2DVWB

Structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
73
structure length
73
Chain Sequence
b'MDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 26S proteasome non-ATPase regulatory subunit 10
publication title Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/protein-binding
total genus 27
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2dvwB00
5EP2A 2DZOB 5DYIA 1QZMA 2C9OA 1UM8A 2VIIA 4L4UA 4LZZA 4LJ5A 3U5ZB 4L16A 2X8AA 1SXJE 4KO8A 2QBYA 1OFIA 4FD2A 2KRKA 3SC3A 4KLNA 4FCVA 4QNRA 1D2NA 3K1JA 1OFHA 5FTMA 5FTJA 1OJLA 3D8BA 3EIHA 2ZAMA 4QNMA 2R62A 2V1UA 1IQPA 4FW9A 3VLFB 3CF0A 5EXPA 4ZPXA 1SXJB 5EQTA 1HT1E 2C98A 2ZANA 3GLHB 5C1BA 1C1KA 3SYLA 2CEAA 1S3SA 4LY6A 2BJWA 3GLFB 1NY6A 4I4LA 5EXSA 3BOSA 3AJIB 1HT2E 3DZDA 4LJAA 5FTLA 2Z4SA 3UK6A 4LJ6A 1JR3A 3GLGB 3M0EA 1DO0A 1W5SA 3KDSE 1NVMA 1KYIA 1XXHB 1IY0A 5FTKA 4LCBA 1L8QA 3SYKA 2QENA 1IN4A 2CHVA 3VFDA 1DO2A 2RKOA 1SXJA 5DYGA 5EP4A 3MHVC 2CHQA 3WHKA 1IN7A 3GLHA 3GLIB 2HCBA 1JR3D 2QZ4A 4D82A 1G4AE 4D80A 1NJFA 4LJ7A 3HU1A 1LV7A 1X37A 2XSZA 1JQJC 3B9PA 2CE7A 4FCTA 4LJ8A 5EXTA 3U61B 3GLFA 1E94E 2C96A 1NSFA 1R7RA 3CF2A 1W5TA 4D81A 3PXGA 1IXRC 3PFIA 1SXJD 1E32A 4I81A 3GLGA 2ZAOA 3WHLA 5JI2E 4LRTA 3R8FA 2XSZD 1IN5A 1IXZA 1IY1A 1J7KA 3HU2A 1NY5A 2C9CA 4FWHA 5JI3E 4WW0A 1IN8A 5C18A 2CHGA 1FNNA 1QVRA 3KW6A 3M6AA 3GLIA 3U60B 2C99A 1HQCA 2Z4RA 4QHSA 5EP1A 2DZNB 4FWGA 2BJVA 2R65A 1G41A 3HWSA 1KSFX 3PVSA 5EP3A 2DVWB 2QP9X 4JN6A 1IN6A 4GITA 3ZH9B 2DWZB 4FCWA 3H4MA 4QOSA 1XXHA 4LJ4A 1IM2A 4A3VB 4FWDA 2QBYB 1IXSB 4KODA 4LJ9A 2FNAA 4Z8XA 4LRSA 1R6BX 4EIWA 2DHRA 1G3IA 5FTNA 4L15A 2QPAA 5EXXA 1SXJC 1IY2A 1NJGA 1XWIA 2V6ZM 3EIEA 4LGMA 3HU3A 4QHTA 1HQYE
chains in the Genus database with same CATH superfamily
2R18A 2KXEA 2EKFA 3FD9A 3TL4X 2GNOA 2DZOB 1T6OA 1N36M 1QZMA 4P17A 4L4UA 5IZ7D 2M5ZA 1L2DA 3GQ4A 4L16A 2X8AA 1SXJE 2DWMA 3Q8GA 1IXSA 4AKIA 2XZFA 4OW0A 3VDUA 5A2QS 1QDRA 4FCVA 3GPPA 4JI8M 1D2NA 4F2LA 5BPVA 3A42A 3EIHA 1V92A 1I94M 1IQPA 1R4GA 3J80S 2N35A 3FKEA 4LGYA 4XBOA 5EXPA 3VLFB 2DXIA 1SXJB 2P5TA 4GRIA 2KRUA 4AW4A 2C98A 2FH0A 3GQ5A 3HJSA 5IREB 3HY5A 4HEOA 1V33A 1D0MA 1S3SA 3FUVA 1VEGA 2BJWA 4OVZA 4IJFA 4B7HA 3KOYE 3LCUA 4PCZA 3TPZA 4WP2A 1OQYA 3BOSA 5EXSA 3U5ZA 5FTLA 3J7AS 1DGHA 1MX0A 3L2AA 4R7GA 3UK6A 5ITRA 3AOGA 3KDSE 3QAUA 2QNJA 4AG5A 1KYIA 1XMQM 3IG8A 4NC6A 3FTEA 1ZMVA 3U6MA 4MM3B 1VDDA 1N77A 2JY7A 3SYKA 2QENA 2E5LM 1IN4A 3SAVA 1DGBA 1EFUB 4LZJA 2L4EA 4AKHA 5DYGA 5EP4A 1ORYB 2QHOB 3KXEC 3MHVC 4JXJA 1YE9A 2CWBA 2HCBA 2Z7JA 1GLNA 3GLHA 1G4AE 1Q39A 1ZQ9A 2X4AA 4GHLA 3HU1A 1LV7A 1X37A 2JY5A 4MGKE 3U61B 3B7QA 1G71A 3LVWA 1NSFA 1R7RA 3MMPA 4CIZA 4YY3M 1W5TA 3FTDA 3JR5A 4GHAA 3C3DA 2JWSA 3OTOM 1PRBA 3K2LA 1V34A 3UMMA 2LXEA 3GP1A 2Q2EB 3DFZA 3JR4A 4NL4H 3U6EA 2R4EA 3AOEA 3GO8A 1VDLA 1NO1A 4HL4A 1OIPA 1TH3A 2C9CA 4FWHA 1IN8A 1FNNA 3M6AA 3KW6A 4OU7A 3GLIA 1Q02A 2KHHA 2JY8A 4JI0M 3A98B 3HHYA 5EP1A 2R46A 4G6ZA 3HJQA 3GQ3A 2APLA 1TTEA 2F5OA 3LW5F 4NSOB 3I01M 2K47A 4RNAA 3V76A 3C58A 1QDTA 1GJTA 4YHHM 2Y21A 1PJQA 1QYRA 2JY6B 5F3WA 3FUWA 2KZUA 2WZJA 1YSYA 2H5XA 3SAWA 2L7IA 3H4MA 4QOSA 2L4FA 4REZA 5LMNM 1IXSB 2A5YB 3R9XB 5E26A 8CATA 4AQYM 3QYEA 4LF5M 4IBKA 4DR3M 1DGFA 1HJPA 4IBJA 1PJSA 3E4RA 1QUTA 1IY2A 2Y0QA 1N75A 2LWXA 2MH8A 3FE3A 4QHTA 2R44A 1HQYE 2CV2A 4OVZB 5DYIA 2VIIA 1XMOM 2W82A 4LZZA 3U5ZB 1E9RA 2MGWA 4MGYE 4GKKM 1DGHB 3ZQJA 1OFIA 1H6UA 2KRKA 4FD2A 5LMUM 4S12A 1E9SA 3GLHE 2F5NA 2BNKA 2DHYA 2FS1A 4XGIA 2XEPA 5FTMA 5FTJA 3AOEC 2I7PA 1VQ1A 1RU3A 3D8BA 3L27A 2ZAMA 3HHXA 2R62A 4QNMA 2FE8A 5H37D 1T3TA 2KA6B 3KP1E 2DZLA 3I04M 5L8RF 3B7ZA 3E46A 4ZPXA 4NOOB 3AKZA 2HKJA 3DA1A 3CGWA 3TQSA 5C1BA 3B74A 2ZANA 1Z5BA 2LVOC 3GLHB 3NBIA 2UUCM 1TH2A 3SYLA 4PD2A 4LY6A 4PDGA 2D7HA 2RGHA 2DENA 2VDBB 3TWLA 3SAUA 3UJNA 2DI0A 3HGIA 1UFZA 1ZAEA 2DAGA 3E21A 4LJ6A 1EE8A 1JR3A 3VKHA 3M0EA 3GLIE 1G8PA 4L8RC 2LBCA 4QOZC 1L1TA 3F92A 3VK7A 1L2BA 2JXNA 4LCBA 1NHGC 3KVWA 5KPZA 