4B3TM

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4b3tM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4b3tM02
2OPFA 4NXMM 3VK8A 4G4RA 1MX0A 4LFBM 4JI2M 1Z59A 5BR8M 4B3SM 4JI6M 3JR5A 4LF5M 3SATA 1MU5A 1FJGM 4PCZA 4DR2M 3JR4A 1HR0M 3U6EA 5LMUM 4PD2A 5IWAM 5FLXS 2UUAM 3A45A 1K82A 3GPUA 4X62M 3GPPA 4DR3M 3U6QA 3SAUA 4DV7M 4NXNM 3TWKA 4LF7M 5ITUA 4DUYM 1EE8A 3U6SA 4K0KM 1L2DA 1XNRM 3VK7A 1PJIA 4NRWA 3TWMA 1PM5A 4JI5M 3GPXA 4B3RM 4DR4M 1L2CA 1HNXM 3U6LA 1IBKM 4DR1M 1J5EM 4G4OA 4JI0M 2UUBM 4DR7M 2EA0A 4DV5M 3SBJA 3U6MA 2UU9M 3GQ3A 1Z5BA 3GPYA 1L1ZA 4JI4M 4LF9M 4PDGA 2UXBM 3U6CA 5ITYA 3A46A 4DUZM 3T1YM 1I94M 2OQ4A 3SASA 2UXDM 1Z5CA 1L1TA 4YY3M 1R2ZA 5ITRA 2UUCM 1K3XA 4LF6M 2XZUA 5ITQA 2E5LM 1HNZM 1N33M 4LFAM 3A42A 4DV3M 3SARA 5ITTA 4DV4M 1NNJA 4DV0M 4GKJM 4JV5M 3OTOM 3J80S 1PJJA 3J7AS 3W0FA 4G4QA 4LFCM 1Q39A 2ZM6M 4YHHM 2F5QA 2UXCM 2XZFA 1IBLM 3U6OA 4JI7M 4B3TM 5IT9S 2Q2EB 1N32M 3T1HM 2VQFM 3GP1A 4JI8M 2F5SA 4X64M 4DV6M 4OX9M 1TDHA 1N36M 4DV1M 1K3WA 4JI3M 1IBMM 4G4NA 1HNWM 5A2QS 4AQYM 4ITQA 4DR6M 1XMOM 1XMQM 4GKKM 4X65M 4JI1M 4DR5M 5ITXE 5LMNM 2F5PA 4X66M 1Q3CA 2ZBKB 2F5OA 5ITXA 3TWLA 3DOAA 4JYAM 4DV2M 1Z5AA 3U6DA 2HHHM 1L2BA 4B3MM 2HKJA 3GO8A 4KHPM 4LF8M 4PDIA 1R2YA 4NRVA 1KFVA 2F4VM 3SAWA 1XNQM 4MB7A 1TDZA 2F5NA 3JAMS 1Q3BA 4LF4M 4CISA 1XC8A 3SAVA 3GQ5A 3C58A 3GQ4A 3U6PA 1N34M 2VQEM 3J81S
chains in the Genus database with same CATH superfamily
3VK8A 4G4RA 2WSCF 4LFBM 1W5SA 4JXJA 3EIHA 5KO3A 1Z59A 2DWZB 5BR8M 4B3SM 4JI6M 2X49A 4LGMA 2DAIA 1QYRA 5C1BA 4I4LA 2Z7JA 3AL0C 4A3VB 1IXRC 1TH3A 2CV1A 3M7GA 3IHPA 1IN8A 1VQ1A 2CP8A 3DFZA 5IWAM 4AKGA 5H37D 1VDLA 2CHGA 4CGYB 1AIPC 1WXQA 1K82A 4NOOB 4OVZB 2NQ8C 1IY0A 4ITQA 3T38A 1NO1A 1OTRA 2FS1A 1TH4A 1EE8A 4FCWA 3U6SA 4L8RC 1GLNA 2QPAA 3UZUA 1L2DA 1IY1A 2JY8A 2R65A 1ZMUA 4L4UA 2RKOA 4NRWA 3CGWA 2C5RA 2GNOA 4LZJA 1EIJA 3GLGA 3SMPA 4JI5M 4LRSA 4B7GA 1VEGA 3WHLA 4B3RM 1NV9A 2JZ1A 3AOEC 3VLFB 4I5SA 2XSZD 4AW4A 8CATA 3THGA 2LBCA 2RGOA 3HJ8A 4JI0M 2XGNA 4GH9A 2J7OA 3HY5A 2UU9M 4JI4M 2MH8A 2R62A 1QAMA 5KPTA 2HL7A 2JXNA 4LJ7A 3U6CA 1RU3A 2LXEA 3LW5F 4L15A 5EXXA 1IM2A 1Z5CA 2HAKA 3I04M 4QHTA 1C7YA 1HQCA 3LCUA 2JP7A 1HJPA 3K9OA 1K3XA 2Y0TA 2E5LM 2FFJA 2QENA 1V92A 4LJ9A 5EP2A 5KQDA 1HNZM 4LFAM 1N33M 2CE7A 2XF3A 2CHQA 1DGHA 1TF0B 2OO9A 2HWJA 3GLHB 3KP1E 4DV0M 4GKJM 2BJWA 1R5LA 3R8FA 4IBCA 3KOWE 3FTEA 1ZMWA 3E9SA 3WHKA 4S12A 1G3IA 3FUWA 2VF8A 5EXTA 4EIWA 1XXHA 2AHMA 1GL7A 1EFUB 1OIZA 1UFZA 3L27A 4OW0A 1BVSA 1FNNA 4LY6A 5IT9S 3UK6A 5DNYA 3VKHA 4CIZA 5KPZA 3IG5A 4JN6A 4DV6M 2Y20A 4OX9M 1TDHA 1X37A 4MGHA 3KVWA 4MGIE 3FYCA 1JR3A 3KSJA 1YSYA 1J7KA 1IBMM 3L25A 1HNWM 2H5XA 3KDSE 4M9ZA 3HWSA 4NSOB 4NL4H 2XH9A 2R18A 4DR5M 1IFYA 5ITXE 5LMNM 4QNMA 4IJEA 1D0LA 2DAKA 5FTJA 1QVRA 3VDUA 4FVMA 1NY5A 2F5OA 4KT0F 1AUAA 2ZAMA 4ZPXA 2DXIA 2Y21A 2M5ZA 1SXJD 1R2YA 1KFVA 3SAWA 1XNQM 3VFDA 1V34A 3HHWA 2C99A 2L2DA 4LJ5A 3CF6E 1WGNA 3JAMS 1Q3BA 2W82A 3C3EA 1TTEA 4LF4M 2KZUA 1V33A 1NV8A 3AJIB 3ZQJA 3U5ZB 3H4MA 4KODA 1G41A 4IBKA 1N34M 4GC5A 1Q02A 1QDTA 4IBFA 2VQEM 4Y28F 5DYGA 3UJNA 4REZA 2OPFA 4DR6M 2JUJA 1MX0A 2OOBA 1TGUA 5DYIA 3KSXA 3LQQA 4LF5M 4MGZE 2MGWA 1J09A 3NBXX 5EXSA 1DGGA 2Z3XA 1G8PA 4P16A 3AOEA 3JR4A 2EKKA 4L16A 3W0LB 4D82A 2MR9A 3I4YA 4IIWA 3QAUA 4PD2A 5LMUM 2UUAM 3BOSA 1IXSA 2L6OA 2K47A 2LHCA 3GRYA 5EJCA 4NXNM 2VDBB 2H1RA 4DV7M 4LF7M 3FUUA 3U60A 3MK6A 4K0KM 4MGYE 1XNRM 3VK7A 1PJIA 3PNYA 1PJTA 1GJTA 3GLFE 3TWMA 2JZ0A 2DWNA 3H4JA 3D8BA 3L29A 4B08A 1PM5A 5FTKA 5EP1A 4RF1A 5L8RF 1SXJE 4GIPA 4BB9A 1HNXM 2LWXA 2L4FA 3U6LA 1NJGA 1OFIA 4OVZA 4QHSA 2WSEF 3HHXA 2KZSA 4G4OA 2J5YA 2MROB 3KOXE 3I51A 2G8LA 4WURA 2DHYA 2ZANA 4CHTB 3GQ3A 5C18A 3U6MA 4GHLA 5BPVA 3K92A 3MHVC 1TR8A 1UM8A 4RKUF 1QAOA 4AZFA 1L1TA 1VEKA 4YY3M 3GLIE 3RGPA 4M0WA 2DKLA 3AOGA 3TE6A 5F3WA 4HEOA 2KA6B 3SYKA 1DV0A 3L28A 3A42A 4DV3M 1YUBA 1ZQ9A 1OFHA 3ZC7B 1CUKA 3HJQA 