3FTDA

Crystal structure of a. aeolicus ksga at 1.44-angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
240
Chain Sequence
SFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 83
structure length 240
sequence length 240
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftdA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftdA01
5LQRA 1F3LA 2JH9A 3DLIA 2C7PA 2N47A 4PCLA 3EMDA 4X41A 1O9HA 1M0EA 1R8XA 5DXAA 5KS2A 1VLMA 2NXCA 3E23A 4A6DA 2EG5A 3GO4A 2ZZMA 4R6XA 4G56A 4C04A 2OPBA 2G1PA 2IPXA 3OPNA 2BM9A 2P1DA 2PX2A 3HVHA 2G8NA 4EKIA 5HILA 4M37A 2O0LA 3UZUA 4OBXA 4E2WA 1UWVA 4DF3A 2GLUA 5EPEA 2PY6A 1N7IA 3VYWA 4FS8A 5EC8A 4CTJA 1X1AA 3WSTA 3OCJA 1JSZA 2ADMA 1L3CA 4CWAA 3FTDA 5DWQA 1SUIA 1EJ0A 3HP7A 1FP2A 3P9IA 1KP9A 4BLWA 4GC9A 2H00A 2OY0A 5T64A 1NW5A 3KR0A 3GNLA 5M5BA 1BC5A 4FT2A 4X1OA 3KQSA 2OBFA 5DM2A 3SVZA 5KYGA 1VE3A 3BZBA 2CMGA 3DULA 3M70A 5DTMA 5EGSA 4RTJA 2IH5A 2IH2A 2ERCA 3KQVA 1V39A 3EVFA 2PLWA 1FPQA 3MTEA 4GOND 2AOTB 1NKVA 4BLUA 1DUSA 4AX8A 5LQUA 3EVCA 4HTFB 4KDRA 1Y8CA 3OU2A 3S68A 3TLJA 3JWGA 1RI5A 1VIDA 4FR0A 5EG5A 4POOA 2AVNA 5E1MA 5K8VA 4F84A 1QYRA 3MB5A 1L3BA 3G2PA 3HCAA 5DSXA 4ER6A 1HMYA 5P8WA 4RTQA 5EQJB 5EZQA 5EOVA 4X61A 4Z2YA 2IIPA 1KPGA 5EEGA 2UYHA 2I6GA 4RVFA 1P39A 3TPZA 5F2NA 2ONYA 3M6UA 2H11A 3RIEA 3KU1A 2C7RA 3EPPA 2GB4A 3KPUA 5DX1A 2BR3A 2GPYA 4A6EA 1UIRA 3EGVA 4LG1A 5GP1A 1SKMA 3SSOA 1G6Q1 2XYRA 1L9KA 2VDUE 5E9JA 2BR5A 5FULA 5GIOE 4PINA 1YFJA 3OU7A 2XYVA 1JQ3A 3TMAA 4PONA 5LR6A 4RVHA 1G38A 1ZHFA 4PGHA 3G8AA 2Z6UA 4ER3A 3TKAA 5EVJA 2IDKA 2I7CA 4KDCA 5HZMA 1TPYA 1KYZA 3R3HA 3KHKA 2WA1A 5FQNA 2E5WA 2PX8A 3VC1A 4QDKA 4WXHA 1NT2A 2AS0A 3AWIA 2VDVE 4U7TB 2PSSA 5K09A 2B3TA 3I58A 4P7FA 4UOEA 1X1CA 3CCFA 1INLA 3E05A 2LD4A 2H1RA 3CJQA 4PYKA 3CJTA 4PNEA 1P1CA 4ER7A 5E9WA 5LQKA 4IV8A 4M38A 1QAMA 3ER9A 1MHTA 2GAFA 2Z6QA 3T0IA 1QAQA 3I64A 3MCZA 1BOOA 3AXTA 1QZZA 2HNKA 4KIGA 2HV9A 3NVKI 2DULA 3P2IA 3X0DA 4MTLA 3CVOA 4AZTA 4C08A 2O05A 3IEIA 1QAOA 3P9KA 5BW5A 5E2BA 3ER8A 5KVAA 1ZQ9A 2IGTA 5LQNA 2CMHA 1JQDA 3O4FA 3HCCA 3LHDA 4MIKA 4XUCA 1D2GA 2IDJA 2R3SA 3EEYA 3MERA 4GF5A 5E8JA 5K0NA 4CKEA 1NE2A 2XVMA 5K0EA 2I9KA 2YVLA 1Q0TA 1EIZA 1X1DA 5EIWA 4YV0A 3NDJA 1NBIA 5HEKA 3HCBA 5DRYA 3RODA 3T7SA 4ER0A 2FK7A 1X19A 4HG2A 5CVUA 2P7IA 3LSTA 3FUTA 3LBFA 3BKWA 4QDJA 5DM4A 10MHA 3P2KA 3LCUA 2IP2A 2YR0A 4XCXA 4YUZA 2UZ4A 2IFTA 4KVZA 3EVBA 3JWJA 3UJ7A 2B25A 4C03A 1R8YA 2P40A 2ZBQA 3Q87B 3LDGA 4DCMA 3EVAA 2ZIGA 3ELYA 2WK1A 2FHPA 3C6KA 5CVDA 5G02A 1AV6A 1XXLA 2G71A 1P1BA 2PXAA 3V97A 2EJUA 5HFJA 3NWBA 3IV6A 4GUAA 3HVIA 2B78A 3FRIA 5LSAA 4QQKA 3M6WA 1O9GA 4PIPA 5DM1A 5FQOA 3DLCA 3DTNA 3M33A 4P7GA 3M6VA 5IH3A 3T7RA 2O07A 3PX3A 1IXKA 1TW3A 3R6TA 5E1OA 5CD1A 2UYCA 5H02A 5CUQA 2BR4A 5HIIA 3UFBA 4FGZA 4E2ZA 1L3IA 1NBHA 3DXYA 2P3QA 4RSRA 3G88A 4HC4A 2YXLA 2ZBPA 2HWKA 5C0OE 3T7TA 2VDWA 3KR9A 4RVGA 1I1NA 5K0GA 5CCXA 4DQ0A 2BZGA 5K0JA 3HA5A 5DT2A 4IWNA 3LCCA 1RI1A 4V0RA 3E7PA 5BP7A 1SUSA 2AN3A 4AZSA 4GEKA 4FSDA 5EMJA 3NMUF 4RTOA 4PYNA 2XYQA 3B3FA 5E8RA 3UA4A 3G2OA 1SQGA 5K0CA 3FPGA 4YUXA 4QPPA 1PRYA 3DMFA 1FBNA 5DXJA 4EMSA 2PT9A 4RWZA 3KQOA 3FTFA 4QQNA 5EMKA 5FA5A 1M6EX 1H1DA 2OKCA 4XUDA 5DSTA 3KQTA 2PX5A 4OQEA 2AOVA 2OYRA 1I4WA 3UJBA 2OXTA 3THRA 3P9CA 3CGGA 5ICCA 1BKYA 2CKDA 4EQZA 1VPTA 2YX1A 1ORIA 5BXYA 1R6AA 2AOWA 3EGIA 1UFKA 2QRVB 3GRZA 3IYLW 4MWZA 2CWWA 4R8SA 5U4XA 5CCBA 4KRGA 3ANXA 3FTEA 3KPVA 3TKYA 4CKBA 5BW4A 4RTNA 3EVEA 5EEHA 5K0BA 3VC2A 4C07A 1HNNA 2OO3A 1G60A 2QE6A 3BWYA 3C6MA 5DPMA 2JHPA 4FZVA 1B42A 3HCDA 2AVDA 1T43A 2PT6A 1R00A 1Z3CA 4XUEA 4X60A 4FT4A 3MHTA 1WG8A 8MHTA 2XVAA 5EZSA 3SSMA 3HTXA 1JQEA 2ZWAA 4EK9A 9MHTA 2PWYA 4YV1A 1N2XA 1FP1D 2YTZA 1RJEA 3A7EA 3GWZA 1OR8A 3OZTA 1RI4A 1WZNA 1VP9A 1EQAA 2JJQA 3U81A 3DP7A 5B1SA 1AQIA 1XCJA 2B9EA 2JHAA 3G7UA 5DX0A 3BWMA 4RTLA 1F38A 3DXZA 3F4KA 3HEMA 4EVIA 2PWPA 3MGGA 4PYJA 5GINE 3KQPA 3PLAE 2WA2A 2ZIFA 2O06A 4LWPA 3P97A 4PYMA 4Y30A 3CKKA 5C1IA 2C7QA 3LDUA 2ZWVA 5IKMA 2AOUA 3FPEA 3LGAA 1JG4A 1ORHA 1XDSA 2P8JA 2PXXA 2PX4A 3LBYA 3A25A 3AY0A 5F2OA 1XCLA 1NV8A 2AZTA 2CL5A 3NDIA 4F86A 4RTPA 4RTMA 4PGGA 3Q7EA 1RI2A 2PXCA 4P58A 4AUKA 3REOA 4GOMD 4ATNA 3PTAA 3HA3A 5KQSA 3KQQA 3E8SA 5F2KA 3LDFA 5DRTA 2GS9A 4P7JA 5DTRA 5GWXA 4KWCA 4ER5A 4DMGA 2FRXA 3K6RA 2R6ZA 3GIWA 4BP3A 2OB1A 2YUIA 2YXEA 3G89A 5K0FA 1JG1A 3PFHA 3R24A 4HSGA 5FWDA 3V8VA 4YMHA 3R9XB 1KHHA 2AN4A 3KPWA 4AZWA 3OE4A 1ZGJA 5K01A 2ZIEA 1VL5A 2JG3A 4DCGA 2UYQA 3UJAA 3EVDA 5LQCA 3TRKA 3PS9A 4HGZA 5K05A 3SGLA 1G8SA 3M4XA 3TM5A 5DLYA 4BP1A 4FP9A 2C7OA 1KPIA 3B3GA 1YB2A 2ZVJA 2XBMA 3FRHA 3P8ZA 5CVVA 1KR5A 3AXSA 1AF7A 2QRVA 3A27A 2AN5A 2P35A 3KQYA 4PYLA 1NW6A 2O57A 3GGDA 4KIFA 3G2QA 5GM2A 3GDHA 3UWPA 3FYCA 3LX6A 3EEOA 2QYOA 2PBFA 3ELUA 4FSXA 3SX0A 3VSEA 3GRRA 1SG9A 4L7VA 3HCEA 3LKDA 3M6XA 2PKWA 2V7EA 3L8DA 4YUVA 1R18A 2OZVA 1ZKDA 3NW9A 3NVMB 2ZZKA 4H0NA 3KR1A 2G70A 2FYTA 4OBWA 5FWAA 5MHTA 2NP6A 3DH0A 5ICFA 4R6WA 3DR5A 5EMLA 4MHTA 1JG3A 2ZZNA 1JG2A 3NTVA 3NWEA 1YZ3A 2G72A 5HIMA 3BT7A 4KW7A 4E70A 2NYUA 5EKUA 4PWYA 