1NV9A

Hemk, apo structure
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
KIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSALFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemK protein
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 88
structure length 264
sequence length 270
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv9A02
4C04A 2NXJA 3LCVB 1NW7A 2JHPA 5C0OE 5U4XA 3NDJA 1G4AE 2HWJA 3EVZA 4PYIA 5DRTA 2QYOA 1DO2A 1M0EA 2L4FA 1BHJA 1QAQA 5FTWA 3RODA 5EEHA 1KYWA 4R05A 3LCUA 2C7OA 3DH0A 3FUWA 2BZGA 4YUYA 1G8AA 5T6BA 3O31A 1N2XA 2PXCA 4LWOA 3HP7A 3NW9A 2JJQA 4DA4A 2ZTDA 4R8RA 4PIPA 2H00A 4FT4A 2ZFUA 3M6VA 2G8NA 2DAGA 1RJEA 4X61A 3R0QA 1IY9A 2I9KA 2RRUA 5LR6A 1EIZA 3LX6A 5F2KA 3AY0A 3EMBA 2IP2A 5M5BA 3M70A 2BH2A 2OO9A 1ZGJA 3LDGA 1I4WA 1P1CA 4YUZA 1L9KA 1XTPA 5DM0A 3KKZA 1YB2A 3K0BA 2XVMA 3I64A 2AVNA 3A25A 4OX9Y 4HG2A 4HEOA 2QHOB 4E2YA 5DX8A 5GIPE 4C06A 2AOXA 3KQPA 3X0DA 1OTRA 3DULA 3JWIA 2GS9A 4P7JA 3GNLA 3C3PA 1UFKA 3MQ2A 2JG3A 3P9NA 3KQWA 2XYRA 2HNKA 5KVAA 3BWBA 2DKLA 5HIKA 3IHTA 4GOOD 2YXDA 2ERCA 4V0QA 5K09A 1QYRA 5BP7A 1JG4A 5GP1A 2PX5A 4LG1A 3BKWA 4RVFA 1IFYA 2XYQA 2VZ9A 1O9GA 3EEOA 2LTUA 5E2AA 4PGGA 2ZBRA 3HCBA 3FPGA 3RIEA 5GM1A 1T6OA 1L3BA 3FUXA 4ER0A 1WHCA 1R00A 4PYOA 4GC9A 1SQGA 2IBSA 3TR6A 2KW5A 2E5WA 2EFJA 2YTZA 3CJRA 3PS9A 4G3OA 1SUSA 5FA8A 1VEKA 1I9GA 5EPEA 1HT2E 2G1PA 4ATNA 3G8BA 5DX0A 4MHTA 5DTRA 5D1HA 3ER8A 3KQQA 2PXAA 1JR4A 2OBFA 1R8YA 2PWYA 4RTMA 2GAFA 4KDCA 2CWWA 2QNJA 2UYCA 2YXEA 3IEIA 1EFUB 1ORHA 5DTQA 3SXJA 5IKMA 4YV2A 1P39A 3HEMA 1B42A 4E2XA 1VBFA 1SVUA 3BGVA 3HCCA 1RI1A 4CWAA 3A7DA 3P9IA 4QTTB 2QY6A 5EHIA 5CCXA 2CMGA 3JWGA 4MIKA 2UZ4A 3KR2A 1FBNA 5EMKA 2B9EA 4K6MA 2IH5A 4FSDA 4AZSA 3A26A 3KPVA 5KS2A 5E9WA 2I62A 1AF7A 1YFJA 4FP9A 2AVDA 4EKGA 3QOXA 4ER6A 2DENA 3DLIA 3CBGA 2JY6B 3WSTA 4PCLA 1V39A 4V0RA 3GLIE 3FRIA 1CUKA 3AJDA 4DCMA 3OU6A 1T43A 5ICGA 1KPHA 3GCZA 3MCZA 2R0IA 2B2CA 3ELDA 3BT7A 2IH4A 5KQSA 4PINA 2PJDA 4M38A 2AOUB 2MJ5B 3K6RA 3FUVA 1Z3CA 1KP9A 3BBZA 3CC8A 1VPTA 4QDJA 2DHYA 2IBTA 3KQVA 3B7PA 1WS6A 4WP2A 1F4IA 5K0JA 3GLGE 3P2IA 3LPMA 5EZSA 1UFZA 3HM2A 1ZMWA 1BKYA 2UYOA 5CUQA 2AOWA 3FTCA 1YZ3A 1RI3A 3BWCA 2IIPA 3ID6C 4KDRA 3O4FA 3I53A 5LQJA 3GLFE 5K8VA 2LD4A 3NJRA 5LQCA 2JH9A 1QANA 2NP7A 3FPEA 2QSFX 3LBFA 1AIPC 1JSXA 5EVJA 3GWZA 3MCTA 4AZTA 1OQYA 2ORED 5HIIA 4DQ0A 3OU2A 3NWEA 3UJ8A 2AZTA 1EG2A 2PXXA 1G3IA 4YMHA 4ZTBA 1L3IA 3H2BA 3TKYA 2GH1A 3CGGA 1ZMUA 5ICCA 3CJTA 2ZTCA 4KIGA 5K05A 2Z6UA 5GINE 5JUWA 4WXHA 1HQYE 4QQKA 1Y8CA 3TFWA 3BGIA 3GJYA 3UFBA 4ER7A 5HEKA 3M6XA 1NV9A 4L7VA 3I5UA 3OPNA 2GPYA 2LBCA 3T7TA 4F84A 5HOQA 1QAMA 2PVCA 2DI0A 3KU1A 5DX1A 1F38A 1NW3A 5K0EA 2Y1XA 5DM4A 5CIYA 1G38A 4AZVA 3EVAA 4QDKA 4M36A 4PYMA 1NW8A 5T64A 3UBTA 5EMLA 5HZMA 1KXZA 2ZCJA 1Q02A 1JSZA 2Z6AA 1RI2A 4OA5A 3OZRA 4R6WA 4GF5A 2G3QA 4A6DA 2I6GA 1KIAA 1WXWA 4EQZA 1I1NA 4FT2A 3SSNA 2MR9A 3GU3A 1SG9A 2AR0A 3THRA 4R8SA 2JUJA 4XCXA 5FULA 3THSA 5HILA 2DZLA 4GEWA 4KW7A 4E30A 2PLWA 1VDLA 2ONZA 5GIOE 3FYCA 2DAEA 2MGWA 4R6XA 1ORIA 2YXLA 5F2NA 2OO3A 4B17A 3P97A 1VEJA 1P1BA 7MHTA 3A27A 5CD1A 1D2HA 2PT6A 5DT2A 2VS1A 1JQDA 1PRYA 1IXKA 1G41A 4IWNA 1XVAA 1N7JA 3UJAA 1V92A 1NW6A 5H02A 5LQAA 3FPHA 1EQAA 2HAKA 3FRHA 1FP1D 1JTFA 4QVGA 2H5XA 4GC5A 4P58A 1TPYA 2PWPA 1C7YA 2ZBPA 4QPNA 2FK7A 3HA3A 1FJXA 5EG5A 2NYUA 4YV1A 3ELUA 3F92A 1NBHA 3NTVA 3UJCA 5K01A 2XBMA 3DXZA 1Y8GA 5ICEA 3P9CA 2IH2A 2ZIGA 5G02A 1X19A 1JG3A 5EOVA 2DAIA 1DL5A 4AX8A 4E2ZA 4OQEA 3HVKA 4E33A 2KNZA 3I9FA 3OZTA 1QZEA 3LDFA 3OE4A 5DLYA 4EMSA 2ZZMA 4HTFB 4XUDA 3HCEA 1PJZA 4F86A 2P35A 3AXTA 3EVBA 2CL5A 4KIFA 3GXOA 1Q0SA 5BW4A 3V8VA 2P3LA 4QTUB 5EHGA 3REOA 2FCAA 1XDUA 3IECA 2EG5A 5K0BA 3KR0A 2ZBQA 4UN2B 1BVSA 5K03A 2NP6A 4CKBA 3K9PA 3OCJA 3LSTA 4BLWA 2LVPC 5BW5A 9MHTA 3HCDA 4OA8A 5DXJA 10MHA 1R4GA 1X1BA 1VE3A 3AXSA 3B3GA 3IYLW 5LQUA 4DMGA 4YV0A 8MHTA 2ZSUA 1VEGA 3TPZA 4EVIA 4FR0A 3HTXA 4GOMD 4RVHA 3ELWA 3FPJA 3R6TA 2O07A 3G88A 3DR5A 3OFKA 3SSOA 3KPJA 1RJGA 1YZHA 2C7PA 4C08A 1ZQ9A 3G2MA 2EX4A 4HGYA 1O54A 2AN4A 3P2EA 1Q0TA 2ZVJA 1OAIA 2P41A 1M6YA 2FPOA 1MHTA 2AOUA 5EKUA 4O29A 4UOEA 1WGNA 4M37A 2O05A 1G60A 2I7CA 1KPGA 1WJ7A 1SUIA 5CVUA 3V97A 4XUEA 5EGSA 5E9JA 2P3OA 1YLAA 3LL7A 4CKEA 1BOOA 5B1SA 4C07A 3DP7A 3E23A 2BR5A 5K0CA 2G70A 3SMQA 2IDKA 2B25A 4WVLA 5DRYA 4RVGA 1IXSA 2QRVA 1R18A 4PYKA 4HGZA 3FE3A 4HC4A 3SR4A 5T67A 3A7EA 3PLAE 2NXNA 1YF3A 2YQZA 4G56A 3NVKI 4FS8A 4E32A 3T7RA 4Y30A 1SKMA 2HR1A 1VP9A 3UJBA 5E9QA 4QVKA 3NVMB 1VP3A 2AOTB 4RYLA 3OU7A 4RTRA 1TR8A 3MERA 1HNNA 5CVEA 2IDJA 4YUWA 3DXYA 3LGAA 2YUIA 2FYTA 1YUBA 4CTKA 2BM9A 2ZZKA 2HMYB 4CKCA 3CKKA 4EK9A 1VL5A 3EGIA 4U7PB 4GBED 2R3SA 2CWBA 3NWBA 4CXMA 3GDHA 3FZGA 5DM1A 1WIVA 3C6MA 5EEGA 2DULA 4YMGA 2JZ0A 3TQSA 3ORHA 4IKPA 3LDUA 3BWMA 3KQOA 1H1DA 2PX2A 2K0BX 2OB2A 5C1IA 2BM8A 3QOWA 1VG5A 2L2DA 2OZVA 3P71T 1A5TA 5CVDA 2OOAA 3PFHA 4IV8A 3ER9A 1NBIA 2O0LA 3H4JA 1X1CA 3L8DA 5CVVA 1WG8A 3G89A 3PVCA 1RJFA 3KR9A 2NNWB 2AN3A 5FWAA 3SX0A 3EMDA 5FQOA 2CMHA 2KNAA 4RSRA 3FUUA 4LWPA 