2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 26S proteasome non-ATPase regulatory subunit 10
publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/protein-binding
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
2CHGA 3EIEA 4LCBA 4QHSA 2BJVA 4QNMA 4FWDA 3EIHA 2R65A 5EP3A 1IY1A 2CHVA 4LJ6A 3U60B 5FTNA 4L16A 2QZ4A 3CF0A 3K1JA 3CF2A 1NVMA 2ZAMA 1XXHA 5FTJA 1NJGA 2KRKA 1IY0A 1XWIA 4A3VB 1J7KA 4LJ5A 3GLHA 4FW9A 1W5TA 5EXPA 3HU1A 1NJFA 2CHQA 4D81A 4I4LA 1QVRA 3DZDA 4JN6A 1IN5A 3GLIB 1G4AE 2XSZA 2Z4SA 3B9PA 3AJIB 1S3SA 2CE7A 5JI2E 1E32A 1X37A 4I81A 5EXTA 1KYIA 4KO8A 4L4UA 3KW6A 1W5SA 4ZPXA 3GLFA 1IQPA 2C99A 2XSZD 2C96A 2V1UA 3HWSA 3GLHB 1L8QA 2QBYA 5EP1A 1DO2A 3D8BA 1JR3A 2QP9X 1SXJA 1OFHA 1SXJC 2C9OA 3MHVC 3GLGA 1DO0A 2X8AA 4WW0A 3U5ZB 5EP4A 4L15A 2RKOA 1IY2A 4KODA 4LJAA 4FCWA 1R6BX 1HQCA 3GLFB 4LJ7A 4Z8XA 1JR3D 3SYLA 1OFIA 4LRSA 5EP2A 5FTMA 3UK6A 1XXHB 1IXRC 2CEAA 2ZANA 1SXJE 3SC3A 3M0EA 1NY5A 2QBYB 5C1BA 1IXZA 4FWHA 4LJ8A 1HT1E 2Z4RA 1SXJB 4LGMA 4FD2A 3SYKA 2C98A 1FNNA 1G41A 4LY6A 4QOSA 1IM2A 2ZAOA 1E94E 2DWZB 1NSFA 1IXSB 2V6ZM 2R62A 5DYIA 4D80A 4LJ4A 4LZZA 3ZH9B 3GLIA 3HU2A 4FWGA 1IN4A 5FTKA 1UM8A 1HT2E 3KDSE 2QENA 2BJWA 4FCTA 3VFDA 3WHLA 3HU3A 2DZOB 3VLFB 5C18A 2DZNB 1IN6A 5EXSA 1SXJD 3WHKA 4KLNA 5JI3E 1OJLA 5DYGA 1C1KA 1HQYE 3H4MA 1G3IA 2VIIA 2HCBA 3M6AA 5EXXA 1JQJC 1QZMA 1IN7A 1LV7A 4FCVA 2DVWB 4LJ9A 4GITA 3R8FA 4LRTA 3PXGA 2DHRA 3PFIA 3GLGB 3BOSA 1IN8A 1R7RA 2QPAA 5FTLA 1KSFX 2FNAA 1D2NA 1NY6A 5EQTA 4QHTA 4QNRA 4D82A 4EIWA 3PVSA 2C9CA 3U61B
chains in the Genus database with same CATH superfamily
3EIEA 2Q2EB 1DGFA 5KQDA 2J5YA 2DXIA 1SG9A 3EIHA 2R65A 3QAUA 4IBIA 3OTOM 2CHVA 4L16A 2QZ4A 3CF0A 3TWKA 1TDHA 3DFZA 1PJTA 1ZMWA 3HX3A 1PJJA 4K0KM 2VDBB 3FRIA 4GEWA 2HWJA 3J27B 3U6LA 3A46A 1DGHB 1TH4A 1D0MA 3AOGA 1W5TA 4FW9A 4RNAA 5EXPA 3SHGB 5KQ8A 1QUTA 1ORYB 4I4LA 3GLIE 4MGKE 5KO3A 3HHWA 1D0LA 3I4VA 4IJEA 4IBGA 1N36M 4CISA 3QYBA 1QAMA 4CIZA 1CUKA 4IIWA 3GLIB 1G4AE 2XSZA 2WZJA 2JY6B 4L6V6 2ZBKB 2GNOA 3GRYA 2CE7A 1TR8A 1XMQM 3UJNA 1QAQA 3MMPA 4I81A 4LF8M 3K8ZA 2ZTDA 3JR4A 5IREB 3GLHE 1ZMUA 3A98B 4DUZM 1I4WA 4Y28F 3GLHB 3IHPA 5KPTA 5IZ7D 4OX9M 3W0FA 1TGUA 4I5SA 1J5EM 1L8QA 2QBYA 2Z3XA 4G4QA 3SMPA 1YUBA 3D8BA 4JI1M 1JR3A 1K3WA 2Z7JA 4OVZA 1ZAEA 1OFHA 1SXJC 2RRUA 4GHAA 2QHOB 3M7GA 4R71A 2XZUA 3J80S 1G71A 2X8AA 2MGWA 3GLFE 1NHWC 3PNYA 4L15A 1N34M 4KODA 2FE8A 1NNJA 4FCWA 4NXMM 3AOEC 1R6BX 3GLFB 5FSWA 2RGHA 1QDTA 2DZLA 2CUZA 3AFHA 3SATA 3UK6A 4IBJA 4IBBA 2DWLA 2UXCM 3U60A 4AKHA 1NV9A 2D7EA 4B7FA 1PJIA 3K92A 5BR8M 4B3SM 2LNHC 1HT1E 4FD2A 3SYKA 1Y8GA 4LF4M 2C98A 3KXEC 2APLA 4GC9A 1IM2A 3LMMA 2K9DA 1T43A 2JZ1A 1NSFA 5ITXE 1V34A 2G8LA 1IXSB 4GC5A 1V33A 2JY7A 4LF5M 2EUCA 4OU7A 4LZZA 2R6FA 3NBXX 4DR3M 1NV8A 1WGLA 3TPZA 1ZQ9A 2XLJA 2BJWA 4II7A 4HEOA 3WHLA 4W5WA 4BBAA 4M0WA 3KS8A 2DZNB 2WSCF 4AW4A 1Q3CA 4JXJA 4KLNA 1XC8A 1AIPC 4QOZC 3H4MA 2LXEA 1MJGM 2VIIA 3GLGE 1UFZA 2DWNA 4LJ9A 4DV6M 2DVWB 2OOAA 3C9PA 4UN2B 3ZC7B 4JI6M 3PFIA 5GKNA 3GLGB 3U6SA 1IN8A 2F5OA 1R7RA 2L7HA 3IG8A 2QPAA 5FTLA 1KSFX 4JI5M 1D2NA 2LTUA 4FVMA 4DR2M 3KOZE 1L2CA 3RE8A 4QHTA 4IBEA 4EIWA 4G4NA 3U61B 2C9CA 3U5ZA 1K82A 2R18A 3U6EA 2BJVA 4FWDA 3SMSA 4L8RC 4KHPM 1DGGA 2W82A 4MGZE 4WURA 3Q8XA 5E26A 5EP3A 4JI3M 2KA6B 3HY5A 3TL4X 2DHYA 1IY1A 3T15A 4NOOB 1WHCA 4PDIA 1C7YA 3FUUA 1XXHA 2ZM6M 5FTJA 2ZTCA 1NJGA 2F5PA 2LH0A 5IWAM 1G8PA 2KRKA 1XWIA 1FJGM 3SARA 4A3VB 4B3TM 1MX0A 3FUTA 1G59A 2HHHM 2UU9M 1AUAA 1JB0F 3T6PA 2F5QA 3DZDA 3HJSA 2LVNC 3L28A 4P16A 2EJSA 4X66M 1IBKM 2EO2A 3NWLA 4L78A 2XEPA 1R2YA 1P3QQ 3B9PA 1K3XA 1PJQA 3L29A 4B3MM 3L25A 2Y0QA 1QDRA 5JI2E 2LWXA 1IBLM 2D7HA 2L4FA 5ITUA 1X37A 1N78A 3KW6A 1W5SA 1GABA 1V92A 2R45A 3FYCA 1QZEA 2M60A 5ITYA 3A42A 2C96A 3HWSA 2WSFF 3GQ4A 1EE8A 2Y21A 4LZJA 3KP0E 5A2QS 2K0BX 4Z6YA 5L8RF 1GLNA 1XHBA 1VEGA 2KXEA 2K47A 1KFVA 1SXJA 2KDLA 3FD9A 1E9SA 3IG5A 4G3OA 4JI7M 2M5ZA 4WW0A 