5GM1A 2AOUB 5FHQA 1KIAA 3FUVA 3FTCA 3G8BA 5ERGB 1NW3A 2QY6A 2Y1XA 3JWIA 1EAMA 4M7RA 4YUYA 3ID6C 2YXDA 3TR6A 5D1HA 2EFJA 2NXNA 3C3YA 3BWBA 3LKZA 1JR4A 3EVGA 3JWHA 5EHGA 4C05A 3ELWA 1VP3A 4Y2HA 2ZTHA 5E1BA 1QANA 2B2CA 4GOLD 3BGDA 4RYLA 3UA3A 3B3JA 3HCFA 3FPJA 3PB3A 1G55A 1WY7A 4X63A 5T67A 3G5TA 1KXZA 1DL5A 4OQDA 1RI3A 3BGVA 3KPJA 3GCZA 3BGIA 2ZLBA 5CIYA 2ZW9A 3OZSA 2ORED 3MQ2A 3PFGA 4V0QA 4EKGA 4PYQA 5GIPE 2Z6AA 4OA5A 2P3LA 3FYDA 2Q41A 4LWOA 4BLVA 3THSA 5K0LA 2ZULA 3KR2A 4C06A 1YUBA 4DKJA 1D2CA 4WVLA 4HGYA 4R8RA 1G8AA 5EHIA 5DTQA 2BM8A 4GBED 3ORHA 3MTIA 4ISCA 3GRUA 1U2ZA 1XDZA 3DMHA 3EVZA 5FA8A 3UJDA 3CJRA 5C9ZA 2NNWB 2P41A 1YF3A 4IKPA 1PJZA 4DM3A 3UBTA 4OX9Y 4CKCA 4RVDA 2A14A 1M6YA 1NW7A 3B89A 3SXJA 1SVUA 1EG2A 4BY9E 1L1EA 4YV2A 1BHJA 2OB2A 3DXXA 5CVEA 2UYOA 3OU6A 3KQMA 4P7KA 3PT9A 3QV2A 3FPHA 4E31A 4RTRA 4C4AA 3HM2A 5GOZA 2V74B 2ONZA 5T6BA 2ZSUA 4HH4A 2IBSA 4E2XA 2I62A 4IV0A 7MHTA 5LQAA 4QTTB 5CM2Z 2EJTA 4RTKA 5LQJA 3CC8A 3KQWA 2K4MA 4AZVA 3LECA 3SSNA 2P3OA 4E2YA 3C3PA 3PX2A 3EMBA 1RJGA 3UJ6A 2HTEA 3R0QA 5DX8A 3SR4A 4MQ4A 2ZCJA 3G2MA 1ZGAA 2AR0A 2YQZA 2JHCA 3DOUA 3LL7A 3ME5A 3QOWA 4GC5A 4O29A 1N7JA 2AOXA 2FCAA 3O31A 3HVJA 5EMMA 1AQJA 5FUBA 2P7HA 1YZHA 1JTFA 1WXWA 1XDUA 1RJDA 1YFLA 2DPMA 5E2AA 3NJRA 1MJFA 1NW8A 1O54A 3GXOA 3OFKA 4PYIA 5EIFA 4E32A 4B17A 3AJDA 4OA8A 1KYWA 3I5UA 2VS1A 3GRYA 4YMGA 3UJ9A 2GH1A 2VP3A 2FK8A 3GJYA 4QVKA 4ZTBA 2HMYB 4HRAA 3TFWA 3UJCA 5EKXA 3GRVA 3A26A 3KKZA 2F8LA 3P71T 5E9QA 2BH2A 1KPHA 5ICEA 1NV9A 3LPMA 3KPYA 2ESRA 5E1DA 5D1NA 2PVCA 4R05A 3TOSA 3OE5A 3DUWA 1IM8A 3LCVB 3FZGA 3C0KA 1XTPA 3RW9A 2ZFUA 4RX1A 1JSXA 1JTEA 4U7PB 4QVGA 3O7WA 4K6MA 3OFJA 3BXOA 5DM0A 3K0BA 3B5IA 3P9NA 3PVCA 4LECA 4CXMA 3BWCA 3OZRA 3UJ8A 1FJXA 1Q0SA 1WS6A 5CVJA 3TQSA 3TM4A 4M36A 1RJFA 2EX4A 2FPOA 2GA9A 5FHRA 2IBTA 3ERCA 5HIKA 2PV0A 3G5LA 4PIMA 3A4TA 1SQFA 3SMQA 4E30A 3ELDA 4F85A 4DZRA 1VQ1A 4JXJA 1P91A 4GOOD 4E33A 1XVAA 5ICGA 5KQRA 1VBFA 3HNRA 1TW2A 3SM3A 3MCTA 1DCTA 1XJ5A 2QM3A 4NECA 3BUSA 1R74A 3A7DA 3DMGA 2AOTA 2Y1WA 3CBGA 4HTFA 2NXJA 3QOXA 5FTWA 5JUWA 5JR3A 3MAGA 3IHTA 3H2BA 4CTKA 1I9GA 1X1BA 3HVKA 4RV9A 4PCAA 4PYOA 5FCDA 3I53A 1IY9A 1ZG3A 2PJDA 3GU3A 3P2EA 4QPNA 1WXXA 3D2LA 3EGEA 4GQBA 1D2HA 2KW5A 5HOQA 2IH4A 4QTUB 4DA4A 2VZ9A 3FPFA 2NXEA 3FUXA 3FUWA 3BKXA 1EJ6A 5FADA 5K03A 2ZBRA 3I9FA 2PGXA 2NP7A 3FUUA 5HIJA 2HR1A 2JH8A 4YUWA 3HA7A 3B7PA 4RTSA
chains in the Genus database with same CATH superfamily
1L7EA 1BTOA 1CIVA 1JQKA 1IC6A 1NR7A 1ZVVA 5J2TF 3HVHA 3WMRA 1CY6A 3WKCA 4AUMA 1X1EA 3GGPA 1V16A 5DYIA 3LM8A 4AJ9A 1Z8DA 2IDZA 2H00A 4WBNF 3QKWA 2CL7X 1PWEA 4BZQA 4ZT7A 5HUQA 2EBUA 1XVIA 5EJ8A 3JWGA 1CLUA 1ISPA 3IVRA 4DUYM 1VKHA 4LDJA 4RSMA 3KS9A 3VK7A 3FKJA 3MT0A 1X2EA 2GXUA 2XMZA 2XCTB 2Z6UA 1BYIA 2C5EA 5B3KA 4DCOA 4UZEA 3VR4H 3DKPA 3K70D 3WBJA 3EG9A 1P1CA 1NJ1A 4KLZA 5ALEA 4IOKA 4MVJH 2P79A 5CJPA 3KO8A 1L2DA 4Y2JA 1USUA 3VX3A 4E14A 1XT6A 2GNAA 4KNVA 2G5TA 3M4JA 1CFJA 4DLTA 5DM4A 3KVWA 3FX2A 3JWJA 4D97A 5FBVB 3V5NA 1N5OX 3USZA 1PZNA 4RAQA 3WISA 1MB4A 1WL8A 4LOIA 2ZXUA 3HU5A 1QHHA 2KMLA 4PAWA 3D4PA 3T7RA 2E55A 1RXWA 3FLAA 4YRJA 1UBNA 4KU4A 4F1IA 5JMWA 3QLUC 4TQUS 5ALIA 1PJ3A 2MSWA 3FPLA 5HFNA 4B1FA 3T9FA 5DN9A 5KDDA 1Z37A 5LLTA 5K0CA 4QATA 5IH7A 5KQPA 4TTVA 3G2KA 1K66A 3O8QB 5D7BA 3CEHA 5KEIA 3CGGA 3QELB 4CE6A 3QWIA 1TDHA 1WZUA 1Z7GA 1HKHA 3NHWA 3MBIA 3VNSA 1JW9B 1FQOA 1Y7IA 2CBGA 5TE9A 2ZWAA 5JLJA 2P62A 3P27A 4D6PA 4U5XA 2JHAA 3KEQA 4PLZA 5G0TA 2CFOA 1L1ZA 3FI0A 1YRLA 1W36D 4ZOBA 4ZVVA 1ZLYA 4RD4A 2H1SA 1LPBB 1N25A 4BYGA 4C2UA 4DLUA 1NPTO 5A7FA 2MCFA 4N48A 2JGIA 2BMWA 2RB4A 2H4JA 3E82A 1X94A 4YY3M 4IHJA 3OQBA 2O5VA 3TJZA 2AQHA 2CN1A 1ZAYA 4ZZ1A 1Q16A 4IKEA 5H8WA 1G8SA 3BFVA 2GILA 1XYYA 3H84A 4BLTA 2WOOA 3P8ZA 2UYGA 3KQYA 1QZTA 5IMSA 3THYA 2Q45A 4GR4A 2QUBA 3RVKA 1RT9A 1ITZA 3NUGA 2JUJA 4BNGA 1ZSVA 2PH3A 1D6MA 4OKIA 2HSEA 3PNBA 3OY2A 5DASA 4JP2A 1NE7A 1EAMA 3EXHC 1YZGA 3ORQA 1AKYA 5KVQA 1IRIA 4X1KA 2HF9A 2VUUA 4BVAA 4V02A 2VSYA 4IUYA 3V8MA 4EG4A 3BULA 4M22A 4EG5A 1KXJA 4GPEA 4MQBA 3JQBC 4DDMA 2IYZA 2GK3A 3ZGLA 3DOOA 3GHHA 2GMWA 2CNDA 3C3PA 3UPDA 2LHCA 3I5YA 4DR5M 2A5LA 1KWKA 2YWEA 1C3VA 2I7DA 2WTEA 1PL8A 4HYYA 2VP3A 3HC7A 5EXSA 2IV7A 5M2QA 4J16C 1IQPA 4Q3DA 4N6OA 1Y6QA 1U7HA 1G5IA 5H3LA 2XYPA 5SICE 1BFDA 4OJTA 3U1TA 1IBCA 2CV2A 3UMFA 2WI8A 5TXGA 3DCYA 4LXQA 3A2MA 4R31A 2M32A 2YIMA 4YH1A 4RJLA 1G8JA 4ZTZB 3SBOA 1X8XA 1N34M 1QDRA 1BQEA 1R5JA 3W3AD 2GM9A 2NUAA 2DLCX 1SWVA 1JU9A 3MWJA 2JIZD 3BGWA 1U1DA 4I3GA 3ZZNA 4IS2A 1L4MA 1KMHB 2QXYA 3CG4A 3AHDA 1WGLA 3O8OB 2ADMA 3WC4A 4CR7A 5T64A 3BJIC 1JPVA 1MGOA 3ZIUA 1QQAA 1WU8A 5KYGA 2GVZC 4IIJA 3ZI4A 821PA 1OJLA 1CV2A 3JZAA 2OV3A 2FSVA 4I19A 3QNUA 4XZ3A 4RZQA 4QDZA 3SMPA 5DSXA 5JNLA 5I48A 2FHSA 4X61A 4X44A 3I72A 5BWMA 3LPNA 4NOLA 1PWHA 1RCTE 2Q8NA 4BFZA 2ZRJA 3WWOA 1LUAA 3L1UA 4EPXA 3CPEA 2HDNB 1WXDA 4KFUA 1NPDA 1VYVA 4DR3B 2A35A 2Q2NA 1CF4A 4TWBA 2AC4A 2ZTCA 1INLA 4LXHA 3UUEA 1DKRA 3H19A 2YWFA 3I32A 5KKNB 4P80A 3UMYA 2FWAA 5DJ5A 4IINA 5CW1A 4WADA 4WOKA 3H5OA 2IXBA 