2OOAA 2V1CA 2CHVA 2CRUA 4JYAM 2RKOA 3LQQA 3FUTA 2CHQA 1TDHA 2LHGA 1IN7A 3GLIB 2VQEM 2UXBM 1JR3D 2LNHC 1YLAA 1NJFA 4GKJM 4LJ7A 3FUUA 4FCTA 1IBLM 5ITQA 2CE7A 2AHMA 1NNJA 2JZ0A 3GLFA 3IG5A 2KNAA 3UZUA 2OQ4A 4D81A 2KNZA 5DNYA 1BVSA 3FRHA 1XNRM 4I81A 5BR8M 4OX9M 3K9OA 3WHLA 3AV0A 1SG9A 2CUZA 3UGJA 4X64M 4LRTA 4LF4M 2D7GA 2EO2A 3KOWE 4B7GA 1IN5A 1IXZA 2XH9A 2VQFM 4NXMM 2MR9A 1J7KA 3HU2A 1KFVA 2F4VM 1NY5A 5JI3E 1TGUA 4WW0A 5C18A 3Q8XA 1TF0B 2J7OA 4AZFA 1ZMUA 3KOXE 1TDZA 1ZMWA 2LTUA 1NHWC 4FWGA 1G59A 4JI4M 3SBJA 1OIZA 2Z8YM 4JI6M 3IHPA 4DUYM 3TWKA 3HWSA 2JUJA 3A45A 3RGPA 5EJCA 1KSFX 2RRUA 4PDIA 3U6LA 2KNVA 4JI1M 2DAMA 5EP3A 3T15A 1IN6A 1OAOC 3ZH9B 2DWZB 2O01F 4B08A 5DFLA 4PT5A 4LFAM 4DR6M 1IM2A 4BBAA 1D0LA 3T1HM 2LVPC 4LJ9A 4KODA 4MGHA 4LRSA 4GMQA 1R6BX 4EIWA 2XLJA 2R4JA 2KDLA 1NV9A 2WSEF 4IBCA 3U60A 5FLXS 2J5YA 2RGOA 4IBIA 2L2DA 2HAKA 4IBBA 5EXXA 4LF7M 3C3EA 4II7A 1NJGA 1K3WA 2JP7A 3PNYA 3HJ8A 1JR3E 1QZEA 3EIEA 4Y28F 2UUBM 5ITXA 4HLQA 2BWBA 3SFZA 1WGLA 2KEBA 3ILKA 4IBDA 3U6CA 2CFOA 4CHTB 2UU9M 4LJ5A 2ZBKB 3AL0C 4KO8A 2QBYA 2XF3A 2K0BX 1Z5CA 3H4JA 3NWLA 1J5EM 2JA2A 4TUWA 4QNRA 1OAIA 1I4WA 3L26A 3QWLA 1C7YA 2G5GX 4DR1M 4G4RA 4L78A 3GLFE 2XGNA 1R2YA 2V1UA 1ZV1A 3SATA 4KHPM 4FW9A 3SMPA 2EUCA 1XB2B 1T43A 4FVMA 1K3XA 2DWNA 2FFJA 3J27B 2I7NA 1HT1E 3FTFA 3DOAA 1PGYA 2Y20A 1NV8A 1XXHE 2CEAA 4GIPA 5ITTA 3SARA 2L6OA 2OO9A 3KS8A 3GLFB 1GL6A 3B89A 1WHCA 4I4LA 2XFTA 3KSXA 3DZDA 3AJIB 2F5SA 3K8ZA 2Z4SA 2QSFX 3J81S 2GQFA 1Z59A 3T38A 1XXHB 3J7BA 4GC5A 5FTKA 4B3TM 1L8QA 4F1IA 4LF8M 4DR7M 1HNWM 3QYBA 3VFDA 2YFQA 1DO2A 1IBMM 2EA0A 1PJTA 3WHKA 3MK6A 1N33M 3GPXA 4D80A 3B9PA 5EXTA 3E9SA 3FRIA 2C96A 2B3TA 3I51A 4NRWA 2HWJA 3C9PA 4M0WA 4L6V6 4R71A 1DV0A 2L09A 3FYDA 1E32A 3GLGA 3L25A 2O25A 4DV5M 2ZAOA 1WR1B 1PJIA 2HHHM 2LVAA 4JI2M 1IY1A 5KQ8A 3U6PA 1YUBA 3NBXX 2VF7A 4LFCM 2D7EA 3AFHA 2XFSA 2DAEA 4GH9A 4ITQA 1XC8A 1MU5A 3U60B 3SASA 5ITXE 2C99A 4DV7M 1HQCA 4LF9M 2Z4RA 1QUSA 2DZNB 1HNZM 4DV6M 1OKSA 3KSJA 3ZC7B 2Y0TA 3HZJA 2BJVA 2DAKA 1G41A 1VEKA 3GPYA 2G8LA 3W68A 1VEJA 4LFBM 2DVWB 4G4QA 2UXCM 3JAMS 4M9SA 1HR0M 4FCWA 2MROB 3GRVA 1XXHA 4LJ4A 4A3VB 1K82A 3IECA 4FWDA 2QBYB 2J7NA 3ZCBB 4RF0A 1GO5A 4B3MM 2FNAA 4IBGA 4Z8XA 4X65M 1FJGM 4DV2M 1R5LA 4M0DA 1Y8GA 2DHRA 3TWMA 4DR2M 5KO3A 3BXWA 1L1ZA 5FTNA 4IIWA 4CJ6A 4IBEA 1TR8A 2OOBA 3THGA 4X66M 1XWIA 2NQ8C 5KQDA 1JB0F 2CV1A 3RFWA 2UUAM 4M9XA 3K9PA 2MJ5B 4LGMA 4GEWA 3BBZA 1R2ZA 4JI7M 5EP2A 1J09A 3FUXA 3TE6A 2F5QA 3K92A 4LF6M 2LVQD 1GL7A 2C9OA 3KFUG 1UM8A 3SHGB 1F4IA 1Q3BA 1GJSA 4NRVA 3T1YM 3VKGA 1QAMA 4I5SA 1GKIA 3I4VA 4W5WA 2YQZA 2WSFF 2DAIA 3SC3A 4KLNA 4BB9A 4X62M 1A5TA 1N34M 2YR0A 1WXQA 3K1JA 1OFHA 3GPUA 1QQWA 4DR4M 1OJLA 1Z6TA 3RGSA 1N32M 3W67A 2DKLA 3CF0A 1PM5A 3GRRA 3SHFA 2ZTCA 3J2PB 5EQTA 2Z3XA 1XHBA 3GLGE 3D8LA 1XNQM 5ITUA 2LHCA 3W0FA 2CP8A 5GKNA 1C1KA 5FSWA 2ERCA 5KPTA 2DNAA 4AKGA 1GABA 2G3QA 3B7NA 4GC9A 1NY6A 3CTWB 3U6SA 1HT2E 4LJAA 1P3QQ 3HHZA 3HHWA 3GRUA 4MB7A 3GLGB 7CATA 4KT0F 1DO0A 1W5SA 4B3SM 3HX3A 1NVMA 1IY0A 1WIVA 1L2CA 2QCUA 3U6OA 1N78A 4I8OA 3RE8A 2R45A 1D0KA 1QANA 1SXJA 1WJ7A 3LVVA 4K0KM 4JI5M 2LH0A 1IFYA 1WGNA 4P16A 2QZ4A 4D82A 2EJSA 4LJ8A 1MJGM 1QAQA 2XSZA 1JQJC 5E6JA 2WSCF 2C5RA 3M7GA 3W0LB 1E94E 4RKUF 4DR5M 3VK8A 1AUAA 3CF2A 4B7FA 4DV3M 3U6QA 1TH4A 3PXGA 5KPRA 1IXRC 4LG2A 2K9DA 3LQRA 3PFIA 1SXJD 1DGGA 2EKKA 4B3RM 3LMMA 3T6PA 2H1RA 5JI2E 3R8FA 3I4YA 2XSZD 4DUZM 1PJJA 2HL7A 3LCVB 4NXNM 2JZ1A 3KOZE 1CUKA 1VG5A 2CHGA 1QVRA 4MGZE 2DWLA 3KS4A 4G3OA 4JI3M 4G4NA 3L28A 2QQ8A 4QHSA 2O5RA 3U61A 4MH0E 2UXDM 1Z5AA 4R3DA 2OPFA 2JNHA 2K6BA 2FOIC 1LTMA 2R65A 4IJEA 1NNUC 3VDPA 4AG6A 3PVSA 3FTCA 4MGIE 4BLCA 1GVNA 1AIPC 1Q3CA 1IBKM 1HNXM 4ANRA 2QP9X 3FYCA 4JN6A 2BWEA 1MN3A 1OTRA 4GITA 2ZM6M 4DV0M 1QAOA 2VF8A 4XK8F 3A46A 4DV1M 3SMSA 5IT9S 2CV0A 2M60A 3L29A 5ITYA 2F5PA 3HKPA 4Q7JA 5IWAM 3GRYA 1EIJA 2YNMD 2KZSA 2R0IA 3CF6E 4WURA 4JV5M 2ZTDA 2KW0A 3PNVA 4AI6A 1G3IA 4UN2B 2L7HA 3U6DA 3MJ5A 2X49A 4NSRA 4DV4M 4L15A 2R6FA 2QPAA 2XZUA 4M9ZA 2LVNC 1SXJC 4CGYB 2V6ZM 4CISA 4DBGB 3KP0E 4G4OA 3HU3A 4RF1A 4Z6YA 4IBFA
