UXB M;  4I4L A;  1N78 A;  3HJ8 A;  3GLG A;  1IN5 A;  4IBD A;  2QP9 X;  3U5Z B;  1NVM A;  3U5Z A;  2JXN A;  1TGU A;  7CAT A;  1VEK A;  3GLG B;  3HKP A;  1WXQ A;  2QBY B;  1QVR A;  4B3T M;  2K0B X;  1OTR A;  1L2C A;  1GJT A;  3L26 A;  3TQS A;  1HNZ M;  1F4I A;  4XBO A;  1PJQ A;  4X62 M;  1W5T A;  1OFI A;  1IXS B;  4YY3 M;  2Y0Q A;  4RF0 A;  1PM5 A;  2JY6 B;  3KXE C;  3PFI A;  1TH3 A;  3I51 A;  3SC3 A;  4PCZ A;  1N32 M;  1N75 A;  2C99 A;  4LJA A;  3W0F A;  2YNM D;  4R3D A;  2EUC A;  3AFH A;  3U6O A;  3AL0 C;  5E26 A;  3FYC A;  3MK6 A;  1FNN A;  4RNA A;  3CF0 A;  4LF5 M;  3F92 A;  4G4R A;  2L7I A;  1R2Z A;  3GQ3 A;  2DZN B;  3TL4 X;  3W67 A;  1HT1 E;  1IY1 A;  1D0L A;  3SAR A;  1XXH E;  3E21 A;  3J2P B;  4LFA M;  4BB9 A;  3GRU A;  3CGW A;  3I01 M;  3U6L A;  1IXR C;  2DAG A;  5IT9 S;  3FRI A;  2Z8Y M;  4YHH M;  1TF0 B;  2XFS A;  3FUX A;  2O5R A;  3SMS A;  3LVV A;  2QZ4 A;  1C7Y A;  3U6C A;  1G71 A;  4HL4 A;  3VFD A;  1XNQ M;  2KNA A;  5EXP A;  1PJI A;  1HR0 M;  4GIP A;  4DR4 M;  1V33 A;  3KDS E;  1SXJ B;  4FWG A;  4LJ5 A;  1DGH A;  2VDB B;  1IBK M;  4LFB M;  3GO8 A;  2HCB A;  4FVM A;  4WUR A;  3W0L B;  4JI5 M;  1ZQ9 A;  1HT2 E;  3AOG A;  1XMO M;  1KYI A;  4Z6Y A;  3MHV C;  1XC8 A;  1XNR M;  5FLX S;  2UXD M;  4JI0 M;  2DWM A;  4B3M M;  3FTE A;  2DAE A;  2R6F A;  4OX9 M;  1HNX M;  3C9P A;  3H4M A;  1IBM M;  2MH8 A;  5KPZ A;  2DZO B;  4TUW A;  2XF3 A;  1HQY E;  1WR1 B;  2H1R A;  4LJ7 A;  5KPT A;  3A98 B;  2DWL A;  2JP7 A;  1QAO A;  2XZU A;  3T38 A;  4DUZ M;  2C9C A;  2UXC M;  1PGY A;  4AQY M;  4LF6 M;  2VQE M;  2DKL A;  3K8Z A;  3BXW A;  2CRU A;  4XGI A;  5EQT A;  3W68 A;  1YUB A;  2LVQ D;  4B7H A;  4OVZ B;  4WP2 A;  2ZBK B;  2CEA A;  4B08 A;  2DVW B;  1EE8 A;  3AV0 A;  3NWL A;  1DGF A;  1V34 A;  1XMQ M;  5GKN A;  2RGO A;  4GHL A;  4F2L A;  1DO0 A;  3EIH A;  5H37 D;  3VDU A;  2BNK A;  2FFJ A;  4GKK M;  4KOD A;  2CV1 A;  3E4R A;  4MGK E;  1E9S A;  2VII A;  2L6O A;  2YQZ A;  1NY6 A;  3VDP A;  2XEP A;  2XZF A;  2WSE F;  2E5L M;  2Z7J A;  2Z4S A;  