1NV9A

Hemk, apo structure
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
KIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSALFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hemK protein
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
total genus 88
structure length 264
sequence length 270
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv9A02
2PXCA 4Y2HA 2HAKA 2HWJA 3MMPA 2YXLA 1HNNA 3UFBA 3KR2A 5EZSA 2HR1A 5DFLA 4R6XA 1RJFA 5EIFA 1JTFA 2ONZA 3PT9A 5T64A 2ZBRA 3GRUA 2LVNC 1G8SA 1XXLA 4RSRA 1TPYA 1JR3E 2G71A 3TKYA 1JSZA 4RVFA 4RTSA 4EQZA 4E33A 4P7FA 3M6XA 3E7PA 1XVAA 3F4KA 2DZLA 1ZGAA 3UJCA 3PB3A 2WA2A 5E9QA 3K6RA 1Y8GA 5CM2Z 3G8BA 2IP2A 4GOOD 5EEHA 1EJ6A 2OZVA 1EQAA 2P3OA 3A7EA 2L4FA 2HTEA 3EVZA 4HRAA 5DTRA 4LWPA 2PBFA 1IY9A 4QPNA 3OFJA 4RTQA 3D2LA 3X0DA 5ERGB 3QOWA 3CJRA 4GOLD 4C04A 3BUSA 3ERCA 1WHCA 3LCVB 3FPGA 4GUAA 1FPQA 3GLHE 3SGLA 3FUVA 2OPBA 2XYQA 3FTEA 4DA4A 1SKMA 4OBXA 2XBMA 2JZ0A 3LX6A 2XYVA 2CL5A 5EKUA 2OY0A 4R6WA 1QAOA 5HIIA 5IH3A 4PYQA 3TM5A 1H1DA 2BR3A 2K4MA 3T7RA 3FYCA 3BT7A 2DHYA 2QYOA 1ZG3A 3GRZA 2PJDA 2ZZMA 3PLAE 1RI3A 3A26A 3EEYA 3KPVA 5G02A 2JUJA 2DAKA 2DAMA 3UJ8A 3EVBA 4G3OA 4V0RA 5DX0A 5K0NA 3HCFA 2P1DA 3UJ9A 5FQNA 5DWQA 4E2WA 3EVGA 5LR6A 3GO4A 1G60A 2JP7A 2AOUA 4YUVA 1QYRA 3R24A 3EGEA 3JWGA 5CVVA 3BKWA 1TR8A 3BWCA 3UJAA 2PX8A 3FRIA 3PS9A 2UZ4A 3GNLA 2XYRA 1G4AE 1N2XA 1F3LA 5EHIA 3F92A 4MIKA 2YXEA 1UFKA 5F2KA 1QANA 4YMHA 4XCXA 4PCAA 4YUYA 2AOVA 3MTEA 4EK9A 10MHA 1R74A 2ZSUA 4FGZA 2A14A 4WXHA 1NBIA 3IEIA 3NVMB 1MJFA 5HIKA 1YFJA 3KQVA 4CTKA 2EJUA 5EMLA 3MERA 1IM2A 2O57A 4OA5A 2R3SA 5FA8A 3A25A 2YR0A 1NE2A 1NW6A 2EX4A 4L7VA 5GINE 3FUWA 1Q0TA 2C7OA 1WY7A 3WSTA 2YX1A 1I9GA 2V7EA 2DPMA 4WP2A 3NWEA 3OU7A 1C7YA 4DM3A 2FPOA 3GRYA 2AZTA 3M70A 3PFGA 4E30A 2FK7A 2PWYA 1NT2A 3BGDA 3IHTA 1MHTA 2NYUA 4R8RA 4QDKA 1YZHA 2JY7A 4LG1A 4KDRA 3M4XA 4EKGA 1G41A 4P58A 2LD4A 3V8VA 2AN5A 1TW3A 2QE6A 3HM2A 3DLIA 1D2GA 4FSXA 1XDSA 1G38A 4R05A 2IBTA 5F2NA 3FTDA 5LQJA 2IFTA 5FWDA 4IWNA 3KQYA 2BWBA 1RJGA 2PT6A 5FUBA 3MQ2A 3SX0A 4LWOA 2UYHA 1YB2A 1RI2A 4XUDA 3MCTA 2EKFA 3ER9A 3ORHA 1G3IA 3PFHA 2AVNA 4Y30A 4EVIA 4X61A 2GB4A 1A5TA 5DRTA 1DO2A 1WIVA 3Q7EA 5E1OA 2UYOA 2AN3A 5CIYA 1IM8A 4RVGA 3OCJA 3G89A 5CUQA 1XXHE 2EKKA 3HCCA 2GLUA 1V92A 2HV9A 3KPJA 4EKIA 4E70A 1G8AA 3LDUA 1Q0SA 2QRVA 3KQOA 3KPYA 1WJ7A 1E94E 3C3PA 2PV0A 3FPHA 3I5UA 1ZQ9A 2LVQD 3EVFA 4FT4A 2OB2A 1WR1B 2H1RA 3P9NA 2AR0A 1EAMA 5FULA 1BVSA 5KS2A 4POOA 3TOSA 4RTPA 1R00A 5BW5A 4ER3A 1NW3A 3BWBA 7MHTA 2AOWA 4IKPA 2ZLBA 5GM2A 3ELDA 2YTZA 3AY0A 3KPUA 3BGIA 2Q41A 3FTFA 4OQDA 4Q7JA 5JUWA 3ELYA 4PINA 2L2DA 3KQMA 2Y1XA 4PYMA 5LQNA 2IH2A 3MTIA 4X60A 3LGAA 1ZMUA 5DM0A 5GP1A 2WA1A 2ZZNA 1QZEA 1KXZA 4F85A 4KW7A 3SSNA 1PGYA 1VEGA 3BZBA 1D2HA 1UIRA 4ER7A 4HH4A 4RTMA 1ZMVA 3ER8A 2VS1A 3E23A 4OBWA 1L1EA 1SG9A 3LBYA 4P7GA 2AS0A 1R8YA 2QM3A 4X63A 5CCBA 3CJQA 2IGTA 5DTMA 1T43A 1FP1D 2ZWVA 4DKJA 2JJQA 2C7RA 1G6Q1 2ZIFA 2G70A 2PX2A 3IYLW 4K6MA 3CVOA 5FTWA 2LBCA 3NWBA 4B17A 2LVAA 4R8SA 1BC5A 3IV6A 3LSTA 5GOZA 2GAFA 4RX1A 2XVMA 2AOTA 4G56A 4FR0A 4DBGB 5LQCA 1VG5A 4BLWA 4M36A 3KQPA 1KYIA 5B1SA 1ORIA 1XDUA 3KU1A 3TRKA 5CCXA 2NXCA 3IHPA 2OXTA 3O7WA 4UOEA 2G72A 4FP9A 1O9GA 3B3FA 5DM4A 2I6GA 3T6PA 4F84A 4KRGA 2FYTA 2FRXA 5CVUA 5M5BA 3HA3A 2DAGA 2HMYB 4MHTA 4P7JA 1M6EX 2ZIGA 4QVKA 2GPYA 5JI2E 5KQSA 4YMGA 5EMKA 4PCLA 3P9KA 5DRYA 3TQSA 3OZTA 1YZ3A 1VQ1A 2ZULA 2R6ZA 5MHTA 4GC9A 1P91A 1VEKA 3L8DA 3ME5A 5LQAA 1HQYE 3G8AA 1EJ0A 5K05A 1QZZA 4GF5A 3GRVA 5GM1A 1X1AA 4V0QA 5DX8A 2OB1A 3GDHA 5HIJA 3CBGA 5EMMA 3O4FA 1B42A 4YV1A 4DF3A 3UBTA 5E9JA 5LSAA 2VP3A 5BW4A 3UZUA 2H5XA 1SVUA 4QPPA 4FZVA 2ZTDA 2CKDA 5EKXA 4FT2A 1JQ3A 5FHRA 4QVGA 1P3QQ 1F4IA 4KDCA 1NW8A 4AZWA 5K09A 3G2QA 2IDKA 3JWIA 2ORED 1ZHFA 3THRA 2KNAA 2YVLA 3TKAA 4HG2A 2P3QA 1NKVA 2JY8A 4PYIA 2OO3A 2QNJA 2VDVE 4ATNA 4GOND 5ICCA 3EMDA 3TPZA 5IKMA 1YF3A 2QY6A 5KQRA 2DAIA 3LCUA 3KR0A 1P39A 3SSOA 2NXJA 3AWIA 5E1DA 2L4EA 4A6EA 2BR5A 1NV9A 5E2BA 3HCEA 4E2ZA 1OQYA 1EIZA 1YFLA 3P71T 4KVZA 4XUCA 4QDJA 4GOMD 2JG3A 1IXSA 4PYJA 3BWMA 3SR4A 4QTTB 2WZJA 3NVKI 3LECA 4YUWA 3SMQA 3KR9A 4ISCA 2C7PA 3UA4A 1L3IA 3LKZA 3BGVA 4C06A 3FPFA 4U7TB 2KHHA 5KYGA 1RI1A 1KR5A 3OE5A 1INLA 4HGZA 2BZGA 5HOQA 3T7SA 5DLYA 1EG2A 2O0LA 4PIMA 4P7KA 4RTOA 1YLAA 1P1BA 1HT1E 1ORHA 1KP9A 3FPJA 4HTFB 2K0BX 2BM9A 3DOUA 1JG1A 4YV2A 3GIWA 5DXJA 2FHPA 2E5WA 5K0EA 4F2LA 3H2BA 1VP3A 1VL5A 5CVEA 5K0JA 5EOVA 3FTCA 2PXAA 2P35A 3LHDA 3HVKA 3RIEA 3P9CA 3FUXA 1FJXA 2C7QA 3KPWA 1G55A 3EPPA 2JH8A 2NP6A 4H0NA 5DM1A 2JHCA 5HEKA 5EIWA 5C1IA 1YUBA 4BY9E 2O06A 4IV8A 3B5IA 5FWAA 2G8NA 2FK8A 1AV6A 2ZCJA 2MJ5B 3DULA 3EEOA 3DH0A 5HIMA 3E8SA 5E8RA 1NW5A 2KNVA 5K0CA 3DXXA 4E2XA 2ZW9A 2CMGA 3DXZA 3KQSA 2MGWA 2ZVJA 4DMGA 1L3CA 3AXSA 2OYRA 3GLGE 3P8ZA 4RTKA 3QV2A 4XUEA 3K0BA 3FPEA 5CVDA 3EVCA 2F8LA 1ZV1A 1VLMA 9MHTA 2B78A 4R71A 3G2PA 1VE3A 1WZNA 3RODA 4GEKA 5BXYA 3OZSA 4ER0A 4RVDA 1FP2A 2EJSA 3R0QA 5EVJA 4ZTBA 5E1MA 2ZTHA 4A6DA 2YUIA 1JG3A 4C05A 5CD1A 5K0FA 1ZKDA 5D1HA 2ERCA 