2KNZA

Nmr structure of cip75 uba domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
b'GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquilin-4
publication title NMR structure note: UBA domain of CIP75.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knzA00
1HQYE 2OOBA 1Q02A 1TR8A 1ZV1A 1G3IA 3FRIA 3LCUA 3B89A 3E21A 2JY8A 1G41A 5DFLA 1GO5A 3IHPA 2KNZA 1MN3A 3K9PA 2DNAA 1HT2E 1HT1E 2LVPC 3BBZA 2CWBA 2CP8A 2H5XA 2JZ0A 4HEOA 4F1IA 1XB2B 1R4GA 3H4JA 1V92A 2O25A 1A5TA 1OTRA 1VEJA 2DAMA 2DENA 2K9DA 1IXSA 4UN2B 1XXHE 2JUJA 4WP2A 1F4IA 1DO0A 1NV8A 2LVAA 4G3OA 2DZLA 2LBCA 3FE3A 1Y8GA 1G4AE 2MROB 1JR3E 3LCVB 2DAEA 2EJSA 3FRHA 2JP7A 2DI0A 1VEGA 2JY7A 1WHCA 1YLAA 2K0BX 4DBGB 2EKFA 1DV0A 2QHOB 2R0IA 2ZTDA 1AIPC 1VEKA 2DAGA 3F92A 3IECA 2KNAA 1UFZA 1E94E 2JY6B 3MMPA 3GLIE 2LVQD 1SG9A 2EKKA 1ZMWA 2LVOC 2OO9A 1C7YA 1EFUB 4GEWA 5JI2E 2RRUA 1OQYA 1T6OA 1VDLA 2JNHA 1QZEA 2DAIA 2L2DA 1WJ7A 3K9OA 4R71A 1VG5A 2L4EA 2BWBA 4F2LA 1BVSA 2KHHA 1T43A 2DAKA 2G3QA 1IFYA 1IM2A 1VQ1A 2QNJA 2MJ5B 4Q7JA 3T6PA 2L4FA 2DHYA 1HJPA 2DKLA 2HAKA 2MGWA 2LVNC 1TTEA 3E46A 2BWEA 2MR9A 2B3TA 1WGNA 3GLGE 1PGYA 1WIVA 1NV9A 3GLHE 1WGLA 2OOAA 2WZJA 2ZTCA 1P3QQ 1ZMUA 1CUKA 2HWJA 1WR1B 1OAIA 1ZMVA 2QSFX 1OKSA 2KNVA 3GLFE 1DO2A 2LTUA 1KYIA 2JY5A 2JZ1A
chains in the Genus database with same CATH superfamily
3C9PA 3AOEA 2QCUA 3FUWA 2OOBA 3UZUA 5LMUM 4NSRA 1G3IA 4QNMA 3K8ZA 4GKKM 3IHPA 3UJNA 2KA6B 2J5YA 3M6AA 1MN3A 3RE8A 4KO8A 3FUXA 1NJFA 4PD2A 4WURA 2YNMD 2Y20A 1HT1E 3BBZA 2JZ0A 4HEOA 1N33M 2R4JA 2R6FA 4EIWA 1L1ZA 4FW9A 3SYLA 3GRYA 1R2ZA 4DV0M 3J81S 2ZAOA 3GLHB 2QP9X 2QZ4A 1V92A 4IBBA 1DGHA 1OTRA 4MGKE 3LQRA 2D7GA 2DENA 5EJCA 1G59A 2EUCA 4UN2B 1GJTA 2AHMA 1XXHE 2RGOA 1K82A 4LJ8A 1DO0A 2O01F 2YR0A 4G3OA 2DZLA 4AG5A 3M0EA 2XFSA 4MH0E 3FE3A 3GLFB 1I94M 4P17A 3FD9A 2C96A 2DZOB 3LCVB 2XLJA 2R18A 4HLQA 1SXJE 2WSFF 3U61B 2DAEA 2EJSA 3LMMA 4XGIA 1IN6A 5ITXA 3GPXA 3HHWA 4IBCA 3JAMS 5IT9S 1DGBA 1WHCA 1YLAA 2D7HA 3FTCA 3U6PA 1PJJA 2XFTA 4LF9M 4GIPA 3E9SA 1AIPC 1YE9A 1IBLM 3L25A 2R44A 4P16A 1OFIA 2KNAA 3HX3A 3JR4A 4RNAA 4LF4M 4QHSA 1PJQA 8CATA 4JI7M 2HHHM 3ZQJA 3SAWA 1S3SA 4L15A 2OO9A 4G4NA 1EFUB 3B7ZA 2FFJA 5IZ7D 5EP1A 2QBYA 2XGNA 3J2PB 2I7PA 3FTFA 2ERCA 1T6OA 1VDLA 2JNHA 2XSZA 4LY6A 2VQEM 2UUAM 2WSCF 2K6BA 2DWMA 1IN7A 4I8OA 3GPPA 3FYCA 4ITQA 1XXHB 4OVZA 4F2LA 1IY1A 4L78A 2FH0A 3GO8A 5F3WA 4GC5A 4GITA 2KEBA 4AI6A 3KSJA 1TH2A 1IFYA 2VQFM 3R8FA 2CV2A 3LW5F 3EIEA 4MGYE 3VKHA 1SXJB 2RGHA 5DYIA 3T6PA 2L4FA 5IREB 2H1RA 3SHFA 2MGWA 4DV2M 3NBIA 3HJ8A 1TTEA 4M9SA 2W82A 4LG2A 1EIJA 1T3TA 2UXCM 2B3TA 4CIZA 5DNYA 2Z7JA 4DV6M 3A98B 3PNYA 4OU7A 1PGYA 1R7RA 