3FTDA

Crystal structure of a. aeolicus ksga at 1.44-angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
240
Chain Sequence
SFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 83
structure length 240
sequence length 240
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftdA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftdA01
5FWDA 3KQOA 4ISCA 3BKXA 4PGHA 4DMGA 2B78A 3C3YA 1ZG3A 3EMDA 1SQFA 5ERGB 1G6Q1 2UYHA 3EVBA 4YMGA 3IEIA 2IPXA 1ZGJA 2AOVA 2VDUE 4PCAA 2G71A 3G2PA 1KR5A 2AOUB 3PS9A 1EJ6A 3P9NA 4GOLD 2XYRA 3REOA 2OPBA 2YR0A 5KQRA 2OY0A 3R3HA 4GBED 5EMKA 2P8JA 2FCAA 4HTFB 5FHQA 3EVDA 5E2AA 4MQ4A 4M38A 2CWWA 2QRVA 3MHTA 1JSXA 4M36A 3FRIA 4KW7A 2NYUA 3M6WA 1RI1A 4MTLA 4KWCA 3WSTA 3TPZA 4G56A 4R8RA 5T6BA 1XDSA 4EK9A 2QYOA 3BWYA 5DXAA 4DQ0A 1BOOA 1XCJA 3NJRA 4C03A 4ER5A 4GOMD 2ONYA 3PT9A 3G88A 3KKZA 4H0NA 2BR3A 2B9EA 5ICCA 5IH3A 3OE5A 5EHGA 3EVGA 5K0CA 3IHTA 1RJGA 1NW3A 3GIWA 2YTZA 1XTPA 1L3IA 2O57A 3GRUA 2I62A 5GM2A 4X60A 3SX0A 3G8BA 5K0BA 3FRHA 1WS6A 3TKAA 3KQVA 3Q87B 4BLWA 5EC8A 2XVMA 4LECA 1RI4A 1JG3A 5F2NA 4DZRA 4E2YA 3P2KA 4HC4A 3P9CA 1NKVA 4IWNA 4RYLA 4FGZA 5HIKA 4PYOA 4QVKA 1VP9A 3CKKA 4GOOD 1ORHA 2G70A 5FTWA 5HIIA 2Z6QA 1OR8A 4QDKA 1JG1A 3EGVA 3I64A 3ER8A 2IFTA 4RVDA 1QANA 3FPFA 1XXLA 3LCCA 3R0QA 2ZZMA 1R8XA 2AZTA 4CKEA 1VE3A 3E23A 3QOWA 2ZFUA 3BGIA 3EVEA 2YXDA 3TMAA 1SUSA 1X1CA 2G8NA 2VZ9A 4ER6A 5DPMA 3V8VA 2HWKA 1NV9A 3PTAA 2ZBRA 2O0LA 5E9JA 5E1MA 3KPWA 4GEKA 5EEGA 5DTQA 1YZHA 2PXAA 1WXWA 3GU3A 3L8DA 1ZGAA 4PWYA 3HTXA 3JWHA 3NTVA 2HMYB 1NW5A 5DM1A 4RVHA 3D2LA 3UBTA 2JHPA 4QTUB 3DLCA 3PX3A 2P7IA 4MIKA 2Q41A 1RJFA 4ER3A 5DT2A 3B7PA 4AZWA 3FUVA 1X1BA 2PLWA 3TQSA 3DOUA 3IV6A 3P71T 2ZIFA 3BXOA 5EEHA 5B1SA 1MHTA 3EVAA 1Y8CA 3SMQA 5K05A 5EGSA 1R6AA 2N47A 1UIRA 2PKWA 5F2KA 5K0FA 1WXXA 