2KNZA

Nmr structure of cip75 uba domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
GPLGSMPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquilin-4
publication title NMR structure note: UBA domain of CIP75.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knzA00
2R0IA 1HQYE 5DFLA 3T6PA 3B89A 3BBZA 2DAKA 3FRHA 2JZ0A 1P3QQ 1T43A 2KNVA 3GLFE 1G3IA 1ZV1A 1GO5A 1SG9A 1VEKA 1XXHE 2LTUA 4UN2B 2K9DA 1DO0A 1KYIA 1TTEA 2ZTCA 3FRIA 5JI2E 2OOAA 2DHYA 3E46A 2LVPC 2JP7A 2G3QA 1WJ7A 2B3TA 2DAEA 4WP2A 2K0BX 1IM2A 1OKSA 1C7YA 2JY6B 1JR3E 1OQYA 1CUKA 1OTRA 2DENA 1WHCA 1G4AE 1IXSA 2DAIA 1IFYA 1VQ1A 2LVNC 3H4JA 2MR9A 2L4FA 4F2LA 2JNHA 2JUJA 2LVQD 1NV8A 1VEGA 4GEWA 2CWBA 1QZEA 1WR1B 2LVAA 2JY7A 1ZMVA 1HT2E 2ZTDA 1ZMUA 1ZMWA 1VG5A 2DZLA 3F92A 3MMPA 2MGWA 2KNAA 2L4EA 1VDLA 2JY5A 1R4GA 2H5XA 1A5TA 1HT1E 2DI0A 2MROB 1F4IA 3K9OA 1XB2B 2BWEA 1VEJA 2MJ5B 1EFUB 2DAMA 3IECA 2OO9A 3IHPA 3GLIE 3K9PA 2QNJA 2EKFA 1V92A 2RRUA 1UFZA 2DKLA 4F1IA 1DO2A 2DAGA 2L2DA 1WIVA 2HWJA 3FE3A 2DNAA 3LCUA 1Y8GA 2O25A 1DV0A 3GLGE 1YLAA 2QSFX 2QHOB 2JZ1A 2KHHA 3GLHE 3E21A 4R71A 1T6OA 1WGLA 1NV9A 2EKKA 4Q7JA 1AIPC 2JY8A 1PGYA 1OAIA 1WGNA 2EJSA 2CP8A 1TR8A 4HEOA 4G3OA 1HJPA 1G41A 4DBGB 2LBCA 2KNZA 2HAKA 1Q02A 2LVOC 1E94E 1BVSA 2OOBA 1MN3A 2WZJA 3LCVB 2BWBA
chains in the Genus database with same CATH superfamily
3HWSA 3T6PA 1IXZA 4LZJA 4MB7A 3SYLA 2ZAOA 3C3DA 2CRUA 2KW0A 5KO3A 3QYEA 4DR1M 1T43A 2KNVA 4Z8XA 1J5EM 1IBMM 3SHGB 3K92A 4L78A 4DV6M 4DUZM 5KPTA 4PCZA 3UGJA 1N32M 1LTMA 3LVWA 1K3XA 1GJSA 4LRSA 1VEKA 4OU7A 1DO0A 3U6QA 3I51A 4X66M 2P5TA 4GRIA 2F5QA 4LJAA 4LGYA 3E46A 3J2PB 3VLFB 4LY6A 2B3TA 5ITYA 4NOOB 1Q3CA 5IZ7D 3VFDA 3TQSA 4IBKA 3KS8A 2L09A 4FCVA 2CFOA 3J7AS 4LF9M 4BBAA 1MU5A 3CF0A 1JR3E 2QP9X 3GPYA 2VIIA 4GC5A 4I81A 1TH3A 1ZQ9A 3CF2A 1L2BA 1C1KA 4WURA 2D7GA 3TE6A 4YHHM 3U60A 2Y0TA 4XK8F 1IFYA 3GPUA 3PFIA 4B7FA 4LF6M 2QBYA 4JXJA 5GKNA 2XLJA 3FYDA 3Q8XA 3SBJA 3T38A 1NV8A 1VEGA 4LGMA 1AUAA 4RF1A 4QNRA 4XBOA 3GPXA 1XNRM 1G71A 3FUUA 2YFQA 1QZEA 5EJCA 4PDIA 4TUWA 3JR5A 1HR0M 1GKIA 3LVVA 3U6DA 2DWMA 2ZTDA 1ZMUA 1ZMWA 3HY5A 4IJFA 3SAUA 1N36M 5EP1A 4ITQA 1E9RA 4GKJM 2XSZA 2BJVA 4JI3M 2KNAA 2I7PA 4MGHA 3GLIB 3MK6A 1ZAEA 1S3SA 4OVZA 1A5TA 4IBIA 3KOYE 2V6ZM 2E5LM 3KDSE 2MJ5B 1EFUB 3IHPA 2OO9A 2QQ8A 4MH0E 2F5OA 1TF0B 4CISA 2R6FA 2EKFA 1NHGC 3DOAA 4KT0F 1IY0A 2DKLA 3UMMA 3FUWA 2L2DA 4DR6M 1WIVA 1Y8GA 2KDLA 3U6PA 2EA0A 1JR3D 2O25A 2XZFA 2BJWA 2HHHM 4CJ6A 3ZCBB 4II7A 1NSFA 1QAOA 2JXNA 4XGIA 2QHOB 5ITRA 2O01F 2KHHA 1PJSA 3IG8A 2FE8A 1IN6A 1D0MA 4MGYE 3E21A 1T6OA 3I4YA 2HCBA 5JI3E 2R18A 3HKPA 5BPVA 1WGNA 2YQZA 3AOEC 3K1JA 2EJSA 4LRTA 1R2YA 