1VDLA 2HAKA 3CTWB 1YSYA 3QWLA 3ZCBB 2KNVA 2RKOA 5LMUM 2F5SA 4DV1M 4DR1M 3AOEA 1L1TA 3LVVA 4CGYB 4TUWA 1I94M 1OFIA 4NRVA 3KOWE 4LRSA 1GVNA 4X62M 3HHYA 1JR3E 3U6CA 2JZ0A 2ZANA 3SC3A 4LFCM 3M0EA 4PT5A 2UUCM 2QBYB 2G5GX 4OVZB 4DV0M 2CV0A 2R0IA 4AZFA 2MJ5B 3GPXA 3B89A 4IBDA 3HKPA 1A5TA 4IJFA 4AI6A 2JNHA 2KRUA 1WJ7A 3E21A 3VKHA 2KW0A 3AV0A 3HGIA 3KVWA 2R62A 1GL7A 2JA2A 3DOAA 3GLIA 2Y0TA 4FWGA 5FTKA 1PM5A 3VDPA 1IFYA 2YFQA 3KDSE 3W67A 3VFDA 2KZSA 4G4RA 1SXJD 2LHCA 1OIPA 1OAIA 2DENA 2FOIC 4G6ZA 4X64M 3VK8A 5DYGA 3THGA 2DWMA 4DR4M 5FLXS 4LFAM 4B08A 1IBMM 2UXDM 4XGIA 4JI8M 5EXXA 3FYDA 3I01M 2BNKA 1HR0M 4GITA 4LRTA 3AKZA 2DHRA 3J2PB 2LVOC 3U6DA 4S12A 2OOBA 4PD2A 3Q8GA 4LGYA 1MU5A 3GRUA 3LCVB 4MGIE 4CHTB 2UUAM 2VF7A 1L2BA 3AL0C 4D82A 1TTEA 2CV2A 5EJCA 2CFOA 2CRUA 1F4IA 2OQ4A 1TH3A 3TWMA 1R4GA 4GHLA 4DV2M 1Q39A 4LJ6A 3GPUA 4WP2A 2V1CA 2YNMD 3K1JA 3KSJA 2AHMA 3VK7A 1NVMA 5DNYA 2KNZA 1R5LA 4DV3M 3LCUA 3T1YM 1IY0A 3J81S 2OPFA 1J7KA 1ZV1A 4LJ5A 3TE6A 3HU1A 1NJFA 2CHQA 3UZUA 4M9XA 2RGOA 1Z6TA 1QVRA 1DV0A 4JN6A 4R7GA 1IN5A 2A5YB 3K9OA 4LF9M 1T6OA 2BWEA 3U6PA 4LF7M 2J7OA 3W0LB 1IXSA 1OIZA 2DKLA 3A45A 3HHXA 4NSOB 4B3RM 2XGNA 1KYIA 1D0KA 4OW0A 3SASA 4L4UA 3D8LA 3W68A 1IQPA 2C99A 3L26A 1XB2B 2WSEF 2XF3A 1GKIA 2LVQD 4BLCA 3SHFA 1GJTA 2V1UA 4GMQA 1Z5CA 4DR7M 4Q7JA 4MGHA 5EP1A 2X49A 3DA1A 5LMNM 4B7GA 3B74A 4NRWA 3U6OA 5E6JA 3BXWA 3GLGA 3L2AA 3T1HM 2GQFA 5ITQA 2EKKA 3RGSA 5EP4A 2H1RA 1XMOM 1OQYA 4LG2A 3FTFA 4P17A 1IY2A 4DV4M 4LJAA 2J7NA 4YY3M 3SAVA 2KNAA 1XNRM 2OO9A 1HQCA 1VEKA 4HLQA 3I04M 3J7BA 4Z8XA 1PGYA 3SYLA 4ITQA 5EP2A 3E9SA 4NL4H 2KHHA 5FTMA 3C58A 3CF6E 1H6UA 2I7PA 2KEBA 1Q02A 2DAIA 3LW5F 1SXJE 1EIJA 1NY5A 2K6BA 4AG5A 2Y20A 1IXZA 5C1BA 3U6MA 3HHZA 2L7IA 4ANRA 2JXNA 4FWHA 2Z4RA 1Q3BA 1SXJB 4LGMA 4JI2M 2DAGA 3GRRA 4GRIA 2LVPC 1MN3A 2MH8A 3SFZA 1G41A 2F4VM 2VQFM 4XK8F 4QOSA 3FTEA 2ZAOA 3U6QA 5F3WA 1WIVA 2HL7A 3HZJA 2V6ZM 1NHGC 5DYIA 2R44A 4LJ4A 4GKKM 4RF1A 3ZH9B 1GJSA 1IN4A 1TF0B 1UM8A 3B7QA 1N77A 3LVWA 4MM3B 1Z59A 2JY5A 1DGBA 4FCTA 1ZMVA 3HU3A 7CATA 1QQWA 5C18A 3L27A 1IN6A 5ITTA 4KT0F 4GH9A 3K9PA 5IT9S 3B7NA 2JY8A 1TH2A 4AQYM 4JI0M 1OJLA 2L09A 1L1ZA 1C1KA 1HQYE 3HJ8A 1YLAA 3H4JA 1G3IA 4MH0E 2XH9A 4NSRA 3SAWA 4JV5M 1QZMA 1IN7A 1LV7A 1BVSA 2UXBM 3UMMA 5DFLA 1DGHA 1WGNA 2JUJA 3MJ5A 1OAOC 2FNAA 3KP1E 1N32M 1NY6A 2I7NA 2KZUA 3JAMS 4MGYE 4QNRA 3SBJA 1NO1A 2CHGA 2DAKA 1HJPA 1GO5A 4LCBA 4QHSA 2HKJA 2G3QA 4QNMA 3B7ZA 2QNJA 1PRBA 1R2ZA 3C3EA 1GL6A 3U60B 5FTNA 3GQ5A 1XNQM 1OTRA 2QCUA 3CF2A 3F92A 2ZAMA 2DAEA 2L2DA 3GRVA 3KSXA 4YHHM 2N35A 3KOXE 2JWSA 2D7GA 2MR9A 1QANA 2XFTA 1L2DA 3FUVA 4DR6M 3GPYA 4HL4A 3ZQJA 3GLHA 4R3DA 2CV1A 3VDUA 1YE9A 4D81A 4MB7A 5KPRA 3E4RA 2FH0A 3FE3A 1LTMA 5ITRA 3I4YA 1VG5A 3FKEA 2Z4SA 2MROB 8CATA 3AJIB 1S3SA 3FTCA 2VQEM 1E32A 5EXTA 3KFUG 1E9RA 2XZFA 3FUXA 3FTDA 4KO8A 4B7HA 1RU3A 4ZPXA 3GLFA 2FFJA 2LVAA 4F2LA 2R4JA 1T3TA 2XSZD 2EA0A 4X65M 3FRHA 4NXNM 4DR5M 2XFSA 1PJSA 3IECA 5BPVA 3RGPA 2X4AA 2BWBA 3FUWA 3TWLA 3QYEA 1DO2A 3K2LA 4DV7M 1N33M 2QP9X 4DBGB 3I51A 1HNXM 4JYAM 2Z8YM 1VDDA 2C9OA 3LQQA 3MHVC 4M0DA 1HNZM 2O5RA 2YQZA 1DO0A 4IBFA 2QSFX 3U5ZB 1NNUC 2DNAA 4LFBM 1Z5BA 5H37D 1HNWM 4LJ7A 1XXHE 4CJ6A 3MK6A 1JR3D 4IBCA 2E5LM 5ITXA 2ERCA 2DI0A 2O25A 2CWBA 4F1IA 3T38A 1XXHB 4AKGA 1IXRC 2CEAA 3PNVA 1QYRA 3HJQA 1WR1B 2R46A 1VQ1A 3J7AS 4NC6A 4BB9A 4LJ8A 4PCZA 5KPZA 3RFWA 2LBCA 2DAMA 3CGWA 1EFUB 1FNNA 4LY6A 4M9ZA 3GQ3A 2UUBM 3VKGA 1QAOA 2F5NA 4LF6M 1E94E 2DWZB 3UGJA 2EKFA 1WXQA 2L4EA 2P5TA 2YR0A 4D80A 3SAUA 4IBKA 2L6OA 4JI4M 2QQ8A 3R9XB 3HU2A 3C3DA 4RKUF 2FS1A 4M9SA 1HT2E 3JR5A 2CP8A 2QENA 3U61A 4PDGA 1TDZA 3BBZA 4AKIA 2DZOB 4GIPA 3TQSA 3VLFB 3E46A 1QUSA 2VF8A 5EXSA 3WHKA 2NQ8C 2JP7A 2LHGA 3GO8A 3V76A 5JI3E 3ILKA 4DUYM 1J09A 3KS4A 1OKSA 3NBIA 1VEJA 1Z5AA 2HCBA 3M6AA 2C5RA 2R4EA 1JQJC 4FCVA 4G4OA 4XBOA 4DV5M 2O01F 3R8FA 3PXGA 3LQRA 3BOSA 4REZA 3GPPA 4RF0A 2B3TA 2H5XA 5EQTA 3KOYE 3GP1A 3PVSA 4I8OA 4GKJM 1N75A 4AG6A
