3VFDA

Human spastin aaa domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
266
Chain Sequence
b'LANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLGEKLVRALFAVARELQPSIIFIDQVDSLLDASRRLKTEFLIEFDGVQRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPENMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spastin
publication title Crystal structure of the human spastin AAA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 266
sequence length 289
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vfdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vfdA01
1NN0A 2FWRA 2P6UA 3KJIA 2VHTA 3DEFA 3W3ZB 2B7BA 3LX5A 2P0EA 4CGZA 4EKDA 1SXJB 4L9WA 2C77A 2NTYC 3PUZA 4HAXA 1VKJA 4FN5A 4LI0A 1OFTA 3T5GA 3ND8A 3TUJC 2BM0A 1TF2A 2QN6A 1Q21A 2GJ8A 1Z0IA 3ZS8A 1A5TA 2E87A 1KI9A 1KGDA 3PXGA 3T35A 5L3VA 4B3BA 5DISB 3G0HA 3AVTA 3THXB 1F2TB 3R9XA 4PAOA 1WE2A 4EJSB 3TW4A 1ZM4A 2SHKA 5B30A 2Z83A 3TAHA 2WJIA 2QZ4A 1NVVR 3PIRA 2ZRKA 1N6LA 3IIJA 3R8FA 1UBEA 2WOJA 2ODWA 4FWGA 2PEYA 3KL4A 2V6ZM 4DUGD 1IN6A 1R5BA 1M7GA 1YE8A 4HDCA 4UNRA 1LVGA 1OKKA 4OQNA 1T3SA 3O8DA 2FGJA 4B3CA 1JBKA 1W5SA 3K9HA 3ZD6A 1FMJA 2H92A 4OI0A 2YV5A 4EPWA 2Z4SA 1Z0JA 1G7RA 4R9UC 4TYPA 1M6NA 5FOTA 1NRJB 4PPQA 1CJUC 3CPJB 5EP2A 3UK6A 3ZJYA 1KKMA 2BMDA 2I3BA 3AF4A 4TSFA 1ZYUA 4RSGA 5DN6A 3SBDA 4TLBA 3TVTA 3DHWC 3W9YA 2UZIR 1XMIA 2IWHA 5P21A 1V5WA 3EG5A 4U5XA 2B92A 2XJ4A 1YR8A 4BLRA 1DAEA 5BN4A 2QM8A 4C0JA 1NLYA 1P2VA 2GDJA 1VCOA 4JLPA 1SVWA 2WWIA 3A1UA 1DO2A 1KMQA 4DSNA 4ZCIA 3ZVRA 5FTNA 3CRMA 3LBNA 1P72A 2QSZA 2GF0A 1LTQA 2JJ1D 3QXXA 1OFIA 1WDTA 3EARA 2ZYVX 4HZUB 5CIWA 4IOLA 5LDDC 2B6HA 3CPHA 2OESA 3FVQA 2C99A 4GDFA 2CJWA 5A4JA 3VFDA 4URWR 4E22A 1ZVQA 1E9AA 3OESA 1DG3A 4I99A 3SEAA 1UKZA 3WRXC 3OAAD 4LV6A 4Z51A 1AQYA 2J7PD 3QPWA 4MYHA 4TMZA 2VA8A 3I8SA 5M04A 4QXAA 4ZDJA 2WM9B 3IGFA 2GEVA 2RAPA 4Q9KA 4LRWA 2A7QA 1TX4B 2VSXA 4M1WA 4HAYA 2OAP1 1XPRA 2QY9A 2QMUA 1KMHB 1J8YF 2ZUBA 4TN1A 1N3BA 2FPLA 5HPYB 4TYYA 4IVRA 5EJEA 3TNFA 5AUOB 3IBGA 3GLHE 3T5DA 3GLGA 1HQYE 3P20A 4QGGA 4UNNA 1DG1G 1KJZA 3RS5A 1BMFD 1KI6A 4PXAA 4US2R 3EWAA 2NPFA 2V1XA 1QZXA 4RZ3A 4DLXA 5K8IA 2HXSA 4M0LA 4A0GA 1GM5A 2WOOA 4URUR 1KI7A 2EFCB 1D2EA 4IKEA 4ON9A 3B1ZA 3KFVA 1UKEA 4MKFA 3W6NA 3EIQA 1OV4A 1R5OA 1QVAA 1TAGA 2VP9A 3U44B 1GIAA 2YINC 3SQXA 3QF7A 3IHWA 3AVQA 3EC1A 2ZJBA 1JAHA 3LH5A 5FPTA 4EDHA 4NCHA 1W5TA 1R0XA 4KVGA 1Z6AA 3QE0A 4G5QA 4KFRA 2VH5R 3K0FB 1XD9A 3D6TB 1UFQA 3HP1A 4NL4H 3J81k 1SULA 2O52A 2YJTD 4NZYA 4E03A 3KTAA 4GP6A 4H1UA 1JB1A 1WXQA 4LHWA 1KK3A 1P7CA 4Q1CA 2RGNC 4Q7JB 4TLDA 4C0AC 1NBMA 3TQFA 1B0UA 4PC3A 1W0KA 3MFYA 1LV7A 2UVQA 4XSGA 3ZVMA 3VHLB 1ZINA 2F3RA 2FX3A 2GZDA 1IOZA 4C0BA 1H8HD 3RRMA 2ZETA 4B35A 2HT1A 5EXXA 3A36A 2ONJA 4BFUA 1OLOA 2F3TA 2W0SA 2Y8EA 2VYFA 3VLFB 5AJZA 1JR3A 1SVSA 4IOMA 3IUYA 4A9AA 1IXZA 3QF4A 4HI0E 3OHMA 3VU9A 1E9FA 1N6NA 4FD2A 5JJIA 4HLUA 2CK3A 1FL9A 3SN6A 3VHXA 4JKYA 1VCNA 3JZMA 4CDGA 3LO5A 4LDJA 4LYJA 3WMEA 5FPKA 4YMTA 4RFSA 2I1VB 1OH5A 1GUAA 2RGDA 3NHBA 2MMGA 3K9GA 4GT1A 4Q9IA 1XJ0A 3A1VA 3KJEA 2RGBA 3LX8A 4X8LA 3S1AA 3IEVA 5CDFA 1ANKA 4P31A 1SXJA 4LJ8A 5JWOA 2IBMA 2VHQA 2OCAA 2GBLA 3I61A 2Z43A 3SYKA 1U0LA 2AXNA 3K9LA 3UMRA 4DLVA 5BN3A 1EESA 3A4LA 3AF3A 1G4UR 1RIFA 4RD3A 4RJLA 4CT5A 3A8TA 4IEEA 4JJZA 1QZMA 2VEDA 5JMTA 3EZ7A 3EPKA 8OHMA 2XOKA 1XEWY 1F2TA 3QPUA 3THXA 4QOSA 2CE7A 2BIFA 3Q3JB 4R98A 4EJSA 3W5JA 2EVWX 2ZIAA 3EC2A 3K8YA 1IN4A 4IRUB 1JPNA 1NMYA 2JIZD 3X1WA 4R2IA 1M7BA 1GOTA 5IK2D 3SZRA 4AYTA 2IYZA 4EPYA 4PHFA 5CB6A 2QQ0A 3L43A 2IXGA 1XTJA 2OCBA 2ZXUA 4XD7D 2QRNA 2ZRCA 4QHSA 1R0WA 1VYVA 4BE7B 3QXCA 4QM7A 3V4RA 2I1QA 2ZSDA 2OILA 2YVUA 2FPKA 3Q8XB 1Q1BA 2NMVA 1Z3IX 2J5XA 5SZHB 4DCVA 1AGRA 4CEHB 3EZFA 3TAUA 4HAVA 5IRCD 5LB2A 4TWZA 3VKHA 1MABB 1FPMA 5G3ZA 5HE8A 3DKVA 5DLQC 3QG5A 1P75A 2IEYA 3L0PA 1NP6A 1X8JA 2QRZA 2R44A 3B82A 3U7GA 5EQTA 3B1YA 3EIHA 3RWOA 1QHSA 1N6IA 3OEEA 4TMTA 4A82A 1NJGA 3U61B 5AJYA 5GVRA 1D8TA 1QHXA 4K81B 2HF8A 3U60B 1QHYA 1Z63A 1LS6A 1E2DA 2PBRA 3AF1A 3W6OA 1YVDA 2QENA 2VTKA 121PA 1Z0FA 5L3RA 2OCPA 1TF5A 1P61B 3REFA 5FI0B 3CNNA 2P67A 2ZAOA 3NH6A 4OQMA 4UJ3A 4MRRA 4XOIA 5HCNA 4O2RA 3B1WA 5HTKA 4URZR 2C9CA 1RZ3A 1NIPA 4K8OA 4GNKA 4HZUA 1UF9A 1X37A 1BYUA 2QE7D 3L8YA 4R71A 2GAOA 2GJKA 1KKLA 5DHAA 1Z6YA 4PQRA 2X8AA 1DS6A 3R7WB 2FF7A 2FFQA 1US8B 2GJ9A 2WJJA 2DY1A 1VYTA 1ZNZA 1CU1A 2ZJAA 3B9QA 2BBWA 2A78A 4JZKA 2ZTSA 1UAAA 3IO5A 4NE2A 3K70D 1TF7A 2IS6A 1K5GA 1NVWQ 2XZOA 4HB2A 4PQYA 2YWFA 1KMHA 4MQBA 4M1TA 4M9XA 2AD5A 2WSMA 1G7SA 4BUJA 1R7RA 2IEZA 3K09A 1XBTA 2OSBA 4KYUA 4ZKDA 4IVPA 3U3KA 3I5XA 1Z83A 1W2HA 2JCSA 5H1YA 4RD4A 2ZJ5A 1LB1B 5B57C 2QEQA 5HKKA 2F1IA 4A2QA 5FBWB 5G3YA 5AUPB 3UG6A 1IXSB 4WBSA 3KQHA 2AD1A 1RYFA 3K53A 4D4KA 1OYYA 3EZ6A 4JVSB 2IYTA 4L9SA 5AK0A 1F5NA 3KJHA 5KSYA 3AP3A 3FWYA 1F60A 2H18A 3PUYA 3U44A 3QEJA 4QM6A 3TW8B 5DIFA 1CKEA 4QBHA 5D3MB 3B78A 2QPAA 3KW6A 4MRVA 5KUTA 1XPUA 2I4IA 1HURA 4JLVA 3ADDA 3I4LA 5JCZA 3K0FA 3QI2A 5BYJA 1HT2E 1NVXQ 3I1FA 3BFXA 1LY1A 2XEXA 1XEXB 1G5RA 1II8B 3QG1A 4HAWA 2XB2A 3UMSA 5CLLA 2FN4A 1E99A 4GRAA 