4FWGA 3SMSA 3SAUA 4RF0A 4CISA 1WIVA 1NJGA 4DR7M 1NV9A 2EA0A 4QOSA 4DV4M 2F5QA 1WGLA 2UUBM 2WZJA 2Q2EB 2LHCA 4X62M 4JV5M 2ZM6M 5KPZA 1W5TA 2V6ZM 4Z6YA 3QWLA 3FUUA 1OAIA 1LTMA 2C5RA 3KXEC 2J7NA 2KXEA 2JXNA 2QPAA 3LVVA 4L16A 4NXNM 1V33A 5DYGA 2ZANA 3W67A 1XC8A 2CV1A 1NHGC 2ZBKB 1D0KA 1TGUA 2M5ZA 2KZSA 4NRWA 1NNUC 3EIHA 1Z5BA 3U6OA 4ANRA 1JQJC 4KT0F 1HQCA 2LHGA 1IBMM 2LH0A 1G41A 1XWIA 3HKPA 4DV1M 1HNXM 4QNRA 3I4YA 1QVRA 3L27A 4GMQA 4MB7A 2GQFA 3HWSA 3VK7A 2CWBA 3VDPA 4F1IA 3AKZA 4KHPM 3VLFB 4ZPXA 3SHGB 4B08A 5ITRA 1R4GA 1QUTA 2FS1A 4B3MM 3FTEA 1NVMA 5ITYA 2C9CA 3Q8GA 2YFQA 2JWSA 2X49A 2RKOA 3HHXA 3T15A 4IJEA 2XZUA 1G71A 4JI4M 1OIPA 4LF5M 1A5TA 3TWMA 5EXXA 2EO2A 2BJVA 4CHTB 3I51A 2D7EA 4WP2A 1I4WA 2KW0A 2ZAMA 5FTJA 4D81A 1F4IA 1NV8A 4YY3M 2M60A 2GNOA 3MJ5A 4NRVA 4X66M 4LRSA 1XMQM 4BBAA 2N35A 5FLXS 3J80S 1Y8GA 3HU3A 1JR3E 1E32A 4B7FA 1L2CA 4CJ6A 4JI5M 3UK6A 1PM5A 3TPZA 1HR0M 2R4EA 4GC9A 4FWDA 3KSXA 4JI0M 3TQSA 5C18A 2FOIC 3U6CA 3A46A 2DWNA 2K0BX 3FUVA 4M0WA 2EKFA 4DBGB 1DV0A 1IY2A 2QHOB 1FNNA 1L8QA 4LCBA 1TF0B 1UM8A 2DAGA 4DR1M 3F92A 1UFZA 2V1CA 5KPTA 3D8BA 3SASA 4BLCA 3GPYA 1NY6A 2VDBB 3J7AS 4LZZA 4PT5A 2RRUA 4CGYB 3GLIA 3U6QA 1TDZA 4B3SM 2DWLA 2XH9A 4REZA 5FTNA 1OJLA 1SXJC 4X65M 2DAIA 1QAOA 1SXJD 1YUBA 2R46A 5FTMA 2QBYB 3RGPA 1WJ7A 2X4AA 3LVWA 3U6LA 2CHVA 2L4EA 3RFWA 2BWBA 5KO3A 1MJGM 5ITQA 1BVSA 2KHHA 4NL4H 3U5ZA 1K3WA 2DAKA 4FVMA 1ORYB 3DFZA 3RGSA 1W5SA 4OVZB 3TE6A 2G3QA 1V34A 3ZCBB 3K1JA 4DR4M 3C3DA 2F5SA 2QNJA 2MJ5B 4AKGA 3W0FA 4Q7JA 2HL7A 3WHLA 1QYRA 5H37D 1R6BX 4JYAM 1IN5A 1GL7A 3L29A 4BB9A 2LVNC 1E9SA 3K92A 3E46A 1IBKM 2BWEA 3KVWA 4MGHA 1N32M 1XNRM 4AKHA 3L26A 3KP1E 3TWKA 3SARA 3MK6A 1ZQ9A 3I01M 2C98A 3U6SA 2P5TA 1Z5CA 1L2DA 3GP1A 2OOAA 1IXZA 3FYDA 1KFVA 2F5PA 4IBIA 1JB0F 2G8LA 3SMPA 1ZMUA 4S12A 2HWJA 5BPVA 3GLHA 2C99A 3CF0A 2FE8A 1ZAEA 3LQQA 1ZMVA 1QAQA 1NNJA 3KS8A 4IJFA 4DR6M 1OKSA 2LXEA 1NY5A 4R3DA 5EXTA 1Q39A 3FTDA 3CF2A 4B7HA 5EQTA 3E4RA 3HJSA 2QENA 3PVSA 5ITTA 4LJ5A 3SYKA 1Q02A 1TR8A 4LF7M 2L7IA 3HGIA 1FJGM 4FCWA 2CE7A 2KNZA 2CRUA 5FSWA 2R62A 3K9PA 3GQ5A 1NO1A 4YHHM 4G4RA 4I4LA 1IN4A 2LVPC 3GLGA 1N77A 4GKJM 2HKJA 3CF6E 1E9RA 2KRKA 1H6UA 3AV0A 3U60B 2E5LM 3KFUG 3A42A 3R9XB 1VEJA 3OTOM 2K9DA 3FUTA 1IXSA 4LJ4A 3C3EA 1J7KA 3VDUA 4B3TM 4IBGA 4LFCM 3W68A 3PFIA 3ZH9B 1QZMA 1NHWC 3M7GA 5ITXE 2F5NA 1XXHA 2Z3XA 1G4AE 2APLA 2MH8A 3GRUA 3MHVC 5L8RF 2J7OA 2CHGA 4IBKA 4JI6M 1AUAA 4G6ZA 1VDDA 1QAMA 2G5GX 2DI0A 3GRRA 3GPUA 3HZJA 4XK8F 4QOZC 3KW6A 3B74A 3QYBA 4AZFA 3H4MA 3KDSE 4GH9A 5E26A 1K3XA 4DV3M 2CUZA 4B7GA 4D82A 4DR5M 1N78A 2ZTDA 5C1BA 3WHKA 3C58A 4RF1A 4JI3M 1TH3A 4FWHA 2L6OA 3T38A 2UXBM 