1NV9A

Hemk, apo structure
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
270
structure length
264
Chain Sequence
KIWSLIRDCSGKLEGVTETSVLEVLLIVSRVLGIRKEDLFLKDLGVSPTEEKRILELVEKRASGYPLHYILGEKEFMGLSFLVEEGVFVPRPETEELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFKEKFASIEMILSNPPYVKSSALFEPPEALFGGEDGLDFYREFFGRYDTSGKIVLMEIGEDQVEELKKIVSDTVFLKDSAGKYRFLLLNRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemK protein
publication title Structures along the Catalytic Pathway of PrmC/HemK, an N(5)-Glutamine AdoMet-Dependent Methyltransferase
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 88
structure length 264
sequence length 270
ec nomenclature ec 2.1.1.297: Peptide chain release factor N(5)-glutamine methyltransferase.
pdb deposition date 2003-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
A PF17827 PrmC_N PrmC N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1nv9A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nv9A02
4QPNA 5FWAA 2ZBRA 5IH3A 1HMYA 3EVGA 2XYQA 4PGGA 1G60A 5DTMA 3DLIA 3LKDA 4QQNA 5EKUA 4M7RA 3TFWA 1QZZA 4R05A 1ZGAA 4JXJA 2WA1A 5CCXA 2IFTA 3UJ6A 1AF7A 4FP9A 2PXAA 3WSTA 3HTXA 5D1NA 1ZMWA 2YXEA 3A27A 3UJCA 1JG4A 2YUIA 3I58A 5DX0A 4K6MA 2BWBA 1RJGA 5EEHA 3PT9A 3G5LA 1VIDA 1N2XA 3UZUA 3O7WA 3VC1A 3GRUA 1EIZA 4HH4A 5DM0A 2O05A 3MTIA 3M6UA 4X60A 4QTUB 1M6EX 2VS1A 2NP7A 2I62A 3TPZA 5GM2A 2PT9A 1TW3A 5IKMA 4GF5A 3FTEA 4C06A 5H02A 2ZCJA 1XDSA 1AQIA 3I53A 2JY5A 1NKVA 2DZLA 3K6RA 2PSSA 1WR1B 1VLMA 3HVKA 5EQJB 3G5TA 4YMGA 3LPMA 3VC2A 2XVMA 1YZHA 3NW9A 2GB4A 4G3OA 3HVJA 1KPGA 1VPTA 1XB2B 5KVAA 2ZZMA 3KPWA 2GAFA 4E33A 4AX8A 1KYWA 2C7PA 1HNNA 1O9GA 1NT2A 3KQVA 4A6DA 3DTNA 3VYWA 3HCBA 1MN3A 1N7IA 2ONZA 1HT1E 2AOTB 2EKFA 4OA5A 5GOZA 2AVDA 2IP2A 1I4WA 5DFLA 5ICGA 2QSFX 5EG5A 5C1IA 3TM5A 3CCFA 3NDJA 4YUXA 3GLHE 4POOA 1QAOA 2UYHA 4HGZA 4AUKA 3MB5A 1VG5A 1BC5A 1EQAA 3AY0A 5T6BA 1L1EA 2MROB 3JWHA 2PV0A 2P3LA 4XUEA 4GEWA 3OU2A 3OCJA 4UOEA 5DM4A 2FHPA 2ZULA 2FCAA 4Z2YA 4C03A 3TKYA 4E2YA 2GLUA 2BH2A 5F2NA 4FS8A 1RI4A 5T64A 3GDHA 3FUVA 3PFGA 3HCAA 3UA3A 1QAMA 3CJRA 4GOND 3KPVA 2C7OA 2JY8A 4EK9A 1KP9A 5E2BA 1F4IA 1NW8A 2VDVE 4PIPA 3BBZA 4M38A 4PYLA 2MJ5B 2PX2A 1XJ5A 4F86A 3SGLA 5DPMA 4X63A 2YVLA 4QQKA 3A4TA 2IH2A 1KPHA 2OKCA 4PYOA 4QTTB 3FRIA 5EHIA 1WGLA 2CWBA 2PBFA 3G8BA 5ERGB 5LR6A 2JHCA 4FSDA 1XTPA 2FK8A 1RI3A 1RJFA 2IIPA 4MTLA 4ER0A 2OOAA 3H2BA 2KNAA 3CJQA 1H1DA 5HIIA 4RVFA 1SG9A 1P1BA 3JWJA 3KPJA 2LTUA 5CVVA 4YUZA 3DP7A 1MHTA 2R0IA 4F84A 3Q87B 5K8VA 3AWIA 4QVKA 5FCDA 2AOVA 5K01A 5E1OA 4PCLA 2AOUB 1Y8GA 3UJDA 2EKKA 2YXLA 4KWCA 2QNJA 2V7EA 4FT2A 1IM8A 1JSXA 3JWIA 5K0EA 1F3LA 3EVAA 3CC8A 3ID6C 5T67A 3AXTA 2I9KA 2NXEA 5DWQA 3TM4A 2DAIA 2O25A 1TPYA 4U7TB 1XCJA 3DR5A 4MQ4A 4KRGA 3FUUA 1ZMVA 3V97A 2VZ9A 5CIYA 2GPYA 1X19A 1PRYA 3C6MA 5DSTA 1AIPC 4R6WA 3IECA 3IHTA 3OZSA 3BZBA 1G38A 2ZW9A 2CP8A 4MWZA 2NNWB 3B3JA 3E05A 2O06A 2Z6QA 2P3QA 3UJBA 3PVCA 3FYDA 3NMUF 3BWMA 3SXJA 3KQWA 3FPFA 2JP7A 1KPIA 3OU6A 1L3BA 2O07A 1V39A 4GC5A 2AS0A 3FTFA 5FTWA 5DTRA 4C08A 3QOXA 1P91A 5FHQA 1NV8A 4E30A 4PYJA 4GQBA 1VP9A 4PYKA 2LVPC 5HILA 4RTLA 2ZFUA 3KPUA 2HWJA 4R6XA 2ORED 5FWDA 1ZG3A 2HMYB 4O29A 2PKWA 1O54A 3EVZA 3FPHA 3BXOA 3PLAE 2Q41A 4M36A 2O0LA 4WVLA 3JWGA 4OQDA 5LSAA 1NBHA 1WJ7A 1RJDA 4P7JA 5KS2A 2QRVA 3E21A 4YMHA 2VDUE 5BP7A 4RVHA 4HG2A 2P35A 2BWEA 2V74B 2CWWA 3BGVA 3LDUA 1KYIA 2OO3A 3PX2A 4E2ZA 3LL7A 4ER7A 4RTJA 5DSXA 2YX1A 2BR3A 5LQRA 4DZRA 1T43A 3PS9A 3GU3A 3G89A 1P3QQ 2RRUA 4X61A 3EEOA 4CWAA 2P7IA 4P7FA 3SX0A 3T7RA 1Z3CA 3FUTA 3RW9A 1XXHE 3MGGA 3HVHA 2GH1A 3G2MA 2LVOC 3D2LA 3HNRA 3R6TA 4C4AA 2IH5A 2LVQD 3QV2A 3OFJA 5DM1A 3TRKA 4P7KA 2OYRA 1DCTA 1HQYE 1ORIA 3CGGA 1WIVA 5LQAA 2BM9A 1B42A 3FE3A 5D1HA 4KDCA 1JG1A 3GGDA 3OU7A 5DX1A 5ICEA 2NP6A 3A25A 2MGWA 4PGHA 1ORHA 2FRXA 2PVCA 2B25A 1UWVA 1TTEA 2KNVA 3GCZA 3ELUA 3UJ9A 2HNKA 1JR4A 4F85A 1WG8A 2K9DA 4OA8A 5E1MA 2UYOA 4RTQA 5KQSA 2PY6A 3P9CA 4CTKA 3HEMA 4RTKA 2XYRA 4KIFA 3SSNA 4EMSA 4IWNA 10MHA 2IGTA 4XUDA 2PLWA 1MJFA 1Q02A 1EG2A 4GEKA 3VSEA 2OXTA 3FUXA 5FUBA 3SM3A 2JY6B 1OTRA 4P58A 4RTSA 4IV8A 3TR6A 3EMBA 5K0FA 4PNEA 2O57A 5HEKA 1DL5A 1ZHFA 4E31A 3LDFA 3HCDA 3NVMB 3F4KA 3UA4A 2A14A 3ELDA 3T0IA 1EAMA 5K0BA 5JI2E 1T6OA 2UYCA 1VDLA 4MIKA 1G3IA 4PYIA 8MHTA 5CD1A 3B5IA 3DOUA 4WXHA 2EJUA 4AZSA 3HA7A 4HTFA 2AN3A 2L2DA 2LBCA 2H11A 3HM2A 4OBXA 3DH0A 3X0DA 4RVDA 3LX6A 3K9OA 1JG3A 3P97A 1OQYA 4L7VA 5EC8A 3C3YA 3U81A 1DO2A 3GLIE 2G70A 2XYVA 4CXMA 4ISCA 1G8SA 5FA5A 2Z6UA 5ICFA 3FPJA 1FBNA 3DUWA 5DX8A 4KDRA 3L8DA 3NJRA 3G2QA 3GLFE 5G02A 2OO9A 2FYTA 1L9KA 1DUSA 4QDJA 4QDKA 5EZQA 1Y8CA 1IXSA 2ZLBA 1G6Q1 1C7YA 5HIMA 5P8WA 1IXKA 4ER6A 5EIFA 5LQJA 1KXZA 1R18A 1V92A 1AV6A 1FPQA 3K0BA 4AZTA 5DXAA 1VEKA 1SUIA 3MQ2A 2CKDA 1JQ3A 3DLCA 1O9HA 2ZIEA 3LCCA 4FGZA 5F2OA 1IY9A 5F2KA 2KNZA 1UFKA 3A26A 4IKPA 2EX4A 1QYRA 4WP2A 1IM2A 3LSTA 2AVNA 3Q7EA 5HIKA 2PJDA 4ER5A 3FTDA 4BP1A 4Q7JA 1X1AA 2DULA 4FSXA 1R4GA 4P7GA 3KQMA 3MCTA 5HFJA 1YUBA 4A6EA 4C07A 3S68A 4YV2A 5EMMA 2P40A 4BLUA 4GBED 2KW5A 3GXOA 5GIOE 4RTRA 4RYLA 5FADA 2FPOA 3HA5A 1X1BA 2NXCA 4UN2B 3ER9A 3LECA 