3U6S A;  1FJG M;  1OQY A;  1IN6 A;  2O25 A;  3GRY A;  3KVW A;  4PDG A;  4M9X A;  2V6Z M;  2EKF A;  2FE8 A;  1J09 A;  1Z5A A;  4DV7 M;  4AKG A;  5LMN M;  1LV7 A;  1TH2 A;  2ZM6 M;  2GNO A;  4QNR A;  1GJS A;  1GL6 A;  2CHV A;  4FCT A;  1TR8 A;  5LMU M;  2L09 A;  4W5W A;  4DR7 M;  3IG5 A;  3B7N A;  3CF2 A;  4CIS A;  4FWD A;  4L16 A;  4GHA A;  2OPF A;  3SAS A;  2C5R A;  1XB2 B;  5ITR A;  1QZE A;  2R65 A;  2UUA M;  3LQR A;  3SYK A;  3Q8G A;  2OQ4 A;  4DR3 M;  2O01 F;  2XSZ D;  1K3X A;  4II7 A;  4Y28 F;  4LJ9 A;  4DBG B;  1NHG C;  3GLF A;  1TDH A;  2QQ8 A;  3TPZ A;  1LTM A;  1SXJ A;  2KHH A;  1QAN A;  3FTC A;  4GMQ A;  1ZMW A;  5KPR A;  4LCB A;  1IQP A;  1JR3 A;  1MN3 A;  3QYE A;  2F5S A;  3AJI B;  2UU9 M;  5IZ7 D;  3SFZ A;  4FCV A;  3U60 B;  3ILK A;  3T6P A;  4BBA A;  1NNJ A;  2HL7 A;  1L2D A;  4HEO A;  2F5Q A;  1DO2 A;  1VG5 A;  3MMP A;  1OAI A;  4D81 A;  2KW0 A;  1IBL M;  5EP4 A;  3HHY A;  3GRR A;  4B3R M;  4I81 A;  4CIZ A;  2A5Y B;  2K6B A;  3GLI A; 
#chains in the Genus database with same CATH homology
 1Z59 A;  4DV5 M;  1L1Z A;  5DYI A;  1C1K A;  1GKI A;  3SAT A;  3R9X B;  4AKI A;  3UZU A;  2KEB A;  3LQQ A;  3GLI B;  3Q8X A;  3RE8 A;  4NXN M;  3L27 A;  1R2Y A;  1E32 A;  3FKE A;  4D82 A;  1OJL A;  4L15 A;  3DZD A;  1J5E M;  4LJ8 A;  2XLJ A;  2FOI C;  2ZAM A;  1Z6T A;  3KP1 E;  4LY6 A;  3JR5 A;  1UM8 A;  3M6A A;  3UMM A;  1E9R A;  1QAM A;  2D7E A;  3AOE C;  5DYG A;  2F5P A;  4REZ A;  4I5S A;  3L29 A;  2M5Z A;  1QYR A;  2R4E A;  4Z8X A;  4GC9 A;  3U6P A;  3MJ5 A;  1NNU C;  3TWL A;  1L8Q A;  3HHX A;  4QNM A;  4DV1 M;  2Y21 A;  3KOY E;  4KHP M;  4X66 M;  1HNW M;  3DFZ A;  4JI7 M;  4FD2 A;  3KSX A;  1R6B X;  2BJV A;  2CFO A;  3IG8 A;  4GH9 A;  5ITQ A;  2CV2 A;  3LVW A;  3PNY A;  3JAM S;  1G4A E;  1XWI A;  3AKZ A;  3HU1 A;  2K47 A;  4DR5 M;  2XH9 A;  2Z4R A;  3U61 A;  1NY5 A;  3A42 A;  3D8B A;  2X4A A;  1KFV A;  4LFC M;  1IN8 A;  3HU2 A;  2F5O A;  3TWM A;  2CHG A;  2XGN A;  3FUT A;  3J81 S;  3VK8 A;  3FUW A;  4JI3 M;  2EO2 A;  3A46 A;  2X8A