3PVSA 3OTOM 1QDRA 3J80S 3DZDA 1PJJA 3ILKA 3W0FA 4LFCM 1GABA 3AFHA 2MJ5B 2DAEA 2F5QA 2UXCM 3FUVA 1IXZA 2XZFA 3A98B 4FWDA 4LG2A 2LHGA 2YQZA 1N77A 1N75A 2QBYB 4JI7M 1ZV1A 4IBBA 1N32M 4LJAA 3T1HM 2F5SA 4IJFA 4X64M 3W68A 3J2PB 1N36M 3LVWA 1PGYA 2O01F 4MH0E 4F1IA 2JY6B 4BBAA 3GLHA 1H6UA 2JWSA 2DZLA 1WHCA 4GC9A 1OIPA 1WIVA 1PJQA 3J27B 1NVMA 1GJSA 4AI6A 3TL4X 1Q3CA 1TH2A 5FTMA 3SHFA 1SG9A 3DOAA 1HT1E 2EO2A 4DV2M 1MN3A 3U6DA 2L7HA 3E46A 1QZMA 3NBIA 3SHGB 3PNVA 2F4VM 4II7A 3R9XB 3FTDA 5EQTA 1TDZA 4WW0A 1P3QQ 2YNMD 2F5NA 2K6BA 4CISA 1PJSA 1A5TA 3FUTA 1WGLA 4GRIA 3C58A 4RNAA 2L7IA 2QZ4A 1QQWA 3HGIA 3U6PA 4DBGB 5JI3E 2KDLA 3J81S 2DWLA 2V1CA 4LJ4A 3EIEA 3LCVB 3FUXA 3W67A 3HZJA 2I7NA 3SATA 2D7EA 3UMMA 4F2LA 3GLFB 1Y8GA 3FD9A 1L8QA 1LV7A 1PRBA 2DNAA 3K2LA 3M6AA 3HHYA 3VDPA 4ANRA 2RGHA 3U6EA 3E21A 3FTFA 2M60A 5FLXS 2DAGA 1JB0F 1E94E 1SXJB 1QUSA 2GQFA 2V6ZM 3U5ZA 2APLA 2DENA 4IBJA 4M0DA 5EXPA 2N35A 2YR0A 3FRHA 3UGJA 4X62M 3SAUA 3RFWA 4QOZC 3TWKA 3LQRA 5ITUA 4DUYM 3K9PA 2I7PA 2P5TA 2D7GA 2XFSA 4AKHA 1GO5A 2DVWB 5E26A 1T6OA 3GLGE 4M9SA 2K0BX 2O5RA 2DI0A 4FW9A 2G3QA 3GRUA 5KQ8A 3FRIA 3B7ZA 1JR3D 2C98A 4FCTA 3GPXA 3GLIB 4AKIA 2R6FA 2O25A 1IBKM 1S3SA 1F4IA 2FH0A 1OAIA 3K8ZA 4I81A 2UUBM 1R4GA 4DR7M 4DV5M 3KW6A 5GKNA 1YLAA 1Z5BA 1HT2E 2FE8A 2R44A 1OJLA 1IN7A 3I01M 4NSRA 2DZNB 3K1JA 2OOAA 4WP2A 2OQ4A 4DUZM 1W5TA 3T1YM 1I94M 2UXDM 1R2ZA 2D7HA 3F92A 3FKEA 2C9CA 4LF6M 2XZUA 3MMPA 2DWMA 3B89A 3KXEC 1IY2A 3HJSA 3NWLA 4MGKE 3AKZA 3SARA 2CWBA 5FSWA 4OU7A 4DV4M 1QANA 4AG5A 1NNJA 4JV5M 1SXJC 2QNJA 2JY5A 1E9SA 1C1KA 2XFTA 3U61B 1XXHE 2XLJA 2ZM6M 4YHHM 2LNHC 1IN6A 1IBLM 1IN5A 4HLQA 2FNAA 4XBOA 3FYDA 2QSFX 1D0KA 2VQFM 5E6JA 1QAQA 4JI8M 2B3TA 3CTWB 1G4AE 1JR3E 1WR1B 3QYEA 3T6PA 1D0MA 1G71A 3C9PA 4DV1M 1K3WA 3Q8XA 2CEAA 5DFLA 2HCBA 3IECA 3PFIA 2ZAOA 3C3DA 4KO8A 1NHWC 2QCUA 5EP4A 4AQYM 1XMOM 1QZEA 2Y0QA 2WZJA 4Z8XA 4X65M 4JI1M 2LTUA 2C9OA 2DZOB 2XSZA 3QWLA 3KOZE 2F5PA 4M9XA 3KP0E 1I4WA 2ZBKB 3AV0A 1VEJA 5ITXA 3TWLA 3KOYE 3B9PA 3I4VA 2QBYA 4R3DA 2KNZA 1Z5AA 2QQ8A 2V1UA 2CV2A 4B3MM 4JYAM 2HKJA 2X8AA 3TQSA 2LVOC 3SFZA 4L78A 1LTMA 3ZH9B 2C96A 4MB7A 4Z6YA 4AG6A 2BJVA 2RRUA 4QOSA 3Q8GA 4GITA 1XC8A 2BWEA 2JNHA 2WSFF 2JA2A 4P17A 2BWBA 3PXGA 4TUWA 3HX3A 1IN4A 4L6V6 2Z4RA 3SMSA 4NXMM 3GRRA 2DAMA 2G5GX 2L09A 1XB2B 2LVAA 4JI2M 1NY6A 1KSFX 4UN2B 2A5YB 2KHHA 3JR5A 2R46A 7CATA 1JQJC 1MU5A 2KRUA 1ORYB 1FJGM 4PCZA 1NHGC 3GLGB 4BLCA 4DR2M 4PT5A 1GVNA 1HR0M 1DGFA 3L26A 2EJSA 1VDDA 3QYBA 3A45A 3FTCA 3B7QA 3D8LA 1DO2A 3GPUA 1T43A 4LZZA 2R45A 1DO0A 4CJ6A 4LGYA 3GPPA 4DR3M 3U6QA 5IZ7D 1N78A 1GKIA 2DHRA 1KYIA 4GHAA 3KS8A 1YE9A 3M0EA 2FOIC 1Z6TA 2QP9X 3DA1A 1ZAEA 3HHZA 1G59A 2R4JA 4MM3B 4D80A 3GLFA 2KNAA 1E32A 4B7FA 4DR4M 1VG5A 4W5WA 1L2CA 2EKFA 3HKPA 3IG8A 3BXWA 1OKSA 1SXJA 1R7RA 4DR1M 3B7NA 1DGHB 1J5EM 4B7HA 2KW0A 3CF2A 2LVQD 1XWIA 5EP3A 2EA0A 2VF7A 1OAOC 3SBJA 2ZTCA 4LF9M 3GPYA 1L1ZA 2Z8YM 4PDGA 4NC6A 2UXBM 3LMMA 3L2AA 5ITYA 3A46A 1XXHB 3HU1A 4LJ6A 3SASA 3BBZA 2LH0A 1D2NA 4IBGA 2VIIA 4D81A 1R6BX 3E4RA 3RE8A 5ITRA 2UUCM 1XHBA 2J7NA 2XEPA 4XK8F 5ITQA 2CV0A 4R71A 1NSFA 2CHVA 3GLIA 1DGBA 2CFOA 4IBIA 3SC3A 2KRKA 4LJ8A 2L4EA 5ITTA 5KPRA 4HL4A 4RF0A 3J7AS 1NNUC 4GEWA 4G4QA 3HU2A 4G6ZA 3MJ5A 1Q39A 2X4AA 3GRVA 2KXEA 3KFUG 3U6OA 3T15A 4IBDA 3B74A 3V76A 4B3TM 2KEBA 1OQYA 2Q2EB 3TPZA 2CUZA 3FE3A 2KNVA 4GMQA 4I8OA 4XGIA 3SYLA 4LRTA 3GP1A 4FWHA 3CF0A 1E9RA 4FD2A 4IBEA 1NJFA 2QHOB 1ZMVA 3J7BA 4FWGA 3GLHE 2BNKA 2Z4SA 3KS4A 4JI3M 4Q7JA 2K9DA 3LVVA 4G4NA 5A2QS 2R0IA 2YFQA 1IQPA 1XMQM 5IREB 3U61A 2ZTDA 4GKKM 1T3TA 1HQYE 5FTNA 4QNRA 1WJ7A 4X66M 5JI2E 2HHHM 1L2BA 2LVNC 4LCBA 5FTLA 3GO8A 2R4EA 4LF8M 4KHPM 4PDIA 3ZCBB 4NRVA 1GL6A 1MJGM 3RGSA 4KLNA 3VKGA 2EUCA 3HU3A 4R7GA 2ERCA 2JY7A 4FCVA 2CRUA 1IXSB 3SAVA 3GQ5A 4G3OA 2LVPC 3GQ4A 3U60B 1QUTA
chains in the Genus database with same CATH topology
