3VFDA

Human spastin aaa domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
289
structure length
266
Chain Sequence
LANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLGEKLVRALFAVARELQPSIIFIDQVDSLLDASRRLKTEFLIEFDGVQRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPENMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Spastin
publication title Crystal structure of the human spastin AAA domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 266
sequence length 289
ec nomenclature ec 5.6.1.1: Microtubule-severing ATPase.
pdb deposition date 2012-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vfdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3vfdA01
3PFIA 2NMVA 2ZANA 2FWRA 3FVQA 1NSTA 4F4IA 3SBEA 3H2YA 5EE0A 1XPOA 4JT4A 1R6BX 3GJXC 4WIAA 4TYQA 2XSZA 2EYQA 2O0HA 3KFXA 4AG6A 1EESA 1ZD9A 1NMXA 4E03A 1Q44A 5H8WA 1T5LA 3NBZC 3O47A 3B1WA 4M1WA 2JLRA 4NYIR 3MWKA 3L0PA 1D9XA 3B78A 1DAKA 4PSKA 2X8AA 2W58A 3CB4A 2V54A 3GFPA 3RSOA 1KAGA 5EQTA 2IYUA 3KKPA 3AP2A 1G4UR 3U4QA 4Z54A 4AURA 1ZU5A 3TLXA 4TZ0A 3OFND 1TQ4A 1AS0A 4KBGA 4A36A 2WKQA 1UAAA 4RZ3A 1KAOA 2ZI3A 1E2MA 1RVDA 4PZZA 1KGDA 1R0ZA 3D3QA 1XMIA 2PL3A 1OHHA 1H8HD 2OXRA 2PZGA 3LXXA 2R6FA 2A30A 1VDZA 1D5CA 4LGMA 5TB5A 1EX7A 2IHYA 2BCJQ 1ZC4A 4BFVA 2IYZA 4F4CA 2YWEA 5KUTA 4QHSA 1J2JA 2P3SA 3TAHA 3ETLA 5HE8A 4B35A 3R9IA 2DFKB 4NH0A 2YOGA 2ZUCA 3QY0A 1MO3A 2ZJYA 3W34A 1MABB 4XWOA 1G5TA 2OSBA 1NVUQ 2WPDD 1Z8FA 1ZRHA 1D2EA 4PPGA 2ZJ5A 2CVHA 3NEJA 3AVTA 3WHKA 1EFTA 5E7IA 1U2RA 1HY3A 4GZMA 1D8TA 4RFSA 2Z6VA 3B9PA 2LWIA 3QKUA 5AJVB 5FOWA 3QF4B 3NH9A 2QPTA 4UXIA 1KO5A 1VYVA 3B1ZA 1P3JA 1R8QA 3CR8A 2I1VB 3K0FA 3I1FA 3FMFA 5F98A 5AUQA 4PHTA 2V7QA 5DI9A 4Q9LA 2OAP1 1S1CA 3FMPB 4E07A 2GHIA 4PR0A 4DVGA 2N42A 2RMKA 1KK3A 2QE7A 3AUYA 2A7QA 4JVSB 4JVNA 2YYZA 1S1MA 4L16A 4PPFA 2ZR7A 2VSFA 4P4SA 2LKDA 3CF0A 1VTKA 3P4YA 3KXLA 4N1AA 5DE3A 1XPRA 4CGZA 1N6LA 1AIPA 1AKYA 4IOLA 4Q02A 2HCBA 4PZYA 4TL7A 1WP9A 4TMKA 1YU9A 4TMXA 3S1AB 4I4LA 3UG7A 3VU9B 1GKUB 1RC8A 4HAXA 4B44A 1U8YA 1A5TA 1E2QA 2ZI9A 1U0JA 1XTJA 3B8HA 3OIWA 4YMTA 5D3MA 4IRUB 2C96A 1OH6A 2ZYTX 3IDQA 2O52A 1UKYA 1DAFA 1JQLB 1SKYE 4DLXA 2IT1A 5GJCA 3UKDA 2ANCA 2JDID 3A36A 2ERXA 2WAXA 4P32A 1ZM2A 4QKQA 2ZRAA 2REOA 1E99A 4LC0A 1F5NA 2QSYA 5LPNA 4KU4A 4LRSA 3PJRA 3VR3A 1KK1A 2HDNB 1W5TA 1P61B 3K0EA 1JR3A 3VX3A 1FW6A 3OZXA 2ZSEA 3ECCA 4A82A 1XZQA 1NKSA 4POAA 2D7DA 4WA7A 5TY0A 1OJLA 4I1SA 1HTWA 1R0XA 1UDXA 4LJ9A 2J0SA 1NG9A 1KJZA 1XTQA 3B1YA 4ESHA 2ZXUA 2WWIA 4FCTA 1CJTC 2WJJA 4AYXA 2DBYA 2J5XA 1DARA 2BMDA 3SR0A 2QAGC 4G5GA 4K81B 1KI6A 1VG0B 1OXXK 1XWIA 2V55B 3W90A 4Q03A 4QGGA 2G0TA 2GJSA 1E94E 3CWZA 1B23P 4TYWA 1E2GA 3B7GA 3W5IA 2XJ9A 2WIBA 1A82A 1GNRA 2OFXA 4L4UA 1K6MA 5E7JA 3R7WB 4LBYA 2PMKA 1QG4A 1KDRA 1CULC 4S35A 4OK5A 4Q7JB 4ITRC 1EX6A 1N2CE 4UNRA 3NDPA 3U3JA 1L4UA 5CITA 3WMGA 1J7KA 3AKCA 1LTQA 1OXVA 3PUVA 4JT2A 1XD9A 5CB6A 3SQXA 2PH1A 4OL0A 5AR1A 1G8HA 4Q1EA 5AJYA 2C03A 1CF4A 3DZDA 3VX4A 3LY5A 3U5ZB 2P5SA 4Y0AA 2IC5A 5A4JA 1JEEA 2ZTSA 4O0MA 4RD0A 1GAJA 2BBOA 3FKSA 3JVUA 3VR4A 4KHZA 1E1QD 4QXAA 2HF9A 3ZZTA 4LDJA 4DSNA 5KDDA 4M0LA 1SVSA 1G16A 4M1KA 1T8UA 3PR1A 5JZVA 4A0GA 4QRHA 1XRJA 1OLOA 2EW1A 2RGNC 3ND9A 1G21E 3KB2A 3QKRB 1TADA 1CBUA 4TQ9A 4ILEA 2VP0A 3HJNA 5JS8A 1GNQA 3TH5A 3LX8A 1T3LA 4KV9A 1FNMA 3QKTA 3DKPA 3U3OA 1PV4A 4HZUB 4DSUA 2Q3HA 3WYFA 1VHLA 4L5BA 4UJ5A 3KQNA 1T9HA 1TUEA 4U02A 3RANA 1RRPA 4QG7A 3GPLA 1E2KA 1XD2A 3I5XA 3K70B 3AGPA 2Z43A 3P26A 1XEWX 3DHWC 4AD8A 3U3RA 1JPNA 3ASZA 5EE3A 3MWLA 2EU8A 3EZ2A 1Z06A 2VL7A 4UNSA 4O3MA 1EG7A 5FUXA 3MSXA 4N3NA 1W7AA 1VCOA 1VCMA 2CK3A 3AKDA 3MWJA 3PUYA 5EXPA 1F6BA 3BAFA 5AJWA 4C0AC 2FN4A 2WPDA 5F9FA 1E1RA 4HAUA 1YR9A 3BC1A 1UBFA 4C0KA 3BERA 4JYCA 3SFZA 4KLNA 3RNLA 5JWHA 2QTFA 2WKPA 3DKVA 5M04A 4D82A 1Q12A 1MH1A 2VYFA 1GKYA 3HR8A 3MCAA 521PA 3RS5A 1DEKA 4B6EA 4BZPA 1JXMA 3JZMA 4ZIRB 1ZAKA 4MKGA 4LHWA 1DAHA 2IYLD 2BKUA 3O8BA 3WYAA 3K0AB 1H8ED 1PLKA 2NOAA 1QHXA 2GWHA 3C8UA 4DLTA 5JLJA 1MT0A 1ZUNB 2FZ4A 1R5OA 1MV5A 3Q7PA 4MGIR 2J59A 2OO7A 2GAOA 3L82B 4II7A 3FPAA 1Q20A 4TMTA 1DE0A 4I1UA 1E2JA 2O5VA 4Q5IA 4D4MA 2WWXA 1IY0A 3LV8A 4CEHA 4EJSA 2GEUA 4LJ8A 4P0TA 4TMWA 3G0HA 2DYKA 2X1VA 4KI0A 3HU3A 1OFIA 3R9WA 1F2UA 2P2LA 1M74A 4M9QA 4HATA 4Z8YA 1LS6A 3RWMB 4B32A 3ZZ0A 2YWFA 5FOSA 4DRZA 1R4AA 3EG5A 1E9FA 4FINA 1L7VC 4KVGA 2GK7A 3IO5A 1EK0A 4UKDA 4Z1MD 5JFGA 3BFXA 4ACBA 2OBNA 3CKLA 2Y8EA 1VG9B 1CRPA 3JZAA 1TF2A 1EFRD 1LF5A 4CEJB 1N0UA 1DBSA 3K1JA 3Q7QA 1G8GA 4PSAA 1M34E 4F7WA 1SXJA 1E79A 1P2VA 2JLQA 3MGCA 2R62A 3C16C 5LB2A 3LWNA 1IN4A 5KNDA 4V0NA 1G41A 4F91B 2WWGA 3PUZA 2ZJ2A 2C2HA 1KOFA 1WA5A 4JLOA 4TMVA 2O8BB 1DAMA 4IDPA 4RD6A 5EP4A 2H17A 3RRNA 5K8UA 2G88A 1FX0B 5KDOA 2EVWX 2QP9X 3ZQJA 1SVOA 1KI9A 1B0UA 3AP3A 1ANKA 2QQ0A 1Z3IX 2D2EA 1M7HA 3PEWA 4JKYA 2V1UA 1Q1ZA 2YV5A 3IO3A 4BLTA 2B8WA 1Z5ZA 2IS6A 3B9QA 1RRCA 4G01B 2QM7A 4OQFA 4YDSA 3N2EA 4HAZA 2FPMA 5EE9A 3TK1A 4BWYA 2UKDA 4DIEA 4B2LA 1DO2A 1OH7A 3RS3A 3T12A 4XH9B 3BIFA 4EJSC 2JASA 2AL7A 3HU2A 3A1WA 2ZJBA 1NN3A 2YWGA 621PA 1AQYA 3TSWA 1RJ9A 1T5IA 4X8OA 