3FRHA 2CMHA 5KVAA 1WGNA 4KIFA 2IIPA 3CKKA 4FSDA 3HTXA 4E31A 1AQIA 2B2CA 5GWXA 5P8WA 4C07A 2PWPA 3HVHA 1XB2B 3G5TA 3C0KA 3A7DA 1JG2A 3CJTA 3T0IA 3UJ6A 2PX5A 4ER5A 4U7PB 3DTNA 3GLFE 2PGXA 3BWYA 2ONYA 2BR4A 1OKSA 2P40A 4OX9Y 1T6OA 5EEGA 3I64A 2PLWA 2O25A 5F2OA 3HNRA 2VDUE 3NMUF 3S68A 4M37A 3FE3A 4DQ0A 5K8VA 3HCDA 4AZTA 1PRYA 5GIOE 5C0OE 4MTLA 1JSXA 2Y1WA 5LQRA 5HZMA 3B7PA 4HGYA 3M33A 3P97A 3MHTA 3FYDA 3I58A 4C08A 4AZVA 2CP8A 2EJTA 3TLJA 4CTJA 4ER6A 5K0LA 3AJDA 3HCBA 2Z6AA 4YV0A 2NNWB 1RI5A 1BHJA 2AVDA 1PJZA 1JR4A 3PX2A 1AF7A 3R3HA 2K9DA 2LVOC 5HFJA 2B25A 2PSSA 1UFZA 5LQKA 3O31A 4C4AA 3P2EA 3I53A 2CWBA 1WXWA 2QHOB 2ZTCA 2BWEA 2JHAA 3DMFA 3T7TA 2EFJA 3K9PA 1TTEA 3K9OA 1X19A 5K0BA 2OOBA 3R6TA 2MROB 5K01A 3DR5A 1M6YA 2DI0A 4MWZA 4PGHA 3M6VA 4HC4A 3TM4A 3GXOA 1AQJA 3NDJA 3KKZA 1KPGA 4AUKA 3KQWA 5DTQA 2ZFUA 3GRRA 3GLIE 3VYWA 1O9HA 3Q87B 2EG5A 1F38A 2AOXA 3EGIA 5EQJB 4RTLA 2O07A 3IECA 2RRUA 4CWAA 2UYCA 1O54A 2R0IA 2H11A 3GGDA 4CKBA 1OTRA 4DCGA 2ZBQA 1P1CA 3LDGA 3SSMA 4QQKA 1KHHA 2AOUB 4CXMA 5ICFA 4BLVA 5D1NA 1VBFA 3OFKA 2H00A 3UJBA 2OKCA 3HVJA 4BLUA 2KW5A 3BKXA 2DAEA 2Z6UA 3UJDA 5U4XA 2B9EA 3LL7A 2PKWA 2P41A 2I9KA 3FZGA 1X1DA 1DCTA 4AZSA 5K0GA 4Z2YA 1HMYA 5LQUA 1RJEA 1X1CA 2UYQA 5FADA 3C3YA 1I1NA 1OR8A 2JNHA 1NV8A 4RV9A 5T6BA 4PGGA 2HNKA 3DMHA 2GH1A 1CUKA 4X41A 3AXTA 3PVCA 1HT2E 3C6MA 5HILA 4CKCA 3C6KA 3JWHA 3VC1A 3THSA 2VDWA 3OPNA 4BP3A 1EFUB 2ZIEA 3CCFA 3RW9A 1IFYA 5ICEA 1Y8CA 4OA8A 5K03A 2HWKA 5EMJA 1SQGA 2ZZKA 3E21A 3DP7A 2Z6QA 1RJDA 2V74B 1L9KA 2AN4A 3EVAA 3G2MA 4PNEA 2JY6B 1SQFA 3LPMA 1TW2A 2ZBPA 1JG4A 3H4JA 5EC8A 3MB5A 5DSXA 4PYKA 2YQZA 5ICGA 5E9WA 1XJ5A 3R9XB 1V39A 2PT9A 4OQEA 5GIPE 3A27A 2GA9A 2BH2A 3CGGA 4MQ4A 3UA3A 2IBSA 1QAMA 1WXXA 4PYOA 2DKLA 3TMAA 3KHKA 2P7IA 1MN3A 3E46A 3DLCA 4DCMA 3PTAA 3NJRA 3JWJA 3LDFA 3HP7A 2DULA 1XCLA 5DX1A 3KR1A 4PONA 4CKEA 4PYNA 2I7CA 3P2KA 4FS8A 3KQTA 4RTJA 1R4GA 4GBED 3PX3A 2B3TA 2IH4A 1KYWA 3FUUA 2OO9A 5EG5A 3E05A 8MHTA 3G2OA 3M6UA 2JY5A 3CC8A 2QSFX 3G5LA 1KIAA 5T67A 5DT2A 3OU6A 1R18A 4PYLA 3LKDA 1RI4A 4YUZA 2DENA 3UJ7A 3HA5A 5DM2A 2CWWA 3GJYA 3DUWA 5E2AA 2JH9A 2QRVB 5EZQA 3LCCA 3HA7A 3VSEA 1VEJA 3OZRA 1ZGJA 2BM8A 5BP7A 3HEMA 4E2YA 2N47A 4LECA 4JXJA 4M7RA 3B3JA 2ESRA 1KPHA 1Q02A 3ANXA 1VPTA 2JHPA 1DUSA 2NP7A 4F1IA 4GC5A 4GQBA 5JR3A 2OBFA 2P8JA 4RTRA 3QOXA 3ID6C 3P2IA 1N7JA 3ELWA 4X1OA 5E1BA 5DSTA 3MGGA 2P7HA 3OE4A 1OAIA 1JQDA 3REOA 1QAQA 2JZ1A 2P3LA 3FUTA 3TFWA 4HEOA 4QQNA 5EGSA 4IV0A 3MCZA 3SXJA 1DO0A 5E8JA 1KPIA 2G1PA 4C03A 3BXOA 4HTFA 5EPEA 1VIDA 1N7IA 1X1BA 1BOOA 4NECA 5DXAA 1JTEA 5DPMA 4RVHA 5FCDA 1DL5A 2PVCA 3OU2A 4KIGA 4DZRA 2LTUA 3EVEA 1SUSA 4HSGA 3B3GA 1DV0A 1UWVA 1BKYA 5H02A 3NW9A 2OOAA 2IDJA 1Z3CA 3SVZA 2YXDA 3P9IA 3V97A 2IH5A 3TR6A 4RWZA 2PY6A 4UN2B 1XCJA 2LVPC 1GO5A 3ELUA 2XVAA 5CVJA 2VZ9A 1D2CA 2KNZA 3HVIA 5FHQA 3B89A 4WVLA 2AOTB 4YUXA 1XTPA 3GWZA 2DNAA 5C9ZA 3NTVA 3LBFA 3VC2A 4AX8A 3MAGA 4F86A 1L3BA 4RYLA 4KWCA 3NDIA 1I4WA 1XDZA 4E32A 4QTUB 4BP1A 2WK1A 1VDLA 5EHGA 4EMSA 4GEWA 3GU3A 3G7UA 1ZMWA 5FA5A 2I62A 2PX4A 4O29A 4M38A 3KQQA 4RTNA 1WS6A 3HCAA 1WGLA 2ZWAA 3U81A 3M6WA 1R8XA 3G88A 3EMBA 1NW7A 3SM3A 1KYZA 3EVDA 2NXNA 3UWPA 3GCZA 2IPXA 3DXYA 1JQEA 5FQOA 1M0EA 2NXEA 1FBNA 1HJPA 3DMGA 2ADMA 2MR9A 2G3QA 3BBZA 3I9FA 1SUIA 2GS9A 1AIPC 1IXKA 1U2ZA 4PIPA 1WG8A 4PWYA 1NBHA 1VP9A 2O05A 3EGVA 1R6AA 2FCAA 2PXXA 3A4TA
chains in the Genus database with same CATH superfamily
4IJ6A 4WXMA 2IYYA 1P1JA 1FRVA 1U0HC 2QUAA 2VNIA 2ZSIA 3R74A 1Y1TA 3C8MA 1CJSA 5EZSA 2WJPA 4CODB 1JTFA 3WBKA 2AFHB 1UZNA 2HDOA 1MB9A 5F73A 1KXJA 2ZBRA 3GNSA 1ODJA 4KLNA 3PFWO 1M54A 2LVNC 4NOJA 4IL5A 1NVXQ 3OPYA 5JI3E 2G71A 1WKCA 3DGEC 5G1OA 4EGFA 2WSIA 1O4VA 3DYBA 3M6XA 4DYVA 1H4SA 3WVNA 2PH7A 2X23A 3JAWB 1ETUA 5LDHA 2I3DA 1DBIA 2NZJA 1R5NA 1EAYA 4KOAA 4ZVKA 2I4TA 3B1WA 1ABEA 4D9GA 1BROA 3JQRA 1Z06A 3WLPA 4WVFA 1EXWA 5KUTA 3PD7A 1CDZA 4JBGA 1YJCA 3RQSA 3QSYA 4TXLA 3CF6E 2C77A 5BSWA 4O2AB 4CN8A 3FFAA 4PG8A 3BE5A 1OLUA 3NXKA 5K8UA 4IRMA 1BGXT 4P98A 1Y1RA 2JZ0A 3GEPA 4ZMRA 1OFVA 4FE4A 3GPYA 4O4HB 1GDHA 1Z59A 3WRYC 2Q5CA 2Q3LA 3NDRA 2QI9F 4L02A 2JBAB 5DHFA 4C22A 4CMEC 3MJ5A 2W42A 4MR7B 3EEYA 2B69A 4XWWA 1XLVA 1W5SA 5DX0A 4KQFA 4B4UA 4RNDB 4UBIA 4DUGA 2VOEA 4UUNA 2WQ7A 1XCBA 4L4SA 2HD4A 4ITQA 1MUUA 2PHZA 4GICA 4A10A 3HXMA 2NUTB 4YUVA 5H3LA 3A1FA 2DCUA 3JASB 4G5OA 3GNLA 4EHJA 4IXWA 4S1TA 4BMYA 2CYBA 4JJ8A 5IP5A 2RBGA 2H2AA 1ZH6A 2JI9A 5KYYB 5LZ8A 2ADOA 4LNHA 5DGXA 1MU0A 3W5HA 1SA0A 4YUYA 1L5FA 2AOVA 5A6VA 2VNAA 2EQAA 3IKTA 3WIVA 2G40A 4MV0A 5CPBA 3OHSX 1HLDA 4V0ME 4EW2A 2HSEA 4MGYR 1AKNA 2I71A 2PTHA 1PYDA 3B6KA 3IPLA 4OA5A 2REQB 1NW6A 4FD2A 3WNQA 2QRKA 2VHYA 3UWOA 4EGQA 3SEAA 3L0OA 4DJJA 3S5UA 3QU4A 2BEVB 2ZSBA 1HE1C 2D8MA 1KC3A 3CW2A 4LRUA 2NSDA 3K73O 3H84A 3KV1A 2AZTA 2ID7A 4FDVA 3A1SA 1T5BA 3QXCA 1BQEA 1EHIA 1NBAA 2FZGA 3CWQA 3IVRA 4J90A 5HMMA 2XIJA 5K6TA 4MPTA 4HQNA 3MJRA 3QA9A 4UHKA 4BO1A 1JA9A 1ZBDA 4KSBA 1M67A 1XTZA 4TMKA 5EJIA 3GY0A 1JR2A 1U4SA 1XCPA 3VYTB 2CUZA 4MEBA 5JQGF 1KZGB 2PJUA 1PFVA 4B7GA 4BNIA 