3VK8A 4G4RA 4LFBM 1W5SA 4JXJA 3EIHA 5KO3A 1Z59A 2DWZB 5BR8M 4B3SM 4JI6M 2X49A 4LGMA 1QYRA 5C1BA 4I4LA 2Z7JA 3AL0C 4A3VB 1IXRC 1TH3A 2CV1A 3M7GA 1IN8A 4AKGA 3DFZA 5IWAM 5H37D 4CGYB 2CHGA 1WXQA 1K82A 4NOOB 4OVZB 2NQ8C 1IY0A 3T38A 1TH4A 1EE8A 4FCWA 3U6SA 4L8RC 1GLNA 2QPAA 3UZUA 1L2DA 1IY1A 2R65A 4L4UA 2RKOA 4NRWA 2C5RA 4LZJA 3GLGA 3SMPA 4JI5M 4LRSA 4B7GA 3WHLA 4B3RM 3AOEC 3VLFB 4I5SA 2XSZD 4AW4A 8CATA 3THGA 4JI0M 2RGOA 3HJ8A 2XGNA 4GH9A 2J7OA 2UU9M 4JI4M 2R62A 1QAMA 5KPTA 2HL7A 3U6CA 4LJ7A 2LXEA 4L15A 5EXXA 1IM2A 1Z5CA 4QHTA 1HQCA 1K3XA 2Y0TA 2E5LM 2FFJA 2QENA 4LJ9A 5EP2A 5KQDA 1HNZM 1N33M 4LFAM 2CE7A 2XF3A 2CHQA 1DGHA 3GLHB 4DV0M 4GKJM 3KP1E 2BJWA 3R8FA 4IBCA 3KOWE 3FTEA 3E9SA 3WHKA 4S12A 1G3IA 3FUWA 5EXTA 4EIWA 1XXHA 2AHMA 1GL7A 3L27A 4OW0A 1FNNA 5IT9S 4LY6A 3UK6A 5DNYA 3VKHA 5KPZA 3IG5A 4JN6A 4DV6M 2Y20A 4OX9M 1TDHA 1X37A 4MGHA 3KVWA 4MGIE 3FYCA 1JR3A 3KSJA 1YSYA 1J7KA 1IBMM 3L25A 1HNWM 3KDSE 4M9ZA 3HWSA 4NSOB 4NL4H 2XH9A 2R18A 4DR5M 5ITXE 5LMNM 4QNMA 4IJEA 2F5OA 5FTJA 1QVRA 3VDUA 4FVMA 1NY5A 2ZAMA 4ZPXA 2Y21A 2M5ZA 1SXJD 1R2YA 1KFVA 3SAWA 1XNQM 3VFDA 3HHWA 2C99A 4LJ5A 3CF6E 3JAMS 1Q3BA 2W82A 4LF4M 2KZUA 3AJIB 3U5ZB 3H4MA 4KODA 1G41A 4IBKA 1N34M 4GC5A 2DXIA 2VQEM 4IBFA 2OPFA 5DYGA 3UJNA 4REZA 1MX0A 1TGUA 5DYIA 3KSXA 3LQQA 4LF5M 4MGZE 1J09A 5EXSA 1DGGA 2Z3XA 1G8PA 4P16A 3AOEA 3JR4A 4L16A 3W0LB 4D82A 4IIWA 3I4YA 4PD2A 3QAUA 5LMUM 2UUAM 3BOSA 2L6OA 2K47A 3GRYA 5EJCA 4NXNM 4DV7M 2H1RA 4LF7M 3FUUA 3U60A 3MK6A 4K0KM 4MGYE 1XNRM 3VK7A 1PJIA 3PNYA 3TWMA 2DWNA 3D8BA 3L29A 4B08A 1PM5A 5FTKA 5EP1A 4RF1A 1SXJE 4GIPA 4BB9A 1HNXM 2LWXA 3U6LA 1NJGA 1OFIA 4OVZA 4QHSA 3HHXA 2KZSA 4G4OA 3KOXE 3I51A 2G8LA 4WURA 2ZANA 4CHTB 3GQ3A 3U6MA 5C18A 4GHLA 5BPVA 3K92A 3MHVC 1UM8A 1QAOA 4AZFA 1L1TA 4YY3M 3RGPA 4M0WA 3AOGA 5F3WA 3TE6A 2KA6B 3SYKA 3L28A 3A42A 4DV3M 1YUBA 1ZQ9A 1OFHA 3ZC7B 3HJQA 3PVSA 3OTOM 3J80S 3DZDA 1PJJA 3ILKA 3W0FA 4LFCM 3AFHA 2F5QA 2UXCM 3FUVA 1IXZA 2XZFA 3A98B 4FWDA 4LG2A 2YQZA 1N77A 1N75A 2QBYB 4JI7M 4IBBA 1N32M 4LJAA 3T1HM 2F5SA 4IJFA 4X64M 3J2PB 1N36M 3LVWA 4MH0E 4BBAA 3GLHA 1H6UA 4GC9A 3J27B 1NVMA 4AI6A 3TL4X 1Q3CA 1TH2A 5FTMA 3SHFA 3DOAA 1HT1E 2EO2A 4DV2M 3U6DA 2L7HA 1QZMA 3NBIA 3SHGB 3PNVA 2F4VM 4II7A 3R9XB 3FTDA 5EQTA 1TDZA 4WW0A 2YNMD 2F5NA 4CISA 3FUTA 4GRIA 3C58A 4RNAA 2L7IA 3HGIA 2QZ4A 1QQWA 3U6PA 5JI3E 3J81S 2DWLA 2V1CA 4LJ4A 3EIEA 3FUXA 2I7NA 3SATA 2D7EA 3UMMA 3GLFB 3FD9A 1L8QA 1LV7A 3K2LA 3M6AA 3VDPA 3HHYA 2RGHA 3U6EA 3FTFA 2M60A 5FLXS 1E94E 1SXJB 2V6ZM 3U5ZA 4IBJA 4M0DA 5EXPA 3UGJA 2YR0A 4X62M 3SAUA 4QOZC 3RFWA 3TWKA 3LQRA 5ITUA 4DUYM 2I7PA 2P5TA 2D7GA 2XFSA 4AKHA 2DVWB 5E26A 4M9SA 5KQ8A 2O5RA 4FW9A 3GRUA 1JR3D 2C98A 4FCTA 3GPXA 3GLIB 4AKIA 1IBKM 1S3SA 3K8ZA 4I81A 2UUBM 4DR7M 4DV5M 3KW6A 5GKNA 1Z5BA 2FE8A 1HT2E 1OJLA 1IN7A 4NSRA 2DZNB 3K1JA 4DUZM 3T1YM 2OQ4A 1I94M 1W5TA 2UXDM 1R2ZA 2D7HA 3FKEA 2C9CA 4LF6M 2XZUA 2DWMA 3KXEC 1IY2A 3HJSA 3NWLA 4MGKE 3AKZA 3SARA 5FSWA 4OU7A 4DV4M 1QANA 4AG5A 1NNJA 4JV5M 1SXJC 2XFTA 1E9SA 1C1KA 3U61B 2XLJA 2ZM6M 4YHHM 2LNHC 1IN6A 1IBLM 1IN5A 4HLQA 2FNAA 4XBOA 3FYDA 2VQFM 5E6JA 1QAQA 4JI8M 3CTWB 1G4AE 4DV1M 1K3WA 3Q8XA 2CEAA 2HCBA 3PFIA 4KO8A 2ZAOA 4AQYM 4ITQA 1NHWC 2QCUA 5EP4A 4DR6M 1XMOM 2Y0QA 4Z8XA 4X65M 4JI1M 3QWLA 2C9OA 2DZOB 2XSZA 2F5PA 3KOZE 4M9XA 3KP0E 1I4WA 2ZBKB 3AV0A 5ITXA 3TWLA 3KOYE 3B9PA 3I4VA 2QBYA 4R3DA 4JYAM 1Z5AA 4B3MM 2V1UA 2CV2A 2HKJA 2X8AA 3TQSA 3SFZA 4L78A 3ZH9B 2C96A 4MB7A 4Z6YA 4AG6A 2BJVA 4QOSA 4GITA 1XC8A 2JA2A 3PXGA 4TUWA 1IN4A 2Z4RA 3SMSA 4NXMM 3GRRA 2L09A 2G5GX 4JI2M 1NY6A 1KSFX 2A5YB 3JR5A 2R46A 7CATA 1JQJC 1MU5A 2KRUA 1ORYB 1FJGM 4PCZA 1NHGC 3GLGB 4BLCA 4DR2M 4PT5A 1GVNA 1HR0M 1DGFA 3L26A 1VDDA 3A45A 3FTCA 3D8LA 1DO2A 3GPUA 4LZZA 2R45A 1DO0A 3GPPA 4LGYA 4DR3M 3U6QA 5IZ7D 1N78A 1GKIA 2DHRA 1KYIA 4GHAA 3KS8A 1YE9A 3M0EA 2FOIC 1Z6TA 2QP9X 3DA1A 1ZAEA 3HHZA 1G59A 2R4JA 4MM3B 4D80A 3GLFA 4B7FA 1E32A 4DR4M 4W5WA 