2BNKA 4FW9A 2XZUA 4G3OA 1DGGA 2ZANA 4DBGB 1YUBA 2MH8A 4B3SM 2L6OA 4LJ8A 3Q8GA 2LVOC 4IBEA 3A42A 1H6UA 1OJLA 4MM3B 4X62M 5LMUM 4G4OA 2XFTA 1KFVA 4L4UA 4LG2A 2OOBA 2WZJA 4RKUF 1YE9A 3E9SA 3FUTA 3PXGA 1SXJA 1HQYE 1OAOC 2ERCA 3DFZA 4LJ7A 2DAKA 1Z6TA 3FRHA 2F5SA 4LF5M 2JZ0A 3PVSA 3J80S 3T1HM 1NJGA 3HHXA 2ZAMA 1IN4A 4NXMM 3J7BA 4JI5M 3B74A 2KRUA 3DA1A 3M6AA 4QOZC 5KQDA 5IWAM 5EXSA 5ITXA 3L25A 2KZSA 2C96A 3A45A 4M0DA 4NC6A 4PT5A 1XXHE 2XF3A 2L7IA 2YNMD 1PJIA 4R7GA 1KYIA 1XXHA 1TTEA 4I4LA 3WHLA 2OQ4A 5JI2E 2WSCF 2D7EA 3PNVA 3AFHA 4NL4H 4CGYB 1TDHA 2LVPC 3LW5F 3U6OA 3TPZA 1FJGM 2LHCA 1L1ZA 3KW6A 1I94M 4YY3M 3B9PA 3M7GA 1QZMA 2K0BX 4G4QA 2C98A 4JI6M 3L27A 3QAUA 3R9XB 5F3WA 2CHQA 2R65A 2W82A 4FCTA 2JY6B 4LJ9A 1OTRA 5DYGA 1WHCA 1DGFA 3KOXE 5FTNA 4M9SA 3UK6A 2DAIA 2G5GX 3ZC7B 1N77A 3V76A 1PJJA 1VQ1A 2V1CA 4K0KM 2MR9A 2L4FA 5A2QS 4G4RA 3L2AA 1QDTA 2LVQD 1JB0F 3KSXA 4B08A 4B3TM 2X4AA 2APLA 3SC3A 5ITUA 2LVAA 5BR8M 2UXCM 1DGHB 4OVZB 4OW0A 3SAWA 2LHGA 1QUSA 2CEAA 3FYCA 3C58A 1IXSB 1WXQA 3CF6E 2EO2A 3HU2A 2DZLA 4L16A 3EIHA 3E4RA 4RF0A 2DVWB 4LFCM 3AL0C 3GQ3A 2WSFF 4IBJA 2MGWA 2L4EA 4I5SA 5DYIA 2VQFM 3GLHA 1ORYB 1NVMA 3W68A 3DZDA 1JQJC 2H5XA 5KQ8A 3C9PA 1HT1E 1MJGM 5EXTA 5IT9S 3UZUA 1QAMA 1VEJA 4R3DA 1J7KA 2LNHC 2R44A 3IECA 2FOIC 2J7OA 2Z7JA 2CUZA 3NBIA 1UFZA 5FTKA 3W0FA 4F1IA 1DO2A 2HWJA 2WSEF 3VDPA 3D8LA 1DV0A 5FTLA 3GLGE 4D81A 2Z8YM 4NRWA 5E6JA 3GLGA 2QSFX 1NY5A 2FFJA 2JZ1A 3U61B 2O5RA 1Z5CA 2Y0QA 4P16A 1QQWA 3KOZE 3TWKA 1L2CA 3GLFA 3SARA 2UXDM 3LQQA 1W5SA 3VKGA 4NRVA 2C5RA 2UXBM 2EKKA 2CV1A 4Q7JA 3HHWA 4QHTA 3THGA 3VK8A 3ZQJA 2RGOA 1QVRA 1HNZM 4X65M 2CP8A 4JI2M 3U5ZA 1TR8A 4HEOA 1XHBA 2CV0A 2V1UA 1YSYA 4G4NA 1Q02A 2R4EA 3JR4A 4QNMA 3MJ5A 2ZM6M 3HU1A 1MN3A 1E32A 3HU3A 3LCVB 4WW0A 2Q2EB 3SMPA 3TWMA 3A98B 1N75A 1Q39A 2HKJA 2RGHA 2C9CA 1NHWC 3BBZA 4DV4M 4FWDA 2VQEM 4HL4A 2X8AA 4LF7M 2KA6B 3SYKA 2Z4SA 1OFHA 4D80A 1ZV1A 1D0KA 2DZOB 4JI0M 3MHVC 2UU9M 1GVNA 4M9ZA 4B3MM 1E9SA 2LTUA 2KRKA 5DNYA 2K9DA 4JI4M 4B3RM 3HJQA 3PNYA 8CATA 3FRIA 2NQ8C 1QANA 1G59A 1KSFX 2Z4RA 3J27B 3W0LB 3KFUG 4LFAM 3C3EA 1IY1A 1L8QA 2G3QA 1WJ7A 2VDBB 2DAEA 5EP4A 2XSZD 2J5YA 3AOGA 1TH2A 4FVMA 5FLXS 4LFBM 3AOEA 1PJTA 4AG6A 5L8RF 5LMNM 4DV7M 1SXJE 1QYRA 2HL7A 3RGPA 3VKHA 4PD2A 1C7YA 4L8RC 1R7RA 1GL7A 1R5LA 3KVWA 1CUKA 4D82A 3HHZA 4DR7M 2M60A 4LZZA 1XC8A 1NY6A 4IBDA 4NSOB 4PDGA 2R46A 1HQCA 5ITXE 1D2NA 1I4WA 2QPAA 2LVNC 4LJ4A 5E26A 1NJFA 1XWIA 1IQPA 3J81S 4F2LA 2JUJA 2LWXA 1J09A 3L29A 3OTOM 3SASA 3VDUA 1V34A 2UUAM 3GLIA 4JI1M 1Z5AA 3HGIA 4GEWA 3GRRA 4GIPA 3L26A 4GC9A 4AQYM 1W5TA 4IBCA 2JY7A 3GRUA 1PJQA 2CV2A 3FTDA 2M5ZA 2LXEA 1QDRA 2OPFA 3U6MA 2CHGA 