2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 26S proteasome non-ATPase regulatory subunit 10
publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/protein-binding
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
3SC3A 1IN6A 3GLHA 4LRTA 4FWDA 3GLGB 2C96A 1XXHB 3HU2A 5EP2A 1IN8A 3U61B 5JI3E 1KSFX 1SXJE 3M0EA 5EP4A 3WHKA 1KYIA 1HT2E 4EIWA 5EXPA 5EQTA 4L4UA 2DVWB 2QBYB 3HWSA 1C1KA 2ZANA 4LY6A 4KODA 2C9OA 3AJIB 4KLNA 5EXTA 4LJ8A 2BJVA 1X37A 2C9CA 2DZOB 3EIHA 1D2NA 1SXJA 1IXZA 4LCBA 2CHQA 2QENA 3GLFA 5C1BA 2QZ4A 4FCTA 3U5ZB 1IXSB 1IN5A 1NJFA 1NVMA 1W5TA 4QOSA 3B9PA 1OFIA 4FWGA 4A3VB 1QVRA 4ZPXA 2XSZD 4L15A 3BOSA 4FD2A 2V6ZM 3HU3A 5C18A 1DO0A 1G41A 1HQCA 3H4MA 1R6BX 3K1JA 1NJGA 1E32A 3SYLA 3GLIB 1E94E 3DZDA 5FTKA 4FCWA 4KO8A 4FW9A 2ZAOA 5EP3A 2QP9X 5JI2E 4I81A 1W5SA 3SYKA 3CF2A 1NY5A 3HU1A 1FNNA 3KW6A 3UK6A 5FTJA 3GLGA 2ZAMA 1G3IA 1XXHA 3VLFB 2CEAA 1OJLA 3MHVC 1QZMA 3PFIA 2BJWA 3KDSE 3VFDA 2R62A 2X8AA 4QNRA 4WW0A 3PXGA 2QBYA 4FCVA 3WHLA 3GLHB 1IN7A 1LV7A 2Z4SA 4LZZA 5EP1A 1NSFA 4D81A 4LJ5A 1UM8A 5FTLA 1L8QA 1SXJD 1IY0A 1IY2A 3PVSA 4LRSA 4QHSA 1IQPA 1S3SA 1HT1E 1SXJC 2C98A 5EXXA 4LJ7A 2CHVA 1R7RA 3CF0A 2HCBA 4LJAA 3U60B 4D80A 4QHTA 1SXJB 4D82A 1OFHA 1IXRC 1IN4A 3GLFB 5DYIA 1DO2A 1HQYE 1G4AE 5EXSA 2KRKA 2DHRA 1JR3A 3GLIA 3ZH9B 3M6AA 5FTMA 3R8FA 1JQJC 2C99A 4I4LA 2CE7A 2CHGA 1J7KA 4JN6A 2DZNB 1XWIA 2QPAA 2XSZA 4LJ9A 2V1UA 4LJ6A 5FTNA 4GITA 1IY1A 2RKOA 1IM2A 3D8BA 4FWHA 2FNAA 4Z8XA 2VIIA 4LGMA 2DWZB 2Z4RA 1NY6A 1JR3D 4L16A 2R65A 4QNMA 4LJ4A 5DYGA 3EIEA
chains in the Genus database with same CATH superfamily
1IN6A 3IHPA 4LFBM 2LTUA 1XXHB 2DENA 4GRIA 3HU2A 1IN8A 1PJTA 4M0WA 5JI3E 3U61B 4LF9M 1SXJE 5EP4A 1KYIA 4FVMA 1HT2E 3KP1E 1VQ1A 4EIWA 4II7A 1Q02A 1TTEA 3FUWA 4IBGA 2KEBA 4LY6A 4KODA 4B3SM 2OPFA 1PGYA 2K9DA 4MGKE 2UUAM 2VQFM 4AG6A 2KZUA 4QOZC 4JI3M 3BXWA 3W0FA 3L26A 1D2NA 1SXJA 2QENA 3VKHA 2YNMD 1Q3CA 4FCTA 1IXSB 1DV0A 1ZAEA 1YSYA 4QOSA 4MH0E 4NRVA 2CV0A 3F92A 3T1YM 2L4FA 3HJSA 2LVOC 1NNJA 1CUKA 4P17A 3E21A 4AKHA 4FD2A 1PJSA 1PJQA 4ANRA 5C18A 1DO0A 3LW5F 2P5TA 3THGA 3GPXA 5ITYA 1NJGA 2MGWA 3NWLA 3L27A 3GLIB 4MGYE 1E94E 2L7HA 2XZUA 4FW9A 4MB7A 1TR8A 1TF0B 3KOYE 2JP7A 2QP9X 1JR3E 4LFCM 1N78A 3FTDA 4GMQA 4LGYA 2UXDM 3IECA 2JA2A 3H4JA 2R44A 1QUSA 2LVAA 3KW6A 2WSCF 4AZFA 3J2PB 4HLQA 3MHVC 1QZMA 3GO8A 2BJWA 1G71A 3KDSE 3VK7A 4REZA 2XH9A 4WW0A 4Q7JA 2R18A 4FCVA 3WHLA 2OOBA 1OAIA 1WGLA 1MX0A 4GC9A 5GKNA 2JY6B 3J7BA 1V92A 4D81A 4LJ5A 1XMOM 5FTLA 5BR8M 1IY0A 2FE8A 2JWSA 2YFQA 3KOZE 3JAMS 1S3SA 2DXIA 2O25A 1SXJC 3GRRA 2M5ZA 2QSFX 2CHVA 1XMQM 1GJSA 1MN3A 2Z3XA 3SAVA 3SARA 3J7AS 2LVPC 1NHGC 2Q2EB 4QHTA 3AOEC 1ZMWA 1SXJB 1QAOA 1VDLA 5IZ7D 3U6QA 3BBZA 3KSJA 4DR1M 2N35A 2RGOA 3B89A 5EXSA 4RKUF 2DHRA 2DI0A 4CGYB 4PDGA 3ZH9B 3M6AA 3SAWA 2CRUA 4F2LA 1DGHA 1JQJC 2C99A 3CF6E 3KS4A 2CHGA 4DV1M 1J7KA 1VDDA 4YY3M 3U6PA 3SMPA 2V1UA 2GQFA 4LJ6A 4B7GA 1LTMA 3C58A 4GITA 4L8RC 3FUXA 1D0MA 1J5EM 2KNZA 1NV8A 3B74A 3CGWA 3KP0E 3RGPA 2OQ4A 2HHHM 2FFJA 4L16A 2R65A 4LJ4A 1T43A 4M9SA 1GKIA 3RE8A 4OVZA 4LRTA 3FUVA 3QWLA 4FWDA 3R8FA 4KT0F 3C3DA 2UXBM 2MH8A 1IBMM 2KDLA 1HNWM 1N32M 3WHKA 2F5OA 5ITXE 2J7OA 4IBJA 2H1RA 3I04M 3GLGE 3QYBA 2F5NA 3E46A 4L4UA 3HWSA 3GP1A 2ZANA 2C9OA 3VDUA 3AJIB 4KLNA 3U6DA 5EXTA 3HJQA 3VDPA 1DGFA 2C9CA 4UN2B 2R4EA 1OAOC 2ZTDA 3JR4A 4X65M 3T1HM 3U60A 3L28A 4NRWA 1IXZA 1XB2B 5ITXA 2UU9M 3GPPA 1Y8GA 3B7QA 2ZTCA 3GLFA 2QZ4A 1GVNA 5LMNM 4JXJA 1IN5A 4JI8M 2L7IA 1Z6TA 3AV0A 2DAKA 3FTFA 2ERCA 2UUCM 2KRUA 5KO3A 4G4RA 1KFVA 4G3OA 3ILKA 4ZPXA 1MU5A 3PNVA 2J7NA 1NO1A 3FTEA 2LBCA 2DWLA 3H4MA 1ORYB 2K47A 4PD2A 3GQ5A 4BB9A 2EO2A 1HJPA 3U6OA 5F3WA 4IBIA 3T6PA 1OQYA 4FCWA 4KO8A 1DGHB 3C3EA 5FSWA 5DNYA 2ZAOA 3CTWB 5EP3A 4B08A 4G4OA 3U6SA 2EUCA 5JI2E 4I81A 1H6UA 1PJIA 1XNRM 3SYKA 1A5TA 2R4JA 2DAMA 3SMSA 2Z7JA 1NHWC 1NY5A 1QQWA 3HU1A 4IBKA 1FNNA 2XF3A 3KOXE 3J81S 3UK6A 5FTJA 3LQRA 4W5WA 4I8OA 5LMUM 