2KNZA

Nmr structure of cip75 uba domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure note: UBA domain of CIP75.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Ubiquilin-4
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knzA00
2KNZA 1HT1E 4HEOA 2RRUA 3GLIE 2LVPC 2EKFA 2LVQD 2DKLA 2LVNC 1F4IA 1UFZA 1HJPA 2L4EA 1SG9A 1HT2E 1OAIA 1VEJA 2BWBA 1C7YA 1OKSA 2CWBA 3FE3A 3LCVB 4WP2A 2KNVA 1CUKA 1Q02A 1JR3E 2EJSA 1TTEA 5JI2E 2LVAA 2DAMA 3FRIA 1HQYE 1G4AE 4UN2B 1G3IA 2L2DA 2DNAA 2DHYA 4DBGB 1VEKA 3K9OA 1WHCA 4F2LA 1VG5A 1ZMUA 1VEGA 1TR8A 2LTUA 3FRHA 2KHHA 1VDLA 3E46A 1OQYA 2QNJA 2MGWA 3GLHE 3LCUA 1XXHE 1WIVA 4GEWA 2LBCA 3B89A 2JY6B 1XB2B 2R0IA 2QSFX 2MJ5B 1WR1B 2OOAA 3BBZA 1G41A 1DO2A 2JUJA 1E94E 2JY5A 2DAIA 2JZ0A 1ZMWA 2QHOB 4Q7JA 2OO9A 1ZV1A 1V92A 1ZMVA 3IHPA 1GO5A 5DFLA 4F1IA 2JZ1A 2K9DA 1WGNA 2JNHA 2MR9A 2DI0A 2DAEA 1VQ1A 4G3OA 1MN3A 1NV9A 2K0BX 1IM2A 2WZJA 1R4GA 1BVSA 2DAGA 2EKKA 2L4FA 1EFUB 1IFYA 1DV0A 2HAKA 2KNAA 1OTRA 1AIPC 2ZTCA 2ZTDA 2OOBA 3IECA 2DENA 2G3QA 1IXSA 2DAKA 1YLAA 2DZLA 3MMPA 3GLFE 1NV8A 2BWEA 3K9PA 1T43A 2LVOC 2O25A 4R71A 2HWJA 1Y8GA 3T6PA 3H4JA 1KYIA 2JY7A 1PGYA 1DO0A 1T6OA 1WJ7A 1P3QQ 3E21A 2JP7A 1WGLA 2CP8A 3F92A 2B3TA 1A5TA 3GLGE 2H5XA 1QZEA 2JY8A 2MROB
chains in the Genus database with same CATH superfamily
5FTLA 4IBKA 2OPFA 4DR3M 1Q3CA 4X65M 1E32A 2V1CA 3KOYE 3LQRA 3FUXA 4L15A 5ITQA 4IBBA 1C7YA 4AKIA 1OKSA 4MGYE 5FLXS 1LTMA 3FE3A 1N75A 3VDUA 1OJLA 3GLHA 4LZZA 3FYDA 2C98A 4G4OA 5JI2E 3GRYA 2XLJA 3I4YA 1IXSB 1OFHA 2CHGA 1GLNA 3CGWA 4OVZB 2I7PA 2L2DA 3BXWA 1XMOM 1HNWM 4DV4M 1VEKA 4DUYM 4DR4M 3K9OA 2F5SA 1IBMM 1EIJA 4M0DA 3B7ZA 1Z6TA 2QP9X 3KS4A 1ZMUA 3CF2A 1JQJC 3I51A 3L27A 2HKJA 2Z3XA 1R6BX 2QENA 4DUZM 3FRHA 1NO1A 4OVZA 5KQ8A 1NJFA 4NC6A 1HNZM 4G4QA 3FTFA 3NBIA 3K2LA 4B3TM 4EIWA 2DVWB 3HY5A 1XXHE 1FJGM 1WIVA 1L8QA 3KSJA 4B7FA 3B89A 3GLGA 1UM8A 3QYEA 4WURA 3KDSE 3BBZA 2DHRA 4QHTA 4GIPA 3AOEA 3FYCA 5DYGA 1Q39A 1E94E 4L6V6 4L78A 2JY5A 1D2NA 1QDTA 4DV3M 1H6UA 1PJIA 4P16A 2OO9A 4PDGA 1TF0B 2FFJA 4GMQA 4AW4A 3D8LA 4AKHA 3FKEA 1EE8A 3J81S 1E9RA 3GQ4A 4NRWA 4A3VB 4LF8M 3AFHA 1D0LA 3KP1E 2DAEA 3LVWA 4Y28F 1IBLM 4MGKE 1MN3A 4Z8XA 1R2YA 1QYRA 4LJ5A 1QDRA 4L4UA 1IBKM 4K0KM 3UJNA 1R4GA 1TGUA 3I4VA 1Z5CA 1GJTA 1SXJD 2DAGA 3U60A 1EFUB 2KXEA 2KA6B 3SAUA 1JB0F 1NNUC 1IXZA 3BOSA 4XGIA 3UK6A 1DV0A 5EP2A 1L2CA 1OTRA 1AIPC 2ZTCA 2F5QA 1ZAEA 3VK8A 2XGNA 4AZFA 2J7NA 1YLAA 2Z8YM 4M9ZA 3KS8A 3C3DA 3M0EA 2R4JA 3KSXA 2ZAMA 3KOXE 1DGHA 2BWEA 1D0MA 2VDBB 3K9PA 3C58A 2LH0A 5EP3A 3T6PA 2C9OA 3U6OA 3J27B 2Z7JA 1IXRC 3GPXA 3SATA 4OX9M 4DV0M 1NHGC 2A5YB 2AHMA 3B74A 1PJQA 2UUAM 3HJ8A 3LVVA 