5EZ5A 1GRRA 4OHZA 2WJIA 1AZTA 3BBPA 5KPDA 5IT5A 5FTNA 3W5JA 3PQCA 1E2LA 1E2FA 3KL4A 4QGHA 4ZI2A 2WJYA 2OT3B 4IDOA 3TAUA 5E4FA 3KB1A 4V0ME 5B30A 2ZRKA 1OB2A 4FXPA 2XITA 5IHPA 2YJTD 4YQFA 3IHLA 3EPJA 2QRNA 4ZCMA 1S2MA 4LBVA 3QKSB 4ZI3A 2OCYC 4Q1FA 2WWWA 1Z08A 2IXFA 3KTAB 1GRNA 4KJZA 4ASUD 2V8OA 2FGKA 4C9BA 5TDHA 1OT3A 1Z6XA 1ZU4A 4LJAA 3FMOB 4IOMA 4HLQB 4W7SA 5EE1A 5FI0B 2BC9A 4NYJR 4LHVA 4MRSA 4Q01A 3O8CA 2WMOB 4YXWD 2R6GA 5H1YA 2IYWA 4S2EA 1YZQA 2ODEA 3X1WA 1N6KA 2FNAA 1JXOA 2GEDA 2H18A 2KWIA 3IPXA 5CLQA 4B76A 2OFWA 1X37A 4AI6A 3D6TB 3X1ZA 1RRFA 2J0VA 4JBWA 5KSZA 2LCFA 1XTSA 3PXGA 2WZQA 1K8RA 2F9MA 4QBIA 3K09A 2XZPA 4HLUA 2CDNA 3ADKA 3U44A 1EGAA 1NIPA 3LQRA 5JCPA 3QF7A 2BBTA 2C04A 1FQKA 1KI7A 2OESA 3KJIA 3D8BA 1JR3E 1K5DA 3U7GA 3KJHA 3RS2A 3GLFB 1II8B 1O87A 1P73A 3A8TA 2K5UA 4KFRA 1F3OA 1E2NA 1N6OA 1ZUIA 2XNDA 1Q1BA 1U99A 4GP7A 4TT3A 4Z8XA 2V6JA 5FPSA 3T15A 1W0JA 1W4CA 3X1YA 1QBKC 3ONWA 2QRZA 2OILA 1G3QA 1UEIA 2ZYUX 5SZIA 1R2QA 5TXGA 4BASA 1BO6A 1XMSA 4XTRA 4PZLA 2FV8A 4ABYA 3QXXA 3KUDA 1QDEA 1UF9A 3NBFA 4US0R 4NCIA 2D4HA 2CHGA 4QFMA 3ZS8A 4D26A 1OB5A 2IS2A 1RIFA 2P6UA 2QU8A 3GJ0A 1D2NA 2W0MA 2EWVA 4ZPXA 3GLIB 4IFEA 5BYKA 3TGPA 1YR6A 1NNEA 3TNFA 2XSZD 5JBQA 3DOEA 2KB0A 5CDFA 2I3BA 3MLEA 1AGRA 1UBCA 4OHWA 3LLUA 2DHRA 2VP4A 2C9CA 4XSHA 3WBKA 3PEYA 3E1SA 3T35A 1KO1A 4XVQA 1X8JA 1KSJA 2MMCA 3MFYA 1P9RA 2AKAB 1ZM3A 1XEWY 4GMDA 3ZS9A 5HR5A 4C7OB 4B3FX 1DS6A 1NL3A 5SZKB 3RWOA 1G7SA 2FF7A 1W46A 3K9LA 5HE9A 3QPVA 2OCBA 4MGZR 2HUPA 3K09C 4DLUA 1NLFA 2RH5A 3BE4A 5ELXA 4Q4AA 2ODNA 3GLGB 3JVVA 4MYTA 1Z6YA 2HEIA 3O8DA 4M1MA 1OHHD 4URZR 1E3MA 3NTUA 4C0HA 5G3ZA 3V4RA 1U94A 1XX6A 2B6HA 3FOZA 1FP7A 4Q7KA 221PA 2WVJA 1GM5A 4B47A 1EFHA 2PX3A 1Q0UA 2DFTA 3P20A 1HT2E 1TL7C 5SZHB 4CEIB 2VQSA 1ZW6A 5J4KA 4H9GA 2PEZA 3BFVA 3HPRA 4Q48A 4MUBA 4EPRA 4BEJA 2DPXA 1ZNWA 1ZNZA 4BZXA 5LBIA 5KO2A 3DMDA 1R7RA 2IUTA 3ND8A 2GESA 2JLSA 1E4VA 2W2TA 1BMFD 2W2XA 3WMEA 3THWA 1UBGA 3TW8B 2FSFA 2N46A 3I61A 1XU4A 3M4YA 3T1QA 4RCYA 3I92A 4QBHA 2E87A 4CVNA 1ZBDA 3AB3A 4TTPA 4A4DA 3A6PC 2H7VA 3CLVA 3FYHA 4NYIQ 5JECA 2CJWA 1CJKC 1T3HA 3GEEA 4JS0A 4EPXA 2RAPA 4Q4JB 1I4DD 1QF9A 5SZJA 2V7QD 2ZVQX 5LD2B 4Q1CA 2AWNA 4Q4HB 2H8KA 3OE7A 2VHTA 3KJGA 4A8JB 1ZNXA 2BEKA 3R9XA 4MRNA 3WBJA 3AF0A 4W5JA 3ADDA 4MYCA 2O8FA 2GRJA 1KNQA 2AD1A 5DI3A 2FE4A 1CKEA 1NVMA 2CL7X 2QE7D 3EWSA 3SOPA 5HKKA 5L3RA 3E70C 3M6AA 1KI3A 4TYYA 1S8FA 1DAGA 1KDOA 2G77B 1PJRA 4LPKA 4V0OA 4HUTA 4BZQA 1TX4B 2ZI6A 3AVXA 1CR0A 3UPUA 2DWQA 4PSVA 3CBQA 2P6RA 3ZGXA 3QNUA 2CL6X 5K8TA 3ZYCA 2NZJA 3SE0A 4OQLA 1NBMA 4EPTA 4B48A 3EPKA 2NG1A 3B2EA 5JHGB 1AS3A 2GCNA 1DAIA 4Q1AA 2F55A 4FIDA 4PHHA 3SFVA 1NJFA 2NO9A 2VEDA 4KBFA 2X19A 3C14C 1GP2A 3ZVNA 4FMDF 2LKCA 2AXPA 4XTCS 1IOZA 3EZ7A 4IVQA 4UXHA 2CNWA 3CIOA 2FOLA 4OI2A 2CLSA 1U98A 1JR3D 2F1HA 3Q3JB 4TLDA 2IL1A 1Q1QA 4D0LB 4BLRA 3W3AA 2RB4A 5JWOA 4TL6A 4JJKA 2DVWB 1Y3AA 3UG6A 1N6HA 2IWHA 2JLXA 2HYIC 1U0LA 4ZKDA 3BRWD 3VHLB 1IJFA 4QOSA 1QZMA 2ZE6A 3C5CA 2GZHA 3IILA 2G3YA 3I62A 5BN5A 1SXJE 121PA 3SNHA 4U5XA 3KW6A 3AF3A 2VF7A 2W2VA 2Z0MA 3MRSA 5J4LA 1XNJA 5C4MA 1M7BA 3FKQA 3D7MA 3Q5DA 4YMWA 1AA9A 3FHCB 3UMRA 4B2PA 1JAIA 2GNOA 2XOKA 1JALA 1KMQA 4P31A 4X8LA 3OEHA 1IBRA 1Z47A 2GETA 1F60A 3IQXA 3EARA 2A9KA 5JSZA 1S3GA 4K8OA 4P33A 2EFHB 2GZAA 5DYGA 4XVUA 1SGWA 4TN1A 3FKSD 2VP2A 4C0QC 2P0EA 4DCNA 2JCSA 1NRJB 1V5WA 1VKJA 2PZEA 4DT1B 3THXB 5FUWA 3THOA 1YZLA 1XB2A 2JJ2A 1M2OB 4A0RA 3FE2A 3F0TA 2G83A 5B64A 1P75A 1Y63A 4ACAA 4XIGS 4EFNA 2CHQA 5L8VA 4W9MC 3LRPA 3PENA 1KKMA 4FWTA 1A2BA 3Q85A 3T1TA 1TTTA 2O8CA 3BOSA 2ZRFA 3T1OA 3IEVA 4TLEA 1G7RA 1NF3A 4G5SA 4B3BA 1CJUC 4QGFA 1G3UA 2OG2A 1G4AE 2RGCA 1I2DA 1ZCAA 4IFBA 5K8IA 3QBVA 3R8CA 5ANRB 3K70C 1WRBA 3LAWA 4L15A 4ZDJA 3U3KA 3BH6A 5KTYA 4OI1A 1T0HB 3X2SA 3U6KA 4DB2A 2CK3D 2ZYVX 4TQUS 4G1UC 2P5TB 4MRRA 5L3QB 3RVBA 2KI5A 1FOEB 1BMFA 1E1RD 3LXRA 1XJ0A 2BHRA 2DZNB 3TUZC 3ZDQA 2ZUDA 2QQEA 1FTNA 1LB1B 3UWKA 3FGNA 2J41A 3AVWA 2DY1A 4B3DA 2XXAA 2O8BA 3FWYA 5FUYA 2B7CA 2ODWA 4YDHB 1CR2A 1DOAA 2N1BA 2QAGA 1NY6A 1C9KA 1NI3A 2VBCA 3UMSA 1W1WA 2TMKA 2GZDA 1M8PA 4JBXA 2R65A 2ZRBA 3LBNA 4M1OA 4V0MA 3TSOA 4ARZA 4Q1BA 1XTIA 3HDTA 1JEDA 2VHUA 2C77A 2IK8A 4A6PA 1N6PA 1GIAA 5UKDA 2JEOA 1MO6A 2QMEA 1XMJA 1SZPA 2ZSAA 1QHGA 3EIQA 4G0NA 4MH0R 1IONA 3DL0A 1MR3F 3CRQA 1G3MA 5H68A 3MMPA 5BN4A 1OF1A 3AP1A 4GP6A 5FPHA 1X86B 4FMCB 5L3SB 2ZJOA 2QP3A 3FB4A 5J4VA 4OHYA 1KTVA 3GJ4A 2F43A 2J0QA 1N3BA 2Q9AA 2W83A 1U81A 1E32A 3EZ9A 5JEEA 5JI3E 1TU4A 3P27A 4HAWA 3ZQ6A 5CDFE 4FWHA 1GZSA 3WMFA 5CK4A 2QORA 4DCSA 3THYA 3CM0A 3QG1A 1DPFA 2IS1A 2FU5C 1R10A 1XEXA 2WIAA 5FL7A 1S9DA 3GLHA 4OHVA 5FOTA 2C99A 1OXUA 4EIWA 2ONKA 4GT1A 2RGNA 1Z63A 1OE0A 5LDDC 2YHSA 3GMTA 1K5GA 1W2HA 1A2KC 1YR8A 2BCGY 5EUMA 3OAAA 1SVLA 1SXJD 1E79D 4CF7A 2CCJA 4U7DA 1US8B 1HV8A 1CXZA 1W5SA 1GNPA 4KAXA 3SQWA 4GOKA 1N5JA 2IYSA 2QP4A 2ZAMA 2ZE8A 2DFNA 3AF2A 4KFSA 1NKTA 1Q22A 4HSEA 4TTQA 3ICQB 3ASYA 1XMVA 5EJEA 3AVQA 4FCWA 5JJLA 3ADBA 4BEBA 3DO6A 1XCPA 3UIEA 2ZRJA 2QBYA 2UVQA 3DM9B 1LY1A 2F1RA 4JL6A 3KUCA 4M22A 5B2ZA 2G1JA 4URVR 1W36C 5DH9A 3X1DA 