3VFDA

Human spastin aaa domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
266
Chain Sequence
b'LANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLGEKLVRALFAVARELQPSIIFIDQVDSLLDASRRLKTEFLIEFDGVQRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPENMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spastin
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal structure of the human spastin AAA domain.
pubmed doi rcsb
total genus 83
structure length 266
sequence length 289
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vfdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vfdA01
2G3YA 3ECCA 2CVHA 4TMZA 4WA7A 4DEXA 3A1VA 4ZI2A 4LJ7A 1ZD9A 1L4UA 3GJ4A 3DZDA 1P2SA 2GEDA 4O2RA 5H1YA 2JASA 3WHKA 3NG1A 4M0LA 4IKEA 4OK6A 2P5TB 1QHHA 3SZRA 4PAQA 1SHZA 5EP3A 2P5SA 1CKEA 5FUVA 2VHTA 3NIBA 4KYIB 1BOFA 3EA5A 3LX5A 2R6FA 4TQAA 5TVKA 3WMFA 4C0JA 2W6JA 2ZRKA 3NC1C 4KFRA 1NBMA 4EKDA 3M0EA 4JBYA 2J7KA 3SHFA 2R6CA 4HDQB 4D26A 1KO8A 3BGWA 5FI0B 4LBZA 1EWRA 4NU0A 4IVRA 2ZE6A 4Q5IA 1XTQA 1XMSA 4MUBA 3R9XA 4M21A 2ZRPA 3F3YA 3EZ7A 5DO9A 5IHPA 3FOZA 4NPHA 1QHSA 2OCYC 2QROA 3EG5A 2J0QA 2VTKA 4PXAA 2FE4A 4OQMA 2AWOA 3FKSA 1E2FA 1E96A 2PZFA 4B3DA 4HB0A 5FFMA 2NO1A 1YVDA 5BWMA 1EESA 2IT1A 1J8MF 4CEHB 1KI7A 3A37A 5FUXA 3VR1A 5CK4A 4CW7A 1CJKC 4NE2A 3LVQE 4YLGA 4A2PA 3P26A 3GFTA 5CM9C 1FQKA 1TQDA 4B71A 1XCPA 3AV0B 1WE2A 4UXHA 2BKEA 2N1BA 4C0AC 5C18A 4V0NA 2JLVA 3EIQA 1SKYB 2OCBA 1FW6A 1RIFA 2ZAOA 1XNJA 2DFLA 2WVJA 4XTCS 4GITA 3NHBA 2W0MA 4ABYA 4DIEA 4QBIA 4R2HA 4M1YA 2DVWB 5JLJA 1HQYE 2J0VA 2ZYVX 4JLAA 1H8HD 2GK7A 5CLQA 3RC3A 1DAEA 4QG7A 4DZZA 2XGJA 1OT3A 2QQEA 5FPHA 4LJAA 2ZJBA 4W5JA 4HATA 2IEZA 3DOFA 4FI3C 2JIZD 4KYUA 1G4AE 5GJVC 2W0SA 3EC2A 3GLFA 1TF7A 8OHMA 2NZJA 1IM2A 2GAOA 2WAXA 2QN6A 3CM0A 2IXEA 5CJPA 4Z1MA 1KAGA 4C3ZA 4E07A 4F38A 1Q57A 1ZP6A 2B21A 3ZQ6A 4Q9JA 2CBZA 4LY6A 5FTNA 1DOAA 1AGRA 1HTWA 2H92A 3AP2A 3LY5A 4KLZA 2RGGA 2ZI9A 4JVMA 3SFZA 3U3MA 3UIEA 4ARZA 1GRNA 5ELXA 4ACBA 2J0UA 2NO9A 5KSYA 1U90A 4DB4A 2BM0A 2JLQA 1RKBA 3SNHA 4JJZA 4JMPA 3LLUA 5JRZA 2EYQA 3VR2A 5FPYA 1TMKA 3TKLA 4G01B 1VYTA 3ZS8A 4W7SA 3SYLA 1KK2A 4AG5A 2NOAA 1E2HA 3IHWA 1G19A 4ZDIA 3VNUA 1XFAA 5EXTA 2WV9A 3NBYC 1VG8A 1AGPA 1Z5ZA 1L7VC 3BD9A 5SZKB 2G88A 4Q03A 5EE1A 2BBTA 1F60A 3H4MA 2FSIA 2QTHA 1S1CA 4OQNA 2ONKA 2IYUA 2VEDA 1GM5A 3D7MA 4A3VB 1I4TD 1UKZA 3GJ7A 3U7HB 2IUUA 3JVUA 2Z83A 4N3NA 1JALA 4DSOA 2JA1A 3AF1A 2ZITA 3I62A 3OHMA 3GP8A 3FTQA 3CX8A 1A5TA 1KJZA 3QI2A 1E9SA 4LOAA 3VU9B 1K6MA 1SZPA 2BOVA 4XSGA 3W9YA 3THXA 1G16A 1P2UA 3AJIB 4IRUB 3RRNA 3EASA 2WHXA 1E0AA 1B0UA 4N0DA 4TSFD 3W34A 2F1HA 3RRMA 1OB5A 1OJLA 3CNLA 2E1RA 4JLVA 4L9SA 4P4UA 4Q02A 4I1VA 4ZDJA 1G8GA 3GFOA 4LJYA 1TU3A 1PV4A 4Q4AA 3JZMA 3W6NA 1PVOA 3TSZA 4A2WA 1KSHA 3BE4A 3WNBA 2QUZA 2NG1A 3C41J 3R7WB 3TSWA 1CXZA 4NCKA 3QKSA 5B2ZA 4KLNA 2ZAMA 2ZRHA 3QG5A 1VYVA 2IYZA 3LAWA 1N0VC 4OHWA 1XDBA 3A4MA 4PO1A 3CKLA 4Q1DA 1DADA 1HT1E 1T8TA 2BBOA 3U3KA 1U8YA 1TUEA 4DLXA 3FGNA 4BLRA 2GCNA 3Q85A 4BASA 4BFWA 4ZIRA 1QHIA 2FA9A 2OFWA 1R0WA 1Q20A 3QKRB 4MYUA 2YWEA 1GL6A 1W4BA 1AKYA 2WWIA 1OF1A 2B6HA 4JSTA 1IQPA 3BJIC 4LHVA 1OXVA 3R8CA 3W5IA 2UZ3A 1YQTA 4EFNA 1G9XA 1N6LA 1UADA 1ZUIA 2A2ZA 1JJVA 2VHCA 4Y0AA 2BMFA 1II9A 4PZZA 1NF3A 4YC7A 1I4DD 4JJKA 2IYWA 3PVSA 1GOTA 2BVNA 4JT4A 1J7KA 4P33A 1P2VA 5GJCA 2W6IA 3EXAA 1JR3E 4P32A 3SC3A 1SXJC 2AD1A 2BCGY 3AKEA 4PC6A 3DKPA 4FWGA 3TNFA 4YMVA 1OIWA 5AUQA 3TAHA 3U61B 1W5SA 1FMLA 2QRNA 2ZIAA 4HZUB 4ZCIA 2HYDA 4MGIR 4NTZA 3U7EB 5EZ5A 2A78A 1OKKD 4M9XA 1Q3TA 2XTNA 4EFLA 4HUQA 2YJTD 1IN7A 1JEEA 1E3MA 5DI9A 3TQFA 3M1IA 4Q19A 4G1UC 2W2TA 3TIFA 4A0RA 4ERNA 2REXB 3OIUA 2OFOA 3AB3A 1E0JA 1W36C 1PZNA 2ANBA 4RD3A 3B6EA 4C7OA 2RGNC 3TH5A 4JLPA 5HKKA 1FQJA 2CXXA 1TTTA 4V0ME 4X8LA 1U99A 4QGFA 2FZLA 3TW8B 2J0UB 3F5FA 3S1AB 4KVAA 4Q7MB 1E0KA 2GXSA 3IBYA 5G40A 3GEEA 1NJFA 4RD6A 4RD2A 3LQQA 4BEBA 1D5CA 1QHNA 1QRAA 3CZQA 3DZ8A 1KIMA 3RS7A 1Z0JA 2HV8A 5DSZA 4KFTA 1J90A 2CL0X 2A30A 3KJHA 4HYYA 1LVGA 2WZQA 3CB4A 3PR1A 2GZDA 3AP3A 4LJ6A 4JLOA 1YZLA 3P1JA 3SE0A 3FMPB 2TMKA 4D4MA 4C7OB 2FPMA 3U3JA 1M34E 5BQ5A 2F7SA 2ZE7A 5JZVA 1L2TA 4I99A 1JPNA 1HA3A 1ZU5A 2D3WA 5KSPA 2QM8A 1GNPA 4MYTA 3VQTA 3SS8A 4CGZA 1MABB 4URVR 3WXMA 1CRQA 3KQHA 1W4RA 1IN4A 3FPAA 3B5JA 3PV0A 3DHWC 1OSNA 1LY1A 2ZVQX 4V0KA 3WP1B 5EE5B 2Q3MA 2V9PA 1Z0FA 1R10A 3PUXA 1US8A 4R2IA 3RLFA 1FX0B 1EFRD 1FUUA 1UKEA 4A2QA 2QY9A 1XXHA 5FPKA 2ZI6A 1ESMA 4NCJA 1SVWA 2KI5A 3GEIA 3LRPA 2OAQ1 4TSFA 2OESA 1IONA 3KW6A 1AIPA 2GF9A 3GLHE 3KFXA 2Q9AA 4LDJA 3ZDQA 4II7A 3MAAC 3H0KA 5CYPA 4LYJA 4B2IA 3AM1A 1GKYA 4M53A 2BEJA 2WJGA 1N6IA 3EAQA 2QEQA 4AYWA 2Q3HA 4N1AA 2IYXA 4JLKA 4OBEA 1PJRA 2ZI7A 4YDHB 1HYQA 1AS3A 4NONA 4RFVA 1E9DA 1YZQA 4XTRA 1VG0B 3A1UA 5CB6A 5E7JA 3EWAA 3HDTA 2RHDA 1NIPA 2OSBA 4LZZA 1VYUA 4P4SA 5FOWA 2ZSFA 1I2MA 1S2MA 3K0EA 5CLLA 1R0XA 1ZNXA 2CLDX 2MSCB 3AQ4A 3D3QA 4B3BA 3RS0A 4PC2A 3LBIA 4F91B 2JLSA 5GVRA 1X3SA 1IY1A 2Z4SA 2PMDA 3PUZA 2RMKA 2GVDC 2W83A 2XAUA 4NMMA 3K70C 2PJZA 1RPZA 1SVSA 3FVQA 3WNDA 3GLGA 2F6RA 1HQCA 2NO6A 2NQ2C 3Q5EA 4D82A 