chains in the Genus database with same CATH topology
3EIEA 2Q2EB 1DGFA 5KQDA 2DXIA 3EIHA 2R65A 3QAUA 4IBIA 3OTOM 2CHVA 4L16A 2QZ4A 3CF0A 3TWKA 1TDHA 3DFZA 1PJJA 4K0KM 3J27B 3U6LA 3A46A 1DGHB 1TH4A 4RNAA 3AOGA 1W5TA 4FW9A 5EXPA 3SHGB 5KQ8A 1ORYB 4I4LA 4MGKE 5KO3A 3HHWA 3I4VA 4IJEA 4IBGA 1N36M 4CISA 1QAMA 4IIWA 3GLIB 1G4AE 2XSZA 2ZBKB 3GRYA 2CE7A 1XMQM 3UJNA 1QAQA 4I81A 4LF8M 3K8ZA 3JR4A 5IREB 3A98B 4DUZM 1I4WA 3GLHB 5KPTA 4OX9M 5IZ7D 3W0FA 1TGUA 4I5SA 1J5EM 1L8QA 2QBYA 2Z3XA 4G4QA 3SMPA 1YUBA 3D8BA 4JI1M 1JR3A 1K3WA 2Z7JA 4OVZA 1ZAEA 1OFHA 1SXJC 4GHAA 3M7GA 2XZUA 3J80S 2X8AA 1NHWC 3PNYA 4L15A 1N34M 4KODA 2FE8A 1NNJA 4FCWA 4NXMM 3AOEC 1R6BX 3GLFB 5FSWA 2RGHA 2CUZA 3AFHA 3SATA 3UK6A 4IBJA 4IBBA 2DWLA 2UXCM 3U60A 4AKHA 2D7EA 4B7FA 1PJIA 3K92A 5BR8M 4B3SM 2LNHC 1HT1E 4FD2A 3SYKA 4LF4M 2C98A 3KXEC 4GC9A 1IM2A 3LMMA 1NSFA 5ITXE 2G8LA 1IXSB 4GC5A 4LF5M 2EUCA 4OU7A 4LZZA 4DR3M 3TPZA 1ZQ9A 2XLJA 2BJWA 4II7A 3WHLA 4W5WA 4BBAA 4M0WA 3KS8A 2DZNB 4AW4A 1Q3CA 4JXJA 4KLNA 1XC8A 4QOZC 3H4MA 2LXEA 2VIIA 2DWNA 4LJ9A 4DV6M 2DVWB 4JI6M 3ZC7B 3PFIA 5GKNA 3GLGB 3U6SA 1IN8A 2F5OA 1R7RA 2L7HA 3IG8A 2QPAA 5FTLA 1KSFX 4JI5M 1D2NA 4DR2M 4FVMA 3KOZE 1L2CA 3RE8A 4QHTA 4IBEA 4EIWA 4G4NA 3U61B 2C9CA 3U5ZA 1K82A 2R18A 3U6EA 2BJVA 4FWDA 3SMSA 4L8RC 4KHPM 1DGGA 2W82A 4MGZE 4WURA 3Q8XA 5E26A 5EP3A 4JI3M 2KA6B 3TL4X 1IY1A 3T15A 4NOOB 4PDIA 3FUUA 1XXHA 2ZM6M 5FTJA 1NJGA 2F5PA 2LH0A 5IWAM 1G8PA 2KRKA 1XWIA 1FJGM 3SARA 4A3VB 4B3TM 1MX0A 3FUTA 1G59A 2HHHM 2UU9M 2F5QA 3DZDA 3HJSA 3L28A 4P16A 4X66M 1IBKM 2EO2A 3NWLA 4L78A 2XEPA 1R2YA 1K3XA 3B9PA 4B3MM 3L29A 3L25A 2Y0QA 5JI2E 2LWXA 1IBLM 2D7HA 5ITUA 1X37A 1N78A 3KW6A 1W5SA 2R45A 3FYCA 2M60A 5ITYA 3A42A 2C96A 3HWSA 3GQ4A 1EE8A 2Y21A 4LZJA 3KP0E 5A2QS 4Z6YA 1GLNA 1XHBA 2KXEA 2K47A 1KFVA 1SXJA 3IG5A 3FD9A 1E9SA 4JI7M 2M5ZA 4WW0A 3CTWB 1YSYA 3QWLA 3ZCBB 2RKOA 5LMUM 2F5SA 4DV1M 4DR1M 3AOEA 1L1TA 3LVVA 4CGYB 4TUWA 1I94M 1OFIA 4NRVA 3KOWE 4LRSA 1GVNA 4X62M 3HHYA 3U6CA 2ZANA 3SC3A 4LFCM 3M0EA 4PT5A 2UUCM 2QBYB 2G5GX 4OVZB 4DV0M 2CV0A 4AZFA 3GPXA 4IBDA 3HKPA 4IJFA 4AI6A 2KRUA 3VKHA 2KW0A 3AV0A 3HGIA 3KVWA 2R62A 1GL7A 2JA2A 3DOAA 3GLIA 2Y0TA 4FWGA 5FTKA 1PM5A 3VDPA 2YFQA 3KDSE 3VFDA 2KZSA 4G4RA 1SXJD 2FOIC 4X64M 4G6ZA 3VK8A 5DYGA 3THGA 2DWMA 4DR4M 5FLXS 4LFAM 4B08A 1IBMM 2UXDM 4XGIA 4JI8M 5EXXA 3FYDA 2BNKA 1HR0M 4GITA 4LRTA 3AKZA 2DHRA 3J2PB 3U6DA 4S12A 4PD2A 4LGYA 1MU5A 3GRUA 4MGIE 4CHTB 2UUAM 1L2BA 3AL0C 4D82A 2CV2A 5EJCA 2CFOA 2OQ4A 1TH3A 3TWMA 4GHLA 4DV2M 1Q39A 4LJ6A 3GPUA 2V1CA 2YNMD 3K1JA 3KSJA 2AHMA 3VK7A 1NVMA 5DNYA 4DV3M 3T1YM 1IY0A 3J81S 2OPFA 1J7KA 4LJ5A 3TE6A 3HU1A 1NJFA 2CHQA 3UZUA 4M9XA 2RGOA 1Z6TA 1QVRA 4JN6A 4R7GA 1IN5A 2A5YB 4LF9M 4LF7M 3U6PA 2J7OA 3W0LB 3HHXA 3A45A 4NSOB 4B3RM 2XGNA 1KYIA 4OW0A 3SASA 4L4UA 3D8LA 1IQPA 2C99A 3L26A 2XF3A 1GKIA 4BLCA 2V1UA 3SHFA 4GMQA 1Z5CA 4DR7M 4MGHA 5EP1A 5LMNM 2X49A 3DA1A 4B7GA 4NRWA 3U6OA 5E6JA 3GLGA 3L2AA 3T1HM 5ITQA 3RGSA 5EP4A 2H1RA 1XMOM 4LG2A 3FTFA 1IY2A 4DV4M 4LJAA 2J7NA 4YY3M 3SAVA 1XNRM 1HQCA 4HLQA 3J7BA 4Z8XA 3SYLA 4ITQA 5EP2A 3E9SA 4NL4H 5FTMA 3C58A 3CF6E 1H6UA 2I7PA 2KEBA 1SXJE 1NY5A 4AG5A 2Y20A 1IXZA 5C1BA 3U6MA 3HHZA 2L7IA 4FWHA 2Z4RA 1Q3BA 1SXJB 4LGMA 4JI2M 3GRRA 4GRIA 3SFZA 2F4VM 1G41A 2VQFM 3FTEA 4QOSA 2ZAOA 3U6QA 5F3WA 2HL7A 2V6ZM 1NHGC 5DYIA 4LJ4A 4GKKM 4RF1A 3ZH9B 1IN4A 1UM8A 1N77A 3LVWA 4MM3B 1Z59A 4FCTA 1DGBA 3HU3A 7CATA 1QQWA 5C18A 3L27A 1IN6A 5ITTA 5IT9S 4GH9A 1TH2A 4AQYM 4JI0M 1OJLA 2L09A 1L1ZA 1C1KA 1HQYE 3HJ8A 1G3IA 4MH0E 2XH9A 4NSRA 3SAWA 4JV5M 1QZMA 1IN7A 1LV7A 2UXBM 3UMMA 1DGHA 3MJ5A 2FNAA 3KP1E 1N32M 1NY6A 2I7NA 2KZUA 3JAMS 4MGYE 4QNRA 3SBJA 2CHGA 4LCBA 4QHSA 2HKJA 4QNMA 1R2ZA 1GL6A 3U60B 5FTNA 3GQ5A 1XNQM 2QCUA 3CF2A 2ZAMA 3KSXA 3GRVA 4YHHM 3KOXE 4DR6M 2D7GA 2XFTA 1QANA 1L2DA 3FUVA 3GPYA 4HL4A 3GLHA 4R3DA 2CV1A 3VDUA 1YE9A 4D81A 4MB7A 5KPRA 3E4RA 5ITRA 3I4YA 3FKEA 2Z4SA 