chains in the Genus database with same CATH topology
2R18A 2KXEA 3FD9A 3TL4X 1N36M 2DZOB 1QZMA 4L4UA 5IZ7D 2M5ZA 1L2DA 3GQ4A 4L16A 2X8AA 1SXJE 2DWMA 4AKIA 2XZFA 4OW0A 3VDUA 5A2QS 4FCVA 3GPPA 4JI8M 1D2NA 5BPVA 3A42A 3EIHA 1I94M 1IQPA 3J80S 3VLFB 3FKEA 4LGYA 4XBOA 5EXPA 2DXIA 1SXJB 2P5TA 4GRIA 2KRUA 4AW4A 2C98A 3GQ5A 3HJSA 5IREB 1S3SA 3FUVA 4OVZA 2BJWA 4IJFA 4B7HA 3KOYE 4PCZA 3TPZA 5EXSA 3BOSA 3U5ZA 5FTLA 3J7AS 1DGHA 1MX0A 3L2AA 4R7GA 3UK6A 5ITRA 3AOGA 3KDSE 3QAUA 4AG5A 1XMQM 1KYIA 3IG8A 3FTEA 3U6MA 4MM3B 1VDDA 1N77A 3SYKA 2QENA 2E5LM 1IN4A 3SAVA 1DGBA 4LZJA 4AKHA 5DYGA 5EP4A 1ORYB 3KXEC 3MHVC 4JXJA 1YE9A 3GLHA 2HCBA 2Z7JA 1GLNA 4GHLA 1G4AE 1Q39A 1ZQ9A 2X4AA 3HU1A 1LV7A 1X37A 4MGKE 3U61B 3LVWA 1NSFA 1R7RA 4YY3M 3JR5A 4GHAA 1W5TA 3FTDA 3OTOM 3K2LA 3UMMA 2LXEA 3GP1A 2Q2EB 3DFZA 3JR4A 4NL4H 3U6EA 2R4EA 3AOEA 3GO8A 4HL4A 1TH3A 2C9CA 4FWHA 1IN8A 1FNNA 3M6AA 3KW6A 4OU7A 3GLIA 4JI0M 3A98B 3HHYA 5EP1A 2R46A 4G6ZA 3HJQA 3GQ3A 2F5OA 4NSOB 2K47A 4RNAA 3C58A 4YHHM 5F3WA 2Y21A 1QYRA 3FUWA 2KZUA 1YSYA 3SAWA 2L7IA 3H4MA 4QOSA 4REZA 5LMNM 1IXSB 2A5YB 3R9XB 5E26A 8CATA 4AQYM 4LF5M 4IBKA 4DR3M 1DGFA 4IBJA 3E4RA 1IY2A 2Y0QA 1N75A 2LWXA 4QHTA 1HQYE 2CV2A 4OVZB 5DYIA 2VIIA 1XMOM 2W82A 4LZZA 3U5ZB 1E9RA 4MGYE 4GKKM 1DGHB 1OFIA 1H6UA 2KRKA 4FD2A 5LMUM 4S12A 1E9SA 2F5NA 2BNKA 4XGIA 2XEPA 5FTMA 5FTJA 3AOEC 2I7PA 3L27A 3D8BA 4LF8M 2ZAMA 3HHXA 2R62A 4QNMA 2FE8A 5H37D 1T3TA 2KA6B 3KP1E 4ZPXA 4NOOB 3AKZA 2HKJA 3DA1A 3TQSA 5C1BA 2ZANA 1Z5BA 3GLHB 3NBIA 2UUCM 1TH2A 3SYLA 4PD2A 4LY6A 4PDGA 2D7HA 2RGHA 3TWLA 3SAUA 3UJNA 3HGIA 1ZAEA 4LJ6A 1EE8A 1JR3A 3VKHA 3M0EA 1G8PA 4L8RC 4QOZC 1L1TA 1L2BA 3VK7A 4LCBA 1NHGC 3KVWA 5KPZA 2V1CA 2CHVA 4JYAM 2RKOA 3LQQA 3FUTA 2CHQA 1TDHA 1IN7A 3GLIB 2VQEM 2UXBM 1JR3D 2LNHC 1NJFA 4GKJM 4LJ7A 3FUUA 4FCTA 1IBLM 5ITQA 2CE7A 2AHMA 1NNJA 3GLFA 3IG5A 3UZUA 2OQ4A 4D81A 5DNYA 1XNRM 4I81A 5BR8M 4OX9M 3WHLA 3AV0A 2CUZA 3UGJA 4X64M 4LRTA 4LF4M 2D7GA 2EO2A 3KOWE 4B7GA 1IN5A 1IXZA 2XH9A 2VQFM 4NXMM 1J7KA 3HU2A 1KFVA 2F4VM 1NY5A 5JI3E 1TGUA 4WW0A 5C18A 3Q8XA 2J7OA 4AZFA 3KOXE 1TDZA 1NHWC 4FWGA 1G59A 4JI4M 3SBJA 4JI6M 4DUYM 3TWKA 3HWSA 3A45A 3RGPA 4PDIA 5EJCA 1KSFX 3U6LA 4JI1M 5EP3A 3T15A 1IN6A 3ZH9B 2DWZB 4B08A 4PT5A 4LFAM 4DR6M 1IM2A 4BBAA 3T1HM 4LJ9A 4KODA 4MGHA 4LRSA 4GMQA 1R6BX 4EIWA 2XLJA 2R4JA 4IBCA 3U60A 5FLXS 2RGOA 4IBIA 4IBBA 5EXXA 4LF7M 4II7A 1K3WA 1NJGA 3PNYA 3HJ8A 3EIEA 2UUBM 5ITXA 4HLQA 3SFZA 2KEBA 3ILKA 4IBDA 3U6CA 2CFOA 4CHTB 2UU9M 4LJ5A 2ZBKB 3AL0C 4KO8A 2QBYA 2XF3A 1Z5CA 3NWLA 1J5EM 2JA2A 4TUWA 4QNRA 1I4WA 3L26A 3QWLA 2G5GX 4DR1M 4G4RA 4L78A 2V1UA 2XGNA 1R2YA 3SATA 4KHPM 4FW9A 3SMPA 2EUCA 4FVMA 1K3XA 2DWNA 2FFJA 3J27B 2I7NA 1HT1E 3FTFA 3DOAA 2Y20A 2CEAA 4GIPA 5ITTA 3SARA 2L6OA 3KS8A 3GLFB 1GL6A 4I4LA 2XFTA 3KSXA 3DZDA 3AJIB 2F5SA 3K8ZA 2Z4SA 3J81S 1Z59A 3T38A 1XXHB 3J7BA 4GC5A 5FTKA 4B3TM 1L8QA 4DR7M 1HNWM 3VFDA 2YFQA 1DO2A 1IBMM 2EA0A 3WHKA 3MK6A 1N33M 3GPXA 4D80A 3B9PA 5EXTA 3E9SA 2C96A 3I51A 4NRWA 4M0WA 2L09A 3FYDA 1E32A 3GLGA 3L25A 4DV5M 2ZAOA 1PJIA 2HHHM 4JI2M 1IY1A 5KQ8A 3U6PA 1YUBA 4LFCM 2D7EA 3AFHA 2XFSA 4GH9A 4ITQA 1XC8A 1MU5A 3U60B 3SASA 5ITXE 2C99A 4DV7M 1HQCA 4LF9M 2Z4RA 2DZNB 1HNZM 4DV6M 3KSJA 3ZC7B 2Y0TA 2BJVA 1G41A 3GPYA 2G8LA 4LFBM 2DVWB 4G4QA 2UXCM 3JAMS 4M9SA 1HR0M 4FCWA 3GRVA 1XXHA 4LJ4A 4A3VB 1K82A 4FWDA 2QBYB 2J7NA 3ZCBB 4RF0A 4B3MM 2FNAA 4IBGA 4Z8XA 4X65M 1FJGM 4DV2M 4M0DA 2DHRA 3TWMA 4DR2M 5KO3A 1L1ZA 5FTNA 4IIWA 4IBEA 3THGA 4X66M 1XWIA 2NQ8C 5KQDA 2CV1A 2UUAM 3RFWA 4M9XA 4LGMA 1R2ZA 4JI7M 5EP2A 1J09A 3FUXA 3TE6A 2F5QA 3K92A 4LF6M 1GL7A 2C9OA 3KFUG 1UM8A 3SHGB 1Q3BA 3VKGA 4NRVA 3T1YM 1QAMA 4I5SA 1GKIA 3I4VA 4W5WA 2YQZA 3SC3A 4KLNA 4BB9A 4X62M 1N34M 2YR0A 1WXQA 3K1JA 1OFHA 3GPUA 1QQWA 4DR4M 1OJLA 1Z6TA 3RGSA 1N32M 3CF0A 1PM5A 3GRRA 3SHFA 3J2PB 