5EOVA 2HTEA 3MAGA 5HOQA 1RI1A 3FZGA 1DV0A 4CTJA 3FUWA 1NW7A 3C6KA 1SQGA 3G88A 2BR5A 2WK1A 3MHTA 2QE6A 1NE2A 3GO4A 1Q0TA 2ERCA 3KR0A 3R9XB 3LCVB 2E5WA 5KQRA 2AOWA 2HWKA 4E2WA 3DULA 1WS6A 3M33A 2ZWAA 2H5XA 5JUWA 4KIGA 4BLVA 3RODA 2JNHA 4ATNA 2ZVJA 3DMGA 3B7PA 3UJAA 5CVEA 4OX9Y 2EJTA 1BOOA 1RI5A 1BVSA 2ADMA 4PCAA 2AN4A 2NYUA 5FHRA 4RX1A 1NW6A 4BLWA 4M37A 4R71A 4XUCA 1JR3E 1GO5A 1BKYA 2WZJA 3CJTA 4DKJA 1UFZA 4CKEA 2PGXA 9MHTA 5DRYA 2OB2A 3OE4A 3I5UA 3IYLW 3H4JA 2G3QA 2JY7A 4F2LA 4G56A 1SQFA 2IBTA 5CVDA 5EMJA 3A7DA 3GNLA 1JQDA 3DMFA 3P2KA 2G72A 3ANXA 3KHKA 1I1NA 4YUYA 3FYCA 3KR2A 1QZEA 3GIWA 3ELYA 4PONA 1INLA 5CUQA 1UIRA 2K0BX 3TOSA 3G7UA 3EVBA 3BT7A 4KVZA 5LQUA 2PXCA 2ZTDA 2N47A 3BKXA 4C05A 5GWXA 4HTFB 2WA2A 3GJYA 3ER8A 4DA4A 5DLYA 2YTZA 2XBMA 4ZTBA 3PX3A 4PINA 4GOOD 1FJXA 1L3CA 3QOWA 3PB3A 3E23A 5EZSA 3IV6A 4DCGA 3KU1A 4KW7A 2DAMA 5KYGA 3DXXA 3GRZA 2BR4A 4FR0A 5CVUA 3UJ8A 2FK7A 3GRYA 5E8RA 3KQYA 1YB2A 3RIEA 1KHHA 4R8SA 3UJ7A 5C9ZA 5K0GA 1OKSA 3P2IA 3R0QA 3CVOA 3E8SA 2EJSA 5EMLA 2VP3A 5EMKA 1ZGJA 5BXYA 1TW2A 4H0NA 1VL5A 4NECA 2JHAA 2K4MA 1U2ZA 2G71A 5DXJA 2C7RA 5LQCA 3DXYA 2YXDA 2GA9A 3EGEA 3F92A 4GOLD 1XDZA 3EGVA 2OB1A 4PYMA 2PWPA 3KQOA 3OZTA 2QYOA 5C0OE 2YQZA 1OAIA 1WZNA 2IPXA 3R3HA 2AZTA 2JG3A 1VQ1A 1NW5A 2QY6A 3A7EA 1VBFA 4E70A 2B3TA 3E46A 3THSA 1A5TA 3R24A 3REOA 2JH8A 1QAQA 3HCEA 1WXXA 5DM2A 3HP7A 4F1IA 3GRVA 1VEGA 3M6WA 4IV0A 2AOXA 4OBWA 2HAKA 5E8JA 5K05A 3C3PA 3E7PA 3BWCA 1JTFA 2DENA 2ZIGA 5K0LA 3KR9A 3BGIA 1KIAA 4CKCA 4HC4A 3LCUA 5FULA 3KR1A 4BY9E 5BW5A 1JG2A 2AOUA 1L3IA 3AXSA 4GUAA 1KYZA 2QHOB 3KQPA 3KQQA 4LG1A 4B17A 3IEIA 5CVJA 5DT2A 3EVEA 3P9IA 2OBFA 2BM8A 1NW3A 4X1OA 2NXNA 3CBGA 3EMDA 1P1CA 1SKMA 3EVDA 2EG5A 3GLGE 5E2AA 2KHHA 3V8VA 1QANA 2Z6AA 2DPMA 2IDJA 3NTVA 2F8LA 5EKXA 2JZ0A 2PX8A 2GS9A 2IH4A 3MCZA 3BWBA 2DHYA 2I6GA 1SUSA 4FT4A 2DKLA 4GOMD 2G8NA 2ONYA 3KQTA 3EGIA 2OPBA 4XCXA 4YUVA 4RVGA 3P9NA 1EFUB 1RI2A 3SMQA 5CM2Z 3LHDA 4U7PB 2BZGA 2OZVA 2H00A 3P8ZA 2MR9A 1PGYA 4DF3A 5E1BA 4RV9A 5M5BA 5E9JA 3PFHA 3TMAA 3C0KA 4DQ0A 2PX5A 1OR8A 5E9QA 4PWYA 2YR0A 2ZZKA 4PYNA 3AJDA 2JZ1A 3ERCA 3ORHA 7MHTA 4X41A 2ZIFA 1PJZA 5GINE 3M6VA 3EPPA 4AZVA 3SSMA 5EGSA 4EVIA 3MMPA 4EQZA 5BW4A 1IFYA 4RTOA 1EJ6A 1D2GA 5K0CA 4E32A 4E2XA 2DAGA 2ZTCA 2Y1XA 2PX4A 3K9PA 2QRVB 3ELWA 2L4EA 5EIWA 4MHTA 3IHPA 3EEYA 1E94E 1VEJA 2PWYA 4Y30A 1DO0A 3B3FA 4R8RA 1FP2A 5FA8A 1WHCA 4YUWA 3KQSA 1XDUA 5GP1A 4RTPA 1XVAA 3P2EA 1WY7A 4RSRA 2NXJA 1YLAA 2QM3A 4YV0A 5E9WA 3SVZA 5ICCA 3PTAA 3MTEA 1N7JA 1R00A 3M6XA 2DNAA 2LVAA 2CMHA 4QPPA 4FZVA 1TR8A 3DMHA 3FPEA 3UWPA 4BP3A 1VP3A 1KR5A 3G2OA 4CKBA 2B9EA 3T6PA 3HVIA 2ZTHA 1JSZA 1R6AA 3P9KA 1ZV1A 1XCLA 2HV9A 2LD4A 2P41A 3EVCA 3OE5A 3SSOA 2ESRA 3FRHA 2I7CA 3FTCA 1ZKDA 3KPYA 4HGYA 1Q0SA 2ZZNA 5FQOA 1I9GA 5CCBA 2DI0A 2Y1WA 4RTNA 2DAKA 2VDWA 4GC9A 3TQSA 2CL5A 5DRTA 1SVUA 5EHGA 3G8AA 3G2PA 5E1DA 2EFJA 1R8XA 3BUSA 5HZMA 2ZWVA 5LQKA 2ZBQA 1M6YA 1R8YA 1HJPA 4C04A 2OOBA 2JJQA 5HIJA 2PXXA 4V0QA 5K0JA 3DXZA 4QVGA 3HA3A 1X1CA 4HEOA 1YFJA 1AQJA 5LQNA 4Y2HA 5K03A 2DAEA 4PIMA 1D2CA 3NWEA 2R3SA 1NBIA 5EVJA 4RTMA 4PYQA 1BHJA 5GIPE 5JR3A 1R74A 3I64A 4LWPA 3M70A 1YFLA 1F38A 4DMGA 1NV9A 1EJ0A 2HR1A 1G41A 2C7QA 3LDGA 3LGAA 3O4FA 3T7TA 2UYQA 1WGNA 4LWOA 4EKGA 3FPGA 3I9FA 2AOTA 2JHPA 2B78A 5MHTA 3LBFA 3EVFA 3BKWA 3BWYA 4AZWA 2L4FA 2UZ4A 1D2HA 2CMGA 3M4XA 2P1DA 2AN5A 1JQEA 1ZMUA 3NVKI 3OPNA 3CKKA 5GM1A 1WXWA 1G4AE 5EEGA 4LECA 3GRRA 4HRAA 3LBYA 1G8AA 2LVNC 3HCFA 3MERA 1CUKA 2P7HA 2PT6A 5FQNA 3KKZA 4DM3A 2OY0A 3OFKA 1M0EA 1X1DA 4DBGB 2G1PA 3THRA 3NWBA 3BGDA 4HSGA 3GWZA 1FP1D 1VE3A 4RWZA 2IBSA 1G55A 2JUJA 5B1SA 3B89A 2R6ZA 3SR4A 2ZSUA 3HCCA 3TKAA 3P71T 2ZBPA 1ZQ9A 2AR0A 3B3GA 5K09A 4YV1A 2JH9A 2IDKA 2P8JA 4DCMA 3TLJA 1P39A 3OZRA 4EKIA 1JTEA 3T7SA 1YF3A 3UFBA 4ER3A 3ME5A 4OQEA 3NDIA 4V0RA 2XVAA 5U4XA 3O31A 2P3OA 2B2CA 3LKZA 5K0NA 2H1RA 5DTQA 1RJEA 1YZ3A 3UBTA 1XXLA 5EPEA 1HT2E
chains in the Genus database with same CATH superfamily
2OCAA 5FI5A 1PFUA 3H5RA 1WY5A 2Y68A 3TQIA 3RS8A 4NFLA 1S5PA 2GXSA 1YJ8A 5GMOA 1M2EA 3IP9A 1C7JA 1NQTA 8LDHA 2Y8EA 2C4UA 5JXWA 1RHQA 4KO8A 3HSYA 3TNYA 3HDYA 4BLSA 4YR9A 2YV1A 4CKBB 3AJRA 4WXMA 3AHFA 1L1FA 1P1KA 4NESA 3RROA 3R7NA 3U4AA 1SELA 4PBRA 1LZLA 3IKMB 2AEFA 2F1OA 5CPBA 1P9LA 3FPSA 4XKJA 4N41A 1X7ZA 1YA4A 3IMFA 1U5CA 4PRYA 5HE9A 4Z4CA 1P9WA 3AUAA 1ZMWA 1MC1A 3P9ZA 1JFLA 2AGVA 1WW8A 3LQ2A 4K6MA 3Q3CA 1R8JA 5JT1A 1QG2A 4PLZA 1ZOSA 2XMQA 3ICEA 2WFAA 1ZI9A 3Q8MA 3JRWA 3GBVA 3GRUA 1M10A 3T61A 3NB0A 3F71A 4GVPA 2P30A 4N6NA 3COSA 1WW2A 4O4LA 3IXLA 3BIWA 2B8NA 3K70D 4A0RA 2XF8A 3EFOA 5H1YA 4N6GA 1XDSA 5F7OA 3NETA 4LC0A 5AUQA 1ZFNA 5GONA 4WOKA 4FPXA 4RH3A 2C2XA 1WMAA 1XQYA 3KB8A 1BX3A 1PDOA 3B85A 4UASA 4DUGA 2N75A 3DEFA 1OYYA 4Z0NA 5K6AA 3WRXA 2OG1A 4EBBA 3KC2A 3VVBA 4L9WA 1WMBA 2OBYA 5K3AA 1W49A 4AX8A 4EELA 4TWJA 3GP5A 3HU3A 3KQVA 3HN2A 1QDRA 3RTCA 2AOTB 2XRZA 1XPOA 5BT9A 2ORYA 1DWUA 4OA5A 2ID9A 5C1IA 4QX6A 3DMNA 3AMVA 2XT0A 5CB4F 4Q3OA 3EIHA 1TJPB 2AZ4A 3C74A 1SC6A 3TD2A 4AB1A 3PICA 1K7SN 1U0OC 1JWLA 1MABA 3OU2A 4Q3DA 4UOEA 4JX8A 2PA0A 3Q2IA 3JQRA 2VO1A 4BTVA 3PA8A 4BNVA 3KS4A 