3VFDA

Human spastin aaa domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
266
Chain Sequence
LANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLGEKLVRALFAVARELQPSIIFIDQVDSLLDASRRLKTEFLIEFDGVQRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPENMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human spastin AAA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Spastin
total genus 83
structure length 266
sequence length 289
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vfdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vfdA01
4U5XA 4ZI2A 3A1SA 5KTYA 3SYNA 2A7QA 4BFSA 3AVXA 1CEEA 5AJWA 2QE7D 3IHLA 3TSZA 2OBNA 3DVLA 3IEUA 4DEYA 3AP2A 4GRAA 2BJVA 4IOJA 2NPIA 5CM8B 1GITA 2RHDA 5JS7A 1A2KC 3B13B 2QENA 3Q8XB 4C3ZA 2C2HA 3AVTA 3U7HB 3Q72A 3BH0A 4ZKEA 2PEYA 1AN0A 1R0YA 1H8ED 3DZ8A 3PV0A 1ZMXA 1CS4C 1TQ6A 2GF9A 4N0DA 3UXMA 4FINA 3QBTA 2ZI3A 1FP6A 4XWKA 1F2TA 3B1XA 2ZPTX 5CIQA 3R8FA 1ZNZA 4TLEA 2WBLC 3SJAA 2VP5A 1JPJA 4QBGB 3QKRB 4K8OA 2DB3A 2O0HA 4BUJA 3RRMA 1KO8A 2G9NA 1W0KA 1Z6TA 1K6MA 3PCRB 4JVSB 4Q01A 4LI0A 3RSOA 1SVSA 2Z5FA 3X2SA 4KSCA 5AUNB 3UPUA 1D9ZA 2D06A 4LC0A 1EGAA 5LD2C 5C1BA 1E2QA 4TZ0A 1II8B 1MKYA 3DL0A 2GVZC 3OEED 3BH7A 3VR5A 2Q9AA 2B7BA 1FNNA 4Q4AA 4ACBA 2BV3A 3U4QB 4B73A 4ASUD 3U3OA 2HT1A 1NN5A 2LWIA 4TT3D 1EFTA 3K8YA 5EE5B 1CIPA 3MLEA 1QG4A 2MSDB 2DVWB 3CW2A 3SN6A 1IM2A 2WZQA 2NO7A 4JLBA 2FNAA 4Q1FA 1DAHA 2P5SA 4TLAA 3PUXA 4MGIR 2QP9X 2C78A 4TLDA 2IYLD 3FVQA 4M9SA 2FFAA 2C04A 3QF4B 4Q66C 4OHVA 2BCJQ 5KSZA 2RGGA 3GLHE 3SQWA 3B6EA 4BLPA 2ZYUX 3I3SR 1NVMA 1W46A 2WKRA 4OL0A 2O5VA 3FKSA 2ZJOA 3DM5A 5HZKA 4BEJA 1Q1EA 3EZ9A 3UWOA 2O8FA 4JLDA 5CB8A 3C4JA 2RGBA 1Z08A 1FQJA 3WRXC 4HZIA 2XGJA 2C99A 3EX7C 4E03A 1I4LD 1E79A 5H68A 3O8CA 5L3SA 1QVRA 3B9QA 3CLVA 3E2IA 5TB5A 1JB1A 1U8ZA 4MA4A 4B3CA 3AH8A 4HLQB 5DISB 4RD4A 3WNCA 2EW1A 3LLMA 1GG2A 4O25A 2UKDA 2I3BA 2VHQA 1QHXA 1WXQA 6Q21A 3VKGA 1FX0A 1OHHA 1U0JA 4Q4HB 3W8RA 5HKKA 1FMJA 4TTPA 1Y63A 4A36A 4LBVA 4UXHA 1N6RA 1OF1A 2BEKA 1NG1A 1E0SA 1E96A 3KXKA 1R0ZA 3DO6A 1F2UB 4CT5A 2FFBA 2OCYC 2K5UA 1XEXB 3NDPA 4RKFA 3H4MA 1SKYB 1G3MA 2UVQA 1DVRA 4QGFA 5EUQB 3U44B 1Z2AA 2FPMA 1XD2A 1TX4B 4Q1BA 1AS2A 4EJSC 3P4XA 5LBIA 4AYXA 4EQ6A 4RJLA 1Z47A 3HU1A 2PL3A 2FSGA 2ZRGA 4YMVA 3VFDA 1CP2A 4PSAA 2ECKA 4YXWD 1ESMA 4JZKA 4C0AC 1CJKC 1S0UA 2HUPA 1IN6A 1T3SA 2YYZA 4US0R 5KDLA 5DI3A 1ZP6A 2LCFA 2JJ2A 3LLUA 4Q7JB 1SXJA 3ZQJA 3THWB 2YKGA 4LJ7A 1E0AA 1CR1A 1PUJA 2JJ1A 1UKVY 1NBMA 2IXGA 2XSZD 2ZRMA 3TUJC 2FDCA 2B8WA 1RVDA 3HP1A 3NEYA 2IUSA 4KXFB 4R98A 4LPSA 4D4MA 1JQLB 1VCOA 5GADl 2F1RA 1ZRHA 1RW4A 4ESHA 5KPJA 2D2FA 4I81A 2GJKA 2I1QA 1I4DD 1UDWA 3NXSA 4AKEA 4EFLA 4BLSA 2QAGB 3L43A 1NMZA 3FDIA 4GZMA 4N3NA 2ZANA 2V6IA 1C9KA 4MGZR 1E2IA 4I1UA 2ZR9A 3LH5A 1NL3A 3MGCA 3SE0A 1D5CA 1UF9A 1II0A 2FA9A 2Q3FA 3C16C 2O8EB 4JLNA 3BOSA 1OJLA 2D7DA 2REBA 3GLHA 1I2DA 3MWLA 1YR9A 2WWFA 5JSZA 3A1WA 3IQWA 1IJFA 2IWRA 3V4RA 1EX6A 2QM7A 2E9SA 1RJ9B 3F8TA 4HUTA 1VKJA 3CKLA 4NDZA 4NCIA 3WMGA 1KI9A 3ZVRA 3B7GA 2F3TA 3K0FA 3WXMA 2ZUCA 1U0HC 1F48A 5B30A 4MYUA 4YXWA 4D26A 3I5XA 2X1VA 4A0RA 1OV4A 1TAGA 3AQ4A 1ZD1A 3QY0A 4DSUA 3U5ZB 5FTKA 3I4LA 2IYUA 5FBLB 1GRNA 4A0HA 4ZIRB 1F2TB 1P62B 4DCUA 4AYTA 1U2RA 5KU1A 3TK1A 4URVR 5KDOA 3WP1B 4URYR 4UNRA 3OESA 4GZLA 4PHHA 3I72A 3IKJA 4KFTA 4ZCLA 1E9AA 2Q0HA 3ZGXA 2WVJA 3T06B 2JLQA 3LA6A 3KQLA 2WKPA 4HUQB 1CJUC 3REFA 5G40A 1Q3HA 1DS6A 2ZRBA 3ONWA 4URUR 2DHRA 1JR6A 3I8XA 4D4JA 3WMEA 4CEJA 1FPMA 4DLTA 2RKOA 2JCSA 3CBQA 3CPHA 2BBSA 3THYA 4DDTA 3AV0B 3GJXC 4HAVA 3P26A 5TARA 2B6HA 1OFIA 1MO5A 2CLSA 5GJCA 1XXHE 4UNNA 5AJXA 1QDEA 3FWYA 1GILA 3EC1A 3FFAA 5SZIA 1PZNA 1G3UA 1IY0A 1OPXA 4XTRA 4DUGA 5DIFA 2AHOA 1OKKD 4MDFA 2PLRA 2ZJYA 4V02A 4C2TA 4H9GA 2WM9B 3QJYA 1DADA 1G7TA 2ORIA 2VSXA 2YWGA 5EE3A 5FOSA 2VA8A 4B3DA 4C0QC 2VIIA 3T34A 4LBYA 1E9SA 3S1AB 4EFNA 4XD7A 1ZD9A 1X8LA 1DARA 1KI4A 4Q1DA 3ADBA 1YZNA 3GCGA 1Z0AA 1P75A 4TYPA 4Q9HA 5KDDA 3IBYA 4FCWA 3DEFA 2P65A 2A5JA 4QJ5A 2W2TA 1TQ4A 2FEOA 3R9XA 5DN6D 4GDFA 1P7CA 3BWDD 3GP8A 2GDJA 4TMTA 4ABYA 2NZJA 4TQAA 1RE0A 4KAXA 5E3HA 4P32A 1D2NA 4RCYA 1Q21A 1SVMA 1KY2A 4KFUA 2H92A 1LFDB 5EP2A 1VDZA 1UPTA 1J8MF 2YOFA 3ZIAD 3K53A 3ZZUA 4DLRA 1FUKA 3NH6A 1YZTA 2C9CA 5LPNA 1VYUA 1GKYA 4MKFA 2ZRPA 3A1VA 4PSKA 4PHGA 1DAGA 4K46A 5IK2D 1MABA 4NE2A 1NVUQ 2VHCA 3NBZC 1J8YF 2Z4RA 2PT5A 2AWOA 2DY1A 4BZPA 1Q1ZA 1YR7A 2QNRA 3IEVA 4YLGA 5JWHA 2CBZA 3KJHA 1W0KD 4PR0A 3AP1A 3BFKA 3TLXA 4BGDA 3EAQA 3THXB 4L4UA 1OKKA 2WAXA 4ZKDA 5K8LA 1MO3A 2HYIC 3RC8A 4DT1A 1A82A 2AD1A 1Z6GA 2ZAMA 2WSSD 3GLFA 2YC4C 4M9XA 1GZSA 3KTAB 3NEJA 5HE8A 3UMRA 5B64A 2V3CC 2OUKA 5AJZA 5DLQC 4AG6A 3IHWA 4HAUA 5EE9A 4XD7D 4B33A 5KNBA 1XMVA 4RZ2A 4CDGA 4LHWA 1HQCA 4EDHA 1AK2A 2RGNC 5FOTA 3C5CA 2YV5A 1Q20A 4IEEA 2RB4A 4P4TA 5FL3A 4BFYA 2W0SA 2H16A 2OCAA 5CDFE 5DYIA 3I5YA 4C7OB 2BBTA 1LW7A 1XTQA 3D8BA 3TBKA 4IDNA 1DG3A 2P0EA 4NCHA 2ZYVX 5AUQA 1U81A 2ZXUA 1P2UA 1ELOA 2VPPA 2O8BA 4EPWA 1NN3A 3S1AA 3H2YA 5FI0B 4FWDA 3IIJA 1J90A 3IBGA 1FP7A 2PT7A 2WWXA 2XOKD 3IIKA 2FPLA 1P2TA 1E1QA 4BWYA 2J41A 