4JLNA 4NH0A 1MO4A 4TMVA 3E1SA 3RRZA 3F0TA 4D4KA 821PA 4OI4A 1RJ9A 3RYTC 3TUZC 2F3TA 3AKDA 4HZUA 3LX8A 5EP1A 5BN3A 1KMHA 3AF3A 1YJ5A 3BIFA 2ORVA 3QXJA 4LPKA 4OK3A 1QZMA 4AC9A 1E2KA 5EE3A 2GRJA 4ITRC 4A4DA 1Z22A 2W6ID 421PA 5JCZA 1TEVA 4FXPA 5KU1A 3NTUA 4B47A 5B30A 1FNNA 1DAGA 1E2QA 1RJ9B 4UNPA 2KB0A 2EU8A 3ASZA 5D3QA 4DUGD 2HT1A 1KI1A 1T3LA 3LA6A 3UMRA 2IYTA 3WHLA 1U94A 4NCIA 1KSJA 5H70A 3MWKA 2V6IA 3PEWA 1R5NA 1I2DA 3HYTA 2GWHA 1KK3A 1D2EA 4M22A 3QVUA 4PZYA 1ZM9A 3IEVA 1NVMA 5FOVA 4LCBA 2HEIA 4S35A 3MJHA 4AYTA 1D9ZA 3K09A 4YXWA 1ZINA 1GUAA 4ARZB 5IDVA 3PQCA 1PUIA 3TE6A 1NLFA 2XXAA 2VO1A 2I4IA 1BH2A 3G82C 2GZAA 1R0ZA 1Z83A 1CJTC 3TJZA 3BORA 4M9ZA 2C9CA 1QHXA 1ZM3A 2Q0HA 4B2LA 5JS7A 1GNRA 3B82A 4CEIB 1X8JA 3B1WA 2KWIA 3T5DA 3ADCA 1T3SA 2GEUA 2ZRCA 3MCAA 5FOXA 2GXAA 5JEDA 3NXSA 3SHWA 3TW4A 2EQBA 2IYYA 3OESA 2ZSEA 3ZZUA 3PCRB 3MHVC 2Z43A 1WDTA 2GVZC 4BZQA 1RYHA 1G21E 2ERXA 4Q4HA 3HP1A 4ON9A 1XCMA 2GJKA 1NVXQ 3K70D 3DVLA 1DAMA 3B8HA 4G5GA 2VQSA 2BBSA 2X77A 1BMFD 3B9PA 3UANA 5HPYB 4QBFA 1AS0A 2QP3A 1EX6A 4URXR 2IBMA 1NKSA 1WRBA 2BJWA 1DELA 2OCAA 4RZ3A 1QG4A 1Z3IX 4US2R 2QORA 4BFSA 1GNQA 3DL0A 1N0UA 2D2EA 2PZGA 1EK0A 4PTLA 4H1UA 1Q44A 4TN1A 3V9PA 5DN6D 1E79A 2XZPA 2ZE5A 3VKWA 1OHHD 2WWHA 3M6AA 2OLJA 3QQ5A 4HEJA 2ONJA 3ZD7A 1W48A 3LQRA 3QEOA 2H8KA 2HF9A 1J2JA 1M7GA 4M1MA 2IW3A 2EWVA 4ZIRB 3EX7C 4KFUA 4LJ4A 4Q1CA 2KSQA 5L3QA 1TEXA 4PPQA 2PH1A 2QZ4A 4WZ6A 3M4YA 5D3MB 4TLEA 3AH8A 3PXGA 5HE9A 2X2EA 5KO2A 2VHUA 3I72A 2V1XA 2QMOA 4GMDA 1XEXB 5CDFE 3DPUA 1AK2A 2JJ2D 1A4RA 3QUSA 1KSGA 2IL1A 1CTQA 1LF0A 3BB4A 2FH5B 4LHZA 1VKJA 5JI2E 3SBDA 1U98A 5P21A 3EZ9A 5HR5A 2XJ4A 1RRFA 5BYKA 4RKEA 5FL7D 5FR2A 5FTLA 3SQXA 3OFND 5AUPB 1YE8A 3AGQA 1FL9A 1Z6GA 3VHXA 1XPOA 1P61B 2R2AA 4LHXA 1G6HA 1IAQA 2XNDD 4YMUA 1U0HC 1TAGA 3DMNA 3I8SA 1FP6A 1JAHA 3GLHB 2XTZA 4WXPA 1G7CA 2YC4C 4M8NE 1UBCA 2I1QA 2CK3A 5K8TA 4PPGA 2JJ8A 4UXIA 1DAIA 3IILA 1NN0A 3ZVNA 4DCUA 4RZUA 4PSAA 4DCSA 2A5YB 4BZXA 4MGYR 2XITA 2JLWA 2XZLA 3AGPA 1R0YA 2GJ8A 2IWHA 5GJWC 3AVOA 1NN3A 3SU8A 2CNWD 5FBLB 1KZGB 2OAP1 2BIFA 4N0EA 3CRMA 4B44A 1VIYA 2GHIA 1CF4A 2ZUBA 1GL9B 2ZE8A 2ZRDA 3VR4A 1F2UA 2AFHE 3IIMA 3AVTA 4XWKA 1AA9A 1G3UA 4IDHA 4U5XA 3TVTA 5LDDC 2JAQA 4QNMA 4MRVA 3QXHA 1HY3A 2PJRA 4PQRA 5TDHA 2C9YA 3L0OA 5CJ2A 2JLXA 3R8FA 1JXOA 4ASUA 2VSOA 5CB8A 1NMYA 4KFSA 4QHSA 2ZEJA 1C4OA 3KKQA 2GK6A 1E2GA 4LK2A 2W2VA 4MKGA 1WXQA 5KNCA 1CIPA 4TT3A 5C1BA 2AHOA 3BC1A 3FKQA 1E2IA 1QHYA 3IQXA 3VX4A 3K9NA 3B2EA 4HB4A 5HTKA 5HZKA 5K8IA 1D9XA 4G5OA 2XXAB 1IOZA 1W36B 1KY2A 4Z8XA 5DYGA 4C9BA 3LO5A 1MO6A 2FFHA 2NZ8A 5E95A 3TR0A 2W6JD 1DTSA 2OUKA 3OIYA 1IY2A 3X1ZA 4DRZA 2ZRGA 1UJ2A 3ZVMA 1G64A 5TXGA 5M04A 2QPOA 3U6KA 3ZQJA 3PIRA 3GPLA 4Y0VA 3NBFA 2IK8A 4GP7A 1T5LA 2CHVA 3CX6A 4FMDB 4RKFA 2O8EA 3QBTA 4QL3A 5FOSA 2WKRA 1QHHB 2K5UA 5DE3A 2JDIA 4PHTA 2C78A 3THWB 4TYYA 3OEHD 1G3IA 3RAPR 3AVUA 3ZD6A 4H1VA 2OFXA 1E9RA 1MH1A 3U4QA 1II8B 3VKHA 3CPEA 1P62B 4P4SB 2J9RA 2AR7A 1JR3D 2UVQA 1KI6B 4DLYA 3MWLA 3EA0A 5AWFC 2QGNA 2QQ0A 4QBGB 3K1JA 5L3QB 1DO0A 4BGDA 1OLOA 2EYUA 1ZJ6A 4DCNA 3LFUA 3AVQA 3C7KA 4XH9B 1HURA 4Q48A 2YKGA 2QP9X 5DN6A 4NCNA 3THWA 4IW3B 4PO8A 3RS4A 5CK5A 2DR3A 3NC0C 2IF2A 3GEHA 2F1IA 3QSYA 521PA 1UDXA 2Z5FA 1EFHA 4LRTA 4QXAA 1X8KA 4OKSA 4JVNA 1F2TA 3TK1A 3B60A 2YC2C 3P32A 2XNDA 3OF5A 4TQUS 3HR7A 2Q6TA 2OBNA 1QDEA 1G41A 1E1RD 2RH5A 4Q7LA 4AURA 2FEOA 2FPLA 4WZBE 2QT1A 2BJVA 4HAUA 3CNOA 1G5TA 4IDPA 2QA5A 5JJIA 2RGBA 3FHTA 3UK6A 4RFSB 1ZMXA 2G1KA 4YONB 1TUIA 2WWWA 1P73A 1W4CA 1TL7C 4JKIA 3TBKA 1TX4B 3OAAA 2QSZA 1UFQA 1S3GA 4BRWA 1UEIA 3IPYA 3BFXA 2ZS8A 4FCVA 1P6XA 1E98A 3NBZC 2B8TA 4QOSA 4WBSA 3N2IA 4D0LB 5JHGB 4S2EA 3T12A 4FD2A 2X8AA 1N5KA 1YR9A 2BBWA 1KI8A 1RZ3A 4B2PA 4ESVA 2WJHA 3VTKA 1G5PA 3UMSA 4CT4B 4MYCA 4L16A 1JNYA 3SJZA 3RNLA 1SXJD 4F92B 1MOZA 4IVQA 4XWOA 3OE7D 2NPFA 3IKJA 4GL2A 3B7GA 1WCV1 1NL3A 3E70C 1GWNA 1RFLA 3FYHA 4GBMA 5FPTA 2PEZA 3L0IB 5BN5A 2EFCB 2CNWA 5SZHB 2VF7A 2V8OA 3PUVA 4MRPA 4RD0A 1Q1EA 5LB4A 4X8OA 5FBVB 1FX0A 4PO9A 5FL7A 3SFVA 3PG5A 2ZU0C 5LPNA 1IN5A 2EFHB 5FTKA 1FZQA 2PX0A 1I4LD 2V7QA 4TYQA 4BLPA 2BV3A 5LD2C 1WB9A 3U3RA 5DI3B 4Q9LA 1CU1A 2PT5A 3H2YA 1KO7A 3GFPA 4RCYA 4DKXA 1E2DA 2WMNB 2YWHA 2MSEB 3L82B 1M6NA 1S8FA 1XF9A 3CUEF 1KMQA 2OXCA 4O2LA 2ZXUA 4QHYA 3IPXA 2JEOA 2C99A 5HCIA 4RZ2A 3ASYA 5KYKA 3FE2A 2CLSA 3O8BA 2DFNA 2F9LA 2FJUA 4TMTA 5FBRB 2ZRNA 4PZLA 4C0SA 5KUTA 4JT2A 3LLMA 4D4JA 2PT7A 2IXFA 1FUKA 1KKMA 1ZD1A 2PCLA 3W90A 2NO7A 3AVPA 4FW9A 4EPYA 1IXSB 2AX4A 1W1WA 1D8TA 3T35A 4TWZA 1XMIA 4D6PA 2AK3A 1SXJE 1CP2A 1P9NA 2F43A 3BRWD 1XZPA 4UKDA 1J70A 4LWZA 2VHJA 2BKUA 4OHYA 1J99A 2Q3FA 2WAYA 4HAXA 1CJVC 2QAGC 2XEXA 2QP4A 2ZJAA 3QKSB 3QPWA 2IF0A 2QE7D 3FB4A 4D80A 3NDPA 3LXXA 4EQ6B 4FWIB 4LRSA 3DM5A 2HUPA 2QMEA 3DEFA 4LHYA 3KX2A 4LUCA 2XOKA 1R2QA 3MSXA 3QE0A 4CEJB 4TTRA 3SOPA 3TLXA 3I5XA 3HU3A 1KI2A 1UDWA 2RGAA 3CF0A 1HH4A 4DVGA 1HE1C 2YOGA 4QGHA 4ZCMA 4RD1A 4LJ9A 1GTVA 3D31A 1E94E 1XBTA 2HLDD 2J45A 4Z54A 2QG6A 4IFEA 4TYNA 2W2XA 1E1RA 4TMKA 2AL7A 4LPSA 2DHRA 2IYVA 2J5XA 3AVXA 1H8HA 5EP4A 4TTPA 4L15A 4LSGA 