8CATA 3AJIB 1S3SA 3FTCA 2VQEM 1E32A 5EXTA 3KFUG 1E9RA 2XZFA 3FUXA 3FTDA 4KO8A 4B7HA 4ZPXA 3GLFA 2FFJA 2R4JA 1T3TA 2XSZD 2EA0A 4X65M 4NXNM 4DR5M 2XFSA 5BPVA 3RGPA 2X4AA 3FUWA 3TWLA 4DV7M 1DO2A 3K2LA 1N33M 2QP9X 3I51A 1HNXM 4JYAM 3MHVC 1VDDA 2C9OA 3LQQA 4M0DA 1HNZM 2O5RA 2YQZA 1DO0A 4IBFA 3U5ZB 1NNUC 4LFBM 1Z5BA 5H37D 1HNWM 4LJ7A 3MK6A 1JR3D 4IBCA 2E5LM 5ITXA 2ERCA 3T38A 1XXHB 4AKGA 1IXRC 2CEAA 3PNVA 1QYRA 3HJQA 2R46A 3J7AS 4BB9A 4LJ8A 4PCZA 5KPZA 3RFWA 4M9ZA 3GQ3A 1FNNA 3VKGA 4LY6A 2UUBM 1QAOA 2F5NA 4LF6M 1E94E 2DWZB 3UGJA 1WXQA 2P5TA 2YR0A 4D80A 3SAUA 4IBKA 2L6OA 4JI4M 3R9XB 3HU2A 4M9SA 1HT2E 3JR5A 2QENA 3U61A 4PDGA 1TDZA 4AKIA 2DZOB 4GIPA 3TQSA 3VLFB 5EXSA 3WHKA 2NQ8C 3GO8A 5JI3E 3ILKA 4DUYM 1J09A 3KS4A 3NBIA 1Z5AA 2HCBA 3M6AA 2C5RA 2R4EA 1JQJC 4FCVA 4G4OA 4XBOA 4DV5M 3R8FA 3PXGA 3LQRA 3BOSA 4REZA 3GPPA 4RF0A 5EQTA 3KOYE 3GP1A 3PVSA 4I8OA 4GKJM 1N75A 4AG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHG A;  3EIE A;  4LCB A;  4QHS A;  2BJV A;  4QNM A;  4FWD A;  3EIH A;  2R65 A;  5EP3 A;  1IY1 A;  2CHV A;  4LJ6 A;  3U60 B;  5FTN A;  4L16 A;  2QZ4 A;  3CF0 A;  3K1J A;  3CF2 A;  1NVM A;  2ZAM A;  1XXH A;  5FTJ A;  1NJG A;  2KRK A;  1IY0 A;  1XWI A;  4A3V B;  1J7K A;  4LJ5 A;  3GLH A;  4FW9 A;  1W5T A;  5EXP A;  3HU1 A;  1NJF A;  2CHQ A;  4D81 A;  4I4L A;  1QVR A;  3DZD A;  4JN6 A;  1IN5 A;  3GLI B;  1G4A E;  2XSZ A;  2Z4S A;  3B9P A;  3AJI B;  1S3S A;  2CE7 A;  5JI2 E;  1E32 A;  1X37 A;  4I81 A;  5EXT A;  1KYI A;  4KO8 A;  4L4U A;  3KW6 A;  1W5S A;  4ZPX A;  3GLF A;  1IQP A;  2C99 A;  2XSZ D;  2C96 A;  2V1U A;  3HWS A;  3GLH B;  1L8Q A;  2QBY A;  5EP1 A;  1DO2 A;  3D8B A;  1JR3 A;  2QP9 X;  1SXJ A;  1OFH A;  1SXJ C;  2C9O A;  3MHV C;  3GLG A;  1DO0 A;  2X8A A;  4WW0 A;  3U5Z B;  5EP4 A;  4L15 A;  2RKO A;  1IY2 A;  4KOD A;  4LJA A;  4FCW A;  1R6B X;  1HQC A;  3GLF B;  4LJ7 A;  4Z8X A;  1JR3 D;  3SYL A;  1OFI A;  4LRS A;  5EP2 A;  5FTM A;  3UK6 A;  1XXH B;  1IXR C;  2CEA A;  2ZAN A;  1SXJ E;  3SC3 A;  3M0E A;  1NY5 A;  2QBY B;  5C1B A;  1IXZ A;  4FWH A;  4LJ8 A;  1HT1 E;  2Z4R A;  1SXJ B;  4LGM A;  4FD2 A;  3SYK A;  2C98 A;  1FNN A;  1G41 A;  4LY6 A;  4QOS A;  1IM2 A;  2ZAO A;  1E94 E;  2DWZ B;  1NSF A;  1IXS B;  2V6Z M;  2R62 A;  5DYI A;  4D80 A;  4LJ4 A;  4LZZ A;  3ZH9 B;  3GLI A;  3HU2 A;  4FWG A;  1IN4 A;  5FTK A;  1UM8 A;  1HT2 E;  3KDS E;  2QEN A;  2BJW A;  4FCT A;  3VFD A;  3WHL A;  3HU3 A;  2DZO B;  3VLF B;  5C18 A;  2DZN B;  1IN6 A;  5EXS A;  1SXJ D;  3WHK A;  4KLN A;  5JI3 E;  1OJL A;  5DYG A;  1C1K A;  1HQY E;  3H4M A;  1G3I A;  2VII A;  2HCB A;  3M6A A;  5EXX A;  1JQJ C;  1QZM A;  1IN7 A;  1LV7 A;  4FCV A;  2DVW B;  4LJ9 A;  4GIT A;  3R8F A;  4LRT A;  3PXG A;  2DHR A;  3PFI A;  3GLG B;  3BOS A;  1IN8 A;  1R7R A;  2QPA A;  5FTL A;  1KSF X;  2FNA A;  1D2N A;  1NY6 A;  5EQT A;  4QHT A;  4QNR A;  4D82 A;  4EIW A;  3PVS A;  2C9C A;  3U61 B; 
#chains in the Genus database with same CATH topology
 3EIE A;  2Q2E B;  1DGF A;  5KQD A;  2J5Y A;  2DXI A;  1SG9 A;  3EIH A;  2R65 A;  3QAU A;  4IBI A;  3OTO M;  2CHV A;  4L16 A;  2QZ4 A;  3CF0 A;  3TWK A;  1TDH A;  3DFZ A;  1PJT A;  1ZMW A;  3HX3 A;  1PJJ A;  4K0K M;  2VDB B;  3FRI A;  4GEW A;  2HWJ A;  3J27 B;  3U6L A;  3A46 A;  1DGH B;  1TH4 A;  1D0M A;  3AOG A;  1W5T A;  4FW9 A;  4RNA A;  5EXP A;  3SHG B;  5KQ8 A;  1QUT A;  1ORY B;  4I4L A;  3GLI E;  4MGK E;  5KO3 A;  3HHW A;  1D0L A;  3I4V A;  4IJE A;  4IBG A;  1N36 M;  4CIS A;  3QYB A;  1QAM A;  4CIZ A;  1CUK A;  4IIW A;  3GLI B;  1G4A E;  2XSZ A;  2WZJ A;  2JY6 B;  4L6V 6;  2ZBK B;  2GNO A;  3GRY A;  2CE7 A;  1TR8 A;  1XMQ M;  3UJN A;  1QAQ A;  3MMP A;  4I81 A;  4LF8 M;  3K8Z A;  2ZTD A;  3JR4 A;  5IRE B;  3GLH E;  1ZMU A;  3A98 B;  4DUZ M;  1I4W A;  4Y28 F;  3GLH B;  3IHP A;  5KPT A;  5IZ7 D;  4OX9 M;  3W0F A;  1TGU A;  4I5S A;  1J5E M;  1L8Q A;  2QBY A;  2Z3X A;  4G4Q