2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/protein-binding
molecule keywords 26S proteasome non-ATPase regulatory subunit 10
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
4LJ9A 3GLGA 4L16A 2DVWB 4Z8XA 3GLIA 3U5ZB 4EIWA 1G4AE 2RKOA 3SYLA 2FNAA 1S3SA 4LJ5A 1XWIA 1IN5A 1IY2A 3K1JA 4L4UA 3HWSA 1KSFX 1L8QA 2Z4SA 4LJ7A 5FTJA 3PXGA 4QNRA 1SXJE 1D2NA 2ZAOA 2C99A 2R62A 1HT2E 4I4LA 1LV7A 2C9OA 3VLFB 2CHVA 5DYGA 3GLIB 3B9PA 4LZZA 1X37A 3M6AA 1NSFA 4WW0A 5DYIA 4LJAA 5EP2A 1IN6A 1QVRA 3U61B 1R7RA 2R65A 1IXRC 5EP4A 5FTNA 4LRTA 1XXHA 1NJGA 3AJIB 3BOSA 1OFIA 1DO0A 4A3VB 4FWHA 5EP1A 4ZPXA 3UK6A 1QZMA 1HQCA 4FW9A 3HU1A 4FWDA 1SXJA 3ZH9B 4LGMA 1JR3A 2QBYB 4KODA 4KLNA 1NY6A 1IN4A 4KO8A 1G3IA 4LCBA 5EXSA 2HCBA 3M0EA 3WHKA 2ZANA 5JI2E 2C9CA 2CHGA 3PFIA 5EXPA 2C98A 4QNMA 1IXZA 2Z4RA 4FD2A 5FTKA 2XSZD 3EIEA 5FTMA 1IN8A 4I81A 5JI3E 3H4MA 3SC3A 3VFDA 4LY6A 4D80A 2QP9X 2BJWA 2QZ4A 3GLFA 1IQPA 4QHTA 1DO2A 3GLHB 3SYKA 4JN6A 3EIHA 4FCVA 3HU2A 3D8BA 1OFHA 3GLGB 5FTLA 2V6ZM 5EXTA 2X8AA 1HQYE 1XXHB 3DZDA 3R8FA 1JR3D 5EXXA 4D81A 1W5SA 1SXJD 4QOSA 4QHSA 1E94E 1IN7A 4FCTA 2V1UA 1OJLA 1J7KA 1HT1E 2DZOB 4LJ8A 2CE7A 2QENA 2DZNB 4LJ6A 3U60B 1E32A 1IY0A 2QPAA 3CF0A 2ZAMA 1IXSB 3KDSE 4FCWA 4LJ4A 1NVMA 5EQTA 3HU3A 3MHVC 1R6BX 2CHQA 4LRSA 5EP3A 5C18A 1IY1A 1JQJC 1NJFA 2XSZA 2VIIA 2CEAA 1FNNA 2DHRA 1W5TA 4GITA 1G41A 1SXJC 5C1BA 1C1KA 1NY5A 2KRKA 3WHLA 3PVSA 2C96A 1KYIA 4D82A 3GLFB 1IM2A 3KW6A 1UM8A 4FWGA 3GLHA 2BJVA 1SXJB 4L15A 3CF2A 2QBYA 2DWZB
chains in the Genus database with same CATH superfamily
3FTDA 3GLGA 1AIPC 1OAOC 2DVWB 4WP2A 3K92A 1G8PA 1R2ZA 3TWLA 2L4FA 2MROB 3UMMA 4YHHM 3VK8A 1S3SA 1Z5CA 4LJ5A 2EKKA 3MMPA 5KPTA 2CWBA 2Q2EB 4KHPM 3OTOM 2BNKA 1KSFX 1QAOA 2O01F 3PXGA 4QNRA 4DR1M 2D7EA 4OVZB 2ZAOA 1WHCA 2JZ1A 2R62A 1QAQA 2F4VM 2DZLA 5ITXE 3FUUA 3VLFB 1GABA 1GJTA 3KOZE 4LZZA 4G4QA 3U5ZA 2QNJA 2F5PA 4JI4M 1R5LA 1DGFA 1V92A 1OQYA 4AKHA 2DWNA 3FKEA 5GKNA 1GKIA 1JR3E 3L2AA 3NBXX 3GRRA 1NV9A 4MGKE 1L2CA 1Q02A 3DA1A 1DO0A 3AL0C 1Z5BA 3KOYE 3UK6A 3W67A 4GHLA 3IHPA 4FW9A 4B08A 5ITRA 2UXDM 1ZMUA 2JZ0A 1DGGA 1ZMVA 3ZH9B 4JV5M 3FUVA 1AUAA 1YUBA 4LGMA 2DAEA 2QBYB 3E9SA 3DOAA 4GKKM 3LCVB 5EXSA 2VDBB 4RF1A 3WHKA 2ZANA 3AOEC 2Y0TA 2C9CA 2CHGA 1K82A 3HJSA 1GL7A 4QNMA 4AKGA 4DV1M 3BXWA 3U6EA 1VDDA 4GC5A 2JUJA 1QDRA 1Z6TA 1IBLM 2R6FA 2OOAA 2K9DA 3H4MA 3SATA 4IBBA 1NNJA 3SARA 4LY6A 2DI0A 3FTFA 2HWJA 3KP0E 2DWLA 2R45A 1EFUB 2JNHA 4IBCA 4GRIA 4OX9M 1OIPA 4F1IA 4ITQA 4JN6A 3GPXA 2RRUA 3QYBA 3U61A 4GC9A 2DWMA 3FUXA 2GNOA 5FTLA 3GLGB 4JI6M 2EO2A 2KNAA 2R18A 2ZTDA 4HEOA 4MGYE 3I51A 4D81A 3UGJA 3TPZA 3L27A 2Z7JA 1SXJD 2FOIC 5IT9S 4ANRA 3KSJA 2O25A 2KZUA 3AFHA 4OW0A 1OAIA 3LVWA 1L2BA 2JY5A 3W0FA 2CE7A 2QENA 4X65M 2DZNB 1MJGM 1IY0A 2QPAA 3KDSE 2ZAMA 2WZJA 5EQTA 1PJIA 1T3TA 2KXEA 3B7QA 4HL4A 3U6CA 3HY5A 1Z59A 4GHAA 3C3DA 4DR7M 1R6BX 1XB2B 4LRSA 1LTMA 5C18A 4JI7M 4GH9A 1NJFA 2LVQD 3HJ8A 3GPYA 3F92A 4KT0F 2VIIA 2O5RA 3SMSA 2XZUA 2N35A 1G41A 4GITA 4DV2M 1L1TA 2WSEF 3SASA 2CRUA 2XFSA 4NSOB 2C96A 1KYIA 3GLFB 3NWLA 3L28A 2LNHC 2V1CA 1HJPA 3GLHA 1RU3A 2BJVA 4FWGA 5A2QS 3CF2A 2CUZA 3W68A 2QBYA 2DWZB 3RFWA 1XHBA 4GEWA 1WIVA 3A98B 4IBIA 3FUTA 3SHFA 2BWEA 4LFAM 1G4AE 3SYLA 2LVNC 2HAKA 1IN5A 4P17A 3RE8A 3K1JA 1XMOM 1QQWA 2KNVA 2YFQA 4L4UA 1PJSA 1YLAA 2NQ8C 3C3EA 3HWSA 3H4JA 4IIWA 1HNZM 1XC8A 1SXJE 3FTCA 3I04M 5EJCA 2VF7A 1IXSA 2LXEA 1LV7A 3QAUA 2XH9A 4M9ZA 3GLIB 3B9PA 3KP1E 3SAUA 1Q3CA 4R71A 3QYEA 5EP2A 1NSFA 4M9XA 5DYIA 2CP8A 3QWLA 2K47A 1IN6A 1QVRA 4CGYB 5KQ8A 3GPPA 3U61B 2R65A 3GQ4A 1DV0A 4HLQA 1NJGA 4R7GA 3W0LB 1XMQM 5LMNM 3LQQA 1QZEA 4IBKA 1OKSA 2EUCA 2JY7A 4NRVA 4AI6A 4I5SA 4ZPXA 1N78A 3SMPA 3UZUA 4R3DA 4B7FA 4AKIA 1R4GA 1Y8GA 4M0DA 3HU1A 4GKJM 4FWDA 4JI3M 1SXJA 4NSRA 4DR5M 4AW4A 5H37D 3KXEC 1JR3A 2YQZA 1D0MA 4DUYM 1PJQA 2D7GA 1GL6A 1G3IA 1TH2A 1VG5A 2HCBA 3M0EA 4LCBA 3SAWA 1R2YA 1MU5A 4DV0M 4FD2A 3T38A 3U6OA 3SHGB 