1L2CA 3IG8A 3HKPA 1SXJA 1R7RA 4DR1M 1J5EM 1DGHB 4B7HA 2KW0A 3CF2A 1XWIA 5EP3A 2EA0A 3SBJA 4LF9M 3GPYA 1L1ZA 4PDGA 2UXBM 3LMMA 3L2AA 5ITYA 3A46A 1XXHB 3HU1A 4LJ6A 3SASA 2LH0A 1D2NA 4IBGA 2VIIA 4D81A 1R6BX 3E4RA 3RE8A 5ITRA 2UUCM 1XHBA 2J7NA 2XEPA 5ITQA 2CV0A 1NSFA 2CHVA 3GLIA 1DGBA 2CFOA 4IBIA 3SC3A 2KRKA 4LJ8A 5ITTA 5KPRA 4HL4A 4RF0A 3J7AS 1NNUC 4G4QA 3HU2A 4G6ZA 3MJ5A 1Q39A 2X4AA 3GRVA 2KXEA 3KFUG 3U6OA 3T15A 4IBDA 4B3TM 2KEBA 2Q2EB 3TPZA 2CUZA 4GMQA 4XGIA 4I8OA 3SYLA 4LRTA 3GP1A 4FWHA 3CF0A 1E9RA 4FD2A 4IBEA 1NJFA 3J7BA 4FWGA 2BNKA 2Z4SA 3KS4A 4JI3M 3LVVA 4G4NA 5A2QS 2YFQA 1IQPA 1XMQM 5IREB 3U61A 4GKKM 1T3TA 1HQYE 5FTNA 4QNRA 4X66M 5JI2E 2HHHM 1L2BA 4LCBA 5FTLA 3GO8A 2R4EA 4LF8M 4KHPM 4PDIA 3ZCBB 4NRVA 1GL6A 3RGSA 3VKGA 4KLNA 2EUCA 3HU3A 4R7GA 2ERCA 4FCVA 1IXSB 3SAVA 3GQ5A 3GQ4A 3U60B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPF A;  4NXM M;  3VK8 A;  4G4R A;  1MX0 A;  4LFB M;  4JI2 M;  1Z59 A;  5BR8 M;  4B3S M;  4JI6 M;  3JR5 A;  4LF5 M;  3SAT A;  1MU5 A;  1FJG M;  4PCZ A;  4DR2 M;  3JR4 A;  1HR0 M;  3U6E A;  5LMU M;  4PD2 A;  5IWA M;  5FLX S;  2UUA M;  3A45 A;  1K82 A;  3GPU A;  4X62 M;  3GPP A;  4DR3 M;  3U6Q A;  3SAU A;  4DV7 M;  4NXN M;  3TWK A;  4LF7 M;  5ITU A;  4DUY M;  1EE8 A;  3U6S A;  4K0K M;  1L2D A;  1XNR M;  3VK7 A;  1PJI A;  4NRW A;  3TWM A;  1PM5 A;  4JI5 M;  3GPX A;  4B3R M;  4DR4 M;  1L2C A;  1HNX M;  3U6L A;  1IBK M;  4DR1 M;  1J5E M;  4G4O A;  4JI0 M;  2UUB M;  4DR7 M;  2EA0 A;  4DV5 M;  3SBJ A;  3U6M A;  2UU9 M;  3GQ3 A;  1Z5B A;  3GPY A;  1L1Z A;  4JI4 M;  4LF9 M;  4PDG A;  2UXB M;  3U6C A;  5ITY A;  3A46 A;  4DUZ M;  3T1Y M;  1I94 M;  2OQ4 A;  3SAS A;  2UXD M;  1Z5C A;  1L1T A;  4YY3 M;  1R2Z A;  5ITR A;  2UUC M;  1K3X A;  4LF6 M;  2XZU A;  5ITQ A;  2E5L M;  1HNZ M;  1N33 M;  4LFA M;  3A42 A;  4DV3 M;  3SAR A;  5ITT A;  4DV4 M;  1NNJ A;  4DV0 M;  4GKJ M;  4JV5 M;  3OTO M;  3J80 S;  1PJJ A;  3J7A S;  3W0F A;  4G4Q A;  4LFC M;  1Q39 A;  2ZM6 M;  4YHH M;  2F5Q A;  2UXC M;  2XZF A;  1IBL M;  3U6O A;  4JI7 M;  4B3T M;  5IT9 S;  2Q2E B;  1N32 M;  3T1H M;  2VQF M;  3GP1 A;  4JI8 M;  2F5S A;  4X64 M;  4DV6 M;  4OX9 M;  1TDH A;  1N36 M;  4DV1 M;  1K3W A;  4JI3 M;  1IBM M;  4G4N A;  1HNW M;  5A2Q S;  4AQY M;  4ITQ A;  4DR6 M;  1XMO M;  1XMQ M;  4GKK M;  4X65 M;  4JI1 M;  4DR5 M;  5ITX E;  5LMN M;  2F5P A;  4X66 M;  1Q3C A;  2ZBK B;  2F5O A;  5ITX A;  3TWL A;  3DOA A;  4JYA M;  4DV2 M;  1Z5A A;  3U6D A;  2HHH M;  1L2B A;  4B3M M;  2HKJ A;  3GO8 A;  4KHP M;  4LF8 M;  4PDI A;  1R2Y A;  4NRV A;  1KFV A;  2F4V M;  3SAW A;  1XNQ M;  4MB7 A;  1TDZ A;  2F5N A;  3JAM S;  1Q3B A;  4LF4 M;  4CIS A;  1XC8 A;  3SAV A;  3GQ5 A;  3C58 A;  3GQ4 A;  3U6P A;  1N34 M;  2VQE M;  3J81 S; 
#chains in the Genus database with same CATH topology
 3VK8 A;  4G4R A;  2WSC F;  4LFB M;  1W5S A;  4JXJ A;  3EIH A;  5KO3 A;  1Z59 A;  2DWZ B;  5BR8 M;  4B3S M;  4JI6 M;  2X49 A;  4LGM A;  2DAI A;  1QYR A;  5C1B A;  4I4L A;  2Z7J A;  3AL0 C;  4A3V B;  1IXR C;  1TH3 A;  2CV1 A;  3M7G A;  3IHP A;  1IN8 A;  1VQ1 A;  2CP8 A;  3DFZ A;  5IWA M;  4AKG A;  5H37 D;  1VDL A;  2CHG A;  4CGY B;  1AIP C;  1WXQ A;  1K82 A;  4NOO B;  4OVZ B;  2NQ8 C;  1IY0 A;  4ITQ A;  3T38 A;  1NO1 A;  1OTR A;  2FS1 A;  1TH4 A;  1EE8 A;  4FCW A;  3U6S A;  4L8R C;  1GLN A;  2QPA A;  3UZU A;  1L2D A;  1IY1 A;  2JY8 A;  2R65 A;  1ZMU A;  4L4U A;  2RKO A;  4NRW A;  3CGW A;  2C5R A;  2GNO A;  4LZJ A;  1EIJ A;  3GLG A;  3SMP A;  4JI5 M;  4LRS A;  4B7G A;  1VEG A;  3WHL A;  4B3R M;  1NV9 A;  2JZ1 A;  3AOE C;  3VLF B;  4I5S A;  2XSZ D;  4AW4 A;  8CAT A;  3THG A;  2LBC A;  2RGO A;  3HJ8 A;  4JI0 M;  2XGN A;  4GH9 A;  2J7O A;  3HY5 A;  2UU9 M;  4JI4 M;  2MH8 A;  2R62 A;  1QAM A;  5KPT A;  2HL7 A;  2JXN A;  4LJ7 A;  3U6C A;  1RU3 A;  2LXE A;  3LW5 F;  4L15 A;  5EXX A;  1IM2 A;  1Z5C A;  2HAK