2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/protein-binding
molecule keywords 26S proteasome non-ATPase regulatory subunit 10
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
2CHQA 1G3IA 5EP4A 2V1UA 2QP9X 4QNRA 3H4MA 1XXHB 4FW9A 5EXSA 3U60B 1IM2A 1IN6A 1NY5A 2C9OA 4KLNA 1QVRA 4FWDA 4LGMA 1G4AE 4Z8XA 3UK6A 1DO2A 3SYLA 2ZANA 2FNAA 1D2NA 4WW0A 1E94E 2CEAA 4KODA 3U5ZB 4LZZA 1W5SA 2QZ4A 1OJLA 5DYIA 5EP3A 3BOSA 5EXPA 2QBYB 3GLIA 1E32A 2C99A 2DZOB 4FCVA 2VIIA 1SXJA 4LY6A 4A3VB 2X8AA 2CHVA 2BJVA 1KSFX 3GLHA 2CE7A 4L4UA 1IQPA 2DWZB 2QENA 1NJGA 4LJ4A 2XSZD 1OFIA 1HT2E 1W5TA 3KW6A 3GLFA 1IY2A 1HT1E 4I81A 1HQCA 3B9PA 3VLFB 1J7KA 1IXZA 1IN8A 3HU3A 2QPAA 3R8FA 2ZAOA 1OFHA 1NY6A 4KO8A 1NSFA 5DYGA 4I4LA 1S3SA 4LCBA 5JI2E 2RKOA 4ZPXA 2CHGA 3M6AA 3U61B 5EXXA 3K1JA 5JI3E 3WHLA 1IY1A 3GLIB 4L16A 4D82A 5EQTA 1XXHA 2C9CA 1SXJC 4LJ6A 4GITA 1JR3D 3KDSE 5C1BA 4LRSA 1NVMA 3AJIB 5FTLA 5EP2A 1G41A 2HCBA 1IN5A 1DO0A 3HWSA 3ZH9B 2V6ZM 3GLFB 2C96A 3PFIA 4QHSA 1R7RA 1R6BX 1IY0A 3SYKA 4QOSA 4FCTA 1IXSB 3GLHB 1UM8A 1JQJC 3HU1A 5FTJA 2R62A 3VFDA 2XSZA 1QZMA 1HQYE 4D80A 3D8BA 3GLGB 5EXTA 5FTMA 2C98A 2QBYA 1JR3A 4FD2A 1NJFA 1LV7A 1SXJB 2DVWB 4LJ7A 5EP1A 4LJ9A 2DHRA 1C1KA 2KRKA 3PVSA 2ZAMA 3M0EA 2R65A 5FTKA 4L15A 4JN6A 4LJAA 1IXRC 1XWIA 3DZDA 4FCWA 1KYIA 4QNMA 3WHKA 5FTNA 3CF0A 4D81A 3HU2A 2BJWA 3CF2A 3EIEA 3SC3A 2Z4RA 1SXJD 2DZNB 4LJ5A 4LRTA 1FNNA 2Z4SA 3MHVC 4QHTA 3EIHA 1SXJE 4FWGA 1X37A 4LJ8A 4EIWA 5C18A 1IN7A 1L8QA 4FWHA 1IN4A 3PXGA 3GLGA
chains in the Genus database with same CATH superfamily
3R9XB 2HWJA 2HL7A 2F5SA 4OX9M 2K6BA 4AZFA 2R0IA 3SHFA 1IM2A 1GJTA 1PJIA 1T43A 1TR8A 4MGHA 3SAWA 2XFSA 1XC8A 4IBEA 3AV0A 4Z8XA 3L2AA 3SYLA 4LFCM 3K2LA 4AQYM 3K8ZA 4IBFA 2FNAA 4CIZA 3U6DA 1V33A 3C3DA 1QANA 3KP1E 1E9SA 1W5SA 2O25A 4YHHM 2J7NA 4B7HA 1HNWM 4M0DA 3TQSA 4XGIA 4Y28F 1L2DA 1E32A 2C99A 2JP7A 2DZOB 4DR1M 1ZMVA 1SXJA 3GQ3A 5KQ8A 4IBCA 3QWLA 1QUTA 2CE7A 3I4VA 1MX0A 1NJGA 2QNJA 1OFIA 2EO2A 1HT1E 1JR3E 5H37D 3H4JA 3K92A 4G3OA 1QAQA 2LVNC 4NOOB 3W68A 3GQ5A 3VK7A 1FJGM 1D0KA 2XEPA 1NV8A 2AHMA 3J2PB 3B7ZA 3U60A 4WP2A 2CWBA 1N36M 4DBGB 5DYGA 4LZJA 4CISA 4I4LA 4NXMM 1ZAEA 4GH9A 1H6UA 4ZPXA 1GLNA 2VF7A 3HJ8A 1Z5AA 4JI0M 3K1JA 3GPXA 2VQEM 4JI3M 3SARA 5ITUA 5EQTA 4G6ZA 3HHZA 4LJ6A 1L1ZA 4GITA 1QZEA 1QYRA 3IHPA 1NVMA 5KO3A 2H5XA 3AJIB 4LF7M 1G41A 3SFZA 4F1IA 1GKIA 4IBGA 4KHPM 1N78A 2ZBKB 3SYKA 1NHGC 2Z3XA 3AFHA 1IXSB 5FTJA 1PM5A 5ITYA 2LNHC 1QZMA 1HQYE 2UU9M 4GC5A 4NRVA 5ITXA 2O01F 4WURA 5FTMA 2GQFA 1R2YA 2QBYA 4FD2A 2DWLA 3T15A 4JXJA 3L27A 1N75A 1LV7A 1VEGA 4GRIA 5L8RF 1C7YA 2DVWB 2B3TA 2FE8A 3CGWA 2KXEA 4NC6A 3U6QA 4JI1M 3LVWA 2C5RA 1V92A 4B3SM 2DAIA 4DV2M 3PVSA 2ZAMA 1EE8A 2R65A 3M0EA 5E26A 1QQWA 3QAUA 3HY5A 3KOXE 1XWIA 3DZDA 2JZ1A 4IBBA 3KFUG 4FWHA 2LWXA 4MM3B 4B3TM 3WHKA 1VEKA 2QCUA 3RGSA 3TL4X 1Z5CA 1QAOA 4D81A 2BJWA 3SMPA 3NBXX 1MU5A 2Z4RA 2MH8A 3CF6E 3KOYE 5KPZA 3J7AS 4DR6M 3HHXA 4LJ5A 3DFZA 1FNNA 2V1CA 3EIHA 3GRRA 3ILKA 3J7BA 2I7NA 3KP0E 2ERCA 1X37A 3GPYA 2JY5A 3SMSA 1L8QA 2DKLA 3LW5F 5BPVA 4II7A 2XGNA 3PXGA 3JAMS 3U6SA 1HNZM 1HR0M 4DV7M 2QP9X 2KZUA 2QQ8A 1WR1B 1DGHA 3H4MA 3U60B 4MGIE 4JI2M 4L78A 1DV0A 1IN6A 1LTMA 4R71A 3A98B 3U6LA 3SAVA 4ANRA 3GRVA 3KXEC 3FYDA 3VK8A 4GC9A 2J7OA 3UK6A 2ZM6M 1P3QQ 2CV0A 1D2NA 3FYCA 4WW0A 2UXBM 1E94E 3KOWE 4DV1M 4G4RA 4GKJM 4KODA 4JI8M 4LZZA 3KS8A 2JA2A 2QZ4A 5DYIA 4DR5M 3C9PA 5IREB 3BOSA 3KS4A 5EXPA 3SASA 3GLIA 2GNOA 2VIIA 1XNQM 1WIVA 2HAKA 3AKZA 2CHVA 4UN2B 1CUKA 2DNAA 2BJVA 1TF0B 1TTEA 4L4UA 1Q39A 2DWZB 2E5LM 4LFAM 1W5TA 1HT2E 3FUVA 1IBKM 3IG8A 1XMQM 1IFYA 3GLFA 2LH0A 5KPTA 3TWKA 4I81A 1BVSA 1MJGM 1HQCA 1PRBA 4LG2A 1VDLA 3VLFB 3TPZA 4IJFA 2F5QA 4X64M 2H1RA 3I4YA 3CTWB 1Z59A 1L2CA 2JUJA 2VF8A 3FTCA 4B3RM 1TH2A 4JV5M 2L7IA 2EA0A 4L16A 4D82A 1XXHA 2C9CA 4DV3M 4OW0A 3M7GA 1R2ZA 4Z6YA 3KDSE 2L2DA 2LHGA 3L25A 5ITTA 1TH4A 1IN5A 1DO0A 3HWSA 3ZH9B 3FRHA 3U6MA 4M9XA 