1UM8A 3T15A 3TL4X 5ITQA 5KPRA 3U60B 4BLCA 4GHAA 3HX3A 2QBYB 3MMPA 5FTMA 4JV5M 2Y20A 1PRBA 2KEBA 2UUBM 2JA2A 3NBXX 4GHLA 4Y28F 5EXPA 4IBBA 2KXEA 1MX0A 2JY5A 3NWLA 1R4GA 3H4MA 3GQ4A 3M0EA 2DI0A 4KODA 2MROB 1F4IA 4ANRA 2QZ4A 1XB2B 3RGSA 2DAMA 3IG5A 4MGKE 3HZJA 4L6V6 1GL6A 3FUVA 2QNJA 3RE8A 3JAMS 4X64M 1PM5A 2RRUA 4AKHA 3CTWB 1SXJD 4LJ5A 5EQTA 3CGWA 3ILKA 4DV0M 4DR3M 3FE3A 2DNAA 3GP1A 1DGBA 4IIWA 3W67A 3BXWA 4Z6YA 4GKKM 1RU3A 2GQFA 4DV5M 4EIWA 4LJ6A 3U5ZB 2DWLA 2X49A 4DUYM 4ZPXA 3KSJA 1EE8A 3I04M 3B7QA 2FH0A 2DWZB 4AW4A 3GLHE 1N34M 3LQRA 1NV9A 3B7NA 1AIPC 2JY8A 1PGYA 3HJ8A 1OAIA 2FNAA 3I4VA 4IBGA 1XMQM 4JN6A 3KOWE 2CE7A 3SFZA 4AKGA 1G41A 3SATA 2LBCA 2DWNA 1IBKM 2KNZA 2HAKA 4IJEA 2C99A 4FWHA 4REZA 4JI8M 2C9OA 2Z3XA 1BVSA 2XEPA 3FUXA 4KO8A 5IREB 3QYBA 2BWBA 2RKOA 2R0IA 5DFLA 5EXXA 3B89A 2QENA 5EP2A 5H37D 1Z59A 2XFSA 4A3VB 1JR3A 1P3QQ 7CATA 3GLFE 4DV2M 2R4JA 1IN7A 3SMSA 4QOSA 2F5PA 3SAVA 1HNXM 1G3IA 3LMMA 3K8ZA 1L1TA 1GO5A 2L7HA 1SG9A 4GH9A 4UN2B 3U6LA 1N78A 4NSRA 4JI7M 1V33A 1SXJB 2ZTCA 3FTFA 3VK7A 1QAQA 2OOAA 4DR2M 2A5YB 2DHYA 3T1YM 4G6ZA 2JP7A 3KS4A 2H1RA 4DR5M 2Y21A 3A46A 2J7NA 4GMQA 4AZFA 2KZUA 4WP2A 4KLNA 5ITTA 1IM2A 1R6BX 1N33M 1OKSA 2D7HA 3KXEC 2QCUA 5C18A 1NNJA 4KHPM 3HJSA 1XXHB 4NXNM 3U6EA 4AKIA 1OQYA 2DENA 4GITA 4P17A 3EIEA 3FKEA 1DGHA 4MGIE 1G4AE 2K47A 1IXSA 1GJTA 4DV3M 4AI6A 5FSWA 3R8FA 3H4JA 4M9XA 1OIZA 2K6BA 4S12A 1GLNA 3RFWA 5FTJA 2JNHA 2LH0A 4DR4M 4QHSA 1NNUC 5EP3A 3KP0E 3FTCA 2DXIA 2CWBA 4LCBA 1NO1A 3GRYA 1WR1B 1Q3BA 1ZMVA 1IXRC 1HT2E 2GNOA 3UJNA 4OX9M 1VG5A 4I8OA 2CHVA 1GABA 3F92A 1TDZA 4FD2A 4W5WA 5C1BA 3U6CA 3AV0A 1K3WA 2F5NA 1LV7A 3L28A 4B7HA 2N35A 4L15A 4FWGA 4DV1M 1VDLA 3KP1E 2XH9A 2ZBKB 3QWLA 3SHFA 1IN8A 4FCWA 1FNNA 4HLQA 3GRVA 3K9OA 1SXJC 3TWLA 3B7ZA 3U61A 1K82A 2BWEA 1L2DA 4LF4M 2G8LA 2XGNA 1HNWM 3K2LA 3GLIE 3I01M 3K9PA 1EIJA 1V92A 1IN5A 4MGZE 5KPZA 2DAGA 3AKZA 4B7GA 1OFIA 3GLHB 3LCUA 1XNQM 2EUCA 1OIPA 3BOSA 1IBLM 3D8BA 3FTEA 1IY2A 1TGUA 2VF7A 3GQ5A 4CIZA 1YLAA 2R45A 2UUCM 1XMOM 3WHKA 4BB9A 1TH4A 1T3TA 2AHMA 4CHTB 3FD9A 4R71A 1WGLA 4LF8M 1VDDA 4JYAM 2YR0A 1R2ZA 2JWSA 2F4VM 3AJIB 3HHYA 2DZNB 2I7NA 2FS1A 1QUTA 1HJPA 1Z5BA 3GLGB 3U6SA 4M0WA 2R62A 2VF8A 4RNAA 4AG5A 3GPPA 3ZH9B 3GLFB 1E94E 3GO8A 1G8PA 2DHRA 1X37A 4IBFA 1D0LA
chains in the Genus database with same CATH topology