4JSYA 2C96A 5FTMA 2GNOA 2P6RA 1UKYA 4GOXA 1DAEA 5JRZA 3A1TA 4X8MA 2DZNB 5IK2A 1W7AA 2FZLA 2CCGA 1UAAA 3BXZA 4P0TA 5D3MA 1KMHA 4LC1A 1NVVR 3P27A 1SHKA 4IOMA 4MQBA 4XOIA 5AUOB 3HJNA 2XSZA 4DCSA 2D62A 3ICEA 4JJZA 3NDBB 4B71A 4C0BA 4W9MC 2PLFA 3REGA 4AKGA 1KI3A 2A30A 1D2MA 2PJRA 3T1QA 3VR3A 5L8VA 4GMDA 5CITA 1TEXA 1TL7C 1N6LA 1US8B 1G4AE 3HYRA 5AUPB 4FMBB 2PH1A 4F91B 1KI6A 1SGWA 4LJ9A 2PMKA 4P4UA 4QBFA 4QBIA 2HLDD 4UKDA 2NO9A 2QMUA 4L8GA 2BM0A 3EWAA 1OH6A 1KAOA 3RS4A 2OILA 2AN9A 3CNLA 4WIAA 2J46A 5CK5A 3QXCA 2W83A 1XMSA 1ZD8A 4PHTA 4Q02A 5A5GA 3GFTA 4LDJA 1Z28A 2O8BB 2WJYA 4JYCA 5H1YA 4PSVA 3OIWA 2RAPA 2VP9A 3SJZA 2J7PD 2DFLA 3E5HA 4M2LA 1WF3A 1FW6A 4CEJB 2XOKA 5LB2A 2QTHA 2QRZA 4KYIB 2A5YB 2GAAA 5G3ZA 3K0FB 4IXMA 4M4SA 4LYJA 3LQRA 4FCTA 5AJYA 2QG6A 3FMPB 1H65A 2JJ2D 2AWNA 1VG9B 3LWNA 3MCAA 2ZJAA 2MMGA 2GETA 3T1TA 2WWHA 1KO1A 5CYOA 2F1JA 3SEAA 2CCKA 1ANKA 2F9LA 2W0MA 4EFMA 4X8LA 5JMTA 3AP3A 1JECA 3HR8A 1G3RA 1G18A 3DOFA 2HCBA 3W5IA 2WOOA 1L4YA 1AM4D 4B35A 1G5PA 1FTNA 1UKEA 2C03A 3IGFA 3BB4A 2QBYB 2WSMA 1WRBA 1T9HA 2ZRCA 1VIYA 4Q47A 1CKEA 4IOKA 5CDFA 4AURA 2KSQA 3EPLA 1E2FA 3VR1A 3H0KA 4TSFA 1G7CA 1XU4A 1G8YA 4GBMA 3UIEA 4CYMA 1P9WA 3K09C 4B2PA 3QNUA 3SYLA 5JI3E 4ITRC 1SXJC 4FWTA 4C0HA 1YZLA 2WJVA 3C7KA 3QKTA 3E70C 3KB1A 3MD0A 2TMKA 1R4AA 2UZIR 3ZVMA 1N5LA 2ZE6A 2PEZA 2ZREA 4URWR 1E9RA 1E2JA 1II9A 2FSHA 1N6KA 2ZSFA 2IEZA 3W6PA 3G0HA 2YWFA 4JVLA 1UBFA 2ZE7A 2XNSA 1LVGA 3D31A 2V4ZA 3BGWA 3SNHA 3IIMA 2QT0A 4LHVA 4RY2A 1G7RA 3AGQA 3WYAA 4WZ6A 1KO7A 3QF4A 1JPNA 5KNDA 2BMFA 2HYDA 3KB2A 3EW9A 4HLCA 2V9PA 4FW9A 2XTZA 4NHOA 4CW7A 3KQUA 1C1KA 3TVDA 3GLGB 5J5CA 5CYPA 2QU8A 2O8DA 1N25A 1GSIA 1Z06A 4BFWA 5JLJA 4AC9A 4P33A 4ESVA 1HQYE 2ZVQX 5EZ6B 2ANBA 3BB1A 4I1VA 4QRHA 5FL7D 1LB1B 4FMDF 1SKQA 5EXPA 3U61B 4Q4JB 1W4BA 4I1SA 3NBFA 1SXJD 2NQ2C 3LVQE 5CIWA 1G8GA 5E7IA 3BC1A 1CF4A 2OM2A 4UXIA 2GJ9A 1N5KA 4LHZA 5FBVB 2H7VA 1M8PA 4LWZA 3MJRA 3ECCA 4ZCIA 2W6IA 3ZVNA 2ODWA 2CCJA 3AVYA 3KUCA 5CM9C 5FUWA 2ONJA 3GLFE 2FV8A 1MO6A 5GVRA 5E95A 3ZD7A 2YVUA 1T4GA 2N46A 4Q7LA 3QI2A 1R8QA 3W8NA 1Z83A 1DO0A 2FZ4A 3AKCA 4XSHA 2OAQ1 2KBFA 5J4LA 2VO1A 5FPYA 3VU9B 1DBSA 2ZU0C 4LK2A 5D3MB 1BYUA 1LV7A 3BK7A 3PEWA 2JDIA 3WBKA 4P4SB 3ETLA 4TTRA 5EJEA 1DO2A 5KYKA 3JZMA 2DCUA 4EPYA 4AIIA 1X3SA 1GNQA 2A2ZA 2YNMA 2FWRA 1TEVA 4POAA 4US2R 4B6FA 2GJSA 2QGNA 4QHTA 2C95A 3SBDA 4BLOA 1E94E 4KO8A 1S96A 2IF0A 2XTNA 3AF2A 3AEZA 4JL8A 3PUZA 4JJKA 5JI2E 1NLYA 1KJZA 1NVWQ 4JS0A 4NYJQ 1VCIA 5LDDC 3TJZA 3U6KA 4F92B 2OFXA 1BS1A 3TIFA 3U44A 5KSYA 1FNMA 1EWRA 1WE2A 1OIWA 1KI2A 1RRFA 3X1XA 2UZ3A 4D2IA 4G5SA 4D6PA 3FMFA 4HAXA 4TMWA 4EUNA 2N42A 4M1TA 2VF7A 1XTIA 1ZAKA 3OE7A 1XJCA 4MRVA 5TDHA 3SR0A 3CRVA 1OXVA 2QTFA 1GM5A 4LRSA 5EP1A 5BYJA 1II8A 1VG8A 1ZU5A 5HR5A 2P6NA 1R7RA 5SZJA 2V6ZM 4TLCA 4IDHA 4DT1B 1DOAA 3K0CA 5EXXA 1T3HA 2O8EA 1S1MA 3RANA 4PZLA 2GZAA 4X8OA 1ZVQA 2A78A 3RS0A 2NO0A 2CHQA 3B1ZA 1L7VC 3PQCA 5H70A 2ZI9A 5BN4A 4EPRA 3W6OA 4MKHA 3LD9A 5EXSA 1PVOA 4MRPA 2Z6VA 2D74A 1AA9A 1LTQA 1GL9B 3FHOA 1D9XA 2WWWA 3HPQA 1EFHA 1UADA 4TYYA 4TMXA 1UBEA 3PIRA 1MR3F 4NYIR 1NN1A 3CZPA 4HB0A 4DLYA 1GNPA 2C8VA 5FBRB 3GJ7A 3T1OA 2NG1A 1K5GA 1XEFA 1W2GA 2RGAA 4UJ3A 2D2EA 3B82A 1XEWX 2O8CB 3KFVA 2PMDA 4DSNA 3THXA 2IS1A 4RZUA 2BJWA 1ZC3A 5ELXA 2LKDA 1OW3B 2BWJA 4MITA 4JMPA 1JJVA 1KK1A 2W2XA 4HEJA 1R5BA 5K8TA 2BEJA 4NCJA 3TR5A 1XD2B 4G3XA 5C2JB 2FFQA 5DSZA 4HDCA 4ZO4A 3MJHA 2YZ2A 3N2EA 3PJRA 2J0SA 1G8FA 2XB2A 2QSYA 1TADA 1COWA 4LJYA 2IWHA 3ADDA 4XWOA 1M6NA 4KJZA 4F7WA 1Q1BA 3R8CA 1W49A 3FE2A 4XWAA 3TUIC 2B7CA 5TV2A 1U99A 5ANRB 1ZCAA 4ARZB 1GKUB 3ZIAA 1N0WA 4V0KA 2Z0MA 1FMLA 4D0GA 4EJSB 4OQXA 2RGXA 1JBKA 4YDSA 2Q6TA 4M8NE 1MOZA 3GMTA 2C5LA 3LVRE 3GJ4A 2XNDD 1SVOA 3HU3A 2OE2A 3KDSE 2IXFA 1ZNXA 3U3JA 3IILA 2N1BA 2OXCA 4JL6A 3EC2A 2ZRFA 3PENA 4JBWA 2YHSA 3BS4A 3DZDA 2W2VA 1NBME 5DI9A 3QKSB 4Z1MA 1RRPA 1N6PA 1Z5ZA 2ERXA 2FEMA 1E98A 2W00A 2IW3A 1X86B 1PLKA 3THWA 1E2KA 2CEAA 4PPQA 3JVUA 1Q1QA 1QZMA 3GLHB 1NJFA 1WBDA 2IEYA 4FD2A 4HLDA 1E2GA 1O3YA 1G9XA 4TN1A 1GNRA 4BPBA 5EE1A 2OZEA 3MWYW 1W47A 2BDTA 2IYYA 3QENA 2XZPA 5JS8A 4AWXA 4TLBA 1NMXA 3SC3A 4NMMA 1KDPA 4UXJA 5FOXA 2QBYA 1XDBA 1G6OA 4F38A 1V5WA 1BOFA 4AKHA 2GEDA 2ZYTX 3KXIA 3PEYA 2PCLA 3R7WB 2IK8A 4LRWA 4OQLA 4C0LA 4E22A 3PUYA 1EFRD 1XCMA 3B1YA 1OYWA 1VG0B 4WZAE 2DZOB 3AJIB 2GHIA 2ZQ5A 1KK2A 1R0WA 4WVFA 2Q3HA 2JEOA 4NU0A 4G0NA 3AF4A 3FKSD 4DBLC 2VEDA 5KSOA 5BN5A 3T5GA 2NIPA 2A9KA 4QGGA 4RSGA 2WJIA 1CXZA 5SZKB 4QKQA 1LNZA 3F5FA 5HTKA 2V1UA 2CNWD 1A4RA 2CDNA 3C41J 5FH9A 3T12A 4EPTA 2HJVA 1O87A 2VHUA 3OIUA 2WOJA 1JR3A 1OLOA 1ZIOA 4M53A 2WMNB 4QHSA 4LHYA 2BBOA 1ZM9A 3KJGA 1EX7A 3ND8A 4YMWA 2CVHA 4KITB 3AVUA 4LZZA 4LOAA 4WW0A 2RGCA 3GFPA 2NPFA 1SXJB 1A5TA 3GJ0A 4KVAA 4PO9A 1J7KA 2RGNA 3RWMB 5FOWA 4BQSA 2XXAB 4M1OA 1N6NA 2W6JD 1YQTA 1WBBA 1Z8FA 3DMNA 2IYVA 1WP9A 2BKEA 3DKVA 4BRWA 4DB4A 3RLFA 4M1SA 3ZLJA 5J4VA 1OB5A 3ASZA 3PR1A 2JLVA 2ZSDA 2ZU6A 4H1UA 4S35A 1OXTA 1R8SA 1MRNA 2A5GA 2MMCA 4Q5IA 1BO6A 4RD0A 3OAAA 2ZI5A 1KSGA 5AJVB 1KMHB 3A4NA 1E1RA 4M21A 4QXAA 1CR0A 4NPHA 2ZUDA 