2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/protein-binding
molecule keywords 26S proteasome non-ATPase regulatory subunit 10
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
1IY1A 4FCVA 4LJ4A 4KLNA 4LRTA 1IXZA 3GLFA 1KSFX 2FNAA 4ZPXA 2V1UA 1G4AE 1QVRA 3ZH9B 4LZZA 1JQJC 1NVMA 1R7RA 4LJAA 2V6ZM 2DHRA 1SXJE 3WHKA 1L8QA 4A3VB 3K1JA 3U5ZB 1G3IA 1NSFA 1IXSB 2CHQA 1DO2A 1NJFA 2QPAA 1IN5A 1KYIA 2C96A 4FCTA 4LJ6A 4FWGA 2QBYB 5DYIA 1SXJA 4KO8A 2R65A 3PFIA 2QP9X 3GLGB 3HWSA 1S3SA 1NY5A 3MHVC 3BOSA 1FNNA 1E32A 1NY6A 1XXHA 3CF0A 3GLIB 5EP4A 3KW6A 2DZNB 4FWDA 2CHGA 3EIEA 5DYGA 2ZAMA 1C1KA 3B9PA 4LY6A 4L4UA 1IY0A 2X8AA 2DZOB 4LGMA 5EP2A 5FTJA 3M6AA 1OFIA 4FW9A 1JR3A 4D80A 3KDSE 2BJWA 1JR3D 3GLHA 1UM8A 2R62A 4GITA 5EXSA 3H4MA 1G41A 4LJ5A 3DZDA 1IN8A 3M0EA 4QNRA 5EQTA 3SYKA 1IN6A 3VLFB 5C1BA 1IY2A 2DVWB 2C9OA 4FCWA 5EXPA 3GLFB 4D81A 1W5TA 1IQPA 1IM2A 1HT1E 1NJGA 1HQCA 1OFHA 4FWHA 4FD2A 4QHTA 4L16A 2KRKA 3SC3A 3U60B 4LJ9A 5C18A 2BJVA 4QNMA 1IN7A 5EP3A 1HT2E 1SXJC 3D8BA 1E94E 2CHVA 1R6BX 1LV7A 5JI3E 5FTMA 4QHSA 1OJLA 4KODA 3WHLA 5JI2E 4LRSA 2CE7A 3SYLA 2Z4SA 4QOSA 2C99A 1X37A 5EXXA 2QBYA 3AJIB 2DWZB 1SXJB 4D82A 2QENA 2ZANA 4LCBA 4LJ7A 3HU3A 2Z4RA 3GLGA 4EIWA 3HU1A 1D2NA 1J7KA 1XXHB 2XSZA 3PVSA 3GLIA 1SXJD 2XSZD 3UK6A 3HU2A 3PXGA 1QZMA 3U61B 1W5SA 1HQYE 3VFDA 2ZAOA 2RKOA 1IXRC 1IN4A 2C98A 2C9CA 2VIIA 1DO0A 4L15A 4LJ8A 5FTLA 4I4LA 5FTKA 5FTNA 3EIHA 3R8FA 3CF2A 2HCBA 4WW0A 3GLHB 1XWIA 5EXTA 4I81A 5EP1A 2CEAA 2QZ4A 4JN6A 4Z8XA
chains in the Genus database with same CATH superfamily
3T1HM 1IY1A 4GKKM 1QDRA 4IBIA 4KLNA 4LRTA 1Z5BA 1GL7A 5A2QS 4G4OA 3GQ4A 4P16A 1QANA 2D7HA 3GPPA 4LZZA 1MJGM 2VF8A 4DV7M 4R7GA 2F5NA 5LMUM 1JQJC 1D0MA 2APLA 2JY7A 5GKNA 2YFQA 3UZUA 1K3WA 4GHLA 4FVMA 4X64M 4HL4A 1Z6TA 5KO3A 2R0IA 3K1JA 3QYBA 2DAGA 1G3IA 1NSFA 2DZLA 2JP7A 1TF0B 3B74A 4GIPA 2MGWA 3J7BA 1NJFA 3T1YM 1IN5A 1RU3A 5KPZA 2QBYB 1R4GA 2Y0TA 1SXJA 1G8PA 2R65A 3BXWA 1OKSA 3LQQA 4KO8A 1S3SA 3MHVC 3SATA 2Y0QA 3CF0A 2JA2A 2I7PA 2R4JA 3IHPA 3A42A 4PDIA 4M9SA 1C1KA 3TE6A 1A5TA 2B3TA 2KZSA 4DV2M 1R5LA 4LFCM 4OVZA 4MH0E 4MGYE 4JV5M 3KOWE 3HHWA 1XB2B 3NWLA 1JR3A 4MM3B 3QAUA 4GH9A 2J7NA 2UUCM 3R9XB 1QZEA 1UM8A 2G3QA 2R62A 3H4MA 2QCUA 2R45A 3I04M 3K92A 3SMSA 2GQFA 3SHFA 4QNRA 5KQ8A 4B3MM 3E4RA 3HJ8A 2JZ0A 3JAMS 2NQ8C 2JZ1A 3GRUA 5EXPA 3GLFB 4D81A 1VDLA 4B7FA 1L2DA 1W5TA 2QSFX 4W5WA 3W67A 4MGZE 3J27B 3I4YA 1OFHA 4FD2A 4AKHA 2CV0A 3LCUA 2JY6B 3FKEA 3FUUA 1VEGA 3L29A 2BJVA 4RF0A 2KEBA 2XGNA 2MROB 1IN7A 3AOGA 3LW5F 4MGHA 1HT2E 2XH9A 1QQWA 1WHCA 2Y21A 3D8BA 4DV5M 4GHAA 4LFBM 2UXDM 2JWSA 4M0WA 4XK8F 3KP0E 5KPRA 1N33M 3CTWB 4KODA 4PT5A 1ZAEA 3WHLA 3RE8A 1L1ZA 1GJTA 1WXQA 4QOSA 4CIZA 4DUYM 2C99A 5EXXA 2Q2EB 2G8LA 4GRIA 1D0KA 2DWZB 3L27A 4WURA 1SXJB 1VDDA 2K0BX 3QYEA 4Z6YA 4LJ7A 2HHHM 2RGOA 5KQDA 4LF7M 3IG5A 1D0LA 2XZUA 2UXBM 4REZA 3SBJA 3RGPA 2YR0A 2LVAA 1TH4A 2XSZD 3HU2A 3W68A 4CHTB 3GQ5A 3PXGA 4DR3M 3U61B 3SASA 3FE3A 1HQYE 4CJ6A 4K0KM 2OQ4A 3ZCBB 3U6LA 1IN4A 3A98B 2A5YB 4OVZB 3H4JA 2OPFA 3GPUA 2VIIA 1K3XA 2JXNA 2Z8YM 4NSOB 3DA1A 3EIHA 2W82A 2LVNC 2VF7A 4DV4M 2CFOA 3GPXA 1I4WA 3KP1E 3K2LA 4GC9A 2QZ4A 1PRBA 3T6PA 4Z8XA 1OAOC 3GLHE 3GLFE 3GLFA 1NHGC 1IXZA 4Y28F 2V1CA 2L4FA 4M9ZA 1VQ1A 2ZTDA 4ZPXA 3E21A 2UU9M 4PCZA 3KFUG 1QVRA 3T38A 1PJSA 3HX3A 4XBOA 1LTMA 3L26A 2DHRA 2L4EA 4G4NA 3GPYA 2L09A 3AV0A 4A3VB 4B08A 3SARA 1UFZA 2OO9A 2P5TA 4MB7A 3B7QA 4L78A 4DR4M 2RRUA 4LG2A 3HHYA 4IBKA 2LVOC 4JI8M 1H6UA 1KYIA 1QAMA 4GKJM 4LJ6A 2KHHA 2F5OA 2CV1A 1N32M 5DYIA 1QDTA 1DGHA 2DKLA 3L2AA 3PFIA 3FTEA 3HWSA 4IBJA 1L1TA 3NBIA 3BOSA 1FNNA 4NC6A 4DR7M 1NY6A 3I51A 5EP4A 1FJGM 2HWJA 2DZNB 3GLGE 3EIEA 3U61A 1QUTA 4LF8M 4OU7A 2MH8A 4NXMM 2HAKA 4L4UA 4JXJA 2CUZA 3VK8A 1P3QQ 5E26A 4B3TM 3M6AA 4JI5M 1XMOM 4FW9A 2AHMA 4OW0A 1IFYA 2BWEA 3CF6E 3FYDA 4D80A 4JI1M 4G4QA 1WR1B 1E9SA 3SYKA 4KT0F 3VDUA 2QNJA 4CISA 2KNZA 5BPVA 2Z3XA 2DVWB 4DBGB 