1KHTA 4EAQA 3TSOA 3TLXA 1CR0A 1N0WA 3HR8A 1XJCA 5C18A 4KITB 1CRQA 1OIXA 4JBXA 4HDOB 2ZSEA 2YWHA 2ZSAA 2CNWA 4KYIB 1T3HA 3ADKA 4M2LA 3TRFA 4E5UA 3QIAA 4BQSA 4IHQA 3U6BA 4TYQA 3I5YA 2ZE8A 2CDNA 1GKIA 4RKFA 4A1FA 3SQWA 2W2VA 2CVHA 1LF5A 2ZRFA 4Z8YA 4JVNA 2IA5A 1N6HA 4KO8A 2AWOA 5A0FA 2XX3A 3GFPA 1VHTA 4D82A 5FTKA 2KBFA 1NN1A 3WP1B 3BS4A 4LHYA 3M0EA 3EAQA 3CUEF 5E7JA 3NC0C 4KAXA 1B23P 1E1QA 2NPIA 4BLPA 3I8XA 5E95A 4V0OA 2WKRA 3EASA 1ZUHA 2QMOA 4I1SA 4BLOA 1QG4A 3BORA 4FWTA 3IIMA 2G3YA 4ZIRB 4ARZB 2D3WA 4CVNA 2JLQA 5JSZB 3T1TA 3CWQA 3P1JA 1FFHA 4PC1A 1KK2A 1ZC3A 1E2GA 2IF0A 2JA1A 2KE5A 3LNCA 4NDZA 3WNBA 2PLRA 2J0QA 4KSBA 2RCNA 4EFMA 3FTQA 2QPTA 3W5IA 2Q21A 3JVUA 2FMXA 1EFCA 1NLFA 2DWOA 3H2YA 4LC1A 1H65A 4YMVA 1KDPA 1XD8A 1QHGA 4D81A 1YJ5A 2C03A 1Z47A 2YOFA 4NCNA 3ICEA 4YMSA 3Q5EA 1G20E 2F1RA 2V7QA 4L8GA 1UEIA 1E2EA 2YYZA 4WXPA 1E9SA 2F7SA 2VHCA 2XAUA 4W5HA 2X2EA 2ZPTX 4CEHA 5AR1A 2IXFA 2FSGA 4M1SA 4LK2A 4DJTA 5FL7D 3ZIAA 4IDPA 1TEVA 1AJEA 1EWRA 1G3RA 2CL0X 3FMPB 1U90A 4Q4HB 1XPOA 2GEUA 3HYTA 3R9WA 4URXR 1UEJA 3K0EA 1HV8A 1K8RA 3C14C 4JLBA 1G8PA 1Z28A 3B8HA 4JYBA 5AUQA 4URVR 3BXZA 4IVQA 4A92A 1NN5A 4QHTA 3FHTA 2LKCA 1R0ZA 4AURA 4A15A 4B73A 1ETUA 2GZHA 1COWA 5AWFC 3SJBA 4LJ6A 1ZM9A 4PO9A 3GLGE 2N46A 3ZZ0A 4TLAA 1W7AA 1EGAA 1N5JA 1E2IA 4YMWA 1D2MA 2P5TB 1Q1EA 2EWWA 1E2QA 3C16C 4JLJA 4W5WA 1EWQA 2BKEA 1PJRA 2XNDA 3DM5A 1N6OA 2OXCA 4HEJA 2ZI6A 2XSZD 2CE2X 3BB4A 3HJNA 2GETA 1XMVA 1VG1A 4JL6A 3R7WA 3LBIA 2QGZA 1US8A 3A1TA 1M8PA 4JLKA 3RRNA 2J87A 1ZIOA 3KXKA 5K8UA 4D6PA 1NG1A 1G291 2A9KA 1OXUA 5JRZA 1OF1A 2IT1A 3OIYA 2PJZA 5BN5A 2ZI3A 3ZS9A 5KNCA 2X1VA 4EPXA 4EPRA 2DFTA 3QXJA 3GLIE 1IBRA 2OAQ1 3O8RA 4GFDA 4HUTA 4NYIQ 3IIKA 1KJYA 4FXPA 1ZRHA 5GJVC 4AD8A 2QI9C 4LV5B 4POAA 3LD9A 4LX0A 2OE2A 1AQUA 4TTRA 3TVDA 4AK9A 1UBGA 2REBA 4IXNA 1YZQA 3AKCA 1G64A 2NO6A 1OIWA 2O0JA 5JHGB 1D9ZA 2VLIA 2CVFA 2YC2C 2DFKB 1F6BA 5J47A 3F0TA 1FQKA 1ZD8A 2P6NA 1JR3E 4B3DA 5JZVA 4MYUA 1K5DA 4MKGA 5FTMA 5DO9A 5E4FA 2ZREA 3GEEA 3CF0A 1KI6B 1ZUNB 5J40A 5D3MA 1TNDA 5TB5A 1FNMA 4GZMA 4IDNA 5H8WA 1D6JA 2JEOA 3P4XA 4C4PA 5LD2B 1S4QA 4Q9JA 3AF2A 4QJ3A 3RS0A 4DCUA 1NJFA 1XEXA 1II8A 4GBMA 4J0QA 1JQJC 1XXHE 5CDFE 1U8AA 3A6PC 3OIUA 2ZI9A 4JSTA 1Z22A 5CK4A 2FZ4A 1E9RA 1Z2CA 3BB1A 4IOKA 1P62B 1VIYA 4L16A 3KX2A 1PUIA 5EE0A 4Z54A 3U6KA 5DHFA 5KDDA 4ZKEA 4H9GA 2W00A 2XTMA 5DYGA 3H4MA 3GLIB 5GVSA 3CWZA 2BMEA 3OFNA 4DVGA 4QBFA 4A2PA 4M1YA 1TEXA 1TUEA 2W2XA 3THWA 1G18A 2AFIE 3LRPA 4OQLA 1PLKA 4OHYA 3GJ5A 1ZU4A 4NYMQ 5TY0A 1S2MA 1EFRD 2BOVA 3Q5DA 1ZCBA 4M1MA 4DB2A 1HEIA 4EPVA 4CZ2A 2OBLA 3GJ3A 4O0MA 1XD2B 3TQCA 5FPSA 1IY2A 2BMFA 2IYWA 1NVUQ 3GJ4A 3QOFA 5E7MA 4YONB 3D31A 2L0XA 3GJ7A 4NMMA 4RFVA 4X8OA 2JLSA 4CW7A 2D06A 4ITRC 2ZJZA 3PEUA 4M9QA 3W8NA 4EJSC 4Z1MD 5B64A 4NTZA 3VQTA 2A5JA 2D2FA 3UANA 1O87A 3IPYA 4ZIRA 4LSGA 2WWGA 4ARZA 5JSZA 2ZAMA 5DI9A 3NEJA 2OFWA 3S1AB 1XXHB 1KZ7B 3PCRB 3AUYA 1Y3AA 1IJEA 1II0A 5LPNA 3SHWA 1JALA 1H8ED 2FGKA 1OJLA 3U5ZB 2OG2A 2V9PA 1U8YA 3CLVA 4PFSA 5KYKA 4MYCA 3EPHA 4OI4A 2Q9AA 3MSXA 4PZZA 4A6XA 1DEKA 3Q7QA 1KTVA 2EFDB 3UWKA 2CEAA 1WMSA 1Q1QA 3A58B 3AF0A 3CBQA 4W5JA 5FOSA 1ZM7A 1QVRA 2REOA 4DLYA 3ASZA 1FP7A 2QTFA 4ZDWA 1EG7A 4B43A 4QL3A 3ONWA 1LF0A 2OO7A 4CRWB 1J8MF 1E2HA 5FBRB 1NY6A 4N0EA 4TL7A 2C8VA 3VR2A 4QC2A 1X3SA 2BBSA 2VSOA 3NKVA 1U8ZA 4QGHA 4QNRA 1AKEA 4Q7MB 4Q4HA 3RWMB 3RYTC 4D25A 5FTLA 3T1OA 3PITA 2FE4A 1CS4C 2F9MA 2PL3A 2WAXA 2ZE5A 2KRKA 2H16A 3LLUA 4KV9A 1HT1E 5GJBA 2NO1A 4A2WA 1KDOA 4BLQA 2ZUCA 4ZCMA 3GMTA 2CLDX 2D62A 2OEPA 4PX9A 4WW0A 3K0AB 1E2LA 4TMKA 1NIJA 1E9BA 2PMDA 3NIBA 3P32A 4HB0A 4D80A 5J4VA 4Q4LA 4DUGA 1X1RA 1KO4A 1X8KA 2P3SA 4D2IA 2IC5A 4D4JA 3HDTA 4LHZA 1P9WA 1PLLA 3NH9A 5CJ2A 5GJWC 3SNHA 3GEIA 2YC4C 3TUIC 3V00A 3EXAA 3QBTA 4EQ6A 2YOHA 1W0JA 1KY3A 3B13B 3QVVA 4QBIA 5IT5A 3VR4A 2ZS7A 1S9DA 4PPNA 5F9FA 3R8CA 1CP2A 1JECA 1E79D 5FOVA 3P4YA 2J0UB 3ZQ6A 2O8BB 4KCGA 4AG5A 4OK5A 2VP5A 3LQRA 5DSZA 5EP1A 4HDQB 1OB2A 3K09C 5DGXA 3EIEA 3D3QA 3PUXA 4DLTA 1R10A 1E32A 1OPXA 1W46A 1PVOA 5KSZA 1X1SA 4G0NA 3T34A 1ZW6A 1XZPA 1J99A 1G41A 3MWLA 3ASYA 4MDEA 1UADA 2R2AA 2PMKA 3MWJA 5G41A 1CLUA 4RY2A 1Q0UA 1A2KC 3IKJA 4MUAA 2ZYTX 1XEFA 4UXIA 1YR7A 1W44A 2J0SA 1CIPA 4DWJA 1MKYA 2W6JD 3LBHA 2BC9A 2ERYA 3FKSD 1ZNYA 1NG9A 1Q22A 4EUNA 3LXXA 1UKYA 1N25A 2O0HA 1UDWA 4TLCA 4GI7A 5TVKA 1IY0A 1VPLA 4S35A 1IJFA 4NYJQ 1U99A 4JN6A 2O0KA 2ANCA 1QF9A 1CJMA 2DFLA 3OAAA 4OHWA 2J7PA 3B6EA 1IN7A 1XMJA 1E69A 1I4DD 2OFXA 1O3YA 1S1MA 2GRJA 3THOA 3K70B 4GOJA 1UKVY 5C46F 5C1BA 4JBWA 1PV4A 3A1SA 521PA 1X8LA 4Q01A 3AVXA 1GL7A 2RKOA 2BM1A 4FINA 4XH9B 2H8KA 2XXAB 2GWHA 2RHDA 2ZITA 4EFLA 2HCJB 4WVFA 1BMFA 1E1RD 3GLIA 3T1QA 1JEEA 3Q72A 1ZC4A 1OH8A 5F9HA 4LGMA 3MRSA 5DI3B 4AKIA 2XZLA 4G01B 5JEDA 2XTZA 1T5IA 1TQDA 1W0KD 2GF9A 1XTKA 1XCPA 1PZNA 2FEOA 2W58A 2OM2A 3KKOA 1VECA 4BFYA 1IHUA 2YWEA 4D0LB 1E9EA 3QKUA 3OZXA 3NG1A 5EXPA 4KHZA 2WV9A 1AS3A 4WZAE 3EX7C 1XD2A 1A1VA 1KDRA 4JJKA 2IYLD 2QTVB 4GPTA 4FMBB 1KO8A 4BEBA 3MG9A 3NBFA 2A5DA 2RMKA 5TXGA 2DWZB 1F2UB 4G5GA 5EZ5A 3Q7PA 1EFHA 2ORWA 2ZRAA 3CM0A 