3HGMA 4F3TA 3GLGA 3AHFA 1Y6RA 3DM5A 3FTDA 2VSFA 4EPWA 5FWDA 4GKVA 3MHPA 4LWOA 5CT4A 3KALA 4RFSA 1GL9B 3R3SA 2IZ7A 1QZXA 2XWJI 5EFZA 5H4GA 4BAZA 5ALDA 5D2CA 4DBZA 1IM8A 3DS8A 4ZK6A 1ATIA 2OFFA 2W6QA 4CCYB 4L9AA 3THYB 1XXHA 4OJTA 3RS8A 2OHVA 1M6VA 3QF4A 1YL5A 4BLCA 2Q9BA 4JQOA 4JD5A 5CMLA 2VIIA 2YVQA 1GL6A 4MRSA 1N5OX 5ITXA 1L7XA 2B7CA 1E94E 3OZCA 4LE0A 1RZUA 1ZD1A 3P52A 3F2VA 4IS3A 4FT4A 4TN1A 3SE0A 4JT4A 2OCLA 2O2IA 5FULA 1PNOA 1T2CA 3PA6A 1IEQA 1YSCA 4LDNA 4UBNA 2C7GA 4UM9D 5GOTA 5K0TA 4LBVA 4TQUS 1E1LA 3AY0A 4CIAA 2JLCA 2YC2C 1NNUA 1WU7A 3WB0A 2IH2A 3L6UA 1AUVA 4BMCA 3F0TA 4O59O 4MR8A 3KL2A 1KXZA 2XB8A 4F85A 1WB9A 3WK4A 2W6JA 2HLDA 2GM4A 1AHPA 4DRZA 1UIRA 4AF8A 4GRDA 4GT1A 2QN3A 3T9DA 2GF9A 1HWYA 3GV0A 3TLEA 3ER8A 1V0JA 4HSEA 1B26A 1S8NA 5CCBA 3K0CC 2HFJA 4EY4A 4I1IA 1NBMD 3ZXUB 3D4LA 4MLZA 4MS1B 4RJTA 1I2BA 1RVDA 4Q3BA 5EP4A 2RH5A 1QFMA 4JVNA 4DXDA 2G70A 5KNCD 3NOQA 4N9QA 3QPAA 3CNHA 2FUCA 3TLKA 4OSEA 1XTVA 4KCGA 3RVOA 4DBGB 3SZLA 1SXGA 4MWSA 3A4IA 3U1BA 1VDDA 5SYNA 4IDPA 3VR6A 1RLTA 4WN9B 4Z7JA 2GKSA 4FGLA 1RRVA 2F00A 4A3VB 4YRKA 5F4ZA 4CLHA 1PBNA 5B4VA 1B2RA 3KKLA 3ZVNA 3SHQA 5LP1A 2IIVA 4ZJUA 1EVQA 3IQHX 2OQ2A 4G1MB 3C58A 1UJ6A 5IJXA 2FFQA 3OLWA 3CRMA 2D4HA 4D9BA 3ZE7A 1YZ3A 1VQ1A 2I7VA 1QUTA 1JIQA 2EDAA 2VJMB 4H1WA 1VEKA 1YSYA 3NWPA 4GHWA 5LWQA 1BQ3A 5DIFA 3KAJA 1R15A 2Q9UA 2EV9A 2H9IA 5JDIA 1BCRB 1RPTA 3RC8A 1Q21A 3K0AA 1S3GA 4GSYA 5EHZA 5CYPA 3IHWA 5T6MA 5DLEA 5AR1A 1A4UA 1LW6E 4PSUA 2XQGA 2AFHE 4TN5A 4EYOA 3FHCB 3GHHA 4LGMA 1W19A 1C1YA 1T1JA 2WJAA 4ZAXA 4UREA 2GZHA 4R2JA 5DBEX 4Q37A 2Y4NA 5KSPA 1U99A 1G63A 4OHOA 4PW0A 5A7FA 3TGWA 5ES3A 4TZKA 1MAAA 3TPZA 3AT1A 4FINA 3PUJA 3A8TA 2IY9A 4MITA 2LBPA 1RNLA 2JCGA 2QY6A 1FOEB 4REZA 5EJCA 4K9PA 1P39A 1XEXB 4G4RA 5AKZA 4KUHA 1QQ6A 2HMWA 3QTLA 1AUPA 4D74A 4AVYA 3RHSA 3HWX1 1Q84A 2BUCA 2VHZA 2AF4C 3Q5DA 2D7EA 5KJ6A 5IG2A 1K8ZB 1MX3A 3SR4A 3F4LA 3SEFA 2FOXA 5FWYA 1RQGA 3UFXB 4BUZA 1QC5A 2FJUA 3DMRA 4RKUF 4UE6A 3TZHA 5ANRB 2PUWA 5JWRA 3N8IA 5KYGA 4PNHA 4ZYLA 3NIWA 3OE5A 4B4VA 2P9TA 3PP8A 3AFNA 1QRSA 3FNRA 4REQA 2UXCB 4RH3A 3EXHA 1XZMA 3LKVA 3HABA 2BHLA 4P7KA 3IMFA 1DGHA 5F5LA 3WKDA 3SEQA 3I6ZA 5DHPA 3OQ1A 3FOEC 4EJMA 1Z9BA 5IH7A 2C5SA 4FK8A 3OWXA 1TM5E 2ECKA 1GUBA 2ZGVA 4TL7A 1GA6A 1NAIA 4MRPA 5LP6C 3BJIC 4KMSA 2AFIA 3EPPA 3LC1O 4UVDA 3MB8A 3QKUA 4P1ZA 4S1PA 2C5AA 2O06A 4UC0A 4JLMA 5FWAA 5BRAA 1THMA 4OI1A 3E2PA 3IOBA 1AVTA 3DH0A 3ZV3A 1X8LA 3FTNA 5ELLA 2J08A 4M8SA 2FTKE 1JEOA 1IZYA 1AKYA 1P7CA 2JI4A 3E9QA 1WE2A 2XAUA 2WSCF 3P8ZA 4J7CA 4RTKA 1K08A 3QV2A 2Z0MA 2QGNA 3LVFO 5DNYA 1CUFA 1T9HA 2F8LA 2VJOA 1DGGA 3LQYA 2NUPB 4ER0A 4RVDA 3HWRA 1BIFA 1IBMM 2QNBA 3PNMA 1U6KA 3E7XA 3JD0A 3W4KA 1ZWLA 4FI3F 4J9UE 1JS1X 5JCOA 3BH6A 3IR5A 5EIBD 1NDQA 1FCJA 2VP5A 1ZH2A 4IBGA 3OTQA 2JFHA 5J4LA 4QXPA 2WTBA 3HTXA 3RGGA 3Q0EA 5GZ3A 1S1MA 5SYMA 4ID9A 1T5LA 4MRRA 1X14A 4C07A 2Q27A 3RUPA 3C0KA 5IKXA 1AJEA 4Q93A 1W76A 3FLAA 4HAUA 2JWSA 2ZUUA 5EIBC 4LJ4A 3IQIX 3GJ8A 3WLLA 2ZS7A 2ONYA 2LKCA 2PDAA 4YLGA 1RRKA 5A02A 1BDIA 1FRFS 5ALVA 1SG0A 1PJ3A 3FDJA 1P4SA 4CTNA 5JLJA 4CR6A 4JA2A 1H05A 1EUDB 3IP9A 3O5AA 5A3QA 3HCDA 1ULUA 2IOFA 4JJEA 2DERA 1RBMA 1S9HA 4XGIA 2HBZA 4EJ2A 1XRMA 1K7EB 1R0CA 4NS1A 1K4KA 5LIRA 4BNKA 4MR9B 3Q3IA 3U3ZA 1IEXA 2H48A 2EBWA 4ARZB 1DV2A 4DDTA 2VDKB 1HK7A 5IZCC 2XUKA 4XDHA 3FJOA 4OQPA 4GMGA 1A98A 1XMOB 4JI0M 4AQYM 2HDWA 4PWZA 1DDIA 2UZIR 2IE8A 4Y6OA 3RTAA 4OIFA 4WA8A 3R3HA 2LVOC 1ZZGA 1DNPA 2P62A 2PSSA 4QIHA 3FR8A 1BNCA 3IAAA 4NK5A 1G66A 1JE1A 4RMHA 3M8KA 3U4MA 1U9CA 2FSFA 2ZDHA 2AK3A 2BUAA 4NFHA 1OIXA 1XZIA 1XPJA 3R6TA 4IH9A 2HAEA 5H37D 4NFLA 3AEKA 1PJQA 4EG8A 4PGHA 4LS3A 5LNK1 3HL4A 1PQ4A 4XQGA 3VKFA 2DG2A 2ZUEA 2Q5OA 4Y2RA 2I0FA 1QHXA 1J97A 2F8TA 3DHEA 3M34A 4J94A 1NVVQ 5C35A 1NLUA 4PLHA 2G83A 4GZ3A 4B8YA 5AKIA 3FPBA 4KPGA 1GRVA 3GGDA 1GFZA 4BNFA 4WK0B 4KN8A 2L7IA 1FIUA 3EFBA 1DC8A 2CGEA 4F0JA 1VSTA 4CLOB 3Q5GA 2G4CA 2AGVA 4X3PA 3I5AA 5KAMA 4OP1A 5F1OA 1OUMA 5KTNA 2R6R1 2QUJA 3IP6A 1ZJZA 3SSAA 2QTLA 3HB5X 3ONNA 4QTXA 5U4XA 4CMJA 1TJ5A 3GLHA 3HU5A 4Q3KA 1TFUA 3C5HA 1WKBA 1YS1X 4QUAA 3ZUPA 1JLRA 3I92A 4RJIA 4PGGA 2CDAA 4G4JA 4BNJA 3TRIA 2OILA 4EPXA 4GNRA 3M7GA 2GH1A 3HY5A 1CQIB 1CUKA 2ZRPA 3U61B 3GWGA 2J1LA 3V2GA 4GECA 4EHBA 3I04A 1HT2E 5J63A 4OXNA 4CKCA 4N5MA 4JLKA 2VRNA 3LDHA 2GFQA 1W88B 1XU9A 4MAMA 4HWSA 5H9VA 1ZESA 2DPYA 1QRAA 1SVKA 2IIQA 3CPSA 4BKPA 5F76A 4QDUA 2JY6B 2PLAA 4MB2A 4QYTA 3QE4A 3SDBA 4CM5A 2OXFA 1ZU5A 2QIPA 1GR1A 2QAGB 2JCSA 5COAA 1SBQA 1P1IA 4JOBA 1YKSA 1UJ5A 1UBUS 2AG6A 4QBGB 1AV7A 4H6VA 3TMYA 3N6XA 5D8DA 4LE2A 5K3EA 2BY4A 1E3EA 4PYOA 4BKOA 3TMAA 1FFSA 4LF8B 4L0DA 3NHYA 2KS6A 1I94B 4B7XA 2X8AA 3EC1A 1GUAA 1NKSA 2V97A 4WW0A 2W90A 2XY4A 4AJIA 2HO5A 4RJ2A 1G16A 1N6HA 2PUTA 4BMVA 1JLMA 2ZIVB 4ILKA 1SEPA 4P2BA 2V0GA 3EQ8A 2Y0EA 4LMAA 2GCIA 3TTXA 4P92A 5BORA 2R11A 4TSFA 4XYBA 4DOMA 2BD0A 4LYJA 5IAOA 1GPNA 2AG1A 1CEEA 3HFGA 4HYEA 4QGGA 4IG4A 3ZGLA 4DANA 3ZE9A 2XVXA 2QRVB 2W7TA 5AK3A 3D31A 4OHKA 4I4TA 3F98A 2H08A 1ZGJA 4R9RA 1Z6AA 5CGQB 2VYVD 4CNQA 3B3JA 