1PJQA 3VDUA 2MR9A 2C96A 2MGWA 2LVAA 4QOSA 5IT9S 3HGIA 4ITQA 3GLHB 5BR8M 3HU1A 4DUYM 2M5ZA 1YUBA 2LVPC 5EXTA 3TWLA 2C98A 2DAKA 1OTRA 2BWBA 2WSEF 3L28A 3RFWA 1GL6A 1JR3A 2KNVA 3T6PA 2MROB 3IG5A 2A5YB 3SBJA 3MK6A 4KT0F 1SXJB 2DI0A 3J27B 2XFTA 2DHRA 2FOIC 2JY7A 4RNAA 1GO5A 4PDIA 2RGHA 4NSRA 1VDDA 3E21A 3GO8A 1IBMM 1GVNA 5ITQA 3SAUA 5ITXE 4LJAA 1UFZA 2XZUA 3QYEA 2Y21A 2D7HA 1IXRC 3FUWA 3GPPA 4MGKE 1AIPC 1XHBA 2KHHA 1XXHE 3CF0A 1QUSA 1N77A 4LF6M 2UXDM 5IWAM 4CJ6A 4JI5M 1VEJA 2FH0A 4HL4A 1XB2B 2L4EA 4PD2A 4QOZC 2QSFX 3CF2A 2WSCF 3AOGA 2XZFA 1TDZA 4W5WA 3MMPA 3KVWA 2DAMA 3I04M 1GABA 1A5TA 3MHVC 3GLIE 3KSJA 1D0LA 5E6JA 1N32M 4R7GA 4GHAA 4TUWA 2XLJA 2R45A 3T1YM 5C18A 2D7GA 2KNZA 1OKSA 2XF3A 5FLXS 4BLCA 2LHCA 1G3IA 4DV5M 3E46A 3LVVA 2DHYA 2JXNA 5EP4A 2V1UA 3ZC7B 2JWSA 1D0MA 1R5LA 3PNYA 2LVQD 1XXHB 2LVOC 2X4AA 4FW9A 5EXSA 3HX3A 2J5YA 4IBJA 4NL4H 3UJNA 2LXEA 3LCUA 1NY5A 1SG9A 2C9OA 4CGYB 4KLNA 4DR4M 4FWDA 4DUZM 4LGMA 2WSFF 3THGA 2M60A 3GP1A 3NBIA 1WHCA 1QAMA 4R3DA 4XK8F 2CEAA 2F4VM 1HJPA 7CATA 5EP3A 4B7GA 3C58A 1PJTA 1VG5A 3A46A 3JR4A 2Z7JA 3GQ4A 2R46A 4A3VB 2K47A 4S12A 2R4EA 4YY3M 2UUAM 2Q2EB 4OVZB 4P17A 4NRWA 3GLHA 3LMMA 2G5GX 1XMOM 2QENA 5ITRA 2R6FA 3KW6A 3I51A 2DENA 2CV2A 2DAEA 1N34M 2OO9A 2BNKA 3TE6A 3U6PA 3AL0C 2UUCM 4NSOB 3L29A 3B9PA 3B7NA 1IXZA 3U6OA 2O5RA 1WGNA 3R8FA 1HNXM 3J80S 4JI6M 1NY6A 4KO8A 2FFJA 5LMNM 1I94M 2DXIA 1NV9A 3LQRA 1Z6TA 4LCBA 4M0WA 2YR0A 3U61B 3M6AA 4RF0A 4LF9M 3W0FA 3ZCBB 3Q8XA 5JI3E 4P16A 4MH0E 3WHLA 1IY1A 3GLIB 4B3MM 3BXWA 1ZMUA 1K82A 1SXJC 3HKPA 4X65M 2W82A 4DR3M 3LCVB 1T6OA 3UZUA 4IJEA 2N35A 4RKUF 2G3QA 4DV4M 5EP2A 1L1TA 3AOEA 1I4WA 3T38A 2F5OA 2V6ZM 3GLFB 1OAOC 1PJJA 3PFIA 4QHSA 4DR7M 1R7RA 4RF1A 2KNAA 1R6BX 1IY0A 1YSYA 2R18A 1JQJC 2R62A 3GLHE 2EKKA 4AW4A 2ZTDA 3I01M 2XSZA 4D80A 5FSWA 2HKJA 4Q7JA 3GLGB 2EUCA 2XH9A 4CHTB 2UXCM 2KW0A 4NXNM 5EJCA 3B89A 5EP1A 1C1KA 2KRKA 4M9SA 1J09A 4AKIA 2JNHA 4L15A 1Y8GA 1XNRM 1WJ7A 4X62M 1WXQA 5FTNA 4LF4M 2LBCA 5DFLA 4DV0M 2DZLA 3JR5A 4JYAM 1K3XA 2Y0TA 1GJSA 2G8LA 1ZV1A 3EIEA 3SC3A 3GRUA 3K9PA 4G4QA 5KPRA 3C3EA 2CFOA 1NO1A 5A2QS 4LRTA 2Z4SA 3SATA 1EIJA 2KA6B 2QHOB 2JY8A 3OTOM 2D7EA 4FWGA 3FTEA 3A45A 3FE3A 3FRIA 1IN7A 4MGYE 5DNYA 5GKNA 5LMUM 3GLGA 3ZQJA 1TGUA 4I8OA 4PT5A 2CHQA 2BWEA 2DWNA 4K0KM 1OIPA 2OOAA 1KFVA 4QNRA 1DGGA 1QDTA 1TDHA 3BBZA 3IECA 3E9SA 4GIPA 3J81S 3RE8A 3VDPA 1OQYA 3RGPA 1DGFA 4X66M 4AG5A 4B7FA 4AKHA 1RU3A 3VKHA 2R44A 2LTUA 3HZJA 2ZTCA 3A42A 1QVRA 1V34A 2DAGA 3FTDA 1G4AE 4AKGA 1DO2A 3TWMA 2CRUA 2ZANA 2YQZA 1IXSA 3HJSA 1IBLM 1NNUC 1YE9A 4MGZE 3FUUA 3U5ZB 2NQ8C 4I5SA 3GLGE 1OJLA 3W67A 2KEBA 4F2LA 2QBYB 2K9DA 1OIZA 1N33M 2RGOA 3FKEA 4HEOA 4FCVA 4LY6A 4REZA 2X8AA 3PNVA 3U6CA 1AUAA 1OAIA 1G59A 2UUBM 1GL7A 1R4GA 2P5TA 2JY6B 1KSFX 2WZJA 4PDGA 3B7QA 3SHGB 3F92A 1IQPA 1PJSA 4LJ4A 2XSZD 3HHWA 2I7PA 3AOEC 3Q8GA 4JI4M 4GKKM 3VKGA 1IY2A 3UGJA 2OQ4A 1TH3A 2DWMA 4JI7M 3MJ5A 2K0BX 1J7KA 2EKFA 3DOAA 1IN8A 3D8LA 2QPAA 3HU3A 1Q02A 2L7HA 2ZAOA 1OFHA 3HHYA 3U6EA 5IZ7D 1NSFA 4HLQA 1S3SA 3GPUA 2R4JA 3LQQA 5JI2E 2L6OA 2RKOA 2CHGA 5EXXA 1Q3BA 3NWLA 4LFBM 1JB0F 5KQDA 3L26A 1Q3CA 2F5PA 4LF8M 4LF5M 3QYBA 2FS1A 2MJ5B 4GMQA 1JR3D 2YFQA 4MB7A 5C1BA 4LRSA 3T1HM 1ZMWA 2KRUA 5FTLA 1ORYB 2HCBA 1PGYA 1J5EM 2VDBB 3FD9A 2APLA 2X49A 1G71A 1ZQ9A 3GLFE 2CV1A 2HHHM 2KZSA 3KSXA 1EFUB 4FCTA 4DR2M 1UM8A 3HJQA 2CUZA 4B08A 3VFDA 1NNJA 3D8BA 4L6V6 3K9OA 4GHLA 3KOZE 3V76A 4AI6A 4OU7A 1NJFA 1T3TA 4LJ7A 4BB9A 4LJ9A 1QDRA 1DGBA 1NHWC 1WGLA 2KDLA 3B74A 4DV6M 1G8PA 2L09A 1F4IA 2L4FA 5F3WA 4IIWA 5FTKA 4JN6A 4XBOA 1DGHB 1MN3A 1YLAA 4FCWA 1KYIA 4QNMA 4OVZA 4IBKA 1E9RA 2OPFA 3E4RA 4BBAA 2JZ0A 4M9ZA 3DA1A 3U5ZA 2Y20A 3HU2A 8CATA 2VQFM 2Y0QA 3W0LB 1L2BA 4L8RC 4G4OA 2F5NA 4IBIA 2YNMD 1SXJD 2DZNB 4G4NA 4LGYA 2EJSA 4AG6A 1Z5BA 4PCZA 3FUTA 3GRYA 4QHTA 1K3WA 1SXJE 2OOBA 3FUXA 3U61A 3FTFA 4GEWA 2Z8YM 4LJ8A 4EIWA 1VQ1A 4IBDA 3UMMA 2CP8A 1IN4A 4FVMA 2RRUA
