1NV9A

Hemk, apo structure
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
KIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSALFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords hemK protein
total genus 88
structure length 264
sequence length 270
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv9A02
3FYCA 4BLWA 2JNHA 5LSAA 5HILA 5E1MA 3GIWA 2YR0A 5BW4A 2IBSA 2IDJA 4F86A 4PYQA 1N7JA 2N47A 5P8WA 4A6EA 3LCUA 1X1BA 2PY6A 1JQEA 3H2BA 4FZVA 3EVEA 3HCCA 3KQMA 3EVBA 2O06A 3JWIA 2AOVA 2PVCA 4GQBA 4KRGA 5JUWA 3DMHA 2DULA 4Y30A 3BWCA 3FTFA 4F1IA 3FRHA 3K9PA 4L7VA 4BY9E 2Z6UA 4DMGA 2FCAA 5E1BA 1RI2A 1DL5A 1EJ0A 3CJTA 4PYLA 5DTQA 1VBFA 4XCXA 5E2BA 3ER8A 3F92A 1VIDA 3EVAA 1R00A 1XCLA 4PGHA 1WXXA 3HCBA 1KYZA 2JY5A 1ORHA 3E46A 2AOXA 2ONYA 2YUIA 3A25A 1OQYA 1YZHA 3P97A 5LQRA 5KS2A 3LCVB 1YUBA 3K6RA 4MIKA 3P9KA 5ICFA 3UJ6A 2CP8A 5BW5A 3FPHA 1HJPA 4RV9A 2FYTA 3ME5A 4ER6A 4PYNA 2GH1A 4YUZA 2YX1A 2P41A 5HIMA 1VP9A 4AZTA 2OY0A 4Q7JA 3SXJA 1L3CA 2B2CA 1I1NA 2GPYA 2PX4A 1HMYA 2Y1XA 1F38A 4C05A 3GLHE 2BR5A 1H1DA 3GRRA 2K4MA 3EMBA 4YUXA 3NWEA 3DLCA 4MHTA 5LR6A 3QOXA 4GBED 4Z2YA 2G3QA 1AIPC 3A26A 3CC8A 3EVGA 2JH9A 5K0GA 3HM2A 1YFJA 5K0CA 2VDWA 2ZLBA 3SSOA 1IXKA 5DT2A 1EIZA 3LDFA 3WSTA 3EGIA 2OO3A 3I64A 2DAEA 1HNNA 1NW7A 1SVUA 2RRUA 2DPMA 2EJTA 2PX8A 3BUSA 1RI5A 4E2WA 3GLFE 2GA9A 2NXJA 4Y2HA 5E8JA 3NVKI 3IYLW 5LQJA 1XDZA 1BOOA 2GS9A 3I53A 5GOZA 1YZ3A 4B17A 2PX5A 1VDLA 2HV9A 3L8DA 2V7EA 2JUJA 4R05A 4ZTBA 5K8VA 3CCFA 3E8SA 4QDKA 1DO0A 1V92A 1XXLA 2JHPA 3TOSA 5K03A 1O54A 2PXXA 1WS6A 2AVNA 3LGAA 3EEYA 2HAKA 2ZTCA 3QOWA 2GLUA 4FS8A 4RVFA 1QAQA 3TFWA 5GIPE 5CIYA 4F85A 5F2OA 3UZUA 2GB4A 2BR3A 4YUYA 5FULA 3GRYA 2NXEA 2P7HA 3BGVA 3ELYA 1PGYA 1RJEA 4RVHA 3EVDA 1RI4A 1VQ1A 3P9IA 1F4IA 1NBHA 2FRXA 5ICGA 1IFYA 2IIPA 1ZMWA 3NJRA 4ER5A 4XUEA 5EGSA 1D2GA 1A5TA 1VPTA 3HCEA 3MTEA 2XYVA 2ZWVA 3HEMA 3KPJA 5FADA 4FSXA 4IWNA 4YV0A 4RTRA 1VEKA 1WG8A 1SQFA 3B3JA 1G4AE 5JR3A 3UFBA 8MHTA 1MJFA 3S68A 4AUKA 4DCMA 2C7PA 4HSGA 1JG2A 3OE4A 5EZQA 4DF3A 3UBTA 3KQTA 4RWZA 5MHTA 2Z6QA 3HA3A 3IHPA 5K0BA 2LTUA 5GP1A 3THRA 5G02A 3VC2A 1T6OA 1WHCA 2PXCA 1X19A 2QNJA 4NECA 1KYWA 4OA5A 5HZMA 2YVLA 3SX0A 2BM8A 4GF5A 4MQ4A 5EPEA 3KQVA 4FR0A 4GOND 4R6WA 3ELDA 2YXLA 4E31A 3NTVA 4MTLA 4RTJA 3C3YA 2PV0A 5F2NA 5K0EA 2ZZMA 3SSMA 3TLJA 2AZTA 2O0LA 5CVDA 4P7JA 3ER9A 3HA7A 4WP2A 4RTLA 3FRIA 5KVAA 3UJ7A 2PT6A 2HWKA 3G8BA 3A7DA 3KQOA 3IECA 2ZVJA 5GM1A 4BLUA 3G7UA 2PJDA 1EQAA 4RYLA 1Q02A 2JHCA 1R4GA 3KQYA 4AZVA 2R0IA 2B9EA 1G55A 5ICCA 2ZSUA 3HTXA 1NBIA 5EMLA 3ID6C 2A14A 3TKYA 2ZCJA 4EKIA 4DQ0A 1L3BA 3MQ2A 1L1EA 4M37A 3F4KA 2YQZA 5BP7A 1BKYA 4QVKA 4PIMA 2IGTA 3GWZA 3JWHA 3BGDA 5E9QA 2JH8A 5CCBA 3B7PA 3KQPA 1X1AA 2WZJA 4GC5A 2B25A 4PCLA 3DMGA 5DM4A 5E8RA 2OXTA 3V97A 5F2KA 4E32A 2LVPC 4HTFA 1B42A 4RTOA 3P2KA 4EQZA 3LECA 2FHPA 4PYMA 3UA4A 3FTDA 2QYOA 4HGZA 4IV0A 4AX8A 5B1SA 1TR8A 4G56A 1HQYE 2ZIGA 3GRVA 4HEOA 2XYRA 1AF7A 4GOOD 2ZZKA 1VL5A 2OZVA 5FTWA 1JSZA 3HVIA 4FP9A 3GXOA 4U7TB 1C7YA 5HIJA 4YUVA 3TPZA 4AZWA 3OU2A 2B78A 2WA1A 4CKEA 4PNEA 2AR0A 5DX1A 1L9KA 2HNKA 3ANXA 2ZTHA 4KVZA 3C3PA 1QAMA 4P7KA 4C06A 4OX9Y 1JR3E 3FUUA 4YMGA 5LQAA 1DO2A 1R8YA 1KXZA 2IFTA 4PONA 5EMKA 1AQJA 3CBGA 4YMHA 1WGNA 2XVMA 3FZGA 4X63A 4R8SA 4RTPA 2P3OA 2EJUA 2DNAA 4P58A 2QY6A 3M6WA 2L4FA 2PKWA 5DX0A 3SMQA 2NXNA 3BBZA 3BGIA 1QAOA 3UJ8A 2QHOB 1BC5A 4OQDA 3KR1A 4ER0A 5KQRA 3EEOA 5DRYA 4QTUB 3FYDA 3KU1A 4QQKA 2JJQA 3FE3A 2ZIEA 5FHRA 3VYWA 2I9KA 2BH2A 2ZW9A 1XJ5A 3OPNA 2QM3A 3TMAA 4RSRA 2BWEA 3M4XA 5FCDA 3O4FA 3P8ZA 4GEKA 5CM2Z 3HVKA 2H1RA 4R71A 2I62A 1NV8A 5E1OA 1WZNA 4ER3A 1R74A 4KDRA 5D1NA 1JTFA 4E2XA 3DXXA 1DCTA 1D2HA 3EPPA 3PX3A 3MMPA 1G8SA 5LQCA 5GWXA 5KQSA 2P8JA 5CCXA 1ZHFA 5FA5A 1INLA 3A4TA 4KIGA 1NE2A 5T6BA 3DLIA 3LDUA 3UJ9A 3CJRA 5GIOE 1P91A 4X60A 2K9DA 3GNLA 2B3TA 3KR9A 3K0BA 1XB2B 2JZ0A 1GO5A 3CVOA 3GRUA 3TR6A 2UYHA 3T7TA 1RI1A 3EMDA 5E2AA 4GEWA 3PB3A 2G71A 2QE6A 2PLWA 3GO4A 2LD4A 3LKDA 3ERCA 3Q87B 2OYRA 4PGGA 2NYUA 3BZBA 4R8RA 5GM2A 1TPYA 3VC1A 3R24A 3SSNA 5FA8A 4RVDA 3V8VA 10MHA 3LKZA 1AQIA 3QV2A 1Y8CA 2NXCA 2LVQD 1FPQA 2OB1A 5EMJA 3FTEA 4GOLD 1YLAA 4F2LA 3BWYA 1NV9A 3AWIA 3G5LA 1KPIA 1HT1E 3DULA 2EX4A 1VP3A 3OU6A 2H11A 2DENA 2OKCA 3G2MA 3JWGA 1OR8A 3OZTA 5DM2A 5EHIA 5JI2E 2WA2A 4YV1A 3HA5A 5FWDA 2Z6AA 3T0IA 1TTEA 2VDVE 4P7GA 2ORED 2CMHA 4RX1A 5LQUA 3U81A 2QSFX 3SVZA 1FBNA 3EVCA 3GJYA 3P9CA 2KHHA 3TM4A 3UJCA 4F84A 3OE5A 4RTMA 2C7OA 3E23A 1RJFA 2JY8A 1N2XA 1P1BA 3AJDA 3BKXA 4XUDA 5K0LA 1HT2E 2VDUE 3OCJA 2AVDA 1D2CA 3E7PA 4LWPA 5EIWA 5EC8A 4UOEA 2UYCA 1YF3A 5H02A 1IM8A 3TM5A 1XCJA 5DXAA 3KR0A 2JY6B 3MERA 3C6MA 2PT9A 2EKKA 1Q0SA 3KKZA 4EMSA 2UZ4A 2IPXA 2WK1A 1BVSA 3ELUA 3LBFA 1NW5A 3G2OA 3TKAA 3UJAA 3IHTA 1NW6A 5CVUA 4CXMA 1SKMA 3PT9A 2IBTA 4M38A 3P9NA 1NW8A 1WIVA 2VS1A 1P1CA 5C0OE 3DP7A 5T64A 1OAIA 3PFHA 2DKLA 5E9WA 1KP9A 2QRVB 5HFJA 1RJGA 1M0EA 2G70A 1TW3A 4LECA 7MHTA 4CKBA 2EJSA 3RIEA 1NKVA 5D1HA 2DAMA 2FK7A 1QZZA 2L4EA 3P71T 2OOBA 1VEJA 4HG2A 4PIPA 2ESRA 1M6YA 4RTNA 2OBFA 