3DO8A 1CNFA 5B7GA 1KY2A 5KO2A 5F21A 3GLGE 1PZHA 3L46A 3OEHA 2DZLA 4AG5A 4YV7A 4XE5A 3ILVA 1NFRA 2AW3A 4D9MA 4TV8A 3ZHVA 3R5KA 4W99A 5AKYA 2J5RA 4EFLA 3SLGA 2JH3A 3ND6A 4MKRA 3RUAA 5EXEA 1GGHA 4C6HA 5JNSA 2AC7A 1F2UB 2JFHA 5DM70 1IVYA 3TLGA 4X7MA 2B99A 1RZRD 3FCCA 1EFPA 3AK4A 4F9FA 4PQGA 3CB4A 2RD2A 4DBVO 4JLNA 3SF0A 4IBCA 5H3CA 5K8JB 4V2IA 5L7WA 2O2XA 2ZB3A 4DCJA 2XH9A 2XVAA 3F6CA 3TNYA 5KWVA 4K2AA 3SIRA 4LOLA 2D4AA 2I67A 3GEHA 4J0IA 5KAPA 5CDFA 1E6MA 2HWXA 4N8SA 4BE4A 4DLNA 1YL7A 2PRZA 3R7NA 2C7VA 1EWYA 3NU1A 4KGDA 1QLHA 5B3LA 4B47A 4LMAA 1PR9A 3OKFA 4F5DA 2KRUA 5J1TB 5ES3A 1BN7A 2PBLA 5IBPA 1FJ2A 1B0PA 4OGKA 4D8TA 4RNAA 1H4TA 2GBPA 5SY6A 4BO0A 4R1LA 4WLVA 1II8B 1T34A 2XRMA 1Q21A 4AF8A 4JROA 1ADYA 5CG2A 1VMIA 3GMTA 4JR0A 4X8LA 3PD7A 5E1BA 5D00A 2PZGA 2JBHA 1HWYA 3L1HA 4FFLA 3MWGA 4MGHA 1LSJA 2VWGA 1QDEA 2VHQA 4MW4A 4FN5A 5EIBC 4RMNA 4WMLA 5BPFA 1MDFA 5H80A 3B53X 2O0HA 1GA4A 4YV2A 3H17A 3VU3A 3DXXA 4G1BA 5WRFA 5J63A 9ABPA 2A0UA 4D4HA 1DJPA 2CFRA 3WK6A 1GUZA 1X8LA 4Q7MB 3OETA 4WKNA 1Q95A 5ALFA 1ISGA 2ZJFA 1N57A 2PLRA 1QRTA 1DKOA 1Z68A 4NQZA 1AU9A 1RHKA 1S5PA 2O8CB 2NUPB 2YKGA 2BBWA 4C2BA 1P5ZB 5DM0A 3BWCA 3E4DA 3SZUA 4HNRA 3PGVA 1SOAA 2HC9A 2RHBA 4X8HA 1VBFA 4XQEA 3RAFC 2X2FA 3FYTA 2KQUA 2XVXA 5CTJA 3R7SA 3ZW8A 1GGVA 4AYWA 4FBLA 2PT5A 5HOQA 5ALTA 5LB2A 2CDBA 1W2HA 4QSHA 2E4UA 3CWQA 1X74A 3O4RA 3HA7A 1OTYA 1H8HA 1AURA 2D5IA 3D8UA 3LY5A 2IBMA 1SU4A 4OBXA 3RI3A 3KXKA 5AVOA 3VPCA 3ROTA 1ETHA 3VNUA 4F9GA 2WF9A 4LZWA 5JSZB 3RKRA 1G4AE 1YONA 3B6ZA 4D4LA 2BFFB 4Q15A 4URFA 3SVZA 1R8JA 5LLDA 4GKJM 2ERCA 2DF8A 2VPYA 2WHEA 1RZVA 2NZWA 4ZIRB 1YTUA 2W6MA 1KPGA 2TMGA 2ZP1A 2V7QD 3BMQB 1OZ0A 4HWGA 5JPDA 3JWPA 4RKUF 2FN7A 3PQDA 2BZ1A 5K5EA 2XYVA 1PR0A 3ZHZA 3RFVA 4ZMRA 4JR2A 3Q9NA 5AJTA 4Z4GA 2Q5CA 3FCYA 5F9MA 3L4SO 5CX4A 2IOQA 1TX4B 2CV0A 3ZD9A 1Y5IA 2G0NA 2H16A 1KMHA 4HH1A 3GR6A 3LNTA 4M38A 3O8OA 3QUAA 4WFIA 3EY9A 2OSBA 3B6KA 4MGYR 1OHHA 2C2KA 2O8DA 5JMPA 1S01A 3TMYA 1F6BA 2R3SA 3FIJA 4RESA 3FHLA 3ICVA 3NDJA 2JGLA 4UAJA 1TM2A 1VG0B 4NPCA 1CRPA 3GLRA 4RYDA 2JCGA 4G85A 1OXBB 3OJXA 3JYHA 3ADCA 1IZYA 4U2BA 5AI5A 4O2BA 2J9XB 1LS1A 1WBBA 1JA1A 4O2LA 2DLDA 1CS4C 1V5FA 1E2MA 4NFLA 5H68A 1GRCA 1MW9X 1L5GB 4GMDA 3U3RA 5NULA 4XVHA 3IOEA 3D5TA 2Q21A 3N9IA 3A1VA 2AR7A 3E4CA 1L7MA 4MW1A 3U09A 4IRMA 2HHJA 2OYRA 2VDJA 5GAJA 5ITUA 3EZFA 2DRIA 4Q1AA 3N8KA 5BOVA 4FYJA 1TVKB 5IZ7D 3WTBA 1QG2A 3VSBA 2G6BA 1B1CA 1Q1BA 5D51S 2I1WA 4UEJA 4QXPA 3JYNA 3PLAE 4BDSA 1HDRA 4C4TA 3VNBA 4Z51A 4GL2A 3C6QA 1BGVA 1A8IA 2F3QA 3O9MA 4IP0A 2WM8A 1ONOA 3RPEA 3REOA 3CWCA 3KTDA 1MV5A 1G16A 3OUUA 1WBDA 2YS7A 4N7MA 4AECA 3L7AA 1S3FA 5CAEA 5EJ7A 5CVVA 4WT7A 4NQRA 2J3QA 1RZUA 4KZPA 2G17A 4P4TA 1OF1A 3BILA 2C57A 1YHZA 4C1BA 4DM4A 3NWEA 1EFCA 3HKEA 1X92A 1D8AA 4XJSA 3JQGB 4MICA 2AEMA 1PNVA 4KRXA 3AKEA 1GPMA 4ZN6A 4R83A 5JS6A 1ZU5A 3FFBA 4B7UA 3L4BA 3V7NA 4BCCA 5MGBA 4OB7A 1OWNA 4YP0A 3WY9A 2P41A 3NT2A 1IWOA 3UBTA 2VT3A 1P1RA 3KKMA 2TECE 4RTRA 2KLHA 4WAUA 1NTOA 2CFIA 3KSMA 1L8QA 2IVFA 2JY5A 1JJVA 1TKRA 1A8SA 4AAYA 4QT0A 4D5GA 2FW9A 2CJFA 2I99A 2DCUA 1II8A 2IP4A 2EEZA 5LYJF 1R2YA 1M8GA 3D3NA 4KNWA 2Y77A 4BC0A 5BSHA 3K20A 2W2VA 3CN7A 3N2YA 3KPYA 4YBRA 2QD1A 2AX3A 3F6BX 3RREA 3ZHQA 3O7WA 4MVXA 4LECA 2JIOA 4MW9A 2XAAA 2ODNA 4M36A 1YE5A 4LTNA 4EO9A 3WLFA 4J4HA 5HIKA 4WESB 2JEOA 4BNNA 4XVUA 1PLKA 2DXIA 1DCTA 1ZVQA 5A5EA 2ZUWA 1CTQA 3GPIA 2P2NA 2HA2A 4L73A 2I4MA 4X1YB 4K87A 2FA9A 4P7BA 3ILHA 5B1YA 3AW9A 3VDXA 2JNWA 5CDUA 4KB5A 1XDWA 5EKSA 2BPOA 4DR4M 3RDPA 4ZCIA 3TW8B 4CGZA 3G3EA 2VAPA 4IGAA 1ZH4A 1BXKA 4MKGA 2LCFA 1DQNA 4X64M 2O8CA 1N5MA 3OF2A 1GFZA 2OLJA 4PC6A 3S2SA 3IIKA 3QWAA 4X9XA 1J2EA 1YCHA 3C58A 1OB5A 2WQZA 2FGJA 2PZJA 4HZIA 3N2KA 4OP2A 4POOA 1JWLA 4LXXA 2UYHA 1RLMA 1EI9A 2NO4A 5CFNA 3UYLA 4JDUA 3ZZTA 1GU7A 4RVHA 4DCCA 4M0DA 1SHJA 2J0QA 1J2YA 3UGKA 4WL0A 4YO8A 2WA1A 4CKXA 3G2HA 1M54A 4PSDA 1X8KA 1GPUA 1VIYA 3F7TA 4BJ6A 2YRFA 4FWDA 4DSAA 2VF4X 2GCGA 3OX4A 5JSZA 1QZZA 2XUIA 1Z7EA 3WKAA 3BBLA 2BFFA 3P9KA 3HDQA 2CFTA 1ESNA 4MPJA 2PMCA 3ANLA 1O89A 3KJXA 4XDGA 1VEKA 4HG2A 4ZIRA 5BYAA 3AX6A 5KINB 1MIOB 1V45E 4NCAA 1KC3A 5ES4B 4LYHA 5IREB 4PDIA 1ZHOA 3OZVA 2QG9A 3ZZ0A 3I01A 4EUFA 2I7PA 3BVPA 4HWSA 5HMLA 5EWLB 3V4LA 1ZNQO 4MLCA 3VAYA 1JEQB 2GPBA 2JAWA 3UA4A 3B6EA 5AKZA 5E6SA 1DV0A 4J49A 2HJ9A 1IOWA 2RI0A 4K6OA 1QE0A 4CTMA 4DR7B 4N5MA 2O0KA 2ZRMA 1M2NA 3Q2OA 4DFDA 2AVDA 3GZ4A 4OSOA 2QLMA 1OZFA 2KZSA 9MHTA 2WG1A 1J8FA 3A7EA 2OWEA 3LWDA 1GPJA 2Q5FA 4KFCA 2XB4A 3LOQA 5ELXA 3KXEC 2HADA 5JYBA 3LT2A 4JI4B 1RYDA 1KK0A 4RZSA 2VHTA 1M83A 3K35A 4I4CA 2CDCA 4IZIA 3EIXA 1TUBB 1M6WA 2VHCA 4GE0A 3S29A 4OQLA 5E7IA 4WZBB 2UUPA 4QHSA 1S8OA 4HQ0A 3PS9A 1DEXA 4JT4A 3LS2A 1GRRA 2WM2A 2GO7A 2H4ZA 3BK7A 1J07A 1WMSA 4X90A 2HHLA 1TVKA 2DZDA 4N41A 3UXEA 1SQ5A 1FSSA 5BYBA 2J67A 1B6RA 4LTDA 1J99A 2W58A 2E4WA 2CF5A 3OI7A 2F3PA 2AHRA 3DDUA 4Y2UA 1VRWA 1K9VF 2ZBFA 1JE0A 3WFJA 1NJ2A 1QUSA 1YS9A 1O77A 2OHIA 4GL4A 4HLUC 3OIDA 4Z99A 2DBRA 5L8VA 3QSGA 3AM4A 5ADHA 5EIBD 4QECA 1N2EA 3ROKA 4NXMB 3DDCA 4DWVA 