A;  3I04 M;  4QHT A;  1C7Y A;  1HQC A;  3LCU A;  2JP7 A;  1HJP A;  3K9O A;  1K3X A;  2Y0T A;  2E5L M;  2FFJ A;  2QEN A;  1V92 A;  4LJ9 A;  5EP2 A;  5KQD A;  1HNZ M;  4LFA M;  1N33 M;  2CE7 A;  2XF3 A;  2CHQ A;  1DGH A;  1TF0 B;  2OO9 A;  2HWJ A;  3GLH B;  3KP1 E;  4DV0 M;  4GKJ M;  2BJW A;  1R5L A;  3R8F A;  4IBC A;  3KOW E;  3FTE A;  1ZMW A;  3E9S A;  3WHK A;  4S12 A;  1G3I A;  3FUW A;  2VF8 A;  5EXT A;  4EIW A;  1XXH A;  2AHM A;  1GL7 A;  1EFU B;  1OIZ A;  1UFZ A;  3L27 A;  4OW0 A;  1BVS A;  1FNN A;  4LY6 A;  5IT9 S;  3UK6 A;  5DNY A;  3VKH A;  4CIZ A;  5KPZ A;  3IG5 A;  4JN6 A;  4DV6 M;  2Y20 A;  4OX9 M;  1TDH A;  1X37 A;  4MGH A;  3KVW A;  4MGI E;  3FYC A;  1JR3 A;  3KSJ A;  1YSY A;  1J7K A;  1IBM M;  3L25 A;  1HNW M;  2H5X A;  3KDS E;  4M9Z A;  3HWS A;  4NSO B;  4NL4 H;  2XH9 A;  2R18 A;  4DR5 M;  1IFY A;  5ITX E;  5LMN M;  4QNM A;  4IJE A;  1D0L A;  2DAK A;  5FTJ A;  1QVR A;  3VDU A;  4FVM A;  1NY5 A;  2F5O A;  4KT0 F;  1AUA A;  2ZAM A;  4ZPX A;  2DXI A;  2Y21 A;  2M5Z A;  1SXJ D;  1R2Y A;  1KFV A;  3SAW A;  1XNQ M;  3VFD A;  1V34 A;  3HHW A;  2C99 A;  2L2D A;  4LJ5 A;  3CF6 E;  1WGN A;  3JAM S;  1Q3B A;  2W82 A;  3C3E A;  1TTE A;  4LF4 M;  2KZU A;  1V33 A;  1NV8 A;  3AJI B;  3ZQJ A;  3U5Z B;  3H4M A;  4KOD A;  1G41 A;  4IBK A;  1N34 M;  4GC5 A;  1Q02 A;  1QDT A;  4IBF A;  2VQE M;  4Y28 F;  5DYG A;  3UJN A;  4REZ A;  2OPF A;  4DR6 M;  2JUJ A;  1MX0 A;  2OOB A;  1TGU A;  5DYI A;  3KSX A;  3LQQ A;  4LF5 M;  4MGZ E;  2MGW A;  1J09 A;  3NBX X;  5EXS A;  1DGG A;  2Z3X A;  1G8P A;  4P16 A;  3AOE A;  3JR4 A;  2EKK A;  4L16 A;  3W0L B;  4D82 A;  2MR9 A;  3I4Y A;  4IIW A;  3QAU A;  4PD2 A;  5LMU M;  2UUA M;  3BOS A;  1IXS A;  2L6O A;  2K47 A;  2LHC A;  3GRY A;  5EJC A;  4NXN M;  2VDB B;  2H1R A;  4DV7 M;  4LF7 M;  3FUU A;  3U60 A;  3MK6 A;  4K0K M;  4MGY E;  1XNR M;  3VK7 A;  1PJI A;  3PNY A;  1PJT A;  1GJT A;  3GLF E;  3TWM A;  2JZ0 A;  2DWN A;  3H4J A;  3D8B A;  3L29 A;  4B08 A;  1PM5 A;  5FTK A;  5EP1 A;  4RF1 A;  5L8R F;  1SXJ E;  4GIP A;  4BB9 A;  1HNX M;  2LWX A;  2L4F A;  3U6L A;  1NJG A;  1OFI A;  4OVZ A;  4QHS A;  2WSE F;  3HHX A;  2KZS A;  4G4O A;  2J5Y A;  2MRO B;  3KOX E;  3I51 A;  2G8L A;  4WUR A;  2DHY A;  2ZAN A;  4CHT B;  3GQ3 A;  5C18 A;  3U6M A;  4GHL A;  5BPV A;  3K92 A;  3MHV C;  1TR8 A;  1UM8 A;  4RKU F;  1QAO A;  4AZF A;  1L1T A;  1VEK A;  4YY3 M;  3GLI E;  3RGP A;  4M0W A;  2DKL A;  3AOG A;  3TE6 A;  5F3W A;  4HEO A;  2KA6 B;  3SYK A;  1DV0 A;  3L28 A;  3A42 A;  4DV3 M;  1YUB A;  1ZQ9 A;  1OFH A;  3ZC7 B;  1CUK A;  3HJQ A;  3PVS A;  3OTO M;  1QDR A;  3J80 S;  3DZD A;  1PJJ A;  3ILK A;  3W0F A;  4LFC M;  1GAB A;  3AFH A;  2MJ5 B;  2DAE A;  2F5Q A;  2UXC M;  3FUV A;  1IXZ A;  2XZF A;  3A98 B;  4FWD A;  4LG2 A;  2LHG A;  2YQZ A;  1N77 A;  1N75 A;  2QBY B;  4JI7 M;  1ZV1 A;  4IBB A;  1N32 M;  4LJA A;  3T1H M;  2F5S A;  4IJF A;  4X64 M;  3W68 A;  3J2P B;  1N36 M;  3LVW A;  1PGY A;  2O01 F;  4MH0 E;  4F1I A;  2JY6 B;  4BBA A;  3GLH A;  1H6U A;  2JWS A;  2DZL A;  1WHC A;  4GC9 A;  1OIP A;  1WIV A;  1PJQ A;  3J27 B;  1NVM A;  1GJS A;  4AI6 A;  3TL4 X;  1Q3C A;  1TH2 A;  5FTM A;  3SHF A;  1SG9 A;  3DOA A;  1HT1 E;  2EO2 A;  4DV2 M;  1MN3 A;  3U6D A;  2L7H A;  3E46 A;  1QZM A;  3NBI A;  3SHG B;  3PNV A;  2F4V M;  4II7 A;  3R9X B;  3FTD A;  5EQT A;  1TDZ A;  4WW0 A;  1P3Q Q;  2YNM D;  2F5N A;  2K6B A;  4CIS A;  1PJS A;  1A5T A;  3FUT A;  1WGL A;  4GRI A;  3C58 A;  4RNA A;  2L7I A;  2QZ4 A;  1QQW A;  3HGI A;  3U6P A;  4DBG B;  5JI3 E;  2KDL A;  3J81 S;  2DWL A;  2V1C A;  4LJ4 A;  3EIE A;  3LCV B;  3FUX A;  3W67 A;  3HZJ A;  2I7N A;  3SAT A;  2D7E A;  3UMM A;  4F2L A;  3GLF B;  1Y8G A;  3FD9 A;  1L8Q A;  1LV7 A;  1PRB A;  2DNA A;  3K2L A;  3M6A A;  3HHY A;  3VDP A;  4ANR A;  2RGH A;  3U6E A;  3E21 A;  3FTF A;  2M60 A;  5FLX S;  2DAG