4BP3A 1D2GA 2LVOC 5EIFA 2BR4A 4C03A 4OBWA 3K9OA 2P1DA 1ZKDA 3JWJA 3R3HA 2L4EA 4FGZA 5EMJA 3SGLA 1DUSA 2WA2A 2QM3A 3E8SA 1KR5A 2UYHA 1TTEA 4Q7JA 3EVFA 4Y2HA 5FA5A 3B5IA 5DPMA 4KRGA 4DF3A 4F85A 5DM2A 3CJQA 3HNRA 4P7FA 3UA3A 3HVJA 3KPYA 2IPXA 4RTPA 3DUWA 2JY7A 4PNEA 3M33A 4CTJA 5HIMA 3OZSA 5EQJB 4PCAA 1VLMA 1JR3E 1L3CA 2P8JA 5KYGA 5EKXA 4XUCA 4RTQA 1OKSA 4ER5A 2P7HA 2PX4A 4FZVA 2LVNC 3GRVA 5CVJA 3EVCA 1U2ZA 3GRYA 1ZHFA 3A4TA 2O06A 3AWIA 4C4AA 3UJ9A 1TW3A 3HVHA 2YR0A 4GUAA 3MB5A 2JY5A 1GO5A 1HMYA 5DWQA 1G6Q1 4P7KA 2KNVA 1WZNA 3E05A 4GOLD 1XDSA 4RTSA 2GLUA 4KVZA 5HFJA 1YFLA 1SQFA 2LVQD 1NT2A 3BUSA 3GRZA 3Q87B 5FHQA 3KQTA 1AV6A 4HTFA 1N7IA 3GRRA 2OY0A 2V7EA 1UWVA 5LSAA 2A14A 2DPMA 4C05A 2LVAA 3HVIA 3EVGA 1VIDA 3SVZA 1M6EX 3LHDA 3UZUA 3G2QA 2EKKA 4FSXA 4OQDA 3PT9A 4KWCA 2PT9A 3EEYA 5DSXA 3VSEA 3O7WA 3MMPA 3PB3A 2HTEA 3M6UA 1ZGAA 2ZIEA 4RV9A 1ZMVA 3DLCA 3FUTA 2JHCA 2CKDA 3IV6A 3BXOA 4H0NA 5LQRA 3KR1A 3T6PA 2XYVA 1KYIA 3ANXA 3TKAA 2ZIFA 1NKVA 4OBXA 2KHHA 3TOSA 1P91A 2JNHA 2VDVE 4GEKA 3QV2A 3UWPA 3TMAA 3SSMA 4QPPA 2O25A 3EVEA 3D2LA 3EGVA 4NECA 3KQYA 2GB4A 4PYLA 5D1NA 3PTAA 5DSTA 5HIJA 2PGXA 1EJ0A 3E46A 2NXEA 3GGDA 3HA5A 4RTNA 5MHTA 4E31A 3RW9A 2HV9A 3DTNA 4X41A 2VP3A 1AQIA 2VDUE 4MTLA 3GO4A 1TW2A 2GA9A 5FWDA 3G8AA 5CM2Z 2VDWA 3DMHA 3TLJA 2G72A 3G2PA 5LQKA 4PONA 5EMMA 1MN3A 3DOUA 3BZBA 1RJDA 3S68A 1ZV1A 3HCAA 5GOZA 1X1DA 2AN5A 3I58A 2AOTA 3BGDA 2DAKA 2BWEA 2N47A 3C3YA 1P3QQ 3MHTA 3MGGA 3KPUA 2AS0A 1XJ5A 2PKWA 2IGTA 4DM3A 1MJFA 5FADA 3TRKA 4P7GA 4YUXA 1DO0A 4HH4A 1NE2A 4ISCA 5E8RA 3UJDA 1HT1E 1XDZA 5FQNA 4F2LA 4LECA 4PYNA 2QE6A 4JXJA 3KQSA 2NXCA 3EPPA 2DAMA 5E2BA 1WGLA 2JP7A 1XXHE 5FHRA 2P3QA 2ESRA 1O9HA 3FYDA 3DMGA 2PBFA 5EIWA 2G71A 5FUBA 1QZZA 5KQRA 3GLHE 2ZZNA 2EKFA 1XCLA 3LKDA 2EJSA 2ZW9A 3R9XB 5E1BA 2HWKA 4PYQA 2P40A 2PY6A 4RVDA 1G55A 2OYRA 1F3LA 1L1EA 3MTIA 3B3JA 3VC1A 1JTEA 4RTJA 2CP8A 1NV8A 2O57A 3OE5A 4GOND 5F2OA 4YUVA 2K4MA 3FTDA 3Q7EA 3B3FA 2EJUA 5DXAA 2ZULA 2BR3A 5EZQA 2FHPA 5CCBA 5DFLA 2PX8A 3LECA 3SM3A 5ICFA 1R8XA 3G5TA 1KHHA 4A6EA 1JG2A 1KPIA 1JQEA 1BC5A 3F4KA 3NDIA 3FPFA 1RI5A 2WZJA 2ZWAA 4BLUA 3G7UA 2JH8A 4DKJA 5JR3A 5E1MA 4MQ4A 2PV0A 4BY9E 4PIMA 2OXTA 3KPWA 4IV0A 1JG1A 3ELYA 2IFTA 4RTOA 3CVOA 1D2CA 4DCGA 2ADMA 3T0IA 1INLA 2YX1A 2MROB 1AQJA 4PYJA 3EVDA 1FPQA 1JQ3A 4EKIA 4ER3A 5E8JA 4X63A 5K0LA 3FTFA 3TM4A 3C6KA 2QRVB 4RX1A 4QQNA 2H1RA 2JHAA 3B89A 4M7RA 4E2WA 3LKZA 3ERCA 4R71A 3OFJA 4DBGB 2JZ1A 3PX3A 4AZWA 4BP1A 2C7QA 4DZRA 4F1IA 2B78A 3R24A 3M6WA 1RI4A 2WK1A 5IH3A 2PSSA 3G5LA 4BLVA 2DNAA 3PX2A 4X60A 1XB2B 4MWZA 3C0KA 2ZWVA 2Z6QA 1G8SA 1ZG3A 1PGYA 2Q41A 3M4XA 3U81A 2UYQA 3TM5A 2OPBA 3LBYA 4GQBA 5EC8A 1QAOA 3LCCA 1WY7A 1DV0A 2OKCA 2YVLA 5GM2A 2BWBA 3VYWA 3HCFA 5FCDA 3FTEA 3GRUA 5K0NA 2K9DA 1IM8A 1R6AA 1WR1B 2H11A 2V74B 1XXLA 1VQ1A 4PGHA 4HRAA 3P8ZA 2XVAA 4RTKA 3DMFA 3UA4A 2AOVA 5BXYA 2F8LA 2WA1A 3EGEA 3PFGA 5E1OA 5C9ZA 3ME5A 3CCFA 4HSGA 2Y1WA 3KQMA 5JI2E 2JY8A 5DTMA 1FP2A 2ZLBA 2C7RA 4E70A 2P7IA 1R74A 4RWZA 2B3TA 5K0FA 3IHPA 1KYZA 1HJPA 3G2OA 1UIRA 3T7SA 3UJ6A 1EAMA 1EJ6A 3JWHA 3E7PA 3BWYA 2EJTA 5E1DA 4POOA 3GIWA 2ONYA 3MTEA 2R6ZA 5LQNA 1NW5A 4U7TB 3NMUF 1OR8A 3MAGA 2OOBA 3UJ7A 2ZTHA 4AUKA 3VC2A 3P9KA 1WXXA 3HA7A 5P8WA 4X1OA 3P2KA 1DCTA 5ERGB 3DXXA 1E94E 3E21A 2FRXA 3KHKA 4RTLA 4Z2YA 4PWYA 1IM2A 3BKXA 5GWXA 1X1AA 1XCJA 2FK8A 2OB1A 5K0GA
chains in the Genus database with same CATH superfamily
1C1XB 4DR6M 4WKBA 2ODEA 4TKUA 2O4CA 3EBOA 1GNLA 4E7PA 4YAUA 2BN4A 4KJZA 3QXSA 4AUNA 2N0SA 2OK8A 4U2GA 4IFEA 4N8EA 5LUAA 4R7GA 3CUYA 1S2LA 3I9OA 3KSDO 2GYWA 1T6NA 1QAQA 2VSYA 1KI6B 5FTWA 3EFEA 3R2JA 3QPDA 1BWQA 3LCUA 3WFIA 2C7OA 3UPDA 1C3VA 4A0FA 3DO5A 4MYHA 4H16A 2AW5A 5AW9A 3K2BA 1RRCA 3ZG6A 5ALVA 1IRXA 2DB3A 4XTRA 4HK4A 5JEEA 2ZJ1A 5G0UA 3JZIA 3KZMA 3NBQA 1E6CA 2EWWA 2QM0A 2W71A 2XVXA 2O1SA 2YDYA 1P2GA 1U9IC 4O0LA 1U5AA 3BEDA 1JVBA 4RFLA 5JNWA 4AT1A 1XA0A 1UANA 1MGPA 2B1RA 2Q9BA 2YOGA 4J7XA 1L9KA 2MT9A 2XVMA 3CPEA 3I64A 4JKIA 1YGPA 4M1OA 1J0XO 1E9CA 2BMEA 1N2CE 2Z09A 2CYCA 4KWIA 3WYBA 5IT4A 1EFHA 2QLMA 5CXSA 1B7GO 4TMTA 1DMSA 4LN1A 5DM70 4WW0A 4CKYA 4MB2A 5GP1A 4TKLA 3DZBA 5JMOA 3BKWA 3COVA 1NX9A 4ZC8A 4OXNA 5HIAA 2YS6A 1KDZA 4Y6QA 4LCEA 5EZYB 4G1EB 4J2OA 3RGWS 2PL9A 1E1QA 4IUYA 1SU6A 2V1UA 4N3GA 1N5LA 3KXKA 5KO2A 4DZTA 4G41A 2HLHA 1V8OA 1L5LA 4GC9A 1TAUA 3LF2A 2GM9A 2RHHA 2ZIZA 1LS1A 3B85A 1GADO 5F77A 4TGLA 4TL6A 3GL9A 1CEYA 2X8WA 2VAWA 2IV3A 2ZG6A 5H3HA 4G5FA 1ZMRA 5D3MB 1G5HA 1E7RA 4MHTA 4DNOA 3ESRA 2O0JA 5JRJA 1JR4A 2OBFA 2CW5A 3MLAA 4OSOA 1FU4A 4RPKA 2FCRA 5U4QA 3RTCA 3K9NA 1U5CA 4FD3A 1SELA 1GKYA 2YYYA 3MXTA 1WDMA 3CO0S 4OUDB 2O23A 4RGYA 4IHJA 1M33A 1B42A 2WWYA 1FK8A 4DZZA 1BCSA 1RYNA 4BGDA 1GFWA 2LIPA 4ML3A 4AN1A 3P9IA 4WZAE 4KZKA 1GRQA 1DKMA 5AUNB 2I62A 4MITA 3FKSD 2ODBA 2ZXUA 4BE4A 3QX9A 3TQRA 4DC9A 4N5LA 5BQPA 3CBGA 4G0NA 3LY5A 4DCUA 1P2DA 1V39A 2FPXA 1YD7A 1HSOA 5JNUA 1GPAA 4Y9SA 3FRIA 4O1IA 5DHRA 5JS1A 2IH4A 5KQSA 4PINA 5LYYA 2PJDA 3KL4A 1F20A 4EY8A 3QUTA 1LTMA 1JEEA 3PNPA 1NBWB 3V4LA 3HCNA 5C31A 