1NV9A

Hemk, apo structure
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
b'KIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSALFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemK protein
molecule tags Transferase
source organism Thermotoga maritima
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
total genus 88
structure length 264
sequence length 270
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv9A02
3CBGA 2JNHA 1BC5A 2IFTA 4V0RA 5CVVA 4E2WA 2K0BX 2MROB 3OU7A 2WK1A 4M36A 2B9EA 2OYRA 4E2YA 5E9WA 2OKCA 1YFJA 3OCJA 3GWZA 2GB4A 2DAIA 4PYKA 4RTSA 2HTEA 1HNNA 1HT1E 1KYZA 4GC5A 2OXTA 4E32A 3IV6A 1RI1A 4ER5A 1NW8A 3HCAA 4RTNA 3LBYA 3PX3A 5HIJA 5DM1A 5K09A 5LQRA 3HTXA 5JI2E 4DF3A 2EKKA 1G8AA 4KDRA 5BW5A 4CXMA 3QOXA 5EVJA 1D2CA 3HVHA 5GWXA 3DOUA 2KHHA 4RTMA 5C1IA 2IIPA 3FTEA 4GOMD 3AJDA 3TPZA 4CTJA 3V97A 2YX1A 3V8VA 4QPNA 3FPJA 3JWIA 2B78A 1DO0A 3AY0A 5JR3A 3NJRA 10MHA 1AIPC 2ZTCA 2OB2A 4R71A 1KPGA 1SUSA 1VE3A 3B3GA 3B3JA 3TRKA 3PTAA 3FE3A 2GAFA 3R3HA 1Q02A 3H2BA 2FK7A 5CM2Z 5K0EA 1UIRA 1ZQ9A 1FBNA 2LD4A 1ZHFA 2NXCA 3HM2A 4E30A 3ER9A 5DSTA 3DXXA 2XVAA 4ER7A 2UYCA 4BLUA 1AQIA 1WIVA 2CP8A 1FPQA 1PJZA 3EVAA 3FYCA 4XUCA 3MHTA 3EVZA 3LX6A 5D1NA 1NW7A 3SM3A 2Z6QA 1RI3A 2P41A 2FHPA 2O25A 2UZ4A 1P91A 4HGZA 1V92A 2YXDA 3DR5A 3LDGA 1INLA 3M6UA 1X1CA 1X1DA 4GOLD 4PCLA 4X41A 3DMHA 4AZWA 1R4GA 2VS1A 2WZJA 2B25A 3UA4A 4HTFB 4RVDA 3KQPA 5CVJA 4QDKA 3FPEA 1G8SA 3REOA 3TKYA 1IXKA 3DLCA 3UJCA 1EJ6A 2AVDA 4MTLA 2LVNC 1NV9A 2ZIGA 5KQSA 3RIEA 3THRA 4QPPA 3BBZA 3UWPA 5CCXA 4GEWA 2PLWA 1OR8A 1JQEA 1NW5A 4HRAA 4EKGA 3M33A 4EVIA 2AN3A 2ZCJA 1YUBA 4HEOA 3BWBA 2DKLA 5F2OA 5G02A 5H02A 2YXEA 1O9HA 2BR5A 3D2LA 4KIGA 1DV0A 4GOND 5FCDA 2P7HA 2OOBA 4FP9A 4WXHA 2HV9A 2AOTA 2BR3A 3DXYA 3EVBA 1NBHA 2EJSA 4KRGA 5KS2A 3GLIE 3BT7A 1YFLA 3DMGA 3SR4A 5T67A 2K4MA 5DRYA 1SQFA 2QE6A 1TPYA 4AUKA 2Z6AA 4M38A 2I62A 1QAQA 1FJXA 3ID6C 1WS6A 2VDVE 1JG2A 2PWPA 5K0CA 3GLFE 5GM2A 2JHAA 1JSZA 1WGNA 2LBCA 5ICEA 4MIKA 4U7PB 1JG4A 4G56A 3CCFA 1E94E 2PV0A 1G38A 3DP7A 1RI2A 2PT6A 3ELYA 3G2PA 3HVIA 5MHTA 3GDHA 2PXXA 3QOWA 1WZNA 1SKMA 4YMHA 5KVAA 3HCDA 2NXJA 3M70A 4Y30A 5E8JA 2B2CA 4OQDA 1R00A 1L1EA 3MAGA 4WVLA 1IXSA 1SUIA 3KPVA 2NNWB 3T7SA 4RVGA 2LTUA 1B42A 4E33A 3DH0A 5T64A 2ERCA 3EVGA 5DFLA 1VEGA 2I6GA 3TR6A 2H11A 3PT9A 2GPYA 3BKWA 2HWJA 5EC8A 1RJFA 1R74A 2ZSUA 5EZSA 2JUJA 2OBFA 3FTDA 1TW3A 2P35A 2R6ZA 2ZULA 3GCZA 5GP1A 3TOSA 3TLJA 1UWVA 1Z3CA 2QM3A 2WA2A 1G6Q1 3BKXA 3EPPA 4RX1A 3BWYA 1BOOA 5EMJA 3NVKI 3M6VA 5EMKA 1WXXA 3KR2A 4PNEA 3P2EA 4RV9A 3SSMA 3E05A 5GIOE 2PBFA 3G88A 2YXLA 2IPXA 4RTKA 2H5XA 2IP2A 4MQ4A 2ZBQA 1KPHA 4C03A 3I64A 2AOXA 2G1PA 5EQJB 4XCXA 1R8XA 4RTQA 2EFJA 3DTNA 3Q7EA 3UBTA 4BLVA 5E1MA 3BGVA 2IBSA 2OZVA 2BZGA 4FZVA 2AS0A 3HCCA 2FRXA 1ZMVA 1QYRA 5EKUA 2AOWA 5DRTA 3UJDA 3HP7A 4LG1A 2QSFX 1FP2A 2L4EA 3G8AA 2CWBA 1OKSA 3K9PA 2CWWA 4PGHA 4KIFA 3KU1A 3VC1A 2QHOB 1JSXA 1Y8GA 3LGAA 3NVMB 1BVSA 1NBIA 3BGIA 3E46A 2ADMA 4GF5A 2I7CA 5FQNA 5FQOA 3TQSA 4QVGA 3FPGA 3T0IA 4YUYA 4F85A 3TFWA 3ER8A 4YV2A 3P71T 5CUQA 1HT2E 3LSTA 4ISCA 3FYDA 3X0DA 4AX8A 4YMGA 1ZMUA 1ORHA 4M7RA 1G60A 3GLHE 2PVCA 2JY5A 2XYRA 3MERA 1VBFA 4K6MA 4PONA 5EIFA 1EIZA 3GJYA 5HEKA 2OOAA 2KNAA 3CJQA 3GNLA 4P58A 3FUTA 5K0NA 2OO9A 2LVQD 5K0BA 5T6BA 4DKJA 5DM4A 1I4WA 1XXLA 2AOUB 4IV8A 1P1CA 9MHTA 4LWPA 5LQKA 4P7FA 2G70A 2E5WA 2VDWA 5K0JA 3BUSA 3SGLA 1QZEA 5CVDA 2LVPC 1IY9A 3GRYA 1TTEA 2JY7A 3EVEA 3EVCA 5ICCA 2RRUA 3O7WA 3G5LA 5EPEA 3UZUA 1KR5A 3HA7A 4IV0A 1F4IA 4R8RA 1IM2A 5FA8A 5CCBA 5EMMA 4YUWA 4DQ0A 4KDCA 4JXJA 4X1OA 1SQGA 5JUWA 3KPWA 5DT2A 3PLAE 4L7VA 2VZ9A 4GUAA 3OE5A 2Y1WA 1VP9A 3FUWA 3MTEA 3UJ9A 1NKVA 5LQUA 4QDJA 2P7IA 1NV8A 2IH2A 4M37A 4G3OA 3KQOA 2DZLA 3MTIA 2FYTA 5FWAA 2G72A 4FSDA 2VDUE 3MGGA 1D2GA 3OZSA 4MWZA 2ORED 2WA1A 1L3IA 1T43A 2N47A 3E21A 5EEHA 3KPJA 1YB2A 2A14A 3CVOA 4PIMA 3G2QA 5FULA 3VSEA 2ZVJA 1HJPA 1OAIA 1XDUA 4YUXA 1N2XA 2DENA 4PYMA 4RYLA 5HOQA 2HWKA 2XYQA 2DAMA 3KQWA 2DPMA 1D2HA 2P40A 3E8SA 3FUVA 1T6OA 1O9GA 3KQTA 3C0KA 3MQ2A 1BHJA 4F86A 4ATNA 1Y8CA 3B3FA 1KYWA 1R6AA 2FPOA 2ZWVA 3DUWA 3GGDA 5E1DA 5F2KA 3RODA 3NMUF 5GIPE 3OPNA 2OB1A 4HTFA 2OO3A 2XBMA 3B7PA 3OU2A 5DTQA 2PX5A 4CKCA 1H1DA 2HNKA 4C05A 2QRVB 2PXCA 3ERCA 1PRYA 4LWOA 1VPTA 1F3LA 5HIKA 1EAMA 1DO2A 2MR9A 1M6YA 3KQYA 4DCMA 4EKIA 1MHTA 1YZHA 2L2DA 3F4KA 3GRZA 4A6EA 3SVZA 2DULA 1G4AE 2P3LA 3R6TA 3OFKA 4QVKA 2UYHA 5CD1A 5EEGA 1QANA 1VL5A 2ZIFA 1ORIA 3G5TA 3UJ7A 3DLIA 3NTVA 1IM8A 4OBXA 5D1HA 5E8RA 2PWYA 1XJ5A 3MMPA 4PYIA 2JY8A 4DCGA 1OTRA 1VP3A 5B1SA 1SG9A 3PFGA 2IGTA 1XDZA 2GS9A 4R6XA 2P1DA 5IH3A 5E9JA 4Y2HA 3G2MA 3MCZA 2JY6B 3A27A 3A7DA 5K0LA 3KPYA 3LECA 5K0FA 1JTEA 2G8NA 1XCJA 2EJUA 1X1AA 2Y1XA 3HEMA 4IKPA 1XDSA 1ZGAA 4RWZA 2NP6A 1A5TA 2FK8A 3E7PA 3P8ZA 1C7YA 4PCAA 3LBFA 4EK9A 1CUKA 1WHCA 2O05A 5LR6A 2GA9A 2BM9A 4Z2YA 2HAKA 5EZQA 3K6RA 2PKWA 1HMYA 3CJTA 5FTWA 3H4JA 3T7TA 3I58A 2K9DA 1AF7A 3DULA 3I5UA 3THSA 4C08A 4CKBA 2ONYA 2IDKA 1M6EX 3KQQA 5DTMA 4FS8A 4F1IA 2KW5A 4A6DA 2NXEA 2PX4A 3CGGA 4DMGA 5EKXA 