1OKSA 3SATA 1XNQM 2QNJA 4Z6YA 3PFIA 3E9SA 3FD9A 2V1CA 4RF1A 2OOAA 4QNRA 2CV2A 2LHGA 5KPZA 4OVZB 2XZFA 4CIZA 3K9PA 2R46A 3U6CA 2Z4SA 5EP1A 1VG5A 1L1ZA 4M9XA 4S12A 2DKLA 3FRHA 1UM8A 2LH0A 2UXCM 1GL6A 3RGSA 3FUUA 4DR3M 1PM5A 1T3TA 4DR5M 3PVSA 4LRSA 4QHSA 3I01M 1HT1E 3U5ZA 4R7GA 2HCBA 3LQQA 2ZBKB 3FE3A 3HJ8A 4XGIA 3U60B 2LWXA 2ZM6M 1OFHA 4DV3M 2LVNC 4JI2M 1GLNA 2BNKA 2EJSA 2W82A 1P3QQ 3GLFB 1DO2A 2UUBM 2DAIA 4CHTB 3OTOM 1EE8A 1N75A 1JR3A 2L09A 1I4WA 2RRUA 2JXNA 4DUYM 4NL4H 1R5LA 4HL4A 3HHZA 2QQ8A 4I4LA 4JN6A 1XWIA 2QPAA 3UZUA 4NOOB 3GPUA 3MJ5A 2DNAA 2Z8YM 3GLHE 4X66M 4JI7M 1DGGA 4G6ZA 3JR5A 2YQZA 4LF4M 1F4IA 2RKOA 1IM2A 2BWEA 3KS8A 4DR6M 1L2CA 1D0KA 4FWHA 2FNAA 2Y21A 3U6MA 4CISA 1J09A 2Y0TA 3W68A 2M60A 1ZMVA 4LGMA 1UFZA 5H37D 1QAQA 2I7PA 5E6JA 2NQ8C 1TH2A 3GLHA 1D0LA 3SASA 5L8RF 3A45A 2C96A 1PRBA 4NXMM 1KSFX 3MK6A 3LCUA 4RF0A 4F1IA 1G8PA 1XXHE 2KW0A 1QYRA 5ITRA 1G59A 2DVWB 2OO9A 1WXQA 4AG5A 4LF6M 1Q39A 3HGIA 2KZSA 1K82A 4IJEA 4LF7M 2HWJA 2MROB 3K8ZA 3SFZA 1Q3BA 2CV1A 4DR2M 1GJTA 2BJVA 3EIHA 3TL4X 3NBXX 4YHHM 4G4QA 4ITQA 2KNAA 4LCBA 3HX3A 3J80S 2F5SA 4MGHA 2Y20A 5C1BA 1TDZA 3K2LA 3U5ZB 1NJFA 4DV2M 1NVMA 1QUTA 1W5TA 4XK8F 5KPTA 2JY7A 1VEJA 3L25A 4M0DA 1OFIA 4A3VB 4AW4A 1FJGM 2AHMA 2D7EA 2MR9A 1QVRA 2XSZD 1QAMA 3BOSA 1WGNA 2V6ZM 1G41A 2CFOA 3GQ4A 1V34A 4JI6M 2L2DA 2G5GX 1R2ZA 3SYLA 3RFWA 4I5SA 3TE6A 4DV5M 2R0IA 3NBIA 1Z5BA 4L6V6 5IWAM 4R3DA 2J5YA 2D7HA 1NV9A 1IXSA 2XEPA 1W5SA 1VEKA 2XGNA 4MM3B 5E26A 2JZ1A 5IT9S 2WSFF 3KXEC 4DBGB 3L2AA 3E4RA 5KPRA 3DFZA 3GLGA 4NC6A 1G3IA 3FUTA 3W0LB 4AI6A 3I51A 3PNYA 5BPVA 4PCZA 1OJLA 2CEAA 3AFHA 1ZQ9A 4LZJA 4JI5M 3VFDA 2R62A 2CWBA 2JNHA 2X8AA 3HHYA 3PXGA 2X4AA 2QBYA 2CUZA 3GLHB 3Q8XA 2VF7A 1IN7A 1LV7A 4OW0A 4B3RM 2FH0A 4LZZA 3D8LA 4MGZE 3FTCA 1IFYA 1L2DA 2GNOA 1QANA 4M9ZA 3QYEA 1JB0F 1L8QA 1GL7A 3T38A 3UGJA 4AKIA 4HEOA 3HZJA 4LF5M 3U6EA 2C98A 1C7YA 1YE9A 5EXXA 4GHLA 4JI4M 4DV0M 3A46A 3HHXA 1R7RA 4LJAA 4JI0M 3FKEA 1TDHA 4D80A 2EKKA 2XLJA 4D82A 2HAKA 2EKFA 4DR7M 3SBJA 3LCVB 2QHOB 4KHPM 1G4AE 2G3QA 2MJ5B 2KRKA 4AKGA 2JY8A 3SHGB 4R71A 4B3MM 4NXNM 3SAUA 2RGHA 1K3WA 4BBAA 2DZNB 1AUAA 1Z5AA 4IIWA 3IG5A 4P16A 2BWBA 2FS1A 2XSZA 4LJ9A 4TUWA 1N36M 4GKJM 3HHWA 4LF8M 5FTNA 2VQEM 3DA1A 2EA0A 2JZ0A 4B3TM 1IY1A 1Z59A 3SHFA 3QAUA 2F4VM 4X62M 4DV4M 2X49A 3B7NA 4Z8XA 5ITTA 2XFTA 2DWZB 3UMMA 1NY6A 1N33M 3TPZA 3MMPA 3AOEA 3GRYA 4B7FA 4WP2A 4IJFA 1OTRA 3SC3A 2YR0A 8CATA 4DUZM 2O01F 4NSOB 3U6LA 3GLGB 1HR0M 3TWLA 1OIPA 5EP2A 4LFAM 1WR1B 3M0EA 4MGIE 5ITQA 4AQYM 1OIZA 1YUBA 2APLA 2KNVA 5EXPA 5EQTA 1GABA 2QBYB 3LMMA 1C1KA 4K0KM 4GKKM 3TQSA 4BLCA 1V33A 3B7ZA 1EIJA 2DZLA 1NNUC 2K6BA 3AOGA 3K92A 4LJ8A 1K3XA 1X37A 1TGUA 2DZOB 3UJNA 3GPYA 1N34M 1RU3A 4GC5A 7CATA 2F5PA 2CHQA 3ZQJA 3VKGA 1WJ7A 2VDBB 2KA6B 2DWNA 4OX9M 3AKZA 4Y28F 2CP8A 2VF8A 3TWKA 4GH9A 3B9PA 5KQDA 1R4GA 3Q8GA 4FWGA 5A2QS 3I4YA 4L15A 1L1TA 5EJCA 3HU3A 1HQCA 4GIPA 2KHHA 4XBOA 5DYGA 2C5RA 2DWMA 1R6BX 2I7NA 3K1JA 1E32A 2DAEA 4B7HA 2HL7A 3DZDA 3VK8A 5FTKA 1PJJA 1ZV1A 3KFUG 3I4VA 3HY5A 3KOWE 1WHCA 1T6OA 4GHAA 2Y0QA 4DV6M 1L2BA 3CF2A 1DGBA 2WSEF 3FRIA 3GQ3A 3DOAA 2DHYA 2R6FA 2ZAMA 4IBEA 1EFUB 1XXHA 4NSRA 3VLFB 4G4NA 3U61A 4DR4M 1BVSA 3R9XB 1YLAA 1SG9A 2O5RA 1XC8A 2KXEA 4IBCA 2LNHC 4DV7M 3LVWA 3M7GA 4L78A 4JI1M 3V76A 5KQ8A 3ZCBB 3FYDA 4RNAA 3AL0C 1NSFA 1QZEA 2QCUA 3T15A 2LXEA 1SXJD 1IY2A 1TH3A 2WZJA 1VEGA 1ZMUA 4LG2A 1IQPA 3ZC7B 3C9PA 2D7GA 3KSXA 3GLIE 1GO5A 1IBKM 4LJ7A 2L6OA 3K9OA 1N77A 3CF0A 5DFLA 2G8LA 1AIPC 4CJ6A 3FYCA 1MJGM 3TWMA 2XFSA 4PT5A 4IBFA 1IXRC 4GEWA 1IN4A 3A98B 1E9SA 3J27B 2JUJA 2LHCA 1HQYE 2L4EA 2R45A 5DYIA 4X64M 1I94M 2K0BX 4OU7A 2JY5A 3KVWA 5FLXS 5FTMA 3GLIA 1QDRA 3LVVA 3IG8A 2FOIC 1HNXM 3GLFE 1Z5CA 2CE7A 2DAGA 3A42A 4WURA 2E5LM 5ITUA 3HKPA 4JV5M 4IBBA 1XHBA 1R2YA 2H5XA 4IBDA 4PDIA 1IBLM 1E9RA 1TH4A 3W67A 3D8BA 1WIVA 3L29A 2HKJA 2A5YB 3GRUA 5IREB 3GRVA 2VIIA 2F5QA 2Z4RA 1HNZM 1JR3D 2B3TA 4QNMA 2LVQD 1QDTA 3EIEA 4JYAM