A;  5EP2 A;  4JXJ A;  4G4O A;  4M9Z A;  2ZAN A;  4QOS A;  4LF7 M;  3TE6 A;  1R7R A;  4GIT A;  4QHT A;  3RGS A;  3RGP A;  1OFH A;  3DOA A;  3UGJ A;  4G6Z A;  2YR0 A;  5KO3 A;  5FTN A;  1YE9 A;  2P5T A;  1NSF A;  4IBF A;  2V1U A;  3WHK A;  3UK6 A;  4B7G A;  3SAW A;  4JN6 A;  2LH0 A;  4NL4 H;  4LGY A;  4DR2 M;  5IRE B;  4OVZ A;  3R8F A;  2ZAO A;  2VQF M;  3I4V A;  1DGG A;  1N77 A;  3HGI A;  3EIE A;  1G3I A;  1J7K A;  2DHR A;  2HHH M;  3SHF A;  1TH4 A;  2UUC M;  4EIW A;  2DWZ B;  3GQ4 A;  3KFU G;  3VKG A;  2X49 A;  5EXX A;  1X37 A;  4HLQ A;  4IBK A;  3FUV A;  3HJQ A;  1XXH B;  1L2B A;  1I4W A;  4P16 A;  4LGM A;  2F5N A;  4JI2 M;  4MB7 A;  4L8R C;  2NQ8 C;  2R4J A;  4LRS A;  1GLN A;  4PDI A;  4AG5 A;  2LNH C;  3K2L A;  4L4U A;  5EXS A;  3U6E A;  4CHT B;  4L78 A;  3QWL A;  1K82 A;  3L28 A;  4MGH A;  4IBE A;  3KW6 A;  1SXJ C;  1ZAE A;  4LJ4 A;  4DR6 M;  4NOO B;  1XHB A;  4IBC A;  5E6J A;  3BOS A;  4LZZ A;  4G4Q A;  1W5S A;  4PT5 A;  2DWN A;  2ERC A;  4MH0 E;  1YSY A;  2LWX A;  1HQC A;  1QAQ A;  3T15 A;  2FNA A;  3L25 A;  4CGY B;  4A3V B;  4PD2 A;  2CE7 A;  4QOZ C;  2F4V M;  4D80 A;  3FUU A;  3FTF A;  4AKH A;  1VDD A;  2D7G A;  2I7P A;  2RGH A;  3RFW A;  3HJS A;  2CUZ A;  3KSJ A;  4IJF A;  3KS8 A;  4G4N A;  4MM3 B;  3K92 A;  2C98 A;  3SAV A;  2CHQ A;  4LF9 M;  4WW0 A;  2Q2E B;  3JR4 A;  4M0D A;  4M0W A;  4IJE A;  1PJJ A;  3DA1 A;  3KOX E;  3L2A A;  1KSF X;  4NRV A;  1G8P A;  1IY0 A;  4IBJ A;  5A2Q S;  1QZM A;  2M60 A;  3THG A;  2QBY A;  5FSW A;  3SHG B;  1DGB A;  3WHL A;  3U6M A;  2Y20 A;  3PXG A;  4B3M M;  1ORY B;  1NJF A;  3U60 A;  4LG2 A;  4X65 M;  4K0K M;  1Z5B A;  2KXE A;  4ZPX A;  4M9S A;  3KS4 A;  3UJN A;  2L7H A;  4RF1 A;  1MX0 A;  2RKO A;  2C96 A;  2D7H A;  2Y0T A;  2EA0 A;  3NBI A;  5C1B A;  1N34 M;  4AZF A;  4QHS A;  2DXI A;  1G59 A;  5BPV A;  3GLF B;  1IXZ A;  1H6U A;  2QCU A;  3J80 S;  3SAU A;  4LJ6 A;  2BJW A;  5BR8 M;  4NXM M;  2G8L A;  1I94 M;  4DV4 M;  3KP0 E;  3VK7 A;  3J7A S;  4GKJ M;  2V1C A;  1SXJ D;  2KRK A;  1SXJ E;  