1VLMA 2H1RA 3A25A 3M4XA 4ER3A 2P3QA 2JH9A 1ZG3A 4PWYA 4Q7JA 3BWMA 2JZ0A 4RSRA 2HR1A 5EG5A 2C7OA 3G8BA 1JG3A 5DXJA 2OPBA 2QRVA 2AN4A 3CJRA 2B3TA 5FUBA 1EQAA 4ZTBA 2G3QA 2KNZA 4DBGB 1XVAA 3A26A 2JG3A 2ZZNA 2LVOC 1NT2A 4AZVA 5KQRA 3U81A 1ZGJA 3G7UA 5GOZA 1VEKA 1WR1B 3IHPA 2PX2A 3FZGA 1RI4A 4QTTB 3LHDA 4YV1A 2JHPA 5F2NA 5CIYA 2PJDA 3C6MA 3RW9A 4E2XA 5LQJA 3ELDA 3ELUA 4GOOD 3PVCA 5C0OE 2Q41A 5DX8A 1G41A 1XXHE 2R0IA 2NXNA 3HNRA 3NWBA 2NP7A 1L9KA 3CKKA 4PYOA 2CKDA 1NW6A 4XUDA 5E2AA 1WGLA 3HCBA 3OFJA 4YUVA 3UJ6A 7MHTA 4HC4A 2UYQA 1NE2A 3P9IA 2L4FA 5DLYA 4E70A 1YLAA 3PFHA 4GBED 1EFUB 4KVZA 2LVAA 1L3BA 4FSXA 5DSXA 1AV6A 1BKYA 2MGWA 1N7IA 1RI5A 3O4FA 3K9OA 4FT4A 4LECA 4X63A 3M6XA 2C7PA 2QYOA 4KWCA 3IYLW 5ICGA 3A4TA 3R24A 3P9CA 4P7GA 1JR3E 2CMGA 5DM2A 4OQEA 4P7KA 3IHTA 1UFKA 3EMBA 3EVFA 3UFBA 4HG2A 2BWEA 1GO5A 2P3OA 3FRHA 3GRRA 1G3IA 1NW3A 2ZTHA 3K0BA 3KR9A 5EOVA 3A7EA 2YUIA 3CC8A 5FHQA 3KR0A 2QY6A 3PB3A 5GM1A 4C06A 4POOA 1DUSA 4RTRA 1G55A 2QNJA 4XUEA 2ESRA 3P2KA 2EG5A 4C07A 4E31A 2ZBRA 3VYWA 2JH8A 1XCLA 4KW7A 3VC2A 4BY9E 2AN5A 3ELWA 4H0NA 3BWCA 3GO4A 2AOUA 1V39A 2O0LA 1TW2A 3GIWA 1VG5A 2CL5A 2IH5A 5E1BA 2PXAA 2P8JA 3QV2A 3UA3A 4DZRA 5FHRA 2Z6UA 2JHCA 3LKDA 2IH4A 3PX2A 2UYOA 2ZW9A 3BXOA 1KPIA 1KP9A 3L8DA 5EIWA 2V7EA 1VIDA 2PY6A 3EMDA 2PT9A 3GXOA 5ICFA 5K05A 1EG2A 1Q0TA 2IDJA 3DXZA 4RTJA 1R8YA 4RTLA 2HMYB 5LSAA 4B17A 4RTOA 3NDJA 5BXYA 8MHTA 1DL5A 3OU6A 5LQAA 4DA4A 2YR0A 1TR8A 1VDLA 3C3YA 1F38A 4QTUB 1Q0SA 3Q87B 3P97A 4GQBA 4ER6A 1KHHA 2O57A 3NW9A 5HIMA 4RVHA 3UJAA 2ZZKA 1QAMA 3DMFA 1R18A 1P1BA 5EHGA 5K03A 1DCTA 3JWJA 3LL7A 4MHTA 3TM4A 4OX9Y 3TMAA 3AWIA 3FUXA 1WG8A 2ZTDA 1JG1A 2ZWAA 3I9FA 5KYGA 1X19A 3ANXA 3HCFA 5DM0A 1JQDA 2F8LA 3EVDA 5M5BA 2VP3A 1KIAA 2FCAA 2EJTA 5K8VA 2BH2A 1RJGA 5EGSA 1KYIA 1L3CA 1AQJA 5HZMA 2IBTA 1EJ0A 5IKMA 1ZKDA 4QQKA 4V0QA 3HVJA 3WSTA 3R9XB 4OA8A 1RJDA 3HCEA 4YUZA 2JJQA 1YF3A 3SSOA 2BM8A 3NWEA 4PYJA 1XB2B 4BP1A 3LCVB 2ZLBA 4E2ZA 3JWHA 3UJ8A 2AOTB 5CVEA 1U2ZA 3SX0A 5FA5A 4P7JA 3LCCA 5EHIA 1PGYA 5LQCA 4GEKA 3GU3A 4CTKA 5E1OA 3FPFA 2ZZMA 1RJEA 2GLUA 4EQZA 2PX8A 5C9ZA 3GRVA 4BP3A 5DX0A 2EKFA 1ZV1A 3EGVA 3O31A 5E9QA 4IWNA 2CMHA 5BP7A 4WP2A 2V74B 2OY0A 2EX4A 4RTPA 3SMQA 3GRUA 4AZTA 4O29A 4PYQA 1VQ1A 3SSNA 4ER0A 1I1NA 1O54A 3ORHA 2YQZA 4HGYA 3R0QA 3FTFA 2JP7A 2XYVA 3AXSA 3GLGE 3LDFA 3OZTA 5BW4A 1XTPA 3B89A 2O07A 4NECA 3HA3A 1YZ3A 1WXWA 3FTCA 4FT2A 4R05A 2JZ1A 3AXTA 5DXAA 4GC9A 5DTRA 5HFJA 3S68A 4DM3A 4F2LA 5FWDA 3F92A 1X1BA 4F84A 1QAOA 5E2BA 3FPHA 5DX1A 1FP1D 2MJ5B 3P9NA 2ZBPA 4HH4A 4R8SA 3T7RA 4RVFA 4PYLA 2NYUA 3ME5A 5HIIA 1IFYA 2DHYA 3KQVA 5P8WA 4C04A 3EGEA 3OE4A 3IECA 1KXZA 2AVNA 3HA5A 2DAGA 4UOEA 2C7QA 3SXJA 2AOVA 2R3SA 2XVMA 1MJFA 1UFZA 3LPMA 4QQNA 4PINA 1HQYE 4U7TB 4BLWA 4EMSA 1MN3A 3FRIA 2DI0A 5DWQA 4CWAA 3EGIA 2G71A 3KQSA 3E23A 4FR0A 1M0EA 5HILA 5GINE 3HVKA 2BWBA 2GH1A 3JWGA 3OZRA 3MCTA 3P2IA 4OBWA 3G89A 3FUUA 2DNAA 4AZSA 5CVUA 1SVUA 1JQ3A 2ONZA 3B5IA 3IEIA 3MB5A 3KR1A 4C4AA 5LQNA 3C3PA 2AZTA 4PIPA 4R6WA 2KNVA 3LCUA 5U4XA 1P39A 2AR0A 4YV0A 3C6KA 2PSSA 4HSGA 1OQYA 3EEYA 3P9KA 1JTFA 5K0GA 3LDUA 3KPUA 3LKZA 4PYNA 2DAKA 5DPMA 2O06A 5K01A 3T6PA 4OA5A 4CKEA 3TM5A 2ZIEA 1QZZA 3G2OA 1ZMWA 3BGDA 3KQMA 4UN2B 4X60A 5ERGB 1I9GA 3EEOA 3I53A 1WJ7A 3TKAA 1N7JA 3UJBA 4FGZA 1WY7A 4X61A 5EMLA 1VEJA 3M6WA 3NDIA 2I9KA 2BR4A 2ZFUA 3KHKA 3KKZA 2YTZA 3PS9A 5FADA 1JR4A 2H00A 4PGGA 2YVLA 2PGXA 2C7RA 1P3QQ 3BZBA 2DAEA
chains in the Genus database with same CATH superfamily
1XKTA 2WC1A 1KYVA 3ZDYB 1MLDA 3NWPA 3AG5A 1D0IA 3HGIA 5TEWA 4OGGA 5CLJA 2K0BX 5LJIA 4REQB 3OU7A 2RGRA 4KK4A 5H4GA 1AXEA 1KMIY 4C3ZA 5JJ5A 3OA2A 5J40A 4IM7A 1YGPA 3B1WA 1DRWA 2AD1A 2ZSDA 1A9PA 4MI1A 4EZEA 1OBHA 2VPTA 4LS3A 4D0NA 3UB4A 5C35A 1O89A 2OO5A 4G84A 4XPIA 3BX1A 4TM7A 5KHAA 4L08A 2XJ9A 3B6ZA 3GYBA 4JBWA 3MJ4A 4H4DA 1A5SB 3TDKA 1MO6A 2IIPA 2C2HA 2UZAA 4GOMD 2XA2A 2YASA 5TPZA 2VXYA 3I5XA 2QMOA 4R1NA 1EUZA 1V8OA 4PVCA 3TRHA 2BPOA 4G0NA 3WHLA 4AIIA 1DO0A 4IGAA 2WDZA 1D4ZA 1DC8A 2DWCA 2HIGA 2WUGA 3U80A 1H9BA 1PJ4A 4RKFA 4TXMA 2XAUA 3PPWA 3R3HA 2BYTA 4FS3A 5CM2Z 1JEOA 1N2CA 4XWWA 1JSCA 1WMBA 4TQGA 2BGLA 2PKRA 2QRQA 1G17A 2CLSA 1JEYB 2P9ZA 1J20A 3X1KA 1GPUA 3HL4A 1B8OA 2ZPUA 3LL4A 4RDIA 2P41A 2EW1A 3AHHA 1PQ4A 4QXMA 4EGQA 2GF2A 3Q6MA 4IUYA 6NULA 3GMIA 3PHIA 1NFRA 3QP9A 4WXMA 2HYDA 5G0WA 4OHZA 3VO9A 1IWOA 4FR2A 2GMWA 3K1AA 4PCLA 3IQDB 4IFBA 4AY3A 4US1R 1WMFA 3AF5A 3E9SA 1ZNXA 1VM6A 2BUCA 3RWBA 3QI2A 1SC9A 4R9VA 2VSOA 1T8YA 2CXRA 4I3GA 3EGXA 3JQBA 2LVNC 3LBAA 2JLCA 2DWZB 1EFHA 1UBGA 3HBAA 2MSKA 4NEQA 4B3XA 4ZT6A 4A8HA 2CXNA 2ATXA 2VXBA 4Q4JA 2N46A 2PNFA 3HMKA 3USZA 2GPJA 3V1KA 3LTNC 1ZNZA 1JV2B 4WKBA 2DKLA 1NQWA 5DNAA 1WSWA 2JJ8A 5F4ZA 1HNWM 1DC7A 1NL3A 3RB8A 2B21A 3K7EA 4GMKA 2P7HA 1FFXB 2RBEA 3IUSA 3PXUA 4HBGA 4HEQA 2XODA 4TS3A 5CA0F 1LX6A 5MGNA 3M4YA 5TMDA 4HCJA 1YCHA 3TL3A 4D98A 1T0IA 2C54A 4MGKE 4NCNA 3PTZA 1NRIA 2W93A 3WIOA 2FP4B 2K4MA 2PSFA 2WVJA 2XNHA 4X7MA 4I19A 3RYIB 5I9TA 1AM4D 5T8KC 3J81k 3FCYA 4YRNA 2R18A 1O1YA 4CN9A 3Q41A 3ETLA 1NPYA 2CJWA 2JHAA 