chains in the Genus database with same CATH topology
1IN6A 4LFBM 1XXHB 4GRIA 3HU2A 1IN8A 4M0WA 5JI3E 3U61B 4LF9M 1SXJE 5EP4A 1KYIA 4FVMA 1HT2E 3KP1E 4EIWA 4II7A 3FUWA 4IBGA 2KEBA 4LY6A 4KODA 4B3SM 2OPFA 4MGKE 2UUAM 2VQFM 4AG6A 2KZUA 4QOZC 4JI3M 3W0FA 3L26A 1D2NA 1SXJA 2QENA 3VKHA 2YNMD 1Q3CA 4FCTA 1IXSB 1ZAEA 1YSYA 4QOSA 4MH0E 4NRVA 2CV0A 3T1YM 3HJSA 1NNJA 4AKHA 4FD2A 5C18A 1DO0A 3THGA 2P5TA 3GPXA 5ITYA 1NJGA 3NWLA 3L27A 3GLIB 4MGYE 1E94E 2L7HA 2XZUA 4FW9A 4MB7A 3KOYE 2QP9X 1N78A 4LFCM 3FTDA 4GMQA 4LGYA 2UXDM 2JA2A 3KW6A 4AZFA 3J2PB 4HLQA 3MHVC 1QZMA 3GO8A 2BJWA 3KDSE 3VK7A 4REZA 2XH9A 4WW0A 2R18A 4FCVA 3WHLA 1MX0A 4GC9A 5GKNA 3J7BA 4D81A 4LJ5A 1XMOM 5FTLA 5BR8M 1IY0A 2FE8A 2YFQA 3KOZE 3JAMS 1S3SA 2DXIA 1SXJC 3GRRA 2M5ZA 2CHVA 1XMQM 2Z3XA 3SAVA 3SARA 3J7AS 1NHGC 2Q2EB 4QHTA 3AOEC 1SXJB 1QAOA 3U6QA 5IZ7D 3KSJA 4DR1M 2RGOA 5EXSA 2DHRA 4CGYB 4PDGA 3ZH9B 3M6AA 3SAWA 3R8FA 1DGHA 1JQJC 3CF6E 2C99A 3KS4A 2CHGA 4DV1M 1J7KA 1VDDA 4YY3M 3U6PA 3SMPA 2V1UA 4LJ6A 4B7GA 3C58A 4GITA 4L8RC 3FUXA 1J5EM 3KP0E 3RGPA 2OQ4A 2HHHM 2FFJA 4L16A 2R65A 4LJ4A 4M9SA 1GKIA 3RE8A 4OVZA 4LRTA 3FUVA 3QWLA 4FWDA 2UXBM 1IBMM 1HNWM 1N32M 3WHKA 2F5OA 5ITXE 2J7OA 4IBJA 2H1RA 2F5NA 4L4UA 3HWSA 3GP1A 2ZANA 2C9OA 3VDUA 3AJIB 4KLNA 3U6DA 5EXTA 3HJQA 3VDPA 1DGFA 2C9CA 3JR4A 2R4EA 3T1HM 4X65M 3U60A 3L28A 4NRWA 1IXZA 5ITXA 2UU9M 3GPPA 3GLFA 2QZ4A 1GVNA 5LMNM 4JXJA 1IN5A 4JI8M 2L7IA 1Z6TA 3AV0A 3FTFA 2ERCA 2UUCM 2KRUA 5KO3A 4G4RA 1KFVA 4ZPXA 3ILKA 1MU5A 3PNVA 2J7NA 2DWLA 3H4MA 1ORYB 2K47A 4PD2A 3GQ5A 4BB9A 2EO2A 3U6OA 5F3WA 4IBIA 4ITQA 4FCWA 4KO8A 3FTEA 1DGHB 5DNYA 5FSWA 2ZAOA 3CTWB 5EP3A 4B08A 4G4OA 3U6SA 2EUCA 5JI2E 4I81A 1H6UA 1PJIA 1XNRM 3SYKA 2R4JA 3SMSA 2Z7JA 1NHWC 1NY5A 1QQWA 3HU1A 4IBKA 1FNNA 2XF3A 3KOXE 3J81S 3UK6A 5FTJA 3LQRA 4W5WA 4I8OA 5LMUM 3SATA 1XNQM 4Z6YA 3PFIA 3E9SA 3FD9A 2V1CA 4RF1A 4QNRA 2CV2A 5KPZA 4OVZB 2XZFA 2R46A 3U6CA 2Z4SA 5EP1A 1L1ZA 4M9XA 4S12A 1UM8A 2LH0A 2UXCM 1GL6A 3RGSA 3FUUA 4DR3M 1PM5A 1T3TA 4DR5M 3PVSA 4LRSA 4QHSA 1HT1E 3U5ZA 4R7GA 2HCBA 3LQQA 2ZBKB 3HJ8A 4XGIA 3U60B 2LWXA 2ZM6M 1OFHA 4DV3M 4JI2M 1GLNA 2BNKA 2W82A 3GLFB 1DO2A 2UUBM 4CHTB 3OTOM 1EE8A 1N75A 1JR3A 2L09A 1I4WA 4DUYM 4NL4H 4HL4A 3HHZA 4I4LA 4JN6A 1XWIA 2QPAA 3UZUA 4NOOB 3GPUA 3MJ5A 4X66M 4JI7M 1DGGA 4G6ZA 3JR5A 2YQZA 4LF4M 2RKOA 1IM2A 3KS8A 4DR6M 1L2CA 4FWHA 2FNAA 2Y21A 3U6MA 4CISA 1J09A 2Y0TA 2M60A 4LGMA 5H37D 1QAQA 2I7PA 5E6JA 2NQ8C 1TH2A 3GLHA 3SASA 3A45A 2C96A 4NXMM 1KSFX 3MK6A 4RF0A 1G8PA 2KW0A 1QYRA 5ITRA 1G59A 2DVWB 4AG5A 1WXQA 4LF6M 1Q39A 3HGIA 2KZSA 1K82A 4IJEA 4LF7M 3SFZA 3K8ZA 1Q3BA 2CV1A 4DR2M 2BJVA 3EIHA 3TL4X 4YHHM 4G4QA 4LCBA 3J80S 2F5SA 4MGHA 2Y20A 5C1BA 3K2LA 3U5ZB 1NJFA 4DV2M 1NVMA 3L25A 1W5TA 5KPTA 4M0DA 1OFIA 4A3VB 4AW4A 1FJGM 2AHMA 2D7EA 1QVRA 2XSZD 1QAMA 3BOSA 2V6ZM 1G41A 2CFOA 3GQ4A 4JI6M 2G5GX 1R2ZA 3SYLA 3RFWA 4I5SA 3TE6A 4DV5M 3NBIA 1Z5BA 5IWAM 4R3DA 2D7HA 2XGNA 4MM3B 2XEPA 1W5SA 5E26A 5IT9S 3KXEC 3L2AA 3E4RA 5KPRA 3DFZA 3GLGA 1G3IA 3FUTA 3W0LB 4AI6A 3I51A 3PNYA 5BPVA 4PCZA 1OJLA 2CEAA 3AFHA 1ZQ9A 4LZJA 4JI5M 3VFDA 2R62A 2X8AA 3HHYA 3PXGA 2X4AA 2QBYA 2CUZA 3GLHB 3Q8XA 4B3RM 1IN7A 1LV7A 4OW0A 4LZZA 3D8LA 4MGZE 3FTCA 1L2DA 1QANA 4M9ZA 3T38A 1L8QA 1GL7A 3UGJA 4AKIA 4LF5M 3U6EA 2C98A 1YE9A 5EXXA 4GHLA 4JI4M 4DV0M 3A46A 3HHXA 1R7RA 4LJAA 4JI0M 3FKEA 1TDHA 4D80A 2XLJA 4D82A 4DR7M 3SBJA 4KHPM 1G4AE 4AKGA 2KRKA 3SHGB 4B3MM 4NXNM 3SAUA 2RGHA 1K3WA 4BBAA 2DZNB 4P16A 1Z5AA 4IIWA 3IG5A 2XSZA 4LJ9A 4TUWA 1N36M 4GKJM 3HHWA 4LF8M 5FTNA 2VQEM 3DA1A 2EA0A 4B3TM 1IY1A 1Z59A 3SHFA 3QAUA 2F4VM 4X62M 4DV4M 2X49A 4Z8XA 5ITTA 2XFTA 2DWZB 3UMMA 1NY6A 1N33M 3TPZA 4B7FA 3GRYA 3AOEA 4IJFA 8CATA 3SC3A 2YR0A 4DUZM 3U6LA 4NSOB 1TDZA 1HR0M 3GLGB 3TWLA 5EP2A 4LFAM 3M0EA 4MGIE 5ITQA 4AQYM 1YUBA 5EXPA 5EQTA 2QBYB 3LMMA 1C1KA 4K0KM 4GKKM 3TQSA 4BLCA 1NNUC 3AOGA 1K3XA 3K92A 4LJ8A 1X37A 1TGUA 2DZOB 3UJNA 1N34M 4GC5A 