1NV9A 4LF5M 3MJ5A 1OAIA 1WIVA 3IG8A 1HT1E 1NJGA 1HQCA 3K9PA 3TPZA 5ITXA 4G6ZA 3GO8A 4NXNM 1PJJA 1N75A 4L16A 4QHTA 2LNHC 3U60B 4LJ9A 3FUWA 2OOBA 4NOOB 1VG5A 4JI7M 5ITRA 2O25A 3RGSA 5E6JA 2BWBA 1AUAA 2CHVA 1IBKM 4AQYM 2M5ZA 5FTMA 4QHSA 3M7GA 5JI3E 1OJLA 5JI2E 3I4VA 4DR2M 4NRVA 4IJFA 3E46A 4AW4A 2LH0A 3LCVB 3U6MA 1I94M 1ZQ9A 1Z59A 1QYRA 3AJIB 4BB9A 3UGJA 2D7EA 1DGHB 4LCBA 3J81S 3HU3A 1Z5CA 2Z4RA 4RKUF 4EIWA 2LXEA 1D2NA 1PGYA 3BBZA 3FUTA 2DWMA 1Q3BA 4JI4M 5IZ7D 3PVSA 3KS4A 2DWLA 1SXJD 3ZQJA 3UK6A 2ZBKB 2R6FA 4ANRA 4DUZM 1ZMWA 2RKOA 3THGA 3UJNA 1IXRC 2KDLA 2L7IA 5DFLA 1GJSA 3C58A 2C9CA 3FTCA 1AIPC 3HHXA 1DO0A 4L15A 4LJ8A 5FTLA 3R8FA 5FTNA 4QOZC 2EKFA 2OOAA 2F5QA 3GLHB 1PJQA 2MR9A 3AL0C 2RGHA 4AKIA 1EFUB 1E9RA 1TH2A 1YE9A 4DV6M 3FUVA 4JN6A 3NBXX 3KVWA 2LVQD 1WGNA 2WSFF 3KS8A 4LJ4A 1C7YA 4AG6A 2FNAA 2V1UA 1G4AE 1ZMVA 4M9XA 4I5SA 4HLQA 4NSRA 4CGYB 2FS1A 1GO5A 3SMPA 3U60A 1NVMA 5ITYA 1R7RA 4LJAA 3ZC7B 1Z5AA 2V6ZM 1L2BA 2F5PA 1GLNA 2JNHA 1J09A 1NNUC 1MX0A 3HY5A 5EJCA 2DXIA 3KSJA 3W0LB 5DNYA 2CHQA 2JY5A 2QPAA 3L25A 1T6OA 3MK6A 2R44A 4FCTA 2WSEF 4FWGA 4KHPM 4DR5M 4HEOA 2JUJA 2O01F 5F3WA 4LF9M 3GLGB 3FYCA 2FE8A 4RNAA 4DV0M 1NY5A 2CV2A 3U6SA 2DAKA 1E32A 2XFTA 1XXHA 1QUSA 3GLIB 4PDGA 4IJEA 1OIPA 4FWDA 3U6CA 2CHGA 2ZTCA 5DYGA 4DV1M 2HL7A 4DR1M 2ZAMA 5KPTA 3B9PA 4TUWA 4LY6A 4B7HA 1Q39A 2XLJA 4GMQA 4B7GA 4LGMA 5EP2A 3AKZA 1OFIA 3KOYE 2KZUA 4Q7JA 2XEPA 3KDSE 1N77A 2DWNA 2BJWA 4YHHM 1EE8A 3GLHA 4GITA 3TL4X 1T3TA 5EXSA 3TWLA 1PJTA 2DAMA 3HHZA 1PJIA 3DZDA 3AFHA 3M0EA 4P17A 5EQTA 1IN6A 2KA6B 2WSCF 1OQYA 1L2CA 3AOEA 3VLFB 2EUCA 5C1BA 2C5RA 1IY2A 3F92A 2F4VM 2DAIA 3UMMA 4LFAM 3FUXA 3VKGA 4R3DA 3KSXA 2MJ5B 1ZMUA 4BBAA 1NHWC 4LGYA 2DAEA 3GRYA 1Y8GA 3SC3A 5C18A 2LHGA 3VK7A 4GC5A 3LQRA 4QNMA 1V33A 2WZJA 1SXJC 3U5ZA 1IBLM 2K47A 3KOZE 4JI3M 2LTUA 1XHBA 3TQSA 3U6PA 2DI0A 3IECA 1HNXM 2CE7A 5BR8M 3U6EA 3B7NA 1V34A 2I7NA 3FRHA 1X37A 2D7GA 3A45A 2R46A 2O5RA 3HJSA 3LVWA 1HNZM 4NRWA 1N78A 3LMMA 2QENA 2ZANA 3GLGA 1QAQA 3HKPA 4F2LA 1XXHE 3HU1A 4NL4H 5IREB 1J7KA 1TH3A 1XXHB 2K9DA 4IBGA 3GLIA 2G5GX 2KNAA 2Z7JA 2UUBM 1QAOA 3VFDA 4M0DA 3K8ZA 4ITQA 5ITTA 3FTDA 4IBBA 3RFWA 5H37D 2H5XA 4GEWA 2DNAA 1R2ZA 2JY8A 1BVSA 4I4LA 5FTKA 4X62M 4JYAM 2HCBA 4WW0A 3T15A 1NV8A 1XWIA 2N35A 1XNQM 3B89A 1ZV1A 4I81A 3JR5A 3SAUA 1N36M 1OTRA 2XF3A 1R2YA 4OX9M 2L2DA 4FCVA 2CRUA 4B3RM 1VEJA 1TR8A 2KNVA 4XGIA 1IBMM 1KSFX 3L28A 2BNKA 3VDPA 4IBDA 2M60A 2HKJA 3JR4A 3ZH9B 4IBEA 3CGWA 4JI2M 3VKHA 2UUAM 2R4EA 3SAVA 3W0FA 1SXJE 3WHKA 4L8RC 1EIJA 1L8QA 2CP8A 1Q02A 2X49A 4MGIE 3TWKA 5LMNM 2X4AA 3DOAA 3U5ZB 3HGIA 3PNYA 4S12A 4LF4M 1IXSB 2FH0A 4L6V6 1DO2A 3FRIA 4WP2A 2QQ8A 3C3EA 2C96A 3FTFA 5L8RF 2L7HA 2DENA 1OIZA 3MMPA 2J7OA 3C3DA 1YSYA 2QP9X 3GQ3A 4DV3M 3GLIE 3GRVA 2J5YA 3QWLA 3OTOM 1KFVA 1F4IA 4AI6A 2ZM6M 3KW6A 1HNWM 4F1IA 2Y20A 4X66M 2XZFA 4AKGA 2EKKA 5FLXS 1XC8A 1GKIA 4JI6M 4JI0M 8CATA 1IY0A 4IBCA 2X8AA 1DGGA 2DZOB 5ITUA 1G71A 4BLCA 3A46A 5FTJA 2L6OA 1DGBA 4DR6M 2R18A 2H1RA 4PD2A 2FFJA 2EJSA 4LZJA 1T43A 5ITQA 2K6BA 1JR3D 1G41A 4LJ5A 2KW0A 2LBCA 1IN8A 2EO2A 5IWAM 2LVPC 1DGFA 2KXEA 3FD9A 4FCWA 2C9OA 3DFZA 1GVNA 1TDHA 2EA0A 2GNOA 1XMQM 3SAWA 4LF6M 3SFZA 1JR3E 1IQPA 1IM2A 3TWMA 1JB0F 4FWHA 1ORYB 4B3SM 2KRUA 3C9PA 3I01M 3J2PB 2KRKA 5FSWA 1SG9A 1HR0M 2YNMD 1G59A 1TGUA 3GRRA 1HJPA 1YLAA 2CWBA 5EP3A 1E94E 3AOEC 3KXEC 3Q8XA 1R6BX 2FOIC 5IT9S 1IXSA 1LV7A 1MN3A 2LWXA 1NNJA 4LRSA 3PNVA 4UN2B 4RF1A 3SYLA 4X65M 2Z4SA 7CATA 2QBYA 3KOXE 4R71A 1WJ7A 1TTEA 4D82A 3U6OA 1J5EM 2YQZA 2F5SA 1PM5A 2VDBB 2LHCA 2VQEM 4YY3M 2XSZA 3ILKA 1DV0A 2XFSA 4G4RA 1GABA 1CUKA 1QZMA 3GP1A 3U6QA 1NO1A 1W5SA 2ZAOA 3B7ZA 3D8LA 3HJQA 4MGKE 3J80S 2UXCM 1YUBA 4I8OA 4AZFA 4IIWA 5ITXE 2C98A 4II7A 4G3OA 3LVVA 3Q8GA 1TDZA 4AG5A 1GL6A 2ERCA 1Q3CA 1MU5A 4IBFA 3SHGB 3CF2A 2E5LM 3U6DA 2VQFM 1WGLA 3J7AS 1N34M 3HZJA 5EXTA 1V92A 5EP1A 2CEAA 3E9SA 1K82A 3K9OA 1XNRM 1VEKA 2QHOB 3V76A 2DHYA