5EQTA 2Z3XA 1XHBA 3D8LA 1XNQM 5ITUA 3W0FA 5GKNA 1C1KA 5FSWA 2ERCA 5KPTA 4AKGA 4GC9A 1NY6A 3CTWB 3U6SA 1HT2E 4LJAA 3HHZA 3HHWA 3GRUA 4MB7A 3GLGB 7CATA 1DO0A 1W5SA 4B3SM 1NVMA 1IY0A 1L2CA 2QCUA 3U6OA 1N78A 4I8OA 3RE8A 2R45A 1QANA 1SXJA 3LVVA 4K0KM 4JI5M 2LH0A 4P16A 2QZ4A 4D82A 4LJ8A 1QAQA 2XSZA 1JQJC 5E6JA 2C5RA 3M7GA 3W0LB 1E94E 4DR5M 3VK8A 3CF2A 4B7FA 4DV3M 3U6QA 1TH4A 3PXGA 5KPRA 1IXRC 4LG2A 3PFIA 3LQRA 1SXJD 1DGGA 4B3RM 3LMMA 2H1RA 5JI2E 3R8FA 3I4YA 2XSZD 4DUZM 1PJJA 2HL7A 4NXNM 3KOZE 2CHGA 1QVRA 4MGZE 2DWLA 3KS4A 4JI3M 4G4NA 3L28A 4QHSA 2O5RA 3U61A 4MH0E 2UXDM 1Z5AA 4R3DA 2OPFA 2FOIC 2R65A 4IJEA 1NNUC 3VDPA 4AG6A 3PVSA 3FTCA 4MGIE 4BLCA 1GVNA 1Q3CA 1IBKM 1HNXM 2QP9X 3FYCA 4JN6A 2ZM6M 4GITA 4DV0M 1QAOA 4DV1M 3A46A 3SMSA 5IT9S 2CV0A 2M60A 3L29A 5ITYA 2F5PA 3HKPA 5IWAM 3GRYA 2YNMD 2KZSA 3CF6E 4JV5M 4WURA 2KW0A 3PNVA 4AI6A 1G3IA 2L7HA 3U6DA 3MJ5A 2X49A 4NSRA 4DV4M 4L15A 2XZUA 2QPAA 4M9ZA 1SXJC 4CGYB 2V6ZM 4CISA 3KP0E 4G4OA 3HU3A 4RF1A 4Z6YA 4IBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EP2 A;  2DZO B;  5DYI A;  1QZM A;  2C9O A;  1UM8 A;  2VII A;  4L4U A;  4LZZ A;  4LJ5 A;  3U5Z B;  4L16 A;  2X8A A;  1SXJ E;  4KO8 A;  2QBY A;  1OFI A;  4FD2 A;  2KRK A;  3SC3 A;  4KLN A;  4FCV A;  4QNR A;  1D2N A;  3K1J A;  1OFH A;  5FTM A;  5FTJ A;  1OJL A;  3D8B A;  3EIH A;  2ZAM A;  4QNM A;  2R62 A;  2V1U A;  1IQP A;  4FW9 A;  3VLF B;  3CF0 A;  5EXP A;  4ZPX A;  1SXJ B;  5EQT A;  1HT1 E;  2C98 A;  2ZAN A;  3GLH B;  5C1B A;  1C1K A;  3SYL A;  2CEA A;  1S3S A;  4LY6 A;  2BJW A;  3GLF B;  1NY6 A;  4I4L A;  5EXS A;  3BOS A;  3AJI B;  1HT2 E;  3DZD A;  4LJA A;  5FTL A;  2Z4S A;  3UK6 A;  4LJ6 A;  1JR3 A;  3GLG B;  3M0E A;  1DO0 A;  1W5S A;  3KDS E;  1NVM A;  1KYI A;  1XXH B;  1IY0 A;  5FTK A;  4LCB A;  1L8Q A;  3SYK A;  2QEN A;  1IN4 A;  2CHV A;  3VFD A;  1DO2 A;  2RKO A;  1SXJ A;  5DYG A;  5EP4 A;  3MHV C;  2CHQ A;  3WHK A;  1IN7 A;  3GLH A;  3GLI B;  2HCB A;  1JR3 D;  2QZ4 A;  4D82 A;  1G4A E;  4D80 A;  1NJF A;  4LJ7 A;  3HU1 A;  1LV7 A;  1X37 A;  2XSZ A;  1JQJ C;  3B9P A;  2CE7 A;  4FCT A;  4LJ8 A;  5EXT A;  3U61 B;  3GLF A;  1E94 E;  2C96 A;  1NSF A;  1R7R A;  3CF2 A;  1W5T A;  4D81 A;  3PXG A;  1IXR C;  3PFI A;  1SXJ D;  1E32 A;  4I81 A;  3GLG A;  2ZAO A;  3WHL A;  5JI2 E;  4LRT A;  3R8F A;  2XSZ D;  1IN5 A;  1IXZ A;  1IY1 A;  1J7K A;  3HU2 A;  1NY5 A;  2C9C A;  4FWH A;  5JI3 E;  4WW0 A;  1IN8 A;  5C18 A;  2CHG A;  1FNN A;  1QVR A;  3KW6 A;  3M6A A;  3GLI A;  3U60 B;  2C99 A;  1HQC A;  2Z4R A;  4QHS A;  5EP1 A;  2DZN B;  4FWG A;  2BJV A;  2R65 A;  1G41 A;  3HWS A;  1KSF X;  3PVS A;  5EP3 A;  2DVW B;  2QP9 X;  4JN6 A;  1IN6 A;  4GIT A;  3ZH9 B;  2DWZ B;  4FCW A;  3H4M A;  4QOS A;  1XXH A;  4LJ4 A;  1IM2 A;  4A3V B;  4FWD A;  2QBY B;  1IXS B;  4KOD A;  4LJ9 A;  2FNA A;  4Z8X A;  4LRS A;  1R6B X;  4EIW A;  2DHR A;  1G3I A;  5FTN A;  4L15 A;  2QPA A;  5EXX A;  1SXJ C;  1IY2 A;  1NJG A;  1XWI A;  2V6Z M;  3EIE A;  4LGM A;  3HU3 A;  4QHT A;  1HQY E; 
#chains in the Genus database with same CATH topology
 2R18 A;  2KXE A;  2EKF A;  3FD9 A;  3TL4 X;  2GNO A;  2DZO B;  1T6O A;  1N36 M;  1QZM A;  4P17 A;  4L4U A;  5IZ7 D;  2M5Z A;  1L2D A;  3GQ4 A;  4L16 A;  2X8A A;  1SXJ E;  2DWM A;  3Q8G A;  1IXS A;  4AKI A;  2XZF A;  4OW0 A;  3VDU A;  5A2Q S;  1QDR A;  4FCV A;  3GPP A;  4JI8 M;  1D2N A;  4F2L A;  5BPV A;  3A42 A;  3EIH A;  1V92 A;  1I94 M;  1IQP A;  1R4G A;  3J80 S;  2N35 A;  3FKE A;  4LGY A;  4XBO A;  5EXP A;  3VLF B;  2DXI A;  1SXJ B;  2P5T A;  4GRI A;  2KRU A;  4AW4 A;  2C98 A;  2FH0 A;  3GQ5 A;  3HJS A;  5IRE B;  3HY5 A;  4HEO A;  1V33 A;  1D0M A;  1S3S A;  3FUV A;  1VEG A;  2BJW A;  4OVZ A;  4IJF A;  4B7H A;  3KOY E;  3LCU A;  4PCZ A;  3TPZ A;  4WP2 A;  1OQY A;  3BOS A;  5EXS A;  3U5Z A;  5FTL A;  3J7A S;  1DGH A;  1MX0 A;  3L2A A;  4R7G A;  3UK6 A;  5ITR A;  3AOG A;  3KDS E;  3QAU A;  2QNJ A;  4AG5 