1MU5A 1D0LA 5EP2A 1E94E 3MMPA 3CGWA 4L6V6 1SG9A 1ZMWA 3IG5A 4DUYM 1NSFA 1DGHB 2LVOC 1XHBA 3SC3A 1C7YA 3DOAA 4GEWA 3QAUA 3K2LA 4IBDA 2L7HA 3AOGA 3U6DA 1OQYA 1RU3A 4NXMM 4AQYM 1JR3D 2DZNB 2L2DA 4G4QA 5KQDA 3K9OA 4R71A 3UMMA 1GLNA 3NWLA 4JI1M 3FKEA 1N75A 1T43A 3GQ3A 3I04M 2F5OA 3J27B 5FTLA 3T1YM 1VQ1A 3U5ZB 5IWAM 1DGGA 3B7QA 4D80A 2KDLA 3HJQA 3HY5A 3QYEA 3SAVA 4OX9M 4A3VB 2HAKA 1J5EM 4M0DA 2BJWA 3PNVA 5E6JA 4GHAA 2QQ8A 2CEAA 3HHZA 4NSOB 4HL4A 2DHRA 3KOYE 4LFAM 4LF6M 4L8RC 4RKUF 1WGNA 7CATA 5EXSA 3GLGE 2CHQA 1OAOC 2UXDM 1Z6TA 3Q8XA 2ZTCA 3DZDA 4GHLA 3VKGA 2HCBA 4AKIA 5EP4A 5BR8M 2DWZB 3B7NA 3KOZE 1Q3CA 3W0LB 1N34M 4OW0A 2NQ8C 4NC6A 1Z59A 1QDRA 2KNVA 1IXRC 1GJSA 4GRIA 3TL4X 4LFBM 4Z8XA 2JA2A 1L2BA 1N36M 1YSYA 1HQYE 1ZV1A 3SFZA 3FRIA 3LCUA 3B89A 3E21A 2JY8A 4IBJA 5DFLA 4DR2M 1GO5A 2DVWB 1QUSA 3SATA 4X64M 4IIWA 5LMNM 1PJIA 3KS4A 4M9XA 4WW0A 2DNAA 1HT2E 1PRBA 2KZUA 4IBFA 3D8LA 4R7GA 2CP8A 2H5XA 1QDTA 2O5RA 3I4VA 2A5YB 3KP0E 4IBEA 3HHYA 4KLNA 5EP3A 4XBOA 1XB2B 4PDIA 5JI3E 5EXPA 2BNKA 1HNWM 2VF7A 3GLGB 4L4UA 2KRUA 2R65A 2Z8YM 4K0KM 3HU2A 3H4JA 3V76A 2UU9M 3AOEC 2O25A 1X37A 4LGYA 4LF8M 1OFHA 2DAMA 3DA1A 4PDGA 2K47A 1Q3BA 2JUJA 2LNHC 4LRTA 3GLFA 2FNAA 2LVAA 4LJ9A 3AJIB 1IXSB 3U61A 2LBCA 3JR5A 1D2NA 3KOWE 2Y0QA 2MROB 2VF8A 3CTWB 4LGMA 2F4VM 2R45A 3U6EA 1R2YA 4LJ7A 3FRHA 4LJ6A 2JP7A 3L28A 3PXGA 2CV0A 1QANA 1JR3A 3THGA 1TH4A 2DXIA 2WSEF 4AG6A 4JI8M 1VEGA 4FCVA 1GVNA 2JY7A 5GKNA 5FTKA 5A2QS 1WXQA 1Z5AA 1L1TA 2R0IA 4TUWA 4I81A 2XEPA 4DUZM 3ZC7B 1PJTA 1VEKA 4FCTA 4DV5M 3IECA 4NOOB 3GQ4A 3L2AA 1XNQM 2JY6B 3GLIE 1PJSA 2LVQD 2EKKA 5ITUA 1J09A 2OQ4A 3AFHA 1C1KA 3NBXX 1QQWA 4QHTA 5KPRA 1XMOM 5JI2E 3J7BA 1EE8A 2OPFA 3UGJA 2V1UA 4LJAA 4JN6A 4KODA 1QZEA 3A45A 3IG8A 1GKIA 1GABA 4G4OA 2Z4RA 3SBJA 1HNZM 1VG5A 2L09A 1SXJA 3BXWA 4Y28F 1R5LA 2XZFA 3BOSA 4FD2A 1IQPA 1G8PA 1IM2A 3KOXE 3U6MA 4MM3B 2DHYA 1TDHA 1HJPA 2DKLA 3VK8A 3T1HM 1GL6A 4PCZA 2Z4SA 4AW4A 2MR9A 2I7NA 3AL0C 4DR3M 2XSZD 3GRVA 1IN8A 1KSFX 2YQZA 4II7A 1LV7A 1IY0A 4MGZE 3TWLA 1D0MA 5KQ8A 4JI2M 1DGFA 2Y0TA 4LZJA 3GLHE 2X8AA 4W5WA 3GLIB 1P3QQ 4B3RM 1CUKA 1MX0A 3U60A 1WR1B 3B9PA 2XF3A 4MGIE 2CFOA 4DV7M 2LWXA 2QSFX 2Y21A 2C9OA 3GLFE 2UUCM 1DO2A 2LTUA 4I5SA 1KYIA 1OIZA 2JY5A 2VIIA 3ILKA 4JXJA 3VFDA 4M9ZA 3HU1A 2JZ1A
chains in the Genus database with same CATH topology