3WI7A 1QG0A 4OQLA 5EJ4A 1FRZA 2FVXA 3RBVA 2KBEA 3BCHA 2D1SA 2PV0A 4EG8A 1GXSA 3H0CA 3FMFA 4O02B 2HT6A 3BF7A 3M1IA 1OASA 3H7IA 1GG9A 5TEVA 1OIXA 2XHZA 4Z0NA 2G76A 3N8HA 4RJ2A 4ZZ2A 3GZ4A 2PZKA 5KB3A 4RPKA 1QG6A 1SB8A 4L5JA 5LMUM 2PCJA 3U31A 4L3VA 2NNWB 4WZAE 3VDNB 2ZAIA 5KYYA 1Q57A 3PGXA 2H0AA 4CLEA 5M3BA 4LF6M 3ORSA 4YTEA 2ATCA 2X0JA 5JDIA 1IHDA 1NRXA 3Q3GE 2V0GA 3UOGA 1IBCA 1FVHA 1TW3A 2XT0A 2ZULA 3AL2A 2JGNA 2PSJA 2V6JA 4LK2A 4BE9A 3A31A 2PX0A 4R41A 2CVPA 2OZPA 4TKLA 4EVSA 1PGOA 4LAFA 4RM2A 4KSBA 3PJEA 1SIBE 3MZ0A 4JJEA 3WWYA 3ZI4A 1IY0A 3NNDA 2IPXA 1JE1A 2C04A 5IULC 2AOXA 1QH9A 4WBNF 4ZYLA 2EFJA 3DTNA 1YR2A 2VUHB 3BGVA 1JWBB 2OZVA 4DZTA 3F3YA 4EUSA 3QWLA 1W75A 4HAYA 5DRTA 3LLMA 1OLSA 1VE5A 5B3AA 2FGKA 4DYDA 2FRDA 3UFXB 2QHOB 4DQKA 1SBIA 4F5EA 2HKIA 1ENPA 5CRIA 4RESA 3FN4A 3JV7A 4JUBA 3VYRB 5B37A 3QHPA 3VVMA 3D8SA 3LSTA 2J08A 3EWIA 2ZRQA 4OHCA 4ZEOA 1I36A 2CK3D 1ZMUA 1UPXA 1IZ7A 2HU7A 2DP4E 3H4IA 1GPJA 5JSHA 3CG0A 3MERA 2HDHA 3QLVC 3CWQA 4ND1A 3QF4A 2OGUA 2J4DA 2EKDA 2HA2A 3KT3A 4NBVA 3ENWA 3GFQA 4RC9A 4X44A 1TRKA 3BDVA 1HQKA 5JWHA 3TXAA 1G7RA 1E3WA 2VJAA 3HJ8A 1EXWA 4MLPA 1I0ZA 4YDHB 4U7DA 9MHTA 2JIZD 1T8WA 4FX2A 5IZCA 1NXXA 4LOHA 1YMUA 3F4LA 4Y2GA 1ODLA 3DZBA 1P18A 1R3DA 3G17A 3OC0A 5GJWC 2QRJA 3EULA 4IVPA 4PHHA 3LGSA 4BVLA 1E3EA 3K2QA 3ZV4A 4PWZA 2FN7A 3USES 2ZYDA 4NATA 4GG1A 2X4LA 2J9FB 3B9PA 3ZHRA 1IM2A 4C3UA 3B5EA 2QJRA 3I8OA 3LHKA 5H68A 2LIPA 2RAUA 2XMGA 3ZIUA 4KREA 3E22A 2I78A 3RYCB 1CEXA 5CT9A 1FXWF 1CR0A 1ZCJA 2FEOA 4L0QA 1ADFA 4LY0A 2AK2A 3KT0A 3RVDA 4JI3M 5HKLA 1VKJA 1XAHA 3WJ1A 3C98A 1X2EA 3H9JA 4U2DA 5FWAA 1R0RE 1M75A 1RXCA 2VQSA 3G6KA 3TQFA 1GZDA 3MGGA 4AY4A 3LKBA 4CMBA 5KPDA 2TMGA 3AEXA 2ODPA 4JT8A 1NP6A 4RA6B 4F9TA 3IAUA 4M8IA 4WUVA 3F3MA 5EEHA 1RWVA 1PTJC 2WIJA 1KAGA 4MOWA 4LG2A 4Y3UA 3SJCA 1AKNA 4QSMA 1NZJA 4ND5A 4OTZA 1HDIA 4PRYA 1QLWA 1HFEL 1ZIYA 2Q5CA 2ZWMA 3JAWA 3KCNA 4DQLA 2RI6A 1TAUA 2W00A 4RF1A 4EO7A 1MXHA 2AQKA 1HYHA 4BVKA 4B7AA 1JH9A 3A4NA 4FMCB 5IM5A 3TJRA 2PVSA 2RCNA 4QSHA 3UJ3X 5LA6B 3ZKAA 4CYMA 2DETA 2MSLA 2X8AA 4MUBA 1DLIA 2AMFA 2PIAA 3QU2A 3QMMA 4W82A 4F46A 2BBTA 4TV8B 2KZUA 3OWXA 2O2ZA 4FQ5A 5K6RA 1ISRA 2IQIA 3U0VA 1YS6A 1RYMA 4TL9A 2Z58A 1ADBA 4G0ZA 4PHTA 1IOWA 3QE0A 5AQ1A 2D1YA 4U5XA 5KO2A 1EFPB 3PCTA 2VYVA 3QPAA 1VFNA 2HEIA 4FFNA 1IJFA 1ORIA 2WE8A 3VZCA 3A0UA 2QP3A 3RKRA 1T2AA 3QU7A 1ZUWA 1QV7A 3EQZA 1TPZA 2F3PA 2XE8A 4MGZR 2OG1A 2EW2A 3DE5X 4M9CA 1JHXA 5K0LA 2PVPA 4CR8A 3LECA 5IH7A 5IM4F 5J63A 1JTEA 1PQPA 3SSAA 1FDWA 1XDSA 3NASA 4UPDA 2ZTMA 2GJ4A 4NFLA 1I5RA 3D6TB 4C0WA 5LWQA 3W3AA 4LNUA 4ENUA 1KAEA 2WJVA 4KB5A 2X23A 5JEEA 4N3BA 4UEWA 3I5UA 1CJBA 3FNBA 4G41A 1Y89A 2F43A 2Q0SA 4ON9A 3DV2A 3IG8A 5IKOA 2AFHE 2I4MA 3DEAA 1KDZA 4GFDA 1KXJA 1COWA 1SD1A 1YJCA 1W35A 4J0GA 3ROFA 3WKDA 4YCCA 4JHLA 2IE0A 4P0PB 3FCXA 4PBRA 6REQB 3MBOA 1FRNA 2O2YA 2ERXA 2IYPA 3IX7A 3ZOZA 9GPBA 4OHMA 4Q7JA 5JNWA 2OHFA 4IHKA 4HJXA 3TBKA 4XTCS 1SUBA 1R2QA 2OPBA 2QMZA 4JI2M 1JIKA 5TF4A 2G3QA 1OYVA 2C2ZA 1I3MA 5EJ7A 5F3WB 2PKQP 3M6IA 1JA9A 1U0SY 2BI4A 2Q6OA 4HDQB 1A9YA 2UYGA 1IAQA 2GK7A 3WK8A 5IM4A 4RK0A 5TQ0A 4AUNA 4KRFA 3ZV6A 1J21A 4O8CA 1ZM9A 1Q7CA 4JLVA 4FB5A 4OQQA 1W2GA 2GETA 2O2DA 2O48X 3C6QA 1QCDA 3PNKA 1T9GS 1UJ5A 3R23A 3Q2OA 3Q3VA 4LJ4A 1GADO 2PQMA 3R7NA 3ZY4A 3IC5A 5I6DA 5IKPA 3I9V1 2XKJE 1GVNA 3NHZA 3RK1A 1IEQA 1XXHE 1G5FA 1ZH2A 2V96A 1WW3A 2CY0A 3UUEA 2E87A 3HCRA 4XUDA 4LA4A 5EE3A 4K7JA 4Z9FA 2VNSA 4D96A 1S2IA 1J5XA 4Y9RA 1NU6A 3G8CA 3FD8A 1V16A 3N2GB 3UAZA 2LVAA 4FSXA 4UOZA 3BB3A 1ADGA 4YJDA 5JYBA 5BR4A 1UC4B 3IMKA 3G2IA 3D0OA 2QY9A 1M2VA 1MX5A 3TAHA 3G79A 2Y1LA 4DG8A 5I7EA 4P7KA 3IEMA 3IHTA 3EMBA 3K8OE 2F5QA 4NBKA 4OQMA 2VP9A 221PA 2BE7A 3A7EA 2HCJB 4BVGA 1M34A 1HDYA 1U0EA 5GM1A 2O2EA 1EINA 1RXSA 3DZDA 2XD4A 1KJZA 2CUNA 3J81A 3KSUA 1HT0A 2RH5A 1DELA 4J94A 1P0QA 4BKUA 3LUCA 4JVLA 4KN5A 1UM8A 1XMOM 3UEOA 1VG5A 4ECAA 3KOZE 3QFSA 2XF8A 1XLWA 2CBXA 2VFAA 3O73A 4DZRA 3RRFA 4TLEA 2JHCA 3EZLA 1QH8B 2HNBA 2P69A 2QZZA 2WLTA 3L7OA 1J99A 3HBNA 3LC0A 4D57A 2QTLA 3CZMA 3EMDA 1DO8A 1RXIA 1S7CA 3FSGD 1LI4A 4HAOA 1RHUA 2J6HA 4WBNB 3VO1A 3W2IA 3AFHA 3BTVA 2E55A 2V7UA 3MMSA 3B2QA 2LWXA 3NG1A 4GH5A 4HXFB 3WYFA 3PA8A 4JT9A 1KSGA 3K70D 3W0FA 1U9IA 4BO4A 1F38A 4B3TB 4Q9LA 3GEIA 3O4IA 4GYYA 5EJEA 2ZXUA 4L0DA 4UHFA 3QNMA 4Y6SA 4C7KA 3L8CA 4OP3A 3B6IA 1CULC 1SUCA 2VXCA 4EMTA 4G0UA 1FSPA 5DEIA 2WFAA 4F7DA 1YIDA 4CG1A 2IY9A 4GYKA 2P1ZA 4Z6YA 2HU8A 3TSOA 3ZJ4A 4YREA 4CL3A 4X1KB 1QQ5A 1U31A 1N34B 4QWWA 2D0DA 4C4SA 2CFIA 5M5BA 4RKRA 5TGZA 4QJIA 2P3SA 4NU5A 1YQTA 3KL4A 1XHFA 3PPYA 5KCZA 3K15A 1E4EB 1YQUA 3WZ2A 1NC1A 3GUCA 3FY4A 1HLFA 2NV2B 2Q99A 1JIJA 4DTCA 1IQUA 4JYCA 2EX1A 2VRCD 1AQLA 1Z08A 4YP0A 2ZSHA 3WFZA 2AEFA 2BNKA 2YNMD 3U6CA 1SFRA 1QVWA 1M7BA 4B3FX 1NVFA 1A8UA 3A1VA 4XK8F 1M0SA 4B3DA 2PUEA 3ZQ4A 3ANSA 4LKOA 4CTKA 2AFIB 1KBQA 4RSMA 4C7VA 3FSRA 1ZGZA 1K2VN 2RJOA 2V6IA 2GF9A 3ENKA 5K3DA 4FONA 5AOCA 1KHTA 2YUTA 1T5OA 2Z5VA 1NPDA 3AEZA 3CLUC 3DZCA 2ZJ8A 4JDPA 3NHKA 3RHSA 2DPGA 2EJVA 5B1IA 2QIOA 4DEYA 4DPKA 2ZT5A 4N5IX 