4ZAVA 3LPNA 4UU1A 4BLPA 5IT9S 3INTA 4GQBA 1OX4B 5JLAA 1KK1A 2ANCA 3BQMB 3Q41A 4TUYF 1VXRA 1W0JA 1YR2A 4WN3A 4JK3A 4RTRA 2QLMA 1L2CA 3IBCA 3K70B 3ELWA 4BQFA 2HK7A 5E1BA 4BJ3A 3W90A 1ZCJA 3HB1A 4QM6A 3CVUA 4FR5A 3RVSA 1G5TA 1QTNA 1YS7A 4TM8A 1RWBA 1XVVA 1OAIA 4DLKA 4TVSA 2IYTA 4DV7B 4BGDA 3QVGA 4OLAA 2G1PA 3RSZA 2OSBA 1HOTA 5EPEA 1J2EA 2C4UA 4EJSC 5IT5A 1QK4A 3N07A 4RVHA 4N5DA 1DLJA 4GOXA 1G19A 5JS6A 1YQXA 4YJGA 1K88A 1UK9A 2AEFA 4JJ6A 3ZW8A 4NRWA 3RF6A 5LKAA 3RTDA 4RE6A 5E7MA 4PAQA 1Y6ZA 1GA4A 3ZJYA 4EPRA 3H0CA 3E48A 5T4FA 2OA0A 3LU1A 1MLDA 3L9XA 4LDJA 2WUWE 5F3DA 2PY6A 4UN2B 3E4CA 3FG9A 5KNDH 1D2CA 2DM6A 4XR9A 1WMEA 5FKJA 3LOUA 1ZR2A 3QKIA 4QOSA 1ZICA 3VC2A 2PIDA 3ES9A 2PJRA 1CUBA 1L3BA 2PG3A 1YO6A 2YBEA 3DBLB 1SC4A 1FBTA 2F4NA 3GLQA 1PFYA 4II2A 3F78A 1QGYA 2FEOA 3FMFA 4JLBA 1P2UA 2QN2A 4M38A 4RTNA 3VKGA 4NU8X 3D6HA 2VF7A 2BI4A 2W2LA 4YWHA 4G07A 3FKQA 1AB6A 2CUTA 3JPYA 5HZKA 2H1CA 3SYRA 3SM3A 1EQ2A 2MSLA 2HIGA 3AHDA 3QVKA 2HC9A 4BKMA 4W82A 3DXYA 2XLCA 1FFXA 4XDGA 3ZR4B 4BVLA 2H65A 1M0EA 1DADA 4WSOA 1OGYA 2EATA 2DU8A 4CV2A 3DMGA 1U1FA 3BOSA 3AF1A 2YOHA 3MTGA 5TEWA 4QPDA 1ISFA 2GQ0A 3HJBA 2XMSA 1R6AA 4RGBA 1N3LA 3AZOA 3D7LA 4G89A 4DTCA 1DXOA 2PZFA 4K81B 4OM8A 2X9LA 1JG7A 3U3KA 3VU1A 2C94A 5JT1A 4IJVA 3PFCA 3WLJA 1PTKA 2ZXEA 3LZ6A 4DB4A 1EMDA 4G01B 1EZ4A 3VO2A 5IJWA 3B6EA 3TQIA 2VDNB 1DWQA 4RD3A 3B51X 3COWA 1JSZA 1O1YA 4RTSA 1RJ9A 5F7XA 3RAEC 3ADOA 1L4YA 1WXFA 1BX0A 3P5SA 1FUIA 3EVTA 1SC3A 1P5FA 1ZMBA 3L7DA 4IDDA 3RGSA 1WMSA 1XNGA 4WKOA 1HETA 2YZ2A 3BIWA 3K6RA 1LTMA 3EEFA 4TWZA 3UMBA 2H5IA 3PNKA 1PVDA 5GV7A 2JCVA 4YK7A 1JHAA 3GN1A 4O2BB 2H2GA 1HFJA 4IDGA 1F4PA 4UHJA 2OECA 3V8BA 2JIQA 4Y9TA 5AJZA 1I4LD 2X8LA 4B7AA 1XQYA 5G4KB 621PA 3FPGA 4GUAA 1NUQA 1Q16A 2WM9B 4TTJA 1USWA 2AG8A 1TK2A 3CM0A 3C70A 5I45A 2PAFA 5FF9A 1Q15A 3D2CA 1SKMA 4WJZA 3UGQA 3NOXA 4YXWA 2EZTA 4L4RA 5AM5A 1J22A 1NZDA 1AUAA 3QIAA 2ES4A 1PWXA 5HK8A 4E2FA 1UK7A 5EMHA 3IV9A 3PLAE 1P74A 3OT4A 2FPGA 1IMOA 1JP7A 1JBQA 3SVTA 2XCUA 5AHOA 5DTIA 5COQA 2AFRA 2GMWA 2IS2A 2W2XA 1U7XA 5K0NA 3LJKA 2BHRA 2EKBA 1H93A 1CIJA 1GJTA 1ZI8A 4BFYA 5ULLA 4EF5A 3PD1A 3ST7A 1CWUA 5EE0A 2PT7A 3T1HB 5DN6D 1I51A 3C6XA 2EF0A 1XFDA 4ZC1A 1YHZA 5BYJA 2DAPA 3JWGA 3GVXA 2QU8A 4RGVA 3S1LA 4LBZA 2FS1A 4KN5A 4KQCA 3PS9A 3REGA 2WINI 1NJ8A 1O5TA 5JMWA 3PXUA 4XX0A 3NNSA 1I1HA 2WVAA 1WNTA 4DMMA 1YBHA 1Q91A 1SZCA 3HHPA 1VDZA 2ZRGA 1YTUA 3CT6A 2R1UA 1UL1X 4JUDX 5EXSA 1QP8A 2FN3A 2FW9A 3ZKAA 4JI4B 1LBSA 3IEIA 1YH3A 4MMZB 1FYVA 2RAVA 1GRNA 3GELA 1T6ZA 1U8UA 1M6HA 4OV6B 3PUXA 1D2RA 5JD5A 3C5WP 3IUBA 2Q28A 3MERA 3SBEA 1Z6QA 4HGQA 5KSZA 2VJAA 1RS0A 4EG6A 3MW8A 1LBIA 2C7OA 1P5ZB 4YACA 1I32A 2V7EA 3EB9A 4FFSA 2JLAA 3T3PB 1GY8A 4BAGA 3U40A 6PFKA 3S2EA 2DP4E 3GPDG 1K4YA 1MHTA 1ACLA 4PHTA 4AKSA 2D2VA 1TZ2A 1KKLA 4Q1EA 5AUQA 4MGHA 1NRWA 2QHXA 1KK0A 3M4XA 2PAAA 2RGNA 2RARA 1HE2A 4CLXA 1J8YF 4NMLA 2LD4A 4V02A 2Q49A 4J0KA 4ZK2A 4L22A 5LB2A 5EWLA 2W98A 2NG1A 1JIXA 5FUBA 3Q8KA 3HXQA 2H16A 4MH0R 3R9KA 1I4DD 4RHEA 1VYUA 2AVNA 3Q9NA 3TCXB 2IEZA 2CC2A 1NYLA 1OYYA 3Q7EA 2AN3A 3HBLA 3JQAB 4OHUA 2CLIB 3A0UA 2XXJA 4CDGA 1QNFA 3KSZO 1PSDA 1ZDMA 2YJZA 3G8CA 4MI9A 2B35A 1YFKA 3NVDA 1PS0A 3ABOB 4B45A 4E70A 4AQ7A 5CLLA 1KTIA 3KPYA 3AFHA 4DRYA 3PDJA 4M7OA 3I45A 1BJTA 4O25A 2FPMA 4UJ5A 3ZOZA 1VHDA 2UVPA 2YWFA 4Q4JA 4HNTA 4QGAA 1OZFA 1Z6PA 1EX7A 4FYMA 5DV9A 3KP1E 1IDOA 3K0EA 1E0AA 1IZ9A 3W9SA 2PR2A 2XF2A 4IKPA 2RK4A 2GQFA 1MX9A 4Q9HA 3OA0A 4NJEA 5MFPA 3ELYA 4MEJA 4WY5A 3L7YA 2I54A 2WKSA 3KVNA 5DM0A 4ZVOA 3L4BC 2V6JA 4UPDA 4UBMA 1HOXA 3ZJ5A 4R1UA 1DUIA 2X3YA 1JHYA 2D00A 3QVTA 3B8HA 3T4PA 2BCJQ 5DE3A 4X44A 4RNAA 2VS1A 1XV5A 4QTYA 3CJQA 2Z2XA 5EJFA 5DTMA 2YJ6A 1LK0A 1FYFA 3AILA 2NU6A 1QX4A 1ZSVA 2P6MA 2X0FA 1D6NA 3TNDA 4HB4A 2AZ4A 2ZIFA 3HN2A 4Y6GB 5IZ4A 4WACA 5FTWA 2LBCA 2QX8A 4Z5XA 3OF2A 5I7EA 1FNMA 1ZSYA 1YUNA 4P34A 2RH9B 3EY9A 5BW6B 3RWBA 2W00A 3DTYA 1LXCA 4X7RA 3Q7TA 2G28A 2IZ6A 1UUFA 1GPUA 1TADA 4JI7M 5CBKA 1KYIA 2IEGA 4EUEA 1UJMA 1V95A 2WU3A 1KU6A 1KH2A 4YRDA 5E4YA 4BBZA 1Y3AA 4I46A 3RSCA 4EENA 1MNQA 3BSYA 4E4TA 4AROA 5G53C 2HRZA 3LX5A 4DIMA 3HPRA 4RW0A 5BRJA 1PJ4A 5T4BA 3CGWA 4JKYA 5D00A 1R9JA 2F3PA 1PKXA 4MS3B 4J91A 2XA1A 2X5OA 2JIMA 3CG4A 1EXNA 5AXBA 4UU0A 1NA5A 3EXFB 2NWQA 3ICQB 1PW7A 2XOKD 1O87A 3FGPA 4C6SA 2R7LA 2K5UA 4I08A 1RM4A 2SNIE 1YJQA 1HQYE 3WLFA 2A67A 2ETXA 5BVHB 2ROQA 2QJWA 2YZMA 4K40A 1RBQA 2WSLA 5GM1A 1PI3A 3D4PA 2UXDM 3KFVA 5E9JA 2PD3A 4EFNA 2ZTDA 2QQFA 2G04A 4INPA 1ITZA 5FHRA 4IV5A 3T3DA 4NKRA 1RAAA 1HDOA 2I78A 5EY5B 1XPRA 2RGXA 4C6TA 4D5EA 3A4VA 4RV5A 4H3KB 3VBCA 2C2ZA 3R7FA 3IUMA 3E9DA 1ISSA 3I6QA 3OLCX 4MUHA 4M86A 3S8YA 1CUXA 3ESYA 2GN6A 1ZP6A 4M87A 2UDPA 2DAIA 3RWOA 2PKEA 5BPHA 4TZ0A 5BN4A 2IPLA 3H2KA 4IJEA 1SKBA 1GTG1 2A35A 3IBYA 5JAZA 4K03A 3U6CA 2IL1A 3RSOA 1C7EA 1U0SY 4B6EA 1Z0SA 5ABPA 4QAQA 4XUCA 3SS8A 1ZA1A 5JRZA 4AWBA 1WUHS 3ROMA 1UZAA 7AT1A 3GUVA 4S2UA 5JNTA 3SMQA 5LMUB 1GNPA 2P5TB 5FORA 2NOAA 4JI3B 3MJTA 5L53A 3FMIA 4JBHA 3RVNA 3H2IA 1RD4A 4DNPA 5FPKA 1U3FA 4QG7A 3KKKA 1JEQB 