2JA2A 3K8ZA 4OU7A 2Y0QA 3SC3A 3VFDA 2XLJA 1PRBA 2QSFX 3J2PB 4D80A 3KS4A 2QP9X 4LF7M 4LF8M 4II7A 3KS8A 4DR4M 1DGHB 4MM3B 3GLFA 3GQ3A 1N36M 3LCUA 1IQPA 3GLHB 4PT5A 2FH0A 5ITXA 3V76A 3EIHA 4FCVA 4BB9A 1ZV1A 3HU2A 3D8BA 2AHMA 2J5YA 4IJFA 4G4NA 2APLA 1QDTA 2R44A 2OPFA 3E4RA 1W5SA 2D7HA 4GIPA 3TWKA 2Y21A 2F5QA 3HHYA 1HT1E 4IBJA 2RGOA 3VKGA 4NXMM 3LW5F 5FSWA 3A42A 3R9XB 1HNWM 3SAVA 5L8RF 3B7NA 4LJ6A 4MB7A 4LF6M 1E32A 1VEGA 1Q39A 4IBEA 3GRYA 4JI5M 2EJSA 2KEBA 5BR8M 3HU3A 3MHVC 3CGWA 1VEKA 3ZC7B 3GO8A 2M5ZA 3GRVA 4JI2M 2CHQA 5EP3A 1IY1A 1JQJC 2JXNA 4X62M 1JB0F 2MJ5B 4YY3M 2CEAA 1SXJC 2P5TA 1WJ7A 4IBGA 3GQ5A 4G6ZA 1C1KA 2OOBA 2KRKA 3MJ5A 3RGPA 5KO3A 5IZ7D 3U60A 3HZJA 1WGNA 5BPVA 2ZTCA 2LTUA 3FD9A 2J7OA 1IFYA 3KW6A 4DR6M 3HHWA 1CUKA 1D0KA 1SXJB 1ZMWA 2KZSA 4L15A 1QANA 4L16A 2FFJA 3GLHE 3U5ZB 4K0KM 4EIWA 1HNXM 2FNAA 3JAMS 1IY2A 3GLFE 5KQDA 2ERCA 1N33M 1NNUC 3J7AS 1MX0A 3BBZA 3E21A 4M0WA 2UUAM 1L8QA 2Z4SA 4LJ7A 2MR9A 5FTJA 2G3QA 3J80S 5IWAM 1HR0M 2DAMA 2KNZA 1OIZA 3VKHA 2JY8A 2DENA 1GJSA 2C99A 2KHHA 2F5NA 4I4LA 2RGHA 2LHCA 2WSFF 2C9OA 1TF0B 2CHVA 5DYGA 3PNYA 4LGYA 1OTRA 2XFTA 3U6LA 1YSYA 1MN3A 2DNAA 3M6AA 1T6OA 4LJAA 2JY6B 3SBJA 1T43A 3A45A 3FUWA 5EP4A 4Q7JA 1QUSA 3NBIA 3BOSA 4A3VB 4FWHA 3JR4A 4G4OA 1QZMA 4IBDA 4DUZM 2DAGA 1N77A 3KVWA 2GQFA 4PCZA 2UXCM 1Q3BA 2CV1A 4LFBM 4JI1M 1V34A 4NOOB 1NV8A 8CATA 4LG2A 1TDHA 4L78A 4AQYM 2XGNA 4MGZE 4LZJA 1IN4A 2QHOB 4DR3M 2JWSA 4Y28F 4KO8A 3ZQJA 2LVAA 4MGIE 2EKFA 3RGSA 3PFIA 4S12A 5EXPA 3JR5A 4BLCA 2C98A 2Z4RA 3HGIA 2VF8A 2XSZD 3EIEA 1PGYA 4CISA 1PJTA 3MK6A 2G5GX 4PDGA 5JI3E 5FLXS 4DV5M 2R4EA 5KPRA 2HHHM 5DNYA 1N75A 2QCUA 3J27B 3TWMA 5ITUA 2BJWA 1IBMM 2QZ4A 1DGBA 2UU9M 4QHTA 4G4RA 3HX3A 3SYKA 3FYDA 3AKZA 2LH0A 2I7PA 1H6UA 3HJQA 1N34M 3KOXE 1XXHB 2FE8A 3R8FA 1ZQ9A 1JR3D 5EXXA 3TL4X 4TUWA 1A5TA 4QHSA 1IN7A 1E94E 4FCTA 2V1UA 3FE3A 2K0BX 1L2DA 2DAKA 4UN2B 2G8LA 3LMMA 4IJEA 2DZOB 2E5LM 1SG9A 2I7NA 1GVNA 2EA0A 3T6PA 3K9PA 4LJ4A 2F5OA 3ZCBB 4NRWA 3GP1A 1NHWC 2LVOC 3K2LA 3VK7A 1EE8A 4GMQA 3VDUA 2VQFM 2MGWA 4DR2M 2LBCA 1TH4A 2R4JA 1XNQM 1XXHE 2QQ8A 4B3RM 1F4IA 4LF9M 1Z5AA 1WR1B 1YE9A 2DKLA 3DFZA 4W5WA 2LHGA 3IG5A 4B3MM 5DFLA 3FTEA 4CIZA 1IM2A 2WSCF 4LF5M 3I01M 1VEJA 4JI0M 4F2LA 1IXSB 4AZFA 3U6DA 3T1HM 1E9RA 1K3WA 4LF4M 5ITYA 4LJ9A 3LVVA 4XK8F 4Z8XA 3GLIA 5IREB 4IBFA 1VQ1A 1IBKM 2RKOA 4X64M 2OQ4A 2A5YB 4L8RC 3E46A 2H1RA 1XWIA 2JP7A 4DBGB 4WURA 2UXBM 3U6MA 4FVMA 2KA6B 1QAMA 3L29A 2K6BA 3UJNA 3HKPA 2L4EA 4RF0A 1BVSA 2L7HA 3A46A 4DV4M 1D2NA 1TDZA 1HT2E 4NC6A 1N32M 5E6JA 2CV0A 4P16A 3I4YA 2B3TA 3B89A 3M7GA 4NL4H 2J7NA 3T15A 1X37A 4WW0A 1VDLA 1WXQA 3FYCA 7CATA 5E26A 1R7RA 2Z8YM 1IXRC 4M9SA 5FTNA 4LRTA 1XXHA 3SFZA 2YNMD 2X49A 3AJIB 2KRUA 1FJGM 1OFIA 5EP1A 5LMUM 1G59A 1G71A 1HQCA 3AOGA 2LWXA 3Q8XA 2R0IA 3C9PA 4PD2A 4DV6M 4B7HA 3IECA 3GPUA 3T1YM 3LQRA 4KODA 1J5EM 2Y20A 4KLNA 1NY6A 3CF6E 4JI8M 1DGHA 5JI2E 1E9SA 2Z3XA 1KFVA 3U6PA 2HKJA 2H5XA 2YR0A 1IXZA 3KFUG 2CFOA 2HL7A 5FTKA 3GLIE 3C58A 1C7YA 5FTMA 1IN8A 4I81A 3FRHA 4MH0E 2VQEM 1WGLA 2C5RA 2OO9A 4OVZA 1TH3A 1QUTA 2MH8A 2CV2A 2BWBA 1D0LA 1NHGC 4X66M 5ITTA 1DO2A 5KPZA 2L6OA 1I4WA 2XF3A 3KSXA 3Q8GA 4NXNM 4RKUF 3TE6A 3GRUA 4AG5A 5ITQA 3GLGE 1K3XA 2DAIA 4LFCM 4JXJA 4DV3M 3TQSA 1OFHA 4AG6A 2XZFA 3HHZA 4QOZC 4I8OA 2V6ZM 4REZA 5EXTA 2X8AA 1HQYE 3B74A 3DZDA 3IG8A 3PNVA 2L7IA 4QOSA 2LVPC 4B7GA 2W82A 2ZBKB 2R46A 1OJLA 3CTWB 1GLNA 1J7KA 3L25A 4LJ8A 1TGUA 3ILKA 4CHTB 3U6SA 2M60A 4B3SM 3AOEA 3U6QA 1J09A 4PDIA 3J7BA 3U60B 1UFZA 3CF0A 4FCWA 3FRIA 4XBOA 1EIJA 1V33A 1NVMA 4XGIA 4B3TM 1NO1A 1I94M 1TR8A 2DHYA 1XNRM 3L26A 4DV7M 4CJ6A 3THGA 1QYRA 2DXIA 1GO5A 5F3WA 1PM5A 1L1ZA 2KDLA 4G3OA 4L6V6 3HHXA 2XSZA 3B7ZA 1FNNA 2DHRA 1W5TA 2KW0A 2L2DA 1TTEA 2L09A 3AV0A 3D8LA 4BBAA 5C1BA 2F5SA 1NY5A 4Z6YA 2UUCM 1P3QQ 3PVSA 4RNAA 3WHLA 2UUBM 4JYAM 4MGHA 4D82A 2X4AA 3KOWE 1UM8A 3K9OA 3VDPA 1PJJA 2FS1A 1ORYB 2XEPA 3I4VA 2ZM6M 1ZAEA 3J81S
