2KNZA

Nmr structure of cip75 uba domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure note: UBA domain of CIP75.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Ubiquilin-4
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knzA00
2DI0A 1WR1B 4R71A 2KHHA 3H4JA 3K9OA 2DZLA 1PGYA 2DNAA 2QHOB 4F2LA 2DAIA 1F4IA 3B89A 2ZTCA 2EJSA 2JZ0A 3LCUA 1ZMUA 2MR9A 3LCVB 3IHPA 2DHYA 1HT1E 3GLGE 2L2DA 3T6PA 2L4EA 3GLHE 2B3TA 2LVQD 1G4AE 2LVAA 1G3IA 1C7YA 2QSFX 2JY6B 2JY5A 2MJ5B 2K9DA 1R4GA 1VDLA 2MGWA 3BBZA 2JZ1A 1DO0A 2JUJA 1BVSA 2LVPC 1VQ1A 3F92A 2RRUA 2OOBA 3FRHA 2L4FA 1UFZA 2OOAA 1A5TA 2EKKA 1IFYA 1ZMVA 2G3QA 2BWEA 2WZJA 3FRIA 1OAIA 2DAMA 1DO2A 2JY7A 3E21A 1ZV1A 2LBCA 1MN3A 2LVOC 1NV9A 1YLAA 3FE3A 2JP7A 2DAGA 2DKLA 2DENA 1Y8GA 1Q02A 1NV8A 1GO5A 4Q7JA 1E94E 1WGNA 1XXHE 4UN2B 1OKSA 2OO9A 3GLFE 1T6OA 2CWBA 5JI2E 1IXSA 1EFUB 1XB2B 4F1IA 3GLIE 1VEGA 2LVNC 1KYIA 5DFLA 4DBGB 2JNHA 2R0IA 1QZEA 2DAKA 4WP2A 4GEWA 1T43A 3K9PA 2KNZA 2HAKA 2K0BX 1SG9A 1OTRA 1DV0A 3E46A 1WJ7A 1VEJA 2KNAA 1VG5A 1TR8A 1WGLA 1IM2A 1CUKA 2EKFA 2JY8A 2HWJA 2QNJA 1ZMWA 2BWBA 1HJPA 2O25A 2ZTDA 4G3OA 1OQYA 3MMPA 1P3QQ 1VEKA 2H5XA 1TTEA 1WIVA 1V92A 2MROB 2DAEA 2KNVA 3IECA 1G41A 2LTUA 1AIPC 1WHCA 1HQYE 1JR3E 4HEOA 1HT2E 2CP8A
chains in the Genus database with same CATH superfamily
1OIZA 4LFAM 2CE7A 3T15A 3HY5A 3U60A 3GPUA 2F5QA 4IJFA 3VDUA 2VDBB 1G71A 3ZC7B 3KS8A 4G4RA 2D7HA 1UM8A 2WSFF 4P17A 3U5ZA 2DNAA 1SXJC 2QHOB 4LCBA 2OPFA 4LFBM 1Z5CA 1F4IA 1D2NA 2V6ZM 4P16A 2Y21A 1RU3A 2JZ0A 3K2LA 4DR4M 3TPZA 3I4YA 3IHPA 4XBOA 3GPYA 1K3WA 1NSFA 2H1RA 2YNMD 4IIWA 4ANRA 3U6DA 3GLGE 3GLIB 2F5SA 4GKKM 1IY0A 2Y20A 2HHHM 3KOWE 3FKEA 1QAOA 2LVAA 1G3IA 5ITRA 2MJ5B 2JY5A 1QANA 4OX9M 2A5YB 4YHHM 4AI6A 2VIIA 2F4VM 3MHVC 1KSFX 3HZJA 1L2CA 4X64M 2CRUA 2LVPC 1MU5A 4RF1A 4JI4M 2FNAA 1PM5A 3FTDA 4JI8M 1E9SA 3R9XB 1E32A 4DV6M 3HU3A 4I81A 4A3VB 2JXNA 1PJJA 4L6V6 2JA2A 1NHGC 3T1HM 3HJQA 2DAMA 5KPZA 1IN7A 1NNUC 2JY7A 1JQJC 4G4OA 3HU2A 3B9PA 3NBXX 3KS4A 1MN3A 4AG6A 3AFHA 3TQSA 5FSWA 2KZUA 3TL4X 5ITXE 5JI3E 3FE3A 2ZANA 3CF2A 4MGKE 3SBJA 1J7KA 2DAGA 2DKLA 4AW4A 2DENA 1NY6A 1PJSA 4Q7JA 1SXJA 2C96A 1WGNA 2Y0TA 3SHFA 2OO9A 3GLFE 4PCZA 2JWSA 2QZ4A 4MB7A 2XEPA 4JN6A 3WHLA 4NXMM 5JI2E 1W5SA 3LMMA 5EXPA 3FYCA 4DR5M 3UZUA 5EP2A 3WHKA 3KOZE 2E5LM 3GO8A 3GP1A 3D8BA 3HGIA 4PDGA 3TWKA 1ORYB 2KRKA 4FWDA 2L6OA 3CF6E 5IWAM 3B74A 1XNQM 1QQWA 2CHQA 3PVSA 3GQ4A 3W67A 2FE8A 2D7EA 4FW9A 2AHMA 4GEWA 3J81S 1N33M 2KNZA 1OTRA 3W0FA 4CGYB 3E46A 2Z7JA 4IBCA 1VEJA 1HR0M 5GKNA 4OVZB 2EO2A 3GPXA 4LGYA 1L2BA 1CUKA 1QAMA 3B7NA 2HWJA 4G4NA 2R4JA 3GLGB 2UUAM 1NJFA 3EIHA 5LMUM 4WW0A 3KDSE 3E9SA 