2MSDB 1KEVA 4F04A 1INLA 4RHFA 5IRCD 1YE9A 5JMOA 4EG1A 5LOVF 2PMFA 3VHXA 2O0LA 4KK4A 3MPOA 4FYVA 4FILA 1ORHA 2SKEA 1EK5A 3VKHA 1P81A 5IARA 3DOUA 2O01F 1JG1A 3JALB 3L7OA 1ORVA 4D0RA 1X7XA 2OG2A 3DL0A 1VP3A 4X62M 1YMQA 5JNLA 1GAXA 1J5PA 3LUGA 3FCXA 5DYNA 3UPUA 2F4VM 3MA0A 4J4TA 5LBIA 1GL3A 1SEVA 4ARSA 1PEAA 4ZVMA 1Y42X 1G2OA 4TL9A 4K8RB 3WHIA 4Q3AA 3UJ3X 2DTXA 3S27A 3A04A 5IKPA 2QLNA 2ZYVX 2E4ZA 4RPLA 3OC0A 5HIMA 1E1CB 3DXXA 3IG8A 3G1UA 4CHGA 3GQVA 4CDRA 4B3MM 2OYRA 2FFAA 4IO1A 5IMBA 1X2EA 3K0BA 3DM9B 5CP8A 3BJZA 3CSSA 4HFRA 3O4HA 3HR7A 4JBNA 1JX6A 3N3AC 1KGSA 1NQ5A 1B0UA 1BQ4A 1GRQA 3TTSA 4GEKA 3E9EA 2AW5A 3GEEA 1XPOA 2DBRA 1XTUA 4K6CA 1Z25A 4EHAA 3IVAA 3J2PB 5HBGA 1ZKDA 4P5EA 3FRHA 5DGDA 2ISSD 3A4LA 2F1OA 2R8PA 3CKKA 1KKUA 4D8YA 3OEEA 4RD1A 4OVZA 1B8NA 1E2QA 5FWXA 1IONA 3CJTA 4NMHA 2BP7A 4MUJA 4UQLA 1SOAA 3CZ9A 3J81k 1U5BA 3J7AC 3D9QX 3ROZA 5HRUA 3C3EA 2XMDA 2A9FA 1OKSA 2JAQA 3VDRA 1CUJA 1QG2A 4O4IB 4EYEA 1J2YA 4UBLA 3ZU3A 1PG0A 3R0VA 3ZZNA 1CY1A 1E3IA 4EB3A 5LA6B 1J49A 2N46A 1MV8A 1KP3A 2D1YA 2J45A 3OZUA 1KVRA 4GR9A 5ALGA 3W8DA 5KNBH 3RASA 2JLRA 2DBVO 5KREA 2N75A 1OI4A 1JE0A 3JR5A 3H1EA 3W34A 1JBEA 4I50A 1E2GA 1CUUA 3ONFA 3IPRA 2REOA 3B48A 4YV0A 1RI5A 3GK3A 3VPHA 4R83A 1ACMA 1SCIA 2GZSA 3PVZA 3TUIC 1UFZA 2UUPA 2W4QA 1V5EA 2XZFA 2V7WA 1DSSG 5ALQA 3A06A 1FRQA 1WXWA 5H0IA 3T35A 2BWEA 2XQIA 3EXEA 1IOVA 3A32A 2RKBA 1TTEA 2R44A 1E1QA 4AP6A 2J9ZB 2PKYX 2JC3A 2YICA 4UTPA 2CVFA 3PC8C 2QI9C 3R23A 1C1XA 4ZU1X 4OHWA 4QRDA 4EX7A 3DHVA 1FYEA 2HU5A 4IIUA 1J8MF 3HKPA 5H4HA 3DTVB 3HLKA 1FDUA 3WYDA 2ZIXA 1A1SA 2OE2A 2WHXA 4IIVA 1FF9A 1MO3A 1LLQA 2P4EA 2PRYA 1A9OA 4L0CA 2ONKA 3K1AB 2ZBQA 3FETA 5KYKA 3A4MA 3OM8A 4QQKA 4F5DA 3DNPA 1OLSA 3ZK7A 2NGRA 3RT9A 4D82A 1IHXA 3LFTA 4LOHA 2A2ZA 4ZN6A 2VT6A 3VDQA 2X5NA 2KW5A 3FE2A 3D7MA 5KOIA 1JHVA 3PYLA 4F7WA 3C3XA 2C5HA 2QTGA 1QNLA 1M7GA 3FZGA 1S2GA 4KHPM 4XJTA 2FDXA 4RS3A 1XTRA 3FJ1A 3ISVA 1RXWA 2XMPA 5C52B 3UXMA 3EGXB 4MB0A 4GH9A 1VJCA 1IFXA 2CNNA 4LXIA 4H7DA 1JKMA 3VPGA 1E2DA 2ZR8A 4KXFB 1P2BA 4UMEA 2AL7A 1EBUA 4IM7A 5F7ZA 4DM7A 4MKGA 2Z30A 2VRWA 1JFFB 4IQ0A 1UEJA 2Z6QA 2AN4A 4FGSA 4N5LA 3PEYA 4MUKA 1U9IA 3V48A 4U4AA 2BPOA 3QE9Y 3M0EA 5GIPE 2ZWOA 3A27A 4D57A 4W9NA 2DTDA 3H9BA 5F1PA 1ZUNB 3LXMA 2JIOA 2O8EB 2BZ0A 2NYAA 1HDEA 2P9ZA 4RUKA 4HX9A 2CXSA 1MN3A 4MGIE 3G0BA 2VK1A 4Y2SA 4DEXA 1IJBA 3HKBB 1Q1GA 3TUJC 3E70C 4LKOA 2G9ZA 4PONA 3ZDZB 1QG4A 1E3DA 3H17A 3FF1A 2C2YA 4ZCMA 4QOIA 2GZMA 3BQNB 1UZUA 4X9XA 1ZD2P 4R3UC 4IIXA 1TVEA 2JATA 1PQPA 3EIOA 4PYRA 2BTEA 3OF5A 3V4LA 1Z4MA 5DM2A 1A9SA 3IALA 2RHJA 2UVQA 4KUGA 4XGNA 2WWXA 3E9ZA 2XGJA 1VEJA 4X6LA 4INOA 4E2YA 4LECA 3CEMA 1E8MA 4TT8A 4YTEA 4ETWA 1DUSA 2CJWB 1OWNA 4F1IA 4ZU3A 2PS1A 4H7JA 2OV8A 3VHLB 4PICA 1Y4ZA 1N7JA 1X2BA 3PC3A 4GOJA 1V4VA 4Z4FA 4D5GA 2AZXA 3TQOA 2P7HA 3OE4A 2V54A 3I42A 5JJ5A 3HHXA 2BEUB 5EGSA 2R97A 1ABFA 2Q07A 1N7IA 2OGSA 1A72A 1TUIA 2RHOA 1SC6A 1R4ZA 3LM8A 4DCUA 2ZAGA 1SR8A 4YHBA 1UPFA 3PUKA 1VHTA 3JQPA 3FCEA 3GUZA 1DKQA 1TXGA 1I1QB 1ISRA 5JVDF 4ICIA 4ZVVA 2IBMA 2VYND 4II3A 2XECA 1U2RA 2B7BA 2XE4A 2XTMA 2G5PA 4HS9A 4QPZA 1SVNA 4Z0PA 2Y76A 2WSBA 4LZAA 2CBZA 4F2GA 2Y1LA 4Z9XA 3ZUGA 2Z1MA 3FDIA 1Y34E 3H11B 1RXVA 3ZDFA 1YZGA 1DINA 4OK3A 5E6RB 5TC4A 3SYMA 4MCHA 3GRKA 3LVWA 1G5IA 2YN4A 4RMNA 5DTEA 1KK3A 4GGOA 4B3JA 1WETA 2GPWA 2OAEA 2DJ5A 4ZRDA 4EZEA 4G4SP 3L7AA 1QE5A 1XP5A 2M6KA 3G7UA 1K4MA 1CUWA 1A9ZA 2BEWB 1IB6A 2FGJA 3R09A 5KU1A 3FHLA 1MMFB 4NEQA 2KRKA 4UNPA 3C7TA 3WSVA 2FZVA 1VHJA 4LVCA 3KW6A 4DRXA 1Y9DA 5JSQA 2QRZA 5FD8A 3MLAA 4YN3A 4BRUA 1WL8A 3CZQA 4LRSB 2NVBA 3K0FA 4J4HA 1EXDA 1Y3FE 4G86A 1WZEA 2VL7A 2PLFA 2QM0A 2F55A 3I6YA 2CV2A 2O48X 4FYWA 4CGZA 2VT3A 2O05A 3EGVA 3NAZA 3F8SA 5CLGA 4D9FA 3GBSA 4RKYA 1E0JA 2V9PA 1XNRB 2YXLA 2V7QA 3I2YX 4I1UA 5CB8A 2VDJA 5J43A 1XDWA 4RHTA 2DHDA 3L07A 3GRUA 5BMOA 1QUEA 4LY6A 2KPOA 3CNQS 4B2LA 1VKOA 1IHPA 4YRCA 4BEVA 4JJ4A 3NTXA 3TO5A 4RK7A 3TLMA 3GP1A 3E3MA 4Q39A 3MBOA 1KDZA 4U0KA 4ZCQA 2EX1A 1N4DA 3SJBA 2AHOA 4BO2A 2XUHA 1B8OA 3U6OA 2XBUA 3QFTA 3GLKA 4G0PA 1FVFA 4HN9A 5KOJB 5JISA 1IYZA 2VP2A 2GO1A 4ZHSA 3VGJA 4E5YA 2H4ZA 3P2OA 5AVKA 5BMVF 1UMDB 4BHTA 4D3SA 3OX3A 3FZNA 2FX2A 1KO1A 3FCUB 3SVLA 5J58A 4R1NA 3MYYA 3WKAA 2QYHA 3NCTA 1CSEE 1W85A 5AM3A 4F7DA 3ETGA 2W2NA 4HVCA 4R7TA 3KLMX 5C4MA 3WQHA 4KE8A 4DWJA 2B0JA 3GB9A 3EQ9A 1JZQA 5JFOA 4BQNA 1Y7PA 1NW9B 4OBXA 4H7IA 3WE7A 1KBQA 3BRWD 4FMDF 3TM5A 3JXEA 3ENZA 4JJGA 5F4BA 4N7RA 3VU0A 2WF8A 1DT5A 2HHJA 4LF9B 5LQMA 1L5VA 5E9AA 1MC1A 5GJWC 2OPHA 2M6SA 2O8CA 3TSCA 3LOQA 4Y1GA 1E1NA 3ED1A 4G3OA 2VNSA 1QH0A 3OPXA 1G3MA 2W58A 4UZFA 2ODNA 2R7NA 1P4GA 4YR9A 3BREA 4IIYA 1KY5A 2DWQA 2KWIA 5FBLB 2V0NA 4JL5A 2DZOB 1LQ2A 3I5MA 4YAWA 4M9XA 2JP7A 3NHLA 3KS4A 3AK4A 4IXTA 4UEOA 4UVHA 4CV0A 3I4YA 3C87A 4KXWA 3ABIA 2C57A 3F92A 4NEHB 1J5XA 2KLHA 2EJCA 5G41A 5F12A 5A3RA 4QULA 1P0FA 1QANA 2ZRJA 4UCXA 4U7JA 2O2CA 7MDHA 10MHA 3QWFA 3OPMA 1N2CB 3FNQA 3CH6A 2PH3A 4MPJA 2ZYHA 3EAGA 5DI3B 5EYPB 5BV2P 1XT6A 2CVPA 3EWSA 3M2TA 1PEKE 5EZ6B 4FI3C 1LNZA 4Y6LA 2YR0A 3EG9A 2J8ZA 