3OIVA 2IUSA 3KKPA 4K8OA 3MD0A 4RJLA 2FSFA 2ZYTX 3Q72A 4DJTA 5FH9A 2HYIC 3ND9A 2FZ4A 4CT5A 3OAAD 2V1UA 1FTSA 2O5VA 3HJNA 1U8AA 3C16C 4KVGA 2YHSA 3ZZ0A 1F2TB 2OBMA 2ERYA 3H84A 3RWOA 3QKUA 3NVAA 3SEAA 4EDHA 3IO3A 5EUMA 1YU9A 3OEEA 3DKVA 1YZGA 4PAMA 3T06B 3ADBA 2WWGA 4LV5B 4HLDA 5JSZA 5FBWB 2P6RA 3RABA 3TUIC 3QKRA 2XSZA 2CJWA 3CZPA 1DVRA 3RWMB 4KV9A 1RRPA 2PCJA 3N2EA 4GOKA 3DM9B 3REFA 3A1SA 3P20A 2V4ZA 2XB2A 4RCZA 1TU4A 4Z8YA 1QF9A 3QOFA 2WPDA 4MH0R 2F1RA 2ZQ5A 1KDRA 1SVOA 1ZW6A 4FWDA 4IDQA 4QJ3A 4Q1EA 2DFKB 4DCVA 2O8DA 1Z29A 4JYCA 4YMWA 1T3HA 3VU9A 5L3SA 3THXB 1LW7A 4M4SA 1JAIA 1IJFA 2ZYWX 1CEEA 5FTJA 2FSGA 4HLUA 4LV6A 2DBYA 1JB1A 2HJGA 2V6JA 4Q47A 4TTQA 4OQXA 2BHRA 1SXJA 4DDWA 3B1ZA 2X19A 4G3XA 1R8QA 1ZUHA 2FX3A 5DGXA 4DLVA 1XD9A 3C5HA 4TL6A 5G41A 3LBNA 4FCTA 4B75A 2WSSD 3WBJA 3LXRA 3LW7A 221PA 3MUFA 3ZLJA 2XNSA 5JEEA 3I73A 2HXSA 2O8DB 4MA4A 3R9IA 2GJ9A 3KUDA 4AI6A 2WSMA 5DI3A 3LD9A 1NBME 1QHGA 1O87A 2VHQA 2C95A 3BBPA 4UNRA 3I4LA 4R7ZA 4B6EA 4BFYA 5BW8A 1M2OB 1NG1A 2G1JA 2ZI4A 4BEJA 2BEKA 3IGFA 5KTYA 4TYWA 2P2LA 4KSBA 3HU2A 2KBEA 4TLDA 3BH0A 2DZOB 4GNKA 4C0LA 1NN1A 1CJMA 1VG1A 2ZSAA 4EJSA 5KSOA 4HI0E 2GJSA 4G5RA 4JL5A 1BYIA 1KK0A 1UEJA 2CL7X 1KO5A 4J0QA 4Q00A 2V6ZM 5KNBA 1OXUA 1YR8A 4B3XA 1W36D 3Q8XB 4CDGA 1YZTA 3CRRA 2HJVA 2GZHA 1NI3A 3FKSD 3TAUA 1N6OA 4DT1B 3CRW1 4U02A 4AK9A 4E09A 1U0JA 5JWOA 1TQ6A 2ZR0A 5CDFA 1KI3A 1XPUA 1ZM4A 3K0FB 4C30A 1F5NA 2PLFA 5KSZA 2J7PA 4CEJA 4EJSB 4O3MA 1RYFA 3GLIB 1SULA 1FMJA 3LDAA 4LGMA 4EQ6A 2JLRA 1Y63A 1XMJA 2E87A 4GZMA 4XWAA 4BQSA 4DLWA 5JMTA 3RS5A 2BCJQ 5DHFA 1XD2A 5H68A 2GF0A 3BFVA 1P7CA 4L5BA 4C0HA 3R7WA 3SR0A 1G5RA 1NVVQ 3Q7PA 4AYXA 2DPXA 1SVKA 1E9EA 3DDCA 1XZQA 3K0FA 4I4LA 1H8EA 3K0AB 3SJAA 3G0HA 3KJGA 3VMFA 3X1DA 4QHTA 1XTRA 5DHAA 3K0CA 2ANCA 2ECKA 1GITA 4DSNA 2ZI3A 1II0A 2HLDA 3IIKA 2RB4A 2EFDB 2ZREA 2RAPA 1EGAA 2QPAA 2ZR7A 2OXRA 5C4MA 3THYA 2WWXA 4BUJA 2WJVA 1HE8B 2GDJA 2O8FB 2ZANA 2VPPA 2GTPA 1KDTA 2KE5A 3GLFE 2MMCA 1KZ7B 4DHEA 4GPTA 4M9SA 3NDBB 3FDIA 3THOA 2CCJA 4M1OA 2VL7A 2WPDD 4CRWB 3T34A 1VCNA 2X2FA 2WWYA 3EARA 1W0KD 2CE2X 3K9HA 1Z0IA 1FFHA 4RZXA 2YYZA 3A36A 4BFUA 2JLYA 2A5FA 3QF4A 4Q9KA 5CM8B 5F9FA 2QTVB 4QJ5A 4CIDA 3NEYA 4O25A 4EPVA 3EZ6A 1UBGA 4YXWD 1KJWA 3VAAA 4CF7A 1S9HA 2GA8A 2XSZD 4JVSB 4E5UA 4C2UA 5BXQC 3C5CA 2OHFA 4DBLC 4MQBA 1ZNYA 1FNMA 4M2LA 1DAFA 1F2UB 3TSOA 2WTUA 3ZYCA 1KO1A 2GCOA 4YMSA 2D2FA 1XCGB 4HUQB 4JKYA 1OIVA 1OXTA 2D7CA 4EAQA 2LKDA 3AUXA 2O8EB 1P75A 2OO7A 3ZGXA 1RRCA 3KTAB 3OIWA 4E22A 3RC8A 4DWJA 1OPXA 2ZETA 5EXPA 1KO4A 2FFBA 1BYUA 5BN4A 1CR2A 3QKTA 1SXJB 1DARA 3VR3A 4DSTA 3QY0A 3T5GA 4TLAA 3U2QA 4QKQA 1VCOA 3GJ3A 1BMFA 3K8YA 1EFRA 3EPJA 1VHTA 4DCTA 1Z0KA 3CRVA 3I32A 5B64A 1E0SA 4HAWA 3HU1A 5UKDA 4W9MC 4KITB 2J59A 2IEYA 2OT3B 3U3OA 1M7HA 2BDTA 4MDEA 4M1KA 3HPRA 2IS4A 2DY1A 1PLLA 2IX3A 3BERA 4OYHA 4CVNA 1R5OA 2QNRA 3AKYA 4P31A 4BPBA 3PUYA 1MKYA 5GJBA 4IEIA 1P9RA 4HSEA 1S0UA 1ESNA 2OEPA 4KSCA 4C0QC 1KI4A 5A5GA 2O0HA 1E6CA 1YHNA 2J87A 4YDSA 2F55A 4JN6A 4FMBB 1JQJC 1OFUX 2HCBA 1II8A 2WOOA 1SVMA 1QBKC 3Q3JB 1L8QA 2BMEA 1NVUQ 2AWNA 4RY2A 3VR6A 4A92A 2P6NA 5F98A 4FWTA 1OIXA 3ZIAA 4KO8A 4BECA 2ZU6A 1OH6A 2F9MA 3GCGA 5JJKA 3Q5DA 4KXFB 1OFTA 5L3RA 3AVVA 1WQ1R 2ZRMA 4CZ2A 2QMUA 3K9LA 1Z47A 1DO2A 4JBWA 4B73A 2XB4A 4OI2A 4IXMA 4GRAA 1C1KA 2I3BA 2IYLD 3KKNA 4EPRA 3KB1A 1KMHB 2Z4RA 3JVVA 4KU4A 2H16A 2D62A 3E2IA 1XEXA 4QRHA 4KODA 4G5SA 1AJEA 4URZR 3ONWA 1KKLA 4QGAA 4Q1AA 4Q4LA 1NIJA 5AJYA 1PLKA 3KKMA 3UG7A 3P4XA 4B48A 2CJWB 2G6BA 2N42A 2J1LA 4ZCLA 1OFIA 2ATXA 1KNXA 4D0GA 2NO0A 2CL6X 2RGEA 1EWQA 1DG3A 2R9VA 4EIWA 1X86B 3NHAA 4MKIA 5IK2A 1W47A 4AG6A 4EPWA 4IDNA 1V43A 1G18A 2ODBA 4R98A 1U9IC 1SVIA 3K0SA 1KNQA 3PJRA 1E2JA 4E03A 2P0EA 1DPFA 1E32A 3KFVA 1Z2CA 4ILEA 4PC1A 3HPQA 3U7FB 4FMCB 1KJYA 4POAA 4B3GA 1BKDR 1ETUA 1H65A 2B8WA 1OH5A 4JLMA 3AVYA 1NN5A 3TQCA 4XVRA 2C04A 5SZIA 5J47A 2R6GA 2FSHA 5JBQA 1XWIA 2BC9A 2O8BB 5F3WB 4F4IA 1NVVR 4CEIA 1Z6YA 2ZJOA 3WMEA 3ADKA 5E7IA 5J4KA 1KYIA 3S1AA 2C96A 3QVVA 3PEVA 2G0NA 3GLHA 4PPFA 4HDOB 4JYBA 1AN0A 5AK0A 4A15A 3ADDA 2DB3A 3X1YA 4U00A 3DO6A 3EZFA 1Z2AA 4QJ4A 3X2SA 3CR8A 1D2NA 5E4FA 1G7SA 4LBWA 3IO5A 2VP6A 1U0LA 1DEKA 1P2TA 4A36A 4AWXA 2DFTA 3A1TA 2A9KA 3TVDA 2DWPA 3B13B 1COWA 5JFGA 4V0LA 4FINA 4Q4AB 3WYFA 5EE0A 1OW3B 4TZ6A 1G8PA 2GXUA 2WICA 1K5GA 1MO5A 1F3OA 4A0FA 2IYSA 4UNNA 1M74A 2IA5A 4PAOA 2V55B 2ZRLA 1B23P 1LTQA 3CR7A 2AXNA 2IWRA 5JJLA 3QXXA 1LS1A 2AXPA 2V54A 2LCFA 2D06A 1GIAA 4GP6A 3FHCB 1TPZA 3A1WA 2J0SA 4DDUA 1Y3AA 4GDFA 1P60A 3QXCA 3ZIAD 2OV2A 4IOJA 2ZUCA 1OFHA 3NEJA 4Q1BA 4A6PA 3AF4A 2IS1A 5A4JA 3H1TA 5AUOB 2BMDA 3A4LA 5AR1A 1N6RA 1RRGA 2QAGA 3PEUA 5AUNB 1IN8A 3HYRA 4JS0A 4YQFA 4V0MA 3L0PA 2RHMA 1NRJB 2O0JA 4BLOA 1SKQA 4AD8A 4Q4JB 4TZ0A 4UNSA 1Z8FA 1F6BA 2YWGA 3U60B 1YRAA 1G7RA 3TGPA 5EXXA 2NMVA 1XU4A 5G53C 1XD2B 1GKIA 3CNNA 4IOMA 3UATA 1DE0A 1N6NA 1IXRC 2Q9CA 3OFNA 1ZNWA 1KHTA 1FTNA 3O8DA 4TMXA 5CIQA 1E69A 2IYQA 3EW9A 3W8RA 1OB2A 1ZM7A 1LNZA 1XEWY 1S3SA 3QPVA 5JI3E 1CS4C 4ZI3A 5K8UA 4XD7D 4LRWA 2WM9B 1TQ2A 1N6HA 2V3CC 1N6PA 1M8PA 2CCGA 2CK3D 