3QAUA 4GC9A 3B7QA 1MJGM 3MJ5A 3GLGE 2ZBKB 4R7GA 2H5XA 1OIZA 3GQ5A 1Q3BA 4R71A 2D7HA 3V76A 3U6PA 2MROB 3K92A 4PCZA 3JAMS 4LRSA 4DR7M 5ITUA 1NY6A 3EIHA 5FSWA 3SARA 1N33M 2RRUA 3GLIE 4B08A 2LVPC 4GH9A 2EKFA 2G8LA 2LVQD 2XZFA 4G6ZA 3ZCBB 2JXNA 1QZMA 1T3TA 2N35A 1QQWA 2R44A 4IBDA 2L4EA 2ZANA 1HT2E 1OAIA 1VEJA 4NRVA 3LW5F 3WHKA 3E4RA 8CATA 1NNJA 1R7RA 4LF4M 1C1KA 1J7KA 1IN8A 4JN6A 3C9PA 2LNHC 4RF0A 1OFIA 1TTEA 4JI3M 4M9SA 7CATA 3AKZA 3NWLA 1XWIA 2CE7A 2ZAOA 2LHCA 2R46A 4OW0A 2CV1A 3SMPA 4DBGB 4AG5A 3GPPA 3A45A 1WHCA 3DZDA 4F2LA 4I81A 4B7HA 1VEGA 2WSEF 1RU3A 1SXJE 2LXEA 4QHSA 2JA2A 3SC3A 2KHHA 1IY0A 3DA1A 2W82A 1OQYA 3L28A 2DWMA 2OQ4A 4CGYB 3HHWA 4CHTB 2QZ4A 3KOZE 2LBCA 4GEWA 4NL4H 2QBYA 4FWGA 2R0IA 2QSFX 3FTDA 2C99A 2DWLA 2ZM6M 1G41A 2BJVA 2H1RA 3UMMA 4IBFA 5LMUM 2R45A 2NQ8C 2CHVA 1PRBA 1DGHB 3Q8XA 3AOEC 3KOWE 3M7GA 4DV5M 1W5SA 3A42A 1V92A 2M60A 3A98B 4IBGA 2R65A 4DR2M 3SAWA 3HWSA 4NSRA 2UUBM 1QVRA 4LZJA 4F1IA 3GLGB 4G4NA 2JZ1A 3ILKA 3R8FA 2JNHA 4RF1A 3L26A 4JYAM 5IT9S 1IY1A 1VQ1A 2KZSA 1NVMA 4QNMA 5KPRA 1R2ZA 3H4MA 2VQFM 3GRUA 4JI0M 2L4FA 1GVNA 2EKKA 1QUSA 5E26A 3WHLA 2EO2A 4IJFA 4LCBA 4DR1M 2K47A 4P17A 2HAKA 3L2AA 3TWKA 4X64M 3TL4X 4LFCM 3B9PA 3K8ZA 3GPYA 2BNKA 2F5OA 3GLHB 3RE8A 1J5EM 1YE9A 4I5SA 4LJ9A 3L25A 3IECA 4JI4M 2G3QA 3SYLA 1QUTA 2DZLA 2HCBA 4JI7M 4LJ7A 2YR0A 1Z59A 2CEAA 3IG5A 3ZC7B 1NV8A 2X49A 4GC5A 4NXNM 1IN6A 2HWJA 4QNRA 3W0FA 2C5RA 2KZUA 4AI6A 2CUZA 4GHLA 1DGFA 3J7BA 4REZA 1P3QQ 3E21A 4JI8M 3HHZA 1R5LA 1SXJB 1NSFA 1Z5BA 1WGLA 4GRIA 1OIPA 1L2BA 4GITA 2Q2EB 3F92A 2B3TA 5FTNA 4LRTA 3SYKA 1MX0A 1TH3A 1AUAA 4KODA 1XNRM 4KT0F 4M9XA 4MGZE 4AG6A 4LG2A 2C96A 4GKJM 1ZQ9A 1V34A 5EXTA 1HT1E 1TH4A 4HEOA 5FTKA 2Y0TA 4Z6YA 4DV7M 3U5ZA 2XZUA 4B3RM 1E9SA 5ITYA 2KRUA 4YY3M 1IN7A 4I8OA 2GQFA 2LVNC 4DV6M 3AOGA 3VFDA 4NSOB 3VDPA 2BWBA 3PVSA 4FCVA 4LJAA 5EP4A 4JI2M 3D8BA 4LF7M 3C3EA 2RGOA 3HU2A 3THGA 1XNQM 2CWBA 3R9XB 2YFQA 4IBJA 4TUWA 3TWMA 2QPAA 3J80S 2J7OA 1CUKA 4L16A 4BB9A 1JR3E 4LGMA 2EJSA 4IBCA 2XSZD 3FUTA 3GLFB 3B7NA 3FRIA 2FNAA 2UUCM 2VQEM 2QBYB 1G4AE 1WXQA 1NJGA 4B7GA 3AV0A 1G3IA 3U6SA 3HU3A 3U6CA 1MU5A 3HZJA 4XBOA 5KO3A 2DWZB 3I01M 3UZUA 1IQPA 2DZOB 1QAQA 4ANRA 4BLCA 2UXCM 1N78A 3GO8A 1FNNA 1VDLA 3W0LB 4MH0E 3E46A 2R4EA 1PJSA 4HLQA 3KP0E 3GLHE 5IWAM 5C18A 3KFUG 1HR0M 3SASA 2QQ8A 3MHVC 2JY6B 1GL6A 3TPZA 4NXMM 4KHPM 2HL7A 5EP1A 4BBAA 1N36M 5A2QS 1IN4A 3U5ZB 1S3SA 1WR1B 2OOAA 4JI6M 3SHFA 2F5PA 4QOSA 4FVMA 3W68A 3K1JA 3MK6A 3TQSA 4CJ6A 4JXJA 2FE8A 1G71A 4S12A 4KO8A 1ZMWA 4Q7JA 1QANA 2XFTA 3U6LA 2DWNA 2F4VM 1ZMVA 3IHPA 4HL4A 2CFOA 4D82A 3A46A 2CV2A 4PT5A 5DFLA 3OTOM 1XXHA 2D7GA 2MR9A 4R3DA 1N77A 