2R0IA 1HQYE 5DFLA 3T6PA 3B89A 3BBZA 2DAKA 3FRHA 2JZ0A 1P3QQ 1T43A 2KNVA 3GLFE 1G3IA 1ZV1A 1GO5A 1SG9A 1VEKA 1XXHE 2LTUA 4UN2B 2K9DA 1DO0A 1KYIA 1TTEA 2ZTCA 3FRIA 5JI2E 2OOAA 2DHYA 3E46A 2LVPC 2JP7A 2G3QA 1WJ7A 2B3TA 2DAEA 4WP2A 2K0BX 1IM2A 1OKSA 1C7YA 2JY6B 1JR3E 1OQYA 1CUKA 1OTRA 2DENA 1WHCA 1G4AE 1IXSA 2DAIA 1IFYA 1VQ1A 2LVNC 3H4JA 2MR9A 2L4FA 4F2LA 2JNHA 2JUJA 2LVQD 1NV8A 1VEGA 4GEWA 2CWBA 1QZEA 1WR1B 2LVAA 2JY7A 1ZMVA 1HT2E 2ZTDA 1ZMUA 1ZMWA 1VG5A 2DZLA 3F92A 3MMPA 2MGWA 2KNAA 2L4EA 1VDLA 2JY5A 1R4GA 2H5XA 1A5TA 1HT1E 2DI0A 2MROB 1F4IA 3K9OA 1XB2B 2BWEA 1VEJA 2MJ5B 1EFUB 2DAMA 3IECA 2OO9A 3IHPA 3GLIE 3K9PA 2QNJA 2EKFA 1V92A 2RRUA 1UFZA 2DKLA 4F1IA 1DO2A 2DAGA 2L2DA 1WIVA 2HWJA 3FE3A 2DNAA 3LCUA 1Y8GA 2O25A 1DV0A 3GLGE 1YLAA 2QSFX 2QHOB 2JZ1A 2KHHA 3GLHE 3E21A 4R71A 1T6OA 1WGLA 1NV9A 2EKKA 4Q7JA 1AIPC 2JY8A 1PGYA 1OAIA 1WGNA 2EJSA 2CP8A 1TR8A 4HEOA 4G3OA 1HJPA 1G41A 4DBGB 2LBCA 2KNZA 2HAKA 1Q02A 2LVOC 1E94E 1BVSA 2OOBA 1MN3A 2WZJA 3LCVB 2BWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0I A;  1HQY E;  5DFL A;  3T6P A;  3B89 A;  3BBZ A;  2DAK A;  3FRH A;  2JZ0 A;  1P3Q Q;  1T43 A;  2KNV A;  3GLF E;  1G3I A;  1ZV1 A;  1GO5 A;  1SG9 A;  1VEK A;  1XXH E;  2LTU A;  4UN2 B;  2K9D A;  1DO0 A;  1KYI A;  1TTE A;  2ZTC A;  3FRI A;  5JI2 E;  2OOA A;  2DHY A;  3E46 A;  2LVP C;  2JP7 A;  2G3Q A;  1WJ7 A;  2B3T A;  2DAE A;  4WP2 A;  2K0B X;  1IM2 A;  1OKS A;  1C7Y A;  2JY6 B;  1JR3 E;  1OQY A;  1CUK A;  1OTR A;  2DEN A;  1WHC A;  1G4A E;  1IXS A;  2DAI A;  1IFY A;  1VQ1 A;  2LVN C;  3H4J A;  2MR9 A;  2L4F A;  4F2L A;  2JNH A;  2JUJ A;  2LVQ D;  1NV8 A;  1VEG A;  4GEW A;  2CWB A;  1QZE A;  1WR1 B;  2LVA A;  2JY7 A;  1ZMV A;  1HT2 E;  2ZTD A;  1ZMU A;  1ZMW A;  1VG5 A;  2DZL A;  3F92 A;  3MMP A;  2MGW A;  2KNA A;  2L4E A;  1VDL A;  2JY5 A;  1R4G A;  2H5X A;  1A5T A;  1HT1 E;  2DI0 A;  2MRO B;  1F4I A;  3K9O A;  1XB2 B;  2BWE A;  1VEJ A;  2MJ5 B;  1EFU B;  2DAM A;  3IEC A;  2OO9 A;  3IHP A;  3GLI E;  3K9P A;  2QNJ A;  2EKF A;  1V92 A;  2RRU A;  1UFZ A;  2DKL A;  4F1I A;  1DO2 A;  2DAG A;  2L2D A;  1WIV A;  2HWJ A;  3FE3 A;  2DNA A;  3LCU A;  1Y8G A;  2O25 A;  1DV0 A;  3GLG E;  1YLA A;  2QSF X;  2QHO B;  2JZ1 A;  2KHH A;  3GLH E;  3E21 A;  4R71 A;  1T6O A;  1WGL A;  1NV9 A;  2EKK A;  4Q7J A;  1AIP C;  2JY8 A;  1PGY A;  1OAI A;  1WGN A;  2EJS A;  2CP8 A;  1TR8 A;  4HEO A;  4G3O A;  1HJP A;  1G41 A;  4DBG B;  2LBC A;  2KNZ A;  2HAK A;  1Q02 A;  2LVO C;  1E94 E;  1BVS A;  2OOB A;  1MN3 A;  2WZJ A;  3LCV B;  2BWB A; 
#chains in the Genus database with same CATH topology