1HQYE 2OOBA 1Q02A 1TR8A 1ZV1A 1G3IA 3FRIA 3LCUA 3B89A 3E21A 2JY8A 1G41A 5DFLA 1GO5A 3IHPA 2KNZA 1MN3A 3K9PA 2DNAA 1HT2E 1HT1E 2LVPC 3BBZA 2CWBA 2CP8A 2H5XA 2JZ0A 4HEOA 4F1IA 1XB2B 1R4GA 3H4JA 1V92A 2O25A 1A5TA 1OTRA 1VEJA 2DAMA 2DENA 2K9DA 1IXSA 4UN2B 1XXHE 2JUJA 4WP2A 1F4IA 1DO0A 1NV8A 2LVAA 4G3OA 2DZLA 2LBCA 3FE3A 1Y8GA 1G4AE 2MROB 1JR3E 3LCVB 2DAEA 2EJSA 3FRHA 2JP7A 2DI0A 1VEGA 2JY7A 1WHCA 1YLAA 2K0BX 4DBGB 2EKFA 1DV0A 2QHOB 2R0IA 2ZTDA 1AIPC 1VEKA 2DAGA 3F92A 3IECA 2KNAA 1UFZA 1E94E 2JY6B 3MMPA 3GLIE 2LVQD 1SG9A 2EKKA 1ZMWA 2LVOC 2OO9A 1C7YA 1EFUB 4GEWA 5JI2E 2RRUA 1OQYA 1T6OA 1VDLA 2JNHA 1QZEA 2DAIA 2L2DA 1WJ7A 3K9OA 4R71A 1VG5A 2L4EA 2BWBA 4F2LA 1BVSA 2KHHA 1T43A 2DAKA 2G3QA 1IFYA 1IM2A 1VQ1A 2QNJA 2MJ5B 4Q7JA 3T6PA 2L4FA 2DHYA 1HJPA 2DKLA 2HAKA 2MGWA 2LVNC 1TTEA 3E46A 2BWEA 2MR9A 2B3TA 1WGNA 3GLGE 1PGYA 1WIVA 1NV9A 3GLHE 1WGLA 2OOAA 2WZJA 2ZTCA 1P3QQ 1ZMUA 1CUKA 2HWJA 1WR1B 1OAIA 1ZMVA 2QSFX 1OKSA 2KNVA 3GLFE 1DO2A 2LTUA 1KYIA 2JY5A 2JZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQY E;  2OOB A;  1Q02 A;  1TR8 A;  1ZV1 A;  1G3I A;  3FRI A;  3LCU A;  3B89 A;  3E21 A;  2JY8 A;  1G41 A;  5DFL A;  1GO5 A;  3IHP A;  2KNZ A;  1MN3 A;  3K9P A;  2DNA A;  1HT2 E;  1HT1 E;  2LVP C;  3BBZ A;  2CWB A;  2CP8 A;  2H5X A;  2JZ0 A;  4HEO A;  4F1I A;  1XB2 B;  1R4G A;  3H4J A;  1V92 A;  2O25 A;  1A5T A;  1OTR A;  1VEJ A;  2DAM A;  2DEN A;  2K9D A;  1IXS A;  4UN2 B;  1XXH E;  2JUJ A;  4WP2 A;  1F4I A;  1DO0 A;  1NV8 A;  2LVA A;  4G3O A;  2DZL A;  2LBC A;  3FE3 A;  1Y8G A;  1G4A E;  2MRO B;  1JR3 E;  3LCV B;  2DAE A;  2EJS A;  3FRH A;  2JP7 A;  2DI0 A;  1VEG A;  2JY7 A;  1WHC A;  1YLA A;  2K0B X;  4DBG B;  2EKF A;  1DV0 A;  2QHO B;  2R0I A;  2ZTD A;  1AIP C;  1VEK A;  2DAG A;  3F92 A;  3IEC A;  2KNA A;  1UFZ A;  1E94 E;  2JY6 B;  3MMP A;  3GLI E;  2LVQ D;  1SG9 A;  2EKK A;  1ZMW A;  2LVO C;  2OO9 A;  1C7Y A;  1EFU B;  4GEW A;  5JI2 E;  2RRU A;  1OQY A;  1T6O A;  1VDL A;  2JNH A;  1QZE A;  2DAI A;  2L2D A;  1WJ7 A;  3K9O A;  4R71 A;  1VG5 A;  2L4E A;  2BWB A;  4F2L A;  1BVS A;  2KHH A;  1T43 A;  2DAK A;  2G3Q A;  1IFY A;  1IM2 A;  1VQ1 A;  2QNJ A;  2MJ5 B;  4Q7J A;  3T6P A;  2L4F A;  2DHY A;  1HJP A;  2DKL A;  2HAK A;  2MGW A;  2LVN C;  1TTE A;  3E46 A;  2BWE A;  2MR9 A;  2B3T A;  1WGN A;  3GLG E;  1PGY A;  1WIV A;  1NV9 A;  3GLH E;  1WGL A;  2OOA A;  2WZJ A;  2ZTC A;  1P3Q Q;  1ZMU A;  1CUK A;  2HWJ A;  1WR1 B;  1OAI A;  1ZMV A;  2QSF X;  1OKS A;  2KNV A;  3GLF E;  1DO2 A;  2LTU A;  1KYI A;  2JY5 A;  2JZ1 A; 
#chains in the Genus database with same CATH topology