5EQTA 1KDOA 1Q12A 2OG2A 2QTFA 3W5JA 2FGJA 1NSTA 4KJZA 4XVUA 2PBRA 4D0NA 3QF4B 1EX7A 2QM7A 1G4UR 2VSXA 2GEVA 5EUQB 3EZ2A 2OBLA 3ZJYA 1P5ZB 3B1VA 4QNRA 1PUJA 4NYIQ 1ZNZA 3C14C 721PA 1FOEB 3GJ0A 3GMTA 2B7CA 5J4LA 2WIAA 4Q18A 3ND8A 1W4AA 5K8LA 2ZS9A 1CULC 4JVLA 1X1RA 4HLQB 2A3RA 4NZYA 4V03A 2EFGA 4ZO4A 4QM6A 3G5UA 2FGKA 1TF2A 3TRFA 3IHLA 3EPHA 4F4JA 5AJWA 5JECA 5J40A 4HAYA 5KHOC 2ZJYA 2ZPTX 3IUYA 4Q21A 621PA 1NY5A 1FP7A 4IOLA 1BO6A 2H57A 5TY0A 4WAUA 4URWR 4BZPA 2IS6A 4TMWA 3VR5A 2R62A 1F48A 2LKCA 3KTAA 2WKPA 4OJKA 2DZNB 2HCJB 4WIAA 1D6JA 1IHUA 1ZCAA 2JLZA 1IN6A 3CH5A 1YZUA 4TL7A 2GBLA 5E7MA 1JQLB 4KHZA 2C5LA 1LFDB 4OJQA 2P65A 1N2CE 1G8HA 5CYOA 5CITA 1G291 2GKSA 4Q01A 5DIFA 4A0HA 2QAGB 3R9WA 2R8RA 1HUQA 4ZKEA 3RS2A 2WJIA 1LF5A 2VBCA 3CLVA 5J4VA 3SBEA 2YOHA 1T9HA 3MWYW 1M1YE 4BRUA 3MJRA 1CRPA 3OEHA 1DBSA 5FTMA 4PSVA 2WBLC 2FWRA 2DWQA 1COWD 2G77B 4FIDA 4ZDKA 3GJ5A 5SZJA 2GESA 3P27A 2I1VB 1OHHA 1Z07A 1LB1B 1NMZA 1JR3A 1U2RA 3I92A 5FBQB 2A7QA 5EJEA 3U44A 1JXMA 2W00A 2XOKD 4RSGA 4OK5A 2YNMA 3Q9LA 4RD4A 1VMAA 3AP1A 2H1LA 2HXYA 1JECA 3AKCA 4X8HA 4HAVA 1E2PA 4UJ3A 1P4SA 3C15C 3D6TB 1S1MA 3CRQA 2WWFA 3ICEA 1G3RA 2P3SA 2VP4A 3CPJB 3P4YA 5AJZA 1Q3HA 5KPJA 2YINC 3UPUA 4Q4JA 3VNVA 1N3BA 4W5WA 1CR0A 5AJVB 2VSFA 1CJUC 3KQKA 4B76A 3FWYA 1G17A 3U44B 1RE0A 1GP2A 1US8B 3KXIA 4HLCA 4OI0A 4LHWA 3I5YA 1Q1ZA 4LX0A 4Q7JB 1GVNB 1VTKA 3QPUA 1IJEA 2ZJ8A 3L8YA 3VX3A 2ZJZA 5F2EA 1TNDA 2A5DA 4AKEA 2A5GA 2ZR9A 1JI0A 3U4QB 1UBEA 5FOUA 1EFCA 1G8YA 2QI9C 3LW8A 4GOXA 2EFEB 2OLKA 1UPTA 4EJSC 1KY3A 3DMDA 1AKEA 4A8JC 2XZOA 4M1TA 1E9AA 4MGKR 1E2NA 3VHLB 1GRRA 1GKUB 1YKSA 4NYJR 3FMFA 3AF2A 2DWZB 1WF3A 2DYKA 3BS4A 2R6AA 1U81A 1JEDA 5HZHA 4Q7KA 1JBKA 5IRCD 1HT2E 4V0OA 5FPSA 3LVRE 4DXAA 5G3ZA 4OHZA 2ZS7A 2RGDA 1P9WA 1QZXA 2FFQA 3PUWA 2R44A 1NBMD 1XEFA 3RANA 2C77A 4DC9A 1GRQA 3V00A 4Q66C 5JS8A 1W7AA 2O8BA 1G1MA 1IBRA 3C8UA 2QENA 5F9HA 4DLRA 4DDTA 1OV4A 3VLFB 2HDNB 1XEWX 3L43A 1W2HA 4KBFA 4AIIA 3CBQA 3CO5A 1XXHE 1ODFA 1W0JD 2ZRAA 4B35A 4NDZA 4NL4H 1GSIA 2FU5C 3GJ6A 4HLUC 4ZDWA 1OH8A 3QF7A 3CF2A 4RFSA 3EPLA 3BWDD 1ZIPA 1P3JA 2GJAA 3IEUA 1RVDA 2QU8A 1KI9A 1MO3A 4B3FX 3EWSA 2V7QD 3T61A 4PHFA 3R20A 4MGZR 1OXXK 2C8VA 5JSZB 1ELOA 4K81B 2QPTA 3VFDA 4JSYA 2ODNA 4TLCA 2QAJA 6Q21A 1Z63A 5JWHA 3WYAA 3ZS9A 4MKFA 1XJ0A 3QG1A 3I8XA 1GAJA 4I1UA 5DISB 4DDVA 5LD2B 2VP2A 4PC3A 3D8BA 1WP9A 3L0SA 1VDZA 2CHGA 4JLJA 1YZNA 2P67A 5TV2A 3WY9A 3NKVA 4BWYA 4ZV4A 2O8CA 2WIBA 3BK7A 4IJMA 4DLTA 2ZSBA 2R6DA 1SHKA 2E9SA 4WXRA 2AN9A 1D2MA 2VYFA 2JIZA 3BFKA 1XB2A 4LV8B 2VP5A 2ZTSA 1ZUNB 3B1XA 4G5QA 1W0KA 4BFTA 1U9IA 4FMDF 4D25A 3KKOA 2Q9BA 5L3VA 4P0TA 3NH6A 4M1WA 1NJGA 1A2KC 2Y8EA 5EXSA 3KQLA 1Q0UA 4C0BA 2JATA 1E79D 1M7BA 3KXKA 4KBGA 4PR0A 4U7DA 2VP9A 3RS3A 3FMIA 3BH7A 4URYR 1UM8A 2F3RA 3B85A 3WRXC 3MLEA 4HZIA 3TMKA 1E4YA 1JPJA 3B9QA 1W44A 1NVWQ 1CBUA 2OILA 3N70A 3QBVA 4TL9A 4PHGA 4A0GA 2IHBA 1JR6A 2GXQA 2B7BA 1T0HB 2A5JA 2ZRIA 4B3CA 1MT0A 3B78A 5AJXA 4TT3D 1DAHA 5BYJA 4TL8A 5LBIA 4OHVA 5HE8A 1MRNA 1AQUA 1YR7A 2MMGA 2H7VA 4O0MA 2ZJ5A 4Q4HB 5FI1B 1Z0AA 1LV7A 3AF0A 2ZI5A 4JBXA 1BIFA 5J4YA 1QVAA 1E1QA 1GILA 2VH5R 2UKDA 3BB1A 4IEEA 2EWWA 5FR1A 3KZ1E 3QNUA 4CYMA 3UG6A 4DIDA 1A2BA 2G83A 5DYIA 4D81A 1W49A 2L0XA 1QVRA 2Q21A 2RGXA 1KTVA 1ZRHA 2VF8A 5JRJA 2VRWA 1A82A 2ATVA 3EIEA 4FWHA 4V02A 2YOFA 5J4HA 2REOA 5D3MA 1G20E 3AVWA 2REBA 3CX7A 2ZRJA 3QIAA 4W5HA 1XXHB 4MKHA 1VECA 2D7DA 2GETA 4QGGA 2ORWA 1SKYE 1ONBA 4C2TA 4IFBA 1EFUA 2FG5A 2IYRA 2NIPA 1Q1BA 1YR6A 2O0KA 3K9GA 1A1VA 1G3QA 3WBKA 5KPDA 1G7TA 4DLZA 1N5IA 1OE0A 1XX6A 2QMHA 3ZVRA 3T1VA 1K8RA 4QC2A 1OXSC 3K70B 3AUYA 1HV8A 3U6BA 1J8YF 1E9FA 1VCMA 1GG2A 4K46A 4UXJA 2N46A 2WSSA 2AK2A 1AQYA 4MRSA 1WBDA 2BMJA 2O8FA 4Z51A 5JCPA 2ASEA 2J46A 4ESHA 4LJ8A 3QJYA 2IUTA 3A8TA 2AD5A 5H8WA 1Z0DA 1R8SA 3ZVLA 1V5WA 4M9QA 3I1FA 4IOKA 3J81k 1DAKA 3QENA 1IY0A 1X8LA 3TUJC 3CIOA 5IK2D 1CR4A 1NSFA 2OCPA 4NYMQ 1L4YA 3GJ8A 3Q7QA 2DCUA 4LC1A 3EIHA 2G9NA 1NG9A 3BB3A 1NY6A 1Z6TA 4DT1A 1TQ4A 3A58B 4OI1A 4PX9A 1U8ZA 2O52A 3A4NA 2QBYA 4HB3A 2ODEA 3ETLA 1JJ7A 2GCOB 3MMPA 2JDID 4US1R 3WP0A 4EPXA 1W0JA 1XTIA 5DH9A 3WRYC 4OQFA 1OH7A 3SJBA 4GMXA 5G3YA 3RDPA 3GJXC 4XJXA 5EE9A 4MDFA 3GLFB 5DNYB 3CWZA 3FMOB 4F7WA 2OE2A 1KSFX 1VCIA 4L9WA 2C2HA 1XTKA 3PENA 4BFXA 3GLIE 3KXLA 5KOYA 4BLQA 1Z28A 3W3ZB 4LC0A 3W8NA 4EFMA 3PFIA 3RRYA 3NBXX 4LBVA 1NMXA 2ZYUX 1DS6A 4PHHA 4ASUD 5LB2A 1T6NA 1XJCA 2IC5A 3C4JA 2ZSDA 1GDDA 2OM2A 4KI0A 1WA5A 1H8ED 2GCPA 5JWRA 1R6BX 1DG1G 2JCSA 4TQ9A 3UWOA 3UXMA 3L8ZA 3O47A 1NNEA 4NYJQ 2GILA 1X37A 2CE7A 2PX3A 3CPHA 2Z6VA 2IHYA 1AZTA 4GFDA 4CEHA 1MV5A 3X1XA 1KOFA 2J41A 3OEED 3L2OB 1XTJA 5CIWA 5HCNA 5C4GB 1T4GA 2CCKA 1C9KA 1Q1QA 1OKKA 2CMKA 3TR5A 4FCWA 3AEZA 4EPTA 1T8UA 4PPNA 1AS2A 1R5BA 4DLUA 3W3AA 3MRSA 4G0NA 3PEYA 1ZC4A 4GSYA 3EC1A 5EP2A 3KQNA 4PSKA 2D4HA 4NP6A 4UNQA 4MITA 1AZSC 4BFZA 4Q9HA 1XJQA 5DLQC 4D2IA 4PC7A 3RVBA 2XJ9A 5HKKD 2YWFA 2EW1A 1ZBDA 5FUYA 3LNCA 2PL3A 1IXZA 4OHXA 3CH4B 4US0R 2QT0A 4UQOA 5E3HA 3RSLA 3LBHA 4BE7B 1T91A 1W2GA 4WVFA 2ZUDA 2WOJA 4IXNA 2ZRFA 1N6KA 4F93B 1N5JA 3HWSA 5FL3A 2PLRA 