3VH2A 2R7KA 5F2NA 3K0CC 4FS8A 2VTBA 1ND5A 3PFGA 1SIWA 4IMRA 3TEMA 3LFTA 4JSYA 1Y1LA 3EC7A 1DLIA 3EY9A 3LC0A 4DABA 3ZK9A 2AT1A 3KYCB 1S3FA 3L7KA 4D0NA 2OFOA 4KPUA 3L3BA 1G18A 1J21A 3DZJA 2IH2A 1KPHA 3CX3A 1ZMBA 5DNVA 4MB6A 3ONFA 2WDZA 1IONA 2W8BB 2QN1A 3EYWA 4HLQA 4J3JA 2BISA 1QGUA 3IHKA 4ER0A 4HDRB 1KKMA 5LQMA 4JGBA 2HD4A 4Y2SA 1XTJA 3VAAA 4NOMA 3NHMA 4XVQA 2KW0A 3S8YA 3U3KA 3G23A 1MHTA 1AK2A 5K8VA 1AZTA 1Y8ZA 3DKPA 1YI8A 1OBCA 1YOBA 4HZIA 5DYIA 2WFMA 2W6OA 4B2PA 2YXLA 4G4NA 1ZC3A 2JIZD 1GV0A 4QODA 4G1CA 3HKCA 1GAEO 1FSGA 2ZJ8A 2J09A 1SVIA 4NNJA 1WNFA 2G07A 2DAIA 5DWQA 4JP2A 3ZU6A 1X7ZB 2AMLA 3QA3E 1TAUA 1H85A 4BZZA 1UKEA 1L6IA 2RG7A 3OT5A 2F5PA 3MGBA 3K0CA 2YJ3A 2GXUA 4FYJA 4B8YA 2OLKA 4PX5A 1KH1A 4KSCA 4AQYM 4BO0A 3UJBA 3VKVA 2WYHA 4ZOLA 3WFZA 3SXJA 2JP7A 2OM2A 3L6EA 3OU6A 4I50F 1TDZA 4GRAA 1WPGA 2NNLD 4G8CA 3E81A 2I7DA 2FPLA 5CNKA 1Z33A 3ZHUA 1RZ3A 1GTSA 2ZFUA 3DEYX 3MYYA 2HWJA 1ZD1A 1F9AA 4EGJA 3TGPA 4KXWA 3GLHB 2PH7A 2HA2A 5DDIP 1K63A 5CB6A 1XTVA 1QB8A 3LXMA 3CPHA 4UEWA 4PNPA 2NU8A 4OX9B 5IZ4A 3WZ2A 1K3TA 2V55B 4P3PA 2V74B 2QLJA 1T0IA 4AP6A 1VCMA 3CW8X 3PC8C 5AW2A 1CYDA 4TTTS 3F9IA 1WABA 4IBEA 1YZQA 2W2KB 3GXBA 1QH8A 4ER7A 4J1NA 4FDVA 1I5OA 5KWJA 1MG0A 2YHIA 1C4OA 2IIBA 1X7GA 5AJTA 2C3OA 5EJ2A 3FGPA 3RW9A 3ZWDA 5LD2C 2R5NA 5IZ7D 1NC1A 2P4QA 2IGBA 1QCCA 3IERA 1U3GA 1XQVA 1HQYE 3WBBA 1QNFA 3WADA 4F12A 3GFTA 4NJOA 3BJMA 1PZNA 1AURA 1BMDA 1JHDA 2VTBB 1NW9B 4ND5A 1PR6A 5BN1A 4IDEA 4PVDA 3SR3A 3GFOA 1QC5B 1P33A 5BW6B 1CDEA 4WVFA 2B4QA 2FKNA 4KPUB 4R1SA 4UCFA 2C8LA 3I4VA 2V6BA 5IM4A 2OLJA 3KBOA 2YY7A 3BX1A 4DCOA 3EGXA 3JWPA 4B3SB 5BOSA 2DPGA 4UTNA 2R4QA 4KFRA 1ZHHA 1LXCA 4RGBA 4MRRA 1JG7A 2Z3XA 1TCVA 1B7GO 2GZSA 2JFUA 3ZCSA 4L22A 3J7TA 4GHLA 4UDNA 1H0HA 4EW1A 4RUKA 3PC8A 4HNHA 4BNUA 1SXJC 2EKZA 5JAQA 4RD2A 2MR6A 1SBCA 1XHFA 5J9FA 4O4IA 1CXZA 3EAGA 5L53A 4JUBA 1ISRA 2C82A 4Q18A 1I8TA 4AJJA 3Q40A 4QL3A 2VATA 1E63A 2G0TA 1XQ6A 1JAIA 1M76A 3HBJA 3CWZA 2L2DA 3HM2A 3HADA 3JZDA 5F7XA 1E0DA 5K3BA 3P97A 1G4UR 4AECA 3GEIA 3GJTA 5EC8A 3LWNA 3RF7A 2XMCA 4E12A 4AUEA 5BMOA 3IG5A 3KOYA 3HFRA 1XMVA 5DHTA 1L8QA 3URKA 4CISA 4X3OA 1RYBA 3K6JA 4NU6A 3JU3A 3CVVA 4URFA 1I5RA 1POWA 3I01A 4H6VA 2OO9A 3K5HA 2VOJA 2C2KA 1MMFB 2NZYA 1TT7A 5D51S 3S2SA 4A92A 4U8HA 4HYTA 3FCOA 2B1RA 2WRZA 1CV2A 3RC7A 3WE7A 1DBVO 4HX5A 1VCOA 1WV1A 2WMOB 1QV6A 1KO7A 1SUIA 4RHFA 3ZHOA 5DGXA 3HB5X 1KE2A 2JJYA 3K9QO 4GBGA 1AUVA 3H2YA 2Q9CA 2XNKA 1FDSA 2WUGA 3FI9A 1GUBA 4LSMA 4I5DA 2JGJA 1YUNA 1N5JA 3DOIA 2ZT5A 2QPLA 2F5QA 4Q7EA 4JN6A 3QX8A 4BNLA 1SXJA 5HFJA 3S2GA 1YUBA 4A6EA 4OXQA 2WPNA 2O8EB 3M1IA 4NKRA 1NQXA 2CY0A 1QH8B 5GIOE 2XQGA 5AW6A 1NR7A 4OB6A 2VWPA 1MAWA 1RIFA 4K6HA 2FUCA 3LE8A 5EOVA 4CM5A 1PZMA 4AG3A 2ZSAA 1P0PA 1NW7A 3U0BA 5KNCD 1SQGA 2LVBA 3RSOA 4YREA 2BR5A 1KYTA 4ARBA 2AUTA 4P9NA 2XSZA 3QI7A 4PN7A 3B7NA 4HQ0A 1GU7A 5JD6A 3MZ0A 3BQNB 5ALXA 3D6TB 4IDQA 5CYPA 5TVGA 1DGQA 3FVQA 4FXOA 5T4BA 2I55A 3UJ3X 2JVIA 1IWBB 3T7JA 1FS6A 3RWMB 3WGKA 2R60A 3DDNA 3G59A 5CW1A 2YW2A 4OX9Y 5JI3E 2X77A 1OUMA 1V35A 5H8WA 5DT9A 3E18A 3PEUA 5LZ8A 2R1TB 4YRNA 2V9ZA 3NC1C 5K8TA 1PI3A 4RLHA 3EPHA 1GO5A 4F4HA 3UATA 4TXJA 4YXWA 1KMCA 2P27A 2LGJA 4C0QC 4I5SA 4XLTA 4EOGA 3B9PA 2IIQA 4KPGA 5AQEA 3HGTA 2OOKA 3P96A 3OE4A 2JJ1A 2GPNA 3BIXA 2ZAOA 2NPIA 4RADA 1ECJA 3HBNA 4D4GA 2WABA 3EODA 1QHYA 3L1UA 1SMKA 5CTAA 2JL1A 5COBA 4H9GA 1S8AA 5FUWA 3ORQA 4KR9A 1XB2A 5HJ7A 4IHKA 1FFHA 4OXIA 1L4BA 2FOXA 5LD2B 2PXCA 3GPDG 3BERA 2WA2A 1AN9A 4NU5A 3IEKA 1E6UA 2IRWA 4J3NA 4RULA 4YRGA 3OQMA 3OM1A 5EKTA 1YHYA 2YTZA 2BCEA 4ESEA 1AK9A 3H04A 5EP2A 1W9MA 2IYRA 2C42A 3NYIA 4PINA 2I78A 4MEJA 1RS0A 1PFWA 2IZ5A 5E7MA 4JI2B 4K28A 1BGXT 1OZGA 3W2FA 1PQ4A 4Z3DA 1O94D 3V5NA 1E62A 3EOZA 5AKIA 5FLYA 4AQ7A 2BT4A 5JDIC 3N5CA 5HKBA 3HV0A 1JEOA 1VL1A 1JIQA 3GRYA 4NJMA 4BVGA 1OV4A 3KQYA 1XVIA 1CIPA 5JO0A 1VHJA 4ERNA 3KKEA 4BLRA 3AUXA 2CJPA 4FDLA 3GD5A 1HDZA 3EEIA 3KAKA 1P77A 4ZVVA 5CDFA 1F6WA 4QYWA 1L1ZA 4P17A 4C5BA 4KMRA 2I66A 3JX9A 3SP1A 1OAIA 1H2EA 4Z9YA 3W8RA 1N5IA 4Q03A 1SXJB 3S7ZA 3HZZA 4YA6A 4NMXB 1A50B 3R24A 2JH8A 1GKLA 4C6TA 3QPVA 4DV5B 3GOQA 5BNWA 1N33B 3GFSA 4R1TA 5GZ3A 2X9NA 4D9KA 3FGNA 1G3RA 1EUCB 3GZ4A 5EE5B 3E7PA 3C41J 3ZOZA 2VQ3A 2B1JA 5CXQA 1B3RA 3NCTA 4DQLA 3KJIA 4GS5A 1RMTA 3EDMA 3MC1A 4P4GA 1MAHA 1N75A 1SZDA 1UEJA 3I4YA 2B7BA 3P2MA 1T29A 5JDIA 1C0IA 4QOGA 1TXGA 4JR0A 5AOAA 1OQAA 1YULA 2AJ8A 3PXCX 3R8FA 2PZ8A 4CIZA 2NTVA 5TXGA 4NV3A 2VTVA 5LMCA 3WKDA 3ZIDA 5EKXA 3JYOA 2Z57A 3FMVA 2ODQA 2B8JA 3E48A 1QOZA 2DTDA 1SUSA 5JZOA 4NPHA 2DKLA 1PJRA 5A9TA 4E13A 5LMZA 3SK0A 2FPKA 2Q7DA 3HGIA 5H82A 1N5RA 1N0UA 2X0IA 3P9NA 5G0TA 1Q0ZA 3ESYA 5JPDA 3AFIA 3U7HB 2X2OA 3L4KA 2X8WA 3LQFA 3LUPA 3NHKA 4NMMA 2FSPA 1Z6GA 3N5KA 3B6KA 3U39A 2EHJA 4BB0A 4G09A 1NVUQ 3TMAA 3OLXA 1HXHA 2WPDA 1FRZA 1PTJC 1CEXA 4R4JA 3AR2A 2OCBA 2BMWA 3SQOA 4JSRA 2W2XA 3JQ8B 5FTKA 3EIQA 1X1EA 3LRXA 4PWYA 4Y2JA 1TA4A 1CF2O 4DA0A 2VRCD 3ANYB 1LNZA 4Y7CA 3QTTA 1E9RA 4UHCA 3EPPA 1FRVA 2FMXA 3R7LA 3QIVA 4V03A 1MB2A 3KSZO 4NS4A 4CODB 1U6IA 4AN0A 1EJ6A 5K3FA 4D9HA 4KGVA 1PJBA 3PZBA 5HBRA 2GBFA 2R8XA 3V2IA 3WHKA 2EBUA 1HH4A 