1UAAA 3UHJA 3B7PA 4ZI7A 2XEXA 5IN5A 3SQOA 1EDOA 3JPYA 3HM2A 1X7HA 4B3SB 5KPRA 1BKYA 3R7DA 2Z8ZA 2AOWA 1C3XA 3N3BC 1BMTA 3BMNA 3PD1A 4GG1A 4OOEA 1MQSA 3BQMB 2O5VA 3PI6A 2ZYVX 4QT0A 4Z3OA 2ZETA 1GGMA 3DKKA 2PKEA 4IWYA 1F14A 5MF6A 1U2PA 1YZLA 4H7HA 3AG5A 1PFQA 3DVRX 1HNWB 1BH6A 2FOLA 2Y1OA 2Q8NA 3OU2A 2OZEA 4ZXPA 3KLBA 5ALLA 2V8BA 1G5FA 4ZVSA 4KE6A 2BAGA 1NVKA 3AGPA 2H31A 1PFYA 3GW8A 5ICCA 3AVWA 1UQTA 2XGOA 2EDCA 4LXGA 4ZAVA 1ADJA 1R2YA 3GFGA 5B30A 2JKYA 2REBA 1GQFA 4LWZA 2W5UA 4QT4A 3ZU3A 4ZQGA 1B6GA 4L6IA 2RHJA 4S1VA 4AJHA 3SU8A 2FEXA 4HKTA 1T4GA 1RWVA 1KRWA 2J3QA 3ZY3A 3GMTA 1MIOB 2QD1A 3VDUA 3DAYA 4CJXA 4UHFA 1PZNA 3OLCX 3OOEA 5CLHA 3PG5A 1MW8X 2HMSA 1TVKB 3V42A 1XPUA 1OV4A 1KXZA 4QXPA 2C8KA 4XBOA 4OU5A 1U28A 4MI6A 3C6XA 4H4EA 4GF5A 3GA7A 2UYYA 1BU8A 1Z7WA 1CY8A 2IK8A 4JT4A 4B8YA 1BYIA 1E9RA 3TL6A 4I4LA 3DEJA 2VUIB 2WWFA 1GCIA 3UXEA 4I46A 4BNKA 5HXAA 4ECEA 3LQFA 2XMPA 1Z33A 2FUKA 1TM3E 4OATA 4PIVA 1DGFA 4HWTA 1U0OC 2Z5LA 1Z4KA 2LR0A 5AVYA 2Q4DA 3D6UA 1U1GA 1Z62A 3THWA 1RBYA 3WGVA 3DCIA 3COPA 4F45A 4LRXA 2PT6A 4MIYA 3FWPA 5JFTA 1Z83A 5A7GA 3UK1A 1E18A 1K6JA 2JEOA 2H1LA 2VQEM 3Q3VA 1GV0A 1ND6A 4DR5M 4CHGA 1DSSG 2QE7D 1A5SB 1C7IA 4V1CA 2TYSB 2H5XA 2BHLA 3DFMA 3DS8A 2O3TA 1ANKA 2ZBDA 3DPUA 1WXGA 2IXDA 4Q4HA 2XSZD 3GLHA 2DE0X 3P9CA 2Z83A 1GABA 2DKFA 2DWUA 3T7JA 5J2UA 2GZ3A 1Z5VA 3RKUA 1NLFA 3H75A 4P83A 3HVKA 1VIMA 4RXUA 3AL0C 1K27A 4FKBA 2AMFA 1UK9A 1YV9A 5DLYA 1YU6A 1GARA 4EMSA 3L1VA 2J7OA 2B1QA 4QC2A 5BUSA 5T57A 2HHJA 4E15A 3SE0A 3FVQA 4TTTS 2HA2A 4LXQA 3PHGA 2C82A 1EFUA 3KR0A 1HT0A 5TJHA 1XC7A 3UK6A 1E1KA 4LRSA 1GTMA 3QELB 3MS7A 2JFYA 3OLYA 2WVHA 5KU7A 3WLFA 1KP3A 2OR3A 2E3JA 3IYLW 3ETCA 2AJTA 2JEZA 3F5QA 3NC0C 4QSMA 2J9RA 5FJIA 2H1CA 5AI9A 1THZA 3DR5A 3K15A 1UM9B 3RFFA 3KEMA 4WJZA 3OVMA 4P86A 1ZQ9A 3ZKWA 5BSWA 3GC6A 4JMPA 1N36B 3TK1A 1XZNA 1M74A 4Q1DA 3ONFA 5HS6A 3GRFA 4M37A 3MXOA 4KVGA 2I7CA 1H5UA 3QPVA 1FFXB 3JS5A 3IVAA 4C0HA 3MC1A 2JGIA 1LI7A 1V6SA 2Y0TA 3GWGA 3SLKA 1RXSA 3QE4A 4B7FA 5BQOA 4PSAA 3SR3A 1N6IA 3L26A 2BKUA 3E23A 1Q7TA 3OT5A 3JPWA 2ZJ7A 2WDPA 1W29A 3SMQA 2Q7OE 4MS4A 3W8RA 3KU4A 4FK8A 3UKOA 5F7ZA 3WBJA 4PYKA 2LW7A 3WZ2A 3PGKA 3EPHA 2PUAA 2FMXA 3PFFA 1HK7A 5JASA 3SAVA 3S2GA 1N2OA 2H4HA 1V3TA 1N2ZA 3CONA 1RKUA 3S1LA 5LZ2A 3W5DA 4MGIR 1IQPA 1E2UA 1ML3A 3OPYI 4ZCTA 1LUAA 5L6MB 3JVDA 1DV1A 4G86A 4ZOLA 3HXQA 2VTEA 3HLKA 1U7XA 4RTRA 4DRYA 4LJ6A 4FFPA 4Z5XA 3SQXA 2ZZKA 2HMYB 3TW8B 3ECAA 2XD4A 2R3SA 3WLIA 4KZPA 5JSUA 1WEKA 4CLOB 3RGGA 5IAAA 5KMGA 3B1YA 2OA0A 1GAQA 3O7MA 1NJ8A 4DJFC 4JS0A 1QIDA 1SOMA 1L4UA 1XA3A 3OUTA 3QOWA 4JCOA 4IF6A 2DR3A 3NFRA 2FW7A 2Q7DA 1PW5A 3SX2A 5CA1B 2IVZA 3K0FA 3FSGA 2QB5A 2W70A 2I7VA 3VH4A 1CNFA 3BRWA 4ENTA 3LDAA 1Q3CA 1YL6A 4L73A 4NX2A 2J30A 3NH9A 5JAOA 1DCMA 3O8OB 2V6IA 3K9OA 2IS1A 3JWJA 3Q2OA 4QQRA 1LI5A 2XKBA 3DOAA 2C3PA 5TPZA 2C7GA 4P81A 2PYDA 2VYND 2DZNB 3B7ZA 1UM8A 2AEJA 2H7YA 3CJQA 1YXMA 3HVJA 4LG2A 4WI1A 3GZNA 3C7TA 1H9CA 4UBIA 1MJGA 1S01A 1L3CA 2BP7B 2P8JA 5EKXA 4FGUA 4B7HA 2PX4A 5BQFA 3ILHA 5HX7A 3PGVA 1XG5A 1E59A 5CT6A 1AKNA 4ZHQA 4YT5A 3A4TA 4TYMA 5CFOA 4IBFA 4YT4A 3AWIA 3LC1O 2Q2EB 2DYKA 4IVQA 2IUTA 3PJGA 4WTOA 4ZDWA 3GPUA 2A58A 2JY5A 3WV4A 2PUHA 3G8DA 2ZOSA 1TI7A 4P7KA 3O94A 2OCGA 4TVOA 3ANYB 2RCYA 4P92A 1G3MA 3BMCA 1JEDA 1A7KA 3IB3A 3CR7A 4R7TA 4C9BA 1SQFA 4KQMA 3VHLB 4G84A 2GYUA 4UFNA 5TMDA 5DLEA 1KKUA 5KYVA 4XGKA 5FKJA 4ZV9A 1BHQ1 1LRKA 2EKPA 3T1YB 1QYVA 5LKAA 2DKNA 3VNVA 1SG0A 5CEEA 1VIDA 7ABPA 2VSFA 3OKFA 1NKTA 1XAJA 4D79A 1EVIA 3ZH9B 1OIZA 3O7WA 4Y6GB 3R7AA 4GWGA 2KQUA 4AVYA 4FLMA 3KOZA 2WIKA 3GDFA 4B09A 2FF7A 3K2EA 4EG4A 4C7OA 1BMFA 2Q5FA 5LQRA 4BKUA 1ZD8A 2O5RA 3OP1A 1GVNB 1QTNA 4FXPA 2ZK7A 4O6VA 1P72A 3FMVA 2QKYA 2BYTA 3Q3CA 1P91A 3LFTA 1RTKA 2Y66A 2Z08A 1U65A 3CH5A 2W6PA 3D2LA 2Y0DA 1EE9A 5JC1A 4HH1A 1AMOA 1TJ5A 4V0NA 5BRNA 2Z2JA 2F8SA 4MTCA 3C74A 2JDIA 4KBGA 4HDCA 4AY2A 3RW9A 1Z6YA 4OEHA 4PFKA 4G09A 3T35A 1S3SA 4HOYA 1MT3A 3HFGA 3S3TA 5JFGA 2YJ6A 5AVJA 3FPSA 5IEJA 3CX7A 1MPTA 3M1LA 2RB4A 1JJ7A 4Q7MB 2D0OB 3DONA 3EXHC 2ZU0C 5G3YA 1H69A 3BIJA 4FBGA 4A5OA 4GNKA 1RP1A 1MN3A 1N8NA 2CLOB 3CH7A 3KVOA 2DBYA 3R76A 4ZC1A 1KVRA 1SUBA 3RS4A 1WD5A 3NBKA 5ALIA 1YBVA 4EPYA 2QT1A 3AM1A 4UM9D 5CP8A 2WTUA 4JN6B 1PQPA 1BN7A 1XN4A 3MVEA 2HIGA 1G5RA 1E9VA 2DG2A 3ZWNA 2W2TA 1O87A 3G0OA 5FF9A 2V7BA 1DO0A 2XNSA 3OICA 1I24A 4HDMA 4J1NA 4YJGA 2CCKA 4IAOA 4LECA 2PTHA 1RAEA 4P17A 2X8LA 4DC0A 5KYWB 3TCNA 1U3VA 3OIGA 4UTNA 2NU8A 1KZ7B 2P3QA 1SXJA 2C2YA 4FOLA 4BO5A 3DMGA 1TYCA 5EIWA 3SHFA 1WSBA 5IRCD 2OGZA 2FSGA 4GDMA 3QLVC 1CFZA 2EKFA 1XCLA 3WRYA 3R9XB 3AEXA 5EQTA 1ZA2A 4V2IA 5BNZA 4ZO6A 1C2TA 2J5RA 4NSOB 1WOMA 1T3GA 1R0BA 3WDSA 3H2KA 4NP6A 1AUQA 3PXAA 1OC2A 3KXLA 4CFYA 2Z3WA 1RAFA 2CP8A 4JXZA 4MRMA 1NQTA 1OTHA 4NU5A 3BFXA 4U3JA 2B1IA 2AA3A 1ORWA 4XARA 3RSGA 5DHSA 4LNAA 3TVDA 3UMBA 1AK1A 4P7BA 3KC2A 4EW1A 3PQ3A 3ZZMA 5LP6C 2QLTA 8OHMA 3HJTA 5EJ2A 2Q3EA 2PVPA 4IO0A 4DHWA 4BKMA 1QHHB 1FDSA 4WKCA 2C8JA 5H3LA 2L09A 3MB8A 2RGNA 4IV0A 3UXHA 1YFZA 2PL5A 4RPIA 4ON9A 2VPTA 3A1WA 1A95A 