3DZ8A 2UZ3A 3FHOA 2IWRA 1U9IC 2RGAA 2KBEA 2GNOA 4L15A 4JL5A 4DRZA 1HY3A 5D3QA 2ATXA 2AWNA 1U0JA 3CRRA 3CPEA 1XXHA 1TQ6A 5EXTA 4JBYA 1ZD1A 3HR7A 2WJHA 2F43B 5KSPA 2AK3A 4BGDA 2PLFA 3D8BA 2WMOB 4FCVA 2KWIA 3VR6A 2WPDD 1P60A 2ORVA 4QG7A 4DSTA 5JEEA 3LLMA 1KAGA 3E70C 1G6HA 1TMKA 2W83A 2ZEJA 5AJXA 2P6RA 4XJXA 4BZXA 1JQLB 1DAFA 2DYKA 3MWKA 3RS3A 4Q5IA 4BRUA 3CKLA 2JGNA 4QHYA 2IYXA 2UKDA 1G19A 5KHOC 2DB3A 5TV2A 1GFIA 2H57A 4OHVA 2IYYA 1CR1A 3ECCA 2BEJA 4H1VA 4AC9A 4BZQA 4JVLA 2J7KA 4F4IA 4JSYA 3UKDA 1ZCAA 4KODA 2ZJ2A 3PFIA 4BPBA 3D7MA 5A5GA 4YLGA 3KJGA 4M22A 2BV3A 1W4BA 1ZD9A 1U81A 2IYVA 1Z0DA 1Y63A 1P9NA 3TKLA 4P4TA 1P2SA 4DZZA 1N5KA 2JIZA 5IK2A 3K0AA 1AS2A 2JDIA 1KNXA 3CR8A 5JECA 1R2QA 3NDBB 4BASA 2FOLA 4PO1A 2VSFA 3AGQA 5HE9A 5TARA 3JZAA 1SHKA 3NHAA 2TMKA 1NN3A 4XD7A 2DZNB 1F3OA 2EW1A 3KKQA 4V0LA 4PZYA 4LPSA 3REGA 2DCUA 3P27A 1KI2A 3HU3A 3WNCA 2OXRA 3DOFA 5IDVA 2EU8A 1N6KA 1RYHA 3MD0A 3NBYC 1OFUX 2NO7A 4IOJA 4Q1FA 5F98A 3FYHA 4LBWA 4X8HA 1K6MA 1WBDA 1KSHA 1GRRA 1R8SA 4A36A 2QMHA 3MWYW 3TUZC 4GMXA 2J0UA 2IUTA 2J1LA 2WHXA 2O8BA 2OLJA 3CRW1 4MA4A 4DCNA 2QGNA 1FZQA 1KOFA 3KKPA 1Q1ZA 4M4SA 2ZS9A 1FP6A 2J3EA 4L5BA 3KUCA 4PHGA 4UXHA 2WICA 2QROA 2JLRA 4DBLC 2ERXA 3ADBA 3LFUA 3V9PA 1VIAA 2ZJ8A 3FPAA 3LVQE 4XIGS 3UPUA 1I2MA 3I72A 4XVQA 5CYPA 1E4YA 3A37A 1T8UA 2LWIA 4LJ5A 3O8CA 4QJ4A 4RCZA 1G17A 1GKYA 1Z5ZA 4M1KA 1W48A 4KVAA 5JWRA 2O8CA 1OFHA 5FR1A 2G1JA 3CF6R 3I32A 4IJMA 3T61A 3U3JA 3VAAA 3HU2A 2BEKA 4US1R 1OB5A 4TZ0A 4IEIA 1NVVQ 3FB4A 2J9RA 1ZJ6A 2NZJA 2HV8A 3VX4A 4CYMA 2OV2A 3DKPA 1A4RA 3U3RA 3ZYCA 4XSHA 4U7DA 2HJGA 3I73A 2OBMA 1UDXA 4TQUS 4Q9LA 2G9NA 4ILEA 4ACAA 2V6JA 2ZR0A 3BB3A 4NCIA 1LNZA 3F8TA 2WKQA 3TSWA 1G3QA 4MGIR 2WVJA 2PEZA 2IUUA 4PHTA 4QGAA 1NSFA 5GJCA 2QBYB 2OLKA 1GITA 1DARA 3SJAA 3KXIA 1HE8B 1L4UA 2YZ2A 3CNOA 3SS8A 1KZGB 4LUCA 2DBYA 4PR0A 3BE4A 3PG5A 3AQ4A 1JPJA 4DLWA 1RKBA 2HF9A 2XXAA 4G5RA 3OEHD 4JKIA 3IHLA 4Q03A 3ND9A 4GSYA 3FFAA 1KSFX 2OCYC 2REXB 4MGKR 1C1KA 3U3OA 4IDOA 2AHOA 4LYAA 1S96A 2R6AA 1CR2A 5DI3A 3DOEA 1YZKA 1GILA 3H0KA 1RPZA 4TQ9A 2EWVA 3KQKA 2Q3HA 4F38A 2WWXA 2IS1A 2NZ8A 3ZGXA 2YWGA 3W34A 4F4JA 4MDFA 2QA5A 2WWHA 2G0NA 3KB2A 1GL9B 3RRZA 4B48A 4BFWA 1P4SA 5TMPA 4TT3D 3PUWA 4QRHA 3ZQJA 3N5CA 3LW8A 1XP8A 2G83A 4B44A 1AK2A 4HSEA 4F92B 3X1YA 2JJ2D 3THWB 1FNNA 2G77B 2C5LA 2XJ9A 5JHHB 4I81A 1SKQA 1F2UA 4WZ6A 1U94A 4XTCS 2GHIA 1N5IA 1KSGA 2ORIA 2IL1A 2DVWB 1OXVA 4HAUA 2J0VA 2FNAA 4V0KA 4A4DA 5KPDA 3TJZA 5TDHA 4UNPA 5E7IA 4LBYA 2IS4A 2F9LA 4WZBE 1TU4A 4DB4A 3W90A 1YRAA 2F43A 4WA7A 4LOAA 4ZCLA 4B75A 4C3ZA 3BAFA 1W36C 3BIFA 3AM1A 4RKEA 4Q47A 4FMCB 2BHRA 4TL8A 2FSFA 3UWOA 3ZVLA 1BH2A 1E94E 2GA8A 1RRGA 2FPMA 2PT7A 1XTQA 3C7KA 5J4LA 3ZZTA 3AVVA 2NG1A 1GNQA 1D5CA 1GG2A 4MRNA 1U9IA 2DFNA 2YOGA 1NVMA 2ZRGA 3GFOA 4TYNA 1AA9A 2C04A 3RSLA 5FBVB 4V02A 3LVRE 1OXXK 4A0FA 3BRWD 3QKRB 5FOUA 3SYNA 2QP9X 3K0SA 1PUJA 5J5CA 3A1WA 4FWIB 3TR0A 4ESVA 2A3RA 2ZRLA 3LA6A 1W36B 4PAMA 2G88A 5FI1B 4FIDA 4YXWD 5KOYA 4QKQA 5FOWA 4G1UC 3VR5A 5EP4A 3X1XA 4DC9A 4DSUA 1P3JA 1T3LA 3MAAC 1M2OB 1NLZA 4Q1DA 3VR3A 2RB4A 3W6PA 1E0KA 1QBKC 5JBQA 3GLFE 3WY9A 5G53C 2FV8A 4C9BA 2HLDD 2QMEA 5FUXA 2Q9BA 1G7TA 4CEJB 4LRSA 2ZYUX 4Q1BA 1EFTA 2JAQA 3MMPA 2JATA 4JIMA 4P3YA 1TQ2A 1N6RA 1E9CA 2CMKA 2GXSA 3BGWA 4GP7A 1OHHD 2WSSD 3PUVA 5EE3A 3H86A 3BERA 3IQWA 3FDIA 5JI2E 2IYUA 4UQOA 2CXXA 4B47A 5LBIA 1YRBA 3KXLA 4B2IA 1BOFA 3E1SA 4HLDA 2DR3A 5IF9A 1CULC 1G8HA 2W6ID 4DDVA 2BDTA 1RVDA 3FFBA 3KFXA 3HWSA 1Q57A 1BYIA 5FL7A 5BW8A 2Z6VA 3RRYA 5C4MA 4LY6A 421PA 4ZI2A 5FBQB 3PV0A 2BJVA 4NONA 1GP2A 2F1HA 1U2RA 4ACBA 2A2ZA 4LJ7A 4LWZA 4EQ6B 4P4SB 4DXAA 1KI8A 2OUKA 4R7ZA 4LC0A 2HT6A 3I3SR 3LXRA 4P33A 1T0JB 4JLMA 4B3XA 3ZLJA 3ZDQA 1XB2A 4QBGB 4IDHA 3R20A 4G5SA 1NKSA 3GJ8A 4A6PA 3SHFA 1MO6A 2C95A 1HTWA 1UJ2A 3GLFB 1T8TA 3A4NA 2ODBA 1G6OA 3O47A 4MRPA 1IM2A 1C1YA 1A7JA 1IXRC 2G0TA 3CX8A 3TE6A 3X1ZA 1OT3A 3WRYC 1T9HA 3ZD7A 2IHYA 1W49A 1Z0AA 2IUSA 2ZRNA 3FMFA 2ZRBA 2XSZA 2B7CA 2VL7A 3BK7A 1E0SA 1XNJA 4RD2A 5CM8B 3G82C 3QXSA 4NPHA 5LD2C 4HAZA 3BD9A 1DOAA 5CYOA 1G7CA 3LDAA 4IW3B 3U2QA 1JXMA 1YZGA 4NHOA 4TYWA 1GAJA 1G3MA 4BFZA 1L8QA 2GK7A 3A4MA 1GRQA 4XWAA 4XWKA 2B21A 3QVUA 4B76A 3CZPA 3GQBA 2W0MA 2V55B 1S9HA 2ZI5A 4HUQB 2QBYA 5F3WB 4AG6A 4KI0A 5DYIA 4UNQA 3WHKA 1ONBA 3VKGA 2WIBA 1IN8A 4OQFA 1GL6A 2EYQA 4HB4A 4HB3A 1WBBA 4FCWA 4GITA 2JLUA 4LRTA 1TUIA 1L4YA 1SKYE 4DEXA 5CK5A 4KFSA 4DLZA 2FEMA 2XITA 4YMUA 1E4VA 4KFTA 2ZU0C 1JAIA 1MO5A 1HA3A 3RANA 1TU3A 3LV8A 1G1MA 1S0UA 2R6GA 1D9XA 2MSCB 2PZEA 3IBYA 4GOXA 3LW7A 1BKDR 2ZRPA 4KBGA 5KTYA 1FTSA 4W9MC 4C2TA 1DELA 1YKSA 2CHGA 1Z8FA 1Z0KA 4Q4AB 1CTQA 2BJWA 4X8MA 3LQQA 1RJ9B 2PX0A 4MUBA 1XTRA 4ASUD 2QORA 4FMCF 1BIFA 1JI0A 2IW3A 2WTUA 3ZH9B 3RLFA 3Q9LA 2RH5A 3AGPA 4AKEA 1BO6A 2QPOA 2YNMA 3IILA 4CIDA 4DHEA 1SZPA 1IY1A 5H70A 4KJZA 2C78A 3U7EB 3SDZA 4LZZA 2BCGY 3SC3A 2AK2A 4OHXA 2DWQA 2D74A 4LCBA 1JXOA 2EYUA 1AGPA 3QKTA 4K46A 4MKIA 1ZUIA 3ZZUA 1KO5A 2PCLA 4GMDA 2ATVA 3KDSE 4ABYA 3FMOB 4JLDA 3L0IB 1Z6XA 1DBSA 1TPZA 3WHLA 4DIDA 1NY5A 3FE2A 1KNQA 4MRSA 1SKYB 2E1RA 2NGRA 3TBKA 