chains in the Genus database with same CATH topology
3R9XB 2F5SA 2HL7A 4OX9M 4AZFA 3SHFA 1IM2A 1PJIA 4MGHA 3SAWA 2XFSA 1XC8A 4IBEA 3AV0A 4Z8XA 3L2AA 3SYLA 4LFCM 3K2LA 4AQYM 3K8ZA 4IBFA 2FNAA 3U6DA 1QANA 3KP1E 1E9SA 1W5SA 4YHHM 2J7NA 4B7HA 1HNWM 4M0DA 3TQSA 4XGIA 1L2DA 1E32A 2C99A 4DR1M 2DZOB 3GQ3A 1SXJA 5KQ8A 4IBCA 3QWLA 2CE7A 3I4VA 1MX0A 1NJGA 1OFIA 2EO2A 1HT1E 5H37D 3K92A 1QAQA 4NOOB 3GQ5A 3VK7A 1FJGM 2XEPA 2AHMA 3J2PB 3U60A 1N36M 5DYGA 4LZJA 4CISA 4I4LA 4NXMM 1ZAEA 4GH9A 1H6UA 4ZPXA 1GLNA 3HJ8A 4JI0M 1Z5AA 3GPXA 3K1JA 2VQEM 3SARA 4JI3M 5ITUA 5EQTA 4G6ZA 3HHZA 4LJ6A 1L1ZA 4GITA 1QYRA 5KO3A 1NVMA 4LF7M 3AJIB 1G41A 3SFZA 1GKIA 4IBGA 4KHPM 1N78A 2ZBKB 3SYKA 1NHGC 2Z3XA 3AFHA 1IXSB 5FTJA 1PM5A 5ITYA 2LNHC 1QZMA 1HQYE 2UU9M 4GC5A 4NRVA 5ITXA 4WURA 5FTMA 1R2YA 2QBYA 4FD2A 2DWLA 3T15A 4JXJA 3L27A 1N75A 1LV7A 4GRIA 4DR6M 4JI1M 2DVWB 2FE8A 2KXEA 3U6QA 3LVWA 2C5RA 4B3SM 4DV2M 3PVSA 2ZAMA 1EE8A 2R65A 3M0EA 5E26A 1QQWA 3QAUA 3KOXE 4IBBA 1XWIA 3DZDA 3KFUG 4MM3B 2LWXA 4B3TM 3WHKA 2QCUA 3RGSA 3TL4X 1Z5CA 1QAOA 4D81A 2BJWA 3SMPA 1MU5A 2Z4RA 5KPZA 3CF6E 3KOYE 3J7AS 3HHXA 4LJ5A 3DFZA 1FNNA 2V1CA 3EIHA 3GRRA 3ILKA 3J7BA 2I7NA 3KP0E 2ERCA 1X37A 3GPYA 3SMSA 1L8QA 5BPVA 4II7A 2XGNA 3PXGA 3JAMS 3U6SA 1HNZM 1HR0M 4DV7M 2QP9X 2KZUA 1DGHA 3H4MA 3U60B 4MGIE 4JI2M 4L78A 1IN6A 3A98B 3U6LA 3SAVA 3GRVA 3KXEC 3FYDA 3VK8A 4GC9A 2J7OA 3UK6A 2ZM6M 2CV0A 1D2NA 3FYCA 4WW0A 2UXBM 1E94E 3KOWE 4DV1M 4G4RA 4GKJM 4KODA 4JI8M 4LZZA 3KS8A 2JA2A 2QZ4A 5DYIA 4DR5M 5IREB 3BOSA 3KS4A 5EXPA 3SASA 3GLIA 2VIIA 1XNQM 3AKZA 2CHVA 2BJVA 4L4UA 1Q39A 2DWZB 2E5LM 4LFAM 1W5TA 1HT2E 3FUVA 1IBKM 3IG8A 1XMQM 3GLFA 2LH0A 5KPTA 3TWKA 4I81A 1HQCA 4LG2A 3VLFB 3TPZA 4IJFA 2F5QA 4X64M 2H1RA 3I4YA 3CTWB 1Z59A 1L2CA 3FTCA 4B3RM 1TH2A 4JV5M 2L7IA 2EA0A 4L16A 4D82A 1XXHA 2C9CA 4DV3M 4OW0A 3M7GA 1R2ZA 4Z6YA 3KDSE 3L25A 5ITTA 1TH4A 1IN5A 1DO0A 3HWSA 3ZH9B 3U6MA 4M9XA 3VDUA 2C96A 4QOSA 5IT9S 3HGIA 4ITQA 3GLHB 5BR8M 3HU1A 4DUYM 2M5ZA 1YUBA 5EXTA 3TWLA 2C98A 3L28A 3RFWA 1GL6A 1JR3A 3IG5A 2A5YB 3SBJA 3MK6A 1SXJB 3J27B 2XFTA 2DHRA 2FOIC 4RNAA 4PDIA 2RGHA 4NSRA 1VDDA 1IBMM 3GO8A 1GVNA 5ITQA 3SAUA 5ITXE 4LJAA 2XZUA 2Y21A 2D7HA 1IXRC 3FUWA 3GPPA 4MGKE 1XHBA 3CF0A 2UXDM 1N77A 4LF6M 5IWAM 4JI5M 4HL4A 4PD2A 4QOZC 3CF2A 3AOGA 2XZFA 1TDZA 4W5WA 3KVWA 3MHVC 3KSJA 5E6JA 1N32M 4R7GA 4GHAA 4TUWA 2XLJA 2R45A 3T1YM 5C18A 2D7GA 2XF3A 5FLXS 4BLCA 1G3IA 4DV5M 3LVVA 5EP4A 2V1UA 3ZC7B 3PNYA 1XXHB 4FW9A 2X4AA 5EXSA 4IBJA 4NL4H 3UJNA 2LXEA 1NY5A 4DR4M 2C9OA 4CGYB 4KLNA 4FWDA 4DUZM 4LGMA 3THGA 2M60A 3GP1A 3NBIA 1QAMA 4R3DA 2F4VM 2CEAA 7CATA 5EP3A 4B7GA 3C58A 3A46A 3JR4A 2Z7JA 3GQ4A 2R46A 4A3VB 2K47A 4S12A 2R4EA 4YY3M 2UUAM 2Q2EB 4OVZB 4NRWA 3GLHA 3LMMA 2G5GX 1XMOM 2QENA 5ITRA 3KW6A 3I51A 2CV2A 1N34M 3TE6A 2BNKA 3U6PA 3AL0C 2UUCM 4NSOB 3L29A 3B9PA 1IXZA 3U6OA 2O5RA 3R8FA 1HNXM 4JI6M 3J80S 1NY6A 4KO8A 2FFJA 5LMNM 1I94M 2DXIA 3LQRA 1Z6TA 4LCBA 4M0WA 2YR0A 3U61B 3M6AA 4RF0A 4LF9M 3W0FA 3ZCBB 3Q8XA 5JI3E 4P16A 4MH0E 3WHLA 1IY1A 3GLIB 4B3MM 1N33M 1K82A 1SXJC 3HKPA 4X65M 2W82A 4DR3M 3UZUA 4IJEA 4DV4M 5EP2A 1L1TA 3AOEA 1I4WA 3T38A 2F5OA 2V6ZM 3GLFB 1PJJA 3PFIA 4QHSA 4DR7M 1R7RA 4RF1A 1R6BX 1IY0A 1YSYA 2R18A 1JQJC 2R62A 4AW4A 2XSZA 4D80A 5FSWA 2HKJA 3GLGB 2EUCA 2XH9A 4CHTB 2UXCM 2KW0A 4NXNM 5EJCA 5EP1A 1C1KA 2KRKA 4M9SA 1J09A 4AKIA 4L15A 1XNRM 4X62M 1WXQA 5FTNA 4LF4M 4DV0M 3JR5A 4JYAM 1K3XA 2Y0TA 2G8LA 3EIEA 3SC3A 3GRUA 4G4QA 5KPRA 2CFOA 5A2QS 4LRTA 2Z4SA 3SATA 2KA6B 3OTOM 2D7EA 4FWGA 3FTEA 3A45A 4MGYE 5DNYA 1IN7A 5GKNA 5LMUM 3GLGA 1TGUA 4I8OA 4PT5A 2CHQA 2DWNA 4K0KM 1KFVA 4QNRA 1DGGA 1TDHA 3J81S 3E9SA 4GIPA 3RE8A 3VDPA 3RGPA 1DGFA 4X66M 4AG5A 4B7FA 4AKHA 3VKHA 3A42A 1QVRA 3FTDA 1G4AE 4AKGA 1DO2A 3TWMA 2ZANA 2YQZA 3HJSA 1IBLM 1NNUC 1YE9A 4MGZE 3FUUA 3U5ZB 2NQ8C 4I5SA 1OJLA 2KEBA 2QBYB 2RGOA 3FKEA 4FCVA 4LY6A 4REZA 2X8AA 3PNVA 3U6CA 1G59A 2UUBM 1GL7A 2P5TA 1KSFX 4PDGA 3SHGB 1IQPA 