A;  3SMP A;  1YUB A;  3D8B A;  4JI1 M;  1JR3 A;  1K3W A;  2Z7J A;  4OVZ A;  1ZAE A;  1OFH A;  1SXJ C;  2RRU A;  4GHA A;  2QHO B;  3M7G A;  4R71 A;  2XZU A;  3J80 S;  1G71 A;  2X8A A;  2MGW A;  3GLF E;  1NHW C;  3PNY A;  4L15 A;  1N34 M;  4KOD A;  2FE8 A;  1NNJ A;  4FCW A;  4NXM M;  3AOE C;  1R6B X;  3GLF B;  5FSW A;  2RGH A;  1QDT A;  2DZL A;  2CUZ A;  3AFH A;  3SAT A;  3UK6 A;  4IBJ A;  4IBB A;  2DWL A;  2UXC M;  3U60 A;  4AKH A;  1NV9 A;  2D7E A;  4B7F A;  1PJI A;  3K92 A;  5BR8 M;  4B3S M;  2LNH C;  1HT1 E;  4FD2 A;  3SYK A;  1Y8G A;  4LF4 M;  2C98 A;  3KXE C;  2APL A;  4GC9 A;  1IM2 A;  3LMM A;  2K9D A;  1T43 A;  2JZ1 A;  1NSF A;  5ITX E;  1V34 A;  2G8L A;  1IXS B;  4GC5 A;  1V33 A;  2JY7 A;  4LF5 M;  2EUC A;  4OU7 A;  4LZZ A;  2R6F A;  3NBX X;  4DR3 M;  1NV8 A;  1WGL A;  3TPZ A;  1ZQ9 A;  2XLJ A;  2BJW A;  4II7 A;  4HEO A;  3WHL A;  4W5W A;  4BBA A;  4M0W A;  3KS8 A;  2DZN B;  2WSC F;  4AW4 A;  1Q3C A;  4JXJ A;  4KLN A;  1XC8 A;  1AIP C;  4QOZ C;  3H4M A;  2LXE A;  1MJG M;  2VII A;  3GLG E;  1UFZ A;  2DWN A;  4LJ9 A;  4DV6 M;  2DVW B;  2OOA A;  3C9P A;  4UN2 B;  3ZC7 B;  4JI6 M;  3PFI A;  5GKN A;  3GLG B;  3U6S A;  1IN8 A;  2F5O A;  1R7R A;  2L7H A;  3IG8 A;  2QPA A;  5FTL A;  1KSF X;  4JI5 M;  1D2N A;  2LTU A;  4FVM A;  4DR2 M;  3KOZ E;  1L2C A;  3RE8 A;  4QHT A;  4IBE A;  4EIW A;  4G4N A;  3U61 B;  2C9C A;  3U5Z A;  1K82 A;  2R18 A;  3U6E A;  2BJV A;  4FWD A;  3SMS A;  4L8R C;  4KHP M;  1DGG A;  2W82 A;  4MGZ E;  4WUR A;  3Q8X A;  5E26 A;  5EP3 A;  4JI3 M;  2KA6 B;  3HY5 A;  3TL4 X;  2DHY A;  1IY1 A;  3T15 A;  4NOO B;  1WHC A;  4PDI A;  1C7Y A;  3FUU A;  1XXH A;  2ZM6 M;  5FTJ A;  2ZTC A;  1NJG A;  2F5P A;  2LH0 A;  5IWA M;  1G8P A;  2KRK A;  1XWI A;  1FJG M;  3SAR A;  4A3V B;  4B3T M;  1MX0 A;  3FUT A;  1G59 A;  2HHH M;  2UU9 M;  1AUA A;  1JB0 F;  3T6P A;  2F5Q A;  3DZD A;  3HJS A;  2LVN C;  3L28 A;  4P16 A;  2EJS A;  4X66 M;  1IBK M;  2EO2 A;  3NWL A;  4L78 A;  2XEP A;  1R2Y A;  1P3Q Q;  3B9P A;  1K3X A;  1PJQ A;  3L29 A;  4B3M M;  3L25 A;  2Y0Q A;  1QDR A;  5JI2 E;  2LWX A;  1IBL M;  2D7H A;  2L4F A;  5ITU A;  1X37 A;  1N78 A;  3KW6 A;  1W5S A;  1GAB A;  1V92 A;  2R45 A;  3FYC A;  1QZE A;  2M60 A;  5ITY A;  3A42 A;  2C96 A;  3HWS A;  2WSF F;  3GQ4 A;  1EE8 A;  2Y21 A;  4LZJ A;  3KP0 E;  5A2Q S;  2K0B X;  4Z6Y A;  5L8R F;  1GLN A;  1XHB A;  1VEG A;  2KXE A;  2K47 A;  1KFV A;  1SXJ A;  2KDL A;  3FD9 A;  1E9S A;  3IG5 A;  4G3O A;  4JI7 M;  2M5Z A;  4WW0 A;  1VDL A;  2HAK A;  3CTW B;  1YSY A;  3QWL A;  3ZCB B;  2KNV A;  2RKO A;  5LMU M;  2F5S A;  4DV1 M;  4DR1 M;  3AOE A;  1L1T A;  3LVV A;  4CGY B;  4TUW A;  1I94 M;  1OFI A;  4NRV A;  3KOW E;  4LRS A;  1GVN A;  4X62 M;  3HHY A;  1JR3 E;  3U6C A;  2JZ0 A;  2ZAN A;  3SC3 A;  4LFC M;  3M0E A;  4PT5 A;  2UUC M;  2QBY B;  2G5G X;  4OVZ B;  4DV0 M;  2CV0 A;  2R0I A;  4AZF A;  2MJ5 B;  3GPX A;  3B89 A;  4IBD A;  3HKP A;  1A5T A;  4IJF A;  4AI6 A;  2JNH A;  2KRU A;  1WJ7 A;  3E21 A;  3VKH A;  2KW0 A;  3AV0 A;  3HGI A;  3KVW A;  2R62 A;  1GL7 A;  2JA2 A;  3DOA A;  3GLI A;  2Y0T A;  4FWG A;  5FTK A;  1PM5 A;  3VDP A;  1IFY A;  2YFQ A;  3KDS E;  3W67 A;  3VFD A;  2KZS A;  4G4R A;  1SXJ D;  2LHC A;  1OIP A;  1OAI A;  2DEN A;  2FOI C;  4G6Z A;  4X64 M;  3VK8 A;  5DYG A;  3THG A;  2DWM A;  4DR4 M;  5FLX S;  4LFA M;  4B08 A;  1IBM M;  2UXD M;  4XGI A;  4JI8 M;  5EXX A;  3FYD A;  3I01 M;  2BNK A;  1HR0 M;  4GIT A;  4LRT A;  3AKZ A;  2DHR A;  3J2P B;  2LVO C;  3U6D A;  4S12 A;  2OOB A;  4PD2 A;  3Q8G A;  4LGY A;  1MU5 A;  3GRU A;  3LCV B;  4MGI E;  4CHT B;  2UUA M;  2VF7 A;  1L2B A;  3AL0 C;  4D82 A;  1TTE A;  2CV2 A;  5EJC A;  2CFO A;  2CRU A;  1F4I A;  2OQ4 A;  1TH3 A;  3TWM A;  1R4G A;  4GHL A;  4DV2 M;  1Q39 A;  4LJ6 A;  3GPU A;  4WP2 A;  2V1C A;  2YNM D;  3K1J A;  3KSJ A;  2AHM A;  3VK7 A;  1NVM A;  5DNY A;  2KNZ A;  1R5L A;  