2OAP1 1QO0D 3CW9A 2ADMA 4IIWA 2V4UA 3PRHA 1VB5A 1CUIA 2FOXA 5JDIA 2GYYA 4ZV7A 4G07A 3I04A 3WGNA 4K03A 3TQOA 1I7NA 4WHMA 2PPLA 1FLAA 1C9YA 3KAQA 3KOYA 4UEKA 2C7QA 4CIYA 2A7QA 4FYPA 3MYYA 4CI9A 4A4DA 3ZZTA 2OOKA 2ZCUA 5ALSA 4P2GA 3S99A 3MGBA 5JXIA 5FPTA 2JJ1D 1JH9A 1UJ5A 2Q41A 4URYR 1AKMA 3GG2A 1K3WA 3Q7QA 2O14A 3D81A 1TH3A 5DCLA 3EFBA 2W8BA 4H7FA 4I6EA 4AY4A 5AKXA 2ODNA 3QENA 1JSLA 1K7XB 2V74B 5IJXA 4IMJB 1VQ1A 4J0FA 2V9ZA 4YRPA 1AK2A 2HLNA 4HAWA 1KJNA 3ZXSA 2XQIA 1E77A 5IM5A 1IN6A 2AOVA 4RXTA 3PC4A 2HNAA 2F8LA 1MRNA 4EP1A 5F35A 1HDZA 2RAUA 4Y7DA 1W2WB 4QASA 1YIDA 3BE4A 1JQJC 4Q6BA 2NGRA 1RYDA 4B3RM 2ACKA 1UBOS 3OEYA 2X6RA 3B8HA 4HB2A 4MARA 4OM7A 4BKQA 4PW0A 2B3TA 1UZLA 1L1ZA 1KYZA 4DBZA 1Z4OA 4INOA 2WUGA 3PPIA 2HY7A 3JWHA 2JI8A 5LD2C 4M98A 3JZFA 4HMOA 1P9OA 3QY0A 3NDPA 5JE8A 1QH1B 3RREA 1JJVA 2CNBA 4A26A 1ZH8A 3K70D 4K6FA 2BLNA 3AC0A 4TQ9A 4ZOBA 3RGSA 5EWJA 5KYKA 4JI6M 2N1MA 1WXXA 5HJ7A 5P8WA 1FFBA 3NH6A 1D2NA 1Z7GA 3MJDA 5FO0A 3E21A 1P9LA 4WSOA 4Z2YA 1TXGA 1FTGA 1GG2A 4UXHA 3MINA 4B8ZA 4A91A 4DIUA 1I3LA 1S2GA 3CB2A 1Y3FE 3ONWA 4WZZA 1NIPA 2NXJA 1G7SA 3T3OA 3JVEA 1OA1A 2OHVA 3UK2A 4EGSA 1A27A 1RCFA 1WTCA 2A5LA 2VTBB 2G77B 2RE8A 1ZUWA 4ZAGA 3M7IA 3O8LA 4D8TA 1SZJG 3IDQA 3OQ6A 3P0FA 2BJWA 5IF3A 1H42A 2CJYA 3NOOA 4GI7A 1N1EA 2V9CA 1Y8QA 1YHZA 1UKEA 4V24A 4ERNA 4KN8A 7GPBA 1XMQM 3VVCA 1XIVA 4YRCA 3B6ZA 2PT7A 5H8WA 4AURA 3F6EX 1NE7A 1N6NA 3GPDG 2OXIA 4YRTA 2F17A 1JAIA 4PIPA 3M4NA 3W9UA 4F97A 1R2QA 2G8NA 1UBRS 2BE7A 4F2PA 1ZCBA 4TMXA 2QTGA 2J6BA 1IZ9A 2ZR8A 1BQEA 2NYAA 3EHEA 5L4LA 3O83A 2IP2A 3OZFA 3DT8A 2BH2A 1EWKA 3WWEA 1JJIA 4Q00A 2V0GA 3LX8A 1IL0A 3UQYS 2EJVA 5I7OA 1RC0A 1QQWA 2QXTA 4HNRA 1T6YA 2ZJ8A 1HE1C 4ZZ2A 2RGBA 3M2TA 1XCPA 3G0CA 3ZHQA 3BIXA 4TZ6A 2C88A 3WWPA 2FH5B 1J6UA 3IULA 1XU4A 4CGZA 3FI9A 1NI4A 3MTQA 1WQ1R 4C4RA 3O1IC 5C8DA 4MQBA 3HRHA 1C29B 3BH6A 3NHZA 3DDZX 3N0WA 2TMKA 5JEDA 2P4SA 1T4CA 2LTUA 4Z1MA 4RF5A 1TOAA 4G8JA 1NBOA 4Q6WA 2PMWB 3LPNA 4MDEA 1QDLB 1OAOC 1L3BA 4AECA 1AKEA 4EGFA 3AERB 3ZWYA 2H6EA 4F3YA 2IBSA 1UBCA 3NWLA 1VSUA 3TR6A 2JFVA 1Z16A 3GQVA 4IF4A 1P61B 5FA8A 1JKIA 1LU9A 3H7IA 1Y89A 1ZVQA 3C1TA 4ZWNA 2XUQA 3VNUA 4UHEA 4HVAA 2JANA 4KOAA 3ZE0B 4UBOA 1KOGA 5HGXA 3N2GA 4YRNA 4A6XA 3AFGA 1JDVA 2VAMA 1FUKA 4DYVA 1XU9A 4JKYA 2GNOA 5A62A 3L0DA 1KZGB 1QG6A 2UYCA 3IEIA 4N18A 4G81A 3EEQA 2FPKA 4CNBA 3KJEA 4JZKA 3AW8A 4NWIA 2FW9A 3QEOA 4KWHA 3S8MA 2OFPA 2PX6A 3FOEC 1FP4A 4WINA 4H60A 4L5CA 3PDCA 5EP3A 5KQLA 1FX0A 5CFZA 4OHOA 1GKIA 4BNVA 3CX4A 1OOEA 1MX3A 5SY9A 1NL3A 1NSYA 3TNDA 4EUFA 1TDJA 3PKZA 4JJ4A 2DENA 1JHZA 5FXMA 1X7ZA 3VPSA 4RJKA 2VP9A 4QU0A 3GZ4A 1HG1A 4B3FX 2IE0A 2NO7A 4RD0A 3UPUA 3OIYA 3TMYA 2GZAA 1FYEA 3AF2A 4EB6B 3BBZA 2N42A 3SNHA 2NZXA 1WPGA 3U6KA 4K7JA 1WS6A 4B43A 3R7BA 1CDEA 5KVVA 4JFRA 4N9WA 4UDNA 3PXUA 3NTUA 1WXIA 5E6UB 4QYIA 5T41A 4TKVB 4NPCA 4TV8A 2O19A 1TF7A 4HX9A 4OXYA 1N0HA 5JW6A 3KJZA 3LX4A 2PR7A 3WGQA 3O26A 3F97A 1FNBA 2ETVA 4E5NA 2ZAGA 1QANA 2NP7A 1S1CA 3HJ8A 2QQ5A 1Y4ZA 2JBAA 1UDXA 1UC4B 1VIVA 1ZK4A 4YJHB 1BFDA 1ABBA 2AZTA 4QDUA 3KS9A 4IRXA 3DMTA 2Z56A 3R20A 4M3NA 3MJTA 5I4KA 1RXUA 3H2BA 3UO8B 1MVLA 4UAVA 3EIQA 3TD9A 4IDPA 4KIGA 2C5HA 4LOAA 3QE0A 4A2PA 4CKZA 4C0QC 1CG6A 4P3XA 3CNLA 5KREA 5KYUA 4Y8VA 1I7SB 3BGIA 3DE1X 2IRWA 1XAIA 2OXCA 3C70A 2ZIUB 3AHIA 4PPGA 3K1YA 2GPSA 1K7EB 3WL7A 1X2EA 5HEKA 4PR0A 3I5UA 4ARVA 1QE5A 3BA1A 4IVPA 4PZAA 4WCFC 2DWCA 1TB4A 3WLAA 4D99A 2PVCA 1YCHA 5LLTA 5HUQA 1Z7BA 1Q3TA 4JI0B 3VGJA 4A8JB 5EIBD 1G38A 1NMZA 4AZVA 2W6ID 1YR2A 4NY1A 2DR2A 4LSWA 1YB7A 3MN1A 5TARA 3OAAD 2V55B 2BPOA 2GEKA 1ZOPA 2VJOA 3HH8A 5LVAA 4HFRA 1YKFA 4FT2A 3DYIA 5AESA 4DMKA 3R4CA 1CXZA 1JHUA 3SF8A 1ZDMA 2QZZA 4XEUA 1XL0A 2PZKA 3T3NA 1T2FA 2L42A 4II3A 3IODA 4FGSA 4BLOA 2YHBA 4R6XA 4HF7A 2E21A 2VT6A 1J1UA 1JEQB 4F9TA 4UBMA 4EJSB 2GF9A 1W44A 1DG1G 2BFFA 3C98A 4FIZA 4C4OA 4YB8A 4L2IB 1X9IA 4E88A 5DT2A 1KH1A 3PJEA 4CQMD 3KQNA 3NRBA 5BN5B 3WI7A 5CW1A 1I2CA 4J0EA 4AF6A 1L8QA 3THXB 4ABYA 2M1XA 3X2SA 3WHPA 2BF7A 4BKOA 1ZNXA 1EP9A 1DWQA 4IBGA 4LGVA 1KOFA 1L7XA 4MCIA 1VRWA 4YRKA 3GAFA 2PXHA 3U4HA 3G1WA 4G85A 2H29A 2REQA 3QY9A 3EAFA 3OOJA 4OM8A 1YVDA 1PSWA 4WLVA 5HE9A 2VO1A 5J40A 2WHRA 4ACAA 2FP4B 4CIZA 2HRDA 2M6RA 2X0JA 5JAIA 1JLLB 3FD8A 4JL6A 4KBFA 4LDPA 3AJRA 1U2DA 5KNLA 2BEVA 1X19A 1T5OA 3KALA 4GM0A 3K31A 3AUYA 1CVIA 3MK31 2Z58A 5DSZA 2B0CA 4LF8B 4LBZA 4EJ6A 1L5SA 1P5RA 4JVSB 2OXFA 2X8BA 5AM4A 1GPH1 3VHXB 2FV8A 5K8CA 2QP9X 1AB5A 4I3GA 1K8QA 2GFQA 1C41A 5JXHA 1BS2A 2X2FA 4UZSA 1B00A 1WB4A 4TRNA 1H2BA 5KOHB 1MC4A 3GJXC 3IEVA 1DBSA 3PQ4A 3TZQA 1OWNA 2EG5A 4IX9A 2UUBB 1M1NB 3RM3A 5I48A 4AI6A 1PT5A 2FI1A 4Z4GA 2I4MA 4EB8A 1Z0UA 1T0JB 3EIWA 4A82A 3K4PA 3TPZA 4EVIA 2ERXA 4DUYB 2PLAA 4IZOA 1EHCA 1WXDA 3IMEA 4UVHA 2PH3A 1VCNA 3UHFA 2X4DA 1ODCA 1FSPA 4KSBA 2ET6A 2UZIR 3TIGA 1OZAA 2DT5A 2R2AA 2D1QA 3QI7A 4DEXA 4V0ME 1IHXA 3GGPA 2P4HX 3GJ7A 5HJ2A 3P2EA 4M53A 1QX3A 2R84A 2FPOA 3U7QA 4AUMA 1WB6A 5DNYA 3EQ2A 2XZOA 2H06A 4M8SA 3D7LA 5HNKA 5E9JA 1KMQA 5DNVA 1YVEI 3ZVNA 4JA2A 1AHNA 3HB4X 4U2EA 4GPAA 