2CKDA 1M6YA 3ME5A 4PIPA 3KHKA 3DXXA 2HV9A 5M5BA 1XVAA 3C6KA 3O4FA 3FZGA 3QOXA 3UJ7A 2NP6A 2NP7A 3EGEA 2P3QA 3OE4A 3O31A 1QYRA 4CWAA 4IV8A 2UYQA 1VP3A 3LCVB 5LQCA 1R18A 5GP1A 4PYMA 3TLJA 4E70A 3MB5A 1FPQA 1KP9A 2VDVE 3T7SA 1WG8A 3R9XB 3LX6A 2V7EA 2WA2A 3K6RA 4GF5A 3MTIA 4RTLA 4YV1A 3THSA 3FPGA 4RWZA 5KVAA 5CVDA 3K0BA 1VIDA 4CKBA 3BZBA 3EMBA 3DP7A 3OCJA 5ICGA 1FBNA 3E8SA 1I1NA 3ANXA 5KYGA 4E30A 2GA9A 1Z3CA 1I4WA 3MAGA 3FPJA 3RODA 1JTFA 4CTJA 2IH4A 4YV0A 2GAFA 3A27A 3KQPA 3KPUA 2C7RA 4RTMA 1F3LA 1VPTA 2OXTA 4ER0A 3FPEA 3M6XA 4RTOA 3CJRA 5CVEA 5D1HA 3FUTA 3EVFA 4OA8A 2BZGA 3O7WA 5CUQA 3SR4A 1KPHA 4MWZA 5BP7A 3CC8A 3NDIA 2EFJA 5EIFA 2ZLBA 2IH5A 3SSNA 3B3GA 5JUWA 1SVUA 1L3BA 1TW3A 1T43A 2Y1XA 2PX8A 2CL5A 4IV0A 3AWIA 3GRRA 4GOND 3UJ8A 4F84A 4JXJA 2ERCA 3HVKA 4OBXA 3LDGA 3RIEA 4FR0A 5E8RA 4CKCA 4QTTB 5DXJA 2YQZA 3G89A 1N7JA 1IM8A 2QM3A 1JQ3A 2OBFA 3KQMA 1U2ZA 4R6WA 2ZZKA 3MGGA 5E2BA 5K0JA 5FCDA 2KW5A 3MERA 1O9HA 2NXJA 3I5UA 5T64A 2PT9A 4RTRA 4P58A 5EQJB 2I6GA 2QRVB 3KQYA 3OFKA 4OQDA 1SUIA 3GWZA 2C7QA 1QZZA 2ADMA 1PJZA 2LD4A 1P1CA 1AQJA 3SSOA 5GOZA 3TRKA 2JH8A 1DCTA 3G5LA 4WVLA 3HEMA 2BH2A 5EMMA 2IDKA 3FYDA 2P7HA 2ZSUA 4RSRA 5DLYA 5GIOE 3A4TA 4LWPA 1WZNA 2PX2A 3NVMB 3PB3A 1JQDA 2B2CA 5G02A 2AS0A 4YMHA 2EJUA 3NWBA 5EKUA 2XBMA 5EG5A 3TKYA 4QPPA 5GM1A 2NXNA 3P2IA 4QQKA 1YB2A 1X1AA 4X61A 3FUWA 1AQIA 4PYNA 4QDJA 3G2QA 5E1DA 1O54A 3LL7A 3FTEA 3MQ2A 5CCBA 3A25A 3AY0A 1RI2A 3P2EA 2HR1A 3TR6A 2OKCA 3NWEA 1SKMA 4PINA 1RJEA 2GB4A 2H00A 3I58A 5GWXA 4ER7A 4GUAA 3S68A 4X1OA 1KPIA 3HCBA 3IYLW 4B17A 4MHTA 2OYRA 1FP1D 4R05A 4PNEA 3ELWA 5EZSA 2ESRA 3HCFA 3UA3A 1IY9A 1MJFA 3HCAA 2EG5A 4PYJA 1DUSA 5FQNA 3LPMA 2IBSA 1XDUA 3OPNA 4PYLA 5DSXA 4FT4A 2PXXA 2BM8A 2CMGA 4E2XA 2GH1A 5P8WA 1Q0SA 2P3OA 3A7DA 3M33A 4Y2HA 1R8YA 3OZRA 3PFHA 