chains in the Genus database with same CATH topology
3T1HM 1IY1A 4GKKM 4IBIA 4KLNA 4LRTA 1Z5BA 1GL7A 5A2QS 4G4OA 3GQ4A 4P16A 1QANA 2D7HA 3GPPA 4LZZA 4DV7M 2F5NA 4R7GA 5LMUM 1JQJC 5GKNA 4GHLA 1K3WA 2YFQA 3UZUA 4FVMA 4X64M 4HL4A 1Z6TA 5KO3A 3K1JA 1G3IA 1NSFA 4GIPA 3J7BA 1NJFA 3T1YM 1IN5A 5KPZA 2QBYB 2Y0TA 1SXJA 1G8PA 2R65A 3LQQA 4KO8A 1S3SA 3MHVC 3SATA 2Y0QA 3CF0A 2JA2A 2I7PA 2R4JA 3A42A 4PDIA 4M9SA 1C1KA 3TE6A 2KZSA 4DV2M 4LFCM 4OVZA 4MH0E 4MGYE 4JV5M 3KOWE 3HHWA 3NWLA 1JR3A 4MM3B 3QAUA 4GH9A 2J7NA 2UUCM 3R9XB 1UM8A 2R62A 3K92A 3SHFA 3H4MA 2QCUA 2R45A 3SMSA 5KQ8A 4QNRA 4B3MM 3E4RA 3HJ8A 3JAMS 2NQ8C 3GRUA 5EXPA 3GLFB 4D81A 4B7FA 1L2DA 1W5TA 4W5WA 4MGZE 3J27B 3I4YA 1OFHA 4FD2A 4AKHA 2CV0A 3FKEA 3FUUA 3L29A 2BJVA 4RF0A 2KEBA 2XGNA 4MGHA 1IN7A 3AOGA 3J81S 4LF9M 1HT2E 2XH9A 1QQWA 2Y21A 3D8BA 4DV5M 4GHAA 4LFBM 2UXDM 4M0WA 3KP0E 5KPRA 1N33M 3CTWB 4KODA 4PT5A 1ZAEA 3WHLA 3RE8A 1L1ZA 1WXQA 4QOSA 4DUYM 2C99A 5EXXA 2Q2EB 2G8LA 4GRIA 2DWZB 3L27A 4WURA 1SXJB 1VDDA 4Z6YA 4LJ7A 2HHHM 2RGOA 5KQDA 4LF7M 3IG5A 2XZUA 2UXBM 4REZA 3SBJA 3RGPA 2YR0A 2XSZD 1TH4A 3HU2A 4CHTB 4DR3M 3GQ5A 3PXGA 3U61B 3SASA 1HQYE 4K0KM 2OQ4A 3ZCBB 3U6LA 1IN4A 3A98B 2A5YB 4OVZB 2OPFA 3GPUA 2VIIA 1K3XA 4NSOB 3DA1A 3EIHA 2W82A 4DV4M 2CFOA 3GPXA 1I4WA 3KP1E 3K2LA 4GC9A 2QZ4A 4Z8XA 3GLFA 1NHGC 1IXZA 2V1CA 4M9ZA 4ZPXA 2UU9M 4PCZA 3KFUG 1QVRA 3T38A 4XBOA 3L26A 2DHRA 4G4NA 3GPYA 2L09A 3AV0A 4A3VB 4B08A 3SARA 4MB7A 2P5TA 4DR4M 4L78A 4LG2A 3HHYA 4IBKA 4GKJM 4JI8M 1H6UA 1KYIA 1QAMA 4LJ6A 2F5OA 1N32M 2CV1A 5DYIA 1DGHA 3L2AA 3PFIA 3FTEA 3HWSA 4IBJA 1L1TA 3NBIA 3BOSA 1FNNA 4DR7M 1NY6A 3I51A 5EP4A 1FJGM 2DZNB 3EIEA 3U61A 4LF8M 4OU7A 4NXMM 4L4UA 4JXJA 2CUZA 3VK8A 5E26A 4B3TM 3M6AA 4JI5M 1XMOM 4FW9A 2AHMA 4OW0A 3CF6E 4D80A 3FYDA 4JI1M 4G4QA 1E9SA 3SYKA 3VDUA 4CISA 5BPVA 2Z3XA 2DVWB 4LF5M 3MJ5A 3IG8A 1HT1E 1NJGA 1HQCA 3TPZA 1PJJA 5ITXA 4G6ZA 3GO8A 4NXNM 1N75A 4L16A 4QHTA 2LNHC 3U60B 4LJ9A 3FUWA 4NOOB 4JI7M 5ITRA 3RGSA 5E6JA 1IBKM 2CHVA 4AQYM 2M5ZA 5FTMA 4QHSA 3M7GA 5JI3E 1OJLA 5JI2E 3I4VA 4DR2M 4NRVA 4IJFA 4AW4A 2LH0A 3U6MA 1I94M 1ZQ9A 1Z59A 1QYRA 3AJIB 4BB9A 3UGJA 2D7EA 1DGHB 4LCBA 3HU3A 1Z5CA 2Z4RA 4EIWA 2LXEA 1D2NA 3FUTA 2DWMA 1Q3BA 4JI4M 5IZ7D 3PVSA 3KS4A 2DWLA 1SXJD 3UK6A 2ZBKB 4DUZM 2RKOA 3THGA 3UJNA 1IXRC 2L7IA 3C58A 2C9CA 3FTCA 3HHXA 1DO0A 4L15A 4LJ8A 5FTLA 3R8FA 5FTNA 4QOZC 2F5QA 3GLHB 3AL0C 2RGHA 4AKIA 1E9RA 1TH2A 1YE9A 4DV6M 3FUVA 4JN6A 3KVWA 3KS8A 4LJ4A 4AG6A 2FNAA 2V1UA 1G4AE 4M9XA 4I5SA 4HLQA 4NSRA 4CGYB 3SMPA 3U60A 1NVMA 5ITYA 1R7RA 4LJAA 3ZC7B 1Z5AA 2V6ZM 1L2BA 2F5PA 1GLNA 1J09A 1NNUC 1MX0A 5EJCA 2DXIA 3KSJA 3W0LB 5DNYA 2CHQA 2QPAA 3L25A 3MK6A 4FCTA 4FWGA 4KHPM 4DR5M 5F3WA 3GLGB 3FYCA 2FE8A 4RNAA 4DV0M 1NY5A 2CV2A 3U6SA 1E32A 2XFTA 1XXHA 3GLIB 4PDGA 4IJEA 4FWDA 3U6CA 2CHGA 4DV1M 5DYGA 2HL7A 4DR1M 2ZAMA 5KPTA 3B9PA 4TUWA 4LY6A 4B7HA 1Q39A 2XLJA 4GMQA 4B7GA 4LGMA 5EP2A 3AKZA 1OFIA 3KOYE 2KZUA 2XEPA 3KDSE 1N77A 2DWNA 2BJWA 4YHHM 1EE8A 3GLHA 4GITA 3TL4X 1T3TA 5EXSA 3TWLA 3HHZA 1PJIA 3DZDA 3AFHA 3M0EA 5EQTA 1IN6A 2KA6B 1L2CA 3AOEA 3VLFB 2EUCA 5C1BA 2C5RA 1IY2A 2F4VM 3UMMA 4LFAM 3FUXA 3VKGA 4R3DA 3KSXA 4BBAA 1NHWC 4LGYA 3GRYA 3SC3A 5C18A 3VK7A 4GC5A 3LQRA 4QNMA 1SXJC 3U5ZA 1IBLM 3KOZE 2K47A 4JI3M 3U6PA 1XHBA 3TQSA 1HNXM 2CE7A 5BR8M 3U6EA 2I7NA 7CATA 1X37A 2D7GA 3HJSA 2O5RA 2R46A 3A45A 3LVWA 1HNZM 4NRWA 1N78A 3LMMA 2QENA 2ZANA 3GLGA 1QAQA 3HKPA 3HU1A 4NL4H 5IREB 1J7KA 1TH3A 1XXHB 3GLIA 4IBGA 2G5GX 2Z7JA 2UUBM 1QAOA 3VFDA 4M0DA 3K8ZA 4ITQA 5ITTA 3FTDA 4IBBA 3RFWA 5H37D 1R2ZA 4I4LA 5FTKA 4X62M 4JYAM 2HCBA 4WW0A 3T15A 1XWIA 1XNQM 4I81A 3JR5A 3SAUA 1N36M 4OX9M 2XF3A 1R2YA 4FCVA 4B3RM 4XGIA 1IBMM 1KSFX 3L28A 2BNKA 3VDPA 4IBDA 2M60A 2HKJA 3JR4A 3ZH9B 4IBEA 4JI2M 3VKHA 2UUAM 2R4EA 3SAVA 3W0FA 1SXJE 3WHKA 4L8RC 1L8QA 2X49A 4MGIE 5LMNM 3TWKA 2X4AA 3DOAA 3U5ZB 3HGIA 3PNYA 4S12A 4LF4M 1IXSB 1DO2A 3FTFA 2C96A 2L7HA 2J7OA 1YSYA 2QP9X 3GQ3A 4DV3M 