chains in the Genus database with same CATH topology
3FTDA 3GLGA 2DVWB 1R2ZA 3K92A 1G8PA 3TWLA 3UMMA 4YHHM 3VK8A 1S3SA 1Z5CA 4LJ5A 5KPTA 2Q2EB 4KHPM 3OTOM 2BNKA 1KSFX 1QAOA 3PXGA 4QNRA 4DR1M 2D7EA 4OVZB 2ZAOA 2R62A 1QAQA 2F4VM 5ITXE 3FUUA 3VLFB 3KOZE 4LZZA 4G4QA 3U5ZA 2F5PA 4JI4M 1DGFA 4AKHA 2DWNA 3FKEA 5GKNA 1GKIA 3L2AA 3GRRA 4MGKE 1L2CA 3DA1A 1DO0A 3AL0C 1Z5BA 3KOYE 3UK6A 4GHLA 4FW9A 4B08A 5ITRA 2UXDM 1DGGA 3ZH9B 4JV5M 3FUVA 1YUBA 4LGMA 2QBYB 3E9SA 3DOAA 4GKKM 5EXSA 4RF1A 3WHKA 2ZANA 3AOEC 2Y0TA 2C9CA 2CHGA 1K82A 3HJSA 1GL7A 4QNMA 4AKGA 4DV1M 3U6EA 1VDDA 4GC5A 3SATA 1Z6TA 1IBLM 3H4MA 4IBBA 1NNJA 3SARA 4LY6A 3FTFA 3KP0E 2DWLA 2R45A 4IBCA 4GRIA 4OX9M 4ITQA 4JN6A 3GPXA 3U61A 4GC9A 2DWMA 3FUXA 3GLGB 5FTLA 4JI6M 2EO2A 2R18A 4MGYE 3I51A 4D81A 3UGJA 3TPZA 3L27A 2Z7JA 1SXJD 2FOIC 5IT9S 3KSJA 3AFHA 2KZUA 4OW0A 3LVWA 1L2BA 3W0FA 2CE7A 2QENA 4X65M 2DZNB 1IY0A 2QPAA 3KDSE 2ZAMA 1PJIA 5EQTA 1T3TA 2KXEA 4HL4A 3U6CA 1Z59A 4GHAA 4DR7M 1R6BX 4LRSA 5C18A 4JI7M 4GH9A 1NJFA 3GPYA 3HJ8A 2VIIA 2O5RA 3SMSA 2XZUA 4GITA 1G41A 1L1TA 4DV2M 3SASA 4LFCM 2XFSA 4NSOB 2C96A 1KYIA 3GLFB 3NWLA 3L28A 2LNHC 2V1CA 4FWGA 3GLHA 2BJVA 5A2QS 3CF2A 2CUZA 2QBYA 2DWZB 3RFWA 1XHBA 3A98B 4IBIA 3FUTA 3SHFA 4LFAM 1G4AE 3SYLA 1IN5A 3RE8A 1XMOM 3K1JA 1QQWA 2YFQA 4L4UA 3HWSA 2NQ8C 4IIWA 1HNZM 1XC8A 1SXJE 3FTCA 5EJCA 2LXEA 1LV7A 3QAUA 2XH9A 4M9ZA 3GLIB 3B9PA 3KP1E 3SAUA 1Q3CA 5EP2A 1NSFA 4M9XA 5DYIA 3QWLA 4CGYB 2K47A 1IN6A 1QVRA 3U61B 5KQ8A 3GPPA 2R65A 3GQ4A 4HLQA 1NJGA 4R7GA 3W0LB 1XMQM 5LMNM 3LQQA 4IBKA 4AI6A 2EUCA 4NRVA 4I5SA 4ZPXA 1N78A 3SMPA 3UZUA 4R3DA 4B7FA 4AKIA 4M0DA 3HU1A 4GKJM 4FWDA 4JI3M 1SXJA 4NSRA 4DR5M 4AW4A 5H37D 3KXEC 1JR3A 2YQZA 4DUYM 2D7GA 1GL6A 1G3IA 1TH2A 4LCBA 2HCBA 3M0EA 1R2YA 1MU5A 4DV0M 4FD2A 3T38A 3U6OA 3SHGB 2JA2A 3K8ZA 4OU7A 2Y0QA 3SC3A 3VFDA 2XLJA 4D80A 3J2PB 3KS4A 2QP9X 4LF7M 4LF8M 4II7A 3KS8A 4DR4M 1DGHB 4MM3B 3GLFA 3GQ3A 1N36M 1IQPA 3GLHB 4PT5A 5ITXA 3EIHA 4FCVA 4BB9A 3HU2A 3D8BA 2AHMA 4IJFA 4G4NA 2OPFA 3E4RA 1W5SA 2D7HA 4GIPA 3TWKA 2Y21A 2F5QA 3HHYA 1HT1E 4IBJA 2RGOA 3VKGA 4NXMM 5FSWA 3A42A 3R9XB 1HNWM 3SAVA 4LF6M 4LJ6A 4MB7A 1E32A 1Q39A 4IBEA 3GRYA 4JI5M 2KEBA 5BR8M 3HU3A 3MHVC 3ZC7B 3GO8A 2M5ZA 3GRVA 4JI2M 2CHQA 5EP3A 1IY1A 1JQJC 4X62M 4YY3M 2CEAA 1SXJC 2P5TA 4IBGA 3GQ5A 4G6ZA 1C1KA 3MJ5A 2KRKA 3RGPA 5KO3A 5IZ7D 3U60A 5BPVA 3FD9A 2J7OA 3KW6A 4DR6M 3HHWA 1SXJB 4L15A 2KZSA 1QANA 4L16A 2FFJA 3U5ZB 4K0KM 4EIWA 1HNXM 2FNAA 3JAMS 1IY2A 5KQDA 2ERCA 1N33M 1NNUC 3J7AS 1MX0A 4M0WA 2UUAM 1L8QA 2Z4SA 4LJ7A 3J80S 5FTJA 1HR0M 5IWAM 3VKHA 2C99A 2F5NA 4I4LA 2RGHA 2C9OA 2CHVA 5DYGA 3PNYA 4LGYA 2XFTA 3U6LA 1YSYA 3M6AA 4LJAA 3SBJA 3A45A 3FUWA 5EP4A 3NBIA 3BOSA 4A3VB 4FWHA 3JR4A 4G4OA 1QZMA 4IBDA 4DUZM 1N77A 3KVWA 4PCZA 2UXCM 1Q3BA 2CV1A 4LFBM 4JI1M 4NOOB 8CATA 4LG2A 1TDHA 4L78A 4AQYM 2XGNA 4MGZE 4LZJA 1IN4A 4DR3M 4KO8A 4MGIE 3RGSA 3JR5A 4NRWA 3PFIA 4S12A 5EXPA 4BLCA 2C98A 2Z4RA 3HGIA 2XSZD 3EIEA 4CISA 4PDGA 3MK6A 2G5GX 5JI3E 5FLXS 4DV5M 2R4EA 5KPRA 2HHHM 5DNYA 1N75A 2QCUA 3J27B 3TWMA 5ITUA 2BJWA 1IBMM 2QZ4A 1DGBA 2UU9M 4QHTA 4G4RA 3SYKA 3FYDA 3AKZA 2LH0A 2I7PA 1H6UA 3HJQA 1N34M 3KOXE 1XXHB 2FE8A 3R8FA 1ZQ9A 1JR3D 5EXXA 3TL4X 4TUWA 4QHSA 1IN7A 1E94E 4FCTA 2V1UA 1L2DA 2G8LA 3LMMA 4IJEA 2DZOB 2E5LM 2I7NA 1GVNA 2EA0A 4LJ4A 2F5OA 3ZCBB 3GP1A 1NHWC 3K2LA 3VK7A 1EE8A 4GMQA 3VDUA 2VQFM 4DR2M 1TH4A 2R4JA 1XNQM 4B3RM 4LF9M 1Z5AA 1YE9A 3DFZA 4W5WA 3IG5A 4B3MM 3FTEA 1IM2A 4LF5M 4JI0M 3U6DA 1IXSB 4AZFA 3T1HM 1E9RA 1K3WA 4LF4M 5ITYA 4LJ9A 3LVVA 4Z8XA 1IBKM 3GLIA 5IREB 4IBFA 2RKOA 4X64M 2OQ4A 2A5YB 4L8RC 2H1RA 1XWIA 4WURA 2UXBM 3U6MA 4FVMA 2KA6B 1QAMA 3L29A 3A46A 3UJNA 3HKPA 4RF0A 4DV4M 3SAWA 2L7HA 1D2NA 1TDZA 1HT2E 1N32M 5E6JA 2CV0A 4P16A 3I4YA 4NL4H 3M7GA 2J7NA 3T15A 1X37A 4WW0A 1WXQA 3FYCA 7CATA 5E26A 1R7RA 1IXRC 4M9SA 5FTNA 4LRTA 1XXHA 3SFZA 2YNMD 2X49A 3AJIB 2KRUA 1FJGM 1OFIA 5EP1A 5LMUM 1G59A 1HQCA 3AOGA 2LWXA 3Q8XA 4PD2A 