2CK3A 2QNIA 4WMLA 3UVEA 3NVAA 2O20A 3QFFA 1NJ2A 5IN4A 2FU5C 3HYCA 4MB7A 2I3AA 3ZVMA 2ROQA 4WX2B 1XTVA 2KPOA 4FMCB 3LWNA 3FYHA 4RV4A 1YR3A 3L7IA 1JR3A 3A6FA 1O4VA 3IP3A 3S5JA 4DDMA 4MI1A 3NVMB 3TJZA 3HWSA 3VZQA 4N0PA 3P96A 2Q0HA 1MO2A 3KJGA 4KN5A 1WNFA 3OQ1A 4H0FA 5CAEB 4YUWA 3S28A 5BMVA 4I1SA 4AG3A 2GAJA 3WNBA 2QY9A 5HUJA 1WIWA 1CZRA 1LNSA 4CXMA 4D46A 4J3FA 1T3ZA 4KR3A 1CKEA 3CCBA 3KD2A 3ANNA 4IW3B 1J25A 4FC6A 3O8NA 1H94A 1FLNA 1H1DA 1USWA 5AK4A 1E66A 5C1IA 4C3VA 1PWEA 1NOKA 2OZVA 1O94A 1HDRA 3Q6MA 3KVNA 1YMVA 1Y4AE 4JBGA 2BL4A 2O0LA 1X1CA 3MUFA 1G1MA 1G8FA 2O2IA 3L8DA 2OGWA 3RU9A 5DH9A 2NNWB 5FWAA 3W4JA 2NTYC 4D0RA 4EVQA 3B2NA 1FTQA 5AHXA 3SG0A 4YALA 3FGPA 1E20A 4RANA 4A36A 2FG5A 2BR4A 1V1MA 2DPHA 3TRJA 4UEWA 3D2CA 4EDHA 4ESHA 1TT5B 3H6KA 3WWYA 2CXRA 4L8LA 4R41A 2PZAA 3K0CC 2A1IA 2GEFA 5BUQA 1GTSA 4P22A 3KTAA 2WHQA 5DBGA 4LRTB 4JP1A 2FTKE 1F4VA 3IKMB 2WF5A 1AUOA 1Q1ZA 3B74A 2I4LA 2JGNA 3R0VA 4UREA 4D98A 4F06A 3WYFA 2IEDA 3ZJYA 3EEFA 4CTJA 3OZSA 3T7KA 1QIHA 5IZCC 4QICA 4O2AF 2PRSA 2J31A 4C0JA 1VJCA 2ISQA 4FYHA 3SZLA 4GMHA 2F48A 3F47A 1SVLA 5KSZA 3GRVA 4DLPA 1BA2A 3DO8A 2NZ2A 3LUFA 2GXUA 3WE7A 4JHLA 3VR1A 1P6UA 3PL1A 3F46A 2JD2A 4XWGA 2PRZA 1LJ8A 1U0TA 2VA9A 4DA0A 1T13A 2IZ0A 5TGZA 2X4AA 1UOPA 3BCRA 4N7BA 4CT5A 2ZWIA 4TMFA 4HAXA 2LVQD 3BUSA 2QLFA 1X70A 1Y4SA 1XTZA 4UQLA 3I9V6 1T4MA 3SIWA 1NQVA 1LLFA 3GRRA 2QRGA 1WW3A 2AMVA 4PDIA 1XJ0A 1N7GA 3SVZA 3KB6A 1QIIA 1ZJ4A 3G2QA 2XH8A 2FR0A 4KWCA 4AICA 1J20A 2PT9A 1WZ2A 1BDBA 4O63O 1T8SA 4BVKA 2XWSA 4HV4A 2R60A 2YFHA 2JI7A 2HWUA 5ES4B 3FUTA 4BFVA 4HJXA 1YQXA 1U8ZA 2O5EA 4ZCIA 1XTIA 2OFFA 3VVLA 5LMUB 1E6WA 4GGPA 3X1ZA 2NZ8A 1MHPA 5AJXA 2PH1A 4RCZA 1TEXA 4U4AA 2QF7A 4ETIA 1CUZA 3R7FA 3DV2A 5CHEA 1ATZA 1VZ2A 3SSMA 4IILA 2PD3A 3DKPA 4PYLA 3U7GA 3JALA 1W9HA 3RC9A 3QFHA 4AY5A 3GGDA 4EUSA 3JASB 2IOFA 5I7VA 3KO8A 1DTWA 3H1AA 1Z68A 2VHWA 4NHEA 2QAIA 2R4TA 4M1EA 2ZIXB 1HG0A 1VZ3A 1G3QA 1YGYA 1I7PA 1W49A 4DSTA 4DV7B 1ZOLA 4ND5A 1ACLA 4PG6A 5DI3A 2BEUA 2GARA 2WU3A 2CFCA 2JH3A 3I39X 1WHTA 4B2IA 3SSAA 1RJDA 3D4BA 3SICE 1EESA 1G2OA 4EUKA 4RK0A 3H8SA 3DEIA 4LZOA 4HYEA 4D6XA 1W76A 1LW6E 5CM9C 3SI7A 2ZXEA 4LY6A 3IDSA 1P3QQ 1EK2A 3A31A 4HFJA 4NENA 1E2FA 1MJFA 3ST7A 1U2TA 4BP8A 4YRIA 1SB9A 2VDOB 2XMDA 2RHWA 4EA8A 3GVIA 3SJAA 4LMRA 4XYBA 1CJVC 1L4MA 2PMFA 3PF9A 1TTHA 1SURA 6LDHA 2OV1A 3SZ3A 1TYAE 2R4EA 2CE7A 1TVEA 3A3PA 4J1TA 4PTYA 3N58A 5CCEA 2NTVA 2FPPB 1ZR4A 2A0UA 1WF6A 4RH0A 1RW4A 1XA4A 2HWKA 2QL6A 5C8YA 4HLNA 2MCFA 2PY6A 4WK2B 3T0FA 1AQUA 4F6CA 1G55A 2OYRA 2SKEA 3GAZA 1A7UA 4B80A 1EK1A 2R00A 4XQ0A 3LLVA 4JNCA 2OKGA 4RF2A 4NPHA 1U8EA 3DD5A 3SYKA 1XI2A 4L3VA 1JTEA 1D0IA 1F6DA 3UUFA 1U7OA 1QB7A 2O57A 4LEIA 4FYVA 3L27A 3KOXA 1GEGA 1XKXA 3EMVA 1Q7RA 1DG3A 3ZPXA 3V80A 1R8XA 1NNJA 5EPOA 2VJMA 1E2QA 2WW8A 5TIIA 1MRSA 4X3CA 3G17A 4JBWA 1XNHA 2CXSA 3U4CA 2ES4A 1Z8NA 4H7KA 3EC7A 4I50F 2H65A 4OREX 3EG9B 4PIMA 3IXMA 3D0RA 4DB4A 5CB4A 4OQ4A 1PJRA 1T10A 3BD8A 4DDTA 2R87A 2V65A 3VX4A 2QBYB 4GRDA 3RS0A 4RSMA 4II2A 4FFWA 5KNDH 1E8DA 3JQ9A 3RVDA 2QHXA 4M1WA 4IOMA 5IFKA 5L3RA 5DO9A 2PS3A 5ECDA 1SCUB 3DPSA 2NWQA 3SBDA 2H1RA 4XWWA 3ERCA 1YDMA 2V1XA 1PQUA 4BP1A 3HL0A 3A9TA 5JJBA 4LHEA 4ND8A 3M6WA 3U5TA 3WAGA 2WD9A 2DNAA 3V00A 1HZJA 1U9CA 2HHCA 2NU9A 4UJ3A 5CDYA 3K1JA 4W1QA 1GGEA 3IHWA 3VU9A 4LIPD 4MV0A 3LCCA 2OKCA 2QVLA 1H4QA 2X4IA 3UB4A 4YRMA 1E1RA 1G8KA 2BBWA 5C5DA 5ITTA 1JPJA 3P26A 3IO3A 1FL9A 1VE9A 3I05A 1R4ZA 3HJGA 2R8XA 1VBNA 4QOFA 3EFOA 1ZHOA 3HNOA 3CLSD 1FUIA 5JHHB 3OZBA 2JAQA 1YC2A 3VVMA 4HSGA 1UJMA 1UC8A 3KQMA 5FTNA 1Y81A 2CHUA 2OHGA 1M2FA 4AKIA 5HS4A 2RH5A 1H6CA 4GDFA 1JS1X 3TW0A 1HJPA 5J1SB 4NXMM 1DKOA 3STXA 1JXAA 4LQDA 3ER6A 2G0TA 5LQNA 1QLJA 3KAPA 2XTMA 3DJFA 4KDFA 4MR8A 2X0IA 4E5DA 3LQ1A 2LE0A 3ACDA 3PNKA 1E1CA 3GR6A 4RU1A 4OXKA 3IBSA 1A2QA 3WLKX 3OZGA 4ME6A 4Q4JB 1PFUA 2XDWA 1FEZA 1P9RA 3TIXB 2AFIA 4OX9B 3VHQA 3EQ6A 1O2DA 1Y6ZA 5EIHA 3E3OA 3GNSA 2XTZA 4HT3B 1DIGA 4C2AA 2RSLA 3FE2A 1LDMA 4FIDA 1JHPA 1U1CA 2W2KB 4DCNA 2XCLA 4BZPA 4YCSA 3W9SA 3T12A 1OBOA 3DEAA 3DZDA 5CT8A 5D3KA 2H2DA 1O0BA 1DAEA 2C20A 1O95A 1P1KA 1GRRA 2HXSA 2YS7A 4CJ6A 2DKOA 1X94A 4JWTA 3RRFA 5MDHA 4I36A 4TMWA 2ZYHA 1MC8A 2ZB3A 5JCJD 2H7CA 1SD2A 2I9KA 3LSYA 4U7DA 3E27A 2WICA 3LIPA 3GP3A 3U60B 1ZGJA 3G85A 3LDGA 1P1CA 4M9CA 5F7OA 1MBZA 2GUGA 4RD2A 1T91A 3I8XA 3P0JA 1HLDA 1X3LA 3RBVA 2HV8A 4EMBA 1I2MA 3BIFA 2VTVA 2GSWA 1P19A 3JWIA 2A1UA 1NTRA 1Y1SA 4E2FA 3H16A 1LSJA 4HPWA 2PCJA 4YJDA 5AKYA 5AW8A 1TZCA 4PLPA 1V5EA 4V0QA 2F3UA 2XA9A 5TT1A 1V25A 2CHEA 4LG1A 4WBSA 5KPTA 4N76A 3PNYA 1Q44A 3H9GA 3KWJA 3BS4A 3UHOA 3ODGA 3GXBA 4C0SA 2G28A 1FQWA 2OCLA 4BRWA 2IDMA 2HSWA 5GOTA 2I2BA 1BMQA 4RF4A 4I4CA 1RYMA 4JV5M 3MWDB 1HTTA 3P9ZA 3B1ZA 1OIWA 4NFHA 5THKA 3DW3X 1I9GA 1TT7A 5EPEA 4IGIA 4O4HF 5J23A 1HT2E 4PLCA 2G1PA 4N40A 2I3GA 3I09A 3AFOA 3ADBA 1XTBA 1IBKB 4IQ0A 3KJXA 5K3SA 2PXAA 3WKEA 1K3FA 2DFKB 5ERXA 3MWFA 4YRQA 1U1EA 2JI4A 3OOHA 5FT9A 5FOTA 1XQ9A 2V4ZA 1UPBA 1ZZEA 4QIHA 1USGA 3H0CA 4NBWA 5ARBA 3JAWA 1Y7TA 1N32B 1SVUA 2I99A 1TIBA 