2OCAA 2KSQA 4BQSA 1I4LD 3GFTA 4WW0A 5JJIA 1NN0A 1G5PA 4Q7LA 4QC2A 3H1TA 1AS2A 4CT4B 2OHFA 2IEZA 4QBFA 1IXRC 1G1MA 3BS4A 3CO5A 3LBHA 3LD9A 3RS0A 5CB8A 3H4MA 3SU8A 1CR1A 1E2EA 4Q9JA 3C4JA 3QEJA 3FFBA 4C2UA 3CZPA 1DVRA 2F9LA 1U9IC 4RKFA 3LNCA 4A2WA 3W6PA 2W00A 1XPUA 2D74A 2GCOA 4J0QA 4L9WA 2X77A 1YKSA 3FMIA 4V0KA 4AC9A 1J70A 4B33A 4US2R 2IUUA 1Z29A 5DN6A 5FL3A 4NMMA 2H1LA 1T3SA 2VHCA 4LRWA 3TUJC 3AV0B 4QJ4A 4HLCA 2ZROA 2QEQA 5JHHB 1IN5A 3AKYA 5C4GB 2BMJA 5JMTA 4R98A 2CEAA 2WM9B 2YOFA 4MGKR 5LB4A 2XB2A 5DGXA 1QG2A 5FPTA 1QRAA 1UKZA 3PITA 4QNMA 3BXZA 1XXHA 2JATA 2BMFA 4OKSA 3EASA 2FX3A 1GSIA 2A5JA 1UPTA 4V03A 4M21A 1TF5A 4OQNA 3GEHA 2QN6A 1CP2A 1NBME 4TZ6A 4ZCIA 2W6JA 1ZUHA 3U7HB 1T0JB 1R8SA 2C9YA 3EWAA 1VHTA 4OK6A 3QXCA 1G6OA 4QL3A 3VR5A 4E09A 2ATVA 4LWZA 2YINC 3D31A 1XCGB 3HYRA 3LW8A 4M1SA 2PJZA 4LUCA 2GBLC 1FZQA 1QHHB 2L0XA 3T5DA 4DDWA 1TQDA 1NG1A 3IIMA 2AD5A 4HUQB 3HWSA 4I99A 4LV5B 3KKOA 4G5OA 2XGJA 2KBEA 4HI0E 4HLDA 1SVWA 5CIQA 4LYAA 4C4PA 1KMHB 2O8DB 5BXQC 4TT3D 1W49A 2XNDD 1UDWA 2ZEJA 3C7KA 3EIEA 1W0JD 3EC1A 3NHBA 4M1YA 1IXZA 4C30A 4JYBA 3TR0A 4IVRA 4MRPA 3U2QA 3KXIA 1KI4A 1TNDA 3FTQA 3L8YA 4DUGA 1W4BA 1XJCA 2PT5A 3RS7A 2AFHE 4I1OA 2OUKA 2IXGA 2J0UB 3L0OA 2IEYA 4LJ6A 2GXAA 3WP0A 3L0SA 1KY2A 1N0WA 4I1VA 1WXQA 1F48A 1QHYA 2HF8A 2ZR9A 4JL5A 4RD2A 4W5HA 3SHFA 2C8VA 4G5RA 3BH7A 4QM7A 1QHNA 4B34A 2I1QA 4NYJQ 2ZU0C 5IDVA 1RFLA 1NVVR 1Z2AA 3QUSA 3AVPA 2R9VA 4XD7A 4D4KA 2ZETA 4JLVA 4NU0A 3H84A 4TL9A 4Q4JA 3B13B 1NN1A 2WSSD 2RGXA 4X8MA 4DLRA 4LYFA 4A8JA 1KKLA 3R20A 4WAUA 2VRWA 4A0FA 4EQ6A 1TQ6A 2FZLA 4OJQA 3ADCA 3PUXA 3OEEA 2J7PA 4DEYA 3U4QB 2ZUBA 3B5JA 5TARA 2BDTA 1PZNA 4LHZA 4M9SA 1T91A 5F2EA 5F9HA 2AHOA 1AGPA 2ZRCA 4PQRA 1EWRA 3B85A 3SEAA 5EXXA 3U7FB 1DAEA 2HCJB 4C0BA 3NC1C 4OI4A 4C2TA 2FSGA 3LVQE 4M53A 3CF2A 2GEVA 1RW4A 2VSXA 5JJKA 2ZR0A 2FJUA 2AKYA 1GRQA 4ZKEA 1X8KA 4IDQA 3C41J 2D2FA 2PLFA 3VAAA 5FBWB 4LV8B 3REFA 3W8RA 1PLLA 2IF0A 4YLGA 1N5LA 1HA3A 2CHVA 1Z0KA 1II9A 1FUUA 2WWHA 1Z28A 2SHKA 3HYTA 2NPIA 2O8EA 4WZBE 4IJMA 4MUAA 4WXPA 1OFUX 1W4RA 1CTQA 2AX4A 3QI2A 4JSYA 4BLPA 1KYIA 2ANBA 1XTRA 1BKDR 1QHSA 1T8TA 3SYNA 4MITA 1AZSC 5FBLB 4MDEA 2J46A 4Y0VA 2VP6A 4HB4A 4RFSB 4NHOA 5CK5A 4BPBA 3WNCA 3LFUA 2VIIA 3J81k 2C98A 5GVSA 4A15A 4DCVA 4PO8A 5DYIA 3K0FB 1F2TA 3WNBA 5FR1A 4R7ZA 1WBDA 1S4QA 4OI0A 2ZIAA 3OE7D 5FPKA 4D81A 2EQBA 4M2LA 1G64A 5FBVB 1OW3B 5LD2C 1FQJA 5HPYB 3GCGA 4A8JC 1NVWQ 2ZS8A 4BRUA 3SJZA 5HKKD 1YZGA 3EC2A 2JLZA 3AGQA 2JLWA 2IA5A 5FTLA 5KHOC 1P2UA 3CF6R 2JLUA 3VKHA 4O25A 1NY5A 3QIAA 4P4SB 5AJXA 2FGJA 2ZSBA 3CRMA 3DOFA 4B3XA 4BFZA 2JJ1A 1JI0A 2NO1A 2NZ8A 1CEEA 2RCNA 5IK2A 3PEUA 2FA9A 1NBMD 1OPXA 3KKNA 5D3MB 2CE7A 3X1XA 3BJIC 4KFUA 1VCIA 1JJVA 2RGGA 2ZSFA 1J90A 3WNDA 3SC3A 5AK0A 1C1KA 4HZIA 4EFMA 2IXEA 4LC1A 1IJEA 2CBZA 2WSMA 5FOUA 3TRFA 5DNYB 4D4LA 2BBWA 3DPUA 1FMJA 3FDIA 3N5CA 4NL4H 3L2OB 3QOFA 1G3RA 3IEUA 2CNWD 5JWRA 4FW9A 2Q21A 1GILA 4PXAA 5GVRA 2OLKA 1TMKA 4I81A 3EIHA 1IY2A 2JAQA 4HYYA 4CDGA 1ZP6A 1XFAA 1EXMA 4FWIB 3GLHE 4LOAA 4NP6A 3W3ZB 3IBGA 1NSFA 3U60B 3TW4A 5C1BA 2Z4RA 3L43A 4E5UA 4HAVA 2F7SA 4IEIA 4B73A 3NEYA 3QG5A 1HURA 3QPUA 1CLUA 2AK2A 3ZVRA 1KO4A 1M6NA 2A5DA 1KI6B 1II0A 4NZYA 3K70D 1R5NA 4AYWA 3T61A 1JR6A 4NPHA 2Q6TA 1E0AA 3AUXA 4IXMA 4Q18A 3SDZA 3ICEA 1CRQA 4JSTA 2XOKD 4A0HA 3MHVC 2WHXA 4GMXA 4LBWA 5FUVA 2RKOA 1OIXA 3KXKA 3K8YA 2ZI5A 2HT1A 1DADA 2FSHA 3OEHD 5JRJA 3A1SA 4MRVA 4RZUA 1MABA 721PA 3KQLA 2ZAOA 4K46A 1FPMA 2HXYA 2Q0HA 3R8FA 3OIVA 3BK7A 5FTJA 3GJ6A 4M9ZA 1EFCA 2BOVA 2HJVA 2QROA 3N2IA 3P32A 4RKEA 4C3ZA 5JS7A 3OESA 4DKXA 2PLRA 1BH2A 1KY3A 3QF4A 3CNLA 1AQUA 4IHQA 2MMGA 1SQ5A 4M4SA 3RRYA 2IYQA 5CM8B 2J87A 2IYYA 2MSCB 2NIPA 4KSBA 5KSPA 4BECA 1NLZA 1ONBA 2JJ2D 2A5GA 2AR7A 4ERNA 3EPLA 5K8LA 1JECA 2WSSA 4IOJA 2OBLA 3DDCA 5H70A 3SZRA 1L8QA 2A78A 3M0EA 4ZDKA 1TAGA 4KODA 5CYPA 2P6NA 1G5RA 4UNQA 2ZITA 1TQ2A 1SVIA 3L0IB 5EP3A 2F1JA 2ZI4A 1PUIA 1VG8A 4MGYR 1ZNYA 3ZH9B 4D0NA 2PX0A 4R2HA 3TBKA 4PQFA 4HDCA 5FR2A 3S1AA 3VU9A 3ZD6A 1E0SA 5EUQB 4F93B 2ZSDA 1YJ5A 2OBMA 3AVUA 1XEFA 1N0VC 1XD2B 3W9YA 2CL0X 1G20E 2NTYC 2X2FA 3Q5EA 4GOJA 4D6PA 1XXHE 3KQKA 2PJRA 3F8TA 3K0CC 1S96A 5D3QA 1FFHA 2JGNA 2PEYA 4JJZA 2ONJA 5B57C 3LH5A 3AJIB 4URXR 1GKIA 4NE2A 1XF9A 3TE6A 4AYTA 1NMYA 1E9CA 3I4LA 3AVVA 4TQAA 3V00A 3TR5A 3HPQA 4GNKA 2FPKA 2ERYA 1P72A 4PAOA 5L3VA 4DBLC 2ZS7A 5FPYA 1G7TA 1KZGB 1UBEA 1YQTA 3LLMA 2ZQ5A 1KK2A 2GVDC 2W6IA 2QGNA 1D9ZA 1NJGA 3KFVA 3TQCA 3ZVLA 1WCV1 4YC7A 3VHXA 2QMUA 1N5KA 5GJVC 2FFBA 1W36D 1KSGA 1G291 2GVZC 1KO7A 3BB3A 1XBTA 2FMXA 4Q66C 4DLWA 2J7KA 1C4OA 4RY2A 4DXAA 3OF5A 2DWZB 1WF3A 3CRW1 3EA0A 4GI7A 1VMAA 4NKRA 1VIYA 1IXSB 2UZ3A 3UANA 4Q9KA 3R7WA 4CRWB 4YMSA 4QM6A 5E95A 2QTVB 1GDDA 4MKHA 1IQPA 1X8LA 2ORWA 5JEDA 2FFQA 4CEHB 4D25A 4IOKA 2ZRDA 3ZVMA 4EJSB 1AJEA 2IUSA 4A2PA 1GFIA 4TTRA 1Z6TA 2F3TA 2REXB 2R6CA 2ZRNA 1F2UB 1WQ1R 1ZC3A 5HTKA 3WRXC 3PCRB 2UZIR 3AF1A 3IQWA 4Q1DA 4OQMA 3W8NA 4N0EA 3F5FA 2AN9A 5FL7D 4DJTA 3A37A 5JCZA 3LQQA 4TLBA 3IIKA 4HDOB 2G1KA 2WMNB 3OIUA 2XEXA 4B3GA 3PVSA 1GG2A 2DWOA 1OIVA 4R2IA 3QKRA 1IY1A 1P2TA 1U90A 2A5YB 