4DLXA 4B3FX 1S3SA 2EFDB 4LUCA 2QROA 4LRTA 1NLZA 4MRSA 1IN4A 4XVRA 1XD9A 2A3RA 3OF5A 4NYMQ 1YJ5A 4HDOB 5JSZB 2ZRJA 1RIFA 2XZOA 2GJ8A 4GL2A 3UG6A 4UNPA 3D7MA 3P32A 1HA3A 1X8KA 4GNKA 5JCPA 2BIFA 3EIEA 1DPFA 3M4YA 3THOA 1KI7A 1T0HB 4W5WA 1G17A 3NKVA 4O2RA 2EQBA 2OFWA 2ZETA 3WY9A 1SZPA 1KO4A 4OJKA 2XX3A 4MYHA 3IO5A 2F3RA 1XPRA 3JVVA 1HUQA 3OEHD 5FOVA 3GJ3A 4N0EA 1RFLA 2CL6X 2IS4A 1N6IA 1E2LA 1M7HA 4HLUC 1CJTC 2XXAA 4JN6A 3EZ6A 3AGPA 4IRUB 3VR4A 3VX3A 1RC8A 2PX3A 2CJWB 5TXGA 4DUGD 1A2BA 2DR3A 3W3AA 4MGYR 1QHGA 1Z2CA 1TUEA 2HF8A 1AQYA 1T8UA 3EA0A 1NF3A 3VU9A 2IHYA 4LJ4A 4RVCA 4CEIB 4ZI3A 2NGRA 2PZEA 1SVWA 1UEIA 4OHWA 2FMXA 1E1RD 3GLIA 3QSYA 5J4YA 2ZSEA 4DLZA 2WICA 3LY5A 5EZ5A 1Z0FA 2P6UA 2AD5A 4DWJA 1F60A 1G19A 4BEBA 1OSNA 1ESNA 4F4IA 1NJGA 2BHRA 5FL7A 3OE7D 4TYWA 2O8CA 3SQXA 4PC6A 3O8RA 1XNJA 1E9FA 1NSFA 3TW8B 3KJEA 1XXHB 2ZVPX 4PC7A 5P21A 2JA1A 2F55A 1HY3A 2QORA 3AKEA 3ADCA 1E4VA 4BRUA 3VKHA 3A1UA 4NYIQ 1PJRA 2V6JA 2AFHE 5L3SB 1TF7A 4BFZA 2GXAA 1NKSA 2FSIA 1F3OA 2G88A 4EQ6B 4A6PA 5F9FA 3N70A 1TUIA 5F3WB 1IY2A 2ZJ2A 1G291 1ZM2A 3PUVA 2F1HA 3PVSA 1KJWA 2ZS9A 4IKEA 2BKUA 2NOAA 2B92A 3Q5EA 5BQ5A 1JNYA 4A8JC 4NH0A 1KI8A 5AK0A 3WHKA 2GCOA 2ZEJA 4RFVA 1SQ5A 3RNLA 1US8A 4KODA 4U00A 3L0PA 3B5JA 2CXXA 3TGPA 1KIMA 4LJ6A 1XD8A 2IT1A 4M9QA 2WWIA 3W34A 4UQOA 3X1WA 1RKBA 2QP3A 2GK6A 3OEEA 1OXSC 4W5HA 4C2UA 3QG1A 2IS6A 1RZ3A 4II7A 5FUXA 1U98A 4URXR 2OAP1 3Q85A 1KOFA 3OHMA 3MUFA 4GMXA 2VTKA 4OI4A 1Q57A 4KV9A 4A15A 4EJSA 3KQKA 3FHTA 3RSLA 1UFQA 4RCZA 4LPKA 1QVAA 1ONBA 4NTZA 4PAOA 4CRWB 4DZZA 2IYWA 2BMJA 3FHCB 4IFEA 3CRQA 4ZV4A 1COWD 1IONA 4HB3A 3W3ZB 2ASEA 2X2FA 4KYUA 1JR3E 4IDQA 4OK6A 4A82A 1VHTA 1YR8A 4JLKA 2GJAA 2X77A 4BE7B 5G3YA 2ZS8A 2YWHA 4D0LB 3U60B 1NLFA 1FTSA 1FFHA 1EG7A 1G5TA 2QQEA 3CX8A 5EQTA 3LO5A 3T61A 4QGHA 3W90A 4B32A 5JWRA 3T35A 3MHVC 1HURA 1EXMA 5JCZA 1NNEA 1OB2A 2WJHA 3LW8A 3GJ8A 3CX7A 3V9PA 1YVDA 2CNWA 3CRRA 3EARA 1KKMA 4IVRA 1IAQA 2H8KA 5BYKA 3AUYA 1ZINA 4HAZA 2QEQA 1GTVA 2WWYA 1JR3D 4N1AA 5FR1A 2QMEA 3SJBA 4PANA 1JEDA 4QBHA 2WSSA 5BN3A 3LBHA 1KDTA 2R6DA 1KK0A 1RYHA 5DI3B 1KZ7B 1YZGA 4B2IA 2JIZA 3RRZA 1Z29A 1GIAA 5KPDA 4LSGA 3IO3A 3WP0A 3L82B 1X8JA 4Q9LA 1A7JA 3LXXA 1P60A 2QSZA 1Y3AA 4M1WA 5JJLA 1DE0A 1G4UR 1ZUHA 3R20A 4OHYA 1NN0A 1QHSA 1PLJA 1WMSA 3O8BA 4YC7A 1TQ2A 2QE7A 1YZUA 4TYNA 1YHNA 3WRYC 4AG5A 2AL7A 2ODNA 4CVNA 1XX6A 2Q3MA 5KHOC 3CIOA 1JAIA 2AKAB 5FTJA 1EWQA 3CB4A 1BIFA 2XB4A 4G01B 5AR1A 4LJAA 4PPFA 3QKUA 1KTVA 4OYHA 4U02A 3C5HA 4OQMA 1G21E 1NKTA 2VF8A 5J4HA 4G5OA 3RVBA 2FG5A 3U3KA 1T0JB 1DAFA 4Y0AA 5DYGA 4MDEA 1CLUA 2VBCA 2JASA 1RYFA 2FX3A 2JJ1D 1ZM7A 1SHZA 3WHLA 1MT0A 1Q12A 2GEUA 2YJTD 3KJIA 3AKYA 3VR2A 3K0EA 3OFNA 4TSFD 2XNDA 1KZGB 4PPNA 2CE2X 4C7OA 3QXSA 2ATVA 1BKDR 4WZBE 3SHFA 1NG9A 2L0XA 4OHZA 1HT1E 4MRRA 1IHUA 1G5RA 2QZ4A 2E87A 2ZRDA 4ZPXA 2F43B 3LV8A 4B34A 2RMKA 3KFXA 1W0JA 2QMOA 1HV8A 2VP4A 3G5UA 3ASYA 4R7ZA 2BM1A 2EWVA 5EE0A 5DH9A 1Q44A 2EU8A 4DIDA 3N5CA 1XWIA 2F7SA 2BCGY 4G5QA 1DELA 2ZM5A 3QPVA 4CGZA 4M1YA 5CLLA 1WCV1 4Q03A 3HPRA 1TU4A 2HXYA 2MSEB 2KE5A 3KX2A 2V7QD 5M04A 3BBPA 2X2EA 1MABB 1KAGA 3WNDA 4IFBA 3M6AA 1X1SA 3RS5A 3TUZC 2Q9CA 5EXTA 3ADKA 4WXRA 2GVDC 1V43A 4WOPA 5JZVA 2JLWA 4I1OA 1E0JA 1LS6A 5KO2A 3WMFA 2QUZA 3RC3A 1UEJA 4UNSA 4HATA 3SZRA 4Q00A 3SFVA 4DC9A 3EA5A 4QGAA 1EESA 3MSXA 4JKIA 1EFRA 2J7KA 1X37A 1E2PA 2RCNA 4GFDA 4C30A 1IJEA 2CL7X 3ZZ0A 4DKXA 5HPYB 1XCPA 4OI0A 1RRGA 3EIHA 1Z6XA 1JXMA 4QOSA 3CR7A 3CR8A 4IW3B 5DO9A 1HYQA 3KQHA 2JLRA 3CX6A 3A4LA 2R6AA 1BMFD 2XEXA 2ZJZA 1I2MA 4KLZA 4F4JA 4HAYA 1KSFX 3KKMA 2OESA 3MFYA 1PUIA 4ZCMA 3ZS8A 4Z8XA 3TVTA 3DHWC 3HU2A 1W0JD 3FMIA 4XTCS 3QF7A 3SYKA 1EFCA 3GFOA 1XTKA 4PXAA 3UKDA 4M9ZA 4Q1EA 5FTLA 2CHGA 2I1VB 1E9DA 2HLDA 2J3EA 3KTAA 3UG7A 2LKCA 5HZHA 2JATA 5LB4A 1WB9A 2WWGA 3KKNA 1U9IC 5D3QA 1TU3A 1XPOA 2H1LA 2QPTA 3V00A 3TE6A 4B43A 2OO7A 2ZRNA 2EYUA 3LRPA 1GL7A 4YMTA 1E9BA 2GXUA 3QUSA 3NVAA 4IDOA 2XTMA 4YONB 5JEDA 1I4TD 5HE9A 4BFVA 1QHHB 4IVPA 4KU4A 4Z54A 3QKRA 1R5NA 1KYIA 1OE0A 1F6BA 1R5OA 4ZDKA 2H57A 2DYKA 3NWJA 2C9OA 4CIDA 2J0VA 1D2EA 2GA8A 1WQ1R 2G77B 4P3YA 1RPZA 2R6FA 3D6TB 1XMIA 2ZR0A 3U3RA 2R9VA 3FFBA 1LY1A 1GRRA 4MH0R 2QPAA 2IF2A 3VHXA 5JHGB 2QI9C 4DCTA 3FOZA 2DFKB 3R9IA 3TAHA 3U3MA 2ERYA 2P67A 1FUUA 3TMKA 3FTQA 4CF7A 2WJJA 5JJKA 3NHAA 3AVWA 3WBJA 4E09A 2EFGA 1IXSB 4Q9IA 2OCPA 5A0FA 2QA5A 3QXJA 1W48A 4NZYA 2GZHA 4KFRA 3A8TA 3EPJA 3RWOA 2WPDD 1W36B 1X6VA 1UJ2A 2HXSA 5G41A 4C0SA 4HAWA 3RABA 1YR6A 3FMOB 3VNUA 1YRBA 4G5GA 4PC3A 2J0QA 4B3XA 1A1VA 4CEIA 2WHXA 4EKDA 1P9NA 3CWQA 3A6PC 1WA5A 3RS7A 4OQFA 3VAAA 1AS0A 3GLFB 1VYVA 1VTKA 521PA 2BC9A 2V1XA 4KLNA 3A58B 3K70C 1FX0B 4Q4HA 4OJQA 4DCVA 3X1YA 5C18A 1Z6AA 3RHFA 3QKSA 1G6HA 4NONA 1L2TA 1W44A 5L3QB 5TY0A 2GILA 2J0UB 1Z0IA 2J9RA 2QAGA 4TQUS 4NCNA 2FGJA 2P3SA 1S2MA 2F1IA 5CJPA 4X8HA 4E5UA 2BVNA 4D0NA 2GXSA 4GOKA 3TKLA 3EZ2A 4JLOA 4DSOA 3TQFA 3LX8A 5JEEA 4Q9KA 3QXHA 3FPAA 2CL0X 5JHHB 1XF9A 4IDPA 4NYJR 4IXNA 2KWIA 1HTWA 2P5TB 3LBNA 4A8JB 4E07A 4ZDJA 3KKOA 2ZRIA 3ZVLA 1OXXK 1K5DA 1Z22A 1Z0DA 3GJ5A 1VHLA 3DKPA 3Q7PA 4ZDIA 2R62A 