2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle/protein-binding
molecule keywords 26S proteasome non-ATPase regulatory subunit 10
publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
1SXJD 3SYKA 1IN7A 2C98A 1QZMA 3GLHA 4GITA 5EXSA 3DZDA 4I4LA 2R65A 5EXXA 3ZH9B 1W5SA 3KDSE 1SXJA 4KODA 3GLFA 2CHGA 2DZNB 4L4UA 1E32A 4EIWA 2DHRA 4FCWA 2C9OA 3U60B 3M0EA 4LCBA 2QBYA 2FNAA 1XXHB 1X37A 2V6ZM 3H4MA 2RKOA 2VIIA 3D8BA 3EIEA 2QPAA 1W5TA 4LJ6A 4D80A 4D81A 2C9CA 5EXPA 1IN4A 3VFDA 1NJFA 1OFHA 5FTKA 1HT2E 4A3VB 5FTLA 4Z8XA 3VLFB 2Z4RA 2CEAA 1FNNA 5EXTA 5C1BA 3K1JA 4LJ9A 1HT1E 5JI3E 4WW0A 1LV7A 4D82A 3GLHB 2ZAMA 4LGMA 3GLIB 1DO0A 4QOSA 4L16A 1DO2A 3U5ZB 5DYIA 3PVSA 2BJWA 3MHVC 2HCBA 1IY2A 3GLGA 1IN5A 2QENA 2ZANA 3M6AA 3HU2A 5FTMA 3GLFB 2V1UA 5EQTA 3EIHA 1IQPA 1KSFX 4FW9A 2C96A 3U61B 4LJAA 4QNMA 4LJ7A 1IM2A 1D2NA 1XWIA 1XXHA 2CHQA 2DVWB 1G3IA 2KRKA 3PFIA 5FTJA 4FD2A 2DWZB 1G4AE 1NSFA 3CF0A 1OJLA 1S3SA 4QHSA 3BOSA 2QP9X 2XSZD 2Z4SA 3UK6A 1OFIA 3R8FA 4ZPXA 5JI2E 4QNRA 1QVRA 4LJ5A 3B9PA 2ZAOA 4LJ4A 4JN6A 4FCTA 1IXZA 4KLNA 4LY6A 4FWGA 5EP4A 1IN6A 1J7KA 1SXJB 3HU1A 2X8AA 2C99A 2R62A 1HQCA 3CF2A 1SXJE 1NY5A 4FCVA 5FTNA 3GLIA 5EP1A 3PXGA 3WHKA 5C18A 1R6BX 2BJVA 2QBYB 4KO8A 1KYIA 4LRSA 3GLGB 1R7RA 1E94E 1HQYE 1G41A 1SXJC 3WHLA 3KW6A 4LZZA 3SC3A 1UM8A 5DYGA 1NVMA 1JR3D 4FWHA 4QHTA 1IY0A 2CE7A 2QZ4A 2CHVA 4LRTA 4FWDA 5EP2A 1IY1A 1NY6A 1IN8A 4I81A 5EP3A 3HWSA 3AJIB 4LJ8A 1IXSB 1NJGA 3HU3A 1JR3A 3SYLA 2DZOB 1C1KA 2XSZA 1JQJC 4L15A 1L8QA 1IXRC
chains in the Genus database with same CATH superfamily
2C98A 3QAUA 4X62M 2JY6B 2F5QA 1NV9A 2O25A 3GLHA 3HHYA 1L2DA 2K0BX 3DZDA 4NOOB 3JR4A 4DR7M 4AKGA 2EKKA 2JP7A 2CFOA 5EXXA 1ZQ9A 1V34A 3H4JA 1IBKM 3KP0E 4MH0E 1IBMM 3KDSE 1SXJA 4JI5M 1NO1A 1QAOA 2R4JA 3D8LA 1RU3A 4EIWA 2CV2A 1D0LA 3F92A 3U61A 2C9OA 4DUYM 4AZFA 4YY3M 3HJSA 5ITUA 2I7NA 2QBYA 1A5TA 1AIPC 2MH8A 2RKOA 5ITQA 3FYCA 2VIIA 2YFQA 3IHPA 4OW0A 1NHWC 4L6V6 3BBZA 2HKJA 2LTUA 3D8BA 1K82A 4LJ6A 4B7GA 4BB9A 4D81A 4NL4H 2C9CA 5EXPA 1N34M 2H1RA 1IN4A 3PNYA 3T1YM 3B89A 4M9XA 3U6QA 2XLJA 1ORYB 5FTKA 5IREB 3U6SA 2JA2A 5FLXS 1IFYA 4GKKM 1YE9A 1L1ZA 1R5LA 2Z7JA 1YLAA 1NNUC 1FJGM 1QZEA 1P3QQ 3LVWA 2JNHA 4LJ9A 4LFAM 4GIPA 4MGIE 4WW0A 3T38A 3UZUA 2LNHC 2R46A 3AOEC 4M9ZA 3KS4A 4GEWA 2I7PA 4I8OA 4LGMA 2OOAA 1WXQA 2LVQD 3SAWA 1PM5A 3FTFA 1XNRM 4LF7M 3J7BA 1XNQM 2DWNA 1GJSA 2HCBA 2QENA 2V1UA 1D0KA 1LTMA 2CP8A 2APLA 3SATA 5EQTA 3EIHA 1NHGC 4LJAA 2WSEF 4LJ7A 1XWIA 4DV0M 2EO2A 3THGA 3B7ZA 1Z5CA 1K3XA 4NC6A 3L27A 3JR5A 2J7OA 3J2PB 3TL4X 3U6OA 3OTOM 4B3TM 1OJLA 2OO9A 3HX3A 2XSZD 1CUKA 4M0WA 2Y21A 3A46A 4QNRA 4HL4A 3ZCBB 3B9PA 1F4IA 3RFWA 5IZ7D 3SHGB 5IWAM 1TH4A 2P5TA 4L78A 4PDIA 4KLNA 4REZA 1Z5BA 1DGBA 2YNMD 1XC8A 2C99A 3W67A 3NBXX 2DAEA 3GLFE 1WGNA 2R45A 3U6DA 4WURA 2G5GX 1GL7A 3GPUA 1QAQA 2QCUA 4XK8F 3PXGA 3DFZA 3WHKA 5C18A 1R6BX 2DAIA 4F1IA 5H37D 4DBGB 3B74A 3L28A 1KYIA 3SMSA 3GLGB 1E94E 2EKFA 4P16A 4AW4A 3UMMA 4IIWA 4LZZA 3T15A 1XB2B 3SC3A 5DYGA 1NVMA 1JR3D 4FWHA 2XZFA 3I01M 4LRTA 3VKGA 4DR3M 7CATA 2KW0A 3Q8XA 4I81A 4IBIA 5EP3A 2JUJA 4S12A 3GPPA 1IXSB 3K2LA 3HU3A 2JY5A 1QUSA 3LW5F 4L15A 4B7FA 4HLQA 3GPYA 5ITRA 3GRUA 1QZMA 4X66M 2CWBA 5EXSA 2VF7A 3I04M 4IBKA 1QAMA 1GVNA 2FH0A 2W82A 5KQ8A 3KOYE 3SAVA 4M9SA 4KODA 3GLFA 3LCVB 4G4QA 1YUBA 4II7A 4L4UA 3MJ5A 4AKIA 2LH0A 1E32A 1DGGA 3W0LB 2JXNA 1OQYA 2DENA 4G3OA 2X4AA 2L09A 2DWLA 3GQ5A 2UUAM 2KEBA 2UXDM 2LVPC 1JB0F 1X37A 1XXHB 2DAGA 2V6ZM 4LZJA 3LMMA 1N33M 2F4VM 5EJCA 2FS1A 2QPAA 1VDDA 4QOZC 4D80A 4OU7A 4G4RA 2MR9A 3FE3A 3A42A 1NJFA 1G59A 4MM3B 1N78A 2HWJA 2B3TA 4R3DA 2FE8A 1MU5A 3W0FA 4Z8XA 2Z4RA 3V76A 2Y0TA 1FNNA 4DUZM 4TUWA 5EXTA 3K1JA 3SAUA 2C5RA 1N77A 4LGYA 4YHHM 4LFCM 1LV7A 1VQ1A 5KPZA 2F5PA 4XBOA 2UU9M 3DA1A 2ZAMA 3GLHB 3KOZE 3LCUA 1ZAEA 8CATA 3FUUA 4OVZB 1DO2A 3U5ZB 5DYIA 3PVSA 3MHVC 4PD2A 1IY2A 5FTMA 3M6AA 3GQ3A 1TH2A 1Y8GA 2MROB 3HJ8A 3HU2A 3K8ZA 3M7GA 