2YOHA 3OAAD 2NPFA 4F4JA 4DCTA 1PLJA 2QMHA 1SXJB 4URUR 5C46F 1P60A 4IDHA 4ON9A 3VNVA 3SJAA 2ZE5A 5KYKA 4HZUA 2HLDA 1BYIA 3TSZA 3NKVA 3A58B 4B75A 1PUJA 4RD1A 4HB3A 1QZXA 1CU1A 3I8XA 4Q4LA 2R2AA 3UWOA 1XJQA 5DLQC 2GILA 4DEXA 3I5YA 5KNCA 2QTHA 2WAYA 3PIRA 2EYUA 3AEZA 1RZ3A 1HH4A 4F38A 2F1IA 4ZO4A 1YE8A 2XTZA 1YRAA 4W5WA 2P67A 4FI3C 1Z2CA 1UJ2A 1RRGA 1FL9A 1N6IA 5JRZA 1W44A 4TLCA 2CLCX 3EAQA 4P4UA 1KJWA 1ETUA 4E22A 4GDFA 2IW3A 4NCNA 2QPAA 2GKSA 2J9RA 1RJ9B 1QHIA 3IKJA 4NCJA 2CE2X 4OBEA 3GD7A 2OV2A 5TMPA 4UNNA 2C5LA 4LSGA 3CNNA 3PUWA 3KKQA 3K9HA 4ZIRA 2BVNA 3CUEF 5DN6D 4JVLA 1IM2A 1VECA 3B82A 3I72A 4LPSA 5AUNB 1KI1A 3CPEA 3K0AA 1VCNA 1SVKA 4JKIA 4CW7A 1VYUA 2H57A 2XX3A 1FP6A 4L9SA 3CPJB 4EFLA 3MJHA 2FG5A 2WKRA 1V43A 4AKEA 2GCPA 1GTVA 4FMCF 4R9UC 4DHEA 1CS4C 1Z6GA 3NIBA 3EX7C 4H1VA 1TUIA 5P21A 2FEOA 8OHMA 4AG5A 4JLBA 3ZIAA 3A4NA 5CJ2A 2W6JD 2QA5A 1UEJA 4GRAA 1KDTA 4B71A 4FMDB 4PTLA 4B74A 2H16A 2QENA 2XZOA 1COWA 2GF9A 3PV0A 5DSZA 2KE5A 2EFDB 3GQBA 2NQ2C 4A6XA 3U44B 3GJ8A 4LCBA 1HQYE 4AWXA 1G8YA 4CEJA 1E6CA 2V3CC 2B8TA 4B43A 2QY9A 1YRBA 1GOTA 2VTKA 4PO1A 3MUFA 5A0FA 3VKGA 3CONA 4KVAA 3K0SA 2X2EA 2WJGA 4KO8A 1NIJA 2YNMA 5E7MA 5E3HA 5AUPB 2YZ2A 3LA6A 4JIMA 3BFKA 2IS4A 4YONB 3B1VA 1FX0A 4QBGB 2QSZA 4BFXA 4DUGD 2BBSA 1IN6A 2ORIA 4JVMA 1OXSC 4D4JA 4NCHA 3CRRA 2CCGA 1S9HA 2FH5B 4LBZA 4Q00A 2ZREA 1M1YE 3I73A 2HYDA 1LS1A 3NXSA 2CVFA 5EZ6B 4DDVA 4MDFA 4FCVA 4RCZA 2IF2A 1E0JA 2IYVA 4AKGA 4M8NE 5GADl 1U8ZA 1ZVQA 1A7JA 4ZDIA 1ZIPA 2GAAA 3LDAA 3BH0A 1T6NA 4JLDA 2YC4C 3UXMA 5G40A 4XD7D 3NBYC 2HV8A 2QG6A 1Q1EA 4PX9A 2IYXA 4FWDA 1SKYB 2W0SA 5CLLA 4Q9HA 2FPLA 1U9IA 4TMZA 2OLJA 3Q8XB 4M9XA 3RSLA 4LX0A 1JNYA 1E2IA 2RHDA 2ZU6A 3ZJYA 3EZFA 3OEED 2BM1A 1QVAA 2QMOA 3QBTA 2J7PD 4G5QA 5KSYA 1X6VA 4ZV4A 2C95A 4G3XA 4D80A 4KLZA 4MA4A 4DWJA 2QGZA 3KZ1E 4HAYA 3FFAA 4F92B 4Q4AB 421PA 2QL6A 4BGDA 1AN0A 3LX5A 1W47A 3QKSA 1I4TD 3A1VA 2DFLA 2WV9A 2GJAA 1G3IA 3KTAA 2F3RA 4PO9A 5BWMA 3U7EB 1SULA 1ZM4A 3P1JA 3T34A 3HU1A 3W6NA 4XOIA 4NBSA 4JLKA 3P4XA 2ZRGA 1FTSA 3B1XA 4HB2A 4JLNA 1G8FA 3K9GA 1DTSA 1R5BA 4PC3A 5GJWC 5FBRB 5GJBA 1GWNA 5TV2A 2GDJA 2FEMA 1MOZA 1E9EA 3NBXX 4NYMQ 4URWR 5KDLA 5J4YA 2GXQA 4BFUA 2D7CA 2GBLA 4WVFA 4TYNA 3KKMA 3THWB 3QXJA 2VO1A 1KI2A 4D2IA 1NVVQ 1O3YA 5AJZA 4DSOA 1GL6A 5KPJA 4V02A 1RPZA 3K53A 3DM5A 4O2LA 1OH8A 1N5IA 2ZRIA 4LYHA 2FFHA 5HCIA 1M7GA 1G17A 3GEIA 5A5GA 4B3CA 4Q19A 1VPLA 3GLFA 2CJWB 1II8A 1W0KA 1KNXA 2QUZA 2ZRPA 4TWZA 4B2IA 5BW8A 2BV3A 3WP1B 1YZKA 4UNPA 2G0NA 2JIZA 1HQCA 1TU3A 1XD8A 3CPHA 3H0KA 3AH8A 4ZDWA 3UK6A 2D3WA 2IYRA 4Q7MB 1UADA 4A2QA 3CH4B 2O8FB 1W4AA 5AWFC 5DI3B 3PEVA 1HT1E 3FHOA 3MD0A 2MSDB 3CX8A 2DR3A 1Q3TA 1G7CA 1TPZA 1KSHA 1Z6AA 4P4TA 1N6NA 2CXXA 1ZMXA 1AKEA 3QSYA 4AKHA 3TMKA 5DO9A 2JJ1D 1KIMA 5FBQB 2RHMA 1Z0FA 3RLFA 5IK2D 4DLSA 3GLIA 1WMSA 2WOJA 3QQ5A 3KJEA 3QPWA 1Z83A 1ZM7A 3DEFA 4AY2A 4PC2A 1Z07A 3BD9A 4EKDA 1JJ7A 1SHZA 4UJ3A 3C5HA 4DB4A 1DG3A 3WXMA 5G3YA 2J1LA 4LJ7A 1E98A 2NGRA 4C7OA 4JN6A 1IAQA 2VH5R 1ZM9A 2V1XA 4TL8A 3VR1A 1Q3HA 3NG1A 2Q9BA 4LHXA 4QGAA 1RYFA 1TEVA 1AM4D 4DCUA 5AUOB 4C0JA 4XWAA 3L8ZA 3OFNA 4YMVA 5FI1B 5J4HA 1HYQA 3GLGA 4MYHA 2ZE7A 2WTUA 1A1VA 3KQUA 2FSIA 2XB4A 1NVXQ 3BB1A 5HZKA 5DHAA 1GL7A 4JZKA 4PC6A 2JLVA 1H8HA 3CWQA 1VYTA 1ZD8A 4GITA 1KO8A 1Z0DA 1GITA 1P2SA 4DDUA 4CEIA 1G18A 4GOXA 4IEEA 4CT5A 4LYJA 1LV7A 5BN3A 4ZCLA 4CYMA 2VPPA 1AK2A 2ODBA 4XWKA 5CIWA 3WRYC 1ESNA 3V4FA 2WWYA 1BS1A 4RFVA 1XDBA 4IDNA 5JSZB 4NYMR 4IXNA 5CM9C 2ZRHA 4QJ3A 5FTMA 1LFDB 1OXTA 2AXNA 5TVKA 4R71A 2OZEA 2YKGA 1NMZA 4TSFD 1KSFX 4KYIB 5J5CA 1IHUA 4XJXA 5BQ5A 2GJKA 1XP8A 1ODFA 3QVVA 1GUAA 2NO0A 3WY9A 2GXSA 2DWPA 3GFOA 3NVAA 5FFMA 3W6OA 4Q4HA 2O0KA 1IN8A 1P4SA 4DC9A 2B7BA 1E9DA 4A9AA 4O2RA 1SKQA 2PZFA 3Q9LA 4MKFA 1P9WA 4EAQA 3CH5A 3IIJA 2IYTA 1OH5A 1ZCBA 1KDPA 3GP8A 3TIFA 4AKIA 1DELA 5JI2E 4RD4A 2VHQA 2O8CB 2KRKA 5BYJA 4DIDA 1G9XA 3LVRE 2VA8A 2G6BA 2E9SA 4Q47A 3EA5A 4CIDA 1CR4A 5G53C 4A1FA 2AWOA 3M1IA 2CCKA 4LHYA 1E0KA 1DG1G 5DHFA 4PANA 4QJ5A 4DDTA 1D6JA 3K9NA 4RVCA 3NH6A 3G5UA 3VNUA 2PCJA 3RRMA 1GVNB 3T5GA 4EPYA 2V6ZM 5EP1A 3EXAA 3CRVA 3TJZA 3E2IA 1L4YA 1XCMA 2JDIA 3NHAA 2XJ4A 4PHFA 1G6HA 5EP2A 1X3SA 3BORA 2XNSA 1HE1C 1ZD1A 4NDZA 3REGA 2JLYA 5FH9A 1NP6A 3WYGA 4GL2A 2D62A 1WB9A 1P5ZB 2ZVPX 1OKKD 3C15C 3AQ4A 3CZQA 4DSTA 2R8RA 4IVPA 1MO5A 4C0SA 2W6ID 3KDSE 3GJ5A 1UKVY 2ZI7A 2G9NA 1T4GA 2XXAB 4RZXA 3B60A 3CX6A 4BFSA 3U3MA 2QAGB 1ESMA 4FWGA 3CR7A 1W36B 2WWFA 4MQBA 4OQXA 3AKEA 4JLJA 1E2HA 2IWRA 1LVGA 3SJCA 1Q57A 4ARZB 4U00A 3CW2A 1OV4A 4DLVA 2ZJAA 3IPYA 1E9SA 3ZLJA 1P7CA 3E5HA 1UKEA 1Q21A 4MYUA 2J3EA 2V6IA 4BE7B 4OHXA 4WBSA 2Z4SA 3QENA 5FOXA 3I32A 1D2MA 4FMBB 4BLSA 4PAQA 2EWWA 3NC0C 2RGDA 2OCPA 1Z22A 1WE2A 3SBDA 4WOPA 2DZOB 1FMLA 2GA8A 3HR7A 4Q21A 2F43B 3QJYA 1E9AA 3A4MA 2J45A 4PPQA 1L2TA 2KBFA 4GZLA 2DCUA 4KXFB 3DZ8A 4JLMA 1RKBA 3THYB 3AM1A 4RZ2A 4BFTA 4CZ2A 1E1QA 1WBBA 1XEXB 2QZ4A 3EZ6A 3RRZA 4DT1A 2ASEA 3THXA 2DB3A 3RHFA 2QT0A 2XTMA 3GLHB 4N0DA 3MWYW 3RABA 4DZZA 5F3WB 4XSGA 3FHTA 1TF7A 2GF0A 3NDBB 4M1TA 4EUNA 1S3SA 4ESVA 3ZD7A 4WZAE 3CX7A 1HUQA 3DVLA 4LJ4A 