3CF6R 5TB5A 2D74A 3CONA 2RGCA 3BOSA 1E1QD 1VG9B 4MYHA 4A82A 5GVSA 3GLGB 1A7JA 3V4RA 2KBFA 2GBLC 1T5IA 1LS6A 1RC8A 1W46A 1ZM2A 2HT6A 5TMPA 2AKYA 1G8FA 2FOLA 4M1SA 4XIGS 1GL7A 2CLCX 2CVFA 2OZEA 4QBHA 2H17A 3FHOA 4LI0A 4XD7A 1KDPA 4NKRA 4PQFA 1KAOA 2BM1A 2JJ1D 2XTMA 2FF7A 4Q1FA 4JZKA 1E99A 2GAAA 1X1SA 4HB2A 3DOEA 4B43A 3RSOA 3V4FA 4HDCA 1EXMA 3GD7A 4WZAE 4LYFA 5KDOA 1K5DA 2YZ2A 1R4AA 3NH9A 4XSHA 4R71A 1S4QA 5GADl 2ZM5A 1SQ5A 1E2MA 1ZCBA 3B1YA 1TADA 3IQWA 3KL4A 1EG7A 2BWJA 4LBYA 4L8GA 3RHFA 2YV5A 4YMTA 3ZZTA 2MSDB 3IBGA 1G3MA 4D4LA 3BXZA 1ZAKA 5TARA 5FUWA 5B58C 2ODWA 1XRJA 3QXSA 4WW0A 2C98A 5C2JB 2FMXA 3U7GA 3A6PC 3K0CC 3BAFA 1Z6AA 1UF9A 2PMKA 2X1VA 3LWNA 4C4PA 2ORIA 1G6OA 4NYMR 1E4VA 1CR1A 4DUGA 4I1OA 2C9OA 1O3YA 1XTSA 2IXGA 2QE7A 4OQLA 2J3EA 2P6UA 3KDSE 4A6XA 4HUTA 1N0WA 5IT5A 4KCGA 1Z08A 2KJQA 4LJ5A 4NBSA 4WOPA 4P3YA 2QL6A 1KGDA 4P4TA 4AKHA 1MABA 4NYIR 3REGA 4EUNA 4ACAA 4PFSA 1C1YA 3HR8A 3ICQB 2FEMA 3PITA 4R9UC 4TYPA 4X8MA 4BLTA 3O8RA 3QEJA 1KI6A 2WMOB 4DB2A 4XOIA 2FNAA 2RKOA 4JL6A 2ZJ2A 4MUAA 1SGWA 5B57C 4KAXA 4A8JB 3EPKA 4URUR 4JLBA 4B6FA 3KUCA 1WBBA 2WJYA 2GNOA 4RVCA 5KDDA 3GLGE 1UKYA 2QSYA 1E2LA 4HAZA 3LH5A 4AKGA 1XPRA 3E5HA 2ZROA 1AM4D 2F43B 1N5LA 1GFIA 1ZU4A 1XP8A 1RW4A 4PQYA 1XD8A 1GZSA 1NP6A 2EVWX 4FN5A 2VA8A 1VIAA 5L8VA 3MGCA 4BFVA 4GT1A 2G0TA 3F8TA 5J5CA 3T1QA 4GOJA 4LYAA 1R7RA 4DEYA 1E9BA 3W6PA 4DSUA 4I81A 1CLUA 3MG9A 3KB2A 3SQWA 1FPMA 2CHQA 3WNCA 3O8CA 3FFAA 3T1OA 3SYNA 1S96A 1UBFA 2F1JA 4IDOA 1T0JB 3T1TA 2PZEA 2RCNA 2WJJA 2B92A 4IVPA 4JIMA 3WMGA 4NCHA 4GI7A 3T15A 5L3SB 2RGNA 2PEYA 1EFTA 4ZKDA 1Z06A 3UKDA 5KDLA 2AKAB 3NWJA 1TF5A 2CEAA 4F4CA 2DWOA 1MRSA 4BLSA 2R65A 4A1FA 3SN6A 2O8CB 1WMSA 121PA 1PLJA 3MFYA 4AKIA 1SVLA 3K09C 3U5ZB 4AY2A 4I1SA 3GLIA 1OYYA 3CW2A 4UJ5A 3W6OA 2UZIR 2FV8A 2Z0MA 3I3SR 4H9GA 4B74A 2FDCA 1W5TA 2LWIA 2NPIA 4QFMA 2JJ1A 1UAAA 2H5EA 2HF8A 3H86A 3IIJA 4XVQA 2YVUA 2NGRA 3VKGA 1YRBA 1UKVY 4QM7A 1Z6XA 3LV8A 1NKTA 1ZC3A 2SHKA 2VIIA 3K53A 4JL8A 3UWKA 1X6VA 1KK1A 5ANRB 1ZVQA 4IHQA 4B32A 1XMVA 4C0KA 4GZLA 1BS1A 3CWQA 5C46F 3OZXA 1ZIOA 2IS2A 4Q9IA 4Z1MD 1Q22A 4B33A 3N5CA 1E2EA 3SDZA 3THYB 3ZH9B 2JGNA 1QG2A 4PANA 2FFAA 4ZPXA 1ANKA 1Q21A 2ZVPX 2QBYB 4TLBA 3SI7A 1VHLA 3KJIA 2FPKA 2WKQA 4NHOA 2CDNA 3X1WA 2XX3A 3FFBA 4A9AA 2JLUA 4A8JA 5EZ6B 3I61A 2QGZA 3KQUA 1N25A 2VP0A 5FOTA 2C03A 2W58A 4JLDA 1MR3F 1S9DA 2ZRBA 1NLZA 3JZAA 3KJEA 2FN4A 5KNDA 1P72A 3MWJA 4FMCF 5IF9A 4DLSA 3WYGA 1OYWA 3BH6A 3OE7A 4MRNA 3SYKA 1E9CA 1HEIA 1NLYA 2AFIE 1ZYUA 4B34A 5A0FA 2J7PD 4MRRA 1ZD8A 1YZKA 2H18A 4LYHA 3SJCA 4OL0A 2KRKA 3IDQA 2VLIA 3GQBA 2JJ2A 3UMFA 2QRZA 4L4UA 5JHHB 3K0AA 2NTYC 1VPLA
chains in the Genus database with same CATH superfamily
3ECCA 4PM4A 3NDJA 1UANA 2YXPX 1TO2E 3M4ZA 4QFBA 4KOEC 4WA7A 5CW2A 4EF5A 1UK7A 2DLDA 3WG9A 2JGKA 2NV2B 3PXUA 3NG1A 4IKEA 4Q6BA 1RJGA 1TUGA 3E9SA 2J85A 3FHLA 4CWAA 2R66A 4DA7A 1K06A 1SHZA 3ITDA 4TVOA 1QH1A 4OEHA 5FUVA 4HWGA 4KYIB 1BOFA 5LXTF 5TVKA 3WMFA 1WZUA 1AKRA 2BFEA 4I3GA 2B1RA 2OZVA 3W5CA 1FMCA 3WJ1A 2P8SA 4L73A 2IBSA 2P41A 3DS8A 2VQ3A 4DSZA 3G8BA 2ZB2A 3RYHB 2FP3A 1KO8A 4UHJA 2PT6A 4D26A 5FI0B 4LBZA 1N1EA 4BWVA 2ZE6A 3R23A 1L4BA 3JASB 4YGYA 1NI4B 1T2DA 1SCAA 1XMSA 2XRYA 4GXQA 2BFNA 4M21A 3UZUA 2WAMA 2ZRPA 5FLKA 3F3YA 3EZ7A 1Y6JA 3KUXA 4NPHA 1QHSA 4P80A 3WL4A 5IM4F 4MVWA 5A0VA 3PVZA 5ENDA 4GX0A 5I5EA 2AWOA 4MQMA 3FKSA 2QI9F 3L7CA 1E96A 4QELA 3WKCA 4HB0A 1EPUA 3CLTD 5FFMA 1EESA 3CXUA 3KLNA 4G4IA 3N0RA 3WZ2A 1QMPA 4G89A 2C5BA 3DOIA 4LMBA 4N5NA 3WQBA 4IIBA 3VR1A 1V16B 5CK4A 3LUBA 2BFOA 4M9CA 4QICA 4NE2A 4EJFA 1BU8A 2F5QA 4YLGA 3LQYA 5K3FB 1CDEA 2JK1A 2QJTA 2OGTA 1JSZA 1PNOA 3BAZA 1FQKA 2R8YA 1TQDA 3LGXA 2QRMA 3PXAA 4B71A 4F8EA 3RYCB 2BKEA 3DE0X 4C0AC 2JFQA 5IP5A 4ZHSA 3QBJA 2H5JA 1DKOA 1RSZA 2CJXA 3EIQA 3DWEX 2OCBA 1FW6A 2HAEA 4Q1VA 5FEMA 2ZAOA 2DFLA 4I9GA 4GEKA 4QBIA 5A4MS 3D8HA 3BGSA 2Y67A 4KWTA 2OCGA 1C4KA 3ROQA 2J0VA 1HOXA 4D8XA 1H8HD 3HO1A 2DAKA 2XGJA 1ILWA 1DAEA 3COVA 4BMPB 4C20A 1OT3A 3AMVA 3MIZA 1TCAA 3N2GA 4O4HF 5FPHA 5HFJA 4DHWA 3K8ZA 3JATB 1XNQM 1X38A 3AUAA 3D6UA 5KQLA 2PGLA 2O3RA 4K6KA 3RI3A 1JVSA 4JI0M 2WNHA 1X80B 3EXEA 3R5TA 1KR5A 3CM0A 2GAOA 2WAXA 5CJPA 4E07A 2PQ6A 5CLFA 1KAGA 4F38A 4ZYZA 4H3HB 3D7LA 1AUQA 1UOEA 4N6GA 1CETA 1NURA 2FH0A 5IN5A 3U26A 2A7XA 4FQ8A 2H92A 2VTVA 4KRXA 5H9WA 4LSWA 4HCJA 3A6JA 3ND7A 2O0MA 2WHEA 4D0RA 5IJ9B 4E3WA 2G08A 2KZUA 1B26A 1DZ3A 1Y1QA 1JAXA 4I0WB 1FEZA 3KSAC 2EYQA 2O3TA 3J27B 5AYVA 3VR2A 3OE5A 3HHYA 4XGQA 5AOVA 3PF9A 2DFVA 1FUEA 2Y71A 4JUAA 1DIOB 3WLSA 3ZS8A 4AG5A 1RWKA 5AXBA 3C3JA 2DH5A 4IH9A 4OXYA 4ZVLA 3RWBA 1CRLA 1WU8A 1XFAA 2WFMA 3K92A 2VUTA 2VJLA 4H0FA 1J0EA 2WV9A 4P82A 5ALJA 4EH1A 2HLHA 3CNBA 1K6IA 2QZJA 5FRDA 3P2OA 4YJFA 3EXHC 4Q3CA 2W8BA 1MPXA 1GO2A 3BHMA 2QTHA 3L7IA 3TZKA 5F78A 4WOCA 3RJMA 3LY7A 2DWUA 3U7HB 3WE7A 4BV2A 3AG5A 1K0FA 3H5TA 5K4AA 4UBOA 4LFAM 5KOHA 2Z83A 3JTEA 1P2GA 2J6CA 4IPTA 1RXSA 2JA1A 3KWFA 4TLLB 4ZWNA 2B0CA 1Y42X 4FR5A 4TRRA 3AZOA 4G23A 4C29A 3FTQA 3CX8A 1F8GA 1KJZA 1Z2OX 2SKCA 1Z4MA 4IBJA 1TYDE 1Z26A 1ZN2A 2C2GA 8CATA 2HU8A 2V4MA 2VNKA 