1E94E 3SR4A 3UA3A 1TW2A 2MGWA 3MCZA 4OA8A 1G8AA 4X41A 3HCDA 4CTKA 4EK9A 2ONZA 2OOAA 3MTIA 4HC4A 3HCFA 4KW7A 5C1IA 4BP1A 2MJ5B 2PSSA 3DTNA 1NW3A 4PYIA 5DX8A 5FHQA 4CKCA 3M6XA 3PS9A 2AS0A 4FT2A 5FUBA 4RTKA 2ZULA 4AZSA 1WJ7A 1QZEA 1KPGA 1CUKA 1VLMA 4GOMD 4ER7A 4QDJA 3A7EA 2MR9A 3LX6A 5EQJB 3TQSA 5DLYA 5BXYA 2AOUA 2JY7A 3LHDA 2XVAA 2CMGA 5CVVA 3G2PA 3GGDA 4PCAA 1QYRA 1XVAA 3CJQA 2QRVA 1DV0A 1UFKA 2H00A 3CKKA 3ELWA 2DAIA 2OB2A 2FPOA 2P3LA 3P2IA 2G72A 2PGXA 3PX2A 1VE3A 5DPMA 5IKMA 4JXJA 2IH4A 2O57A 3E05A 3KPWA 4DZRA 3FPFA 5CD1A 1Q0TA 2P40A 4XUCA 3DOUA 1YB2A 4RVGA 3PVCA 4RTSA 3G88A 3FUWA 3DUWA 4BLVA 2OPBA 3DMFA 1XDSA 3MCTA 1WXWA 2PX2A 3D2LA 3GDHA 2AOTA 2P35A 4H0NA 3G2QA 3C0KA 3NDJA 2XBMA 4R6XA 2ZIFA 1I4WA 1G60A 2CWBA 2YTZA 4X1OA 3UWPA 2C7RA 1X1DA 4V0RA 4E70A 4FGZA 1JTEA 3EVFA 3FTCA 2UYQA 4OBXA 4C03A 4E30A 3GU3A 1UWVA 1ZG3A 1YFLA 2F8LA 4V0QA 4POOA 3G89A 3DXYA 1P39A 3BKWA 1F3LA 1EJ6A 2ZBPA 4HRAA 2O05A 3FUTA 3BT7A 3JWJA 2Y1WA 4BP3A 3FPEA 5LQKA 2IH5A 2PBFA 5HIKA 4E33A 4PYJA 1NT2A 5K09A 5DFLA 2C7QA 2GAFA 1FP1D 3GLIE 3AY0A 3VSEA 4DM3A 2NP6A 1O9GA 2DZLA 1KHHA 3OFKA 5EOVA 2KNVA 3LDGA 1RJDA 5EMMA 4WVLA 1UFZA 3NVMB 3B3GA 2AOWA 3BWBA 3RW9A 3R9XB 1ZKDA 4DKJA 3G5TA 2AN4A 3B3FA 4PYKA 3UJDA 3I9FA 2LVNC 2JHAA 3MB5A 5C9ZA 1JQ3A 2KW5A 4QPNA 3O7WA 2O25A 3Q7EA 2NNWB 3EGVA 3I58A 3NMUF 5DTRA 5EKXA 3DH0A 1Z3CA 3R3HA 4KWCA 4CTJA 3NDIA 1XTPA 5DM1A 4CWAA 1XXHE 3P2EA 5DRTA 5M5BA 4FSDA 5GINE 2ZWAA 2BR4A 3KQWA 5DXJA 1AV6A 4WXHA 3T6PA 5K0NA 3GCZA 3DXZA 3LSTA 5K0JA 5EVJA 1Y8GA 1R8XA 1SUSA 2ZTDA 3BWMA 3ORHA 4QPPA 5EKUA 1FJXA 4RTQA 1ZQ9A 5K0FA 2DI0A 1IXSA 5CVJA 2EG5A 3G8AA 1SUIA 3IV6A 2HR1A 2G8NA 1KIAA 1ORIA 3GLGE 3AXSA 3HVJA 3M6UA 3KPVA 4LWOA 4K6MA 3BXOA 5EZSA 5FWAA 2LBCA 4E2ZA 1OKSA 2E5WA 5FQNA 1I9GA 5EIFA 2FK8A 4IV8A 4GC9A 4C04A 4EKGA 3OFJA 1KR5A 5ERGB 5ICEA 5U4XA 3PLAE 3A27A 1U2ZA 2XYQA 1SG9A 5EG5A 3EGEA 1L3IA 2PWPA 2JP7A 1JQDA 4P7FA 2BWBA 5E9JA 1XDUA 3T7RA 5DM0A 5KYGA 1G38A 1R6AA 2O07A 3OU7A 1MN3A 4OBWA 4PYOA 5CVEA 3THSA 4C08A 2R6ZA 2HMYB 2JZ1A 2YXEA 2ZFUA 3HVHA 4LG1A 5LQNA 1WGLA 3PFGA 5DTMA 1DUSA 4M7RA 5FQOA 3KPYA 5DWQA 5K05A 3M33A 2CKDA 1ZV1A 2ERCA 2AOUB 2L2DA 4UN2B 1FP2A 2KNAA 2PXAA 3NW9A 3E21A 3LPMA 4ISCA 4KDCA 5DSTA 3HNRA 4ATNA 1BHJA 1ZGAA 2EFJA 3SGLA 4FT4A 1JR4A 4IKPA 4X61A 1M6EX 5HEKA 3R6TA 3SM3A 1MHTA 1G6Q1 3OZRA 4DA4A 2K0BX 5HOQA 2HTEA 1VEGA 4G3OA 1KYIA 3HP7A 1JG3A 1G41A 3B5IA 3IEIA 5CUQA 2AN3A 3KHKA 3I5UA 3LBYA 1EAMA 3O31A 2P3QA 4E2YA 4KIFA 2LVOC 2ZBQA 3T7SA 1ZGJA 3FPGA 5T67A 3RODA 4M36A 3KQSA 4C4AA 3LL7A 3K9OA 4YV2A 2JG3A 1WY7A 2PWYA 4A6DA 3KQQA 3X0DA 3B89A 2V74B 5DSXA 5HIIA 4DBGB 4DCGA 1ZMUA 3FUVA 1JSXA 2VZ9A 2CWWA 1G3IA 5K01A 3EVZA 2VP3A 1WR1B 3FUXA 2ZBRA 3R0QA 4HTFB 3OZSA 1OTRA 4C07A 2P7IA 5EHGA 3PTAA 3GRZA 2H5XA 4QVGA 2ZZNA 1SQGA 2BZGA 4HGYA 1P3QQ 1KPHA 2CL5A 2P1DA 3FPJA 4EVIA 3LCCA 4QTTB 4YUWA 2G1PA 1RI3A 3M6VA 4OQEA 1PJZA 3MHTA 3REOA 3DR5A 2OO9A 3NWBA 3UJBA 1UIRA 1X1CA 2I7CA 3MGGA 3MAGA 2HWJA 1R18A 4PINA 3M70A 1EFUB 2R3SA 2BM9A 2IDKA 3C6KA 4PWYA 2YXDA 4MWZA 2IP2A 3TRKA 2I6GA 3CGGA 5EEHA 3HCAA 4U7PB 5E1DA 3H4JA 2MROB 3AXTA 2ADMA 1O9HA 1JG4A 3KPUA 1PRYA 1EG2A 1IM2A 1N7IA 1VG5A 2DHYA 1QANA 2LVAA 2KNZA 4GUAA 2NP7A 4QQNA 2DAKA 1IY9A 2UYOA 1V39A 2AN5A 2DAGA 2Q41A 4HH4A 4O29A 2IH2A 3KR2A 2EKFA 5EEGA 9MHTA 1ZMVA 1T43A 1JG1A 2AOTB 5IH3A
chains in the Genus database with same CATH superfamily
1PF7E 1SK9A 3JQFA 2G36A 4X3PA 5E1MA 4OK3A 3VZRA 2OYSA 5BW4A 3UMMA 2AMFA 1XCMA 4HWGA 4IQ8A 4IGIA 4KWEA 1LW7A 3TZKA 1MAUA 5IAGA 4A6XA 1CF2O 4DW8A 4WBXC 3HCCA 3PFWO 1N1MA 1YRWA 2HQRA 2WW8A 2AOVA 3D1LA 4RPLA 4C0LA 4XWWA 3AI3A 4WLNA 2XD4A 4L8WB 3OF2A 3V8RA 4BNVA 3L7MA 3BWCA 2DLNA 5JCOC 1EZZA 3DT9A 5E7MA 4W5NA 1U04A 5H68A 4OLFA 4AS1A 1ZICA 4FEEA 1N2GA 4CISA 3EAFA 1VIDA 1FZQA 3EYWA 2VPZA 1AB6A 4BLRA 2C0PA 5K6RA 4X8OA 4QFDA 4PGHA 1J8QA 1ZUNA 4P8RA 4CUKA 1W4RA 5EESA 4ABYA 4BP9A 3F7NA 2I67A 1OQYA 1V4VA 3NBZC 5DASA 2GFQA 3VKGA 4AW9A 3A9WA 5I48A 4JYZA 5DCUA 4OI0A 4CMCA 3LUGA 3PNBA 1DEOA 3GZJA 2AKEA 3CEAA 3AVXA 4P22A 5B3AA 3PUZA 3WISA 3ZEAA 1KO1A 1L3CA 3EXFA 1UDCA 2UZ3A 3ZBPA 5ELLA 2B8TA 4Q9JA 2D5LA 3QPBA 4DV5B 4JNCA 5MN4A 1E1RA 4DILA 3NWEA 5KPJA 4O0LA 4JC4A 3QOXA 1BCSA 4PX2A 4BJHB 4K87A 3AHHA 3ZDDA 1VJTA 4YRLA 1FJGB 4RACA 4TTPA 1P60A 1QKIA 3NYWA 1B00A 1RPNA 1UBCA 3R0IA 1QB7A 5EXXA 1GCIA 1Z4QA 1E5VA 2Y1LA 2CDRA 3EFOA 3IOMA 3HXKA 3LDFA 3UYLA 4OHZA 1YI8A 1NW7A 3FF1A 3OO0A 5K1ZA 5EIEA 4LHEA 1CEQA 3ZY4A 5JNVA 5AWFC 5ULLA 1SUEA 3GY0A 2QQ0A 3EQ8A 1JLMA 2IC5A 4FYPA 1IJBA 1A9PA 4LFAM 4Y6QA 1PG0A 1LF0A 1RLUA 3NYRA 1E2QA 3O03A 4R05A 1C3OB 1E3EA 1GEGA 4J1NA 4QDUA 4WLUA 1ZSVA 4LC0A 1U0TA 2YKGA 1OGYA 4HAIA 5AKYA 1VA5A 5WRFA 3EEYA 3HK2A 2GLUA 1T2AA 4MI9A 3M34A 4HLQB 2JBAA 3A36A 4MS3B 4C0AC 4D7AA 3LP8A 3G2NA 4LF8B 1E0AA 1WABA 4YUYA 2D0OB 3UKOA 1KMCA 2XB2A 4K05A 1XK7A 1T4MA 3MINB 4MQEB 4BQIA 1UFOA 1JLLB 3MS7A 1PJTA 5AJVB 4W9RA 5I7OA 2JI4A 1R0WA 3O91A 4FB4A 1KI3A 3SZGA 3U49A 2FPIA 3KZOA 3V4ZA 2BFMA 5EGSA 3W06A 2X22A 5C7IO 1ORVA 3RJ5A 1NQOA 2WLTA 1HFEL 3JQBA 4FFPA 5DHPA 