4LJ4A 2XSZD 3HHWA 2I7PA 3AOEC 4JI4M 4GKKM 3VKGA 1IY2A 3UGJA 2OQ4A 1TH3A 2DWMA 4JI7M 3MJ5A 1J7KA 3DOAA 1IN8A 3D8LA 2QPAA 3HU3A 2ZAOA 2L7HA 3U6EA 1OFHA 3HHYA 5IZ7D 1NSFA 4HLQA 1S3SA 3GPUA 2R4JA 3LQQA 5JI2E 2L6OA 2RKOA 2CHGA 5EXXA 1Q3BA 3NWLA 4LFBM 5KQDA 3L26A 1Q3CA 2F5PA 4LF8M 4LF5M 4GMQA 1JR3D 2YFQA 4MB7A 5C1BA 4LRSA 3T1HM 2KRUA 5FTLA 1ORYB 2HCBA 1J5EM 3FD9A 2X49A 1ZQ9A 2CV1A 2HHHM 2KZSA 3KSXA 4FCTA 4DR2M 1UM8A 3HJQA 2CUZA 4B08A 3VFDA 1NNJA 3D8BA 4GHLA 3KOZE 4AI6A 4OU7A 1NJFA 1T3TA 4LJ7A 4BB9A 4LJ9A 1DGBA 1NHWC 4DV6M 1G8PA 2L09A 5F3WA 4IIWA 5FTKA 4JN6A 4XBOA 1DGHB 4FCWA 1KYIA 4QNMA 4OVZA 4IBKA 1E9RA 2OPFA 3E4RA 4BBAA 3U5ZA 4M9ZA 3DA1A 2Y20A 3HU2A 8CATA 2VQFM 2Y0QA 3W0LB 1L2BA 4L8RC 4G4OA 2F5NA 4IBIA 2YNMD 1SXJD 2DZNB 4G4NA 4LGYA 4AG6A 1Z5BA 4PCZA 3FUTA 3GRYA 4QHTA 1K3WA 1SXJE 3FUXA 3U61A 3FTFA 4LJ8A 4EIWA 4IBDA 3UMMA 4FWHA 1IN4A 4FVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHQ A;  1G3I A;  5EP4 A;  2V1U A;  2QP9 X;  4QNR A;  3H4M A;  1XXH B;  4FW9 A;  5EXS A;  3U60 B;  1IM2 A;  1IN6 A;  1NY5 A;  2C9O A;  4KLN A;  1QVR A;  4FWD A;  4LGM A;  1G4A E;  4Z8X A;  3UK6 A;  1DO2 A;  3SYL A;  2ZAN A;  2FNA A;  1D2N A;  4WW0 A;  1E94 E;  2CEA A;  4KOD A;  3U5Z B;  4LZZ A;  1W5S A;  2QZ4 A;  1OJL A;  5DYI A;  5EP3 A;  3BOS A;  5EXP A;  2QBY B;  3GLI A;  1E32 A;  2C99 A;  2DZO B;  4FCV A;  2VII A;  1SXJ A;  4LY6 A;  4A3V B;  2X8A A;  2CHV A;  2BJV A;  1KSF X;  3GLH A;  2CE7 A;  4L4U A;  1IQP A;  2DWZ B;  2QEN A;  1NJG A;  4LJ4 A;  2XSZ D;  1OFI A;  1HT2 E;  1W5T A;  3KW6 A;  3GLF A;  1IY2 A;  1HT1 E;  4I81 A;  1HQC A;  3B9P A;  3VLF B;  1J7K A;  1IXZ A;  1IN8 A;  3HU3 A;  2QPA A;  3R8F A;  2ZAO A;  1OFH A;  1NY6 A;  4KO8 A;  1NSF A;  5DYG A;  4I4L A;  1S3S A;  4LCB A;  5JI2 E;  2RKO A;  4ZPX A;  2CHG A;  3M6A A;  3U61 B;  5EXX A;  3K1J A;  5JI3 E;  3WHL A;  1IY1 A;  3GLI B;  4L16 A;  4D82 A;  5EQT A;  1XXH A;  2C9C A;  1SXJ C;  4LJ6 A;  4GIT A;  1JR3 D;  3KDS E;  5C1B A;  4LRS A;  1NVM A;  3AJI B;  5FTL A;  5EP2 A;  1G41 A;  2HCB A;  1IN5 A;  1DO0 A;  3HWS A;  3ZH9 B;  2V6Z M;  3GLF B;  2C96 A;  3PFI A;  4QHS A;  1R7R A;  1R6B X;  1IY0 A;  3SYK A;  4QOS A;  4FCT A;  1IXS B;  3GLH B;  1UM8 A;  1JQJ C;  3HU1 A;  5FTJ A;  2R62 A;  3VFD A;  2XSZ A;  1QZM A;  1HQY E;  4D80 A;  3D8B A;  3GLG B;  5EXT A;  5FTM A;  2C98 A;  2QBY A;  1JR3 A;  4FD2 A;  1NJF A;  1LV7 A;  1SXJ B;  2DVW B;  4LJ7 A;  5EP1 A;  4LJ9 A;  2DHR A;  1C1K A;  2KRK A;  3PVS A;  2ZAM A;  3M0E A;  2R65 A;  5FTK A;  4L15 A;  4JN6 A;  4LJA A;  1IXR C;  1XWI A;  3DZD A;  4FCW A;  1KYI A;  4QNM A;  3WHK A;  5FTN A;  3CF0 A;  4D81 A;  3HU2 A;  2BJW A;  3CF2 A;  3EIE A;  3SC3 A;  2Z4R A;  1SXJ D;  2DZN B;  4LJ5 A;  4LRT A;  1FNN A;  2Z4S A;  3MHV C;  4QHT A;  3EIH A;  1SXJ E;  4FWG A;  1X37 A;  4LJ8 A;  4EIW A;  5C18 A;  1IN7 A;  1L8Q A;  4FWH A;  1IN4 A;  3PXG A;  3GLG A; 
#chains in the Genus database with same CATH topology
 3R9X B;  2HWJ A;  2HL7 A;  2F5S A;  4OX9 M;  2K6B A;  4AZF A;  2R0I A;  3SHF A;  1IM2 A;  1GJT A;  1PJI A;  1T43 A;  1TR8 A;  4MGH A;  3SAW A;  2XFS A;  1XC8 A;  4IBE A;  3AV0 A;  4Z8X A;  3L2A A;  3SYL A;  4LFC M;  3K2L A;  4AQY M;  3K8Z A;  4IBF A;  2FNA A;  4CIZ A;  3U6D A;  1V33 A;  3C3D A;  1QAN A;  3KP1 E;  1E9S A;  1W5S A;  2O25 A;  4YHH M;  2J7N A;  4B7H A;  1HNW M;  4M0D A;  3TQS A;  4XGI A;  4Y28 F;  1L2D A;  1E32 A;  2C99 A;  2JP7 A;  2DZO B;  4DR1 M;  1ZMV A;  1SXJ A;  3GQ3 A;  5KQ8 A;  4IBC A;  3QWL A;  1QUT A;  2CE7 A;  3I4V A;  1MX0 A;  1NJG A;  2QNJ A;  1OFI A;  2EO2 A;  1HT1 E;  1JR3 E;  5H37 D;  3H4J A;  3K92 A;  4G3O A;  1QAQ A;  2LVN C;  4NOO B;  3W68 A;  3GQ5 A;  3VK7 A;  1FJG M;  1D0K A;  2XEP A;  1NV8 A;  2AHM A;  3J2P B;  3B7Z A;  3U60 A;  4WP2 A;  2CWB A;  1N36 M;  4DBG B;  5DYG A;  4LZJ A;  4CIS A;  4I4L A;  4NXM M;  1ZAE A;  4GH9 A;  1H6U A;  4ZPX A;  1GLN A;  2VF7 