5LQAA 5EHXA 1ZIDA 2PK3A 3BIOA 2FP4B 4K28A 4DPKA 5FPPA 3K9HA 2LIVA 2ZYVX 4CIZA 1TF0B 4PPQA 5JNUA 3CW2A 3AJDA 1HQCA 1BS1A 5A06A 4PPGA 2Z7JA 3SS9X 2ESRA 3N6VA 4KAJA 3WJAA 1ZOPA 2VNAA 4BN0A 1KZYC 4D9IA 1CD5A 4D25A 3C3JA 1GJRA 1T8RA 4BUZA 1AS3A 3A1CA 3B7ZA 3TTVA 4JI2B 2ZI7A 1L9XA 1FUYB 5KOJB 4TSKA 5DLDA 4Q9HA 1L4KA 2LXEA 1B6TA 3LX5A 1BVSA 1QFSA 4O4IB 1E5QA 4GQBA 1D7OA 3MQFA 5BUZA 1U8EA 3TIIA 2A0XA 2NXEA 4DT1B 1X87A 3FOEC 5A5VA 1SHLA 2WJ3A 1T8SA 4M1TA 1V2GA 3V2HA 1E96A 3ZXYA 4LISA 1QPZA 4A0HA 2EX0A 4WINA 1NMYA 3K3PA 4LNUB 1HLPA 1K9SA 4OQZA 2AH5A 2YYZA 3D8RA 3EHEA 2W2LD 1DBVO 5FORA 1YKFA 1M76A 2FNAA 2C2XA 1Q0RA 1NXTA 4WESA 2F1JA 1NQXA 3GLUA 5A5DA 2IUFA 3TW0A 4UEOA 3TPZA 3SFZA 1KEVA 3IB3A 1H69A 3GPYA 1QGED 4QJ5A 4NEHB 1UM8A 4X1YA 4WPGA 3BTVA 4DCTA 3AUJB 2EFEB 3WGQA 1J0BA 3RLIA 4IM7A 5M3BA 2EW2A 1E9BA 3GG2A 2VATA 4ZZ0A 3V48A 3WLLA 2Y0EA 1PGJA 4GP6A 3TFQA 4ZICA 1WMBA 3I2IA 3NHAA 2IYEA 5KSZA 5CLLA 2V9CA 4NLLA 3TTXA 4DXDA 4CL3A 3PLRA 2Z8YM 1I30A 3QU9A 2W22A 2AN1A 1TXGA 2ZI3A 1RZ3A 5BQXA 3AB7A 2ARKA 3I52A 3K0KA 5SY4A 3T5DA 2Z5LA 3T4UA 4QYSA 5SYMA 2BKAA 4AG6A 2YHSA 3K0CC 2MYNA 4M8SA 3H9JA 5KO3A 2NZ2A 3E21A 4RVGA 2OYSA 1R4AA 3ANNA 3ROGA 5KPZA 2DR3A 4GEKA 3JQRA 4MS1A 4WLUA 1A9SA 2EFYA 1QF9A 4MGIE 3BB3A 4AXBA 3VPGA 2ZRGA 3C8HA 2AOWA 3ADKA 2FG6C 1LTHR 4GSLA 3QYAA 1U28A 5BW4A 3ZGOA 4IIEA 4D7AA 1GRVA 2VJDA 4BLSA 1MIOA 4A36A 2V7GA 3RIGA 3FNHA 2Q0XA 3VZDA 1JN0A 1RM4A 3HEMA 1AA6A 1UC9A 3R6LA 4DLZA 2A9VA 3WLJA 5DDIP 1H2RS 1WULS 1LBQA 4EQ6A 1OPRA 2FSPA 3JCZA 1LJLA 5DFAA 4BO6A 3BB4A 4Q7QA 1JEQA 3EW7A 2ZBUA 3HBLA 2CHFA 2FZCA 2YFQA 1XJQA 3RO7A 3RJZA 3DMTA 3SVLA 4M89A 1YTLA 5H4GA 3IC5A 1UEXC 3V80A 1YS2X 3QIAA 3CRZA 5AHXA 1HDEA 4AJHA 1NDHA 1IG0A 4JA2A 1H0RA 4UBLA 4D3DA 4BMSA 1VA4A 5A5GA 2FW0A 1M10A 5CFOA 1Z5PA 3RNOA 1HORA 1RI3A 4HEJA 4IJMA 3VYTB 5C52B 2RGEA 1R16A 2HPVA 4MAAA 1GUFA 2NV6A 4PT5A 1NW9B 2A14A 1XTSA 3QZUA 2R6FA 2V6JA 5J2TB 1YBFA 4CQMB 4JV5B 3ZU2A 4EG6A 2WAXA 2GDZA 3TAUA 1PL7A 4WBNB 4POAA 1KWGA 2XYGA 5D87A 2G6TA 3NTXA 2DPMA 1LJ8A 1MRSA 1J25A 1FYEA 1RQPA 1UBTS 4GMKA 1J0EA 2ANCA 3A26A 3FYUC 1KK1A 1G5HA 1O96B 3K70C 2EXXA 2QMEA 5FEUA 4RK7A 2C5RA 3K9QO 1N33B 3TQSA 5E6JA 2GN8A 4ZRMA 1PDVA 1OWLA 2IBTA 3UWOA 1HFEL 1D6NA 3I9LA 4FZ3A 1XZIA 3D7KA 3V00A 2YFYA 4DG8A 4IS3A 4HZUA 4UBJA 3SY8A 2JA2A 3LDAA 4NU8X 2BUCA 5BT8A 1P7YA 2FP4A 3ZDYB 3T3OA 1X9GA 5KS2A 1Y8QA 3NBKA 5TEWA 1HDGO 1PJ4A 1QGUA 1XMVA 4TVOA 1HUQA 1WV0A 2E2WA 4FCTA 4MQLA 2O59A 1CX9B 1T8YA 5DTMA 3NGLA 1ORWA 2QZ9A 2I6QA 4RMGA 2PLWA 2RGCA 4YCJA 1I94M 3W1VA 3NB0A 4RQAA 3OOEA 4HQFA 3PXXA 4O4IA 1J42A 4N3AA 2DAPA 4R51A 3X44A 2V8BA 4P3PA 3UHOA 1WCV1 2CLSA 1RAHA 4WGGA 1MDBA 4XIFA 3ZE8A 2VDVE 1QRDA 5TGDA 4OTZA 2F5PA 1FU4A 3AXTA 4LNUA 4HX5A 3VZSA 2EG9A 1UBOS 4HXEB 2AMVA 4MGKE 3U4AA 4FWIB 5A4IS 5JAHA 4UVDA 2O8FA 3W6UA 2OCBA 1R6TA 4JEIA 1PWYE 3EGOA 1G7CA 3SYMA 3TRJA 1L7OA 1SXHA 1FY2A 1O5IA 2WWWA 2F2TA 1R3UA 2IPMA 1YDFA 1DADA 3WIOA 4NABA 5IH3A 3R3JA 3LQKA 1OW3B 4FS3A 3FI9A 3LWZA 3S8MA 1N3BA 1ISRA 5K6AA 3E0XA 4EW3A 1IJKA 4D99A 1MTOA 4AZ0A 3H2IA 1J33A 4DV4B 2CKMA 1C2TA 2QENA 1HI9A 3VPAA 2W6OA 2Y0TA 1SCIA 1SG6A 4EDFA 3ZVNA 4RENA 4EX7A 4YAEA 5CCBA 1YZLA 4L5JA 3FTPA 4TWZA 1IDN1 2PT6A 2DB3A 4X60A 2CDNA 4XD2A 1H2ZA 3T3IA 4ALKA 1L5RA 1NXPA 4C7XA 3QY0A 4FEGA 2ZYRA 4K88A 2FUG1 4DMFA 4L6AA 3AILA 2XD4A 3LGXA 1Y6ZA 2HHHM 2HCFA 2QRKA 4HAVA 1R0BA 5A4AA 4RTMA 4ERNA 2XIJA 3GI1A 1BCSA 3I62A 1JZTA 1MX9A 1IUPA 2GEVA 1DT5A 3PQEA 4MP3A 1EGQA 1Q50A 4GOXA 1LRLA 4Q7KA 3K71B 2IK8A 3O2JA 1SBZA 1K6IA 2YJZA 4WCFC 1QVVA 1OWMA 1YMUA 3C1TA 4WSOA 3CH4B 5THXA 3CNBA 3WA7A 1M7GA 3A1WA 2XVZA 2QRHA 2WILA 1EQUA 2BFOA 4ZCTA 3K9FC 4AQYM 3Q3GE 1CVLA 1Z5UA 2P4EA 2QXUA 1JWAB 4Q1CA 1KH1A 4QNNA 4KQ2A 4XI9A 1XMOB 4BAGA 4EBFA 2HJVA 3WGMA 2DEUA 3NRCA 4JWTA 4NE2A 4IILA 2C92A 1PT9A 2GTPA 4F97A 1DJLA 3GZTB 3RM3A 1NOIA 5E95A 1P75A 4JJGA 1O5TA 1EE1A 3TDKA 3LT4A 1YB6A 1WUYA 1JIIA 3BDIA 4UTVA 4M9UA 3DMDA 4ZI5A 3F98A 2QRZA 3MINB 1GIAA 4DV0B 3LZCA 4GNRA 2JATA 9ATCA 2YJ5A 1VXRA 4QRDA 3RTDA 4X66B 2ZBDA 1VFPA 3OCZA 3F5MA 1P7VA 1P77A 3JQDA 1W4BA 1XKQA 2XJ4A 5ARDA 1LC0A 2F8SA 4Y1GA 3RFCA 3AFOA 5AT1A 4BNWA 3ADBA 2MMGA 5AVYA 2PG3A 1L4LA 3P2EA 3PRHA 4AXXA 1PR2A 4N3BA 5KCMA 5KYKA 1KERA 2UYYA 1HG0A 4ZD6A 2RDMA 2J4FA 1F12A 3I6YA 2QVXX 2GR9A 3K9OA 1O96A 3OCJA 4YIHA 2O20A 3K73O 5C7LO 1LBIA 2FW1A 4WECA 4FE3A 2LIPA 1HEUA 1NI4B 5KJ1A 2PL3A 1C41A 2JCSA 3KLPX 2I2FA 1C4OA 1Z18A 2GRJA 1D9XA 1KETA 2VXYA 1NVGA 5EEGA 1P39A 1NVKA 2JVIA 1TVEA 3T0FA 1DQYA 2EERA 1U2TA 4DEXA 5I5GA 3C48A 1ADFA 1K3XA 1U8TA 2NQTA 3SS8A 1A7AA 2YXNA 3UAVA 1Z47A 2AX4A 1FPMA 2D1FA 3B13B 2P1RA 4NMHA 1DWPA 3ITDA 3T9DA 1OREA 4MJLA 3HY6A 4LGCA 4DMLA 1EE8A 2B30A 1PJJA 2J48A 1A9PA 5FRDA 2D8MA 3IQHX 4JCOA 3JQAA 3PPIA 1DG3A 1ORRA 5AICA 1XQ6A 3V97A 4EI9A 1JTVA 1VLLA 2PPLA 1E3EA 1UWLA 3LUHA 4IF4A 4L4YA 3CRW1 1CYDA 2H1IA 2JW5A 4OEHA 7ADHA 3AEQB 1YFZA 1U0HC 1M1YE 2I4NA 2H5IA 3Q2IA 1JR3E 3GH3A 3ESBA 1RWXA 1CY4A 5EESA 2XUOA 3H1FA 3T4XA 3F71A 5K3EA 5A0TA 1M6EX 5KWIA 4GM0A 1TAHA 1VPTA 2PMDA 3HU2A 1WD7A 3LW8A 4DVJA 