1FJGM 2C00A 4UAJA 3CHYA 4R7ZA 1A9XA 3IQXA 3TN7A 1VLHA 3W34A 5EJAA 3E5NA 1K4MA 4HNUA 1F9EA 2O8BB 1FBNA 4K6MA 4C0KA 5BV2P 5TQ0B 2MMCA 4UAGA 1OC4A 2FE8A 4KAFA 4ND4A 3WMFA 4NBTA 1XKLA 3NT2A 2RGDA 2QVXX 3Q85A 3AESB 3NAQA 1Z13A 4D2IA 5LLDA 2I6XA 1X92A 2IYNA 4N54A 4LTMA 4F4HA 1DDIA 1KHTA 3GLFB 1NVVQ 1XCGB 2H2HA 4P31A 3IIKA 3LVQE 1Z7EA 1JXMA 2FPGA 4FQ7A 1BDIA 1IY2A 4FGJA 4GLJA 1HRKA 1WKBA 3OY2A 3JQCA 3I4VA 3KB1A 5CLIA 1RHJA 5HBRA 3A4IA 3VDPA 2P8SA 2VP2A 1IK4A 3KKMA 3UEOA 2H52A 2FUG1 3IS3A 4GR9A 1XO1A 3KKQA 4WY5A 3GLFE 4UPEA 4UE6A 2VH2A 2HDHA 1BJKA 1ZUNA 1KR2A 3TUIC 1R0YA 5DBOA 2IUEA 4ZODA 1M76A 1W1WA 4F5YA 2Y92A 3HXMA 5M2QA 5IU6A 3VAZA 1RLUA 4RQBA 3B1WA 421PA 3FA2A 1I7LA 4MVJE 1TE2A 2AUNA 1NQXA 4MUEA 3TSWA 2ZTCA 3KNZA 3KSBC 1F2VA 2FUNB 1BW9B 2LHGA 3CUKA 2FFQA 2QVCA 1IJEA 3DTVD 4TWZA 2RGHA 3TFWA 3ZYZA 4A3VB 3T15A 3KEQA 4XGQA 1YONA 2NZJA 1S2MA 2IEYA 4KMOA 4BVHA 1MORA 3INTA 2FNAA 4DCJA 2X7XA 3F73A 4G1CA 5F12A 2QRNA 3OPVA 1OKKD 3R40A 1CVLA 1P74A 1DJLA 3EVAA 4P33A 5IPFA 4JX9A 4FE7A 1ZGHA 4ZDIA 3UBTA 3W4IA 2AQIA 4U7WA 1QGUB 1KFBB 3H2YA 5IM4F 1HNXB 1RI2A 4Q48A 2O2GA 3FGZA 5ADHA 5HOEA 1U3CA 3QG5A 3IQDB 1PFGA 3TEJA 3CUUA 2I6GA 3GRAA 2MR9A 2HF8A 1KTVA 4Y1RA 3MK6A 4RGBA 3LTNC 3PNOA 2VP0A 3CZ5A 4K86A 3NJ4A 3HVUA 4MR9B 4QM6A 2YMLA 3T3GA 5HM8A 2OBNA 3BWDD 3L92A 1WVMA 3HG7A 1MXHA 2PLNA 1OLUA 4GP6A 3O1HB 1UBJS 3BTVA 4NC9A 5CVCA 4HH3C 5CD1A 1NDQA 4FNGA 3OO1A 5GONF 1U8FO 3FMGA 1ICIA 4M9SA 3NG1A 3R8CA 1YNOA 4XIIA 1NXWA 5KNDD 2PZEA 4K2HA 4AY6A 3UCFA 3OJXA 1T9HA 4AULA 1L8XA 2HU5A 2Q5IA 4KITB 2WG1A 3D6TB 2Z5FA 4P93A 5J3JA 2R1UA 2NVOA 1L5NA 1ONOA 1TK3A 2VNAA 5EG5A 2GHQA 1KJZA 4EJ0A 3WMRA 4ZPXA 3BXXA 2CLMB 2KA6B 3R0JA 4JI0M 1WETA 2BJVA 4LOLA 2GN9A 3GMDA 2PUGA 4G5RA 3S55A 4B6FA 2XIJA 1RCUA 1K5HA 2AG8A 2Y99A 3MRTA 6CHYA 5EOVA 1CJKC 1LI4A 3L49A 1Z2CA 5G40A 4ZOCA 2FQWA 3OZTA 3ZE1B 4K9LA 4ZMBA 3VR0A 4MS1A 4KNVA 2FPRA 2KYRA 3R44A 3TNYA 5G53C 3I52A 2NO4A 2W4QA 3HCEA 1NY6A 1RQ2A 4J07A 2C9DA 5EXTA 2VYVA 3RT7A 3VXKA 2MSCB 3BXHA 1G8MA 1YVPA 3RJZA 3V8VA 4ETWA 2P3LA 1T36A 1R12A 1AS3A 5CNJA 2I3BA 2VPQA 1IWBB 4BNNA 3NUGA 3HO8A 4EYSA 4H4DA 4LJAA 3K9PA 3OCJA 4C0WA 4MGKR 4MZDA 3TI7A 1VPVA 2ATIA 10MHA 4QZVA 3B3GA 1EZ4A 1NYQA 4C78A 2DFLA 3MLEA 1HE8B 1Y3HA 2LWXA 1PNVA 4KIWA 4UEQA 3FPJA 1GT91 3SKYA 1NXSA 4JYAM 3EAQA 3THOA 3LYLA 5B55A 1N3LA 4XYLA 3RHSA 1Q5PA 4BNDB 1Z0SA 2FEAA 2J7PA 4Y2JA 4LF5M 3JQAA 1O54A 3BXGA 1DQPA 2W22A 4UFPA 1C3EA 4JENA 3CR8A 1X77A 1EVEA 5IAJA 4NPAA 2Z3VA 4NU8X 4BL5A 2NSYA 5ED4A 1KEPA 2ZI4A 1JHMA 1Y8ZA 2GPBA 4DJDC 1IPEA 4UU0A 4KHPM 3KJHA 1KBOA 4CKEA 4RJ2A 1E79A 4C07A 3W8EA 1RLTA 1T8YA 3R7WB 1J9GA 2HCJB 2ZJ0A 1XZBA 1I33A 2BGLA 1SK8A 3QNWA 4O0MA 3V1UA 3IDZA 2AL7A 2QRVA 1QG2A 2FX3A 4O2RA 2B7CA 2BMFA 3NHJA 4V0KA 4P4LA 5BWMA 1E3WB 2E7ZA 1PJIA 4IKOA 3IUEA 3EDMA 4BFZA 3MWLA 2DOKA 4IM7A 4BECA 1Z75A 1BCRB 3EAGA 3NTLA 3UJHA 1VG9B 4CMGA 2UUBM 4FE3A 2A84A 4KK3A 4IEEA 4LXTA 3A2KA 2PR2A 2IUYA 4DNXA 1EFLA 1ZCAA 4B3IA 4DYDA 3ZCPA 3ETJA 2BM9A 4CKCA 4M9QA 3FDZA 4K9RA 4DUYM 2J59A 1EZ1A 5GVSA 1J4AA 2ZWPA 2LUOA 3GIDA 3IKLA 4G9BA 3NWBA 4X6YA 4BHTA 3Q40A 1RRGA 5FNZA 3LZDA 3SZOA 4JDUA 1W5SA 5A5FA 5BRJA 3UV7A 2HAEA 2VAXA 4AU1A 4R84A 2YQ5A 2YHSA 3KE9A 1WHSA 4JLPA 2C7VA 5H5JA 1UL1X 4OKSA 1A5TA 2CE2X 5JBNA 1O5TA 1RZRD 3ZV3A 3GARA 4CMCA 3ESCA 3OQIB 3PHCA 3PEYA 3A4LA 1VI6A 5CVVA 3D8LA 2JCGA 3HWWA 1OXKB 2AN3A 1CY4A 4M60A 4WZBA 4PN3A 3R7LA 4M49A 5FQOA 3GUZA 4WESB 4GMKA 1MAAA 3U6EA 1L4FA 5EIFA 2I8AA 4K6GA 1DGHB 1BHO1 3PUVA 5B53A 2UV8A 3R3HA 2VBGA 1KBZA 4BQEA 2EATA 3SGLA 5AJYA 4E5PA 4RK1A 5IWAM 3G1TA 4F60A 1PTJC 1YSYA 4LMBA 3UWMA 2OYCA 4FVMA 1I3NA 2HU2A 3KRTA 1RU3A 2J5XA 3U40A 2YYAA 1CUYA 2A0XA 4Y9UA 2CXQA 2IPXA 1U2EA 3FJYA 2FETA 3KOWA 2VTDA 4JY7A 4HLDA 4KB5A 4LOJA 2O8DA 5LIRA 1IJKA 4XUCA 2Q9AA 3AB8A 2IC5A 3STHA 3U0BA 4PRLA 5DNDA 2G9QA 5KJEA 2QEQA 1L1RA 1AJEA 5EWLB 3LUPA 2AE1A 1LNZA 3UJ9A 3DFIA 4W7SA 3MUEA 4OFXA 5JAMA 2ZRHA 3KSMA 1JIXA 1GO5A 5E3HA 3WJ2A 2FLVA 3LDHA 2WYOA 5KSOA 1GT6A 5C32A 5AM5A 2EBHX 4XFKA 4X62B 1RPAA 5CFQA 4BEVA 2NIPA 5K8TA 1I5OA 1TLLA 1W73A 1AZWA 3IBYA 5L4SA 3DVSX 1IXRC 1L5FA 3MQ4A 2WSSD 1XLTA 3AONB 3JU3A 5LSAA 1E7WA 1T24A 1G4UR 1UBMS 1T2CA 1T1IA 3BC1A 1MABB 3X2FA 2GESA 2P9QA 3VSEA 2W6NA 3BH7A 1SH7A 3O3CA 2YZ7A 1ZGAA 3K3PA 4KI7A 3P2MA 4JT8A 1PWYE 1NUAA 1XCBA 2PIDA 3IP9A 3WSVA 1J23A 2ID7A 3SFZA 2H2IA 5A7FA 2UUAM 4X00A 1GXSB 2OZKA 1CQJB 2F64A 1ACJA 5CA0F 1U8UA 3PHIA 4GX2A 5LXTF 3TKAA 5I9BA 2ZIFA 3W78A 1A5AB 4XVQA 1T0BA 3RHTA 1DEXA 2KWIA 4W5QA 4O5OA 4B3GA 2DBRA 2QTCA 4EO9A 2RGRA 4PCZA 4KH0A 1AY0A 5KQPA 2CBZA 2VZ8A 1XHFA 3KQYA 3HB5X 4IMRA 4RLFA 3EXAA 3E3NA 3M4YA 4RC9A 2XCOA 4RA9A 5K1ZA 2P6OA 4LYJA 1QV9A 1J2EA 3UMRA 4UXJA 1ONNA 2PGIA 2ZP1A 5AFSA 3PXBA 3ZW8A 3PFKA 2G04A 5AVTA 2DH5A 4PHFA 1JR6A 2ORVA 3LG2A 2REXB 1QQ5A 4TKUB 5F64A 1B76A 4O2BA 3PVSA 3WLSA 1LWNA 1D8TA 3IIEA 4PAMA 4QUEA 3QJ5A 3RSLA 3LC7O 3G23A 5CM2Z 5E7MA 3HZOA 4AJIA 1AKWA 4MWBA 4DCSA 4JB0A 4EI7A 4ILEA 3WGHA 4XB1A 3BSWA 3DOUA 2B6NA 1OVMA 2IBMA 1ZV1A 4DHEA 1ZM7A 2HYDA 3IVCA 4H1WA 1UJ2A 4D9MA 3AIKA 