2Z5FA 5FFMA 4JLAA 3MHVC 3OE7D 2G6BA 1YHNA 4BRWA 2CCJA 3BJIC 1EFRA 3C41J 1KO7A 2O5VA 1NKTA 4M21A 2W2TA 1R6BX 2FFHA 4WOPA 1HH4A 1GNRA 1KI1A 4WAUA 2GXAA 5FTJA 4ZDIA 1CJVC 2ZRIA 2Q6TA 3VNVA 1ZNWA 1E0AA 1OH7A 3AH8A 1QHHB 3QKRA 2F1JA 1GTVA 3H84A 1FTNA 2GCNA 2GXQA 4Z1MA 2X19A 3MJRA 3SU8A 3AVUA 2ZQ5A 4IFBA 1G5TA 4ZO4A 4UKDA 3BFKA 2GESA 3NWJA 4AKGA 2PCJA 2RGEA 5JJKA 1MH1A 4CT4B 2CCGA 3WNDA 4L4UA 3RVBA 5AJVB 3PEWA 1H8EA 4C2UA 3NTUA 1GDDA 1P73A 3IDQA 1OSNA 4A8JB 1E98A 1XTSA 4S2EA 4UXJA 4CEJA 3B1VA 2R62A 1N5LA 1OKKD 1XEWX 4F4CA 5JS8A 2FSIA 4B3FX 2FJUA 1P9RA 4OJQA 3DMNA 3ICQB 2A5GA 3JVVA 2XB4A 4Q1AA 2Q3FA 3U7FB 5K8TA 3GJ6A 4NU0A 1G5PA 1XDBA 3QKSB 2OBNA 2C9OA 1OIVA 3I62A 5KDLA 1VMAA 3CRQA 1VCMA 2HUPA 3THYB 5JCPA 1G4AE 1Q3HA 4OK3A 4DCTA 4O3MA 2QSYA 2HJVA 3SBEA 4ERNA 3LAWA 5UKDA 4TSFD 1D2NA 3LY5A 4Q00A 5DN6D 3L2OB 3MCAA 3U7HB 3Q85A 2C2HA 4OL0A 2HEIA 2WAYA 3N70A 4OQXA 4Q19A 5EZ6B 3P26A 2NOAA 1W0JD 2ANBA 4P4SA 2V54A 3IQXA 5FUYA 4FWDA 3CH4B 2GEDA 1CRPA 3PEYA 5SZIA 3RC8A 3FGNA 1G3IA 1S3SA 4LJAA 4WXRA 2ZM5A 2R8RA 2O8EB 3X2SA 4C0HA 4TZ6A 2QM7A 1S1CA 1L7VC 2JLWA 1DAKA 3SYLA 4RZ2A 3WYFA 5L3QB 3GLFA 2QQEA 3RC3A 2ZS8A 1T5LA 2HCBA 2RGCA 3T12A 4D0GA 1RRCA 4I1OA 5FPYA 1AM4D 4C30A 1E2KA 1FUKA 4V03A 3FOZA 5J4KA 1LS1A 221PA 721PA 2C98A 3OE7A 1XRJA 3KZ1E 3K70C 4I4LA 1E79A 4A0HA 2GKSA 1ZMXA 3AKEA 1MOZA 2P2LA 1TADA 2O8CB 2AKYA 1XCGB 2QG6A 4LJYA 4HLQB 4PANA 2QU8A 2JJ1A 3BWDD 5JFGA 1ZIPA 3VX3A 3LWNA 3BH7A 2ZE7A 3N2IA 2DWPA 4HUQA 3NBZC 1I4TD 1Q3TA 4W7SA 4TL9A 4F93B 3HPQA 4F91B 1CR4A 2P5SA 4FMDB 4PHHA 3GJ0A 2IYRA 2BBTA 2V8OA 4QNMA 2VRWA 3EZ2A 4AWXA 5EE9A 1T0HB 1V43A 2V3CC 3EA0A 1FW6A 2O8DB 1NL3A 2VIIA 4MH0R 4C7OB 2ZU6A 4P0TA 4Q4JB 2MSEB 1FMLA 1W47A 2W6JA 1U98A 3SR0A 1E2JA 4B2PA 3AP2A 3FKSA 2GXUA 1NI3A 2AX4A 2OHFA 3QXHA 2QAGA 2IXEA 5HR5A 1SVIA 2ZANA 3GFTA 1E0JA 2FU5C 1JJVA 3WBJA 4PPFA 4Q4AA 1WP9A 4Q7LA 3RDPA 5HZHA 1G8GA 2FDCA 3GCGA 1RJ9A 2B8TA 3PJRA 1XCMA 4RZXA 3RS7A 1KI4A 4BEJA 5JJLA 1AKYA 1G9XA 4Q7KA 3SJCA 1NBMD 2MMCA 4JT2A 5BXQC 4B3GA 3QY0A 4D4LA 3AVWA 4M53A 1WF3A 5FL3A 3PENA 3K9NA 2ZR9A 4OJKA 2R65A 5CB8A 1E2MA 1LFDB 1JR3D 2EQBA 2CLCX 3UG7A 1E1RA 1KAOA 2GCPA 3NEYA 1SVKA 3RAPR 1Q12A 2CK3D 3WBKA 5C2JB 3QSYA 2AR7A 4G3XA 1E2FA 2VP0A 3L0OA 1R4AA 2EFEB 3WYGA 1BS1A 3W3AA 2CHVA 5SZKB 1H8HA 1QRAA 1R8QA 2Q0HA 5GADl 1KDTA 1SXJD 3RNLA 4LJ4A 3TH5A 3GLHB 4RD6A 4Q02A 2CHQA 4YC7A 1KY2A 3DPUA 1VG8A 1AS0A 1SGWA 5CM9C 3SI7A 3AVOA 2Q3MA 1SVMA 3CO5A 4MKHA 1Z06A 5KNBA 1KJWA 1QHHA 4EPTA 3WYAA 2CL7X 4AYXA 2JLZA 2VP4A 2ZSBA 3FMIA 4HZIA 1P5ZB 4DCSA 3AVYA 1KI3A 2XOKD 1MO4A 2WIAA 3T15A 5EE5B 2HXYA 4BFVA 1CEEA 2OT3B 1FOEB 3GPLA 4O25A 4CF7A 2WWFA 1T4GA 1NMZA 4IDQA 1W4CA 1IQPA 2GZAA 1J7KA 3FHCB 1RC8A 3G5UA 4NCKA 2ZSFA 3VKWA 3TSZA 2A5FA 1JR6A 2WPDA 1R0YA 3UATA 1E6CA 4Q18A 3KKNA 5LB4A 4A8JA 4DEYA 5J4HA 2B8WA 4BECA 4OBEA 1EX7A 4XWOA 4DLUA 3M6AA 1XX6A 5J4YA 1G8FA 2VF7A 3TK1A 3AP1A 1P2TA 2EFHB 5AJWA 2JLYA 2HYDA 2HDNB 2ODEA 1M34E 4YDSA 2VP2A 3B85A 3SFVA 4OKSA 3K0CC 2KB0A 2A5YB 4V0MA 1XWIA 4XVRA 2YHSA 1J90A 5FUVA 2WWYA 2BBOA 3MGCA 5CJPA 1U0HC 2JDID 3QKSA 4NKRA 3HYRA 4NYIR 1L2TA 3SE0A 3U3MA 1HE1C 3THYA 5E3HA 3W8RA 4P32A 3FKQA 2YKGA 4BFXA 5EE1A 2JASA 4RZUA 2VPPA 1A2BA 1S3GA 1PLJA 3OEED 1ZU5A 3DVLA 3SOPA 3B60A 2ZJOA 4LPKA 3CRVA 4JT4A 2CLSA 4N0DA 1NSTA 1VCIA 5DH9A 4WIAA 1WB9A 4TTPA 3TGPA 3HU1A 5FR2A 1SVOA 821PA 1RRPA 2F6RA 2FG5A 3C15C 4HYYA 4KLZA 1Z07A 3EPLA 2PJRA 3WP0A 4JVMA 2O8EA 4FCTA 3GEHA 2LKDA 4A3VB 4GOKA 4OYHA 4D0NA 2EFGA 5L3QA 1YQTA 4PPGA 4II7A 4PC7A 4V0NA 4NCJA 4Y0AA 4FMDF 5ELXA 2GILA 4EIWA 2GJSA 5F2EA 3BBPA 2R9VA 3NXSA 4DLSA 2ECKA 1DAHA 1S8FA 1Z2AA 2RHMA 4G5OA 1ZP6A 3UMFA 5DE3A 4Z8XA 4AIIA 4B6FA 1DE0A 1CF4A 1GZSA 4M1OA 3PQCA 4TMXA 1M7HA 1C4OA 5FPHA 2A30A 2ZI4A 2ZYWX 2BWJA 4PSKA 2D7CA 4LV8B 5HCIA 1GRNA 4OI1A 2ODNA 5BWMA 2OFOA 1OXSC 2PT5A 2XTNA 3DMDA 2QE7A 2FSHA 4LBVA 2BMJA 4NYMR 4B6EA 4KXFB 4PSVA 1ZAKA 1NF3A 1FUUA 2H17A 4Q48A 5HKKD 2QAJA 1GVNB 1Z08A 3CR7A 3EWSA 3PR1A 3QBVA 4O2LA 3CIOA 4N1AA 5CLQA 2O8DA 4I1VA 1W4RA 2FH5B 3NVAA 4Q4JA 4C7OA 1QHNA 3AJIB 1CJKC 5EUQB 4AKHA 2WBLC 2QT0A 3B9PA 2AFHE 4DT1B 1OH6A 1F48A 1XFAA 1EXMA 1CBUA 4MITA 5KNDA 2LCFA 1E96A 4KU4A 1HUQA 2E9SA 2IK8A 3T06B 3L82B 4PC6A 2VP6A 5CIQA 5JLJA 2FFBA 1Q20A 1N0VC 3V4FA 4PSAA 1II9A 2ZE6A 1EK0A 1KK0A 2Z4RA 2FZLA 2OZEA 1OXTA 1XTIA 3QENA 5L3SB 4JLNA 4TLEA 4BZPA 4DLRA 3EPJA 3X1DA 5K8LA 2XZPA 4U02A 2ZRMA 3T1VA 3KKMA 1MV5A 4UJ5A 1E3MA 5KU1A 3VR1A 2CNWD 2QUZA 3OEHA 3PEVA 1FQJA 2GVDC 3DDCA 4JLOA 4IFEA 1OE0A 1LW7A 4BLTA 3KQUA 1HYQA 1E2PA 3KB1A 3CX7A 1P6XA 1ODFA 4KFUA 5SZJA 4M9ZA 4JYCA 2GJAA 2H1LA 1KSJA 4E07A 1QHIA 3OF5A 1TTTA 1KYIA 4Q9HA 2AXPA 5BQ5A 5G40A 3F3YA 1ZNXA 3DL0A 4PTLA 3GD7A 3TMKA 2ZRDA 4TT3A 2C9YA 2IYSA 4UNSA 2J45A 1E1QD 3GLHA 1WRBA 2DPXA 4OK6A 5KO2A 4B33A 2JJ2A 2WMNB 3DM9B 1QG2A 2PH1A 2VF8A 4M8NE 1NMXA 4Q1EA 4B2LA 1UBCA 3B2EA 4ZPXA 1CXZA 1QDEA 1ZBDA 3WMFA 4BFSA 1EFUA 3WXMA 3BH0A 3U4QB 4FW9A 3C5CA 3MUFA 4CEIB 4DDTA 3BC1A 2J59A 2VHJA 2RGNA 3E2IA 1UM8A 1DAGA 1ZM2A 1J2JA 4U00A 2WJYA 1E2NA 1RRFA 3OIWA 3E5HA 4Q21A 5FH9A 4YQFA 1FX0B 4F7WA 3WMGA 