4CLDA 1N92A 1CJUC 1Q12A 4EI8A 4PSDA 4MTCA 5CX1A 4WP2A 3WBFA 5ELMA 4Q4HB 5DGCA 1DT3A 1J20A 3EZYA 5HR5A 4X84A 4BNNA 5LMZA 3V4ZA 3AUJB 4MS4B 4BCCA 3MQFA 1DZ3A 1ZEJA 3IUYA 4BNTA 4KOEC 4OQ4A 3G23A 3WGVA 1N2IA 1GTSA 3A9RA 3EF0A 2VXOA 5D51S 1X37A 5IAAA 4P8RA 4AL4A 3ZQUA 2WYWA 4P58A 2D7GA 3IESA 1YDFA 2WSSD 1MO5A 3V4FA 3NIFB 4QWMA 4DB2A 3KQYA 1GQSA 4JT9A 3I04M 1R0XA 7ABPA 1T29A 1EFVB 3EGWA 1OASA 3OZVA 2VHWA 2VEDA 1GGKA 3JQ9C 2Y20A 1WIVA 1GU0A 4RVGA 3UOWA 1M34A 4B3BA 1W4ZA 1GJRA 1PNVA 5CVCA 4TXNA 3RNOA 2EKKA 3LH5A 4HNGA 3C3CA 3V4PB 4QEZA 3HXTA 4MUGA 3CRVA 1Q14A 3WA6A 4MCAA 1BXGA 1UM9A 2RGAA 3TLYA 3SYNA 5AW7A 4YCNA 1TH3A 1GCUA 4KE6A 1J56A 4Z1MA 4PRZA 4YI5A 1R10A 2HRBA 3GLFA 4FZ3A 5EWMB 4YB8A 1EDOA 3D3WA 2XJ9A 1QF9A 2FGKA 4WCDA 3LYUA 1M3SA 3HJCA 2Y0CA 3ZK9A 5LQNA 5I9TA 4NCJA 1X9GA 3KQLA 3G6KA 3SU8A 5SY9A 4KQWA 1MF7A 4OOEA 4JBYA 2ZTMA 1QONA 2JDIA 5CIQA 4QU9A 2NO1A 1RMYA 2GJ9A 1KI6A 1T4DA 3I0NA 4HH4A 5AXAA 5KC8A 1UC5B 3TSOA 3BJRA 2H0AA 4L5BA 3M83A 4MV6A 5JJCA 4K2HA 2VAWA 1GLVA 1XRQA 4GP9A 1DQYA 5ITUA 4KQJA 1L7VC 2VSNA 1JPNA 2FEXA 2VRCD 1H4VB 4AJJA 2HA3A 3NTLA 3NQ41 3BZWA 4D0SA 4K3UA 1XZJA 4B6RA 1SCUB 3WGMA 2O7SA 4UEWA 5TVGA 2P5UA 3E7WA 2OT3B 4ZEOA 2KE5A 2HHAA 5IUNC 3I2FA 4K8OA 4RDCA 3TINA 5J47A 5BURA 1ZHOA 3HG7A 1JFLA 2DF8A 4B7ZA 1CVRA 2XWPA 1ORIA 2PH5A 4KYIB 2WOJA 4R1TA 4IF6A 3WL4A 3JVDA 1X7ZA 4X3CA 1DXYA 2XD4A 1V9LA 3DMPA 5IHXA 1L5NA 5A71A 2UYYA 1GZVA 5DM4A 5BNWA 3B7ZA 5IUKC 5JAOA 2VG8A 1BWSA 1NF9A 4CU2A 2JARA 3HA3A 1RZRA 2HMYB 3CUUA 2DMRA 5ILOA 2ID4A 2FUG6 3TZLA 1T2NA 2YJGA 5SZHB 4BNXA 3W0FA 4I1PA 1SXQA 1YNSA 1IJKA 4I9HA 4MW1A 1UJCA 1XC8A 3RKSA 2ZULA 3TLCA 4K88A 2G06A 1WR8A 4N6GA 4FBGA 3DQPA 2BM1A 1IY2A 4XB2A 3ZD7A 1X0VA 1OBVA 4B6JA 1GOTA 3KLNA 5HIJA 2GFHA 1FL9A 2V6BA 3CT4A 1B42A 3IRVA 2Z4SA 1SBIA 3UBTA 1F6DA 3T7JA 4BZPA 4QPPA 1JHZA 5BWCA 4RC9A 1OREA 4DA9A 2ALJA 3TIIA 3JARB 1OZHA 1Y4DE 3IE0A 2G77B 3ICCA 4RHYA 3CBQA 4GLFA 1GQFA 2IUSA 5L4LA 3L5OA 4IZHA 5EI5A 4Q15A 1HDCA 4RA6A 2BSXA 1ORDA 3TIFA 1NKVA 5G1NA 4I55F 2Y0DA 5I9SA 2VDVE 2QROA 3NOVA 4GXQA 2FRVA 4BQPA 2EBHX 2WE8A 3QVVA 2F43A 5JH7B 2VK2A 2FPXA 5H3HA 3O2NA 2W0MA 3AWIA 1GPKA 4ARIA 3KJNA 5BUSA 3NS7A 2ZR7A 4WXEA 3CEAA 3DKKA 1P2FA 2PSHA 4WBXC 4KTTE 4DV6B 1QHHB 2ZRLA 4R69A 1X7HA 3UB3A 4IDQA 3H9UA 4GKKB 2R6GA 2FMTA 2WZJA 1F60A 2J5KA 3PHCA 4H16A 3T5PA 5JDCA 1V16B 2NT4A 2CNWA 1DUVG 4OHVA 1U8FO 3N2YA 3VSBA 3TMKA 1R9NA 4AZ3B 2Q2WA 3MWEA 2NO5A 2XUJA 4W7HA 1I2AA 1I8TA 1I4EB 2ZETA 3MGCA 4HGZA 4IEFB 3ZLUA 5KYXB 1XZKA 3PGMA 1G0OA 1CJKC 5AJTA 1T5SA 4Q3EA 1JLHA 1KP9A 4MW2A 5GAJA 6YASA 4WL0A 3V1TC 5DXJA 3U31A 3PNVA 3TQHA 1HLGA 3BK2A 1Q1AA 3UMFA 3HJTA 3MN1A 4CVNA 4HH0A 3IB6A 1V1MB 2QMZA 3KB6A 3PJGA 3VOSA 4DYHA 3GFPA 4RF1A 3P9CA 1VLVA 2JGLA 2SBTA 1FJXA 3RD5A 4MW5A 2C7QA 4HYQA 3TCNA 2GD0A 1IPEA 3A9WA 1TVMA 1P29A 2VAXA 1V8DA 1SZDA 4R01A 4IIJF 4K6FA 3GPBA 4WBNB 4LHVA 4D02A 5JG7A 1GRRA 1TGYA 1W4BA 1XRLA 2C78A 1H42A 3S28A 1E59A 2XH9A 2QSYA 3PE4A 5E8RA 2OV6A 4PZYA 4Y2VA 3L0DA 4BO4A 1A7AA 1QRTA 3R5JA 3OJ0A 1ZJ4A 2ZVJA 1OLXB 2MR6A 1A9QA 4CQNA 3GLGE 3UH1A 1LI7A 1KEEA 1Z6TA 1B0ZA 3GAZA 3E84A 3K2IA 1UBHS 1N2CE 2ODTX 1M5UA 2WWHA 3G2PA 3N2EA 4FKZA 1JHMA 3W2EA 3RODA 3KRTA 4G5YA 1VCOA 1V8ZA 3QGMA 3U9TA 2TSYB 4Q1BA 5EVJA 3QU2A 1E6KA 3UGJA 3OA2A 2X9NA 2QRLA 1ZIPA 1N32B 5IF9A 4YCJA 1Z7YA 2O50A 5D1HA 1NVMA 1B1CA 1A69A 1RP7A 1JQAA 3C15C 4ZOLB 4O8CA 3VOBA 1H2XA 5E2IA 2WIFA 3OZBA 1AZTA 4R98A 1UBKS 4ZOAA 2FSGA 3T0IA 5F1KA 2DSTA 2WILA 2WG1A 4EMBA 3FDZB 2I22A 3M81A 3GJSA 3QSGA 2V8BA 1LPPA 3HMKA 3D7RA 4PZUA 2YXBA 3SZGA 3IHLA 2ADFA 1ODTC 2R48A 5HQ3B 2HX1A 1T6OA 4M8NE 3HNRA 2C2HA 4G09A 1XOIA 5ESRA 4E5MA 3ZCSA 2D5AA 3IGFA 1Y63A 4MPRA 4I1YA 4DQKA 1PRYA 4DUYM 1X7WB 1IN5A 2OD7A 2B36A 2E5LM 2BMVA 2VQSA 1VKZA 1NHGA 2YRFA 1C3OB 4F2HA 4BRWA 1GGNA 2X5JO 4MROA 1P9RA 1X0XA 3E58A 3ML1A 2PL5A 3BIFA 4F9TA 3RE8A 1KFVA 5JEDA 3FIUA 2OUKA 1VRVA 3I1JA 3W5SA 1VBKA 5EKSA 2H3EA 5CHEA 4JP1A 1Y5RA 3I0ZA 4B71A 1BHJA 3AESB 3FBWA 4N1AA 1PJZA 2HLNA 5ALZA 1VSBA 3ROEA 4W5NA 1N78A 5EWJB 1OPXA 1F5SA 4RVNA 1LU9A 2I3GA 3BFKA 2A1TS 4O4JF 3P96A 4XIYA 3A6GA 4H1VA 4TVKA 3F9IA 1PZGA 4P84A 1ZPDA 2JHAA 3MFYA 1Z4NA 1W47A 3AONB 3B1KA 4OX9M 2RCNA 1FUYB 4NOKA 4LFCM 1Z12A 3PI7A 4EUHA 5CXUA 1N0HA 1O7JA 4IWXA 2R8EA 1JKJB 2NUAB 2GN0A 2WG0A 3MCAA 4NYMQ 3IMEA 1GYQA 1KPGA 3GDOA 4MIEA 4GFDA 1IBMB 5B6PA 3UMCA 2WW8A 4NONA 3EGIA 4OGWA 3A1NA 4K7JA 3KXDA 1N0UA 4HWPA 1ADFA 1BGWA 4D41A 4XYEA 1WW2A 3S2FA 3KOYA 5FFNA 6LDHA 1PE0A 4ZGGA 1VPVA 4K9LA 1KHHA 1OFGA 2Q99A 4G0OA 1E1RD 3ZEAA 4F21A 3K6SA 3V1NA 1RWKA 4EG7A 4KU4A 4IDHA 3W7BA 3BKXA 3RLFA 1UMBB 4BGVA 3U7FB 3C6QA 5DNAA 2DFVA 4M9CA 2ZJAA 4ENVA 1G2IA 2Y0QA 4C0AC 5ILGA 2V7GA 1U3DA 2UYQA 4MVJM 1NHWA 5EN4A 3ESDA 1MN6A 2AMVA 2V6ZM 2OFOA 3FPCA 3I51A 4CV1A 2FAXA 1JAIA 2A0FA 1MQ8B 1M2OA 3VJRA 1CEXA 5A0FA 1I6LA 4K9KA 1M1YB 1URPA 5DNVA 2VDWA 1W36D 2OAP1 3BF8A 1MVLA 1Z5ZA 1SC1A 4RXMA 1QBGA 3AR2A 4HVAA 2YZKA 4MCJA 3CCFA 5F9HA 4XW2A 1OY1A 4LRTB 3TDNA 3ZH2A 4PANA 3WGIA 1Y7IA 3TFQA 1G9XA 1G0NA 1YE3A 3CS3A 5I7WA 4CQMA 3QUSA 2BFBA 4OB7A 