4MGYE 3U61B 2JWSA 1XMQM 3FUTA 3E4RA 1D2NA 1ZMUA 1VEJA 1VEKA 3FYDA 4PDGA 3QWLA 5FTJA 1PJIA 1G3IA 3NBIA 4GHAA 3HHWA 3AL0C 3PNVA 3KVWA 3HHXA 1SG9A 2JZ0A 2K47A 3VDPA 3KOWE 4QHSA 1G8PA 4NSOB 3GQ4A 2QP9X 3HKPA 1OFIA 3SBJA 3R8FA 3AOEA 1HJPA 1OAIA 2QHOB 1NNJA 2K6BA 4LJ5A 4LJ4A 3BXWA 3L29A 4DR5M 1K3WA 1HNWM 4KHPM 1ZMVA 3QYEA 2QQ8A 4AG6A 2L7IA 3MMPA 2R0IA 4IBDA 3HU1A 1OIZA 5ITXE 2X8AA 3J7AS 2R62A 3CF2A 1HQCA 1QDTA 2L4EA 2XGNA 3KFUG 1J5EM 3AV0A 2LXEA 2H5XA 3AFHA 2DXIA 4B3SM 2M60A 2QNJA 3SHFA 2AHMA 3I51A 1XMOM 2NQ8C 1R7RA 1G41A 1L2BA 4JI3M 3KW6A 1N75A 1HNZM 4MGHA 3VDUA 2OQ4A 4AG5A 2XF3A 3SARA 4PT5A 5L8RF 4DR2M 1WJ7A 2CHVA 2R6FA 5EP2A 1IY1A 1J09A 1NY6A 2JY7A 3FUXA 5KO3A 2KZUA 4LF8M 1Q02A 3VKHA 3AJIB 4LJ8A 1N32M 2WZJA 1OAOC 3A98B 3HHZA 3RGSA 3J80S 2KNAA 1JQJC 1I94M 4LFBM 1WHCA 1IXRC 1EE8A 1SXJD 1IN7A 4IBCA 4JI2M 3GRRA 4GITA 3I4YA 3SMPA 3TE6A 5LMUM 1ZV1A 3E21A 2R65A 2KXEA 4JI6M 5ITXA 4R71A 4PCZA 1W5SA 1YSYA 3KP1E 4I5SA 4G4NA 3TQSA 2MJ5B 4LF5M 2LVOC 1TTEA 4OX9M 2CRUA 3C58A 3VK8A 3GRYA 3GP1A 4IBBA 3U60B 2RRUA 4X65M 3K9OA 4LCBA 4R7GA 1HNXM 2K9DA 2FNAA 2QSFX 4MGKE 4XGIA 2YQZA 2VQEM 3UGJA 3KSXA 1XXHE 2BWBA 4BBAA 3IG8A 3EIEA 1EFUB 3FTDA 1W5TA 1OKSA 1T3TA 3K92A 4Y28F 3FTCA 5LMNM 2KRUA 4Z6YA 2EJSA 1OFHA 2E5LM 1DGHA 3HY5A 4CGYB 3C9PA 4A3VB 4DV4M 4DR6M 1IXSA 1HR0M 3LQRA 3ILKA 1GABA 1Z6TA 3KSJA 5C1BA 2UUCM 1N36M 5JI3E 1GKIA 3A45A 2Z3XA 5BR8M 2ZM6M 1UFZA 3CTWB 1GLNA 4GH9A 3B7NA 4MGZE 4JXJA 3GLIB 1DO0A 4QOSA 2VDBB 1TF0B 4GMQA 5KPRA 4M0DA 1XHBA 1IN5A 2ZANA 3C3EA 4NXNM 4KT0F 3GLFB 4NXMM 2XH9A 1PJSA 5F3WA 2LWXA 1KSFX 2C96A 4G4OA 2F5NA 4AI6A 4QNMA 4B3MM 2FOIC 1XXHA 1PJJA 2KRKA 2DVWB 2DZLA 2RGHA 3PFIA 2UXBM 4BLCA 3L25A 3FKEA 5ITYA 1G71A 4ANRA 3SASA 2DWZB 4WP2A 2LHCA 1NSFA 3AOGA 3CF0A 1EIJA 3FUVA 2UXCM 1VEGA 3BOSA 1JR3E 2JZ1A 2EA0A 4LF4M 3UK6A 4ITQA 5E6JA 2KHHA 5JI2E 2YR0A 1V92A 1QQWA 4RNAA 4CISA 2DAMA 2HAKA 4JN6A 4JYAM 1MX0A 3KXEC 1MN3A 1VDLA 2ERCA 1ZMWA 2ZTCA 5E26A 3ZC7B 5EP4A 2GQFA 1IN6A 1Q3BA 1OIPA 1QANA 1SXJB 4JI8M 4NRVA 2XFSA 1TR8A 2JY8A 5KQDA 4FCVA 3U6MA 1VG5A 1T43A 1NV8A 1OTRA 2J7NA 2KZSA 5KPTA 1BVSA 1WIVA 5EP1A 1L1TA 4OVZA 5FSWA 4B7HA 4DV1M 2BJVA 3FD9A 4GC9A 4B08A 2Y0QA 3U6LA 3U5ZA 4KO8A 4GRIA 1D0MA 1Q3CA 2QBYB 3LVVA 4LRSA 4DV2M 1HQYE 3FUWA 1SXJC 4HEOA 1MJGM 4DR4M 3U6EA 2OOBA 3IECA 4QHTA 2CE7A 4FWDA 1PRBA 1IN8A 2DKLA 3FTEA 4NSRA 2CUZA 2F5OA 1QYRA 2DAKA 4RF1A 1NJGA 1PJQA 1JR3A 2KNVA 2MGWA 2DZOB 3SYLA 2EUCA 2VQFM 1C1KA 2BNKA 4UN2B 1IBLM 3J81S 3Q8GA 2RGOA 3SYKA 4RKUF 2DHYA 1AUAA 5GKNA 3NWLA 2LVAA 2J5YA 3J27B 4I4LA 3RE8A 1E9SA 4JI1M 3IG5A 2DNAA 2R4EA 3I4VA 3TWLA 3TWMA 3ZH9B 2DI0A 4Q7JA 2X49A 2CHGA 2O01F 4NRWA 2DZNB 1C7YA 3GLGE 3R9XB 1DGFA 2KA6B 2DHRA 2UUBM 4FCWA 2R18A 1PGYA 3CF6E 4P17A 3GRVA 5DFLA 3M0EA 2R44A 5DNYA 3H4MA 3U6PA 1Z59A 2G3QA 2F5SA 3HZJA 1GJTA 1T6OA 2A5YB 2LBCA 2LVNC 2Q2EB 2XFTA 4JI4M 2L2DA 4GHLA 3CGWA 3VFDA 4AKHA 1Z5AA 4IBGA 3UJNA 1HT2E 3HGIA 5FTLA 2D7EA 3FRIA 3VLFB 2V1CA 4GC5A 4LF6M 2CEAA 2Z8YM 4LG2A 3L2AA 3T6PA 4RF0A 3ZQJA 2OPFA 1HT1E 2WSCF 3KOXE 2DWMA 1R4GA 4CJ6A 1Q39A 4D82A 3HJQA 1DV0A 1QUTA 2Y20A 2L7HA 4L16A 3GLIE 1R2ZA 2WSFF 3GLGA 2BJWA 2D7GA 1L2CA 4DR1M 4FVMA 5A2QS 1WR1B 3VK7A 2CV1A 4W5WA 1IQPA 4FW9A 4LF9M 3U60A 3E9SA 4IJFA 4IBFA 2LHGA 3FRHA 3K9PA 3AKZA 1IM2A 2G8LA 4IBJA 3T1HM 2CHQA 2XEPA 4IJEA 4FD2A 1WGLA 2N35A 1G4AE 2KNZA 1S3SA 1TDHA 3QYBA 3U6CA 2M5ZA 4IBEA 2L4FA 2D7HA 3RGPA 3W68A 2Z4SA 3C3DA 4ZPXA 5IT9S 1DGHB 4DV3M 1QVRA 3LQQA 4L8RC 3B7QA 2ZAOA 4B3RM 4MB7A 2CV0A 3GLHE 4CIZA 3MK6A 4K0KM 1I4WA 4F2LA 4FCTA 4JV5M 1KFVA 1IXZA 4LY6A 4FWGA 1V33A 5BPVA 1J7KA 1TH3A 3L26A 1SXJE 1NY5A 4JI0M 1E9RA 3GPXA 1H6UA 5FTNA 3TPZA 3GLIA 2GNOA 4G6ZA 2HL7A 4DV5M 4AQYM 2BWEA 4GKJM 5ITTA 3JAMS 3SFZA 2HHHM 4JI7M 2FFJA 3WHLA 2ZTDA 4DV6M 2ZBKB 1PJTA 1UM8A 1GO5A 2O5RA 2VF8A 2KDLA 4DV7M 1IY0A 2QZ4A 2L6OA 2XZUA 1R2YA 3GO8A 1GL6A 3HWSA 4X64M 3E46A 3KS8A 2XSZA 1QDRA 1TDZA 3TWKA 3DOAA 1TGUA 1L8QA 4CHTB
