3FTDA

Crystal structure of a. aeolicus ksga at 1.44-angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
240
Chain Sequence
SFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Dimethyladenosine transferase
total genus 83
structure length 240
sequence length 240
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftdA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftdA01
1WG8A 1F38A 3FRHA 1KYZA 5E1DA 5E2AA 3C3PA 2OYRA 5FQOA 3BGIA 3TKYA 4X60A 3QV2A 2AOWA 3FPHA 1L9KA 5KYGA 2P3LA 3SR4A 5HEKA 2AOUA 2YUIA 4CKEA 4QTUB 4IKPA 5HZMA 3EGIA 1SQFA 5JR3A 3CGGA 4RV9A 3TM5A 3EVFA 1I9GA 3FUXA 2AOVA 5E1MA 3KPJA 4E2ZA 4PNEA 1D2GA 4FP9A 5DPMA 5DTRA 2OZVA 3UJ7A 2BR3A 3EMDA 4DZRA 4YV0A 4RVDA 1L3IA 5LQNA 1FP2A 4CKCA 1ORHA 1NW3A 5EMKA 3LKZA 4JXJA 2PBFA 1VQ1A 3FUWA 4FT2A 5EKUA 2ZZMA 5KQSA 1ZHFA 2PT9A 5CCBA 4DCMA 2CMGA 3AJDA 3HCBA 1O9HA 1ZGJA 2EG5A 3MAGA 2B9EA 3DR5A 3GRYA 3MCZA 3OZTA 5KS2A 5GINE 4HTFB 3P9NA 1P39A 1XDUA 3DOUA 2ZZKA 3UZUA 2FPOA 4MHTA 3PB3A 4LWOA 2OY0A 2IH4A 5K0FA 4ER3A 3ELYA 4IV8A 5DTMA 3R3HA 3HM2A 1NW7A 4KIFA 4RSRA 3UJ8A 3GGDA 5C0OE 4FGZA 5EVJA 4R05A 5DM1A 2XVAA 3IEIA 3UFBA 4MWZA 3B3FA 3KQOA 1G8AA 2PKWA 1QAOA 2ESRA 3P71T 2YVLA 2AN4A 2PX2A 2JHCA 2UZ4A 2HWKA 3HTXA 1EJ0A 4AX8A 4MIKA 2HMYB 3FUVA 2ZVJA 1IXKA 4GF5A 3TM4A 4RTNA 1KIAA 5EEGA 2VDVE 4AZVA 2IBTA 5LSAA 2ZSUA 3GNLA 4KVZA 3P8ZA 5EMJA 4GUAA 3FPJA 5HILA 1G6Q1 1R74A 2QM3A 4EQZA 7MHTA 3KR2A 4MTLA 4RVGA 3NJRA 3DLIA 4PYLA 3KQSA 1JQEA 2PSSA 3UBTA 2UYHA 3UJ6A 1TW3A 2JHAA 5T64A 1EJ6A 4RVFA 3ELUA 4DCGA 4BLUA 3KR1A 1PJZA 5E1BA 3TLJA 4GC5A 3KPVA 3OU2A 2F8LA 2ZIGA 3SXJA 3AWIA 4E70A 5CD1A 3GDHA 4KDRA 4DMGA 3H2BA 3KQVA 2WA1A 3TOSA 1X1DA 4E31A 2C7QA 4G56A 4QPPA 3GCZA 4F85A 5ICCA 1INLA 1JG1A 2AOTB 4R8RA 2FYTA 4KWCA 2GPYA 1G60A 4GOOD 1NBIA 2PXAA 1UFKA 1XXLA 4ZTBA 3UWPA 3AXSA 3TR6A 4PYQA 1KPIA 3ER9A 5F2NA 3SSMA 3NWBA 3THSA 3DP7A 2QRVA 1X19A 3HA3A 1XCLA 4IV0A 3MQ2A 3T7RA 1VP9A 1WY7A 2ZW9A 5K09A 3LX6A 3EPPA 4QVKA 5ICFA 1EQAA 3C6KA 5KVAA 1DCTA 4HRAA 1EIZA 3BWCA 5BP7A 1JSXA 2H00A 4PYIA 3CBGA 2BR4A 3GRVA 3NTVA 4BP1A 4PIPA 3M70A 5EKXA 3P9KA 5HIJA 3RIEA 3LCUA 5BW4A 1FP1D 1Q0SA 4HSGA 3G2MA 5EIWA 2JHPA 1N2XA 3SVZA 1VPTA 2Z6UA 3ERCA 3VSEA 2O06A 3EGEA 3EEYA 2XBMA 2H11A 1SVUA 2VS1A 3TQSA 1YZHA 3PX2A 4XUDA 5CVDA 5DSTA 3X0DA 2JG3A 5K0EA 4PCAA 3UJCA 3HP7A 4AUKA 5FTWA 3TFWA 2A14A 1RI1A 4IWNA 1JG4A 3KQPA 5JUWA 2G70A 4XUCA 2Z6AA 1IM8A 2P40A 4LECA 3P2EA 5FUBA 4E33A 1RI3A 1RJDA 2FRXA 2IDJA 2PJDA 3EVBA 2YQZA 5E1OA 4RTJA 3ANXA 3E23A 2AVNA 3DMGA 3I58A 5K0NA 2R6ZA 5DRTA 3ID6C 2BZGA 2IGTA 3UJDA 2PX8A 3D2LA 3P97A 4FT4A 3GRZA 2CWWA 1B42A 1NBHA 1DL5A 2P3OA 4C08A 3OPNA 4FSXA 5FCDA 4U7TB 3KPUA 1QAQA 2NXJA 2WA2A 2XYRA 1NE2A 2AOXA 3KQMA 4P58A 5E9JA 5U4XA 2NP6A 2VP3A 4PCLA 2G71A 2NXCA 3R6TA 4YUVA 4RWZA 4P7JA 4PGHA 5DRYA 5BXYA 3ER8A 1FPQA 2G72A 3JWIA 1O54A 1Y8CA 5K0CA 4HC4A 3R9XB 3B3GA 4YMGA 2AS0A 3MHTA 2NXNA 2K4MA 4GOMD 1R6AA 2I7CA 3KQYA 2YXLA 3FPFA 5FULA 4QTTB 5DX1A 4BP3A 3DMFA 2GH1A 3CJTA 4BLWA 2WK1A 5MHTA 3GRUA 4PYJA 2OPBA 2ZIEA 1JSZA 4FZVA 1I1NA 1P1CA 2P35A 2ZLBA 5GM1A 2ZIFA 5IKMA 1L1EA 4X63A 2CKDA 3HVIA 3HVKA 5FWAA 4QVGA 2P1DA 2PX5A 2XYQA 3BWYA 4CTJA 5FQNA 3B3JA 2EJTA 3OU6A 4C07A 1ZKDA 3EVEA 3DH0A 3M6UA 3PX3A 1FJXA 2G8NA 1I4WA 3O7WA 3UJBA 1WZNA 2BM9A 2OBFA 3LCVB 1KR5A 5E9QA 4RTKA 2ZWVA 1BC5A 5D1HA 5FADA 3VC2A 4EKIA 4DKJA 3NDJA 4OA5A 3CJRA 1JQDA 3T7SA 4R6XA 3PT9A 4YUWA 4NECA 2FK8A 1RI4A 1KYWA 3LL7A 1BHJA 2PWPA 3QOXA 4MQ4A 3HCEA 3EEOA 2JJQA 1SUSA 3BKWA 3ELWA 2AN5A 3O31A 3L8DA 3OFKA 1L3BA 4XCXA 5T67A 2R3SA 2ZTHA 3IV6A 1YZ3A 1O9GA 4RVHA 3K6RA 4M36A 2EJUA 4R8SA 1AQJA 5LR6A 1DUSA 4RTSA 1KPHA 1FBNA 4QQNA 2UYCA 1P1BA 2B2CA 2GB4A 4AZWA 3EVAA 4PGGA 4PIMA 3FRIA 4PYNA 3CKKA 5HIMA 5F2KA 5K0BA 4RTPA 3KPYA 4HH4A 5EC8A 1AV6A 3UA4A 3MGGA 5DSXA 3PS9A 4PWYA 1N7IA 4HG2A 4RTOA 3DUWA 2FK7A 1R18A 2P7IA 2VDUE 3I5UA 5DLYA 5ICGA 3FYCA 3ELDA 3G5LA 3M6WA 3KQQA 1X1CA 1G8SA 2EFJA 4P7FA 5CM2Z 3KQWA 5K03A 4U7PB 3DXYA 5HOQA 2B25A 1HNNA 3BUSA 2ZCJA 2IH5A 4E2XA 1JG3A 4WXHA 2Q41A 5LQRA 4V0QA 4RTMA 4C03A 1UIRA 1D2CA 3NVMB 5B1SA 1QZZA 1NW5A 1UWVA 4GC9A 2DULA 4LG1A 3OZRA 3G7UA 3DTNA 4QDJA 3UJ9A 1Z3CA 4X41A 1ZGAA 3E8SA 3M6XA 5DT2A 3M33A 4R6WA 3I9FA 4B17A 5CCXA 4O29A 3C3YA 3LSTA 3OE4A 5CVEA 3TMAA 2IH2A 3PLAE 3B89A 5CUQA 3EMBA 3NW9A 2IPXA 3BKXA 4PYKA 2C7OA 3LKDA 2GS9A 4HGYA 3HA5A 3O4FA 4ATNA 3ORHA 4LWPA 3Q87B 3HVJA 3K0BA 2GA9A 3LPMA 5LQCA 2NNWB 4OQEA 1M0EA 5G02A 5K0JA 3HCFA 3LBFA 5CVJA 3KU1A 5LQAA 5HIKA 5GM2A 3G2QA 5DX8A 2JH9A 3UJAA 4KDCA 2NP7A 3G2PA 2OKCA 3P9IA 3MERA 2YXDA 3SSNA 1KHHA 3LDUA 5H02A 2YR0A 1YUBA 5GP1A 3KR0A 4Y2HA 1M6EX 3OCJA 3AXTA 3U81A 1VE3A 2CMHA 4FR0A 5EMLA 2ZULA 4KIGA 5EOVA 4XUEA 4BY9E 2LD4A 3G89A 2NXEA 3A25A 2VZ9A 4RYLA 3KQTA 2YTZA 1VBFA 3REOA 5EZQA 5C9ZA 3EVCA 1RI2A 1RJGA 4DM3A 1JTFA 3DMHA 1VLMA 4YV1A 3OU7A 5EPEA 1KXZA 3BZBA 3GJYA 3JWHA 5DM0A 5EZSA 4RTRA 1YFJA 5EGSA 2OXTA 1JG2A 3HCCA 3EVGA 1AQIA 2AVDA 4OBWA 1QANA 4DQ0A 5LQKA 3P9CA 1R8XA 2IP2A 2N47A 4CTKA 4PYMA 2BH2A 3HEMA 4C05A 3PVCA 2PXXA 4YUXA 4ER6A 2CL5A 4GOND 4CXMA 