4FYKA 3EEYA 5J5AA 1T3ZA 2I6TA 3AF6A 2M6LA 4NJMB 4K6CA 4YT2A 1J2EA 3TX2A 2WINI 2BGTA 4HFNA 3FOEC 3WK9A 3LZCA 3TR5A 1U2QA 5FDFA 1U0BB 4P2BA 2RONA 1N6IA 4KO1S 3P2EA 4ZDIA 3RUPA 1GGHA 4TLMB 1UQRA 2W90A 2PWAA 2NXJA 2HCTA 1YLAA 1SCKA 2P68A 1E9BA 1YVRA 2HO4A 1YCDA 3KZKA 5BPFA 1ADJA 4S0ZA 4KWHA 5BV0A 4TRNA 4E5NA 4TZ0A 3ZLJA 1JJVA 1NN1A 4TKMA 3VA7A 1EEXB 4NTZA 2IPMA 2PYDA 3OUUA 3ISVA 1Y33E 4ZAVA 3N2GB 3DE6X 3IVRA 1J25A 4M9RA 3FPBA 3QH4A 2KX7A 4IS2A 2HV9A 3BJIC 1Q15A 1DMSA 3EVCA 3S40A 5LKRA 1PTJA 4QUKA 4TL9A 2GYUA 4RDIA 3IT3A 1HE8B 1Z2PX 3ILYA 3I2GA 1SQ5A 1UBGA 1DKRA 3OO1A 2W58A 1ORYB 5KYYA 4M8IA 1NP3A 5TQ0B 4C89A 4YCNA 2OXEA 1D3AA 1V3QE 4DBZA 2PXHA 2TECE 4ARZB 2YQ4A 3HEBA 5A4FS 4W9MC 3R6LA 3ZJUA 3B38A 5LOVF 5KKCA 1RWPA 3DOHA 4EABA 5KBYA 2DH6A 1C14A 5ALGA 3TOXA 3KEFA 4K2AA 2JGMA 5TPZD 1M8GA 3CNLA 4TWIA 2H4JA 1ZCAA 1NBWB 4Y2HA 4MEBA 3MBOA 4UNSA 5IDVA 5L7WA 3WGHA 5A71A 2XT6A 4RTMA 4OK6A 1YE8A 1USGA 3C70A 5AHOA 3VH1A 4LWPA 1UMBB 5JNUA 2TMDA 4K0KM 4TX1A 1ZBQA 4N6OA 2CVOA 3ZI7A 2JDIA 2PANA 3G0GA 3KSUA 3RSCA 3TQCA 4EIWA 3F74A 5HFNA 4Q02A 3PHCA 1C41A 3PWSA 1ZESA 2QQFA 5ESWA 1EUDA 4FWIB 3NVKI 4PSUA 4JL5A 1UOEA 1WXWA 2P9JA 5EEGA 4LECA 3L41A 3LBYA 1B3BA 4A2WA 2UXDB 4I66A 5L6MB 1SG0A 1C0EA 4GU5A 2A4MA 4G65A 4I2VA 1TAGA 5KYXB 1T0HB 1L4EA 4FTWA 4AL4A 3D43A 5FQNA 1H69A 3WV4A 4GGPA 1GZ3A 4B6RA 2G09A 4QU8A 5ELLA 1VE3A 2FCRA 5FUYA 1N5MA 4EHHA 4L6V6 2R9VA 2QVXX 1Y5NA 2J3QA 3E7XA 5ALZA 2JPDA 1ULUA 4OB8A 1GTJ1 5J2UA 3AVVA 2H2HA 4NBUA 3KNZA 1O6BA 3C5WP 1NMYA 3QU5A 4N47A 2VKQA 1LPMA 4CFYA 4FWGA 4QJBA 5EJ5A 1TM1E 4EKIA 1JTEA 3T7SA 3N2LA 3OIYA 4C5CA 2OK8A 1ZUWA 3EW9A 1PV2A 2C2OA 4A0QA 1IMJA 2BEWB 5L3VA 3O31A 5A2GA 1EA5A 4M1ZA 2WMNB 3F46A 3ZLBA 5B1HA 4M7OA 1TTHA 2FMFA 1P4JA 1WO8A 3V8PA 4OP1A 3ZE7A 1QBKC 3ZK8A 4NOLA 4H35A 3DE7X 4RVUA 3W5DA 1JALA 1K0FA 2H2AA 1R64A 2XADA 3ZJ5A 3IULA 2VDKB 1OH8A 1TYAE 1WM1A 2GUWA 3FWNA 3DT8A 4NYIQ 2FLVA 3RKRA 3R8XA 2JH3A 2ZRQA 5ELMA 4E88A 3HY5A 4JBIA 3W6UA 4A8JB 1RBMA 2O2IA 4KLAA 1E1YA 5HE8A 3CKYA 4QRHA 4EVSA 3CZ4A 5AIBA 5KCMA 2V7UA 4ALLA 4ENRA 1IQPA 4BFTA 4BGVA 4KFUA 3IA2A 1AO3A 1A5AB 2BKVA 2CMKA 3A27A 3LBIA 3DVLA 1UEXC 1M0SA 4JYAM 3AGPA 3O7WA 1P3JA 3T5CA 3I23A 2WUEA 4I5IA 2FPXA 4JDPA 1HOXA 4RKYA 4DV6M 4J1QA 4DG5A 3HABA 1EFVA 3QLJA 3IILA 5AM1A 3FTEA 1VOTA 2CBZA 5KVQA 2JIBA 1JBQA 4BUJA 2J31A 3RI3A 5KOHA 1XNGA 3L8MA 3ACBA 2JY5A 4J0IA 3EOAI 1S8NA 4MYCA 3GJXC 2AG5A 2PM8A 5F98A 1J1UA 1I14A 5EQJB 1EBUA 2B1QA 3MIZA 3Q85A 2QRJA 3NGMA 2IHUA 2MHCA 2RGCA 3MT9A 2VA8A 4RDHA 2J5QA 5JXGA 1ANKA 3ENVA 2VLIA 3B9QA 4I4LA 2E4VA 3DTNA 5EIHA 3WBJA 4IIDA 1H1LA 3WL6A 3U3OA 4ND1A 4FNMA 1BHSA 1FEZA 3PDUA 2A33A 3FA2A 1MQAA 4S35A 3PUXA 4NMHA 5CT9A 1E7WA 1EZ4A 1NVVR 3GVHA 2NUTA 3C9PA 4PO3X 1EFKA 5DNCA 1VG5A 4ZC8A 1NBEA 1GILA 3KX2A 5KKNB 2XXBA 2QU7A 4GEWA 1RJ9B 5MN5A 3W68A 3DZ8A 1Z6XA 4HZUB 4LE0A 4E2FA 4KDEA 1CLUA 2PJRA 5EJFA 3BRSA 1HFKA 2Q5HA 4CMIB 4D44A 1PW7A 1C8KA 1NM5C 3LLCA 1DJOA 3PPWA 4IR7A 1SZCA 1A8UA 1XAGA 2Q0QA 1KEPA 3ZVMA 5EYPA 1F4IA 1IJFA 5JMPA 4X5OA 4JLMA 4L07A 3PJEA 1LGYA 1QVVA 4Z9AA 1F3OA 2GAAA 4JLWA 4IQGA 3DWIA 4Z53A 2F4VM 1PIWA 2CL6X 2RHGB 3LF1A 3IEXA 4MTLA 1J5XA 1IBKM 3CF0A 3BXHA 3H2BA 5K1ZA 3HM9A 4KR6A 4RVFA 1LSOA 3I9NA 4LJAA 4YHHM 1R9MA 1X9HA 4RXTA 5C51B 4ZPXA 4B79A 4YUZA 2D2XA 5BR7A 3JQCA 2A7QA 4PSAA 3RBVA 2HK6A 1QZ3A 2A2ZA 2AOVA 3G5AA 3ZWCA 2LXNA 4JBGA 4QUIA 1XU7A 3D4BA 1AUPA 4L72A 5K0EA 5T67A 3GEPA 3AG5A 4X66B 2QX4A 1U94A 3H1EA 2N9UA 1QJCA 1TPYA 3BDVA 4PVCA 5IAEA 2RBEA 1L4HA 1ZMVA 2GSWA 2NZUG 1DC7A 2C98A 3WQBA 1Z4NA 4ESOA 4NEQA 4ESHA 1X7YA 4GRDA 2JGLA 4BAZA 1MNQA 3ASZA 2KRKA 2VUIB 2FV8A 4LXGA 2QE7D 3EW7A 4C08A 4BNDB 3RASA 2VQ6A 4JSTA 1EFVB 1O1YA 1TU3A 4M1KA 1VP9A 1P4RA 2PKQO 5HILA 3V4FA 5KOHB 3D54D 4IIXA 4MMZB 5FWDA 5FI1B 5HZKA 3CLUD 2H8KA 1OZ0A 3RUCA 2XWJI 4JMPA 2O2JA 3M81A 1KEWA 1EEHA 2VQEB 4U4AA 1RJDA 2VT7A 2C1XA 1SD1A 3A4IA 4R84A 3F5FA 2ES4A 1GNQA 1GXSB 4RK4A 2E6UX 1H94A 4RETA 1H1LB 1SUEA 4D8VA 4G8JA 4JBXA 5F1YA 3GU3A 3G89A 2P1RA 4ZJYA 1SCNE 2NUTB 3EEOA 1MENA 3ETGA 2ALJA 4UXHA 3T7RA 1SOVA 3O8BA 4IEEA 4EYOA 4GZ5A 2FWNA 4TPKA 4F9GA 2PQ2A 2LVQD 1PFQA 4PHTA 5CG1A 3GAAA 1QIHA 2O8CB 4AKHA 3VDRA 5BV1A 2IV7A 1JG1A 2OZEA 2VRNA 1MXFA 1DVRA 2MGWA 4AKGA 2X9QA 3BQ9A 1KZ1A 3I3OA 4C01A 1RYFA 4GX5A 3IL2A 1VHTA 1KNXA 1TTEA 4KQIA 1NZFA 3DEIA 4Z9XA 5ILGA 2FGKA 1DEKA 2VN8A 1L7BA 4MQBA 4IG9A 3KL4A 1LK0A 2CNDA 4GI3A 3U1VA 2JFOA 1DKMA 2XBUA 3OCYA 5BV8A 4C4RA 1TKBA 1N8NA 3CMCO 3VV3A 4Z6KA 4GPD1 3BZUA 3G8DA 5C1DA 3ZD8A 3QBTA 3L02A 1OTRA 3D4OA 3Q1KA 4AG5A 1OZHA 4BHTA 2ZBVA 2C5HA 2WU1A 4BX3A 1GEEA 2O57A 5DJ5A 1FNSA 1PVOA 1JQBA 1PRBA 2XW6A 3I6YA 4EUEA 4LRSA 3CN9A 3HCDA 1VHQA 1S2OA 4RD1A 2WW8A 1TQ4A 3R7SA 4B34A 1POXA 3FPAA 2XRMA 4DLYA 3G0DA 4NG5A 4OL0A 5K8LA 1E9SA 2XE4A 3PJFA 2DKNA 2AN3A 3GHYA 4E03A 1S2MA 3OJWA 1L5HA 2XF3A 3NRJA 1VJGA 1XL1A 1UAGA 4ZV9A 1R2YA 1A1SA 2CHQA 2Z6UA 1THMA 3CTMA 3PHLA 4MAMA 1NJGA 3WGZA 5AW3A 4BBJA 4Z99A 2G88A 2AKYA 1X7YB 5EP4A 2FWMX 2IKSA 1J6UA 3K4QA 2DETA 3I2IA 3G2JA 3WWZA 3K9FC 2EGHA 4PX2A 4JJ7A 4JEMA 4B3CA 2BL4A 3KQLA 1DX9A 1LRJA 4TWZA 4RFLA 2ZRIA 3H9CA 1HL3A 2C9MA 1V92A 5CK4A 4B6JA 