A;  1KYI A;  1XMQ M;  3IG8 A;  4NC6 A;  3FTE A;  1ZMV A;  3U6M A;  4MM3 B;  1VDD A;  1N77 A;  2JY7 A;  3SYK A;  2QEN A;  2E5L M;  1IN4 A;  3SAV A;  1DGB A;  1EFU B;  4LZJ A;  2L4E A;  4AKH A;  5DYG A;  5EP4 A;  1ORY B;  2QHO B;  3KXE C;  3MHV C;  4JXJ A;  1YE9 A;  2CWB A;  2HCB A;  2Z7J A;  1GLN A;  3GLH A;  1G4A E;  1Q39 A;  1ZQ9 A;  2X4A A;  4GHL A;  3HU1 A;  1LV7 A;  1X37 A;  2JY5 A;  4MGK E;  3U61 B;  3B7Q A;  1G71 A;  3LVW A;  1NSF A;  1R7R A;  3MMP A;  4CIZ A;  4YY3 M;  1W5T A;  3FTD A;  3JR5 A;  4GHA A;  3C3D A;  2JWS A;  3OTO M;  1PRB A;  3K2L A;  1V34 A;  3UMM A;  2LXE A;  3GP1 A;  2Q2E B;  3DFZ A;  3JR4 A;  4NL4 H;  3U6E A;  2R4E A;  3AOE A;  3GO8 A;  1VDL A;  1NO1 A;  4HL4 A;  1OIP A;  1TH3 A;  2C9C A;  4FWH A;  1IN8 A;  1FNN A;  3M6A A;  3KW6 A;  4OU7 A;  3GLI A;  1Q02 A;  2KHH A;  2JY8 A;  4JI0 M;  3A98 B;  3HHY A;  5EP1 A;  2R46 A;  4G6Z A;  3HJQ A;  3GQ3 A;  2APL A;  1TTE A;  2F5O A;  3LW5 F;  4NSO B;  3I01 M;  2K47 A;  4RNA A;  3V76 A;  3C58 A;  1QDT A;  1GJT A;  4YHH M;  2Y21 A;  1PJQ A;  1QYR A;  2JY6 B;  5F3W A;  3FUW A;  2KZU A;  2WZJ A;  1YSY A;  2H5X A;  3SAW A;  2L7I A;  3H4M A;  4QOS A;  2L4F A;  4REZ A;  5LMN M;  1IXS B;  2A5Y B;  3R9X B;  5E26 A;  8CAT A;  4AQY M;  3QYE A;  4LF5 M;  4IBK A;  4DR3 M;  1DGF A;  1HJP A;  4IBJ A;  1PJS A;  3E4R A;  1QUT A;  1IY2 A;  2Y0Q A;  1N75 A;  2LWX A;  2MH8 A;  3FE3 A;  4QHT A;  2R44 A;  1HQY E;  2CV2 A;  4OVZ B;  5DYI A;  2VII A;  1XMO M;  2W82 A;  4LZZ A;  3U5Z B;  1E9R A;  2MGW A;  4MGY E;  4GKK M;  1DGH B;  3ZQJ A;  1OFI A;  1H6U A;  2KRK A;  4FD2 A;  5LMU M;  4S12 A;  1E9S A;  3GLH E;  2F5N A;  2BNK A;  2DHY A;  2FS1 A;  4XGI A;  2XEP A;  5FTM A;  5FTJ A;  3AOE C;  2I7P A;  1VQ1 A;  1RU3 A;  3D8B A;  3L27 A;  2ZAM A;  3HHX A;  2R62 A;  4QNM A;  2FE8 A;  5H37 D;  1T3T A;  2KA6 B;  3KP1 E;  2DZL A;  3I04 M;  5L8R F;  3B7Z A;  3E46 A;  4ZPX A;  4NOO B;  3AKZ A;  2HKJ A;  3DA1 A;  3CGW A;  3TQS A;  5C1B A;  3B74 A;  2ZAN A;  1Z5B A;  2LVO C;  3GLH B;  3NBI A;  2UUC M;  1TH2 A;  3SYL A;  4PD2 A;  4LY6 A;  4PDG A;  2D7H A;  2RGH A;  2DEN A;  2VDB B;  3TWL A;  3SAU A;  3UJN A;  2DI0 A;  3HGI A;  1UFZ A;  1ZAE A;  2DAG A;  3E21 A;  4LJ6 A;  1EE8 A;  1JR3 A;  3VKH A;  3M0E A;  3GLI E;  1G8P A;  4L8R C;  2LBC A;  4QOZ C;  1L1T A;  3F92 A;  3VK7 A;  1L2B A;  2JXN A;  4LCB A;  1NHG C;  3KVW A;  5KPZ A;  2OOA A;  2V1C A;  2CHV A;  2CRU A;  4JYA M;  2RKO A;  3LQQ A;  3FUT A;  2CHQ A;  1TDH A;  2LHG A;  1IN7 A;  3GLI B;  2VQE M;  2UXB M;  1JR3 D;  2LNH C;  1YLA A;  1NJF A;  4GKJ M;  4LJ7 A;  3FUU A;  4FCT A;  1IBL M;  5ITQ A;  2CE7 A;  2AHM A;  1NNJ A;  2JZ0 A;  3GLF A;  3IG5 A;  2KNA A;  3UZU A;  2OQ4 A;  4D81 A;  2KNZ A;  5DNY A;  1BVS A;  3FRH A;  1XNR M;  4I81 A;  5BR8 M;  4OX9 M;  3K9O A;  3WHL A;  3AV0 A;  1SG9 A;  2CUZ A;  3UGJ A;  4X64 M;  4LRT A;  4LF4 M;  2D7G A;  2EO2 A;  3KOW E;  4B7G A;  1IN5 A;  1IXZ A;  2XH9 A;  2VQF M;  4NXM M;  2MR9 A;  1J7K A;  3HU2 A;  1KFV A;  2F4V M;  1NY5 A;  5JI3 E;  1TGU A;  4WW0 A;  5C18 A;  3Q8X A;  1TF0 B;  2J7O A;  4AZF A;  1ZMU A;  3KOX E;  1TDZ A;  1ZMW A;  2LTU A;  1NHW C;  4FWG A;  1G59 A;  4JI4 M;  3SBJ A;  1OIZ A;  2Z8Y M;  4JI6 M;  3IHP A;  4DUY M;  3TWK A;  3HWS A;  2JUJ A;  3A45 A;  3RGP A;  5EJC A;  1KSF X;  2RRU A;  4PDI A;  3U6L A;  2KNV A;  4JI1 M;  2DAM A;  5EP3 A;  3T15 A;  1IN6 A;  1OAO C;  3ZH9 B;  2DWZ B;  2O01 F;  4B08 A;  5DFL A;  4PT5 A;  4LFA M;  4DR6 M;  1IM2 A;  4BBA A;  1D0L A;  3T1H M;  2LVP C;  4LJ9 A;  4KOD A;  4MGH A;  4LRS A;  4GMQ A;  1R6B X;  4EIW A;  2XLJ A;  2R4J A;  2KDL A;  1NV9 A;  2WSE F;  4IBC A;  3U60 A;  5FLX S;  2J5Y A;  2RGO A;  4IBI A;  2L2D A;  2HAK A;  4IBB A;  5EXX A;  4LF7 M;  3C3E A;  4II7 A;  1NJG A;  1K3W A;  2JP7 A;  3PNY A;  3HJ8 A;  1JR3 E;  1QZE A;  3EIE A;  4Y28 F;  2UUB M;  5ITX A;  4HLQ A;  2BWB A;  3SFZ A;  1WGL A;  2KEB A;  3ILK A;  