2GCOB 1M74A 1T6NA 3ZVNA 2O8FB 3HPRA 2AKAB 4XVUA 2IS2A 5DNYB 2ZROA 1Z6TA 1N0UA 3ETLA 4NP6A 1VTKA 5KPJA 3RS2A 4EFNA 5FUWA 1XF9A 1MT0A 3AUXA 2P65A 1SVLA 3NBXX 1DADA 5BYKA 2VO1A 1WQ1R 2RGXA 5JRJA 4JS0A 1MRNA 1T91A 2V7QD 2WJVA 4DKXA 3KUDA 2R6DA 4BLSA 1JNYA 4C0KA 3KQNA 2N42A 4PAQA 4B71A 1YU9A 1RW4A 3IO3A 1RFLA 1IAQA 1C9KA 3IEUA 3ZIAD 3UXMA 2RGGA 1ELOA 5FBLB 4US0R 1VYUA 2D4HA 3RABA 4AY2A 2QNRA 4TTQA 1ESNA 3KQLA 3RHFA 3NC1C 4YXWA 3VTKA 1YR9A 3NDPA 1VG0B 4PC2A 1TQ4A 4C0QC 2R6CA 1TL7C 4LYHA 1DO0A 2JLVA 3EW9A 4RD0A 3CX6A 4LJ9A 4JL8A 4B74A 1DPFA 1IN5A 5B2ZA 1AZSC 1MRSA 1IONA 2ASEA 2FA9A 3TR5A 1MABA 1UPTA 2HLDA 2QL6A 3K0CA 1XZQA 2C96A 2R6FA 4C0LA 1COWD 5EXSA 4NYJR 2KI5A 4R2HA 3EA5A 2FFAA 2VHUA 2HYIC 1YZNA 2X2FA 3RS4A 1OHHA 4URYR 1Z6GA 2WSSA 621PA 4KBFA 2JLXA 2CL6X 2XNDD 4BFTA 3L0SA 6Q21A 3C5HA 1GKUB 5L8VA 1GSIA 5C4GB 2ONKA 4KSCA 4XTRA 2IYQA 3QNUA 4GZLA 2H7VA 2W6IA 2QP3A 3OIVA 3C4JA 1NNEA 2QP4A 2ZUDA 5JS7A 4LHXA 1YZTA 4A0RA 4I1UA 2BKUA 4KLNA 3B7GA 1WCV1 3F5FA 3PVSA 3B5JA 1DAMA 2GAAA 2NO9A 4N3NA 3ADCA 4HATA 1J70A 2CCKA 3H1TA 3RSOA 1SHZA 2ZVPX 5FOXA 4Q66C 1GNPA 4RCYA 5CITA 2ZJYA 3CH5A 1YZLA 3R9IA 1I2DA 1JEDA 4ZV4A 1VHLA 2NIPA 4PQFA 4M9SA 2DHRA 4TQAA 1G21E 2NQ2C 4QGFA 4LBZA 2NO0A 3AKYA 4YDHB 3MLEA 4QJ5A 1XJQA 4D4MA 2QAGC 3TIFA 1X86B 2D7DA 4B32A 2Q9CA 3DO6A 2J41A 3QEOA 1UBFA 2KSQA 2CJWB 4AI6A 1DAIA 2QTHA 1KK1A 2J46A 4C0SA 3O8BA 4DT1A 3M1IA 5HZKA 4FI3C 3QQ5A 3QPVA 4RVCA 4Y0VA 4HLCA 4TMWA 1OYWA 1MO3A 3AVPA 4MYTA 1NBME 1I4LD 4TMVA 3CW2A 1N6PA 4OHZA 3VMFA 2ZR7A 1AZTA 3K1JA 4RD1A 2XGJA 4GL2A 1W2GA 1YR6A 5KSOA 3AEZA 2V6IA 1P2UA 2QAGB 4LHVA 2V4ZA 5EUMA 4DSOA 5L3SA 3GLGB 2IX3A 3SJZA 4LYFA 2VBCA 4OI2A 4P4UA 1Z29A 2G1KA 2H5EA 4ZDKA 4DDWA 3CF2A 4NH0A 1DVRA 3OFND 4QFMA 2D2EA 4JMPA 5IHPA 3DZDA 1E9DA 2PZGA 2V1UA 1Q44A 1G16A 2GK6A 1VG9B 3MJHA 3QUSA 1HQCA 4PZLA 1EX6A 3B1XA 4IXMA 3SFZA 1OW3B 1AIPA 4DDUA 5B58C 3L8ZA 3GP8A 2IHBA 4ESHA 4NBSA 3CZQA 2BVNA 4DIEA 1A82A 4ZI3A 2ZVQX 1SXJE 2PZFA 2Z0MA 1G3UA 5ANRB 1JJ7A 1KIMA 2WZQA 3AB3A 2QT1A 5AUNB 2PX3A 1XMSA 2WKPA 1CJTC 4HLUC 4PO8A 2BCJQ 2CBZA 2GVZC 1ZM3A 2GTPA 2JJ8A 2WWWA 1G8YA 3CONA 3KTAB 4ASUA 1RE0A 1KO1A 2ZI7A 1DTSA 2XNSA 1W1WA 3QJYA 4B34A 3EZ9A 2N1BA 3AV0B 3I92A 4D26A 2KJQA 3N2EA 4MGYR 4AYWA 1R5NA 4E09A 5JI3E 3BOSA 1M1YE 1MR3F 2K5UA 3AKDA 4V0ME 3U4QA 4CEIA 1SXJC 1ESMA 2VQSA 2WJGA 2F55A 2GBLC 5KDOA 5EP3A 2AN9A 1AN0A 1N2CE 3BH6A 2MSDB 5JWHA 1X6VA 4A8JC 1FX0A 2GCOA 1GWNA 2X77A 1YZUA 2ZRHA 5H68A 2O8FA 3QF4B 3UIEA 3VU9B 3M4YA 4BWYA 3BFVA 3GJXC 3CNLA 4MGZR 3VNUA 2AL7A 1VDZA 1WA5A 2IF2A 1W4AA 3C8UA 3CB4A 4TL6A 2DZOB 4RFSB 1XU4A 4FWHA 1W36D 1SQ5A 2ZRJA 3IPXA
chains in the Genus database with same CATH superfamily
2BFEB 4HHEA 2C4WA 3NWLA 4LI0A 1A9OA 4IBJA 1YAJA 1TDHA 3EG9B 2FPGA 1P80A 2DU8A 3TW4A 4DLBA 1N78A 4JI3M 4MVJH 3WFJA 2EEPA 2P40A 1DBQA 3OLZA 1AQJA 2JIDA 2EBFX 3OJOA 3IXLA 2C4UA 2D00A 1R00A 1NRJB 1FXSA 3AJDA 1GGFA 2HQRA 1WZUA 3PNOA 4G5YA 1IDN1 4MQUA 3R77A 3I2YX 5ITTA 1U2PA 4D41A 2PGAA 1O03A 2X4AA 1ZL0A 2G9ZA 1DO2A 2JJ1D 1SO8A 2HHHB 3R4CA 4HZUB 2O1XA 4IOLA 2B6HA 1KE1A 5KJFA 4UN2B 2YFQA 4C6TB 3KVNA 2Z2IA 3MAGA 1R3UA 4M1WA 5EMJA 4TN1A 3L28A 5AUOB 3RS5A 1KI6A 4TVBA 2RK6A 4F12A 2MH8A 2WHQA 3SKVA 2IODA 3HEMA 1ZLXA 4XX0A 1TCBA 2XCUA 3EC1A 2XVZA 4YVFA 1NUUA 3PHBE 1UH5A 3QEBZ 4Q7JB 3AV0A 3EVCA 2BMVA 1ZINA 2F3RA 3DW1X 5LQJA 2ONJA 1BVYF 2F3TA 2Y8EA 5AP9A 1PFQA 2X15A 2FZVA 4JMLA 4TRJA 1YA6A 5E38A 1HZZC 2BAGA 3LO5A 4RFSA 4BKPA 3NHBA 1Y4AE 2WVHA 5FLEX 5ALVA 1UJBA 3JQRA 3IL2A 5E26A 3LZ6A 4BLCA 3NAQA 1FNCA 8OHMA 4XGNA 3THXA 4JLWA 3FNGA 5KTNA 2R1TB 3PZBA 1JPNA 3OZUA 4R2IA 5BRNA 4ZVRA 5IK2D 4J0KA 2EP5A 1XTJA 2OCBA 4GVXA 5LXTB 3HYLA 4ECAA 3Q8XB 1SHTX 2EKLA 4K9DA 5AVKA 4LDAA 1XJ5A 4P3NA 2WUFA 4FILA 3A6KA 1C3JA 4ER3A 5EUCA 3TG8A 1QHYA 1CUBA 1PNQA 5IT0A 4BVFA 3CNNA 1P74A 3KZKA 4B4KA 3BTUA 4XYBA 3PE6A 1XRQA 2AB0A 3ENQA 2Y1CA 3AHIA 5FAXA 1LX7A 5IWAB 2HSGA 3L93A 1Q0ZA 1JVBA 1U1IA 5A5FA 3W8DA 2YY7A 3IEKA 1QH8B 1F38A 1BXGB 4HXYA 1BJKA 1ESEA 4OGKA 1X1BA 2H1RA 3QUQA 5TGTA 5AUPB 2W93A 4LMPA 5JAUA 3WMRA 1Z2EA 3AL2A 3KKEA 3QEJA 1GLNA 4HX5A 1CKEA 4OHRA 2I4IA 5IARA 4B3RM 5DCWA 2HMTA 3PPVA 2JHGA 5JNSA 1N0WA 1VBNA 2XIJA 3VNRA 3O4FA 5CG1A 2ZSAA 3TRFA 2HJHA 2X41A 4TYQA 4DG9A 4A1FA 5DM2A 1LF5A 4G4SP 7AT1A 2XQKA 3EEQA 4DV0B 3TAXA 3HXTA 1GTZA 4MHSA 5G2OA 1EFVB 2WKRA 1NPDA 3BORA 3OTWA 1ADFA 2OECA 5T3UA 3VR5D 4NDZA 2KE5A 2PLRA 1R37A 1NI5A 2WG0A 1JIKA 3JVUA 1EFCA 3AMVA 4M76B 1QFJA 2H0AA 3QE2A 4JBGA 1V41E 3I04M 4QYMA 2HCRA 1UDBA 4WXPA 1PT5A 3JD0A 1ZCZA 2NXEA 3H5VA 4M0DA 1L8XA 3GFRA 4AUKA 2NYAA 4NXMB 3DDNA 2Q4TA 3FR8A 1PL7A 1SKBA 2ZKIA 2I67A 3PX7A 3LFHA 2LKCA 3QU4A 4B73A 3LMMA 5H16A 1DJOA 3OMWA 1P1IA 3WGQA 3H5WA 3C16C 10MHA 2QIPA 5DMHA 4JYAM 3A1TA 3G0IA 5HJEA 3UUEA 2OD9A 4DNOA 2XE7A 2OGZA 3O8RA 5J63A 1ZRHA 3KD3A 4LGYA 2OK8A 2O0JA 3STWA 1DFGA 2IW1A 4CCSA 5A6SB 2ZREA 1X8XA 1QORA 2LGJA 4J07A 2EKKA 3AW9A 3AF2A 4WDRA 1YA4A 3HCEA 4DV4B 4GPZA 1K7CA 2LTAA 2ZYGA 4Z54A 2V03A 3N9IA 4FK8A 1U2DC 4GLBA 4YMGA 2QYOA 2QYTA 3GI1A 4NQZA 5DTEA 1E3SA 2JEZA 4DB2A 4CCWA 1B0AA 3GJ3A 3DB2A 3ZHZA 