chains in the Genus database with same CATH topology
2C98A 3QAUA 4X62M 2F5QA 1L2DA 3GLHA 3HHYA 4NOOB 3DZDA 3JR4A 4DR7M 4AKGA 2CFOA 5EXXA 1ZQ9A 1IBKM 3KP0E 4MH0E 1IBMM 3KDSE 1SXJA 4JI5M 1QAOA 2R4JA 3D8LA 4EIWA 2CV2A 3U61A 2C9OA 4DUYM 4AZFA 4YY3M 3HJSA 5ITUA 2I7NA 2QBYA 2RKOA 5ITQA 3FYCA 2VIIA 2YFQA 4OW0A 1NHWC 3D8BA 2HKJA 1K82A 4LJ6A 4B7GA 4BB9A 4D81A 4NL4H 2C9CA 5EXPA 1N34M 2H1RA 1IN4A 3PNYA 3T1YM 4M9XA 3U6QA 2XLJA 1ORYB 5FTKA 5IREB 3U6SA 2JA2A 5FLXS 4GKKM 1YE9A 1L1ZA 2Z7JA 1NNUC 1FJGM 3LVWA 4LJ9A 4LFAM 4GIPA 4MGIE 4WW0A 3T38A 3UZUA 2LNHC 2R46A 3AOEC 4M9ZA 3KS4A 4I8OA 2I7PA 4LGMA 1WXQA 3SAWA 1PM5A 3FTFA 1XNRM 4LF7M 3J7BA 1XNQM 2DWNA 2HCBA 2QENA 2V1UA 3SATA 5EQTA 3EIHA 1NHGC 4LJAA 4LJ7A 1XWIA 4DV0M 2EO2A 3THGA 1Z5CA 1K3XA 3L27A 3JR5A 2J7OA 3J2PB 3TL4X 3U6OA 3OTOM 4B3TM 1OJLA 2XSZD 4M0WA 2Y21A 3A46A 4QNRA 4HL4A 3ZCBB 3B9PA 3RFWA 5IZ7D 3SHGB 5IWAM 1TH4A 2P5TA 4L78A 4PDIA 4KLNA 4REZA 1Z5BA 2YNMD 1DGBA 1XC8A 2C99A 3U6DA 2R45A 4WURA 2G5GX 1GL7A 3GPUA 1QAQA 2QCUA 3PXGA 3DFZA 3WHKA 5C18A 1R6BX 5H37D 3L28A 1KYIA 3SMSA 3GLGB 1E94E 4P16A 4AW4A 3UMMA 4IIWA 4LZZA 3T15A 3SC3A 5DYGA 1NVMA 1JR3D 4FWHA 2XZFA 4LRTA 3VKGA 4DR3M 7CATA 2KW0A 3Q8XA 4I81A 4IBIA 5EP3A 4S12A 3GPPA 1IXSB 3K2LA 3HU3A 4L15A 4B7FA 4HLQA 3GPYA 5ITRA 3GRUA 1QZMA 4X66M 5EXSA 4IBKA 1QAMA 1GVNA 5KQ8A 2W82A 3KOYE 3SAVA 4M9SA 4KODA 3GLFA 4G4QA 1YUBA 4II7A 4L4UA 3MJ5A 4AKIA 2LH0A 1E32A 1DGGA 3W0LB 2X4AA 2L09A 2DWLA 3GQ5A 2UUAM 2KEBA 2UXDM 1XXHB 1X37A 2V6ZM 4LZJA 3LMMA 1N33M 2F4VM 5EJCA 2QPAA 1VDDA 4QOZC 4D80A 4OU7A 4G4RA 3A42A 1NJFA 1G59A 4MM3B 4R3DA 2FE8A 1MU5A 3W0FA 4Z8XA 2Z4RA 2Y0TA 1FNNA 4DUZM 4TUWA 5EXTA 3K1JA 3SAUA 2C5RA 1N77A 4LGYA 4YHHM 4LFCM 1LV7A 5KPZA 2F5PA 4XBOA 2UU9M 3DA1A 2ZAMA 3GLHB 3KOZE 8CATA 1ZAEA 3FUUA 4OVZB 1DO2A 3U5ZB 5DYIA 3PVSA 3MHVC 4PD2A 1IY2A 5FTMA 3M6AA 3GQ3A 1TH2A 3HJ8A 3HU2A 3K8ZA 3M7GA 4MGYE 3U61B 1XMQM 3FUTA 3E4RA 1D2NA 3FYDA 1PJIA 4PDGA 4GHAA 3QWLA 5FTJA 1G3IA 3NBIA 3HHWA 3AL0C 3PNVA 3KVWA 3HHXA 2K47A 3VDPA 3KOWE 4QHSA 1G8PA 4NSOB 3GQ4A 2QP9X 3HKPA 1OFIA 3SBJA 3R8FA 3AOEA 1NNJA 4LJ5A 4LJ4A 3L29A 4DR5M 1K3WA 1HNWM 4KHPM 4AG6A 2L7IA 4IBDA 3J7AS 5ITXE 3HU1A 2X8AA 3KFUG 2R62A 3CF2A 1HQCA 2XGNA 1J5EM 3AV0A 2LXEA 3AFHA 2DXIA 4B3SM 2M60A 3SHFA 1XMOM 2AHMA 3I51A 2NQ8C 1R7RA 1G41A 1L2BA 4JI3M 3KW6A 1N75A 1HNZM 4MGHA 3VDUA 2OQ4A 4AG5A 2XF3A 3SARA 4PT5A 4DR2M 2CHVA 5EP2A 1IY1A 1J09A 1NY6A 3FUXA 5KO3A 2KZUA 4LF8M 3VKHA 3AJIB 4LJ8A 1N32M 3A98B 3HHZA 3RGSA 3J80S 1JQJC 1I94M 4LFBM 1IXRC 1EE8A 1SXJD 1IN7A 4IBCA 4JI2M 3GRRA 4GITA 3I4YA 3SMPA 3TE6A 5LMUM 2R65A 2KXEA 4JI6M 5ITXA 4PCZA 1W5SA 1YSYA 3KP1E 4I5SA 4G4NA 3TQSA 4LF5M 4OX9M 3C58A 3VK8A 3GRYA 3GP1A 4IBBA 3U60B 4X65M 4LCBA 4R7GA 1HNXM 4MGKE 2FNAA 2VQEM 4XGIA 2YQZA 3UGJA 3KSXA 4BBAA 3IG8A 3EIEA 3FTDA 3K92A 1W5TA 1T3TA 5LMNM 3FTCA 2KRUA 4Z6YA 1OFHA 2E5LM 1DGHA 4CGYB 4A3VB 4DV4M 4DR6M 1HR0M 3LQRA 3ILKA 1Z6TA 3KSJA 5C1BA 2UUCM 1N36M 5JI3E 1GKIA 3A45A 2Z3XA 5BR8M 2ZM6M 3CTWB 1GLNA 4GH9A 4MGZE 4JXJA 3GLIB 1DO0A 4QOSA 5KPRA 4GMQA 4M0DA 1XHBA 1IN5A 2ZANA 4NXNM 3GLFB 4NXMM 2XH9A 5F3WA 2LWXA 1KSFX 2C96A 4G4OA 2F5NA 4AI6A 4QNMA 4B3MM 2FOIC 1XXHA 1PJJA 2KRKA 2DVWB 2RGHA 3PFIA 2UXBM 4BLCA 3L25A 3FKEA 5ITYA 3SASA 2DWZB 1NSFA 3AOGA 3CF0A 3FUVA 2UXCM 3BOSA 2EA0A 4LF4M 3UK6A 4ITQA 5E6JA 5JI2E 2YR0A 1QQWA 4RNAA 4CISA 4JN6A 4JYAM 1MX0A 3KXEC 2ERCA 5E26A 3ZC7B 4JI8M 5EP4A 1IN6A 1Q3BA 1QANA 1SXJB 4NRVA 2XFSA 5KQDA 4FCVA 3U6MA 2J7NA 2KZSA 5KPTA 5EP1A 1L1TA 4OVZA 5FSWA 4B7HA 4DV1M 2BJVA 3FD9A 4GC9A 4B08A 2Y0QA 3U6LA 3U5ZA 4KO8A 4GRIA 1Q3CA 2QBYB 3LVVA 4LRSA 4DV2M 1HQYE 3FUWA 1SXJC 4DR4M 3U6EA 4QHTA 2CE7A 4FWDA 1IN8A 3FTEA 4NSRA 2CUZA 2F5OA 1QYRA 4RF1A 1NJGA 3SYLA 1JR3A 1TDZA 2DZOB 2VQFM 2EUCA 1C1KA 2BNKA 1IBLM 3J81S 2RGOA 3SYKA 5GKNA 3NWLA 3J27B 4I4LA 3RE8A 4JI1M 1E9SA 1N78A 3IG5A 2R4EA 3I4VA 3TWLA 3TWMA 3ZH9B 2X49A 2CHGA 4NRWA 2DZNB 3R9XB 1DGFA 2KA6B 2DHRA 2UUBM 4FCWA 2R18A 3CF6E 