4DV3 M;  3LCU A;  3T1Y M;  1IY0 A;  3J81 S;  2OPF A;  1J7K A;  1ZV1 A;  4LJ5 A;  3TE6 A;  3HU1 A;  1NJF A;  2CHQ A;  3UZU A;  4M9X A;  2RGO A;  1Z6T A;  1QVR A;  1DV0 A;  4JN6 A;  4R7G A;  1IN5 A;  2A5Y B;  3K9O A;  4LF9 M;  1T6O A;  2BWE A;  3U6P A;  4LF7 M;  2J7O A;  3W0L B;  1IXS A;  1OIZ A;  2DKL A;  3A45 A;  3HHX A;  4NSO B;  4B3R M;  2XGN A;  1KYI A;  1D0K A;  4OW0 A;  3SAS A;  4L4U A;  3D8L A;  3W68 A;  1IQP A;  2C99 A;  3L26 A;  1XB2 B;  2WSE F;  2XF3 A;  1GKI A;  2LVQ D;  4BLC A;  3SHF A;  1GJT A;  2V1U A;  4GMQ A;  1Z5C A;  4DR7 M;  4Q7J A;  4MGH A;  5EP1 A;  2X49 A;  3DA1 A;  5LMN M;  4B7G A;  3B74 A;  4NRW A;  3U6O A;  5E6J A;  3BXW A;  3GLG A;  3L2A A;  3T1H M;  2GQF A;  5ITQ A;  2EKK A;  3RGS A;  5EP4 A;  2H1R A;  1XMO M;  1OQY A;  4LG2 A;  3FTF A;  4P17 A;  1IY2 A;  4DV4 M;  4LJA A;  2J7N A;  4YY3 M;  3SAV A;  2KNA A;  1XNR M;  2OO9 A;  1HQC A;  1VEK A;  4HLQ A;  3I04 M;  3J7B A;  4Z8X A;  1PGY A;  3SYL A;  4ITQ A;  5EP2 A;  3E9S A;  4NL4 H;  2KHH A;  5FTM A;  3C58 A;  3CF6 E;  1H6U A;  2I7P A;  2KEB A;  1Q02 A;  2DAI A;  3LW5 F;  1SXJ E;  1EIJ A;  1NY5 A;  2K6B A;  4AG5 A;  2Y20 A;  1IXZ A;  5C1B A;  3U6M A;  3HHZ A;  2L7I A;  4ANR A;  2JXN A;  4FWH A;  2Z4R A;  1Q3B A;  1SXJ B;  4LGM A;  4JI2 M;  2DAG A;  3GRR A;  4GRI A;  2LVP C;  1MN3 A;  2MH8 A;  3SFZ A;  1G41 A;  2F4V M;  2VQF M;  4XK8 F;  4QOS A;  3FTE A;  2ZAO A;  3U6Q A;  5F3W A;  1WIV A;  2HL7 A;  3HZJ A;  2V6Z M;  1NHG C;  5DYI A;  2R44 A;  4LJ4 A;  4GKK M;  4RF1 A;  3ZH9 B;  1GJS A;  1IN4 A;  1TF0 B;  1UM8 A;  3B7Q A;  1N77 A;  3LVW A;  4MM3 B;  1Z59 A;  2JY5 A;  1DGB A;  4FCT A;  1ZMV A;  3HU3 A;  7CAT A;  1QQW A;  5C18 A;  3L27 A;  1IN6 A;  5ITT A;  4KT0 F;  4GH9 A;  3K9P A;  5IT9 S;  3B7N A;  2JY8 A;  1TH2 A;  4AQY M;  4JI0 M;  1OJL A;  2L09 A;  1L1Z A;  1C1K A;  1HQY E;  3HJ8 A;  1YLA A;  3H4J A;  1G3I A;  4MH0 E;  2XH9 A;  4NSR A;  3SAW A;  4JV5 M;  1QZM A;  1IN7 A;  1LV7 A;  1BVS A;  2UXB M;  3UMM A;  5DFL A;  1DGH A;  1WGN A;  2JUJ A;  3MJ5 A;  1OAO C;  2FNA A;  3KP1 E;  1N32 M;  1NY6 A;  2I7N A;  2KZU A;  3JAM S;  4MGY E;  4QNR A;  3SBJ A;  1NO1 A;  2CHG A;  2DAK A;  1HJP A;  1GO5 A;  4LCB A;  4QHS A;  2HKJ A;  2G3Q A;  4QNM A;  3B7Z A;  2QNJ A;  1PRB A;  1R2Z A;  3C3E A;  1GL6 A;  3U60 B;  5FTN A;  3GQ5 A;  1XNQ M;  1OTR A;  2QCU A;  3CF2 A;  3F92 A;  2ZAM A;  2DAE A;  2L2D A;  3GRV A;  3KSX A;  4YHH M;  2N35 A;  3KOX E;  2JWS A;  2D7G A;  2MR9 A;  1QAN A;  2XFT A;  1L2D A;  3FUV A;  4DR6 M;  3GPY A;  4HL4 A;  3ZQJ A;  3GLH A;  4R3D A;  2CV1 A;  3VDU A;  1YE9 A;  4D81 A;  4MB7 A;  5KPR A;  3E4R A;  2FH0 A;  3FE3 A;  1LTM A;  5ITR A;  3I4Y A;  1VG5 A;  3FKE A;  2Z4S A;  2MRO B;  8CAT A;  3AJI B;  1S3S A;  3FTC A;  2VQE M;  1E32 A;  5EXT A;  3KFU G;  1E9R A;  2XZF A;  3FUX A;  3FTD A;  4KO8 A;  4B7H A;  1RU3 A;  4ZPX A;  3GLF A;  2FFJ A;  2LVA A;  4F2L A;  2R4J A;  1T3T A;  2XSZ D;  2EA0 A;  4X65 M;  3FRH A;  4NXN M;  4DR5 M;  2XFS A;  1PJS A;  3IEC A;  5BPV A;  3RGP A;  2X4A A;  2BWB A;  3FUW A;  3TWL A;  3QYE A;  1DO2 A;  3K2L A;  4DV7 M;  1N33 M;  2QP9 X;  4DBG B;  3I51 A;  1HNX M;  4JYA M;  2Z8Y M;  1VDD A;  2C9O A;  3LQQ A;  3MHV C;  4M0D A;  1HNZ M;  2O5R A;  2YQZ A;  1DO0 A;  4IBF A;  2QSF X;  3U5Z B;  1NNU C;  2DNA A;  4LFB M;  1Z5B A;  5H37 D;  1HNW M;  4LJ7 A;  1XXH E;  4CJ6 A;  3MK6 A;  1JR3 D;  4IBC A;  2E5L M;  5ITX A;  2ERC A;  2DI0 A;  2O25 A;  2CWB A;  4F1I A;  3T38 A;  1XXH B;  4AKG A;  1IXR C;  2CEA A;  3PNV A;  1QYR A;  3HJQ A;  1WR1 B;  2R46 A;  1VQ1 A;  3J7A S;  4NC6 A;  4BB9 A;  4LJ8 A;  4PCZ A;  5KPZ A;  3RFW A;  2LBC A;  2DAM A;  3CGW A;  1EFU B;  1FNN A;  4LY6 A;  4M9Z A;  3GQ3 A;  2UUB M;  3VKG A;  1QAO A;  2F5N A;  4LF6 M;  1E94 E;  2DWZ B;  3UGJ A;  2EKF A;  1WXQ A;  2L4E A;  2P5T A;  2YR0 A;  4D80 A;  3SAU A;  4IBK A;  2L6O A;  4JI4 M;  2QQ8 A;  3R9X B;  3HU2 