4IBD A;  3U6C A;  2CFO A;  4CHT B;  2UU9 M;  4LJ5 A;  2ZBK B;  3AL0 C;  4KO8 A;  2QBY A;  2XF3 A;  2K0B X;  1Z5C A;  3H4J A;  3NWL A;  1J5E M;  2JA2 A;  4TUW A;  4QNR A;  1OAI A;  1I4W A;  3L26 A;  3QWL A;  1C7Y A;  2G5G X;  4DR1 M;  4G4R A;  4L78 A;  3GLF E;  2XGN A;  1R2Y A;  2V1U A;  1ZV1 A;  3SAT A;  4KHP M;  4FW9 A;  3SMP A;  2EUC A;  1XB2 B;  1T43 A;  4FVM A;  1K3X A;  2DWN A;  2FFJ A;  3J27 B;  2I7N A;  1HT1 E;  3FTF A;  3DOA A;  1PGY A;  2Y20 A;  1NV8 A;  1XXH E;  2CEA A;  4GIP A;  5ITT A;  3SAR A;  2L6O A;  2OO9 A;  3KS8 A;  3GLF B;  1GL6 A;  3B89 A;  1WHC A;  4I4L A;  2XFT A;  3KSX A;  3DZD A;  3AJI B;  2F5S A;  3K8Z A;  2Z4S A;  2QSF X;  3J81 S;  2GQF A;  1Z59 A;  3T38 A;  1XXH B;  3J7B A;  4GC5 A;  5FTK A;  4B3T M;  1L8Q A;  4F1I A;  4LF8 M;  4DR7 M;  1HNW M;  3QYB A;  3VFD A;  2YFQ A;  1DO2 A;  1IBM M;  2EA0 A;  1PJT A;  3WHK A;  3MK6 A;  1N33 M;  3GPX A;  4D80 A;  3B9P A;  5EXT A;  3E9S A;  3FRI A;  2C96 A;  2B3T A;  3I51 A;  4NRW A;  2HWJ A;  3C9P A;  4M0W A;  4L6V 6;  4R71 A;  1DV0 A;  2L09 A;  3FYD A;  1E32 A;  3GLG A;  3L25 A;  2O25 A;  4DV5 M;  2ZAO A;  1WR1 B;  1PJI A;  2HHH M;  2LVA A;  4JI2 M;  1IY1 A;  5KQ8 A;  3U6P A;  1YUB A;  3NBX X;  2VF7 A;  4LFC M;  2D7E A;  3AFH A;  2XFS A;  2DAE A;  4GH9 A;  4ITQ A;  1XC8 A;  1MU5 A;  3U60 B;  3SAS A;  5ITX E;  2C99 A;  4DV7 M;  1HQC A;  4LF9 M;  2Z4R A;  1QUS A;  2DZN B;  1HNZ M;  4DV6 M;  1OKS A;  3KSJ A;  3ZC7 B;  2Y0T A;  3HZJ A;  2BJV A;  2DAK A;  1G41 A;  1VEK A;  3GPY A;  2G8L A;  3W68 A;  1VEJ A;  4LFB M;  2DVW B;  4G4Q A;  2UXC M;  3JAM S;  4M9S A;  1HR0 M;  4FCW A;  2MRO B;  3GRV A;  1XXH A;  4LJ4 A;  4A3V B;  1K82 A;  3IEC A;  4FWD A;  2QBY B;  2J7N A;  3ZCB B;  4RF0 A;  1GO5 A;  4B3M M;  2FNA A;  4IBG A;  4Z8X A;  4X65 M;  1FJG M;  4DV2 M;  1R5L A;  4M0D A;  1Y8G A;  2DHR A;  3TWM A;  4DR2 M;  5KO3 A;  3BXW A;  1L1Z A;  5FTN A;  4IIW A;  4CJ6 A;  4IBE A;  1TR8 A;  2OOB A;  3THG A;  4X66 M;  1XWI A;  2NQ8 C;  5KQD A;  1JB0 F;  2CV1 A;  3RFW A;  2UUA M;  4M9X A;  3K9P A;  2MJ5 B;  4LGM A;  4GEW A;  3BBZ A;  1R2Z A;  4JI7 M;  5EP2 A;  1J09 A;  3FUX A;  3TE6 A;  2F5Q A;  3K92 A;  4LF6 M;  2LVQ D;  1GL7 A;  2C9O A;  3KFU G;  1UM8 A;  3SHG B;  1F4I A;  1Q3B A;  1GJS A;  4NRV A;  3T1Y M;  3VKG A;  1QAM A;  4I5S A;  1GKI A;  3I4V A;  4W5W A;  2YQZ A;  2WSF F;  2DAI A;  3SC3 A;  4KLN A;  4BB9 A;  4X62 M;  1A5T A;  1N34 M;  2YR0 A;  1WXQ A;  3K1J A;  1OFH A;  3GPU A;  1QQW A;  4DR4 M;  1OJL A;  1Z6T A;  3RGS A;  1N32 M;  3W67 A;  2DKL A;  3CF0 A;  1PM5 A;  3GRR A;  3SHF A;  2ZTC A;  3J2P B;  5EQT A;  2Z3X A;  1XHB A;  3GLG E;  3D8L A;  1XNQ M;  5ITU A;  2LHC A;  3W0F A;  2CP8 A;  5GKN A;  1C1K A;  5FSW A;  2ERC A;  5KPT A;  2DNA A;  4AKG A;  1GAB A;  2G3Q A;  3B7N A;  4GC9 A;  1NY6 A;  3CTW B;  3U6S A;  1HT2 E;  4LJA A;  1P3Q Q;  3HHZ A;  3HHW A;  3GRU A;  4MB7 A;  3GLG B;  7CAT A;  4KT0 F;  1DO0 A;  1W5S A;  4B3S M;  3HX3 A;  1NVM A;  1IY0 A;  1WIV A;  1L2C A;  2QCU A;  3U6O A;  1N78 A;  4I8O A;  3RE8 A;  2R45 A;  1D0K A;  1QAN A;  1SXJ A;  1WJ7 A;  3LVV A;  4K0K M;  4JI5 M;  2LH0 A;  1IFY A;  1WGN A;  4P16 A;  2QZ4 A;  4D82 A;  2EJS A;  4LJ8 A;  1MJG M;  1QAQ A;  2XSZ A;  1JQJ C;  5E6J A;  2WSC F;  2C5R A;  3M7G A;  3W0L B;  1E94 E;  4RKU F;  4DR5 M;  3VK8 A;  1AUA A;  3CF2 A;  4B7F A;  4DV3 M;  3U6Q A;  1TH4 A;  3PXG A;  5KPR A;  1IXR C;  4LG2 A;  2K9D A;  3LQR A;  3PFI A;  1SXJ D;  1DGG A;  2EKK A;  4B3R M;  3LMM A;  3T6P A;  2H1R A;  5JI2 E;  3R8F A;  3I4Y A;  2XSZ D;  4DUZ M;  1PJJ A;  2HL7 A;  3LCV B;  4NXN M;  2JZ1 A;  3KOZ E;  1CUK A;  1VG5 A;  2CHG A;  1QVR A;  4MGZ E;  2DWL A;  3KS4 A;  4G3O A;  4JI3 M;  4G4N A;  3L28 A;  2QQ8 A;  4QHS A;  2O5R A;  3U61 A;  4MH0 E;  2UXD M;  1Z5A A;  4R3D A;  2OPF A;  2JNH A;  2K6B A;  2FOI C;  1LTM A;  2R65 A;  4IJE A;  1NNU C;  3VDP A;  4AG6 A;  3PVS A;  3FTC A;  4MGI E;  4BLC