3VU9B 3W9YA 2B3DA 2BTEA 1M75A 2Q6OA 1OGJA 2PRYA 2YICA 1H0RA 3GWZA 2EV9A 5F2OA 1E0AA 3PD0A 3QVLA 4N0DA 2V8BA 3UV3A 3VR3D 1SXQA 2LBPA 1BVSA 3CG0A 2O1XA 3HACA 2R5NA 1KIFA 4BNDA 4DQVA 1F0KA 4MTCA 4BYMA 3PEWA 4JLVA 4L9SA 3QRWA 4LXIA 1AH2A 3I6ZA 5TPWB 1XVAA 1CY8A 1R9NA 4ZDJA 2X40A 3N8IA 2O25A 3GFOA 4C7MA 1PT9A 3DMTC 4Q4AA 2YWBA 3H4TA 4D44A 5AQ1A 2OLEA 1PVOA 4KQIA 3U0BA 2GEKA 4LTNA 4KAFA 1KSHA 4P38A 3BE4A 1G8AA 4DCOA 3FBTA 1T9GS 1A8SA 3W6UA 3NEAA 4G2TA 1K8QA 3A9SA 2MDTA 1CXZA 4M0DA 4N82A 3V8VA 5KX5A 1T9BA 1X42A 3IP8A 3RVLA 3W2HA 5A06A 1ECBA 1OJ7A 3QMMA 4PO1A 1PS0A 1E4OA 3D2CA 2EOAA 1YA4A 2FOXA 3GRCA 3TRIA 3ACCA 1T8TA 3WB9A 4CG0A 1DC7A 2PXCA 5ITXA 4ZIRA 2ZDGA 4BLRA 4RTOA 4DQDA 1UMDA 3GB9A 2WZBA 4DKJA 2FA9A 2J3MA 4X6LA 2YFQA 1TYEB 4IL5A 4JAVC 3QKRB 1H85A 2R1VB 2YWEA 5B4VA 1JLSA 4GAEA 5CG1A 3KXEC 2PV0A 2FPIB 3N7UA 4D98A 5I7OA 3BJIC 1ZGBA 1A76A 1EDZA 4TOIA 1GA6A 2CZQA 1IHOA 1G9XA 4MW0A 3DF7A 5BSTA 2VATA 1XELA 2G4LA 4J3FA 5A2QA 5K3FA 3TEFA 1DFIA 1XTUA 4E13A 3GBVA 4N47A 3CXRA 3H1GA 5KHLB 2FJ0A 1LBTA 1LW6E 4E2FA 4HK4A 4ADSG 3B7ZA 2BY4A 4XUGB 2W22A 4P33A 4RE5A 2GYWA 3V3TA 3ZDBA 5TQVA 4X64B 2W6IA 3EXAA 1N9KA 3SC3A 3VZDA 4PC6A 3CR3C 1KMIY 4FWGA 2AT1A 3DKPA 2OZLB 3OZRA 4OH7A 5H81A 4YXFA 3KPJA 4H7JA 3I9OA 4YMVA 1IY9A 4RVOA 3U61B 1FMLA 2QRNA 4J03A 1LPSA 4JNCA 1BWQA 1Q7CA 3MRTA 4M99A 3WL8A 4ZCIA 2F59A 3D5EA 3U7EB 1CRZA 2RBGA 5LR6A 1R4ZA 4BVGA 3JQ9A 4ZCPA 1QRDA 4NJOA 2YJTD 1MB0A 4CISA 4F96A 4J4HA 1HSOA 3QVWA 4INOA 1P74A 5C8ZA 1W85A 1EIWA 1GZDA 3M1IA 4PR3A 2W2TA 4PINA 4JUFA 5CA0A 5I48A 4ERNA 3BHNA 3V4LA 1NP7A 3IP5A 2XCRB 3AB3A 1PJ2A 3M83A 3WK6A 5CRIA 1W36C 1PZNA 2W2LD 2XA2A 3LT1A 3M3HA 4C7OA 4HDKA 3ZW7A 3FCXA 2WYHA 1FQJA 3AU9A 4Q6WA 3WHIA 1ZEMA 3ROEA 5IVPA 5K0ZA 3EIXA 4QXQA 3JWHA 3CZ9A 3S1AB 1ZN8A 1T4DA 1QM5A 3B9BA 1O6ZA 4KVAA 1R0BA 2EQAA 5J1TB 4Y1GA 3AILA 3DZ8A 2CZCA 2QRJA 3FYUA 1KYYA 2QAIA 3O1LA 3X43A 1JB9A 3RIXA 2YMQA 4LFCB 4N7JA 3OF3A 1X74A 2YWRA 1QH9A 2HMUA 4HYYA 3CB4A 1FTGA 1OAOC 4O2AB 1Y8GA 4K86A 3DFUA 4JT9A 1IC6A 4CMHA 5JXHA 4ESVA 1ODKA 1PR1A 1XQ1A 3VPXA 1OX5A 1Y4AE 2PLAA 3KWLA 3EF3A 4I4TA 2HWJA 4J1NA 5EPOA 4YMHA 2GPBA 4GEGA 1U2QA 1JPNA 1M1UA 3V4VB 1HA3A 2E82A 4XBOA 1W88A 2ZYSA 3GHHA 4M87A 3S0JA 3ZTYA 4ZYVA 2VUSA 2GBGA 5KSPA 3F46A 5AM0A 2BW0A 3SS8A 4CGZA 3N8KA 4MUFA 3P9SA 1MABB 1TIPA 5CVJA 1RLUA 4BL5A 1YQDA 1CRQA 1W4RA 1PJTA 3G79A 1J9EA 2XUOA 2E1PA 2HCTA 2WYUA 1DX6A 1FS6A 2PYZA 1O54A 3EBPA 4OHUA 4LF5M 2R87A 4OMUA 3I09A 3BFPA 4GVXA 4CMJA 2GJ4A 3OFJA 1N2HA 1UP6A 4V0KA 3TIIA 4QDTA 1R10A 1U0OC 1QIGA 3MJDA 2ZWPA 4R2IA 1EFRD 1XDDA 3E9QA 4J2OA 1ECLA 2XADA 4MMYB 3PXBA 1E6EA 5EJFA 2NTNA 2LGJA 5LA6B 2PL1A 3SSAA 5FPKA 2QUIA 1D7AA 4NCJA 5LMNB 3O90A 4JI0B 1YO6A 2A0FA 3LRPA 5AXDA 1I3NA 2OAQ1 4JDPA 1HG1A 1TD9A 1IONA 1OLSB 5C5IA 5AVKA 2AIRA 2J9YB 1AIPA 1B14A 2GF9A 3KTOA 5A4AA 3FR7A 1DIHA 3L84A 5IH7A 2YHAA 2Q9AA 1KJNA 1JV2B 3C85A 1X77A 3AWDA 5LQUA 4II7A 3OKPA 4RGYA 4B2IA 3GQ5A 1B4DA 3QGMA 2CMHA 4ILKA 4BKOA 2ZZNA 2YJZA 3JD3A 4I8OA 5LP6F 5AVTA 3B6IA 1PJ3A 3KEOA 1I8TA 1UPUA 1V33A 4EQZA 1GPMA 1T5OA 2B8EA 3SAJA 1KEPA 1YDHA 2MSWA 3K0KA 5IFLA 3A9WA 2ZI7A 5NLLA 3B3JA 1HYQA 3D3EA 3JAKB 5IAGA 5FFNA 4ENRA 3TFOA 1S3IA 1C4XA 1SHTX 1VG0B 1U7UA 5K0SA 5BQOA 4UHKA 5K3DA 3EJ6A 5IDXA 4RMIA 1NIPA 3P0HA 4MVJD 5FOWA 2LDBA 1GLVA 3NHRA 4ND7A 3TLZA 1T29A 1I2MA 1PFUA 1SCJA 2X3YA 5CLHA 4BO8A 5CLLA 5DYWA 2MSCB 3AQ4A 3ZWQA 4ZRDA 3LKDA 1FP4B 4RF3A 4MB2A 5DXJA 2B4KA 1BXRA 3A27A 3FKEA 2Q27A 1PX2A 1HK7A 1T9CA 4YUVA 1X3SA 3REQB 4EYEA 5A03A 3RADC 2YXBA 2XMPA 2JFPA 2RMKA 4YO8A 4V0SA 3FVQA 3D59A 3WNDA 4C87A 1Y82A 3WWYA 4WY2A 4E2ZA 1QYDA 3DOAA 2P0YA 2WABA 5ALEA 4D82A 4TMVA 4F5WA 4Y18A 1WD5A 1JHUA 2A1TS 3O8QB 1DP4A 4GGPA 4NC6A 4B6RA 5K0GA 2HWXA 3DOOA 3F0TA 1YR2A 4D4KA 1QDLB 1L4LA 2A3NA 4PG4A 4TUYB 3TUZC 4ME6A 4IICA 4PZUA 4E6EA 4BC0A 2H06A 5EP1A 2QSJA 4HVTA 4EVRA 2WVHA 1BGVA 2YIVX 3IVCA 4QIHA 4P9NA 2IBTA 5FBZA 5KTKA 2H2WA 2H4YA 2ORVA 5JSFA 2QKYA 1QZMA 2WTNA 3T3EA 4AC9A 1VRCA 2AOXA 5JUWA 4XZ3A 5BMVA 4DBVO 4BHTA 2HA6A 2QJOA 1N3YA 1L5YA 3KZKA 3ER9A 3ZGZA 4OGFA 2VPYA 1OWOA 5AIAA 4BMZA 1U5BA 5DPMA 3WGMA 3NTUA 4GW3A 4OYRA 1SU4A 4QOFA 4W5RA 4AULA 1O8BA 1DQPA 4M55A 1GNVA 4BLVA 2KB0A 2EU8A 3ESAA 5LOVB 4F4DA 1RAGA 1Z74A 3DVQX 5D3QA 4D56A 1KI1A 4DUGD 1VDDA 1T2AA 5JO0A 4CR7A 3RVMA 2C29D 3KPUA 3T4UA 2BISA 1KSJA 1OBFO 3ETGA 4IP0A 3MWKA 4LMRA 3B51X 4MWDA 4JWTA 3HYTA 3DA1A 3IP3A 2OZKA 1HNNA 1P9OA 1QHEA 2QDXA 2GWHA 1KK3A 4J2HA 4M22A 4AJ4A 1KHHA 1W9MA 3AIIA 3CUSA 3GPCA 3LPMA 3IEVA 3VH4A 3MJHA 3HBAA 4MVYA 1XKQA 1ISFA 3GL9A 4ALNA 1AX9A 4J7UA 4FYWA 1DBWA 3RTGA 1RNLA 2EDCA 1HZZA 3I61A 2G9VA 2UUCB 1QUEA 2VO1A 1N2EA 1FVOA 4RY9A 4IHJA 4KDRA 1R0ZA 3MWEB 4WUVA 3A42A 1QTIA 1SCQA 4HNQA 3Q1KA 4QG3A 5JS7A 2KZSA 1CHNA 2I4TA 3KCNA 4EP1A 1GNRA 1QE5A 2GNPA 3B82A 4EGCB 4N3GA 1WR1B 2KWIA 3F96A 4GKJB 2MOKA 3DEJA 3N53A 1L8OA 3DJFA 4Z0HO 3BRQA 3MCAA 3QE2A 1UH5A 5FOXA 3VNSA 4B47A 2GXAA 1U8FO 3ILSA 5TSDA 5JEDA 3NXSA 1VOTA 2WFLA 1WDTA 4BZQA 1VHDA 2JI8A 1MQSA 1G21E 4YQEA 4XYBA 4Q4HA 2IDZA 4BN5A 4V1CA 2NUAB 2GJKA 1C3EA 3VPFA 1FFYA 2BBSA 4BYGA 4NXNM 3B9PA 