2DI0A 2KDLA 2BJWA 2V6ZM 2UXBM 2L09A 1K3XA 2JWSA 4G3OA 5GKNA 5L8RF 2P5TA 5BR8M 1NV9A 1YSYA 2E5LM 1IM2A 4DV2M 2WZJA 3I04M 3GRVA 2R6FA 4I4LA 5EJCA 3T38A 1BVSA 3JR4A 1L1ZA 3ZH9B 1N34M 1L2DA 3HU1A 2EA0A 2HHHM 2Z4RA 1JR3D 3HJQA 4LGYA 1OAOC 1PJJA 3SAVA 5KQDA 2XEPA 2DXIA 2D7EA 5ITXA 4D81A 3HGIA 4OU7A 3T1HM 5H37D 3VKGA 1D0KA 2DENA 4KLNA 4D80A 1IN5A 2DAKA 1HQCA 3EIEA 2C9CA 4FCTA 4AQYM 3DFZA 3KVWA 3JR5A 3HX3A 3GLFE 4LF6M 4DV1M 2CHQA 3FD9A 4ZPXA 2LVOC 2FS1A 2O25A 3PNYA 4CIZA 1Y8GA 3LQQA 1YUBA 1KYIA 2Y21A 4M0WA 1PGYA 1T6OA 1J09A 5KPZA 1N32M 4X66M 2CP8A 1TDHA 3FTCA 4MM3B 3KXEC 1PJTA 1ORYB 2L7HA 3RGSA 5LMNM 1A5TA 2WSCF 4QOZC 2XF3A 3GQ3A 2QCUA 1LV7A 4LFBM 1IY2A 3QWLA 5EXPA 4YHHM 2ERCA 1KSFX 2KNZA 1XXHB 1G59A 3UGJA 3NBXX 5EXSA 4B3MM 2Y0QA 3L29A 4LY6A 4MGHA 1TH2A 2DKLA 4XK8F 1F4IA 2G5GX 1UFZA 2X8AA 3FUVA 1HJPA 3SFZA 3U6MA 1SG9A 4GKKM 4JV5M 5KPTA 2M5ZA 4L8RC 4WW0A 5ITRA 1X37A 5EQTA 3FUUA 2XH9A 3LCVB 4WP2A 2R62A 2VF8A 2YQZA 3E9SA 1PM5A 2KNVA 2FOIC 4B3SM 1Q02A 2F5NA 3DOAA 2UU9M 4LF5M 1G8PA 2O01F 2LVAA 2DAMA 1HQYE 2VIIA 2VF7A 4UN2B 5JI3E 4NOOB 2CV0A 1SXJA 2Z4SA 1XHBA 3LMMA 2DHYA 2DNAA 2XSZA 4IBIA 4LJ6A 3PXGA 1XMQM 1KFVA 4X62M 1VG5A 1V33A 1TR8A 3RFWA 2LTUA 5DYIA 5IZ7D 3GRRA 4RKUF 1VDDA 1GABA 3CF0A 2QNJA 1NY5A 2XFSA 3Q8GA 2V1UA 3HKPA 2MGWA 3GLFA 2X4AA 3LCUA 1DGBA 4FD2A 4G4RA 3VKHA 3GPUA 3AJIB 1XB2B 2EUCA 4LJ4A 3ZQJA 1K82A 3U6QA 2APLA 2MJ5B 5E6JA 4DR5M 2J5YA 5ITXE 1GKIA 2WSFF 4W5WA 3T1YM 4RNAA 1DO2A 2JUJA 3U6EA 2KRKA 3W67A 4JI5M 3U60B 1K3WA 1L1TA 3SHGB 3VK7A 1I4WA 4FWHA 2DAIA 2JZ0A 2QHOB 3PNVA 4IJEA 3HHYA 1ZV1A 5ITTA 4JI1M 5EXXA 2UXDM 2L6OA 2GNOA 2L7IA 1GO5A 3GLIA 3U6DA 2K9DA 1WGNA 1TDZA 1IFYA 4IBEA 3M6AA 4MB7A 4LF9M 2RGHA 1JR3A 5F3WA 2K0BX 3TE6A 2I7NA 2MH8A 1DGGA 4CISA 5FTJA 3GLIB 2O5RA 3CF6E 4LJ8A 3GP1A 4GHAA 5FTMA 1SXJC 3T15A 2RKOA 4PDIA 4PD2A 4DR6M 5BPVA 2KNAA 1GL7A 1QAOA 3KW6A 1QAMA 2Y20A 4AKGA 2ZTDA 2KEBA 1NHWC 2OOBA 3FUWA 2DZNB 1Z5AA 4FWDA 2R18A 1IXSA 3SBJA 3J7AS 3MMPA 4FW9A 3QYBA 2KW0A 3HJSA 4ITQA 4IIWA 3PFIA 3FTEA 1T43A 3HHXA 3VLFB 3AL0C 4MGIE 1GJSA 3CTWB 2K6BA 3SMSA 3U61B 3H4JA 2JY7A 1W5TA 5IREB 1XC8A 1DO0A 1I94M 3RGPA 1WJ7A 2FH0A 2JP7A 3J2PB 5C1BA 2CRUA 2LWXA 4FCWA 3U61A 4LFAM 1HNXM 3IG8A 4II7A 3TWLA 2LHGA 1QZEA 2YNMD 2JY8A 5DNYA
chains in the Genus database with same CATH topology