3PVS A;  2XFT A;  4JYA M;  4JV5 M;  5FTJ A;  1XXH A;  1JR3 D;  2KZU A;  5ITX A;  5ITX E;  3I4Y A;  4AW4 A;  2J7O A;  1G41 A;  3HHZ A;  5ITU A;  4IBI A;  1N36 M;  5EP1 A;  3HHW A;  4ITQ A;  1Q3C A;  3E9S A;  2KZS A;  3A45 A;  2YFQ A;  2KA6 B;  3SMP A;  3HWS A;  4LF8 M;  3ZCB B;  1QQW A;  3U6Q A;  3GRV A;  3QAU A;  4MGZ E;  1L1T A;  4DV0 M;  4JI8 M;  2UUB M;  3T1H M;  1Q39 A;  2QPA A;  4LZJ A;  2R62 A;  3GLH B;  3KOZ E;  3GPU A;  3GPY A;  4IIW A;  5KQ8 A;  1T3T A;  3CF6 E;  1E94 E;  3PNV A;  5JI2 E;  2XSZ A;  3FD9 A;  1N33 M;  3CTW B;  2KRU A;  3FYD A;  3B9P A;  4DUY M;  2R46 A;  3SYL A;  1JQJ C;  3GPX A;  3AOE A;  4AG6 A;  8CAT A;  3GPP A;  2CV0 A;  4MGI E;  4NSR A;  3J7B A;  4FW9 A;  2J7N A;  3KOW E;  2HKJ A;  3ZC7 B;  5FTL A;  3U61 B;  5FTM A;  2QEN A;  4OU7 A;  4FCW A;  3VKH A;  3FTD A;  1IN4 A;  3GP1 A;  1GVN A;  3M7G A;  2R18 A;  2C9O A;  3J27 B;  4FWH A;  5DNY A;  1Z5C A;  3GLH A;  2G5G X;  1Q3B A;  3M0E A;  2Z3X A;  3C58 A;  1IY2 A;  3SBJ A;  4JI4 M;  5KQD A;  1DGH B;  4R7G A;  3T1Y M;  4NSO B;  2R45 A;  1IM2 A;  2W82 A;  4KLN A;  4KO8 A;  5IWA M;  4AI6 A;  3HU3 A;  4MGY E;  1GL7 A;  1K3W A;  4DV3 M;  2JA2 A;  4B7F A;  4LF4 M;  1MU5 A;  5FTK A;  2LXE A;  3LMM A;  4IBB A;  4JI1 M;  5EP3 A;  1NHW C;  4B3S M;  5F3W A;  5JI3 E;  4GRI A;  5ITY A;  4JI6 M;  4OW0 A;  1D2N A;  5ITT A;  3VLF B;  4BLC A;  4NRW A;  4LRT A;  1IN7 A;  3D8L A;  3TWK A;  3GQ5 A;  1TDZ A;  4S12 A;  4DV6 M;  4I8O A;  4GC5 A;  1NJG A;  4DV2 M;  4X64 M;  3K1J A;  3ZH9 B;  5EJC A;  3OTO M;  3U6D A;  2I7N A;  4DR1 M;  5C18 A;  1S3S A;  5EXT A;  2AHM A;  4IBG A;  2UXB M;  4I4L A;  1N78 A;  3HJ8 A;  3GLG A;  1IN5 A;  4IBD A;  2QP9 X;  3U5Z B;  1NVM A;  3U5Z A;  1TGU A;  7CAT A;  3GLG B;  3HKP A;  1WXQ A;  2QBY B;  1QVR A;  4B3T M;  1L2C A;  3L26 A;  3TQS A;  1HNZ M;  4XBO A;  4X62 M;  1W5T A;  1OFI A;  1IXS B;  4YY3 M;  2Y0Q A;  4RF0 A;  1PM5 A;  3KXE C;  3PFI A;  1N32 M;  1TH3 A;  3I51 A;  3SC3 A;  4PCZ A;  1N75 A;  2C99 A;  4LJA A;  3W0F A;  2YNM D;  4R3D A;  2EUC A;  