A;  3HJ8 A;  1Z5A A;  4JI0 M;  3K1J A;  3GPX A;  2VQE M;  4JI3 M;  3SAR A;  5ITU A;  5EQT A;  4G6Z A;  3HHZ A;  4LJ6 A;  1L1Z A;  4GIT A;  1QZE A;  1QYR A;  3IHP A;  1NVM A;  5KO3 A;  2H5X A;  3AJI B;  4LF7 M;  1G41 A;  3SFZ A;  4F1I A;  1GKI A;  4IBG A;  4KHP M;  1N78 A;  2ZBK B;  3SYK A;  1NHG C;  2Z3X A;  3AFH A;  1IXS B;  5FTJ A;  1PM5 A;  5ITY A;  2LNH C;  1QZM A;  1HQY E;  2UU9 M;  4GC5 A;  4NRV A;  5ITX A;  2O01 F;  4WUR A;  5FTM A;  2GQF A;  1R2Y A;  2QBY A;  4FD2 A;  2DWL A;  3T15 A;  4JXJ A;  3L27 A;  1N75 A;  1LV7 A;  1VEG A;  4GRI A;  5L8R F;  1C7Y A;  2DVW B;  2B3T A;  2FE8 A;  3CGW A;  2KXE A;  4NC6 A;  3U6Q A;  4JI1 M;  3LVW A;  2C5R A;  1V92 A;  4B3S M;  2DAI A;  4DV2 M;  3PVS A;  2ZAM A;  1EE8 A;  2R65 A;  3M0E A;  5E26 A;  1QQW A;  3QAU A;  3HY5 A;  3KOX E;  1XWI A;  3DZD A;  2JZ1 A;  4IBB A;  3KFU G;  4FWH A;  2LWX A;  4MM3 B;  4B3T M;  3WHK A;  1VEK A;  2QCU A;  3RGS A;  3TL4 X;  1Z5C A;  1QAO A;  4D81 A;  2BJW A;  3SMP A;  3NBX X;  1MU5 A;  2Z4R A;  2MH8 A;  3CF6 E;  3KOY E;  5KPZ A;  3J7A S;  4DR6 M;  3HHX A;  4LJ5 A;  3DFZ A;  1FNN A;  2V1C A;  3EIH A;  3GRR A;  3ILK A;  3J7B A;  2I7N A;  3KP0 E;  2ERC A;  1X37 A;  3GPY A;  2JY5 A;  3SMS A;  1L8Q A;  2DKL A;  3LW5 F;  5BPV A;  4II7 A;  2XGN A;  3PXG A;  3JAM S;  3U6S A;  1HNZ M;  1HR0 M;  4DV7 M;  2QP9 X;  2KZU A;  2QQ8 A;  1WR1 B;  1DGH A;  3H4M A;  3U60 B;  4MGI E;  4JI2 M;  4L78 A;  1DV0 A;  1IN6 A;  1LTM A;  4R71 A;  3A98 B;  3U6L A;  3SAV A;  4ANR A;  3GRV A;  3KXE C;  3FYD A;  3VK8 A;  4GC9 A;  2J7O A;  3UK6 A;  2ZM6 M;  1P3Q Q;  2CV0 A;  1D2N A;  3FYC A;  4WW0 A;  2UXB M;  1E94 E;  3KOW E;  4DV1 M;  4G4R A;  4GKJ M;  4KOD A;  4JI8 M;  4LZZ A;  3KS8 A;  2JA2 A;  2QZ4 A;  5DYI A;  4DR5 M;  3C9P A;  5IRE B;  3BOS A;  3KS4 A;  5EXP A;  3SAS A;  3GLI A;  2GNO A;  2VII A;  1XNQ M;  1WIV A;  2HAK A;  3AKZ A;  2CHV A;  4UN2 B;  1CUK A;  2DNA A;  2BJV A;  1TF0 B;  1TTE A;  4L4U A;  1Q39 A;  2DWZ B;  2E5L M;  4LFA M;  1W5T A;  1HT2 E;  3FUV A;  1IBK M;  3IG8 A;  1XMQ M;  1IFY A;  3GLF A;  2LH0 A;  5KPT A;  3TWK A;  4I81 A;  1BVS A;  1MJG M;  1HQC A;  1PRB A;  4LG2 A;  1VDL A;  3VLF B;  3TPZ A;  4IJF A;  2F5Q A;  4X64 M;  2H1R A;  3I4Y A;  3CTW B;  1Z59 A;  1L2C A;  2JUJ A;  2VF8 A;  3FTC A;  4B3R M;  1TH2 A;  4JV5 M;  2L7I A;  2EA0 A;  4L16 A;  4D82 A;  1XXH A;  2C9C A;  4DV3 M;  4OW0 A;  3M7G A;  1R2Z A;  4Z6Y A;  3KDS E;  2L2D A;  2LHG A;  3L25 A;  5ITT A;  1TH4 A;  1IN5 A;  1DO0 A;  3HWS A;  3ZH9 B;  3FRH A;  3U6M A;  4M9X A;  1PJQ A;  3VDU A;  2MR9 A;  2C96 A;  2MGW A;  2LVA A;  4QOS A;  5IT9 S;  3HGI A;  4ITQ A;  3GLH B;  5BR8 M;  3HU1 A;  4DUY M;  2M5Z A;  1YUB A;  2LVP C;  5EXT A;  3TWL A;  2C98 A;  2DAK A;  1OTR A;  2BWB A;  2WSE F;  3L28 A;  3RFW A;  1GL6 A;  1JR3 A;  2KNV A;  3T6P A;  2MRO B;  3IG5 A;  2A5Y B;  3SBJ A;  3MK6 A;  4KT0 F;  1SXJ B;  2DI0 A;  3J27 B;  2XFT A;  2DHR A;  2FOI C;  2JY7 A;  4RNA A;  1GO5 A;  4PDI A;  2RGH A;  4NSR A;  1VDD A;  3E21 A;  3GO8 A;  1IBM M;  1GVN A;  5ITQ A;  3SAU A;  5ITX E;  4LJA A;  1UFZ A;  2XZU A;  3QYE A;  2Y21 A;  2D7H A;  1IXR C;  3FUW A;  3GPP A;  4MGK E;  1AIP C;  1XHB A;  2KHH A;  1XXH E;  3CF0 A;  1QUS A;  1N77 A;  4LF6 M;  2UXD M;  5IWA M;  4CJ6 A;  4JI5 M;  1VEJ A;  2FH0 A;  4HL4 A;  1XB2 B;  2L4E A;  4PD2 A;  4QOZ C;  2QSF X;  3CF2 A;  2WSC F;  3AOG A;  2XZF A;  1TDZ A;  4W5W A;  3MMP A;  3KVW A;  2DAM A;  3I04 M;  1GAB A;  1A5T A;  3MHV C;  3GLI E;  3KSJ A;  1D0L A;  5E6J A;  1N32 M;  4R7G A;  4GHA A;  4TUW A;  2XLJ A;  2R45 A;  3T1Y M;  5C18 A;  2D7G A;  2KNZ A;  1OKS A;  2XF3 A;  5FLX S;  4BLC A;  2LHC A;  1G3I A;  4DV5 M;  3E46 A;  3LVV A;  2DHY A;  2JXN A;  5EP4 A;  2V1U A;  3ZC7 B;  2JWS A;  1D0M A;  1R5L A;  3PNY A;  2LVQ D;  1XXH B;  2LVO C;  2X4A A;  4FW9 A;  5EXS A;  3HX3 A;  2J5Y A;  4IBJ A;  4NL4 H;  3UJN A;  2LXE A;  3LCU