 3HWS A;  3T6P A;  1IXZ A;  4LZJ A;  4MB7 A;  3SYL A;  2ZAO A;  3C3D A;  2CRU A;  2KW0 A;  5KO3 A;  3QYE A;  4DR1 M;  1T43 A;  2KNV A;  4Z8X A;  1J5E M;  1IBM M;  3SHG B;  3K92 A;  4L78 A;  4DV6 M;  4DUZ M;  5KPT A;  4PCZ A;  3UGJ A;  1N32 M;  1LTM A;  3LVW A;  1K3X A;  1GJS A;  4LRS A;  1VEK A;  4OU7 A;  1DO0 A;  3U6Q A;  3I51 A;  4X66 M;  2P5T A;  4GRI A;  2F5Q A;  4LJA A;  4LGY A;  3E46 A;  3J2P B;  3VLF B;  4LY6 A;  2B3T A;  5ITY A;  4NOO B;  1Q3C A;  5IZ7 D;  3VFD A;  3TQS A;  4IBK A;  3KS8 A;  2L09 A;  4FCV A;  2CFO A;  3J7A S;  4LF9 M;  4BBA A;  1MU5 A;  3CF0 A;  1JR3 E;  2QP9 X;  3GPY A;  2VII A;  4GC5 A;  4I81 A;  1TH3 A;  1ZQ9 A;  3CF2 A;  1L2B A;  1C1K A;  4WUR A;  2D7G A;  3TE6 A;  4YHH M;  3U60 A;  2Y0T A;  4XK8 F;  1IFY A;  3GPU A;  3PFI A;  4B7F A;  4LF6 M;  2QBY A;  4JXJ A;  5GKN A;  2XLJ A;  3FYD A;  3Q8X A;  3SBJ A;  3T38 A;  1NV8 A;  1VEG A;  4LGM A;  1AUA A;  4RF1 A;  4QNR A;  4XBO A;  3GPX A;  1XNR M;  1G71 A;  3FUU A;  2YFQ A;  1QZE A;  5EJC A;  4PDI A;  4TUW A;  3JR5 A;  1HR0 M;  1GKI A;  3LVV A;  3U6D A;  2DWM A;  2ZTD A;  1ZMU A;  1ZMW A;  3HY5 A;  4IJF A;  3SAU A;  1N36 M;  5EP1 A;  4ITQ A;  1E9R A;  4GKJ M;  2XSZ A;  2BJV A;  4JI3 M;  2KNA A;  2I7P A;  4MGH A;  3GLI B;  3MK6 A;  1ZAE A;  1S3S A;  4OVZ A;  1A5T A;  4IBI A;  3KOY E;  2V6Z M;  2E5L M;  3KDS E;  2MJ5 B;  1EFU B;  3IHP A;  2OO9 A;  2QQ8 A;  4MH0 E;  2F5O A;  1TF0 B;  4CIS A;  2R6F A;  2EKF A;  1NHG C;  3DOA A;  4KT0 F;  1IY0 A;  2DKL A;  3UMM A;  3FUW A;  2L2D A;  4DR6 M;  1WIV A;  1Y8G A;  2KDL A;  3U6P A;  2EA0 A;  1JR3 D;  2O25 A;  2XZF A;  2BJW A;  2HHH M;  4CJ6 A;  3ZCB B;  4II7 A;  1NSF A;  1QAO A;  2JXN A;  4XGI A;  2QHO B;  5ITR A;  2O01 F;  2KHH A;  1PJS A;  3IG8 A;  2FE8 A;  1IN6 A;  1D0M A;  4MGY E;  3E21 A;  1T6O A;  3I4Y A;  2HCB A;  5JI3 E;  2R18 A;  3HKP A;  5BPV A;  1WGN A;  2YQZ A;  3AOE C;  3K1J A;  2EJS A;  4LRT A;  1R2Y A;  2BNK A;  4FW9 A;  2XZU A;  4G3O A;  1DGG A;  2ZAN A;  4DBG B;  1YUB A;  2MH8 A;  4B3S M;  2L6O A;  4LJ8 A;  3Q8G A;  2LVO C;  4IBE A;  3A42 A;  1H6U A;  1OJL A;  4MM3 B;  4X62 M;  5LMU M;  4G4O A;  2XFT A;  1KFV A;  4L4U A;  4LG2 A;  2OOB A;  2WZJ A;  4RKU F;  1YE9 A;  3E9S A;  3FUT A;  3PXG A;  1SXJ A;  1HQY E;  1OAO C;  2ERC A;  3DFZ A;  4LJ7 A;  2DAK A;  1Z6T A;  3FRH A;  2F5S A;  4LF5 M;  2JZ0 A;  3PVS A;  3J80 S;  3T1H M;  1NJG A;  3HHX A;  2ZAM A;  1IN4 A;  4NXM M;  3J7B A;  4JI5 M;  3B74 A;  2KRU A;  3DA1 A;  3M6A A;  4QOZ C;  5KQD A;  5IWA M;  5EXS A;  5ITX A;  3L25 A;  2KZS A;  2C96 A;  3A45 A;  4M0D A;  4NC6 A;  4PT5 A;  1XXH E;  2XF3 A;  2L7I A;  2YNM D;  1PJI A;  4R7G A;  1KYI A;  1XXH A;  1TTE A;  4I4L A;  3WHL A;  2OQ4 A;  5JI2 E;  2WSC F;  2D7E A;  3PNV A;  3AFH A;  4NL4 H;  4CGY B;  1TDH A;  2LVP C;  3LW5 F;  3U6O A;  3TPZ A;  1FJG M;  2LHC A;  1L1Z A;  3KW6 A;  1I94 M;  4YY3 M;  3B9P A;  3M7G A;  1QZM A;  2K0B X;  4G4Q A;  2C98 A;  4JI6 M;  3L27 A;  3QAU A;  3R9X B;  5F3W A;  