2KNZA 1HT1E 4HEOA 2RRUA 3GLIE 2LVPC 2EKFA 2LVQD 2DKLA 2LVNC 1F4IA 1UFZA 1HJPA 2L4EA 1SG9A 1HT2E 1OAIA 1VEJA 2BWBA 1C7YA 1OKSA 2CWBA 3FE3A 3LCVB 4WP2A 2KNVA 1CUKA 1Q02A 1JR3E 2EJSA 1TTEA 5JI2E 2LVAA 2DAMA 3FRIA 1HQYE 1G4AE 4UN2B 1G3IA 2L2DA 2DNAA 2DHYA 4DBGB 1VEKA 3K9OA 1WHCA 4F2LA 1VG5A 1ZMUA 1VEGA 1TR8A 2LTUA 3FRHA 2KHHA 1VDLA 3E46A 1OQYA 2QNJA 2MGWA 3GLHE 3LCUA 1XXHE 1WIVA 4GEWA 2LBCA 3B89A 2JY6B 1XB2B 2R0IA 2QSFX 2MJ5B 1WR1B 2OOAA 3BBZA 1G41A 1DO2A 2JUJA 1E94E 2JY5A 2DAIA 2JZ0A 1ZMWA 2QHOB 4Q7JA 2OO9A 1ZV1A 1V92A 1ZMVA 3IHPA 1GO5A 5DFLA 4F1IA 2JZ1A 2K9DA 1WGNA 2JNHA 2MR9A 2DI0A 2DAEA 1VQ1A 4G3OA 1MN3A 1NV9A 2K0BX 1IM2A 2WZJA 1R4GA 1BVSA 2DAGA 2EKKA 2L4FA 1EFUB 1IFYA 1DV0A 2HAKA 2KNAA 1OTRA 1AIPC 2ZTCA 2ZTDA 2OOBA 3IECA 2DENA 2G3QA 1IXSA 2DAKA 1YLAA 2DZLA 3MMPA 3GLFE 1NV8A 2BWEA 3K9PA 1T43A 2LVOC 2O25A 4R71A 2HWJA 1Y8GA 3T6PA 3H4JA 1KYIA 2JY7A 1PGYA 1DO0A 1T6OA 1WJ7A 1P3QQ 3E21A 2JP7A 1WGLA 2CP8A 3F92A 2B3TA 1A5TA 3GLGE 2H5XA 1QZEA 2JY8A 2MROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNZ A;  1HT1 E;  4HEO A;  2RRU A;  3GLI E;  2LVP C;  2EKF A;  2LVQ D;  2DKL A;  2LVN C;  1F4I A;  1UFZ A;  1HJP A;  2L4E A;  1SG9 A;  1HT2 E;  1OAI A;  1VEJ A;  2BWB A;  1C7Y A;  1OKS A;  2CWB A;  3FE3 A;  3LCV B;  4WP2 A;  2KNV A;  1CUK A;  1Q02 A;  1JR3 E;  2EJS A;  1TTE A;  5JI2 E;  2LVA A;  2DAM A;  3FRI A;  1HQY E;  1G4A E;  4UN2 B;  1G3I A;  2L2D A;  2DNA A;  2DHY A;  4DBG B;  1VEK A;  3K9O A;  1WHC A;  4F2L A;  1VG5 A;  1ZMU A;  1VEG A;  1TR8 A;  2LTU A;  3FRH A;  2KHH A;  1VDL A;  3E46 A;  1OQY A;  2QNJ A;  2MGW A;  3GLH E;  3LCU A;  1XXH E;  1WIV A;  4GEW A;  2LBC A;  3B89 A;  2JY6 B;  1XB2 B;  2R0I A;  2QSF X;  2MJ5 B;  1WR1 B;  2OOA A;  3BBZ A;  1G41 A;  1DO2 A;  2JUJ A;  1E94 E;  2JY5 A;  2DAI A;  2JZ0 A;  1ZMW A;  2QHO B;  4Q7J A;  2OO9 A;  1ZV1 A;  1V92 A;  1ZMV A;  3IHP A;  1GO5 A;  5DFL A;  4F1I A;  2JZ1 A;  2K9D A;  1WGN A;  2JNH A;  2MR9 A;  2DI0 A;  2DAE A;  1VQ1 A;  4G3O A;  1MN3 A;  1NV9 A;  2K0B X;  1IM2 A;  2WZJ A;  1R4G A;  1BVS A;  2DAG A;  2EKK A;  2L4F A;  1EFU B;  1IFY A;  1DV0 A;  2HAK A;  2KNA A;  1OTR A;  1AIP C;  2ZTC A;  2ZTD A;  2OOB A;  3IEC A;  2DEN A;  2G3Q A;  1IXS A;  2DAK A;  1YLA A;  2DZL A;  3MMP A;  3GLF E;  1NV8 A;  2BWE A;  3K9P A;  1T43 A;  2LVO C;  2O25 A;  4R71 A;  2HWJ A;  1Y8G A;  3T6P A;  3H4J A;  1KYI A;  2JY7 A;  1PGY A;  1DO0 A;  1T6O A;  1WJ7 A;  1P3Q Q;  3E21 A;  2JP7 A;  1WGL A;  2CP8 A;  3F92 A;  2B3T A;  1A5T A;  3GLG E;  2H5X A;  1QZE A;  2JY8 A;  2MRO B; 
#chains in the Genus database with same CATH topology