 3C9P A;  3AOE A;  2QCU A;  3FUW A;  2OOB A;  3UZU A;  5LMU M;  4NSR A;  1G3I A;  4QNM A;  3K8Z A;  4GKK M;  3IHP A;  3UJN A;  2KA6 B;  2J5Y A;  3M6A A;  1MN3 A;  3RE8 A;  4KO8 A;  3FUX A;  1NJF A;  4PD2 A;  4WUR A;  2YNM D;  2Y20 A;  1HT1 E;  3BBZ A;  2JZ0 A;  4HEO A;  1N33 M;  2R4J A;  2R6F A;  4EIW A;  1L1Z A;  4FW9 A;  3SYL A;  3GRY A;  1R2Z A;  4DV0 M;  3J81 S;  2ZAO A;  3GLH B;  2QP9 X;  2QZ4 A;  1V92 A;  4IBB A;  1DGH A;  1OTR A;  4MGK E;  3LQR A;  2D7G A;  2DEN A;  5EJC A;  1G59 A;  2EUC A;  4UN2 B;  1GJT A;  2AHM A;  1XXH E;  2RGO A;  1K82 A;  4LJ8 A;  1DO0 A;  2O01 F;  2YR0 A;  4G3O A;  2DZL A;  4AG5 A;  3M0E A;  2XFS A;  4MH0 E;  3FE3 A;  3GLF B;  1I94 M;  4P17 A;  3FD9 A;  2C96 A;  2DZO B;  3LCV B;  2XLJ A;  2R18 A;  4HLQ A;  1SXJ E;  2WSF F;  3U61 B;  2DAE A;  2EJS A;  3LMM A;  4XGI A;  1IN6 A;  5ITX A;  3GPX A;  3HHW A;  4IBC A;  3JAM S;  5IT9 S;  1DGB A;  1WHC A;  1YLA A;  2D7H A;  3FTC A;  3U6P A;  1PJJ A;  2XFT A;  4LF9 M;  4GIP A;  3E9S A;  1AIP C;  1YE9 A;  1IBL M;  3L25 A;  2R44 A;  4P16 A;  1OFI A;  2KNA A;  3HX3 A;  3JR4 A;  4RNA A;  4LF4 M;  4QHS A;  1PJQ A;  8CAT A;  4JI7 M;  2HHH M;  3ZQJ A;  3SAW A;  1S3S A;  4L15 A;  2OO9 A;  4G4N A;  1EFU B;  3B7Z A;  2FFJ A;  5IZ7 D;  5EP1 A;  2QBY A;  2XGN A;  3J2P B;  2I7P A;  3FTF A;  2ERC A;  1T6O A;  1VDL A;  2JNH A;  2XSZ A;  4LY6 A;  2VQE M;  2UUA M;  2WSC F;  2K6B A;  2DWM A;  1IN7 A;  4I8O A;  3GPP A;  3FYC A;  4ITQ A;  1XXH B;  4OVZ A;  4F2L A;  1IY1 A;  4L78 A;  2FH0 A;  3GO8 A;  5F3W A;  4GC5 A;  4GIT A;  2KEB A;  4AI6 A;  3KSJ A;  1TH2 A;  1IFY A;  2VQF M;  3R8F A;  2CV2 A;  3LW5 F;  3EIE A;  4MGY E;  3VKH A;  1SXJ B;  2RGH A;  5DYI A;  3T6P A;  2L4F A;  5IRE B;  2H1R A;  3SHF A;  2MGW A;  4DV2 M;  3NBI A;  3HJ8 A;  1TTE A;  4M9S A;  2W82 A;  4LG2 A;  1EIJ A;  1T3T A;  2UXC M;  2B3T A;  4CIZ A;  5DNY A;  2Z7J A;  4DV6 M;  3A98 B;  3PNY A;  4OU7 A;  1PGY A;  1R7R A;  4FWG A;  3SMS A;  3SAU A;  4RF0 A;  4CIS A;  1WIV A;  1NJG A;  4DR7 M;  1NV9 A;  2EA0 A;  4QOS A;  4DV4 M;  2F5Q A;  1WGL A;  2UUB M;  2WZJ A;  2Q2E B;  2LHC A;  4X62 M;  4JV5 M;  2ZM6 M;  5KPZ A;  1W5T A;  2V6Z M;  4Z6Y A;  3QWL A;  3FUU A;  1OAI A;  1LTM A;  2C5R A;  3KXE C;  2J7N A;  2KXE A;  2JXN A;  2QPA A;  3LVV A;  4L16 A;  4NXN M;  1V33 A;  5DYG A;  2ZAN A;  3W67 A;  1XC8 A;  2CV1 A;  1NHG C;  2ZBK B;  1D0K A;  1TGU A;  2M5Z A;  2KZS A;  4NRW A;  1NNU C;  3EIH A;  1Z5B A;  3U6O A;  4ANR A;  1JQJ C;  4KT0 F;  1HQC A;  2LHG A;  1IBM M;  2LH0 A;  1G41 A;  1XWI A;  3HKP A;  4DV1 M;  1HNX M;  4QNR A;  3I4Y A;  1QVR A;  3L27 A;  4GMQ A;  4MB7 A;  2GQF A;  3HWS A;  3VK7 A;  2CWB A;  3VDP A;  4F1I A;  3AKZ A;  4KHP M;  3VLF B;  4ZPX A;  3SHG B;  4B08 A;  5ITR A;  1R4G A;  1QUT A;  2FS1 A;  4B3M M;  3FTE A;  1NVM A;  5ITY A;  2C9C A;  3Q8G A;  2YFQ A;  2JWS A;  2X49 A;  2RKO A;  3HHX A;  3T15 A;  4IJE A;  2XZU A;  1G71 A;  4JI4 M;  1OIP A;  4LF5 M;  1A5T A;  3TWM A;  5EXX A;  2EO2 A;  2BJV