2CHQ A;  2R65 A;  2W82 A;  4FCT A;  2JY6 B;  4LJ9 A;  1OTR A;  5DYG A;  1WHC A;  1DGF A;  3KOX E;  5FTN A;  4M9S A;  3UK6 A;  2DAI A;  2G5G X;  3ZC7 B;  1N77 A;  3V76 A;  1PJJ A;  1VQ1 A;  2V1C A;  4K0K M;  2MR9 A;  2L4F A;  5A2Q S;  4G4R A;  3L2A A;  1QDT A;  2LVQ D;  1JB0 F;  3KSX A;  4B08 A;  4B3T M;  2X4A A;  2APL A;  3SC3 A;  5ITU A;  2LVA A;  5BR8 M;  2UXC M;  1DGH B;  4OVZ B;  4OW0 A;  3SAW A;  2LHG A;  1QUS A;  2CEA A;  3FYC A;  3C58 A;  1IXS B;  1WXQ A;  3CF6 E;  2EO2 A;  3HU2 A;  2DZL A;  4L16 A;  3EIH A;  3E4R A;  4RF0 A;  2DVW B;  4LFC M;  3AL0 C;  3GQ3 A;  2WSF F;  4IBJ A;  2MGW A;  2L4E A;  4I5S A;  5DYI A;  2VQF M;  3GLH A;  1ORY B;  1NVM A;  3W68 A;  3DZD A;  1JQJ C;  2H5X A;  5KQ8 A;  3C9P A;  1HT1 E;  1MJG M;  5EXT A;  5IT9 S;  3UZU A;  1QAM A;  1VEJ A;  4R3D A;  1J7K A;  2LNH C;  2R44 A;  3IEC A;  2FOI C;  2J7O A;  2Z7J A;  2CUZ A;  3NBI A;  1UFZ A;  5FTK A;  3W0F A;  4F1I A;  1DO2 A;  2HWJ A;  2WSE F;  3VDP A;  3D8L A;  1DV0 A;  5FTL A;  3GLG E;  4D81 A;  2Z8Y M;  4NRW A;  5E6J A;  3GLG A;  2QSF X;  1NY5 A;  2FFJ A;  2JZ1 A;  3U61 B;  2O5R A;  1Z5C A;  2Y0Q A;  4P16 A;  1QQW A;  3KOZ E;  3TWK A;  1L2C A;  3GLF A;  3SAR A;  2UXD M;  3LQQ A;  1W5S A;  3VKG A;  4NRV A;  2C5R A;  2UXB M;  2EKK A;  2CV1 A;  4Q7J A;  3HHW A;  4QHT A;  3THG A;  3VK8 A;  3ZQJ A;  2RGO A;  1QVR A;  1HNZ M;  4X65 M;  2CP8 A;  4JI2 M;  3U5Z A;  1TR8 A;  4HEO A;  1XHB A;  2CV0 A;  2V1U A;  1YSY A;  4G4N A;  1Q02 A;  2R4E A;  3JR4 A;  4QNM A;  3MJ5 A;  2ZM6 M;  3HU1 A;  1MN3 A;  1E32 A;  3HU3 A;  3LCV B;  4WW0 A;  2Q2E B;  3SMP A;  3TWM A;  3A98 B;  1N75 A;  1Q39 A;  2HKJ A;  2RGH A;  2C9C A;  1NHW C;  3BBZ A;  4DV4 M;  4FWD A;  2VQE M;  4HL4 A;  2X8A A;  4LF7 M;  2KA6 B;  3SYK A;  2Z4S A;  1OFH A;  4D80 A;  1ZV1 A;  1D0K A;  2DZO B;  4JI0 M;  3MHV C;  2UU9 M;  1GVN A;  4M9Z A;  4B3M M;  1E9S A;  2LTU A;  2KRK A;  5DNY A;  2K9D A;  4JI4 M;  4B3R M;  3HJQ A;  3PNY A;  8CAT A;  3FRI A;  2NQ8 C;  1QAN A;  1G59 A;  1KSF X;  2Z4R A;  3J27 B;  3W0L B;  3KFU G;  4LFA M;  3C3E A;  1IY1 A;  1L8Q A;  2G3Q A;  1WJ7 A;  2VDB B;  2DAE A;  5EP4 A;  2XSZ D;  2J5Y A;  3AOG A;  1TH2 A;  4FVM A;  5FLX S;  4LFB M;  3AOE A;  1PJT A;  4AG6 A;  5L8R F;  5LMN M;  4DV7 M;  1SXJ E;  1QYR A;  2HL7 A;  3RGP A;  3VKH A;  4PD2 A;  1C7Y A;  4L8R C;  1R7R A;  1GL7 A;  1R5L A;  3KVW A;  1CUK A;  4D82 A;  3HHZ A;  4DR7 M;  2M60 A;  4LZZ A;  1XC8 A;  1NY6 A;  4IBD A;  4NSO B;  4PDG A;  2R46 A;  1HQC A;  5ITX E;  1D2N A;  1I4W A;  2QPA A;  2LVN C;  4LJ4 A;  5E26 A;  1NJF A;  1XWI A;  1IQP A;  3J81 S;  4F2L A;  2JUJ A;  2LWX A;  1J09 A;  