1J42A 5AVXA 2BKLA 2ZTUA 1QH8B 5GONF 1DIBA 1ST3A 1TJ3A 4HXFB 2EARA 5LM3A 2GVZC 1YZTA 3PDIB 2ZBDA 2C9DA 2HBQA 2C57A 2RI0A 1KSFX 1Z5CA 2JIOA 5EZQA 3V1TC 3M6AA 3IIMA 4LHXA 1WDWB 1WCIB 1N2EA 5CLGA 3VVLA 1RRKA 1VPDA 2XW6A 3T5BA 4GRIA 1X9IA 2W4MA 5TMDA 2FRDA 2E21A 3S1SA 4OM8A 4IZHA 3QZUA 5L9AA 5BSFA 3IOYA 2J0EA 2HFJA 3V32A 1S4MA 2EJCA 3N2KA 2AJ8A 4TWJA 1R9JA 2Z3ZA 2DX7A 2ZB3A 4R41A 4AF8A 4EYQA 2W6OA 1C41A 3OWOA 4DA7A 2HYIC 1KJ8A 1Y81A 2PBLA 5BSWA 2HK9A 3LD9A 3KQYA 3WL3A 2B9EA 2IEIA 3EZ7A 4Q3OA 1HDCA 1QCYA 1EE1A 3ROMA 1ML3A 1SH7A 2L18A 5A2QS 4KR0A 5BW8A 5KTRA 1JBEA 1GCAA 5DO9A 3IOEA 3HO1A 4AQ7A 4BFZA 1V6AA 2O2SA 1W87A 1JFRA 2CVZA 4NL4H 3A1NA 3AJ9A 1H22A 5E8RA 5H16A 3VZQA 3EC1A 2E1RA 2WWHA 3LU1A 5JSZB 1ZH8A 4OH1A 1M33A 1VB5A 2Z6VA 1XHEA 3EYAA 4QXRA 2XQGA 2QX7A 3LQQA 5EKSA 4YAIA 1T9GS 3VMFA 4JB3A 3KQUA 2CF5A 3OPVA 4G56A 2F5SA 1PJ2A 1YVEI 4GOOD 2ZJ3A 3QVLA 2Y9PB 3GRFA 3HXLA 4OHBA 1P9RA 2GCOA 5A7GA 4A0HA 3KOXE 3MELA 4OHYA 2LKDA 4PNEA 2ZU6A 3A3NA 5D3QA 4TV8F 1ZMOA 4OOEA 1XAGA 4M4SA 3LLSA 3NHUA 4LXHA 4LQ4A 2WTXA 3D9QX 2J6IA 1FXWF 2FR8A 1R8YA 2XDYA 1U31A 2I2CA 4OX9M 2IIQA 5DMXA 1QGZA 2W58A 2EJUA 5AXCA 3ICEA 4QPJC 4GG1A 1F8XA 4XDYA 3BH0A 5TNXA 1I6MA 1OX4A 3B9PA 2VL7A 4BC1A 2K6GA 4URWR 4WOKA 3ZCPA 4CM8B 2QHOB 2ES4A 2YH2A 1PNVA 4PSUA 1LDEA 1R6XA 4LIPD 4R8MA 3KL2A 3OVMA 4ZJZA 3CUKA 1JBKA 1RWBA 1SB8A 3PI6A 3FE3A 2PZEA 4MIEA 5CX1B 5DNAA 4AM8A 1N78A 1GTRA 4DTCA 1XJ5A 2BV3A 3QI2A 3QPWA 2AB0A 4TRNA 5IP5A 4G0MA 3TW8B 2QIOA 3DFMA 1ZHHA 3UTCA 4F3NA 4G6ZA 2FZEA 1QZTA 1YB6A 3BGWA 3E9QA 2C7VA 2YY6A 3OLQA 3L7OA 4JBYA 1Q22A 2ECKA 2P27A 3SDSA 4JMLA 3SZOA 3DYVA 2B8WA 4ZYYA 3MMPA 1VCHA 1GPYA 5CA1A 1UOQA 3C4JA 3C1OA 2ZT5A 2LTAA 5F2EA 3P4XA 4PTLA 1A5SB 1AKTA 1PZHA 3WQRA 2XSZD 2R6HA 4Y2VA 4TTIA 1U0HC 2OGZA 1Q7EA 4YY3B 1DKOA 4BNHA 3K0BA 2VBFA 1MRSA 2Q3CA 2XQFA 1FTGA 1JFSA 2VYVD 3FUCA 4GEWA 1DCMA 4LE2A 3KT8A 5F35A 4BVAA 5IVPA 5JD6A 4JXZA 3Q87B 2OYRA 3BZBA 2Q3LA 1OY1A 5K7SA 3ANNA 4DA0A 2VFAA 5FA8A 4Q3EA 2HPVA 4WNCA 2RBEA 4YMIA 4QJBA 1W76A 3QV2A 2E6KA 3FYUB 3LY8A 2JI7A 3SBJA 5H0IA 1WWKA 3CYFA 4L4YA 4A7PA 4LZOA 4ZOLB 1PS0A 1S2NA 3ZWMA 2DENA 6GPBA 2XKAA 3WOHA 2AK3A 4AWBA 1NA5A 3FCUB 4RUKA 5ECWA 3UV7A 2Z1NA 1E60A 3K09C 3H8JA 4R2XA 4KGZA 2QTTA 1C81A 3CE6A 1RWWA 4WEQA 3WWZA 1HV8A 5B1YA 4DB2A 2QSFX 2FRDC 4XRRA 3HJUA 1LY1A 3AFOA 1V96A 5ALGA 1VL0A 2JFOA 2WRZA 2L2QA 2ODBA 2QVZX 2HGSA 2XB4A 1JH9A 1ND5A 2X19A 4XDZA 5CB4B 4TYWA 4HTAA 3CO0S 3HY5A 3OZ7A 1YF3A 3VA7A 2J7OA 3JD4A 2E4VA 4RA9A 4L85A 4BZPA 4NATA 3KR0A 2J3LA 2EKKA 4ZJYA 1WVMA 3DF9A 1C2YA 2DWOA 2PANA 4GYWA 2GJ9A 1TGUA 4Y9SA 2WSIA 4OAQA 3MM4A 1SKMA 2GUGA 3VDQA 1VECA 3F6EX 3L43A 4QUGA 4UXHA 2XUAA 3R7DA 1KNQA 1AUQA 1WIVA 5KPRA 1SELA 2Z5GA 3A9UA 3VDNB 4FXPA 3HDQA 2V7QD 2X4LA 3NBUA 1M0EA 1FMTA 4V2UA 1QRUA 4U7WA 4R1UA 4YP5A 1HDOA 1XNQM 2DFKB 3L4BA 3PDUA 4DJEC 3UPUA 4KFRA 3WHIA 4I6EA 4YMVA 2UXBM 1YKGA 4PX9A 5H9VA 3UA3A 1MB0A 3FHLA 4URFA 5BWLA 5FJJA 4LHZA 3WLMA 1EGAA 1MORA 2F6RA 1Q2XA 2R751 1SXJD 3JZAA 4BQRA 1DRJA 5AKXA 4ZAVA 1GILA 4I6GA 5FHQA 1CJUC 4PYIA 4H77A 4UARA 2YZ2A 4C78A 2CN1A 1OBHA 5B36A 1TDZA 4X8MA 3M5PA 4KWHA 2AW5A 3DNFA 4DGSA 4AZSA 1DQSA 2IZOA 1G21B 1U4NA 3GEHA 2WG2A 4HMPA 3GFOA 1N36B 5DLYA 5JTUA 1DGHA 3TDKA 3VKHA 4O8ZA 5BOSA 2X4AA 2OM2A 1PNRA 1THTA 1E32A 4GMQA 1U8AA 3UAVA 4YTEA 5EE1A 1EUDB 5AUPB 3MJ5A 1Q0LA 3I1FA 5FTJA 8ADHA 2WQ6A 1UKCA 2F3UA 2Z8XA 4QJ5A 3U6BA 4ROTA 4GSLA 2RH8A 3NAZA 2HMTA 1T5HX 4J1TA 4MVJM 3T06B 1EA7A 2CF6A 3VZPA 1UWCA 1G0NA 1QV7A 2NQ2C 1Z12A 3KOYA 2DCMA 4ND2A 1TL7C 1XTQA 1XTSA 2DKNA 2ZQ5A 4GECA 4WJKB 4NENB 3UWKA 4AYWA 2L0XA 2MSEB 1PR5A 2I4OA 5IDWA 1SKBA 2OP0A 1W75A 1XDSA 1M5TA 1T8PA 5TQ2B 3MWDB 4TVKA 1QTIA 3A6JA 1ILEA 3BTVA 1W7AA 4RQUA 3A1VA 4ZDIA 3AINA 4CKYA 4W5HA 3AR2A 3UCFA 1T4CB 3DDZX 3HYCA 4Q9AA 1J22A 3H1FA 4DFDA 1HZZA 4Y9RA 4E70A 3FTCA 5A3VA 4IUCS 2NQ8C 1CQXA 5C5IA 5CHEA 3QELA 1YWGO 1NM5A 2BL4A 2XF2A 1LI7A 3HO6A 2QQ5A 3A1FA 3QFSA 5CNJA 2O05A 2XZUA 2NUPA 2H65A 3EG5A 5G4KB 3VZBA 5LQKA 3NRJA 4XPZA 1E9FA 4ECEA 5HIKA 4OJQA 4MCHA 3R5JA 4P5DA 4CCSA 3HUTA 3AETA 4LJ5A 4H6WA 3CINA 3AUSA 1FP1D 2WSFF 5BQ3A 4MYTA 2GWHA 2H7CA 2JFBA 5KHAA 5JS2A 3NXKA 1Z5UA 2VC2B 2VH5R 5B1EA 5CA0B 2O5VA 2KNVA 3CT4A 3DAYA 3M6LA 4LWQA 1UXOA 1TH3A 5IUJC 5J2TA 2AOWA 1W2HA 1RLJA 2Q6TA 4DSOA 4Q7KA 4INPA 4DKJA 1FTNA 4PYKA 2ZJBA 4XD2A 4I55F 1WZUA 4OREX 4F5ZA 3OT1A 2HXYA 2KW5A 2VHWA 4MS1B 4BCBA 3CF6R 1K98A 4LSMA 4HEJA 4LCJA 2XA2A 1IBSA 1W4AA 3SBDA 3DE3X 4CTJA 4DCTA 1Y6QA 5DRTA 5LMNM 1OILA 1Z36A 3HBFA 4B83A 2ZWAA 3TBFA 4FGLA 3BWDD 3CF2A 3DLPX 4MVYA 3VVMA 1WL8A 1FTSA 2SICE 1QJCA 2GPJA 4C87A 4E08A 4DE5A 2OCIA 3I6QA 3WB2A 1P4JA 4FDLA 3AL3A 5BQPA 1AGNA 1SUIA 3PICA 4AMYA 1DC3A 3A0RB 3PK0A 4DZZA 1QSGA 2JLQA 4GMGA 2FK8A 4GMKA 1NASA 4IV8A 2XNCA 1BU5A 2R00A 4G86A 3SFVA 5ERGB 2VHZA 3TTUA 2Z8YA 1C0EA 5I47A 2ZTVA 1DG1G 1R4NB 4EMTA 4E88A 1XV5A 3LVBA 2QTHA 3L7NA 4JHLA 2C3MA 4MB2A 2RHGB 2J30A 5DK6A 3T7RA 5DM0A 3A2NA 3SMPA 1L5MA 2DG2A 4Q7MB 2FGKA 3I9KA 3WLPA 4Q4CA 1UC4B 4ZI7A 1IN7A 1JXMA 2XKJE 3AW9A 4GOXA 4L6AA 3SFTA 3BIWA 