4FYXA 5E9WA 1NQWA 4G1FA 1MAHA 3OAAA 3RYIA 1W36C 5CDHA 1MB2A 4TTPA 1C1KA 1QGUA 3H8WA 4O1IA 4KHZA 3WBJA 4UQOA 5EJMA 4HVLA 1OVMA 4AFNA 3ZU4A 4BDTA 3PXBA 5K4GA 1ONPA 1QVVA 5FPPA 2GEKA 4IUDS 4A91A 3N7TA 4MDYA 4BFSA 3GT7A 4JU9A 4XJSA 4MAAA 3R5HA 1QQAA 1GILA 2YIJA 3E9SA 1R6UA 3I34X 2A57A 1UC9A 5FDFA 1ULZA 3E22A 1NQOA 1PLKA 3AJIB 1ML3A 1GFWA 3P2KA 4X93A 3UOAB 2NAFA 1L7AA 5AW0A 1EFCA 3TXXA 4L57A 3E05A 1D0MA 2K47A 2DGDA 4ESHA 1UPCA 2WU0A 1H2FA 1R18A 1L2DA 5AK0A 3NHSA 1D2MA 1VBNA 3ZWQA 1NF3A 4P6VF 3PDIB 3C5VA 4W5QA 2JLZA 1RHRA 4LWQA 4HQFA 2IHKA 5C37A 4H4CA 3UJPA 1RYBA 4I3HA 4BQIA 2CFTA 2VF8A 3R3JA 4DV3B 2XB4A 3VH1A 4TYPA 1ARZA 1F14A 4BECA 3R76A 5FBKA 4OQYA 1A9RA 3EEBA 5CK5A 3T9BA 5CURA 1W6RA 2ZB4A 4B3DA 2QX9A 3UAVA 3AZQA 1VMAA 2QUZA 3RFTA 1HF3A 1U2TA 2Y77A 4B2IA 2Y1OA 3I37X 3OEHA 3PXXA 1GXSA 1DQPA 2GRUA 1KEZA 2YHBA 1TGVA 3HO6A 1LFDB 5C8YF 4LXHA 1FS4A 3C24A 5AHXA 3C6ZA 3SF8B 5LMCA 3OLXA 2V3WA 2FDCA 1QCZA 1WQ4A 3N6VA 2B2NA 1N5KA 2O0HA 1UK8A 5TB5A 3BN3A 1A8IA 4KPUB 2RK6A 2IDJA 1FFCA 3D7NA 3QPCA 4LK3A 3P9IA 1JHRA 4A6PA 3HDYA 1T9GS 4XLZA 3T4UA 3BTSA 3E1SA 1Z4LA 4B3XA 2RGOA 4I4CA 1PTJA 1Z6XA 3UYLA 1AT1A 1XTPA 4ZI7A 2AV6A 1NJ5A 3BK1A 5JTUA 4ND7A 4RYLA 3FTQA 2CB9A 1JT2A 2LKDA 3UXYA 1I80A 4WLOA 5CHYA 5KQDA 1JJFA 4DMLA 2YVUA 4MVJA 3C41J 5PGMA 1WSBA 2PCLA 1LDBA 2V6IA 1HE5A 1AHNA 1OBHA 1VA5A 4Y2YA 3JW8A 1GUZA 2QQ0A 2Z9DA 1B2LA 3UK2A 1EE1A 4A0RA 2UAGA 4KFCA 4X1KA 4UM5A 3TS1A 3T94A 3BJEA 1NLZA 4W1SA 3K2LA 2EFEB 4RQBA 4XBOA 4AY5A 3GBVA 2IU6A 1L5LA 3KHSA 1NW7A 4FXOA 3GZ4A 1RYDA 1NQXA 4YO8A 5FQOA 1LH0A 2SKDA 4E88A 2GEUA 4Z3KA 3GBPA 1IXYA 3ESBA 1G8FA 2C5LA 2IEAA 2IF0A 1W0CA 2YNMA 2C5GA 4BZXA 1P8JA 2FCAA 4U7HA 2ZZMA 4FKMA 1FQWA 4JR2A 1J2RA 1ONOA 1G98A 1QKKA 3GGSA 3R2JA 2CMFA 2P79A 1DAPA 2R84A 2CFOA 2H5JA 4EUFA 3V2UA 2HPAA 2AC4A 5T64A 5C5IA 1ZJYA 3VI4B 2BGNA 4W5RA 4LXTA 1W46A 3DW1X 3PC6A 5EPOA 1TIBA 4J0JA 5CBPB 2EKZA 5A5FA 2Q1UA 1D5WA 2IHZA 4JLDA 3VJMA 3BVPA 2O5CA 1TT5B 3PZBA 4NBLA 2PKQO 3HDJA 5KX5B 3SEZA 2N3ZA 4CM9D 3WDKA 4NXMB 4L8RC 3LK6A 5CM2Z 3G8BA 1RFGE 1HA3A 1QP7A 4K2AA 2BFEB 3REQB 2BGLA 4KYUA 4TXJA 5HWSA 4IGFA 4DE5A 3EXIB 2JIZA 2ERYA 3LBAA 4RTQA 4P0TA 2CCJA 4DR6M 1ILEA 4BBJA 5FI0B 1O95D 3N2KB 2W4MA 3LCVB 2ZRNA 4TV8A 4AK9A 3P4XA 3GLHE 3WL6A 4RGQA 3B1FA 2GKGA 3M1AA 3KKPA 4FC7A 2QOEA 1TDHA 3WGYA 2GXUA 3TZBA 4M55A 1KI1A 2XBMA 4R8KA 1TZJA 4BV9A 4QBHA 1XG5A 2XADA 4R6WA 1SCJA 3T9AA 1J99A 5HTOA 4K0KB 4PLZA 1RQ7A 3WFJA 1FC0A 3EFOA 3T52A 4DMHA 3SZOA 2CF6A 3T0GA 5DISB 5LLTA 1R2QA 1O95C 2VDOB 3NEYA 1Z8FA 1HQDA 3IT2A 1A76A 3QBJA 2R87A 1WLSA 5F7OA 5C4GB 3UJ8A 1YRYE 2VTBB 1DZIA 1KZ9A 3ZPXA 5KSYA 3PCXA 1J2UA 4MLCA 3FVRA 5DWQA 2ZT7A 3ZE2B 3H8VA 4WNAA 2VDLB 5EJ2A 1ZNWA 4MUAA 5DBFA 3R24A 1U2QA 4LYAA 4P4SB 5ENVA 5JFGA 4K05A 3BKWA 2JAOA 1KEPA 4QUDA 1NMXA 3DOOA 1Q2XA 3UEOA 5H3CA 1I36A 2F67A 4MIKA 1QG6A 1UFKA 2FEPA 1YU6A 3LQ1A 4O4LB 2X8WA 3ZNPA 4YMHA 2FWBA 3RJ5A 4K9NA 4BV3A 3H05A 1H94A 1KBZA 3GJZA 2Q8QA 3HKEB 5H68A 4A2QA 3KHTA 4EVSA 4PNPA 1ECFA 3T5TA 3TOXA 4FYJA 3A3NA 2ZRAA 4V1CI 3N7UA 3S8MA 4RDIA 3EWNA 4EHDA 4NYMR 1YQEA 3U09A 1IRIA 1F2TB 3S29A 1M1YE 3KQVA 3V4VB 3URKA 4E14A 1G6HA 4BFZA 1OT3A 1FRZA 4YASA 4TGLA 2P0AA 1NE2A 2Q9CA 5AYVA 4IHJA 3CUKA 3WRVA 1WY7A 5EXPA 5F7JA 2NSLA 4BVEA 1O96B 3VQTA 1PFKA 1VB3A 1LS6A 3QLUA 5KYTA 2HXSA 2X49A 3IBGA 2X7HA 3AVQA 3NX4A 5FYQA 4E30A 2PBRA 2MDTA 3BGDA 1PL8A 3EVNA 4QZVA 3BD9A 1G9TA 4QDKA 2B99A 3OEYA 1LPNA 3ZGVA 4NHEA 3AHJA 3OFSA 2L6OA 3IAUA 3QYFA 2XNHA 4P86A 3RFXA 3V3KA 2NZVG 3QYEA 4R05A 2XAAA 3BD8A 3LY7A 1ZK0A 1YCHA 1W4CA 3JQGB 3QPVA 4J3NA 4EY8A 1UDXA 1YB2A 5D87A 1W93A 3FZEA 4NABA 2O1WA 1XBTA 3K31A 1A5TA 1NQVA 4FZ5A 3W5IA 2QL7A 1YOVB 4TKMA 1CY6A 3OQOA 1K3FA 3N5CA 3IV7A 4ZVLA 1B6TA 2IW3A 4BB9A 1E2EA 3WGUA 1YZNA 1DMRA 2GBPA 1TLTA 3QVWA 4JEMA 3ZY3A 5A4AA 1HFWA 2VNJA 3C3PA 4K87A 5BSKA 1ZQ9A 5GONA 1YCGA 2ODPA 3M3DA 3R0JA 2I6FA 2B1JA 1BWPA 1T36A 1TT7A 5C32A 1SKAA 1FA9A 2BFWA 1LV7A 4MUIA 4MEAA 1D1TA 3HB0A 2Z5VA 4L8GA 3QUBA 1GKLA 2ZLBA 3NHWA 4KXYA 3PQ4A 5A4KA 2JAXA 1YVUA 4UNNA 5IW8A 2XPCA 4R3NA 2VF2A 3OQ6A 4R1PA 1OZ0A 4RANA 1Z7GA 4BKRA 4B7HA 2H1OA 2FXIA 1TZKA 3RTGA 4ZMSA 3BE6A 2Z1DA 1X86B 1E1YA 3TYXA 5HE9A 1F17A 4E09A 1A82A 4NFYA 1S8FA 3U4QA 2EZUA 1NVFA 1HDZA 2BGTA 2WOOA 3EZLA 4PGFA 3CRZA 2QM3A 3GDGA 5HK9A 1QCDA 3IEVA 1K6IA 1GG5A 1GCAA 1UOOA 4F5ZA 1FDIA 2RIPA 1TKAA 1ODIA 2Y2VA 2QZ9A 1XF9A 4PNZA 1FFYA 5JALA 1D0IA 4KBYA 4PSVA 3LSTA 2GAFA 4LRQA 2AUNA 4Y98A 4C2TA 4P36A 1HMPA 2H1VA 5AW5A 4URVR 4M36A 1QQTA 1L5HB 5I7RA 4P3KA 1XA4A 3MINA 3IAFA 4IYRA 5JSHA 2O1EA 3BULA 3Q7IA 4TLMB 4UNQA 4AM8A 4A8JA 2YVAA 4R41A 2O5VA 4GM1A 1HDXA 3JD3A 2AEMA 2CF5A 3BFPA 3NYIA 2JFOA 1U9YA 4F84A 2FYTA 2FRXA 4KQ1A 1QUFA 3BWEA 3DAPA 1E4VA 3I9LA 1QKIA 3SDSA 4HLCA 2ZAIA 3TGLA 5JBNA 2CLEB 4K5QA 3FN4A 1LPOA 2J0UB 3DAYA 1IIBA 3GFVA 3OZTA 2WM2A 2ZJ7A 4O2LA 1YHYA 1XMQB 1RRFA 5J4KA 1N1GA 1PJRA 4O3MA 4E07A 4ZT6A 1GAQA 3DHYA 3GUHA 1JQLB 2O59A 2LDXA 2ECPA 4DMRA 2P3SA 4E46A 1CE8B 2HZBA 2CMDA 4CEJB 3I28A 2WAAA 4FYHA 4WASA 2OGUA 5J2TB 2WAOA 2GHIA 5TX7A 3UZUA 1I5OA 1HFKA 