2UXCM 1IN6A 1D0KA 1HNWM 2UXDM 2H5XA 2XFTA 1WIVA 3B7QA 1SXJB 2DAEA 3IECA 1GLNA 3I04M 4LY6A 4ZPXA 3SFZA 3U5ZB 1N36M 1HNZM 4JI5M 3ZH9B 3U6EA 1GVNA 1WHCA 1HQYE 2C99A 4HEOA 4DV5M 3HKPA 2DVWB 5DYIA 1EE8A 5ITXA 1R2ZA 3K1JA 2LNHC 2R62A 1IXZA 2DI0A 5EXXA 3HWSA 1LV7A 5E26A 4DV1M 1DGGA 4MH0E 2X4AA 3GLFB 1PGYA 4F2LA 5KQ8A 3L28A 3A45A 1Z59A 2DAIA 1HQCA 2RKOA 2RGHA 2DZOB 3KOYE 4LRTA 3JR5A 1GKIA 4REZA 4CJ6A 1R2YA 3I51A 2X49A 3Q8XA 1FNNA 5KPRA 3THGA 4CISA 4QNMA 1IBKM 3UGJA 2YR0A 4Z6YA 4DUYM 4OVZA 4B3MM 2O01F 2DWZB 2L7IA 4DR6M 3FUUA 2XF3A 1DGBA 1QAQA 2K47A 1K3XA 2KXEA 2L4EA 2LVQD 3LVVA 2KW0A 5ITTA 4DR2M 1G4AE 3L2AA 2QQ8A 3GRYA 5FTLA 4BLCA 1H6UA 5EP3A 1NVMA 1R4GA 3VLFB 3ZQJA 3QWLA 2MGWA 4RKUF 3V76A 4IBDA 2EUCA 3LQQA 1XXHA 1DO0A 2QP9X 3GPPA 2CUZA 1SXJE 3AOEA 1QUSA 2KZSA 3RFWA 3F92A 2R46A 3VK7A 2F5PA 3VK8A 4DV7M 4I8OA 3U6SA 2DZNB 2WZJA 1OAIA 5EP1A 3IG5A 4DUZM 3SAVA 3SAUA 1Q3BA 4R3DA 4LZZA 1V34A 1ZV1A 2O5RA 3U61A 4IBFA 1W5TA 3H4MA 4FCTA 3J7AS 1IQPA 2KDLA 1YLAA 4GMQA 4I5SA 2EA0A 3RGPA 3GLHB 1Q02A 4FD2A 4B3TM 2QPAA 4JI0M 1GO5A 1XMQM 3AL0C 1XXHE 1T6OA 4I4LA 4LF7M 3U6QA 1OFIA 2YQZA 1TH2A 4KLNA 2VF7A 3KOXE 4B7GA 3TWMA 3GRUA 3KFUG 2VQEM 3U6MA 4JI3M 2LVNC 1GL6A 1KYIA 4LF8M 2V1UA 5EP4A 2JNHA 4MGYE 1IBMM 3VKGA 2R0IA 2MH8A 5H37D 1QZEA 2DAKA 1N78A 4D80A 2G8LA 5L8RF 4R7GA 3ILKA 1T43A 4PT5A 2HAKA 2I7NA 3J2PB 1SG9A 4DR7M 1EIJA 3E4RA 4FCVA 2LH0A 5E6JA 2R44A 2C9CA 1D0LA 1S3SA 4JI7M 5KO3A 2EKFA 2JY8A 3FTCA 2C9OA 4XGIA 1G8PA 3SATA 1GJSA 4OW0A 5FTKA 2WSCF 2P5TA 2ZTDA 5FTJA 3SMSA 3W68A 2ZAOA 1OQYA 3J27B 1IBLM 1P3QQ 1AUAA 1VEKA 2RGOA 2XH9A 1J09A 2CV1A 4L4UA 2FH0A 3CGWA 1G41A 2LTUA 3PNVA 3RGSA 3GLFA 4GITA 1N34M 4DR3M 4L78A 2D7GA 1JR3D 2J7NA 4AKIA 1JR3E 4LRSA 2V1CA 4QHTA 5EQTA 3U6CA 1NO1A 4NOOB 4G6ZA 4L15A 4AG5A 1TH3A 4KHPM 1WR1B 4IBJA 4R71A 1Q3CA 4M0WA 2KHHA 3A42A 3H4JA 4M0DA 5KQDA 2DZLA 4AKGA 3FUVA 2ZM6M 1YUBA 8CATA 4NL4H 4MGHA 1R5LA 4AQYM 2BNKA 2EJSA 2N35A 4KO8A 2Q2EB 2UUCM 2Z4RA 2R65A 3M7GA 3LCUA 4IBIA 1ZMUA 2MR9A 2C5RA 2XGNA 4JYAM 4JI2M 1PJTA 1HT1E 1QDTA 2DHYA 4GIPA 4M9SA 4PD2A 5C18A 1NJGA 3A46A 1IN4A 3DFZA 2XSZA 4RNAA 3J7BA 1TF0B 3T6PA 3SASA 1XNRM 1GJTA 2LWXA 3SYLA 4II7A 1NY5A 2XFSA 4BB9A 4LZJA 3KP1E 3RE8A 1N77A 1R7RA 1C7YA 2QSFX 2JY6B 2K9DA 2ERCA 3QYBA 2DWLA 3UMMA 1N75A 4IBEA 2R45A 3C58A 1IN8A 3T1YM 3NBIA 1C1KA 3HX3A 4EIWA 3MJ5A 1IN5A 2VF8A 3I4VA 4LF4M 2OOBA 3FRHA 3QAUA 2L4FA 3HHYA 2C98A 1UFZA 2OOAA 1DGFA 4LJ8A 3UK6A 2EKKA 4QHSA 1IFYA 1ZMVA 1TGUA 2G3QA 2HL7A 4B7HA 3FRIA 1GABA 4AKHA 2Z4SA 1DGHB 3BOSA 5ITYA 4JI6M 3LW5F 2W82A 4LF5M 3E21A 2YFQA 1IXSB 2LBCA 1NV9A 4AZFA 3DA1A 3Q8GA 3A98B 3FUWA 1V33A 2JP7A 4D82A 1XHBA 2GNOA 5BPVA 