3AFH A;  3U6O A;  3AL0 C;  5E26 A;  3FYC A;  3MK6 A;  1FNN A;  4RNA A;  3CF0 A;  4LF5 M;  4G4R A;  2L7I A;  1R2Z A;  3GQ3 A;  2DZN B;  3TL4 X;  1HT1 E;  1IY1 A;  3SAR A;  3J2P B;  4LFA M;  4BB9 A;  3GRU A;  3U6L A;  1IXR C;  5IT9 S;  4YHH M;  3FUX A;  2XFS A;  2O5R A;  3SMS A;  3LVV A;  2QZ4 A;  3U6C A;  4HL4 A;  3VFD A;  1XNQ M;  5EXP A;  1PJI A;  1HR0 M;  4GIP A;  4DR4 M;  3KDS E;  1SXJ B;  4FWG A;  4LJ5 A;  1DGH A;  1IBK M;  4LFB M;  3GO8 A;  2HCB A;  4FVM A;  4WUR A;  3W0L B;  4JI5 M;  1ZQ9 A;  1HT2 E;  3AOG A;  1XMO M;  1KYI A;  4Z6Y A;  3MHV C;  1XC8 A;  1XNR M;  5FLX S;  2UXD M;  4JI0 M;  2DWM A;  3FTE A;  4OX9 M;  1HNX M;  3H4M A;  1IBM M;  5KPZ A;  2DZO B;  4TUW A;  2XF3 A;  1HQY E;  2H1R A;  4LJ7 A;  5KPT A;  3A98 B;  2DWL A;  1QAO A;  2XZU A;  3T38 A;  4DUZ M;  2C9C A;  2UXC M;  4AQY M;  4LF6 M;  2VQE M;  3K8Z A;  4XGI A;  5EQT A;  1YUB A;  4B7H A;  4OVZ B;  2ZBK B;  2CEA A;  4B08 A;  2DVW B;  1EE8 A;  3AV0 A;  3NWL A;  1DGF A;  1XMQ M;  5GKN A;  2RGO A;  4GHL A;  1DO0 A;  3EIH A;  5H37 D;  3VDU A;  2BNK A;  2FFJ A;  4GKK M;  4KOD A;  2CV1 A;  3E4R A;  4MGK E;  1E9S A;  2VII A;  2L6O A;  2YQZ A;  1NY6 A;  3VDP A;  2XEP A;  2XZF A;  2E5L M;  2Z7J A;  2Z4S A;  3U6S A;  1FJG M;  1IN6 A;  3GRY A;  3KVW A;  4PDG A;  4M9X A;  2V6Z M;  2FE8 A;  4DV7 M;  1J09 A;  1Z5A A;  4AKG A;  5LMN M;  1LV7 A;  1TH2 A;  2ZM6 M;  4QNR A;  1GL6 A;  2CHV A;  4FCT A;  5LMU M;  2L09 A;  4W5W A;  4DR7 M;  3IG5 A;  4CIS A;  3CF2 A;  4FWD A;  4L16 A;  4GHA A;  2OPF A;  3SAS A;  2C5R A;  5ITR A;  2UUA M;  2R65 A;  3LQR A;  3SYK A;  2OQ4 A;  4DR3 M;  2XSZ D;  1K3X A;  4II7 A;  4LJ9 A;  1NHG C;  3GLF A;  1TDH A;  3TPZ A;  1SXJ A;  1QAN A;  3FTC A;  4GMQ A;  5KPR A;  4LCB A;  1IQP A;  1JR3 A;  2F5S A;  3AJI B;  2UU9 M;  5IZ7 D;  3SFZ A;  4FCV A;  3U60 B;  3ILK A;  4BBA A;  1NNJ A;  2HL7 A;  1L2D A;  2F5Q A;  1DO2 A;  4D81 A;  2KW0 A;  1IBL M;  5EP4 A;  3HHY A;  3GRR A;  4B3R M;  4I81 A;  2A5Y B;  3GLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...