5IT5A 3DL0A 4URXR 3V4RA 1GOTA 3KUUA 2ZYTX 5CH5A 3GEMA 3ONEA 5ESDA 1EDOA 5DBEX 2FX3A 4JIGA 1G5PA 3B7GA 3CUUA 2O50A 5H3HA 1V9LA 3PHGA 3VBCA 2UZ1B 2X0JA 2VT2A 2WZBA 3GROA 3UC5A 1HNXB 2PXCA 3KKLA 5IZCA 1IFXA 4JODA 4YWHA 1VG8A 2I33A 4L9AA 2V6GA 2DVMA 2XUFA 1OFVA 4XWKA 4B2PA 2O2IA 2L2QA 1JAXA 2FV8A 5BR1A 1TTPB 3KYCA 3TOZA 1HGXA 1NNEA 2BTQB 1VTKA 5JY6A 4OD0A 1H5NA 2Q5EA 5JALA 4ZOLF 4PO9A 3C4VA 3PQ8A 1JJFA 1FMLA 5T67A 4PZCA 1E9RA 2FR8C 4R1MA 4TMKA 3S2EA 4IX1A 3PEWA 3LXRA 4CQJA 1AXGA 2IPNA 1P5JA 1PWZA 5CFPA 2R0QC 2TYSB 4WXPA 4DM3A 2BKXA 4IIDA 1W44A 4W7IA 1ZP6A 1ZYUA 3JYOA 5KKAA 3A9SA 4ZAVA 3CONA 4FJ1A 4KR6A 4Q4JA 1N75A 2GD1O 5CT8A 3TQCA 3MOGA 2NZYA 4WUTA 1CPYA 2B2NA 2V96A 1HNZB 1SA0A 3LY9A 1ZM4A 1Z75A 3GBPA 3UBMA 3TB4A 2C61A 1TADA 2PL5A 4WLNA 5TPZD 4DA8A 4RHEA 4AJIA 4PLTA 5AW9A 2H06A 1XD8A 3EA4A 4I7EA 1WB6A 1Q3CA 1EK0A 4KQMA 3VLFB 4HUQA 2CLLB 3G5LA 1P91A 4DJJA 3C5WP 3ZE2B 3MTGA 1R74A 4TV9A 4Q3AA 1ZJJA 5FCDA 5IJ9B 4LOAA 1V96A 1TD9A 3U61A 2XEDA 2ACWA 4JT9A 4BVGA 1VPVA 4WOJA 3CR8A 2FRDC 4EUKA 1GQ2A 2BKLA 4H1WA 3RT1A 1DOZA 4MVJM 4DTCA 2ZQZA 4WI1A 4Q05A 1H8ED 1GRQA 3WHKA 3KQSA 3X1ZA 3ZXXA 4QM6A 4BQIA 3DE7X 4YXWA 1W8IA 2GVNA 3TH5A 3ZWCA 3L4EA 1CERA 5ADUS 1NATA 4B44A 2RBKA 3H5IA 3E3NA 1MJHA 4CTNA 1Y1SA 1XQVA 3IQEA 3OX2A 3Q3IA 4UPEA 4AJ1A 3H1TA 1U9YA 3TKAA 5EVJA 3U39A 1TPYA 1TH3A 2KZUA 4IIBA 2G80A 4U7FA 3T9AA 2OG1A 1PNTA 1OI4A 2IS1A 5LQKA 3E35A 4BO5A 2JFFA 1QQWA 5F9FA 4RJ2A 2VBGA 2F4VM 3K1AB 1D0KA 3IUMA 1NI4A 3AM1A 1P1HA 3S1LA 1XK7A 3PU6A 4OXKA 2P40A 2XZOA 2C29D 1CETA 2CHQA 2Z1NA 5JEEA 3HQ4O 5L4NA 2L42A 2EZ9A 5F23A 1ZDMA 3SZLA 1UXGA 3WYEA 1NMEA 1QIEA 4IEIA 4GI3A 1IZ7A 3NAGA 5F7ZA 3UWKA 1P29A 3P9QA 4F4IA 1Y80A 2IYNA 4AROA 2P9YA 3N86A 4LZPA 2JFZA 2KNZA 4ZO8A 4AMUA 3NEAA 3FPBA 2F3SA 1YUMA 4KRGA 3FTEA 2BELA 1PVOA 4B0OA 4D82A 3BWYA 4A03A 1X7GA 2H2DA 3ABIA 2IW1A 3O84A 3F9RA 1XCGB 3QX3A 3W06A 1P61B 2OLKA 1SC6A 1YU9A 2JJYA 1CR2A 5D2CA 1IOLA 1YVDA 3SJCA 4M55A 4CGYB 2X9QA 3H1BA 4B9EA 1KZHA 1ZI8A 1KP3A 4P58A 4F96A 2GZ3A 4XTCS 2DI0A 4Q01A 1FX0A 3RRZA 4UVHA 2C4TA 3ZC7B 4BP1A 2R2GA 3EEBA 1KY4A 1P0MA 4KQHA 4TQGA 2ZB8A 2PJZA 1GGFA 4I8XA 3S40A 4YUVA 1CE8B 5JWRA 1KVRA 4LY6A 2ICAA 1ONNA 3QLVA 1W0KD 3L1JA 1SXJA 2UZ1A 4YRLA 2AN9A 3Q15C 1QOPB 1R0SA 4K2HA 1C1DB 3ZLBA 1DL5A 4CQNA 4NCXA 4KEAA 2ORED 4CMCA 3ZGNA 1K1EA 3R3SA 4X3CA 1UAAA 3ZOKA 2UUAM 1UJNA 5T8KC 3GY0A 3UJDA 4CTOA 2PPVA 1T9ZA 1QSGA 2C97A 2NO5A 2Y05A 2RI1A 3HSSA 1X1SA 1W0JD 1WF6A 4LDQA 4AP5A 2K4MA 1ZNXA 4RK1A 1WPGA 3AV0B 3EMBA 2ECPA 5KNBA 3SJZA 5DX8A 1LV7A 2BTQA 2VJQA 3ESQA 4RV5A 3BTOA 5HKLA 2DUWA 3OFKA 3AF0A 4HGPA 1R4GA 3FVTA 5AKLA 4MR7B 1Q15A 5T5QA 2RC5A 2IXDA 1F2VA 4E5NA 1Z0ZA 1YVUA 1GPNA 2DWQA 4E6EA 1KIMA 2BDUA 3B5IA 1P0FA 4QEZA 2HH9A 3UQYS 2N3ZA 4FBGA 2GZRA 3B74A 4RXTA 2B7CA 3HZJA 3UVEA 3HGQA 1RLIA 2YZKA 3IHTA 1X9IA 3BSSA 1IB0A 2PUTA 4YGXB 4II7A 1G66A 4C3OB 3HXQA 1JSCA 3DTYA 4C78A 3WLRA 2BM1A 3SAVA 5BNFA 1YOBA 1QYDA 3QQPA 1QYIA 4YJDA 2K0BX 3ZS9A 2G36A 3UNXA 3BS4A 3I3SR 3IPLA 5IJAA 1Z26A 1PKEA 4GBGA 1VRVA 1GR1A 3QTBA 3ITEA 3K31A 3HMKA 2HXGA 1RXEA 2KHHA 4HXYA 2OV8A 1P31A 3EVCA 3KZNA 4EA7A 3WV5A 3MB5A 1K5PA 2HA7A 4BS9A 2PWBA 4HB3A 2PRSA 1II0A 1O9BA 1UJCA 1DUVG 3DZHA 3ZJYA 3W5HA 4ZT3A 5IJ9A 2BR5A 1AB6A 4IDNA 3OZFA 1YLAA 5HZMA 2BGUA 3A9CA 5HF5A 4LX0A 3A9WA 3NORA 3HXKA 1ULTA 1ZH8A 5LM3A 2Z6QA 1Q14A 4C4ZA 1Z22A 3P2IA 4V1CI 5FTMA 1UPUA 3ASVA 3ESXA 4YR7A 3JSXA 4I9NA 2WJHA 4RD1A 3B2QA 3O8QA 4YRPA 4GGPA 3QELA 3PFFA 1YL5A 1HTBA 3BXWA 1SPXA 1IK4A 3DL4A 3FAZA 5K2OA 1ECCA 4P7GA 3M6VA 4MB2A 3DDWA 1RPAA 5HIIA 4HK4A 3DXYA 4AUEA 2H2IA 2MYUA 2GNOA 2GZ1A 4E3ZA 4YS6A 3IIMA 3T1YM 1XQ9A 2W5UA 4P82A 2IUUA 3AR7A 3S2GA 5D8DA 3M9WA 1ZOIA 2JEZA 4W5TA 3ZWDA 4MQUA 5AW7A 4YNBA 3GELA 4KMOA 5IHPA 3RVLA 1Q57A 1T10A 4JKYA 4NMLA 1VG5A 1Q1EA 1WG8A 1MVOA 3FWZA 1C8VB 1HFJA 1F9AA 2VJNA 2FMFA 3N3BC 2A5FA 1QGYA 3M7IA 4PHFA 4RTLA 3C3XA 4U2KA 3STVA 3J27B 2XNKA 1OCEA 1G7SA 3GLSA 1U3CA 4OQMA 5CYPA 3KYIB 3E9CA 4OI0A 2PSEA 3Q3HA 3KHSA 5AI6A 5IC4A 3A36A 2CXHA 5BO5A 2J9YB 3SDBA 5G1PA 4FB4A 3FCUB 1KRXA 2LVNC 3DFIA 4FSXA 5G2OA 5HA5A 5CXXA 5EKTA 3O75A 2EQBA 2HYIC 2M5ZA 4PG6A 1E3DA 3KR1A 3WMWA 4LOKA 1OD6A 1AGRA 1YQWA 3EPHA 3O9VA 3OTIA 3B9QA 3KB2A 1LW6E 4QLOA 3UEOA 2EFJA 2B69A 4A15A 1FMFA 1XHEA 5ITQA 3PNLA 2ZUBA 5KNBH 1VSQA 3PGA1 2ZLBA 4RA6B 3FGOA 3NJ8A 3KOZE 4JXXA 4Q9IA 1G8AA 4GBED 4IKOA 4FNAA 1X7ZB 1RD4A 3CF0A 2OCYC 5LZ8A 2B98A 1ZM3A 3NEPX 1Y9ZA 1YUNA 5DHTA 4ZI7F 1ZW6A 3UK2A 1Z5CA 4IMJB 3JR7A 4DMCA 3H7AA 1GKKA 3KJQA 3P1JA 5C1BA 4HPJB 3QOWA 4A82A 2Z6VA 4QARA 4UMDA 5KDOA 4ESEA 2F43B 1FS4A 2C54A 5AUQA 1EIJA 3U7EB 1QH8B 4PGFA 5E9QA 4Z54A 1C1DA 1G98A 1KORA 1ATIA 2P2YA 4FD3A 4JVNA 3H99A 2AB0A 4Z4IA 3K7EA 2QUIA 1EFRA 3ZQKA 3RUEA 1QYCA 2YHUA 2GA9A 3ZE6A 3PHIA 4YI3A 1SKBA 3OPVA 5K3FB 2JVKA 5FT9A 4HVCA 2CNWA 1U02A 1KE2A 1DEKA 4QDUA 1NXOA 3HG7A 2WIBA 3AV0A 1NXSA 4NE7A 1JIQA 3RSGA 2VNIA 1O94D 2I6UA 4HWOA 3DLIA 3U4CA 4MR7A 1M8KA 4PTLA 4EA8A 3ICWA 4BNYA 1YIOA 5IAGA 4GUDA 2KSQA 5CH3A 1FIUA 2V7TA 2IYVA 2EO2A 2XNDD 2C3MA 4OHKA 2VZLA 2AEJA 2RARA 