4DV6M 4B7HA 3GPUA 3T1YM 3LQRA 4KODA 1J5EM 2Y20A 4KLNA 1NY6A 3CF6E 4JI8M 1DGHA 5JI2E 1E9SA 2Z3XA 1KFVA 3U6PA 2HKJA 2YR0A 1IXZA 3KFUG 2CFOA 2HL7A 5FTKA 3C58A 5FTMA 1IN8A 4I81A 4MH0E 2VQEM 2C5RA 4OVZA 1TH3A 2CV2A 1NHGC 4X66M 5ITTA 1DO2A 5KPZA 2L6OA 1I4WA 2XF3A 3KSXA 4NXNM 3TE6A 5ITQA 4AG5A 3GRUA 1K3XA 4JXJA 4DV3M 3TQSA 1OFHA 4AG6A 2XZFA 3HHZA 4QOZC 4I8OA 2V6ZM 4REZA 5EXTA 2X8AA 1HQYE 3DZDA 3IG8A 3PNVA 2L7IA 4QOSA 4B7GA 2W82A 2ZBKB 2R46A 1OJLA 3CTWB 1GLNA 1J7KA 3L25A 4LJ8A 1TGUA 3ILKA 4CHTB 3U6SA 2M60A 4B3SM 3AOEA 3U6QA 1J09A 4PDIA 3J7BA 3U60B 3CF0A 4FCWA 4XBOA 1NVMA 4XGIA 4B3TM 1I94M 1XNRM 3L26A 4DV7M 3THGA 1QYRA 2DXIA 5F3WA 1PM5A 1L1ZA 3HHXA 2XSZA 1FNNA 2DHRA 1W5TA 2KW0A 3D8LA 4BBAA 2L09A 3AV0A 5C1BA 2F5SA 2UUCM 1NY5A 4Z6YA 3WHLA 3PVSA 4RNAA 2UUBM 4JYAM 4MGHA 4D82A 2X4AA 3KOWE 1UM8A 3VDPA 1PJJA 1ORYB 2XEPA 3I4VA 2ZM6M 1ZAEA 3J81S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJ9 A;  3GLG A;  4L16 A;  2DVW B;  4Z8X A;  3GLI A;  3U5Z B;  4EIW A;  1G4A E;  2RKO A;  3SYL A;  2FNA A;  1S3S A;  4LJ5 A;  1XWI A;  1IN5 A;  1IY2 A;  3K1J A;  4L4U A;  3HWS A;  1KSF X;  1L8Q A;  2Z4S A;  4LJ7 A;  5FTJ A;  3PXG A;  4QNR A;  1SXJ E;  1D2N A;  2ZAO A;  2C99 A;  2R62 A;  1HT2 E;  4I4L A;  1LV7 A;  2C9O A;  3VLF B;  2CHV A;  5DYG A;  3GLI B;  3B9P A;  4LZZ A;  1X37 A;  3M6A A;  1NSF A;  4WW0 A;  5DYI A;  4LJA A;  5EP2 A;  1IN6 A;  1QVR A;  3U61 B;  1R7R A;  2R65 A;  1IXR C;  5EP4 A;  5FTN A;  4LRT A;  1XXH A;  1NJG A;  3AJI B;  3BOS A;  1OFI A;  1DO0 A;  4A3V B;  4FWH A;  5EP1 A;  4ZPX A;  3UK6 A;  1QZM A;  1HQC A;  4FW9 A;  3HU1 A;  4FWD A;  1SXJ A;  3ZH9 B;  4LGM A;  1JR3 A;  2QBY B;  4KOD A;  4KLN A;  1NY6 A;  1IN4 A;  4KO8 A;  1G3I A;  4LCB A;  5EXS A;  2HCB A;  3M0E A;  3WHK A;  2ZAN A;  5JI2 E;  2C9C A;  2CHG A;  3PFI A;  5EXP A;  2C98 A;  4QNM A;  1IXZ A;  2Z4R A;  4FD2 A;  5FTK A;  2XSZ D;  3EIE A;  5FTM A;  1IN8 A;  4I81 A;  5JI3 E;  3H4M A;  3SC3 A;  3VFD A;  4LY6 A;  4D80 A;  2QP9 X;  2BJW A;  2QZ4 A;  3GLF A;  1IQP A;  4QHT A;  1DO2 A;  3GLH B;  3SYK A;  4JN6 A;  3EIH A;  4FCV A;  3HU2 A;  3D8B A;  1OFH A;  3GLG B;  5FTL A;  2V6Z M;  5EXT A;  2X8A A;  1HQY E;  1XXH B;  3DZD A;  3R8F A;  1JR3 D;  5EXX A;  4D81 A;  1W5S A;  1SXJ D;  4QOS A;  4QHS A;  1E94 E;  1IN7 A;  4FCT A;  2V1U A;  1OJL A;  1J7K A;  1HT1 E;  2DZO B;  4LJ8 A;  2CE7 A;  2QEN A;  2DZN B;  4LJ6 A;  3U60 B;  1E32 A;  1IY0 A;  2QPA A;  3CF0 A;  2ZAM A;  1IXS B;  3KDS E;  4FCW A;  4LJ4 A;  1NVM A;  5EQT A;  3HU3 A;  3MHV C;  1R6B X;  2CHQ A;  4LRS A;  5EP3 A;  5C18 A;  1IY1 A;  1JQJ C;  1NJF A;  2XSZ A;  2VII A;  2CEA A;  1FNN A;  2DHR A;  1W5T A;  4GIT A;  1G41 A;  1SXJ C;  5C1B A;  1C1K A;  1NY5 A;  2KRK A;  3WHL A;  3PVS A;  2C96 A;  1KYI A;  4D82 A;  3GLF B;  1IM2 A;  3KW6 A;  1UM8 A;  4FWG A;  3GLH A;  2BJV A;  1SXJ B;  4L15 A;  3CF2 A;  2QBY A;  2DWZ B; 
#chains in the Genus database with same CATH topology
 3FTD A;  3GLG A;  1AIP C;  1OAO C;  2DVW B;  4WP2 A;  3K92 A;  1G8P A;  1R2Z A;  3TWL A;  2L4F A;  2MRO B;  3UMM A;  4YHH M;  3VK8 A;  1S3S A;  1Z5C A;  4LJ5 A;  2EKK A;  3MMP A;  5KPT A;  2CWB A;  2Q2E B;  4KHP M;  3OTO M;  2BNK A;  1KSF X;  1QAO A;  2O01 F;  3PXG A;  4QNR A;  4DR1 M;  2D7E A;  4OVZ B;  2ZAO A;  1WHC A;  2JZ1 A;  2R62 A;  1QAQ A;  2F4V M;  2DZL A;  5ITX E;  3FUU A;  3VLF B;  1GAB A;  1GJT A;  3KOZ E;  4LZZ A;  4G4Q A;  3U5Z A;  2QNJ A;  2F5P A;  4JI4 M;  1R5L A;  1DGF A;  1V92 A;  1OQY A;  4AKH A;  2DWN A;  3FKE A;  5GKN A;  1GKI A;  1JR3 E;  3L2A A;  3NBX X;  3GRR A;  1NV9 A;  4MGK E;  1L2C A;  1Q02 A;  3DA1 A;  1DO0 A;  3AL0 C;  1Z5B A;  3KOY E;  3UK6 A;  3W67 A;  4GHL A;  3IHP A;  4FW9 A;  4B08 A;  5ITR A;  2UXD M;  1ZMU A;  2JZ0 A;  1DGG A;  1ZMV A;  3ZH9 B;  4JV5 M;  3FUV A;  1AUA A;  1YUB A;  4LGM A;  2DAE A;  2QBY B;  3E9S A;  3DOA A;  4GKK M;  3LCV B;  5EXS A;  2VDB