3PXGA 1LTMA 2XZFA 4PDIA 3AJIB 3UJNA 3SAWA 3K92A 4MGZE 2QBYA 1E94E 1PJQA 2M60A 1SXJD 4LF6M 4W5WA 3B7ZA 2R6FA 2DWNA 3C3EA 1Z5BA 3KW6A 3PFIA 4FWHA 1EFUB 1VDDA 4M9ZA 2QENA 3ZCBB 4NRVA 1XB2B 1HNXM 4LFCM 3GLHA 4D81A 4F1IA 2CEAA 3GLIE 1VEGA 5DNYA 2DXIA 2KA6B 4DBGB 3FUXA 4BBAA 5IZ7D 2R4EA 1QVRA 2LXEA 1NHWC 4ITQA 3D8LA 3J80S 3GRVA 3K9PA 4LJ6A 1XMOM 1DV0A 3SMPA 3I01M 4IJEA 2OQ4A 2Z8YM 3SYKA 2I7PA 1QZMA 1E9RA 1VG5A 1TR8A 2FOIC 4FCWA 1X37A 2QNJA 5C1BA 3U6LA 1ZMWA 2BWBA 5FTMA 3W0LB 3L26A 2J7OA 3MMPA 1QYRA 1TTEA 2MROB 1V92A 4GHAA 4LJAA 2KNVA 4LJ5A 4NC6A 1OJLA 3KSJA 3BXWA 2BJWA 2HKJA 3JR4A 3FUTA 3U6OA 1QDRA 2GQFA 4FVMA 2CV0A 4IBGA 4IBKA 4LGMA 4HL4A 5F3WA 1WXQA 5BR8M 2CP8A 2ZAMA 3VDPA 4LJ7A 3SHGB 4DV3M 5LMNM 4JV5M 1ZAEA 2Y0QA 3HU1A 1J5EM 3VFDA 2CV2A 2LHGA 3HJ8A 3K9OA 3CTWB 1MJGM 4Y28F 2DWMA 4NSRA 4FWGA 4B08A 1K82A 4IBBA 3B89A 3U61B 2ZTCA 2Z3XA 1ZQ9A 1FJGM 2R18A 1R6BX 3DZDA 3LCVB 1TH4A 4JXJA 1L1ZA 4L8RC 1XWIA 4JI1M 3KP0E 3U60B 4NRWA 1L1TA 3TE6A 3GRRA 5EJCA 2L2DA 3AV0A 3M0EA 3FTEA 2QCUA 4RF0A 3SARA 2DHRA 3DOAA 4KODA 3L25A 2L7HA 1YSYA 3GLHE 3LQRA 2B3TA 4B7FA 5FLXS 2UXBM 1OAOC 3GQ5A 1GL7A 3SC3A 1I94M 1YE9A 3L27A 2F5NA 1VDLA 3GQ3A 2L09A 2UUBM 3FYDA 1I4WA 2K6BA 1DGHA 4LJ9A 3OTOM 1PJIA 4LJ4A 3BBZA 3LVWA 1IY2A 2JZ1A 2JUJA 3C9PA 2HCBA 1BVSA 2FS1A 3R8FA 2VQFM 3KVWA 1VQ1A 5ITUA 2CFOA 4B3RM 2RRUA 3AOEC 4B3SM 1T3TA 3IG8A 3MK6A 3HHXA 1A5TA 1MX0A 4GC5A 3JAMS 4GH9A 2BWEA 4DV4M 2G5GX 3M6AA 4KT0F 4XK8F 1NNJA 1OIPA 2XZUA 1DO2A 1TDZA 4L16A 4WURA 5ITQA 2BJVA 5DYGA 2F5OA 2LVOC 1JB0F 4OU7A 2ZBKB 4YY3M 3K8ZA 2LHCA 3FD9A 5IREB 4X66M 4X65M 5A2QS 4CIZA 1KFVA 1Y8GA 1JR3A 3U6PA 4K0KM 1Z5AA 1NV8A 1QUTA 3EIEA 1Q39A 4MGIE 1Z6TA 4CHTB 3HHZA 4GKJM 4UN2B 1OKSA 1IXRC 4NXNM 1L8QA 2CWBA 2M5ZA 3PNYA 4DV2M 4Z8XA 2XLJA 3HJSA 5EXSA 4DV0M 1IXSA 2CHGA 4DR1M 2X8AA 2WSEF 4S12A 2UU9M 4M9XA 4QNRA 3KXEC 4LF9M 4HLQA 7CATA 2XSZD 3L29A 1XXHB 2QBYB 5DFLA 2APLA 3GLGA 4G4QA 1PRBA 2J5YA 4WP2A 2KEBA 2NQ8C 2KRUA 1OFHA 2K0BX 4GRIA 3VKHA 4X62M 4GHLA 1L2DA 1WJ7A 5EXTA 2FFJA 2KNAA 3FTFA 3GLIA 1WGLA 1IM2A 4TUWA 5IT9S 1D0MA 3HHWA 1N32M 3AOGA 3C3DA 4QOSA 1IY1A 3T38A 2CHVA 5KPTA 1HJPA 2O25A 4G3OA 4GC9A 3KSXA 1XC8A 3CF0A 3QYEA 1AIPC 1G59A 4MM3B 4QOZC 4LG2A 3AKZA 3TWLA 4NSOB 1HT2E 1TDHA 5FTNA 3NWLA
chains in the Genus database with same CATH topology