3N2GA 4FZVA 2CKDA 2DETA 1V1JA 3CX4A 1SXPA 4HDAA 3UMVA 1P3QQ 3NOOA 1SUDA 4DPLA 3ROPA 4OMCA 3TKAA 1EI9A 2CL7X 4LX0A 3COZA 5LPNA 2PU7A 5DLDA 2XF8A 4LSGA 1V11B 5IZCA 3EMDA 3K9FC 3DUFB 3S1AB 3TAUA 4MVJG 4FFVA 1RW4A 2R96A 1ZNYA 1SXJD 4IBJA 2AHRA 3ON5A 2B6HA 3G59A 3O0TA 5AOCA 5E2BA 3HCEA 1RBZA 5ITZA 3NTQA 2FMXA 3ONWA 1T6NA 5A5GA 1IXSA 1IZ7A 3E8MA 4XVUA 2P9BA 1S8OA 5CNJA 1LC0A 2O8DA 4B3SB 2VPXA 1AK9A 5KHOC 3LECA 1V48A 3CE6A 3KR9A 4IOLA 2E4VA 2NM0A 2L0XA 1WMAA 2C20A 3RS0A 2XJ4A 2I03A 4C0JA 1SXJC 5CIWA 4XWTA 4HLUC 3VH4A 4WESA 4RF4A 2PRJA 3GT4A 2BZGA 1YBMA 5DLYA 4TYMA 4NBVA 1GKYA 3TBHA 1YLAA 1P1BA 4QGBA 1NR5A 2FW8A 4FDAA 5JAPA 2R4JA 1VPEA 2HADA 5JCJA 5BPFA 2E5WA 4F2LA 3FNIA 4I81A 2VP9A 2C8KA 2XD9A 4YJ3A 1VIMA 1VL5A 4MV7A 1THGA 5ES4B 1SHKA 5EOVA 4GQIA 4A82A 4CM6A 4XARA 5K20A 3RIEA 2DRIA 3CKYA 1Q77A 3IC5A 2QTMA 1X1QA 1JXQA 1QHIA 1YUMA 2I33A 1PIWA 4IZIA 2OZPA 4YDRA 3TRJA 4JYZA 2J3LA 2VJQA 3EEOA 1TYBE 3A6KA 4KYVA 4CRWB 3TX6A 3DFZA 4CI9A 1VL0A 2YW2A 4ZPXA 1U0BB 2P11A 1EGQA 4H1TA 3QYJA 1UZMA 4BEBA 3NT2A 3D6MA 5AVQA 3CR3C 3RGPA 3Q2OA 2C07A 1F8FA 4UPEA 1GNQA 4YJKA 3KCNA 3ZDBA 1ORWA 1VLMA 4MMXB 1P17A 4NENB 3EBOA 1VJGA 3VZBA 1P72A 4RQUA 2YWRA 3R7SA 4B1FA 5KCMA 3SFZA 2EFGA 3X1DA 1WPGA 2QLFA 3QKSA 3FCSB 3E53A 5A1TA 1OIVA 3MWDB 2UYGA 3SQOA 4ROTA 3ORFA 5E6SA 1UKVY 1X8KA 2QLLA 4OYRA 4PPQA 2BJHA 4ZANA 3QBVA 1ZLYA 4QHYA 4S3MA 5EAIA 5I8PA 3VVBA 2QX4A 1XELA 4CIWA 2Y1FA 5T4HA 3CZAA 5JAUA 4UAJA 2Y6VA 1MENA 4YREA 3PQDA 3E18A 1U02A 5FFMA 3DB2A 1XTBA 3Q0IA 3F7OA 1V35A 4FB5A 3B1XA 1NI3A 1M75A 1NJGA 3EMVA 3AVVA 2IPNA 2ZYUX 4EW6A 5BQOA 1H6DA 4COKA 1GD1O 4LGVA 2X22A 4WINA 5MDHA 3OPYB 2WICA 4JN6A 5K4AA 1G20A 5BN5A 2WUDA 3S70A 1G7TA 1K66A 1YBAA 4HAYA 1W44A 3HE3A 2A6PA 2F4VB 4XSVA 1EUQA 3KX2A 2Z6AA 3VNSA 3C8UA 4GKJB 2H4JA 4LCEA 3C6BA 1QFXA 4PG4A 1W7AA 1PWEA 2VBGA 3C9PA 4ZPJA 2PSJA 4OH7A 3SZUA 5LXTF 4BMDA 3LW7A 3NP9A 4TYNA 1OLUB 4YAOA 1NAHA 1ULSA 1JAYA 1WVGA 2ZUFA 5K0BA 1KO7A 6NULA 3GFSA 1W49A 2BF4A 5TJHA 1NULA 1T1IA 4L0MA 3M6VA 4C0WA 2KBEA 1VLJA 3IG5A 5ECDA 3SOZA 3OETA 1YE8A 3KKZA 1W1WA 3KQWA 3NPAA 2WJVA 4DSZA 1XZAA 4EO9A 2VFAA 1F38A 1UBGA 1QYDA 5J4VA 1Q92A 1MC5A 3JYPA 3O9ZA 2QTCA 4IDEA 5AM2A 3VBEA 4CGYA 1S0UA 4V0OA 4B6FA 4B85A 2G07A 5FR1A 3QELA 3RBZA 2FLVA 4JIGA 4HL6A 1IQUA 2J9FA 2H1HA 4KRYA 2GUGA 2WFMA 1DV1A 1W6UA 4Q4CA 1F48A 3THXB 4DG8A 5D1NA 3NBKA 5DOVA 2YHSA 2ZRIA 4DCSA 1A4RA 2F3SA 4QJ5A 1RKUA 1G6OA 1G7SA 3KK0A 2H18A 4DJEC 1R0WA 4OHXA 2VQEB 1YB7A 1N3YA 3BMCA 1C0PA 4BIIA 5CTJA 1SA0B 3DZJA 4DNXA 4RKFA 1I1NA 5KWIA 4RHXA 4RA9A 4RV9A 3BERA 2JASA 2KMLA 3BIXA 1QOZA 2Q4DA 3OJFA 4BVBA 2F3RA 5C8VA 5JSZA 2NVUA 4UAVA 3WLRA 2WIDA 1W48A 4N82A 1A2KC 1Y48E 3MGAA 3R7NA 1GUYA 1ULTA 1L7DA 4I1RA 4UUQA 5EUCA 5CDGA 4ZQFA 4JUIA 2NT3A 3IQWA 4L07A 3UJHA 4G1VA 5KVVA 2RBKA 2ZTUA 3INNA 5HZGA 1AUXA 4S1OA 3RB8A 5B57C 3BDVA 3SHFA 2EIXA 4WOPA 4JGGA 4NC6A 1SQFA 2ZBPA 2B1QA 3HRKA 4FDLA 3ND9A 1O08A 2DSNA 2VUHB 2BI7A 1F1JA 2ZJBA 3IAEA 1U7OA 4NNOA 1A8PA 4DT1A 4IMRA 2OHHA 1EP1B 3UICA 4EZBA 1C4KA 1R4NA 2VCYA 1D1SA 1GZ3A 2AX4A 4TMXA 1LTKA 3H18A 3ZQJA 3PTAA 3AYZB 3GLGB 3HP7A 3JZIA 4I9FA 3ODGA 3KR1A 1K7YA 1PZEA 4P17A 2QRHA 3V6MA 4RFSB 1UAYA 1RLMA 3D6TB 2XVZA 3Q9LA 3STWA 1IBLM 5DKFA 1BAPA 1GIAA 2VDQB 1XJ0A 3GFOA 3GJ0A 3IURA 3G5LA 3I2IA 1XXHB 3RNLA 5HZHA 1M6VB 3QF4B 4PG5A 4Y3UA 3TAXA 5JD6A 1EDZA 5CJJA 1EVYA 1CQJA 2JIBA 2A3RA 3F6YA 2X2EA 1DKUA 5J23A 2PZLA 3NCHA 1CU1A 4B32A 1BMFA 4QODA 2NU9A 3IVXA 2C1EA 2OZKA 2R00A 5SICE 1Z0AA 3TAHA 3ZBPA 4WADA 2QTHA 3ESAA 1E2KA 3MQ4A 1S2IA 2LTAA 5HJEA 5FTMA 3HDTA 1Z5BA 1A5ZA 4A27A 1VOTA 3EZ2A 1XD8A 4KHPB 1C9JA 2WB4A 5JYEA 3REOA 2PR7A 3DWFA 1QF7A 3FUTA 2PA0A 1NDHA 2PD6A 2QXTA 4K6HA 2F3UA 5DHQA 2EJBA 3N8DA 1AHHA 2AYXA 4RPHA 4KPFC 4MR8B 4TQGA 4IYJA 2PVCA 1HBJA 1R6VA 1E1MA 3AGQA 1K7FB 3O94A 2WVHA 3VU9A 2WKQA 3ZI7A 4MA0A 3CLRD 4TL8A 1ONBA 2AG0A 1BKYA 3DLBA 4XM1A 1PJCA 2GVDC 4ABTA 2IK8A 3T3MB 1O0BA 4B82A 4QREA 3ZU6A 5CVTA 2QMQA 1UEXC 5AOAA 3RRFA 2PANA 3U2QA 3CLRC 2UV8A 2HU2A 2LCFA 4OQXA 4UBKA 3UBMA 5ALWA 5IN4A 1QSGA 3DMNA 4C4PA 5A0TA 5LZ5A 4DCPA 1DRKA 4RK0A 3W7VA 5AJXA 1JMVA 5EHGA 4EMSA 2PZKA 2H52A 5AVUA 3FPLA 5FWNA 4FW8A 3U81A 3ND5A 3DL2A 1S3FA 2IP1A 1UBEA 3RSQA 3Q40A 2BDTA 4BFXA 1OGJA 3LPDA 3WRWA 4DGSA 1XNHA 4J7UA 4HX5A 3K72B 5LFAA 3E15A 4Y7CA 1Z4PX 3FLEA 3UY4A 2VDMB 3TB4A 4OAPA 1IAQA 3TNYA 5A03A 4J0CA 1I2ZA 3IP8A 1D2EA 1D2AA 2EFHB 3HXLA 2XXBA 3O3OB 1LVGA 3K0AB 4R2HA 2KHZA 3M5DA 1JEDA 2WVGA 5C4IA 3B52X 5J1SB 1N2GA 3FDXA 4ZFNA 4PGAA 4Y6RA 2PXCA 3LVQE 3V00A 1EZZA 2F1JA 4R9SA 1OFIA 1EIWA 4URUR 1VKHA 1D8AA 1NBWB 4K1LA 5KYUA 4Q1FA 2VLIA 2G80A 4F8EA 3LQFA 1GGFA 4RAQA 4J3FA 3ZD9A 4L4ZA 2H2DA 3PEFA 1ZIXA 5AKKA 3ZGOA 3DZFA 1PSWA 1MV5A 4INAA 4K9MA 3OECA 2DZLA 1N5RA 4YT2A 1IUOA 5FTNA 4FWTA 1J0CA 4TS9A 3R5XA 2AZDA 3RI3A 4UFPA 1C8KA 9GPBA 4QUBA 2OAGA 4HB2A 2Y1DA 2WHPA 2XEPA 1JVNA 4D9NA 3VNQA 4QPNA 2FZKA 2XUFA 5CLFA 2QMUA 5FWYB 1QC5B 2VPTA 1LDNA 2JBWA 3AKZA 1ZJ6A 4QU5A 1CB7A 9LDBA 1EVKA 4WZAA 2W71A 5FUVA 2QPAA 2WMDA 1OKKD 3WSWA 5H1YA 3BXXA 1BMDA 1W4RA 4REQB 4OJQA 3LX6A