5K0NA 3M6UA 2IIPA 5EPEA 3SGLA 3DTNA 3LHDA 4CTKA 3P9IA 2ONZA 2O06A 1KXZA 2OZVA 4YV2A 8MHTA 2OO3A 4CXMA 1RI3A 1IXKA 5K0GA 1Q0TA 3Q7EA 4HSGA 1N7IA 1ZHFA 5FUBA 2PY6A 2YX1A 3LBFA 3JWIA 4BLVA 4DA4A 1B42A 1P1BA 3GNLA 5KQSA 2PVCA 1PRYA 3KPJA 4HG2A 3SSMA 2ZIGA 3HA7A 4RTPA 1JR4A 3DULA 4R8SA 4ZTBA 3BWCA 3UZUA 3ID6C 2JHAA 10MHA 4XUEA 2ZIEA 3HM2A 1HMYA 5DM0A 1ORIA 3G8AA 3OU2A 1DL5A 3U81A 4POOA 5E1BA 2BR5A 2JHCA 3LGAA 4X41A 5C0OE 1NBIA 5LQNA 1V39A 3DUWA 1M0EA 2JG3A 3NDJA 4F85A 3BGDA 1NW6A 1NW7A 4L7VA 3UJCA 3I53A 2XYVA 2B25A 2P40A 3A26A 5MHTA 2ZWAA 4E32A 3KR2A 2FK7A 3FYCA 3CVOA 1X19A 2H11A 1EQAA 3KQTA 5CVUA 3HVIA 4C06A 2Z6UA 1X1DA 4HGYA 5EMJA 4KIFA 3EEYA 1JSZA 2A14A 2IDJA 1KYZA 3C0KA 1KPGA 5CD1A 4GC9A 3CBGA 4DCMA 2QE6A 3G2OA 4K6MA 3VC1A 3GCZA 1RJDA 2ZBPA 3FTCA 2PXCA 2Y1WA 3DMGA 5EZQA 5LQUA 5LQKA 1ZKDA 2YVLA 2BM9A 2PSSA 3OZTA 4P7JA 2VP3A 4E33A 1UFKA 2AN3A 5E9WA 2O05A 3FTDA 5LQAA 2FHPA 1JG2A 4C07A 5FADA 3BWMA 4PONA 5DX0A 5C9ZA 2G72A 4XUCA 1FP2A 3VYWA 7MHTA 5C1IA 5DTMA 3PVCA 3X0DA 2XYQA 4AUKA 4E2ZA 4QPNA 3GGDA 4M37A 2AOTA 2PT6A 5F2OA 3UJ9A 3DMFA 2IBTA 1BKYA 3RW9A 2ZBQA 3B5IA 2K4MA 4KIGA 5FWAA 9MHTA 5FQOA 2H1RA 2JJQA 1XDZA 4HGZA 5DM4A 3F4KA 1D2CA 3G2MA 3ORHA 4P7GA 2AOXA 5IKMA 3NMUF 5HIMA 5HOQA 3C3PA 5BW5A 2YUIA 4FP9A 3P8ZA 3SVZA 3KR0A 3ELUA 3DR5A 4HRAA 3ELDA 3FPHA 4FS8A 4KRGA 3TM5A 5E9QA 2FPOA 5K03A 5CVVA 1F38A 4Z2YA 4RVGA 5DX1A 4YUWA 4BP3A 1NE2A 3EVCA 1EJ0A 2P35A 4BP1A 3TM4A 5EIWA 3BKWA 4QVGA 5DTRA 5JR3A 5EVJA 2O07A 2QY6A 3B3FA 2OB1A 4F86A 3FTFA 5GIPE 2G1PA 2WK1A 3JWGA 1L9KA 2UYCA 3THRA 3BT7A 4YUYA 4UOEA 4C05A 3KQSA 4FSXA 4P7KA 4FSDA 3OZSA 4EVIA 1FJXA 3B3JA 3BUSA 1NBHA 5FHRA 4KDCA 3MCZA 5EMLA 1TPYA 2NNWB 2P1DA 2C7PA 1EAMA 3CCFA 2IGTA 2AOUA 5BXYA 5CM2Z 3FUUA 1AF7A 2IP2A 2YXLA 3M6VA 4E2WA 2ZTHA 4HTFA 4RTKA 1L3CA 1N2XA 