 5FTL A;  4IBK A;  2OPF A;  4DR3 M;  1Q3C A;  4X65 M;  1E32 A;  2V1C A;  3KOY E;  3LQR A;  3FUX A;  4L15 A;  5ITQ A;  4IBB A;  1C7Y A;  4AKI A;  1OKS A;  4MGY E;  5FLX S;  1LTM A;  3FE3 A;  1N75 A;  3VDU A;  1OJL A;  3GLH A;  4LZZ A;  3FYD A;  2C98 A;  4G4O A;  5JI2 E;  3GRY A;  2XLJ A;  3I4Y A;  1IXS B;  1OFH A;  2CHG A;  1GLN A;  3CGW A;  4OVZ B;  2I7P A;  2L2D A;  3BXW A;  1XMO M;  1HNW M;  4DV4 M;  1VEK A;  4DUY M;  4DR4 M;  3K9O A;  2F5S A;  1IBM M;  1EIJ A;  4M0D A;  3B7Z A;  1Z6T A;  2QP9 X;  3KS4 A;  1ZMU A;  3CF2 A;  1JQJ C;  3I51 A;  3L27 A;  2HKJ A;  2Z3X A;  1R6B X;  2QEN A;  4DUZ M;  3FRH A;  1NO1 A;  4OVZ A;  5KQ8 A;  1NJF A;  4NC6 A;  1HNZ M;  4G4Q A;  3FTF A;  3NBI A;  3K2L A;  4B3T M;  4EIW A;  2DVW B;  3HY5 A;  1XXH E;  1FJG M;  1WIV A;  1L8Q A;  3KSJ A;  4B7F A;  3B89 A;  3GLG A;  1UM8 A;  3QYE A;  4WUR A;  3KDS E;  3BBZ A;  2DHR A;  4QHT A;  4GIP A;  3AOE A;  3FYC A;  5DYG A;  1Q39 A;  1E94 E;  4L6V 6;  4L78 A;  2JY5 A;  1D2N A;  1QDT A;  4DV3 M;  1H6U A;  1PJI A;  4P16 A;  2OO9 A;  4PDG A;  1TF0 B;  2FFJ A;  4GMQ A;  4AW4 A;  3D8L A;  4AKH A;  3FKE A;  1EE8 A;  3J81 S;  1E9R A;  3GQ4 A;  4NRW A;  4A3V B;  4LF8 M;  3AFH A;  1D0L A;  3KP1 E;  2DAE A;  3LVW A;  4Y28 F;  1IBL M;  4MGK E;  1MN3 A;  4Z8X A;  1R2Y A;  1QYR A;  4LJ5 A;  1QDR A;  4L4U A;  1IBK M;  4K0K M;  3UJN A;  1R4G A;  1TGU A;  3I4V A;  1Z5C A;  1GJT A;  1SXJ D;  2DAG A;  3U60 A;  1EFU B;  2KXE A;  2KA6 B;  3SAU A;  1JB0 F;  1NNU C;  1IXZ A;  3BOS A;  4XGI A;  3UK6 A;  1DV0 A;  5EP2 A;  1L2C A;  1OTR A;  1AIP C;  2ZTC A;  2F5Q A;  1ZAE A;  3VK8 A;  2XGN A;  4AZF A;  2J7N A;  1YLA A;  2Z8Y M;  4M9Z A;  3KS8 A;  3C3D A;  3M0E A;  2R4J A;  3KSX A;  2ZAM A;  3KOX E;  1DGH A;  2BWE A;  1D0M A;  2VDB B;  3K9P A;  3C58 A;  2LH0 A;  5EP3 A;  3T6P A;  2C9O A;  3U6O A;  3J27 B;  2Z7J A;  1IXR C;  3GPX A;  3SAT A;  4OX9 M;  4DV0 M;  1NHG C;  2A5Y B;  2AHM A;  3B74 A;  1PJQ A;  2UUA M;  3HJ8 A;  3LVV A;  3QAU A;  4GC9 A;  3B7Q A;  1MJG M;  3MJ5 A;  3GLG E;  2ZBK B;  4R7G A;  2H5X A;  1OIZ A;  3GQ5 A;  1Q3B A;  4R71 A;  2D7H A;  3V76 A;  3U6P A;  2MRO B;  3K92 A;  4PCZ A;  3JAM S;  4LRS A;  4DR7 M;  5ITU A;  1NY6 A;  3EIH A;  5FSW A;  3SAR A;  1N33 M;  2RRU A;  3GLI E;  4B08 A;  2LVP C;  4GH9 A;  2EKF A;  2G8L A;  2LVQ D;  2XZF A;  4G6Z A;  3ZCB B;  2JXN A;  1QZM A;  1T3T A;  2N35 A;  1QQW A;  2R44 A;  4IBD A;  2L4E A;  2ZAN A;  1HT2 E;  1OAI A;  1VEJ A;  4NRV A;  3LW5 F;  3WHK A;  3E4R A;  8CAT A;  1NNJ A;  1R7R A;  4LF4 M;  1C1K A;  1J7K A;  1IN8 A;  4JN6 A;  3C9P A;  2LNH C;  4RF0 A;  1OFI A;  1TTE A;  4JI3 M;  4M9S A;  7CAT A;  3AKZ A;  3NWL A;  1XWI A;  2CE7 A;  2ZAO A;  2LHC A;  2R46 A;  4OW0 A;  2CV1 A;  3SMP A;  4DBG B;  4AG5 A;  3GPP A;  3A45 A;  1WHC A;  3DZD A;  4F2L A;  4I81 A;  4B7H A;  1VEG A;  2WSE F;  1RU3 A;  1SXJ E;  2LXE A;  4QHS A;  2JA2 A;  3SC3 A;  2KHH A;  1IY0 A;  3DA1 A;  2W82 A;  1OQY A;  3L28 A;  2DWM A;  2OQ4 A;  4CGY B;  3HHW A;  4CHT