1PVOA 4FW8A 4BKOA 5CDHA 2DHDA 3LKVA 3LOQA 4O29A 4QEKA 3ZCQA 1PKEA 4XVHA 4DGSA 2HKJA 4KX3A 5IF9A 1GZ5A 4M0UA 1L5HB 4Q7QA 2WAAA 3HZJA 4G6ZA 1OWNA 2BSAA 3VH4A 5BV1A 3NGMA 4ZXPA 2MWMA 2ONKA 4MA0A 5LIPA 2P4UA 4PLPA 1OFVA 3SYNA 3SZLA 3BFPA 5JSKA 2OCDA 3ZXUB 5E2BA 1MB2A 2C9MA 8CATA 1JFVA 3CLVA 1FNNA 4I1OA 4KKVA 3WL4A 1JU4A 1AMNA 2LE0A 4HNUA 1NNI1 1X39A 2D7JA 1LBQA 4RKEA 4XIJA 1OFIA 4RIGA 3T7RA 1XEWX 5JARA 3MMXA 3PKZA 3OOJA 3U4GA 2FPKA 5GONF 2DHYA 5P8WA 5JZMA 3BSFA 3L41A 4LUCA 4JI6B 4A8PA 1IBLB 1NMSA 1HG1A 4HB3A 2ZJFA 4ESVA 3IJ5A 4U7TB 1J1ZA 1KJNA 1T9HA 4MLDA 5SY4A 1PCXA 2AG5A 4UC0A 3ESQA 4FWDA 2AFHA 4A0QA 5INTA 2GH1A 3P2IA 3UHJA 2YYZA 1GA4A 1D9XA 3CF6R 4BWGA 3I9KA 4ZCSA 2DERA 1G98A 1DTWB 1SRQA 1RYNA 1WULS 3P0JA 4YV0A 2YCLA 1FJHA 1KFKB 2FQQA 3LDUA 2JCGA 4MKXA 1RLJA 5LOVF 1K4MA 4OUDA 1DWUA 3DBVO 1E79D 1QZZA 2C5SA 4Q02A 2LW7A 2G9UA 4B74A 1GCAA 1MO4A 3O21A 3UJBA 5JNRA 2BGNA 5T41A 3RTCA 1Z15A 1FW8A 1AG9A 2Y1EA 3RRMA 4D25A 4IS2A 1X8LA 3AVYA 4JK3A 4IW3B 1AURA 1OY1A 4N6GA 3B70A 1DBIA 1RXYA 5A4MS 1XOIA 2C5AA 5IVIA 1YDMA 5CW1A 4H1UA 2J0UB 4B2IA 3CUYA 5C7LO 4FE7A 4HAUA 3QIAA 4RQUA 1Z5OA 4DG5A 1P3DA 4AN4A 2O8EA 5WRFA 3GGJA 2A9QA 5IKEA 1FSFA 1NHGC 2MINA 3DAOA 2OAGA 4M1ZA 2OBYA 2HTEA 3D2BA 1UFRA 4JIMA 3RU2A 3IKTA 3PJRA 2QYTA 1M54A 4GC5A 2IIVA 2I8CA 4MP8A 4MVJD 4PS1A 3HKEA 2H8KA 5DE3A 3WV4A 3T0GA 2WG2A 4BGEA 3WIVA 1AUPA 2FETA 5CJ2A 2EEPA 2BF7A 2NGRA 2ZI9A 3FZEA 1Y98A 3GJ5A 5AXDA 4C3OB 5KDOA 1PV4A 1PNRA 4GMGA 2WYVA 1MEJA 5KSPA 1ZCBA 1Q0HA 5BWLA 2WM9B 3QOXA 1GG2A 3KJXA 4B31A 2CLKB 2D7EA 1NI4A 4ZGWA 4FFDA 1K8YB 1SCQA 2P75A 4M0LA 1PWXA 4JBLA 1BRMA 2OG2A 4A3VB 2YBDA 4LHSA 1SK9A 3V8VA 2H1OA 4QU9A 1UANA 2MT9A 3MEQA 3LUKA 4I2VA 4RFSA 2VJMB 4KN8A 2WWXA 4FW9A 3ZC3A 2B4QA 1CIJA 2A59A 3D3NA 1YA4A 1WPXA 3FCSB 2J3LA 3H1GA 3IXMA 4LSGA 1LLDA 2AMJA 4Z4GA 5CXSA 4RIHA 1CFZA 3G2LA 4WZ6A 3S1LA 4D3ZA 5J4LA 3AV0A 4LFBM 3RG8A 3DA1A 3L7KA 4KCGA 3F9CA 3H05A 4J0IA 1QV9A 2C5LA 2BEVA 4Q9DA 5D00A 1DFHA 2P27A 3ROZA 4BX0A 4RHYA 2RGCA 5D1NA 4D80A 1QGUA 1ZMRA 3P9RA 1NVWQ 3REFA 3WRYA 4HGZA 4V3CA 2D62A 5H8WA 2ZQZA 4CTMA 4NZYA 3JARA 3PGLA 2BFFB 2COEA 3HI4A 1PDWA 3P9PA 1X1CA 1E7WA 2CXXA 3NHSA 1KTVA 3F8SA 4GOLD 4HL4A 1C8VB 4EHHA 3ZOKA 2Q6VA 4HTFB 5IT9S 2ZVPX 1H9CA 1MJNA 2R7MA 3SC3A 2XITA 3HKCB 1P4RA 1CUUA 1J07A 1T25A 4KZKA 4AROA 2G9ZA 2RBGA 3O8QA 2ISQA 4K6OA 3M5CA 3D4PA 1T1RA 2FUNB 1T6YA 3ZWVA 4YRBA 3WP0A 3ZNPA 1NW5A 1AKRA 4UZFA 5GGXA 5IUKC 3WLFA 4BTLA 2GBLC 1LPPA 2I76A 4XE5A 1JHDA 3KDAA 3OG9A 3JU3A 5FCDA 4NYIQ 4YRKA 2R45A 3FCCA 3NT4A 4XZ3A 4TWBA 3VZBA 5JBIA 4JXXA 2AOTA 2XDQA 2C0PA 3CEMA 4EG1A 3OX2A 4YB8A 2W6CX 5KYTA 5NLLA 3H3JA 4PQEA 3T5DA 2HN9A 1Y4DE 2JJMA 3PDUA 3W6OA 3AUFA 3KOUA 4JYMA 1N1EA 1UXOA 4QG7A 1GPAA 2Y99A 2W70A 3LF2A 1YE3A 4BX9A 5LYJB 5LP1A 1W76A 4MYHA 3ZHXA 3ZD8A 1X42A 2VQFB 2Q6KA 1FUYB 5C31A 1I2MA 1P6UA 1QHGA 4ZVNA 5B7NA 2X2FA 3CSUA 3N0TA 3EXFB 4MQ6A 3OD5A 3VBEA 5BN4A 4QXOA 1BWSA 3Q8MA 1KETA 3EMKA 1MQSA 3GEEA 5J5AA 4NE9A 4KR9A 3STTA 3FOZA 3H5NA 2PLRA 3LPCA 3M70A 3INTA 4WK2B 3CONA 2FPPB 3LYHA 3GUYA 3NNNA 1GVHA 4FFWA 4QKQA 5L6MB 1WIWA 1T0BA 2LV8A 1XNRM 1E1DA 4MPJA 5EWLB 2BFDB 4ES6A 1CF4A 3WGYA 4QULA 3SJ7A 1KJWA 2EO2A 3PK0A 4JAVC 2BTQA 4PN7A 1Y8AA 3Q7TA 2Q49A 3QYPA 4UPVA 3VKUA 4LY6A 1ZR2A 4JC4A 1GSHA 1CK4A 1YOVA 4JA2A 2Z2YA 3FTDA 2FDXA 2PZ8A 3UMCA 3LQKA 5B6IA 4IEEA 2ZK7A 3IEKA 3P94A 2ZRHA 3UMBA 1RHMA 1RKQA 5F7JA 3ZCVA 4DN6A 2RC6A 3MA0A 1AGNA 3PJGA 3WQBA 1GLVA 4RGYA 1QZTA 3ZDCA 3MRTA 3B5JA 2RGWA 4DADA 4ZHQB 3T9EA 3HB5X 1TA0A 3T9FA 3FDZA 2OFFA 1E98A 1CJMA 1MA3A 3NEYA 3PD7A 1N36M 3Q7EA 1BE8A 4LKRA 1B76A 4UVHA 1COWD 3ZDAA 3D8UA 4IDOA 1ECLA 2NU8A 4E15A 1V5FA 3AVXA 1LRLA 2QSFX 3D3KA 5DASA 3UW3A 4BV8A 2I91A 4EQ6A 4YRRA 4Z7OB 3WS7A 1URPA 1GY8A 3LYAA 5G4KB 2D7HA 3E8MA 1NYRA 3B7QA 2O1XA 1JMKC 3KVNA 1ZY2A 5A1TA 4YO7A 1PYDA 4YRTA 4YMGA 4HQRA 3W4JA 1N5OX 4ITUA 4WRRA 1Q0LA 4RNAA 1MRZA 5EXSA 1VBFA 2YXNA 1JF8A 3W1EA 3ZV7A 2GN0A 4EJ6A 4HOYA 2I29A 3PV0A 4OKIA 1G38A 3BH7A 1KEVA 1NQXA 3A1SA 2E18A 1UP4A 4K05A 1KZHA 2HMUA 4BC1A 3S44A 3EBLA 3LMKA 4AP9A 3EHEA 3QX3A 4M6WA 5AK4A 3FGPA 3JZDA 1Q0PA 3Q85A 4G26A 5CLLA 1LEHA 2EQ5A 2C42A 4R31A 4ZQBA 5TJHA 3AVVA 2APJA 5J59A 1V9SA 2DR3A 4MV0A 4MSUA 5LDHA 1R0CA 5I5EA 2QT1A 1GUFA 16PKA 4W1SA 2C5FA 3BIWA 4QHTA 1ZX1A 5EPEA 1BU8A 2DY1A 5C1PA 3BXXA 3OICA 2N42A 5EY5B 1H2XA 1JHZA 3SJZA 4YAWA 2V59A 4AS1A 3Q3EA 5AVTA 4DQ0A 3S81A 4DDMA 3AR5A 1IVYA 3BRCA 2GXUA 4MX8A 4NABA 2Y1WA 4GX2A 1V3QE 3AOEA 5LQUA 1Z7EA 4QBKA 2WMOB 4MVJP 2XIJA 5SZKB 4XQ0A 4I5IA 3OT1B 1LC0A 4G1MB 4OJTA 3LYUA 1HNWB 2PUJA 2DFVA 1OUMA 1OV4A 1UFQA 1Q91A 3EDMA 1RBMA 3MT7A 1DEAA 2A1UA 2O6HA 4MDEA 3HBLA 4ZI3A 4O2BB 1T2NA 2QTGA 1YZVA 2CJXA 2YV4A 4GRAA 3VSEA 2G36A 1K7XB 4E51A 5EXTA 3T94A 1KMCA 2YH2A 4BJ5A 4F97A 1T6ZA 4MVJF 2CLMB 1NQUA 2VUTA 3KEOA 5LYJF 1KU0A 2YWBA 2Y27A 4TVOA 4YQYA 3K32A 4CKBB 1TTPB 1NOJA 1PEKE 2CXHA 3RV3A 5HF6A 4G24A 1SQSA 2HCRA 4P83A 5DN6A 4AZ0B 1QG2A 4DSNA 3OPNA 3IO5A 4RCVA 3GZJA 4MJ7A 4MYSA 1UKEA 1H1DA 1MF7A 4OKSA 4C0BA 1I33A 2RGYA 4GP9A 3F6CA 3LT2A 4U9UA 3T12A 3V6LA 2G6BA 