4NRDA 5TPWB 1WAMA 4AZTA 1QDLB 3PQ6A 1U7WA 2IYFA 1E77A 4BXOA 4JB2A 4N0DA 4IAOA 4FE3A 4QTZA 1Q0UA 1S2GA 5ITRA 4KQ6A 1U4OA 1IM2A 3WL8A 1XRJA 3GT4A 5ADUS 1AUQA 2B5OA 4Q7JA 2PVSA 1C3OB 2VEOA 4RF3A 4KGDA 3F8WA 3IRUA 4LQCA 5JCPA 3V33A 2J0UB 3RKSA 3O4HA 3GXOA 2BI7A 1GZ6A 5FYDA 5FOVA 4FJ1A 2BFCB 1UK7A 2AFHE 1DWOA 2C97A 2IS4A 1XX6A 4KL8S 4NXNB 3DQPA 3RVSA 1MAAA 2NZJA 2XE7A 3VHQA 4BC0A 4O59O 4LYEA 1VPEA 3SNKA 4IXNA 1O6ZA 1JHUA 1COWA 1YTLA 2X1VA 3E84A 4P81A 1A7JA 2J8ZA 4ZVKA 1G8JA 5H3HA 5ALJA 1QTNA 3FKSD 5CT8A 3HP1A 3C7DB 5ESRA 5BSEA 5AVKA 3EGDB 4EAAA 1O9BA 1N8TA 2YDXA 5KTKA 4Q0MA 5LXTF 3EF3A 3TTUA 2FFAA 2IYUA 1JMKC 4KX3A 3FE2A 2JNWA 4L4ZA 1YQEA 1QIFA 2PRSA 4ZYYA 1TMKA 2A5FA 4RX1A 1Q77A 2P9EA 3LFHA 4M37A 4RD4A 2QRLA 3M9LA 3R5XA 2EOAA 3OPYI 4JI7M 3CTWB 2QJTA 4FW8A 1KJ8A 1TMYA 2NX2A 1FSPA 3K2QA 5KJ1A 2PJUA 3DF9A 1CSEE 3VHXB 3I0MA 2XUPA 4D6PA 3RC1A 2DLCX 2HX1A 1UMDA 4LRSB 4L4UA 2GTIA 1AHHA 4DDKA 2B99A 3Q3IA 4YUYA 4W5JA 4FDMA 3ZCRA 1JE1A 4B85A 2GRUA 4UXIA 1D2AA 5JECA 2E3JA 5LQUA 4BTLA 3DKKA 1QGAA 3ZGOA 4MV4A 4TL6A 4R41A 4QUHA 2D0IA 3A9CA 1NNLA 3UWOA 3CH5A 2Z2KA 1B16A 1H6DA 3PB3A 3U6KA 3VJLA 5JY6A 2HLDA 1VCHA 2GPAA 1VMKA 4QOEA 4YYEA 2PPVA 4GITA 4F6CA 1YJAA 1PYOA 2A7XA 1QXSA 1NURA 3ZWPA 4HX9A 3A1UA 2YIMA 3CGWA 4ZKEA 3V2GA 4CCSA 2HU8A 3SF0A 4K8RB 4UD2A 2ECOA 4INJA 5C9ZA 4XUGB 2OO5A 4W9NC 3MUOA 2WP0A 3OZWA 4IBFA 3HBAA 3PYLA 2DPXA 2A0KA 2D7EA 3VU0A 4DSNA 4X54A 4QJ5A 3QBJA 4BXOB 2QL9A 1SQSA 1F17A 4JA0A 2WU8A 1CB7A 3A0UA 4GQAA 4C3VA 4YC7A 4BVAA 3JVUA 5C0OE 2W8BA 1ENPA 2JFBA 1S7GA 3GFBA 3QXJA 1Z2EA 2CXQA 2ZBEA 2NADA 3BD8A 1RXIA 2N35A 3BBPA 4HDRA 4D5GA 4QFBA 4HBGA 1XCBA 2X5NA 4RVNA 5FPTA 5IF3A 5LMUM 1E32A 1JTFA 4UUQA 2ZIGA 2DWCA 1KRWA 1YR8A 2X58A 3WO1A 3LCUA 1PGJA 1HSOA 1TM7E 1AA6A 4ZREA 2PZAA 3PQ3A 1MXHA 4JODA 3NIFB 2QXUA 3N2KA 3IEIA 4RNCA 2ZXEA 4NMLA 2HHHM 4QUBA 1H5NA 4N01A 1WMEA 4KR2A 5K3CA 4PDIA 4HWRA 1QHNA 3ZLVA 4WLUA 4L5BA 3MSXA 1GPKA 3OM8A 3ZIAD 2XV1A 1QZXA 2W2OA 4JAVC 2GEFA 2WWGA 2CLLB 4GDMA 4W82A 4PFSA 4HH3C 1UEIA 2GBCA 2IH4A 4RJKA 1AVTA 1NAHA 2BZ1A 4IFIA 1Q44A 3NHJA 4QHSA 3OESA 3JAMS 2FEPA 4JOQA 1FPMA 4IDAA 1JXOA 2HEGA 4P16A 4PZCA 1RI2A 2KQUA 5MF6A 2WUFA 2QZSA 1XK7A 3ZEIA 4F6LA 2MR9A 4WXRA 1D04A 5D3KA 3GLHA 3EIOA 4UULA 1G17A 3PFHA 4NH4A 5KZMB 2DVMA 3EAQA 1UMDB 3GEDA 3NUGA 2RHWA 4OUKX 4L6AA 4Y67A 3LHSA 5FTNA 3HY4A 1WCXA 2J9RA 4EPVA 4KK4A 4XDZA 4B5LA 3E3OA 3UNXA 1GGKA 2E21A 1QQTA 4J7AA 2K5UA 4PYNA 3OECA 3U3RA 3OKCA 2PV7A 4FONA 4LBYA 4YXFA 3TNJA 1ZGZA 3RAJA 5CIQA 3KJXA 2W2KA 3IUBA 2R46A 1C9MA 4DLPA 2EX0A 4EZBA 2PO5A 4B3IA 1JE0A 2ZP1A 2FNAA 5C53B 3AEUA 1Y6JA 2RAFA 2ZTCA 5EP1A 2PRYA 1A27A 3SU8A 4DWJA 3T99A 1T1JA 2UU9B 2ETVA 1Y98A 2JW5A 1TQ6A 4NULA 1A71A 4EB6B 1FX1A 3UV6A 5A2QS 1IZZA 1WVIA 2C20A 2R96A 3MPUA 1BROA 3R5JA 2IZZA 1TQDA 1FTSA 4O1HA 1KQPA 3Q7TA 4RKQA 1QC5A 5DYNA 3W6OA 1LWOA 1PNOA 3TXXA 4F6RB 3GRKA 2V6JA 3O8DA 3MK6A 4DLUA 5DZSA 5CNIA 4J8PA 1RABA 4P84A 3UGKA 1KC1A 3MLAA 3K8ZA 2HHAA 3E4RA 2WFLB 1PS0A 2ZJYA 4OLBA 3AJEA 4YQEA 3F0TA 2IIVA 4C7OA 3NAZA 4H7EA 3DOCA 2P41A 4P33A 1NAIA 3PNBA 4TWRA 1NIJA 2WOJA 3VRHA 2YDYA 3N2IA 3IAM1 1WX1A 3C15C 1SG6A 4M3NA 3BGOS 3O91A 4BZWA 4ZI7A 2PH1A 1VXRA 1E2PA 3GEGA 4JI4M 3QUQA 1B73A 4AQYB 2DI0A 2QOEA 2P4SA 5HF5A 3TW8B 2XGNA 3OHSX 2EFJA 2ZWVA 2GCNA 4DTIA 4Y9SA 1A4IA 4BO9A 4D43A 3N2KB 2J67A 4RZSA 3ND5A 3M5DA 2WSBA 9LDBA 1NMQA 2GCPA 2CC2A 1T9DA 3VPBA 1Z68A 4JR1A 3HUUA 3G13A 4IOKA 4WESB 3UV7A 2C2WA 4PYQA 3L9WA 4MRPA 3BFVA 1ZI8A 3BDAA 4L8VA 1DJPA 1Z7EA 2REXB 3UHJA 4LHSA 4XDGA 5JXJA 3BMCB 4K1XA 1W5BA 3WB1A 2Q07A 1K82A 3R76A 2JHPA 2QXYA 3D02A 4C30A 5CYFA 1P74A 2QZ4A 1CQWA 1D7OA 2VK4A 3G9XA 3DZKA 3WAGA 1G4AE 2WJAA 4XYGA 5DGTA 2VSOA 4ZDWA 4H7DA 4RHYA 1ZH2A 1IDN1 3SZGA 5F4ZA 3EWNA 1GNRA 1YUMA 3LY5A 1FYWA 1ZH6A 2PZLA 4CG3A 4G3XA 4FNAA 4PU0A 1QPZA 2DFDA 1X1DA 4DBGB 1QO9A 1IXSB 1BSVA 2IYZA 4TUYF 1A9TA 2WIFA 3GWZA 3RVBA 5J43A 1UJ2A 1L7RA 4WADA 1TNDA 1D2NA 5F5NA 2W4IA 1DELA 3I61A 1JAYA 4GOKA 2O8EA 1ONOA 4DEVA 3PVZA 3NWOA 1NQ5A 4OXKA 3N28A 4XM2A 2PMCA 2B4RO 1KJWA 4EYQA 2GYWA 2ZYDA 2H59A 3X1MA 2P8JA 3OX3A 1E59A 3AEUB 4DWVA 1IZ7A 1CUBA 3ZXIA 2REBA 3MWJA 3H9BA 4DIUA 3T4EA 1GQFA 4U7FA 4E1VA 3AJAA 3LKZA 1JDBB 1JL3A 4EY8A 3G7SA 1VFNA 4DIDA 3TKLA 2O4CA 4ZEXA 2YWJA 1YZ3A 5C81A 2OLEA 2HNBA 1X37A 2LNDA 2GHQA 1XZPA 4CKWB 2ZBRA 1CLEA 2WWRA 2ZG6A 1RU3A 4AT1A 4TT3A 2JARA 3NORA 3ZHZA 2VQSA 3WY9A 5BQOA 1DAOA 4YRJA 5E95A 1EFRD 4K9NA 3QJYA 4HS9A 2D7DA 3F73A 5EKUA 1YB6A 2WZQA 2P0AA 5G1PA 2GI4A 2UAGA 4H3HB 2R1TA 4C7OB 2RD2A 1J2UA 4HNTA 1V41E 2VYNA 4QT0A 4EKDA 2G6BA 2PXAA 4X64M 1NF2A 3LCJA 3PIRA 2VDRB 2YXEA 4X95A 3UJCA 1JG4A 4ZI7B 3R6GA 2OWEA 4AMYA 2GASA 3PNVA 5ARDA 3R0ZA 5B1DA 3VC1A 3OIFA 1N3YA 1EIZA 2R2AA 4OQXA 2P1ZA 3M6UA 3Q3JB 4JJAA 4BTEA 2CRUA 5GM2A 4FX5A 1RE0A 3HJCA 3RRJA 5LA6A 2ZCJA 3I53A 2GZHA 3TOCA 3F1KA 1QFSA 1MJGM 2MMGA 4HUQB 4FKZA 4AU1A 3JQ6A 4CETA 4ZO9A 4MVJD 3TQOA 1VYUA 4ZAZA 1YWGO 1YZHA 3NW9A 3QSYA 1JFVA 4BX0A 5EE1A 3DDOA 2DFTA 3FHJA 3IOYA 4TM8A 1KYWA 2P69A 1K9SA 3ZTWA 1KDOA 4DGQA 4YBRA 3VYWA 2XMGA 3IDAA 4HLNA 4MINA 2PZBA 1TA9A 3PV0A 1DC5A 2ZI4A 5KQPA 3E9NA 2PUEA 2XPCA 2V96A 2F5OA 