5EIFA 2G1PA 1MHTA 4KW7A 5K05A 2ERCA 1XDZA 1G55A 1Q0TA 2HTEA 5DM4A 2DPMA 4ER0A 4QPNA 2PY6A 5IH3A 4POOA 4UOEA 2ZBRA 4RTLA 3C0KA 3FZGA 1XVAA 2PT6A 5HIIA 3GXOA 3IYLW 3FTFA 3HCDA 3E7PA 3JWJA 5CIYA 4HTFA 2ONZA 3G2OA 3SGLA 2QY6A 3LECA 3GO4A 5E8RA 4C04A 4RTQA 3FTEA 3R0QA 10MHA 3I64A 5KQRA 2OO3A 1H1DA 4E32A 3OFJA 3FTDA 2P41A 5EEHA 2E5WA 1KPGA 5T6BA 4EKGA 5DWQA 3TRKA 4F84A 2PXCA 2ONYA 2O0LA 5GWXA 3VC1A 2Y1XA 3DULA 5FA8A 1D2HA 2FHPA 5FA5A 2VDWA 1PRYA 2YXEA 3EGVA 3MTEA 4HGZA 5FHRA 5LQJA 9MHTA 4DF3A 3BGVA 2IIPA 5P8WA 3BT7A 2B3TA 2UYOA 3BXOA 4PYOA 3DLCA 2PGXA 2Y1WA 4P7KA 3MTIA 3HVHA 4QDKA 1IY9A 2V7EA 5GIPE 2GLUA 4K6MA 4OBXA 5GOZA 3SSOA 3CC8A 3HNRA 1XDSA 2AR0A 2H1RA 3BWMA 5ERGB 1XCJA 5K01A 5D1NA 1X1BA 2OB1A 2KW5A 1JQ3A 3WSTA 4CWAA 5GIOE 2I62A 2ZBQA 3V97A 4YV2A 2P8JA 1BOOA 4L7VA 4Z2YA 3A26A 1YFLA 3FUUA 1XJ5A 3BWBA 3GRRA 2QE6A 1SQGA 3ME5A 4BLVA 3PTAA 1NT2A 1EAMA 4WVLA 2OB2A 1RJEA 2PX4A 5EHGA 4AZSA 1M6YA 2O07A 1AF7A 2PV0A 4YUYA 2IBSA 3LGAA 3Q7EA 2AOTA 3M6VA 1N7JA 5FWDA 4C4AA 5E8JA 4P7GA 5LQUA 3V8VA 3FTCA 2P3QA 5HFJA 3F4KA 4ER5A 2ZBPA 1VL5A 1WXWA 1ZQ9A 2QRVB 4GEKA 4E2WA 2XVMA 4EVIA 3A27A 1YB2A 2QYOA 3DXXA 1MJFA 3G88A 1R00A 3HCAA 3R24A 4X1OA 5F2OA 3PFGA 5E2BA 1YF3A 5C1IA 4A6DA 1HMYA 3A7DA 3JWGA 2BM8A 2YX1A 3AY0A 4GBED 2HNKA 1NV9A 1RI5A 3G8BA 5K0GA 5EMMA 4H0NA 3TKAA 2FCAA 4KRGA 2ZFUA 4EMSA 3E05A 3C6MA 2BR5A 1JR4A 4F86A 4OQDA 3KKZA 3MB5A 2Z6QA 3OE5A 3S68A 3FYDA 1SUIA 3G5TA 4FSDA 4M38A 4C06A 5CVVA 5BW5A 8MHTA 5CVUA 1XTPA 4ER7A 1NW8A 1EG2A 1T43A 1JTEA 1L3CA 3T7TA 3VYWA 3CCFA 3IHTA 2IFTA 3G8AA 3NWEA 5K0LA 2AOUB 3SMQA 3UA3A 4DA4A 2C7PA 3M4XA 1KP9A 4OX9Y 3NVKI 4E30A 3OZSA 1OR8A 2AZTA 3KR9A 3PFHA 4ISCA 1VIDA 1WXXA 3SX0A 4AZTA 1QAMA 1P91A 5K8VA 4YUZA 1U2ZA 3FUTA 3LBYA 4E2YA 4CKBA 4YMHA 5DTQA 2ZWAA 1NKVA 3T0IA 4FS8A 2ORED 4QQKA 2HV9A 2IDKA 3P2IA 1BKYA 5ICEA 2P7HA 1ORIA 2O57A 5DM2A 3KPWA 5E9WA 3GU3A 3MCTA 3FPEA 2PLWA 2JH8A 4GOLD 1TPYA 3FPGA 4GQBA 5DX0A 1TW2A 2ADMA 3A4TA 2HR1A 3LDGA 3EVDA 3THRA 1QYRA 3GWZA 3SM3A 2I9KA 4A6EA 1ZG3A 1RJFA 1X1AA 5M5BA 2ZZNA 2AN3A 2EX4A 3NMUF 2O05A 3EVZA 1NW6A 2NYUA 4M7RA 5FHQA 4RX1A 3DXZA 3TPZA 1F3LA 3I53A 3NDIA 2XYVA 1NV8A 2V74B 1V39A 5DXAA 3HA7A 3B7PA 3LHDA 2I6GA 3B5IA 2PVCA 1R8YA 4M37A 4Y30A 1SKMA 4PINA 2PWYA 4EK9A 4OA8A 3P2KA 5EG5A 5EQJB 1G38A 3QOWA 3LDFA 4V0RA 5DXJA 2C7RA 1VP3A 3A7EA 5EHIA 2B78A 3BGDA 3CJQA 4PONA 3RODA 3LCCA 1SG9A 3KHKA 2UYQA 3CVOA 3GIWA 4X61A 2GAFA 1WS6A 3RW9A
chains in the Genus database with same CATH superfamily
1OC4A 1JH8A 1XLTC 1I3MA 2FEKA 2NTYC 2V7UA 2WV9A 2XCQA 1T5SA 3F6EX 5E1DA 5E2AA 5JSFA 1X0VA 2QCUA 1ISSA 4GX5A 4QYSA 4UN2B 1HH4A 4LZPA 5JCJD 4O1HA 4UU8A 2WTEA 4EHFA 1HG1A 1W5EA 3JAMA 2Q1XA 2BBOA 1NF2A 2VVTA 1GZ7A 2QSYA 3JD3A 2G3QA 1IZ9A 5HZMA 1U65A 2QORA 4MWOA 4UCFA 3IPCA 1HZZC 1BX3A 2F3SA 2HO5A 3CGGA 4NTZA 3BTUA 4YJHB 1C8VB 2VEDA 1YBMA 2BN4A 1TYBE 2JGFA 4TTVA 2NYVA 2VHQA 3ONWA 3COJA 2VXOA 5EJCA 2DU8A 4G2NA 4KKVA 3CX3A 4RJLA 3S70A 3DL7A 1H6BA 3TNYA 4HDKA 1J2RA 3LQ2A 2DWUA 3RTDA 5K2OA 5AXAA 3J80S 2GARA 2HBZA 3MUNA 5IWAM 4L15A 1R10A 3B7GA 1OLXB 1XCOA 2B2XA 1JNYA 3H0EA 3QG1A 4E2FA 2ICAA 3QVLA 4QIHA 3GPDG 4MSUA 1PYGA 3PC6A 3B7ZA 3SPXA 5CJPA 3WFIA 4A92A 4YRJA 2JJ1A 3KOXE 1XMVA 3Q88A 3P5SA 3KKKA 4PIVA 4JLMA 5T4FA 4MO9A 2G6BA 1GG9A 5C0OE 4KYIB 1UKYA 2BY4A 5CK4A 2WWFA 3IOEA 3IEIA 3K30A 4XGKA 5K6RA 3AT1A 3L4BC 3I42A 3MUEA 3ZZMA 3AEXA 5JIBA 3QQPA 3VR5D 3DLAA 3P71T 4TT3A 4BWVA 3OT5A 4KH0A 1H85A 1H1LA 1WZCA 4KU4A 5TX7A 3OM0A 2Q5LA 4NC9A 2RI0A 4XKJA 5EJ4A 5JYEA 5IKOA 1UM9A 3IBYA 1HEYA 2YCBA 1ZA2A 5EEGA 2I3AA 4J49A 1RXEA 3HR4A 3N86A 2W2KB 1JKJA 1SOVA 5NULA 4F45A 2BELA 4GVPA 4QL3A 4DQLA 2WHPA 4GZ3A 4OQXA 1I5RA 5CYGA 3KQSA 2RIPA 1CK4A 3IXLA 1Q20A 1DHRA 1JAIA 3EIWA 2R1TA 2R00A 1AO3A 3M9LA 4D4MA 1WNTA 4XLZA 1DIHA 4MRAA 1IHOA 2HBQA 2C8JA 4H3KB 3HDVA 3KPVA 5ALOA 1CJBA 1Y3DE 2CHFA 2C99A 3OJXA 3ROXA 2QD5A 2Q21A 2DLNA 4H35A 4ROSA 3E7XA 3WK6A 5TIIA 1TM1E 1Z15A 1D03A 1GHTA 3LLSA 3PZRA 1YL5A 5GGYA 1FRZA 2IQ5A 4LFBM 1FYFA 1Z75A 3P2JA 1Y4ZA 4NOKA 2JLYA 1P8JA 1K6IA 2HUNA 5A4KA 2AG1A 4ARSA 1X80A 4YALA 1BCSA 2LE0A 4KUHA 2CVOA 3LXMA 2FUNB 3U09A 2VJKA 5B36A 1G3IA 3B48A 4R0MA 2EQ5A 1Z4MA 5FR2A 3GG9A 4Y9DA 5DW3A 5AOBA 5KUTA 4X65M 1ARZA 3GUUA 2H4XA 4REOA 2FU5C 1Z7BA 2BKXA 2CHUA 4X1IA 1D6NA 2M6RA 1RRGA 1E3QA 4LXIA 3P0HA 2V97A 4HDRA 4OV6B 2AUNA 4A23A 2GERA 1C9JA 4CLRA 4NE2A 2OQ4A 1F0KA 1OCEA 2DLDA 3ADKA 5KDOA 3RHTA 1X1TA 3GGSA 3PJEA 5L3RA 1N2IA 3FTPA 4ALLA 1QMPA 3RKUA 1VEKA 1BVHA 4IBJA 2PJDA 2A67A 3D6VA 1I7PA 3VR6D 2MHCA 5B3LA 1N3BA 2G8LA 1Q11A 2WJ6A 2BZGA 3AUTA 3EMVA 3NM4A 3OT1A 4CM4B 3UJDA 4EPRA 1GG5A 2PX8A 4V38A 4NYIR 2HYIC 1XZDA 4JVNA 4ZU3A 1GVHA 4R69A 4U6SA 5IZ7D 4JOQA 4YRNA 1HJPA 1ANKA 1C4WA 4J16A 5L3SA 2Y0PA 1GD1O 3KQMA 2PZEA 3QKTA 2ZUVA 3DHYA 4ESOA 3WK7A 2OT3B 2Q50A 4CG2A 1QPZA 3X1JA 1CQWA 4GBGA 3WYDA 1A2BA 3HFJA 4HK4A 5K3FB 5EZ5A 5IN4A 1E6WA 3G0CA 3IHWA 1F5SA 1UBJS 5AKLA 1W9HA 1FDTA 1JRLA 1DADA 2FP3A 2C8KA 4IEFB 1Y8ZA 4V0NA 2IITA 4CGYA 2K4MA 4KWHA 4ZOLA 4Q15A 3RSQA 1ESNA 1CRLA 2GBFA 2QJRA 3GCWA 1HL7A 3HPRA 