B;  4RF1 A;  3WHK A;  2ZAN A;  3AOE C;  2Y0T A;  2C9C A;  2CHG A;  1K82 A;  3HJS A;  1GL7 A;  4QNM A;  4AKG A;  4DV1 M;  3BXW A;  3U6E A;  1VDD A;  4GC5 A;  2JUJ A;  1QDR A;  1Z6T A;  1IBL M;  2R6F A;  2OOA A;  2K9D A;  3H4M A;  3SAT A;  4IBB A;  1NNJ A;  3SAR A;  4LY6 A;  2DI0 A;  3FTF A;  2HWJ A;  3KP0 E;  2DWL A;  2R45 A;  1EFU B;  2JNH A;  4IBC A;  4GRI A;  4OX9 M;  1OIP A;  4F1I A;  4ITQ A;  4JN6 A;  3GPX A;  2RRU A;  3QYB A;  3U61 A;  4GC9 A;  2DWM A;  3FUX A;  2GNO A;  5FTL A;  3GLG B;  4JI6 M;  2EO2 A;  2KNA A;  2R18 A;  2ZTD A;  4HEO A;  4MGY E;  3I51 A;  4D81 A;  3UGJ A;  3TPZ A;  3L27 A;  2Z7J A;  1SXJ D;  2FOI C;  5IT9 S;  4ANR A;  3KSJ A;  2O25 A;  2KZU A;  3AFH A;  4OW0 A;  1OAI A;  3LVW A;  1L2B A;  2JY5 A;  3W0F A;  2CE7 A;  2QEN A;  4X65 M;  2DZN B;  1MJG M;  1IY0 A;  2QPA A;  3KDS E;  2ZAM A;  2WZJ A;  5EQT A;  1PJI A;  1T3T A;  2KXE A;  3B7Q A;  4HL4 A;  3U6C A;  3HY5 A;  1Z59 A;  4GHA A;  3C3D A;  4DR7 M;  1R6B X;  1XB2 B;  4LRS A;  1LTM A;  5C18 A;  4JI7 M;  4GH9 A;  1NJF A;  2LVQ D;  3HJ8 A;  3GPY A;  3F92 A;  4KT0 F;  2VII A;  2O5R A;  3SMS A;  2XZU A;  2N35 A;  1G41 A;  4GIT A;  4DV2 M;  1L1T A;  2WSE F;  3SAS A;  2CRU A;  2XFS A;  4NSO B;  2C96 A;  1KYI A;  3GLF B;  3NWL A;  3L28 A;  2LNH C;  2V1C A;  1HJP A;  3GLH A;  1RU3 A;  2BJV A;  4FWG A;  5A2Q S;  3CF2 A;  2CUZ A;  3W68 A;  2QBY A;  2DWZ B;  3RFW A;  1XHB A;  4GEW A;  1WIV A;  3A98 B;  4IBI A;  3FUT A;  3SHF A;  2BWE A;  4LFA M;  1G4A E;  3SYL A;  2LVN C;  2HAK A;  1IN5 A;  4P17 A;  3RE8 A;  3K1J A;  1XMO M;  1QQW A;  2KNV A;  2YFQ A;  4L4U A;  1PJS A;  1YLA A;  2NQ8 C;  3C3E A;  3HWS A;  3H4J A;  4IIW A;  1HNZ M;  1XC8 A;  1SXJ E;  3FTC A;  3I04 M;  5EJC A;  2VF7 A;  1IXS A;  2LXE A;  1LV7 A;  3QAU A;  2XH9 A;  4M9Z A;  3GLI B;  3B9P A;  3KP1 E;  3SAU A;  1Q3C A;  4R71 A;  3QYE A;  5EP2 A;  1NSF A;  4M9X A;  5DYI A;  2CP8 A;  3QWL A;  2K47 A;  1IN6 A;  1QVR A;  4CGY B;  5KQ8 A;  3GPP A;  3U61 B;  2R65 A;  3GQ4 A;  1DV0 A;  4HLQ A;  1NJG A;  4R7G A;  3W0L B;  1XMQ M;  5LMN M;  3LQQ A;  1QZE A;  4IBK A;  1OKS A;  2EUC A;  2JY7 A;  4NRV A;  4AI6 A;  4I5S A;  4ZPX A;  1N78 A;  3SMP A;  3UZU A;  4R3D A;  4B7F A;  4AKI A;  1R4G A;  1Y8G A;  4M0D A;  3HU1 A;  4GKJ M;  4FWD A;  4JI3 M;  1SXJ A;  4NSR A;  4DR5 M;  4AW4 A;  5H37 D;  3KXE C;  1JR3 A;  2YQZ A;  1D0M A;  4DUY M;  1PJQ A;  2D7G A;  1GL6 A;  1G3I A;  1TH2 A;  1VG5 A;  2HCB A;  3M0E A;  4LCB A;  3SAW A;  1R2Y A;  1MU5 A;  4DV0 M;  4FD2 A;  3T38 A;  3U6O A;  3SHG B;  2JA2 A;  3K8Z A;  4OU7 A;  2Y0Q A;  3SC3 A;  3VFD A;  2XLJ A;  1PRB A;  2QSF X;  3J2P B;  4D80 A;  3KS4 A;  2QP9 X;  4LF7 M;  4LF8 M;  4II7 A;  3KS8 A;  4DR4 M;  1DGH B;  4MM3 B;  3GLF A;  3GQ3 A;  1N36 M;  3LCU A;  1IQP A;  3GLH B;  4PT5 A;  2FH0 A;  5ITX A;  3V76 A;  3EIH A;  4FCV A;  4BB9 A;  1ZV1 A;  3HU2 A;  3D8B A;  2AHM A;  2J5Y A;  4IJF A;  4G4N A;  2APL A;  1QDT A;  2R44 A;  2OPF A;  3E4R A;  1W5S A;  2D7H A;  4GIP A;  3TWK A;  2Y21 A;  2F5Q A;  3HHY A;  1HT1 E;  4IBJ A;  2RGO A;  3VKG A;  4NXM M;  3LW5 F;  5FSW A;  3A42 A;  3R9X B;  1HNW M;  3SAV A;  5L8R F;  3B7N A;  4LJ6 A;  4MB7 A;  4LF6 M;  1E32 A;  1VEG A;  1Q39 A;  4IBE A;  3GRY A;  4JI5 M;  2EJS A;  2KEB A;  5BR8 M;  3HU3 A;  3MHV C;  3CGW A;  1VEK A;  3ZC7 B;  3GO8 A;  2M5Z A;  3GRV A;  4JI2 M;  2CHQ A;  5EP3 A;  1IY1 A;  1JQJ C;  2JXN A;  4X62 M;  1JB0 F;  2MJ5 B;  4YY3 M;  2CEA A;  1SXJ C;  2P5T A;  1WJ7 A;  4IBG A;  3GQ5 A;  4G6Z A;  1C1K A;  2OOB A;  2KRK A;  3MJ5 A;  3RGP A;  5KO3 A;  5IZ7 D;  3U60 A;  3HZJ A;  1WGN A;  5BPV A;  2ZTC A;  2LTU A;  3FD9 A;  2J7O A;  1IFY A;  3KW6 A;  4DR6 M;  3HHW A;  1CUK A;  1D0K A;  1SXJ B;  1ZMW A;  2KZS A;  4L15 A;  1QAN A;  4L16 A;  2FFJ A;  3GLH E;  3U5Z B;  4K0K M;  4EIW A;  1HNX M;  2FNA A;  3JAM S;  1IY2 A;  3GLF E;  5KQD A;  2ERC A;  1N33 M;  1NNU C;  3J7A S;  