2DI0A 1WR1B 4R71A 2KHHA 3H4JA 3K9OA 2DZLA 1PGYA 2DNAA 2QHOB 4F2LA 2DAIA 1F4IA 3B89A 2ZTCA 2EJSA 2JZ0A 3LCUA 1ZMUA 2MR9A 3LCVB 3IHPA 2DHYA 1HT1E 3GLGE 2L2DA 3T6PA 2L4EA 3GLHE 2B3TA 2LVQD 1G4AE 2LVAA 1G3IA 1C7YA 2QSFX 2JY6B 2JY5A 2MJ5B 2K9DA 1R4GA 1VDLA 2MGWA 3BBZA 2JZ1A 1DO0A 2JUJA 1BVSA 2LVPC 1VQ1A 3F92A 2RRUA 2OOBA 3FRHA 2L4FA 1UFZA 2OOAA 1A5TA 2EKKA 1IFYA 1ZMVA 2G3QA 2BWEA 2WZJA 3FRIA 1OAIA 2DAMA 1DO2A 2JY7A 3E21A 1ZV1A 2LBCA 1MN3A 2LVOC 1NV9A 1YLAA 3FE3A 2JP7A 2DAGA 2DKLA 2DENA 1Y8GA 1Q02A 1NV8A 1GO5A 4Q7JA 1E94E 1WGNA 1XXHE 4UN2B 1OKSA 2OO9A 3GLFE 1T6OA 2CWBA 5JI2E 1IXSA 1EFUB 1XB2B 4F1IA 3GLIE 1VEGA 2LVNC 1KYIA 5DFLA 4DBGB 2JNHA 2R0IA 1QZEA 2DAKA 4WP2A 4GEWA 1T43A 3K9PA 2KNZA 2HAKA 2K0BX 1SG9A 1OTRA 1DV0A 3E46A 1WJ7A 1VEJA 2KNAA 1VG5A 1TR8A 1WGLA 1IM2A 1CUKA 2EKFA 2JY8A 2HWJA 2QNJA 1ZMWA 2BWBA 1HJPA 2O25A 2ZTDA 4G3OA 1OQYA 3MMPA 1P3QQ 1VEKA 2H5XA 1TTEA 1WIVA 1V92A 2MROB 2DAEA 2KNVA 3IECA 1G41A 2LTUA 1AIPC 1WHCA 1HQYE 1JR3E 4HEOA 1HT2E 2CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI0 A;  1WR1 B;  4R71 A;  2KHH A;  3H4J A;  3K9O A;  2DZL A;  1PGY A;  2DNA A;  2QHO B;  4F2L A;  2DAI A;  1F4I A;  3B89 A;  2ZTC A;  2EJS A;  2JZ0 A;  3LCU A;  1ZMU A;  2MR9 A;  3LCV B;  3IHP A;  2DHY A;  1HT1 E;  3GLG E;  2L2D A;  3T6P A;  2L4E A;  3GLH E;  2B3T A;  2LVQ D;  1G4A E;  2LVA A;  1G3I A;  1C7Y A;  2QSF X;  2JY6 B;  2JY5 A;  2MJ5 B;  2K9D A;  1R4G A;  1VDL A;  2MGW A;  3BBZ A;  2JZ1 A;  1DO0 A;  2JUJ A;  1BVS A;  2LVP C;  1VQ1 A;  3F92 A;  2RRU A;  2OOB A;  3FRH A;  2L4F A;  1UFZ A;  2OOA A;  1A5T A;  2EKK A;  1IFY A;  1ZMV A;  2G3Q A;  2BWE A;  2WZJ A;  3FRI A;  1OAI A;  2DAM A;  1DO2 A;  2JY7 A;  3E21 A;  1ZV1 A;  2LBC A;  1MN3 A;  2LVO C;  1NV9 A;  1YLA A;  3FE3 A;  2JP7 A;  2DAG A;  2DKL A;  2DEN A;  1Y8G A;  1Q02 A;  1NV8 A;  1GO5 A;  4Q7J A;  1E94 E;  1WGN A;  1XXH E;  4UN2 B;  1OKS A;  2OO9 A;  3GLF E;  1T6O A;  2CWB A;  5JI2 E;  1IXS A;  1EFU B;  1XB2 B;  4F1I A;  3GLI E;  1VEG A;  2LVN C;  1KYI A;  5DFL A;  4DBG B;  2JNH A;  2R0I A;  1QZE A;  2DAK A;  4WP2 A;  4GEW A;  1T43 A;  3K9P A;  2KNZ A;  2HAK A;  2K0B X;  1SG9 A;  1OTR A;  1DV0 A;  3E46 A;  1WJ7 A;  1VEJ A;  2KNA A;  1VG5 A;  1TR8 A;  1WGL A;  1IM2 A;  1CUK A;  2EKF A;  2JY8 A;  2HWJ A;  2QNJ A;  1ZMW A;  2BWB A;  1HJP A;  2O25 A;  2ZTD A;  4G3O A;  1OQY A;  3MMP A;  1P3Q Q;  1VEK A;  2H5X A;  1TTE A;  1WIV A;  1V92 A;  2MRO B;  2DAE A;  2KNV A;  3IEC A;  1G41 A;  2LTU A;  1AIP C;  1WHC A;  1HQY E;  1JR3 E;  4HEO A;  1HT2 E;  2CP8 A; 
#chains in the Genus database with same CATH topology