3GRVA 3M0EA 3U6PA 5DNYA 3H4MA 2F5SA 1Z59A 2A5YB 2Q2EB 2XFTA 4JI4M 4GHLA 3VFDA 4AKHA 1Z5AA 4IBGA 3UJNA 1HT2E 3HGIA 5FTLA 2D7EA 3VLFB 2V1CA 4GC5A 4LF6M 2CEAA 4LG2A 3L2AA 4RF0A 2OPFA 1HT1E 3KOXE 2DWMA 1Q39A 4D82A 3HJQA 2Y20A 2L7HA 4L16A 1R2ZA 3GLGA 2BJWA 2D7GA 1L2CA 4DR1M 4FVMA 5A2QS 3VK7A 2CV1A 4W5WA 1IQPA 4FW9A 4LF9M 3U60A 3E9SA 4IJFA 4IBFA 3T1HM 3AKZA 1IM2A 2G8LA 4IBJA 2CHQA 2XEPA 4IJEA 4FD2A 1G4AE 1S3SA 1TDHA 3U6CA 2M5ZA 4IBEA 2D7HA 3RGPA 2Z4SA 4ZPXA 5IT9S 1DGHB 4DV3M 1QVRA 3LQQA 4L8RC 2ZAOA 4B3RM 4MB7A 2CV0A 4K0KM 3MK6A 1I4WA 4JV5M 4FCTA 1KFVA 1IXZA 4LY6A 4FWGA 5BPVA 1J7KA 1TH3A 3L26A 1SXJE 1NY5A 4JI0M 1E9RA 3GPXA 1H6UA 5FTNA 3TPZA 3GLIA 4G6ZA 2HL7A 4DV5M 4AQYM 4GKJM 5ITTA 3JAMS 3SFZA 2HHHM 4JI7M 2FFJA 3WHLA 4DV6M 2ZBKB 1UM8A 2O5RA 4DV7M 1IY0A 2QZ4A 2L6OA 2XZUA 1R2YA 3GO8A 1GL6A 3HWSA 4X64M 3KS8A 2XSZA 3TWKA 3DOAA 1TGUA 1L8QA 4CHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SXJ D;  3SYK A;  1IN7 A;  2C98 A;  1QZM A;  3GLH A;  4GIT A;  5EXS A;  3DZD A;  4I4L A;  2R65 A;  5EXX A;  3ZH9 B;  1W5S A;  3KDS E;  1SXJ A;  4KOD A;  3GLF A;  2CHG A;  2DZN B;  4L4U A;  1E32 A;  4EIW A;  2DHR A;  4FCW A;  2C9O A;  3U60 B;  3M0E A;  4LCB A;  2QBY A;  2FNA A;  1XXH B;  1X37 A;  2V6Z M;  3H4M A;  2RKO A;  2VII A;  3D8B A;  3EIE A;  2QPA A;  1W5T A;  4LJ6 A;  4D80 A;  4D81 A;  2C9C A;  5EXP A;  1IN4 A;  3VFD A;  1NJF A;  1OFH A;  5FTK A;  1HT2 E;  4A3V B;  5FTL A;  4Z8X A;  3VLF B;  2Z4R A;  2CEA A;  1FNN A;  5EXT A;  5C1B A;  3K1J A;  4LJ9 A;  1HT1 E;  5JI3 E;  4WW0 A;  1LV7 A;  4D82 A;  3GLH B;  2ZAM A;  4LGM A;  3GLI B;  1DO0 A;  4QOS A;  4L16 A;  1DO2 A;  3U5Z B;  5DYI A;  3PVS A;  2BJW A;  3MHV C;  2HCB A;  1IY2 A;  3GLG A;  1IN5 A;  2QEN A;  2ZAN A;  3M6A A;  3HU2 A;  5FTM A;  3GLF B;  2V1U A;  5EQT A;  3EIH A;  1IQP A;  1KSF X;  4FW9 A;  2C96 A;  3U61 B;  4LJA A;  4QNM A;  4LJ7 A;  1IM2 A;  1D2N A;  1XWI A;  1XXH A;  2CHQ A;  2DVW B;  1G3I A;  2KRK A;  3PFI A;  5FTJ A;  4FD2 A;  2DWZ B;  1G4A E;  1NSF A;  3CF0 A;  1OJL A;  1S3S A;  4QHS A;  3BOS A;  2QP9 X;  2XSZ D;  2Z4S A;  3UK6 A;  1OFI A;  3R8F A;  4ZPX A;  5JI2 E;  4QNR A;  1QVR A;  4LJ5 A;  3B9P A;  2ZAO A;  4LJ4 A;  4JN6 A;  4FCT A;  1IXZ A;  4KLN A;  4LY6 A;  4FWG A;  5EP4 A;  1IN6 A;  1J7K A;  1SXJ B;  3HU1 A;  2X8A A;  2C99 A;  2R62 A;  1HQC A;  3CF2 A;  1SXJ E;  1NY5 A;  4FCV A;  5FTN A;  3GLI A;  5EP1 A;  3PXG A;  3WHK A;  5C18 A;  1R6B X;  2BJV A;  2QBY B;  4KO8 A;  1KYI A;  4LRS A;  3GLG B;  1R7R A;  1E94 E;  1HQY E;  1G41 A;  1SXJ C;  3WHL A;  3KW6 A;  4LZZ A;  3SC3 A;  1UM8 A;  5DYG A;  1NVM A;  1JR3 D;  4FWH A;  4QHT A;  1IY0 A;  2CE7 A;  2QZ4 A;  2CHV A;  4LRT A;  4FWD A;  5EP2 A;  1IY1 A;  1NY6 A;  1IN8 A;  4I81 A;  5EP3 A;  3HWS A;  3AJI B;  4LJ8 A;  1IXS B;  1NJG A;  3HU3 A;  1JR3 A;  3SYL A;  2DZO B;  1C1K A;  2XSZ A;  1JQJ C;  4L15 A;  1L8Q A;  1IXR C; 
#chains in the Genus database with same CATH topology
 2C98 A;  3QAU A;  4X62 M;  2JY6 B;  2F5Q A;  1NV9 A;  2O25 A;  3GLH A;  3HHY A;  1L2D A;  2K0B X;  3DZD A;  4NOO B;  3JR4 A;  4DR7 M;  4AKG A;  2EKK A;  2JP7 A;  2CFO A;  5EXX A;  1ZQ9 A;  1V34 A;  3H4J A;  1IBK M;  3KP0 E;  4MH0 E;  1IBM M;  3KDS E;  1SXJ A;  4JI5 M;  1NO1 A;  1QAO A;  2R4J A;  3D8L A;  1RU3 A;  4EIW A;  2CV2 A;  1D0L A;  3F92 A;  3U61 A;  2C9O A;  4DUY M;  4AZF A;  4YY3 M;  3HJS A;  5ITU A;  2I7N A;  2QBY A;  1A5T A;  1AIP C;  2MH8 A;  2RKO A;  5ITQ A;  3FYC A;  2VII A;  2YFQ A;  3IHP A;  4OW0 A;  1NHW C;  4L6V 6;  3BBZ A;  2HKJ A;  2LTU A;  3D8B A;  1K82 A;  4LJ6 A;  4B7G A;  4BB9 A;  4D81 A;  4NL4 H;  2C9C A;  5EXP A;  1N34 M;  2H1R A;  1IN4 A;  3PNY A;  3T1Y M;  3B89 A;  4M9X A;  3U6Q A;  2XLJ A;  1ORY B;  5FTK A;  5IRE B;  3U6S A;  2JA2 A;  5FLX S;  1IFY A;  4GKK M;  1YE9 A;  1L1Z A;  1R5L A;  2Z7J A;  1YLA A;  1NNU C;  1FJG M;  1QZE A;  1P3Q Q;  3LVW A;  2JNH A;  4LJ9 