A;  1JB0 F;  1E94 E;  1SXJ B;  1QUS A;  2GQF A;  2V6Z M;  3U5Z A;  2APL A;  2DEN A;  4IBJ A;  4M0D A;  5EXP A;  2N35 A;  2YR0 A;  3FRH A;  3UGJ A;  4X62 M;  3SAU A;  3RFW A;  4QOZ C;  3TWK A;  3LQR A;  5ITU A;  4DUY M;  3K9P A;  2I7P A;  2P5T A;  2D7G A;  2XFS A;  4AKH A;  1GO5 A;  2DVW B;  5E26 A;  1T6O A;  3GLG E;  4M9S A;  2K0B X;  2O5R A;  2DI0 A;  4FW9 A;  2G3Q A;  3GRU A;  5KQ8 A;  3FRI A;  3B7Z A;  1JR3 D;  2C98 A;  4FCT A;  3GPX A;  3GLI B;  4AKI A;  2R6F A;  2O25 A;  1IBK M;  1S3S A;  1F4I A;  2FH0 A;  1OAI A;  3K8Z A;  4I81 A;  2UUB M;  1R4G A;  4DR7 M;  4DV5 M;  3KW6 A;  5GKN A;  1YLA A;  1Z5B A;  1HT2 E;  2FE8 A;  2R44 A;  1OJL A;  1IN7 A;  3I01 M;  4NSR A;  2DZN B;  3K1J A;  2OOA A;  4WP2 A;  2OQ4 A;  4DUZ M;  1W5T A;  3T1Y M;  1I94 M;  2UXD M;  1R2Z A;  2D7H A;  3F92 A;  3FKE A;  2C9C A;  4LF6 M;  2XZU A;  3MMP A;  2DWM A;  3B89 A;  3KXE C;  1IY2 A;  3HJS A;  3NWL A;  4MGK E;  3AKZ A;  3SAR A;  2CWB A;  5FSW A;  4OU7 A;  4DV4 M;  1QAN A;  4AG5 A;  1NNJ A;  4JV5 M;  1SXJ C;  2QNJ A;  2JY5 A;  1E9S A;  1C1K A;  2XFT A;  3U61 B;  1XXH E;  2XLJ A;  2ZM6 M;  4YHH M;  2LNH C;  1IN6 A;  1IBL M;  1IN5 A;  4HLQ A;  2FNA A;  4XBO A;  3FYD A;  2QSF X;  1D0K A;  2VQF M;  5E6J A;  1QAQ A;  4JI8 M;  2B3T A;  3CTW B;  1G4A E;  1JR3 E;  1WR1 B;  3QYE A;  3T6P A;  1D0M A;  1G71 A;  3C9P A;  4DV1 M;  1K3W A;  3Q8X A;  2CEA A;  5DFL A;  2HCB A;  3IEC A;  3PFI A;  2ZAO A;  3C3D A;  4KO8 A;  1NHW C;  2QCU A;  5EP4 A;  4AQY M;  1XMO M;  1QZE A;  2Y0Q A;  2WZJ A;  4Z8X A;  4X65 M;  4JI1 M;  2LTU A;  2C9O A;  2DZO B;  2XSZ A;  3QWL A;  3KOZ E;  2F5P A;  4M9X A;  3KP0 E;  1I4W A;  2ZBK B;  3AV0 A;  1VEJ A;  5ITX A;  3TWL A;  3KOY E;  3B9P A;  3I4V A;  2QBY A;  4R3D A;  2KNZ A;  1Z5A A;  2QQ8 A;  2V1U A;  2CV2 A;  4B3M M;  4JYA M;  2HKJ A;  2X8A A;  3TQS A;  2LVO C;  3SFZ A;  4L78 A;  1LTM A;  3ZH9 B;  2C96 A;  4MB7 A;  4Z6Y A;  4AG6 A;  2BJV A;  2RRU A;  4QOS A;  3Q8G A;  4GIT A;  1XC8 A;  2BWE A;  2JNH A;  2WSF F;  2JA2 A;  4P17 A;  2BWB A;  3PXG A;  4TUW A;  3HX3 A;  1IN4 A;  4L6V 6;  2Z4R A;  3SMS A;  4NXM M;  3GRR A;  2DAM A;  2G5G X;  2L09 A;  1XB2 B;  2LVA A;  4JI2 M;  1NY6 A;  1KSF X;  4UN2 B;  2A5Y B;  2KHH A;  3JR5 A;  2R46 A;  7CAT A;  1JQJ C;  1MU5 A;  2KRU A;  1ORY B;  1FJG M;  4PCZ A;  1NHG C;  3GLG B;  4BLC A;  4DR2 M;  4PT5 A;  1GVN A;  1HR0 M;  1DGF A;  3L26 A;  2EJS A;  1VDD A;  3QYB A;  3A45 A;  3FTC A;  3B7Q A;  3D8L A;  1DO2 A;  3GPU A;  1T43 A;  4LZZ A;  2R45 A;  1DO0 A;  4CJ6 A;  4LGY A;  3GPP A;  4DR3 M;  3U6Q A;  5IZ7 D;  1N78 A;  1GKI A;  2DHR A;  1KYI A;  4GHA A;  3KS8 A;  1YE9 A;  3M0E A;  2FOI C;  1Z6T A;  2QP9 X;  3DA1 A;  1ZAE A;  3HHZ A;  1G59 A;  2R4J A;  4MM3 B;  4D80 A;  3GLF A;  2KNA A;  1E32 A;  4B7F A;  4DR4 M;  1VG5 A;  4W5W A;  1L2C A;  2EKF A;  3HKP A;  3IG8 A;  3BXW A;  1OKS A;  1SXJ A;  1R7R A;  4DR1 M;  3B7N A;  1DGH B;  1J5E M;  4B7H A;  2KW0 A;  3CF2 A;  2LVQ D;  1XWI A;  5EP3 A;  2EA0 A;  2VF7 A;  1OAO C;  3SBJ A;  2ZTC A;  4LF9 M;  3GPY A;  1L1Z A;  2Z8Y M;  4PDG A;  4NC6 A;  2UXB M;  3LMM A;  3L2A A;  5ITY A;  3A46 A;  1XXH B;  3HU1 A;  4LJ6 A;  3SAS A;  3BBZ A;  2LH0 A;  1D2N A;  4IBG A;  2VII A;  4D81 A;  1R6B X;  3E4R A;  3RE8 A;  5ITR A;  2UUC M;  1XHB A;  2J7N A;  2XEP A;  4XK8 F;  5ITQ A;  2CV0 A;  4R71 A;  1NSF A;  2CHV A;  3GLI A;  1DGB A;  2CFO A;  4IBI A;  3SC3 A;  2KRK A;  4LJ8 A;  2L4E A;  5ITT A;  5KPR A;  4HL4 A;  4RF0 A;  3J7A S;  1NNU C;  4GEW A;  4G4Q A;  3HU2 A;  4G6Z A;  3MJ5 A;  1Q39 A;  2X4A A;  3GRV A;  2KXE A;  3KFU G;  3U6O A;  3T15 A;  4IBD A;  3B74 A;  3V76 A;  4B3T M;  2KEB A;  1OQY A;  2Q2E B;  3TPZ A;  2CUZ A;  3FE3 A;  2KNV A;  4GMQ A;  4I8O A;  4XGI A;  3SYL A;  4LRT A;  3GP1 A;  4FWH A;  3CF0 A;  1E9R A;  4FD2 A;  4IBE A;  1NJF A;  2QHO B;  1ZMV A;  3J7B A;  4FWG A;  3GLH E;  2BNK A;  2Z4S A;  3KS4 A;  4JI3 M;  4Q7J A;  2K9D A;  3LVV A;  4G4N A;  5A2Q S;  2R0I A;  2YFQ A;  1IQP A;  1XMQ M;  5IRE B;  3U61 A;  2ZTD A;  4GKK M;  1T3T A;  1HQY E;  5FTN A;  4QNR A;  1WJ7 A;  4X66 M;  5JI2 E;  2HHH M;  1L2B A;  2LVN C;  4LCB A;  5FTL A;  3GO8 A;  2R4E A;  4LF8 M;  4KHP M;  4PDI A;  3ZCB B;  4NRV A;  1GL6 A;  1MJG M;  3RGS A;  4KLN A;  3VKG A;  2EUC A;  3HU3 A;  4R7G A;  2ERC A;  2JY7 A;  4FCV A;  2CRU A;  1IXS B;  3SAV A;  3GQ5 A;  4G3O A;  2LVP C;  3GQ4 A;  3U60 B;  1QUT A; 