B;  2QZ4 A;  3KOZ E;  2LBC A;  4GEW A;  4NL4 H;  2QBY A;  4FWG A;  2R0I A;  2QSF X;  3FTD A;  2C99 A;  2DWL A;  2ZM6 M;  1G41 A;  2BJV A;  2H1R A;  3UMM A;  4IBF A;  5LMU M;  2R45 A;  2NQ8 C;  2CHV A;  1PRB A;  1DGH B;  3Q8X A;  3AOE C;  3KOW E;  3M7G A;  4DV5 M;  1W5S A;  3A42 A;  1V92 A;  2M60 A;  3A98 B;  4IBG A;  2R65 A;  4DR2 M;  3SAW A;  3HWS A;  4NSR A;  2UUB M;  1QVR A;  4LZJ A;  4F1I A;  3GLG B;  4G4N A;  2JZ1 A;  3ILK A;  3R8F A;  2JNH A;  4RF1 A;  3L26 A;  4JYA M;  5IT9 S;  1IY1 A;  1VQ1 A;  2KZS A;  1NVM A;  4QNM A;  5KPR A;  1R2Z A;  3H4M A;  2VQF M;  3GRU A;  4JI0 M;  2L4F A;  1GVN A;  2EKK A;  1QUS A;  5E26 A;  3WHL A;  2EO2 A;  4IJF A;  4LCB A;  4DR1 M;  2K47 A;  4P17 A;  2HAK A;  3L2A A;  3TWK A;  4X64 M;  3TL4 X;  4LFC M;  3B9P A;  3K8Z A;  3GPY A;  2BNK A;  2F5O A;  3GLH B;  3RE8 A;  1J5E M;  1YE9 A;  4I5S A;  4LJ9 A;  3L25 A;  3IEC A;  4JI4 M;  2G3Q A;  3SYL A;  1QUT A;  2DZL A;  2HCB A;  4JI7 M;  4LJ7 A;  2YR0 A;  1Z59 A;  2CEA A;  3IG5 A;  3ZC7 B;  1NV8 A;  2X49 A;  4GC5 A;  4NXN M;  1IN6 A;  2HWJ A;  4QNR A;  3W0F A;  2C5R A;  2KZU A;  4AI6 A;  2CUZ A;  4GHL A;  1DGF A;  3J7B A;  4REZ A;  1P3Q Q;  3E21 A;  4JI8 M;  3HHZ A;  1R5L A;  1SXJ B;  1NSF A;  1Z5B A;  1WGL A;  4GRI A;  1OIP A;  1L2B A;  4GIT A;  2Q2E B;  3F92 A;  2B3T A;  5FTN A;  4LRT A;  3SYK A;  1MX0 A;  1TH3 A;  1AUA A;  4KOD A;  1XNR M;  4KT0 F;  4M9X A;  4MGZ E;  4AG6 A;  4LG2 A;  2C96 A;  4GKJ M;  1ZQ9 A;  1V34 A;  5EXT A;  1HT1 E;  1TH4 A;  4HEO A;  5FTK A;  2Y0T A;  4Z6Y A;  4DV7 M;  3U5Z A;  2XZU A;  4B3R M;  1E9S A;  5ITY A;  2KRU A;  4YY3 M;  1IN7 A;  4I8O A;  2GQF A;  2LVN C;  4DV6 M;  3AOG A;  3VFD A;  4NSO B;  3VDP A;  2BWB A;  3PVS A;  4FCV A;  4LJA A;  5EP4 A;  4JI2 M;  3D8B A;  4LF7 M;  3C3E A;  2RGO A;  3HU2 A;  3THG A;  1XNQ M;  2CWB A;  3R9X B;  2YFQ A;  4IBJ A;  4TUW A;  3TWM A;  2QPA A;  3J80 S;  2J7O A;  1CUK A;  4L16 A;  4BB9 A;  1JR3 E;  4LGM A;  2EJS A;  4IBC A;  2XSZ D;  3FUT A;  3GLF B;  3B7N A;  3FRI A;  2FNA A;  2UUC M;  2VQE M;  2QBY B;  1G4A E;  1WXQ A;  1NJG A;  4B7G A;  3AV0 A;  1G3I A;  3U6S A;  3HU3 A;  3U6C A;  1MU5 A;  3HZJ A;  4XBO A;  5KO3 A;  2DWZ B;  3I01 M;  3UZU A;  1IQP A;  2DZO B;  1QAQ A;  4ANR A;  4BLC A;  2UXC M;  1N78 A;  3GO8 A;  1FNN A;  1VDL A;  3W0L B;  4MH0 E;  3E46 A;  2R4E A;  1PJS A;  4HLQ A;  3KP0 E;  3GLH E;  5IWA M;  5C18 A;  3KFU G;  1HR0 M;  3SAS A;  2QQ8 A;  3MHV C;  2JY6 B;  1GL6 A;  3TPZ A;  4NXM M;  4KHP M;  2HL7 A;  5EP1 A;  4BBA A;  1N36 M;  5A2Q S;  1IN4 A;  3U5Z B;  1S3S A;  1WR1 B;  2OOA A;  4JI6 M;  3SHF A;  2F5P A;  4QOS A;  4FVM A;  