 1OIZ A;  4LFA M;  2CE7 A;  3T15 A;  3HY5 A;  3U60 A;  3GPU A;  2F5Q A;  4IJF A;  3VDU A;  2VDB B;  1G71 A;  3ZC7 B;  3KS8 A;  4G4R A;  2D7H A;  1UM8 A;  2WSF F;  4P17 A;  3U5Z A;  2DNA A;  1SXJ C;  2QHO B;  4LCB A;  2OPF A;  4LFB M;  1Z5C A;  1F4I A;  1D2N A;  2V6Z M;  4P16 A;  2Y21 A;  1RU3 A;  2JZ0 A;  3K2L A;  4DR4 M;  3TPZ A;  3I4Y A;  3IHP A;  4XBO A;  3GPY A;  1K3W A;  1NSF A;  2H1R A;  2YNM D;  4IIW A;  4ANR A;  3U6D A;  3GLG E;  3GLI B;  2F5S A;  4GKK M;  1IY0 A;  2Y20 A;  2HHH M;  3KOW E;  3FKE A;  1QAO A;  2LVA A;  1G3I A;  5ITR A;  2MJ5 B;  2JY5 A;  1QAN A;  4OX9 M;  2A5Y B;  4YHH M;  4AI6 A;  2VII A;  2F4V M;  3MHV C;  1KSF X;  3HZJ A;  1L2C A;  4X64 M;  2CRU A;  2LVP C;  1MU5 A;  4RF1 A;  4JI4 M;  2FNA A;  1PM5 A;  3FTD A;  4JI8 M;  1E9S A;  3R9X B;  1E32 A;  4DV6 M;  3HU3 A;  4I81 A;  4A3V B;  2JXN A;  1PJJ A;  4L6V 6;  2JA2 A;  1NHG C;  3T1H M;  3HJQ A;  2DAM A;  5KPZ A;  1IN7 A;  1NNU C;  2JY7 A;  1JQJ C;  4G4O A;  3HU2 A;  3B9P A;  3NBX X;  3KS4 A;  1MN3 A;  4AG6 A;  3AFH A;  3TQS A;  5FSW A;  2KZU A;  3TL4 X;  5ITX E;  5JI3 E;  3FE3 A;  2ZAN A;  3CF2 A;  4MGK E;  3SBJ A;  1J7K A;  2DAG A;  2DKL A;  4AW4 A;  2DEN A;  1NY6 A;  1PJS A;  4Q7J A;  1SXJ A;  2C96 A;  1WGN A;  2Y0T A;  3SHF A;  2OO9 A;  3GLF E;  4PCZ A;  2JWS A;  2QZ4 A;  4MB7 A;  2XEP A;  4JN6 A;  3WHL A;  4NXM M;  5JI2 E;  1W5S A;  3LMM A;  5EXP A;  3FYC A;  4DR5 M;  3UZU A;  5EP2 A;  3WHK A;  3KOZ E;  2E5L M;  3GO8 A;  3GP1 A;  3D8B A;  3HGI A;  4PDG A;  3TWK A;  1ORY B;  2KRK A;  4FWD A;  2L6O A;  3CF6 E;  5IWA M;  3B74 A;  1XNQ M;  1QQW A;  2CHQ A;  3PVS A;  3GQ4 A;  3W67 A;  2FE8 A;  2D7E A;  4FW9 A;  2AHM A;  4GEW A;  3J81 S;  1N33 M;  2KNZ A;  1OTR A;  3W0F A;  4CGY B;  3E46 A;  2Z7J A;  4IBC A;  1VEJ A;  1HR0 M;  5GKN A;  4OVZ B;  2EO2 A;  3GPX A;  4LGY A;  1L2B A;  1CUK A;  1QAM A;  3B7N A;  2HWJ A;  4G4N A;  2R4J A;  3GLG B;  2UUA M;  1NJF A;  3EIH A;  5LMU M;  4WW0 A;  3KDS E;  3E9S A;  2UXC M;  1IN6 A;  1D0K A;  1HNW M;  2UXD M;  2H5X A;  2XFT A;  1WIV A;  3B7Q A;  1SXJ B;  2DAE A;  3IEC A;  1GLN A;  3I04 M;  4LY6 A;  4ZPX A;  3SFZ A;  3U5Z B;  1N36 M;  1HNZ M;  4JI5 M;  3ZH9 B;  3U6E A;  1GVN A;  1WHC A;  1HQY E;  2C99 A;  4HEO A;  4DV5 M;  3HKP A;  2DVW B;  5DYI A;  1EE8 A;  5ITX A;  1R2Z A;  3K1J A;  2LNH C;  2R62 A;  1IXZ A;  2DI0 A;  5EXX A;  3HWS A;  1LV7 A;  5E26 A;  4DV1 M;  1DGG A;  4MH0 E;  2X4A A;  3GLF B;  1PGY A;  4F2L A;  5KQ8 A;  3L28 A;  3A45 A;  1Z59 A;  2DAI A;  1HQC A;  2RKO A;  2RGH A;  2DZO B;  3KOY E;  4LRT A;  3JR5 A;  1GKI A;  4REZ A;  4CJ6 A;  1R2Y A;  3I51 A;  2X49 A;  3Q8X A;  1FNN A;  5KPR A;  3THG A;  4CIS A;  4QNM A;  1IBK M;  3UGJ A;  2YR0 A;  4Z6Y A;  4DUY M;  4OVZ A;  4B3M M;  2O01 F;  2DWZ B;  2L7I A;  4DR6 M;  3FUU A;  2XF3 A;  1DGB A;  1QAQ A;  2K47 A;  1K3X A;  2KXE A;  2L4E A;  2LVQ D;  3LVV A;  2KW0 A;  5ITT A;  4DR2 M;  1G4A E;  3L2A A;  2QQ8 A;  3GRY A;  5FTL A;  4BLC A;  1H6U A;  5EP3 A;  1NVM A;  1R4G