A;  4LFA M;  4GIP A;  4MGI E;  4WW0 A;  3T38 A;  3UZU A;  2LNH C;  2R46 A;  3AOE C;  4M9Z A;  3KS4 A;  4GEW A;  2I7P A;  4I8O A;  4LGM A;  2OOA A;  1WXQ A;  2LVQ D;  3SAW A;  1PM5 A;  3FTF A;  1XNR M;  4LF7 M;  3J7B A;  1XNQ M;  2DWN A;  1GJS A;  2HCB A;  2QEN A;  2V1U A;  1D0K A;  1LTM A;  2CP8 A;  2APL A;  3SAT A;  5EQT A;  3EIH A;  1NHG C;  4LJA A;  2WSE F;  4LJ7 A;  1XWI A;  4DV0 M;  2EO2 A;  3THG A;  3B7Z A;  1Z5C A;  1K3X A;  4NC6 A;  3L27 A;  3JR5 A;  2J7O A;  3J2P B;  3TL4 X;  3U6O A;  3OTO M;  4B3T M;  1OJL A;  2OO9 A;  3HX3 A;  2XSZ D;  1CUK A;  4M0W A;  2Y21 A;  3A46 A;  4QNR A;  4HL4 A;  3ZCB B;  3B9P A;  1F4I A;  3RFW A;  5IZ7 D;  3SHG B;  5IWA M;  1TH4 A;  2P5T A;  4L78 A;  4PDI A;  4KLN A;  4REZ A;  1Z5B A;  1DGB A;  2YNM D;  1XC8 A;  2C99 A;  3W67 A;  3NBX X;  2DAE A;  3GLF E;  1WGN A;  2R45 A;  3U6D A;  4WUR A;  2G5G X;  1GL7 A;  3GPU A;  1QAQ A;  2QCU A;  4XK8 F;  3PXG A;  3DFZ A;  3WHK A;  5C18 A;  1R6B X;  2DAI A;  4F1I A;  5H37 D;  4DBG B;  3B74 A;  3L28 A;  1KYI A;  3SMS A;  3GLG B;  1E94 E;  2EKF A;  4P16 A;  4AW4 A;  3UMM A;  4IIW A;  4LZZ A;  3T15 A;  1XB2 B;  3SC3 A;  5DYG A;  1NVM A;  1JR3 D;  4FWH A;  2XZF A;  3I01 M;  4LRT A;  3VKG A;  4DR3 M;  7CAT A;  2KW0 A;  3Q8X A;  4I81 A;  4IBI A;  5EP3 A;  2JUJ A;  4S12 A;  3GPP A;  1IXS B;  3K2L A;  3HU3 A;  2JY5 A;  1QUS A;  3LW5 F;  4L15 A;  4B7F A;  4HLQ A;  3GPY A;  5ITR A;  3GRU A;  1QZM A;  4X66 M;  2CWB A;  5EXS A;  2VF7 A;  3I04 M;  4IBK A;  1QAM A;  1GVN A;  2FH0 A;  2W82 A;  5KQ8 A;  3KOY E;  3SAV A;  4M9S A;  4KOD A;  3GLF A;  3LCV B;  4G4Q A;  1YUB A;  4II7 A;  4L4U A;  3MJ5 A;  4AKI A;  2LH0 A;  1E32 A;  1DGG A;  3W0L B;  2JXN A;  1OQY A;  2DEN A;  4G3O A;  2X4A A;  2L09 A;  2DWL A;  3GQ5 A;  2UUA M;  2KEB A;  2UXD M;  2LVP C;  1JB0 F;  1X37 A;  1XXH B;  2DAG A;  2V6Z M;  4LZJ A;  3LMM A;  1N33 M;  2F4V M;  5EJC A;  2FS1 A;  2QPA A;  1VDD A;  4QOZ C;  4D80 A;  4OU7 A;  4G4R A;  2MR9 A;  3FE3 A;  3A42 A;  1NJF A;  1G59 A;  4MM3 B;  1N78 A;  2HWJ A;  2B3T A;  4R3D A;  2FE8 A;  1MU5 A;  3W0F A;  4Z8X A;  2Z4R A;  3V76 A;  2Y0T A;  1FNN A;  4DUZ M;  4TUW A;  5EXT A;  3K1J A;  3SAU A;  2C5R A;  1N77 A;  4LGY A;  4YHH M;  4LFC M;  1LV7 A;  1VQ1 A;  5KPZ A;  2F5P A;  4XBO A;  2UU9 M;  3DA1 A;  2ZAM A;  3GLH B;  3KOZ E;  3LCU A;  1ZAE A;  8CAT A;  3FUU A;  4OVZ B;  1DO2 A;  3U5Z B;  5DYI A;  3PVS A;  3MHV C;  4PD2 A;  1IY2 A;  5FTM A;  3M6A A;  3GQ3 A;  1TH2 A;  1Y8G A;  2MRO B;  3HJ8 A;  3HU2 A;  3K8Z A;  3M7G A;  4MGY E;  3U61 B;  2JWS A;  1XMQ M;  3FUT A;  3E4R A;  1D2N A;  1ZMU A;  1VEJ A;  1VEK A;  3FYD A;  4PDG A;  3QWL A;  5FTJ A;  1PJI A;  1G3I A;  3NBI A;  4GHA A;  3HHW A;  3AL0 C;  3PNV A;  3KVW A;  3HHX A;  1SG9 A;  2JZ0 A;  2K47 A;  3VDP A;  3KOW E;  4QHS A;  1G8P A;  4NSO B;  3GQ4 A;  2QP9 X;  3HKP A;  1OFI A;  3SBJ A;  3R8F A;  3AOE A;  1HJP A;  1OAI A;  2QHO B;  1NNJ A;  2K6B A;  4LJ5 A;  4LJ4 A;  3BXW A;  3L29 A;  4DR5 M;  1K3W A;  1HNW M;  4KHP M;  1ZMV A;  3QYE A;  2QQ8 A;  4AG6 A;  2L7I A;  3MMP A;  2R0I A;  4IBD A;  3HU1 A;  1OIZ A;  5ITX E;  2X8A A;  3J7A S;  2R62 A;  3CF2 A;  1HQC A;  1QDT A;  2L4E A;  2XGN A;  3KFU G;  1J5E M;  3AV0 A;  2LXE A;  2H5X A;  3AFH A;  2DXI A;  4B3S M;  2M60 A;  2QNJ A;  3SHF A;  2AHM A;  3I51 A;  1XMO M;  2NQ8 C;  1R7R A;  1G41 A;  1L2B A;  4JI3 M;  3KW6 A;  1N75 A;  1HNZ M;  4MGH A;  3VDU A;  2OQ4 A;  4AG5 A;  2XF3 A;  3SAR A;  4PT5 A;  5L8R F;  4DR2 M;  1WJ7 A;  2CHV A;  2R6F A;  5EP2 A;  1IY1 A;  1J09 A;  1NY6 A;  2JY7 A;  3FUX A;  5KO3 A;  2KZU A;  4LF8 M;  1Q02 A;  3VKH A;  3AJI B;  4LJ8 A;  1N32 M;  2WZJ A;  1OAO C;  3A98 B;  3HHZ A;  3RGS A;  3J80 S;  2KNA A;  1JQJ C;  1I94 M;  4LFB M;  1WHC A;  1IXR C;  1EE8 A;  1SXJ D;  1IN7 A;  4IBC A;  4JI2 M;  3GRR A;  4GIT A;  3I4Y A;  3SMP A;  3TE6 A;  5LMU M;  1ZV1 A;  3E21 A;  2R65 A;  2KXE