1IZ8A 2O7RA 5BRJA 4G89A 1BFKA 3DVQX 2YDYA 4KODA 4BNZA 1H5UA 2AG0A 3K1TA 2ZDHA 2E0IA 5TVGA 3QXHA 3BA6A 2VZ8A 1N32B 2VDUE 4JKOA 4OHZA 5EHZA 1CJTC 3DBHB 3DEYX 1ZICA 3KD2A 2PEYA 1OE0A 2DFNA 4QDKA 1SUWA 2AMYA 1JJIA 4CCSA 4RPKA 4DSOA 4HUTA 4A73A 1C9MA 3KQKA 2H1RA 1B15A 2WVGA 3KYBA 1QX3A 3ILXA 5LU9A 3LLMA 3T99A 3CYFA 2HCTA 4EP1A 4FDUA 1V48A 4JOCA 5LQNA 4OUKX 2VO1A 3C3EA 3T1HB 1F2UA 4LJ6A 1S4QA 3C15C 3K5HA 3FCSB 2C0QA 1KDOA 2NADA 5B3JA 1ABFA 1YD7A 1U04A 2VKTA 4Z4EA 2C3OA 3QNMA 2FMHA 4HNAB 5AW4A 5CJJA 1DGHB 1W25A 2ZUCA 1ZXXA 1M1XB 3P26A 3ZYCA 4FYMA 2C9ZA 2ENUA 3ZHYA 2J3KA 4L0DA 3STYA 5F9HA 1QIHA 2JGRA 2C07A 4OP3A 4J2HA 4IIXA 4RORA 3JWEA 1U9ZA 4G25A 4P86A 3FPKA 2A9OA 3EAGA 4HFNA 1HZZC 1PV1A 4JBGA 2OXTA 1NWHA 3R6GA 2J3DA 2XSZD 3HHEA 4FFOA 1NBMA 3IPCA 3GWZA 3RVRA 1F60A 2INGX 3ELBA 5KU1A 1O6BA 1Y33E 1JF8A 4EVIA 2Y0PA 4EJFA 1M6VB 1WR8A 1CP3A 2AHMA 1E5XA 5K3SA 2BD0A 5KU7A 1RXIA 2ZCVA 1RS0A 4K9DA 1ORDA 1GSAA 4XIJA 2H17A 1VHDA 4FCCA 2AN4A 1TTEA 5BSGA 1JR2A 3CUTA 4BRWA 3OKCA 1MT3A 3T3PB 1J06A 3PZRA 5JH7F 2H85A 3A04A 3U1VA 2CHGA 2QT1A 3KZMA 4ZYUA 3NBUA 4MRNA 1Q74A 4JL6A 3H0KA 4IWYA 2R1TB 3AZOA 1WA5A 2K47A 2V0NA 3INYA 4J0QA 3TQIA 1IMOA 3B1KA 2CHVA 1QVWA 4MGZR 1N4AA 3UGQA 1EJ2A 1KXZA 2NUTB 3PFKA 3GEPA 2HNAA 2J45A 1ZW1A 4EH1A 1W7AA 4YRAA 3STUA 1AOXA 5DTQA 1NNUC 4NZNA 2NUPA 4TRMA 5IC5A 4ZT4A 3K8OE 3D5EA 4BY9E 2EA0A 1JAYA 3HM2A 1UZUA 3NTOA 4TM7A 3VJKA 1DWUA 5JJIA 2VXOA 4V0MA 4ROTA 1JEAA 4ZC8A 1LDYA 3MD0A 3FZQA 4L0QA 3RNLA 1IUOA 2P7HA 2FPXA 2FEOA 3KU4A 3F1KA 5IKEA 4D8UA 4QJIA 1BN6A 3X43A 3JQCA 2CSUA 1UKCA 5HG0A 1XD9A 2WPNA 3GJ8A 1YCGA 2I78A 4FILA 5E7JA 4KWHA 4R9VA 3O1JC 3JALB 1UK8A 4HEOA 4UQPA 2GX6A 3NR2A 4HADA 2JGFA 4YPVA 3FG9A 1OPXA 3EX7C 2CHEA 4E5MA 3RSCA 5EIAA 2WP0A 3BIJA 4ZRDA 1JPUA 5ICGA 3PJFA 3IE2A 1ZO8A 3GLGB 2HQOA 3A7DA 1TEHA 2NW6A 1HE4A 2CDAA 1EVIA 3VV2A 2KW5A 1SZDA 3KRTA 3SI7A 3BMQA 4G4SP 1KH2A 2H7XA 5D01A 4EA9A 4HQ6A 3CVYA 2OBXA 4DR6B 2G3YA 1G21E 5JD5A 1QH8A 1C3OB 4PQEA 5HILA 1Y8ZA 5ADWA 3X1WA 3TUIC 3P9IA 1V9SA 4BTEA 4BMOB 4UNSA 3AVXA 1ATZA 2G1KA 1E1YA 3D6UA 4DR3M 4AG3A 5ICMA 4ZO6A 1SURA 1RHUA 1JLLB 1G8MA 5K3FA 3T7DA 1ZMBA 2DFKB 2XGNA 4IBEA 2L7IA 3EPPA 4WVFA 1VG9B 3SC4A 1XDGA 5F1OA 1XJCA 1VL6A 5FV7A 3ZX4A 5A62A 2WR8A 2WSLA 3D7NA 4EFMA 1FEZA 4FDTA 3IH5A 3VR3A 1A1VA 3ZC3A 4RCVA 3A6HA 3I58A 3GFBA 2PUAA 3TR0A 4IVPA 4KREA 1PEYA 1PWXA 1ZD2P 1SEPA 3ADOA 4AU1A 4KIUA 3RYHB 1R2ZA 4HPWA 3PUIA 2RONA 2OK7A 1NE2A 3IHKA 5FYDA 4UDXX 5JSFA 1KU0A 1T4CB 3EQZA 1M8JA 2PKQP 4IOJA 2RKOA 2P6NA 4U5QA 5FD8A 4O59O 5HFJA 1USKA 3JR3A 1JHPA 4MV9A 1U8FO 1F06A 1UK7A 1UPFA 2Z9DA 4JJEA 2KPOA 3EIEA 3PHHA 2GJ9A 3AY7A 5MF6A 3C7AA 3F7OA 4HWKA 1L5NA 4J3JA 3U6OA 2PZAA 4AS1A 1E2BA 2AW5A 3H2GA 4S3MA 1SH7A 3LYAA 4XWYA 4LJYA 1HYQA 1YQGA 2QRVB 1KY3A 4ES6A 5CA0F 2BHTA 4TOIA 5CJ2A 1IHYA 3E9YA 2FQYA 2JG3A 2VQDA 5AYVA 3AM3A 3IJEB 3IR7A 1L0BA 1ZCFA 3AONB 1RHJA 4AW4A 3SXPA 1Y8AA 3EDMA 3OQ1A 4P54A 4H4EA 3H6KA 1V7CA 3HXTA 2VZEA 3OLYA 2GCPA 1I5RA 3N5CA 2HMTA 3W5BA 3QHQA 1KQFA 1XZ8A 2ZUTA 1DRKA 3JQGA 3C6BA 4LJ4A 1RI2A 3DQPA 1TZ2A 2HPHA 3PNYA 5DT9A 4J4BA 4V0OA 4AIRA 1JA0A 4MWEA 3IG5A 1V8ZA 4X62B 4DDWA 1CUZA 5EMNA 4N4AA 2XQGA 3F6YA 2G1AA 2ODBA 3HO8A 3KOUA 2NSLA 2COEA 2PGNA 2BF4A 2ZROA 4MUJA 2PZBA 4P35A 3ED5A 4QASA 1NVDA 1ECBA 3ASZA 4P3OA 3GARA 4IAOA 1J22A 4BTVA 1M6VA 2HXYA 3AR8A 3GDGA 2OYCA 5GONF 1E3MA 4M0FA 4LWOA 4HAYA 1Z8HA 3GJQA 2AKEA 1A7JA 4Q1EA 1RP7A 5J40A 2QE7A 4I6GA 4UZFA 4DA9A 3HCRA 1DEHA 4LJRA 2Q4TA 5E4JA 1E66A 5CVEA 5BQ5A 1W9MA 3BN3A 1U1FA 5K1ZA 2ONKA 4GMXA 4I9FA 3R7BA 4OKSA 3IBFA 4F2HA 1GNLA 4RETA 4X84A 3LUKA 1EE2A 4BRSA 1Z34A 3D64A 3IUNA 4IXWA 3WLHA 3L7YA 3SIXA 3SKYA 4X0EA 2XRZA 5I7UA 5CB4F 1RQNA 4UM8B 121PA 3EOZA 2DBQA 1C4KA 4WN3A 1JHDA 3FAKA 4LYYA 4QBHA 3TW8A 3TPCA 3RC7A 3NNSA 3VC7A 4LS3A 4KE9A 4REQB 2VSOA 4G97A 3A4TA 3U80A 4HH0A 5IXSA 4GOOD 1CZKA 3CA8A 3N2EA 3R3UA 5KSWB 3CZPA 5JNVA 4M46A 4LF4B 2XGOA 1NMZA 3D2LA 1Q84A 1YGPA 3CX8A 2OHOA 5AJXA 1GPWB 3E1SA 1ZD3A 1F3LA 3DT8A 1WV1A 4M7OA 3GP8A 3AP1A 5JCJA 4MQFB 5H59A 4B48A 1JDPA 3RSZA 2BSXA 2IL1A 4Q7JB 3HP7A 3I2GA 4X7RA 3JALA 5AMXA 3QPUA 1VSUA 3I01M 2O25A 1B00A 5CBPB 4PZAA 3DULA 5EGSA 2QU8A 3LBNA 3EVFA 3WYFA 4HAIA 2VYFA 2YIDA 5EE0A 4AMGA 2E6UX 5JD4A 2VKQA 3GLGA 3L26A 1MEOA 2AK2A 2XFTA 4Q4AB 2ZSBA 1HBJA 5AKKA 3JQFC 3QMWA 1QCZA 2GEFA 4F2LA 5FQNA 4H18A 1CJSA 4QTXA 4UU8A 1C3OA 5EUQB 4X8MA 4L8FA 1MH1A 5EWLA 4QSMA 4J1TA 3NVKI 3IOMA 2KNAA 4KYIB 3WDSA 4MLZA 5F3DA 4MIKA 4K5QA 3ITNA 2JRCA 1O6CA 5CP8A 1NBIA 1KSHA 1XTUA 2E9SA 4YCBA 5K3DA 2NZVG 4XOUA 2JK0A 4LRWA 3GT4A 2HF8A 3F0TA 4GQAA 4ZT6A 3V1MA 2Y20A 2GPWA 4LXUA 3VAZA 4V2UA 1GAXA 1P80A 3T9BA 1YO6A 3QEMB 1BH2A 4B4WA 4V0RA 3R6DA 3FGNA 2QBYB 1MB0A 3FH0A 4ZAFA 2LW7A 1F0PA 4CLEA 3WNDA 5JE8A 1TUBA 1A4UA 1VHQA 1T9BA 5AVVA 3ZIDA 4WZBA 3RYHA 1GNTA 2R97A 2CSXA 5SYNA 4YAIA 4ZOLB 1JB1A 3VVBA 1F8FA 4MVJG 4QNMA 1M1ZA 3JQ8B 1RRFA 2ORVA 1UMBB 2HBQA 2AJTA 4UBKA 3KQPA 3D8HA 2R4TA 1JE1A 5GJWC 1SCKA 1KI8A 2X1VA 3QXXA 4K1LA 3BG5A 3O8LA 3OQNA 3SC2B 1QU3A 3BREA 3BH0A 4PX9A 4KR7A 1A71A 3PXDA 5L3ZA 