1RC0A 3R7DA 4DE5A 1GUAA 5DNAA 2XMBA 2HMSA 1HE5A 4DREA 2QQ5A 3D3JA 4PAGA 1TVKB 3DLPX 1O8BA 4ZEVA 3GCGA 2OA0A 4JI1M 1SUCA 2FH5B 3RJTA 4TKVB 1OWNA 3ZV7A 1HDEA 2JFFA 3ZWAA 1UPTA 4XASA 1XPJA 3FUVA 3FAZA 4IFBA 3F5QA 3HCAA 1XPRA 4Z7QB 4UZFA 4GPTA 3MFQA 2HMWA 1RRVA 4ALMA 1U0TA 2MJ5B 4B74A 1EUCA 2H51A 5LUAA 1TCBA 2VP0A 3IVXA 1PT7A 2IZOA 2ZWMA 5ALMA 4HYQA 3T0FA 3STYA 5H9VA 5ITYA 4YMVA 2NOAA 2HKJA 1ZD5A 4I1SA 3TDMA 2FSVC 2QV0A 3ZDYB 4YDHB 4HXYA 2DRIA 2XCLA 2GK6A 1T6YA 1YR1A 1EPUA 4N7MA 3L77A 4DC1A 2R0IA 1CD5A 1KDRA 3W2HA 3CRQA 2PGNA 5K01A 1LI4A 3IP5A 4YWJA 3SIXA 4KXXA 1QSGA 2ZAGA 5ALWA 5ITUA 5AP9A 3SHOA 5G3YA 1ST2A 1E2HA 3QNMA 4S1NA 3WGIA 4P3NA 3UUFA 4A0SA 3OQVA 2QNJA 1R8SA 4FKBA 1PSWA 2C4TA 3CC8A 2BRUC 1W6UA 1LBTA 4LF8M 4CN8A 3GFVA 2NU6A 2FMTA 5SICE 4KBFA 3RS2A 5FLXA 5C32A 1J90A 3U61B 4IIFA 3VNAA 2QRQA 2WQZA 2J3EA 4H4CA 1NVKA 2QHXA 3BZBA 4L9AA 4YJ3F 4YACA 4D8TA 4CM6A 4F4DA 4WDQA 4DUZM 2TRSB 1R4ZA 3M3PA 1Q12A 4JENA 2HU2A 1IOLA 2PKRA 5EINA 3CWQA 2Z4TA 4UHKA 3KJQA 5A0VA 1ZHOA 2QORA 1V39A 3JQ8A 1HKHA 4JU9A 3D6NB 3GMIA 2BKXA 2Y0TA 1MQ8B 1PCXA 3ZDFA 1OGYA 2VFAA 5LA6B 1CJVC 4RZIA 1W7AA 1E0SA 5D00A 2VJLA 3QFRA 2P5UA 4IV5A 4M83A 2XQJA 3C3CA 3LIPA 1O7JA 4LQ4A 1E1LA 2I3AA 4B3RM 5IWAM 4GGOA 4BNFA 1WJ7A 1KYQA 1TADA 5D84A 5KS2A 4QG3A 1L2DA 4DBLE 4ENPA 4UU0A 2FI1A 4MWGA 4ONEA 4N5LA 4RE6A 4OO3A 4OG2A 3NOOA 3PF9A 4LXIA 1E7SA 1JT2A 2PH3A 3P20A 3LI2A 3G79A 4ZV7A 3LL7A 1F0PA 1NNEA 3FOAA 3CR7A 4KPFC 1TQ2A 1MX0A 2RRUA 3B6ZA 1ZITA 2P7IA 1BDHA 4MV3A 3WJ1A 4GRIA 2QENA 1YBAA 3PD0A 3MTJA 3UB4A 4EHIA 1JRLA 4A03A 2PZMA 4DARA 1ZK0A 3W3AD 3N2GA 4AJLA 3VVCA 4MTCA 3S5JA 1XT6A 1IC6A 3FNBA 3FYSA 2R8ZA 2PIAA 4FCTA 1RT9A 1Q5PA 2KLHA 3GCZA 1MHPA 1H2ZA 1VG0B 5E1MA 3C5EA 5TQ0A 2NLOA 4KLCA 2PY6A 4ARZA 3SFZA 4TXHA 4IWNA 2OPFA 2IGTA 4DUYM 1EG2A 3OQOA 5EXXA 3QFTA 3FDFA 3W5UA 5IUNC 3R8CA 2FFRA 3LBHA 5AICA 1HDRA 1IJBA 1NI4B 4G1UC 1RQ7A 4TSRA 5EJ9A 3MT7A 4DR2M 4JUIA 4R0NA 2YBDA 3IPCA 2O5CA 2EWVA 4HFRA 3AR9A 2ZYIA 3CNBA 3LDFA 1CZHA 4XM0A 4OKNA 1U2EA 3NTXA 2YS6A 2NO5A 1UMBA 1R12A 4MIKA 1RRPA 2ZRDA 1TCAA 4PYIA 2IXFA 2H4XA 2OWDA 4EO4A 3AUFA 2Y99A 2VT6A 2NU6B 1A4UA 1V26A 2PTHA 1K9VF 4EJFA 4ISCA 1N4DA 1G8SA 1FU4A 2BEUA 3FPJA 2F5SA 1B8NA 4L08A 3PKIA 1FNMA 4A8JC 2GEBA 3QEOA 5FOUA 5KYXA 4RF5A 4B6EA 3L4SO 4GO1A 5KQLA 4QTYA 4N3NA 4B43A 2UVPA 3CB4A 4UU8A 3VNVA 1TJYA 1U5BA 4YP1A 3QOYA 2V5VA 4KKXB 1J2RA 1C7YA 1FVOA 2WJPA 1XFAA 4EUNA 2GN4A 1AMOA 2JANA 2L82A 3FCUB 1GG2A 2WB2A 4BMPB 3L0DA 1IL0A 4TTPA 2Z5FA 4R40A 5I7SA 4V1CB 2Q8PA 1UMCB 3A26A 5IKPA 2DCUA 2AVNA 4TVBA 2BGMA 1W1WA 3GJ5A 5EIBC 1GFSA 2DULA 2BEWA 1ZAEA 3MCTA 1XTSA 3H65A 5BMVF 4M7PA 2ZQYA 4DA7A 4LZPA 4OOFA 4QICA 1M8KA 2PKEA 4IBKA 2OCGA 1CY8A 4FMCB 4XYEA 5J23A 3D4PA 2JWSA 1SGWA 1UXGA 1VKOA 1SXIA 2Q7OE 2VAMA 1E2DA 1M2KA 4AC9A 5LQDA 3T38A 5D5QA 5SZHB 4G84A 5ENDA 3L46A 2EZUA 3AKCA 3OO0A 3VR5D 2VG8A 2N0SA 4A8JA 4NK4A 1PR0A 2W6JA 1WUIS 4RFVA 4NCXA 1WA5A 2ZWAA 4G0UA 4NRVA 1NI3A 3IUSA 3N87A 3D8SA 3G02A 3MUEA 2AD1A 5AFSA 4ETMA 5IT5A 3ZE8A 1Z7GA 5BR8B 4K0KB 1NN5A 3WYCA 3H4IA 4Y1FA 5FUXA 2R4UA 1RM4A 3BXFA 2FETA 1R4NB 1XHEA 1KQNA 1E4EB 1NXTA 3JQFC 6REQB 1QZUA 2OQRA 4RHUA 2P6RA 3DS8A 3QG5A 2HJSA 2BLLA 2HSWA 2OT3B 2G80A 1D09A 2RK4A 4A8PA 3SIWA 3B2NA 1JLMA 2CD7A 1DFGA 1WXGA 1N4AA 1NVBA 3RGGA 3O75A 3I6QA 4NZZA 2IBTA 4LC9A 1JJBA 4BBAA 4BLOA 4OHCA 1P6XA 3FYCA 5CG2A 2VCYA 1EWQA 4LXXA 1UKZA 2R6HA 3NIWA 4WZBE 3ND8A 4FFOA 2W83A 1H6AA 4E5MA 1OSNA 2R45A 1P1FA 2RK6A 2DR3A 4PY2A 3CVWA 4OI0A 1FUEA 3GUYA 3ZR4B 3ZTYA 1D6JA 4Q12A 5I7RA 1KFVA 1CYEA 3AHIA 1G8KA 2C78A 2BEUB 2UUCM 2FN9A 4FC6A 2NM0A 1SK8A 2QZ9A 4NQZA 1RJ9A 1S89A 2UVPB 1IY2A 3L4EA 1U5BB 4HZUA 5IDYA 1TQHA 4XVCA 1ECGA 2X4GA 2WC1A 2K7FA 3QU4A 1J1ZA 3DYBA 4CMIA 4XARA 1Y3HA 2FOIC 4QD3A 3U3XA 5IZCC 1L4LA 4C0BA 4WY2A 2FZ5A 721PA 5HP4A 4FYHA 4EG5A 2YXDA 3A4YA 1YS1X 3F92A 3UICA 4G1FA 1IQUA 4H7FA 2QD3A 1E6MA 1WZNA 1IBCA 2YBEA 3QVUA 5CEEA 2WLSA 3EEBA 3DAGA 3O4JA 1R0XA 3AHHA 3VAYA 4N82A 4U7DA 3KE9A 5BV2P 1IN6A 2B3TA 1ZRNA 1TX4B 3KSBC 1EVJA 1WXXA 1EGQA 4UUOA 4UFNA 2HWWA 1W8IA 4DZTA 5DHUA 4LDQA 1N9GB 1Q21A 4W1PA 5I9NA 5K0LA 3O47A 1KIAA 4JYAB 3HYLA 2UZ0A 5KDDA 3LPCA 2QTWB 2QVBA 4GZLA 1UKCA 1JG2A 6ABPA 4GUAA 4DV6B 2CXNA 1CUEA 1G7TA 2IBMA 2V4UA 4N5NA 1Z74A 3KEQA 1TGUA 3WX0A 1KI8A 4CL2A 2NXWA 4RKFA 5FH9A 1OXVA 3EMDA 1PFVA 2G1KA 2EG5A 3NYRA 1TZKA 5E4FA 1ZNYA 4R31A 2RGXA 3IX7A 3AY6A 2FOIA 1WETA 5IZCA 1SUAA 4JQYA 2Q4TA 3TZCA 2DHYA 2O59A 3T9BA 1H05A 5AHKA 4PC6A 4X65M 2B1GA 3QFSA 3FSGA 4AM8A 1PN3A 1NF8A 4XCXA 1Z6QA 2DWOA 4R69A 4BNDA 2YMPA 2YVAA 3DFMA 2I4LA 1ZNQO 3IQDB 1V3VA 5AVZA 4DA9A 3PKZA 1B6GA 5IAKA 1SU4A 4CEJA 1G291 1T8SA 1A9YA 1BO6A 3BA1A 3V1YA 4G5SA 5GJWC 3W3ZB 1RFGE 4J03A 1XIVA 3VX4A 1A9PA 4G1BA 1EGVB 4NE7A 1UK9A 1D03A 4I1UA 4LTDA 4ZFNA 1GXSA 2UXBB 1R5LA 2XODA 4O08A 3AP1A 4TYYA 4KRXA 4O02B 3TEFA 2WHRA 2J5XA 1GG8A 4K81B 4B82A 2WKPA 5HXAA 4WJLA 1DV1A 4LGVA 4HEQA 4P53A 2IEYA 1YBVA 2OAP1 4OGFA 4RGQA 4D99A 2VAVA 4D3DA 1ADBA 4R7ZA 4N9WA 1D07A 1KQOA 5JNLA 3Q5EA 2BKUA 3WYFA 2LDXA 2O8CA 4J4BA 1TYCA 2CFIA 2QTNA 3HS3A 4PHFA 2NSDA 3P2YA 4YN3A 5FA8A 4HNVA 1SEPA 3WMRA 4RTPA 3UENA 2WTXA 