A;  4CHT B;  3I51 A;  2D7E A;  4WP2 A;  1I4W A;  2KW0 A;  2ZAM A;  5FTJ A;  4D81 A;  1F4I A;  1NV8 A;  4YY3 M;  2M60 A;  2GNO A;  3MJ5 A;  4NRV A;  4X66 M;  4LRS A;  1XMQ M;  4BBA A;  2N35 A;  5FLX S;  3J80 S;  1Y8G A;  3HU3 A;  1JR3 E;  1E32 A;  4B7F A;  1L2C A;  4CJ6 A;  4JI5 M;  3UK6 A;  1PM5 A;  3TPZ A;  1HR0 M;  2R4E A;  4GC9 A;  4FWD A;  3KSX A;  4JI0 M;  3TQS A;  5C18 A;  2FOI C;  3U6C A;  3A46 A;  2DWN A;  2K0B X;  3FUV A;  4M0W A;  2EKF A;  4DBG B;  1DV0 A;  1IY2 A;  2QHO B;  1FNN A;  1L8Q A;  4LCB A;  1TF0 B;  1UM8 A;  2DAG A;  4DR1 M;  3F92 A;  1UFZ A;  2V1C A;  5KPT A;  3D8B A;  3SAS A;  4BLC A;  3GPY A;  1NY6 A;  2VDB B;  3J7A S;  4LZZ A;  4PT5 A;  2RRU A;  4CGY B;  3GLI A;  3U6Q A;  1TDZ A;  4B3S M;  2DWL A;  2XH9 A;  4REZ A;  5FTN A;  1OJL A;  1SXJ C;  4X65 M;  2DAI A;  1QAO A;  1SXJ D;  1YUB A;  2R46 A;  5FTM A;  2QBY B;  3RGP A;  1WJ7 A;  2X4A A;  3LVW A;  3U6L A;  2CHV A;  2L4E A;  3RFW A;  2BWB A;  5KO3 A;  1MJG M;  5ITQ A;  1BVS A;  2KHH A;  4NL4 H;  3U5Z A;  1K3W A;  2DAK A;  4FVM A;  1ORY B;  3DFZ A;  3RGS A;  1W5S A;  4OVZ B;  3TE6 A;  2G3Q A;  1V34 A;  3ZCB B;  3K1J A;  4DR4 M;  3C3D A;  2F5S A;  2QNJ A;  2MJ5 B;  4AKG A;  3W0F A;  4Q7J A;  2HL7 A;  3WHL A;  1QYR A;  5H37 D;  1R6B X;  4JYA M;  1IN5 A;  1GL7 A;  3L29 A;  4BB9 A;  2LVN C;  1E9S A;  3K92 A;  3E46 A;  1IBK M;  2BWE A;  3KVW A;  4MGH A;  1N32 M;  1XNR M;  4AKH A;  3L26 A;  3KP1 E;  3TWK A;  3SAR A;  3MK6 A;  1ZQ9 A;  3I01 M;  2C98 A;  3U6S A;  2P5T A;  1Z5C A;  1L2D A;  3GP1 A;  2OOA A;  1IXZ A;  3FYD A;  1KFV A;  2F5P A;  4IBI A;  1JB0 F;  2G8L A;  3SMP A;  1ZMU A;  4S12 A;  2HWJ A;  5BPV A;  3GLH A;  2C99 A;  3CF0 A;  2FE8 A;  1ZAE A;  3LQQ A;  1ZMV A;  1QAQ A;  1NNJ A;  3KS8 A;  4IJF A;  4DR6 M;  1OKS A;  2LXE A;  1NY5 A;  4R3D A;  5EXT A;  1Q39 A;  3FTD A;  3CF2 A;  4B7H A;  5EQT A;  3E4R A;  3HJS A;  2QEN A;  3PVS A;  5ITT A;  4LJ5 A;  3SYK A;  1Q02 A;  1TR8 A;  4LF7 M;  2L7I A;  3HGI A;  1FJG M;  4FCW A;  2CE7 A;  2KNZ A;  2CRU A;  5FSW A;  2R62 A;  3K9P A;  3GQ5 A;  1NO1 A;  4YHH M;  4G4R A;  4I4L A;  1IN4 A;  2LVP C;  3GLG A;  1N77 A;  4GKJ M;  2HKJ A;  3CF6 E;  1E9R A;  2KRK A;  1H6U A;  3AV0 A;  3U60 B;  2E5L M;  3KFU G;  3A42 A;  3R9X B;  1VEJ A;  3OTO M;  2K9D A;  3FUT A;  1IXS A;  4LJ4 A;  3C3E A;  1J7K A;  3VDU A;  4B3T M;  4IBG A;  4LFC M;  3W68 A;  3PFI A;  3ZH9 B;  1QZM A;  1NHW C;  3M7G A;  5ITX E;  2F5N A;  1XXH A;  2Z3X A;  1G4A E;  2APL A;  2MH8 A;  3GRU A;  3MHV C;  5L8R F;  2J7O A;  2CHG A;  4IBK A;  4JI6 M;  1AUA A;  4G6Z A;  1VDD A;  1QAM A;  2G5G X;  2DI0 A;  3GRR A;  3GPU A;  