#chains in the Genus database with same CATH homology
 3VK8 A;  4G4R A;  4LFB M;  1W5S A;  4JXJ A;  3EIH A;  5KO3 A;  1Z59 A;  2DWZ B;  5BR8 M;  4B3S M;  4JI6 M;  2X49 A;  4LGM A;  1QYR A;  5C1B A;  4I4L A;  2Z7J A;  3AL0 C;  4A3V B;  1IXR C;  1TH3 A;  2CV1 A;  3M7G A;  1IN8 A;  4AKG A;  3DFZ A;  5IWA M;  5H37 D;  4CGY B;  2CHG A;  1WXQ A;  1K82 A;  4NOO B;  4OVZ B;  2NQ8 C;  1IY0 A;  3T38 A;  1TH4 A;  1EE8 A;  4FCW A;  3U6S A;  4L8R C;  1GLN A;  2QPA A;  3UZU A;  1L2D A;  1IY1 A;  2R65 A;  4L4U A;  2RKO A;  4NRW A;  2C5R A;  4LZJ A;  3GLG A;  3SMP A;  4JI5 M;  4LRS A;  4B7G A;  3WHL A;  4B3R M;  3AOE C;  3VLF B;  4I5S A;  2XSZ D;  4AW4 A;  8CAT A;  3THG A;  4JI0 M;  2RGO A;  3HJ8 A;  2XGN A;  4GH9 A;  2J7O A;  2UU9 M;  4JI4 M;  2R62 A;  1QAM A;  5KPT A;  2HL7 A;  3U6C A;  4LJ7 A;  2LXE A;  4L15 A;  5EXX A;  1IM2 A;  1Z5C A;  4QHT A;  1HQC A;  1K3X A;  2Y0T A;  2E5L M;  2FFJ A;  2QEN A;  4LJ9 A;  5EP2 A;  5KQD A;  1HNZ M;  1N33 M;  4LFA M;  2CE7 A;  2XF3 A;  2CHQ A;  1DGH A;  3GLH B;  4DV0 M;  4GKJ M;  3KP1 E;  2BJW A;  3R8F A;  4IBC A;  3KOW E;  3FTE A;  3E9S A;  3WHK A;  4S12 A;  1G3I A;  3FUW A;  5EXT A;  4EIW A;  1XXH A;  2AHM A;  1GL7 A;  3L27 A;  4OW0 A;  1FNN A;  5IT9 S;  4LY6 A;  3UK6 A;  5DNY A;  3VKH A;  5KPZ A;  3IG5 A;  4JN6 A;  4DV6 M;  2Y20 A;  4OX9 M;  1TDH A;  1X37 A;  4MGH A;  3KVW A;  4MGI E;  3FYC A;  1JR3 A;  3KSJ A;  1YSY A;  1J7K A;  1IBM M;  3L25 A;  1HNW M;  3KDS E;  4M9Z A;  3HWS A;  4NSO B;  4NL4 H;  2XH9 A;  2R18 A;  4DR5 M;  5ITX E;  5LMN M;  4QNM A;  4IJE A;  2F5O A;  5FTJ A;  1QVR A;  3VDU A;  4FVM A;  1NY5 A;  2ZAM A;  4ZPX A;  2Y21 A;  2M5Z A;  1SXJ D;  1R2Y A;  1KFV A;  3SAW A;  1XNQ M;  3VFD A;  3HHW A;  2C99 A;  4LJ5 A;  3CF6 E;  3JAM S;  1Q3B A;  2W82 A;  4LF4 M;  2KZU A;  3AJI B;  3U5Z B;  3H4M A;  4KOD A;  1G41 A;  4IBK A;  1N34 M;  4GC5 A;  2DXI A;  2VQE M;  4IBF A;  2OPF A;  5DYG A;  3UJN A;  4REZ A;  1MX0 A;  1TGU A;  5DYI A;  3KSX A;  3LQQ A;  4LF5 M;  4MGZ E;  1J09 A;  5EXS A;  1DGG A;  2Z3X A;  1G8P A;  4P16 A;  3AOE A;  3JR4 A;  4L16 A;  3W0L B;  4D82 A;  4IIW A;  3I4Y A;  4PD2 A;  3QAU A;  5LMU M;  2UUA M;  3BOS A;  2L6O A;  2K47 A;  3GRY A;  5EJC A;  4NXN M;  4DV7 M;  2H1R A;  4LF7 M;  3FUU A;  3U60 A;  3MK6 A;  4K0K M;  4MGY E;  1XNR M;  3VK7 A;  1PJI A;  3PNY A;  3TWM A;  2DWN A;  3D8B A;  3L29 A;  4B08 A;  1PM5 A;  5FTK A;  5EP1 A;  4RF1 A;  1SXJ E;  4GIP A;  4BB9 A;  1HNX M;  2LWX A;  3U6L A;  1NJG A;  1OFI A;  4OVZ A;  4QHS A;  3HHX A;  2KZS A;  4G4O A;  3KOX E;  3I51 A;  2G8L A;  4WUR A;  2ZAN A;  4CHT B;  3GQ3 A;  3U6M A;  5C18 A;  4GHL A;  5BPV A;  3K92 A;  3MHV C;  1UM8 A;  1QAO A;  4AZF A;  1L1T A;  4YY3 M;  3RGP A;  4M0W A;  3AOG A;  5F3W A;  3TE6 A;  2KA6 B;  3SYK A;  3L28 A;  3A42 A;  4DV3 M;  1YUB A;  1ZQ9 A;  1OFH A;  3ZC7 B;  3HJQ A;  3PVS A;  3OTO M;  3J80 S;  3DZD A;  1PJJ A;  3ILK A;  3W0F A;  4LFC M;  3AFH A;  2F5Q A;  2UXC M;  3FUV A;  1IXZ A;  2XZF A;  3A98 B;  4FWD A;  4LG2 A;  2YQZ A;  1N77 A;  1N75 A;  2QBY B;  4JI7 M;  4IBB A;  1N32 M;  4LJA A;  3T1H M;  2F5S A;  4IJF A;  4X64 M;  3J2P B;  1N36 M;  3LVW A;  4MH0 E;  4BBA A;  3GLH A;  1H6U A;  4GC9 A;  3J27 B;  1NVM A;  4AI6 A;  3TL4 X;  1Q3C A;  1TH2 A;  5FTM A;  3SHF A;  3DOA A;  1HT1 E;  2EO2 A;  4DV2 M;  3U6D A;  2L7H