7CATA 2F5PA 2CHQA 3VKGA 2DWNA 2KA6B 4OX9M 3AKZA 3TWKA 4GH9A 3B9PA 5KQDA 4FWGA 5A2QS 3I4YA 4L15A 1L1TA 5EJCA 3HU3A 1HQCA 4GIPA 4XBOA 2C5RA 2DWMA 1R6BX 2I7NA 3K1JA 1E32A 4B7HA 2HL7A 3DZDA 3VK8A 5FTKA 1PJJA 3KFUG 3I4VA 3KOWE 4GHAA 2Y0QA 4DV6M 1L2BA 3CF2A 1DGBA 3GQ3A 3DOAA 2ZAMA 4IBEA 4NSRA 1XXHA 3VLFB 4G4NA 3U61A 4DR4M 3R9XB 1XC8A 2O5RA 2KXEA 4IBCA 2LNHC 4DV7M 3LVWA 3M7GA 4L78A 4JI1M 5KQ8A 3ZCBB 3FYDA 4RNAA 3AL0C 1NSFA 2QCUA 3T15A 2LXEA 1SXJD 1IY2A 1TH3A 4LG2A 1IQPA 3ZC7B 3KSXA 2D7GA 1IBKM 4LJ7A 2L6OA 1N77A 3CF0A 2G8LA 3FYCA 3TWMA 2XFSA 4PT5A 4IBFA 1IXRC 1IN4A 3A98B 1E9SA 3J27B 5DYIA 2R45A 1HQYE 4X64M 1I94M 4OU7A 3KVWA 3GLIA 5FLXS 5FTMA 3LVVA 3IG8A 2FOIC 1HNXM 1Z5CA 2CE7A 3A42A 4WURA 2E5LM 5ITUA 3HKPA 4JV5M 4IBBA 1XHBA 1R2YA 4PDIA 4IBDA 1IBLM 1E9RA 1TH4A 3D8BA 3L29A 2HKJA 2A5YB 3GRUA 5IREB 3GRVA 2VIIA 2F5QA 2Z4RA 1HNZM 1JR3D 3GPYA 4QNMA 5DYGA 3EIEA 4JYAM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SC3 A;  1IN6 A;  3GLH A;  4LRT A;  4FWD A;  3GLG B;  2C96 A;  1XXH B;  3HU2 A;  5EP2 A;  1IN8 A;  3U61 B;  5JI3 E;  1KSF X;  1SXJ E;  3M0E A;  5EP4 A;  3WHK A;  1KYI A;  1HT2 E;  4EIW A;  5EXP A;  5EQT A;  4L4U A;  2DVW B;  2QBY B;  3HWS A;  1C1K A;  2ZAN A;  4LY6 A;  4KOD A;  2C9O A;  3AJI B;  4KLN A;  5EXT A;  4LJ8 A;  2BJV A;  1X37 A;  2C9C A;  2DZO B;  3EIH A;  1D2N A;  1SXJ A;  1IXZ A;  4LCB A;  2CHQ A;  2QEN A;  3GLF A;  5C1B A;  2QZ4 A;  4FCT A;  3U5Z B;  1IXS B;  1IN5 A;  1NJF A;  1NVM A;  1W5T A;  4QOS A;  3B9P A;  1OFI A;  4FWG A;  4A3V B;  1QVR A;  4ZPX A;  2XSZ D;  4L15 A;  3BOS A;  4FD2 A;  2V6Z M;  3HU3 A;  5C18 A;  1DO0 A;  1G41 A;  1HQC A;  3H4M A;  1R6B X;  3K1J A;  1NJG A;  1E32 A;  3SYL A;  3GLI B;  1E94 E;  3DZD A;  5FTK A;  4FCW A;  4KO8 A;  4FW9 A;  2ZAO A;  5EP3 A;  2QP9 X;  5JI2 E;  4I81 A;  1W5S A;  3SYK A;  3CF2 A;  1NY5 A;  3HU1 A;  1FNN A;  3KW6 A;  3UK6 A;  5FTJ A;  3GLG A;  2ZAM A;  1G3I A;  1XXH A;  3VLF B;  2CEA A;  1OJL A;  3MHV C;  1QZM A;  3PFI A;  2BJW A;  3KDS E;  3VFD A;  2R62 A;  2X8A A;  4QNR A;  4WW0 A;  3PXG A;  2QBY A;  4FCV A;  3WHL A;  3GLH B;  1IN7 A;  1LV7 A;  2Z4S A;  4LZZ A;  5EP1 A;  1NSF A;  4D81 A;  4LJ5 A;  1UM8 A;  5FTL A;  1L8Q A;  1SXJ D;  1IY0 A;  1IY2 A;  3PVS A;  4LRS A;  4QHS A;  1IQP A;  1S3S A;  1HT1 E;  1SXJ C;  2C98 A;  5EXX A;  4LJ7 A;  2CHV A;  1R7R A;  3CF0 A;  2HCB A;  4LJA A;  3U60 B;  4D80 A;  4QHT A;  1SXJ B;  4D82 A;  1OFH A;  1IXR C;  1IN4 A;  3GLF B;  5DYI A;  1DO2 A;  1HQY E;  1G4A E;  5EXS A;  2KRK A;  2DHR A;  1JR3 A;  3GLI A;  3ZH9 B;  3M6A A;  5FTM A;  3R8F A;  1JQJ C;  2C99 A;  4I4L A;  2CE7 A;  2CHG A;  1J7K A;  4JN6 A;  2DZN B;  1XWI A;  2QPA A;  2XSZ A;  4LJ9 A;  2V1U A;  4LJ6 A;  5FTN A;  4GIT A;  1IY1 A;  2RKO A;  1IM2 A;  3D8B A;  4FWH A;  2FNA A;  4Z8X A;  2VII A;  4LGM A;  2DWZ B;  2Z4R A;  1NY6 A;  1JR3 D;  4L16 A;  2R65 A;  4QNM A;  4LJ4 A;  5DYG A;  3EIE A; 
#chains in the Genus database with same CATH topology
 1IN6 A;  3IHP A;  4LFB M;  2LTU A;  1XXH B;  2DEN A;  4GRI A;  3HU2 A;  1IN8 A;  1PJT A;  4M0W A;  5JI3 E;  3U61 B;  4LF9 M;  1SXJ E;  5EP4 A;  1KYI A;  4FVM A;  1HT2 E;  3KP1 E;  1VQ1 A;  4EIW A;  4II7 A;  1Q02 A;  1TTE A;  3FUW A;  4IBG A;  2KEB A;  4LY6 A;  4KOD A;  4B3S M;  2OPF A;  1PGY A;  2K9D A;  4MGK E;  2UUA M;  2VQF M;  4AG6 A;  2KZU A;  4QOZ C;  4JI3 M;  3BXW A;  3W0F A;  3L26 A;  1D2N A;  1SXJ A;  2QEN A;  3VKH A;  2YNM D;  1Q3C A;  4FCT A;  1IXS B;  1DV0 A;  1ZAE A;  1YSY A;  4QOS A;  4MH0 E;  4NRV A;  2CV0 A;  3F92 A;  3T1Y M;  2L4F A;  3HJS A;  2LVO C;  1NNJ A;  1CUK A;  4P17 A;  3E21 A;  4AKH A;  4FD2 A;  1PJS A;  1PJQ A;  4ANR A;  5C18 A;  1DO0 A;  3LW5 F;  2P5T A;  3THG A;  3GPX A;  5ITY A;  1NJG A;  2MGW A;  3NWL A;  3L27 A;  3GLI B;  4MGY E;  1E94 E;  2L7H A;  2XZU A;  4FW9 A;  4MB7 A;  1TR8 A;  1TF0 B;  3KOY E;  2JP7 A;  2QP9 X;  1JR3 E;  4LFC M;  1N78 