A;  3C3D A;  4RKU F;  2FS1 A;  4M9S A;  1HT2 E;  3JR5 A;  2CP8 A;  2QEN A;  3U61 A;  4PDG A;  1TDZ A;  3BBZ A;  4AKI A;  2DZO B;  4GIP A;  3TQS A;  3VLF B;  3E46 A;  1QUS A;  2VF8 A;  5EXS A;  3WHK A;  2NQ8 C;  2JP7 A;  2LHG A;  3GO8 A;  3V76 A;  5JI3 E;  3ILK A;  4DUY M;  1J09 A;  3KS4 A;  1OKS A;  3NBI A;  1VEJ A;  1Z5A A;  2HCB A;  3M6A A;  2C5R A;  2R4E A;  1JQJ C;  4FCV A;  4G4O A;  4XBO A;  4DV5 M;  2O01 F;  3R8F A;  3PXG A;  3LQR A;  3BOS A;  4REZ A;  3GPP A;  4RF0 A;  2B3T A;  2H5X A;  5EQT A;  3KOY E;  3GP1 A;  3PVS A;  4I8O A;  4GKJ M;  1N75 A;  4AG6 A; 
#chains in the Genus database with same CATH homology
 3EIE A;  2Q2E B;  1DGF A;  5KQD A;  2DXI A;  3EIH A;  2R65 A;  3QAU A;  4IBI A;  3OTO M;  2CHV A;  4L16 A;  2QZ4 A;  3CF0 A;  3TWK A;  1TDH A;  3DFZ A;  1PJJ A;  4K0K M;  3J27 B;  3U6L A;  3A46 A;  1DGH B;  1TH4 A;  4RNA A;  3AOG A;  1W5T A;  4FW9 A;  5EXP A;  3SHG B;  5KQ8 A;  1ORY B;  4I4L A;  4MGK E;  5KO3 A;  3HHW A;  3I4V A;  4IJE A;  4IBG A;  1N36 M;  4CIS A;  1QAM A;  4IIW A;  3GLI B;  1G4A E;  2XSZ A;  2ZBK B;  3GRY A;  2CE7 A;  1XMQ M;  3UJN A;  1QAQ A;  4I81 A;  4LF8 M;  3K8Z A;  3JR4 A;  5IRE B;  3A98 B;  4DUZ M;  1I4W A;  3GLH B;  5KPT A;  4OX9 M;  5IZ7 D;  3W0F A;  1TGU A;  4I5S A;  1J5E M;  1L8Q A;  2QBY A;  2Z3X A;  4G4Q A;  3SMP A;  1YUB A;  3D8B A;  4JI1 M;  1JR3 A;  1K3W A;  2Z7J A;  4OVZ A;  1ZAE A;  1OFH A;  1SXJ C;  4GHA A;  3M7G A;  2XZU A;  3J80 S;  2X8A A;  1NHW C;  3PNY A;  4L15 A;  1N34 M;  4KOD A;  2FE8 A;  1NNJ A;  4FCW A;  4NXM M;  3AOE C;  1R6B X;  3GLF B;  5FSW A;  2RGH A;  2CUZ A;  3AFH A;  3SAT A;  3UK6 A;  4IBJ A;  4IBB A;  2DWL A;  2UXC M;  3U60 A;  4AKH A;  2D7E A;  4B7F A;  1PJI A;  3K92 A;  5BR8 M;  4B3S M;  2LNH C;  1HT1 E;  4FD2 A;  3SYK A;  4LF4 M;  2C98 A;  3KXE C;  4GC9 A;  1IM2 A;  3LMM A;  1NSF A;  5ITX E;  2G8L A;  1IXS B;  4GC5 A;  4LF5 M;  2EUC A;  4OU7 A;  4LZZ A;  4DR3 M;  3TPZ A;  1ZQ9 A;  2XLJ A;  2BJW A;  4II7 A;  3WHL A;  4W5W A;  4BBA A;  4M0W A;  3KS8 A;  2DZN B;  4AW4 A;  1Q3C A;  4JXJ A;  4KLN A;  1XC8 A;  4QOZ C;  3H4M A;  2LXE A;  2VII A;  2DWN A;  4LJ9 A;  4DV6 M;  2DVW B;  4JI6 M;  3ZC7 B;  3PFI A;  5GKN A;  3GLG B;  3U6S A;  1IN8 A;  2F5O A;  1R7R A;  2L7H A;  3IG8 A;  2QPA A;  5FTL A;  1KSF X;  4JI5 M;  1D2N A;  4DR2 M;  4FVM A;  3KOZ E;  1L2C A;  3RE8 A;  4QHT A;  4IBE A;  4EIW A;  4G4N A;  3U61 B;  2C9C A;  3U5Z A;  1K82 A;  2R18 A;  3U6E A;  2BJV A;  4FWD A;  3SMS A;  4L8R C;  4KHP M;  1DGG A;  2W82 A;  4MGZ E;  4WUR A;  3Q8X A;  5E26 A;  5EP3 A;  4JI3 M;  2KA6 B;  3TL4 X;  1IY1 A;  3T15 A;  4NOO B;  4PDI A;  3FUU A;  1XXH A;  2ZM6 M;  5FTJ A;  1NJG A;  2F5P A;  2LH0 A;  5IWA M;  1G8P A;  2KRK A;  1XWI A;  1FJG M;  3SAR A;  4A3V B;  4B3T M;  1MX0 A;  3FUT A;  1G59 A;  2HHH M;  2UU9 M;  2F5Q A;  3DZD A;  3HJS A;  3L28 A;  4P16 A;  4X66 M;  1IBK M;  2EO2 A;  3NWL A;  4L78 A;  2XEP A;  1R2Y A;  1K3X A;  3B9P A;  4B3M M;  3L29 A;  3L25 A;  2Y0Q A;  5JI2 E;  2LWX A;  1IBL M;  2D7H A;  5ITU A;  1X37 A;  1N78 A;  3KW6 A;  1W5S A;  2R45 A;  3FYC A;  2M60 A;  5ITY A;  3A42 A;  2C96 A;  3HWS A;  3GQ4 A;  1EE8 A;  2Y21 A;  4LZJ A;  3KP0 E;  5A2Q S;  4Z6Y A;  1GLN A;  1XHB A;  2KXE A;  2K47 A;  1KFV A;  1SXJ A;  3IG5 A;  3FD9 A;  1E9S A;  4JI7 M;  2M5Z A;  4WW0 A;  3CTW B;  1YSY A;  3QWL A;  3ZCB B;  2RKO A;  5LMU M;  2F5S A;  4DV1 M;  4DR1 M;  3AOE A;  1L1T A;  3LVV A;  4CGY B;  4TUW A;  1I94 M;  1OFI A;  4NRV A;  3KOW E;  4LRS A;  1GVN A;  4X62 M;  3HHY A;  3U6C A;  2ZAN A;  3SC3 A;  4LFC M;  3M0E A;  4PT5 A;  2UUC M;  2QBY B;  2G5G X;  4OVZ B;  4DV0 M;  2CV0 A;  4AZF A;  3GPX A;  4IBD A;  3HKP A;  4IJF A;  4AI6 A;  2KRU A;  3VKH A;  2KW0 A;  3AV0 A;  3HGI A;  3KVW A;  2R62 A;  1GL7 A;  2JA2 A;  3DOA A;  3GLI A;  2Y0T A;  4FWG A;  5FTK A;  1PM5 A;  3VDP A;  2YFQ A;  3KDS E;  3VFD A;  2KZS A;  4G4R A;  