3HZJ A;  4XK8 F;  4QOZ C;  3KW6 A;  3B74 A;  3QYB A;  4AZF A;  3H4M A;  3KDS E;  4GH9 A;  5E26 A;  1K3X A;  4DV3 M;  2CUZ A;  4B7G A;  4D82 A;  4DR5 M;  1N78 A;  2ZTD A;  5C1B A;  3WHK A;  3C58 A;  4RF1 A;  4JI3 M;  1TH3 A;  4FWH A;  2L6O A;  3T38 A;  2UXB M;  1MU5 A;  1D0L A;  5EP2 A;  1E94 E;  3MMP A;  3CGW A;  4L6V 6;  1SG9 A;  1ZMW A;  3IG5 A;  4DUY M;  1NSF A;  1DGH B;  2LVO C;  1XHB A;  3SC3 A;  1C7Y A;  3DOA A;  4GEW A;  3QAU A;  3K2L A;  4IBD A;  2L7H A;  3AOG A;  3U6D A;  1OQY A;  1RU3 A;  4NXM M;  4AQY M;  1JR3 D;  2DZN B;  2L2D A;  4G4Q A;  5KQD A;  3K9O A;  4R71 A;  3UMM A;  1GLN A;  3NWL A;  4JI1 M;  3FKE A;  1N75 A;  1T43 A;  3GQ3 A;  3I04 M;  2F5O A;  3J27 B;  5FTL A;  3T1Y M;  1VQ1 A;  3U5Z B;  5IWA M;  1DGG A;  3B7Q A;  4D80 A;  2KDL A;  3HJQ A;  3HY5 A;  3QYE A;  3SAV A;  4OX9 M;  4A3V B;  2HAK A;  1J5E M;  4M0D A;  2BJW A;  3PNV A;  5E6J A;  4GHA A;  2QQ8 A;  2CEA A;  3HHZ A;  4NSO B;  4HL4 A;  2DHR A;  3KOY E;  4LFA M;  4LF6 M;  4L8R C;  4RKU F;  1WGN A;  7CAT A;  5EXS A;  3GLG E;  2CHQ A;  1OAO C;  2UXD M;  1Z6T A;  3Q8X A;  2ZTC A;  3DZD A;  4GHL A;  3VKG A;  2HCB A;  4AKI A;  5EP4 A;  5BR8 M;  2DWZ B;  3B7N A;  3KOZ E;  1Q3C A;  3W0L B;  1N34 M;  4OW0 A;  2NQ8 C;  4NC6 A;  1Z59 A;  1QDR A;  2KNV A;  1IXR C;  1GJS A;  4GRI A;  3TL4 X;  4LFB M;  4Z8X A;  2JA2 A;  1L2B A;  1N36 M;  1YSY A;  1HQY E;  1ZV1 A;  3SFZ A;  3FRI A;  3LCU A;  3B89 A;  3E21 A;  2JY8 A;  4IBJ A;  5DFL A;  4DR2 M;  1GO5 A;  2DVW B;  1QUS A;  3SAT A;  4X64 M;  4IIW A;  5LMN M;  1PJI A;  3KS4 A;  4M9X A;  4WW0 A;  2DNA A;  1HT2 E;  1PRB A;  2KZU A;  4IBF A;  3D8L A;  4R7G A;  2CP8 A;  2H5X A;  1QDT A;  2O5R A;  3I4V A;  2A5Y B;  3KP0 E;  4IBE A;  3HHY A;  4KLN A;  5EP3 A;  4XBO A;  1XB2 B;  4PDI A;  5JI3 E;  5EXP A;  2BNK A;  1HNW M;  2VF7 A;  3GLG B;  4L4U A;  2KRU A;  2R65 A;  2Z8Y M;  4K0K M;  3HU2 A;  3H4J A;  3V76 A;  2UU9 M;  3AOE C;  2O25 A;  1X37 A;  4LGY A;  4LF8 M;  1OFH A;  2DAM A;  3DA1 A;  4PDG A;  2K47 A;  1Q3B A;  2JUJ A;  2LNH C;  4LRT A;  3GLF A;  2FNA A;  2LVA A;  4LJ9 A;  3AJI B;  1IXS B;  3U61 A;  2LBC A;  3JR5 A;  1D2N A;  3KOW E;  2Y0Q A;  2MRO B;  2VF8 A;  3CTW B;  4LGM A;  2F4V M;  2R45 A;  3U6E A;  1R2Y A;  4LJ7 A;  3FRH A;  4LJ6 A;  2JP7 A;  3L28 A;  3PXG A;  2CV0 A;  1QAN A;  1JR3 A;  3THG A;  1TH4 A;  2DXI A;  2WSE F;  4AG6 A;  4JI8 M;  1VEG A;  4FCV A;  1GVN A;  2JY7 A;  5GKN A;  5FTK A;  5A2Q S;  1WXQ A;  1Z5A A;  1L1T A;  2R0I A;  4TUW A;  4I81 A;  2XEP A;  4DUZ M;  3ZC7 B;  1PJT A;  1VEK A;  4FCT A;  4DV5 M;  3IEC A;  4NOO B;  3GQ4 A;  3L2A A;  1XNQ M;  2JY6 B;  3GLI E;  