A;  3FTD A;  4GMQ A;  4LGY A;  2UXD M;  3IEC A;  2JA2 A;  3H4J A;  2R44 A;  1QUS A;  2LVA A;  3KW6 A;  2WSC F;  4AZF A;  3J2P B;  4HLQ A;  3MHV C;  1QZM A;  3GO8 A;  2BJW A;  1G71 A;  3KDS E;  3VK7 A;  4REZ A;  2XH9 A;  4WW0 A;  4Q7J A;  2R18 A;  4FCV A;  3WHL A;  2OOB A;  1OAI A;  1WGL A;  1MX0 A;  4GC9 A;  5GKN A;  2JY6 B;  3J7B A;  1V92 A;  4D81 A;  4LJ5 A;  1XMO M;  5FTL A;  5BR8 M;  1IY0 A;  2FE8 A;  2JWS A;  2YFQ A;  3KOZ E;  3JAM S;  1S3S A;  2DXI A;  2O25 A;  1SXJ C;  3GRR A;  2M5Z A;  2QSF X;  2CHV A;  1XMQ M;  1GJS A;  1MN3 A;  2Z3X A;  3SAV A;  3SAR A;  3J7A S;  2LVP C;  1NHG C;  2Q2E B;  4QHT A;  3AOE C;  1ZMW A;  1SXJ B;  1QAO A;  1VDL A;  5IZ7 D;  3U6Q A;  3BBZ A;  3KSJ A;  4DR1 M;  2N35 A;  2RGO A;  3B89 A;  5EXS A;  4RKU F;  2DHR A;  2DI0 A;  4CGY B;  4PDG A;  3ZH9 B;  3M6A A;  3SAW A;  2CRU A;  4F2L A;  1DGH A;  1JQJ C;  2C99 A;  3CF6 E;  3KS4 A;  2CHG A;  4DV1 M;  1J7K A;  1VDD A;  4YY3 M;  3U6P A;  3SMP A;  2V1U A;  2GQF A;  4LJ6 A;  4B7G A;  1LTM A;  3C58 A;  4GIT A;  4L8R C;  3FUX A;  1D0M A;  1J5E M;  2KNZ A;  1NV8 A;  3B74 A;  3CGW A;  3KP0 E;  3RGP A;  2OQ4 A;  2HHH M;  2FFJ A;  4L16 A;  2R65 A;  4LJ4 A;  1T43 A;  4M9S A;  1GKI A;  3RE8 A;  4OVZ A;  4LRT A;  3FUV A;  3QWL A;  4FWD A;  3R8F A;  4KT0 F;  3C3D A;  2UXB M;  2MH8 A;  1IBM M;  2KDL A;  1HNW M;  1N32 M;  3WHK A;  2F5O A;  5ITX E;  2J7O A;  4IBJ A;  2H1R A;  3I04 M;  3GLG E;  3QYB A;  2F5N A;  3E46 A;  4L4U A;  3HWS A;  3GP1 A;  2ZAN A;  2C9O A;  3VDU A;  3AJI B;  4KLN A;  3U6D A;  5EXT A;  3HJQ A;  3VDP A;  1DGF A;  2C9C A;  4UN2 B;  2R4E A;  1OAO C;  2ZTD A;  3JR4 A;  4X65 M;  3T1H M;  3U60 A;  3L28 A;  4NRW A;  1IXZ A;  1XB2 B;  5ITX A;  2UU9 M;  3GPP A;  1Y8G A;  3B7Q A;  2ZTC A;  3GLF A;  2QZ4 A;  1GVN A;  5LMN M;  4JXJ A;  1IN5 A;  4JI8 M;  2L7I A;  1Z6T A;  3AV0 A;  2DAK A;  3FTF A;  2ERC A;  2UUC M;  2KRU A;  5KO3 A;  4G4R A;  1KFV A;  4G3O A;  3ILK A;  4ZPX A;  1MU5 A;  3PNV A;  2J7N A;  1NO1 A;  3FTE A;  2LBC A;  2DWL A;  3H4M A;  1ORY B;  2K47 A;  4PD2 A;  3GQ5 A;  4BB9 A;  2EO2 A;  1HJP A;  3U6O A;  5F3W A;  4IBI A;  3T6P A;  1OQY A;  4FCW A;  4KO8 A;  1DGH B;  3C3E A;  5FSW A;  5DNY A;  2ZAO A;  3CTW B;  5EP3 A;  4B08 A;  4G4O A;  3U6S A;  2EUC A;  5JI2 E;  4I81 A;  1H6U A;  1PJI A;  1XNR M;  3SYK A;  1A5T A;  2R4J A;  2DAM A;  3SMS A;  2Z7J A;  1NHW C;  1NY5 A;  1QQW A;  3HU1 A;  4IBK A;  1FNN A;  2XF3 A;  3KOX E;  3J81 S;  3UK6 A;  5FTJ A;  3LQR A;  4W5W A;  4I8O A;  5LMU M;  1OKS A;  3SAT A;  1XNQ M;  2QNJ A;  4Z6Y A;  3PFI A;  3E9S A;  3FD9 A;  2V1C A;  4RF1 A;  2OOA A;  4QNR A;  2CV2 A;  2LHG A;  5KPZ A;  4OVZ B;  2XZF A;  4CIZ A;  3K9P A;  2R46 A;  3U6C A;  2Z4S A;  5EP1 A;  1VG5 A;  1L1Z A;  4M9X A;  4S12 A;  2DKL A;  3FRH A;  1UM8 A;  2LH0 A;  2UXC M;  1GL6 A;  3RGS A;  3FUU A;  4DR3 M;  1PM5 A;  1T3T A;  4DR5 M;  3PVS A;  4LRS A;  4QHS A;  3I01 M;  1HT1 E;  3U5Z A;  4R7G A;  2HCB A;  3LQQ A;  2ZBK B;  3FE3 A;  3HJ8 A;  4XGI A;  3U60 B;  2LWX A;  2ZM6 M;  1OFH A;  4DV3 M;  2LVN C;  4JI2 M;  1GLN A;  2BNK A;  2EJS A;  2W82 A;  1P3Q Q;  3GLF B;  1DO2 A;  2UUB M;  2DAI A;  4CHT B;  3OTO M;  1EE8 A;  1N75 A;  1JR3 A;  2L09 A;  1I4W A;  2RRU A;  2JXN A;  4DUY M;  4NL4 H;  1R5L A;  4HL4 A;  3HHZ A;  2QQ8 A;  4I4L A;  4JN6 A;  1XWI A;  2QPA A;  3UZU A;  4NOO B;  3GPU A;  3MJ5 A;  2DNA A;  2Z8Y M;  3GLH E;  4X66 M;  4JI7 M;  1DGG A;  4G6Z A;  3JR5 A;  2YQZ A;  4LF4 M;  1F4I A;  2RKO A;  1IM2 A;  2BWE A;  3KS8 A;  4DR6 M;  1L2C A;  1D0K A;  4FWH A;  2FNA A;  2Y21 A;  3U6M A;  4CIS A;  1J09 A;  2Y0T A;  3W68 A;  2M60 A;  1ZMV A;  4LGM A;  1UFZ A;  5H37 D;  1QAQ A;  2I7P A;  5E6J A;  2NQ8 C;  1TH2 A;  3GLH A;  1D0L A;  3SAS A;  5L8R F;  3A45 A;  2C96 A;  1PRB A;  4NXM M;  1KSF X;  3MK6 A;  3LCU A;  4RF0 A;  4F1I A;  1G8P A;  1XXH E;  2KW0 A;  1QYR A;  5ITR A;  1G59 A;  2DVW B;  