A;  4JI6 M;  5ITX A;  4R71 A;  4PCZ A;  1W5S A;  1YSY A;  3KP1 E;  4I5S A;  4G4N A;  3TQS A;  2MJ5 B;  4LF5 M;  2LVO C;  1TTE A;  4OX9 M;  2CRU A;  3C58 A;  3VK8 A;  3GRY A;  3GP1 A;  4IBB A;  3U60 B;  2RRU A;  4X65 M;  3K9O A;  4LCB A;  4R7G A;  1HNX M;  2K9D A;  2FNA A;  2QSF X;  4MGK E;  4XGI A;  2YQZ A;  2VQE M;  3UGJ A;  3KSX A;  1XXH E;  2BWB A;  4BBA A;  3IG8 A;  3EIE A;  1EFU B;  3FTD A;  1W5T A;  1OKS A;  1T3T A;  3K92 A;  4Y28 F;  3FTC A;  5LMN M;  2KRU A;  4Z6Y A;  2EJS A;  1OFH A;  2E5L M;  1DGH A;  3HY5 A;  4CGY B;  3C9P A;  4A3V B;  4DV4 M;  4DR6 M;  1IXS A;  1HR0 M;  3LQR A;  3ILK A;  1GAB A;  1Z6T A;  3KSJ A;  5C1B A;  2UUC M;  1N36 M;  5JI3 E;  1GKI A;  3A45 A;  2Z3X A;  5BR8 M;  2ZM6 M;  1UFZ A;  3CTW B;  1GLN A;  4GH9 A;  3B7N A;  4MGZ E;  4JXJ A;  3GLI B;  1DO0 A;  4QOS A;  2VDB B;  1TF0 B;  4GMQ A;  5KPR A;  4M0D A;  1XHB A;  1IN5 A;  2ZAN A;  3C3E A;  4NXN M;  4KT0 F;  3GLF B;  4NXM M;  2XH9 A;  1PJS A;  5F3W A;  2LWX A;  1KSF X;  2C96 A;  4G4O A;  2F5N A;  4AI6 A;  4QNM A;  4B3M M;  2FOI C;  1XXH A;  1PJJ A;  2KRK A;  2DVW B;  2DZL A;  2RGH A;  3PFI A;  2UXB M;  4BLC A;  3L25 A;  3FKE A;  5ITY A;  1G71 A;  4ANR A;  3SAS A;  2DWZ B;  4WP2 A;  2LHC A;  1NSF A;  3AOG A;  3CF0 A;  1EIJ A;  3FUV A;  2UXC M;  1VEG A;  3BOS A;  1JR3 E;  2JZ1 A;  2EA0 A;  4LF4 M;  3UK6 A;  4ITQ A;  5E6J A;  2KHH A;  5JI2 E;  2YR0 A;  1V92 A;  1QQW A;  4RNA A;  4CIS A;  2DAM A;  2HAK A;  4JN6 A;  4JYA M;  1MX0 A;  3KXE C;  1MN3 A;  1VDL A;  2ERC A;  1ZMW A;  2ZTC A;  5E26 A;  3ZC7 B;  5EP4 A;  2GQF A;  1IN6 A;  1Q3B A;  1OIP A;  1QAN A;  1SXJ B;  4JI8 M;  4NRV A;  2XFS A;  1TR8 A;  2JY8 A;  5KQD A;  4FCV A;  3U6M A;  1VG5 A;  1T43 A;  1NV8 A;  1OTR A;  2J7N A;  2KZS A;  5KPT A;  1BVS A;  1WIV A;  5EP1 A;  1L1T A;  4OVZ A;  5FSW A;  4B7H A;  4DV1 M;  2BJV A;  3FD9 A;  4GC9 A;  4B08 A;  2Y0Q A;  3U6L A;  3U5Z A;  4KO8 A;  4GRI A;  1D0M A;  1Q3C A;  2QBY B;  3LVV A;  4LRS A;  4DV2 M;  1HQY E;  3FUW A;  1SXJ C;  4HEO A;  1MJG M;  4DR4 M;  3U6E A;  2OOB A;  3IEC A;  4QHT A;  2CE7 A;  4FWD A;  1PRB A;  1IN8 A;  2DKL A;  3FTE A;  4NSR A;  2CUZ A;  2F5O A;  1QYR A;  2DAK A;  4RF1 A;  1NJG A;  1PJQ A;  1JR3 A;  2KNV A;  2MGW A;  2DZO B;  3SYL A;  2EUC A;  2VQF M;  1C1K A;  2BNK A;  4UN2 B;  1IBL M;  3J81 S;  3Q8G A;  2RGO A;  3SYK A;  4RKU F;  2DHY A;  1AUA A;  5GKN A;  3NWL A;  2LVA A;  2J5Y A;  3J27 B;  4I4L A;  3RE8 A;  1E9S A;  4JI1 M;  3IG5 A;  2DNA A;  2R4E A;  3I4V A;  3TWL A;  3TWM A;  3ZH9 B;  2DI0 A;  4Q7J A;  2X49 A;  2CHG A;  2O01 F;  4NRW A;  2DZN B;  1C7Y A;  3GLG E;  3R9X B;  1DGF A;  2KA6 B;  2DHR A;  2UUB M;  4FCW A;  2R18 A;  1PGY A;  3CF6 E;  4P17 A;  3GRV A;  5DFL A;  3M0E A;  2R44 A;  5DNY A;  3H4M A;  3U6P A;  1Z59 A;  2G3Q A;  2F5S A;  3HZJ A;  1GJT A;  1T6O A;  2A5Y B;  2LBC A;  2LVN C;  2Q2E B;  2XFT A;  4JI4 M;  2L2D A;  4GHL A;  3CGW A;  3VFD A;  4AKH A;  1Z5A A;  4IBG A;  3UJN A;  1HT2 E;  3HGI A;  5FTL A;  2D7E A;  3FRI A;  3VLF B;  2V1C A;  4GC5 A;  4LF6 M;  2CEA A;  2Z8Y M;  4LG2 A;  3L2A A;  3T6P A;  4RF0 A;  3ZQJ A;  2OPF A;  1HT1 E;  2WSC F;  3KOX E;  2DWM A;  1R4G A;  4CJ6 A;  1Q39 A;  4D82 A;  3HJQ A;  1DV0 A;  1QUT A;  2Y20 A;  2L7H A;  4L16 A;  3GLI E;  1R2Z A;  2WSF F;  3GLG A;  2BJW A;  2D7G A;  1L2C A;  4DR1 M;  4FVM A;  5A2Q S;  1WR1 B;  3VK7 A;  2CV1 A;  4W5W A;  1IQP A;  4FW9 A;  4LF9 M;  3U60 A;  3E9S A;  4IJF A;  4IBF A;  2LHG A;  3FRH A;  3K9P A;  3AKZ A;  1IM2 A;  2G8L A;  4IBJ A;  3T1H M;  2CHQ A;  2XEP A;  4IJE A;  4FD2 A;  1WGL A;  2N35 A;  1G4A E;  2KNZ A;  1S3S A;  1TDH A;  3QYB A;  3U6C A;  2M5Z A;  4IBE A;  2L4F A;  2D7H A;  3RGP A;  3W68 A;  2Z4S A;  3C3D A;  4ZPX A;  5IT9 S;  1DGH B;  4DV3 M;  1QVR A;  3LQQ A;  4L8R C;  3B7Q A;  2ZAO A;  4B3R M;  4MB7 A;  2CV0 A;  3GLH E;  4CIZ A;  3MK6 A;  4K0K M;  1I4W A;  4F2L A;  4FCT