1MX0 A;  3BBZ A;  3E21 A;  4M0W A;  2UUA M;  1L8Q A;  2Z4S A;  4LJ7 A;  2MR9 A;  5FTJ A;  2G3Q A;  3J80 S;  5IWA M;  1HR0 M;  2DAM A;  2KNZ A;  1OIZ A;  3VKH A;  2JY8 A;  2DEN A;  1GJS A;  2C99 A;  2KHH A;  2F5N A;  4I4L A;  2RGH A;  2LHC A;  2WSF F;  2C9O A;  1TF0 B;  2CHV A;  5DYG A;  3PNY A;  4LGY A;  1OTR A;  2XFT A;  3U6L A;  1YSY A;  1MN3 A;  2DNA A;  3M6A A;  1T6O A;  4LJA A;  2JY6 B;  3SBJ A;  1T43 A;  3A45 A;  3FUW A;  5EP4 A;  4Q7J A;  1QUS A;  3NBI A;  3BOS A;  4A3V B;  4FWH A;  3JR4 A;  4G4O A;  1QZM A;  4IBD A;  4DUZ M;  2DAG A;  1N77 A;  3KVW A;  2GQF A;  4PCZ A;  2UXC M;  1Q3B A;  2CV1 A;  4LFB M;  4JI1 M;  1V34 A;  4NOO B;  1NV8 A;  8CAT A;  4LG2 A;  1TDH A;  4L78 A;  4AQY M;  2XGN A;  4MGZ E;  4LZJ A;  1IN4 A;  2QHO B;  4DR3 M;  2JWS A;  4Y28 F;  4KO8 A;  3ZQJ A;  2LVA A;  4MGI E;  2EKF A;  3RGS A;  3PFI A;  4S12 A;  5EXP A;  3JR5 A;  4BLC A;  2C98 A;  2Z4R A;  3HGI A;  2VF8 A;  2XSZ D;  3EIE A;  1PGY A;  4CIS A;  1PJT A;  3MK6 A;  2G5G X;  4PDG A;  5JI3 E;  5FLX S;  4DV5 M;  2R4E A;  5KPR A;  2HHH M;  5DNY A;  1N75 A;  2QCU A;  3J27 B;  3TWM A;  5ITU A;  2BJW A;  1IBM M;  2QZ4 A;  1DGB A;  2UU9 M;  4QHT A;  4G4R A;  3HX3 A;  3SYK A;  3FYD A;  3AKZ A;  2LH0 A;  2I7P A;  1H6U A;  3HJQ A;  1N34 M;  3KOX E;  1XXH B;  2FE8 A;  3R8F A;  1ZQ9 A;  1JR3 D;  5EXX A;  3TL4 X;  4TUW A;  1A5T A;  4QHS A;  1IN7 A;  1E94 E;  4FCT A;  2V1U A;  3FE3 A;  2K0B X;  1L2D A;  2DAK A;  4UN2 B;  2G8L A;  3LMM A;  4IJE A;  2DZO B;  2E5L M;  1SG9 A;  2I7N A;  1GVN A;  2EA0 A;  3T6P A;  3K9P A;  4LJ4 A;  2F5O A;  3ZCB B;  4NRW A;  3GP1 A;  1NHW C;  2LVO C;  3K2L A;  3VK7 A;  1EE8 A;  4GMQ A;  3VDU A;  2VQF M;  2MGW A;  4DR2 M;  2LBC A;  1TH4 A;  2R4J A;  1XNQ M;  1XXH E;  2QQ8 A;  4B3R M;  1F4I A;  4LF9 M;  1Z5A A;  1WR1 B;  1YE9 A;  2DKL A;  3DFZ A;  4W5W A;  2LHG A;  3IG5 A;  4B3M M;  5DFL A;  3FTE A;  4CIZ A;  1IM2 A;  2WSC F;  4LF5 M;  3I01 M;  1VEJ A;  4JI0 M;  4F2L A;  1IXS B;  4AZF A;  3U6D A;  3T1H M;  1E9R A;  1K3W A;  4LF4 M;  5ITY A;  4LJ9 A;  3LVV A;  4XK8 F;  4Z8X A;  3GLI A;  5IRE B;  4IBF A;  1VQ1 A;  1IBK M;  2RKO A;  4X64 M;  2OQ4 A;  2A5Y B;  4L8R C;  3E46 A;  2H1R A;  1XWI A;  2JP7 A;  4DBG B;  4WUR A;  2UXB M;  3U6M A;  4FVM A;  2KA6 B;  1QAM A;  3L29 A;  2K6B A;  3UJN A;  3HKP A;  2L4E A;  4RF0 A;  1BVS A;  2L7H A;  3A46 A;  4DV4 M;  1D2N A;  1TDZ A;  1HT2 E;  4NC6 A;  1N32 M;  5E6J A;  2CV0 A;  4P16 A;  3I4Y A;  2B3T A;  3B89 A;  3M7G A;  4NL4 H;  2J7N A;  3T15 A;  1X37 A;  4WW0 A;  1VDL A;  1WXQ A;  3FYC A;  7CAT A;  5E26 A;  1R7R A;  2Z8Y M;  1IXR C;  4M9S A;  5FTN A;  4LRT A;  1XXH A;  3SFZ A;  2YNM D;  2X49 A;  3AJI B;  2KRU A;  1FJG M;  1OFI A;  5EP1 A;  5LMU M;  1G59 A;  1G71 A;  1HQC A;  3AOG A;  2LWX A;  3Q8X A;  2R0I A;  3C9P A;  4PD2 A;  4DV6 M;  4B7H A;  3IEC A;  3GPU A;  3T1Y M;  3LQR A;  4KOD A;  1J5E M;  2Y20 A;  4KLN A;  1NY6 A;  3CF6 E;  4JI8 M;  1DGH A;  5JI2 E;  1E9S A;  2Z3X A;  1KFV A;  3U6P A;  2HKJ A;  2H5X A;  2YR0 A;  1IXZ A;  3KFU G;  2CFO A;  2HL7 A;  5FTK A;  3GLI E;  3C58 A;  1C7Y A;  5FTM A;  1IN8 A;  4I81 A;  3FRH A;  4MH0 E;  2VQE M;  1WGL A;  2C5R A;  2OO9 A;  4OVZ A;  1TH3 A;  1QUT A;  2MH8 A;  2CV2 A;  2BWB A;  1D0L A;  1NHG C;  4X66 M;  5ITT A;  1DO2 A;  5KPZ A;  2L6O A;  1I4W A;  2XF3 A;  3KSX A;  3Q8G A;  4NXN M;  4RKU F;  3TE6 A;  3GRU A;  4AG5 A;  5ITQ A;  3GLG E;  1K3X A;  2DAI A;  4LFC M;  4JXJ A;  4DV3 M;  3TQS A;  1OFH A;  4AG6 A;  2XZF A;  3HHZ A;  4QOZ C;  4I8O A;  2V6Z M;  4REZ A;  5EXT A;  2X8A A;  1HQY E;  3B74 A;  3DZD A;  3IG8 A;  3PNV A;  2L7I A;  4QOS A;  2LVP C;  4B7G A;  2W82 A;  2ZBK B;  2R46 A;  1OJL A;  3CTW B;  1GLN A;  1J7K A;  3L25 A;  4LJ8 A;  1TGU A;  3ILK A;  4CHT B;  3U6S A;  2M60 A;  4B3S M;  3AOE A;  3U6Q A;  1J09 A;  4PDI A;  3J7B A;  3U60 B;  1UFZ A;  3CF0 A;  4FCW A;  3FRI A;  4XBO A;  1EIJ A;  1V33 A;  1NVM A;  4XGI A;  4B3T M;  1NO1 A;  1I94 M;  1TR8 A;  2DHY A;  1XNR M;  3L26 A;  4DV7 M;  4CJ6 A;  3THG A;  1QYR A;  2DXI A;  1GO5 A;  5F3W A;  1PM5 A;  1L1Z A;  2KDL A;  4G3O A;  4L6V 6;  3HHX A;  2XSZ A;  3B7Z A;  1FNN A;  2DHR A;  1W5T A;  2KW0 A;  2L2D A;  1TTE A;  2L09 A;  3AV0 A;  3D8L A;  4BBA A;  5C1B A;  2F5S A;  1NY5 A;  4Z6Y A;  2UUC M;  1P3Q Q;  3PVS A;  4RNA A;  3WHL A;  2UUB M;  4JYA M;  4MGH A;  4D82 A;  2X4A A;  3KOW E;  1UM8 A;  3K9O A;  3VDP A;  1PJJ A;  2FS1 A;  1ORY B;  2XEP A;  3I4V A;  2ZM6 M;  1ZAE A;  3J81 S; 