3CJTA 4OBWA 3TOSA 5HZMA 1XCLA 2AOWA 5K0LA 3VSEA 2UZ4A 3GXOA 4XCXA 1O9GA 4A6EA 1KYWA 3HCEA 1VQ1A 2HTEA 4GQBA 4AZTA 3MCTA 4QQNA 3NW9A 3OFJA 5LQJA 4PYQA 3HVHA 4YUXA 2PX5A 5EKXA 4C4AA 4E31A 4RV9A 1QAQA 2GLUA 2PWYA 5E8JA 3UFBA 2WA1A 3CGGA 3E7PA 1YFLA 3ERCA 5HFJA 4DF3A 2OB2A 3VC2A 2ZW9A 1TW2A 3LDUA 5CIYA 1R74A 3LCUA 3GJYA 5H02A 3GDHA 5ICFA 2ORED 5K09A 4P7FA 2VS1A 3H2BA 1JG4A 2AVNA 3EVZA 4M7RA 5FA8A 3KU1A 3P97A 3EEOA 1VL5A 3FUXA 3BGVA 1R00A 3KQQA 3M4XA 5DX8A 3MTEA 5EOVA 4DKJA 1AV6A 1VLMA 1JQEA 3KPVA 1EG2A 3DXYA 4DM3A 5K0EA 1YZ3A 3G7UA 1G38A 4EKIA 1RI5A 3HCDA 4RX1A 5D1NA 3GO4A 2P3LA 4RTSA 2YXEA 3LECA 4AZSA 5DRYA 5GINE 3UJBA 2Z6AA 5LR6A 2HNKA 3DXZA 3BWBA 4WXHA 1P91A 1BC5A 2AR0A 2I7CA 3B89A 3UJDA 5K01A 4V0QA 5HIJA 3AXTA 3HVJA 4BY9E 2NXEA 4YUZA 2JH9A 2NXCA 1YUBA 3GRVA 3KR9A 4OA5A 3T0IA 2BR4A 3PX2A 3KQWA 1NW8A 1G55A 3LDFA 4C08A 4U7TB 3UJAA 4KDRA 4HH4A 2PX4A 4C04A 4RTJA 1SQGA 5HILA 2DULA 2AN4A 1INLA 4EKGA 2ZCJA 3KR1A 2ZVJA 4YUVA 3M70A 4RTNA 1P39A 2EX4A 3G5TA 1HNNA 5HEKA 3UJ6A 3DMHA 1H1DA 1EIZA 3HA3A 4FT2A 4GC5A 1BHJA 5FULA 4XUDA 1JTEA 3DLIA 1SG9A 3AXSA 4DCGA 2FRXA 3GRYA 3JWJA 3PFGA 2PBFA 4OQEA 5U4XA 3CJQA 4X63A 4PCLA 3P9KA 2AN5A 1YF3A 3QV2A 4U7PB 5DM2A 4AX8A 1KHHA 4PYIA 2CMHA 5DSTA 3PLAE 2ZWVA 1D2GA 4PIMA 1YFJA 4LWOA 2V74B 5LSAA 4EQZA 5ICEA 4A6DA 1L1EA 3ER9A 3ELYA 2R6ZA 3SM3A 5BW4A 2EJTA 4PGGA 2DPMA 3AJDA 5CVJA 2AVDA 3HP7A 4PYKA 5DWQA 4NECA 1G8SA 3UWPA 5KS2A 2F8LA 3KPYA 4V0RA 5DRTA 4ATNA 3DH0A 2ZZNA 5LQRA 2PWPA 4R6XA 3EGIA 4KVZA 3V97A 4RTQA 3R6TA 3HCCA 5K8VA 1ZQ9A 1G8AA 2AOTB 2PGXA 3OU6A 2FK8A 5CCXA 1WY7A 2XVAA 2I9KA 1KIAA 2PV0A 1NV8A 5T67A 3T7RA 2R3SA 3LBYA 5E1OA 3R24A 2E5WA 3EPPA 1QAMA 4IKPA 4BLUA 3GRZA 2IH2A 3HA5A 2FYTA 3C6MA 3SXJA 4AZVA 2GS9A 2ZULA 3E05A 5EHIA 1QAOA 2C7OA 1NT2A 4Y30A 1I9GA 3I9FA 2UYOA 4FZVA 3A7EA 1XJ5A 3TFWA 2B3TA 2VDWA 4EMSA 4LG1A 3T7TA 1UWVA 3OU7A 1M6EX 2PJDA 3HNRA 3LSTA 4OX9Y 4RVFA 1VBFA 3UA4A 4O29A 1D2HA 1G60A 2GPYA 5FA5A 3NVKI 2P41A 3LKDA 3LKZA
chains in the Genus database with same CATH superfamily
4UPEA 4CMJA 3GUUA 3KOOA 2ZBGA 3HL0A 2AFVA 1XZGA 3OCVA 4YP1A 2BMAA 3LUDA 2DQ4A 1U9ZA 3CRNA 1TL7C 3BWYA 4IIBA 4DQ0A 1YDFA 3A1WA 4HAUA 1E6WA 3G88A 1KAMA 3AB7A 3OE5A 4WSOA 2CF6A 1MQSA 5AKGA 1KFVA 1RQRA 4V0SA 1FRZA 1VJCA 3H4JA 2QY9A 5EYPB 1FX1A 4BBZA 5CFLA 1DBPA 2J3DA 3ZD6A 5KYXA 1JEAA 4XZ3A 1NV9A 5AXDA 3AINA 3ZW8A 4RPGA 1LTQA 3I5AA 5D2CA 4G23A 1CB0A 1TQ2A 3ZWDA 1PEKE 2WSSA 4GNRA 3DEAA 1C1HA 3LRTA 1OTYA 5HS4A 3A9TA 1QNLA 1GTG1 3IIKA 4LVCA 1IHUA 3D4BA 4PC7A 4TYPA 1XMQB 4RV4A 2QHXA 3KJEA 1G7SA 1K9SA 3FYSA 3VYRB 3X1ZA 2RCYA 4Y8VA 3FB4A 1TLLA 2AW3A 1XU4A 3PHGA 2FSVA 3QJYA 3QF4A 3EPKA 1C9EA 1NOIA 1SVUA 1TW3A 1KVTA 2CL5A 4GOND 4B7XA 1T5OA 2D6FA 4L0DA 1KZYC 6NULA 5IDWA 5E2BA 5K0JA 5JQGA 3DEKA 2MMGA 4I46A 3CUUA 4D99A 4CTOA 1KVQA 4S1PA 5I7UA 1PGPA 5BUZA 1HSOA 5EI5A 1TGVA 2BMVA 2PQMA 3KJZA 3EAGA 2HHJA 3FNEA 4RLQA 3OP4A 5DBHX 4Z1MD 1IY9A 1FVFA 1D1TA 1NVEA 4OKSA 1IONA 2PXXA 3WZ2A 1V1MA 4UU7A 2Q45A 1E7YA 1CY1A 5AUQA 4UNQA 5KU1A 4EA8A 5C53B 3TQTA 3FHCB 3OG9A 1Y3HA 5ITZB 3KPJA 1N32M 3JWPA 4FLEA 3HADA 3QYAA 3ZGYA 5F3RA 1GA6A 4AAYA 2P40A 3KX2A 1JB1A 5ITYA 2V6JA 2Y6UA 1QGAA 2Y20A 1YTUA 1GZ7A 2Z6VA 2TS1A 3Q3IA 5LQAA 5G1PA 1F14A 1P1HA 2FXIA 2GN4A 3VMMA 5JZSA 1Y42X 1LQTA 5EJ7A 5LYJA 2AC4A 3WLAA 3RG2A 3TE6A 4JU8A 1Q2XA 2WT4A 3JR5A 2HDWA 3SBXA 2ZIXA 3W2GA 3AOEC 2OE2A 4F86A 5F4ZA 3VFDA 5EE9A 5B2ZA 2DBZA 1DX4A 4Q7JB 5I9BA 2YXLA 3A58B 4HAZA 4EYEA 4UULA 4UEWA 1L1RA 4IRMA 3K31A 3CZAA 1X1TA 1P61B 1O6GA 2XB9A 2G63A 2BHRA 3FMIA 3VC7A 3EMVA 3N2ZB 4EGJA 5AW0A 1C7IA 3LECA 3KFLA 2FSVC 4V0QA 1H1LB 5J2UA 1F51E 3WWZA 4FYIA 4DV1B 1MAUA 