1HO3A 4ZGWA 4BEWA 3DWEX 1NPYA 3FH0A 4Q9AA 1U0FA 3GQ3A 1EBFA 1FFWA 2EQAA 1I1NA 1VRVA 4JD5A 1IBRA 2DQYA 4Q9IA 4ZIRA 1YZYA 5ITWA 5E3IA 4QXPA 5JS6A 2J0QA 1XZAA 1ECGA 4U4AA 1SC9A 2CL0X 2QTCA 3M4ZA 4H6WA 4BPBA 3A6PC 2FPSA 4C2UA 2B1JA 2CXQA 2FCRA 3E9NA 1J8QA 4FE3A 1GCGA 4W5JA 5FOUA 3OQOA 2EJSA 1II8A 1KK0A 5JJCA 4OMDA 2M1ZA 3ZJUA 1B7GO 1TLTA 5CLIA 5KHLB 4GIBA 3RU7A 3ZW9A 4C0BA 2CLCX 1U11A 2GBGA 2M6KA 5JCXA 5D1HA 5FADA 4D99A 2R44A 2CV2A 2X9NA 5K3AA 1ZD5A 4R6XA 4XD7A 4OGGA 1SVWA 2B94A 3LL7A 2FV8A 3R1IA 4M86A 3SC3A 2Q1TA 4HWTA 1SUSA 3OD5A 1Y0BA 2POCA 5LYJA 2COEA 4TXJA 4QT0A 1K89A 2QRJA 4DQDA 2CCKA 3H42B 3IV6A 3FWNA 4IVPA 2VQEM 1JDZA 1Q1GA 2ODBA 1D1TA 1QS0B 2VKQA 3MTAA 4R9VA 3O9ZA 4L4YA 5SZIA 2ON6A 3PK0A 1OX4B 4IGKA 3NHFA 4V0MA 5BRAA 2VL7A 1FNBA 1X7WA 4FXOA 1U8FO 1JFTA 2JLBA 2X6QA 3PGKA 1L4BA 4F4JA 4NJMA 4MRSA 2FN8A 1E2LA 3P45A 4RL6A 4C7XA 1L7AA 4OJYA 1A69A 3KOWE 4TKZA 3D6MA 1BQ3A 1SKAA 1E2JA 2PQMA 3GMDA 3MGGA 4FVTA 4RCZA 4C14A 1FMJA 1ECCA 3EUFA 1E6CA 4MQ6A 2P9BA 2XOEA 1IZ8A 3NEAA 2FK7A 1R18A 4B0PA 3I92A 4KPUA 1SEPA 4J43A 3LM8A 1ODLA 4NQRA 3U3KA 5CAEA 4RVNA 2V7TA 1U2EA 3SMSA 3X2FA 1P62B 3RUEA 1DQYA 1IOVA 1EFVA 1H1LB 2K6GA 1Y3BE 2NQTA 2BFEB 3D3WA 3KJQA 4U7PB 3OBBA 2ZQ5A 5D3MB 3ZZUA 1NQVA 1YVEI 3IBTA 4EFMA 2WU1A 1ABBA 1UM9B 1Z2EA 1GPMA 2EFCB 1NOJA 2AFIE 3QMMA 2JFQA 4NV3A 4MS3A 3HCOA 1O57A 4YAWA 4UE6A 4HQ0A 5KC9A 1UK9A 4A5OA 3F3KA 2EX1A 2NO1A 4AP9A 4F91B 4YIHA 2MSCB 5B12A 5LXTB 2NSLA 1PYDA 5DT2A 3FYUC 5C7IO 3EGXB 2XITA 3WDSA 1LTQA 1HE2A 1ORRA 2DM6A 2EW1A 3FM9A 1W85A 1C3LA 2CLIB 2WILA 3C6QA 3JQGA 3Q7IA 3SEFA 1U0HC 2NWQA 3D64A 5A2QA 4LHYA 1U2GA 2B7LA 3K20A 3AVXA 2PL9A 2G5GX 1Z5CA 2IY9A 3GUCA 1PK8A 1QH8A 2Z83A 3Q87B 3IQEA 4WK2B 4DLXA 4HUTA 3HCFA 1V7QA 1CB7A 1TUGA 4RLHA 5HIKA 5C8ZA 1F8UA 4IHQA 2ZSKA 3GAMA 3QEJA 4DVJA 1CUKA 3OP4A 4Y1FA 3H2YA 2A5FA 4E5NA 1N6RA 2Q3DA 2H31A 4OM8A 5CFMA 1WGNA 3N8KA 3B7NA 3LQ4A 4X65B 2ECPA 3Q9LA 3BHNA 3OPYI 4YCJA 3ANYB 2FSIA 4KPFC 4LRTB 3ZV5A 3DHVA 5FLXS 3QKRA 3W8FA 4Y2JA 1AQLA 1QORA 1T4BA 4UU1A 1SCDA 3UATA 2D0DA 3U9LA 1E6EA 4CYMA 1F2TB 1MQSA 1LA2A 1Q1QA 1Z0JA 2JLVA 5FPPA 3D6HA 5HKOA 4YV1A 2BW0A 2IA5A 3QJGA 3WYCA 5F73A 4C0LA 3TW0A 2BT4A 1L7PA 3WWCA 4IIWA 3Q98A 3OIYA 4OAQA 5CGQB 5ICSA 5K3EA 5I3CA 1N8TA 1VJ0A 2YH2A 2GJ4A 4DV7M 3QAUA 5KTKA 1C0LA 5A5DA 2BH2A 3CHYA 4GM0A 2DB3A 2XH9A 2LDBA 2ZWMA 4PO3X 2CHQA 5EP1A 4IDNA 4UDXX 2F3QA 2RGWA 3FSGA 4WEOA 4R2HA 1Q0TA 2JIMA 1CETA 1L7DA 1N5LA 1LRLA 3R5HA 3O74A 3V1YA 4UOEA 1OQYA 4AS1A 2G04A 3EC7A 4UEWA 4M0UA 4QT4A 2VN8A 5AW7A 5F64A 4FJ0A 1ZOPA 1O95C 3JWJA 4ZOLF 2EA0A 4HB0A 3QUQA 4I4TB 4R9SA 1XP8A 2Q5FA 2X4LA 1BA3A 3RGSA 2GHIA 3BRSA 2ZB7A 2VSNA 3GZJA 4IZHA 4CCSA 5CA1B 3ZNPA 3IOCA 5CDYA 1CUUA 3FF1A 2JFYA 2ZCVA 4O33A 2AF3C 2JS7A 4JXXA 3OCYA 4G0OA 1DGHB 4WA7A 1KMQA 4LXYA 3KCQA 5ITYA 2MSEB 3QXHA 1IBMB 4P5EA 5EE1A 3TDKA 2NNLD 3DULA 2QTNA 1V8ZA 2ZSDA 3HP1A 4AJKA 5EJ6A 1K3WA 1PRYA 2CNKA 4LQDA 3KZOA 4RZSA 2NSHA 3ZG6A 3F8TA 4B4OA 1VGVA 4EL5A 4PHTA 1GRCA 1N8NA 2QVGA 2ZYHA 1JA0A 1XZMA 3BXOA 3GB9A 3I3OA 2HY7A 2WIAA 4LFBB 1E0JA 4D3SA 3KSZO 1DEKA 1RLIA 2GLUA 1Q83A 3NBKA 4B4WA 5H37D 3G17A 5LLTA 1XDSA 1TFUA 3K9CA 3HKCA 1K3FA 2I91A 4XBOA 1IULA 4AKHA 1YHZA 3JRWA 4WKBA 3GJ3A 1LTHR 4CWAA 1HYBA 1OU4A 3U16A 4DJJA 4TTJA 4ZQHA 3I3SR 1J5PA 1PDOA 2CLDX 3FUUA 2I7NA 4IOLA 4F6LA 3UK2A 4P36A 3OLVA 1N5IA 4K81B 2II6A 1Z18A 2YJ5A 5A1TA 1JEAA 3ODGA 1RT9A 4WERA 4AY6A 1PL6A 3QBTA 2XUKA 1UJMA 4GU5A 1YMVA 2BEWB 2EJCA 2G4CA 2NTJA 2X0JA 2YWBA 1SCUB 2Z8YA 2MR6A 3KD3A 5E8JA 4P7GA 1RZVA 2NLOA 5EUCA 2XHEA 3FCYA 3A6EA 2HSJA 2OV2A 2VXBA 1GSIA 1S7GA 4JGBA 1JSRA 2D2FA 4NEGA 1UADA 4H7KA 1Y4UA 4QGAA 3SC6A 4AJHA 5IZCC 3ZOKA 4JJIA 3T61A 1OIVA 2BBTA 3HHZA 3EXIB 5AVUA 1SC3A 3OCUA 1MJFA 2K87A 1W19A 1C9EA 4Z54A 3AU8A 4KR3A 1BRTA 1N9GA 1TEZA 5ALQA 3IBCA 1K7EB 1GXSA 1YF3A 4X7BA 1HMYA 3EEIA 1I4OA 2QRNA 4ML3A 5EJ9A 1ZW6A 2X0DA 4FXPA 1EFUA 1AF4A 4ECEA 1YTLA 2HPHA 4EG8A 1JAXA 1AZLA 1NN0A 4BB9A 1XZHA 3GPUA 1Y9EA 2NUTB 1XL1A 1T6XA 2BFAA 3HV2A 4I5DA 5F5NA 2PKQO 4C0AC 5ITSA 3CG0A 3JQAB 3SVTA 4LCJA 5C5DA 2AHOA 2Z6QA 1T2FA 1B3RA 3CUEF 3EJWA 2PYIA 2BFEA 1C1DB 2C03A 1K8YB 5KMGA 2Y0TA 1HDXA 3BILA 3OX4A 3LVVA 1DS6A 2WWTA 4MP6A 5KTMA 1HDIA 2CEKA 5BT8A 1WETA 1TZKA 2X0FA 1N36B 1IXSB 2P4SA 4TWIA 3HK2A 4XI9A 3GOHA 3JRXA 1YTUA 3S55A 3F47A 4I4TF 1DT5A 1PV2A 1SBQA 3ZBUA 2B21A 4HZUB 3DA8A 1YQUA 5DM60 4YMHA 1E4OA 5KVCA 1S0UA 3JQGB 1B0ZA 1WP4A 1J5EM 4UAJA 4BRWA 3CF4A 1V25A 5EJ2A 2J7PD 5HCIA 3CZMA 2X5KO 2BMAA 1QXSA 3D7KA 1N2BA 2J67A 3M4NA 5CT4A 2AI3A 2NV2B 3OPQA 4ZVKA 5J40A 4GOLD 2L09A 2AWOA 4DY6A 5GONA 1THZA 2D7HA 1TW2A 4ND1A 2X2FA 4XE5A 4LI0A 5TB5A 1K97A 3D0RA 4P53A 4NMWA 1WU7A 4KODA 4FQ8A 4AJPA 1MB0A 5E9AA 3SBOA 3ICWA 1H6CA 1GPYA 2FG6C 4FDTA 4FNGA 1YI8A 4C6RA 4A8HA 5THQA 5U9CA 3VAZA 1FUEA 1IG0A 3EUAA 4OU5A 3WMRA 1ZR2A 1XJ0A 3GJTA 3GRAA 5FHQA 5JALA 1YRHA 1OFHA 2P2DA 3KUCA 4E15A 4F9TA 3K9NA 2FR8C 3N76A 5KWVA 1HYEA 3KVRA 2V74B 4X6LA 1X92A 3B7PA 3V4PB 4ZT4A 4C2TA 3HXOA 1XEWY 5KINB 3LKBA 4PINA 3K0FB 1XRMA 4HGOA 4EK9A 2WKQA 4FBLA 4MUBA 3ANMA 2WIFA 