3ZWXA 5IEJA 3HVHA 2ZI7A 4ZHQB 4RHFA 1WGLA 3AUFA 2A5DA 1D5CA 4JCOA 1NTRA 3DPSA 1Z7EA 2CJFA 5DWQA 5IBPA 5BVHB 5AP9A 2ERCA 1PQPA 1D7AA 2I33A 1MTOA 1GHTA 3KKOA 1GZHB 4X61A 3S1AA 2HHJA 1UJBA 3T9EA 3TBKA 5M3BA 5A5VA 1V33A 3U80A 3C87A 3AESB 4G1CA 5HFAA 1VEGA 4YRAA 1K27A 2IPMA 4Z0PA 3RBVA 3PENA 4LMBA 4MROA 1P2GA 4C4TA 2LVOC 4DRZA 2X76A 4NC9A 4P17A 1T3LA 1CQPA 1N25A 1YZNA 3LL7A 1KFKB 1B6RA 2YZMA 3RPEA 4C5AA 4I8XA 4DCGA 1XEXA 1AOXA 1K92A 3FUVA 1X15A 2XMPA 3EUEA 3IMKA 4J07A 1G3IA 1JKJA 1CQJA 3MWYW 3DEKA 4GQIA 4JLOA 4UCFA 3R0QA 3KV3O 1OTRA 3GA0A 3OLWA 4MVJF 5J4VA 4JXXA 2QHXA 1JHDA 1C0IA 2O5EA 3L6OO 1P3QQ 3K1ZA 5FO1A 1IY0A 2P1DA 2R18A 1Z22A 3HBMA 3F73A 4FOTA 1C9JA 1EVLA 1XVTA 1Y1SA 5EUQB 4QVIA 2WF7A 4D5GA 4LQLA 1GPLA 1UIRA 2BFCA 1LXCA 1QRSA 2XODA 1I1HA 4QM6A 1UWKA 1FXWA 5BV1A 1UDXA 2FJ0A 1DQRA 2NO6A 4G9EA 4RHTA 2E82A 4G4RA 2ZB2A 3ZQ6A 2IP2A 3ZDQA 3R75A 4BECA 3TOVA 5JASA 4IHAA 4HVTA 2FUG6 1CKEA 2WJVA 2PGDA 2WVGA 4KIWA 4BQOA 3ZVRA 1SOMA 1C0LA 4IXWA 1QPZA 4J0FA 3AV3A 1P18A 5FD8A 4EW3A 4WZAE 3T3DA 3I34X 3AUKA 2IVZA 3AVTA 1SXJE 2YOHA 2VRBA 4MUXA 4CMIB 4H1WA 2FU5C 2QK4A 5AI4A 1B15A 4PTZA 3PNVA 3A6LA 1YGYA 1US8B 3DB2A 1ZH4A 1JQEA 2F2TA 5D51S 4J2HA 3ZGZA 4X1IB 3U17A 1UC9A 3H2IA 3JWIA 1S2MA 5I7FA 2H2AA 4NYMQ 3ADPA 4GQBA 2Q7OE 2CLOB 3P2MA 2FSPA 1MG5A 1KRHA 4B87A 5DM60 1F1JA 1W85B 4BEWA 1CB7A 3ZR4B 3QQPA 3OKCA 4JOBA 2HSDA 1L4HA 5I7HA 4Z1MD 3IL2A 4ARIA 5E1BA 4QLAA 1VBFA 4NFYA 3EF1A 1LBHA 1BE1A 1N9GA 4XARA 1EDDA 1SVKA 1ZESA 4JJZA 5B7GA 3AVUA 5SV2A 2V6ZM 1QTNA 1TI7A 1ZN9A 3DNPA 3GJQA 5M29A 2QX4A 3QE2A 1E0JA 4DJ5X 2R9VA 3TBHA 5ITWA 5IULC 4H3KB 1H0RA 5ALJA 4BLOA 5KS2A 3O2JA 1NVGA 4AIRA 5BQ5A 3U6DA 4DTIA 1J0EA 2FYTA 2VF4X 1Q1ZA 2YYYA 4BZZA 2GH1A 5SZKB 2ZAIA 1Y34E 2Z98A 5LIPA 1BW9A 1VG9B 1VJGA 1A1SA 1KI9A 4GL4A 2H2IA 2BDTA 4DIMA 2X8WA 2GPYA 3ET5A 5A4IS 4HSEA 1BHSA 2OZPA 2ZAMA 2P0EA 2ZM5A 3GQVA 2EP7A 2ZKLA 4NBUA 4DMUB 1N8KA 4K6HA 1XNRM 3W1EA 5CDHA 3AUUA 5IWCA 4K88A 2ZI3A 2J59A 3HM2A 3RS4A 4UEQA 3DV0B 2H0RA 1QIKA 1UMCA 3NX4A 3VPFA 1HYGA 2DAEA 2IYTA 2G25A 5K3BA 2JGDB 4HD8A 3GLFE 4DLPA 1KXJA 2OFPA 1XDZA 4PC2A 1PD1A 5GOZA 5A5DA 9ATCA 3PQ3A 4YMSA 3FTQA 3RJTA 2DT5A 3DF7A 2RH9B 4YC7A 3AF4A 2QR2A 3U48A 4OK5A 1NVMB 1QCCA 2R66A 4X54A 1MEEA 1SFRA 1WS6A 2HAEA 3CY6A 4UQLA 1N2CE 3COJA 1QAQA 2GK7A 3BCHA 3WGLA 1MXFA 2UUAM 1N9ZA 1RD4A 1TFRA 4HH3C 3AW8A 3PRKE 1LQUA 1WLYA 1S2OA 3CX6A 2FW6A 5MFZA 2OE2A 1IATA 1TF5A 2C2GA 4UZFA 1ZMWA 1W8DA 2JFZA 3FVTA 1V11A 3PQ6A 3V80A 3PUHA 2R1UA 1JEYA 3WGTA 1OLXA 1RYFA 1VXRA 2YHUA 3ESZA 3NHLA 5H37D 3OIVA 4H1UA 4OYYA 2Q2VA 3P4UA 3Q41A 3VHQA 3P9QA 3O4IA 4UM8B 1V7PC 4QASA 4AUKA 1XRJA 2Q5FA 3IPRA 3UGQA 4B2IA 3B7GA 3OQNA 3HR7A 3AIIA 1I24A 2LTUA 4FQ8A 1A9RA 4H27A 4NFSA 4IIYA 4RF3A 3H6GA 4RGYA 5AHKA 2D7EA 1X19A 3L6CA 1EXNA 1U1FA 4C29A 2HU2A 4EUSA 3IILA 5KQDA 4N5LA 4IJEA 4IYJA 1ORRA 3EVTA 4WHMA 2ONJA 2V7VA 3OPYB 4KXNA 5F3RA 1OI4A 2ZIAA 3A6ZA 3TCNA 5K0EA 2ZZMA 1CV2A 1K0FA 4I5DA 4TRJA 5EIBD 5IBCA 2ODNA 2X0NA 4I7EA 3HA7A 4WP2A 1L9XA 5TVGA 1ES9A 1HNZM 1N32M 1Z16A 3NHBA 5CB4F 3E5MA 4HGNA 4LYDA 4GI2A 5TF4A 4YMLA 4REMA 3G7UA 2HLPA 2XITA 1NSFA 4D6YA 4RYLA 4WRRA 1ZRSA 4DEVA 4YRNA 5ABPA 1GPAA 2ZSUA 3PWZA 4CIXA 4M8IA 2NXWA 3N6XA 2Z0MA 5GJWC 3WLAA 3T54A 3O8NA 4AICA 4EDHA 4OQLA 1EM8B 3IR5A 2HRZA 4QVKA 4UE3S 1Z5BA 3WRWA 5KB3A 3OJ0A 4GC5A 4LXIA 5HK8A 1UBLS 3QVGB 5FBZA 4Q01A 1WSBA 1PK7A 4HXGA 4HFJA 3DFFA 2CZCA 5BMVF 1HDZA 5C37A 4YJHA 2Q2OA 3ASZA 4YLEA 1YR9A 2I2XB 4Y67A 2M6KA 3UQZA 3DD1A 2BP7A 1H9AA 4DG9A 2XWPA 4BQFA 4BCCA 2APLA 4Q9HA 1OFUA 1VL5A 1XEWX 1NBWB 1JSZA 3PXXA 3QLUA 5B57C 4KFCA 1YS7A 2Y0EA 4KMOA 1PFYA 3KVRA 2WYIA 1B0AA 2VO1A 3HCRA 3IA7A 1UZLA 4OATA 2GVNA 1QX3A 1GY8A 4TUYB 5A0VA 3M4ZA 2HA0A 3FSGA 1KJQA 1U8EA 2B2XA 2AZ4A 4B7HA 2AR0A 1QRRA 1TM5E 2PS1A 3E82A 1SMKA 4NE2A 3RSHA 5IJ0A 3PPXA 1XZIA 4ZT5A 1E89A 1RTKA 2ZWIA 4R7ZA 2O1SA 5CDGA 3H9QA 3BJIC 4BWGA 3NBQA 3WK6A 2HWYA 3UB4A 4C9BA 5DW3A 1P44A 1AKMA 4IVQA 1HZZC 3DL4A 1I30A 1YOVB 3GCDA 1NZDA 1B74A 2VRCA 4COOA 3B82A 1VMDA 4XR9A 4NCNA 1GNSA 4MKXA 4Z4FA 1G9SA 3HFJA 4OQDA 4ZVSA 5IBQA 3INYA 4J2TA 1VLJA 1B3RA 4K9SA 3JPWA 3N87A 3FKSA 4QIHA 3LT4A 3DV2A 5IYZB 3CNNA 1BEZA 5A04A 4OGWA 1PR6A 4IVRA 3I9JA 2UUAB 4RVSA 4KWTA 5HS4A 2F90A 2W90A 3DM9B 3KWFA 2ADFA 2OUIA 3VXKA 1N2ZA 2K2WA 1A82A 2ID4A 4ZT2A 4J1TC 5EE3A 3WTCA 1D2HA 1J8YF 2OCPA 2P9TA 2XB8A 1X38A 3MMZA 5THQA 1K9SA 3KE8A 4TV8A 1W46A 4C7OA 4QYIB 5GWXA 1E1QD 2V7XA 4KR2A 2QAIA 3Q7SA 3IQEA 4YROA 4YPFA 4NRVA 1CULC 1R8SA 1OB5A 2WWGA 1BMQA 4NEHB 2IRWA 3KR9A 5D5QA 5JO9A 2CE7A 2O48X 1TT5A 4E2FA 3O95A 5L3VA 2ZOSA 3LRTA 2ZRNA 3MT0A 1JQKA 5JTTA 3U2QA 5J59A 2QW0X 3RADC 2VQSA 3GJ4A 1U9IC 5DM70 3BJMA 1Z73A 2ZB4A 3LNTA 3W5UA 4DUYM 5EINA 3G2JA 5JMTA 1PV1A 2NXCA 2X6RA 6ABPA 5EMJA 3KKPA 1F2VA 5L7YA 4H3HB 4RJTA 3SEZA 2FF5A 1OBCA 5GADl 2FEWB 4PXYA 2H8KA 1XCBA 3WLLA 4IH9A 1V3VA 3FDZB 4BUZA 1W59A 1A72A 1UPFA 2CYAA 1WV0A 2VYFA 3C8DA 1Z34A 3MWFA 4L0DA 4PBSA 3ZWCA 1EGMB 5KDDA 2C5LA 2JW5A 1P72A 3G2LA 2QKYA 5F7OA 3VOAA 5BWNA 4ENQA 4ZDWA 3TLYA 3ZBQA 4C89A 3QX3A 2X0DA 5ALSA 