3OAAD 4C08A 1G59A 1AQNA 2ZJ7A 3NKVA 3O9VA 5KHLB 1DUIA 3R5JA 1T3GA 4GQAA 3VVCA 5JZVA 5DM2A 1V16A 4C3UA 2HYIC 2AE1A 2FOLA 3RVBA 2P91A 4MRMB 3KZVA 1EM8B 4YWHA 5LQRA 5JMOA 1U3WA 4P5EA 3MC1A 5JS1A 2V0GA 1KGSA 1JXMA 4CFSA 1P77A 2YIVX 4FMCF 4D02A 1W5SA 3KYDA 5KTTA 2LCFA 3T3NA 2BGTA 4C78A 2UXBB 1NHWA 1O94A 1XIVA 4D3FA 2MCFA 7CATA 2JD0A 1W44A 3O1IC 1E99A 2YR0A 5G0VA 1XD2A 1WO8A 3NBYC 4BE7B 4DY6A 2AF4C 4R01A 1W8IA 1MB4A 2O5RA 2BGJA 5B1HA 3DP9A 4EPXA 1XB2B 2VHVA 1LXCA 2QSJA 3KSRA 3G79A 2WV9A 2Z5GA 1KFBB 1OJ7A 3WIBA 4E2YA 3LPNA 2YN0A 3OPXA 5DLDA 4L8VA 2XBLA 1TZJA 3U6OA 3RJ5A 3C5EA 1D5WA 2DT8A 4L6AA 1P0CA 3VGJA 5LMZA 1FS6A 3AF3A 1EFTA 4NS4A 2YOFA 4B7AA 1R4NB 4X1KB 2V9PA 4RV5A 1J56A 1LA2A 1SHJA 1UT5A 5LQCA 1WL8A 5ALRA 4BO6A 1EVJA 5KTOA 2FW7A 3QE9Y 2QEQA 4U7DA 3O93A 4TUWA 2QMZA 1PQPA 1T1IA 4B46A 1S9HA 3T4PA 4ER0A 2XNJA 4GRDA 2CB0A 4FFNA 3U4QA 2XLJA 3FHOA 3JYPA 1J49A 4F9EA 721PA 2QRPA 2VEOA 1IHDA 2BWEA 3R41A 1ISGA 3UHFA 1JHPA 3KZMA 4OU5A 3HHEA 2VRCD 4F3YA 2WD8A 3W3ZB 3SSOA 4YJHB 4AN0A 1H0RA 1C9JA 5J2TB 4QRDA 3VOAA 5IYZB 2EARA 4MPJA 1DFGA 3V8QA 1L5GB 3P2EA 4ZKEA 1FXUA 3V9PA 3MT7A 4DQUA 4KO8A 1XZMA 2B4KA 4MWTA 1V4BA 3O2SB 3OO1A 1RM3A 1EUCB 4KREA 1YVDA 3G0BA 3K6KA 5JI3E 2PZLA 2RH9B 1NHWC 1FP6A 4NL4H 3M3DA 2VQEB 3EWAA 4CL8A 3K2BA 2H7CA 4R71A 3CXRA 3MFYA 5LP6B 3N28A 3OEED 1R5JA 2B25A 2ZM5A 3I42A 2CSUA 3OSZA 1W5TA 5C52B 3EH2A 3ETHA 4XGNA 3MILA 3H6GA 3LFHA 4P7JA 3KXIA 3ZWQA 1RWBA 1XJCA 1A1VA 1KZ4A 4PNZA 1WNTA 2VYCA 1B15A 5CEEA 3VVMA 2FDCA 3UHOA 4EGCB 2XQJA 4EY6A 4Y2TA 1B8PA 1G3QA 3B5IA 3ZXYA 1Z8DA 2W71A 2DWQA 2IHTA 1SXHA 3H42B 5JE8A 2APJA 2GJSA 5F7OA 1QVVA 4YQFA 1A4UA 1Z5PA 4CIAA 3JQ8A 1P2TA 2CBGA 2C4HA 4KQ2A 2PGAA 3TE7A 2RHWA 3VO9A 2D3WA 3AO0B 5CM2Z 4HTFA 2HWWA 2V9CA 3E81A 5BV1A 4M9UA 2W6JD 1Q1ZA 3NRCA 4Y7DA 1X8JA 3RHFA 