3L29 A;  3OTO M;  3SAS A;  3VDU A;  1V34 A;  2UUA M;  3GLI A;  4JI1 M;  1Z5A A;  3HGI A;  4GEW A;  3GRR A;  4GIP A;  3L26 A;  4GC9 A;  4AQY M;  1W5T A;  4IBC A;  2JY7 A;  3GRU A;  1PJQ A;  2CV2 A;  3FTD A;  2M5Z A;  2LXE A;  1QDR A;  2OPF A;  3U6M A;  2CHG A;  1UM8 A;  3T15 A;  3TL4 X;  5ITQ A;  5KPR A;  3U60 B;  4BLC A;  4GHA A;  3HX3 A;  2QBY B;  3MMP A;  5FTM A;  4JV5 M;  2Y20 A;  1PRB A;  2KEB A;  2UUB M;  2JA2 A;  3NBX X;  4GHL A;  4Y28 F;  5EXP A;  4IBB A;  2KXE A;  1MX0 A;  2JY5 A;  3NWL A;  1R4G A;  3H4M A;  3GQ4 A;  3M0E A;  2DI0 A;  4KOD A;  2MRO B;  1F4I A;  4ANR A;  2QZ4 A;  1XB2 B;  3RGS A;  2DAM A;  3IG5 A;  4MGK E;  3HZJ A;  4L6V 6;  1GL6 A;  3FUV A;  2QNJ A;  3RE8 A;  3JAM S;  4X64 M;  1PM5 A;  2RRU A;  4AKH A;  3CTW B;  1SXJ D;  4LJ5 A;  5EQT A;  3CGW A;  3ILK A;  4DV0 M;  4DR3 M;  3FE3 A;  2DNA A;  3GP1 A;  1DGB A;  4IIW A;  3W67 A;  3BXW A;  4Z6Y A;  4GKK M;  1RU3 A;  2GQF A;  4DV5 M;  4EIW A;  4LJ6 A;  3U5Z B;  2DWL A;  2X49 A;  4DUY M;  4ZPX A;  3KSJ A;  1EE8 A;  3I04 M;  3B7Q A;  2FH0 A;  2DWZ B;  4AW4 A;  3GLH E;  1N34 M;  3LQR A;  1NV9 A;  3B7N A;  1AIP C;  2JY8 A;  1PGY A;  3HJ8 A;  1OAI A;  2FNA A;  3I4V A;  4IBG A;  1XMQ M;  4JN6 A;  3KOW E;  2CE7 A;  3SFZ A;  4AKG A;  1G41 A;  3SAT A;  2LBC A;  2DWN A;  1IBK M;  2KNZ A;  2HAK A;  4IJE A;  2C99 A;  4FWH A;  4REZ A;  4JI8 M;  2C9O A;  2Z3X A;  1BVS A;  2XEP A;  3FUX A;  4KO8 A;  5IRE B;  3QYB A;  2BWB A;  2RKO A;  2R0I A;  5DFL A;  5EXX A;  3B89 A;  2QEN A;  5EP2 A;  5H37 D;  1Z59 A;  2XFS A;  4A3V B;  1JR3 A;  1P3Q Q;  7CAT A;  3GLF E;  4DV2 M;  2R4J A;  1IN7 A;  3SMS A;  4QOS A;  2F5P A;  3SAV A;  1HNX M;  1G3I A;  3LMM A;  3K8Z A;  1L1T A;  1GO5 A;  2L7H A;  1SG9 A;  4GH9 A;  4UN2 B;  3U6L A;  1N78 A;  4NSR A;  4JI7 M;  1V33 A;  1SXJ B;  2ZTC A;  3FTF A;  3VK7 A;  1QAQ A;  2OOA A;  4DR2 M;  2A5Y B;  2DHY A;  3T1Y M;  4G6Z A;  2JP7 A;  3KS4 A;  2H1R A;  4DR5 M;  2Y21 A;  3A46 A;  2J7N A;  4GMQ A;  4AZF A;  2KZU A;  4WP2 A;  4KLN A;  5ITT A;  1IM2 A;  1R6B X;  1N33 M;  1OKS A;  2D7H A;  3KXE C;  2QCU A;  5C18 A;  1NNJ A;  4KHP M;  3HJS A;  1XXH B;  4NXN M;  3U6E A;  4AKI A;  1OQY A;  2DEN A;  4GIT A;  4P17 A;  3EIE A;  3FKE A;  1DGH A;  4MGI E;  1G4A E;  2K47 A;  1IXS A;  1GJT A;  4DV3 M;  4AI6 A;  5FSW A;  3R8F A;  3H4J A;  4M9X A;  1OIZ A;  2K6B A;  4S12 A;  1GLN A;  3RFW A;  5FTJ A;  2JNH A;  2LH0 A;  4DR4 M;  4QHS A;  1NNU C;  5EP3 A;  3KP0 E;  3FTC A;  2DXI A;  2CWB A;  4LCB A;  1NO1 A;  3GRY A;  1WR1 B;  1Q3B A;  1ZMV A;  1IXR C;  1HT2 E;  2GNO A;  3UJN A;  4OX9 M;  1VG5 A;  4I8O A;  2CHV A;  1GAB A;  3F92 A;  