1SM4A 1LQ2A 2YIVX 3GJ7A 1QIDA 2NUTB 4GX2A 1SD1A 2CL0X 2DFTA 5JD3A 2KBEA 3DZDA 4FHCA 3CLSC 1GZDA 3BE4A 1T24A 4KJZA 2DQ4A 5BSRA 3U3RA 1I10A 2JFWA 4LK2A 2LRHA 2Z4SA 2UXCM 2H48A 3F3KA 4YI3A 1R3DA 2Y66A 2RK4A 5E9AA 1NW6A 3NETA 1TD1A 4N5NA 1B8OA 4M38A 5FOXA 1REQB 1NW8A 3A4IA 4HL6A 3M83A 1OAIA 1HG0A 3EN0A 5BMVB 3C98A 1DPFA 4KHZA 1V5WA 4FYHA 1D5WA 4Q3CA 1Q2UA 2X0FA 4CKBA 2W00A 4H6XA 3N70A 2HL6A 1CHDA 4HG2A 3GZNB 2Z9DA 4TN5A 3UAOA 3HZJA 3C1TA 3TO5A 3BILA 3JVDA 3UHOA 5JDCA 2YOFA 4MXDA 4ZAFA 5FX2A 5KTPA 2ZT7A 2P5TB 2AD1A 2YV3A 3BCUA 3FAKA 1U1IA 3NGLA 4EK9A 4TMYA 2BUAA 2IHJA 1B41A 1OCEA 2IXAA 3N0TA 4D42A 1JHAA 5HRCA 3DA8A 4J94A 1NXPA 3DLTA 4N0MA 4PG5A 1ZGZA 1CUZA 2C04A 4XQ9A 2DXIA 3D8UA 1UBTS 4RF4A 2ZULA 3RYFB 3VOSA 1EXDA 2R48A 3VPHA 1KPGA 3ZZ0A 2R96A 4FW9A 1X7ZB 3ZC3A 4K9DA 2ISSD 1JAHA 4S2UA 1XDGA 1S2IA 2XMGA 3Q9LA 4OMUA 3THXB 3VPCA 2OCGA 3C5EA 3CRZA 2BSXA 4JI5B 4QX6A 3DVAB 2XVZA 3PSAA 2VTVA 2P3LA 4RD3A 3ZC7B 1YUNA 3A6FA 1W73A 1OAOC 1K4YA 1HL3A 1JSCA 1XLTC 1Y8RB 2AI3A 3K2IA 4Q05A 4UOQA 3W8EA 1AKRA 5AOBA 3ZJYA 4R1MA 5FI0B 2G1KA 2HJGA 3B6IA 4DB4A 1PZGA 1ZD2P 1N57A 3JSAA 1A2QA 2ZE8A 5FFMA 3WWCA 3Q3IA 2FW8A 2MYPA 1VGRA 5AVZA 3GVIA 5B3KA 4C0SA 2OHVA 3D54D 4FCTA 1BRMA 2BELA 1E9CA 2C2KA 1SC1A 3I5YA 3C0KA 1I94B 1L5LA 1E2MA 1I4WA 1USUA 2CWBA 1O8BA 3AR6A 4LY6A 3D1JA 3DC2A 3P26A 5DBGA 5TV2A 2NU6B 3WK4A 4C3VA 13PKA 3AVQA 4Q1FA 2OZLA 4PPQA 4AJLA 2QX6A 4OHXA 5IVKA 2I4NA 4V0QA 2BKUA 1C1KA 3BKWA 2ZBPA 3H3XA 3NORA 3IAFA 3BT7A 1VBNA 3A3PA 3L9XA 3HJTA 4RESA 4DIKA 1M2FA 3SHVA 5FLXS 3AG6A 4KXQA 4KXUA 1GL9B 1KDOA 4DM3A 2QVXX 2PH5A 1RXSA 1QNFA 1Z8FA 4F4FA 2F9MA 1YTUA 1UDRA 4C7KA 3TQIA 4DM7A 4KAJA 4WVLA 1N0VC 3BFXA 3C7CB 3LY7A 3MB8A 3H65A 2XA9A 3GMDA 3WRXC 1L7DA 3AU9A 4IP0A 4O4LB 1DJPA 1FJHA 4LRXA 2ZAYA 1ZKMA 3MB5A 1MJ5A 1Q3CA 4H7PA 2NVWA 4N3NA 1D9ZA 1Y9DA 2F4VB 5JH7A 3C6YA 2RD2A 1IZ8A 3KFLA 1YBHA 4BV8A 2V5AA 3PLNA 1NDQA 1R0YA 3E0XA 3OHPA 2GR9A 4GNRA 4FFMA 4I4IA 4Q18A 5M5BA 3LQ1A 1FFHA 2XUHA 4B7UA 4DJJA 2JLBA 4IR7A 1F17A 3VK7A 3HJCA 1N0UA 2XAUA 1MKYA 4G0OA 3KOYE 1TO6A 4KN9S 4YQZA 4YVFA 5EKUA 2CXPA 4GGMX 1RMYA 1URPA 1N77A 3ZHSA 1XWWA 4HZGA 3GLGE 4YGYA 4EENA 1IJFA 3KPVA 4R1TA 1YVUA 3E3NA 3LL4A 6PFKA 1Y5RA 2VDOB 2JS7A 3PUIA 3IXMA 1EUZA 2WG0A 1NHWA 4UM9B 5LU8A 3EZYA 3ZD8A 1AXEA 2QPOA 2Z43A 2VP6A 4C4SA 5LZ4A 4IUDS 5FOSA 1XAJA 4P16A 4FSHA 1IQPA 4WZAA 5B6PA 1DIRA 1ZGGA 3QY0A 5I3ZA 3PNYA 3DBVO 4CEJA 1CWUA 1XI2A 1M1XB 1CUEA 2MYTA 1AN9A 2XUFA 3PHBE 1JFTA 1JYSA 2BBTA 1AVTA 1GPKA 2CD9A 2JEOA 4NMXB 2PD6A 1JJBA 3FWHA 1ILWA 1DUSA 2YYZA 4N5IX 1T6YA 3WX0A 3E81A 2COEA 2BC9A 3F0TA 2OMEA 5AJWA 4A5SA 4UN2B 2NO7A 4INAA 5JNSA 3AR9A 1HFKA 2EZ9A 2WKWA 5T4EA 2FZCA 5KPDA 1XE3A 4CHGA 5JQGF 1MHTA 4OB8A 2GMWA 5D2CA 3H84A 4BO9A 4DA4A 2XJ4A 2CMDA 3KB2A 4E03A 3QVVA 2YMLA 3AP1A 4YJKA 2Z2ZA 3VNSA 1NJSA 4AMBA 1IZ9A 3CZQA 5FLKA 3PX7A 3VNVA 2JFUA 5A05A 1CRLA 3SYLA 3NV9A 4RENA 1II9A 4IHJB 2PAAA 4LV8B 1LPOA 1X1SA 4NK5A 2CV2A 4ZZIA 1YCGA 2Y8EA 4D3FA 3UJPA 1N9KA 4FW8A 4ND1A 5JU6A 3RBAA 4C4YA 3B89A 1JIIA 2FF7A 4H31A 1ZMUA 4X20B 1OAOA 1XLTA 3WR5A 4EAQA 4HTFB 2QR5A 3O74A 2RHRA 3K2EA 3U3JA 2JLZA 2P9BA 5CPFA 5FAXA 5FNVA 3OEYA 4RLQA 3FPJA 4BO5A 2NZYA 5DSZA 3NWLA 1J33A 1NG1A 3M6VA 4GX5A 4HX2A 3D4IA 3MUOA 2EP5A 3B1WA 1N8TA 2Q2WA 4JQCA 4UNPA 5E2IA 5CEJA 1I3LA 3LZDA 3QU2A 4Y6OA 4ZXFA 3RTAA 3Q8XA 3SLKA 1JR3D 4WGFA 5BSUA 5JAPA 4FLEA 1E3DA 2D59A 3WDLA 5IFLA 1M1YE 4MKHA 5IARA 5JZBA 4LY9A 1F3OA 2Q1WA 3LGSA 1J0CA 2X86A 1SZPA 4LZAA 4AQYM 1Y4AE 2XNHA 3S4YA 2NVUA 5KYUA 3WLJA 1NT4A 3KOUA 3ZN2A 4IIDA 1EG2A 2LVAA 2Q4RA 5KPTA 2J4CA 3NBKA 2IT1A 2E3JA 2Y67A 5D3MB 2DAGA 2O1XA 2FZKA 1L1FA 2WU1A 5EEGA 2UVPA 1ZMVA 2QB5A 1J0AA 2QI9F 3URMA 5K8JB 2I6XA 4XYGA 5LSAA 3NBFA 1FJGM 2E0IA 4FFNA 4Q15A 3R8CA 3U09A 3W2HA 3N0XA 3L07A 1V4NA 3PNPA 4BNWA 1EK1A 3VDXA 4ALNA 1EXVA 2LW7A 3OZGA 4RZHA 5IK2D 2R79A 3LRPA 1UDBA 1Y63A 2YC2C 4X93A 4M86A 4BOYA 2NTEA 4IDBA 2F67A 4DMLA 1PK9A 1SXGA 3LI2A 2DULA 3OOHA 4QOJA 1G2IA 3RJ9A 1OBFO 1SJ9A 3LQFA 4MW9A 4IDGA 4YP9A 2J5KA 3EAQA 4F04A 5U4QA 2BPOA 4B2LA 1T0JB 1XZPA 3CUYA 3B1ZA 3QIVA 1XCLA 1TVEA 3WYCA 1HNXM 2NU9A 1Z13A 4Y2QA 3NEAA 1VB3A 3LDHA 4CGZA 2HN9A 4PV7A 4RS4A 2CXOA 3N3BC 1X7HA 3PNQA 2WTUA 3ZCXA 3DVQX 3JRXA 3UJ6A 7CATA 5BNWA 3TUZC 2SECE 1V6SA 4QDXA 4AXXA 4N41A 4QYMA 3DEYX 1YAHA 4UM7A 2FP3A 3D6TB 1C7ZA 4OTZA 4F6RA 3DOIA 1AMOA 4Q7JA 1U7PA 2QVBA 3BTSA 4YHBA 3SXJA 2OCBA 4ALKA 4G01B 1U02A 1QHYA 4B7XA 3SF8A 1VSTA 3K4PA 3NALA 2PLAA 1NVDA 4CQMD 2WF8A 1AIPC 2DR0A 4Y9UA 3STXA 3RANA 1H66A 1BSVA 3ED1A 4LISA 2EQAA 4FGSA 3DEAA 3R9IA 1NVBA 4TKMA 3EGIA 5LXTF 4HATA 1PRBA 2H5LA 2HK7A 3NNSA 3UMBA 4E2WA 4JLKA 3KW6A 2JCXA 4DR4M 5MF6A 4IMJB 4IQ0A 4MRMB 3A8TA 1EUYA 3OD1A 1C9NA 4BU1A 2FWIA 1BD4A 1DJLA 1V35A 3LH5A 2MIIA 3I9V6 4GMXA 3O4JA 3LVFO 4RS3A 3HFGA 3L4SO 2HT6A 1CEXA 1NQTA 1Y8QB 3PXCX 4WKNA 3UCXA 5JSQA 5KNBA 3WB9A 1T13A 4OQYA 4O08A 3WLRA 4CMHA 3PV0A 2C03A 2H29A 3QGMA 5F21A 4A1OA 1CB0A 2P7HA 4RVHA 1LBTA 4OEHA 5CH3A 2BEUA 5ICGA 1P33A 4IWYA 4BV3A 3RFXA 3WKBA 4C7BA 3GLSA 4CBVA 5EE9A 1N3IA 2R8EA 