3CS3A 1I3CA 4FE3A 5IF3A 1SKUA 5B1DA 5ESDA 3NIFB 1NBAA 4I4IA 1PJRA 5JJLA 4NF2A 1SC6A 3E3LA 3TIIA 4MUXA 4OHPA 4EB6A 4HV4A 1E3JA 3G5TA 2LHCA 1CUHA 2H1HA 5JXIA 4U2KA 3S1AA 1M1NB 4E1AA 4HH0A 3TINA 4QGSA 1MT0A 1RAFA 3UAGA 4YFYA 1M2OA 1E1QA 1NU8A 3I6YA 2IZZA 4DEXA 2GCGA 3EGCA 1I32A 4IJQA 1E2MA 2CK3A 2G08A 4GXTA 4RADA 2FK8A 1S3GA 2RKOA 3B53X 2VNJA 3CUEF 2VUUA 4RHUA 5ER9A 4F6LA 3ZJVA 5KX5B 4JBYA 3WA6A 4ZMSA 1V7PC 1DADA 2R8XA 4Z2YA 3DBIA 1KJIA 4M87A 1HMYA 4P4NA 5DLPA 3H4JA 1GR1A 2F55A 3Q5DA 2VSFA 5BSGA 2H1LA 4FVMA 2XXJA 4B8YA 2E1PA 3IAFA 4AFNA 3OI7A 3OCXA 1BH6A 1T2CA 2ZSJA 1TZBA 3EIXA 3OQ1A 4M49A 2X0EA 4DIDA 1FVXA 2QXUA 1MVLA 4RVOA 3EOAI 3H8VA 5B58T 2O19A 2OV6A 1BKDR 1BWRA 3H9GA 1CUCA 3BWMA 4YCAA 2EFDB 5L9AA 4NXNB 2JCXA 4B4VA 4JVMA 4ZV7A 4RUKA 3PJFA 4OI0A 2Z09A 4RDXA 1W36D 2AN4A 5UKDA 2V7TA 3R6GA 3IT3A 4WY8A 3TE7A 5FL7D 3OQIA 1SN7A 3EXHB 4DLZA 3GLGA 2NU9A 4YJFA 1QH1A 2ZPTX 3VPAA 4TTTS 4KXUA 2O2IA 3TKLA 2HZ7A 4WN3A 3D81A 4EEZA 1L4KA 2PE5A 1IHPA 5BNFA 4ZZ1A 4KU4A 2D00A 3R3ZA 4R84A 2TECE 5DCYA 1GPKA 2DGDA 3VHXB 5GY7A 4KFRA 2P2LA 3A9UA 3I5MA 5IKXA 7REQA 3IBCA 3OEWA 4ZANA 3UHPA 2D74A 2XEPA 1KDOA 2ZOSA 5BXYA 2FQ1A 5J2UB 3ZVLA 1M1XB 1P0CA 1IVNA 3BL6A 2C9DA 4YS6A 5JWRA 3NR2A 1TFRA 4IDPA 4NHOA 3BH0A 1AV6A 4AVYA 3F98A 4WURA 4JI3B 1BS2A 3ZGNA 4F0JA 1KY5A 3FPLA 2CL6X 1F0PA 1RRGA 3IYLW 5ICGA 1PHPA 1UDXA 3P9CA 5DM2A 4EEXA 3OAAA 1Z4QA 2F1IA 2VNKA 4JJKA 4TTQA 3RT7A 4HGOA 3GJ4A 1JIQA 5AM0A 3ZU4A 5BSWA 2HA7A 1G3IA 3KHTA 5EOVA 3DFFA 1RWKA 3S7TA 3C16C 3QXJA 4UE2A 4B1FA 4C7OA 4MRNA 5IT9A 2Q2EB 4KLNA 1G3UA 3KBBA 4KLRA 1ZHOA 1BCSB 1NSYA 3KOYE 4FLEA 2FH5B 2H48A 2C2OA 3QSGA 2J9YB 4N01A 4IRUB 4FOPA 2ZTUA 1XMPA 2P6RA 2Y92A 5DNCA 3RIMA 5I8WA 2O0LA 2PD6A 1PZNA 1DJNA 1Q1ZA 2DQZA 1CT9A 4BPBA 2PEYA 2ZG6A 3C15C 4B09A 4BDTA 3PD0A 3K0FB 1KMQA 3HADA 3OM9A 5AXCA 3D0RA 4A1FA 1RAEA 1SVLA 3U7FB 2IH4A 1O94C 5H16A 5L51A 3O91A 1KI6B 1VIDA 4IBOA 5ALMA 2QPOA 3TRJA 2O8FA 1W4CA 1NUTA 1ETHA 1TLTA 4Q7MB 3WGTA 2V58A 3OOSA 1O08A 1QK3A 3CHYA 1EHIA 5FXMA 4YBZA 3JPWA 1K5HA 1SZPA 3DFKA 5DNDA 2PHZA 1Z5VA 2O5VA 4DA4A 2RH9B 1SB9A 2Y1OA 2CYCA 5FPKA 2HQOA 2K2WA 4Q1EA 2VLBA 3BHMA 4O2AB 4RVHA 4LBWA 1NO1A 2W7TA 4B7GA 2X2PA 4TZTA 5EHGA 1LJLA 3SHVA 3ICCA 3O0DA 3CVXA 3ACBA 4FQ8A 5DDIP 1YH3A 5EJIA 3TMAA 4JLUA 1QYDA 1JG1A 2OLJA 2W48A 1AZWA 4FPXA 3CLKA 2HQRA 4IJFA 3IE0A 1QQ6A 2BH2A 1KYTA 5IJ0A 2C99A 5JS8A 1O6ZA 1P1IA 1WXGA 3ZGXA 2BRUA 1E99A 5AW9A 1KFJB 4KT0F 2H65A 1VZ2A 1AGRA 4GLOA 4NYJQ 4R9SA 1RJDA 2SHKA 3HCEA 1YF3A 3SN6A 5E6UA 4H7HA 3NWEA 4CIAA 3SMVA 4NZOA 4DMHA 1W1IA 3WFIA 4XB6B 1R15A 2AE1A 3E4CA 2FP4A 1BJKA 1ODSA 2RFLA 4RMJA 1A50B 1FSGA 1RJEA 3KAQA 4KQ2A 4LYAA 4D97A 1RYBA 3DBHB 1PJBA 3GRVA 2OPHA 1E5VA 5A3SA 5KPZA 5COQA 3IO3A 4B40A 1T35A 3U9LA 4PNHA 5CDSA 1Y0BA 3F5QA 3HXTA 2ONJA 4C89A 2WFLB 4QOSA 4GZ6A 4NX2A 2CVZA 3ZZ0A 3T9DA 2FR1A 3R0QA 4XQGA 2J48A 4J90A 2Y9PB 3GLGE 4LGCA 2DEUA 2JFOA 3BMOA 4TQAA 2BHSA 3QBEA 4L02A 3GELA 3HZHA 4PO3X 2WJ4A 3FPAA 3PE3A 3FNEA 3K8QA 1A7KA 4RIIA 5H59A 2CWDA 4BMDA 3DV0B 4F84A 1J0BA 2YMMA 4K1XA 5K0SA 4JR0A 4DV4B 3I5YA 3FTQA 3WA7A 1VECA 5FOUA 1T3TA 3VNBA 5KYYB 1HL3A 2AXEA 4RVFA 5FBLB 5FBVB 1L7PA 2GF0A 2XEDA 2LPMA 1TH2A 4G0XA 3PEWA 1C9YA 3V34A 4HB0A 2RGNA 1JHAA 4LOAA 4PRZA 1DC6A 4LHXA 3TW4A 3DZJA 3L0DA 4UMEA 3COJA 1PEAA 1J0EA 2W6MA 1FU4A 3EXAA 2BLLA 4QRIA 3DL0A 2IHZA 3L02A 3PGJA 1NKTA 2MU1A 1GKIA 1UAYA 1CNMA 3P32A 3U4CA 4YN3A 1RWPA 2CD9A 3EA4A 3AEKB 4QZVA 1OH5A 5LM3A 3KR1A 4QRDA 4RVUA 1MMFB 3HXQA 2B4RO 3UMVA 3MWYW 4MULA 1BVRA 4HHEA 4Q3OA 3I3OA 3BJIC 4C0LA 1OLSB 2PSSA 5FL7A 2E9SA 1GT91 3GLRA 3P9KA 1MRNA 2C9OA 2GEJA 2IP4A 3OQJA 5AJXA 5BSEA 3I9V6 3BXHA 3JQFA 2QRHA 2W5UA 5ITZA 5U9CA 2KDLA 2NTYC 1V1RB 2C4UA 4WBSA 4WK6A 4CCYA 1YDWA 4B9EA 4RD6A 4JZKA 1YJBA 1DAPA 1E3DA 1P1FA 1R4MB 3DKIA 3INRA 2NLOA 3NDIA 2VHWA 5AJUA 2HW8A 1XHLA 3VDUA 2M1XA 1NF9A 2I7NA 2A0YA 2VK1A 2YMQA 3KKZA 4FYIA 4OM8A 4TL7A 1PN3A 4K5QA 3AESA 4IYRA 3Q7RA 1D4OA 4XX1A 3DBRB 1D1TA 3TL4X 3EW9A 4DRXB 2ZE7A 5KPTA 2V6FA 1IDN1 2YRFA 5C3MA 3ANTA 5HDBB 5A62A 1OXVA 1EUCB 3GPUA 3TO5A 4FMCF 3LRTA 4H7IA 5ITWA 2GKOA 4DNFA 4LCBA 2DU8A 2W2XA 4HGQA 2X4AA 1VJ1A 4ENWA 3ESXA 1Q3HA 3WFJA 4F12A 5A71A 1HX7A 3LUFA 3TNLA 2FWRA 2J9FA 4KGZA 4AQDA 2JFXA 2JGDB 3N0RA 4JL8A 1Q1EA 3EIWA 3TXXA 4BRUA 5DZSA 3FVTA 1KAQA 3PR2B 3T9BA 5BW5A 1WB9A 2V3CC 3RRBA 3QG1A 2WJGA 5EXPA 3TD2A 3TTWA 1TAGA 5GWXA 1H0RA 3MBIA 3QI7A 3V8QA 4RTMA 2GXAA 1E9SA 1FDVA 4JI0M 4UAVA 1PFQA 3GJSA 3SXPA 3UWMA 5CFRA 3PIRA 5TT0A 4EG4A 5KYWB 3SLKA 4PIVA 1RQXA 3QVTA 5C8VA 5CB6A 1PZMA 4OEHA 2IS1A 1UWCA 4OSPA 3B3GA 4DR5B 3HCWA 1OREA 1GTSA 3LK7A 1JQ5A 1KK0A 1JLSA 4LXHA 4H4EA 4TQUS 5AVOA 2LD4A 3PHBE 5KNBA 4YLGA 3M2TA 4E09A 4RETA 2NNLD 4MKZA 1MABB 5EJAA 4L72A 4BLUA 1UJBA 1JAIA 1N6IA 1NZDA 4CGYB 1CV2A 1X9GA 3GN1A 1TM5E 4H9GA 5B3KA 1WUKS 4MV1A 4GMDA 3T3OA 1J5PA 4PAQA 1DRJA 3JAWB 1SY7A 1TXGA 4BKPA 3ASZA 1H6DA 2CDNA 3IIEA 3UC9A 3VISA 2CBZA 2Z3VA 4AO8A 2A0WA 4M1OA 4L73A 3AP2A 4DV0M 3UA4A 2AFRA 1Q12A 1IEWA 3TSZA 4JXKA 5DHSA 3OEYA 2RI1A 3I04M 2C7GA 4LC9A 4NU6A 4WKCA 5D3MA 1QZMA 2PLWA 