3W68 A;  3K1J A;  3MK6 A;  3TQS A;  4CJ6 A;  4JXJ A;  2FE8 A;  1G71 A;  4S12 A;  4KO8 A;  1ZMW A;  4Q7J A;  1QAN A;  2XFT A;  3U6L A;  2DWN A;  2F4V M;  1ZMV A;  3IHP A;  4HL4 A;  2CFO A;  4D82 A;  3A46 A;  2CV2 A;  4PT5 A;  5DFL A;  3OTO M;  1XXH A;  2D7G A;  2MR9 A;  4R3D A;  1N77 A;  2DI0 A;  2KDL A;  2BJW A;  2V6Z M;  2UXB M;  2L09 A;  1K3X A;  2JWS A;  4G3O A;  5GKN A;  5L8R F;  2P5T A;  5BR8 M;  1NV9 A;  1YSY A;  2E5L M;  1IM2 A;  4DV2 M;  2WZJ A;  3I04 M;  3GRV A;  2R6F A;  4I4L A;  5EJC A;  3T38 A;  1BVS A;  3JR4 A;  1L1Z A;  3ZH9 B;  1N34 M;  1L2D A;  3HU1 A;  2EA0 A;  2HHH M;  2Z4R A;  1JR3 D;  3HJQ A;  4LGY A;  1OAO C;  1PJJ A;  3SAV A;  5KQD A;  2XEP A;  2DXI A;  2D7E A;  5ITX A;  4D81 A;  3HGI A;  4OU7 A;  3T1H M;  5H37 D;  3VKG A;  1D0K A;  2DEN A;  4KLN A;  4D80 A;  1IN5 A;  2DAK A;  1HQC A;  3EIE A;  2C9C A;  4FCT A;  4AQY M;  3DFZ A;  3KVW A;  3JR5 A;  3HX3 A;  3GLF E;  4LF6 M;  4DV1 M;  2CHQ A;  3FD9 A;  4ZPX A;  2LVO C;  2FS1 A;  2O25 A;  3PNY A;  4CIZ A;  1Y8G A;  3LQQ A;  1YUB A;  1KYI A;  2Y21 A;  4M0W A;  1PGY A;  1T6O A;  1J09 A;  5KPZ A;  1N32 M;  4X66 M;  2CP8 A;  1TDH A;  3FTC A;  4MM3 B;  3KXE C;  1PJT A;  1ORY B;  2L7H A;  3RGS A;  5LMN M;  1A5T A;  2WSC F;  4QOZ C;  2XF3 A;  3GQ3 A;  2QCU A;  1LV7 A;  4LFB M;  1IY2 A;  3QWL A;  5EXP A;  4YHH M;  2ERC A;  1KSF X;  2KNZ A;  1XXH B;  1G59 A;  3UGJ A;  3NBX X;  5EXS A;  4B3M M;  2Y0Q A;  3L29 A;  4LY6 A;  4MGH A;  1TH2 A;  2DKL A;  4XK8 F;  1F4I A;  2G5G X;  1UFZ A;  2X8A A;  3FUV A;  1HJP A;  3SFZ A;  3U6M A;  1SG9 A;  4GKK M;  4JV5 M;  5KPT A;  2M5Z A;  4L8R C;  4WW0 A;  5ITR A;  1X37 A;  5EQT A;  3FUU A;  2XH9 A;  3LCV B;  4WP2 A;  2R62 A;  2VF8 A;  2YQZ A;  3E9S A;  1PM5 A;  2KNV A;  2FOI C;  4B3S M;  1Q02 A;  2F5N A;  3DOA A;  2UU9 M;  4LF5 M;  1G8P A;  2O01 F;  2LVA A;  2DAM A;  1HQY E;  2VII A;  2VF7 A;  4UN2 B;  5JI3 E;  4NOO B;  2CV0 A;  1SXJ A;  2Z4S A;  1XHB A;  3LMM A;  2DHY A;  2DNA A;  2XSZ A;  4IBI A;  4LJ6 A;  3PXG A;  1XMQ M;  1KFV A;  4X62 M;  1VG5 A;  1V33 A;  1TR8 A;  3RFW A;  2LTU A;  5DYI A;  5IZ7 D;  3GRR A;  4RKU F;  1VDD A;  1GAB A;  3CF0 A;  2QNJ A;  1NY5 A;  2XFS A;  3Q8G A;  2V1U A;  3HKP A;  2MGW A;  3GLF A;  2X4A A;  3LCU A;  1DGB A;  4FD2 A;  4G4R A;  3VKH A;  3GPU A;  3AJI B;  1XB2 B;  2EUC A;  4LJ4 A;  3ZQJ A;  1K82 A;  3U6Q A;  2APL A;  2MJ5 B;  5E6J A;  4DR5 M;  2J5Y A;  5ITX E;  1GKI A;  2WSF F;  4W5W A;  3T1Y M;  4RNA A;  1DO2 A;  2JUJ A;  3U6E A;  2KRK A;  3W67 A;  4JI5 M;  3U60 B;  1K3W A;  1L1T A;  3SHG B;  3VK7 A;  1I4W A;  4FWH A;  2DAI A;  2JZ0 A;  2QHO B;  3PNV A;  4IJE