A;  1QZM A;  3NBI A;  3SHG B;  3PNV A;  2F4V M;  4II7 A;  3R9X B;  3FTD A;  5EQT A;  1TDZ A;  4WW0 A;  2YNM D;  2F5N A;  4CIS A;  3FUT A;  4GRI A;  3C58 A;  4RNA A;  2L7I A;  3HGI A;  2QZ4 A;  1QQW A;  3U6P A;  5JI3 E;  3J81 S;  2DWL A;  2V1C A;  4LJ4 A;  3EIE A;  3FUX A;  2I7N A;  3SAT A;  2D7E A;  3UMM A;  3GLF B;  3FD9 A;  1L8Q A;  1LV7 A;  3K2L A;  3M6A A;  3VDP A;  3HHY A;  2RGH A;  3U6E A;  3FTF A;  2M60 A;  5FLX S;  1E94 E;  1SXJ B;  2V6Z M;  3U5Z A;  4IBJ A;  4M0D A;  5EXP A;  3UGJ A;  2YR0 A;  4X62 M;  3SAU A;  4QOZ C;  3RFW A;  3TWK A;  3LQR A;  5ITU A;  4DUY M;  2I7P A;  2P5T A;  2D7G A;  2XFS A;  4AKH A;  2DVW B;  5E26 A;  4M9S A;  5KQ8 A;  2O5R A;  4FW9 A;  3GRU A;  1JR3 D;  2C98 A;  4FCT A;  3GPX A;  3GLI B;  4AKI A;  1IBK M;  1S3S A;  3K8Z A;  4I81 A;  2UUB M;  4DR7 M;  4DV5 M;  3KW6 A;  5GKN A;  1Z5B A;  2FE8 A;  1HT2 E;  1OJL A;  1IN7 A;  4NSR A;  2DZN B;  3K1J A;  4DUZ M;  3T1Y M;  2OQ4 A;  1I94 M;  1W5T A;  2UXD M;  1R2Z A;  2D7H A;  3FKE A;  2C9C A;  4LF6 M;  2XZU A;  2DWM A;  3KXE C;  1IY2 A;  3HJS A;  3NWL A;  4MGK E;  3AKZ A;  3SAR A;  5FSW A;  4OU7 A;  4DV4 M;  1QAN A;  4AG5 A;  1NNJ A;  4JV5 M;  1SXJ C;  2XFT A;  1E9S A;  1C1K A;  3U61 B;  2XLJ A;  2ZM6 M;  4YHH M;  2LNH C;  1IN6 A;  1IBL M;  1IN5 A;  4HLQ A;  2FNA A;  4XBO A;  3FYD A;  2VQF M;  5E6J A;  1QAQ A;  4JI8 M;  3CTW B;  1G4A E;  4DV1 M;  1K3W A;  3Q8X A;  2CEA A;  2HCB A;  3PFI A;  4KO8 A;  2ZAO A;  4AQY M;  4ITQ A;  1NHW C;  2QCU A;  5EP4 A;  4DR6 M;  1XMO M;  2Y0Q A;  4Z8X A;  4X65 M;  4JI1 M;  3QWL A;  2C9O A;  2DZO B;  2XSZ A;  2F5P A;  3KOZ E;  4M9X A;  3KP0 E;  1I4W A;  2ZBK B;  3AV0 A;  5ITX A;  3TWL A;  3KOY E;  3B9P A;  3I4V A;  2QBY A;  4R3D A;  4JYA M;  1Z5A A;  4B3M M;  2V1U A;  2CV2 A;  2HKJ A;  2X8A A;  3TQS A;  3SFZ A;  4L78 A;  3ZH9 B;  2C96 A;  4MB7 A;  4Z6Y A;  4AG6 A;  2BJV A;  4QOS A;  4GIT A;  1XC8 A;  2JA2 A;  3PXG A;  4TUW A;  1IN4 A;  2Z4R A;  3SMS A;  4NXM M;  3GRR A;  2L09 A;  2G5G X;  4JI2 M;  1NY6 A;  1KSF X;  2A5Y B;  3JR5 A;  2R46 A;  7CAT A;  1JQJ C;  1MU5 A;  2KRU A;  1ORY B;  1FJG M;  4PCZ A;  1NHG C;  3GLG B;  4BLC A;  4DR2 M;  4PT5 A;  1GVN A;  1HR0 M;  1DGF A;  3L26 A;  1VDD A;  3A45 A;  3FTC A;  3D8L A;  1DO2 A;  3GPU A;  4LZZ A;  2R45 A;  1DO0 A;  3GPP A;  4LGY A;  4DR3 M;  3U6Q A;  5IZ7 D;  1N78 A;  1GKI A;  2DHR A;  1KYI A;  4GHA A;  3KS8 A;  1YE9 A;  3M0E A;  2FOI C;  1Z6T A;  2QP9 X;  3DA1 A;  1ZAE A;  3HHZ A;  1G59 A;  2R4J A;  4MM3 B;  4D80 A;  3GLF A;  4B7F A;  1E32 A;  4DR4 M;  4W5W A;  1L2C A;  3IG8 A;  3HKP A;  1SXJ A;  1R7R A;  4DR1 M;  1J5E M;  1DGH B;  4B7H A;  2KW0 A;  3CF2 A;  1XWI A;  5EP3 A;  2EA0 A;  3SBJ A;  4LF9 M;  3GPY A;  1L1Z A;  4PDG A;  2UXB M;  3LMM A;  3L2A A;  5ITY A;  3A46 A;  1XXH B;  3HU1 A;  4LJ6 A;  3SAS A;  2LH0 A;  1D2N A;  4IBG A;  2VII A;  4D81 A;  1R6B X;  3E4R A;  3RE8 A;  5ITR A;  2UUC M;  1XHB A;  2J7N A;  2XEP A;  5ITQ A;  2CV0 A;  1NSF A;  2CHV A;  3GLI A;  1DGB A;  2CFO A;  4IBI A;  3SC3 A;  2KRK A;  4LJ8 A;  5ITT A;  5KPR A;  4HL4 A;  4RF0 A;  3J7A S;  1NNU C;  4G4Q A;  3HU2 A;  4G6Z A;  3MJ5 A;  1Q39 A;  2X4A A;  3GRV A;  2KXE A;  3KFU G;  3U6O A;  3T15 A;  4IBD A;  4B3T M;  2KEB A;  2Q2E B;  3TPZ A;  2CUZ A;  4GMQ A;  4XGI A;  4I8O A;  3SYL A;  4LRT A;  3GP1 A;  4FWH A;  3CF0 A;  1E9R A;  4FD2 A;  4IBE A;  1NJF A;  3J7B A;  4FWG A;  2BNK A;  2Z4S A;  3KS4 A;  4JI3 M;  3LVV A;  4G4N A;  5A2Q S;  2YFQ A;  1IQP A;  1XMQ M;  5IRE B;  3U61 A;  4GKK M;  1T3T A;  1HQY E;  5FTN A;  4QNR A;  4X66 M;  5JI2 E;  2HHH M;  1L2B A;  4LCB A;  5FTL A;  3GO8 A;  2R4E A;  4LF8 M;  4KHP M;  4PDI A;  3ZCB B;  4NRV A;  1GL6 A;  3RGS A;  3VKG A;  4KLN A;  2EUC A;  3HU3 A;  4R7G A;  2ERC A;  4FCV A;  1IXS B;  3SAV A;  3GQ5 A;  3GQ4 A;  3U60 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...