3SAVA 4I6JA 2VVTA 4G0YA 1QX4A 1SBHA 3QUBA 4WZZA 5BPHA 4ARBA 4PXYA 1S2LA 1OXSC 3I6QA 3U3RA 1WXDA 4DPMA 1YWGO 4B71A 4CU2A 2PTGA 4DSOA 2C83A 3UH1A 3FD9A 1ZLYA 2FR8C 2VHXA 3D2LA 3ZNNA 2ZXEA 4I4LA 2W42A 4MWGA 1FX0A 2SNIE 2OOBA 3PDIB 4RZUA 3IP1A 8GPBA 2JGEA 4AURA 3ZGZA 1LTQA 1OMOA 2XBLA 3BD6A 5BRNA 3WX0A 3MRXA 3PX7A 3C3BA 1NG9A 3BT7A 2ZREA 2RGGA 4WE3A 5CDTA 1Q3KA 1O9BA 4RKYA 2IHUA 4FYMA 1MEOA 5AHWA 1PJSA 2C88A 3CSDA 5CA1F 3PQDA 4MW7A 4DIOA 2ZBDA 4C3VA 2ZR7A 4OSOA 4GH9A 4G56A 1NA5A 3NHAA 5JZVA 4EMUA 3CFYA 1N9GB 1RYHA 1Y9EA 5KAMA 2ECOA 3VR2D 3T1QA 1SQ5A 1AX9A 3QX7A 4QOIA 5JNSA 1ND6A 1OPRA 2LIVA 3VR6A 3OPYA 4NBUA 4YT8A 1T13A 1O6CA 1W0KD 3CA8A 3LX5A 4YDQA 3CLHA 1SUIA 1VL1A 1PQWA 1WUHS 2HAEA 1XQYA 2BFCB 3DYVA 3RT1A 3T7SA 1VGVA 3H11B 4HI0E 3WHPA 3LY8A 3CZ9A 3OQ6A 1E0DA 5EA2A 1YTLA 2CNWD 3GNTA 3CX3A 4Q3BA 4Z9YA 1B8NA 2OHVA 3NVAA 1KEWA 4BX3A 2W8ZA 2VHZA 5FFFA 3QEKA 1NXVA 3GCZA 3B2EA 4CE6A 5A6SB 3BKXA 3OY7A 3WBJA 4D9CA 5BUCA 5EMJA 1BOOA 3DEIA 3IVMA 3M6VA 1YRBA 1JRLA 1MC8A 1YQQA 1TCVA 3EDOA 3VR5D 1D3AA 4ZO8A 1JPJA 3VTKA 2C2KA 4DG9A 4MDHA 2B9VA 1G71A 1JDVA 1K92A 2D59A 4COOA 1CUJA 2NTJA 3H6HA 1XX6A 1FTSA 3HNOA 4IJVA 4JYAM 3NC4A 4PNPA 2WAOA 1DDGA 4XCXA 2Q21A 5GJCA 1PFWA 5H3CA 1YFJA 1ZOIA 3OZDA 3DF9A 4TKUB 4MAFA 1Z18A 2BFWA 2V97A 3QLTA 3UJNA 3G85A 4LMPA 1JG6A 1PO7A 2BMDA 1LDNA 2Q27A 2GTPA 3GYGA 4NG5A 3SS9X 1TRHA 3REQA 4IMPA 1GGNA 2GNAA 4YUYA 3OSUA 4J4TA 1X77A 2XVXA 3O82A 5BPVA 1DSSG 2D2EA 3PDJA 3Q7QA 4D3XA 1W49A 4PDIA 1P17A 4WH0A 5CXXA 2QLTA 2XMDA 2BIFA 2YHUA 1ORHA 1EPUA 2QN6A 2VTKA 4PPGA 2ZI6A 3EIOA 4GE0A 1FNMA 4JT2A 4J1TC 4PONA 4A1OA 2REBA 2IVZA 3RDPA 1GPYA 3DTVA 4M8SA 1JL3A 1L6RA 3KE9A 2AIRA 1VL6A 2GCPA 2AI1A 1UJ2A 1GGJA 1Y8QB 5A0FA 5LB2A 2GHTA 1M8GA 4PC6A 4DGQA 3DOOA 2Y1CA 3AR6A 5KWVA 4PDGA 1H8HA 3PHJA 4OLFA 5KVQA 4ZK6A 1IG3A 5LBIA 3PXAA 3HBJA 4P5DA 1CW2B 4RJLA 4V2UA 1VLZA 3EH1A 1D9ZA 3SG0A 4RKUF 3H5IA 1A8SA 3ZCPA 5KBYA 3LAWA 1F4IA 1E3SA 1M8FA 2YWGA 1JA1A 1SEVA 3Q7PA 2HY7A 3LWNA 4M21A 3R75A 3SF0A 5JS7A 2O8DA 3ENZA 1C1DA 4RLHA 3EFOB 3ZQUA 3O0TA 4X1OA 1PKXA 1SIUA 1SQGA 4WEQA 5AHXA 4BX2A 1REQA 3LUBA 4FFOA 1H1TA 1UPCA 2HLNA 2P7IA 2IH2A 1QF6A 1Y5LA 5B57C 4M76B 5KYKA 1I4EB 3AR4A 2J4CA 3KXIA 4PCUA 3WNQA 2XW6A 2EGGA 2CLHB 2I8AA 1Y1KE 3M4JA 1ZU4A 1CNEA 3O1JC 2UZ1B 4JGBA 2IV2X 1M9NA 3FGOA 4M3NA 1Q17A 1XTKA 2A7XA 1WZEA 1K6EA 5B3LA 5FWNA 1DWQA 3KPJA 2FI1A 3V55A 3PNLA 5C4IA 3P9ZA 2RJ3A 4QGHA 4I4TA 1S4MA 3GP1A 2B99A 2FWPA 2ZYUX 4QYTA 4PYMA 5TVKA 3W5IA 2KLBA 4N76A 1KZ7B 1VI2A 1QBKC 3NORA 1SXJA 1RE0A 2DM6A 5AO9A 1D2HA 2VWGA 1JHQA 1Z6XA 2JBHA 3GCDA 1L8QA 3DM5A 5KTSA 4EOGA 5BN3A 3H2KA 4IBIA 1LSOA 4ZK2A 4KPEC 1P45A 3QEMB 1BDIA 2BM1A 1NDHA 1Z63A 2R79A 1YTUA 2E4UA 3BA6A 3H9QA 4JKOA 1TUBA 4U2GA 2B69A 2QLBA 2Y76A 2AFIA 3EX7C 3JTEA 1DCFA 1K7SN 4MQUA 4CLHA 3IVAA 1J8QA 3SYLA 5C1BA 1ZGCA 1DIAA 3F7OA 2QRVB 3L8HA 4MGEA 3EIUA 1EZ1A 1Y1PA 2WSMA 2OXEA 2X1LA 3L06A 4F93B 1DO2A 5JCPA 2NAPA 1P6QA 4IZIA 1MHTA 5FR1A 4V03A 1R5OA 2JFGA 3OT5A 5EEGA 1VL5A 1RM5A 4H2DA 3WLOA 2OD9A 4TYNA 1SUDA 5AR1A 2GPNA 3LY5A 4HWSA 4WEOA 5JMWA 1HI9A 3H16A 1DJOA 3WGJA 1MPTA 3NFRA 1M2WA 2QXTA 2IGTA 3IDQA 4TKVB 4Z8YA 1K68A 1CZRA 1Z38A 1M0TA 3HYLA 3G2MA 2XV1A 2JY6B 4YJKA 1C9MA 1ADCA 4J76A 4TXJA 3OZAA 5FUVA 5FV7A 3QVGB 1Y3FE 2JL1A 4MGZE 5D5PA 1UR5A 3Q2IA 2Z2ZA 2I71A 3QLJA 1RRPA 1N6RA 1U8FO 2YINC 2FX5A 3IESA 3MSCA 3P5BA 4MCIA 4RMHA 3QEOA 1JIUA 2CHEA 4UTVA 4M1EA 1V5GA 4RFLA 4C08A 2KW0A 2CXOA 1THTA 5BORA 1RRVA 1PWYE 1W9MA 2VWQA 3IMCA 1ZN7A 4GKVA 4QRHA 4ZQGA 1GDTA 1O96A 2O3JA 4R8KA 4AUEA 3EF3A 4ZEXA 4C4PA 4QFCA 4LJ5A 1QX3A 2N0SA 2PX4A 4G5HA 4NZPA 2ZRCA 1O5TA 3JALA 1IATA 2WQZA 1GSAA 3ZBUA 2DHRA 4CTNA 4RLSA 3WDLA 1EM8A 1FBTA 1HEYA 1R50A 3G8BA 4OXKA 1S1CA 4K9KA 4AG3A 2EV9A 2JZCA 3PNPA 4UOQA 2FS1A 1HSOA 1ONNA 4Q01A 1U4NA 3NFYA 3UKOA 2EZ9A 1KC1A 1LV8A 1QFZA 3ND8A 3SZMA 1M2NA 3T3EA 1I3LA 3W67A 1VYUA 3WYGA 4LZJA 2EQBA 3LT1A 4D7AA 1X7XB 3D4IA 1SVKA 4JDUA 3RW9A 2YW9A 4X1IA 4GOJA 4REZA 1OPXA 2GI4A 3KKPA 3FOBA 4KQIA 1IWPB 1FL9A 1YS2X 2M5ZA 2PH7A 1JJBA 4QYXA 1M2FA 4UFNA 3BMQA 2DWPA 1VHDA 9ATCA 4D02A 1JHPA 3QV1A 1VMKA 3KXEC 2YYAA 3GZNA 3L1UA 4RCZA 3PZBA 3QWFA 2GN6A 4BN4A 2KHZA 5HP4A 1WL8A 2PGJA 2UVPB 4Q93A 5LP6B 3MT0A 3PR3A 2H57A 2MINB 5TLSA 7AT1A 3LF1A 4M1WA 2BUBA 1PX0A 5C7OO 5CFNA 3GRRA 1QQTA 3GVXA 1GKLA 1FTYA 1XVUA 3B7WA 1PS8A 4P2GA 4BGVA 4JC0A 5E6SA 5FUXA 3CKLA 4MV3A 2GVNA 5G0UA 4C06A 5J47A 5K0TA 3MT8A 2CKMA 1MDFA 1E6MA 2VPWA 4KBGA 3VYWA 4BFYA 3PFNA 1BSVA 1JDZA 1X7YA 5DB4A 2REQA 4AF8A 3H2HA 3KKEA 1WBBA 3GIDA 1YCFA 1LX7A 4ZO9A 3TPCA 3CUTA 4ZYTA 4OY3A 2PGDA 4EY8A 3CPEA 4Q3DA 3VU9B 3DHYA 1Q7EA 1W2HA 3N0XA 1XK7A 4LZOA 1XWFA 5T4FA 1QC5B 3E3MA 2B8EA 4U7HA 5ICFA 3FOFC 1KQOA 4BLRA 4RTLA 5AW3A 2HMYB 3ITDA 1Q84A 2WJIA 4XEHA 2O8NA 2BUAA 4PGMA 3NHWA 1SOWA 4AJKA 2O57A 1ZC3A 4N8DA 1EE2A 1C1XA 1YKSA 5BR7A 1U8CB 2MH8A 1R18A 3QELB 4HVTA 4JJ7A 4DABA 3OX1A 5JFOA 2YQ4A 2O2SA 4OX9Y 4BNLA 6YASA 1LDEA 2CZCA 2QW1A 4GPD1 4GAEA 5KYGA 3N7AA 4I55F 4F2PA 4AQ7A 4DLLA 1U8ZA 3GA5A 2ZGVA 4HFJA 2WZCA 1PT9A 4J1TA 2X4DA 1GRQA 4XM1A 1UM9B 2WF7A 