1X9HA 3DQZA 3JAKA 3OZDA 5EQJB 4YDQA 3WTBA 5JSHA 4FVMA 4AIRA 3AEKA 4P0TA 4G0PA 2B78A 1EX1A 2XGOA 4OQMA 4BFZA 2ZYVX 2X3FA 3FNFA 4OD0A 3ZH2A 1Z5UA 4X61A 2BGJA 2QP9X 1RPAA 1WG8A 1Z73A 3FRHA 4ZXPA 1YQTA 2XB6A 4DUPA 2C2ZA 1SXPA 1W87A 2UV8A 8LDHA 2FH5B 4X60A 1CSEE 4L73A 1BN6A 4JR1A 1A27A 2BUCA 2DUWA 2P3LA 2Q2OA 4C0QC 3RYCA 1W2GA 1IVYA 5I7FA 1DZ3A 3PDUA 1S9HA 2OWDA 5ITTA 3HXLA 2PZJA 5IT9S 2X8WA 3DPIA 4GHWA 1VDZA 2PFGA 2ZSBA 5TRTA 5UKDA 2XMBA 3U5ZB 2FPUA 4OO3A 3VPHA 4CEJA 1E2GA 3AFOA 3LP5A 3IXMA 2XNJA 1M8GA 4GKAA 4OHCA 4BFXA 5BQOA 4HGQA 3AEZA 4L8VA 1J1IA 4PZ9A 4XPIA 5IM4A 5LQNA 2AJBA 3PQCA 4KEAA 4WUVA 1VLLA 4Y9RA 2ATIA 3IESA 4B2PA 1ZYUA 1QTIA 1ZCBA 1VQ1A 5FORA 5ALWA 5T4EA 3UAXA 3W4JA 5K99A 2YMLA 1L4FA 2XBLA 4S0XA 1T13A 1IVSA 2NO9A 2F5OA 5F1KA 3V34A 5EQDA 1CR1A 4MPPA 2WHXA 2ZKIA 3EFOA 1COZA 3GRYA 1DKRA 2CWDA 3I9OA 1DDOA 2HNBA 3AHCA 1LK7A 1PZMA 1RKXA 2ZB8A 4TRMA 3Q7QA 3LTEA 1FTGA 4FHGA 2GMWA 1QQTA 5DBOA 5JS2A 3U7EB 3WL6A 1KORA 4D9HA 5T3YA 3E81A 4GLJA 1AU9A 1GFSA 1PO7A 3LQKA 4IV8A 4MW9A 1HWYA 3PUYA 3K0HA 2XUHA 3HCPA 1YZVA 3UT0A 1MFPA 1SOAA 2P2CA 5HQTA 1ZJYA 2XVAA 3AF2A 3ASZA 2YWDA 4TMWA 3ZJYA 1IRIA 4H0FA 3QVTA 1RJ9B 1FFBA 4GI7A 2ESRA 2OCKA 1EINA 1JFFB 1SPBS 1PX0A 3NHLA 1R12A 1EK6A 1QHYA 4NZYA 2HMYB 3B6KA 5D3MA 1A5AB 1ESEA 1XNJA 4BX0A 3SBJA 2QN7A 7ABPA 1Z22A 1MQAA 3ABQB 3H2JA 1L5HA 3VV2A 1SH7A 5JO9A 3TOCA 4B79A 4D4LA 1UKEA 2CL7X 3AI7A 4IUCS 1VOTA 4Q19A 4EQZA 4B46A 4MGZR 5A7HA 3UB2A 3UMRA 2C5HA 2PFSA 2QQGA 1P7ZA 5JSQA 5LZ5A 1V1MB 3P0FA 4WT7A 1KEPA 3A14A 5JAIA 4MVJG 3GPBA 1E5DA 2JBAB 4B43A 3LQRA 3RCBA 3PC8C 2OCLA 1LS6A 4CLRB 1FMTA 4LF6M 1GEEA 3AY3A 5DHTA 4DBLE 4QG3A 2DZNB 4XWGA 1R50A 4IIDA 2AD5A 5EJ5A 1X7GA 5AW5A 3OE7D 1KY2A 5K6AC 3FIUA 4DR1M 1O8BA 1X9GA 3T3GA 5GV8A 3CNQS 1JHDA 2DKOA 5G53C 4ZTBA 1U2DC 1ZUNA 3PICA 2P67A 1N6OA 1WDWB 2BZ0A 4Q02A 3GY0A 3J7TA 5KWSA 3VH2A 1WDKA 1OQAA 3T7RA 2K7FA 4RVOA 1MW8X 3U1VA 1CY8A 4BEBA 3TKAA 2DHQA 4XRRA 3GQ5A 2OHXA 5ALYA 3QW4B 3PEUA 3TZKA 2PJUA 1JA1A 1PVVA 2H5JA 3R5KA 1W73A 4IO1A 4IIEA 1FU4A 4M0DA 1CQPA 4N6GA 5BNFA 5CBPA 1VZ3A 2JI9A 2NZXA 2JKZA 1YU9A 2Y1GA 3KSDO 4UMDA 4YLGA 1DKNA 4YQZA 4D4KA 1I3LA 2MMGA 1L7NA 3RIXA 1VXRA 1BIFA 3N2GB 1U0LA 3PC2A 2EC5A 1N2CB 3FR8A 2XBMA 2PGDA 5CA0F 5KTSA 1PT8A 3TQSA 4L4SA 1T2DA 2QK4A 3PUHA 1U4OA 2C4KA 4ICIA 1QPGA 4E13A 1V6AA 2X9GA 2ZI4A 2WBLC 4YP9A 3RJ9A 4K6CA 2DAKA 4IWNA 1DRKA 3RVPA 1DVRA 3UXEA 2O6HA 1SPXA 2VO1A 4PXSA 3RYHB 5DI3B 1QO7A 3I5YA 2HIGA 1GUYA 4OVKA 3I58A 2C8LA 3A70A 3DMGA 1XPUA 4HNUA 2LH0A 4GGOA 1Y6GA 5LBUA 3OJFA 4OK3A 1EZZA 3HRHA 4PWZA 3WAKA 4F2DA 2WSIA 4KG7A 2RB4A 2ZTVA 4EY3A 4C08A 3O4JA 3OTQA 4JIMA 3QNWA 1ABEA 2NXJA 3RVMA 4U9IS 3Q3JB 1M9NA 4H27A 4TUYA 2ECQA 3VAYA 1GDTA 1YE5A 1AQ6A 4CF7A 1ZH8A 1CFZA 3D7SA 2CRUA 1FL9A 2RAFA 4RWZA 4YJFA 4WINA 1PX2A 1U9ZA 1N2OA 2HJ9A 2VJBA 4YXWA 5A7GA 2IV7A 2G72A 4DLKA 4RK5A 5K0CA 2RBGA 3R9XB 1TDHA 3L4KA 2V6BA 5BPVA 3FSEA 1SU6A 2YV2A 3ND9A 1U1CA 1T8TA 1SY7A 1R0RE 2A0FA 2FWBA 1C29B 2X2EA 4HS9A 3OUZA 1X7WB 4PNZA 1BFDA 1TYDE 4GMXA 4MPTA 4YMTA 3KE9A 5AW8A 5ECYA 3I30X 2O7NA 3GRUA 3BWEA 3PD1A 4A3SA 1PZFA 1DBVO 5EXXA 3U61A 1XEFA 3D0QA 1CW2B 1UJBA 2COUA 2EGHA 2OYSA 2X0KA 1PEKE 3AP1A 3PXUA 1KHTA 1PTKA 2CKDA 2D62A 3C5EA 1Y8QA 3HQ4O 4CIWA 3HI4A 2DMRA 3SF0A 5B57C 1E8NA 1MT0A 2EJTA 3TGPA 3CEAA 4BEVA 5H7XA 1QFXA 4PEVA 2IUFA 1KR5A 3V1TC 3LPNA 4BP8A 2J5YA 1V8OA 2JKVA 2O25A 4WI1A 2EKKA 4B6SA 5FWYA 2WHRA 3CJRA 3GROA 3RANA 5KYXB 1M54A 1UMCA 1XK6A 1YKSA 4ND8A 4E1VA 5JAUA 4O0LA 3F98A 2PWPA 5ELLA 3SEAA 1W7AA 1JHAA 3CZCA 4BC0A 1W93A 1HE4A 3KUKA 3K0EA 1NA5A 3LRTA 5AJVB 3C3AA 4NY1A 3EOAI 3DMNA 3QEKA 1NHWC 4FINA 4O5OA 3LC7O 2YN0A 3ROTA 4FONA 4RKFA 1FFXB 5HFNA 4RD3A 2QQEA 3PUIA 1FX0A 5CYPA 3PHGA 3FE2A 3GAFA 5ELXA 4B3RB 2B1QA 1I4EB 1Z0SA 2OO9A 1DUSA 4YDSA 5D00A 4Y18A 1PEDA 1W85B 4IMJB 4WNAA 3CF4G 1TR8A 3ON5A 4F2WA 3JQQA 5H8WA 4NZOA 3MMSA 1G3QA 3RTBA 1IN5A 4O3MA 1FC0A 4O2AB 1X39A 4MZXA 2ZJYA 3IC5A 3ZWOA 3NUQA 4PZDA 2YRFA 2NYRA 4YCMA 4QQ8A 1LBSA 2C9ZA 5JWOA 2MH8A 1QOQB 1SIBE 1V26A 1VE6A 1M66A 1WCWA 2DR0A 2ZIZA 4I9NA 4JR2A 3V2GA 1ETHA 3LA6A 2UZIR 4Q4DA 3ZBTA 3KQQA 4CQLB 4V1CB 5M34A 2ZSEA 1W6RA 2OSBA 2BHRA 5LIRA 1T91A 3SE0A 3KQWA 3PHIA 5JH7B 3GK3A 5DYIA 5FI3A 4P2GA 2QMEA 2QL7A 3HV0A 1JHXA 3I9NA 4XQGA 4RTMA 4K03A 1N2SA 2X0RA 3DW1X 2NZJA 4I55B 2GFQA 4P5DA 4HVCA 2REBA 3G2JA 1RM4A 1NW5A 4IUBS 4I3HA 1T9HA 3QWLA 3SJZA 4QM7A 2NT4A 2VPTA 2F67A 4PHGA 3ONEA 1BE1A 2JARA 2QP3A 4MKXA 2FPLA 2EEPA 2ANCA 1AKRA 1U2SA 2FLVA 1R0BA 2QW0X 3W5JA 3DKRA 3FKQA 3SJBA 3O9VA 4BFTA 3AX6A 2IH2A 1NLFA 1V4BA 5HSGA 5AKGA 2J3QA 3KQLA 2JVJA 4MQEB 2E4YA 4G0WA 3DZIA 4EY5A 3HA5A 1WX1A 4JUAA 1M2VA 4Y0AA 5F5LA 2O8EB 3SM9A 3N6VA 1UR5A 3C7TA 1QF9A 5JDIA 2IZ5A 2RSLA 3GH3A 1IUPA 4F46A 1P7YA 2OWEA 1MN3A 2F59A 1BEEA 2XUZA 2F4VB 3IBSA 3OQIB 2XZFA 1NXPA 2YWEA 1H4TA 2ODAA 3AOEC 2WZJA 3WIVA 6YASA 2YR0A 2I2BA 1Y3FE 1JDUA 2OGTA 2Y21A 4RHTA 1QX3A 3IMEA 1E3JA 1T2EA 4D96A 5EJ8A 3FJ1A 4I5FA 3QXJA 2F1JA 5J9FA 3PFBA 4KIGA 5KKCA 1H4VB 5J2UF 2FMXA 4RF5A 3HZOA 3MS7A 1RKVA 4QOIA 5E3JA 4B47A 1ELOA 4JKOA 