3EW9A 2CJWB 3DZKA 3MTEA 4Y2UA 5BR4A 4RLSA 2ACWA 3BEDA 3KOWE 3WXMA 4F21A 3GROA 1V3UA 1WHSA 2DHCA 5AO9A 4MGEA 1G4AE 2HKJA 1ZXLA 1XD2A 3QBVA 1S9DA 5GGXA 3AEQB 4HSGA 2J85A 5BNZA 2AG1A 3S2FA 2VRCD 4EATA 4HP8A 1LK5A 1X2BA 4F3KA 2IV7A 1XEWY 1GM5A 3B9BA 4OVZB 5CB6A 5EPEA 1KJZA 3AJAA 4KQ2A 4UFOA 1K9VF 2PSEA 3LBAA 1HR0B 4MUAA 4G5GA 3GDWA 1FVXA 3LPAA 2V3CC 1MB3A 4PVDA 4G1FA 2H0AA 4GLJA 1O2DA 2BLNA 1RKVA 3BRSA 3E2IA 4P7JA 2HJSA 1V1JA 5E26A 2J6HA 1TK2A 2CLEB 4U0JA 1ZW6A 5ITXE 4EHHA 3IKTA 1DKRA 4XIJA 3P96A 1GQQA 2QEQA 4DNPA 5CT9A 1JR3A 4RVNA 1P45A 2OQVA 3NAMA 1DS6A 2AEFA 2JFQA 3KAQA 3N5CA 1P61B 4KG7A 2ZJ6A 1NBIA 4Q9NA 2Q2EB 1CLEA 3BIJA 4JMPA 3I23A 3QLTA 4MHOA 4YLGA 3M2TA 3ZI7A 4NZOA 3C3DA 3F4KA 4Q1EA 2VQ6A 1U7DA 1W44A 3NV7A 3RRJA 2H63A 1GTJ1 4OJKA 3W6UA 3NVAA 3ROEA 3RYHB 2BGTA 2AFHA 2P6RA 121PA 4UW9A 4D3ZA 2ERXA 3OJXA 3OZBA 5IF3A 3H4MA 1QYWA 2GASA 1KKMA 1BJRE 1G71A 1Z6AA 2AJCA 3R7BA 3E5HA 2Q4BA 3DE2X 3UA4A 1KH1A 2AR9A 3D7SA 1AK9A 5IKOA 3JV7A 1V9LA 2W6JA 1AGRA 4LOHA 3RKUA 3EDCA 1HFWA 2OFWA 1WJGA 2XCUA 5DH9A 1AF7A 1KU0A 1GNLA 2ZZKA 2WD7A 3D6HA 4OQFA 3DOHA 4PF1A 3AERA 3PEVA 5LNK1 1L7NA 5HQJA 4JFRA 1L7BA 2QX9A 1DU4A 4CKEA 2OGUA 3R5KA 4INJA 3STTA 3OQPA 2JIZA 1E79D 3AHEA 4DV2B 3A4NA 2GO7A 1IEQA 2K7FA 2DYKA 3FUUA 4GKJB 4GPD1 2CDNA 2DUJA 2IFTA 4H17A 5TEWA 4ABTA 1EUCB 4L5IA 1F6BA 1P73A 1TYAE 3N2GB 3QX7A 4DA8A 3KXIA 3B36A 4NWIA 3TSWA 2L4FA 3DOJA 3RC7A 3I04M 3BGIA 4BLTA 4F9EA 3GFQA 1ZK4A 3VDPA 3OURA 4FKZA 4OXYA 3VR5A 4HNUA 5CCEA 1EFRD 3FN4A 4B3RM 3HKEA 2EZUA 4EX7A 3OCVA 3UWOA 3HCPA 1GGEA 2FWNA 3N0VA 2VPIA 1UC8A 4JJ4A 2V03A 1I0IA 2WKPA 1JHXA 4RSRA 4RK4A 2ECOA 1WB6A 3NUGA 4R0NA 4IOKA 2XUDA 3FFAA 1GQYA 5CM2Z 1YASA 3HVKA 4R71A 3KEQA 1XMSA 5CVCA 2P90A 4UTNA 1ZD8A 4YRZA 4Q19A 1U1GA 2VNIA 1N92A 1NIPA 3QFRA 3PX3A 2X0IA 1SU8A 2OV2A 4UPDA 1PI3A 1XEFA 2ZAOA 1OMOA 1V8BA 4WOCA 2BFDB 4M1KA 1SY7A 2OGWA 3CH7A 1BJTA 1OXVA 2UVDA 1INLA 2ZRJA 4U6NA 2FPPA 1FFDA 2VJPA 4UDOA 2W2KA 3T7DA 3EXEB 1FCJA 4ZARA 5TC4A 4RSHA 4Z9YA 4YX9A 1CRZA 3BFPA 3S2EA 4FIZA 4QU8A 3SCZA 2HZBA 4KN6A 2BFBB 1XRSB 2G83A 1KSGA 1UBUS 1Y1KE 3A6KA 5AVYA 2AXNA 3Q7QA 4RIFA 5D5HA 4MW5A 5LIRA 5FUYA 5T5QA 1ZWLA 1M6HA 3C8ZA 3R24A 3EDOA 3CX8A 4JODA 2J5QA 5IABA 3FSEA 4RY8A 5CFPA 1JA9A 5DISB 3VAYA 4K40A 1FPQA 5E6SB 4XIGS 5AKJA 4MVJI 4BB9A 1E3IA 1RKBA 1U11A 3IBCA 2IIVA 1EM6A 4MV4A 1GGMA 2P67A 2JJ8A 2HF8A 4Q3NA 5ALQA 3OOSA 1TMYA 4CQJA 4AG5A 3UGJA 1N6RA 3DOEA 1GA4A 1W88B 2BTQB 2J87A 4HDCA 1ZAKA 4R3UC 4QFBA 5DM2A 2NPFA 1HQCA 1ID1A 4LK3A 4LN1A 4YCAA 1IM5A 5JAQA 5ECGC 4EUNA 2D3WA 1RPZA 3CUUA 2QL9A 2ZJZA 3QYPA 1TUEA 4LDPA 2EVWX 4I19A 2CGEA 1JKXA 1G8KA 1F2TA 4CQNA 1B4DA 2XWQA 4DMFA 3OM0A 1Y5LA 3VPDA 3URKA 2MU1A 1F2UB 3CB2A 3HUFA 3WTBA 3IUPA 2J32A 4LTDA 3HWX1 1VHWA 3FY4A 3R7NA 1DAEA 4DR1M 2UZ4A 4A15A 4OQMA 1U2SA 4DC1A 1XRNA 1I0LA 3AB3A 1B1CA 3MTGA 3ZLUA 2O3UA 1EFPA 1OJ7A 2C5RA 1ZD3A 2IHKA 3KOMA 2JJ2D 4WPGA 2VS1A 4E4TA 1UKAA 2I66A 4KREA 2CXSA 2HK6A 5F23A 4KTTE 4W5RA 4R1LA 1L8QA 4UDXX 2JD1A 2H5EA 4RPKA 2FSFA 4YT5A 5D1HA 4CM4B 2VUUA 4DUGD 2O2EA 1Q0TA 3EQZA 4KGXA 1RADA 4PIPA 4LZJA 1WMSA 5IK2A 5A4FS 1N8SA 3ANLA 4RMNA 1YE9A 4U6SA 3GB9A 2ZIVB 4PSKA 2WJHA 1G8AA 1T9ZA 1MUUA 2ONZA 3IESA 3MTIA 4MI3A 1PAUA 3QBEA 1OT5A 2VCYA 5C1IA 3LSYA 3S2UA 3FYHA 3TTXA 4LRSA 5BWMA 2YZNA 4QTZA 2ANBA 2WFMA 3DS8A 4RTKA 1TX4B 2ZWPA 2OYCA 3PFIA 1PW5A 2EW8A 3C7KA 1ITZA 3K6JA 3PGVA 4DVJA 3FXAA 2ODTX 1IN6A 4JI5M 2VTBB 1T3TA 3UPTA 3WHLA 2AOUA 2R7MA 1KEEA 2W8BA 2X5JO 3O3NB 1MU0A 5A4DA 1Z5GA 1POXA 1K4KA 2Q62A 2OO5A 2XAAA 4J29A 2XQKA 4PCAA 4YRSA 1DV0A 4BE4A 3DWFA 2FPOA 2LWXA 4BNLA 5DPMA 2XZLA 3FNFA 3TWMA 1QGAA 2O57A 4KIJA 3BD8A 1CUAA 3E05A 4BZWA 2H51A 2JGLA 3KPWA 4JZYA 4QPDA 4WH0A 2OHIA 4DZRA 4E1AA 3QXGA 2ON6A 4J3FA 4EPWA 1CIVA 2XYHA 4U2EA 3I1YA 4B44A 2ODPA 2WU4A 1Z88A 3FUWA 1TAQA 2GZHA 2G9NA 1FUUA 4PX3A 5JXWA 1QB8A 1ARZA 1W0CA 1M0TA 3FGOA 4LNUA 3ZDZB 4Y7CA 5KJCA 2VPWA 4H0NA 3GF4A 3D8TA 3JD2A 3K0CA 2ZIFA 3QKRA 3JAKB 3PG5A 4R6XA 2XA1A 3IB3A 4B71A 4QT0A 3WYNA 4C03A 1Z6GA 1V1RA 3L7JA 4MIOA 1UWVA 1UWLA 1V16B 1JMKC 4NG5A 4P4SB 5GGYA 5BOVA 2BGGA 2F8LA 5C51B 1XHLA 1XYYA 1A76A 1P39A 1Q1BA 1BYIA 1EJ6A 1IAQA 2H2DA 3FUTA 2HMWA 2LDXA 2B34A 2OGSA 2ZDHA 1E9RA 2FPMA 1OUMA 1AK2A 1Y6JA 2WSEF 4MS4B 3WRXA 4MV1A 1NE7A 3GX1A 4E4YA 5JVDF 3VSEA 3WYFA 4TXMA 5TS3A 4UCWA 5IC6A 4RPCA 4EJMA 4YHHM 3AL2A 1FC0A 5IXSA 5HKKD 3GEEA 4R68A 3UV6A 3L0ZA 1KQNA 3CSDA 3VX3A 2BFFB 4D9CA 4P2GA 2O1WA 1S8AA 2HWWA 4LMRA 1UPTA 1LVUA 3QPUA 2XFSA 1JQ3A 1P75A 4G89A 2IYEA 2HRCA 1P2FA 2YFQA 4H9GA 3NMUF 4BMOB 4DWVA 2FEXA 3RIHA 1HQDA 3WL5A 1HLGA 3E18A 1XPUA 1MIOB 4FVMA 2FOIA 1ZINA 4DAEA 2QMHA 4MV9A 4EGFA 4LXUA 2G0NA 4Z8YA 3RIXA 3ORHA 4AJOA 5F51A 4BNNA 4Y0VA 3K1TA 4F3RA 1A8QA 1PJ4A 1Q0HA 1C9YA 2D1FA 3BMOA 3IG8A 1JALA 3TTYA 5L3RA 3LOQA 2PMBA 2HR1A 3CLUC 4CMAA 3AXSA 2WBLC 2Y27A 4YJ2F 4KXYA 5AKHA 3KFVA 3K9QO 4MRRA 4RPHA 1XVIA 1RAHA 1GUBA 2GKSA 3BE5A 3PR2B 2WUVA 3EH1A 3T95A 4TL8A 4XVUA 4YQFA 2FEPA 5BN3B 1NUQA 3SC6A 1PR4A 3FETA 3W77A 3GL9A 2QT1A 3MJEA 1RW4A 4XJTA 2Y1EA 4OM7A 2F5NA 4IBJA 1U5AA 