2WIAA 5FBQB 3K09A 5FPSA 1Q0UA 3SFZA 4QJ4A 3PITA 1N6OA 1XFAA 2QTVB 1VYTA 3Q7QA 3WNBA 2EFEB 1H8EA 3GPLA 4GSYA 2WKQA 3O47A 4ERNA 4LHXA 3LDAA 1S3GA 4KSBA 1IXZA 4C9BA 3NBXX 1E9CA 4FMCF 1ZNWA 3TNFA 1W5TA 1E79D 2VHTA 2GRJA 3P4YA 3LW7A 4TYQA 3LXRA 4JLAA 3LX5A 4DDUA 2YC2C 2GESA 1XTRA 1UM8A 3PEUA 4DIEA 2OV2A 3CH5A 3CNOA 3UANA 2ORVA 2DWZB 3GEEA 2CJWA 1UBGA 3TSWA 4Q4JA 2HT6A 3HR7A 2OCBA 2V8OA 1OHHD 2ZE5A 3AF0A 3RRNA 4B6EA 5HKKD 4FWGA 4P31A 3RYTC 4Q9JA 4I4LA 2J45A 4ASUA 1N0UA 3A4MA 4YMUA 2FOLA 1W36C 4US1R 4NCKA 5JBQA 3B9PA 2KRKA 1E3MA 1ZM4A 1XRJA 2FU5C 4GITA 4FWIB 1QRAA 3OZXA 2ZE8A 4GPTA 3AVOA 3EWSA 4DLSA 4PQYA 5IDVA 4L16A 1KI1A 1R10A 2XZLA 2VP6A 1ZUIA 2NZ8A 1MRSA 4IOLA 4TQ9A 3QPUA 5IT5A 1W1WA 3GEHA 5L3QA 1GKIA 4RZ3A 1JXOA 3R9WA 3F3YA 3HWSA 1SVIA 3MG9A 2OFOA 4Z51A 1D6JA 2IA5A 2QQ0A 4AYWA 4C0KA 4NP6A 4FWHA 1P61B 4TL9A 1YKSA 4V0OA 3TW4A 3SS8A 2ZRLA 4LCBA 4PQFA 2Z83A 3BRWD 3U2QA 2OSBA 2ZSBA 4FIDA 4GOJA 4P4SA 5F2EA 2CVFA 3X1DA 5JWOA 3R7WA 4L9SA 3D3QA 4S2EA 2VQSA 1P9RA 1N5IA 3UMSA 4DVGA 4MGKR 1ZU4A 2FJUA 2R44A 2J5XA 1ZYUA 3K70B 4JIMA 4A0GA 3OFND 4A0FA 3ZZTA 3BH6A 4I99A 4OK5A 1BMFA 2G1KA 3I61A 1YU9A 1NMYA 1RRCA 1XTSA 2HCJB 3ND9A 2ZI7A 1DAMA 1E32A 1OYYA 1T3LA 4RD3A 3BB3A 4CT4B 5DGXA 3SU8A 1KNXA 3C14C 4IVQA 4Q4LA 1EFUA 3IQXA 4IJMA 1G20E 3NG1A 3W6NA 2JLXA 4A6XA 2DWPA 1N3BA 2AK2A 3Q9LA 3PXGA 3TAUA 4O2LA 4EAQA 4L15A 2IYSA 4KBGA 3VTKA 1OH5A 5JJIA 2ZRHA 1AKYA 3KXLA 1P3JA 4TT3A 1XJ0A 2OBLA 1CRQA 1DAIA 1VMAA 1M1YE 1W4CA 2JLSA 2KI5A 2W58A 1E2EA 2FN4A 2V7QA 2AK3A 4B47A 2VL7A 2ZRKA 4TZ6A 2RHMA 3GLGE 2GAOA 3AB3A 1AQUA 4L5BA 4TMKA 4JBXA 2ZAOA 5C4GB 1G3IA 4PFSA 1L8QA 2PX0A 2WTUA 2A5DA 1CU1A 2G83A 1MH1A 2VRWA 2DBYA 1H8HA 2C77A 2QL6A 1CJVC 1G7SA 3QPWA 1P4SA 2HJGA 5JRJA 1JAHA 1XZQA 2OXRA 1R2QA 3CF6R 4MUBA 2ZUBA 4B48A 3A37A 5TVKA 1U8YA 3OIVA 1XXHA 4JVNA 4MYCA 4R9UC 4TL7A 4WXPA 5E7JA 5L3RA 3FYHA 4MRNA 5KOYA 3FGNA 3GD7A 4M0LA 3T5DA 2AXPA 3B60A 4NL4H 1J99A 2IBMA 5CK4A 3L8ZA 5B2ZA 1Z07A 4QM7A 3OEHA 4XIGS 3LQQA 3AVPA 1CJMA 4EIWA 2F9MA 1P73A 4A3VB 5SZHB 3ICQB 1IOZA 1B23P 4ZDWA 4LGMA 1KMQA 3W5JA 1FZQA 5FTNA 1S4QA 2ZJBA 2ZR7A 3BJIC 2ZI6A 3CF0A 1DTSA 2BMEA 2DFTA 4V0ME 3SOPA 2BMDA 4HUQA 4PAQA 2KBEA 3I92A 3VHLB 4WAUA 2O0JA 2O0KA 3MAAC 3TRFA 1IQPA 3H84A 4PX9A 2KJQA 1QF9A 1XJQA 3W9YA 1TPZA 1M34E 3VLFB 3A36A 4R2IA 2RGEA 3N2IA 2Z43A 4QM6A 2GBLC 4W7SA 4A9AA 2EFHB 1C4OA 3ZJYA 1GVNB 2GZDA 2JLYA 3OIYA 3CONA 3DM9B 3QVUA 3L0IB 4QL3A 3RS2A 1IN8A 4DDWA 5JECA 3IDQA 1VPLA 2WAYA 3P20A 4XSGA 3VKWA 1KKLA 2JAQA 1DEKA 3AF1A 4D25A 3WYGA 4HDQB 1J70A 2DWQA 2GCNA 2FF7A 5F98A 1ZJ6A 2GWHA 2QT1A 3KQNA 2NO6A 4NBSA 5DHFA 3QE0A 4OQNA 2IYRA 4HSEA 4DB2A 4LJ5A 1KJYA 1TMKA 2G6BA 5K8IA 2ONKA 2FFHA 2SHKA 3ZD6A 4UJ5A 4Q18A 4QNRA 4G1UC 1U8AA 1YRAA 2REXB 2C9YA 2ODBA 3BFVA 4HLUA 1NIPA 1JI0A 1G8PA 1G16A 3KL4A 4BFXA 1T5IA 3QEJA 5EP3A 2F43A 3KKPA 5EUMA 2D4HA 821PA 1N5JA 3K9NA 5J40A 5B58C 1U90A 3K0AB 3MWJA 5BW8A 5KNCA 5F9HA 4R71A 1FQKA 4QC2A 2PZFA 4B44A 1XMJA 1QBKC 2B21A 4LBZA 1KDRA 5L3VA 3CUEF 4L9WA 4Q19A 3CM0A 4WA7A 1L4UA 1ZUNB 4UNQA 2OT3B 4MKIA 2I4IA 3RDPA 1MO4A 4LV8B 2OLJA 3V4FA 3ZS9A 1HT2E 3CNNA 1B0UA 3IPYA 3M0EA 1QHNA 3C15C 1U94A 3O8DA 2W6JA 1QHIA 1SVLA 4Y0VA 1KNQA 3K9HA 1FL9A 1P2SA 5CJ2A 1XEWY 5A4JA 3SJCA 4JYBA 4HI0E 4WBSA 4YMSA 5CB6A 3CWZA 3EZFA 3CPJB 1E9EA 4A8JA 1OXUA 4PHFA 2WJGA 5FI1B 5DE3A 1LF0A 4LBWA 2QP4A 4BECA 1N0VC 1D8TA 4ZIRA 1SKYE 2CLCX 2WV9A 1GAJA 3DOEA 4DLUA 3JZAA 3OAAD 4FI3C 4D81A 2PJZA 4J0QA 1P5ZB 1XTJA 2H18A 4TTQA 2B8TA 1QHHA 1Z0JA 4BZXA 1HH4A 5LD2B 3ZDQA 4AY2A 3RAPR 3TR0A 3CF2A 3AVQA 2WIBA 3EPKA 2IX3A 1GOTA 5BWMA 3F0TA 2QAGC 5DN6A 4JLJA 3UK6A 5C46F 2XJ4A 2VYFA 2VP2A 1C1YA 1CR2A 3CH4B 3B2EA 4KFSA 4LYFA 1IY1A 3K1JA 2ZS7A 3CPEA 5E4FA 2EYQA 3KUDA 1UKZA 3GJ6A 4HYYA 5GVSA 2IYZA 1T5LA 3FKQA 4D4KA 3BIFA 1QZXA 3I32A 3P1JA 4GI7A 2X8AA 1G1MA 1E99A 1W4RA 4BASA 4O0MA 4LY6A 1W4AA 2IUUA 1E1QD 4MKGA 4Q1AA 2CLDX 3BAFA 3DMDA 3EXAA 4GP7A 4KVGA 4A2QA 1DG1G 1EK0A 3GQBA 4F93B 5H8WA 1K8RA 1S1CA 3I8SA 3VX4A 3AVVA 1M7GA 2H17A 2YOGA 2WPDA 4MYTA 1GL6A 1T6NA 3AKDA 2DPXA 2HDNB 2JDID 1KSHA 4Q48A 2QN6A 4G5RA 4DDVA 1QHYA 4Q7KA 5BXQC 4AI6A 4IEIA 4DRZA 1E0KA 2QM8A 3PG5A 5K8UA 1T8TA 1TQDA 1UDXA 1Z63A 1KY3A 1N2CE 4R2HA 2ATXA 3BERA 3DPUA 3KZ1E 4HZUB 4TMVA 4ACAA 3SBEA 4RZXA 1S8FA 1TTTA 4C0JA 4LYAA 3HDTA 1XB2A 3NBYC 1LS1A 1W5SA 3UWKA 1WDTA 4LV5B 3K70D 3M1IA 1GDDA 2GK7A 2OHFA 2D7CA 4D82A 4QJ3A 1LF5A 1U9IA 2FSFA 3CO5A 2FH5B 3THYB 2PBRA 3AF3A 1CRPA 2YWEA 2PCJA 1IN5A 4Q1CA 4OHXA 2QRNA 3MRSA 4RKEA 3NH9A 2ZJ5A 3MMPA 5KUTA 1XEXA 2WMOB 2XITA 3L2OB 2DWOA 4Q4AB 1YZQA 2EVWX 2R6CA 1PV4A 3TSOA 3KKQA 2J59A 1JJ7A 3B78A 3NC0C 1H8HD 4FN5A 3GLIE 2GCOB 2J1LA 1VG1A 4W5JA 1TNDA 4A4DA 1G41A 1JEEA 221PA 2AKYA 3ZQ6A 2CE7A 1OIVA 3H86A 2AXNA 4PO8A 3T1VA 2X19A 5IF9A 1J2JA 3B1VA 3QVVA 2OLKA 2V55B 1NI3A 2Q21A 1AKEA 4M1MA 1NRJB 1R0XA 3I73A 5C4MA 4RD2A 4JLPA 4FCVA 2IS2A 1SXJE 1G3QA 5FBWB 1M74A 5CLQA 1ZBDA 1AZSC 4HZUA 2GKSA 3T15A 2O8FB 1KDOA 121PA 4ARZA 5G53C 2HV8A 2NTYC 3AUXA 5J47A 2G3YA 4B74A 1S9HA 5EP4A 4URZR 1ZM3A 4KI0A 3PEVA 4BLTA 4O3MA 2F6RA 2JIZD 1ZW6A 1XBTA 4ON9A 