2OO9 A;  1WXQ A;  4AG5 A;  4LF6 M;  1Q39 A;  3HGI A;  2KZS A;  1K82 A;  4IJE A;  4LF7 M;  2HWJ A;  2MRO B;  3K8Z A;  3SFZ A;  1Q3B A;  2CV1 A;  4DR2 M;  1GJT A;  2BJV A;  3EIH A;  3TL4 X;  3NBX X;  4YHH M;  4G4Q A;  4ITQ A;  2KNA A;  4LCB A;  3HX3 A;  3J80 S;  2F5S A;  4MGH A;  2Y20 A;  5C1B A;  1TDZ A;  3K2L A;  3U5Z B;  1NJF A;  4DV2 M;  1NVM A;  1QUT A;  1W5T A;  4XK8 F;  5KPT A;  2JY7 A;  1VEJ A;  3L25 A;  4M0D A;  1OFI A;  4A3V B;  4AW4 A;  1FJG M;  2AHM A;  2D7E A;  2MR9 A;  1QVR A;  2XSZ D;  1QAM A;  3BOS A;  1WGN A;  2V6Z M;  1G41 A;  2CFO A;  3GQ4 A;  1V34 A;  4JI6 M;  2L2D A;  2G5G X;  1R2Z A;  3SYL A;  3RFW A;  4I5S A;  3TE6 A;  4DV5 M;  2R0I A;  3NBI A;  1Z5B A;  4L6V 6;  5IWA M;  4R3D A;  2J5Y A;  2D7H A;  1NV9 A;  1IXS A;  2XEP A;  1W5S A;  1VEK A;  2XGN A;  4MM3 B;  5E26 A;  2JZ1 A;  5IT9 S;  2WSF F;  3KXE C;  4DBG B;  3L2A A;  3E4R A;  5KPR A;  3DFZ A;  3GLG A;  4NC6 A;  1G3I A;  3FUT A;  3W0L B;  4AI6 A;  3I51 A;  3PNY A;  5BPV A;  4PCZ A;  1OJL A;  2CEA A;  3AFH A;  1ZQ9 A;  4LZJ A;  4JI5 M;  3VFD A;  2R62 A;  2CWB A;  2JNH A;  2X8A A;  3HHY A;  3PXG A;  2X4A A;  2QBY A;  2CUZ A;  3GLH B;  3Q8X A;  2VF7 A;  1IN7 A;  1LV7 A;  4OW0 A;  4B3R M;  2FH0 A;  4LZZ A;  3D8L A;  4MGZ E;  3FTC A;  1IFY A;  1L2D A;  2GNO A;  1QAN A;  4M9Z A;  3QYE A;  1JB0 F;  1L8Q A;  1GL7 A;  3T38 A;  3UGJ A;  4AKI A;  4HEO A;  3HZJ A;  4LF5 M;  3U6E A;  2C98 A;  1C7Y A;  1YE9 A;  5EXX A;  4GHL A;  4JI4 M;  4DV0 M;  3A46 A;  3HHX A;  1R7R A;  4LJA A;  4JI0 M;  3FKE A;  1TDH A;  4D80 A;  2EKK A;  2XLJ A;  4D82 A;  2HAK A;  2EKF A;  4DR7 M;  3SBJ A;  3LCV B;  2QHO B;  4KHP M;  1G4A E;  2G3Q A;  2MJ5 B;  2KRK A;  4AKG A;  2JY8 A;  3SHG B;  4R71 A;  4B3M M;  4NXN M;  3SAU A;  2RGH A;  1K3W A;  4BBA A;  2DZN B;  1AUA A;  1Z5A A;  4IIW A;  3IG5 A;  4P16 A;  2BWB A;  2FS1 A;  2XSZ A;  4LJ9 A;  4TUW A;  1N36 M;  4GKJ M;  3HHW A;  4LF8 M;  5FTN A;  2VQE M;  3DA1 A;  2EA0 A;  2JZ0 A;  4B3T M;  1IY1 A;  1Z59 A;  3SHF A;  3QAU A;  2F4V M;  4X62 M;  4DV4 M;  2X49 A;  3B7N A;  4Z8X A;  5ITT A;  2XFT A;  2DWZ B;  3UMM A;  1NY6 A;  1N33 M;  3TPZ A;  3MMP A;  3AOE A;  3GRY A;  4B7F A;  4WP2 A;  4IJF A;  1OTR A;  3SC3 A;  2YR0 A;  8CAT A;  4DUZ M;  2O01 F;  4NSO B;  3U6L A;  3GLG B;  1HR0 M;  3TWL A;  1OIP A;  5EP2 A;  4LFA M;  1WR1 B;  3M0E A;  4MGI E;  5ITQ A;  4AQY M;  1OIZ A;  1YUB A;  2APL A;  2KNV A;  5EXP A;  5EQT A;  1GAB A;  2QBY B;  3LMM A;  1C1K A;  4K0K M;  4GKK M;  3TQS A;  4BLC A;  1V33 A;  3B7Z A;  1EIJ A;  2DZL A;  1NNU C;  2K6B A;  3AOG A;  3K92 A;  4LJ8 A;  1K3X A;  1X37 A;  1TGU A;  2DZO B;  3UJN A;  3GPY A;  1N34 M;  1RU3 A;  4GC5 A;  7CAT A;  2F5P A;  2CHQ A;  3ZQJ A;  3VKG A;  1WJ7 A;  2VDB B;  2KA6 B;  2DWN A;  4OX9 M;  3AKZ A;  4Y28 F;  2CP8 A;  2VF8 A;  3TWK A;  4GH9 A;  3B9P A;  5KQD A;  1R4G A;  3Q8G A;  4FWG A;  5A2Q S;  3I4Y A;  4L15 A;  1L1T A;  5EJC A;  3HU3 A;  1HQC A;  4GIP A;  2KHH A;  4XBO A;  5DYG A;  2C5R A;  2DWM A;  1R6B X;  2I7N A;  3K1J A;  1E32 A;  2DAE A;  4B7H A;  2HL7 A;  3DZD A;  3VK8 A;  5FTK A;  1PJJ A;  1ZV1 A;  3KFU G;  3I4V A;  3HY5 A;  3KOW E;  1WHC A;  1T6O A;  4GHA A;  2Y0Q A;  4DV6 M;  1L2B A;  3CF2 A;  1DGB A;  2WSE F;  3FRI A;  3GQ3 A;  3DOA A;  2DHY A;  2R6F A;  2ZAM A;  4IBE A;  1EFU B;  1XXH A;  4NSR A;  3VLF B;  4G4N A;  3U61 A;  4DR4 M;  1BVS A;  3R9X B;  1YLA A;  1SG9 A;  2O5R A;  1XC8 A;  2KXE A;  4IBC A;  2LNH C;  4DV7 M;  3LVW A;  3M7G A;  4L78 A;  4JI1 M;  3V76 A;  5KQ8 A;  3ZCB B;  3FYD A;  4RNA A;  3AL0 C;  1NSF A;  1QZE A;  2QCU A;  3T15 A;  2LXE A;  1SXJ D;  1IY2 A;  1TH3 A;  2WZJ A;  1VEG A;  1ZMU A;  4LG2 A;  1IQP A;  3ZC7 B;  3C9P A;  2D7G A;  3KSX A;  3GLI E;  1GO5 A;  1IBK M;  4LJ7 A;  2L6O A;  3K9O A;  1N77 A;  3CF0 A;  5DFL A;  2G8L A;  1AIP C;  4CJ6 A;  3FYC A;  1MJG M;  3TWM A;  2XFS A;  4PT5 A;  4IBF A;  1IXR C;  4GEW