4UMEA 4J0EA 1SXHA 2Y4NA 4HEHA 1Z82A 4DCCA 4PXYA 4EJSC 4JX9A 2VF4X 3RAGA 2Q5OA 1ORIA 5BUCA 3AUYA 2V9PA 1UC4B 1K4MA 2P8SA 4EB6A 3EPHA 2Q9AA 1HEYA 3ZGNA 2XHZA 2H31A 2IV3A 2EL9A 1D0SA 5IVIA 4LNUB 4W5JA 1QVRA 4PLPA 3T7SA 1Y8RA 1JFLA 3IQDB 4B7UA 1Y6QA 4YO7A 5BV8A 4E15A 3B89A 3TWOA 4M3NA 2WD7A 1M2JA 2IPOA 5BPFA 1AKEA 2Q2NA 4D25A 3H9CA 4A2WA 4BLQA 1CK4A 2A0KA 4NSNA 4KHPB 3NX4A 2HWXA 1AMNA 3OUZA 2J9FA 1CS0B 1KO4A 1RWNA 2IC5A 1BNCA 1RXCA 4LZLA 4QBIA 1KMMA 3T54A 3PUIA 1MGPA 1DKMA 2RBEA 3P4YA 2UZ4A 2Q29A 5EZQA 4DUYB 1DC5A 1QFYA 4DLPA 4G0NA 3OTGA 3I6IA 3PU6A 5CLJA 1W9MA 4OXIA 1Y8QA 3JX9A 2V4MA 4EHJA 2J0SA 4ADSG 3TBHA 4C4YA 3DSRA 4H7HA 4L9RA 3F7NA 3RFFA 4P3KA 4F3NA 2I2XB 4NNJA 1MORA 1NUAA 5KB3A 1QF9A 1CJMA 2QGFA 3GGSA 3ELDA 1M5TA 1O3YA 1VPVA 1FP4A 1FVHA 2Y67A 1CEQA 1X1CA 3PGMA 5C1BA 3EXG2 3U16A 4TTVA 2RKOA 4XH9B 3HVRA 1DBVO 2NZ2A 2ZITA 4WVFA 1JIIA 1ZJYA 4PQGA 4K26A 3RO7A 1QYCA 2XZLA 1TJYA 1C9NA 4HVLA 4BO5A 2FEOA 5EXDA 5IVKA 5E7QA 2AXQA 1J2TA 5KPZA 3IBFA 4YY3M 1VDDA 3OD5A 5TXGA 4G1BA 1F2UB 3NIFB 2HTEA 2UZ3A 3W7AA 3IUSA 4H7PA 4MV4A 1X80A 1NNUA 4Z6KA 4J91A 4DSTA 9ATCA 1Y5NA 4EELA 3VPAA 3ZWCA 3JU3A 1IFXA 4Q5IA 4HQ6A 1QRDA 3C5VA 5FV7A 2XF2A 2ZT5A 1GFIA 2JFWA 3HFSA 3D7MA 4U7GA 2REQB 5CFNA 2H3EA 4Q05A 3WQQA 1RJEA 2EAUA 5A2GA 3LWDA 3K5PA 4P2GA 5K3FA 4C7KA 3FCUB 3DV9A 4JI4B 2XVAA 1GG5A 5IN5A 1R2QA 2O7VA 1KZYC 2EJUA 2B9VA 1KI2A 4CM3A 1T0IA 2M98A 1AUOA 2OQIA 1V8DA 2H9AA 4LBWA 2IOYA 4LZOA 1Z13A 4ER5A 2ZCUA 1B3RA 4E4TA 2QGNA 2RB5A 2EP7A 2VNHA 2QROA 4MK4A 3V9PA 2FOIC 1CQWA 1IUOA 4DM7A 1GR0A 1WUIS 1ZJZA 3D4BA 4PZUA 2I4MA 2XUGA 3BSWA 1HYGA 3QK7A 5ALKA 2X7HA 4NZNA 3PXAA 1UBNA 3NGMA 1CUSA 4U2BA 3OKPA 1SFRA 1TUGA 4PHTA 1WHTB 4HDNB 4D6YA 4HL6A 3SJAA 1DARA 1YUBA 1ZL2A 3LY8A 4G5RA 4BBJA 1XWWA 1WIVA 4HYQA 3GLRA 1XAIA 1YZKA 3Q3GE 3ZGXA 3CSSA 4H7IA 1MX1A 1PFYA 3KB2A 2ZUFA 3N5CA 2QTVA 2WTMA 1NYQA 3H4JA 4NOKA 5A4MS 3NP7A 3H7IA 1SUCA 4LOLA 1Z5NA 2C7OA 5D7BA 1WNTA 3ZHBA 1ZH8A 4ZCLA 4FSHA 1V5EA 1U3UA 1UOPA 2PG3A 1SKAA 3I9OA 4BBZA 1BH2A 4I9FA 4PYNA 1RRGA 2Q99A 2ON6A 3QFSA 1UC5B 5JS1A 4ARCA 1CDEA 4TYNA 3ZWNA 2J9GA 4V02A 4QDUA 4GOOD 3C7DB 1Y4DE 4NSOB 1W1UA 1QQ6A 1MQ9A 3OM1A 2WV7A 5DHRA 4Q1BA 1B6SA 1AK1A 4V0RA 4JSRA 4AZ0A 4HF7A 3U13A 2WW8A 3HS3A 2QRGA 3S2SA 1SUWA 4RMIA 1ZY2A 2AH5A 3INNA 2A1TS 2A2ZA 2R47A 1SPBS 3I3SR 3ZU5A 4EQZA 3VOBA 3UC5A 2X0DA 1RKQA 1EGVB 2G0TA 4QEDA 3F2IA 3MMSA 1T13A 1T1EA 2DULA 2Q5JA 1U7DA 3R6TA 1VE5A 1RYDA 1F7VA 2KZUA 2GBFA 2HGZA 2IIPA 3LCRA 1RXEA 3VH4A 5IZ7D 1Z8NA 3CG0A 2JHCA 3KUUA 3DW3X 4YMUA 2BR4A 4KFTA 4H4CA 4NOLA 5K3EA 4YRNA 3OSUA 4OGLA 5KCZA 1D9XA 2PZEA 4GOXA 4W9MC 2NX2A 5ECYA 3KSAC 1U1FA 4KGDA 1RJ9B 3EJ6A 3O1JC 2C1ZA 4BVGA 2CXPA 4WUTA 1TCCA 4DHEA 4NBTA 4GPBA 4MA5A 4NPAA 1XNRB 2CVPA 2MIIA 1Z6XA 4J29A 4IXDA 3AC0A 3VO1A 1NY5A 2XWPA 1DNPA 4KT0F 5DB4A 3AJ8A 2PGJA 1R6BX 4WOPA 1KFCB 2ZRIA 3LBYA 1E0AA 2Q50A 4B4UA 4E2WA 5I8PA 1LJUA 5HUJA 1N7JA 2P11A 4DUPA 1E98A 3AR4A 4WZBA 1UAYA 2FR8A 3V1YA 4IILA 1XEWX 3UJDA 4B3FX 2FJUA 2B20A 2A5GA 1WDLA 1LDMA 2PPLA 1FZTA 2XE8A 4I8OA 3NWPA 1Q16A 3LVWA 5KJ6A 3SQNA 3J7BA 2ZAYA 1JVNA 3ZX5A 1JHRA 3L41A 4G2TA 2HEIA 2OL4A 5KYYB 3ZHUA 3LRTA 3FGNA 1ZDMA 4OLFA 3HY3A 3DBRA 2GPYA 2VPXA 3PCXA 5AVZA 3T7IA 1T4DA 2MDTA 1XAGA 3HCOA 2ZSJA 5FPYA 1AM4D 1JB9A 1UZLA 2WF9A 4BQPA 3CX3A 3O9MA 1GTG1 2PO5A 2WIJA 3HO6A 3M8KA 3P0RA 4BBAA 4DR6M 2ZWVA 4KBYA 4XRRA 2ZOSA 3LWNA 3ZY2A 3N2IA 5F3WA 2PXXA 2WT9A 4NLLA 1QE0A 3HBJA 2PS3A 4U6NA 2HF7A 5F1PA 2WJPA 3RVOA 2VIIA 2ZU6A 1X7HA 1FYEA 4HSGA 1PR9A 3SR0A 4MICA 1E60A 3GCZA 4L5CA 3LT5A 3G5LA 2B83A 5HZHA 3KSUA 5DF1A 5CCEA 1DL5A 4RTOA 3WV4A 4Q24A 3UCFA 1I7PA 1XSEA 3PYLA 2CF6A 5ICFA 4HGRA 3O38A 3FWZA 1SVKA 2YMLA 2NADA 1EUCA 4CCYB 2WUWE 1SQFA 1KARA 4QOHA 2Q5LA 3LP5A 3K5HA 5JPIA 2WZJA 1L4FA 3PLNA 4OKIA 3U17A 4CF7A 1MIOA 2YZ7A 1UXGA 3G5UA 3VKWA 1E6CA 3JD1A 5H59A 3BT7A 1MCZA 1RJGA 4U6QA 2CY0A 4YDSA 2A5YB 4V0MA 2P9HA 4EVIA 5FUVA 1J90A 2WWYA 2KW5A 1MC8A 2XUHA 3V8RA 2ZTMA 1VMEA 1H4VB 4RZUA 1S3GA 3DVLA 3FUCA 2XRZA 3DGEC 3ESZA 1D2AA 3WO1A 2O1EA 3TGPA 4RABA 2XZTA 3H11B 3KRTA 2LKDA 4OQDA 2X9VA 5LA6A 1MNQA 1BHQ1 1RI5A 4EABA 5ELXA 4H6XA 4DV5M 3ERCA 2J5BA 2O0MA 3PHCA 2APLA 1PJSA 2ZI4A 2I6UA 3AIKA 3Q3VA 1GRNA 1J8VA 1DO8A 2PT5A 2BGRA 3TCKA 4HAIA 5JVDB 3ZDFA 1NJ8A 4BQOA 3PR1A 4DXDA 1PEDA 4CN8A 3A4IA 4I1VA 4Q4JA 4HC4A 3W5SA 4F4FA 2JHPA 3D3WA 2AFHE 1P91A 1V5GA 5KNDA 5L4NA 1MLDA 1FSSA 1II9A 4G84A 2V6GA 5KNBH 5K6AA 1CY0A 5CUQA 3JWEA 4UJ5A 1E3MA 2JGFA 3OEHA 4GD3Q 3E9CA 4Z9XA 3KQUA 1RMQA 4JYCA 4DV2B 3OF5A 4OP1A 2JC3A 4DNFA 4LVNA 3U39A 1IOLA 2AFHB 1WRBA 5KO2A 1MOPA 1RHQA 3R0XA 3HLKA 4I4NA 1CUHA 1CXZA 1E2NA 3OIWA 4F7WA 3H18A 1CY8A 3FSEA 3F9RA 5K09A 1XA3A 5CB4F 1LDEA 3NBXX 5T6MA 4LZWA 1GTJ1 3BMXA 1HZZA 4NEHB 4URHA 1U9YA 1CZUA 2JGRA 5JXIA 4PYOA 1F17A 3LF1A 2VDNB 1BMTA 3RHFA 4YXWA 4EYKA 4QA9A 2R6CA 4RM2A 1K7XB 1CDOA 5C0OE 4JL8A 2C92A 3E9MA 2QX8A 1DEHA 2CUKA 3GFGA 5IH7A 1WF6A 1Z6GA 2WSSA 2RHCA 1RWWA 3C5HA 1FBTA 2H7VA 3N0VA 2Q1TA 4FVTA 2FFRA 5TS3A 2XNCA 3VZDA 1U2SA 1IBKM 1E89A 4S1PA 3EF1A 5I5GA 4EARA 2AUNA 1UBKS 2H1VA 3O75A 3QKIA 1EIJA 2SNIE 2QTAA 2IITA 