A;  4JV5 M;  1KFV A;  1IXZ A;  4LY6 A;  4FWG A;  1V33 A;  5BPV A;  1J7K A;  1TH3 A;  3L26 A;  1SXJ E;  1NY5 A;  4JI0 M;  1E9R A;  3GPX A;  1H6U A;  5FTN A;  3TPZ A;  3GLI A;  2GNO A;  4G6Z A;  2HL7 A;  4DV5 M;  4AQY M;  2BWE A;  4GKJ M;  5ITT A;  3JAM S;  3SFZ A;  2HHH M;  4JI7 M;  2FFJ A;  3WHL A;  2ZTD A;  4DV6 M;  2ZBK B;  1PJT A;  1UM8 A;  1GO5 A;  2O5R A;  2VF8 A;  2KDL A;  4DV7 M;  1IY0 A;  2QZ4 A;  2L6O A;  2XZU A;  1R2Y A;  3GO8 A;  1GL6 A;  3HWS A;  4X64 M;  3E46 A;  3KS8 A;  2XSZ A;  1QDR A;  1TDZ A;  3TWK A;  3DOA A;  1TGU A;  1L8Q A;  4CHT B; 
#chains in the Genus database with same CATH homology
 2C98 A;  3QAU A;  4X62 M;  2F5Q A;  1L2D A;  3GLH A;  3HHY A;  4NOO B;  3DZD A;  3JR4 A;  4DR7 M;  4AKG A;  2CFO A;  5EXX A;  1ZQ9 A;  1IBK M;  3KP0 E;  4MH0 E;  1IBM M;  3KDS E;  1SXJ A;  4JI5 M;  1QAO A;  2R4J A;  3D8L A;  4EIW A;  2CV2 A;  3U61 A;  2C9O A;  4DUY M;  4AZF A;  4YY3 M;  3HJS A;  5ITU A;  2I7N A;  2QBY A;  2RKO A;  5ITQ A;  3FYC A;  2VII A;  2YFQ A;  4OW0 A;  1NHW C;  3D8B A;  2HKJ A;  1K82 A;  4LJ6 A;  4B7G A;  4BB9 A;  4D81 A;  4NL4 H;  2C9C A;  5EXP A;  1N34 M;  2H1R A;  1IN4 A;  3PNY A;  3T1Y M;  4M9X A;  3U6Q A;  2XLJ A;  1ORY B;  5FTK A;  5IRE B;  3U6S A;  2JA2 A;  5FLX S;  4GKK M;  1YE9 A;  1L1Z A;  2Z7J A;  1NNU C;  1FJG M;  3LVW A;  4LJ9 A;  4LFA M;  4GIP A;  4MGI E;  4WW0 A;  3T38 A;  3UZU A;  2LNH C;  2R46 A;  3AOE C;  4M9Z A;  3KS4 A;  4I8O A;  2I7P A;  4LGM A;  1WXQ A;  3SAW A;  1PM5 A;  3FTF A;  1XNR M;  4LF7 M;  3J7B A;  1XNQ M;  2DWN A;  2HCB A;  2QEN A;  2V1U A;  3SAT A;  5EQT A;  3EIH A;  1NHG C;  4LJA A;  4LJ7 A;  1XWI A;  4DV0 M;  2EO2 A;  3THG A;  1Z5C A;  1K3X A;  3L27 A;  3JR5 A;  2J7O A;  3J2P B;  3TL4 X;  3U6O A;  3OTO M;  4B3T M;  1OJL A;  2XSZ D;  4M0W A;  2Y21 A;  3A46 A;  4QNR A;  4HL4 A;  3ZCB B;  3B9P A;  3RFW A;  5IZ7 D;  3SHG B;  5IWA M;  1TH4 A;  2P5T A;  4L78 A;  4PDI A;  4KLN A;  4REZ A;  1Z5B A;  2YNM D;  1DGB A;  1XC8 A;  2C99 A;  3U6D A;  2R45 A;  4WUR A;  2G5G X;  1GL7 A;  3GPU A;  1QAQ A;  2QCU A;  3PXG A;  3DFZ A;  3WHK A;  5C18 A;  1R6B X;  5H37 D;  3L28 A;  1KYI A;  3SMS A;  3GLG B;  1E94 E;  4P16 A;  4AW4 A;  3UMM A;  4IIW A;  4LZZ A;  3T15 A;  3SC3 A;  5DYG A;  1NVM A;  1JR3 D;  4FWH A;  2XZF A;  4LRT A;  3VKG A;  4DR3 M;  7CAT A;  2KW0 A;  3Q8X A;  4I81 A;  4IBI A;  5EP3 A;  4S12 A;  3GPP A;  1IXS B;  3K2L A;  3HU3 A;  4L15 A;  4B7F A;  4HLQ A;  3GPY A;  5ITR A;  3GRU A;  1QZM A;  4X66 M;  5EXS A;  4IBK A;  1QAM A;  1GVN A;  5KQ8 A;  2W82 A;  3KOY E;  3SAV A;  4M9S A;  4KOD A;  3GLF A;  4G4Q A;  1YUB A;  4II7 A;  4L4U A;  3MJ5 A;  4AKI A;  2LH0 A;  1E32 A;  1DGG A;  3W0L B;  2X4A A;  2L09 A;  2DWL A;  3GQ5 A;  2UUA M;  2KEB A;  2UXD M;  1XXH B;  1X37 A;  2V6Z M;  4LZJ A;  3LMM A;  1N33 M;  2F4V M;  5EJC A;  2QPA A;  1VDD A;  4QOZ C;  4D80 A;  4OU7 A;  4G4R A;  3A42 A;  1NJF A;  1G59 A;  4MM3 B;  4R3D A;  2FE8 A;  1MU5 A;  3W0F A;  4Z8X A;  2Z4R A;  2Y0T A;  1FNN A;  4DUZ M;  4TUW A;  5EXT A;  3K1J A;  3SAU A;  2C5R A;  1N77 A;  4LGY A;  4YHH M;  4LFC M;  1LV7 A;  5KPZ A;  2F5P A;  4XBO A;  2UU9 M;  3DA1 A;  2ZAM A;  3GLH B;  3KOZ E;  8CAT A;  1ZAE A;  3FUU A;  4OVZ B;  1DO2 A;  3U5Z B;  5DYI A;  3PVS A;  3MHV C;  4PD2 A;  1IY2 A;  5FTM A;  3M6A A;  3GQ3 A;  1TH2 A;  3HJ8 A;  3HU2 A;  3K8Z A;  3M7G A;  4MGY E;  3U61 B;  1XMQ M;  3FUT A;  3E4R A;  1D2N A;  3FYD A;  1PJI A;  4PDG A;  4GHA A;  3QWL A;  5FTJ A;  1G3I A;  3NBI A;  3HHW A;  3AL0 C;  3PNV A;  3KVW A;  3HHX A;  2K47 A;  3VDP A;  3KOW E;  4QHS A;  1G8P A;  4NSO B;  3GQ4 A;  2QP9 X;  3HKP A;  1OFI A;  3SBJ A;  3R8F A;  3AOE A;  1NNJ A;  4LJ5 A;  4LJ4 A;  3L29 A;  4DR5 M;  1K3W A;  1HNW M;  4KHP M;  4AG6 A;  2L7I A;  4IBD A;  3J7A S;  5ITX E;  3HU1 A;  2X8A A;  3KFU G;  2R62 A;  3CF2 A;  1HQC A;  2XGN A;  1J5E M;  3AV0 A;  2LXE A;  3AFH A;  2DXI