4XVHA 2QP3A 2RHOA 4CCAA 1U2ZA 2IBMA 4URXR 2BJWA 7MDHA 3H2KA 5K3EA 5AM1A 4US2R 4EA6A 4P2GA 1L5VA 2FHPA 4QTYA 2C4HA 1JT9A 4TVBA 5DN6D 2MTBA 3V7WA 2XZPA 3KSXA 2ZE5A 3VKWA 2M2IA 4HEJA 3LQRA 2TMGA 3K2IA 4PBRA 1T2UA 1IHXA 1N75A 1M7GA 2HF9A 1A4XA 3GX1A 5LM3A 1XVVA 2NWQA 3PZBA 4DM4A 3DOCA 4BNDB 3EX7C 5JNUA 1OCEA 4OXNA 1Z5VA 4P16A 4EHLA 1TEXA 3BUSA 4PPQA 3L46A 4TSKA 4W4TA 1MU5A 1ZMVA 2V58A 3JRXA 5HOEA 3M4YA 1ESEA 2P78A 3IHKA 2XMGA 4AZTA 3HRHA 4F4HA 2AQKA 5AK6A 5IANA 3GT0A 2P91A 4U9IS 1GCAA 4MQLA 2V1XA 4LFCM 3LX6A 1IK4A 5C7LO 1AK2A 2Q28A 3IIEA 4YUXA 3KZXA 3J7AC 2FEPA 1LF0A 3D1JA 3TRDA 2AG0A 4Z53A 5JI2E 3D4OA 4NNOA 1CZLA 1O95C 1LC0A 1PP4A 5HJEA 3MQ4A 4MV4A 5FQOA 3SWWA 4EZBA 5BYKA 3TOSA 3GC6A 1M2VA 2NV6A 5FL7D 2ZB8A 4MUIA 3OFND 2P2GA 5AUPB 2EP7A 3I2FA 4B80A 4BS9A 1Z6GA 2Q0SA 4K3UA 4AY3A 4MUHA 2YJ6A 1YV9A 4LHXA 4KLRA 3WOHA 1Z4QA 1DKRA 1IAQA 1N7IA 2VDNB 2WUWE 3G8YA 3QFSA 3UXYA 4RF1A 4XE5A 1ZOLA 2CD9A 3D8SA 4PPGA 2JJ8A 1DAIA 4AKSA 4IBCA 1M5RA 1N2IA 4IDFA 5BWOA 5CB0A 4RZUA 4AJ1A 4RIHA 3LVBA 5HFNA 1FDOA 2P9CA 1IZ0A 4TV9F 4BZXA 4UE6A 1CQJA 3RIYA 5LMUM 2V0NA 3CSUA 4L6AA 1R0YA 4XASA 2BFCA 2IS2A 3L4BA 5GJWC 1URPA 3T9CA 2JW5A 3LU1A 5DBIA 2V6GA 2OAP1 1SCUA 2BIFA 3T1NA 2AOUA 2YVLA 4QU9A 5LP6C 4UTNA 1Y5NA 1Z5UA 4H1HA 2GHIA 5IM5A 1T3GA 4CKZA 2OYCA 2HPZA 4UPDA 3QLJA 1XTPA 3BZUA 4IIJA 2ZE8A 1E8DA 3HXOA 1IBMM 3ZDDA 1QYCA 4OLBA 3SCZA 5F64A 3R5FA 3AVTA 4XWKA 4QAJA 4BDSA 4DLPA 1B74A 5KMGB 4HVLA 4HNVA 4QNMA 2J3LA 1ND5A 4FGWA 2JVKA 3GPIA 3HEMA 2C9YA 3IBSA 2G72A 2GYYA 5L8RF 3GLSA 4QTTB 4HMQA 2LV8A 1GTMA 5HIIA 1NVKA 4ASUA 2JGMA 2VSOA 5CB8A 5KZMB 3WGIA 4QHSA 4R7GA 1FNDA 5CG2A 3ENVA 1E2GA 1QZZA 4FDMA 4LK2A 3P45A 1WXQA 3B1JA 2CNOA 3NWLA 3BC1A 2PRKA 3FKQA 1E2IA 3IQXA 3LSYA 4D02A 4YJDA 3VX4A 6LDHA 4GI1A 5IUNC 4YJHB 5EXDA 4D97A 4Z3KA 5HZKA 1D9XA 1HI9A 1QR6A 1RD4A 1SELA 2WRZA 4NU6A 1AE1A 5JCOC 1KY2A 2L69A 3FCUB 1MB4A 5HIJA 4FU0A 2OHJA 2EIHA 2HSWA 4NXMB 4IQ8A 2OUKA 3TBHA 1DC5A 4G24A 1UJ2A 4FE7A 2O2DA 1G64A 4MR8B 3U80A 5FI5A 3UF0A 4E33A 1NLUA 5BT8A 4GOMD 2IPNA 5JADA 4Y0VA 4E4RA 1T5LA 1E6LA 2LDXA 4ZYTA 4FMDB 2O8EA 2WG1A 3W5DA 2HF7A 1NP3A 2PNJA 1M2WA 2WLSA 5DE3A 2JDIA 2I6GA 3AR5A 4ID9A 1KPIA 4Z4FA 2B36A 3GP1A 3OEHD 5HSGA 2QG4A 4LCJA 2FCRA 2A5LA 3FVRA 3GOQA 3JWGA 4DLLA 2VF2A 3CKKA 4H1VA 2OFPA 1E9RA 3Q2IA 4B3SM 4IMPA 4ECEA 1II8B 4ALLA 2QXUA 1P62B 1BJKA 5IAEA 3HJTA 4P4SB 2A0UA 2AR7A 2J9RA 1E3EA 5EIBD 1G8SA 4EHDA 1PTJC 3EA0A 3N7AA 2QGNA 1AXRA 2QQ0A 4H7FA 4OQYA 4QBGB 1H5NA 5K6AC 2A58A 3ZU3A 2GKOA 3O4HA 4BVJA 2HPHA 3QMVA 5JAMA 3R3ZA 1XQ9A 2EYUA 3DJYA 5K6RA 4KREA 1FFBA 3WL6A 1Z9BA 2BUCA 3P7MA 5JPCA 4C5CA 4XH9B 2YKGA 3OZVA 3DKRA 3W0FA 1FFXA 2DSNA 5HK8A 1C29B 2CBXA 5E1DA 2XTJA 3HMKA 3L07A 5JCXA 4PO8A 3T38A 3LCUA 2DR3A 1U6KA 3SX0A 1GQFA 2F1IA 1VLQA 3QSYA 4GZ5A 1UDXA 3LCVB 2BM9A 3N8HA 1M2GA 4FN4A 5DWVA 3DE7X 2ONYA 1EFVB 3O4GA 1X8KA 4HFNA 3GRUA 2P9JA 1V4BA 4OKSA 4ZOLF 3KOZA 1DDIA 4GLOA 3B60A 1RP1A 3SLRA 4MQ6A 1M0WA 4OLJA 5CDYA 4NPCA 4TQUS 2CNNA 1JE0A 1Z5WA 2DMRA 2OBNA 1T9AA 2Q6TA 1NE7A 1QDEA 2VPXA 2RH5A 2WV7A 2Z3WA 4Q7LA 2FEOA 1KQ3A 4WZBE 2QT1A 3A10A 3ZY5A 5MN4A 4LYGA 3L25A 2JFXA 3C0KA 2QA5A 5H59A 3T8YA 1T0UA 1UDBA 3HJUA 2NU9A 2AVDA 4YONB 1TUIA 1M1NB 1C1DA 1P73A 4B3TM 1DJPA 1LV8A 1TX4B 1NLMA 2O2SA 4W1SA 3TBKA 1UFQA 3VOTA 3MQ2A 1XL1A 2C84A 4BRWA 4FCVA 1NM5C 4ZV9A 2IYEA 5ECDA 1GGKA 4XX0B 1EB9A 2DHCA 4HEHA 3D54D 4WLNA 2JY8A 3AK4A 1JH8A 4QOSA 4D0LB 2C5AA 1XLVA 4FD2A 1N5KA 1YR9A 3MBKA 3R2JA 4YCSA 1WHCA 1C3LA 1MC4A 1RZ3A 1XQYA 4B2PA 4O59O 1E7QA 1G5PA 3KQWA 4UBKA 5AW9A 4BO2A 4CT4B 5I7VA 1J0DA 5I9NA 5I9SA 1SXJD 4MTLA 4UATA 5DB4A 4F92B 1U0BB 1GR1A 1MENA 5M29A 3CKMA 4FNMA 1QK4A 3VR5H 5FO1A 3BWXA 4CM3A 4XWOA 1YBVA 1L1RA 2BRUC 2IZ1A 5DOVA 2NPFA 4QD3A 4GL2A 3O74A 3OUTA 4CKWB 1WCV1 2NZ2A 1GWNA 1RFLA 4GBMA 1IPEA 2PEZA 3OY7A 2EFCB 2QM0A 3DXYA 4OKNA 5BN5A 2IEIA 3T7RA 3PUVA 1UMBB 3FVWA 5C80A 2QVLA 2B0JA 3RVJA 4HQOA 1ND6A 4PO9A 1C0LA 5B7QA 3PG5A 4EHIA 2PRZA 4RIGA 4BRSA 1LLFA 4UU7A 3IQDB 4DMLA 1TGYA 1Y8RA 3TXAA 3FTEA 1RAIA 1A9PA 1I4LD 1Y9ZA 1YDEA 4LSZA 4QWMA 5AW1A 2V7EA 1I7PA 2PT5A 3A3KA 2I7NA 3GFPA 4MVJM 2XD4A 4RCYA 4GQIA 2WMNB 4MV1A 2MSEB 1EDDA 1KEWA 2YQZA 4FVTA 5B7NA 7YASA 2ZXUA 3DBRB 4IXDA 2PKXA 4DWWA 4NC9A 1J00A 2D1FA 4TS4A 1J0XO 2FWJA 2GPSA 1XRNA 2C99A 1KP2A 4JH0A 2QN3A 3H9EO 3FN4A 3AJ8A 4UEKA 3E22A 1ZKDA 2Z7JA 4TV9B 4FKZA 5M7EA 2CLSA 5JAIA 3L1UA 2G0AA 1QORA 2ISCA 2F9LA 2FJUA 4TMTA 1B93A 4PZLA 4M36A 4DARA 3MPUA 4JT2A 3C3WA 3ZLBA 3LLMA 4OHRA 2V0GA 1KKMA 1O9GA 3EZNA 4YJ3B 2GD0A 2V7TA 3FTPA 3HG7A 4CF6A 1A9XA 3UJPA 2CSUA 3KQPA 5HX7A 2XVXA 4FPXA 3IAFA 4E6PA 2Y1OA 1BDIA 1D8TA 2JFWA 4NU5A 3EH1A 1PCXA 2NNLD 2VH1A 4EBFA 5KIAA 4QUEA 2BH2A 3AETB 1FP4A 4G0UA 1MAHA 1USIA 2F43A 2W43A 3BRWD 4LNAA 4MS4A 5DYTA 1XZPA 2DWNA 4ERXA 1U2PA 3C87A 3K6SA 3H04A 4R2WA 2VHJA 4LF9B 4OHYA 2WAYA 4HAXA 4M89A 1HETA 2W6CX 1GNSA 4Y1RA 3PQFA 4EI7A 1PWXA 3HB4X 4JI2B 1E3WA 5KYYA 1GXSA 5AK5A 1QIKA 4ER7A 1WHTB 3DM5A 5BRNA 3V97A 5A62A 2AOWA 2RDMA 1E3DA 3KX2A 3KVYA 1JZQA 4FJ0A 4LHYA 4LUCA 4NLLA 4RNCA 2RGRA 4C21A 3LPAA 5BSVA 5AXCA 1I5RA 3SOPA 3TLXA 2BKVA 3KXDA 