4BO0A 5K8VA 1IOVA 1H85A 3VUEA 2ZWOA 2NSYA 2JATA 2C3PA 1G6OA 1MQAA 1ZEJA 2O2JA 3M1YA 5D7BA 2C5RA 2IUSA 1ZDMA 5DLEA 3ED1A 5EHQA 3E8XA 2XIQA 4XAQA 5KJEA 4HL6A 4HB2A 5G41A 2BTEA 3U5ZA 5TIIA 1QFJA 1PSDA 4OMDA 1APBA 3EXIB 4LHZA 4QJBA 4G1CA 4FE4A 1UJ4A 5E1OA 2BISA 1L4LA 2RSLA 2PX8A 2QZSA 2H6EA 2R8PA 1Z2DA 4BJHB 4B7HA 5DK4A 4A8JA 3RTEA 4YAJA 2EKFA 2K87A 3H5WA 1E63A 2X0DA 1Z82A 3GHHA 1LGYA 4XD7D 4WP2A 2QUZA 4JLKA 4MUFA 4UULA 4MWDA 4UXIA 2HXYA 3BS4A 4K8RB 4AZTA 4XCVA 2P4EA 3CT4A 4UTPA 3EZ2A 1KOGA 1YZGA 4Z6KA 3BMCA 2Q7DA 3ZTWA 1OJ7A 2GZAA 1EXDA 1HH4A 2D7GA 1X38A 4NJMB 5JPCA 1Q1GA 2NUAA 2Q4OA 3S68A 2AFVA 1GCIA 1K08A 3DMTA 4EKEA 2BFDA 2NV6A 2OFPA 2OCYC 1Z59A 3PHLA 4U0JA 1WCXA 5HOEA 4DR5M 2IXEA 2H2FA 5H70A 3FVVA 4J4BA 1EDEA 3VOSA 2V7XA 2I4LA 5IABA 1QP7A 3PIIA 2F4NA 3AVUA 2OXFA 4D4IA 1DC3A 3KTAA 4NQRA 5CK5A 2OXRA 4IIBA 4LQ4A 2H2DA 1Y7IA 1YB7A 1U0FA 3CURA 2I7DA 2PZJA 3NOVA 3RFFA 3A1EA 2VDRB 3EGOA 1BMQA 2IPNA 3A1FA 3ODGA 2B6NA 3VR4A 1CEEA 3E27A 1IRXA 1LK5A 3DWIA 3WBBA 1D7AA 1H0SA 3JWGA 1DARA 3MCTA 5AVXA 5CVUA 2ONZA 3OMXA 1HWYA 4DC0A 3HK2A 3URKA 3BEOA 2DWOA 1DI0A 2AV6A 3PEVA 4R6WA 3MOGA 5FBQB 4ZPXA 2O20A 1GSIA 2GBCA 2JGAA 4MARA 4YUAA 2IPMA 4U6NA 4PZDA 5DPMA 1NLUA 1XT6A 5M7EA 3T6PA 3EF1A 4AQYM 2FW6A 5ALZA 4HDNA 2NN3C 3L1JA 5TXGA 5ERGB 3UMSA 3EEOA 5CX1A 4ZTZB 1LS1A 5DM70 2OAP1 4EW3A 2IEIA 3I62A 4MDYA 2BP7B 3M6WA 4OB8A 1GPWB 3UXHA 4E22A 4BNMA 4C0XA 4EYGA 2BDTA 1CY0A 2V0CA 3V7UA 1U8TA 1AQNA 1LDBA 3L8GA 1AKTA 1BROA 1X7WB 2BMWA 2H00A 2ZIWB 3Q4GA 2QRGA 1GA1A 3FPCA 3HHEA 1XALA 4N3NA 1E69A 2FN3A 1CDOA 2JARA 1BC5A 1YS7A 2ZRMA 3FH0A 3DE0X 5KOHA 2GTHA 5JY1A 4X65B 3D6HA 4OHVA 5DGHA 4TMZA 2QNRA 3CCBA 3PXGA 1NC3A 5KI6A 1QHEA 2FTKE 3VXKA 1I51A 2A5JA 2L69A 3LCMA 5JRZA 5L95A 4MVCA 1OAAA 4MJXA 1XA4A 5JCXA 1L7DA 3HTXA 4CCSA 5JI2E 3KW6A 1EFVB 1JZSA 2XAAA 4IOLA 1VHTA 4RXTA 1VRCA 1ZMXA 3UAWA 3P2MA 4BNFA 2I34A 2J87A 3GUHA 3ORQA 3R0JA 5C1IA 3NYIA 2ZWPA 3D4LA 3RRXA 1UP7A 1EWTA 2BI8A 1F1BA 4MUGA 1KTIA 5FUYA 2OBNA 3JWIA 3AY0A 2R751 2V6GA 2ZTCA 2CB9A 2DWNA 3U4QA 1KJQA 1PDVA 3GAZA 4MLZA 4NCBA 4RZXA 2OUIA 4FMPA 5JBQA 2R00C 4FFBB 4BE4A 5B64A 1DBPA 2JGKA 5BN5A 2XH9A 5KYUA 5CDFA 4BV2A 4E30A 3CRNA 2DUNA 2Z9BA 1DQRA 4ER7A 3L84A 2B34A 3QFRA 3I01M 5K1ZA 3HCOA 4ALMA 3VZSA 3OO0A 4UFPA 3MGCA 1YZNA 1KZGB 1Q22A 3MPUA 2Z6QA 2YXDA 5A5GA 2JK1A 3ETNA 1IZYA 1Z2NX 4IG4A 1JAXA 2GAAA 3TQTA 1TJ3A 1V6AA 2VR1A 1YE8A 4BFXA 3F6SA 1V9LA 2H1FA 2EJBA 1J8MF 3NBFA 1UPTA 3MWGA 2R5WA 5FSWA 2CDAA 4HNTA 3A2KA 4Y1GA 2ZIGA 4UTNA 2E6UX 4J1NA 1I6LA 1H2ZA 2R6FA 4D92A 1J7KA 3WHIA 1E58A 4HRAA 2IXDA 2OC9A 1W44A 2ODEA 1KI7A 2P78A 2Z6VA 3PDCA 3PUZA 2B83A 2J33A 4G1EB 2QMHA 1JLKA 2AHRA 2ZRKA 4EB6B 1WE2A 3G1TA 1W1WA 1ZXBA 2ZKIA 3O8OB 1Z9BA 4XM0A 5G02A 2VJLA 4RLFA 4PZZA 2OMEA 3IIKA 3CE9A 1DAHA 1M1NA 3EARA 3UW1A 1K6XA 2OV4A 2L6OA 3MD0A 2HV9A 2JS7A 1WW2A 4D4JA 4Q12A 4Y2TA 3HCPA 1NSFA 1A27A 2IHJA 3G02A 1J8VA 3KZXA 2OT3B 1OWOA 1AZLA 2HUNA 2ZE8A 1Q74A 2FPIB 1XQVA 3DL2A 1G5QA 4Q03A 3E1GA 4LV8B 4MIYA 5IARA 4AUKA 4TTVA 2O8VA 3FF1A 3LZ6A 4PICA 5JXGA 2C95A 1QQAA 2KRKA 1QSGA 2EBHX 2I6TA 1P2TA 4PQYA 4D1YA 3C6XA 2IYYA 1FZTA 2J85A 3DAHA 4MI3A 1BE0A 1P7VA 2OCXA 3IUBA 2JLSA 4D9NA 2R8OA 3ZWXA 5IN4A 5G40A 2FPGB 3BMNA 4PLTA 2FSHA 3HACA 1F8YA 1GPMA 2Z3ZA 4W9RA 1I2ZA 5I7UA 1AHPA 1DAEA 1E4YA 4KR3A 3K2BA 1P3JA 2AI2A 5IAEA 2J0SA 1PL7A 3KPVA 5D5QA 1E2LA 1NLMA 3AO0B 3G3EA 1EVKA 2TSYB 3H5VA 2LTUA 2H7YA 3H7AA 4FNGA 1Z45A 1L6IA 3E9RA 4JMPA 4C0HA 1Z26A 2EWMA 2I6GA 2RH8A 3EBPA 4K9DA 1TC1A 3BKWA 3PQEA 2I54A 1Z4OA 3UIEA 1YIAA 2Z8YA 3X2SA 4V3BA 4ZOQI 3E7FA 5I9LA 1N0HA 5EZSA 1XU7A 2Q1XA 3B52X 3RSLA 3TOSA 4B34A 3ZZUA 1L4MA 1FFAA 1G6KA 2A84A 2B1QA 4N12A 5JAMA 4LDAA 3AB3A 3WGNA 4IMRA 3RTAA 4JMLA 3SSMA 3UPDA 3F2IA 3IAHA 4KFSA 4BB0A 2DPHA 2QSYA 2H5XA 3HYSA 4H6PA 7REQB 3UWSA 3W68A 5IW8A 3IQXA 1TEXA 4Y1EA 1V4BA 1Z5PA 3KJGA 3I6IA 4Q9KA 1H1LB 1TO1E 3LUAA 4K0KM 4B6PA 1ZMVA 4GYWA 5DJ5A 5DN9A 1JN0A 4WKOA 4MGIR 3L7JA 5DYGA 5ALWA 3LPDA 1N6HA 2UXBB 4Y6LA 2RCYA 2G7ZA 2CFSA 4YPVA 2EGUA 3HJRA 3CPJB 3J80S 1W581 2NZ8A 3GQBB 3KHUA 4L6IA 2C7PA 2A5DA 1IBLM 1J56A 2YYYA 3EZNA 3R3UA 5FQOA 3B74A 3HP1A 4PC1A 3FDFA 3R7WB 1W4BA 3W5VA 5TMEA 1G20B 4YYEA 3X0DA 3ZW7A 4KHPB 4ISCA 3HC7A 1QIDA 1Y48E 1AHIA 4BQEA 1CR4A 1KAHA 3HJBA 4ZD6A 4NMHA 4TSFD 4XA8A 3U7EB 4EPVA 2A5GA 3AI2A 5CT4A 1FFBA 1OXTA 3FM9A 4IKEA 3VR0A 2Y21A 4XIGS 3K9QO 5ISMA 4F6RA 3WAJA 2DMRA 4PSCA 1JXMA 2PR2A 3W0LB 2CXQA 3CX4A 3OJLA 4XQEA 5FI3A 4D26A 4WD3A 3THYB 2FPUA 2I2XB 2QBYB 1BZYA 3AETB 4RZ3A 4TLCA 4D42A 1E0KA 2WICA 2FMIA 3FB4A 4JFAA 5AICA 3TPFA 5GZ3A 2C4TA 2BOVA 3ZCRA 3K0FA 2JY7A 4BNVA 4IGIA 3ESRA 1EUDB 1HORA 2F1OA 2FSVA 2QSUA 3M5WA 721PA 4BE7B 3O7WA 4A2CA 2KXEA 3HA7A 2C4KA 4M99A 3RIHA 1F0YA 3JQEA 3PRKE 5CCBA 3DE1X 4IJMA 3I2IA 2V03A 3IJRA 2PRKA 4NPAA 2ZSKA 5JUWA 4RS4A 3GG9A 5KMGA 5LKAA 3O1LA 1YHZA 1VB5A 1OYWA 1UEJA 4NCAA 2PRJA 3GB9A 2Z0MA 5JS2A 3ZZTA 2FYTA 2G72A 1A77A 4Q48A 3OQBA 3QVMA 1ZP6A 2ZIXA 3JD0A 1D2GA 3HLTA 4RPHA 3ZLBA 1L7QA 2G4CA 4E1BA 5H9WA 5LP6F 4CMHA 3BGWA 3PC4A 4U3JB 1V5EA 1CEQA 4HFMA 1MHPA 1YB2A 