3RI3A 2DVWB 1U5AA 1VBFA 1X7YA 9LDTA 3CO5A 4QKQA 1PJ8A 2I6TA 3GLFE 1YA8A 2UUPA 3AZPA 3PR1A 5JXGA 2X0IA 2ES4A 3TIVA 2GJAA 4MQFB 2IYFA 1IRXA 1OAKA 1M1XB 3JWHA 1RQXA 4Q6BA 3BS4A 3GVHA 5THKA 1PZEA 3EVGA 1AQIA 2V4UA 3AU9A 1HFEL 2WB4A 4NG4A 3VK8A 1FRQA 1R8XA 2QT9A 2IF0A 1YJAA 3HI6A 2ZIUB 1AX9A 4O8ZA 3EUEA 1GLNA 3PVCA 1PUIA 4NCIA 4OXYA 1WMEA 3BX1A 4CXMA 4ALMA 1QGAA 3ZVKA 4OQFA 1Y6RA 1DFGA 1NBOA 1QIEA 4US0R 3KQKA 4ZDIA 1JDTA 4BNTA 3FHTA 2FFBA 4U8GA 1WCXA 4IUDS 5FBZA 2ZUEA 4L6AA 4TLBA 8OHMA 2QUJA 3UG7A 4PZ0A 1SQ5A 5JO0A 4LF7B 5D84A 1SB8A 1VG5A 2PT6A 3IO5A 3LLVA 4NH0A 3GXOA 4TXNA 3CF2A 3GBSA 2CJXA 3M6IA 5IAGA 1ZINA 1RWKA 3SGLA 3TXXA 1U2RA 3EIOA 3PNLA 4L0CA 1GXSB 10MHA 3U6SA 4KXFB 4AFNA 3WS7A 1RVDA 1UBFA 1I2AA 1ZNWA 2IGBA 3H6GA 1DXYA 1J8YF 3ZHRA 4Z7QB 4WKNA 2BH9A 4IMIB 3GLGA 2G4LA 2GJ8A 1NG9A 1GCAA 3CNHA 4AY5A 1VGQA 3RGPA 4OXIA 3R3JA 2D1TA 4Q1VA 4EO4A 3VJLA 4B34A 5LZ9A 4QSHA 4FDMA 3JARB 1K8RA 2XWSA 3LIIA 4R1TA 3RT9A 3BXFA 3O6VA 3U49A 3DS8A 2K2QB 3BGOS 1CUYA 2HK7A 3QELB 1NVEA 4IIFA 4QGHA 5P8WA 3WQBA 3J80A 5DHAA 3JSXA 4AT1A 2L2DA 4QDKA 1N2GA 3C3WA 4DV0M 1HC7A 3ZE9A 4M9QA 1AQUA 3ZWQA 1QP4A 2AQHA 1G0NA 1T8WA 4IBCA 1BO6A 1V1MA 5K3CA 2JEYA 3I28A 4IHJA 1RYYA 1VL8A 3LFUA 3OJLA 1UBCA 3DYIA 3EQ2A 1V45E 2P27A 3BAFA 5EHXA 2CK3A 3TLCA 1XDDA 3LJKA 2KRKA 2IYNA 3NUZA 2OXIA 3S8MA 2JIPA 2HNAA 4BO9A 4BLVA 4EZIA 2QRMA 5KYXA 1SZPA 2VWHA 5EHGA 3MRXA 1RJEA 1SCKA 3QTBA 4YP7A 2Z2KA 3ET5A 1GUAA 4DC0A 1KDTA 3LGAA 3L7MA 4JHXA 3T1TA 3N75A 3NC0C 1ECFA 3D7LA 1U3CA 2PU7A 4IRXA 4MUAA 4WJKB 1VLZA 5FWDA 5HE8A 4YPFA 4C4AA 2WM3A 4JEHA 1XRSB 1N3IA 1A95A 2IS2A 1ZLXA 2QTHA 1O97C 2PZMA 1SQSA 1CUAA 2PUCA 1AGYA 2A94A 4EQ6B 3A3KA 2XVMA 1IEQA 1M2EA 1Z3IX 3ETDA 4JUCA 4AJNA 4DV3B 1LBQA 3AZQA 2JANA 1Z06A 2FN4A 4LI3X 4PXYA 4GPEA 3ZDZB 3H1AA 2I29A 2HA7A 2WSSD 4NZPA 1GFIA 1UK6A 1Q0PA 3AUSA 3F1LA 1Z5AA 1V4NA 4LRUA 3E82A 3OM1A 1CEEA 3CX6A 3GH1A 2XOXA 4ID9A 4U02A 2Z0MA 4AF7A 4Y6LA 4RCVA 2BMDA 4YDRA 4RH1A 5JFOA 4N76A 3I9KA 3I1YA 3WWYA 2W8BB 4ZT5A 4OHFA 1BJTA 4CLDA 3MWJA 4ZTZB 4UE3S 4R7TA 4PR3A 4M4SA 1BE6A 3FMGA 2F1OA 3LT0A 1LSUA 4W1PA 1P3JA 1EVJA 1G8GA 2HH9A 2CDCA 2RGNA 2WE8A 1TB4A 3GEBA 3IV9A 3BK1A 3RSOA 4ER7A 4N47A 2O52A 2W6OA 4E03A 5IJ9A 3D0OA 2VP2A 1YCDA 2AFRA 2SECE 4MW0A 5REQA 3UCFA 1WOMA 1KP9A 4ZZ0A 1WABA 2J7PA 1R16A 1YDEA 1P4SA 4Z6YA 3F9RA 3HKBB 3TLYA 1WY5A 3ISVA 3U37A 3E2PA 2W2MA 3F90A 4J4BA 4CEJB 3R09A 2E7ZA 1LI5A 3WBKA 4QECA 1NUSA 2B3DA 4QBTA 4PZYA 3MJEA 2GCNA 4OSEA 4DR7B 5CXXA 1ZBDA 4BBZA 1BKYA 2H5LA 1BCRB 1B1CA 4X3PA 4WCFC 4M9SA 4A2QA 1JJFA 1UK7A 3GVXA 1LC0A 1XR3A 4Y1RA 1F4PA 3O47A 4YAKA 2ZUFA 4HP8A 2NTNA 3S99A 2VUSA 1JKFA 4ZJUA 4A6EA 4H3SA 2OK8A 1Z6TA 3EZXA 4D9BA 5AW2A 4PQEA 5M5BA 4QDZA 1ODSA 2HLDA 4F6CA 1K06A 3HYCA 4YCBA 3T5BA 4JENA 4NMLA 4ASUD 3JAMS 4MUMA 2REXB 4K7JA 4Q1AA 4YBZA 5J59A 4DQKA 4I81A 5BUZA 4D2IA 4BZXA 4JI4B 4XDZA 1OFGA 4KT0F 1W30A 3EODA 2DR3A 4OL9A 3WZ2A 4CMEA 1Z2OX 1ODIA 5JFGA 1G38A 1ZA1A 3CPHA 4D9JA 1PFVA 4QJ5A 4KLAA 5IVHA 1L2CA 3A7EA 1JFFA 1K92A 3NYQA 4P6VF 4P83A 3SC4A 4PONA 3L1IA 1XNHA 2BEKA 1L1TA 1N0WA 3KETA 1RYMA 3LKZA 1FFAA 1JLSA 6CHYA 4JI0M 3EFBA 4GKJM 3Q7SA 4OFBA 3C3JA 3WADA 1C7FA 1HBJA 2PGNA 4DUGD 1A5TA 1LRKA 2OZLB 2SCUB 4H31A 5J4YA 4GKKB 3ET4A 3PTZA 1OV6A 4L76A 1OZGA 2I54A 2JFVA 3KEGA 2C4WA 3AESA 1NNUC 1NBMA 4QULA 4U9HS 4IKPA 3HHPA 1TK3A 1RJ9A 3HSSA 5E6SA 5G40A 1VHWA 4LQLA 3UQYS 1XU7A 3MVEA 3FE3A 2GBCA 3TLBA 3QYBA 1C7QA 2GQ0A 4JBYA 1ZHOA 1HR0M 1L5NA 1MABB 3MWEB 3IP5A 4RKUF 5JNSA 3TUZC 2OZVA 3GLVA 3A3OA 3PPXA 4CEHB 4IDBA 3NOQA 3C16C 2PWZA 2HX1A 1R8QA 1A3CA 1VIMA 3X3HA 1ZONA 1JQLB 4GDFA 1EUYA 4L2IB 2VYQA 4B82A 1RXSA 4DCMA 2OHFA 3TINA 4KMMA 1EFTA 2FW7A 2PBZA 3VMMA 4ZYVA 5FX2A 3IMCA 4YYZA 2F4NA 3DBLB 5AM0A 2JASA 5E7QA 5BPFA 3HM9A 4IPTA 3R4CA 4L5YA 2XODA 4OPMA 4U0JA 1YU6A 1B0PA 2VXYA 2XUPA 4HKTA 1NVDA 4HTFB 1TCCA 2B82A 1JKXA 5HBRA 2EP7A 4MHTA 1DKLA 3DT9A 4E07A 4HBZA 4YB8A 4LJ5A 3SYMA 1QRTA 5JNTA 2RG1A 1HYQA 3UJ8A 3VV3A 3KV3O 3B1FA 3CM0A 1QO9A 1JIKA 1U6IA 1ISHA 2J6CA 5L4SA 2GFHA 2R79A 1KOFA 1TF5A 2GK6A 2X14A 4B80A 5HYVA 3FCAA 1I3KA 3S6JA 1TI7A 2XW6A 5J23A 4B1FA 4KNVA 1TGYA 3C1OA 2J9YB 2HWKA 3A28A 4GDMA 4KMOA 1PLJA 2P5YA 4AX8A 4MIKA 2EL7A 2PR2A 3OJWA 4TVBA 3WOVA 4CV1A 4DV4B 1RQ2A 3HJBA 4LV6A 1LGYA 1JF8A 4RPLA 3LY7A 2OFOA 3M1AA 1EK5A 2V7GA 2GAOA 3JASB 4HXYA 4XVRA 2C84A 2XFTA 2RJ3A 2WJWA 1D0SA 3GFTA 1C0EA 3OIUA 4Q4HB 1XWWA 1B41A 3K92A 3ZXYA 1TC2A 4BMXA 5CCDA 4MR8B 4CKEB 2R1UA 4KDEA 1MV8A 1UT5A 3ZCQA 4YGYA 5BYJA 2CNOA 3GLIA 3JAWB 4IAOA 3RYIA 4CMIB 2QL6A 4DMHA 4GECA 3ZZ1A 4UEQA 3KR1A 4D97A 3LBIA 2WHYA 4JFAA 4JP2A 4M7WA 5A0FA 2P30A 3KZKA 3O92A 4A8TA 5LMUB 4PCZA 3LZCA 4R8LA 4M7PA 2ZTDA 2ACKA 3IIIA 5CD1A 4PX3A 3REGA 1XTQA 4PTLA 4ZC1A 2AKEA 5KOHB 3ZYZA 4F85A 4BATA 2O19A 1C7YA 1W5BA 1NY6A 3LW8A 4DT1B 1L2BA 2V59A 3JD4A 3P4XA 4NHEA 4YP1A 5F98A 1V3QE 1ZY2A 4QDOA 3RD5A 3U7RA 3V4SA 4D9FA 5BN5A 3PQDA 2B2NA 3AVPA 4JVLA 2KSQA 3LUJA 5I7RA 4HUQA 1J33A 3H1BA 5EIBC 5AHKA 4LHZA 1FS5A 1GP2A 2CHGA 2C04A 2Y1EA 5EFOA 1JZQA 1EWYA 3EXHA 4FKMA 3DAFA 4O2BF 2PMBA 1IBLB 4DWOA 