4FQ7A 2HWXA 3I6IA 3EGXB 4PYOA 1R4ZA 4MUEA 2JFFA 1NC1A 4K9PA 2W11A 5IKEA 1G63A 2W8ZA 3U5TA 5LQNA 4MGZR 4B32A 4DYVA 3HZOA 3W5SA 2Q0SA 1FW6A 2DPGA 1KETA 2X23A 3TZBA 1AURA 1JU4A 4Q48A 1EH5A 4RMHA 2GBLC 3P0JA 1MHPA 1ZGAA 4NONA 3I32A 4O6VA 4XWAA 2HHCA 4B6OA 1XX6A 2GYYA 3RRMA 5AVRA 1ZOOA 3IVMA 3F98A 3V76A 5MGNA 4FGUA 1FX1A 3V9PA 4KV9A 3PQ5A 4E2YA 4Y1EA 4AI6A 4FFSA 3PEEA 1F48A 2YRFA 1YZGA 2ZBQA 1ZGJA 3R3VA 1XQVA 2ZIXB 3K9WA 2WMNB 4UTXA 3ESBA 3U9SA 4C4AA 1E7WA 4MCAA 4XFJA 4OQNA 2BKAA 3KXPA 3R5XA 1OYYA 2PZMA 1KZHA 1OLSA 3KQQA 2VJDA 3TIVA 1TVKB 1Q14A 1G2OA 1U5BA 2YHIA 5IAOA 2H0QA 4FYIA 4I4CA 4LYEA 1EA5A 2I55A 4PSVA 3ZXXA 3CZ4A 3KHTA 1GQSA 3BMNA 4TMTA 2VAMA 3KKMA 1DIOB 4IINA 4OQZA 1OI3A 2EBWA 4ZMRA 2JKYA 2P78A 5H81A 1DRWA 3EZFA 3IP9A 4MAAA 1ZJ4A 1GNQA 3MJFA 3MJRA 1GKIA 1GZ3A 4ZGWA 1OXUA 2J6CA 3MTBA 2PUDA 4EZIA 2HI0A 3MAGA 2BJWA 2HWJA 4WVFA 4D46A 1F0PA 2GJSA 2NOAA 2VNSA 5GZ3A 3VSBA 3OCCA 2HHHB 2PCJA 3TRKA 3S0JA 5JYDA 3TLKA 1NGSA 4U7PB 3HU2A 2IPLA 3GUZA 3JARA 3BQNB 1FFAA 3G6KA 3TAUA 1DGQA 1C1DA 4JI3M 3K5HA 2GBFA 4GUAA 5HKKA 2PUJA 1BQEA 1Q1QA 4RJLA 3G5UA 2C9YA 3GHYA 4UAGA 3A3OA 3QVXA 3ETEA 4Z7NB 4P9NA 3ZBTA 3FKQA 4YAGA 4H7FA 2J9ZB 2WHRA 1S9HA 3CH5A 3AC0A 5HILA 1Z3IX 5BSVA 1U2QA 1DQPA 4G4GA 1SVIA 2JK0A 1U6KA 2Y76A 2HGZA 1N7JA 4PNZA 5FPKA 2QM8A 3LCUA 3QNMA 1P1RA 3H2BA 4HMOA 1I13A 1QOQB 1W25A 1IHOA 4JUDX 4R9UC 4X92A 5BSMA 5HW0A 4RCZA 1MW8X 3HJFA 1PVOA 4FDTA 1C9EA 1JEQB 4KQXA 1LPNA 1JS1X 1O3YA 2QORA 3FDFA 2ZI5A 2DB3A 2QTVA 2D8MA 4JGBA 2Z6UA 4X65M 2ZG6A 4PXAA 5ENDA 4CIZA 4PYLA 3RT7A 2IZZA 3G9UA 1H93A 4CT5A 3ZK8A 4GH9A 4E13A 2QROA 1NPDA 3HLKA 4HS9A 2BDEA 2ZUSA 1CUGA 4ETWA 5BWOA 3HCBA 3GEPA 3M3HA 4RKEA 1E4YA 2YUIA 1NN3A 3TOZA 5LQRA 5JOQA 1UUFA 3E4RA 4MIKA 1YC2A 3KAPA 2XH9A 3LF2A 4FWIB 4XGNA 2LNHC 1EZ4A 4NAUA 4QREA 2D2IA 2WFLB 4UBNA 3SQMA 1E4EB 4RV9A 3WL4A 4BE9A 3J27B 4ZZ1A 3QVWA 3WC4A 4FBLA 3WGOA 4YUZA 3CZMA 2HDOA 2YFKA 1IUNA 1AKVA 1F60A 2YYSA 1I1NA 2A1IA 1EVQA 4LC1A 5EERA 2OA0A 5A4JA 3EPLA 1MEJA 4Q82A 4HNGA 4QQRA 1KE2A 3W2IA 3WP1B 3DLCA 1ODTC 3TNJA 3OE1A 2V54A 3JPYA 4P33A 4UREA 3WGQA 4D99A 1E58A 1MPXA 4U2KA 2YQ4A 3T6KA 5ICMA 2IY7A 3E3MA 3EEFA 2HDWA 4PEVA 3THWB 3L8ZA 1EIZA 2IX9A 4IGFA 4N3CA 2C4MA 3EHEA 3TSAA 1TMOA 3W8FA 4CG0A 4KKVA 1RQXA 4WBSA 1XKXA 3RSZA 1NXQA 2PX8A 4IJKA 2ZUTA 2DBZA 1XZEA 1EKXA 1LFAA 2PGOA 2QLNA 2OAGA 3HSSA 3ONWA 4LA4A 2D7GA 1KOFA 1HURA 1HYBA 3QG5A 2NVOA 1J1ZA 2GK6A 5CGZA 2YHAA 2HV8A 5EKDA 3TX2A 1VDLA 1YAJA 2WEKA 1ECBA 3QTBA 3ZXYA 3LQ4A 1WTAA 3CMCO 2G6BA 2H4HA 5CBKA 1H2AS 2XDAA 5M34A 1IVNA 1X6VA 4KH0A 1Z7WA 4M0WA 3AEKA 1JQLB 2ZTCA 3LY5A 4IQ4A 4UATA 3THYB 1HE5A 1BDBA 1PLLA 4LYJA 4B7CA 1XZGA 4NPAA 5FULA 3ZQJA 2Y1KA 3KDAA 2O2JA 2JAOA 2BHRA 2FN3A 1QZMA 1PW7A 2ALJA 2IYOA 2R1VB 5CK5A 1XU7A 1Q83A 1KDRA 1DKQA 1IFYA 1TA9A 1W2GA 2F3PA 2HA7A 2IIPA 3H0KA 1NUHA 4FVTA 1KY3A 4O4JA 3VHRA 1ULTA 1UCFA 2JJ1A 4FE4A 4L1KA 4RIGA 4ZVVA 1SK8A 2DFVA 1DMSA 5F98A 4HBGA 4IWNA 1G2PA 3IP3A 3GPYA 3FKSD 2QAJA 3LP6A 2JI6A 1T9DA 2Q8NA 4KQWA 3KLOA 4L9AA 1DG3A 1Z2DA 2KPOA 1OFGA 4B6SA 2HC9A 4I5SA 2PMWB 1SNYA 1L8LA 1Q6ZA 4ZU6X 2ZRIA 2QZSA 1IG3A 1RFLA 2E5LM 1MCZA 5FEMA 3W9YA 2CCKA 2LE0A 3FA2A 2VDLB 4V3BA 4CQLB 1M2VA 4R6WA 4IGEA 2YXLA 2H18A 1DDGA 1ABEA 2PV0A 4GBGA 5F2NA 2R87A 3OAAA 2WJPA 5CVDA 1YU9A 2VSYA 3ZY3A 2CXNA 3QF4A 3QK7A 4G09A 1TM2A 3LXUX 4EHJA 4IMPA 3G8BA 2RB4A 4NS4A 3A7DA 5C4IA 4YJGA 1VSUA 2D4AA 2EFEB 1A88A 3EA5A 3PFBA 4W5TA 4JI4B 2PJDA 2PPLA 4L07A 1NONA 5DLEA 1JDPA 5C8VA 2BSAA 1EQAA 3Q3JB 2AF4C 4HB0A 2FSGA 4P2BA 4PR3A 2DJ5A 2GRJA 4DIFA 1SVOA 3NTOA 2AWOA 1IY8A 1KY5A 3OHMA 1E2LA 2GWRA 4HDSA 5T4FA 4M37A 3RHFA 1ADFA 4OSOA 2YQZA 2RE8A 3QXXA 2OLKA 3UW1A 4IF6A 4DYHA 1NX9A 2G88A 1CD5A 2PQ0A 2YJ5A 4G0PA 4KQIA 5EJIA 2VN8A 1Q16A 1LSJA 3H9UA 2OBNA 3JYHA 1YKFA 2IXGA 2FUNB 1DJQA 4ZAGA 4MR9B 2BZ0A 3CLTD 3K0FB 4OFXA 1B42A 4L16A 2NMVA 2C9BA 4IRUB 3HNPA 2FLKA 4MDHA 3QLJA 3SDZA 3QLEA 4AX8A 5HKAA 5LL6P 3GRVA 2IHNA 3VTKA 3MNFA 3CR3C 3FZEA 4RFSB 3V9AA 4DABA 5KINB 1CSEE 1NHGA 2HQSA 4YUVA 5C5CA 3OU2A 1D0MA 2F1KA 1OWLA 2RHDA 3KALA 1UQRA 3L7YA 4KVGA 3TEFA 1RLTA 1YQGA 3EH2A 3ZE6A 5GJBA 4KJXA 1L7VC 1AKNA 3DT8A 5I7SA 5I9IA 4HXEB 3HSKA 4HUQB 3IAUA 3KBBA 5EUMA 2ZTSA 2FN9A 4UFNA 4WA7A 3FTNA 3VGPA 4Z7OB 4XWYA 2HDNB 1GKLA 1EK6A 3VRHA 4DIBA 3OESA 1QH9A 3BRWA 3HFRA 3JZFA 3ORRA 3UC9A 2D54A 1U2RA 4EA8A 4ZZ0A 1YRLA 1RC8A 1QUTA 1NFRA 3O8BA 5JJIA 3LPNA 2FRVA 2Z2YA 3FVRA 5DIFA 3V8MA 4UBOA 3CNOA 1FDRA 2HCFA 3ICWA 3BK7A 5BYJA 3RJZA 1D1QA 3O4FA 5JROA 2WR8A 2TS1A 4Q9IA 5CTAA 3HKCA 3JQ8B 3ONNA 2VWHA 2NZ2A 1NV8A 2FUKA 3MC1A 2KQUA 2WMOB 3KD3A 2QMUA 3KJEA 4RADA 5D85A 3EPPA 3K0KA 4F9TA 1ZR2A 1PWZA 3QP9A 1KFVA 5F1YA 1SC4A 1WBJB 2P2ZA 5GV7A 3N2NA 3WO1A 2P8JA 3W6NA 1IHDA 4B0PA 1ESCA 4C6TB 3PHHA 3ZYZA 1KVUA 4KIGA 2IYLD 3EGDB 5IFKA 1YRBA 1E20A 3UK6A 2G5GX 5LUAA 2UZ0A 3CJRA 1VRWA 2MSCB 2YHBA 1QQBA 4PU0A 4GT1A 2GHTA 1NLZA 4TS4A 4ZZ3A 3GN1A 4HRXA 3KSMA 2XB6A 3EIHA 1RI1A 5CP8A 3EMDA 3WFIA 3LC2O 1N2OA 1FYXA 4JVMA 3CO5A 1J09A 2HHLA 1OVGA 3AKYA 4MWBA 3BWEA 5EJ9A 3IE1A 5AFSA 1SWVA 4NAVA 2FG7C 