A;  4B3S M;  2M60 A;  3SHF A;  1XMO M;  2AHM A;  3I51 A;  2NQ8 C;  1R7R A;  1G41 A;  1L2B A;  4JI3 M;  3KW6 A;  1N75 A;  1HNZ M;  4MGH A;  3VDU A;  2OQ4 A;  4AG5 A;  2XF3 A;  3SAR A;  4PT5 A;  4DR2 M;  2CHV A;  5EP2 A;  1IY1 A;  1J09 A;  1NY6 A;  3FUX A;  5KO3 A;  2KZU A;  4LF8 M;  3VKH A;  3AJI B;  4LJ8 A;  1N32 M;  3A98 B;  3HHZ A;  3RGS A;  3J80 S;  1JQJ C;  1I94 M;  4LFB M;  1IXR C;  1EE8 A;  1SXJ D;  1IN7 A;  4IBC A;  4JI2 M;  3GRR A;  4GIT A;  3I4Y A;  3SMP A;  3TE6 A;  5LMU M;  2R65 A;  2KXE A;  4JI6 M;  5ITX A;  4PCZ A;  1W5S A;  1YSY A;  3KP1 E;  4I5S A;  4G4N A;  3TQS A;  4LF5 M;  4OX9 M;  3C58 A;  3VK8 A;  3GRY A;  3GP1 A;  4IBB A;  3U60 B;  4X65 M;  4LCB A;  4R7G A;  1HNX M;  4MGK E;  2FNA A;  2VQE M;  4XGI A;  2YQZ A;  3UGJ A;  3KSX A;  4BBA A;  3IG8 A;  3EIE A;  3FTD A;  3K92 A;  1W5T A;  1T3T A;  5LMN M;  3FTC A;  2KRU A;  4Z6Y A;  1OFH A;  2E5L M;  1DGH A;  4CGY B;  4A3V B;  4DV4 M;  4DR6 M;  1HR0 M;  3LQR A;  3ILK A;  1Z6T A;  3KSJ A;  5C1B A;  2UUC M;  1N36 M;  5JI3 E;  1GKI A;  3A45 A;  2Z3X A;  5BR8 M;  2ZM6 M;  3CTW B;  1GLN A;  4GH9 A;  4MGZ E;  4JXJ A;  3GLI B;  1DO0 A;  4QOS A;  5KPR A;  4GMQ A;  4M0D A;  1XHB A;  1IN5 A;  2ZAN A;  4NXN M;  3GLF B;  4NXM M;  2XH9 A;  5F3W A;  2LWX A;  1KSF X;  2C96 A;  4G4O A;  2F5N A;  4AI6 A;  4QNM A;  4B3M M;  2FOI C;  1XXH A;  1PJJ A;  2KRK A;  2DVW B;  2RGH A;  3PFI A;  2UXB M;  4BLC A;  3L25 A;  3FKE A;  5ITY A;  3SAS A;  2DWZ B;  1NSF A;  3AOG A;  3CF0 A;  3FUV A;  2UXC M;  3BOS A;  2EA0 A;  4LF4 M;  3UK6 A;  4ITQ A;  5E6J A;  5JI2 E;  2YR0 A;  1QQW A;  4RNA A;  4CIS A;  4JN6 A;  4JYA M;  1MX0 A;  3KXE C;  2ERC A;  5E26 A;  3ZC7 B;  4JI8 M;  5EP4 A;  1IN6 A;  1Q3B A;  1QAN A;  1SXJ B;  4NRV A;  2XFS A;  5KQD A;  4FCV A;  3U6M A;  2J7N A;  2KZS A;  5KPT A;  5EP1 A;  1L1T A;  4OVZ A;  5FSW A;  4B7H A;  4DV1 M;  2BJV A;  3FD9 A;  4GC9 A;  4B08 A;  2Y0Q A;  3U6L A;  3U5Z A;  4KO8 A;  4GRI A;  1Q3C A;  2QBY B;  3LVV A;  4LRS A;  4DV2 M;  1HQY E;  3FUW A;  1SXJ C;  4DR4 M;  3U6E A;  4QHT A;  2CE7 A;  4FWD A;  1IN8 A;  3FTE A;  4NSR A;  2CUZ A;  2F5O A;  1QYR A;  4RF1 A;  1NJG A;  3SYL A;  1JR3 A;  1TDZ A;  2DZO B;  2VQF M;  2EUC A;  1C1K A;  2BNK A;  1IBL M;  3J81 S;  2RGO A;  3SYK A;  5GKN A;  3NWL A;  3J27 B;  4I4L A;  3RE8 A;  4JI1 M;  1E9S A;  1N78 A;  3IG5 A;  2R4E A;  3I4V A;  3TWL A;  3TWM A;  3ZH9 B;  2X49 A;  2CHG A;  4NRW A;  2DZN B;  3R9X B;  1DGF A;  2KA6 B;  2DHR A;  2UUB M;  4FCW A;  2R18 A;  3CF6 E;  3GRV A;  3M0E A;  3U6P A;  5DNY A;  3H4M A;  2F5S A;  1Z59 A;  2A5Y B;  2Q2E B;  2XFT A;  4JI4 M;  4GHL A;  3VFD A;  4AKH A;  1Z5A A;  4IBG A;  3UJN A;  1HT2 E;  3HGI A;  5FTL A;  2D7E A;  3VLF B;  2V1C A;  4GC5 A;  4LF6 M;  2CEA A;  4LG2 A;  3L2A A;  4RF0 A;  2OPF A;  1HT1 E;  3KOX E;  2DWM A;  1Q39 A;  4D82 A;  3HJQ A;  2Y20 A;  2L7H A;  4L16 A;  1R2Z A;  3GLG A;  2BJW A;  2D7G A;  1L2C A;  4DR1 M;  4FVM A;  5A2Q S;  3VK7 A;  2CV1 A;  4W5W A;  1IQP A;  4FW9 A;  4LF9 M;  3U60 A;  3E9S A;  4IJF A;  4IBF A;  3T1H M;  3AKZ A;  1IM2 A;  2G8L A;  4IBJ A;  2CHQ A;  2XEP A;  4IJE A;  4FD2 A;  1G4A E;  1S3S A;  1TDH A;  3U6C A;  2M5Z A;  4IBE A;  2D7H A;  3RGP A;  2Z4S A;  4ZPX A;  5IT9 S;  1DGH B;  4DV3 M;  1QVR A;  3LQQ A;  4L8R C;  2ZAO A;  4B3R M;  4MB7 A;  2CV0 A;  4K0K M;  3MK6 A;  1I4W A;  4JV5 M;  4FCT A;  1KFV A;  1IXZ A;  4LY6 A;  4FWG A;  5BPV A;  1J7K A;  1TH3 A;  3L26 A;  1SXJ E;  1NY5 A;  4JI0 M;  1E9R A;  3GPX A;  1H6U A;  5FTN A;  3TPZ A;  3GLI A;  4G6Z A;  2HL7 A;  4DV5 M;  4AQY M;  4GKJ M;  5ITT A;  3JAM S;  3SFZ A;  2HHH M;  4JI7 M;  2FFJ A;  3WHL A;  4DV6 M;  2ZBK B;  1UM8 A;  2O5R A;  4DV7 M;  1IY0 A;  2QZ4 A;  2L6O A;  2XZU A;  1R2Y A;  3GO8 A;  1GL6 A;  3HWS A;  4X64 M;  3KS8 A;  2XSZ A;  3TWK A;  3DOA A;  1TGU A;  1L8Q A;  4CHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...