A;  1IN4 A;  3A98 B;  1E9S A;  3J27 B;  2JUJ A;  2LHC A;  1HQY E;  2L4E A;  2R45 A;  5DYI A;  4X64 M;  1I94 M;  2K0B X;  4OU7 A;  2JY5 A;  3KVW A;  5FLX S;  5FTM A;  3GLI A;  1QDR A;  3LVV A;  3IG8 A;  2FOI C;  1HNX M;  3GLF E;  1Z5C A;  2CE7 A;  2DAG A;  3A42 A;  4WUR A;  2E5L M;  5ITU A;  3HKP A;  4JV5 M;  4IBB A;  1XHB A;  1R2Y A;  2H5X A;  4IBD A;  4PDI A;  1IBL M;  1E9R A;  1TH4 A;  3W67 A;  3D8B A;  1WIV A;  3L29 A;  2HKJ A;  2A5Y B;  3GRU A;  5IRE B;  3GRV A;  2VII A;  2F5Q A;  2Z4R A;  1HNZ M;  1JR3 D;  2B3T A;  4QNM A;  2LVQ D;  1QDT A;  3EIE A;  4JYA M; 
#chains in the Genus database with same CATH homology
 1IN6 A;  4LFB M;  1XXH B;  4GRI A;  3HU2 A;  1IN8 A;  4M0W A;  5JI3 E;  3U61 B;  4LF9 M;  1SXJ E;  5EP4 A;  1KYI A;  4FVM A;  1HT2 E;  3KP1 E;  4EIW A;  4II7 A;  3FUW A;  4IBG A;  2KEB A;  4LY6 A;  4KOD A;  4B3S M;  2OPF A;  4MGK E;  2UUA M;  2VQF M;  4AG6 A;  2KZU A;  4QOZ C;  4JI3 M;  3W0F A;  3L26 A;  1D2N A;  1SXJ A;  2QEN A;  3VKH A;  2YNM D;  1Q3C A;  4FCT A;  1IXS B;  1ZAE A;  1YSY A;  4QOS A;  4MH0 E;  4NRV A;  2CV0 A;  3T1Y M;  3HJS A;  1NNJ A;  4AKH A;  4FD2 A;  5C18 A;  1DO0 A;  3THG A;  2P5T A;  3GPX A;  5ITY A;  1NJG A;  3NWL A;  3L27 A;  3GLI B;  4MGY E;  1E94 E;  2L7H A;  2XZU A;  4FW9 A;  4MB7 A;  3KOY E;  2QP9 X;  1N78 A;  4LFC M;  3FTD A;  4GMQ A;  4LGY A;  2UXD M;  2JA2 A;  3KW6 A;  4AZF A;  3J2P B;  4HLQ A;  3MHV C;  1QZM A;  3GO8 A;  2BJW A;  3KDS E;  3VK7 A;  4REZ A;  2XH9 A;  4WW0 A;  2R18 A;  4FCV A;  3WHL A;  1MX0 A;  4GC9 A;  5GKN A;  3J7B A;  4D81 A;  4LJ5 A;  1XMO M;  5FTL A;  5BR8 M;  1IY0 A;  2FE8 A;  2YFQ A;  3KOZ E;  3JAM S;  1S3S A;  2DXI A;  1SXJ C;  3GRR A;  2M5Z A;  2CHV A;  1XMQ M;  2Z3X A;  3SAV A;  3SAR A;  3J7A S;  1NHG C;  2Q2E B;  4QHT A;  3AOE C;  1SXJ B;  1QAO A;  3U6Q A;  5IZ7 D;  3KSJ A;  4DR1 M;  2RGO A;  5EXS A;  2DHR A;  4CGY B;  4PDG A;  3ZH9 B;  3M6A A;  3SAW A;  3R8F A;  1DGH A;  1JQJ C;  3CF6 E;  2C99 A;  3KS4 A;  2CHG A;  4DV1 M;  1J7K A;  1VDD A;  4YY3 M;  3U6P A;  3SMP A;  2V1U A;  4LJ6 A;  4B7G A;  3C58 A;  4GIT A;  4L8R C;  3FUX A;  1J5E M;  3KP0 E;  3RGP A;  2OQ4 A;  2HHH M;  2FFJ A;  4L16 A;  2R65 A;  4LJ4 A;  4M9S A;  1GKI A;  3RE8 A;  4OVZ A;  4LRT A;  3FUV A;  3QWL A;  4FWD A;  2UXB M;  1IBM M;  1HNW M;  1N32 M;  3WHK A;  2F5O A;  5ITX E;  2J7O A;  4IBJ A;  2H1R A;  2F5N A;  4L4U A;  3HWS A;  3GP1 A;  2ZAN A;  2C9O A;  3VDU A;  3AJI B;  4KLN A;  3U6D A;  5EXT A;  3HJQ A;  3VDP A;  1DGF A;  2C9C A;  3JR4 A;  2R4E A;  3T1H M;  4X65 M;  3U60 A;  3L28 A;  4NRW A;  1IXZ A;  5ITX A;  2UU9 M;  3GPP A;  3GLF A;  2QZ4 A;  1GVN A;  5LMN M;  4JXJ A;  1IN5 A;  4JI8 M;  2L7I A;  1Z6T A;  3AV0 A;  3FTF A;  2ERC A;  2UUC M;  2KRU A;  5KO3 A;  4G4R A;  1KFV A;  4ZPX A;  3ILK A;  1MU5 A;  3PNV A;  2J7N A;  2DWL A;  3H4M A;  1ORY B;  2K47 A;  4PD2 A;  3GQ5 A;  4BB9 A;  2EO2 A;  3U6O A;  5F3W A;  4IBI A;  4ITQ A;  4FCW A;  4KO8 A;  3FTE A;  1DGH B;  5DNY A;  5FSW A;  2ZAO A;  3CTW B;  5EP3 A;  4B08 A;  4G4O A;  3U6S A;  2EUC A;  5JI2 E;  4I81 A;  1H6U A;  1PJI A;  1XNR M;  3SYK A;  2R4J A;  3SMS A;  2Z7J A;  1NHW C;  1NY5 A;  1QQW A;  3HU1 A;  4IBK A;  1FNN A;  2XF3 A;  3KOX E;  3J81 S;  3UK6 A;  5FTJ A;  3LQR A;  4W5W A;  4I8O A;  5LMU M;  3SAT A;  1XNQ M;  4Z6Y A;  3PFI A;  3E9S A;  3FD9 A;  2V1C A;  4RF1 A;  4QNR A;  2CV2 A;  5KPZ A;  4OVZ B;  2XZF A;  2R46 A;  3U6C A;  2Z4S A;  5EP1 A;  1L1Z A;  4M9X A;  4S12 A;  1UM8 A;  2LH0 A;  2UXC M;  1GL6 A;  3RGS A;  3FUU A;  4DR3 M;  1PM5 A;  1T3T A;  4DR5 M;  3PVS A;  4LRS A;  4QHS A;  1HT1 E;  3U5Z A;  4R7G A;  2HCB A;  3LQQ A;  2ZBK B;  3HJ8 A;  4XGI A;  3U60 B;  2LWX A;  2ZM6 M;  1OFH A;  4DV3 M;  4JI2 M;  1GLN A;  2BNK A;  2W82 A;  3GLF B;  1DO2 A;  2UUB M;  4CHT B;  3OTO M;  1EE8 A;  1N75 A;  1JR3 A;  2L09 A;  1I4W A;  4DUY M;  4NL4 H;  4HL4 A;  3HHZ A;  4I4L A;  