A;  3VLF B;  3ZQJ A;  3QWL A;  2MGW A;  4RKU F;  3V76 A;  4IBD A;  2EUC A;  3LQQ A;  1XXH A;  1DO0 A;  2QP9 X;  3GPP A;  2CUZ A;  1SXJ E;  3AOE A;  1QUS A;  2KZS A;  3RFW A;  3F92 A;  2R46 A;  3VK7 A;  2F5P A;  3VK8 A;  4DV7 M;  4I8O A;  3U6S A;  2DZN B;  2WZJ A;  1OAI A;  5EP1 A;  3IG5 A;  4DUZ M;  3SAV A;  3SAU A;  1Q3B A;  4R3D A;  4LZZ A;  1V34 A;  1ZV1 A;  2O5R A;  3U61 A;  4IBF A;  1W5T A;  3H4M A;  4FCT A;  3J7A S;  1IQP A;  2KDL A;  1YLA A;  4GMQ A;  4I5S A;  2EA0 A;  3RGP A;  3GLH B;  1Q02 A;  4FD2 A;  4B3T M;  2QPA A;  4JI0 M;  1GO5 A;  1XMQ M;  3AL0 C;  1XXH E;  1T6O A;  4I4L A;  4LF7 M;  3U6Q A;  1OFI A;  2YQZ A;  1TH2 A;  4KLN A;  2VF7 A;  3KOX E;  4B7G A;  3TWM A;  3GRU A;  3KFU G;  2VQE M;  3U6M A;  4JI3 M;  2LVN C;  1GL6 A;  1KYI A;  4LF8 M;  2V1U A;  5EP4 A;  2JNH A;  4MGY E;  1IBM M;  3VKG A;  2R0I A;  2MH8 A;  5H37 D;  1QZE A;  2DAK A;  1N78 A;  4D80 A;  2G8L A;  5L8R F;  4R7G A;  3ILK A;  1T43 A;  4PT5 A;  2HAK A;  2I7N A;  3J2P B;  1SG9 A;  4DR7 M;  1EIJ A;  3E4R A;  4FCV A;  2LH0 A;  5E6J A;  2R44 A;  2C9C A;  1D0L A;  1S3S A;  4JI7 M;  5KO3 A;  2EKF A;  2JY8 A;  3FTC A;  2C9O A;  4XGI A;  1G8P A;  3SAT A;  1GJS A;  4OW0 A;  5FTK A;  2WSC F;  2P5T A;  2ZTD A;  5FTJ A;  3SMS A;  3W68 A;  2ZAO A;  1OQY A;  3J27 B;  1IBL M;  1P3Q Q;  1AUA A;  1VEK A;  2RGO A;  2XH9 A;  1J09 A;  2CV1 A;  4L4U A;  2FH0 A;  3CGW A;  1G41 A;  2LTU A;  3PNV A;  3RGS A;  3GLF A;  4GIT A;  1N34 M;  4DR3 M;  4L78 A;  2D7G A;  1JR3 D;  2J7N A;  4AKI A;  1JR3 E;  4LRS A;  2V1C A;  4QHT A;  5EQT A;  3U6C A;  1NO1 A;  4NOO B;  4G6Z A;  4L15 A;  4AG5 A;  1TH3 A;  4KHP M;  1WR1 B;  4IBJ A;  4R71 A;  1Q3C A;  4M0W A;  2KHH A;  3A42 A;  3H4J A;  4M0D A;  5KQD A;  2DZL A;  4AKG A;  3FUV A;  2ZM6 M;  1YUB A;  8CAT A;  4NL4 H;  4MGH A;  1R5L A;  4AQY M;  2BNK A;  2EJS A;  2N35 A;  4KO8 A;  2Q2E B;  2UUC M;  2Z4R A;  2R65 A;  3M7G A;  3LCU A;  4IBI A;  1ZMU A;  2MR9 A;  2C5R A;  2XGN A;  4JYA M;  4JI2 M;  1PJT A;  1HT1 E;  1QDT A;  2DHY A;  4GIP A;  4M9S A;  4PD2 A;  5C18 A;  1NJG A;  3A46 A;  1IN4 A;  3DFZ A;  2XSZ A;  4RNA A;  3J7B A;  1TF0 B;  3T6P A;  3SAS A;  1XNR M;  1GJT A;  2LWX A;  3SYL A;  4II7 A;  1NY5 A;  2XFS A;  4BB9 A;  4LZJ A;  3KP1 E;  3RE8 A;  1N77 A;  1R7R A;  1C7Y A;  2QSF X;  2JY6 B;  2K9D A;  2ERC A;  3QYB A;  2DWL A;  3UMM A;  1N75 A;  4IBE A;  2R45 A;  3C58 A;  1IN8 A;  3T1Y M;  3NBI A;  1C1K A;  3HX3 A;  4EIW A;  3MJ5 A;  1IN5 A;  2VF8 A;  3I4V A;  4LF4 M;  2OOB A;  3FRH A;  3QAU A;  2L4F A;  3HHY A;  2C98 A;  1UFZ A;  2OOA A;  1DGF A;  4LJ8 A;  3UK6 A;  2EKK A;  4QHS A;  1IFY A;  