3GRVA 3QWLA 3OTOM 1KFVA 4AI6A 2ZM6M 3KW6A 1HNWM 2Y20A 4X66M 2XZFA 4AKGA 5FLXS 4JI6M 1XC8A 1GKIA 4JI0M 8CATA 1IY0A 4IBCA 2X8AA 1DGGA 2DZOB 5ITUA 3A46A 4BLCA 5FTJA 2L6OA 1DGBA 4DR6M 2R18A 2H1RA 4PD2A 2FFJA 4LZJA 5ITQA 1JR3D 1G41A 4LJ5A 2KW0A 1IN8A 2EO2A 5IWAM 1DGFA 2KXEA 3FD9A 4FCWA 2C9OA 3DFZA 1GVNA 1TDHA 2EA0A 4LF6M 1XMQM 3SAWA 3SFZA 1IQPA 1IM2A 3TWMA 4FWHA 1ORYB 4B3SM 2KRUA 3J2PB 5FSWA 2KRKA 1HR0M 2YNMD 1G59A 1TGUA 3GRRA 5EP3A 1E94E 3AOEC 3KXEC 3Q8XA 1R6BX 2FOIC 5IT9S 1LV7A 2LWXA 1NNJA 4LRSA 3PNVA 4RF1A 3SYLA 4X65M 2Z4SA 2QBYA 3KOXE 4D82A 3U6OA 1J5EM 2F5SA 2YQZA 1PM5A 2VQEM 4YY3M 2XSZA 3ILKA 2XFSA 4G4RA 1QZMA 3GP1A 3U6QA 1W5SA 2ZAOA 3D8LA 3HJQA 4MGKE 3J80S 2UXCM 1YUBA 4I8OA 4AZFA 4IIWA 5ITXE 2C98A 4II7A 3LVVA 1TDZA 4AG5A 1GL6A 2ERCA 1Q3CA 1MU5A 4IBFA 3SHGB 3CF2A 2E5LM 3U6DA 2VQFM 3J7AS 1N34M 5EXTA 5EP1A 2CEAA 3E9SA 1K82A 1XNRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IY1 A;  4FCV A;  4LJ4 A;  4KLN A;  4LRT A;  1IXZ A;  3GLF A;  1KSF X;  2FNA A;  4ZPX A;  2V1U A;  1G4A E;  1QVR A;  3ZH9 B;  4LZZ A;  1JQJ C;  1NVM A;  1R7R A;  4LJA A;  2V6Z M;  2DHR A;  1SXJ E;  3WHK A;  1L8Q A;  4A3V B;  3K1J A;  3U5Z B;  1G3I A;  1NSF A;  1IXS B;  2CHQ A;  1DO2 A;  1NJF A;  2QPA A;  1IN5 A;  1KYI A;  2C96 A;  4FCT A;  4LJ6 A;  4FWG A;  2QBY B;  5DYI A;  1SXJ A;  4KO8 A;  2R65 A;  3PFI A;  2QP9 X;  3GLG B;  3HWS A;  1S3S A;  1NY5 A;  3MHV C;  3BOS A;  1FNN A;  1E32 A;  1NY6 A;  1XXH A;  3CF0 A;  3GLI B;  5EP4 A;  3KW6 A;  2DZN B;  4FWD A;  2CHG A;  3EIE A;  5DYG A;  2ZAM A;  1C1K A;  3B9P A;  4LY6 A;  4L4U A;  1IY0 A;  2X8A A;  2DZO B;  4LGM A;  5EP2 A;  5FTJ A;  3M6A A;  1OFI A;  4FW9 A;  1JR3 A;  4D80 A;  3KDS E;  2BJW A;  1JR3 D;  3GLH A;  1UM8 A;  2R62 A;  4GIT A;  5EXS A;  3H4M A;  1G41 A;  4LJ5 A;  3DZD A;  1IN8 A;  3M0E A;  4QNR A;  5EQT A;  3SYK A;  1IN6 A;  3VLF B;  5C1B A;  1IY2 A;  2DVW B;  2C9O A;  4FCW A;  5EXP A;  3GLF B;  4D81 A;  1W5T A;  1IQP A;  1IM2 A;  1HT1 E;  1NJG A;  1HQC A;  1OFH A;  4FWH A;  4FD2 A;  4QHT A;  4L16 A;  2KRK A;  3SC3 A;  3U60 B;  4LJ9 A;  5C18 A;  2BJV A;  4QNM A;  1IN7 A;  5EP3 A;  1HT2 E;  1SXJ C;  3D8B A;  1E94 E;  2CHV A;  1R6B X;  1LV7 A;  5JI3 E;  5FTM A;  4QHS A;  1OJL A;  4KOD A;  3WHL A;  5JI2 E;  4LRS A;  2CE7 A;  3SYL A;  2Z4S A;  4QOS A;  2C99 A;  1X37 A;  5EXX A;  2QBY A;  3AJI B;  2DWZ B;  1SXJ B;  4D82 A;  2QEN A;  2ZAN A;  4LCB A;  4LJ7 A;  3HU3 A;  2Z4R A;  3GLG A;  4EIW A;  3HU1 A;  1D2N A;  1J7K A;  1XXH B;  2XSZ A;  3PVS A;  3GLI A;  1SXJ D;  2XSZ D;  3UK6 A;  3HU2 A;  3PXG A;  1QZM A;  3U61 B;  1W5S A;  1HQY E;  3VFD A;  2ZAO A;  2RKO A;  1IXR C;  1IN4 A;  2C98 A;  2C9C A;  2VII A;  1DO0 A;  4L15 A;  4LJ8 A;  5FTL A;  4I4L A;  5FTK A;  5FTN A;  3EIH A;  3R8F A;  3CF2 A;  2HCB A;  4WW0 A;  3GLH B;  1XWI A;  5EXT A;  4I81 A;  5EP1 A;  2CEA A;  2QZ4 A;  4JN6 A;  4Z8X A; 
#chains in the Genus database with same CATH topology
 3T1H M;  1IY1 A;  4GKK M;  1QDR A;  4IBI A;  4KLN A;  4LRT A;  1Z5B A;  1GL7 A;  5A2Q S;  4G4O A;  3GQ4 A;  4P16 A;  1QAN A;  2D7H A;  3GPP A;  4LZZ A;  1MJG M;  2VF8 A;  4DV7 M;  4R7G A;  2F5N A;  5LMU M;  1JQJ C;  1D0M A;  2APL A;  2JY7 A;  5GKN A;  2YFQ A;  3UZU A;  1K3W A;  4GHL A;  4FVM A;  4X64 M;  4HL4 A;  1Z6T A;  5KO3 A;  2R0I A;  3K1J A;  3QYB A;  2DAG A;  1G3I A;  1NSF A;  2DZL A;  2JP7 A;  1TF0 B;  3B74 A;  4GIP A;  2MGW A;  3J7B A;  1NJF A;  3T1Y M;  1IN5 A;  1RU3 A;  5KPZ A;  2QBY B;  1R4G A;  2Y0T A;  1SXJ A;  1G8P A;  2R65 A;  3BXW A;  1OKS A;  3LQQ A;  4KO8 A;  1S3S A;  3MHV C;  3SAT A;  2Y0Q A;  3CF0 A;  2JA2 A;  2I7P A;  2R4J A;  3IHP A;  3A42 A;  4PDI A;  4M9S A;  1C1K A;  3TE6 A;  1A5T A;  2B3T A;  2KZS A;  4DV2 M;  1R5L A;  4LFC M;  4OVZ A;  4MH0 E;  4MGY E;  4JV5 M;  3KOW E;  3HHW A;  1XB2 B;  3NWL A;  1JR3 A;  4MM3 B;  3QAU A;  4GH9 A;  2J7N A;  2UUC M;  3R9X B;  1QZE