1TDZ A;  4FD2 A;  4W5W A;  5C1B A;  3U6C A;  3AV0 A;  1K3W A;  2F5N A;  1LV7 A;  3L28 A;  4B7H A;  2N35 A;  4L15 A;  4FWG A;  4DV1 M;  1VDL A;  3KP1 E;  2XH9 A;  2ZBK B;  3QWL A;  3SHF A;  1IN8 A;  4FCW A;  1FNN A;  4HLQ A;  3GRV A;  3K9O A;  1SXJ C;  3TWL A;  3B7Z A;  3U61 A;  1K82 A;  2BWE A;  1L2D A;  4LF4 M;  2G8L A;  2XGN A;  1HNW M;  3K2L A;  3GLI E;  3I01 M;  3K9P A;  1EIJ A;  1V92 A;  1IN5 A;  4MGZ E;  5KPZ A;  2DAG A;  3AKZ A;  4B7G A;  1OFI A;  3GLH B;  3LCU A;  1XNQ M;  2EUC A;  1OIP A;  3BOS A;  1IBL M;  3D8B A;  3FTE A;  1IY2 A;  1TGU A;  2VF7 A;  3GQ5 A;  4CIZ A;  1YLA A;  2R45 A;  2UUC M;  1XMO M;  3WHK A;  4BB9 A;  1TH4 A;  1T3T A;  2AHM A;  4CHT B;  3FD9 A;  4R71 A;  1WGL A;  4LF8 M;  1VDD A;  4JYA M;  2YR0 A;  1R2Z A;  2JWS A;  2F4V M;  3AJI B;  3HHY A;  2DZN B;  2I7N A;  2FS1 A;  1QUT A;  1HJP A;  1Z5B A;  3GLG B;  3U6S A;  4M0W A;  2R62 A;  2VF8 A;  4RNA A;  4AG5 A;  3GPP A;  3ZH9 B;  3GLF B;  1E94 E;  3GO8 A;  1G8P A;  2DHR A;  1X37 A;  4IBF A;  1D0L A; 
#chains in the Genus database with same CATH homology
 2R0I A;  1HQY E;  5DFL A;  3T6P A;  3B89 A;  3BBZ A;  2DAK A;  3FRH A;  2JZ0 A;  1P3Q Q;  1T43 A;  2KNV A;  3GLF E;  1G3I A;  1ZV1 A;  1GO5 A;  1SG9 A;  1VEK A;  1XXH E;  2LTU A;  4UN2 B;  2K9D A;  1DO0 A;  1KYI A;  1TTE A;  2ZTC A;  3FRI A;  5JI2 E;  2OOA A;  2DHY A;  3E46 A;  2LVP C;  2JP7 A;  2G3Q A;  1WJ7 A;  2B3T A;  2DAE A;  4WP2 A;  2K0B X;  1IM2 A;  1OKS A;  1C7Y A;  2JY6 B;  1JR3 E;  1OQY A;  1CUK A;  1OTR A;  2DEN A;  1WHC A;  1G4A E;  1IXS A;  2DAI A;  1IFY A;  1VQ1 A;  2LVN C;  3H4J A;  2MR9 A;  2L4F A;  4F2L A;  2JNH A;  2JUJ A;  2LVQ D;  1NV8 A;  1VEG A;  4GEW A;  2CWB A;  1QZE A;  1WR1 B;  2LVA A;  2JY7 A;  1ZMV A;  1HT2 E;  2ZTD A;  1ZMU A;  1ZMW A;  1VG5 A;  2DZL A;  3F92 A;  3MMP A;  2MGW A;  2KNA A;  2L4E A;  1VDL A;  2JY5 A;  1R4G A;  2H5X A;  1A5T A;  1HT1 E;  2DI0 A;  2MRO B;  1F4I A;  3K9O A;  1XB2 B;  2BWE A;  1VEJ A;  2MJ5 B;  1EFU B;  2DAM A;  3IEC A;  2OO9 A;  3IHP A;  3GLI E;  3K9P A;  2QNJ A;  2EKF A;  1V92 A;  2RRU A;  1UFZ A;  2DKL A;  4F1I A;  1DO2 A;  2DAG A;  2L2D A;  1WIV A;  2HWJ A;  3FE3 A;  2DNA A;  3LCU A;  1Y8G A;  2O25 A;  1DV0 A;  3GLG E;  1YLA A;  2QSF X;  2QHO B;  2JZ1 A;  2KHH A;  3GLH E;  3E21 A;  4R71 A;  1T6O A;  1WGL A;  1NV9 A;  2EKK A;  4Q7J A;  1AIP C;  2JY8 A;  1PGY A;  1OAI A;  1WGN A;  2EJS A;  2CP8 A;  1TR8 A;  4HEO A;  4G3O A;  1HJP A;  1G41 A;  4DBG B;  2LBC A;  2KNZ A;  2HAK A;  1Q02 A;  2LVO C;  1E94 E;  1BVS A;  2OOB A;  1MN3 A;  2WZJ A;  3LCV B;  2BWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...