1E9BA 3IHWA 3O8RA 3ZZUA 2PCLA 1SXJC 2B21A 4QHYA 2HLDD 4PAMA 4AIIA 2GK6A 3RDPA 2EFCB 4IW3B 3I3SR 2D06A 5B58C 4EPWA 4DLZA 2E1RA 2R6DA 1JPJA 4GSYA 1UFQA 2QBYB 2YWHA 3SJBA 3MJRA 3VTKA 3VR6A 5FOVA 3VFDA 4NCKA 3K0CA 5G41A 1CJMA 4AK9A 1J8YF 3SI7A 3GJ7A 4IKEA 1E2DA 1YHNA 2ZYWX 2BWJA 3VR2A 1Z0IA 4FD2A 3I8SA 1YZNA 1UM8A 3SYKA 1J99A 1ELOA 1BIFA 3WHLA 3EPHA 1RYHA 2P65A 5L3QA 1EFUA 2Z5FA 4HB0A 4JBYA 4DLYA 2ZJ8A 2BMEA 1DO0A 4LJYA 3TQFA 4H1UA 3CNOA 4PFSA 3BGWA 4TSFA 1LNZA 1J8MF 1I2MA 1R0YA 2HXSA 2GCOB 1ZJ6A 2ECKA 3SHWA 3GLFE 1U0HC 1KK0A 2MSEB 4NTZA 1MKYA 2IBMA 3SN6A 2OEPA 5CJPA 1JQJC 4BFWA 1OFTA 1H8EA 3UMFA 2CLDX 3UATA 3U61B 3QVUA 4LZZA 3GJ3A 4BLQA 5KOYA 1JBKA 4XVRA 2H5EA 3A1TA 2Q9CA 1BOFA 2BIFA 4JLAA 4MKIA 2ZRMA 1W48A 3SYLA 1U8AA 1FNNA 5HCNA 3IGFA 4RJLA 3QXHA 1XZPA 2ORVA 2VLIA 1XXHB 1LF0A 1N25A 2KJQA 3B6EA 3A4LA 4JL8A 2A3RA 5EE5B 5L3SA 2JA1A 4PPNA 4Z51A 3A1UA 1OIWA 3ZIAD 2XZLA 3RC3A 3BWDD 3GLIE 5HZHA 3QEOA 4HDQB 4HEJA 4UQOA 2PBRA 3RC8A 5C18A 2GTPA 4BRWA 4LJ5A 3T1VA 3RYTC 2GXUA 1COWD 1KHTA 4P3YA 4JLPA 4JMPA 3TUIC 4BUJA 4GBMA 3RAPR 1NLYA 2GJ9A 4Z1MA 1E9RA 4KSCA 2WJHA 3MG9A 4QNRA 2AK3A 4GPTA 3TVDA 4C0LA 4HLUC 2HT6A 1N6RA 2RGBA 1EFRA 2YC2C 3G82C 4KCGA 2IHBA 1SVMA 2OXCA 4KFTA 4PC7A 4QHTA 1OKKA 3TVTA 2V4ZA 2ZJZA 3SS8A 1US8A 4BLOA 1RE0A 1WDTA 1LW7A 2CMKA 4PQYA 5DIFA 6Q21A 2VP5A 4A3VB 5DISB 3GLGE 2EFEB 1G8PA 2R44A 2Z83A 1CIPA 2AFIE 3MAAC 1E96A 4OYHA 2VSOA 3NWJA 1E2PA 1VG1A 1HE8B 4RSGA 2BJWA 1NN5A 1P6XA 3AF4A 1P62B 4L8GA 1A4RA 1E4YA 1E69A 3QXSA 2ZPTX 2ZM5A 3KX2A 1KI8A 3LBIA 4OK3A 4B6FA 821PA 2RGAA 3PG5A 4V0LA 2NO7A 2OE2A 2YVUA 1XTKA 1HEIA 2XTNA 2XAUA 4LI0A 5KSOA 1MRSA 4X8HA 3H86A 1X1RA 2QPOA 2VHJA 1EWQA 3VLFB 5KU1A 4LY6A 2RGEA 4US1R 5EXTA 2HJGA 3VMFA 4EQ6B 1KJYA 1R0WA 2B92A 4WXRA 1JAHA 3LO5A 1SHKA 3N70A 4WZ6A 2O0JA 2R6AA 2BM0A 2I4IA 4URYR 1CJVC 5KNBA 1H65A 1MO4A 1X1SA 1P9NA 1YZUA 4GFDA 4UXJA 5IRCD 4PC1A 3RS4A 1BYUA 1ZINA 1KZ7B 2QI9C 2PMDA 2VF8A 5IF9A 2C78A 5EXSA 3BB4A 3V9PA 1OYWA 3VKWA 3VQTA 4ASUA 4RD3A 2ATXA 1OYYA 4EDHA 2VP9A 2OFOA 1VIAA 4EPVA 2BEJA 4OJKA 1IN7A 3DMNA 4YXWA 4KITB 4LV6A 2QNRA 4A92A 2JJ8A 4TYPA 2PT7A 2O8EB 1OFHA 3LW7A 1FUKA 1ZYUA 2ZRLA 4Q9IA 4PHGA 1YZTA 1QHHA 1TEXA 2NO6A 4YMUA 1Z0AA 2A2ZA 2FFAA 4HUQA 4BFYA 2IX3A 1MRNA 5C2JB 5J40A 2QAJA 1GL9B 1OSNA 3QE0A 2C9OA 3F3YA 4FN5A 1Z0JA 1S0UA 2Q3MA 3IBYA 2REBA 1W0KD 2BJVA 2F6RA 3OHMA 1KMHA 3U6BA 4LRTA 2O8DA 3EW9A 3Q72A 2QT1A 1F2TB 4KYUA 2JIZD 2WOOA 2EFGA 2A5FA 1YVDA 2QM8A 4LK2A 5FTKA 2Q3FA 5J47A 1W2GA 2ZS9A 1YR7A 3IUYA 4D0GA 4NONA 3HP1A 2OM2A 3KQHA 1PVOA 1C1YA 2OAQ1 2V9PA 2WICA 3TKLA 3OIYA 2WBLC 4TLAA 2FDCA 2WJVA 1G19A 2BKEA 1ZIOA 3AVYA 1QVRA 2J0UA 1JB1A 2H92A 3AVOA 5CYOA 2GJ8A 3T06B
chains in the Genus database with same CATH superfamily
3DA1A 4KWCA 2ZANA 3FVQA 4D4HA 1CVLA 2EYQA 2DTEA 1EZZA 1ZD9A 5E2BA 4J3NA 3RQSA 4WBXC 1EVQA 4B83A 4A36A 3PVZA 2PL3A 3OQVA 4X5OA 1ZJWA 2FZKA 4W5OA 4QHSA 4DR6M 1J2JA 4CM8B 4BX0A 3SIWA 1A9RA 4R54A 5AI9A 1PS0A 4RENA 2ZJ5A 1ZK4A 4QPZA 3WHKA 3VU0A 4UBLA 3QKUA 4ZWNA 3NBKA 1WQ3A 1NXVA 4B6PA 2PBZA 4E07A 5LP1A 4B3IA 4I1IA 1EM8A 3KKLA 4P6VF 4U6QA 4U0JA 1L4BA 4Q02A 2HCBA 3LC7O 4RH0A 4B44A 2ZLBA 1FSFA 1Z12A 5E0KB 1L4GA 2ANCA 2P2YA 3HCNA 3HEAA 3PJDA 2Q7DA 2QWXA 4LRSA 1RHKA 4QYWA 3FLAA 5FWYA 3OZXA 2GN0A 4GM0A 4F72A 1UEXC 4NDAA 1NTRA 5BSVA 1RHRA 1CQPA 1EFKA 4QODA 4OD0A 2WE8A 4MA5A 4AYXA 2OFPA 3FFTA 3MCTA 5ERXA 1KDRA 3B6JA 3E03A 5DDIP 1UP7A 1YV9A 3U5ZB 2QX9A 1Y6RA 1ZOLA 3HBLA 3HFRA 1Z26A 2PGLA 3M9LA 3C7TA 2IY9A 2Q28A 2X41A 1YB5A 4K9PA 1B4DA 4UJ5A 1FQWA 4UTXA 1QDTA 4LGCA 3OOWA 4MRMB 3IP8A 3G1WA 5HRCA 3BD7A 3LUDA 2WT9A 3SJUA 5F9FA 1JU9A 4CI9A 1MOQA 2PH3A 3E8MA 1B8NA 3TX6A 5T4HA 4X7RA 1PLKA 3RGGA 4PXSA 3JR7A 4R41A 4TMTA 3EFHA 1UBSB 1K89A 1Y5LA 3V7YA 1HSOA 2DYKA 1BD4A 1R4AA 3D1LA 5DWQA 3MJ5A 4LGVA 1L7VC 1EK0A 3TRIA 3RAJA 4AJOA 2Y8EA 5BSUA 5JDCC 3OKFA 1TF2A 5ICMA 1N5DA 5EZSA 4M6WA 1XWWA 4W1QA 3IDSA 1G41A 1QLHA 1P1FA 3KSZO 1WM1A 2C2HA 2VP3A 3NNSA 4D0RA 1FX0B 4PU0A 3ZQJA 5DGIA 2A1IA 4XB6B 2QQ0A 1Z5VA 4IIWA 2JZ1A 4B82A 3RADC 1UK9A 1Y1RA 4ER3A 4G01B 3N2EA 4DIEA 4B2LA 4KZPA 3QVGA 4JJ4A 3DVAA 2I7VA 3L7MA 4X8OA 3ZWXA 4L5CA 2E5LB 3DP9A 3GCWA 3ISVA 4QGHA 5HQTA 1WHSA 1SUIA 2WJYA 3GH3A 3INGA 3TAUA 1DDGA 4WT7A 3LY8A 1XAIA 4ZCMA 4EUEA 3OQIA 4HNRA 1EVIA 3FMOB 4Q01A 3BAZA 2AQIA 1N6KA 1C7YA 4R01A 5F4ZA 2LVAA 5KSZA 1W5EA 3SX0A 2Z3VA 4OMUA 4YCCA 2Z98A 2JAOA 4NQRA 2BY4A 5DFLA 2K5UA 1F3OA 3VH4A 3KP1A 5TJHA 3ONWA 2QL7A 5E8RA 2AW5A 1PJ3A 1CWUA 4IILA 3KPJA 1O97D 1JQEA 5GAJA 3IUEA 4DLKA 3QXXA 4DCPA 4QFMA 2B8NA 2JP7A 3HHWA 2WB2A 3KYDA 4ZVQA 1Q1AA 3C1OA 4F7DA 4CGYB 3RFFA 2DWUA 3LC1O 4XARA 3TXYA 1KO1A 3R1IA 1LC0A 4KPEC 1DS6A 1SN7A 1KS2A 3T4UA 4LXQA 3QPVA 1X38A 1EP1B 4DLUA 5DX1A 1EP2B 4YRTA 1KAQA 3DHEA 4YVFA 3NTUA 2AFIB 3DAHA 4C6SA 1XX6A 1LXCA 1GM5A 4JHLA 2HD4A 3EW7A 4Q48A 4TTVA 5HQ3A 2XQJA 1VOTA 4YJ3A 3OOSA 2W2XA 2VDMB 1PR0A 2ZCVA 3I61A 2KEBA 4J0HA 2OENG 4X60A 1ZBDA 1GZHB 1G5FA 4BIMA 3ZHUA 2PTHA 4NBUA 1N1MA 1FYFA 3B7WA 4M99A 4RK4A 3OE7A 4NOKA 1JVSA 2GRJA 1NVMA 3GVXA 3ZGXA 4OHUA 2ZBRA 2XMGA 1AS3A 1TMYA 1DRUA 4GPEA 3ZC7B 1W94A 5BR8B 3EZ7A 