1SXJ D;  2FOI C;  4X64 M;  4G6Z A;  3VK8 A;  5DYG A;  3THG A;  2DWM A;  4DR4 M;  5FLX S;  4LFA M;  4B08 A;  1IBM M;  2UXD M;  4XGI A;  4JI8 M;  5EXX A;  3FYD A;  2BNK A;  1HR0 M;  4GIT A;  4LRT A;  3AKZ A;  2DHR A;  3J2P B;  3U6D A;  4S12 A;  4PD2 A;  4LGY A;  1MU5 A;  3GRU A;  4MGI E;  4CHT B;  2UUA M;  1L2B A;  3AL0 C;  4D82 A;  2CV2 A;  5EJC A;  2CFO A;  2OQ4 A;  1TH3 A;  3TWM A;  4GHL A;  4DV2 M;  1Q39 A;  4LJ6 A;  3GPU A;  2V1C A;  2YNM D;  3K1J A;  3KSJ A;  2AHM A;  3VK7 A;  1NVM A;  5DNY A;  4DV3 M;  3T1Y M;  1IY0 A;  3J81 S;  2OPF A;  1J7K A;  4LJ5 A;  3TE6 A;  3HU1 A;  1NJF A;  2CHQ A;  3UZU A;  4M9X A;  2RGO A;  1Z6T A;  1QVR A;  4JN6 A;  4R7G A;  1IN5 A;  2A5Y B;  4LF9 M;  4LF7 M;  3U6P A;  2J7O A;  3W0L B;  3HHX A;  3A45 A;  4NSO B;  4B3R M;  2XGN A;  1KYI A;  4OW0 A;  3SAS A;  4L4U A;  3D8L A;  1IQP A;  2C99 A;  3L26 A;  2XF3 A;  1GKI A;  4BLC A;  2V1U A;  3SHF A;  4GMQ A;  1Z5C A;  4DR7 M;  4MGH A;  5EP1 A;  5LMN M;  2X49 A;  3DA1 A;  4B7G A;  4NRW A;  3U6O A;  5E6J A;  3GLG A;  3L2A A;  3T1H M;  5ITQ A;  3RGS A;  5EP4 A;  2H1R A;  1XMO M;  4LG2 A;  3FTF A;  1IY2 A;  4DV4 M;  4LJA A;  2J7N A;  4YY3 M;  3SAV A;  1XNR M;  1HQC A;  4HLQ A;  3J7B A;  4Z8X A;  3SYL A;  4ITQ A;  5EP2 A;  3E9S A;  4NL4 H;  5FTM A;  3C58 A;  3CF6 E;  1H6U A;  2I7P A;  2KEB A;  1SXJ E;  1NY5 A;  4AG5 A;  2Y20 A;  1IXZ A;  5C1B A;  3U6M A;  3HHZ A;  2L7I A;  4FWH A;  2Z4R A;  1Q3B A;  1SXJ B;  4LGM A;  4JI2 M;  3GRR A;  4GRI A;  3SFZ A;  2F4V M;  1G41 A;  2VQF M;  3FTE A;  4QOS A;  2ZAO A;  3U6Q A;  5F3W A;  2HL7 A;  2V6Z M;  1NHG C;  5DYI A;  4LJ4 A;  4GKK M;  4RF1 A;  3ZH9 B;  1IN4 A;  1UM8 A;  1N77 A;  3LVW A;  4MM3 B;  1Z59 A;  4FCT A;  1DGB A;  3HU3 A;  7CAT A;  1QQW A;  5C18 A;  3L27 A;  1IN6 A;  5ITT A;  5IT9 S;  4GH9 A;  1TH2 A;  4AQY M;  4JI0 M;  1OJL A;  2L09 A;  1L1Z A;  1C1K A;  1HQY E;  3HJ8 A;  1G3I A;  4MH0 E;  2XH9 A;  4NSR A;  3SAW A;  4JV5 M;  1QZM A;  1IN7 A;  1LV7 A;  2UXB M;  3UMM A;  1DGH A;  3MJ5 A;  2FNA A;  3KP1 E;  1N32 M;  1NY6 A;  2I7N A;  2KZU A;  3JAM S;  4MGY E;  4QNR A;  3SBJ A;  2CHG A;  4LCB A;  4QHS A;  2HKJ A;  4QNM A;  1R2Z A;  1GL6 A;  3U60 B;  5FTN A;  3GQ5 A;  1XNQ M;  2QCU A;  3CF2 A;  2ZAM A;  3KSX A;  3GRV A;  4YHH M;  3KOX E;  4DR6 M;  2D7G A;  2XFT A;  1QAN A;  1L2D A;  3FUV A;  3GPY A;  4HL4 A;  3GLH A;  4R3D A;  2CV1 A;  3VDU A;  1YE9 A;  4D81 A;  4MB7 A;  5KPR A;  3E4R A;  5ITR A;  3I4Y A;  3FKE A;  2Z4S A;  8CAT A;  3AJI B;  1S3S A;  3FTC A;  2VQE M;  1E32 A;  5EXT A;  3KFU G;  1E9R A;  2XZF A;  3FUX A;  3FTD A;  4KO8 A;  4B7H A;  4ZPX A;  3GLF A;  2FFJ A;  2R4J A;  1T3T A;  2XSZ D;  2EA0 A;  4X65 M;  4NXN M;  4DR5 M;  2XFS A;  5BPV A;  3RGP A;  2X4A A;  3FUW A;  3TWL A;  4DV7 M;  1DO2 A;  3K2L A;  1N33 M;  2QP9 X;  3I51 A;  1HNX M;  4JYA M;  3MHV C;  1VDD A;  2C9O A;  3LQQ A;  4M0D A;  1HNZ M;  2O5R A;  2YQZ A;  1DO0 A;  4IBF A;  3U5Z B;  1NNU C;  4LFB M;  1Z5B A;  5H37 D;  1HNW M;  4LJ7 A;  3MK6 A;  1JR3 D;  4IBC A;  2E5L M;  5ITX A;  2ERC A;  3T38 A;  1XXH B;  4AKG A;  1IXR C;  2CEA A;  3PNV A;  1QYR A;  3HJQ A;  2R46 A;  3J7A S;  4BB9 A;  4LJ8 A;  4PCZ A;  5KPZ A;  3RFW A;  4M9Z A;  3GQ3 A;  1FNN A;  3VKG A;  4LY6 A;  2UUB M;  1QAO A;  2F5N A;  4LF6 M;  1E94 E;  2DWZ B;  3UGJ A;  1WXQ A;  2P5T A;  2YR0 A;  4D80 A;  3SAU A;  4IBK A;  2L6O A;  4JI4 M;  3R9X B;  3HU2 A;  4M9S A;  1HT2 E;  3JR5 A;  2QEN A;  3U61 A;  4PDG A;  1TDZ A;  4AKI A;  2DZO B;  4GIP A;  3TQS A;  3VLF B;  5EXS A;  3WHK A;  2NQ8 C;  3GO8 A;  5JI3 E;  3ILK A;  4DUY M;  1J09 A;  3KS4 A;  3NBI A;  1Z5A A;  2HCB A;  3M6A A;  2C5R A;  2R4E A;  1JQJ C;  4FCV A;  4G4O A;  4XBO A;  4DV5 M;  3R8F A;  3PXG A;  3LQR A;  3BOS A;  4REZ A;  3GPP A;  4RF0 A;  5EQT A;  3KOY E;  3GP1 A;  3PVS A;  4I8O A;  4GKJ M;  1N75 A;  4AG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...