1Z3IX 1BYIA 2R6GA 1M2OB 2VSFA 4B3BA 1YE8A 2QY9A 3K9GA 4U7DA 2G0TA 3QQ5A 2G0NA 1GWNA 3LNCA 4RD1A 4Z8YA 2J7PA 5B57C 3IUYA 2MSCB 2GXQA 4H1VA 4JSTA 4ILEA 3KW6A 4XVUA 2ZJ8A 3C8UA 1OT3A 1Q3TA 2QAJA 1F2UA 4M22A 3B85A 4TWZA 3WYFA 3Q3JB 4CZ2A 4QG7A 1PLLA 2GBLA 3U4QA 3QBVA 1E2DA 2DFNA 1P72A 1F5NA 4A1FA 3I62A 2P2LA 3FB4A 1XZPA 3G82C 1TF5A 1E69A 3EZ7A 4JKYA 4QNMA 2BBWA 5HCNA 1VECA 1VIAA 1S9DA 4FMDB 3GLGA 1AIPA 4DEXA 2O8DB 2ZI4A 3LFUA 4EPXA 2XJ9A 4HB4A 3TH5A 2Q9BA 1CTQA 1AGRA 1NIJA 1CBUA 3QIAA 4A2WA 3K0CC 3B1WA 4CEHB 1Q22A 3SHWA 4DLWA 1U0LA 2AR7A 2QPOA 2ZTSA 4BZQA 3NIBA 3UMFA 2ZSAA 421PA 1OIXA 5UKDA 4XH9B 4DSTA 4XJXA 3AM1A 1P6XA 2D3WA 1GFIA 3L0SA 1RJ9A 5AWFC 2IYQA 4XVQA 4PO1A 4B75A 3TQCA 1Z0KA 1HEIA 2QGZA 5DNYB 3EASA 621PA 2Y8EA 5KSPA 1AZTA 2IXEA 2VH5R 3K0SA 2IUTA 3CZQA 4K81B 1TF2A 1Z6YA 1NSTA 5GJBA 1ZCBA 4PC2A 2ZITA 2R8RA 3L0OA 1IXRC 4DLVA 2JLZA 2RH5A 3BORA 1G64A 4JLMA 1QG2A 2J87A 4DHEA 4BFUA 1DAKA 2XAUA 4V0MA 3VNVA 2ZRAA 4MUAA 3NTUA 3X1ZA 1HE8B 2YOHA 4PZZA 2ANCA 4QHYA 8OHMA 4OI1A 3U6BA 1KO5A 2HEIA 2PZGA 4EPVA 4JT2A 2R65A 4OI2A 721PA 1AJEA 3Q5DA 5GJVC 4FXPA 4CEHA 2ODEA 3RS3A 3EPHA 3U7GA 3SDZA 3J81k 5J4KA 1NY5A 2FPKA 2ZYWX 5GJWC 3RRYA 4RFSB 4AD8A 2NMVA 2IYXA 3EIQA 4DJTA 2R2AA 3I1FA 3U7EB 3GEIA 2CMKA 1JALA 3U7FB 2ZROA 4GT1A 2AFIE 4LX0A 4KCGA 4TL6A 2C98A 1YZKA 1ZNYA 4OBEA 4PAMA 5FPHA 1XP8A 4D4LA 4KBFA 4RFSA 3H1TA 2GTPA 1SVKA 4LV6A 2OG2A 3LAWA 4NYMR 1XPUA 2BOVA 2JLUA 1KI6B 2JJ8A 2GCPA 1AGPA 1X1RA 3EG5A 1E2NA 5FUYA 4YDHB 4HB2A 5E7MA 2A5FA 4PTLA 4D80A 3MWKA 1VCMA 4PQRA 4OK3A 1KHTA 3BD9A 5HCIA 4F4CA 1E2MA 2KB0A 3NC1C 1MV5A 4A92A 1E6CA 3QOFA 2CK3D 1UBCA 4JBYA 2E1RA 1NVXQ 4AKIA 1KSJA 2VHJA 3VR6A 2ORWA 3QG5A 4LYHA 1T91A 1VCNA 3NHBA 2J0UA 3E1SA 4V0LA 3QXXA 1GUAA 3K0AA 3VQTA 2H5EA 1IBRA 5FPTA 1W36D 1P2VA 2YINC 4B3GA 5IHPA 1N6HA 1NBMD 3DDCA 4V03A 4BLRA 2AX4A 1NY6A 1HE1C 4AK9A 4BFTA 4LJ8A 1XCGB 2IYTA 2Z4SA 1NP6A 4IHQA 1OFUX 2VSOA 2IL1A 2REOA 3BE4A 2W6ID 3SI7A 5DHAA 5JFGA 1E2HA 4TL8A 4TMZA 5TMPA 1BH2A 2O52A 1G8HA 3IPXA 3L8YA 2JGNA 4KHZA 3B8HA 2HF9A 4JT4A 3LBIA 4RD6A 1GRQA 1NVVQ 1R6BX 1CR4A 1OFTA 1ZC4A 1IN7A 2GF0A 4B76A 3ZYCA 4YQFA 3K9LA 2CHVA 5FFMA 3QEOA 1GP2A 4BLQA 2EWWA 4JLVA 4PZYA 1E4YA 4Q7MB 1ODFA 5FPKA 4B2LA 3PFIA 1OH8A 2OEPA 3CRW1 1KK3A 2RGDA 2QMHA 3PUWA 4GP6A 3VMFA 2VLIA 4OKSA 2FE4A 2NO1A 2CK3A 3HYTA 4PPGA 2IHBA 1JQJC 1OH7A 4QFMA 4PC1A 4C4PA 4Z1MD 3ZH9B 1FOEB 1ZIPA 2FGKA 2VP0A 4Q21A 5FOUA 4NKRA 4JL5A 3UATA 2ZIAA 4M1KA 2GEVA 3CRMA 1OFHA 2V54A 4A2PA 5IRCD 1CULC 2OBMA 4JVMA 2EFCB 2G1JA 4DCNA 2IC5A 1ETUA 5FR2A 1KGDA 3GLIB 1M7BA 1W2HA 4FMCB 1AS3A 5FUVA 4V0NA 1SULA 4DXAA 3BFXA
chains in the Genus database with same CATH superfamily
1BFDA 4E51A 4KIUA 2NV6A 4NJEA 4BFSA 4RVUA 1Z75A 3CU5A 4PLFA 4RULA 3ZWNA 1LVUA 5ADWA 2XW6A 1Z7EA 5AJWA 4B4DA 2CDBA 3IHLA 4MQLA 1LH0A 1B73A 1TZJA 3TSZA 3B7QA 3KQVA 3IEUA 5CGZA 1UJ4A 1DUIA 2NPIA 1S2IA 5CM8B 3V1KA 4ZVRA 3NYWA 2EX1A 3DDUA 4CIVA 3L4JA 3LDUA 3KKEA 3B13B 4UM5A 5L3ZA 4IX9A 2QENA 3S81A 3R75A 2EJUA 3VC7A 4YMGA 1EVKA 3BH0A 3IODA 4ZKEA 1YR3A 3Q15C 3THRA 1FYVA 3P9IA 3WSWA 3KOWE 4QGSA 1P7PA 3S2UA 3QBTA 5IXJA 2ZI3A 4ENWA 1F2TA 4RHCA 4XWKA 1YL5A 2ZPTX 5CLGA 4G5HA 3R8FA 4L0DA 5DPMA 3GPIA 1UODA 2WBLC 1Q77A 4M6WB 3CG0A 3SJAA 2XCRB 2D00A 4JA2A 2QLLA 3J2PB 2XQJA 1LK0A 2DB3A 1RCFA 1A3CA 4BUJA 2ZT7A 1Z6TA 3KQQA 2YZKA 4B08A 4MWZA 2PUEA 2VKTA 3PCRB 4FGKA 4RLSA 2L09A 4OMDA 1XE3A 3E8MA 1CNEA 5BPHA 2Q2VA 1R6VA 1RWNA 3U6OA 4GM4A 2ZPUA 3E82A 4KACA 1HZZC 3AFMA 3BXHA 4L4RA 4UPEA 2D06A 9GPBA 3UPUA 3GPCA 1EGAA 5LD2C 5AW2A 1Q91A 3F7TA 4BGVA 3STTA 1MKYA 3BX1A 2I4TA 3DL0A 5CDUA 4RL4A 2BFDA 3BTOA 4L3WA 3IUJA 5FD8A 3VR5A 3BD7A 4H0CA 2B7BA 1JV2B 4X65B 2BV3A 4IBIA 4JP3A 2JK0A 4ABTA 3PFFA 5BNFA 3BA6A 5G0WA 4YJ3A 3U3OA 1UR5A 4HDAA 1NN5A 2F3QA 2WAOA 4DXHA 5HIAA 1NBHA 1DEHA 5D01A 1EK6A 2ZZNA 1CPYA 1E5XA 1OZAA 1UJCA 1DL5A 4AJ4A 4XW2A 1WY7A 5C7OO 5KOHB 4QSMA 2NO7A 2PHZA 5CNIA 3PCTA 1YIOA 4IGFA 2BFOA 4PGGA 2B37A 2QX6A 3UMJA 1LRKA 2EZUA 2P5SA 1K3WA 4P6VF 3RASA 4M7OA 2HQ1A 5IBRA 5A03A 3RKSA 2UYYA 3FVQA 2DHEA 1F7UA 3BMCA 3R23A 2XFSA 2E49A 4OP1A 4XGRA 4NFHA 5C32A 1A9YA 5A3VA 4D79A 3FI0A 2QL5A 3JPYA 3DVRX 3OZRA 4J6EA 1MNAA 1ZZEA 2ZYUX 4MJ7A 5IYZF 2X0RA 3FBGA 2H51A 4UMDA 3U3DA 2WKRA 3G8CA 2H1SA 3CUWA 3LQYA 2F8MA 2ZJOA 3GH1A 1XZJA 4MVYA 5TLSA 2ESRA 4AJEA 3EZ9A 3T3EA 1TGYA 3ROKA 2CUTA 3R40A 4HLQA 2XUDA 4X66B 1NU6A 1FQJA 3WRXC 3L25A 4IIJA 4ZCQA 3WGGA 3D54D 1KQPA 2XGJA 3GMDA 4ALKA 4CQNA 1I4LD 2P1DA 4R8SA 4AIIA 2HHAA 3DKIA 1P6QA 2ZCVA 4K6OA 3P2YA 3WB9A 5L3SA 1QVRA 3E2IA 1QO0D 1U8ZA 4IIGA 3GCXA 4MA4A 3OE5A 2IPXA 5HZKA 4INOA 1SCNE 3G7SA 5DISB 4RD4A 2GRAA 3IUBA 4RGBA 2QR5A 5I9NA 2BFFA 3E9DA 4BMXA 4Z7NB 1U8FO 2UKDA 3R0JA 2VHQA 2H4JA 1WXQA 4B79A 4C06A 3UUGA 4CUKA 5E0KB 4L9AA 1C0KA 2C82A 4CQLA 5H0IA 2R0IA 1XZHA 4AN1A 3IKTA 4FFMA 4ZA2A 3VOBA 1XRLA 3OJXA 4TTPA 1T0UA 4EGQA 3JWEA 3KT3A 4WBXC 1RDFA 1F1JA 2OC4A 4UXHA 3OZ7A 3V7NA 4UFPA 3AW8A 1DIBA 2JFZA 4RE5A 3GNQA 1F2UB 1U7WA 1YVRA 3D6FA 3DTVD 3OFSA 5KNDD 2VDOB 3IX7A 3PNPA 3AEKB 3N3AC 1AUVA 2UVQA 4NZMA 3DFUA 5ICFA 3PF9A 4GECA 4QDZA 5EUQB 