A;  1GVN A;  1AIP C;  1Q3C A;  1IBK M;  1HNX M;  4ANR A;  2QP9 X;  3FYC A;  4JN6 A;  2BWE A;  1MN3 A;  1OTR A;  4GIT A;  2ZM6 M;  4DV0 M;  1QAO A;  2VF8 A;  4XK8 F;  3A46 A;  4DV1 M;  3SMS A;  5IT9 S;  2CV0 A;  2M60 A;  3L29 A;  5ITY A;  2F5P A;  3HKP A;  4Q7J A;  5IWA M;  3GRY A;  1EIJ A;  2YNM D;  2KZS A;  2R0I A;  3CF6 E;  4WUR A;  4JV5 M;  2ZTD A;  2KW0 A;  3PNV A;  4AI6 A;  1G3I A;  4UN2 B;  2L7H A;  3U6D A;  3MJ5 A;  2X49 A;  4NSR A;  4DV4 M;  4L15 A;  2R6F A;  2QPA A;  2XZU A;  4M9Z A;  2LVN C;  1SXJ C;  4CGY B;  2V6Z M;  4CIS A;  4DBG B;  3KP0 E;  4G4O A;  3HU3 A;  4RF1 A;  4Z6Y A;  4IBF A; 
#chains in the Genus database with same CATH homology
 2R18 A;  2KXE A;  3FD9 A;  3TL4 X;  1N36 M;  2DZO B;  1QZM A;  4L4U A;  5IZ7 D;  2M5Z A;  1L2D A;  3GQ4 A;  4L16 A;  2X8A A;  1SXJ E;  2DWM A;  4AKI A;  2XZF A;  4OW0 A;  3VDU A;  5A2Q S;  4FCV A;  3GPP A;  4JI8 M;  1D2N A;  5BPV A;  3A42 A;  3EIH A;  1I94 M;  1IQP A;  3J80 S;  3VLF B;  3FKE A;  4LGY A;  4XBO A;  5EXP A;  2DXI A;  1SXJ B;  2P5T A;  4GRI A;  2KRU A;  4AW4 A;  2C98 A;  3GQ5 A;  3HJS A;  5IRE B;  1S3S A;  3FUV A;  4OVZ A;  2BJW A;  4IJF A;  4B7H A;  3KOY E;  4PCZ A;  3TPZ A;  5EXS A;  3BOS A;  3U5Z A;  5FTL A;  3J7A S;  1DGH A;  1MX0 A;  3L2A A;  4R7G A;  3UK6 A;  5ITR A;  3AOG A;  3KDS E;  3QAU A;  4AG5 A;  1XMQ M;  1KYI A;  3IG8 A;  3FTE A;  3U6M A;  4MM3 B;  1VDD A;  1N77 A;  3SYK A;  2QEN A;  2E5L M;  1IN4 A;  3SAV A;  1DGB A;  4LZJ A;  4AKH A;  5DYG A;  5EP4 A;  1ORY B;  3KXE C;  3MHV C;  4JXJ A;  1YE9 A;  3GLH A;  2HCB A;  2Z7J A;  1GLN A;  4GHL A;  1G4A E;  1Q39 A;  1ZQ9 A;  2X4A A;  3HU1 A;  1LV7 A;  1X37 A;  4MGK E;  3U61 B;  3LVW A;  1NSF A;  1R7R A;  4YY3 M;  3JR5 A;  4GHA A;  1W5T A;  3FTD A;  3OTO M;  3K2L A;  3UMM A;  2LXE A;  3GP1 A;  2Q2E B;  3DFZ A;  3JR4 A;  4NL4 H;  3U6E A;  2R4E A;  3AOE A;  3GO8 A;  4HL4 A;  1TH3 A;  2C9C A;  4FWH A;  1IN8 A;  1FNN A;  3M6A A;  3KW6 A;  4OU7 A;  3GLI A;  4JI0 M;  3A98 B;  3HHY A;  5EP1 A;  2R46 A;  4G6Z A;  3HJQ A;  3GQ3 A;  2F5O A;  4NSO B;  2K47 A;  4RNA A;  3C58 A;  4YHH M;  5F3W A;  2Y21 A;  1QYR A;  3FUW A;  2KZU A;  1YSY A;  3SAW A;  2L7I A;  3H4M A;  4QOS A;  4REZ A;  5LMN M;  1IXS B;  2A5Y B;  3R9X B;  5E26 A;  8CAT A;  4AQY M;  4LF5 M;  4IBK A;  4DR3 M;  1DGF A;  4IBJ A;  3E4R A;  1IY2 A;  2Y0Q A;  1N75 A;  2LWX A;  4QHT A;  1HQY E;  2CV2 A;  4OVZ B;  5DYI A;  2VII A;  1XMO M;  2W82 A;  4LZZ A;  3U5Z B;  1E9R A;  4MGY E;  4GKK M;  1DGH B;  1OFI A;  1H6U A;  2KRK A;  4FD2 A;  5LMU M;  4S12 A;  1E9S A;  2F5N A;  2BNK A;  4XGI A;  2XEP A;  5FTM A;  5FTJ A;  3AOE C;  2I7P A;  3L27 A;  3D8B A;  4LF8 M;  2ZAM A;  3HHX A;  2R62 A;  4QNM A;  2FE8 A;  5H37 D;  1T3T A;  2KA6 B;  3KP1 E;  4ZPX A;  4NOO B;  3AKZ A;  2HKJ A;  3DA1 A;  3TQS A;  5C1B A;  2ZAN A;  1Z5B A;  3GLH B;  3NBI A;  2UUC M;  1TH2 A;  3SYL A;  4PD2 A;  4LY6 A;  4PDG A;  2D7H A;  2RGH A;  3TWL A;  3SAU A;  3UJN A;  3HGI A;  1ZAE A;  4LJ6 A;  1EE8 A;  1JR3 A;  3VKH A;  3M0E A;  1G8P A;  4L8R C;  4QOZ C;  1L1T A;  1L2B A;  3VK7 A;  4LCB A;  1NHG C;  3KVW A;  5KPZ A;  2V1C A;  2CHV A;  4JYA M;  2RKO A;  3LQQ A;  3FUT A;  2CHQ A;  1TDH A;  1IN7 A;  3GLI B;  2VQE M;  2UXB M;  1JR3 D;  2LNH C;  1NJF A;  4GKJ M;  4LJ7 A;  3FUU A;  4FCT A;  1IBL M;  5ITQ A;  2CE7 A;  2AHM A;  1NNJ A;  3GLF A;  3IG5 A;  3UZU A;  2OQ4 A;  4D81 A;  5DNY A;  1XNR M;  4I81 A;  5BR8 M;  4OX9 M;  3WHL A;  3AV0 A;  2CUZ A;  3UGJ A;  4X64 M;  4LRT A;  4LF4 M;  2D7G A;  2EO2 A;  3KOW E;  4B7G A;  1IN5 A;  1IXZ A;  2XH9 A;  2VQF M;  4NXM M;  1J7K A;  3HU2 A;  1KFV A;  2F4V M;  1NY5 A;  5JI3 E;  1TGU A;  4WW0 A;  5C18 A;  3Q8X A;  2J7O A;  4AZF A;  3KOX E;  1TDZ A;  1NHW C;  4FWG A;  1G59 A;  4JI4 M;  3SBJ A;  4JI6 M;  4DUY M;  3TWK A;  3HWS A;  3A45 A;  3RGP A;  4PDI A;  5EJC A;  1KSF X;  3U6L A;  4JI1 M;  5EP3 A;  3T15 A;  1IN6 A;  3ZH9 B;  