4MKGA 5E7JA 5JYCA 4RF1A 4PICA 1AUAA 1EINA 2ZI7A 4EPXA 4RAQA 2FPMA 2A0FA 1E1KA 2BFNA 2XUHA 4JYZA 2JJ8A 1QWSA 1V0JA 3WSWA 3AU9A 4TMXA 3W34A 3ZXSA 2FN4A 3PR3A 4DQKA 5D01A 2OHOA 4ZAYA 3SZ3A 2B9EA 3RCBA 3I6BA 1M66A 2LD4A 4ZZ3A 5DM60 1U65A 4HN4B 2QQEA 4QDOA 1SU6A 3EOBI 1XK6A 3QOFA 3H4VA 2XCIA 2WM8A 3N2NA 2ZS9A 4DCSA 4KWTA 1ZA2A 4Q3LA 1ULZA 2G9QA 1TQ8A 3OBBA 1F7VA 2DAKA 1OHHD 3K0EA 5DRTA 4EDFA 4UMVA 2Q2WA 2BLNA 1XZFA 1NGSA 4BMYA 3P9RA 2JJQA 2EEPA 3VR1A 1ETHA 1A77A 1E4VA 4F2WA 2E1PA 2PCJA 1VDMA 2P0YA 1I0ZA 3C5CA 3T1YM 2NO7A 2NUAA 1C80A 3GEMA 2Z8YA 2F3TA 4FZRA 3RVQA 3DZBA 1ZEMA 1NM5A 4QE3A 3BILA 1YZLA 2I6UA 4M88A 5JAUA 3LDGA 1JKFA 1XZIA 4KPYA 1Y9EA 3RH0A 2JGEA 2HHJA 2Z5LA 2OBXA 4TKLA 2JFQA 3II6X 3OFSA 3H9QA 2X0NA 5KO2A 1YDEA 3FRJA 4MUJA 5TPWA 2C00A 1C0LA 3MRXA 2V3VA 3EN0A 1CCWA 2QL7A 4CEJB 2WKWA 3J81A 4P0QB 5EA2A 2P7HA 3IBSA 4YLEA 1YR9A 3KWJA 2D6FA 2R7AA 4UM9D 1Q39A 3GG9A 1D1SA 1NTRA 1FP1D 1C3OA 5CGZA 1AY0A 3HCPA 3HE3A 3A8TA 5T4EA 2J0UA 3KSJA 3SNHA 2W42A 4X8HA 3UAVA 4O4JF 5D7NA 1ECFA 2VT3A 3GJ4A 5ITTA 2FTKE 4UTXA 1U28C 4ZQBA 2VPYA 2BFCA 3DD5A 5AWFC 4DPLA 1YHZA 1UFQA 3RIHA 4TMWA 2Z58A 3CA8A 3L82B 1CUDA 2X0DA 4XSGA 1Y48E 4IINA 1K8QA 2QTCA 2WJVA 2OK7A 2AN1A 3BCHA 4DLAA 4NXMM 3CNNA 3UBTA 3OTOM 5EPEA 4N4AA 4C5AA 3SHVA 4BVJA 5FWAA 3PXGA 2OORC 1Q7BA 2O7RA 1OWOA 3GFFA 1C3VA 4MYDA 5TV2A 2VPPA 4WNCA 4R1UA 3EGDA 2H65A 2N1BA 3F7NA 5CU7A 3WL7A 4WZ6A 3UW3A 2OPHA 5TMBA 1Z16A 4KUHA 1UJ5A 5HR5A 4M9QA 1W4CA 1YDGA 1Z0FA 5LZ4A 1K92A 1K7EB 2WKRA 1SVOA 2IFTA 2FRVA 8ADHA 3C7AA 2BDTA 5FOWA 3HJQA 1R4MB 4P54A 3KE8A 5DWDA 5THXA 1AGYA 4JWKA 3UXEA 5HHTA 4L2IB 2UZIR 5FO0A 4DJDC 2YRXA 2CEKA 3ABZA 3FTNA 3VHXA 2MU1A 3R9KA 4MULA 3TBFA 2FZWA 3EE6A 3SVLA 3E2PA 1K5DA 4M8LA 2ROQA 3HJNA 2IQ5A 4DMHA 2Z2XA 1ATIA 2AMJA 5K2OA 4WBNA 2UXCB 5HA5A 4MRSA 3OSUA 4O8CA 3LYLA 1GARA 2B21A 3DZHA 4QLBA 2OHXA 5IBCA 1FP6A 4NYJR 4B7XA 5A3JA 4Y7DA 4UHDA 1U8AA 1Q2XA 4X0EA 4JLDA 1DSSG 3FMFA 3IAUA 4RZHA 1ZJ6A 3TSCA 2NUAB 1M0TA 4FX2A 3NEJA 3G5TA 1E5VA 5LLSA 4HWGA 1SUFA 1VPTA 3PHIA 1T8YA 4WA7A 3DWGA 2GYVA 2K6GA 4QJIA 4I7EA 1DT3A 4KO4S 4YP0A 3MTDA 4NDNE 1XA4A 2P9TA 1YQWA 4NNPA 1I4WA 3ZU4A 2VDPB 1E9AA 5ICGA 1W2GA 1MN6A 1V3UA 4JNKA 1R0YA 3GLHE 2JFWA 3ACCA 4LW8A 3CW9A 4PZAA 1H9AA 1L1RA 2E49A 4KE6A 2RK3A 1P1HA 2C7VA 1X87A 3OT4A 4J90A 5ERXA 3W6NA 2RC6A 4YIHA 3GPXA 2ZULA 3RR2A 5DBGA 3L1IA 2FCAA 3ZWNA 3A1VA 4LSWA 2NSYA 3U6MA 4MQ5A 8ABPA 3OQJA 1EDEA 1KEUA 5IT9A 3OAAA 3DQQA 2YJTD 2XTAA 5D5PA 2VKTA 4BMCA 1OXUA 3RWOA 4AF6A 2CF5A 1D4ZA 4IIBA 3VO1A 3HRKA 1NW8A 2RB4A 3MS4A 3AFHA 3O82A 4N0QA 2PX2A 2QP9X 5DPMA 1Z5VA 4F71A 3AY3A 2R7MA 4XA8A 2QTFA 1CR6A 5B4TA 2H3HA 4JVMA 3EWSA 3G8BA 5KYNA 2GZMA 3G9ZA 1UT8A 5KNDH 1J07A 4AJHA 4P5EA 1JEEA 2WDPA 1XF9A 4JI7B 4J75A 3AFNA 1CG6A 2GNPA 2WTBA 1A9QA 1P2DA 4IDPA 2ZUDA 1BXGA 2A88A 3NAQA 3NFRA 3BQMB 3LT2A 5BYKA 2L42A 3INRA 2RGOA 3V2UA 1GJSA 2ZITA 1NN0A 3AEQB 3L8CA 1MTZA 1WPRA 2KE5A 1EFAA 4D0SA 2V6ZM 3S99A 4OAQA 1UJBA 3O2NA 1PGOA 3DKRA 1ZL0A 2PR2A 1J5EM 3K9HA 4Y6SA 4L4RA 1NXOA 5HMMA 3EVAA 4EVRA 4FSHA 3BORA 5ABPA 1JJ7A 2CNBA 4KRGA 3DKIA 4ZYVA 3PENA 2WSYB 2VZ9A 3NHSA 4KITB 3MJHA 1IHOA 5DNEA 1U04A 5KSOA 4WNYA 2GLXA 5D3QA 1WOMA 3VU9B 2LH0A 1DJQA 1FYVA 2W9XA 4MWZA 1CJBA 3ETLA 3B3JA 5A9RA 5JCXA 1A7UA 5KQDA 1E2KA 521PA 3LNCA 1M1ZA 1FXWA 4JYBA 2XZFA 1TH4A 4WBNB 1XI2A 3U7QA 4HEA6 1QQBA 2A9RA 3DGFC 5FTWA 2IUYA 1PNTA 3HXOA 2PMKA 5FHQA 3SBJA 4P38A 4M1YA 2OYCA 1W6RA 4WOPA 2QT0A 1PLLA 2GF9A 1KQ3A 3FWZA 2FEWB 5KYTA 1T9HA 2WV9A 3PFWO 3Q3GE 2EJWA 2WHEA 3QG1A 2Q41A 3SC4A 4BDTA 1L8AA 3LUKA 5HM6A 5G53C 1ORTA 1I7SB 4XFKA 4H77A 2QAIA 3BJZA 4REQA 2G9ZA 2B2NA 1IBMM 4EPWA 4EB6A 1Q0PA 3CLSD 1CTQA 3I51A 4LOHA 3LC2O 1VMEA 4M8NE 2P4EA 3PX2A 3VR3D 1VYTA 2MR5A 4JWTA 5K3DA 3P4XA 3GUVA 1AMUA 4Y9TA 1TFUA 3BB3A 3JZIA 4P7FA 3VR4H 4F4FA 2WTUA 1TDHA 2E4WA 1KMIY 4F6RA 2IH5A 2YOGA 2INGX 4AS1A 3UUGA 2RGNC 5IMBA 1VE5A 2B92A 2YOHA 1MG5A 2B69A 3F7TA 3CGGA 5KINB 1S9HA 2HHHB 2WFLA 3RNOA 3GGDA 2NP6A 3WS7A 1TJ4A 4PGHA 3EFEA 1WVGA 4AI6A 1O0BA 2IE0A 2RHBA 4EMBA 5JBNA 2H1CA 1UWVA 1GQRA 4PPFA 2Z43A 4ZRMA 1JMVA 3B1ZA 2HNKA 1YDFA 2FMKA 2A1TR 2K9DA 4TSFA 1GFWA 4WPGA 5KIAA 1QK3A 3LDAA 1MVLA 1FLVA 3EZFA 2P5SA 5LNK6 2ID8A 3TW8A 1IPEA 5H3LA 1IAQA 1O8CA 1JDJA 3MTAA 1VKRA 4BRZA 2QVCA 1MQ9A 3GR6A 4FVTA 3FUXA 1OFIA 2OHFA 5CAEB 1RLUA 1ACMA 3JR5A 1BXGB 2IV2X 1PGQA 2VDMB 3TH5A 3Q72A 2EBHX 5AO9A 1Z29A 3L8HA 4Y1EA 4G0VA 3N76A 4WESA 1M6VB 4YONB 4M54A 4PC3A 1JDBC 4CE6A 3F4KA 3K8YA 4W9NA 1Y3IA 2ISQA 1Y8AA 1U8ZA 4R9UC 2SKCA 8MHTA 4DCTA 4KK3A 3BH7A 1TAHA 3WG9A 2H9YA 3BMCA 1KOLA 5DM70 3PNPA 5BWCA 3P9QA 1IN1A 1G1AA 3Q5GA 4NZOA 5H16A 5AVWA 1TTTA 4I1YA 3LKVA 2RGNA 1OQYA 1AKMA 2CL7X 1KZHA 4BQFA 3UB2A 5LP6C 4Z4IA 2Q0SA 1ZJZA 2YC2C 2HKIA 1FSZA 2HIMA 1N2JA 4C0KA 1HG1A 1K5HA 2OCXA 1H2HA 4AMGA 1E96A 5T3UA 4YAEA 1P2VA 2L19A 2XA2A 3LT4A 3W77A 1ILEA 5G02A 3AB7A 1L9KA 1ODFA 3U7QB 2Q5LA 1G4HA 2QPAA 2OCPA 1U98A 4GPBA 1IXSA 1RHMA 3PFNA 2IEDA 4NQRA 3OPQA 4GZ3A 4ZDKA 3DL7A 2GCGA 3Q7RA 1NZDA 1VSQA 2X5XA 2C99A 1ZGHA 4JFRA 1PEAA 4PIVA 3K0BA 3CF4A 2VJMB 3ZD7A 1PHRA 3KOYE 1O9HA 4EA8A 3QKUA 3FYHA 2J0SA 1N1MA 1ZK4A 2VNJA 1B14A 