5B4VA 3M5DA 3CT6A 2CXQA 1AO0A 2GN6A 4AI6A 4GO1A 3M1IA 3PHIA 1XIVA 3JYQA 4FDTA 2M6RA 1HEUA 2C7BA 4RD1A 1IXSA 1W2GA 5LYJA 4MV5A 5L3SA 2VBCA 2HBYA 3AO0B 2B98A 5H81A 2ABWA 3C70A 1HQCA 5CXXA 1MVNA 1QG0A 3ZW9A 4WCDA 2BVNA 3ME5A 1KPHA 1RCTE 2ZVQX 4X0EA 3HG7A 2PX3A 5IS2A 3BHNA 1IB0A 2W2NA 3EYWA 4RA6B 2N1BA 3GUVA 4PLHA 3AKDA 2W2QA 1TH3A 1BEEA 4Y1RB 1N2CE 3WGKA 1FX0A 1NI4A 5IVHA 3RKSA 3BFVA 3JZDA 2YWBA 3SAJA 1JNXX 4Q4DA 3I2IA 1NN0A 3ZWXA 3PQ3A 3W3ZB 2HWKA 3UMGA 2B7BA 4D8XA 4Q0MA 4D9HA 4RACA 5A1JA 1UZMA 1Q21A 1Z0IA 4QLOA 5CAEB 5BSGA 1GN8A 2HGSA 3PDCA 2QUHA 1LBSA 3K05A 1YR3A 2L7IA 1ZXLA 3KYDA 2J6HA 1ICEA 1LNSA 1N2CB 2QX9A 1XDDA 4TWIA 1IE3A 3BXEA 1R5BA 4HVCA 1UDCA 3C6MA 1T3SA 4Z1OA 2FGJA 4AQ7A 4B3CA 4ID9A 2X14A 1GN9A 1OOEA 2H1OA 3FPFA 1M6NA 5AVWA 1T9KA 4YEDA 4KXVA 3DUFB 5SICE 3DJFA 1TZKA 5C9ZA 4DXHA 2XMBA 2FQQA 3G88A 3FAZA 5FTNA 3P96A 4JUFA 3QEMB 3EHEA 2JXNA 1RYZA 2Z8YA 2A3NA 3ZGVA 5BWOA 1E1LA 1UKZA 3EA4A 3CEHA 2E55A 1DC8A 2H52A 3P94A 2GEVA 5KOHB 3F46A 2ZUBA 2D54A 2Q8NA 5AIAA 2COKA 1NXTA 4RJTA 1KR5A 4NZPA 3EB9A 1H9BA 2LHCA 3G0CA 3G9QA 4ODIA 4EYEA 4ON9A 4OUKX 3GRAA 3KFVA 4IBFA 2QWXA 2Y1FA 3IHWA 2ACVA 4KFRA 3O1LA 4NL4H 4NZYA 3AETB 4YH1A 1JB1A 1N1MA 3AG5A 3MFYA 1H8HD 4FGJA 2C2ZA 2XE6A 2J6BA 5JRDS 2GARA 4UD6A 4WERA 1U2DA 4LDJA 2Q4RA 2XKJE 1VJRA 2I1VB 3SEFA 1DQNA 4OU5A 5JCXA 5JWOA 1J06A 4M60A 1CV2A 1ZZGA 3PTLA 1C3OA 3K1AA 3KQYA 2BONA 4EJSA 5JSKA 2LPMA 3DV0B 2PYDA 2O7QA 3X1WA 2QS9A 5F52A 4AYTA 3KBOA 3T7AA 5ES3A 2ADFA 4P5EA 1L0BA 3DBVO 3EISA 1PR0A 2PZJA 4DCVA 1U3WA 2HWUA 4D8WA 5BSEA 1Q0RA 2VDPB 1O5OA 2QRZA 1UMCA 3CBGA 4RVOA 3D8SA 3U61B 3EWNA 1EI9A 1G63A 1E2DA 3HJUA 4X00A 3R2JA 4IHJB 2ZBEA 3I9FA 1RWOA 4L85A 2BGMA 5HCNA 3WK7A 1FRZA 1NE2A 5DHAA 5EC8A 2FFQA 1ZNZA 5C31A 2JGDA 4V3CA 1H85A 4FGSA 4IY1A 4IWXA 3RGGA 3K70D 1ECPA 5BN5B 2WSMA 2X40A 4JFRA 3U62A 4KYUA 1SC6A 3W3AH 4L72A 1MB0A 3QVJA 4RD4A 5HKKA 4HDRA 4IQGA 3UXEA 1PYOA 1F60A 3PUYA 2BTQB 3LK7A 3TL4X 2E48A 4MRVA 1PSWA 2CFCA 1HT2E 2DH6A 2XB2A 4HAWA 2D0DA 4WBNB 4UU0A 1PDOA 1Z5UA 1Z15A 3HABA 2CNWA 3JVIA 3RYCB 4NBKA 3I5YA 2WT4A 3VDRA 2BGIA 5AI5A 4OXKA 5AFSA 3CVVA 1PJ2A 2FB9A 3BN3A 3WE7A 4BAZA 4Z2YA 5D5QA 1VLLA 3LUKA 3IVCA 4U7WA 3WJ7A 2XADA 3GAFA 3R0IA 2FMUA 3ZIDA 3B38A 3WYCA 3CUTA 4J3JA 4ECEA 3N86A 4RPHA 4L8GA 1UEIA 4KK3A 1DDGA 4W5HA 1UBTS 3TW6A 3ZIAA 2XHEA 3FYCA 5IC6A 3FMPB 3FNEA 1S2NA 3HKDB 1UEJA 3HYNA 3AI3A 2UUBB 2X4LA 1G8PA 3NV9A 4K9OA 4OA8A 3C4QA 1J5EM 4YUWA 4YCAA 1QBGA 1KAHA 4EJ0A 4OEHA 4C01A 5AWFC 2WJAA 3LU1A 3M49A 4LJ6A 3C7CB 5BT9A 1L5YA 2QRUA 2EWWA 2BKEA 4NFHA 1EVYA 4ME6A 1TD1A 1JDSA 1O5TA 1XMVA 3R7WA 4WXHA 2N0SA 1QMPA 3W2IA 5IJZA 2AG1A 3ESXA 1NG1A 3N8HA 3EQ9A 4NOOB 3L77A 1E0DA 3HJFA 2X1VA 4EPXA 2OAQ1 4FW8A 1KJYA 2P2ZA 2JFPA 4EI2A 3FUVA 2FOIA 2V6MA 1X7WB 4AS2A 5K3SA 4F5EA 3F0TA 1UT6A 2ZBKB 2ZB4A 1BMDA 3O8LA 4FJ0A 1E3IA 3EGIA 3HSKA 3G6WA 1M6HA 3IAHA 1UPBA 3A6PC 3RT7A 5EE0A 1C8KA 5FIUA 4QICA 4ZEMA 4UE2A 4IO1A 4UEOA 1XZLA 4N82A 4CQLB 4ZVKA 4OHYA 4GOMD 1MDBA 1U28C 2JCYA 1MJGM 2QTCA 5ITYA 5ALSA 5IMBA 2WUDA 3T3PB 1UK7A 1WSBA 4YAWA 4H18A 3S1AB 5ALPA 3Q0EA 3U5ZB 2VT7A 3CLVA 4MYCA 2ACWA 5CH5A 1Q0TA 1EVJA 3KNZA 1TB4A 3A58B 5IXYA 2LR0A 5LZ5A 4ZA2A 1QUFA 5DSXA 4OHCA 1N0HA 1FQWA 1Q1GA 4YHBA 4TL7A 1XQVA 1E7QA 3Q9SA 3IDFA 4DNQA 4TMKA 1XRPA 3TIVA 2JZNA 3HDTA 4X1KB 3DBIA 5ALGA 2WJWA 3VR4A 1EUZA 4JUAA 3R3ZA 2V59A 1DIRA 2VTVA 5IT4A 2J0UB 4KN5A 4Y6GB 3LQRA 4IIVA 3EOAI 3D3QA 2XI4A 4DR3B 4PVDA 1WXWA 1X1SA 2HMUA 1ZIYA 3HB4X 4TRMA 3I6QA 2I7CA 4MUAA 4RY0A 2QRQA 2G9RA 4IR7A 3WGUA 2FZGA 1KWKA 5IJ9A 2IPLA 3F71A 4DV3M 4NYJQ 4XYEA 3TD9A 1IK4A 4JYMA 4A6EA 4G0YA 1NV9A 1Z68A 2CF5A 2PAAA 4Y7CA 3DDSA 2JAWA 2GWHA 3GG2A 3K2BA 3Q72A 1TK2A 1FMCA 1YONA 2HRRA 5CLGA 3NORA 3ZOZA 1CT9A 1IVNA 3NJ4A 5D01A 3L01A 4UUMA 2XMDA 3EEFA 3BULA 1HFKA 1XD2A 4HYEA 3TVYA 3ZV4A 3PQDA 3RIGA 1QGDA 3GQ5A 2ZYHA 5HCUA 3DZ8A 2RD2A 3HMQA 4IKPA 3V8PA 3HB1A 4GHLA 3UN1A 1ZD1A 2WJHA 5KSPA 1GDHA 4UM5A 2J07A 4XJXA 1U1CA 2A5LA 2YRXA 3A1EA 2I8CA 4OHVA 4E1VA 3RC7A 4C4TA 2IUFA 2J7KA 2RC6A 1ZD3A 5A5GA 3UZUA 5JANA 1TFUA 1TVMA 4A10A 3GB9A 3RYFA 2HPAA 3CE6A 2DAGA 2GN8A 4LRSB 1QDLB 3EXG1 4FGKA 1FC0A 4PO1A 5DGCA 1SHKA 2GFQA 1JQ5A 3GJRA 5CVJA 3ASUA 2X9NA 1TYBE 1R8XA 3UGJA 4JI5B 4JROA 1UXJA 1XNQM 3CRW1 1Q1ZA 2SICE 4L5BA 4XPIB 1WEKA 5JH7B 4JHLA 3PFGA 4HGNA 1LUAA 1ULUA 5K3BA 1ODCA 1PW5A 1W48A 1AY0A 5JWRA 1Z3CA 2RSLA 3BMQA 1XKLA 1GJSA 3ZU6A 4ZJYA 4MJLA 5KNDD 1U4OA 3SYMA 3QLUC 4JLUA 4BJ5A 2Z3ZA 5C1IA 1L5VA 4OQQA 1JDBC 3JQCA 3RVPA 3BE4A 3UBTA 5AKEA 4DLWA 3KTOA 3OEHD 4GX2A 1WWKA 3VNBA 5IEBA 1Y3DE 2OQ4A 2QF7A 2UVPA 1C1KA 4IIYA 3QV1A 5KU7A 2PV7A 4HNTA 4HGZA 3H0KA 4MA0A 4TQ9A 3KQKA 5GTDA 4JOCA 4MDFA 5T5QA 3OQVA 2G0NA 1P4SA 5TMPA 3PUWA 3HYSA 5DLYA 3DYBA 2OAEA 1RWBA 2XJ9A 3OBIA 3E2MA 2IL1A 1KYTA 5KPDA 2VK4A 4C78A 3DDHA 2NSJA 2IS4A 3QXGA 4JP1A 1Q7BA 1RXSA 5K0FA 2W90A 1GNVA 1OA1A 2FSFA 3UWOA 1E94E 4FE3A 3O7WA 1E4OA 2C29D 2PT7A 2NV6A 3L26A 1VM6A 3GFOA 2FR8C 4NAUA 2CFSA 3K2LA 5G4KB 2VUSA 1PRBA 3MERA 4ZREA 5DBOA 4EHIA 4YXWD 3L8EA 4CXMA 3JQ7A 3PA8A 1SHJA 1NMQA 1M2OB 4F2DA 3UKOA 4C9BA 4L3VA 4YJKA 3DTNA 