1X1DA 4NMWA 3P4XA 4Z6YA 3I58A 2AOTA 3BGDA 3MEQA 2EGGA 4W8OA 1ACMA 3HXKA 3J81S 3LLSA 5BSFA 1C1DA 4KNWA 2ZM6B 2XRYA 5C2JB 3OEED 4Q3AA 1AC5A 1YIAA 4EHFA 1YJAA 5E8RA 1PZXA 1ZICA 5LMUM 2C8LA 1YJCA 3AKEA 4DMLA 2VQ3A 4QU5A 5EUMA 1V7PC 5JVDF 3EPPA 4G1UC 3A1FA 3ZD8A 1D4FA 4UKDA 1IG3A 3I1FA 2Y71A 3U3JA 5ADVA 1UMDA 4D4GA 1F8GA 2PBFA 3PQ8A 2H9YA 3GDGA 1Z25A 1U98A 3L7DA 2L7HA 2WYUA 1EVLA 1U8XX 2GILA 4YRRA 5DT9A 3W9YA 2P2NA 5JAQA 2CLDX 1SXGA 3CNEA 2BSAA 1SQ6A 1AT1A 2B94A 1X8JA 3GVPA 4MMZB 3WJ7A 4R2WA 1UBUS 4KMRA 3K1AA 1XJCA 2PSJA 2JAWA 3VC1A 3I23A 3UMJA 1S2NA 4GOND 4YUVA 2K4MA 3A6PC 3DC7A 1OXXK 3FDFA 3FY4A 1U2QA 2DECA 3QPBA 3I34X 2M9MA 5A0TA 1L7OA 3TDMA 2HK7A 4L5IA 1EUDA 2Y1LA 3I6YA 3G5AA 2IYXA 5LM3A 2ZWAA 4K9PA 4HADA 3U6QA 4CV1A 3I6BA 3BK7A 4NBRA 1XVVA 4NE2A 1Y1TA 2Y93A 1P75A 2UXCB 3O84A 1HKUA 2IFTA 1JSRA 2I8CA 3D3WA 1Q77A 1HR0B 1WL8A 2A86A 3B6JA 2HO5A 5AI8A 2JFFA 2YX1A 3EVDA 3VO1A 3HKEB 1D8AA 4IJUA 3I6MA 3SHGB 4BNZA 3T9BA 4EQ6B 3DMPA 1ZMTA 3BK1A 4IJEA 2JIBA 4BZQA 1V3QE 3UMGA 4B84A 4CMIB 2CEAA 3SF0A 3W2TA 4NBKA 3SLGA 4BVAA 1KETA 3HP1A 2BF4A 5BW8A 3ND5A 2ATVA 2BOVA 3E1KA 4NE7A 1KAHA 4Q9IA 4Z7JA 3NGMA 3QTBA 4I8DA 1M7GA 2WWWA 4G8BA 4DAOA 3AUXA 4H3SA 1OJ7A 4Q66C 5LMCA 3INYA 3IQZA 3PQ6A 2C3MA 1RWKA 1I5EA 1TCAA 5KTPA 2FXIA 1WUYA 2VWPA 5GM2A 2GR9A 1FW6A 2BWBA 1SM4A 4MQFA 3MMSA 3GRUA 5K0NA 2AKAB 1ZIPA 1WR1B 1ZIDA 2QPOA 3BFJA 1NJSA 4OXRA 5KTTA 4ZI7B 1T3LA 3QVOA 4DR3B 4AS3A 2VJBA 3KHSA 2H0QA 2A30A 3V9AA 2Y21A 1KZ9A 4Z0HO 2IUSA 5JZSA 4DLRA 3M9XA 2P75A 3T1VA 2EZ8A 3BMNB 3E8MA 2ZJ6A 1JZSA 1R74A 3NT4A 4LOKA 1ZSNA 2ZT8A 3IHPA 2GRAA 1EAMA 2EC5A 4B3SM 2FUCA 2D5BA 4TPKA 3HBAA 1R0KA 2CLHB 2RJOA 4OQZA 1ZD4A 3VC2A 1EQUA 2EWVA 1VE5A 1I4DD 2A78A 4KOEC 1FPMA 3KOMA 1DCTA 1Y6GA 3TTTA 4BFXA 4GM4A 2JC3A 5CB8A 3NM5A 1HNWM 3GFOA 4J2HA 3QW2A 1LCIA 1K4KA 1X1AA 3D8NA 4P32A 1M2NA 1JN0A 1Y5MA 1ORTA 4ACBA 2ZRAA 3LHIA 1DTEA 1JBKA 1HQDA 2J5KA 2UZAA 2FHSA 2V59A 3T7EA 1RKXA 1VMKA 1IQ0A 4D3YA 3UOWA 2OBBA 2CKMA 3HP4A 2VDJA 3NWJA 1ZN2A 4ENVA 4D7AA 1GTRA 1CE8B 1N8SA 2F3RA 5EFOA 4BUCA 3EK2A 1O89A 2MSDB 4ZT4A 1CUHA 3PEFA 1NA5A 2HXYA 2BZGA 3V46A 1T26A 1QKJA 4W9NC 5CJJA 1F5NA 4RE5A 4CMHA 4IXWA 4F3NA 4KREA 1D1PA 3FKQA 2JJQA 4I55A 4MUFA 1CU1A 2VH5R 4MYTA 2F3PA 1PX0A 4XRGA 1RJEA 4YA6A 1BVYF 3SHOA 4A9AA 5FWNA 4KGXA 1DINA 3NS7A 1IZ8A 3ZDYB 3KYIB 4CETA 3OO0A 3ZHSA 3WJ1A 5GKNA 4D82A 2EZUA 4REQB 3KVWA 1Q1GA 1N4DA 3EXEA 5JCOA 3QVLA 3TH5A 3F90A 3IVMA 3C5VA 4GXTA 4IDOA 4HG2A 4CVNA 2Z8YM 3UICA 1XZHA 3C8UA 3X0DA 4P3OA 1O58A 2QRJA 1TEHA 2Z57A 1RXWA 4V03A 4INPA 5IT0A 3P9NA 2XYRA 1AV7A 3AFNA 4JB2A 4YS6A 3PCTA 5FL7A 4Z4QA 4ZCLA 3M3PA 1QKIA 4DV2B 5K09A 2IYWA 3ZD6A 4FUQA 4FB5A 2R25B 2NPFA 4YT8A 4OLHA 3EEOA 2XNDD 1ZR2A 2TSYB 3D8UA 2W42A 2IP4A 2Q3BA 2ZE5A 1EMDA 2Q5EA 2X49A 3E5HA 6GPBA 5TX7A 4EZEA 2VJPA 1R8SA 5G4KA 2PKQP 4D1YA 2DHRA 3C5WP 3QU4A 1K3XA 1XD2A 4MV8A 4LVCA 5K5EA 2X9QA 2H57A 4RIHA 1W35A 1SJ9A 1LF5A 2RK4A 3GPCA 1AMUA 2I91A 5LWQA 2ZPAA 1T5SA 3GT0A 4AMBA 1YO6A 4EI9A 3U80A 1IVYA 3HABA 2P9CA 4J2TA 2RI6A 4W63A 1Z29A 1CUUA 1E2LA 4M6WB 1AXGA 1YS9A 1M5TA 1EFUB 4OW0A 4JI5B 1Q1QA 3DYVA 4YV2A 1O0CA 3B7GA 3IV7A 4BO0A 3ZK9A 4J0CA 1JMYA 1PF7E 3PJDA 3KZ1E 4R0VA 3O9ZA 1Z2NX 2Q5HA 1P7CA 3AX6A 3DEHA 4MH0E 4URWR 3LUKA 4PFSA 5CG1A 2P9JA 5F33A 3EWNA 5CB6A 1Q7GA 3I0MA 1UEJA 2XBLA 3I9JA 4H17A 4QG7A 4O4JB 3DLIA 2ZRJA 1QIEA 1C7JA 3O75A 3LMMA 4MINA 1NHWC 4WZ6A 2EG9A 2B2CA 5IKXA 2FZ4A 3BB1A 3VQTA 5L3QA 3E3MA 2XTAA 1JV2B 5B6IA 1SQ5A 1E2NA 3QBVA 4RK5A 2FZLA 2E4WA 1UEIA 4DQUA 1QJ4A 2V7QA 1IY0A 4LC0A 3PUHA 2D1RA 1N36M 1WMDA 1ZMWA 4UASA 2RI1A 5HP4A 3BFKA 2VP6A 3D5TA 3MRXA 4CMEC 2CNWA 1RC8A 1RI3A 1A88A 1XVTA 2NV6A 4WJKB 1KAEA 4G5GA 3ZUPA 1ZN8A 4LHWA 3LBIA 3UAZA 2F9FA 2PJZA 3Q72A 2VNJA 4B46A 4DQ0A 4EMTA 3W6OA 3K9HA 4I1OA 2P79A 3WLMA 1R0LA 2WJ3A 3BBPA 4ZOLB 5EP2A 2HRQA 2Q6VA 4DQXA 4OFZA 1JT2A 2QAJA 1CERA 2CEKA 4A8JC 3LUHA 4PAWA 2GPTA 2BC9A 1II0A 3T1TA 1M54A 3IAS1 5I3CA 1YTUA 2OLKA 4PRYA 1GRCA 3OTIA 5TGTA 1L2BA 1ECJA 3GG9A 1RAIA 2CLCX 4N48A 4Y1GA 1TM2A 1YH3A 2PVSA 5KX5A 1X9GA 1YK0A 2XRFA 4Q3OA 5IVHA 4FFLA 4US2R 4GI3A 5BSVA 3NHSA 1LBQA 1SPXA 3A4YA 3OSZA 5K0EA 4EUHA 1OX5A 1L5QA 1X74A 5A3QA 5HZMA 1PZMA 1V33A 3GJ8A 3Q7RA 5JWHA 3K0FB 2MINA 4EJSC 4LRYA 1MC1A 1V35A 4MVJM 4YMVA 1WXWA 4GMFA 2Q1WA 1XCMA 1I1NA 2B2XA 5DYIA 2WFLA 5FORA 3OLVA 2AR0A 4NDNE 4E22A 1CY6A 3IMFA 4M0FA 1FXUA 4XCXA 4AJOA 3K71B 4TS9A 1P5ZB 3KCNA 2ONZA 2PKQO 4EH1A 2E49A 1TH2A 4OV6B 2CZGA 2OO3A 2JLSA 1OPXA 2VJQA 1UWLA 3M9LA 3ZWKA 4F3TA 3N2NA 4IWNA 1V92A 4NEGA 2HBQA 2COUA 2ILVA 1AX9A 1KA9H 4ONEA 3FTPA 5DMXA 4JOSA 1E4EA 1QH0A 3JZAA 4WKPA 2J9ZB 2CSXA 3HHPA 1NRJB 3HA3A 5IUNC 2FPMA 3L93A 1PNQA 4I8XA 4DDUA 2Y2VA 1TCUA 1L2CA 1SZPA 2GPNA 1DLIA 2AX3A 1VG8A 3HSSA 2I65A 3K0HA 4KG7A 3GFQA 3V1LA 4LGCA 1KL7A 1OAAA 2W93A 1N5KA 1Z5OA 1HNXM 2QD2A 3RS5A 1T9GS 4OQEA 3OIUA 4E33A 1X7WB 4FSHA 3TW6A 2O8FA 4LY0A 2VHEA 5FUXA 4DWVA 4ND6A 1AKYA 3ND9A 1PJZA 2P35A 3COSA 4NZYA 2F4VB 3E82A 3AEZA 5A4MS 1PG5A 2FCAA 1Z06A 4DG9A 4A8PA 1BVSA 2QYHA 4FYIA 3LPLA 1FOEB 1G20B 2NSLA 121PA 