3AERA 4REQB 2QUBA 1CDOA 4NL4H 2FQ1A 4Y2QA 3L7OA 4P7GA 3H19A 1QUSA 2PGLA 5EMMA 4NBKA 5ECYA 1SM4A 2RGGA 4H7JA 4I0WB 1R37A 3EBOA 2QF7A 2VUSA 2H5EA 3L8GA 4IIHA 1ZAYA 4KREA 4OF4A 2FPOA 3H5OA 3WIOA 4V0LA 4GG1A 4CHGA 4CKWA 2MYTA 3WO0A 3FHTA 3RTDA 4AP9A 2V6GA 4UVGA 3PCXA 1OPXA 1N2GA 1BTOA 2ZJ3A 2Y1GA 3O1IC 1BVRA 2VH2A 5LP6A 2R8BA 3WDSA 2JLQA 4PYRA 1PJIA 2VVTA 1ZCJA 4AJ1A 2ERCA 2QWXA 1HQCA 1SXJE 4NBLA 4ZEWA 4C20A 2ZI9A 1DG9A 1EIJA 2ZUEA 2ZUBA 4LX0A 1R0RE 3C4JA 1BHQ1 4GKBA 3VAZA 1ADGA 4LDZA 1Z25A 1WTCA 3WNQA 1EQ2A 4M55A 2D4AA 3RQIA 4WI1A 4R2JA 3OPVA 1QLJA 4JT2A 2C9CA 5AR1A 4LF4M 1Q74A 4JXKA 3W06A 2F1IA 1PTKA 1S3IA 1L5LA 2EGUA 4EB8A 2C07A 1XAHA 2HY7A 3CJTA 9MHTA 5EZ6B 1GT91 3OCWA 1CQZA 4HUQA 3UUWA 4XOIA 3H4JA 4K03A 3HJUA 3QENA 4N3GA 1GG9A 1WMSA 4WIAA 2G04A 4ZMBA 3KHKA 3S55A 3U49A 5DK6A 4FFPA 1BYUA 2A86A 2OZLB 4EATA 4JJ6A 4RIEA 3IUYA 3BT7A 4WGFA 2G5GX 4BFSA 1VSTA 3HN6A 3BMQB 1CJKC 1R2ZA 4NIMA 3KHTA 2ZPTX 4POAA 1E18A 4ZTBA 1X8XA 4OYYA 4OIFA 3KT6A 3PX3A 4EWLA 1PZGA 1Z6PA 3KU1A 1QQ6A 5H80A 3N3BC 4RK1A 1GHTA 2DGDA 1TVKA 1ESZA 1PQYA 4O4LF 3T1TA 5JXHA 3ESBA 1WCV1 5ALUA 4TLCA 4FBMA 2FK7A 4JUCA 2Q6TA 2R8PA 1W4BA 4TKVA 1UBMS 3A1NA 2OTCA 5IDWA 2P2LA 5F1OA 2FU5C 3G9QA 3VK8A 4E21A 2ACEA 5GONF 4G2TA 2H92A 2FH0A 3VVLA 2ATEA 4BVFA 1VL5A 5HQTA 4AWXA 1HT0A 5E6UA 4KR3A 4JBHA 1L5SA 3HYRA 2BEVB 1TRKA 2ZRMA 3W8FA 4GOLD 5A03A 5CH3A 4WJKB 4P82A 2Q1TA 221PA 2PS9A 1RLOA 3CN7A 1T4BA 5BSWA 1GJRA 3IPLA 3AERB 5LIPA 4YX9A 3HDQA 2ZCVA 1P45A 5DE3A 4I9NA 2JGFA 1BOFA 4LS3A 3WL5A 5HK9A 3TFQA 1X14A 1Y4DE 1UC8A 3VTZA 4MV1A 3TLAA 2E4ZA 4FFSA 5TT0A 2ZJ1A 4U2EA 1JTVA 1NUAA 4X64B 5DULA 4V0SA 4MCIA 2DUUA 2AZXA 4I1PA 2EHDA 2ZVDA 3HDTA 4ZOBA 3ABSB 2ECFA 4LZJA 3OQBA 2NV0A 3C87A 1FBTA 4AY6A 4HX2A 4BLTA 5TQJA 4RE5A 4RZQA 3I12A 3ZLUA 4KQHA 5CDFE 4JJZA 1U63A 4DLNA 4FEYA 4AULA 2Q9UA 1TK9A 3ABQB 3WLSA 5LP6B 3NOXA 1RAFA 4MK4A 3KUCA 3SC6A 1WJGA 2PN1A 3RRYA 1K27A 4WZZA 4K6FA 1XRNA 2TS1A 3B1XA 2KRUA 3ZDAA 4X1OA 3SQXA 4EL5A 3U2QA 4ABTA 2BWJA 1Z6TA 3K4HA 2GETA 3HUFA 4DNPA 3R5HA 3U61A 4KQKA 1Q50A 1F1BA 1P7WA 4BE7B 2CDBA 3IKLA 1GITA 2F8LA 3RARA 3JCZA 1ZLXA 4M1MA 4LAFA 2GJKA 2CLFB 3HBMA 2ID4A 3MGKA 2X9GA 3EDRA 3KQTA 1V4NA 5I9TA 2IU0A 3SHGB 3KU4A 3WAJA 4N3AA 1JFSA 2HLPA 3QE2A 4HGQA 3UQYS 3CH7A 4DDUA 1O3YA 4HHEA 4NATA 3G8YA 4OTZA 2EJCA 4LY3A 1JGTA 2EKQA 2GFIA 3NTQA 2WVHA 4H16A 3ZD9A 2ASEA 1FTGA 5IVIA 1OKKA 1U0RA 3INYA 4MS1B 2NZWA 3ZS8A 1OA0A 3VHRA 2W2LD 1XC8A 3UK6A 7MHTA 4X41A 1LW6E 3EBLA 2YWXA 3WLKX 4DLZA 4HXEB 2CCKA 2XCOA 1MB0A 3FCXA 3QVOA 1JDSA 4DQDA 1RPNA 1EYZA 1NFRA 4ZCRA 4EG7A 2SBTA 1U7ZA 2DAGA 2OCYC 4GDFA 4ZOLF 1PT5A 1KK1A 3TSOA 1TLLA 4HAOA 4UDXX 3M6LA 4ERXA 2P77A 5JJCA 2HHLA 3I76A 5ERYA 4HFMA 4M49A 3P2OA 4G5FA 3H11B 4UHBA 3MLEA 4Q48A 2EZ4A 1YRLA 2YZMA 4PCZA 1XVAA 3BCSA 1RBQA 3E3AA 5DN9A 4DDWA 2PL3A 3D6MA 5E6UB 3TGWA 4QRIA 3OEHA 1FFBA 2QM3A 3BD9A 3IC5A 2XUJA 4JI0M 1YZFA 1Q7EA 4OL9A 1GZHB 5CHEA 1N7JA 2XB4A 3RYIB 3UVEA 3WGYA 1L8LA 4FZVA 1E2MA 5L8VA 2Y1OA 4ZA2A 3T6PA 4RF0A 3HVIA 3Q41A 2GQ0A 2G40A 5B3AA 5IS2A 2QA5A 4KE8A 4ASUD 2C03A 4QKQA 4BL5A 3OHMA 2EG9A 2NV6A 3R23A 3KAQA 1X1QA 2ISSD 1NI4A 3LOQA 4PM4A 3GLGB 4NU0A 4PLPA 5EE3A 4W1QA 4TV8B 4Q3EA 1NUSA 1LLFA 3QXHA 2V98A 1OYVA 4OFWA 4LFCM 3JZAA 5CYGA 3N0VA 3JS5A 5JRZA 4JK3A 2X8BA 3D8RA 3L0PA 2IS1A 5E1DA 2L6OA 5KVVA 5HZMA 4J2HA 3U4MA 4XRRA 1Z34A 2YINC 3L1VA 4LSZA 1PJAA 1TEHA 2G4VA 3RVPA 3F7OA 2W6CX 3DBLA 3WIDA 4ZJZA 4ANFA 1SY7A 2WWYA 1M2WA 4PIMA 1F5SA 3NWEA 2A35A 5CX1B 2OCLA 3B6MA 2ZSKA 1F5NA 3F6SA 2KZUA 2XUOA 4MPJA 2PLAA 5KU7A 5G0WA 4L95C 3LUHA 4B3RB 3E5RA 4ZTZB 3DL0A 5IWAB 4XE5A 4MB0A 1E3DA 2AN9A 4NYMQ 1NV9A 1WLSA 3W5IA 3KO8A 4E14A 2C7QA 3LGAA 3OQ1A 4TSKA 5TY0A 1IN8A 1X38A 3N86A 3PJGA 4L73A 2CMGA 1Z39A 1OX4B 3JQGA 2R6CA 3HZOA 2ISCA 3IHLA 1AX9A 3UJNA 3VUEA 2ZYTX 2FZ4A 2BEJA 2C58A 2LVNC 1JEDA 2FSVA 1H2BA 4UEKA 3HCFA 2CEAA 4JLKA 3HMQA 4HKTA 1N8SA 3WGVA 5B53A 4G5GA 4O4IF 4FGJA 2B36A 4V1CA 3T12A 1T25A 1UMCA 1IPFA 4KQGA 2P6OA 1RACA 4KV9A 1SCJA 2VYVD 3HO6A 3IUQA 4XYLA 3KLBA 2W6ID 1YVDA 3CO0S 1DINA 4PG4A 3DGEC 2JUJA 2WT8A 4L8RC 2R6ZA 3SR4A 2J3DA 2J5BA 3EGWA 3LFUA 3OICA 4MQEA 1REQA 1XWIA 5TEWA 1N5KA 2CLIB 4Z4FA 2QX6A 2WSLA 2FJUA 3IXMA 4YCSA 1XKQA 5AI9A 3V4VB 2C31A 4KVAA 2BRUA 2V0GA 2Y27A 1IZ9A 3COJA 5ALYA 2R48A 4D3SA 4WA8A 3FGOA 2H54A 4PSVA 4ZIRB 5A5DA 1FYFA 4FCWA 1TU0A 3Q3HA 3S7TA 1XXLA 1XA3A 5FJIA 2XLJA 2OVBA 1Z6YA 3L6OO 4QPNA 2XB2A 3R3VA 3RO7A 1M34A 2JJ2D 2QP3A 3COPA 1P9NA 2XYQA 4Q7LA 4DL9A 4N39A 1G60A 1KE1A 2B8WA 4IKOA 5TJ9A 1Z4MA 3LKDA 1YASA 5JAMA 4G0OA 3IT0A 4QPJC 2WB4A 1R4NA 1RYHA 3RFVA 3D3WB 3TFWA 1E4EA 1QZZA 3RSHA 1UZNA 5BQXA 1PLKA 5D87A 6REQA 3E3NA 1DG1G 4MDHA 4HAWA 3SJUA 5D1NA 2C8VA 3AUKA 4YP6A 3IJRA 2CE7A 3AGQA 4WTOA 4I5FA 5H4GA 2AYXA 4RHXA 1E0JA 1J09A 3HRHA 1NATA 2FAXA 3PT9A 3K0HA 1OD6A 1JFTA 4OAPA 1ATZA 1TEZA 3TCNA 5IH7A 3PKJA 2AQIA 5LYJB 3EZ7A 3MTIA 4ZRDA 3D5EA 3DF7A 2O6HA 3TPZA 3PQDA 3E7WA 2BUAA 4C4TA 3NAGA 5IPFA 4XYBA 3DBLB 2HMTA 2X13A 2DHRA 2AB0A 1LK5A 4FFMA 4XPZA 3A1DA 4QLAA 3JY6A 4QBGB 2OFFA 2ZAIA 2OFPA 3L5OA 3HVJA 4CQMD 2NYAA 5F12A 4CF3A 3UCFA 2J3JA 1U90A 4M4SA 1W2WB 4JBWA 4GL2A 2QUKA