3OFND 5KU7A 1ZJJA 4UARA 3QBDA 1Q16A 2GYVA 4C1NA 1R5BA 3AQ4A 2C2HA 3ES9A 4BP1A 1ORDA 4PIPA 5A71A 3QFCA 4UHJA 3LCUA 4M1QA 1M8FA 3O1HB 3HWSA 4N6OA 4INJA 1DCKA 4A7PA 3ZBPA 2HF8A 3Q8GA 1P7VA 2CNBA 1QDLB 4M2LA 2R4JA 1PI3A 2R4TA 3TB4A 3S4YA 1JLMA 1YZHA 4D0LB 2GEUA 3CG4A 3CZPA 5ALTA 6Q21A 2FOIC 3TBKA 2FWMX 3HP7A 5JXWA 5EP2A 1N78A 5DIZA 1RI1A 2OCXA 2WC1A 2JD2A 4WCVA 4ERNA 5JUWA 3CVVA 3AO0B 1JDPA 3JR7A 3ZTTA 5B3KA 1L8LA 3NP9A 2DFLA 3AWDA 1H66A 3ZTWA 3SR3A 2UKDA 2FSFA 4JX9A 1VSBA 2PG3A 1T6ZA 5FUBA 3ZE1B 1W35A 3MSXA 1YASA 4RHYA 1QS0A 5JMOA 2O2XA 3L93A 4Q1FA 3AUJB 3D02A 4N5NA 4L6IA 5E4YA 5KU1A 3KOZE 5DRTA 4B31A 5KYVA 3WQSB 4M1MA 3DTVD 3G9UA 1ST3A 1RWOA 2QLBA 3GRZA 3IEKA 3P97A 4HQ6A 5DV9A 3HSKA 4ZA2A 1B42A 1HLFA 1M74A 3R7LA 4RXUA 1E5LA 3E3AA 3FRJA 3EG9A 5F21A 3KJFA 1ZO8A 1PFUA 1W94A 2O7SA 2XYRA 4KIJA 3OZFA 3PNBA 5KNDD 3KOMA 5IZCA 1ZM2A 2F1IA 3DE4X 4PCLA 1ZJWA 4Z7NB 4C0XA 4N8DA 2PZKA 2I2DA 2Q1SA 2AJCA 3BHIA 4KE8A 1GA6A 1Y8CA 3ZDQA 3U7GA 2XXBA 3M5WA 5EJ7A 4GPAA 1E3LA 4O59O 2VQFB 4MVJM 3C3EA 4RETA 4EPYA 3DMFA 4NARA 4Q03A 1V6CA 2PMDA 4F3RA 1D4FA 1NLUA 1FUYB 4PLWA 5ALEA 2XZPA 4FC7A 3HLTA 3I04M 4WDQA 5KTYA 1EHCA 3IQWA 4JXKA 5EINA 3L6BA 1HQKA 4L3OA 2CLEB 3O1IC 4CUZA 3SLKA 3QFSA 2P9EA 4WOKA 1D1PA 1IWBB 1OA1A 1ZXXA 4A91A 4ZVTA 3HC7A 3MHPA 1I7QB 1T4CA 3TCKA 4QEZA 2GEDA 3O7WA 3V4OA 2WM2A 5KPDA 4WKPA 4OGFA 2H1WA 2CZQA 2ZWVA 3LWNA 4EF5A 1BC5A 1JIIA 1GQYA 1JYEA 3SNHA 5KYTA 4XQCA 1KEUA 2DBRA 2G7MC 4AURA 3DFUA 1UMDA 2G67A 4PRKA 2R65A 1F14A 4MS3B 4Q3NA 2FP4B 2YJ4A 4XCXA 3RTGA 4J2HA 1DEOA 1V2GA 2WJJA 3WMWA 4JI0B 3WL4A 1Y6QA 1MOPA 1PJAA 2CVHA 1Z4PX 4FD2A 3KTDA 1YHYA 5H4HA 2HW8A 4H7FA 1U2TA 1Z12A 3K2BA 2ZJZA 1F1BA 1KPHA 1RWQA 2P2YA 3EQ7A 4K9QA 1P1BA 1W4LA 4PGGA 3MF4A 4W7IA 5K6TA 2HADA 4Z49A 1MRZA 1QH8B 3H0KA 1F1JA 5ITXA 4KQ1A 5F1OA 5T4BA 4EUFA 5JAHA 1FSFA 1R88A 2FSSA 3PNOA 1XV5A 1EMDA 2IEIA 3TW8A 3OZWA 2NOAA 1D6SA 3CH4B 1E9CA 3L7DA 3TL3A 3U39A 2J3KA 1Z07A 3L8HA 4R2JA 3A9CA 2FSVA 3LS2A 4KQEA 4WZ6A 1PFQA 2HXGA 2HF7A 2NUAA 4CIBA 3AFHA 2B7CA 3VNSA 4X20B 2IH5A 4GZMA 4E2XA 1P1RA 8ABPA 1G5QA 1T1GA 4R31A 4R1UA 1YCGA 2W2PA 1U2PA 4MRVA 2VHJA 1KI4A 2QGFA 4OB6A 5B1SA 4YWJA 3L7YA 2BI8A 3Q11A 3OQNA 1NXTA 4EYOA 4LV5B 4IIJB 1KKMA 3D59A 5CR9A 4E94A 1C1XB 5FWXA 4R6WA 1XMJA 4HATA 4B17A 7REQB 4GKBA 4JOBA 3LW7A 1PHRA 3NATA 3VM6A 1JVBA 4GHAA 1XLVA 1JB9A 2J5XA 3N58A 5IDXA 1FMCA 2Q7DA 1M5TA 5K0ZA 5LL6P 2XX3A 1STOA 2QQ5A 2ROQA 1NVGA 3MUFA 5HFAA 3RAPR 1E3EA 3WYBA 2NNWB 4OQEA 4N7MA 5F9HA 3VSBA 2UUBM 3KYJB 1U28A 2JFXA 4JH0A 5GM2A 3E5RA 1NJ5A 3G2QA 3L3BA 3VOSA 4Q21A 3DGEC 3DZFA 3CQ9A 4F0JA 3GPPA 1J8MF 2PZLA 2VUHB 2YXDA 4YJGB 5H02A 2GCEA 4XB1A 5JAZA 5AESA 1SVLA 4B4VA 3GW8A 3IRUA 3OM8A 1U1DA 3R2JA 4UCXA 3T1HB 2GK4A 1EIJA 5B6JA 1P72A 4M8IA 3A6KA 1IHPA 3UOWA 4XWTA 4RHXA 4V02A 3G89A 4DY4A 4UXJA 4B75A 1DC7A 5C5IA 1F2UA 4PLHA 2YOHA 2HBRA 2YVAA 5B55A 1SHZA 2G9VA 1AKUA 3E7FA 3B36A 1S8FA 2WIJA 3CNLA 3H4MA 2H2AA 3PJDA 3AVUA 3KTAB 2H1FA 4Q9LA 4ZYZA 4F9FA 4FKBA 4JYMA 3P9QA 3HYSA 4V24A 2JJ2D 3CEMA 3C7CB 3TKLA 2PS9A 3M4YA 3CT4A 4KO4S 1VA5A 5IP5A 1QFZA 4EHKA 4G23A 4XFDA 5DW0A 1ZICA 2PL5A 5IJXA 4KPEC 3OZAA 4KO2S 4KW7A 4EHAA 1U8ZA 1MEOA 3ZHBA 2C31A 4BFLA 2X2PA 2R87A 5JSZA 3QWFA 1D6JA 2QM7A 2WVHA 2EBWA 3TTWA 5HVNA 1HEIA 3C2QA 3QWBA 1W9MA 4M89A 4IY1A 3WNZA 2OZPA 4MWSA 4PTYA 3TMYA 2BZ1A 3GLTA 2O8NA 3DLTA 1NE7A 2H52A 3JD0A 4H3HB 4E5KA 2FS1A 3TMKA 3TJRA 3VPXA 2ZATA 4OYRA 4YVFA 2IYXA 2RGNC 1HG0A 1XTRA 2R25B 2BUBA 3C5WP 3OFJA 3SSAA 4YLYA 4Z1MD 1RHQA 4CM7A 3ENZA 1QVWA 1KPGA 5TDHA 5GJCA 3W05A 1VSQA 1E18A 4KLCA 3TRKA 3OPYB 1ZC4A 2HL6A 4U39A 2W42A 3JZFA 1TPZA 1CUGA 5LOVF 1KKLA 3OCVA 2YXEA 3LT2A 3MTEA 4S3MA 1YRAA 1KMNA 9MHTA 4BGIA 5EHZA 1B6RA 4MVJF 4OB8A 4ZPJA 5I4BA 4Q66C 1NQTA 4M1ZA 1DC6A 1V96A 2X9VA 1Z8DA 4Z0HO 4ZU6X 1G9XA 3Q8XB 3BFJA 4UAUA 5JADA 2Y93A 1ZS9A 4J0CA 5GIPE 3DL4A 1GL7A 4JI3B 5CJ2A 1P9RA 3IAUA 3UV6A 3V7YA 5IWAB 1MVOA 5ERGB 2PSDA 1T1RA 5G0TA 1MRNA 1X1BA 3RC2A 1YZLA 4XYLA 2QZ9A 3UIEA 2ANBA 3HBLA 1FFEA 3QTLA 2ATCA 3ICOA 3OAAA 2P8JA 5ALJA 1YK0A 3PFWO 5CIWA 5H3LA 5TF4A 1RC8A 1F6WA 2N9UA 2BRUA 1KIMA 1U99A 4QQFA 5FBHA 3AF4A 3LU1A 2IHUA 1QGDA 1Z2PX 4O2AF 4UTVA 3RVSA 4D82A 2FZKA 1T6BY 4R1SA 1CQIB 1DTWA 3K70C 1Y5MA 3EVTA 4AX4A 4IQ8A 2QUHA 1QNFA 1SD2A 2QRVB 1FCJA 2NZYA 3OX1A 1F0NA 5FUWA 4MS1A 1VBNA 4WN9B 4DV5B 3T3NA 4L1KA 4X1OA 1YAJA 1GRRA 1QUEA 1R4MB 2JI6A 3NHWA 4BX3A 4DCVA 5KZMB 1WD7A 1RWNA 2DH5A 1Q0LA 2AR9A 2FRDA 4D3ZA 3AY0A 3M6AA 1Y8AA 3UC9A 1ZNXA 2VNJA 2C54A 1AY0A 3AJ8A 3KX2A 4HQFA 5B6PA 5HGXA 5A06A 1W75A 5K0GA 2JLAA 1Y3AA 3KEMA 4RU1A 4XZ3A 2NIPA 2OHIA 4N0MA 1EKXA 3KXPA 5G1OA 2TMYA 4AWAA 1EFAA 4MWEA 2J0UB 2RCYA 3D31A 4P34A 1SXIA 5BW5A 5ES3A 2J9FA 2W6IA 4HGPA 3IEUA 2J33A 5AOCA 1NOIA 1TM3E 4DAOA 4OI2A 3EY4A 4B8WA 3GO8A 3QLJA 3FYSA 2DX7A 2LPMA 3WGNA 3CCFA 4E6EA 1UIMA 4B7ZA 3DDOA 3CN7A 3G8AA 3NWEA 4PQFA 2Z56A 4TMZA 4UMFA 4UNRA 1QIMA 221PA 3M4XA 4TKMA 1ZGGA 2CXSA 3BTVA 3SX0A 3TSZA 1SHKA 4ISCA 1NYTA 5FWXB 1A9PA 3NFRA 4B40A 2FZ5A 4Z8YA 2JFWA 1KBOA 3SOZA 4MPRA 5DLDA 3ROFA 1QONA 1JEQB 2GWHA 2IIVA 