1ZMV A;  1TGU A;  2G3Q A;  2HL7 A;  4B7H A;  3FRI A;  1GAB A;  4AKH A;  2Z4S A;  1DGH B;  3BOS A;  5ITY A;  4JI6 M;  3LW5 F;  2W82 A;  4LF5 M;  3E21 A;  2YFQ A;  1IXS B;  2LBC A;  1NV9 A;  4AZF A;  3DA1 A;  3Q8G A;  3A98 B;  3FUW A;  1V33 A;  2JP7 A;  4D82 A;  1XHB A;  2GNO A;  5BPV A;  3PXG A;  1LTM A;  2XZF A;  4PDI A;  3AJI B;  3UJN A;  3SAW A;  3K92 A;  4MGZ E;  2QBY A;  1E94 E;  1PJQ A;  2M60 A;  1SXJ D;  4LF6 M;  4W5W A;  3B7Z A;  2R6F A;  2DWN A;  3C3E A;  1Z5B A;  3KW6 A;  3PFI A;  4FWH A;  1EFU B;  1VDD A;  4M9Z A;  2QEN A;  3ZCB B;  4NRV A;  1XB2 B;  1HNX M;  4LFC M;  3GLH A;  4D81 A;  4F1I A;  2CEA A;  3GLI E;  1VEG A;  5DNY A;  2DXI A;  2KA6 B;  4DBG B;  3FUX A;  4BBA A;  5IZ7 D;  2R4E A;  1QVR A;  2LXE A;  1NHW C;  4ITQ A;  3D8L A;  3J80 S;  3GRV A;  3K9P A;  4LJ6 A;  1XMO M;  1DV0 A;  3SMP A;  3I01 M;  4IJE A;  2OQ4 A;  2Z8Y M;  3SYK A;  2I7P A;  1QZM A;  1E9R A;  1VG5 A;  1TR8 A;  2FOI C;  4FCW A;  1X37 A;  2QNJ A;  5C1B A;  3U6L A;  1ZMW A;  2BWB A;  5FTM A;  3W0L B;  3L26 A;  2J7O A;  3MMP A;  1QYR A;  1TTE A;  2MRO B;  1V92 A;  4GHA A;  4LJA A;  2KNV A;  4LJ5 A;  4NC6 A;  1OJL A;  3KSJ A;  3BXW A;  2BJW A;  2HKJ A;  3JR4 A;  3FUT A;  3U6O A;  1QDR A;  2GQF A;  4FVM A;  2CV0 A;  4IBG A;  4IBK A;  4LGM A;  4HL4 A;  5F3W A;  1WXQ A;  5BR8 M;  2CP8 A;  2ZAM A;  3VDP A;  4LJ7 A;  3SHG B;  4DV3 M;  5LMN M;  4JV5 M;  1ZAE A;  2Y0Q A;  3HU1 A;  1J5E M;  3VFD A;  2CV2 A;  2LHG A;  3HJ8 A;  3K9O A;  3CTW B;  1MJG M;  4Y28 F;  2DWM A;  4NSR A;  4FWG A;  4B08 A;  1K82 A;  4IBB A;  3B89 A;  3U61 B;  2ZTC A;  2Z3X A;  1ZQ9 A;  1FJG M;  2R18 A;  1R6B X;  3DZD A;  3LCV B;  1TH4 A;  4JXJ A;  1L1Z A;  4L8R C;  1XWI A;  4JI1 M;  3KP0 E;  3U60 B;  4NRW A;  1L1T A;  3TE6 A;  3GRR A;  5EJC A;  2L2D A;  3AV0 A;  3M0E A;  3FTE A;  2QCU A;  4RF0 A;  3SAR A;  2DHR A;  3DOA A;  4KOD A;  3L25 A;  2L7H A;  1YSY A;  3GLH E;  3LQR A;  2B3T A;  4B7F A;  5FLX S;  2UXB M;  1OAO C;  3GQ5 A;  1GL7 A;  3SC3 A;  1I94 M;  1YE9 A;  3L27 A;  2F5N A;  1VDL A;  3GQ3 A;  2L09 A;  2UUB M;  3FYD A;  1I4W A;  2K6B A;  1DGH A;  4LJ9 A;  3OTO M;  1PJI A;  4LJ4 A;  3BBZ A;  3LVW A;  1IY2 A;  2JZ1 A;  2JUJ A;  3C9P A;  2HCB A;  1BVS A;  2FS1 A;  3R8F A;  2VQF M;  3KVW A;  1VQ1 A;  5ITU A;  2CFO A;  4B3R M;  2RRU A;  3AOE C;  4B3S M;  1T3T A;  3IG8 A;  3MK6 A;  3HHX A;  1A5T A;  1MX0 A;  4GC5 A;  3JAM S;  4GH9 A;  2BWE A;  4DV4 M;  2G5G X;  3M6A A;  4KT0 F;  4XK8 F;  1NNJ A;  1OIP A;  2XZU A;  1DO2 A;  1TDZ A;  4L16 A;  4WUR A;  5ITQ A;  2BJV A;  5DYG A;  2F5O A;  2LVO C;  1JB0 F;  4OU7 A;  2ZBK B;  4YY3 M;  3K8Z A;  