2QRVA 4JT2A 3VSEA 3UC9A 4FGKA 4JBXA 3U62A 3FD8A 4LVUA 2G70A 3G5AA 3GPBA 5I7FA 2DGDA 2XAUA 3I2HA 4X3PA 3EZNA 1RVDA 1RRVA 3OQJA 1G71A 5B57C 4DWJA 3VKWA 1TCCA 3NP7A 1H85A 4MS4B 3TNJA 1HSZA 4EHKA 5SZKB 2P9HA 3TSWA 4YDQA 1ORVA 2J59A 2XOEA 3HU1A 5L3QB 1FYFA 4QTTB 4HGRA 1ULHA 4LSZA 5CTAA 4MRSA 3U0BA 2WPDA 1XROA 5KOJA 1B1AA 3EARA 4MWOA 3ACBA 3O31A 2Q5QA 1II9A 3P45A 2FW6A 4JN6B 3NJRA 3ENQA 4ND1A 4J9VA 2BN4A 4YMTA 1J7KA 4Z2AA 4DT1A 3HNPA 3LT5A 2PMBA 1T0BA 4K6CA 3LY7A 3DL2A 4L85A 3AG6A 2QLFA 1AF4A 2CC2A 1CUEA 1RJFA 1L4NA 4OREX 5DH9A 1UBLS 1V5GA 1DIAA 5T4EA 5DGDA 1XK6A 1FVOA 1XNRB 1IONA 4QTUB 4KP7A 2NP7A 3R8XA 4LXYA 2WVJA 4TWIA 3L8ZA 1DJNA 5THKA 1WHTB 3HJSA 4C7VA 1O5OA 1Y82A 2C5HA 1CZLA 1WVIA 1QM5A 3W5IA 2ECOA 2OY0A 3C41J 1W76A 2OBFA 2P91A 4IIHA 1JG6A 1BXGB 4REQA 3C3WA 1E9AA 1HZJA 2OR3A 5KHOC 3WIEA 4NSOB 2I4RA 1P0QA 4N12A 2GHIA 4IDBA 2I7TA 4RKRA 3GFTA 2PNFA 1KL7A 3WL5A 1HE3A 4F1KA 1P7WA 4FYXA 4CL2A 2SHKA 4QIHA 1IXZA 2OEPA 1V8PA 3V8BA 1N6NA 4OQYA 1RMTA 1ZA1A 1QAQA 1YSCA 4FKMA 5CH8A 3B51X 2J9GA 4B74A 3CE6A 2DSNA 2EATA 4QPZA 4GF5A 1TRKA 3E9ZA 4NSNA 3TWLA 2Z4RA 4GHLA 1PIWA 3KJZA 3L0OA 3EY4A 3A11A 3LSTA 1QONA 2WWIA 3GP3A 4LSMA 3IAXA 1Y7TA 2QD2A 5JRZA 2J7PD 2K2WA 3F78A 2OXCA 4R84A 2ZJ2A 3ZDEA 1KAMA 2X6TA 4JC5A 2R84A 4Q4AA 4A5SA 4BTLA 2YWDA 1GNQA 1CR1A 3IBYA 2QVCA 1RU3A 2H1FA 1YB4A 5AVZA 1L5SA 2CFCA 1OVMA 4BNVA 1KQOA 3U17A 1OYVA 3SQXA 4C7MA 4GBJA 2FZVA 3WL3A 5IULC 1MC5A 1YB5A 4TZTA 4JI4M 1V1JA 3FNIA 1NPYA 2HNBA 4DCVA 1GCGA 4YT2A 2V3WA 2ZE5A 4KT0F 3SBDA 4II3A 4EM6A 5K0BA 3VC2A 4GYKA 1DKPA 2XR1A 4KXVA 1SU7A 1P6QA 1GPKA 1EPUA 3MUOA 2EL9A 4C0SA 2O0JA 2B9EA 2JFNA 2ZJ7A 1E60A 4P93A 1WKBA 5IKPA 2IPLA 1GZ6A 3IALA 3L8YA 1ESCA 1PBNA 3QEMA 4AUKA 4FUQA 3EZXA 1CF2O 2QBYA 4YQEA 5INTA 2VJPA 2YXEA 5TGTA 2FFHA 2R5WA 2OAGA 1QC5B 2PGLA 5KQMA 2XGJA 1V92A 3V7WA 3ZDRA 5L6LB 2WB2A 3Q98A 2B4QA 2WKWA 5AK3A 3GRRA 5J2TA 4ED9A 4CQMA 1WXGA 3VKFA 5LCXA 4NXMM 4LY9A 3CF2A 1FU7A 4WBNA 1XQWA 4YLEA 4Y18A 3KDAA 3MRXA 2VAXA 2B6HA 3O82A 1OI2A 1QFYA 2P69A 1P17A 2P0EA 2YNMA 3SC2A 1U7PA 4AQDA 1DZ3A 2A9JA 4EYGA 2C98A 1EQ2A 3CZAA 3ESYA 3UHJA 3IOYA 4ZVUA 2X8BA 2GO1A 5LNK1 1UXJA 1NRJB 1XOIA 1ZUNB 1VL2A 3O94A 1V5WA 3PX2A 2NOAA 3GAMA 3BDAA 3DV0B 2YMQA 1VKJA 3LVFO 1RQ2A 1ILWA 4NC9A 4CF4A 3ZVRA 5J5AA 4YALA 4W5JA 2JAQA 1JQ5A 3E9MA 4MS4A 4C88A 2UU9B 3FSGA 3N0TA 4ALMA 4MA4A 1W6RA 2XEPA 3KK0A 3HN6A 4H1TA 3QMMA 1QCCA 1VJTA 2QR5A 4M7PA 4FFBB 1K3TA 4ZOQI 3OOSA 5H82A 1D04A 4JYMA 1WNTA 4GWKA 2OO5C 2ZTVA 3DC2A 4RV9A 2VC2B 2BI7A 2Q3CA 4NJMB 4JEMA 1CUSA 3R2JA 2EZUA 4IH4A 1ZJZA 4ILEA 4C04A 1Q02A 2WU1A 5CITA 4NCJA 2RGNC 3UAYA 5LBIA 3WSTA 3NTLA 2QN9A 3N05A 5CXSA 5DCWA 1RRPA 4W5RA 2QKYA 2VEDA 3F46A 1I10A 3C14C 1NW5A 3G13A 3KR0A 2ZI5A 4HVAA 3RUHA 3NOXA 1UPXA 4I8OA 1BO6A 5KNLA 4P0QB 1GCOA 3H9UA 3I1YA 4YCMA 1NYRA 1HG1A 4LE1A 4EF5A 1PGYA 3BRWA 1LB1B 3U49A 1F5NA 4NOOB 4LTMA 1FW6A 2VQFB 1MQ8B 2PM8A 3OLXA 3KPUA 5J58A 1H6BA 1U2EA 4S1NA 5ALJA 3A4IA 3ZJVA 3A6DA 5CW2A 1WMDA 1WHTA 1Z5AA 5I9SA 3RARA 5TMEA 3EXG2 4XQ0A 4P7FA 1GT91 3GUCA 2FH5B 4NU5A 4IV8A 4YHBA 4LRSB 3T5MA 3KOYE 2F64A 3LC0A 2NN3C 2ZRPA 5E2BA 4LEIA 4I50F 2AMJA 1DARA 3RBAA 1KDPA 1WDKA 3OKPA 3LDGA 3SICE 2ZIGA 3NX4A 2V6IA 3T5CA 2HY7A 1XZKA 1Y89A 3V8RA 3AJRA 1HF3A 2HHAA 3A37A 4XIYA 1LTQA 4FC6A 1YB7A 2F67A 3EGXB 3ZY3A 4KPEC 1PT8A 3TTSA 3A6LA 3FFXA 2JJ1D 3PCRB 4C6SA 1NJGA 3EFHA 5KQGA 4ARBA 5JISA 4WXMA 3ZDFA 3RU3A 1QIDA 1Y7PA 3RASA 3AC0A 1OAOA 1T6OA 2V7WA 1W4LA 1KBZA 1OZGA 2CCKA 1XAJA 2F8TA 3OURA 3I37X 1N2SA 1Y3CE 2YOHA 1XRQA 3BHMA 3WLNA 1NP7A 5J4HA 3PYMA 1OH8A 3AHHA 2YJTD 4KDEA 2DFPA 4ZI7B 2HLNA 2B8WA 1D1QA 3IR6A 1FB5A 2ZXEA 3GNSA 4RTPA 1NV8A 2PWZA 3TG8A 2A2ZA 1NC1A 5TLSA 3CQ9A 2W11A 4WLOA 5F2KA 5EJ5A 4OU7A 3AEUB 4JZYA 1WSBA 4BP3A 4ARAA 5C4MA 2AJBA 2GZHA 3BIFA 4RQUA 4DCUA 2QLLA 4TXLA 3A4VA 5FPKA 4C2TA 4C5CA 1PTJA 3C5CA 3HCEA 2HRQA 3U5ZB 4MO2A 3MTJA 5IZ4A 5BURA 3FB1A 2I80A 4JX8A 1LWOA 2XA2A 4K40A 5DYNA 3ICQB 1O94C 1GAQA 2G28A 1B26A 2XQIA 4MJ3A 4GR9A 3RGWS 4C05A 4BNXA 4HDMB 1G55A 1YA6A 3WMFA 3KP1E 1STOA 1KDRA 4ZVLA 4UNRA 3MINA 1D6SA 2IHYA 4DOMA 3QXCA 2MR6A 3K92A 1PS0A 1I36A 4IIFA 4CG0A 1QC5A 3RIYA 3UMVA 3BCHA 2R6JA 5A03A 2J30A 2ECKA 1DMRA 3G9QA 2P30A 2EKBA 1N33M 1K86A 4CLHA 5TT1A 2PQMA 3G2MA 5AVQA 4WHMA 2OLEA 1WZ2A 1XTQA 2OGSA 1ZMOA 3JZIA 3VU1A 2JZ1A 3NYIA 3E2MA 1ID8A 3VNRA 2JANA 4FWBA 2O48X 1KPHA 4Y7CA 2PN1A 1ZUWA 4JH0A 1LA2A 2FTKE 3K96A 5ITSA 4OOEA 3QU5A 3BE5A 3BXGA 4PPFA 1FFHA 4BN5A 3C39A 5L3VA 5LOVF 1SCNE 2CNNA 4ZEMA 1ETUA 3EF0A 1FNSA 1G5QA 2GD0A 4G5OA 2D74A 4D4IA 1TJ4A 3VR6A 4TWJA 2VZ9A 3DV0A 1JHXA 4WXYB 3I9OA 1GV1A 4RTSA 1R8XA 3FVRA 1MX1A 4G8DA 1ECJA 3SBJA 4QG3A 4URHA 2PGJA 2OV4A 2R7MA 3OE7D 5AXDA 4XAQA 4B80A 3EBLA 4BUCA 2C20A 3GWGA 1J2UA 3MJEA 1IL0A 4CMEC 1K89A 3Q7QA 1RACA 3BZBA 2QXTA 4KLRA 1QKKA 2W2QA 3SOZA 3CT4A 3H5TA 4FFBA 3M3DA 3ZLVA 4L2IB 1K06A 5B4VA 3P32A 2LKDA 4M0KA 4FE7A 5C3UA 1J6UA 5KC9A 2A0YA 2ZTMA 3AJ8A 3RAGA 1DFHA 2D0IA 4GLBA 2X19A 1AGXA 1H66A 3DTVB 2JD2A 1G2IA 4UTNA 4NJMA 4U9UA 1D6JA 5EERA 3M6AA 4R1OA 2EGHA 2A1IA 3I4VA 