2XUQA 3TOXA 4OI2A 3UB2A 2VZ9A 3K9PA 3F74A 1W4LA 2VDJA 1M7BA 4F60A 2GTHA 2GERA 3Q11A 5BSGA 4TRJA 5AVKA 4YAIA 1P7WA 3CUUA 4QX6A 1BXGB 1TRHA 1UBNA 3PNPA 4X62M 4I9GA 4ENRA 4XVUA 3SMSA 2P0EA 2JCSA 1SD2A 3WAKA 2QLFA 1L1TA 4QU5A 1B0PA 1I7QB 1B6GA 2A94A 3EGCA 3UKJA 2MJLA 2IXTA 4I5GA 2PQ6A 1A8HA 1G7RA 1DNPA 1U2GA 2L69A 4YJ2F 1FFWA 1WRBA 1FUIA 3K5IA 4F3TA 1ISMA 1TK9A 1QQBA 2XQVA 3TSCA 1ABFA 3G2OA 1QJ4A 4JKOA 4WQMA 1EE9A 3QMPA 4UULA 3F9CA 1DOAA 2X5XA 4JBXA 4KQFA 3KP1E 1XZHA 2Q5CA 4BX8A 2DTXA 3ROEA 2V03A 5AHKA 1XMJA 3VYWA 2Z1MA 3OQJA 2GJ4A 2QP3A 3VNSA 3FMGA 3P27A 4XRRA 4RQTA 3GPXA 2BFNA 2CNBA 1PBNA 2WF9A 3M3PA 4IIYA 5ITVA 2C99A 4NZNA 4KZKA 3L0DA 3GMTA 4R3UC 4TT8A 5EUMA 1CHNA 1USVA 4JI1B 4BMZA 2QJRA 2ZAMA 2WIGA 3FUCA 4O4JF 3QUCA 2GCEA 4FE7A 4U7HA 4QTTB 4URVR 2OCAA 4G81A 2CJFA 5JJIA 1BGVA 5T64A 3JX9A 4KACA 1CUBA 4CM4A 4PWZA 1DP4A 1QIIA 5C8YF 2ZM6B 3G6KA 4N3CA 4DUZB 3K4QA 4RKFA 4L5AA 3MGGA 4OFWA 4BMXA 4L28A 4L9WA 1J70A 4ZC8A 3DMGA 3R7BA 2HA3A 1NUPA 3D64A 2Q2NA 3C43A 1T3SA 1T9ZA 1FMTA 3P52A 1WXEA 3UB4A 1SXPA 1EBUA 2A5JA 4ZQFA 3HKCA 4AS3A 1QSGA 4DGSA 5L4LA 3FPGA 2H2DA 2JFQA 1SMKA 2YINC 5ALGA 5I8PA 3T5DA 2FPXA 3KKOA 1QKIA 4Y6SA 4C4PA 4LYAA 3KWMA 4MXDA 4WCDA 5DB4A 4BB6A 2RHTA 4LA4A 3B3QA 4FFPA 1KYVA 2P4SA 1YXMA 3L0OA 1GPBA 1Y48E 1XL1A 2ADFA 1DGFA 3JQ8A 1I7SB 1C5KA 2R9VA 2HIAA 1YZHA 4Y6RA 3JWHA 3VJKA 5GGXA 3T3HA 4A0FA 3S2IA 3W8FA 2RSLA 2C2YA 4IDBA 3ZE8A 4OO3A 5EPUA 5F2EA 3N59A 5EXXA 1Q1NA 1JIVA 2GPAA 5IHXA 2VDUE 3C41J 2DKFA 4RK0A 4BWFB 1UZUA 2WWHA 2H63A 1CQJA 1YRYE 3JQFC 4JSYA 4KQCA 1GLNA 5FBLB 4EFDA 2J46A 2J5KA 4OQDA 5ALJA 1KQOA 3CHYA 2G9RA 4D81A 1P5FA 4IHAA 2JLZA 2JXNA 5EIBC 2JJ1A 1A96A 2PO7A 1R2ZA 3HGTA 1H94A 1ZWLA 3R5TA 5CA0B 3L07A 3P7MA 1C1KA 2BEWB 2XOXA 2CXTA 3PJFA 1U5AA 1NP7A 4FW9A 1URPA 4C6TB 4QOFA 1L4EA 4YECA 3M49A 1RKVA 4FWIB 3SC2A 1PJ4A 4BUZA 2XA1A 3N0XA 1SZCA 3PHHA 2HB6A 3OLXA 2RJNA 3LT0A 2GKGA 4JQYA 2Q6TA 3SDZA 2B4TO 1B15A 3NHRA 3LF1A 4RK6A 3UOGA 3H7AA 2Q0HA 2QROA 4OKIA 3MWEB 2IQ5A 4MP8A 3HTXA 2C8JA 4OHBA 2O1XA 2LE0A 4Z3KA 5JSQA 4L0MA 4IMPA 2I4LA 1VZ2A 2WSLA 5ALYA 3WLQA 5EHNA 3DCNA 1SQ0A 4KQEA 2ZITA 4O0LA 3CLUD 1IATA 4LZAA 1QBGA 2FP4A 3ZH9B 1Z56C 5BVGA 4HDCA 2J85A 5JFTA 1E0SA 3EBOA 1XD2B 2PJRA 3FD9A 4J8PA 5KU7A 3LH5A 2CD7A 4G8BA 3GFVA 3AVVA 3QPDA 4GNKA 4J76A 4MMZB 4HXEB 4QLOA 2IFTA 1J9ZA 1UBEA 2K6GA 2VDVE 2DP4E 3KFVA 1XTVA 1TJ3A 3CJTA 2CZCA 2WD7A 5DXJA 3UANA 1CCWA 1IL0A 1IY8A 3A1NA 1K3UB 3KR1A 1V33A 4MR8A 3WRXC 2UZIR 3AY6A 2XV1A 2OGWA 3W8NA 4LY0A 4MR7A 4Z86A 1X92A 3AV0A 1NFRA 3PVSA 3V3KA 4P54A 1G5QA 3KFUG 1ZG3A 1AKMA 2XKAA 3CG0A 5IREB 2R6R1 3TSZA 2RGYA 1TAHA 4MUXA 4U7TB 1XZGA 1CP3A 4MGEA 4K9KA 1R5JA 2YTZA 4DEXA 3AUFA 1ZK3A 1FDSA 4PE5B 1YJAA 3BJZA 1J07A 3HP4A 1ETUA 4DAEA 4E22A 2F48A 4F8JA 5BVHB 1XP5A 3GD7A 3TINA 1HZZA 4EB6A 2A0WA 1R4ZA 2BVNA 3B82A 1HG1A 3LC2O 4M46A 3OMXA 3QLJA 2HSWA 4GIPA 3GH1A 1VHDA 2CSUA 4BO2A 2K2QB 2H5IA 4HKTA 4FFLA 2W6JD 2JGJA 2QA5A 1UWCA 3QLUC 4B71A 3WK5A 3KOYE 5IAAA 4Z9BA 4AY4A 4JBIA 2NZWA 2MR5A 2HQBA 5C1IA 1IB0A 4BNVA 3S27A 2QL9A 3MUFA 2Y9PB 2J6HA 4NMXB 1Y6GA 4JIMA 1RI2A 1WPXA 1TKAA 1ZD2P 3BXOA 2K7FA 5EZ6B 2PA3A 1A7JA 1LW6E 5CB4F 2C7OA 1DRWA 1A76A 1G6Q1 4D9CA 1H4TA 3ZXSA 3WLNA 2EO2A 4XIJA 5BWOA 3QBTA 4G5QA 2O59A 4HYEA 4KLZA 3KZ1E 4HXFB 2ZIZA 3BJEA 1QOQB 4FYIA 2ZYGA 3ED1A 1LDBA 5AP9A 3TZCA 1XV5A 4KDEA 3MJTA 5FDFA 3LVBA 5H37D 1Z8DA 3BMXA 4EMUA 2VXCA 3RT9A 3BXHA 1YDHA 3GNSA 4I6JA 2FEMA 3AJAA 4X7MA 1XVAA 3ML1A 3W06A 1IM5A 5J4YA 3D3EA 4LVOA 4CLRB 5JAMA 4WERA 5DN9A 2L2QA 3N2NA 1GGEA 2Y0DA 3LLSA 2A3NA 3MCZA 2I65A 4KT0F 2QD3A 3U31A 4ZDWA 2MCFA 3U6OA 2BF4A 2P9QA 3JV7A 1Z6AA 3USES 2AMFA 4DLSA 3GLIA 4CLXA 2B5VA 4CL0A 4DB4A 2QTZA 4Y6LA 2NUTB 2GRAA 4BZZA 4GSKA 3VR1A 3PC7A 2ZQZA 3QEMB 1ZD3A 1CY0A 2YFHA 4MYSA 2CVPA 4LRTB 3MQFA 1CY8A 3UHPA 2O7VA 2KZUA 2E4AA 4Z0HO 4DDUA 4XDHA 4RFLA 1VBNA 5ITUA 3N3AC 2QV0A 2A5LA 4V24A 4KXYA 1MFZA 1I9GA 4MZDA 1BDIA 1XAGA 3DDSA 2VATA 1XPJA 1NBEA 4BNUA 4CKBA 1W59A 1H22A 4JOQA 4UM9B 2C2GA 3GFOA 2C29D 1E9DA 4EVIA 4XQCA 4BNYA 1BJKA 3ZW8A 3FE3A 3IIJA 4QT0A 2JCYA 1UBTS 3UO8B 3V7NA 4Q7QA 4JB8A 2VA8A 2QL5A 4CIDA 1X42A 2CCKA 3RO7A 3JR5A 3H8VA 1L8AA 1L4NA 1GVNB 2XVAA 4DS3A 3WYGA 2CYAA 5LMZA 7MDHA 3HKBB 3ZHBA 5REQB 1C7JA 3GFQA 4L9AA 3U3MA 4AO6A 3JQCA 1LBQA 1KORA 3DE0X 3W4IA 2FVXA 3ICCA 3WDLA 3A27A 1UKEA 1NM5A 1LK5A 2NU9B 5TMBA 1V9CA 3I32A 4C3OB 4O4LA 3NC0C 1K9VF 3L5KA 4EHJA 4WE3A 2QRPA 4GZLA 3A7DA 4PO3X 4LX8A 3TNJA 4QOIA 1XRRA 3L4BC 2CYBA 4Y6GB 3O8RA 3IHWA 3E27A 4RSMA 2IGBA 2IYAA 1LPAB 4MH0E 1G66A 2H7YA 4CN8A 1I33A 4N65A 5B6JA 1FYXA 5G41A 2OWDA 4ZREA 2JKYA 1KU6A 1YRLA 4YAKA 2QD2A 3EGEA 4KO3S 5IZ7D 3A14A 1OWNA 2P9EA 1R0YA 3N8HA 5JSYA 1YA6A 3E9RA 1U2ZA 4MVJA 4BFWA 4BKQA 2I6GA 2HLPA 1XXHB 3LQYA 5L3SA 1UWVA 1WHCA 3FNBA 3GLIE 2Y93A 4HDQB 4WDRA 1K7YA 3BKXA 2PUCA 2NSJA 3FSJX 4C4AA 4KSCA 3KPUA 4R05A 2HBYA 3SZOA 3I05A 3A3YA 4QHTA 2ZJZA 2C54A 2EFEB 3JYOA 4FU0A 5LYJA 4HNTA 1YMUA 1S5PA 1CIPA 3DLPX 4B6GA 4NJEA 1ZAYA 1JKIA 3P2JA 4DEVA 4UN2B 4IZHA 3MB5A 2ZM5A 3IAM6 3WA7A 4KREA 2X3YA 2O2JA 1YS6A 3HADA 3L7OA 3ZWNA 2EZ8A 1GTJ1 3C3AA 2WIFA 4RW0A 