1J4AA 2FS1A 1PT9A 1YE3A 1Z2AA 2FPMA 2V5VA 1HL3A 4Q1BA 2PU7A 4RGVA 5KPRA 2PT9A 5FNZA 3JZFA 4L78A 4GGPA 3SF8B 2R4UA 3VAYA 1E5VA 4AMVA 1SCDA 4K6HA 1K89A 5MFPA 2Y1OA 4EW6A 3WGLA 2UYQA 2ECKA 4YXWD 4H17A 1Z5VA 2YHUA 3AJDA 1S0UA 2HUPA 2W42A 1IN6A 4P98A 2RKWA 4WN9A 1TZKA 5DI3A 4OATA 3HE3A 1NFRA 4OJTA 2JLBA 2AN1A 3INGA 4Q7JB 4H15A 4ZXPA 4AY5A 2QLBA 3FVVA 3WGZA 2QQFA 4Y18A 2ZIXB 3C6KA 4P58A 4LFAB 1TUBA 1E0AA 4BE9A 2JJ1A 3EGEA 1PT6A 4I50B 2C5GA 4GOMD 2A6PA 1SCUA 5C1IA 3OCWA 3ZBUA 2JGDA 4D4MA 1ADYA 4KXFB 1W5AA 3AWIA 4LPSA 4I55F 4TROA 4CKWB 1SIOA 3URKA 3LNTA 2F1RA 1WHSA 1D3AA 3C4QA 2I1QA 4GBJA 1I4DD 4DZRA 1XTTA 4P92A 1OWMA 4MUGA 4GXTA 1WAMA 3FDIA 4N3NA 3EEYA 1SQGA 4MGZR 4GQAA 4I1UA 4I1IA 4XGIA 1NA5A 1Q0HA 2ZR9A 3LH5A 2IFTA 1UF9A 5CTJA 5EUCA 4FX5A 2FA9A 2Q3FA 2O8EB 3AESB 4YQZA 4PYLA 4JLNA 3W2IA 3BD8A 3EQ6A 2REBA 2ZB8A 3HL0A 1RT9A 1Z2PX 4Q6WA 4TM8A 2D7DA 5H81A 4X1IA 1ECJA 1STOA 3N7TA 4HS9A 1KQGA 4G4JA 2KS6A 2JF0A 2E9SA 3F8TA 2DHCA 3BTVA 3ED5A 4GIPA 3MOSA 4NCIA 3WMGA 5KWIA 3EH1A 3LUAA 2AH5A 3AM3A 4GU5A 2WV7A 3K0FA 2IIBA 1MAVA 2PTHA 5B30A 3OPXA 4O4HB 1QF6A 3HHZA 3OZBA 4BS9A 5EKSA 2X1VA 4EKNB 3PS9A 1TAGA 1X94A 3GCDA 3I01M 4AROA 4DSUA 5FTKA 2ZJ0A 1H94A 5J2TF 2XRZA 1G63A 4BQQA 4WNCA 5CA1A 4A0HA 1QUSA 1A8QA 1GRNA 1F2TB 1K8QA 2H85A 3FCYA 2PRSA 1DBQA 1U2RA 2D5AA 4L28A 3U49A 2IX9A 1CFZA 3FX2A 3WB0A 4B2YA 5KDOA 3JS5A 3OLWA 1JEYA 4J0GA 1NVBA 5LLDA 3TZ6A 4B40A 2UUBB 3I1YA 4URYR 4QBTA 3OESA 3AI1A 3IKJA 5CLIA 1Y1LA 1YVEI 5DRYA 2QKYA 1VLLA 2V74B 3T06B 1RLTA 3VHXB 4KDRA 1U1EA 3EGWA 4A16A 3NW9A 1CJUC 2BE7A 5G40A 1ZH2A 2XWJI 3AHEA 2DHRA 5KNBH 1M0TA 1R6TA 3LZCA 2AF4C 4FYHA 2VJAA 3SMVA 4R1LA 2GFIA 3OP1A 4QTYA 1L2DA 3ENNA 4KGXA 4EWLA 1A7UA 3ELDA 1ENOA 2JCSA 4ALJA 3H2BA 4OXYA 3EFOB 3CPHA 4ZT5A 5BSHA 3WGKA 2BBSA 4QYSA 1NULA 1IOVA 3F46A 3HJAA 3I2YX 3OLVA 3RSZA 4XX0A 4PQGA 2BONA 3UCEA 1ZVJA 2KHZA 4ZAGA 4BWVA 1HGXA 1UZMA 3M81A 3L5OA 4LGYA 4UNNA 5GJCA 1MP0A 4N41A 1ZMVA 5KWVA 3NLLA 3W4IA 2Y1DA 3MT8A 3C3PA 3ON5A 3RFVA 3HTXA 3FFAA 3UHAA 2C4WA 4IPTA 4CLRA 1IY0A 5JISA 3E1GA 2R7MA 1HMYA 1P4RA 4C07A 4XTRA 4JCCA 1GNLA 5DIFA 5CXQA 1M2WA 1OKKD 2HL7A 4PYNA 4O59O 2PLRA 4V02A 3TLYA 4Y6OA 2DFPA 4LCJA 1NW5A 2JHAA 2MSNA 2ORIA 2XBLA 2Z2XA 3AESA 1ZRSA 3UHJA 2WU1A 2X49A 3MTBA 3T34A 1V1MA 3QW4B 2ECOA 5ALIA 3W3AH 3FCOA 3OPYB 1VHQA 4MJXA 3VR5D 3S1AB 1B15A 1P1JA 5CXXA 1BW9A 2Y0CA 3AETA 3NONA 3CWCA 1KI4A 3AUTA 4Q1DA 3ADBA 2HA5A 1YZNA 4UTRA 1Z0AA 3H2GA 4LNUA 4CJXA 4EMBA 1DAPA 1Z5BA 4ZHQF 1ZGGA 5KDDA 5LYJB 3TFOA 1QVZA 3ABOB 4FCWA 2ZQYA 1CETA 1KU0A 4QJ5A 5F1KA 3TWLA 3QEMB 2WMYA 1YZFA 1QCZA 4NBUA 3RBXA 1P3QQ 1FS5A 1QR6A 1N33B 4GDFA 1P7CA 1P1RA 1GPKA 3U40A 3H11A 4H7IA 3SYRA 5JALA 4L6V6 4DBVO 2RI0A 1DV2A 2I55A 3UJAA 3FYDA 4KAXA 3WHPA 2UZ4A 2N47A 2GUWA 2JC3A 3EY4A 3GZNB 4UCQA 2ID9A 4W9NC 3OIGA 4KFUA 1KY2A 3JWHA 3L84A 4J94A 4JJGA 4UFNA 1DXHA 4D8TA 1TK9A 4LK3A 1LEHA 1AO3A 1HYEA 2GARA 4FSHA 5F21A 1KDVA 3QFTA 1R4NA 1ULUA 4E08A 4ZI7B 5CFMA 1FUKA 2G36A 1YZTA 2VSQA 4UBOA 1T9AA 3WIEA 2J4DA 3VYSB 4CKCB 3KBBA 3OTOB 3G0DA 2G67A 1I7LA 2EKQA 3GG2A 1SFRA 4E1AA 1M8GA 2QM0A 4K46A 1V2GA 1NHGA 1Z74A 2B7LA 5ALRA 2JAXA 2P4EA 4R2MA 3AHJA 3X1KA 2BMVA 1IM5A 2J3KA 1NURA 2PR7A 2QNRA 3FHLA 2CBZA 3C6QA 4HWPA 2RH4A 4HMQA 2IEBA 4DA6A 5KU7A 1HE5A 4PR0A 4DWWA 4WZAA 3B74A 4EY3A 4ZKDA 1H4VB 3T3NA 3I23A 3OECA 3RC8A 4PXSA 2R6R1 2AD1A 2I3ZA 4M0WA 3FN4A 1GPMA 2P78A 5JANA 1FMTA 1DEOA 1GG9A 4M9XA 1ZIXA 1GZSA 3KTAB 3UMRA 2V3CC 2LWXA 2QW1A 3CKMA 2OUKA 2VJYA 3LX6A 5F35A 1C3LA 5IUJC 5EE9A 4XD7D 1BC5A 3LFHA 4RZ2A 3A32A 5D00A 5CW1A 5HFAA 3FZNA 1EUCB 1WSAA 1WOYA 2DHDA 1HQCA 4H6VA 5ELLA 4EDHA 4GYKA 3K0KA 5IVDA 3R3SA 5T5QA 1Q20A 1KZ1A 4N6OA 4P4TA 1M6HA 4R6WA 4W8OA 5EJIA 5FL3A 3RRFA 4AIRA 3I5YA 5DYIA 4FS3A 2BBTA 3JARA 4A26A 2OPBA 2UYOA 4RABA 2XMGA 1LX7A 2PPLA 4TUWA 1WHSB 1B42A 2ZR8A 1N9GB 2AIRA 3AERB 2X3FA 1E3IA 4I36A 2DF8A 5CVJA 5EFZA 1I80A 1BRMA 1NN3A 2O4CA 1K06A 3H2YA 3S1AA 1ZX1A 3ZLTA 1J90A 5A1TA 5L53A 4M0EA 5H9VA 3AR2A 3D8HA 4QYXA 1WXEA 1VPDA 2WWXA 4GBGA 4IF6A 4LYDA 2HFKA 3BRCA 1P2TA 3H5LA 4BWYA 4ALMA 1OX4A 4CDRA 4UM7A 1XT6A 3FCAA 4GOXA 3FPKA 1DAEA 1E1CA 4MGEA 4C4YA 3LQ1A 4ZTZB 2JI7A 1NBIA 5IK2A 1W7AA 1CB7A 3SM3A 1IEXA 3L1IA 1LRJA 4AY4A 1DUSA 5D3MA 3ZCQA 1M34A 1ISJA 1GO2A 3GWZA 3BZBA 3I2HA 3P27A 4IOMA 1WKCA 1WZIA 4UHBA 3J7AS 5K3FB 3ICEA 5DNEA 4ZJYA 1HNXB 5AXCA 1JSXA 3R44A 1YGPA 1L5RA 2NADA 2PDAA 3KHUA 3WIOA 2FZ5A 4PDGA 2QY6A 3PGJA 1SUSA 3NI2A 4QYTA 3V7WA 4CN8A 5IBCA 5D5PA 3KOXA 3CS3A 5I51A 2A30A 1NPDA 3EOBI 4G37A 1FUIA 1RCUA 2HQOA 3TDMA 4E3ZA 3T1QA 2RAVA 3VR3A 1QRTA 2W7TA 4GMDA 4YP1A 2FFRA 3MB5A 1E1LA 3R7NA 1RMYA 1TL7C 4S1OA 5CITA 5JCOC 2F62A 3AJ9A 5F73A 2K6BA 3GYBA 3OSUA 4FMBB 1VA5A 3DUFB 3WYNA 4CN9A 4P08A 3WGUA 2PH1A 3G23A 3HV0A 4ROSA 3H3FA 1SGWA 2FQYA 4UKDA 2HLDD 2SBTA 1LQUA 1NJ2A 2LP4Y 4L8GA 4EL0A 4MM3B 1OH6A 4QAJA 1KAOA 3CNLA 1KRHA 2A4MA 2OCIA 4C7KA 5IN5A 1Z5PA 4C88A 2DTEA 3AIOA 5LNK6 4RVDA 1XMSA 4PHTA 3GFTA 3NHLA 4L74A 1NW3A 1PF7E 2QJOA 3R6LA 1URPA 1SD1A 1YB4A 2X4GA 5EL0A 3OIWA 5IH3A 4E2FA 2PGNA 3TEMA 3KSRA 2DFLA 4MP6A 4KIWA 4M2LA 4XUGB 2VNSA 