A;  1UM8 A;  2G3Q A;  2R62 A;  3H4M A;  2QCU A;  2R45 A;  3I04 M;  3K92 A;  3SMS A;  2GQF A;  3SHF A;  4QNR A;  5KQ8 A;  4B3M M;  3E4R A;  3HJ8 A;  2JZ0 A;  3JAM S;  2NQ8 C;  2JZ1 A;  3GRU A;  5EXP A;  3GLF B;  4D81 A;  1VDL A;  4B7F A;  1L2D A;  1W5T A;  2QSF X;  4W5W A;  3W67 A;  4MGZ E;  3J27 B;  3I4Y A;  1OFH A;  4FD2 A;  4AKH A;  2CV0 A;  3LCU A;  2JY6 B;  3FKE A;  3FUU A;  1VEG A;  3L29 A;  2BJV A;  4RF0 A;  2KEB A;  2XGN A;  2MRO B;  1IN7 A;  3AOG A;  3LW5 F;  4MGH A;  1HT2 E;  2XH9 A;  1QQW A;  1WHC A;  2Y21 A;  3D8B A;  4DV5 M;  4GHA A;  4LFB M;  2UXD M;  2JWS A;  4M0W A;  4XK8 F;  3KP0 E;  5KPR A;  1N33 M;  3CTW B;  4KOD A;  4PT5 A;  1ZAE A;  3WHL A;  3RE8 A;  1L1Z A;  1GJT A;  1WXQ A;  4QOS A;  4CIZ A;  4DUY M;  2C99 A;  5EXX A;  2Q2E B;  2G8L A;  4GRI A;  1D0K A;  2DWZ B;  3L27 A;  4WUR A;  1SXJ B;  1VDD A;  2K0B X;  3QYE A;  4Z6Y A;  4LJ7 A;  2HHH M;  2RGO A;  5KQD A;  4LF7 M;  3IG5 A;  1D0L A;  2XZU A;  2UXB M;  4REZ A;  3SBJ A;  3RGP A;  2YR0 A;  2LVA A;  1TH4 A;  2XSZ D;  3HU2 A;  3W68 A;  4CHT B;  3GQ5 A;  3PXG A;  4DR3 M;  3U61 B;  3SAS A;  3FE3 A;  1HQY E;  4CJ6 A;  4K0K M;  2OQ4 A;  3ZCB B;  3U6L A;  1IN4 A;  3A98 B;  2A5Y B;  4OVZ B;  3H4J A;  2OPF A;  3GPU A;  2VII A;  1K3X A;  2JXN A;  2Z8Y M;  4NSO B;  3DA1 A;  3EIH A;  2W82 A;  2LVN C;  2VF7 A;  4DV4 M;  2CFO A;  3GPX A;  1I4W A;  3KP1 E;  3K2L A;  4GC9 A;  2QZ4 A;  1PRB A;  3T6P A;  4Z8X A;  1OAO C;  3GLH E;  3GLF E;  3GLF A;  1NHG C;  1IXZ A;  4Y28 F;  2V1C A;  2L4F A;  4M9Z A;  1VQ1 A;  2ZTD A;  4ZPX A;  3E21 A;  2UU9 M;  4PCZ A;  3KFU G;  1QVR A;  3T38 A;  1PJS A;  3HX3 A;  4XBO A;  1LTM A;  3L26 A;  2DHR A;  2L4E A;  4G4N A;  3GPY A;  2L09 A;  3AV0 A;  4A3V B;  4B08 A;  3SAR A;  1UFZ A;  2OO9 A;  2P5T A;  4MB7 A;  3B7Q A;  4L78 A;  4DR4 M;  2RRU A;  4LG2 A;  3HHY A;  4IBK A;  2LVO C;  4JI8 M;  1H6U A;  1KYI A;  1QAM A;  4GKJ M;  4LJ6 A;  2KHH A;  2F5O A;  2CV1 A;  1N32 M;  5DYI A;  1QDT A;  1DGH A;  2DKL A;  3L2A A;  3PFI A;  3FTE A;  3HWS A;  4IBJ A;  1L1T A;  3NBI A;  3BOS A;  1FNN A;  4NC6 A;  4DR7 M;  1NY6 A;  3I51 A;  5EP4 A;  1FJG M;  2HWJ A;  2DZN B;  3GLG E;  3EIE A;  3U61 A;  1QUT A;  4LF8 M;  4OU7 A;  2MH8 A;  4NXM M;  2HAK A;  4L4U A;  4JXJ A;  2CUZ A;  3VK8 A;  1P3Q Q;  5E26 A;  4B3T M;  3M6A A;  4JI5 M;  1XMO M;  4FW9 A;  2AHM A;  4OW0 A;  1IFY A;  2BWE A;  3CF6 E;  3FYD A;  4D80 A;  4JI1 M;  4G4Q A;  1WR1 B;  1E9S A;  3SYK A;  4KT0 F;  3VDU A;  2QNJ A;  4CIS A;  2KNZ A;  5BPV A;  2Z3X A;  2DVW B;  4DBG B;  1NV9 A;  4LF5 M;  3MJ5 A;  1OAI A;  1WIV A;  3IG8 A;  1HT1 E;  1NJG A;  1HQC A;  3K9P A;  3TPZ A;  5ITX A;  4G6Z A;  3GO8 A;  4NXN M;  1PJJ A;  1N75 A;  4L16 A;  4QHT A;  2LNH C;  3U60 B;  4LJ9 A;  3FUW A;  2OOB A;  4NOO B;  1VG5 A;  4JI7 M;  5ITR A;  2O25 A;  3RGS A;  5E6J A;  2BWB A;  1AUA A;  2CHV A;  1IBK M;  4AQY M;  2M5Z A;  5FTM A;  4QHS A;  3M7G A;  5JI3 E;  1OJL A;  5JI2 E;  3I4V A;  4DR2 M;  4NRV A;  4IJF A;  3E46 A;  4AW4 A;  2LH0 A;  3LCV B;  3U6M A;  1I94 M;  1ZQ9 A;  1Z59 A;  1QYR A;  3AJI B;  4BB9 A;  3UGJ A;  2D7E A;  1DGH B;  4LCB A;  3J81 S;  3HU3 A;  1Z5C A;  2Z4R A;  4RKU F;  4EIW A;  2LXE A;  1D2N A;  1PGY A;  3BBZ A;  3FUT A;  2DWM A;  1Q3B A;  4JI4 M;  5IZ7 D;  3PVS A;  3KS4 A;  2DWL A;  1SXJ D;  3ZQJ A;  3UK6 A;  2ZBK B;  2R6F A;  4ANR A;  4DUZ M;  1ZMW A;  2RKO A;  3THG A;  3UJN A;  1IXR C;  2KDL A;  2L7I A;  5DFL A;  1GJS A;  3C58 A;  2C9C A;  3FTC A;  1AIP C;  3HHX A;  1DO0 A;  4L15 A;  4LJ8 A;  5FTL A;  3R8F A;  5FTN A;  4QOZ C;  2EKF A;  2OOA A;  2F5Q A;  3GLH B;  1PJQ A;  2MR9 A;  3AL0 C;  2RGH A;  4AKI A;  1EFU B;  1E9R A;  1TH2 A;  1YE9 A;  4DV6 M;  3FUV A;  4JN6 A;  3NBX X;  3KVW A;  2LVQ D;  1WGN A;  2WSF F;  3KS8 A;  4LJ4 A;  1C7Y A;  4AG6 A;  2FNA A;  2V1U A;  1G4A E;  1ZMV A;  4M9X A;  4I5S A;  4HLQ A;  4NSR A;  4CGY B;  2FS1 A;  1GO5 