2O8FB 1TYCA 3ZIAD 2IDKA 1Q0HA 1AB5A 4N41A 5TV2A 2C7GA 5DM2A 3KZXA 5TF0A 1YS4A 2FZCA 7GPBA 1JVNA 3DDCA 3SYKA 1XYGA 1T4GA 2V96A 1QTQA 1NW4A 3DVLA 1ZAYA 4PD2A 3C8ZA 1T0BA 1ML3A 3K16A 4K86A 1FS6A 1HI9A 4X93A 5JNVA 2FE1A 1O8CA 2DCUA 3IJPA 3BZWA 2JAWA 2QX4A 3KUXA 4RQBA 4ZQCB 1SCIA 4BNNA 4BE9A 1OF1A 3F3SA 3U6CA 2H2FA 2PGAA 2TMGA 1KVQA 3PL5A 3U1TA 4B6OA 1UBMS 2CXHA 2WG1A 4M7RA 1NM5A 1GPLA 4KN8A 4Q16A 1NJSA 1YL6A 2ZUSA 3GEGA 5BN4A 3AR8A 2MTBA 5FL3A 4LHSA 5AM4A 3ST7A 5C51B 2JIBA 3S0JA 1RKUA 2PVCA 2CXUA 5I01A 1CY1A 1OYYA 2PWYA 4XVQA 3GJ4A 3GLKA 1OPRA 4J4TA 4L4ZA 1SUDA 4PX2A 4ZANA 4CF6A 3QOWA 1MG5A 2BOVA 2HJGA 4DSZA 2LZ0A 1TTEA 2PJZA 3EEBA 2XZOA 1VB5A 1TJ4A 2GNPA 2JCVA 5BQFA 4P0QB 1MC1A 4JZYA 4U7FA 1FUKA 3QXXA 4IZIA 2JZCA 4IBGA 3DEZA 1DX9A 2EVWX 3RSFA 5CVTA 3QV2A 4LJ9A 3FPHA 1YGYA 2B8EA 2FXVA 3F5QA 1V95A 2D4AA 5IKXA 1TAHA 1X94A 1SXJE 2PWAA 1FK8A 3U0BA 3TUIC 1ONBA 2VAWA 3EC1A 1UC4B 2Y99A 4KMSA 1D1QA 3UAWA 3RVNA 2L2QA 3WRWA 3G9XA 1J4AA 1FFHA 4EAQA 2QEQA 1C81A 2X1MA 4RZIA 3TM5A 4LPSA 5DN6D 3TZ6A 2AOVA 2CXOA 1XHLA 2D7CA 4TLDA 1L4KA 3DM5A 1D2GA 5FTJA 2Y66A 3IKJA 1OILA 3QX7A 3R8CA 3O38A 1KZHA 2A0YA 2PS3A 3R0JA 1XD2B 3MMNA 5EKUA 3WGTA 1ZD1A 1NYLA 3QU5A 1TMKA 1DC3A 1X7XB 2KI5A 1ZGJA 1IONA 2O3RA 3HDJA 3L8GA 4ZVLA 3EZFA 1T5BA 5IKPA 4RE6A 2HQBA 2ZI7A 1K75A 3C4VA 4HAUA 4CU5A 2H1SA 1XHFA 1WB9A 2ZUUA 4U7WA 2CJFA 3BFVA 3N7AA 3J7BA 2PRSA 3UZUA 2PL3A 1I2CA 2HXYA 3MS2A 4KTVE 2PCLA 3HBMA 3U3DA 4DMLA 2QDXA 2RK4A 3PQ2A 3SAVA 3EPHA 5DTMA 2OL4A 5CBPB 5JCOA 5TQ2B 5HPYB 4UBMA 4R1MA 1VI2A 5IASA 1M5UA 3NTXA 1N34M 3REFA 4HX9A 5KB3A 1A9XA 3ZU3A 1WBJB 4YXFA 2V55B 2NTVA 3AERB 3N07A 5M3BA 1QAOA 2FKAA 4MGIE 4YHBA 5IEBA 4EZBA 2VDQB 2BFFA 2NUAB 1BNCA 2BZSA 3MJDA 3A04A 3QU9A 1GGHA 4G85A 5K0SA 4HUJA 2IK8A 4Q7JA 3IHPA 1XTTA 3H18A 1WQ1R 4RTNA 1KIAA 2EDCA 3MT7A 4EEKA 2VDVE 3VDQA 3QHPA 3BMOB 2HF2A 1XKXA 5JYDA 2FX5A 2CVFA 1KSHA 3KAQA 3O1JC 2ZOSA 2B8JA 3MPUA 4BVBA 5F7OA 2H07A 3VAAA 3R6LA 2OSVA 2FJUA 3LT5A 2N0SA 4JX8A 2OM2A 3RNLA 3FOFC 4OHKA 1QWOA 5TC4A 2VA9A 1JGTA 3OECA 4FOPA 1NZDA 1JFVA 3AWIA 2ZIXB 2HC9A 3OIWA 5EUBA 3VZCA 2ZB4A 3LNCA 5CP8A 4MUIA 5JFTA 4P4SA 2QB5A 3MIZA 4HAIA 4YJFB 1IY8A 3CEJA 4G56A 3GCZA 3GFOA 5A4AA 2WJYA 1D0KA 2AOTB 2P5UA 1G98A 3T7EA 1MB2A 1EDOA 1E5VA 2GRAA 4MRNA 1C7JA 2QMUA 4PXAA 1VKHA 4PYQA 1V9SA 1QR6A 4KQ6A 3NKLA 5KYYA 5LKRA 1UEIA 4ILEA 2Q2WA 4KACA 4DDHA 1T5TA 5IFLA 4YASA 1WY7A 3OUTA 1T24A 4L6CA 1UDCA 3IP3A 5I7UA 2CUNA 1M7HA 1RTTA 2SBTA 1DI0A 4GXNA 3T5MA 2J4CA 4Q4LA 1QHXA 4J0IA 3J7AC 1JSXA 1YZNA 1DHTA 1SOMA 2CHVA 2J7NA 2I7TA 4PNHA 4QEDA 1DZIA 3RVKA 3EGWA 1P1KA 3DB2A 3M70A 4RIEA 5HIJA 5E7JA 3RIEA 4II2A 3T7AA 4FYJA 2OFWA 4HEA1 4Q9NA 2H92A 4ZQGA 4D8UA 4DV1B 1NNI1 1MJGA 3EGEA 3OG9A 4CR6A 3DBHA 3B3QA 3MQ4A 3MUOA 4OKSA 2O1WA 2CXXA 2OA0A 3I62A 3PL1A 4L50A 5K0EA 4UXHA 3DVQX 4HDNA 3QMWA 4MV1A 1IM2A 1D0VA 4P7BA 3QE2A 2ZE8A 4PDIA 2QZJA 2EKZA 4LGMA 2QQ0A 5KMGB 2V7QD 3HYRA 3Q40A 5KKNB 3EIFA 5DLPA 2Q6KA 4R3DA 4C7OB 3EQZA 5SY4A 3S2ZA 1FLVA 4MARA 3W90A 3WLHA 2A78A 5IG2A 2ODNA 2VDOB 2CNNA 3OO1A 2BM1A 1TMGE 4LNHA 2B92A 2FRDC 1RLMA 3IA2A 3I04A 5IVKA 4WZAA 2ZK7A 3CE9A 2FPGB 1J07A 4CF4A 5IUJC 4M8KA 5KWJA 4J0GA 3G49A 5I3ZA 1SUWA 3N1UA 3O4VA 1NE2A 1XALA 2FW0A 1Z45A 4KVGA 4R83A 4HVLA 5JCPA 4WLFA 2P5TB 4DWVA 1ZN9A 3CWZA 3TD6A 5GONB 2P6RA 1AZSC 1DIRA 2EG9A 5CFQA 4KKXB 1TZCA 1NX9A 3JQ7A 2L0XA 3I39X 4RM3A 3AKCA 2Z8ZA 4NZMA 5ENZA 4RHCA 2D5AA 2VHXA 3FTNA 1E96A 2YRXA 1SZCA 3HWRA 4WL0A 4AAYA 3OTOM 1C14A 2RK3A 3IHKA 4Z0PA 5H82A 3SIRA 3LNTA 1VKRA 4I3GA 4NK5A 4TSFA 3VO1A 1RXUA 4DJFC 5A9RA 1XEXB 1FNCA 4Y6SA 2BYTA 4Z51A 3K70B 1KO5A 1YDHA 4EA8A 4QAJA 3ZGXA 1SUAA 1ZKDA 3EVEA 5LNK6 2GILA 1AG9A 1DOAA 4C4SA 1LLUA 2JCYA 2GZRA 1BTOA 3Q8MA 4XJVA 4A4DA 4TYPA 2ZWOA 3B60A 3RFFA 2VP6A 3IULA 3PSAA 4ZMSA 1A7KA 1V0JA 3MFYA 1JLLA 4AMVA 2HKJA 1JQDA 1W4RA 4GO1A 3T7SA 1NI5A 3Q5GA 4GW3A 3OFNA 2FK8A 2QV0A 1XYVA 3KWMA 3V4ZA 2BGNA 3WIEA 4MVYA 5FOQA 2RMKA 1XD2A 2XB8A 3BKWA 2DAIA 5AM5A 3AJRA 2VF4X 5JHGB 1FJGM 1JHUA 1O9GA 1XDWA 2WQZA 3CISA 3NNNA 3BDIA 1Z82A 5A62A 4AJIA 1Q14A 4UOQA 3X1MA 1IUNA 3HBFA 3ZNQA 3JQFA 2NZWA 4DEXA 4M36A 3ZJVA 4RYDA 2K9DA 3RYFA 2LVPC 1SULA 3JQ8B 3MS4A 3WGJA 3IP9A 4FTWA 3WDKA 2O54A 3I6ZA 3DBIA 2Z2XA 3H97A 2UXCB 3F6BX 5BMVF 1NL3A 3FRIA 5BT9A 5HIMA 1NI4B 5LP1A 3N3AC 2PD4A 1PSDA 4PG8A 1RC1A 2D1QA 1HMPA 2Q0SA 2F5SA 3QU7A 5P21A 4ENWA 1TCUA 2FDRA 4LYDA 4HG2A 3VVCA 2RHOA 2B5VA 2VJOA 3DUWA 3L28A 1ZUWA 3HKBA 3NAMA 3I5UA 3DOAA 2VDUE 1ILEA 3RIYA 4UOZA 5DEIA 3FYCA 1UL1X 3DTVB 4QE3A 4AVYA 4EG5A 3WLFA 1M2WA 3M0EA 1WD5A 4G41A 4KTTE 5K03A 5LWHA 4AS3A 4RORA 1JECA 3BUSA 3NTQA 2BHTA 4YBRA 2ZCJA 5LQRA 2XTZA 1WW8A 3E53A 5NLLA 4C1BA 4GLLA 3EXFA 3QPAA 4ROTA 4C03A 2EW8A 3IR7A 3C9PA 4GH9A 1B93A 4BXOA 2AC2A 1OGJA 2EFEB 3LX4A 4KDFA 3AKDA 1LPMA 3DTNA 4Y6GB 1Q1AA 3RRXA 2BTEA 3UK1A 3L7OA 2E1PA 4LYAA 5I7SA 2PGLA 3V9AA 5B4UA 4ZKEA 1NVWQ 3IBGA 3KUUA 3L79A 1CUEA 3KP0E 5E4JA 3G8CA 4EFKA 2DZOB 1XRNA 2HV8A 2CV0A 3DE7X 2GN6A 1Z83A 1JEQA 5I7WA 3REQA 4LZOA 1EXNA 4JB0A 2WVGA 3K6SA 4ZAZA 3DDNA 4L57A 4F56A 3L01A 2GA9A 