A;  1NY5 A;  1SG9 A;  2C9O A;  4CGY B;  4KLN A;  4DR4 M;  4FWD A;  4DUZ M;  4LGM A;  2WSF F;  3THG A;  2M60 A;  3GP1 A;  3NBI A;  1WHC A;  1QAM A;  4R3D A;  4XK8 F;  2CEA A;  2F4V M;  1HJP A;  7CAT A;  5EP3 A;  4B7G A;  3C58 A;  1PJT A;  1VG5 A;  3A46 A;  3JR4 A;  2Z7J A;  3GQ4 A;  2R46 A;  4A3V B;  2K47 A;  4S12 A;  2R4E A;  4YY3 M;  2UUA M;  2Q2E B;  4OVZ B;  4P17 A;  4NRW A;  3GLH A;  3LMM A;  2G5G X;  1XMO M;  2QEN A;  5ITR A;  2R6F A;  3KW6 A;  3I51 A;  2DEN A;  2CV2 A;  2DAE A;  1N34 M;  2OO9 A;  2BNK A;  3TE6 A;  3U6P A;  3AL0 C;  2UUC M;  4NSO B;  3L29 A;  3B9P A;  3B7N A;  1IXZ A;  3U6O A;  2O5R A;  1WGN A;  3R8F A;  1HNX M;  3J80 S;  4JI6 M;  1NY6 A;  4KO8 A;  2FFJ A;  5LMN M;  1I94 M;  2DXI A;  1NV9 A;  3LQR A;  1Z6T A;  4LCB A;  4M0W A;  2YR0 A;  3U61 B;  3M6A A;  4RF0 A;  4LF9 M;  3W0F A;  3ZCB B;  3Q8X A;  5JI3 E;  4P16 A;  4MH0 E;  3WHL A;  1IY1 A;  3GLI B;  4B3M M;  3BXW A;  1ZMU A;  1K82 A;  1SXJ C;  3HKP A;  4X65 M;  2W82 A;  4DR3 M;  3LCV B;  1T6O A;  3UZU A;  4IJE A;  2N35 A;  4RKU F;  2G3Q A;  4DV4 M;  5EP2 A;  1L1T A;  3AOE A;  1I4W A;  3T38 A;  2F5O A;  2V6Z M;  3GLF B;  1OAO C;  1PJJ A;  3PFI A;  4QHS A;  4DR7 M;  1R7R A;  4RF1 A;  2KNA A;  1R6B X;  1IY0 A;  1YSY A;  2R18 A;  1JQJ C;  2R62 A;  3GLH E;  2EKK A;  4AW4 A;  2ZTD A;  3I01 M;  2XSZ A;  4D80 A;  5FSW A;  2HKJ A;  4Q7J A;  3GLG B;  2EUC A;  2XH9 A;  4CHT B;  2UXC M;  2KW0 A;  4NXN M;  5EJC A;  3B89 A;  5EP1 A;  1C1K A;  2KRK A;  4M9S A;  1J09 A;  4AKI A;  2JNH A;  4L15 A;  1Y8G A;  1XNR M;  1WJ7 A;  4X62 M;  1WXQ A;  5FTN A;  4LF4 M;  2LBC A;  5DFL A;  4DV0 M;  2DZL A;  3JR5 A;  4JYA M;  1K3X A;  2Y0T A;  1GJS A;  2G8L A;  1ZV1 A;  3EIE A;  3SC3 A;  3GRU A;  3K9P A;  4G4Q A;  5KPR A;  3C3E A;  2CFO A;  1NO1 A;  5A2Q S;  4LRT A;  2Z4S A;  3SAT A;  1EIJ A;  2KA6 B;  2QHO B;  2JY8 A;  3OTO M;  2D7E A;  4FWG A;  3FTE A;  3A45 A;  3FE3 A;  3FRI A;  1IN7 A;  4MGY E;  5DNY A;  5GKN A;  5LMU M;  3GLG A;  3ZQJ A;  1TGU A;  4I8O A;  4PT5 A;  2CHQ A;  2BWE A;  2DWN A;  4K0K M;  1OIP A;  2OOA A;  1KFV A;  4QNR A;  1DGG A;  1QDT A;  1TDH A;  3BBZ A;  3IEC A;  3E9S A;  4GIP A;  3J81 S;  3RE8 A;  3VDP A;  1OQY A;  3RGP A;  1DGF A;  4X66 M;  4AG5 A;  4B7F A;  4AKH A;  1RU3 A;  3VKH A;  2R44 A;  2LTU A;  3HZJ A;  2ZTC A;  3A42 A;  1QVR A;  1V34 A;  2DAG A;  3FTD A;  1G4A E;  4AKG A;  1DO2 A;  3TWM A;  2CRU A;  2ZAN A;  2YQZ A;  1IXS A;  3HJS A;  1IBL M;  1NNU C;  1YE9 A;  4MGZ E;  3FUU A;  3U5Z B;  2NQ8 C;  4I5S A;  3GLG E;  1OJL A;  3W67 A;  2KEB A;  4F2L A;  2QBY B;  2K9D A;  1OIZ A;  1N33 M;  2RGO A;  3FKE A;  4HEO A;  4FCV A;  4LY6 A;  4REZ A;  2X8A A;  3PNV A;  3U6C A;  1AUA A;  1OAI A;  1G59 A;  2UUB M;  1GL7 A;  1R4G A;  2P5T A;  2JY6 B;  1KSF X;  2WZJ A;  4PDG A;  3B7Q A;  3SHG B;  3F92 A;  1IQP A;  1PJS A;  4LJ4 A;  2XSZ D;  3HHW A;  2I7P A;  3AOE C;  3Q8G A;  4JI4 M;  4GKK M;  3VKG A;  1IY2 A;  3UGJ A;  2OQ4 A;  1TH3 A;  2DWM A;  4JI7 M;  3MJ5 A;  2K0B X;  1J7K A;  2EKF A;  3DOA A;  1IN8 A;  3D8L A;  2QPA A;  3HU3 A;  1Q02 A;  2L7H A;  2ZAO A;  1OFH A;  3HHY A;  3U6E A;  5IZ7 D;  1NSF A;  4HLQ A;  1S3S A;  3GPU A;  2R4J A;  3LQQ A;  5JI2 E;  2L6O A;  2RKO A;  2CHG A;  5EXX A;  1Q3B A;  3NWL A;  4LFB M;  1JB0 F;  5KQD A;  3L26 A;  1Q3C A;  2F5P A;  4LF8 M;  4LF5 M;  3QYB A;  2FS1 A;  2MJ5 B;  4GMQ A;  1JR3 D;  2YFQ A;  4MB7 A;  5C1B A;  4LRS A;  3T1H M;  1ZMW A;  2KRU A;  5FTL A;  1ORY B;  2HCB A;  1PGY A;  1J5E M;  2VDB B;  3FD9 A;  2APL A;  2X49 A;  1G71 A;  1ZQ9 A;  3GLF E;  2CV1 A;  2HHH M;  2KZS A;  3KSX A;  1EFU B;  4FCT A;  4DR2 M;  1UM8 A;  3HJQ A;  2CUZ A;  4B08 A;  3VFD A;  1NNJ A;  3D8B A;  4L6V 6;  3K9O A;  4GHL A;  3KOZ E;  3V76 A;  4AI6 A;  4OU7 A;  1NJF A;  1T3T A;  4LJ7 A;  4BB9 A;  4LJ9 A;  1QDR A;  1DGB A;  1NHW C;  1WGL A;  2KDL A;  3B74 A;  4DV6 M;  1G8P A;  2L09 A;  1F4I