A;  3SMP A;  3U60 A;  1NVM A;  5ITY A;  1R7R A;  4LJA A;  3ZC7 B;  1Z5A A;  2V6Z M;  1L2B A;  2F5P A;  1GLN A;  2JNH A;  1J09 A;  1NNU C;  1MX0 A;  3HY5 A;  5EJC A;  2DXI A;  3KSJ A;  3W0L B;  5DNY A;  2CHQ A;  2JY5 A;  2QPA A;  3L25 A;  1T6O A;  3MK6 A;  2R44 A;  4FCT A;  2WSE F;  4FWG A;  4KHP M;  4DR5 M;  4HEO A;  2JUJ A;  2O01 F;  5F3W A;  4LF9 M;  3GLG B;  3FYC A;  2FE8 A;  4RNA A;  4DV0 M;  1NY5 A;  2CV2 A;  3U6S A;  2DAK A;  1E32 A;  2XFT A;  1XXH A;  1QUS A;  3GLI B;  4PDG A;  4IJE A;  1OIP A;  4FWD A;  3U6C A;  2CHG A;  2ZTC A;  5DYG A;  4DV1 M;  2HL7 A;  4DR1 M;  2ZAM A;  5KPT A;  3B9P A;  4TUW A;  4LY6 A;  4B7H A;  1Q39 A;  2XLJ A;  4GMQ A;  4B7G A;  4LGM A;  5EP2 A;  3AKZ A;  1OFI A;  3KOY E;  2KZU A;  4Q7J A;  2XEP A;  3KDS E;  1N77 A;  2DWN A;  2BJW A;  4YHH M;  1EE8 A;  3GLH A;  4GIT A;  3TL4 X;  1T3T A;  5EXS A;  3TWL A;  1PJT A;  2DAM A;  3HHZ A;  1PJI A;  3DZD A;  3AFH A;  3M0E A;  4P17 A;  5EQT A;  1IN6 A;  2KA6 B;  2WSC F;  1OQY A;  1L2C A;  3AOE A;  3VLF B;  2EUC A;  5C1B A;  2C5R A;  1IY2 A;  3F92 A;  2F4V M;  2DAI A;  3UMM A;  4LFA M;  3FUX A;  3VKG A;  4R3D A;  3KSX A;  2MJ5 B;  1ZMU A;  4BBA A;  1NHW C;  4LGY A;  2DAE A;  3GRY A;  1Y8G A;  3SC3 A;  5C18 A;  2LHG A;  3VK7 A;  4GC5 A;  3LQR A;  4QNM A;  1V33 A;  2WZJ A;  1SXJ C;  3U5Z A;  1IBL M;  2K47 A;  3KOZ E;  4JI3 M;  2LTU A;  1XHB A;  3TQS A;  3U6P A;  2DI0 A;  3IEC A;  1HNX M;  2CE7 A;  5BR8 M;  3U6E A;  3B7N A;  1V34 A;  2I7N A;  3FRH A;  1X37 A;  2D7G A;  3A45 A;  2R46 A;  2O5R A;  3HJS A;  3LVW A;  1HNZ M;  4NRW A;  1N78 A;  3LMM A;  2QEN A;  2ZAN A;  3GLG A;  1QAQ A;  3HKP A;  4F2L A;  1XXH E;  3HU1 A;  4NL4 H;  5IRE B;  1J7K A;  1TH3 A;  1XXH B;  2K9D A;  4IBG A;  3GLI A;  2G5G X;  2KNA A;  2Z7J A;  2UUB M;  1QAO A;  3VFD A;  4M0D A;  3K8Z A;  4ITQ A;  5ITT A;  3FTD A;  4IBB A;  3RFW A;  5H37 D;  2H5X A;  4GEW A;  2DNA A;  1R2Z A;  2JY8 A;  1BVS A;  4I4L A;  5FTK A;  4X62 M;  4JYA M;  2HCB A;  4WW0 A;  3T15 A;  1NV8 A;  1XWI A;  2N35 A;  1XNQ M;  3B89 A;  1ZV1 A;  4I81 A;  3JR5 A;  3SAU A;  1N36 M;  1OTR A;  2XF3 A;  1R2Y A;  4OX9 M;  2L2D A;  4FCV A;  2CRU A;  4B3R M;  1VEJ A;  1TR8 A;  2KNV A;  4XGI A;  1IBM M;  1KSF X;  3L28 A;  2BNK A;  3VDP A;  4IBD A;  2M60 A;  2HKJ A;  3JR4 A;  3ZH9 B;  4IBE A;  3CGW A;  4JI2 M;  3VKH A;  2UUA M;  2R4E A;  3SAV A;  3W0F A;  1SXJ E;  3WHK A;  4L8R C;  1EIJ A;  1L8Q A;  2CP8 A;  1Q02 A;  2X49 A;  4MGI E;  3TWK A;  5LMN M;  2X4A A;  3DOA A;  3U5Z B;  3HGI A;  3PNY A;  4S12 A;  4LF4 M;  1IXS B;  2FH0 A;  4L6V 6;  1DO2 A;  3FRI A;  4WP2 A;  2QQ8 A;  3C3E A;  2C96 A;  3FTF A;  5L8R F;  2L7H A;  2DEN A;  1OIZ A;  3MMP A;  2J7O A;  3C3D A;  1YSY A;  2QP9 X;  3GQ3 A;  4DV3 M;  3GLI E;  3GRV A;  2J5Y A;  3QWL A;  3OTO M;  1KFV A;  1F4I A;  4AI6 A;  2ZM6 M;  3KW6 A;  1HNW M;  4F1I A;  2Y20 A;  4X66 M;  2XZF A;  4AKG A;  2EKK A;  5FLX S;  1XC8 A;  1GKI A;  4JI6 M;  4JI0 M;  8CAT A;  1IY0 A;  4IBC A;  2X8A A;  1DGG A;  2DZO B;  5ITU A;  1G71 A;  4BLC A;  3A46 A;  5FTJ A;  2L6O A;  1DGB A;  4DR6 M;  2R18 A;  2H1R A;  4PD2 A;  2FFJ A;  2EJS A;  4LZJ A;  1T43 A;  5ITQ A;  2K6B A;  1JR3 D;  1G41 A;  4LJ5 A;  2KW0 A;  2LBC A;  1IN8 A;  2EO2 A;  5IWA M;  2LVP C;  1DGF A;  2KXE A;  3FD9 A;  4FCW A;  2C9O A;  3DFZ A;  1GVN A;  1TDH A;  2EA0 A;  2GNO A;  1XMQ M;  3SAW A;  4LF6 M;  3SFZ A;  1JR3 E;  1IQP A;  1IM2 A;  3TWM A;  1JB0 F;  4FWH A;  1ORY B;  4B3S M;  2KRU A;  3C9P A;  3I01 M;  3J2P B;  2KRK A;  5FSW A;  1SG9 A;  1HR0 M;  2YNM D;  1G59 A;  1TGU A;  3GRR A;  1HJP A;  1YLA A;  2CWB A;  5EP3 A;  1E94 E;  3AOE C;  3KXE C;  3Q8X A;  1R6B X;  2FOI C;  5IT9 S;  1IXS A;  1LV7 A;  1MN3 A;  2LWX A;  1NNJ A;  4LRS A;  3PNV A;  4UN2 B;  4RF1 A;  3SYL A;  4X65 M;  2Z4S A;  7CAT A;  2QBY A;  3KOX E;  4R71 A;  1WJ7 A;  1TTE A;  4D82 A;  3U6O A;  1J5E M;  2YQZ A;  2F5S A;  1PM5 A;  2VDB B;  2LHC A;  2VQE M;  4YY3 M;  2XSZ A;  3ILK A;  1DV0 A;  2XFS A;  4G4R A;  1GAB A;  1CUK A;  1QZM A;  3GP1 A;  3U6Q A;  1NO1 A;  1W5S A;  2ZAO A;  3B7Z A;  3D8L A;  3HJQ A;  4MGK E;  3J80 S;  2UXC M;  1YUB A;  4I8O A;  4AZF A;  4IIW A;  5ITX E;  2C98 A;  4II7 A;  4G3O A;  3LVV A;  3Q8G A;  1TDZ A;  4AG5 A;  1GL6 A;  2ERC A;  1Q3C A;  1MU5 A;  4IBF A;  3SHG B;  3CF2 A;  2E5L M;  3U6D A;  2VQF M;  1WGL A;  3J7A S;  1N34 M;  3HZJ A;  5EXT A;  1V92 A;  5EP1 A;  2CEA A;  3E9S A;  1K82 A;  3K9O A;  1XNR M;  1VEK A;  2QHO B;  3V76 A;  2DHY A; 