4OA8A 1V7CA 2XOKA 1L8XA 4NSRA 2I2AA 4JT8A 5LB2A 4B0OA 4EG8A 3ETNA 4KYIB 2F3UA 3A3YA 2DAKA 2A5YB 4IBGA 1FS4A 1WLSA 1HNNA 3M4XA 2BUCA 5G3ZA 4EVSA 2E4VA 3PNBA 3QOYA 5AJYA 2FPPA 4J1NA 3SLKA 4EMTA 3CEMA 5HMLA 3FMPB 1CF2O 4Y6RA 5C5DA 1KIFA 4AQDA 3S4YA 2GETA 2OFFA 2X8JA 2WWHA 3UT5B 2K2QB 2Q5IA 1GABA 2A33A 2CCKA 1ANKA 3OZGA 4UHKA 2D2IA 4CLRB 2DI0A 2FR0A 3PNQA 5JQWA 5JMTA 4JYMA 1JECA 1PZEA 2YHAA 1AOXA 3DOFA 4GYWA 1FVFA 4BQEA 1SBCA 3V9AA 1UT6A 1FFYA 4AN4A 4GIBA 3PVCA 1A5ZA 2QBYB 2ZRCA 2WUVA 5AUQA 3TL6A 4H60A 3CB2A 2WFMA 1G7CA 1XU4A 1G8YA 3SMQA 1NYQA 2QQ5A 5JI3E 4L07A 1SXJC 1JJFA 3CZ4A 4N12A 5LQDA 1C8LA 1SZDA 3QKTA 3KB1A 4CM1A 1JRLA 4QTUB 1VL2A 3H6KA 5FLKA 3USCS 1N5LA 3QBDA 4GPAA 4BXOA 5A6SA 1C1HA 2PEZA 4URWR 4WD3A 3DBHB 1OXBB 4E5KA 5CB4B 2R5WA 4NNJA 3RYCB 3EBOA 5G4LA 1P45A 1SB8A 2ZE7A 4NVRA 2XNSA 4ZXFA 1V5IA 1XZNA 3OVMA 4RY2A 5M29A 2XDAA 5EJGA 3SSOA 2F8TA 4RY9A 4WH0A 4LZOA 2J30A 2XNCA 3EZGA 4ALIA 2C2XA 3WYAA 2OGZA 1UJNA 4WZ6A 4MJLA 5KNDA 1CUSA 5AHOA 1OGYA 2BMFA 4QDOA 5ULLA 1GQFA 5K05A 1L5QA 4FPXA 1YV9A 3EW9A 1ORYB 4EY5A 2RG7A 1FA9A 5GM2A 1KJIA 1HYGA 2V9PA 1V7ZA 1NQWA 5B1HA 4BNJA 1C1KA 2ZBRA 3BXXA 3GLGB 3DQZA 2ZJ3A 4MS3B 4XPIB 1JHUA 4ZOLA 3JWGA 5J5CA 1Z73A 1GSIA 4U3JA 4ZOLF 4D9FA 3PXBA 2ZQZA 4X90A 5EZ6B 3ENZA 1XRSB 4HBGA 4NK4A 3W7VA 1ND5A 3ILVA 5MN4A 1SKQA 1KY4A 5EXPA 2W6OA 4ECAA 1YDGA 4DR2M 5T57A 3TTWA 3CG4A 4Q4JB 4X93A 3ZXUB 1FEZA 2GNAA 5LNK1 3SCZA 5EWLA 1L2CA 3NBFA 2NQ2C 2OC9A 4LFBB 5E7IA 4EH1A 4JBNA 1CF4A 1CDZA 2GJ9A 3GQVA 4WPGA 4BY9E 3G59A 3LRTA 3T9DA 4B3HA 3HUDA 3ETGA 4RWEA 4P4NA 4X24A 2W6IA 1L5MA 2CCJA 1X7YB 5GONB 3T3DA 1FSSA 2Q3DA 3BRSA 5E26A 5FUWA 2FV8A 5KJEA 5GVRA 2XUIA 1PQUA 1T4GA 4S1TA 1WG8A 3B2QA 2V59A 4MTCA 4C5CA 1C3XA 2OMKA 3W8NA 3AKCA 4REMA 4XSHA 4EABA 2J6IA 1THGA 3MWDA 5AKKA 1XVAA 2I3GA 2NU7B 2XODA 2WSBA 2BL4A 3N58A 3DE5X 3BK7A 1SUBA 3UICA 3PEWA 1RLJA 1JGTA 2AEMA 4JI1B 5L95A 1XU7A 1DO2A 2AZDA 1YZHA 1V39A 3AXTA 1DWUA 3VRHA 5LOVA 4D3DA 3PWKA 1AUAA 1MAUA 4RMJA 2BISA 1H93A 1KFJB 2FWRA 4POAA 1TAHA 1RWOA 4LE0A 2C95A 5JU6A 4AZVA 4PYJA 1E94E 4OXQA 1FLVA 4LYGA 3I9KA 4JJKA 3ZK9A 2FK7A 1NLYA 4E5NA 4HJRA 2ZIWB 1NVWQ 4DM3A 4NYJQ 5LDDC 4MS1A 3TIIA 3TJZA 3GIWA 3QY9A 2WB4A 3ORQA 4B7AA 4F92B 3TSCA 5IM4F 1OD6A 4PQEA 4PYKA 3TIFA 1T8PA 4DTIA 1YMUA 1FNMA 2PL1A 5DHPA 2FCRA 4R7TA 5DBOA 4BIMA 2GAJA 1A8IA 1TYCA 2BMWA 2CC2A 4IQ0A 3GMSA 4O4IF 3FMFA 3O8QB 1RYEA 1TFRA 1UOOA 3F98A 4TMWA 4M1TA 2VF7A 1XTIA 1T24A 4MRVA 1XJCA 5TDHA 3IQIX 2GM4A 2QVXX 4BL5A 4AF6A 1KORA 3B6MA 3FYCA 1SCJA 2R8OA 5DBEX 4D8WA 5KI6A 1II8A 4R2LA 4U7HA 5JNTA 2V6ZM 1QP8A 2VWPA 1FSGA 3BMCB 1CUUA 4HVTA 3TQQA 3LPAA 1DOAA 4MUKA 1CUXA 2Z2JA 4F2GA 2ZWIA 2O8EA 3IP9A 5DCYA 1S1MA 3PQ2A 4J90A 1NDQA 2DUWA 2GZAA 4P5EA 4PZLA 1ZVQA 4I5IA 1G42A 2A78A 4X8OA 3INNA 1ZMOA 2NO0A 1JSZA 1L7VC 1NJ1A 3LUPA 2XCUA 1L7BA 2GUGA 4NECA 1G1AA 2HJ9A 1B6TA 3HZRA 3K5PA 4PX2A 5FNVB 5IZCA 3O8OA 2C7VA 1U0SY 1EINA 2JY6B 2RJNA 4GZ3A 4MRPA 4TRMA 4Z6KA 1VHWA 5K0ZA 1I94B 1AA9A 2RGWA 4FGSA 3T0GA 1E5LA 3NAZA 4HXFB 3U17A 1EFHA 2BGGA 1KH1A 1Y80A 5H02A 3PZBA 1UBEA 1GJRA 3NBQA 1KFVA 1BQEA 4NYIR 1QJCA 5BT8A 2P1ZA 2JFPA 3S2IA 4BX2A 4EUFA 2VZEA 1LC3A 4NZOA 3ZNPA 3EXEA 3A7DA 1KAMA 3OZEA 1MGOA 4HB0A 4QTTB 1JQAA 1FX1A 2C8VA 4PSCA 3ZE6A 1Y9DA 3GJ7A 4GAEA 3T1OA 1ZWKA 4GR5A 1NE7A 4NS1A 4UJ3A 1W2GA 1JEYB 1NHWA 1H2XA 3ZWPA 1Q0QA 1XEWX 2M1XA 5INTA 1RAFA 2PMDA 4QIHA 4HTFA 5B7QA 1KVRA 3BJRA 1KAQA 3WLOA 4RZUA 4D8YA 1A8PA 1Z4LA 2LKDA 3BCHA 3Q0TA 5CLFA 5ELXA 1PTJC 3Q41A 2VJMB 5YASA 1M6YA 3TVDA 4NSOB 5CDGA 2BWJA 4MITA 4JMPA 2X9NA 4HEJA 4KMRA 4R2KA 2XMCA 4NCJA 1XD2B 5F2KA 3DAYA 2BKVA 1UFKA 5A6VA 1POXA 2ROQA 3QHAA 3ZD9A 3NPMA 3PPYA 4ZO4A 4KSYA 2JK1A 2GASA 5HRUA 1SY7A 3PJRA 1VA4A 2PGLA 2VC2B 4AZ3A 4X3PA 1Z4QA 4YRAA 3HK2A 5DIZA 3U9SA 1TADA 1L7PA 2D0OB 4LJYA 2IWHA 1Q0SA 4XWOA 4KJZA 3SEQA 4F7WA 1DB3A 5EMJA 1A72A 3R8CA 3ZXYA 2L7IA 1J2UA 1EVZA 2F4VM 2VT3A 5CDYA 5K8CA 4Y2XA 1Y8RB 2M6LA 1ZCAA 2OO3A 4BQNA 4ZQIA 4MA0A 5FLXS 2INGX 1N0WA 2JGFA 3WFZA 1UK7A 4KDCA 4D0GA 5GINE 4NU8X 1JBKA 3BWCA 2Q6TA 1JNXX 1JHYA 5LBTA 4LSWA 4GC5A 2V98A 3W6UA 2EHDA 2Y20A 2C5LA 3RC9A 1I7PA 5C81A 1QQTA 4AY3A 1KJ9A 2H5JA 2M32A 1USGA 5ICCA 5J2TB 3U3JA 1QTIA 4DR3M 1DGFA 1V11A 3NFYA 2FQXA 2CXTA 3C48A 4LGCA 1Q50A 3EC2A 1IZ0A 3OQVA 4RC9A 3A0RB 2PIDA 1R6DA 2DVMA 2EAUA 4KV7A 3OJCA 3BS4A 3M5WA 4ARVA 4DZTA 4JQSA 4KXUA 1EFLA 3BILA 1O6GA 1Z5ZA 2C7GA 3FTEA 2W00A 1J2TA 3TTUA 3IG8A 5C8VA 1EM8A 2GM5A 4ER5A 1PHPA 1WX1A 4WHMA 1ZK4A 2VK4A 2WWTA 3CXRA 1ML3A 1A5SB 5FA8A 5TS2A 3ENWA 1XMOB 1FDWA 2AOWA 2PX2A 4X1OA 4EECA 3ZGNA 1E2GA 3AEUA 2G9RA 3KWLA 1L7QA 2A67A 3GK3A 1SURA 4ISBA 4LDAA 5IAEA 3U48A 2V7PA 1R8YA 2VT7A 4TN1A 2B8JA 4EW2A 4Z99A 1MVNA 2OZEA 3MWYW 3VZDA 1W47A 1CYDA 1BKYA 2NM0A 3JR4A 2HMUA 1ZOLA 4OMFG 5PGMA 4IIEA 4AWXA 1TO6A 1NMXA 4OFWA 3S1SA 2OBXA 2ZYSA 5FOXA 1BVSA 4L02A 4F38A 4ZU1X 1BOFA 4ZRDA 1JDNA 5K20A 2X6TA 2GEDA 3ZDXB 3AOEC 4DG8A 2ODPA 4G97A 4HN9A 5IS2A 1TVCA 3PEYA 3ZZNA 5JAQA 4C0LA 2X1LA 3PUYA 4WLFA 1EFRD 1YS4A 3GXOA 4QXPA 3TM4A 4CISA 4WZAE 3C6XA 1R0WA 3W05A 2WU8A 1TW3A 4LWOA 4NU0A 2HWYA 3AF4A 3ETCA 5DRTA 