1IOWA 4URZR 4Z9XA 3VNAA 4TYMA 4TXHA 4CTNA 1B26A 1TF0B 4FYHA 2VC2B 5CVJA 2NVUA 1W4BA 3W9SA 4RVUA 5KYNA 3EPJA 1QG4A 1KMIY 4QOZC 1QFMA 2Y2VA 4ZQIA 3EY9A 4DILA 4K6FA 4A27A 1KHHA 5BWCA 2GD2A 3AONB 3LP6A 3NC4A 3W7BA 4JLSA 1QZMA 1NVAA 1FVOA 2A0UA 4ETNA 2QL9A 3AXTA 8CATA 1U8YA 5JNWA 1ATZA 1KEVA 2CMHA 2E4XA 4H1VA 4OY3A 2VG8A 5CTAA 1ZN7A 2LCQA 3D3EA 1W88A 3E6AA 3PI7A 4XUEA 3ZU4A 1A88A 4A82A 1RYBA 4B4UA 4ENSA 1VKJA 1A7UA 2RI1A 3KQTA 2C5BA 2AGVA 2WYOA 4G4JA 4FWGA 3L9XA 5TMBA 1TO2E 4YGXB 3Q0IA 1PKEA 2B34A 1YQDA 3P2OA 2QR5A 2IZOA 1J0BA 4NENA 3CRVA 5ALPA 3H0CA 3LFHA 1ZK3A 4FZ3A 5DTIA 4F97A 3VHQA 4WCDA 2JZNA 2CFSA 3QOYA 3I51A 4JVMA 1J6UA 4YT5A 3HADA 3TE7A 1EM8B 3TQQA 1P1JA 1QANA 1NRJB 2CCJA 1PEAA 1VL1A 2P90A 1BX1A 3AC0A 4QUKA 1NF8A 1MH1A 1A72A 3GT4A 5HDBB 5J58A 4DLNA 3G6KA 5ALXA 4UKDA 2IS6A 1F0YA 1UC5B 5CH3A 2IYOA 4WDRA 2L7IA 2DHDA 4RTLA 2W43A 5BRJA 1M8PA 5L95A 2JC3A 3E22A 1EP2B 3U6MA 1THTA 3VDNB 1XVAA 3H11B 4P16A 1XZBA 2NGRA 2Q5OA 4YUWA 4W5NA 3IYLW 1ZUHA 1HFJA 2CJYA 4FYWA 3EFHA 4YAJA 1PWEA 1HF3A 1GITA 3TB6A 4MA5A 1W46A 4E6PA 2XMRA 1DQRA 4IXDA 5KQRA 2QRGA 4IXNA 3NORA 4PX5A 4IDAA 1N2HA 5TS2A 5KVVA 3ROPA 3F5SA 1N3YA 3LCJA 5B2FA 2J45A 1APBA 2QNBA 4EUSA 1QHIA 2WABA 4PAQA 5CXSA 3Q0TA 3W1WA 3AERA 3AH8A 1D2HA 1QGUA 2I7DA 1EXVA 3EGVA 4W9NA 1HT0A 4E1AA 2G6TA 5LMCA 3HB7A 4E22A 1EUDA 2HA5A 2J0EA 3HO8A 1QCDA 1XLUA 4AWBA 2B3TA 4DBGB 1UKAA 4LCEA 4Q7JB 1QPBA 2Y1WA 3WLLA 3JRNA 4BNDA 5JRZA 3TOZA 4W5TA 1NNEA 2G63A 5TY0A 1Y7PA 1UP4A 2WSCF 1VE7A 2Q8QA 3AF1A 3MN1A 1CUIA 3LL4A 2XF2A 2J6BA 3N87A 1OJLA 4FGSA 5K3FA 1OROA 4MVWA 1DUVG 3G0BA 3RIHA 1HKUA 5CYOA 1QYWA 2FSUA 2IQIA 4JB2A 4CMHA 4NRDA 5I7HA 4ZCQA 2W2NA 1DOZA 3O8LA 4LEIA 5DN6A 5HE9A 3UMSA 1KXJA 1UJ2A 1XQVA 2H2HA 1KU6A 1QFJA 3CCCA 3B78A 3K5PA 3HRKA 3Q6MA 4Z2YA 4ERXA 4XLTA 1KO8A 4ZI7F 3W4IA 2FMKA 3D1LA 4K9SA 4RGBA 1X8LA 5TT0A 3VGPA 5HWSA 1ISPA 5KNCD 1JEEA 3B82A 3RQSA 1ZCAA 1W8DA 4OXXA 1CUCA 1AGRA 2QTAA 4Q3LA 2LBCA 1YIDA 4I9HA 3VJKA 1H5NA 3E5HA 2F3PA 5ADUS 1HPLA 1UBTS 2P0YA 4MW6A 1G0OA 1IATA 1DXQA 4EAAA 1KRXA 4B3TB 2AG8A 4AUMA 1ZGZA 1ZVVA 5BVHB 1UOOA 1VJCA 1RPJA 2CZGA 5BN1A 4WBXC 3DE0X 4MV7A 4AYXA 4EVIA 3O83A 1YC5A 3K0KA 2DYKA 4YONB 4ZAYA 1EX7A 1DNPA 1NSYA 3E7DA 3H2ZA 3QY0A 4NJMB 5EQFA 1P2UA 3PF8A 2DWOA 1B8UA 3G2NA 1UMCB 2Q7OE 3I2GA 4K0KB 2C97A 1LB1B 3NHYA 3OI7A 2B99A 3C6XA 1NJ8A 3P2MA 4ZCPA 3EDCA 3NBMA 1RPZA 1RI5A 3CW2A 3G8BA 1HE5A 4HNSA 4DVGA 4ITUA 3EQ8A 5BR8B 2ZFUA 5CPFA 3MT9A 3ZCSA 2N42A 4QUJA 3TIXB 3LUGA 2HA2A 4KIWA 1MA0A 3F9IA 4DRZA 3MTQA 4LY0A 2XDAA 2Z2YA 4UBJA 2CLMB 1BXZA 5C1OA 3IKMB 3V8QA 1LV8A 3CB4A 3C5CA 4HXFB 3WSWA 1NVMA 3OKAA 5CT9A 3LPCA 1ONNA 1DAGA 1JTEA 3O0TA 1PK9A 3IHTA 3ORFA 3L8YA 1TOAA 3TPCA 4BMYA 5K0LA 1CRQA 1U31A 2BMFA 3VKGA 5AVJA 2IWRA 2DLCX 4CV0A 1HLDA 4HDRB 3DFIA 4QUHA 1SELA 5B7GA 3DFMA 4LZZA 3BREA 3H4VA 1QU2A 1UXKA 2AG0A 4AZTA 2XB4A 3FUTA 2BC9A 3IVAA 3OEED 3JD2A 4I66A 3AYXB 3D3WB 2NM0A 3SYRA 1G21A 1XTJA 3TWLA 1CQZA 2HMAA 1QYXA 3FPBA 1ORIA 5JWHA 2GSWA 2ZI5A 2FR1A 4V0LA 5B1YA 1DJMA 4X1KB 5DZSA 2R18A 1Z5ZA 4GQBA 3H6HA 4RSHA 3N2KA 5DX0A 4RFSB 3ZK8A 4DE5A 4DMCA 2NMVA 3DZ8A 3BGWA 2XXAB 3MINA 2PH1A 1ES9A 5ABPA 4D0RA 5B6IA 1FU8A 1AKQA 4DA9A 5DGDA 2I9KA 2HZ7A 2CLLB 4F2GA 4J7AA 4HJRA 2ZZNA 3HFGA 5FTKA 2EX4A 1B00A 4BKRA 1G64A 1CDOA 3CS3A 2P8SA 1VFNA 2O2EA 2DTEA 5FPHA 2WD7B 4IJMA 2VZEA 3BL5A 2IUUA 4NABA 4Y2TA 3WYFA 2O8BB 2J09A 4F5YA 3B51X 3U4MA 4QU5A 1C8KA 2XYVA 2PMEA 4CIDA 2Y76A 1MP0A 4CHTA 2ZS8A 3B5IA 3TD2A 3IALA 3AB8A 3GPYA 4Z3DA 1Z2NX 3I9MA 2NVOA 2VRWA 3CTPA 3V7UA 4COOA 2Y0EA 4G4IA 5G4KA 3HY3A 3S2YA 4X00A 2AFHE 1QIHA 3FLAA 3CVOA 1PK7A 3M49A 1G2IA 1WVGA 2AW3A 4OLJA 5JECA 1JH9A 1T9GS 4TOIA 4G4RA 3SS9X 1KJNA 1NU8A 1ZVMA 4F3KA 2ZRNA 4J8PA 5BXQC 3QSGA 3M3HA 4LK2A 1X7YB 3A9TA 5FUVA 3ZPXA 4AKTA 3ZCPA 1J8FA 2O3UA 3I8SA 2JGIA 4I3FA 2YASA 1DP4A 1FBTA 2FEAA 3JQCA 1RYNA 3KAPA 1RXYA 1Z36A 2BFCB 2RB5A 3OQHA 2XCSB 3EVFA 1K7YA 3OAAD 4HDAA 3FCSB 3UJNA 1AXGA 1D6MA 2WAYA 5G0VA 2DENA 4FP9A 4A0SA 2JH3A 2E87A 3PCRB 1TMOA 3UQZA 5A4MS 5ALNA 4B3XA 4BCDA 2FUEA 4O4IA 2D1YA 4WBSA 4LC1A 4JN6B 4UZEA 5EMKA 1LDNA 5AW3A 1D1SA 2KX7A 2WKRA 4JL8A 3WP1B 4M0FA 2QV7A 4TPKA 1MO4A 1WMSA 2ZRCA 3HJTA 1O9HA 2JZ1A 1GAWA 2VIIA 1A2QA 3CB2A 3DCNA 3HB1A 4MI1A 4UZFA 4EI7A 2I4RA 4EW3A 1M3SA 1T3GA 4LGCA 1Z7YA 1NMXA 2V7BA 3P9NA 3QLVA 3A6ZA 5I6DA 2FPOA 3EWSA 3RRJA 3B85A 4DNQA 2PAAA 3AVVA 3PQ7A 4L8YA 1TK2A 3I6MA 3RTEA 1YK1A 4G8DA 3W3AH 3A2KA 1W2HA 1KOJA 2VSFA 3TXYA 4B45A 3FDZA 2AUMA 1Q7CA 3CIFA 3GP1A 5HZGA 3VOBA 3ED5A 1YI1A 4GOKA 2WAOA 4GPD1 1PAUA 2XNKA 4L3VA 4YMSA 4KN5A 5TMEA 4FHDA 5AM2A 2O0MA 2IEAA 3DV0A 4YR9A 4B3BA 4G0XA 3HTXA 1VCNA 2CSUA 2O0HA 1JHQA 3DT8A 4YJDA 2XAUA 5DYWA 4CT4B 4P31A 2X1LA 2PHZA 2C4MA 3BQ9A 3TPFA 1A50B 2GBPA 4GT1A 3FLEA 4FCWA 4D4HA 1SN7A 3AYZB 2RGXA 1S3GA 3DQQA 3P9PA 4EH1A 3HHEA 3FPJA 5JVDA 2IXAA 4DLLA 1J2UA 3ZV4A 5INTA 1K0FA 2EIXA 2UAGA 3JQPA 2R7LA 4WXMA 4DZTA 1A8HA 2CEAA 3R5FA 2CWBA 3EA0A 4X92A 4YJGA 4DV1M 3UJ6A 2WE7A 4NSNA 1JT9A 2C0CA 4EA6A 3H19A 1Z08A 2PDAA 4JBWA 4NZZA 3KJHA 4AC9A 1K88A 2JAQA 1ORVA 1LVHA 4K5QA