2XDYA 2ZR0A 1OASA 1PBTA 1R2QA 2Y3IA 4AMYA 1D0VA 1GKKA 1P6QA 5I01A 4WN9A 3EXAA 5FT9A 4NU5A 2X0EA 1ZA2A 4XVCA 1W0JD 5D1NA 5G1OA 4JENA 1KMQA 2LTUA 3UJBA 4TUYB 2P2ZA 4KITB 1TYCA 3R6WA 4UHFA 3RREA 1TQ4A 4NU0A 3C8HA 1KKLA 3LXXA 2HF8A 2IZZA 3C87A 1VDDA 4WHMA 3U6QA 5J23A 5DNVA 1R0RE 4UHEA 3G5TA 3S4YA 3DLIA 4G2TA 4BRWA 4A82A 4BQPA 4U7PB 5LSAA 1L2TA 1L1EA 1LSSA 1IHOA 2C2HA 5ALHA 4LXGA 1XTRA 1ARZA 4IIJB 3RASA 3IBTA 4PO3X 2FK8A 2FCRA 1JTVA 4TSFD 5ITUA 1GPMA 4TSKA 2DHYA 3UICA 4UAUA 4EWLA 4JUCA 2FWNA 1AF4A 5C46F 2X49A 1LW7A 3OZ7A 4NY1A 4D0NA 1GSOA 1J0CA 4J6FA 2GPBA 1NXTA 4FCCA 1TMKA 4D8XA 3DA1A 3GFFA 4JLPA 4UDXX 4G2NA 5CB6A 3NHYA 2KPOA 5FI3A 3UAOA 2OY0A 4FC7A 1CVIA 1CUUA 3D3NA 2LV8A 2NYUA 3AF4A 4B6GA 2X8AA 4A8PA 3PD7A 5ITRA 3BWXA 4OXRA 3NYIA 1C8BA 2C84A 2VYND 1QF6A 4MA0A 3LQFA 2R84A 5C18A 3FFAA 1JG3A 3IIMA 2GUWA 3C3KA 2ZUTA 2PL5A 1PZNA 2BEWB 2Z9BA 1H2RS 4BWGA 5ILOA 2F9MA 5IKOA 3VGPA 1GABA 4OQZA 2EC5A 1X2EA 2HL7A 5K0FA 4L4YA 3TLZA 3KHKA 3O84A 3FKSD 4PYMA 2VH1A 2Q5FA 1GEGA 3O8OA 1YBMA 4B2YA 1R12A 3ZUGA 2FW0A 3A27A 2I1VB 4D81A 1RTTA 4FHFA 1VEKA 2WYVA 5DYNA 2JNWA 4K40A 2RG1A 1KU0A 1NNI1 1EDZA 3BYZA 1A9OA 3KZXA 3KLPX 2EQBA 2PR2A 2P11A 1W49A 3SSAA 3M5PA 2DLCX 1VCOA 3C97A 2H1CA 3I01A 5AVRA 4PD2A 5IARA 1P1CA 1OBVA 5B53A 5TQ2A 1XZPA 4J29A 3NBQA 2PL1A 1XRNA 2ZUFA 1QP0A 1J1ZA 1PFWA 2DHRA 3DE2X 3NBAA 1G0OA 2HR1A 2I33A 4FZJA 3LLMA 5FO1A 2C5SA 2H92A 5CDGA 2HNBA 2HBYA 1TM5E 1YHZA 4RABA 2LGJA 4G0VA 2RG7A 3EBPA 3K6SB 1EWTA 5FUBA 3IHLA 4O4JB 4HG2A 2AZXA 4AJIA 4XTCS 1ISIA 4KR6A 1Z17A 1L4HA 1P44A 3NHPA 4OHOA 1QYVA 3HXPA 4KIFA 1KYZA 2XITA 3ROGA 5CD1A 3NPMA 1WZCA 4KNVA 3L7KA 2DPHA 3E9ZA 2AG5A 4ZO7A 4DV7M 1H2XA 3ACCA 2IBTA 3S2GA 2ZITA 3FOAA 3WYBA 3QVSA 4G4IA 1E6EA 3DB1A 3CT6A 4DSOA 2QHOB 3EJWA 1HV8A 4BGIA 2CXSA 3OTOM 1DTWB 1H6BA 4MKXA 