2G5GX 2H1RA 1TLTA 4OCZA 4YFVA 4OX9Y 4LJ9A 1C7QA 3AR4A 3FZQA 1E94E 2FQQA 2IRWA 2J45A 2GVNA 3BF8A 3HSSA 3KQYA 4R1LA 4FOPA 3SC2A 2W2XA 3I2YX 3RKRA 4FYVA 4BUCA 1E5QA 2IP2A 4LPSA 4JBHA 5EP4A 2XCLA 3NX4A 4LSGA 4TTPA 2IUSA 2FSFA 4XXHA 3D02A 4NJMA 1Y1LA 4CT5A 3BDIA 1FSZA 4UU0A 3GFBA 4DY6A 5KU7A 3UCFA 1FMFA 3O9ZA 4KVGA 2PX4A 3ENNA 3USCS 4YIHA 4E32A 3HQ4O 3N0TA 2OBMA 4KPYA 3IMFA 1IEXA 1UL1X 3NVAA 3B5IA 4L2IA 3SEAA 3IO3A 2VBGA 3QFHA 1YU9A 2D2IA 4G6ZA 2OECA 2Y6VA 4H3KB 2XOXA 4WCFB 1YZGA 4PAMA 3T06B 5KEIA 5LQRA 4RYLA 1HLFA 2P79A 1I01A 2V7XA 4FFPA 4UULA 4ARIA 4UAVA 2FQ1A 2YFYA 3PUJA 2YYAA 3BWEA 4FC6A 4UMEA 1X70A 5CPBA 1E1KA 3WFIA 4Y2XA 5LWHA 2YN4A 2CJWA 3GYBA 3U40A 1FQOA 5JS1A 4LN1A 4AQYM 3C6MA 1B15A 1ZN9A 3GU3A 2ID4A 4LVCA 4DR3M 2I6FA 3I9NA 1PVDA 4RA9A 3KHSA 2XCIA 1LTMA 3L1IA 3P20A 4TM8A 1D6MA 5E6UA 3UAYA 3ZE1B 4EGSA 1DBVO 4Z8YA 1B0AA 1QF9A 1XO1A 4WNAA 2I65A 2WPDA 4MH0R 4R54A 2ZQ5A 1W4ZA 1KDRA 3OUZA 1YKGA 4EEKA 4HNSA 3ICVA 1NW3A 1HZZC 4R9NA 4F04A 1ZW6A 4FWDA 2OUIA 3EGWA 3HXPA 3KSRA 4IDQA 1YL6A 3SVLA 4LDRA 4A27A 3HHWA 4YMWA 3ABRB 5L3SA 1P0PA 1YB4A 3VC3A 1QBGA 2FSGA 4LV6A 1X1AA 4FFDA 1F1BA 2AJDA 2DBYA 5AO9A 4FSXA 2HJGA 4MIEA 5G4KB 1M2EA 3GJYA 2ZSHA 2YY5A 4Y6SA 1TH4A 3PS9A 1R8QA 2FX3A 5DGXA 3ZCSA 1Z6QA 1IEWA 4I8DA 4AMBA 4DLVA 2GS9A 3K0HA 4M0FA 1QGED 1VSQA 2RJOA 3LBNA 4G0PA 4OATA 5G41A 3ZLJA 3LXRA 1CNMA 4ZHQA 2CF5A 3TB6A 2ZSJA 2UYYA 4DV7B 3PI6A 4CM5A 1DKQA 1OTYA 1BJRE 3D5TA 4I6EA 3C3CA 3WISA 4AN1A 2O8DB 3C3XA 3E05A 3BMQA 5U1PA 2O2GA 1PRBA 4R16A 1QS0B 3UHJA 3WGTA 3A26A 2P30A 1SOWA 3DE3X 3FW1A 4Z4CA 4OQ4A 2PUAA 2E4XA 2CFIA 2VHQA 3LY9A 3KE8A 3M89A 1AZWA 2FPRA 2V6FA 4B6EA 4BFYA 1FZTA 3DDNA 1AOXA 1M2OB 1YH3A 4KAJA 3IGFA 3PDCA 5JO9A 5AW8A 4TYWA 4C43A 4GHLA 2P2LA 4KSBA 4R8SA 4B4VA 4DCJA 3CBGA 3W5SA 4E1AA 3QWAA 1L5HB 2KBEA 3PPIA 5MGNA 1AZLA 3BH0A 4DR7B 2DZOB 4C0LA 2HA0A 3S27A 1CUSA 1ZV1A 1KDYA 3CISA 1U0NA 2C5GA 3RFVA 2A9OA 4B3IA 4F6LA 5M2QA 3JQPA 2GJSA 1QQTA 2AG6A 1BYIA 3BMOB 1KO5A 1G2PA 1OLXB 2V6ZM 2EHJA 1OXUA 2XWBF 2Z1MA 3BDAA 3Q8XB 3TTWA 2HJVA 2BMAA 1UXHA 3L7OA 1WO8A 3G2OA 5AKLA 2AA3A 3FKSD 4A5OA 1N6OA 2GN4A 2I91A 1MIOA 2JAUA 4U02A 3KZCA 4E09A 5LXTB 3EGEA 5B5SA 3UAGA 2I5PO 4M0EA 1XPUA 3V7NA 3WLKX 2II6A 4M0KA 4P5PA 1F5NA 1K88A 1VKZA 1NC3A 1Y8QA 4CEJA 4EY7A 1WBJB 1Y3CE 1GQYA 3HUDA 2HZBA 4Y6GB 3GLIB 1ZA2A 1KL7A 3IAXA 2Q4DA 1ENZA 4H0CA 3ICCA 4UFOA 4ESOA 2BT4A 2FK7A 4GZMA 2X2OA 4WBXC 4L08A 4GBGA 1MD9A 1S7GA 3WQHA 4C03A 3A32A 5DHFA 5H68A 3MBIA 1U2DA 1P80A 2SCUA 4CR8A 3ELYA 1GU7A 3HLKA 3Q40A 3ZJUA 1TIKA 1G5RA 1C0EA 4GDMA 2PS0A 5CNIA 5HUQA 2OPFA 1UP4A 3UGTA 4I4LA 1H8EA 4NCXA 2Z8YA 1JHVA 3VMFA 2P2SA 4XAQA 1H4SA 1L7NA 3K0CA 1Q02A 2X8JB 4ZVRA 2JIQA 1DCMA 2PGJA 3HM2A 4CL2A 2HLDA 3OKFA 1TI7A 1Z12A 2QU7A 2GWRA 3V80A 3VVLA 4DRYA 4RACA 1CZKA 1JKJB 2VJBA 4IIJB 4U7WA 4LDNA 5C3MA 5L7TA 4OH1A 1ZA1A 2ZR7A 1DX4A 4FGLA 4GLBA 4YAIA 2WWXA 5C4MA 4CLOA 2B5OA 4BUJA 1Y98A 4WZBB 5ES3A 3CLTC 2ZANA 1RI1A 2Q8NA 2GTPA 2VPPA 2KE5A 3DE4X 4FBMA 4GI2A 4KYTA 3AEUA 1KZ7B 3C1AA 2EWMA 4GPTA 4OTZA 4FDAA 5DF1A 3THOA 3OCUA 2CCJA 3HY6A 2WPDD 3FHJA 3DVAA 2X2FA 4LDAA 3ZKWB 3H9CA 1YA8A 1X80A 3EARA 2CE2X 4RZXA 1FFHA 1QKJA 2CSXA 1TTQB 2WHPB 3S44A 2JLYA 1OI3A 3U3DA 4Q9KA 3RBXA 3U37A 1YB5A 1YCDA 1LSUA 4H16A 1YS7A 1ES9A 4M3NA 5CX1B 2XSZD 4E5UA 1QQ5A 2XGNA 1XMOB 3TCXB 3WNVA 1Q0SA 3IG8A 3A7DA 3JWIA 2XYRA 2ZJ6A 4E51A 1D1SA 3FNRA 4BWGA 4WKCA 3IP6A 4J1TC 2JLAA 3OM0A 3P2KA 3PZRA 2WTUA 4XQ9A 2QYOA 5F3WA 3KOXA 4YMSA 1XCGB 4A8HA 3RH0A 5JNRA 5DXAA 1T9KA 1TAHA 4FYYA 1LK7A 1EUDB 4HXEB 3H9BA 3AHEA 4EAQA 2JY5A 4IR7A 3AUXA 3NTVA 4ZQIA 2O8EB 4P81A 1RRCA 3DTVB 3FDFA 3KTAB 4XPZA 2BR5A 4E22A 5BVHB 4H7KA 3H3XA 2UAGA 2GB4A 1N3IA 3E7FA 1NBEA 1BYUA 1V9LA 2PWPA 3QKTA 1LSJA 4Z0PA 1TCUA 3U49A 3VR3A 4AU1A 2WF7A 3HUUA 4DSTA 4YRBA 4TLAA 3N75A 3WAJA 3F98A 3GJ3A 4CTJA 4RORA 1BMFA 3K8YA 3Q0IA 2HIGA 2WUGA 4LZLA 2XMRA 3ZLUA 1E1MA 1IE3A 2POQX 3HXQA 2QB5A 4WFKA 1PJBA 4QATA 1GAEO 4NPAA 1Z0KA 1NQVA 2Z9CA 4NAUA 4PZDA 4PYMA 1E0SA 3ZHSA 3S3TA 2V03A 3ABOB 3HCAA 5UKDA 2FN7A 2PD6A 4C14A 1Q7RA 2J59A 4DC0A 5KJCA 1M7HA 1TC1A 2BDTA 4MWEA 1S89A 4M1KA 2BD0A 3HPRA 1GT6A 1GYRA 1PLLA 2DY1A 2R4JA 3RC2A 5BUZA 4CVNA 3BEOA 4N0MA 4BPBA 4PRZA 2JGDB 3ESXA 3TDKA 4FFMA 4OXKA 5GJBA 3NHWA 1P9RA 1L7OA 2W9XA 1ESNA 2ZUEA 3C8DA 4RV9A 3TO5A 1KI4A 2F1KA 4WXMA 5KQRA 3CVUA 3Q15C 3AUKA 1N2GA 1TYCA 2DG2A 1CC1S 4DLTA 5BVGB 1J21A 4EG6A 1L7PA 3B74A 1AT1A 2WOOA 4O3FA 4DR3B 2JGRA 4CCYB 4JX9A 5DZSA 1QDRA 1NVUQ 4QYMA 5LNK1 4KDEA 4A92A 1KKUA 1YRYE 1OIXA 3OOEA 4O4JA 4KO8A 2ACWA 5KS2A 4BECA 2R86A 2CDBA 4OGGA 3DDOA 4KXFB 1JDNA 2ZRMA 4K2HA 5CMLA 4DV1B 1XWWA 2QMUA 3QE3A 5M3BA 5BR8M 4YJ3A 3A11A 3FKJA 2C2KA 3GR6A 4JUDX 3UJNA 4QOEA 1O7JA 2GK3A 4DRXA 1UP7A 1YAJA 2IYLD 3KKNA 3DR5A 3BMXA 3OQPA 3O3MB 3QA3E 1IEQA 2Z4RA 4HQLA 2I6SA 5JG7A 2IV7A 3E2IA 1XEXA 2X9NA 1CDZA 4AW9A 3K6SB 2H48A 1N9GB 4MUMA 1XZHA 1EE1A 3OHPA 4B8YA 2ZSKA 4ZK2A 1A4IA 4URZR 3MMZA 3PNKA 1KKLA 3FCCA 1FFCA 4Q4LA 4QVGA 4C76A 1PLKA 2JD1A 5JT1A 1TQHA 1GGMA 1OXKB 4R68A 5F3DA 2J1LA 5CLGA 4F84A 4A23A 5J1SB 3QOXA 4RQUA 2CL6X 1D1PA 2ZIXA 4B7GA 5C9ZA