4Q3KA 1GZDA 2EJWA 5IARA 4K28A 3X0DA 4RSGA 1J7JA 3CVYA 2XHEA 1I1HA 4NI5A 2CNWD 2L18A 5IASA 1VIVA 2ATCA 2HPZA 4L5IA 4P86A 2IZ7A 4Y2UA 2HJVA 3MELA 3R3JA 1O87A 1DWQA 2VHUA 3KIPA 2PO7A 1J8DA 3F7MA 3VPGA 1XN4A 4YP9A 1ZIOA 2XUPA 3V7YA 1C4WA 1GQ2A 1NNUA 2HU8A 1GKKA 1YK1A 1EX7A 4QXRA 1JT9A 5JZMA 2OLEA 2L82A 1XVUA 1ZL2A 2CVHA 4MW4A 3T9EA 4DUYM 13PKA 1I2CA 4LOAA 2G8LA 5GV7A 3GFPA 1I30A 3IBSA 4PVCA 3MMXA 2OQ2A 4MQMA 4X85A 1EEHA 3KO8A 3WS7A 4QOZC 2EL7A 2J6BA 1P33A 3GJ0A 2QW8A 3JAWB 4KWEA 4PO9A 3RHTA 4BX3A 3EXHB 3RWMB 1AXRA 3RU3A 3GPXA 4WA8A 4R9VA 4BGEA 4BQSA 1N6NA 1TIPA 2Q4OA 3FETA 1Z8FA 4HK4A 3DMNA 1WBBA 2VXOA 2BKEA 4AZ0A 3L79A 3ZHYA 4BRWA 5BW5A 4DB4A 3E03A 3RLFA 2CV0A 1SXQA 5IC4A 3T5MA 3LO8A 2ZTCA 4MYSA 1BWRA 7AT1A 1QLJA 4O4LF 3WYBA 2ZSDA 3CFYA 1JIJA 3TRIA 3VC2A 4W5OA 1J00A 1JG3A 1R8SA 3AINA 4HAIA 4TQGA 4NOMA 2C8JA 3LXMA 4JJAA 4XM2A 1GARA 1BWPA 2XA1A 1M34B 3A4NA 1E1RA 4J0FA 4M21A 1CR0A 4HGYA 4AZWA 4MARA 3PEFA 4W4TA 3V5NA 1QS0A 1SOVA 4B3FX 2EFDB 4TV8F 1QIMA 3K9WA 4PZCA 4MRSA 1IN4A 2XVZA 2QDXA 4H0FA 5ENVA 5EUBA 5K0SA 1WCXA 1DBPA 2A3RA 4AX4A 1BXKA 2LVAA 1XMPA 3PUKA 4HWGA 2EARA 4HWOA 4XR9A 4KOEC 3PDJA 5KVSA 1RI4A 4K6CA 4DNFA 5CD9A 2FX2A 3PNSA 1X8KA 3EC7A 5JCPA 1E4EB 5BYBA 2V97A 3ZUGA 2TS1A 4C6RA 3O9ZA 4XI9A 5LZ9A 3JWIA 4X00A 4YECA 3HB5X 3V1YA 3BG5A 5KNCD 5ARBA 5AM3A 3NKVA 2WIFA 5ILOA 2EQBA 4M6WA 4OSEA 2KX7A 3WY9A 3ZK7A 3GAZA 3VC1A 2XX3A 3G79A 4MYHA 3V8BA 2Q0SA 2K7FA 3TDKA 2NN3C 1HUQA 3OEHD 2XWBF 5FADA 1JWLA 1E7SA 3GOQA 1JDVA 4CF4A 4BB6A 1NBOA 1SXGA 1M7HA 5CLHA 4HLUC 4FJ1A 3KD3A 4OHRA 3ZWQA 4LTNA 4IRUB 2AF3C 3VR4A 4XXHA 3LVBA 3UMVA 2PX3A 4ANFA 2OQRA 5KQGA 1DC4A 2NQ8A 3KU1A 5TXGA 1A2BA 2JIBA 2GX6A 4MGYR 5BPVA 5E3JA 5EIOA 1VE7A 3LBYA 2HF8A 3PXXA 4OXRA 1AQYA 2A1IA 2ID8A 3CURA 3KAJA 3ZIUA 8MHTA 1W4LA 2L2QA 2ZB3A 2QX4A 5ICMA 1PG5A 1H23A 3ABRB 3ZXSA 1BCSA 3BDAA 3F6YA 2IHYA 2NYUA 4BTVA 2BKXA 2PZEA 3KYBA 4B9EA 3HDVA 3TRHA 2R1TA 4FTWA 4OHWA 1N5MA 3BWEA 3HYCA 1Q84A 3USES 1C9YA 4NLLA 1XTVA 2WICA 3DAGA 3K72B 5JV5A 4CL0A 1Z0FA 1T4CB 2P6UA 3A05A 3K1AB 3GP5A 4M36A 3IDFA 1F60A 1LW6E 3IHKA 3TL3A 3SF0A 2Z1MA 1OSNA 3Q88A 1B8VA 2ZIZA 1NJGA 2BHRA 2ZDQA 2ZKIA 2H1FA 4QTZA 4F4IA 5IZ4A 1F9EA 5JNWA 4X65M 4I1RA 4WZZA 3F78A 4TYWA 3KJEA 2WHPB 4YX9A 2LBPA 1Q11A 2F17A 1H85A 4G23A 3U26A 3I04M 4MKZA 5KYGA 2LVBA 3ADCA 3H8VA 3GN2A 3DW1X 3G0CA 4DREA 4XUEA 1JPUA 4NS4A 3ASUA 1U0OC 4MPDA 2CUZA 2F5QA 1PJRA 1VSQA 3E48A 5E6SA 1RC1A 1EXVA 5L3SB 1N78A 2AEFA 4HNRA 2TECE 3BD6A 1O4VA 2EA0A 2FSIA 5CH3A 5CVUA 2G88A 4LF8M 2V6BA 3E9YA 1TUIA 1QBGA 2HY7A 3L07A 4XGQA 2BYTA 5F3WB 1IY8A 1KH2A 3MS2A 2HRCA 4RA6B 5DNCA 2Y4NA 1EZ4A 1R15A 1KJWA 2ZS9A 3ORSA 4YR9A 1PRBA 2BKUA 1H42A 3W0FA 2HTFA 2NOAA 4J6FA 4V1CI 3Q5EA 4TWJA 1JNYA 2JCBA 2P2CA 2Y0EA 4NH0A 1ND6A 5AK0A 3W7BA 4LJLA 4F96A 1V7QA 5AVWA 1ISHA 1S7GA 1M8JA 2FETA 3CLTD 4RFVA 2O1EA 2AZXA 2Q7OE 2QXTA 4PS1A 4YRFA 5BMVF 1KIMA 4WDRA 2IT1A 3UT6A 5EVCA 5AM2A 2ET6A 3W34A 4C14A 2C42A 1WVGA 4UQOA 2GPTA 2Y21A 1YJAA 1G38A 3MTAA 4L5YA 1QP4A 5AVZA 3OEEA 1T8RA 2FP3A 1RZ3A 1SHJA 3HZJA 2XVYA 1VPEA 4J0JA 4URXR 1EFPA 1KYXA 3TLCA 3WDLA 3FNEA 3MUFA 4OLHA 1IUOA 1OVMA 1C9MA 3GDWA 2BNKA 1MTOA 3G5AA 1JQ3A 3PRYA 4KR0A 3VJKA 2I6QA 1D0KA 1K27A 4A15A 2GFQA 5DLPA 1NNLA 2C1XA 4RCZA 1AGNA 1KE1A 2XHZA 2P2GA 1QVAA 1ONBA 4DZZA 3VTZA 5AVRA 1DGQA 4R1NA 3HNOA 4RXMA 1ATZA 3T7CA 3HHXA 3BSYA 4QLOA 1ZSYA 3R7DA 3W3ZB 2JUJA 4IDQA 1L2BA 4OK6A 5AOAA 4A82A 1B0AA 5LUBA 1VHTA 5IG2A 4YGYA 3KD2A 2X77A 4JLKA 3SBOA 3UKJA 2FCAA 1FTSA 1KAHA 1RXVA 4Y1FA 4DF3A 1FFHA 1I4EB 1K3TA 1K8YB 2DFVA 3CX8A 1WHTB 2HIHA 3UJNA 1RC0A 2CB9A 4QGHA 3T61A 3ZGVA 5JWRA 1FYDA 1DIRA 2B36A 2VNJA 4I8OA 3T35A 4K7JA 1E59A 5EQDA 3KCQA 4X3OA 1PK7A 1HURA 4U6SA 3WLNA 2IHVA 3ZNNA 4K2HA 1W8IA 1ZUNA 2WJHA 4X41A 1Z8HA 5JCZA 1BD4A 3AM5A 3TEJA 3I42A 1SR8A 4MIYA 3V9PA 4R8MA 2CNWA 5I9BA 4CI0B 4KBYA 1JEQB 5L7TA 3STUA 3H5OA 3K2BA 4GSLA 5BYKA 2Z2IA 1ZINA 1FJHA 3AUYA 3K0BA 2TYSB 3D2AA 3KR0A 1J06A 2WF8A 1GG8A 4K9DA 5KX5A 4P4GA 2QMEA 3SJBA 5J1SB 1TA9A 3DH0A 1CNMA 3JSXA 4B83A 3N5KA 2QSFX 5KNDH 1T1EA 3FYTA 1PGYA 3H7IA 2ABWA 4ZANA 4WTOA 4YBRA 1KK0A 3TW8A 2Q1YA 1UP4A 2LVOC 4B2IA 3ESXA 4Y2PA 4EO7A 4DIKA 1Z29A 1E3DA 1MLDA 4MUNA 3VU0A 1YVPA 4QU0A 4NRDA 3FD8A 4E3WA 4KPFC 1YA8A 3LCMA 1GPDG 3KFUG 4MVJH 3IO3A 3TRDA 2HXGA 4AG3A 1UPCA 1XLTA 4Q9LA 5A5FA 5KYTA 4N40A 1G5FA 2VZ9A 3UOGA 1Y3AA 2G08A 3L41A 3W5HA 1DE0A 1G4UR 1ZUHA 3EWNA 4HD8A 1ZOSA 3TOVA 2CLKB 4UAUA 2XTAA 5IVPA 3FCCA 5JY6A 3QWIA 2N0SA 2VAPA 4K9KA 3VNSA 4HRAA 4AG5A 1L3BA 2ODNA 2VYVD 2XV1A 4QVGA 1XX6A 2G25A 4ZI5A 5BNZA 4DLAA 4JR2A 4P5PA 3RB8A 2GN8A 2ZIFA 5JJBA 3LT4A 3OU7A 3M4ZA 3NORA 4ZOAA 2EXXA 1ZUWA 3QKUA 4QE3A 4OU7A 4OYHA 1EJ6A 3C5HA 5IX8A 1G21E 4KTTE 2PO5A 4N18A 5HM8A 1DDGA 1OBHA 1H0HA 2O1SA 4CMIA 4FT4A 1R0SA 1W1IA 1HFKA 3OJ0A 3WGHA 3SSMA 3V97A 1SUAA 3DOUA 5DYGA 3D3EA 4FGZA 5B12A 5JPCA 2QLTA 1QPBA 1FDOA 4LF9B 1E8NA 1VE1A 1X3LA 1GLVA 2JJ1D 5KYWB 3PDCA 4M87A 1UPAA 3LHDA 3VR2A 2E4AA 3KJIA 4OVKA 1NUAA 2XRMA 3Q8WA 3JQ9C 3BL6A 3UFBA 3BBLA 4HVLA 2VVTA 3OCUA 5I7UA 3WA6A 1KZGB 3JARB 2CMHA 1C4XA 4PPNA 4WURA 1DUVG 2CE2X<