A;  2L4F A;  5F3W A;  4IIW A;  5FTK A;  4JN6 A;  4XBO A;  1DGH B;  1MN3 A;  1YLA A;  4FCW A;  1KYI A;  4QNM A;  4OVZ A;  4IBK A;  1E9R A;  2OPF A;  3E4R A;  4BBA A;  2JZ0 A;  4M9Z A;  3DA1 A;  3U5Z A;  2Y20 A;  3HU2 A;  8CAT A;  2VQF M;  2Y0Q A;  3W0L B;  1L2B A;  4L8R C;  4G4O A;  2F5N A;  4IBI A;  2YNM D;  1SXJ D;  2DZN B;  4G4N A;  4LGY A;  2EJS A;  4AG6 A;  1Z5B A;  4PCZ A;  3FUT A;  3GRY A;  4QHT A;  1K3W A;  1SXJ E;  2OOB A;  3FUX A;  3U61 A;  3FTF A;  4GEW A;  2Z8Y M;  4LJ8 A;  4EIW A;  1VQ1 A;  4IBD A;  3UMM A;  2CP8 A;  1IN4 A;  4FVM A;  2RRU A; 
#chains in the Genus database with same CATH homology
 3R9X B;  2F5S A;  2HL7 A;  4OX9 M;  4AZF A;  3SHF A;  1IM2 A;  1PJI A;  4MGH A;  3SAW A;  2XFS A;  1XC8 A;  4IBE A;  3AV0 A;  4Z8X A;  3L2A A;  3SYL A;  4LFC M;  3K2L A;  4AQY M;  3K8Z A;  4IBF A;  2FNA A;  3U6D A;  1QAN A;  3KP1 E;  1E9S A;  1W5S A;  4YHH M;  2J7N A;  4B7H A;  1HNW M;  4M0D A;  3TQS A;  4XGI A;  1L2D A;  1E32 A;  2C99 A;  4DR1 M;  2DZO B;  3GQ3 A;  1SXJ A;  5KQ8 A;  4IBC A;  3QWL A;  2CE7 A;  3I4V A;  1MX0 A;  1NJG A;  1OFI A;  2EO2 A;  1HT1 E;  5H37 D;  3K92 A;  1QAQ A;  4NOO B;  3GQ5 A;  3VK7 A;  1FJG M;  2XEP A;  2AHM A;  3J2P B;  3U60 A;  1N36 M;  5DYG A;  4LZJ A;  4CIS A;  4I4L A;  4NXM M;  1ZAE A;  4GH9 A;  1H6U A;  4ZPX A;  1GLN A;  3HJ8 A;  4JI0 M;  1Z5A A;  3GPX A;  3K1J A;  2VQE M;  3SAR A;  4JI3 M;  5ITU A;  5EQT A;  4G6Z A;  3HHZ A;  4LJ6 A;  1L1Z A;  4GIT A;  1QYR A;  5KO3 A;  1NVM A;  4LF7 M;  3AJI B;  1G41 A;  3SFZ A;  1GKI A;  4IBG A;  4KHP M;  1N78 A;  2ZBK B;  3SYK A;  1NHG C;  2Z3X A;  3AFH A;  1IXS B;  5FTJ A;  1PM5 A;  5ITY A;  2LNH C;  1QZM A;  1HQY E;  2UU9 M;  4GC5 A;  4NRV A;  5ITX A;  4WUR A;  5FTM A;  1R2Y A;  2QBY A;  4FD2 A;  2DWL A;  3T15 A;  4JXJ A;  3L27 A;  1N75 A;  1LV7 A;  4GRI A;  4DR6 M;  4JI1 M;  2DVW B;  2FE8 A;  2KXE A;  3U6Q A;  3LVW A;  2C5R A;  4B3S M;  4DV2 M;  3PVS A;  2ZAM A;  1EE8 A;  2R65 A;  3M0E A;  5E26 A;  1QQW A;  3QAU A;  3KOX E;  4IBB A;  1XWI A;  3DZD A;  3KFU G;  4MM3 B;  2LWX A;  4B3T M;  3WHK A;  2QCU A;  3RGS A;  3TL4 X;  1Z5C A;  1QAO A;  4D81 A;  2BJW A;  3SMP A;  1MU5 A;  2Z4R A;  5KPZ A;  3CF6 E;  3KOY E;  3J7A S;  3HHX A;  4LJ5 A;  3DFZ A;  1FNN A;  2V1C A;  3EIH A;  3GRR A;  3ILK A;  3J7B A;  2I7N A;  3KP0 E;  2ERC A;  1X37 A;  3GPY A;  3SMS A;  1L8Q A;  5BPV A;  4II7 A;  2XGN A;  3PXG A;  3JAM S;  3U6S A;  1HNZ M;  1HR0 M;  4DV7 M;  2QP9 X;  2KZU A;  1DGH A;  3H4M A;  3U60 B;  4MGI E;  4JI2 M;  4L78 A;  1IN6 A;  3A98 B;  3U6L A;  3SAV A;  3GRV A;  3KXE C;  3FYD A;  3VK8 A;  4GC9 A;  2J7O A;  3UK6 A;  2ZM6 M;  2CV0 A;  1D2N A;  3FYC A;  4WW0 A;  2UXB M;  1E94 E;  3KOW E;  4DV1 M;  4G4R A;  4GKJ M;  4KOD A;  4JI8 M;  4LZZ A;  3KS8 A;  2JA2 A;  2QZ4 A;  5DYI A;  4DR5 M;  5IRE B;  3BOS A;  3KS4 A;  5EXP A;  3SAS A;  3GLI A;  2VII A;  1XNQ M;  3AKZ A;  2CHV A;  2BJV A;  4L4U A;  1Q39 A;  2DWZ B;  2E5L M;  4LFA M;  1W5T A;  1HT2 E;  3FUV A;  1IBK M;  3IG8 A;  1XMQ M;  3GLF A;  2LH0 A;  5KPT A;  3TWK A;  4I81 A;  1HQC A;  4LG2 A;  3VLF B;  3TPZ A;  4IJF A;  2F5Q A;  4X64 M;  2H1R A;  3I4Y A;  3CTW B;  1Z59 A;  1L2C A;  3FTC A;  4B3R M;  1TH2 A;  4JV5 M;  2L7I A;  2EA0 A;  4L16 A;  4D82 A;  1XXH A;  2C9C A;  4DV3 M;  4OW0 A;  3M7G A;  1R2Z A;  4Z6Y A;  3KDS E;  3L25 A;  5ITT A;  1TH4 A;  1IN5 A;  1DO0 A;  3HWS A;  3ZH9 B;  3U6M A;  4M9X A;  3VDU A;  2C96 A;  4QOS A;  5IT9 S;  3HGI A;  4ITQ A;  3GLH B;  5BR8 M;  3HU1 A;  4DUY M;  2M5Z A;  1YUB A;  5EXT A;  3TWL A;  2C98 A;  3L28 A;  3RFW A;  1GL6 A;  1JR3 A;  3IG5 A;  2A5Y B;  3SBJ A;  3MK6 A;  1SXJ B;  3J27 B;  2XFT A;  2DHR A;  2FOI C;  4RNA A;  4PDI A;  2RGH A;  4NSR A;  1VDD A;  1IBM M;  3GO8 A;  1GVN A;  5ITQ A;  3SAU A;  5ITX E;  4LJA A;  2XZU A;  2Y21 A;  2D7H A;  1IXR C;  3FUW A;  3GPP A;  4MGK E;  1XHB A;  3CF0 A;  2UXD M;  1N77 