A;  3HHY A;  1ZV1 A;  5ITT A;  4JI1 M;  5EXX A;  2UXD M;  2L6O A;  2GNO A;  2L7I A;  1GO5 A;  3GLI A;  3U6D A;  2K9D A;  1WGN A;  1TDZ A;  1IFY A;  4IBE A;  3M6A A;  4MB7 A;  4LF9 M;  2RGH A;  1JR3 A;  5F3W A;  2K0B X;  3TE6 A;  2I7N A;  2MH8 A;  1DGG A;  4CIS A;  5FTJ A;  3GLI B;  2O5R A;  3CF6 E;  4LJ8 A;  3GP1 A;  4GHA A;  5FTM A;  1SXJ C;  3T15 A;  2RKO A;  4PDI A;  4PD2 A;  4DR6 M;  5BPV A;  2KNA A;  1GL7 A;  1QAO A;  3KW6 A;  1QAM A;  2Y20 A;  4AKG A;  2ZTD A;  2KEB A;  1NHW C;  2OOB A;  3FUW A;  2DZN B;  1Z5A A;  4FWD A;  2R18 A;  1IXS A;  3SBJ A;  3J7A S;  3MMP A;  4FW9 A;  3QYB A;  2KW0 A;  3HJS A;  4ITQ A;  4IIW A;  3PFI A;  3FTE A;  1T43 A;  3HHX A;  3VLF B;  3AL0 C;  4MGI E;  1GJS A;  3CTW B;  2K6B A;  3SMS A;  3U61 B;  3H4J A;  2JY7 A;  1W5T A;  5IRE B;  1XC8 A;  1DO0 A;  1I94 M;  3RGP A;  1WJ7 A;  2FH0 A;  2JP7 A;  3J2P B;  5C1B A;  2CRU A;  2LWX A;  4FCW A;  3U61 A;  4LFA M;  1HNX M;  3IG8 A;  4II7 A;  3TWL A;  2LHG A;  1QZE A;  2YNM D;  2JY8 A;  5DNY A; 
#chains in the Genus database with same CATH homology
 2KNZ A;  1HT1 E;  4HEO A;  2RRU A;  3GLI E;  2LVP C;  2EKF A;  2LVQ D;  2DKL A;  2LVN C;  1F4I A;  1UFZ A;  1HJP A;  2L4E A;  1SG9 A;  1HT2 E;  1OAI A;  1VEJ A;  2BWB A;  1C7Y A;  1OKS A;  2CWB A;  3FE3 A;  3LCV B;  4WP2 A;  2KNV A;  1CUK A;  1Q02 A;  1JR3 E;  2EJS A;  1TTE A;  5JI2 E;  2LVA A;  2DAM A;  3FRI A;  1HQY E;  1G4A E;  4UN2 B;  1G3I A;  2L2D A;  2DNA A;  2DHY A;  4DBG B;  1VEK A;  3K9O A;  1WHC A;  4F2L A;  1VG5 A;  1ZMU A;  1VEG A;  1TR8 A;  2LTU A;  3FRH A;  2KHH A;  1VDL A;  3E46 A;  1OQY A;  2QNJ A;  2MGW A;  3GLH E;  3LCU A;  1XXH E;  1WIV A;  4GEW A;  2LBC A;  3B89 A;  2JY6 B;  1XB2 B;  2R0I A;  2QSF X;  2MJ5 B;  1WR1 B;  2OOA A;  3BBZ A;  1G41 A;  1DO2 A;  2JUJ A;  1E94 E;  2JY5 A;  2DAI A;  2JZ0 A;  1ZMW A;  2QHO B;  4Q7J A;  2OO9 A;  1ZV1 A;  1V92 A;  1ZMV A;  3IHP A;  1GO5 A;  5DFL A;  4F1I A;  2JZ1 A;  2K9D A;  1WGN A;  2JNH A;  2MR9 A;  2DI0 A;  2DAE A;  1VQ1 A;  4G3O A;  1MN3 A;  1NV9 A;  2K0B X;  1IM2 A;  2WZJ A;  1R4G A;  1BVS A;  2DAG A;  2EKK A;  2L4F A;  1EFU B;  1IFY A;  1DV0 A;  2HAK A;  2KNA A;  1OTR A;  1AIP C;  2ZTC A;  2ZTD A;  2OOB A;  3IEC A;  2DEN A;  2G3Q A;  1IXS A;  2DAK A;  1YLA A;  2DZL A;  3MMP A;  3GLF E;  1NV8 A;  2BWE A;  3K9P A;  1T43 A;  2LVO C;  2O25 A;  4R71 A;  2HWJ A;  1Y8G A;  3T6P A;  3H4J A;  1KYI A;  2JY7 A;  1PGY A;  1DO0 A;  1T6O A;  1WJ7 A;  1P3Q Q;  3E21 A;  2JP7 A;  1WGL A;  2CP8 A;  3F92 A;  2B3T A;  1A5T A;  3GLG E;  2H5X A;  1QZE A;  2JY8 A;  2MRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...