3TZBA 4JSYA 3DAPA 4F2DA 2LVPC 1H2AS 4N12A 1X39A 3T1YM 1FBTA 1MB2A 4XA8A 3N07A 4J0KA 3N28A 4HFNA 4TVSA 4C7OB 5K20A 3C8MA 2YDXA 3DOCA 3OD1A 1GZ5A 4Q4AA 13PKA 3RROA 4XK8F 2AW3A 1NN0A 4JI8B 2PUWA 4E11A 5FOUA 4TM7A 4JVLA 2C7PA 4QUBA 2IYUA 4G23A 2PGJA 5EUCA 4KKXB 2FN7A 1KRHA 3G9UA 4LJKA 1RBZA 4CUKA 4ZVPA 5DI9A 4TL9A 4P98A 5EKUA 2CT8A 2INGX 5EJ6A 3B51X 5AR1A 3DCYA 3JD2A 2IELA 2ORWA 4I8IA 2VDNB 1P31A 3JD1A 3CF2A 2JGKA 3HB0A 4I0WB 2K47A 5IARA 1G59A 3MAAC 1TQHA 1XX6A 5F3RA 5B57C 2P5SA 4PR3A 4BFTA 1TAGA 1S0UA 1W4CA 2H5IA 2YZMA 3HU3A 3BEOA 5EJMA 2HTFA 3H2JA 2IZZA 5T67A 4EG7A 1GSHA 4U02A 1YF3A 3GZJA 2B30A 4C76A 2Q5OA 1Z6GA 1WCV1 2MH8A 3EZLA 1RXYA 3H4IA 1WCIA 2LWIA 2XITA 4IUCS 1S4QA 1PR0A 3HGMA 1EVYA 1ISIA 1UPXA 1YRYE 4YCDA 4WK4B 3SMPA 3LGAA 1KQOA 1YUBA 1QMPA 5JH7F 1IOZA 2OBXA 5B5SA 2KEBA 1DWOA 2IYLD 3TO5A 1OBFO 1IOVA 1Y63A 4XEHA 2Q62A 4YMGA 8AT1A 5TT0A 3DKVA 1YB1A 3C3JA 4F5EA 1OFIA 1M6NA 1MUUA 2GN6A 4YAJA 3BGWA 3K9CA 4IV8A 1R27A 1O6GA 3BXFA 2HN9A 3RVLA 3LVVA 4B2YA 1OREA 5ALRA 3ET4A 1DQZA 1T25A 3KHUA 3UJPA 4JELA 4KUEA 3OF5A 3L4EA 1PLKA 3WLQA 2LVOC 4CLHA 1TEZA 3FF4A 3B13B 2P1DA 3A98B 4FGZA 4FR2A 1E58A 1HDXA 4UUQA 4K40A 3ZYCA 5F23A 4U3JB 3KHTA 1UF9A 1IG0A 1TTEA 4Y2HA 4BUJA 1CR6A 4E5UA 2PJRA 2O7QA 2JCXA 2ZROA 4UM7A 1X7YB 3BL5A 1P3Y1 1O57A 2P30A 3G6WA 1OIXA 1MU0A 4QWMA 1FUUA 1KFJB 4KE8A 3PA8A 3LTEA 2ZRDA 3OCCA 1I4LD 4XJVA 3KJQA 2YV2A 1YQ9A 3B70A 5AKKA 1C0PA 4I1IA 4ZYUA 4DJEC 3K0EA 1EB8A 1LD3A 3H2IA 4FFBB 1KC3A 1KP2A 5BR7A 2IKQA 1C7QA 4K3UA 5IDVA 1TJNA 3SWWA 4E12A 1RWPA 1OJLA 4C4AA 3VPXA 4OIMA 1VLLA 4GUAA 3A2NA 2AK3A 3T1QA 3MJRA 2PZBA 5C8VA 5BPFA 5CDFE 2X6QA 1KEUA 1WZNA 2P90A 3NBFA 3CIOA 1FFGA 4HRVA 4C7BA 5FBWB 3TINA 1FNSA 4EYOA 1SVMA 1SEPA 1CQIB 2Q8QA 4CQLA 2JFGA 4PSCA 5EYPA 2GWHA 3AZQA 3SKXA 1FQJA 3H5OA 2W8BB 3QFSA 2BGGA 5CXQA 3QVMA 3GT3A 3HDJA 1EU1A 1VL0A 1WW2A 4K05A 3PEEA 3U9SA 4WQMA 2JEYA 5FWYA 1ISJA 5CFRA 3W0FA 7MDHA 3AW9A 1F51E 2IHJA 3S2FA 1R64A 4Q19A 5KPZA 1AA6A 1AGRA 1ZMVA 1KK3A 1V3UA 1QVZA 4J0IA 4TKMA 4EYQA 3T5GA 3IX7A 1HORA 4KQ1A 1FY2A 1JQLB 1D0MA 2QZJA 4LF4B 1HKHA 4W1RA 4HCJA 2WIGA 4E5SA 3D0OA 1TM5E 1Z88A 2KHHA 2FVYA 3N75A 4AZ0A 3C9PA 1J8QA 2E37A 4LX0A 2F5OA 3O8RA 2QZPA 2D7GA 5EWJB 1HL7A 2ONKA 3V2GA 2JFPA 2XGJA 4MM3B 4NLLA 3PTAA 4POAA 1ABEA 2PGXA 2F1IA 3E46A 4HDKB 4DDHA 3B1JA 4FZRA 1TGVA 3LC0A 3WWDA 5JC8A 1B2LA 2DCUA 3BICA 4GXQA 3MINB 1CIVA 5FUMA 4U6QA 4FC7A 3G8AA 1ZLXA 3ZTWA 3TLJA 5KCMA 5IBRA 2IA5A 4P8RA 4HVCA 4X85A 5KBYA 3QYJA 3AR9A 3OWXA 1V6AA 4F6RB 3ZD7A 1MX9A 2HL6A 2QX7A 2BHNA 3PRKE 3FNFA 2YVUA 2JGMA 3K0AA 1SHZA 1Q20A 3H87A 2ZUEA 2FW0A 4KQ6A 2BWEA 4JI3B 3TOVA 1KY4A 3D6MA 3MGGA 3KPUA 2AS0A 5JADA 2OUKA 1L0BA 2NSJA 2P5UA 4MVJG 2V0CA 5BR8B 3IQEA 1IBMB 4URXR 1QS0A 3FIJA 2A0FA 4QBKA 3SJZA 2TMYA 3OOYA 1RP7A 1GSAA 2QE6A 1P5JA 3KUKA 1V5WA 1SXQA 3FN4A 1BO6A 2CUZA 4GPEA 1NU6A 1MDFA 2P1RA 3NCHA 3WQRA 2B8JA 1ABFA 1QFJA 1UFRA 3U4QA 4D6PA 2VK8A 4XM1A 4GXNA 3E15A 1DEOA 3E4CA 4JR2A 3OSUA 2G71A 4DEVA 1T9ZA 3LQ2A 3NLLA 4R51A 2QUIA 4FEGA 3F8WA 3UW3A 1JFFA 1NI4B 4RFSA 4Y28F 4E7OA 1IIBA 3DOFA 2NT4A 2CZQA 5AOVA 3VR5A 4DA7A 3URMA 3W7AA 3KT0A 3Q0IA 2VZ0A 4NDZA 1F3LA 1LLUA 4CM9D 3LQQA 1QB8A 3B78A 4IIVA 3SDBA 3LS2A 2RHBA 2FFAA 2ALJA 2WV7A 1DDGA 2HJSA 4R3DA 5AOAA 1SVKA 5GZ1A 4X6XA 4QG3A 2H3HA 1DDOA 3G5TA 1KGSA 1JEYA 1K0UA 1ZVMA 2WZQA 4HAVA 1PI3A 3NDIA 3QK7A 4PG7A 4PZ0A 3BREA 5DGDA 1LRJA 2IW3A 3C87A 6YASA 5E1MA 5D5QA 1BS9A 2X1HA 2KSQA 1V9CA 2RAFA 4IH9A 3N2GB 3ULKA 2GBLA 4CIXA 4GWLA 3MCAA 2IX9A 4AQYB 4H7JA 4YCLA 2WEKA 4BV9A 3ENNA 3DE0X 3WMEA 5GADl 5ETJA 2C4MA 1M34B 1SVOA 4KXQA 2PMEA 4WAUA 3DV9A 3G82C 1KEKA 1CR0A 2RHTA 3RIGA 3F5DA 2XY4A 2WIFA 4HAZA 4QAJA 4FMDB 3EH1A 3QBTA 4ITQA 1QU3A 3IPRA 4Z4HA 3V8RA 2NN3C 1FX0B 4KQEA 3MJ5A 5LP6F 2BFDA 4BNHA 3TR0A 1RRPA 4WXRA 4MYCA 3N0XA 4P84A 4ETNA 1FFHA 4IIGA 3CLRD 3ZXYA 1YRAA 5BNTA 5COQA 5KAMA 3RJMA 2AFVA 4PGHA 2HJHA 2HMUA 4B6RA 3PZRA 1ZS9A 1T8RA 4XYEA 2P9YA 4RTKA 4XJTA 4INZA 3VKGA 3DF7A 4BXOA 3EGEA 3AH8A 4QYIB 1OFUX 2R6R1 3L07A 3RBAA 4BNWA 4EA7A 3PEVA 1DKRA 1GTG1 4BV3A 2POCA 3G59A 3C45A 1KO5A 2VBFA 2JBAB 2R48A 1HR0M 4OK6A 3U16A 1I6WA 3GIWA 4WA8A 3L0OA 3V7UA 2JFXA 2HO4A 2R6ZA 1LNQA 2J45A 1KU6A 1L7DA 4CCYA 3UANA 2OOBA 1V0JA 2FX5A 5DK6A 4LJRA 3VMFA 4Q3CA 4ARZB 4XPZA 4ZZ0A 5EKSA 1JB1A 3P94A 4MV3A 3ZWCA 3B6KA 4PQEA 5L45A 1JX6A 4L78A 3MJCA 1C7EA 3RYHA 5KYUB 4NYIR 1SUCA 4BQIA 5FLYA 2FWAA 2MSEB 4HRXA 1UDRA 1NW7A 5G3ZA 3T54A 4C4SA 1N3YA 4QU9A 1CR2A 1KE1A 2PWZA 3CLKA 3L25A 1QFZA 2ZIAA 3DMYA 2XADA 3WWZA 4M0CA 5SZIA 4F72A 3M1AA 2XOKA 4WXYB 4MUNA 1TU3A 2CFOA 2LRHA 3NC4A 5JBQA 3PIDA 3QXGA 5KQDA 4DR3M 3FLEA 3FPAA 2V7XA 3S8EA 2VBIA 2Y9MB 3VMMA 2D1SA 4WDQA 2QD5A 5FPSA 4YQFA 1X0XA 3B6IA 3D1JA 3IR7A 4REZA 4FFSA 1XZCA 1NJ5A 1ISHA 2CFIA 3AKCA 2UAGA 4JC4A 4Q7EA 3SF8B 4JUBA 1O7JA 1NN1A 2QL7A 4NYMR 4IQ4A 5M5BA 2CLIB 2QD4A 4DILA 4R1QA 2UUPA 2WYVA 2D8AA 4RY0A 2IDZA 4Y0AA 2VDBB 5FOWA 4JLJA 5B7GA 2IZ6A 4F91B 1LX7A 1GKLA 5FH9A 2BFFB 5IHXA 2VZEA 4A2CA 4U2DA 1W30A 1OZGA 5CJPA 5KUTA 3IHTA 3FSJX 2Q6IA 5C1BA 1JXQA 4XD2A 2IXFA 1XHEA