1U2DA 4AW4A 2PUBA 1CF9A 3ZW7A 1K08A 1YZUA 5JJCA 4HQ6A 1BYUA 1RQLA 1TE2A 2DM6A 4PFQA 3T7KA 1YDGA 2R45A 3T7RA 2JVJA 4LV6A 1ZMWA 1MQ8B 1QNFA 2CDBA 2WZBA 2I55A 1S6YA 1LX7A 5LQSA 4Y7DA 1OVMA 4FN5A 2BAGA 4XFJA 3A26A 3WGHA 1F2TB 4J1TA 3EGXB 3RKRA 3IUBA 3R6DA 3BEOA 4G4QA 3BMCA 3ANNA 2FZGA 2VFAA 1GQ2A 3HEBA 2OSVA 1MAWA 2DWCA 5CFPA 3M5WA 4F4IA 4WESB 4JYPA 4AG6A 1EESA 4EBFA 2WW8A 1Q44A 4TKUA 5AM1A 4NYIR 1T3TA 1CQXA 4P3OA 3A05A 1L5QA 2PN1A 5BSFA 4OUDB 2WTNA 2WKQA 2DY0A 4E6EA 2A30A 5A6VA 3NW9A 1NNI1 3L3BA 1L7EA 3KZCA 2R5WA 1VM6A 1RR6A 4NH0A 3I04A 3G2PA 4C14A 4PPGA 3W2HA 1D0SA 1HY3A 3W8DA 1P18A 4A3SA 1SQSA 5F23A 2EG9A 3GRKA 4PHTA 4R3DA 2AJDA 2LNHC 2FB9A 3FNFA 3N2KA 3LQ1A 3ONEA 3L7DA 1EWTA 1Q50A 3U48A 4L16A 4PPFA 4KQKA 3AJEA 3KXLA 5DE3A 1JAXA 3DE1X 1JEAA 1QLWA 4HNAB 1B6RA 5MN4A 3RARA 2F17A 5IXJA 2P3LA 3AU8A 4L8FA 1W5TA 4UATA 5KMGA 4IJQA 1FW6A 2EEPA 4MUKA 3AK4A 3OETA 1UT6A 3QYBA 3PNVA 3BXPA 1Y6ZA 3VZDA 1GPYA 3LLVA 2C20A 1CJTC 1F14A 2P1RA 3SR0A 1WU8A 2X1LA 3P0FA 1OOEA 4ZVKA 4DQUA 4B6JA 1GNRA 2YFYA 3R7WB 3WRYA 4CXMA 1AGNA 3Q41A 3PRHA 4JT2A 4CG3A 2ZBPA 4FLMA 3DZDA 1GTZA 4AZVA 2IC5A 5A4JA 1HGXA 3E9NA 3E22A 3JVUA 4CMKA 3UHJA 1W34A 3UJNA 3K9CA 5E0OA 1O94C 1G21E 1CBUA 5EIHA 1H6BA 3RJZA 3GA7A 2RHRA 1GNQA 1U6KA 5KSWB 3QU7A 4IZOA 3NHYA 1WPRA 4MVJI 5H02A 1E2KA 4XR4A 4PLGA 1JPNA 2G3QA 1KEUA 4U7JA 4D9JA 3EIWA 3KS8A 1W88B 2WT8A 3BAFA 2J8ZA 3WLRA 4WD3A 3Q3HA 4ILKA 2C3PA 2PY6A 5CX1B 1D4ZA 2PU7A 3BIWA 1O95D 2PUAA 1T36B 1BRMA 3HSKA 4KV7A 4JROA 1AHIA 4ITVA 1DE0A 4BS9A 4NX2A 1XDZA 3FD8A 2GEUA 4LJ8A 4J07A 4M37A 2R1VB 3CVXA 1LS6A 4FGKA 4B32A 3ZZ0A 4DRZA 1C3LA 1O89A 5L4NA 1F8UA 2GK7A 5JFGA 4JCOA 1UP4A 1V8ZA 5IJXA 2QF7A 1H4QA 3UYLA 3B53X 4FK8A 4KXWA 4YH1A 1BXZA 4UAVA 4F91B 2ZJ2A 4JLOA 3KU1A 3Q7IA 1DAMA 3K73O 2PFGA 3NYIA 4KWIA 3GN2A 1ENZA 4IX1A 4Z9XA 4YRPA 1FC0A 2W8BA 1O96B 3WNZA 1AKRA 2YXDA 4MROA 4HNQA 2IPNA 3GGSA 4O4IA 3E2MA 2WJIA 3WWYA 3T7TA 2PTGA 3W5JA 3H2ZA 2X7XA 4PSCA 3WB1A 3AZPA 2Z09A 3WYDA 1O77A 1P8JA 1R4NA 2OCYC 2ZUFA 2Q2VA 4FYYA 4K87A 4BWVA 3KPWA 3MHPA 1BXRA 1GU0A 1NVTA 2B83A 5DNEA 5EMJA 2WM8A 5T6MA 2CDNA 4BXOB 4MV5A 3UCXA 2WIKA 1A8UA 4KFRA 5KS2A 1L2DA 5JSUA 2OILA 2HJSA 2A57A 1UEIA 4GYKA 5G1NA 4BASA 3VO1A 1L4KA 2FV8A 3ZV4A 2APLA 2CHGA 4HGPA 2IUFA 2W0MA 2I2WA 4IFEA 5BYKA 3ZW9A 2XSZD 1ZLXA 4N03A 4WV3A 4NZZA 1AGRA 1HFEL 4OHWA 4FYPA 5A0TA 3E1SA 4JWTA 2P75A 1L3IA 4AZFA 4V3CA 4R8MA 3BPSA 4MKXA 3PSAA 3QV1A 2PD6A 5ELXA 2Q3CA 1C0KA 2HEIA 1BRTA 1U94A 4MGKE 2WVJA 2PX3A 4PZ9A 1TGUA 2IBSA 3LLCA 2ECOA 2IUTA 4IO1A 3LP6A 3IQFA 1AV6A 3MIIA 3A6PC 1SUPA 1QF9A 2V7QD 2HMUA 3OU2A 2AWNA 2WF6A 1BHJA 5IU6A 1L1FA 1E3SA 3UOAB 2DWQA 2Q27A 3VTZA 1SY7A 4MS1B 2Y6UA 3ZYCA 1FRZA 3TS1A 1OGIA 1CDZA 4HWSA 4CQJA 1USIA 1D03A 1JU3A 5SY4A 4QRDA 2VEDA 2X19A 1UXOA 3AOEC 4O2AA 4D0LB 5I7HA 2QRHA 1DT5A 2BP7B 3CLSC 1JDVA 2IV7A 2ZWOA 121PA 5IM5A 2Z2ZA 3MRSA 1KBOA 1XNJA 2R5NA 3RREA 3BHMA 3B89A 1TLFA 2CT8A 4HVLA 1KMQA 2VBIA 3RB8A 3Q7SA 1NSYA 2YVQA 5AI0A 1JT9A 1NXXA 3MQ4A 1R8JA 3PFWO 1GGVA 5DYGA 2Q46A 1XZKA 1W35A 3FE2A 3B3AA 3FHLA 2G83A 4U2EA 1P75A 1Y63A 3PENA 4RNCA 4WWHA 1MV8A 1FDUA 2O8CA 3CTMA 1S8NA 1G3UA 2D13A 1SIUA 1FX1A 4FOTA 5LMCA 2DPGA 3O4RA 1XDWA 4UHEA 1KJNA 2QNBA 1HOXA 3G1UA 4ID3A 4RCVA 2XXAA 3IV9A 1KVQA 3H04A 4QYIB 1W1WA 1U0NA 4L3VA 4C7XA 4AJHA 2FWBA 1JEDA 1V11A 3T5TA 3I4YA 1K8XB 3TPFA 4D43A 1QHGA 4NIMA 2YIDA 1PZEA 2J0QA 3EZ9A 2HK7A 5JI3E 5HKAA 3GJZA 4OHVA 4TWIA 1I1HA 4YY3M 2YHSA 1T4CA 2G63A 5TMEA 4NOOB 3OM8A 4MQLA 3TGWA 2HHLA 2ZE8A 5IH7A 4NFLA 4PW0A 3RTDA 4OLAA 1XCPA 2QBYA 3EDYA 3L1IA 3H99A 4BVKA 3O03A 1FFBA 5IUKC 5F3RA 2VT2A 1S8AA 3WTCA 1ITZA 3U81A 4YIHA 2OHFA 1IXRC 3BS4A 3V4LA 4RSRA 1JE0A 3NWLA 1E2EA 3H42B 3SNKA 4OU5A 2QLLA 2BGWA 3SAJA 3OM1A 1RKQA 1PR1A 4B33A 4ECEA 2WU0A 1WIVA 4DNXA 1VSVA 2IHUA 2HOQA 3U0VA 2WM9B 1AZWA 2NSHA 3F49S 5CDHA 1FVOA 1VDDA 3ETDA 2G67A 1GSIA 1UPTA 4TWJA 5TGTA 4DR4B 3VTFA 3OT1A 4WSOA 2W6JA 4ZCIA 3K2IA 4Z2YA 1MB4A 3MT7A 4QL3A 1ZJZA 3UB3A 1M6EX 4TKVB 2PJZA 2WUFA 4JQCA 1PL7A 3E9SA 3ODPA 4DY4A 3HMQA 4QO7A 5BXQC 2C7VA 3PNOA 2ZEJA 3GFFA 1FUYB 3WWEA 3PWTA 1R4MA 3L8YA 4FW8A 2EDCA 5TGDA 2IXGA 4OMFG 5K8VA 3HVIA 4RD2A 4AWBA 4NYJQ 4ANRA 1W4ZA 3HY3A 4OJNA 1KETA 1VKHA 4D4KA 1KE1A 2JLCA 1TQ6A 3TZLA 4E2XA 3U4QB 2VNHA 3C4QA 4KN6A 3EUEA 3PQ7A 4PF1A 3WLSA 1Z8NA 3CF2A 2GEVA 3I04M 1H2EA 1E66A 1RC1A 3VAAA 2Z7JA 1KRHA 4N6OA 4RKYA 3WKDA 4XGIA 1KJIA 2LHGA 2FMUA 2JHAA 3TNDA 2G40A 1TTHA 3MYRA 1SVNA 3GG9A 4YGXB 4YLYA 3ZZ1A 2C98A 5DYIA 4IQ4A 1ZXLA 2Y6VA 1Y7HA 1V5IA 5HKKD 2GASA 1DCKA 1NY5A 4OXRA 3ZDCA 4DNFA 5LZ7A 4X1KA 4XLLA 3ZY5A 3H3FA 5D3MB 3DULA 3U3ZA 4P5PA 4YPOA 2M32A 4GGOA 4LRQA 1IJEA 5DNYB 5FOUA 4NL4H 1N78A 3WTBA 1P29A 3V2IA 1XFAA 3F98A 3T94A 2YXBA 4H31A 2ILTA 3O2SB 4KXMA 4YMHA 3MJSA 4CM8A 3OQBA 4NBWA 5EKTA 4M76B 5JRJA 2OD2A 3M3HA 3I01A 4YT4A 1UL1X 4M9ZA 2HJVA 3N2IA 1JJIA 4ZO7A 4UFNA 1BH2A 2BZGA 3I2GA 1ZH8A 1BWRA 2EJSA 1TVKB 2WFLB 4UM9D 2JCXA 2IOFK 2A78A 2X9QA 2I03A 4DPKA 3PNMA 5AKYA 5U1PA 2V7WA 4F93B 4FR5A 5JC1A 1UWLA 2PEYA 2JY8A 4UCXA 1CDEA 4KH0A 4NBLA 2I7XA 2X7HA 5HF6A 1M76A 3GDOA 3OA2A 2J7KA 2WIJA 3DCIA 2WLTA 3MK31 