#chains in the Genus database with same CATH homology
 3T1H M;  1IY1 A;  4GKK M;  4IBI A;  4KLN A;  4LRT A;  1Z5B A;  1GL7 A;  5A2Q S;  4G4O A;  3GQ4 A;  4P16 A;  1QAN A;  2D7H A;  3GPP A;  4LZZ A;  4DV7 M;  2F5N A;  4R7G A;  5LMU M;  1JQJ C;  5GKN A;  4GHL A;  1K3W A;  2YFQ A;  3UZU A;  4FVM A;  4X64 M;  4HL4 A;  1Z6T A;  5KO3 A;  3K1J A;  1G3I A;  1NSF A;  4GIP A;  3J7B A;  1NJF A;  3T1Y M;  1IN5 A;  5KPZ A;  2QBY B;  2Y0T A;  1SXJ A;  1G8P A;  2R65 A;  3LQQ A;  4KO8 A;  1S3S A;  3MHV C;  3SAT A;  2Y0Q A;  3CF0 A;  2JA2 A;  2I7P A;  2R4J A;  3A42 A;  4PDI A;  4M9S A;  1C1K A;  3TE6 A;  2KZS A;  4DV2 M;  4LFC M;  4OVZ A;  4MH0 E;  4MGY E;  4JV5 M;  3KOW E;  3HHW A;  3NWL A;  1JR3 A;  4MM3 B;  3QAU A;  4GH9 A;  2J7N A;  2UUC M;  3R9X B;  1UM8 A;  2R62 A;  3K92 A;  3SHF A;  3H4M A;  2QCU A;  2R45 A;  3SMS A;  5KQ8 A;  4QNR A;  4B3M M;  3E4R A;  3HJ8 A;  3JAM S;  2NQ8 C;  3GRU A;  5EXP A;  3GLF B;  4D81 A;  4B7F A;  1L2D A;  1W5T A;  4W5W A;  4MGZ E;  3J27 B;  3I4Y A;  1OFH A;  4FD2 A;  4AKH A;  2CV0 A;  3FKE A;  3FUU A;  3L29 A;  2BJV A;  4RF0 A;  2KEB A;  2XGN A;  4MGH A;  1IN7 A;  3AOG A;  3J81 S;  4LF9 M;  1HT2 E;  2XH9 A;  1QQW A;  2Y21 A;  3D8B A;  4DV5 M;  4GHA A;  4LFB M;  2UXD M;  4M0W A;  3KP0 E;  5KPR A;  1N33 M;  3CTW B;  4KOD A;  4PT5 A;  1ZAE A;  3WHL A;  3RE8 A;  1L1Z A;  1WXQ A;  4QOS A;  4DUY M;  2C99 A;  5EXX A;  2Q2E B;  2G8L A;  4GRI A;  2DWZ B;  3L27 A;  4WUR A;  1SXJ B;  1VDD A;  4Z6Y A;  4LJ7 A;  2HHH M;  2RGO A;  5KQD A;  4LF7 M;  3IG5 A;  2XZU A;  2UXB M;  4REZ A;  3SBJ A;  3RGP A;  2YR0 A;  2XSZ D;  1TH4 A;  3HU2 A;  4CHT B;  4DR3 M;  3GQ5 A;  3PXG A;  3U61 B;  3SAS A;  1HQY E;  4K0K M;  2OQ4 A;  3ZCB B;  3U6L A;  1IN4 A;  3A98 B;  2A5Y B;  4OVZ B;  2OPF A;  3GPU A;  2VII A;  1K3X A;  4NSO B;  3DA1 A;  3EIH A;  2W82 A;  4DV4 M;  2CFO A;  3GPX A;  1I4W A;  3KP1 E;  3K2L A;  4GC9 A;  2QZ4 A;  4Z8X A;  3GLF A;  1NHG C;  1IXZ A;  2V1C A;  4M9Z A;  4ZPX A;  2UU9 M;  4PCZ A;  3KFU G;  1QVR A;  3T38 A;  4XBO A;  3L26 A;  2DHR A;  4G4N A;  3GPY A;  2L09 A;  3AV0 A;  4A3V B;  4B08 A;  3SAR A;  4MB7 A;  2P5T A;  4DR4 M;  4L78 A;  4LG2 A;  3HHY A;  4IBK A;  4GKJ M;  4JI8 M;  1H6U A;  1KYI A;  1QAM A;  4LJ6 A;  2F5O A;  1N32 M;  2CV1 A;  5DYI A;  1DGH A;  3L2A A;  3PFI A;  3FTE A;  3HWS A;  4IBJ A;  1L1T A;  3NBI A;  3BOS A;  1FNN A;  4DR7 M;  1NY6 A;  3I51 A;  5EP4 A;  1FJG M;  2DZN B;  3EIE A;  3U61 A;  4LF8 M;  4OU7 A;  4NXM M;  4L4U A;  4JXJ A;  2CUZ A;  3VK8 A;  5E26 A;  4B3T M;  3M6A A;  4JI5 M;  1XMO M;  4FW9 A;  2AHM A;  4OW0 A;  3CF6 E;  4D80 A;  3FYD A;  4JI1 M;  4G4Q A;  1E9S A;  3SYK A;  3VDU A;  4CIS A;  5BPV A;  2Z3X A;  2DVW B;  4LF5 M;  3MJ5 A;  3IG8 A;  1HT1 E;  1NJG A;  1HQC A;  3TPZ A;  1PJJ A;  5ITX A;  4G6Z A;  3GO8 A;  4NXN M;  1N75 A;  4L16 A;  4QHT A;  2LNH C;  3U60 B;  4LJ9 A;  3FUW A;  4NOO B;  4JI7 M;  5ITR A;  3RGS A;  5E6J A;  1IBK M;  2CHV A;  4AQY M;  2M5Z A;  5FTM A;  4QHS A;  3M7G A;  5JI3 E;  1OJL A;  5JI2 E;  3I4V A;  4DR2 M;  4NRV A;  4IJF A;  4AW4 A;  2LH0 A;  3U6M A;  1I94 M;  1ZQ9 A;  1Z59 A;  1QYR A;  3AJI B;  4BB9 A;  3UGJ A;  2D7E A;  1DGH B;  4LCB A;  3HU3 A;  1Z5C A;  2Z4R A;  4EIW A;  2LXE A;  1D2N A;  3FUT A;  2DWM A;  1Q3B A;  4JI4 M;  5IZ7 D;  3PVS A;  3KS4 