2J3IA 2VTKA 3U3ZA 1OT3A 4HLQA 2VZLA 1H2HA 3H3JA 4BL5A 5JJLA 2FSVA 2Y21A 2YNMD 1QIMA 4FKMA 2QRZA 5B64A 4MGYR 1LW6E 3EMKA 3P0EA 3AWIA 1OWOA 1KQOA 3AY7A 3D6NB 2EX4A 2Q7DA 3Q8LA 4EI7A 3JWGA 1BVHA 3TMKA 2OXIA 3OEWA 5JI2E 4R9RA 1KYYA 1ZM9A 3NOOA 4KVAA 4MJ7A 3F8WA 1N75A 5TF0A 4V1CA 3HVUA 5GMOA 3S81A 1TKCA 3LT2A 2EF0A 2NNLD 4RGVA 1G8YA 1V5EA 4B3HA 5HPYB 2O2GA 1MBZA 3TN7A 2YUTA 4FFWA 4J0QA 4BNFA 4ZDKA 2FEMA 2I7XA 2HMAA 3FAZA 1U3WA 5FL7A 2FMTA 5IHPA 1B1AA 2H3HA 3PDIA 5DYNA 3T0GA 4XWKA 5F9HA 1Z6TA 3G13A 5EC8A 3RUEA 4AZ3B 4UOEA 3C3EA 3DT6A 4LJ7A 2KSQA 1IM8A 3BXWA 2NN3C 3CZ9A 4G5HA 5LA6B 5D8DA 3SHWA 4AY6A 2WINI 5DHRA 1CEYA 5JCOA 3OA0A 5A2GA 5KPZA 3LBFA 4AO7A 3F9CA 3G2OA 1W29A 2Q3JA 3RVNA 3BXZA 3HZHA 4CXMA 4BGUA 3LUJA 4M0FA 1XG5A 2O8FB 1S7CA 2JKZA 2H2GA 3H5IA 2X5KO 3U1VA 1DXOA 3GO8A 2P2LA 3IRUA 2GD6A 3E35A 3GI1A 2ECPA 2DAMA 2A1UB 5J9FA 5FOWA 3GRKA 4IDCA 1BWPA 3KVVA 3QKSB 3GFRA 5HHTA 1NVEA 4PC6A 5IN5A 5FWXA 3SXUB 4ZHQF 4LGYA 1V5FA 1P4HA 2IEZA 4IX9A 1QO7A 1DUVG 4ZC8A 1UQTA 4H18A 2P9FA 3M6XA 4Q1CA 3GT7A 1WTCA 1YJ8A 3FYTA 2OUKA 1VRCA 3TRHA 3IDFA 5JSZA 4B3SM 2ADOA 4OYLA 1XJ0A 1J21A 3MMSA 4TZ0A 4B79A 4LJLA 3M6IA 5AQEA 3L8EA 2XVAA 2AMJA 3F9RA 1G5RA 3SAUA 3MQ4A 2BGJA 3SYMA 2NTJA 3WP0A 4R2HA 1QYRA 3AF1A 4PPYA 3R9WA 4D6PA 3CR7A 3IVGA 3RSQA 3OC0A 4C2TA 1U7OA 4JQSA 3STYA 2DPXA 2GXUA 3PX2A 4ZQEA 1E3SA 3HBAA 3C58A 3HJAA 1FDSA 2REBA 2WIFA 3X1ZA 3QOFA 5DGTA 5LR6A 4DR2B 5CD1A 5B3JA 4A36A 3TL6A 3RRXA 2WB2A 4XUCA 5HOEA 3KZXA 3NI2A 4KMSA 4OVKA 3H9JA 5IMBA 1EJBA 1GUZA 3D02A 3RAPR 1PCXA 2GEDA 4K9QA 3GDHA 1U8UA 2AOTA 2R86A 3FOCA 4KN5A 5C7YA 3K71B 5AHRA 3SAVA 2ZJ4A 3PEFA 4GP6A 4LC9A 4REOA 4DY6A 3BAZA 3DEHA 1XNQB 3E22B 1CHNA 2YMPA 4G81A 1GT91 3H99A 4PYRA 1RMTA 3A06A 2OP1A 3VR6D 4CM8A 1H2YA 4C22A 4CMKA 1G6OA 3S3TA 4QGHA 1IPEA 1J1IA 2EG9A 1R9MA 1H85A 1TYEB 5B1IA 5GKNA 4C0HA 4HBZA 1JAXA 2K5UA 4UCXA 2G9UA 1CUHA 3EIEA 1HYQA 4JT2A 1I3CA 1RYHA 4FU0A 4KGDA 1J2EA 1S01A 4RU1A 4UDNA 8AT1A 2KLHA 3QSGA 2JLVA 3CUEF 5EWJB 3RE1A 1IBMM 1JEOA 2A67A 2J9XB 5FYQA 3EQ2A 1QHIA 4PGFA 4CFSA 3FOFC 3GJSA 4WNAA 3ESQA 3U61A 1O77A 3OFKA 3NC1C 4XD7D 4RMIA 2G0TA 4DEYA 1QTQA 1BTOA 3IMCA 2TYSB 3BWBA 3R3UA 3AKDA 5DGIA 2BRUC 5DNUA 2I3DA 3B3FA 2FWPA 3DQPA 3K9NA 2LVNC 2WSCF 2L19A 3PJFA 4W9NA 4XJXA 1GAXA 3WKEA 4I9HA 2OWDA 1Y3HA 3I58A 4J4BA 1IUOA 4QEDA 3UWSA 3O75A 1RSZA 2WJGA 2IYQA 3JR5A 1VLHA 2OTCA 4QO8A 4ZU1X 1YB7A 5GINE 4U0KA 1AQ6A 3NCHA 4LYAA 3AX6A 3PUJA 1KBQA 3T6PA 4GKKM 2IZ6A 1IBKB 2G8LA 1DINA 1GTG1 1UZUA 1YZQA 5JI3E 1I4TD 3FYUA 4KQCA 3ECAA 3ROTA 1ZJJA 4EBBA 3ND7A 4RF1A 2EG5A 3ORQA 4DV4M 1PQYA 2G5CA 5FOQA 1KKLA 1HEUA 1DVRA 2GQFA 3F46A 2FDXA 4PRLA 1JDSA 1J70A 1QRAA 5AI0A 5FV7A 4IIFA 3M3PA 3UJNA 1PQWA 2QGNA 2R1TB 4P53A 3RF6A 5KYYB 4LDNA 5L7WA 1C7JA 5AJYA 2HA3A 2PFGA 3EB9A 4JK3A 4P81A 2JC3A 5L45A 1RWOA 2BGRA 3IHWA 4M98A 3HYTA 2DHDA 5IZ4A 3VU8A 2AXQA 5BN1A 4X6YA 2XKKA 3DFUA 4L50A 3KWMA 4QYSA 4TPKA 3FFWA 4ZYXA 4GL2A 2O54A 2JIMA 3NTRA 3WGJA 1FSPA 3K16A 3W9BA 4BXOB 2YXEA 1YBFA 1NX6A 3R4CA 4Q12A 4F60A 4M0MA 3ZV6A 2KI5A 3L6EA 1M10A 2PTGA 3B78A 4G36A 1HWYA 3IEUA 4RZSA 5JMOA 4Q1VA 3RS9A 4ZI7F 4XB1A 3UKJA 3DCYA 1TC2A 4PO8A 2ZPUA 4YJ3A 4AZFA 4GP7A 2BE7A 1Z33A 4QJ4A 3RU2A 1NF9A 2EERA 3GJ6A 3TPCA 2VUSA 4OXRA 4AP6A 5IEBA 2YBDA 5F5LA 1Z7GA 3IAM6 5CDYA 1H1LA 2FPGB 3H5NA 3GP8A 1QJ4A 1CERA 3T1YM 4BMXA 1O6FA 2IF0A 3BK1A 1HRKA 1Z4NA 3P0IA 4OK6A 2HLNA 4RLHA 4X00A 3MBOA 1LLDA 1Z9BA 3JR3A 3LT0A 2ZRQA 2QQ8A 4JEMA 5CMLA 5I6DA 2AHOA 1XQWA 4B4WA 1QHXA 1K66A 2YRWA 3K9OA 3Q6NA 3ICCA 4ICIA 3FNRA 5KQGA 4ZCIA 2AW3A 5EJ7A 2LR0A 4HUJA 3WGMA 3INGA 4Q02A 1GRQA 4QLOA 1N2CB 1X3SA 4DQXA 1DBSA 3LUPA 4ARZB 4DANA 5CDTA 3KQNA 4LKOA 2H5XA 1WSAA 1Z8DA 2OT3B 1AUPA 2JK1A 3LFUA 3OJWA 1VKRA 3D6MA 2CL5A 4TVOA 2W6ID 5DBOA 2ZYTX 2VSFA 3BORA 3LDAA 4MEAA 1J8MF 3BB3A 1JZQA 4HEA1 1G5FA 1MT3A 5HKLA 3REOA 4N5HX 2ZE7A 2EWVA 4CDRA 3C3KA 4C2AA 3KYIB 3P7MA 1R18A 2NO1A 2PSHA 2GM9A 4JYPA 3SICE 2O8CB 4OY3A 3OD5A 4GITA 4RBNA 1O94C 4PWYA 5SY6A 1Q0QA 4B76A 4XOIA 1G98A 4GMFA 3GN2A 1PV2A 2JNWA 3RUFA 1J9ZA 3JZDA 3OAAD 4MZXA 4FFLA 4HS4A 3W4JA 4OLJA 1FOEB 2UYOA 2NZJA 2V3WA 4N5DA 4D57A 3E84A 5KQPA 1GL7A 3R23A 4BMVA 4PSAA 4J16A 2PRKA 3GVCA 2RI1A 1GT6A 3L7AA 3OG9A 4N18A 5TPWB 1KYTA 1SXJA 4B3IA 1FLNA 4M9ZA 4L7QA 5IU6A 1KWKA 5AM0A 2QLFA 1KQFA 3W05A 4J90A 1TTTA 2A5GA 2C9ZA 1W34A 2REOA 3SJAA 1KSHA 3RS3A 3EVBA 2BYTA 5FF9A 2PVCA 1IMOA 1K63A 2EW2A 5IANA 1D6SA 1KAOA 1OXXK 2R00C 3V1MA 1JIVA 5JC1A 3NHWA 4EHAA 1Y42X 2OC4A 4MDEA 3HH8A 4W8OA 4LF4M 1KZ4A 1VG0B 1JI0A 1CUWA 4IKOA 4TT3A 4BFYA 4S1WA 2UZAA 2K47A 3RO7A 1X80B 4N47A 5B30A 2A0YA 3DTVA 2V9ZA 1SCJA 3KVWA 4CCYB 5AOAA 4E3ZA 4P36A 4X85A 3U6OA 5LKRA 1IVYA 4NU5A 2QRLA 1KZ1A 5L8RF 1N5LA 4JLAA 4NNPA 2QV7A 1R0LA 2CXTA 3QPAA 4GEGA 3TG8A 1BH2A 1YQWA 3N76A 4D92A 4YR7A 5AM2A 4JX9A 3MK6A 1E1CB 2P41A 4IRMA 3DCIA 1WDKA 2VH1A 1SC3A 4RETA 5ALMA 5DU2A 1CQZA 3H05A 3KT3A 4OAOA 4XCQA 5LKAA 1HMYA 1Z5AA 2CFRA 1HM5A 3KYDA 4GKJM 2C92A 3GFBA 3QUQA 4NBTA 5ITVA 1V6CA 3GRRA 1CDZA 2QJRA 1NQAO 3HHEA 2CVFA 1OIZA 3O2QB 2YXNA 1C4WA 4KNVA