5B5SA 1TIPA 3GEIA 1K4KA 3AEQA 4MJXA 4FXPA 3V4OA 4WP2A 1QIMA 2BHLA 1QF7A 4Z49A 1PG2A 3RVSA 2KJQA 4GH5A 3PA8A 1N8KA 2FEKA 4CJXA 4I2NA 3R09A 1I1HA 3KYJB 4WOCA 5LYJB 2QD3A 4W5QA 3QUCA 3TOVA 2D2VA 1P6XA 1CIJA 2IELA 3WYBA 2B25A 4DV4M 5JU6A 3I4LA 5AVSA 2DCMA 2ZIAA 3CSSA 3PXCX 2JASA 1ZCJA 2GCEA 1MVNA 3DTNA 2BMVA 4CMBA 3FFTA 3G79A 2YJ4A 4JCCA 4RSRA 5JH7B 4YX9A 2A88A 5L6MB 3TFOA 4Z8XA 2DETA 2QUZA 3FCOA 5HJEA 1R4NB 4XUGB 3U40A 1LH0A 3G2OA 3I30X 4L6V6 1KNQA 4TSRA 3QXGA 2X4AA 1M6NA 5HFAA 5AKXA 2EYQA 1EU1A 3PK0A 3UK0A 2JHPA 1R00A 4QGAA 4OQQA 5DK6A 3TZLA 4QJBA 1HE1C 2CD7A 2WNSA 2HA4A 3JAMA 4NWIA 1M5RA 5LDDC 4QXQA 1T4MA 5CEEA 1OROA 5J5CA 4GLFA 5LL6P 1FTNA 1NF2A 3ETNA 2II6A 4CFZA 5F2OA 3R7DA 2I3ZA 2AZTA 1R6DA 1H22A 1GJTA 1DFIA 2QNRA 4KBYA 4YRKA 4OSEA 3N76A 3SQDA 2VRNA 3T1VA 1ZGJA 3G7SA 3TW6A 2J85A 3PDJA 3TQHA 1XMOM 5HQJA 1PRBA 2JD0A 2CNKA 1CQPA 3HHZA 4R6WA 2I2CA 4FWTA 2HREA 2RJOA 4MUKA 5ESWA 5JJKA 1A3CA 3BRCA 4GZLA 2CXTA 4Y2HA 2Q7OE 1ODSA 3UA3A 3W6OA 5DIFA 4L08A 3KZKA 1JKXA 4XYGA 5P21A 3FMPB 3GUZA 1S9HA 3EGWA 2NV0A 2DUUA 3DZBA 3PEEA 4D81A 1E5TA 1NVWQ 3AEUA 2BJHA 3SLRA 5FOSA 3SK0A 5IDWA 4DV0M 2FWMX 2BWJA 4QUEA 3G7NA 3VDMA 3W4KA 3J2PB 2OOBA 2IYSA 3HADA 2OQ2A 4ARZB 1IU9A 2VF2A 1L5MA 3INTA 2L6OA 4FINA 2BP7B 1U8YA 2AR0A 3U5ZA 8LDHA 3S7ZA 3D8BA 2RK6A 3C7KA 4BVKA 1N1EA 4UXIA 4AKIA 4K0KB 1EX7A 3NDRA 2AQ8A 3WIUA 2RCYA 4LK3A 3G2LA 3RFXA 2IKQA 1JSLA 3GRPA 2QI9F 1FLAA 3VR6H 4IDHA 3T1QA 2XPCA 3AU9A 1GUAA 2WG2A 3MOSA 1OFIA 1PT7A 4ENUA 5JWHA 2GXAA 3Q6IA 3B3QA 2YN2A 3NOQA 3QYJA 4HI0E 2NXJA 2H2GA 3QOXA 1JFTA 3EIQA 3L0DA 1UOOA 3FUXA 2V45A 2RHDA 4KR2A 2JKYA 3WGGA 4OYLA 3PFIA 4AWAA 2CF6A 4Z9XA 5EQTA 1M1YB 4QPJC 2CL0X 1E3TA 2ZSEA 3TEFA 2GETA 1E4OA 3OD1A 3UW1A 4B33A 3LGSA 4WH0A 2ZBVA 3TQFA 3V7YA 2I5PO 4YDSA 1ZEJA 2FZ5A 4PGAA 1IH8A 1XELA 1DP4A 3K1AA 3OU2A 3HDJA 1Y3HA 2FVXA 1CY8A 4M49A 5FI1B 4IGEA 2BFNA 1U2DC 5JCOA 4ID9A 1R9MA 3QPBA 3GFQA 1PFQA 2ONCA 3PXBA 3N6XA 1HJPA 1XPRA 4WA8A 2YBDA 5HKAA 4MW0A 5CA0B 5BQPA 3W7BA 3ZQ6A 4U7WA 5FBQB 4K9PA 2LD4A 3A4YA 4TT3A 1BMTA 4CIDA 3RG8A 2FFRA 3I0MA 4HXFB 3BMCB 2OBMA 1XL0A 3PDUA 2HNKA 1KAHA 1DKLA 4MI9A 1KDTA 3GUHA 2CNOA 2EF0A 3H5WA 4QDOA 4JC8A 3SOPA 2ID7A 5EIWA 2AC2A 4B3FX 4I08A 1X19A 4H1HA 4L2IA 1VE6A 4YRRA 5KJCA 3UKOA 1S8AA 4CV0A 1J2RA 3GGJA 3L25A 4YQFA 1NSFA 1I1OA 1GUYA 4JL5A 1TVMA 2AXPA 2BGWA 5TX7A 1YS1X 2Z3ZA 1GM5A 4FGZA 2UXDB 1TI7A 2RAUA 4CIBA 4Z1MA 1CDDA 3OX1A 2GYUA 3GD7A 5D5QA 1C81A 3A46A 3T7CA 4QBIA 4CGYA 4LQDA 1D4FA 3LUCA 1B6GA 1XTKA 4B3TB 2FPKA 3B7WA 3R3VA 1WABA 4J0HA 1HNXM 5LYJA 4BP9A 5GONB 3GFGA 2CXSA 2G1JA 3F47A 2BNKA 1RM5A 4LHZA 4CIWA 2YTZA 2ZI4A 3HUTA 4GMFA 4RIIA 2JJQA 1JDSA 4D96A 1RRGA 5JYEA 1CE8A 5AI9A 4JI1B 1KMCA 4HQRA 1M66A 1YJ5A 1BYUA 2XUQA 5DNDA 1XEWX 1R15A 2OHXA 2WIJA 5JH7A 3A6PC 3E8SA 1R4NA 3HY3A 4HNVA 4FFNA 1CFZA 4YPOA 1BDHA 1FFAA 1TT5B 2AUMA 3LSYA 5CB4B 1DWQA 4KXQA 1KPIA 1XTZA 5ITZB 2J5BA 2A57A 2C42A 3EGCA 1E7QA 2GEUA 1JQJC 3ELUA 3IPRA 2XNJA 2Q27A 5JDCA 2FLKA 2OZVA 1VKRA 1VLVA 2ZAIA 3KSBC 4ZCRA 1CDZA 3LUPA 3RYTC 5FHQA 2WMYA 3PIIA 2GXSA 2IUTA 2R5NA 2ZE6A 4EGAA 4JC4A 4EKEA 3N7TA 4QO7A 3TJRA 1OOEA 1K98A 3G5TA 1B4DA 1AUAA 3E27A 1UBUS 4H4DA 3MBOA 5A6VA 1HNZM 3LNCA 3MTQA 1YF3A 2H4YA 1X1QA 1PHRA 5CK4A 4W1PA 5FWXB 3I92A 2IF0A 2NTYC 1U1GA 3K16A 4RIHA 4E2XA 3DT9A 1JEEA 4AZVA 1K7FB 3MJVA 1T3SA 3OA0A 2JHFA 4IXNA 1ZITA 4P53A 4J4TA 4FGJA 1W96A 4MWDA 4BO9A 3MRVA 2V0CA 5AUNB 4HF7A 1KI1A 1G2OA 3KBOA 5JFOA 3EXAA 4PFJA 5I51A 5LPNA 1XI2A 1XTPA 1G7TA 4D92A 3WMXA 1VYHA 4CMJA 3PVZA 1UFOA 3OJCA 5F33A 3MXOA 2DERA 4WD3A 2DPGA 4A8JC 2DAIA 1GL9B 1M5UA 3EB9A 4KL8S 3UHPA 1N6RA 4RS3A 3ELDA 3RF6A 4F8YA 3I9JA 3MK31 3A1EA 5FTWA 5K6TA 3BX1A 4ARZA 3NC4A 4RKYA 4DLKA 2BP7A 2WJAA 4UU1A 5T4BA 2FPRA 3H65A 2RFLA 4LFAB 3DOIA 4DR1B 4LMBA 4EKNB 3BDVA 3AHGA 2O0LA 1SU6A 4R40A 4CKWB 4D9CA 1GCAA 1R0YA 2XZTA 2XB9A 2ZM5A 2X2OA 2Q50A 2GLTA 3T7IA 3GRCA 2XMQA 3AO0B 4Q9NA 4QYXA 4IVQA 4AP6A 4ITUA 3DP9A 4CMAA 3KDSE 1W73A 5AM4A 3ASUA 2IU6A 1FUUA 1TH2A 2QGZA 1QGZA 5KJEA 3E9NA 1ZK3A 1WW3A 2EKZA 5DVZA 3PUXA 4EEXA 2H11A 4RDHA 2V59A 2D0OB 3CHYA 4ZZ2A 2QV0A 3OC0A 3KAKA 4NFHA 2I1LA 4P3KA 5EE5B 4D41A 5FLKA 2JF0A 3LWBA 3AFNA 3I0ZA 2IYWA 2BLNA 1P72A 1JR3A 1P2GA 2FG5A 1E8MA 3OZ7A 4EVSA 2G9RA 3DFUA 3K1YA 2EZ4A 4GZ3A 5IBQA 2GESA 3JAKB 4RADA 4HWRA 4ZVSA 1OGYA 3JQEA 2TMKA 1ZM7A 1EDDA 1IUNA 3WWDA 3U19A 1DQPA 1JYSA 4MWBA 1K8YB 3SHOA 3V3TA 2O07A 4YRTA 4EIWA 2KBFA 3DBVO 3ZCPA 4QHYA 1A2QA 5CA0A 1NR5A 4W63A 4WEQA 3IRUA 3VPHA 3WKEA 2I76A 3BMCA 5EFOA 2VL7A 4GWLA 3AL2A 1XTBA 3A4MA 3OPQA 1BDJA 4H17A 4PM4A 3CRVA 1JDNA 3GFPA 4LJAA 4MYDA 3UATA 2FXVA 3BHIA 4IUCS 4TSFD 2J1LA 2OVFA 1IZ0A 4MUFA 4KPUB 4G2TA 5DW0A 3HJHA 3OCWA 4MINA 2D7JA 4I4LA 4DIFA 2IHTA 3ND7A 3ES9A 3T7KA 2HCRA 4D02A 1PJAA 2Y0DA 4Y30A 1UBJS 4LNAA 1YR1A 4P0PB 2VP6A 1BE1A 4PSKA 5BSRA 2KNVA 2AMFA 1P1KA 1XCLA 3O8RA 1KKLA 4GOMD 5ENDA 5I9LA 4DCNA 4N49A 2PNJA 3V9PA 4KWCA 4YC7A 1SQSA 4RA6A 1HX7A 5K01A 1LQUA 5FR1A 5BMOA 4P34A 1OWOA 1Y42X 2BWEA 5A2GA 1X7ZA 4KGVA 3PI7A 5G0WA 3EC2A 2ZJ8A 5GONA 1R27A 2GBLA 3DR3A 4Y2PA