A;  4LF6 M;  5IWA M;  4JI5 M;  4HL4 A;  4PD2 A;  4QOZ C;  3CF2 A;  3AOG A;  2XZF A;  1TDZ A;  4W5W A;  3KVW A;  3MHV C;  3KSJ A;  5E6J A;  1N32 M;  4R7G A;  4GHA A;  4TUW A;  2XLJ A;  2R45 A;  3T1Y M;  5C18 A;  2D7G A;  2XF3 A;  5FLX S;  4BLC A;  1G3I A;  4DV5 M;  3LVV A;  5EP4 A;  2V1U A;  3ZC7 B;  3PNY A;  1XXH B;  4FW9 A;  2X4A A;  5EXS A;  4IBJ A;  4NL4 H;  3UJN A;  2LXE A;  1NY5 A;  4DR4 M;  2C9O A;  4CGY B;  4KLN A;  4FWD A;  4DUZ M;  4LGM A;  3THG A;  2M60 A;  3GP1 A;  3NBI A;  1QAM A;  4R3D A;  2F4V M;  2CEA A;  7CAT A;  5EP3 A;  4B7G A;  3C58 A;  3A46 A;  3JR4 A;  2Z7J A;  3GQ4 A;  2R46 A;  4A3V B;  2K47 A;  4S12 A;  2R4E A;  4YY3 M;  2UUA M;  2Q2E B;  4OVZ B;  4NRW A;  3GLH A;  3LMM A;  2G5G X;  1XMO M;  2QEN A;  5ITR A;  3KW6 A;  3I51 A;  2CV2 A;  1N34 M;  3TE6 A;  2BNK A;  3U6P A;  3AL0 C;  2UUC M;  4NSO B;  3L29 A;  3B9P A;  1IXZ A;  3U6O A;  2O5R A;  3R8F A;  1HNX M;  4JI6 M;  3J80 S;  1NY6 A;  4KO8 A;  2FFJ A;  5LMN M;  1I94 M;  2DXI A;  3LQR A;  1Z6T A;  4LCB A;  4M0W A;  2YR0 A;  3U61 B;  3M6A A;  4RF0 A;  4LF9 M;  3W0F A;  3ZCB B;  3Q8X A;  5JI3 E;  4P16 A;  4MH0 E;  3WHL A;  1IY1 A;  3GLI B;  4B3M M;  1N33 M;  1K82 A;  1SXJ C;  3HKP A;  4X65 M;  2W82 A;  4DR3 M;  3UZU A;  4IJE A;  4DV4 M;  5EP2 A;  1L1T A;  3AOE A;  1I4W A;  3T38 A;  2F5O A;  2V6Z M;  3GLF B;  1PJJ A;  3PFI A;  4QHS A;  4DR7 M;  1R7R A;  4RF1 A;  1R6B X;  1IY0 A;  1YSY A;  2R18 A;  1JQJ C;  2R62 A;  4AW4 A;  2XSZ A;  4D80 A;  5FSW A;  2HKJ A;  3GLG B;  2EUC A;  2XH9 A;  4CHT B;  2UXC M;  2KW0 A;  4NXN M;  5EJC A;  5EP1 A;  1C1K A;  2KRK A;  4M9S A;  1J09 A;  4AKI A;  4L15 A;  1XNR M;  4X62 M;  1WXQ A;  5FTN A;  4LF4 M;  4DV0 M;  3JR5 A;  4JYA M;  1K3X A;  2Y0T A;  2G8L A;  3EIE A;  3SC3 A;  3GRU A;  4G4Q A;  5KPR A;  2CFO A;  5A2Q S;  4LRT A;  2Z4S A;  3SAT A;  2KA6 B;  3OTO M;  2D7E A;  4FWG A;  3FTE A;  3A45 A;  4MGY E;  5DNY A;  1IN7 A;  5GKN A;  5LMU M;  3GLG A;  1TGU A;  4I8O A;  4PT5 A;  2CHQ A;  2DWN A;  4K0K M;  1KFV A;  4QNR A;  1DGG A;  1TDH A;  3J81 S;  3E9S A;  4GIP A;  3RE8 A;  3VDP A;  3RGP A;  1DGF A;  4X66 M;  4AG5 A;  4B7F A;  4AKH A;  3VKH A;  3A42 A;  1QVR A;  3FTD A;  1G4A E;  4AKG A;  1DO2 A;  3TWM A;  2ZAN A;  2YQZ A;  3HJS A;  1IBL M;  1NNU C;  1YE9 A;  4MGZ E;  3FUU A;  3U5Z B;  2NQ8 C;  4I5S A;  1OJL A;  2KEB A;  2QBY B;  2RGO A;  3FKE A;  4FCV A;  4LY6 A;  4REZ A;  2X8A A;  3PNV A;  3U6C A;  1G59 A;  2UUB M;  1GL7 A;  2P5T A;  1KSF X;  4PDG A;  3SHG B;  1IQP A;  4LJ4 A;  2XSZ D;  3HHW A;  2I7P A;  3AOE C;  4JI4 M;  4GKK M;  3VKG A;  1IY2 A;  3UGJ A;  2OQ4 A;  1TH3 A;  2DWM A;  4JI7 M;  3MJ5 A;  1J7K A;  3DOA A;  1IN8 A;  3D8L A;  2QPA A;  3HU3 A;  2ZAO A;  2L7H A;  3U6E A;  1OFH A;  3HHY A;  5IZ7 D;  1NSF A;  4HLQ A;  1S3S A;  3GPU A;  2R4J A;  3LQQ A;  5JI2 E;  2L6O A;  2RKO A;  2CHG A;  5EXX A;  1Q3B A;  3NWL A;  4LFB M;  5KQD A;  3L26 A;  1Q3C A;  2F5P A;  4LF8 M;  4LF5 M;  4GMQ A;  1JR3 D;  2YFQ A;  4MB7 A;  5C1B A;  4LRS A;  3T1H M;  2KRU A;  5FTL A;  1ORY B;  2HCB A;  1J5E M;  3FD9 A;  2X49 A;  1ZQ9 A;  2CV1 A;  2HHH M;  2KZS A;  3KSX A;  4FCT A;  4DR2 M;  1UM8 A;  3HJQ A;  2CUZ A;  4B08 A;  3VFD A;  1NNJ A;  3D8B A;  4GHL A;  3KOZ E;  4AI6 A;  4OU7 A;  1NJF A;  1T3T A;  4LJ7 A;  4BB9 A;  4LJ9 A;  1DGB A;  1NHW C;  4DV6 M;  1G8P A;  2L09 A;  5F3W A;  4IIW A;  5FTK A;  4JN6 A;  4XBO A;  1DGH B;  4FCW A;  1KYI A;  4QNM A;  4OVZ A;  4IBK A;  1E9R A;  2OPF A;  3E4R A;  4BBA A;  3U5Z A;  4M9Z A;  3DA1 A;  2Y20 A;  3HU2 A;  8CAT A;  2VQF M;  2Y0Q A;  3W0L B;  1L2B A;  4L8R C;  4G4O A;  2F5N A;  4IBI A;  2YNM D;  1SXJ D;  2DZN B;  4G4N A;  4LGY A;  4AG6 A;  1Z5B A;  4PCZ A;  3FUT A;  3GRY A;  4QHT A;  1K3W A;  1SXJ E;  3FUX A;  3U61 A;  3FTF A;  4LJ8 A;  4EIW A;  4IBD A;  3UMM A;  4FWH A;  1IN4 A;  4FVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...