A;  2DWL A;  1SXJ D;  3UK6 A;  2ZBK B;  4DUZ M;  2RKO A;  3THG A;  3UJN A;  1IXR C;  2L7I A;  3C58 A;  2C9C A;  3FTC A;  3HHX A;  1DO0 A;  4L15 A;  4LJ8 A;  5FTL A;  3R8F A;  5FTN A;  4QOZ C;  2F5Q A;  3GLH B;  3AL0 C;  2RGH A;  4AKI A;  1E9R A;  1TH2 A;  1YE9 A;  4DV6 M;  3FUV A;  4JN6 A;  3KVW A;  3KS8 A;  4LJ4 A;  4AG6 A;  2FNA A;  2V1U A;  1G4A E;  4M9X A;  4I5S A;  4HLQ A;  4NSR A;  4CGY B;  3SMP A;  3U60 A;  1NVM A;  5ITY A;  1R7R A;  4LJA A;  3ZC7 B;  1Z5A A;  2V6Z M;  1L2B A;  2F5P A;  1GLN A;  1J09 A;  1NNU C;  1MX0 A;  5EJC A;  2DXI A;  3KSJ A;  3W0L B;  5DNY A;  2CHQ A;  2QPA A;  3L25 A;  3MK6 A;  4FCT A;  4FWG A;  4KHP M;  4DR5 M;  5F3W A;  3GLG B;  3FYC A;  2FE8 A;  4RNA A;  4DV0 M;  1NY5 A;  2CV2 A;  3U6S A;  1E32 A;  2XFT A;  1XXH A;  3GLI B;  4PDG A;  4IJE A;  4FWD A;  3U6C A;  2CHG A;  4DV1 M;  5DYG A;  2HL7 A;  4DR1 M;  2ZAM A;  5KPT A;  3B9P A;  4TUW A;  4LY6 A;  4B7H A;  1Q39 A;  2XLJ A;  4GMQ A;  4B7G A;  4LGM A;  5EP2 A;  3AKZ A;  1OFI A;  3KOY E;  2KZU A;  2XEP A;  3KDS E;  1N77 A;  2DWN A;  2BJW A;  4YHH M;  1EE8 A;  3GLH A;  4GIT A;  3TL4 X;  1T3T A;  5EXS A;  3TWL A;  3HHZ A;  1PJI A;  3DZD A;  3AFH A;  3M0E A;  5EQT A;  1IN6 A;  2KA6 B;  1L2C A;  3AOE A;  3VLF B;  2EUC A;  5C1B A;  2C5R A;  1IY2 A;  2F4V M;  3UMM A;  4LFA M;  3FUX A;  3VKG A;  4R3D A;  3KSX A;  4BBA A;  1NHW C;  4LGY A;  3GRY A;  3SC3 A;  5C18 A;  3VK7 A;  4GC5 A;  3LQR A;  4QNM A;  1SXJ C;  3U5Z A;  1IBL M;  3KOZ E;  2K47 A;  4JI3 M;  3U6P A;  1XHB A;  3TQS A;  1HNX M;  2CE7 A;  5BR8 M;  3U6E A;  2I7N A;  7CAT A;  1X37 A;  2D7G A;  3HJS A;  2O5R A;  2R46 A;  3A45 A;  3LVW A;  1HNZ M;  4NRW A;  1N78 A;  3LMM A;  2QEN A;  2ZAN A;  3GLG A;  1QAQ A;  3HKP A;  3HU1 A;  4NL4 H;  5IRE B;  1J7K A;  1TH3 A;  1XXH B;  3GLI A;  4IBG A;  2G5G X;  2Z7J A;  2UUB M;  1QAO A;  3VFD A;  4M0D A;  3K8Z A;  4ITQ A;  5ITT A;  3FTD A;  4IBB A;  3RFW A;  5H37 D;  1R2Z A;  4I4L A;  5FTK A;  4X62 M;  4JYA M;  2HCB A;  4WW0 A;  3T15 A;  1XWI A;  1XNQ M;  4I81 A;  3JR5 A;  3SAU A;  1N36 M;  4OX9 M;  2XF3 A;  1R2Y A;  4FCV A;  4B3R M;  4XGI A;  1IBM M;  1KSF X;  3L28 A;  2BNK A;  3VDP A;  4IBD A;  2M60 A;  2HKJ A;  3JR4 A;  3ZH9 B;  4IBE A;  4JI2 M;  3VKH A;  2UUA M;  2R4E A;  3SAV A;  3W0F A;  1SXJ E;  3WHK A;  4L8R C;  1L8Q A;  2X49 A;  4MGI E;  5LMN M;  3TWK A;  2X4A A;  3DOA A;  3U5Z B;  3HGI A;  3PNY A;  4S12 A;  4LF4 M;  1IXS B;  1DO2 A;  3FTF A;  2C96 A;  2L7H A;  2J7O A;  1YSY A;  2QP9 X;  3GQ3 A;  4DV3 M;  3GRV A;  3QWL A;  3OTO M;  1KFV A;  4AI6 A;  2ZM6 M;  3KW6 A;  1HNW M;  2Y20 A;  4X66 M;  2XZF A;  4AKG A;  5FLX S;  4JI6 M;  1XC8 A;  1GKI A;  4JI0 M;  8CAT A;  1IY0 A;  4IBC A;  2X8A A;  1DGG A;  2DZO B;  5ITU A;  3A46 A;  4BLC A;  5FTJ A;  2L6O A;  1DGB A;  4DR6 M;  2R18 A;  2H1R A;  4PD2 A;  2FFJ A;  4LZJ A;  5ITQ A;  1JR3 D;  1G41 A;  4LJ5 A;  2KW0 A;  1IN8 A;  2EO2 A;  5IWA M;  1DGF A;  2KXE A;  3FD9 A;  4FCW A;  2C9O A;  3DFZ A;  1GVN A;  1TDH A;  2EA0 A;  4LF6 M;  1XMQ M;  3SAW A;  3SFZ A;  1IQP A;  1IM2 A;  3TWM A;  4FWH A;  1ORY B;  4B3S M;  2KRU A;  3J2P B;  5FSW A;  2KRK A;  1HR0 M;  2YNM D;  1G59 A;  1TGU A;  3GRR A;  5EP3 A;  1E94 E;  3AOE C;  3KXE C;  3Q8X A;  1R6B X;  2FOI C;  5IT9 S;  1LV7 A;  2LWX A;  1NNJ A;  4LRS A;  3PNV A;  4RF1 A;  3SYL A;  4X65 M;  2Z4S A;  2QBY A;  3KOX E;  4D82 A;  3U6O A;  1J5E M;  2F5S A;  2YQZ A;  1PM5 A;  2VQE M;  4YY3 M;  2XSZ A;  3ILK A;  2XFS A;  4G4R A;  1QZM A;  3GP1 A;  3U6Q A;  1W5S A;  2ZAO A;  3D8L A;  3HJQ A;  4MGK E;  3J80 S;  2UXC M;  1YUB A;  4I8O A;  4AZF A;  4IIW A;  5ITX E;  2C98 A;  4II7 A;  3LVV A;  1TDZ A;  4AG5 A;  1GL6 A;  2ERC A;  1Q3C A;  1MU5 A;  4IBF A;  3SHG B;  3CF2 A;  2E5L M;  3U6D A;  2VQF M;  3J7A S;  1N34 M;  5EXT A;  5EP1 A;  2CEA A;  3E9S A;  1K82 A;  1XNR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...