4JN6 A;  1XWI A;  2QPA A;  3UZU A;  4NOO B;  3GPU A;  3MJ5 A;  4X66 M;  4JI7 M;  1DGG A;  4G6Z A;  3JR5 A;  2YQZ A;  4LF4 M;  2RKO A;  1IM2 A;  3KS8 A;  4DR6 M;  1L2C A;  4FWH A;  2FNA A;  2Y21 A;  3U6M A;  4CIS A;  1J09 A;  2Y0T A;  2M60 A;  4LGM A;  5H37 D;  1QAQ A;  2I7P A;  5E6J A;  2NQ8 C;  1TH2 A;  3GLH A;  3SAS A;  3A45 A;  2C96 A;  4NXM M;  1KSF X;  3MK6 A;  4RF0 A;  1G8P A;  2KW0 A;  1QYR A;  5ITR A;  1G59 A;  2DVW B;  4AG5 A;  1WXQ A;  4LF6 M;  1Q39 A;  3HGI A;  2KZS A;  1K82 A;  4IJE A;  4LF7 M;  3SFZ A;  3K8Z A;  1Q3B A;  2CV1 A;  4DR2 M;  2BJV A;  3EIH A;  3TL4 X;  4YHH M;  4G4Q A;  4LCB A;  3J80 S;  2F5S A;  4MGH A;  2Y20 A;  5C1B A;  3K2L A;  3U5Z B;  1NJF A;  4DV2 M;  1NVM A;  3L25 A;  1W5T A;  5KPT A;  4M0D A;  1OFI A;  4A3V B;  4AW4 A;  1FJG M;  2AHM A;  2D7E A;  1QVR A;  2XSZ D;  1QAM A;  3BOS A;  2V6Z M;  1G41 A;  2CFO A;  3GQ4 A;  4JI6 M;  2G5G X;  1R2Z A;  3SYL A;  3RFW A;  4I5S A;  3TE6 A;  4DV5 M;  3NBI A;  1Z5B A;  5IWA M;  4R3D A;  2D7H A;  2XGN A;  4MM3 B;  2XEP A;  1W5S A;  5E26 A;  5IT9 S;  3KXE C;  3L2A A;  3E4R A;  5KPR A;  3DFZ A;  3GLG A;  1G3I A;  3FUT A;  3W0L B;  4AI6 A;  3I51 A;  3PNY A;  5BPV A;  4PCZ A;  1OJL A;  2CEA A;  3AFH A;  1ZQ9 A;  4LZJ A;  4JI5 M;  3VFD A;  2R62 A;  2X8A A;  3HHY A;  3PXG A;  2X4A A;  2QBY A;  2CUZ A;  3GLH B;  3Q8X A;  4B3R M;  1IN7 A;  1LV7 A;  4OW0 A;  4LZZ A;  3D8L A;  4MGZ E;  3FTC A;  1L2D A;  1QAN A;  4M9Z A;  3T38 A;  1L8Q A;  1GL7 A;  3UGJ A;  4AKI A;  4LF5 M;  3U6E A;  2C98 A;  1YE9 A;  5EXX A;  4GHL A;  4JI4 M;  4DV0 M;  3A46 A;  3HHX A;  1R7R A;  4LJA A;  4JI0 M;  3FKE A;  1TDH A;  4D80 A;  2XLJ A;  4D82 A;  4DR7 M;  3SBJ A;  4KHP M;  1G4A E;  4AKG A;  2KRK A;  3SHG B;  4B3M M;  4NXN M;  3SAU A;  2RGH A;  1K3W A;  4BBA A;  2DZN B;  4P16 A;  1Z5A A;  4IIW A;  3IG5 A;  2XSZ A;  4LJ9 A;  4TUW A;  1N36 M;  4GKJ M;  3HHW A;  4LF8 M;  5FTN A;  2VQE M;  3DA1 A;  2EA0 A;  4B3T M;  1IY1 A;  1Z59 A;  3SHF A;  3QAU A;  2F4V M;  4X62 M;  4DV4 M;  2X49 A;  4Z8X A;  5ITT A;  2XFT A;  2DWZ B;  3UMM A;  1NY6 A;  1N33 M;  3TPZ A;  4B7F A;  3GRY A;  3AOE A;  4IJF A;  8CAT A;  3SC3 A;  2YR0 A;  4DUZ M;  3U6L A;  4NSO B;  1TDZ A;  1HR0 M;  3GLG B;  3TWL A;  5EP2 A;  4LFA M;  3M0E A;  4MGI E;  5ITQ A;  4AQY M;  1YUB A;  5EXP A;  5EQT A;  2QBY B;  3LMM A;  1C1K A;  4K0K M;  4GKK M;  3TQS A;  4BLC A;  1NNU C;  3AOG A;  1K3X A;  3K92 A;  4LJ8 A;  1X37 A;  1TGU A;  2DZO B;  3UJN A;  1N34 M;  4GC5 A;  7CAT A;  2F5P A;  2CHQ A;  3VKG A;  2DWN A;  2KA6 B;  4OX9 M;  3AKZ A;  3TWK A;  4GH9 A;  3B9P A;  5KQD A;  4FWG A;  5A2Q S;  3I4Y A;  4L15 A;  1L1T A;  5EJC A;  3HU3 A;  1HQC A;  4GIP A;  4XBO A;  2C5R A;  2DWM A;  1R6B X;  2I7N A;  3K1J A;  1E32 A;  4B7H A;  2HL7 A;  3DZD A;  3VK8 A;  5FTK A;  1PJJ A;  3KFU G;  3I4V A;  3KOW E;  4GHA A;  2Y0Q A;  4DV6 M;  1L2B A;  3CF2 A;  1DGB A;  3GQ3 A;  3DOA A;  2ZAM A;  4IBE A;  4NSR A;  1XXH A;  3VLF B;  4G4N A;  3U61 A;  4DR4 M;  3R9X B;  1XC8 A;  2O5R A;  2KXE A;  4IBC A;  2LNH C;  4DV7 M;  3LVW A;  3M7G A;  4L78 A;  4JI1 M;  5KQ8 A;  3ZCB B;  3FYD A;  4RNA A;  3AL0 C;  1NSF A;  2QCU A;  3T15 A;  2LXE A;  1SXJ D;  1IY2 A;  1TH3 A;  4LG2 A;  1IQP A;  3ZC7 B;  3KSX A;  2D7G A;  1IBK M;  4LJ7 A;  2L6O A;  1N77 A;  3CF0 A;  2G8L A;  3FYC A;  3TWM A;  2XFS A;  4PT5 A;  4IBF A;  1IXR C;  1IN4 A;  3A98 B;  1E9S A;  3J27 B;  5DYI A;  2R45 A;  1HQY E;  4X64 M;  1I94 M;  4OU7 A;  3KVW A;  3GLI A;  5FLX S;  5FTM A;  3LVV A;  3IG8 A;  2FOI C;  1HNX M;  1Z5C A;  2CE7 A;  3A42 A;  4WUR A;  2E5L M;  5ITU A;  3HKP A;  4JV5 M;  4IBB A;  1XHB A;  1R2Y A;  4PDI A;  4IBD A;  1IBL M;  1E9R A;  1TH4 A;  3D8B A;  3L29 A;  2HKJ A;  2A5Y B;  3GRU A;  5IRE B;  3GRV A;  2VII A;  2F5Q A;  2Z4R A;  1HNZ M;  1JR3 D;  3GPY A;  4QNM A;  5DYG A;  3EIE A;  4JYA M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...