1R9NA 3WLLA 1QP7A 5BURA 1H2BA 4GP7A 2WSSD 1A8QA 4KR2A 2HQSA 4B47A 1MHPA 4L4RA 2CC2A 2WB2A 1K6IA 2ZT7A 1JYSA 2HDHA 3IJPA 3MBIA 3T3GA 1RXUA 5FBQB 3ZLTA 3TRIA 4LJ7A 2QLLA 3RT1A 1YSCA 2IGTA 4IJ6A 4IDHA 4A6PA 3SHFA 2H5IA 1FDVA 5KOJB 5FAKA 3IDSA 3LWZA 2B2XA 1KERA 3GXBA 1Y33E 1ZOLA 4JELA 5CVEA 1QQ7A 3FMFA 2ZRBA 5CM8B 2FSSA 3VDUA 4R3UC 4IW3B 1JXMA 4TYWA 2AMLA 4Z0HO 5HDBB 3DE2X 4N7BA 2B21A 3ZWWA 3LT2A 2EKPA 3QVTA 1MU0A 4MMYB 3INGA 5IUNC 4TVSA 1SIBE 4MWZA 3U80A 3BCHA 4GKAA 4KFSA 1KEPA 3UAGA 1MB4A 2PL1A 4AP6A 4XYLA 2V7BA 1FTSA 1MENA 2B4YA 4X8MA 2PUTA 3KJZA 3BWXA 1JI0A 2RH5A 4UHCA 2YNMA 2HH9A 3IB3A 1GA4A 5IPFA 4AIRA 1KO5A 1HM5A 3GGCA 2ZBRA 4JQCA 1WULS 1ZJ5A 3IDZA 3LSYA 1NBWB 3JASB 4YWHA 2AJBA 4GICA 1HH4A 3ZDBA 1YL5A 3VKVA 3BFJA 3PXCX 4PLVA 1EWVA 2HN9A 5A1TA 3D6AA 3I0ZA 1DQYA 3IJEB 1MH1A 2CCGA 1P73A 5F23A 4PYIA 2PWYA 1NU8A 4OJQA 3QTBA 4AZ3B 5J2TB 3R5HA 5BR8B 3E81A 3U7HB 4CGYB 2C2HA 5KYGA 3ODGA 3F3SA 1PL0A 1HGXA 3BBLA 2XFSA 1X7XA 5AW1A 3FTCA 1RRCA 5HIIA 1KZ9A 5GONF 3AY7A 4PEVA 721PA 4R51A 4HFJA 1XCGB 2FZ5A 4L9AA 5DNVA 3VX3A 1W88B 3AERB 5DHTA 2HRZA 2C8JA 4JP3A 4PHHA 5AOVA 1ZGZA 3GLKA 5K6AC 5CLHA 5JLAA 1E2JA 2K7FA 5HR5A 1OUMA 5BSVA 3G1WA 1P0CA 3DXYA 4PQEA 3GDWA 2PQ6A 4D4LA 1OWPA 3HXLA 2RAUA 3D8RA 1OZ0A 2M60A 4F06A 5IJAA 1PTKA 1AV6A 3IUBA 1TT5A 1YZFA 5C8DA 3HVUA 1VLMA 2UXBB 4S12A 1F12A 2VJMA 2VP4A 4BO2A 1P31A 1CR6A 3VHQA 3ZTWA 3MQ4A 1NMZA 3TSZA 5AW8A 5EGNA 4QOEA 4XE5A 5D6NA 4HWOA 4M88A 1MB9A 2YYSA 3H2IA 2VP2A 4IV5A 5FNVA 3LM8A 3RNOA 2YHSA 4GIPA 3MGCA 3HYRA 1YMUA 2XA1A 3W8RA 2IP1A 4BFXA 3U4CA 3C6XA 1TZBA 1BZYA 3K6RA 2XF3A 1Q15A 3OM0A 1GZ6A 2IYNA 2A9QA 5LKAA 3E23A 3H04A 3LGSA 4BLWA 1SVOA 1KFKB 4QUGA 2L4EA 3IBCA 1Y34E 2V6FA 2GF2A 3N7UA 4GOKA 4MJXA 4KSYA 2BEWB 1L7MA 1PTJC 4XIFA 1F0YA 4DLSA 3VYTB 1ZX1A 4YUYA 1VRVA 1S8FA 1JLRA 3ZBTA 4AIIA 1DE0A 5BQXA 3NUQA 1D07A 3PQCA 1DRWA 4G0WA 5H83A 2ONZA 2BM8A 3BCSA 4RETA 4Z49A 1ZUWA 2VAXA 4PSKA 2XF8A 4JEMA 2QAIA 3LHKA 4CI0B 2AFRA 1ZOPA 5HKKD 2O4UX 2Q2WA 3S5UA 3LGAA 1OKSA 2AEJA 3SMSA 3OCYA 4G5XA 5FDFA 1P2GA 4O4HA 3DT8A 5CIQA 1ZQ1A 2PGOA 2E5LB 4EI8A 3NALA 4ZZ0A 2FUCA 1ULAA 1UMDA 1RKVA 3I28A 2Z4RA 2Q2OA 2FPXA 1HG1A 4JJIA 2R46A 3W2FA 2CNWD 1OE0A 3KB1A 5GINE 4QYXA 4BEWA 3SF8B 3TMKA 2BR3A 2ZRDA 2J45A 4L5YA 2PH1A 1L4BA 4UCQA 4ZVVA 1HDEA 2L18A 1MO2A 5ITXA 4PLZA 3UAVA 1CQJA 1S02A 2O8FB 3HPRA 1M0WA 2ZROA 1MHTA 5JAQA 4H0FA 4LF8M 2NTVA 4PIMA 2IKQA 1FFGA 1NC1A 4BLSA 3HLYA 1K8YB 3ZXUB 4RGQA 3ZIAD 2LCQA 5B1IA 5ECWA 2D4HA 1JT2A 1RTKA 1QKIA 5HIMA 1GAXA 3RPEA 1YR9A 5COAA 1XVTA 4LYHA 1BRMA 4P80A 1EPUA 3PWSA 3P4UA 3CFYA 4I9HA 3RGWS 3UPTA 1RE1A 2CNOA 3RVRA 1B8VA 4NYJR 4YRRA 5EMLA 2QV7A 4LOHA 1QFMA 5B1HA 2FTKE 4R6WA 1EIWA 3L0SA 5KWIA 4BAUA 2BKUA 4OBWA 2BGKA 4RCYA 2Y66A 1YZLA 3G2HA 3FVTA 1F6DA 3QU5A 3CJTA 3AKYA 4Z86A 4Q12A 5JS2A 1M8FA 4BV2A 5DLEA 5IC4A 2B4AA 4RVCA 4Y0VA 1KYXA 4PCUA 1N32M 2H2WA 2XLBA 4TRNA 3E21A 3KVRA 4BVHA 3HN7A 3DHNA 1SOWA 2ZPUA 4OSPA 4ND5A 3SJZA 1V2GA 4JMPA 1S6YA 2XA9A 4QPZA 2XIQA 3NRCA 3BTOA 3EVDA 1ZH4A 1AKQA 4OL9A 3EXIB 3F7MA 4RA9A 3TWKA 4FB4A 3SX4A 1YB2A 1TOAA 1EQAA 5AM1A 3TMYA 3CC8A 1DTSA 3K6SA 3RE8A 1BU5A 2ZWAA 3BOSA 4CEIA 3ED5A 2F55A 2LNHC 3EOBI 2R7LA 3FG9A 2DNAA 4MS1A 4OMUA 1IZYA 2GCOA 1JKFA 3VU9B 4BWYA 2J4FA 1YR1A 3ET5A 4DJAA 3IPXA 3I52A 3KZCA 1WHCA 4EKDA 1HNXB 2NTYC 4FN5A 4B3BA 3IE0A 2IJGX 3EGEA 1LRLA 4FDUA 4RYDA 5L53A 4J76A 1N6LA 2XMSA 4OYYA 5HM8A 1KFJB 5KYUB 2Q62A 1NUQA 4YRGA 4YCSA 3BM5A 1A8SA 1JBKA 3UWDA 3VR4D 1HMPA 1UDRA 1JHAA 4EUKA 4EY7A 1RLUA 4EG7A 1E3TA 3GRKA 3TLMA 2WJ3A 2BMDA 1VJ5A 3R0QA 4FYVA 5DBFA 2UZIR 4DUZM 5FADA 2VYNA 2B92A 4RF1A 1BDHA 1WD7A 4ZCIA 8CATA 5D87A 5EZSA 3JYNA 5DM4A 3UICA 4X9XA 2BL4A 5U4XA 5TPWA 4ZDJA 1T6BY 3G9ZA 4RDXA 5EJ6A 2FPLA 4CM9A 3P9YA 1FX1A 2OOKA 1KJZA 1X1TA 4FHDA 4JOQA 4JDPA 4IKEA 1P0PA 2R96A 3TPCA 2Y1DA 1UKEA 1I8TA 3CNQS 1QVAA 1OREA 1YT5A 2C5AA 1T43A 1JAHA 1V2HE 1NPYA 4N3CA 1OVMA 3O0TA 2YJTD 3KTAA 2E6KA 2VC2B 1K86A 4LE1A 1B0UA 4ZO6A 3IOBA 1OU0A 2FX3A 4MQEB 1OD6A 4TOIA 2HMWA 4EY4A 2ZJ0A 4G85A 4KO3S 1JKMA 3VHXA 1ODTC 5DFAA 3ZOKA 5FPKA 3NS7A 2MMGA 1U28A 1SXJA 3ORFA 3K9LA 3ZWPA 3A4LA 1EYZA 3ILKA 2ONYA 1Q5PA 4I8XA 1T0BA 1U2ZA 3K8YA 5IFKA 4ZHQA 5L7TA 1ZGGA 2QLMA 1GQ2A 2XKAA 5IKPA 3H19A 2QL5A 2J5XA 2VA9A 4BDTA 4TWZA 2ZLBA 1YDEA 5DLQC 3QG5A 3B82A 3DVAA 3TKYA 1RQLA 2ZATA 5AJYA 2DH5A 4KUHA 4DAEA 4UHHA 4IIBA 4FYIA 4P36A 4XOIA 3ELWA 2PUHA 2VOEA 2B8NA 1ZSNA 2K2WA 1MN6A 3ETCA 4OATA 2P30A 4GXQA 1DQSA 4J6EA 4MRAA 5C8YB 1YACA 3ZCTA 4XW2A 2ZTSA 1O9BA 3T0IA 1TF7A 4MQBA 3HU5A 2QHXA 4IVPA 5HJ5A 2JCSA 2QEQA 2WFMA 3KQHA 4D4KA 1OYYA 1RBMA 1F5NA 3W8FA 1WAMA 2NZYA 1DKNA 4L08A 4BIMA 1TM5E 3KW6A 1MPXA 4R83A 3K0FA 3QI2A 1NVXQ 4U4AA 4W1RA 1HJPA 3GWGA 4WJLA 1ZWLA 4L0MA 1X0VA 1OIXA 1WOMA 4ZALA 4R7GA 4D56A 1U8TA 1NX9A 4OHOA 4HY3A 2HCFA 4D82A 4Q9AA 3VYSB 3G0GA 2FPUA 1F4VA 2EFYA 2PHZA 1B23P 4KQCA 1CRZA 5A3QA 2JJYA 1ZJWA 4RTMA 3H2JA 1Z16A 5DHPA 3H5OA 3WQHA 3S2IA 4AY4A 3BMCA 3L8CA 3LNCA 4KSBA 2Q21A 3H2YA 5F7XA 5JAPA 4R68A 4CDNA 2ECQA 2ZJ1A 1G20E 2Z9DA 4RY8A 1X92A 1E2EA 2F7SA 3RVKA 1KBOA 4RMHA 2GTIA 4OXXA 1G3RA 1U5BB 3SZLA