2LHC A;  3FD9 A;  5IRE B;  4X66 M;  4X65 M;  5A2Q S;  4CIZ A;  1KFV A;  1Y8G A;  1JR3 A;  3U6P A;  4K0K M;  1Z5A A;  1NV8 A;  1QUT A;  3EIE A;  1Q39 A;  4MGI E;  1Z6T A;  4CHT B;  3HHZ A;  4GKJ M;  4UN2 B;  1OKS A;  1IXR C;  4NXN M;  1L8Q A;  2CWB A;  2M5Z A;  3PNY A;  4DV2 M;  4Z8X A;  2XLJ A;  3HJS A;  5EXS A;  4DV0 M;  1IXS A;  2CHG A;  4DR1 M;  2X8A A;  2WSE F;  4S12 A;  2UU9 M;  4M9X A;  4QNR A;  3KXE C;  4LF9 M;  4HLQ A;  7CAT A;  2XSZ D;  3L29 A;  1XXH B;  2QBY B;  5DFL A;  2APL A;  3GLG A;  4G4Q A;  1PRB A;  2J5Y A;  4WP2 A;  2KEB A;  2NQ8 C;  2KRU A;  1OFH A;  2K0B X;  4GRI A;  3VKH A;  4X62 M;  4GHL A;  1L2D A;  1WJ7 A;  5EXT A;  2FFJ A;  2KNA A;  3FTF A;  3GLI A;  1WGL A;  1IM2 A;  4TUW A;  5IT9 S;  1D0M A;  3HHW A;  1N32 M;  3AOG A;  3C3D A;  4QOS A;  1IY1 A;  3T38 A;  2CHV A;  5KPT A;  1HJP A;  2O25 A;  4G3O A;  4GC9 A;  3KSX A;  1XC8 A;  3CF0 A;  3QYE A;  1AIP C;  1G59 A;  4MM3 B;  4QOZ C;  4LG2 A;  3AKZ A;  3TWL A;  4NSO B;  1HT2 E;  1TDH A;  5FTN A;  3NWL A; 
#chains in the Genus database with same CATH homology
 2DI0 A;  1WR1 B;  4R71 A;  2KHH A;  3H4J A;  3K9O A;  2DZL A;  1PGY A;  2DNA A;  2QHO B;  4F2L A;  2DAI A;  1F4I A;  3B89 A;  2ZTC A;  2EJS A;  2JZ0 A;  3LCU A;  1ZMU A;  2MR9 A;  3LCV B;  3IHP A;  2DHY A;  1HT1 E;  3GLG E;  2L2D A;  3T6P A;  2L4E A;  3GLH E;  2B3T A;  2LVQ D;  1G4A E;  2LVA A;  1G3I A;  1C7Y A;  2QSF X;  2JY6 B;  2JY5 A;  2MJ5 B;  2K9D A;  1R4G A;  1VDL A;  2MGW A;  3BBZ A;  2JZ1 A;  1DO0 A;  2JUJ A;  1BVS A;  2LVP C;  1VQ1 A;  3F92 A;  2RRU A;  2OOB A;  3FRH A;  2L4F A;  1UFZ A;  2OOA A;  1A5T A;  2EKK A;  1IFY A;  1ZMV A;  2G3Q A;  2BWE A;  2WZJ A;  3FRI A;  1OAI A;  2DAM A;  1DO2 A;  2JY7 A;  3E21 A;  1ZV1 A;  2LBC A;  1MN3 A;  2LVO C;  1NV9 A;  1YLA A;  3FE3 A;  2JP7 A;  2DAG A;  2DKL A;  2DEN A;  1Y8G A;  1Q02 A;  1NV8 A;  1GO5 A;  4Q7J A;  1E94 E;  1WGN A;  1XXH E;  4UN2 B;  1OKS A;  2OO9 A;  3GLF E;  1T6O A;  2CWB A;  5JI2 E;  1IXS A;  1EFU B;  1XB2 B;  4F1I A;  3GLI E;  1VEG A;  2LVN C;  1KYI A;  5DFL A;  4DBG B;  2JNH A;  2R0I A;  1QZE A;  2DAK A;  4WP2 A;  4GEW A;  1T43 A;  3K9P A;  2KNZ A;  2HAK A;  2K0B X;  1SG9 A;  1OTR A;  1DV0 A;  3E46 A;  1WJ7 A;  1VEJ A;  2KNA A;  1VG5 A;  1TR8 A;  1WGL A;  1IM2 A;  1CUK A;  2EKF A;  2JY8 A;  2HWJ A;  2QNJ A;  1ZMW A;  2BWB A;  1HJP A;  2O25 A;  2ZTD A;  4G3O A;  1OQY A;  3MMP A;  1P3Q Q;  1VEK A;  2H5X A;  1TTE A;  1WIV A;  1V92 A;  2MRO B;  2DAE A;  2KNV A;  3IEC A;  1G41 A;  2LTU A;  1AIP C;  1WHC A;  1HQY E;  1JR3 E;  4HEO A;  1HT2 E;  2CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...