2DWZ B;  4B08 A;  4PT5 A;  4LFA M;  4DR6 M;  1IM2 A;  4BBA A;  3T1H M;  4LJ9 A;  4KOD A;  4MGH A;  4LRS A;  4GMQ A;  1R6B X;  4EIW A;  2XLJ A;  2R4J A;  4IBC A;  3U60 A;  5FLX S;  2RGO A;  4IBI A;  4IBB A;  5EXX A;  4LF7 M;  4II7 A;  1K3W A;  1NJG A;  3PNY A;  3HJ8 A;  3EIE A;  2UUB M;  5ITX A;  4HLQ A;  3SFZ A;  2KEB A;  3ILK A;  4IBD A;  3U6C A;  2CFO A;  4CHT B;  2UU9 M;  4LJ5 A;  2ZBK B;  3AL0 C;  4KO8 A;  2QBY A;  2XF3 A;  1Z5C A;  3NWL A;  1J5E M;  2JA2 A;  4TUW A;  4QNR A;  1I4W A;  3L26 A;  3QWL A;  2G5G X;  4DR1 M;  4G4R A;  4L78 A;  2V1U A;  2XGN A;  1R2Y A;  3SAT A;  4KHP M;  4FW9 A;  3SMP A;  2EUC A;  4FVM A;  1K3X A;  2DWN A;  2FFJ A;  3J27 B;  2I7N A;  1HT1 E;  3FTF A;  3DOA A;  2Y20 A;  2CEA A;  4GIP A;  5ITT A;  3SAR A;  2L6O A;  3KS8 A;  3GLF B;  1GL6 A;  4I4L A;  2XFT A;  3KSX A;  3DZD A;  3AJI B;  2F5S A;  3K8Z A;  2Z4S A;  3J81 S;  1Z59 A;  3T38 A;  1XXH B;  3J7B A;  4GC5 A;  5FTK A;  4B3T M;  1L8Q A;  4DR7 M;  1HNW M;  3VFD A;  2YFQ A;  1DO2 A;  1IBM M;  2EA0 A;  3WHK A;  3MK6 A;  1N33 M;  3GPX A;  4D80 A;  3B9P A;  5EXT A;  3E9S A;  2C96 A;  3I51 A;  4NRW A;  4M0W A;  2L09 A;  3FYD A;  1E32 A;  3GLG A;  3L25 A;  4DV5 M;  2ZAO A;  1PJI A;  2HHH M;  4JI2 M;  1IY1 A;  5KQ8 A;  3U6P A;  1YUB A;  4LFC M;  2D7E A;  3AFH A;  2XFS A;  4GH9 A;  4ITQ A;  1XC8 A;  1MU5 A;  3U60 B;  3SAS A;  5ITX E;  2C99 A;  4DV7 M;  1HQC A;  4LF9 M;  2Z4R A;  2DZN B;  1HNZ M;  4DV6 M;  3KSJ A;  3ZC7 B;  2Y0T A;  2BJV A;  1G41 A;  3GPY A;  2G8L A;  4LFB M;  2DVW B;  4G4Q A;  2UXC M;  3JAM S;  4M9S A;  1HR0 M;  4FCW A;  3GRV A;  1XXH A;  4LJ4 A;  4A3V B;  1K82 A;  4FWD A;  2QBY B;  2J7N A;  3ZCB B;  4RF0 A;  4B3M M;  2FNA A;  4IBG A;  4Z8X A;  4X65 M;  1FJG M;  4DV2 M;  4M0D A;  2DHR A;  3TWM A;  4DR2 M;  5KO3 A;  1L1Z A;  5FTN A;  4IIW A;  4IBE A;  3THG A;  4X66 M;  1XWI A;  2NQ8 C;  5KQD A;  2CV1 A;  2UUA M;  3RFW A;  4M9X A;  4LGM A;  1R2Z A;  4JI7 M;  5EP2 A;  1J09 A;  3FUX A;  3TE6 A;  2F5Q A;  3K92 A;  4LF6 M;  1GL7 A;  2C9O A;  3KFU G;  1UM8 A;  3SHG B;  1Q3B A;  3VKG A;  4NRV A;  3T1Y M;  1QAM A;  4I5S A;  1GKI A;  3I4V A;  4W5W A;  2YQZ A;  3SC3 A;  4KLN A;  4BB9 A;  4X62 M;  1N34 M;  2YR0 A;  1WXQ A;  3K1J A;  1OFH A;  3GPU A;  1QQW A;  4DR4 M;  1OJL A;  1Z6T A;  3RGS A;  1N32 M;  3CF0 A;  1PM5 A;  3GRR A;  3SHF A;  3J2P B;  5EQT A;  2Z3X A;  1XHB A;  3D8L A;  1XNQ M;  5ITU A;  3W0F A;  5GKN A;  1C1K A;  5FSW A;  2ERC A;  5KPT A;  4AKG A;  4GC9 A;  1NY6 A;  3CTW B;  3U6S A;  1HT2 E;  4LJA A;  3HHZ A;  3HHW A;  3GRU A;  4MB7 A;  3GLG B;  7CAT A;  1DO0 A;  1W5S A;  4B3S M;  1NVM A;  1IY0 A;  1L2C A;  2QCU A;  3U6O A;  1N78 A;  4I8O A;  3RE8 A;  2R45 A;  1QAN A;  1SXJ A;  3LVV A;  4K0K M;  4JI5 M;  2LH0 A;  4P16 A;  2QZ4 A;  4D82 A;  4LJ8 A;  1QAQ A;  2XSZ A;  1JQJ C;  5E6J A;  2C5R A;  3M7G A;  3W0L B;  1E94 E;  4DR5 M;  3VK8 A;  3CF2 A;  4B7F A;  4DV3 M;  3U6Q A;  1TH4 A;  3PXG A;  5KPR A;  1IXR C;  4LG2 A;  3PFI A;  3LQR A;  1SXJ D;  1DGG A;  4B3R M;  3LMM A;  2H1R A;  5JI2 E;  3R8F A;  3I4Y A;  2XSZ D;  4DUZ M;  1PJJ A;  2HL7 A;  4NXN M;  3KOZ E;  2CHG A;  1QVR A;  4MGZ E;  2DWL A;  3KS4 A;  4JI3 M;  4G4N A;  3L28 A;  4QHS A;  2O5R A;  3U61 A;  4MH0 E;  2UXD M;  1Z5A A;  4R3D A;  2OPF A;  2FOI C;  2R65 A;  4IJE A;  1NNU C;  3VDP A;  4AG6 A;  3PVS A;  3FTC A;  4MGI E;  4BLC A;  1GVN A;  1Q3C A;  1IBK M;  1HNX M;  2QP9 X;  3FYC A;  4JN6 A;  2ZM6 M;  4GIT A;  4DV0 M;  1QAO A;  4DV1 M;  3A46 A;  3SMS A;  5IT9 S;  2CV0 A;  2M60 A;  3L29 A;  5ITY A;  2F5P A;  3HKP A;  5IWA M;  3GRY A;  2YNM D;  2KZS A;  3CF6 E;  4JV5 M;  4WUR A;  2KW0 A;  3PNV A;  4AI6 A;  1G3I A;  2L7H A;  3U6D A;  3MJ5 A;  2X49 A;  4NSR A;  4DV4 M;  4L15 A;  2XZU A;  2QPA A;  4M9Z A;  1SXJ C;  4CGY B;  2V6Z M;  4CIS A;  3KP0 E;  4G4O A;  3HU3 A;  4RF1 A;  4Z6Y A;  4IBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...