1AB5A 2AS0A 3P0IA 4ER7A 4YUVA 1D4OA 1YIDA 3S8MA 4A2PA 1GFIA 4CODB 2Y67A 3KT0A 3U5ZA 1RQXA 3DFZA 2ISSD 1MPXA 2W6CX 3I42A 2OQ2A 4M0EA 1IY1A 3TRDA 3OAAD 4ON9A 1CUEA 2BE9A 3LRTA 4H4EA 3G0GA 4KSYA 2QQFA 4H1TA 4MRMA 4D5GA 2JLAA 4JI0B 4BB0A 1D04A 1B16A 1U7DA 4DQVA 5FWDA 1EB9A 1SCKA 2IW3A 2A7XA 1ONNA 2I87A 2OB1A 3CNNA 3O4FA 3DD1A 4JVLA 3TL2A 3E1GA 1WXGA 4FYMA 3ZCVA 1KL7A 2BWEA 3CPJB 4CPDA 1QZZA 5IDWA 1BE6A 2GN4A 4PGMA 4E5NA 5IJ0B 2RHLA 4YN3A 1NX6A 1T0PA 4RA9B 1IUPA 2QXTA 1DOZA 2DSTA 2XWPA 3GJ8A 4DG5A 4NU6A 3M6UA 4GBJA 4MQ5A 1N34M 1GOTA 2QXYA 4C22A 5A0FA 1IRXA 1U8TA 1TU0A 3TTSA 4HZGA 2B1GA 1FX0A 4KIWA 1UJ4A 1BE8A 4BP1A 2BUCA 4D4JA 1KOLA 1Z0ZA 5DP2A 4DDVA 2HYDA 5BOVA 2PXXA 4YDQA 4RVHA 4FCVA 1CX9B 1E0JA 1OTXA 2YX1A 3UXMA 1VB5A 4MLDA 4GF5A 4FWDA 4JODA 4N7MA 3Q8XB 2HZBA 1I6KA 4XX1A 2XAAA 4OOEA 1SZJG 1KKUA 10MHA 3D4OA 1OFVA 3VO2A 1Q16A 1YE3A 4BGDA 1G3IA 2VHVA 2WEKA 2XECA 2GKOA 4RULA 5BQOA 1WL8A 4URWR 3OE1A 1MW8X 1HX7A 3KKMA 1JEQB 2IU4A 3QXJA 2PLNA 3P9QA 4CQNA 4HVCA 2B6NA 3DEHA 2I2BA 5HCIA 1G17A 4B3CA 2ZRPA 4XB1A 4GBED 4BMPB 3UAYA 3RH0A 2OECA 2WZCA 4EZBA 4NZ9A 3RUEA 3TZBA 1KSHA 1ABEA 2E49A 1OC4A 3QSYA 1JS1X 5DO9A 4QTYA 4IRXA 1Z6PA 5FBQB 3RLFA 2OXEA 1XI2A 2ID9A 3FZGA 3GL9A 4AY2A 4ZHQF 3BD9A 3EWIA 4TKMA 1PS9A 4CGYA 2XE7A 3COYA 1Z0SA 4QPDA 5G3YA 1QR2A 1O6FA 5ALNA 2PVCA 2I33A 1TC2A 4RHEA 4P80A 1Q02A 1DEAA 5I9TA 2WTUA 2X5KO 5IP5A 1DQNA 2AFIA 4C05A 4GOND 1K3FA 1ZD8A 1S2GA 4PZ0A 3H8WA 2NXEA 2QX8A 2LCIA 1U9JA 5JASA 4UQLA 2ODBA 1TM5E 4DJ5X 2C9MA 2WF5A 1FXWA 2ZSHA 5LBUA 1RHUA 4WH0A 4IBDA 4PLTA 4EY6A 1DHTA 5L95A 2HWWA 3NVAA 4MVJD 1O5IA 4GZ5A 4A9AA 5B1IA 3BX1A 2IDKA 4RKRA 1KDPA 3WK9A 4JU9A 2DAPA 2RK6A 1PGYA 1E0KA 1VYHA 3NH6A 1A5ZA 2I2AA 3W05A 1H2AS 3P2IA 2HRCA 3QTBA 2PS3A 2P79A 3A6ZA 3B60A 1CZUA 1ZIYA 3NUZA 4D3DA 1YL7A 1RDFA 1SG6A 1Q57A 2VBFA 2PMFA 3ORRA 1MAUA 1MD9A 2ACVA 3HY4A 1QP7A 4YO7A 3I30X 2C7PA 1BXGA 2ZIXB 3AHIA 1GUZA 4KXFB 2QG4A 1ECFA 4HGNA 4O59O 1PJAA 3CTPA 5D87A 3JAWB 4DYHA 3FHTA 1R9MA 3SD7A 1GKLA 2IZ1A 3WL5A 2B21A 4DILA 2FSUA 2GK6A 2EFCB 4YIKA 4EPWA 2R6DA 4CLHA 4TQGA 4MVXA 3M1AA 3O26A 4N3BA 2KW0A 2PYZA 3JXEA 2QVGA 4AZ0B 3WHLA 2W4MA 1HNZB 1MAVA 3MXTA 4I46A 2VAVA 4BNZA 2RDMA 3L29A 2GR9A 1O95A 1DI0A 3PWSA 3HHEA 2IW1A 3D8HA 3QQPA 3QLVC 3I64A 1H6AA 3A1TA 3G0DA 2I3ZA 4DF3A 5G4KB 1LF0A 3TN7A 3A1UA 4GRIA 5CVDA 4EG0A 4A16A 3T1VA 4EHKA 1B0ZA 3ESAA 4HLUC 3UY4A 3PX2A 4BLUA 1NU8A 3G82C 1UOPA 5F7ZA 3SHVA 5H0IA 4V38A 3WLFA 1VPDA 6CHYA 2F64A 3H5IA 2AFIE 2Z2XA 4O6VA 2ET6A 4HDRB 4B6FA 2RGAA 4OXKA 1VE5A 3UEOA 2OZVA 3A6HA 5IKEA 1ZEJA 4A8HA 4LI0A 4IPTA 2VHJA 2RKWA 3EVAA 3M9WA 4QUAA 1PZHA 4O8ZA 2J33A 1M0EA 1NHWC 1ACJA 4CMAA 3MS4A 2LBPA 5TX7A 1JAHA 4FLEA 2XUGA 3AI7A 4D9GA 4U3JB 1H65A 5JROA 1OU0A 3RI3A 3QKWA 3FOEC 2Q3EA 1V35A 2AXQA 2G4CA 4UDXX 5ALOA 3EIOA 3KC2A 1DIOB 2PMWB 1I0ZA 3IEIA 1B2LA 2C4NA 4UTPA 1V1RB 2F8MA 3K9FC 4JY7A 1A2QA 2A2ZA 1O7JA 2IX3A 4NE9A 2C9OA 2P0AA 4LJLA 3CCFA 3I9V1 3Q72A 2WOOA 2O2CA 3IOCA 3P71T 3WO1A 3BSYA 4HVTA 1WKBA 4Q3CA 2Y0BA 1PVOA 1RXVA 2OMEA 2B8EA 2G7ZA 4HDKB 4GKBA 2H92A 2OXIA 3T06B 1F8GA 3BJMA 4WIAA 2YH2A 4TYQA 2XSZA 3PX7A 3NHLA 1CQWA 2QVYX 4M1WA 4PSKA 3WKAA 3R3SA 1NX9A 1M34A 2QI9F 1O54A 1G1AA 3CF6E 3HH8A 4RZ3A 1AG9A 2ZI3A 1CIJA 2A14A 4DWOA 4LGMA 1VRCA 3I01M 3EMKA 4OJTA 2TECE 2AV6A 1YCHA 3K9QO 3P9CA 4WY5A 3CLTC 4R1LA 1L5GB 5E7IA 5CFZA 1D8TA 4H4DA 4L4RA 1VYVA 5F98A 1GPWB 2BMVA 3R2JA 1E59A 2V7QA 3ZLBA 4B7FA 1PG2A 1TAUA 3GK3A 3V1TC 4RGQA 3S2SA 4TL7A 2JZCA 4MSUA 3SDBA 1RSZA 1S01A 2JFBA 1E2QA 2ZI9A 3UHOA 1QQ6A 2IUYA 4BNXA 5CA0A 3IQIX 1WPGA 2W7TA 3M82A 3Q9UA 1T8RA 5GIPE 3I45A 2I4RA 2BEWA 4O33A 4C6TA 4BE9A 4FONA 1ZN8A 5HJEA 2P6MA 3NBMA 1HTWA 4HEOA 2F8LA 6YASA 4LJ9A 1I2BA 1NATA 2BGRA 2J5XA 3LECA 5J2TF 1NJ8A 4PVDA 2V55B 3T1NA 3QOWA 3FYCA 4AJJA 3LT2A 4ARBA 1PQUA 2FFRA 1E2GA 1K6MA 3Q7TA 1CULC 3G2JA 3L05A 3NDPA 4MW5A 1OXVA 3VPAA 3VSCA 4E4TA 3MWEA 5KJCA 2H1SA 5CGZA 5AM5A 1R3DA 4M0PA 3WJ2A 4GQIA 3ZZTA 1XTBA 1T8UA 5J1TB 2EJTA 3KB2A 3FY4A 3IG5A 4TQ9A 1E5QA 1IIBA 3LX8A 4XXHA 1BG6A 3V32A 3VKVA 4HWPA 2GM5A 1Q0RA 1CUVA 2Q3HA 1YOVB 2DCMA 1XD2A 1UC5B 5D5PA 1SB9A 4DV6B 3G2KA 1SK8A 3EZ2A 4QOGA 4GKVA 3EGWA 3AKDA 2E82A 2FLWA 4OXIA 2WPDA 3TLYA 1EGQA 2Y1XA 4C0KA 4B17A 4GZ6A 4D82A 1MH1A 2VYFA 1AT1A 16PKA 1JHXA 1MUUA 4JASB 3LPMA 3DCJA 4AULA 3K0AB 1E9VA 2JHFA 4FNOA 5E1OA 1TTQB 3U7IA 2RGRA 4D3XA 1ENOA 2QOEA 2WWXA 3QMMA 4ZT4A 5HQJA 1EJ6A 3D6VA 3CX3A 3X0DA 4BO8A 1L7DA 2MSNA 1MU0A 3R3ZA 4FILA 3WGVA 4LXYA 1Z4NA 2MR9A 1T0UA 3QV2A 2H00A 3S29A 2ZZMA 1LF5A 2XVXA 3DE6X 4TTAA 1M34E 1YF3A 1P2VA 5CFMA 3DGEC 1WA5A 3LP8A 2YJGA 5EP4A 2G88A 1XROA 4MW7A 2PGOA 4E51A 1GPKA 1Q1ZA 3B9QA 4YDSA 1KJ8A 2E5LM 3KM0A 2JASA 3A1WA 5BVHA 1ULAA 2R0QC 3BBPA 4NJMB 4NU5A 1OWPA 3PR3A 2VH2A 5IW8A 3H1FA 4YPFA 1Z08A 1JKMA 3KTAB 1GRNA 2VHWA 5FI0B 1Q84A 1TM3E 3BRSA 4MRSA 4N7JA 1K7CA 3VPFA 4AP9A 2HAEA 2GEDA 3UT0A 2J0VA 2ZBUA 4YJDA 1I3KA 2IHTA 4R8VA 1UK7A 3RSQA 2GPTA 2BFDB 1JKFA 3KJIA 4DJDC 3E9DA 1P73A 4Z4EA 2H07A 1G3QA 5SZIA 3NYRA 1AKUA 1PFYA 3LE8A 1UP6A 1GFWA 3WC4A 3VR0A 1MC1A 4US0R 2GRUA 1TO1E 2IS2A 4OVZB 1Q7BA 1NW9B 1YOBA 4Z7QB 1OWMA