3ROGA 5JI3E 3I01A 13PKA 1J0AA 3PFBA 1YCDA 2F5OA 1UC9A 1Y33E 2XTZA 3COSA 3QXXA 1QU3A 4ZCTA 1J5EB 5E3JA 3U3OA 4CMGA 1B16A 2VBIA 2JGFA 5AVQA 2YVAA 1RP7A 3NOOA 1T1IA 1DZIA 4W8GA 3GDWA 3M4NA 1WWKA 4ZOAA 4YEDA 1ZW1A 2Q5IA 4A26A 3NAZA 1ZHHA 5IBQA 1DJPA 1N8NA 2DYKA 2VDJA 1Z25A 5B2EA 4E5MA 2JD2A 1LK0A 1SEPA 2XNDD 4K6GA 3RSCA 2WLSA 3LY9A 3ISJA 1UF9A 1ZZGA 3OJEA 5DGIA 3UK2A 1HE2A 3A2NA 3KJNA 5I8ZA 3U39A 1EAMA 2A0XA 4AXXA 3NB0A 4EKIA 3N2IA 3GRZA 2V7BA 1PNOA 2KI5A 2Q7OE 3RVKA 3UJPA 1F5NA 2H52A 2GUWA 2JFYA 1X7GA 2PT7A 2X22A 5TF0A 3KM0A 4DCGA 2P0YA 4QVIA 1C3OB 1I2DA 2FOLA 2HQSA 2GS9A 2PO7A 3FNQA 5AKJA 1E1RD 4WXPA 1IXRC 5L8RF 2KYRA 3LC2O 4QGBA 3VNUA 3HGTA 4RWZA 1XWIA 1XTUA 4WY2A 4BZZA 3ULKA 1JYEA 1PTKA 3V00A 2JI6A 2KPOA 4DR4B 4DJTA 4EYEA 3ZW9A 3HHXA 4S1VA 4FXPA 4CW7A 2W2VA 4QWMA 4P4LA 3TI7A 1PR6A 2ONYA 2IDKA 1U2DC 1L5ZA 4H08A 1L8AA 2P67A 2DXIA 1RZVA 3ADCA 1EAYA 1OXUA 2JRCA 4X3PA 5GV8A 5ETJA 3QKIA 4LVUA 3GNQA 4L6V6 2DWMA 4PXSA 2VH1A 1T2FA 4XR9A 2HR1A 3MWEA 4V0MA 4HX9A 1NVKA 2PCLA 2C7OA 2H5JA 1Y4SA 3IQIX 5FUBA 1YQGA 5L3QB 1FNBA 3NPMA 4MRPA 2O5RA 2F3UA 3FBWA 2B7LA 2QRPA 2JG3A 2PJUA 2WD7B 1DWOA 4EHBA 1VSTA 5AXAA 3II6X 2D3WA 4GR9A 2OGSA 1Q7RA 3TL6A 1POWA 5AVZA 2RK6A 4P0QB 2MSNA 4OFWA 1V1RA 3RC2A 1KGSA 1OIZA 3C6MA 3IDZA 3W7BA 4E2XA 1XFAA 1QHHA 4JWKA 5GGYA 5C0OE 1AKUA 4JWTA 3FDXA 1MOSA 1E6CA 1O97C 4O1IA 1W25A 5H1YA 3ZHTA 2PUBA 5AKKA 4OHFA 2AK3A 4PYOA 2Q9CA 1T4BA 5IAJA 3ZHYA 2D4AA 1C7RA 1KIFA 1JDTA 4F21A 1LVHA 3G59A 3HU2A 3PBKA 5C18A 1W1UA 3QXHA 4Q3NA 4Q15A 1EDDA 5J2TB 3K0SA 2WILA 4ZCLA 3RVNA 4ID3A 5A4KA 1BKYA 2MGWA 1Q50A 4X63A 5KOIA 3YASA 3FX2A 1ENOA 3J2PB 4OJNA 3KIPA 2JB9A 1KS9A 1T6BY 3DVAB 2PL9A 3PD1A 4JQCA 3CCCA 3HUFA 3T5TA 1UAGA 4B6JA 1YASA 2J4FA 4J6FA 4X45A 1G18A 1RHJA 4IXWA 4KR7A 3DEZA 5JVDA 1FX1A 3RSFA 1V7ZA 1CB7A 1XTTA 2G67A 1F2UB 1PLLA 1S9DA 4QXPA 1IU9A 1ULSA 1EP2B 3GFVA 3I28A 3L7CA 3OZEA 5FPHA 2HUPA 2JI7A 2RHLA 4PPYA 3RU3A 3GLVA 1V39A 5CBPB 3I12A 1DHRA 5KYWA 4PEVA 3LVQE 5KYXB 1TD1A 4WGGA 3I6BA 3LXRA 2WWIA 2IH5A 1M5TA 1SPXA 1B1AA 3AOEC 4J1SA 1BXGA 621PA 3IBSA 2R2GA 1VSBA 2ENWA 2ZAMA 1T2UA 2QI9F 2HSZA 3KYDA 1NVMA 3LXXA 4IICA 2BHTA 2J5BA 3OTOM 5K05A 4F8EA 4WNAA 3R3YA 2BE9A 1Z7BA 2XX3A 1TQ6A 3GPBA 3JZMA 4QNMA 1PFGA 2HF2A 3DZGA 4LW8A 1YDGA 5JAPA 2PU5A 1LKZA 3HR4A 4ZVPA 4S35A 4ANFA 4BOYA 4EDHA 5C8XA 3UWKA 1RJWA 1MKYA 3HDGA 3FNRA 4G63A 3PQ3A 1U7HA 3HXMA 4Y9SA 3MN1A 4DQVA 3DD5A 1HTBA 4O4JF 2DLNA 2AR7A 4TLAA 5E7QA 3GLQA 3UJAA 5IDQA 1VSVA 5BMOA 3DFMA 2QYSA 3FJYA 4DYVA 1S2NA 4HWTA 1IXZA 1E3MA 4HYQA 3GBPA 1EWVA 1LDGA 5F7XA 4BNWA 2BKVA 2IGBA 1PP4A 3FW1A 3I1JA 4OI1A 5BQ3A 5KNDH 4ZVQA 3W9YA 4DJAA 1DEOA 3DOEA 3HWRA 3VV2A 1CUDA 3DE4X 1HBJA 3RAPR 5I7SA 3B1XA 4S1OA 1SKBA 1NVBA 5MN5A 4OIMA 4A15A 2QS9A 2O2GA 2JFZA 1AKMA 3D31A 4O4JB 3CNQS 1UMDA 2A9VA 4O1HA 1Y1TA 1ZJ4A 4HADA 2JFFA 1OLOA 5LKRA 2X9GA 3I32A 4YP6A 4JNCA 3DDSA 1IONA 3P9SA 1TF7A 4L9RA 5DN6D 1YS1X 1YZQA 2JIDA 5DHAA 3BE4A 3ZWAA 4DJ5X 3U44A 3THWB 7ADHA 4W9NA 2P9QA 1JECA 1KEZA 4U5QA 2QPLA 4BLOA 5B30A 3IRVA 4HPXB 5CG2A 4JOQA 5FDFA 1OF1A 1H8HD 3EGVA 3FSJX 4BWVA 3LP6A 4N41A 3DW3X 4E0BA 1BS9A 2QRMA 4GKAA 2QUIA 3PICA 4HH1A 4EI7A 3VO8A 2RBKA 3TG2A 1MG0A 4I6GA 3HUDA 1N9GA 4UUMA 1MO5A 4MPDA 4XLLA 5EE5B 5ALYA 2NU7B 3SC2B 2QEQA 3FTFA 1OX5A 2GSDA 4GVLA 4R3WA 4TV9A 4A16A 3QG5A 2O07A 3IHLA 5ADVA 2QV7A 2XTNA 2ZYIA 4WA8A 4AJLA 2JZ1A 3DAYA 1PE0A 2D2IA 3LH5A 3QU9A 4GRDA 4OCZA 4A0RA 5C8YB 4YIKA 2ALJA 5CIQA 1CP2A 1ZLXA 3DE6X 1CNFA 4HN4B 4YXWD 4CHTB 3ZCSA 1U2PA 4YJGB 4CCAA 1AKWA 1ZJ6A 2IUYA 3PXEA 2NYUA 4UZSA 3S2IA 1Z5NA 2ZM6M 2ATVA 2FSGA 3DA8A 3NHUA 3SYRA 2P62A 3RABA 5IHPA 5IT4A 4S0ZA 2YC4C 4G4GA 3DC2A 4XSHA 2QTHA 3FZNA 1PQUA 4EHDA 4BNZA 3N05A 2ANBA 5FFMA 3FZQA 3KQSA 2JCBA 3H83A 3OE1A 3TLAA 2HJRA 2YZNA 1RLOA 4HNQA 4O2LA 2BWBA 2GR9A 1MX1A 5DLDA 3I76A 3JQAA 5IUJC 3H97A 1CRQA 3KLMX 4CQJA 2EA0A 2DQSA 3STWA 4BO7A 1GV0A 3L8FA 4IFTA 2B36A 4XD7A 1XQWA 2PL3A 4MKIA 3K9NA 4AKGA 4F4HA 3O47A 4C0QC 3L2OB 1UT6A 2RHHA 3ETCA 2OBMA 4G4JA 4LYJA 4LRTA 2JEZA 2XD9A 4W7IA 3DOJA 1L5MA 2N1MA 1X80B 3TM5A 4KR0A 3RFTA 3G0GA 4RF4A 4FM9A 3QENA 3A9VA 1N32M 1VL0A 2GBFA 3I53A 3VFDA 3QFCA 2KWIA 3VV3A 4B7XA 4C5BA 1VPWA 4KQGA 1VFPA 3QYAA 4ZDWA 4A0FA 4JJFA 1T9ZA 2BR4A 2R8RA 2ZFUA 3ACDA 3N6VA 4IQ8A 3UPUA 1HMPA 3ESYA 4DREA 1IJKA 2GCOB 2DAEA 1Y8QA 2C8KA 1LPMA 3SQLA 3T1TA 1Z0KA 4UKDA 4BVBA 4M36A 3HYNA 4BO5A 4ZRMA 2IOYA 5A2QS 3D6NB 3MJEA 2PGLA 3WRYC 4A2WA 5HM8A 2OXTA 2ZIAA 5C8ZA 2E4ZA 1RVV1 2V4ZA 3DHWC 3FI9A 3KX2A 2O8DB 1KMHB 3DWFA 3PWKA 3PX3A 5E7IA 5IBRA 2ERYA 1J2UA 3D8BA 1Z6GA 3L7DA 1PI3A 3FIUA 1VYHA 4B44A 1QRTA 5I4BA 4AMUA 1XA3A 2VYQA 4CMEC 2JD0A 2ZVQX 3D8RA 3QUCA 4K9NA 3PQ2A 4Z49A 4B3RM 2YDYA 2EZ4A 5FUWA 3DVSX 1XL1A 1W8IA 3F78A 4IV5A 5EJ9A 2XGNA 4EVRA 3GH1A 4H18A 4QL3A 2D7CA 4R71A 1QDTA 1L5OA 4IS3A 5K2MA 1A4RA 1P5JA 3LQ4A 4WBXC 1Q02A 3H2BA 4Q39A 5K0EA 1Q3BA 4JL5A 3Q6IA 4HWKA 3PXDA 2LNHC 3U61A 4BMVA 6ABPA 1KI3A 4DWWA 1NLZA 2QUJA 2EFEB 3A4MA 2ZUUA 2EKZA 4MUIA 5IXJA 4F72A 5KDDA 2C96A 2JVKA 3TL2A 4AWAA 1OX4A 1SXJB 3AF3A 1SXJD 3M6FA 3IPYA 4PG6A 3OF2A