1PJS A;  2LVQ D;  2EKK A;  5ITU A;  1J09 A;  2OQ4 A;  3AFH A;  1C1K A;  3NBX X;  1QQW A;  4QHT A;  5KPR A;  1XMO M;  5JI2 E;  3J7B A;  1EE8 A;  2OPF A;  3UGJ A;  2V1U A;  4LJA A;  4JN6 A;  4KOD A;  1QZE A;  3A45 A;  3IG8 A;  1GKI A;  1GAB A;  4G4O A;  2Z4R A;  3SBJ A;  1HNZ M;  1VG5 A;  2L09 A;  1SXJ A;  3BXW A;  4Y28 F;  1R5L A;  2XZF A;  3BOS A;  4FD2 A;  1IQP A;  1G8P A;  1IM2 A;  3KOX E;  3U6M A;  4MM3 B;  2DHY A;  1TDH A;  1HJP A;  2DKL A;  3VK8 A;  3T1H M;  1GL6 A;  4PCZ A;  2Z4S A;  4AW4 A;  2MR9 A;  2I7N A;  3AL0 C;  4DR3 M;  2XSZ D;  3GRV A;  1IN8 A;  1KSF X;  2YQZ A;  4II7 A;  1LV7 A;  1IY0 A;  4MGZ E;  3TWL A;  1D0M A;  5KQ8 A;  4JI2 M;  1DGF A;  2Y0T A;  4LZJ A;  3GLH E;  2X8A A;  4W5W A;  3GLI B;  1P3Q Q;  4B3R M;  1CUK A;  1MX0 A;  3U60 A;  1WR1 B;  3B9P A;  2XF3 A;  4MGI E;  2CFO A;  4DV7 M;  2LWX A;  2QSF X;  2Y21 A;  2C9O A;  3GLF E;  2UUC M;  1DO2 A;  2LTU A;  4I5S A;  1KYI A;  1OIZ A;  2JY5 A;  2VII A;  3ILK A;  4JXJ A;  3VFD A;  4M9Z A;  3HU1 A;  2JZ1 A; 
#chains in the Genus database with same CATH homology
 1HQY E;  2OOB A;  1Q02 A;  1TR8 A;  1ZV1 A;  1G3I A;  3FRI A;  3LCU A;  3B89 A;  3E21 A;  2JY8 A;  1G41 A;  5DFL A;  1GO5 A;  3IHP A;  2KNZ A;  1MN3 A;  3K9P A;  2DNA A;  1HT2 E;  1HT1 E;  2LVP C;  3BBZ A;  2CWB A;  2CP8 A;  2H5X A;  2JZ0 A;  4HEO A;  4F1I A;  1XB2 B;  1R4G A;  3H4J A;  1V92 A;  2O25 A;  1A5T A;  1OTR A;  1VEJ A;  2DAM A;  2DEN A;  2K9D A;  1IXS A;  4UN2 B;  1XXH E;  2JUJ A;  4WP2 A;  1F4I A;  1DO0 A;  1NV8 A;  2LVA A;  4G3O A;  2DZL A;  2LBC A;  3FE3 A;  1Y8G A;  1G4A E;  2MRO B;  1JR3 E;  3LCV B;  2DAE A;  2EJS A;  3FRH A;  2JP7 A;  2DI0 A;  1VEG A;  2JY7 A;  1WHC A;  1YLA A;  2K0B X;  4DBG B;  2EKF A;  1DV0 A;  2QHO B;  2R0I A;  2ZTD A;  1AIP C;  1VEK A;  2DAG A;  3F92 A;  3IEC A;  2KNA A;  1UFZ A;  1E94 E;  2JY6 B;  3MMP A;  3GLI E;  2LVQ D;  1SG9 A;  2EKK A;  1ZMW A;  2LVO C;  2OO9 A;  1C7Y A;  1EFU B;  4GEW A;  5JI2 E;  2RRU A;  1OQY A;  1T6O A;  1VDL A;  2JNH A;  1QZE A;  2DAI A;  2L2D A;  1WJ7 A;  3K9O A;  4R71 A;  1VG5 A;  2L4E A;  2BWB A;  4F2L A;  1BVS A;  2KHH A;  1T43 A;  2DAK A;  2G3Q A;  1IFY A;  1IM2 A;  1VQ1 A;  2QNJ A;  2MJ5 B;  4Q7J A;  3T6P A;  2L4F A;  2DHY A;  1HJP A;  2DKL A;  2HAK A;  2MGW A;  2LVN C;  1TTE A;  3E46 A;  2BWE A;  2MR9 A;  2B3T A;  1WGN A;  3GLG E;  1PGY A;  1WIV A;  1NV9 A;  3GLH E;  1WGL A;  2OOA A;  2WZJ A;  2ZTC A;  1P3Q Q;  1ZMU A;  1CUK A;  2HWJ A;  1WR1 B;  1OAI A;  1ZMV A;  2QSF X;  1OKS A;  2KNV A;  3GLF E;  1DO2 A;  2LTU A;  1KYI A;  2JY5 A;  2JZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...