#chains in the Genus database with same CATH homology
 3FTD A;  3GLG A;  2DVW B;  1R2Z A;  3K92 A;  1G8P A;  3TWL A;  3UMM A;  4YHH M;  3VK8 A;  1S3S A;  1Z5C A;  4LJ5 A;  5KPT A;  2Q2E B;  4KHP M;  3OTO M;  2BNK A;  1KSF X;  1QAO A;  3PXG A;  4QNR A;  4DR1 M;  2D7E A;  4OVZ B;  2ZAO A;  2R62 A;  1QAQ A;  2F4V M;  5ITX E;  3FUU A;  3VLF B;  3KOZ E;  4LZZ A;  4G4Q A;  3U5Z A;  2F5P A;  4JI4 M;  1DGF A;  4AKH A;  2DWN A;  3FKE A;  5GKN A;  1GKI A;  3L2A A;  3GRR A;  4MGK E;  1L2C A;  3DA1 A;  1DO0 A;  3AL0 C;  1Z5B A;  3KOY E;  3UK6 A;  4GHL A;  4FW9 A;  4B08 A;  5ITR A;  2UXD M;  1DGG A;  3ZH9 B;  4JV5 M;  3FUV A;  1YUB A;  4LGM A;  2QBY B;  3E9S A;  3DOA A;  4GKK M;  5EXS A;  4RF1 A;  3WHK A;  2ZAN A;  3AOE C;  2Y0T A;  2C9C A;  2CHG A;  1K82 A;  3HJS A;  1GL7 A;  4QNM A;  4AKG A;  4DV1 M;  3U6E A;  1VDD A;  4GC5 A;  3SAT A;  1Z6T A;  1IBL M;  3H4M A;  4IBB A;  1NNJ A;  3SAR A;  4LY6 A;  3FTF A;  3KP0 E;  2DWL A;  2R45 A;  4IBC A;  4GRI A;  4OX9 M;  4ITQ A;  4JN6 A;  3GPX A;  3U61 A;  4GC9 A;  2DWM A;  3FUX A;  3GLG B;  5FTL A;  4JI6 M;  2EO2 A;  2R18 A;  4MGY E;  3I51 A;  4D81 A;  3UGJ A;  3TPZ A;  3L27 A;  2Z7J A;  1SXJ D;  2FOI C;  5IT9 S;  3KSJ A;  3AFH A;  2KZU A;  4OW0 A;  3LVW A;  1L2B A;  3W0F A;  2CE7 A;  2QEN A;  4X65 M;  2DZN B;  1IY0 A;  2QPA A;  3KDS E;  2ZAM A;  1PJI A;  5EQT A;  1T3T A;  2KXE A;  4HL4 A;  3U6C A;  1Z59 A;  4GHA A;  4DR7 M;  1R6B X;  4LRS A;  5C18 A;  4JI7 M;  4GH9 A;  1NJF A;  3GPY A;  3HJ8 A;  2VII A;  2O5R A;  3SMS A;  2XZU A;  4GIT A;  1G41 A;  1L1T A;  4DV2 M;  3SAS A;  4LFC M;  2XFS A;  4NSO B;  2C96 A;  1KYI A;  3GLF B;  3NWL A;  3L28 A;  2LNH C;  2V1C A;  4FWG A;  3GLH A;  2BJV A;  5A2Q S;  3CF2 A;  2CUZ A;  2QBY A;  2DWZ B;  3RFW A;  1XHB A;  3A98 B;  4IBI A;  3FUT A;  3SHF A;  4LFA M;  1G4A E;  3SYL A;  1IN5 A;  3RE8 A;  1XMO M;  3K1J A;  1QQW A;  2YFQ A;  4L4U A;  3HWS A;  2NQ8 C;  4IIW A;  1HNZ M;  1XC8 A;  1SXJ E;  3FTC A;  5EJC A;  2LXE A;  1LV7 A;  3QAU A;  2XH9 A;  4M9Z A;  3GLI B;  3B9P A;  3KP1 E;  3SAU A;  1Q3C A;  5EP2 A;  1NSF A;  4M9X A;  5DYI A;  3QWL A;  4CGY B;  2K47 A;  1IN6 A;  1QVR A;  3U61 B;  5KQ8 A;  3GPP A;  2R65 A;  3GQ4 A;  4HLQ A;  1NJG A;  4R7G A;  3W0L B;  1XMQ M;  5LMN M;  3LQQ A;  4IBK A;  4AI6 A;  2EUC A;  4NRV A;  4I5S A;  4ZPX A;  1N78 A;  3SMP A;  3UZU A;  4R3D A;  4B7F A;  4AKI A;  4M0D A;  3HU1 A;  4GKJ M;  4FWD A;  4JI3 M;  1SXJ A;  4NSR A;  4DR5 M;  4AW4 A;  5H37 D;  3KXE C;  1JR3 A;  2YQZ A;  4DUY M;  2D7G A;  1GL6 A;  1G3I A;  1TH2 A;  4LCB A;  2HCB A;  3M0E A;  1R2Y A;  1MU5 A;  4DV0 M;  4FD2 A;  3T38 A;  3U6O A;  3SHG B;  2JA2 A;  3K8Z A;  4OU7 A;  2Y0Q A;  3SC3 A;  3VFD A;  2XLJ A;  4D80 A;  3J2P B;  3KS4 A;  2QP9 X;  4LF7 M;  4LF8 M;  4II7 A;  3KS8 A;  4DR4 M;  1DGH B;  4MM3 B;  3GLF A;  3GQ3 A;  1N36 M;  1IQP A;  3GLH B;  4PT5 A;  5ITX A;  3EIH A;  4FCV A;  4BB9 A;  3HU2 A;  3D8B A;  2AHM A;  4IJF A;  4G4N A;  2OPF A;  3E4R A;  1W5S A;  2D7H A;  4GIP A;  3TWK A;  2Y21 A;  2F5Q A;  3HHY A;  1HT1 E;  4IBJ A;  2RGO A;  3VKG A;  4NXM M;  5FSW A;  3A42 A;  3R9X B;  1HNW M;  3SAV A;  4LF6 M;  4LJ6 A;  4MB7 A;  1E32 A;  1Q39 A;  4IBE A;  3GRY A;  4JI5 M;  2KEB A;  5BR8 M;  3HU3 A;  3MHV C;  3ZC7 B;  3GO8 A;  2M5Z A;  3GRV A;  4JI2 M;  2CHQ A;  5EP3 A;  1IY1 A;  1JQJ C;  4X62 M;  4YY3 M;  2CEA A;  1SXJ C;  2P5T A;  4IBG A;  3GQ5 A;  4G6Z A;  1C1K A;  3MJ5 A;  2KRK A;  3RGP A;  5KO3 A;  5IZ7 D;  3U60 A;  5BPV A;  3FD9 A;  2J7O A;  3KW6 A;  4DR6 M;  3HHW A;  1SXJ B;  4L15 A;  2KZS A;  1QAN A;  4L16 A;  2FFJ A;  3U5Z B;  4K0K M;  4EIW A;  1HNX M;  2FNA A;  3JAM S;  1IY2 A;  5KQD A;  2ERC A;  1N33 M;  1NNU C;  3J7A S;  1MX0 A;  4M0W A;  2UUA M;  1L8Q A;  2Z4S A;  4LJ7 A;  3J80 S;  5FTJ A;  1HR0 M;  5IWA M;  3VKH A;  2C99 A;  2F5N A;  4I4L A;  2RGH A;  2C9O A;  2CHV A;  5DYG A;  3PNY A;  4LGY A;  2XFT A;  3U6L A;  1YSY A;  3M6A A;  4LJA A;  3SBJ A;  3A45 A;  3FUW A;  5EP4 A;  3NBI A;  3BOS A;  4A3V B;  4FWH A;  3JR4 A;  4G4O A;  1QZM A;  4IBD A;  4DUZ M;  1N77 A;  3KVW A;  4PCZ A;  2UXC M;  1Q3B A;  2CV1 A;  4LFB M;  4JI1 M;  4NOO B;  8CAT A;  4LG2 A;  1TDH A;  4L78 A;  4AQY M;  2XGN A;  4MGZ E;  4LZJ A;  1IN4 A;  4DR3 M;  4KO8 A;  4MGI E;  3RGS A;  3JR5 A;  4NRW A;  3PFI A;  4S12 A;  5EXP A;  4BLC A;  2C98 A;  2Z4R A;  3HGI A;  2XSZ D;  3EIE A;  4CIS A;  4PDG A;  3MK6 A;  2G5G X;  5JI3 E;  5FLX S;  4DV5 M;  2R4E A;  5KPR A;  2HHH M;  5DNY A;  1N75 A;  2QCU A;  3J27 B;  3TWM A;  5ITU A;  2BJW A;  1IBM M;  2QZ4 A;  1DGB A;  2UU9 M;  4QHT A;  4G4R A;  3SYK A;  3FYD A;  3AKZ A;  2LH0 A;  2I7P A;  1H6U A;  3HJQ A;  1N34 M;  3KOX E;  1XXH B;  2FE8 A;  3R8F A;  1ZQ9 A;  1JR3 D;  5EXX A;  3TL4 X;  4TUW A;  4QHS A;  1IN7 A;  1E94 E;  4FCT A;  2V1U A;  1L2D A;  2G8L A;  3LMM A;  4IJE A;  2DZO B;  2E5L M;  2I7N A;  1GVN A;  2EA0 A;  4LJ4 A;  2F5O A;  3ZCB B;  3GP1 A;  1NHW C;  3K2L A;  3VK7 A;  1EE8 A;  4GMQ A;  3VDU A;  2VQF M;  4DR2 M;  1TH4 A;  2R4J A;  1XNQ M;  4B3R M;  4LF9 M;  1Z5A A;  1YE9 A;  3DFZ A;  4W5W A;  3IG5 A;  4B3M M;  3FTE A;  1IM2 A;  4LF5 M;  4JI0 M;  3U6D A;  1IXS B;  4AZF A;  3T1H M;  1E9R A;  1K3W A;  4LF4 M;  5ITY A;  4LJ9 A;  3LVV A;  4Z8X A;  1IBK M;  3GLI A;  5IRE B;  4IBF A;  2RKO A;  4X64 M;  2OQ4 A;  2A5Y B;  4L8R C;  2H1R A;  1XWI A;  4WUR A;  2UXB M;  3U6M A;  4FVM A;  2KA6 B;  1QAM A;  3L29 A;  3A46 A;  3UJN A;  3HKP A;  4RF0 A;  4DV4 M;  3SAW A;  2L7H A;  1D2N A;  1TDZ A;  1HT2 E;  1N32 M;  5E6J A;  2CV0 A;  4P16 A;  3I4Y A;  4NL4 H;  3M7G A;  2J7N A;  3T15 A;  1X37 A;  4WW0 A;  1WXQ A;  3FYC A;  7CAT A;  5E26 A;  1R7R A;  1IXR C;  4M9S A;  5FTN A;  4LRT A;  1XXH A;  3SFZ A;  2YNM D;  2X49 A;  3AJI B;  2KRU A;  1FJG M;  1OFI A;  5EP1 A;  5LMU M;  1G59 A;  1HQC A;  3AOG A;  2LWX A;  3Q8X A;  4PD2 A;  4DV6 M;  4B7H A;  3GPU A;  3T1Y M;  3LQR A;  4KOD A;  1J5E M;  2Y20 A;  4KLN A;  1NY6 A;  3CF6 E;  4JI8 M;  1DGH A;  5JI2 E;  1E9S A;  2Z3X A;  1KFV A;  3U6P A;  2HKJ A;  2YR0 A;  1IXZ A;  3KFU G;  2CFO A;  2HL7 A;  5FTK A;  3C58 A;  5FTM A;  1IN8 A;  4I81 A;  4MH0 E;  2VQE M;  2C5R A;  4OVZ A;  1TH3 A;  2CV2 A;  1NHG C;  4X66 M;  5ITT A;  1DO2 A;  5KPZ A;  2L6O A;  1I4W A;  2XF3 A;  3KSX A;  4NXN M;  3TE6 A;  5ITQ A;  4AG5 A;  3GRU A;  1K3X A;  4JXJ A;  4DV3 M;  3TQS A;  1OFH A;  4AG6 A;  2XZF A;  3HHZ A;  4QOZ C;  4I8O A;  2V6Z M;  4REZ A;  5EXT A;  2X8A A;  1HQY E;  3DZD A;  3IG8 A;  3PNV A;  2L7I A;  4QOS A;  4B7G A;  2W82 A;  2ZBK B;  2R46 A;  1OJL A;  3CTW B;  1GLN A;  1J7K A;  3L25 A;  4LJ8 A;  1TGU A;  3ILK A;  4CHT B;  3U6S A;  2M60 A;  4B3S M;  3AOE A;  3U6Q A;  1J09 A;  4PDI A;  3J7B A;  3U60 B;  3CF0 A;  4FCW A;  4XBO A;  1NVM A;  4XGI A;  4B3T M;  1I94 M;  1XNR M;  3L26 A;  4DV7 M;  3THG A;  1QYR A;  2DXI A;  5F3W A;  1PM5 A;  1L1Z A;  3HHX A;  2XSZ A;  1FNN A;  2DHR A;  1W5T A;  2KW0 A;  3D8L A;  4BBA A;  2L09 A;  3AV0 A;  5C1B A;  2F5S A;  2UUC M;  1NY5 A;  4Z6Y A;  3WHL A;  3PVS A;  4RNA A;  2UUB M;  4JYA M;  4MGH A;  4D82 A;  2X4A A;  3KOW E;  1UM8 A;  3VDP A;  1PJJ A;  1ORY B;  2XEP A;  3I4V A;  2ZM6 M;  1ZAE A;  3J81 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...