4I36A 3BRWA 2R1UA 2FRVA 4DRXA 3R40A 3ZVNA 4BYGA 4PZDA 5KC9A 4GDMA 3BSYA 4G63A 3CCCA 2Q2VA 5ERXA 1G1MA 2FKNA 2GRJA 1XX6A 3HO1A 2CVOA 3FNHA 3RVMA 4JQZA 4D8TA 1E3QA 4C7OB 1SBNE 4J0HA 2B3DA 3SQDA 4ZTZB 1DOAA 3WYEA 1N6KA 3TW8B 2FEKA 4IBEA 3DWEX 3UCXA 2JP7A 2ZDQA 3SARA 2EGUA 3BG5A 1XZEA 1J5EB 4C5BA 3CLRD 4R31A 2XYGA 4A23A 1U0GA 3G85A 2G5TA 1T2FA 3KALA 4N5IX 4RZUA 1M6WA 4BUJA 1HNNA 4GVXA 1PJTA 4ZMSA 5U4XA 3RAEC 3M2PA 1V35A 1UPTA 4MCAA 1GJRA 4IFBA 4LOJA 3SP1A 4M53A 4W5HA 3V5NA 2PFKA 5H4GA 1JV2B 2ZANA 2LVQD 4RHCA 4DJEC 4RNCA 4MOWA 4PV7A 1QP8A 1V95A 1T36B 3ZBUA 2OEPA 2FYTA 1MC5A 4GP9A 4CQNA 4FZVA 5ECGC 4C0AC 2Q2QA 5FA5A 2WTMA 4DMGA 4HS4A 5MGBA 4H1WA 3IEIA 4P53A 4Q02A 3TIFA 2Y2UA 5KQGA 3ZK9A 4K9RA 3GVHA 4NXMB 2PMFA 3GLVA 1QVZA 3R6LA 4MVJE 2QVLA 2EBUA 2B4RO 4LPKA 2HI0A 4HZUA 3KU4A 3K0FA 4WJKB 5I4CA 4IHJB 1IQPA 1QK3A 4RD1A 5ELLA 2O3JA 1WXFA 1R8QA 2C4VA 4A2PA 1JPUA 4GOOD 3OBBA 3LCCA 4MEJA 2I7PA 1RHKA 2P1RA 3TZCA 4TROA 2RJOA 4ZJUA 3VBCA 4N0QA 4CCAA 3NM4A 4CIVA 2EX1A 3AIMA 2CKDA 3KE9A 4DYHA 5IC4A 4GHLA 1ZO8A 2GF2A 3AM5A 2D5CA 3ZWCA 3N39C 4R16A 5HNKA 4M0LA 4JJKA 2WA2A 4LQDA 1GA4A 3IBSA 3IPXA 3OCJA 4X62M 3KWFA 3ZIUA 3SJUA 1H4VB 2OBMA 3HZOA 2CUKA 2FPIA 3WX0A 4A2CA 3PF8A 1PW5A 2XV1A 5F35A 1ZUWA 2R4JA 2YVKA 1UBFA 1AB6A 2DB3A 1W75A 1E9DA 2ACVA 2WE7A 4F5EA 4P4UA 1GNTA 3LV8A 4L6V6 5AKKA 1CUGA 1D03A 2NM0A 1X15A 1VPEA 2BUBA 4NYMR 1B3RA 4RULA 2WWFA 2I4IA 4K3UA 5CCBA 2AL7A 2WUFA 3FFXA 4LRUA 1C8LA 4WCDA 1PRBA 4JB8A 3LPMA 1Z6TA 3MFQA 4ZV9A 3OOHA 1PFYA 2RGXA 4Q4HB 4RIIA 3SC2B 3AETB 3MUEA 2ZIAA 5SICE 4F5ZA 1ZISA 2C3UA 4QIHA 1XUOA 4HRVA 2WKWA 3DZHA 3UAWA 4Z9AA 4RK7A 2GX6A 4QNNA 3UZUA 1ZMRA 2DXIA 5ALXA 2QL5A 2O0JA 3I53A 3CF4A 2ZG6A 3CVOA 5L4SA 2I03A 5D3KA 5E6UA 3EEYA 3GP3A 4IGIA 4ND8A 1EQ2A 3DKKA 3OZTA 4WLEA 4A91A 2Z09A 1FP2A 3CFYA 2OYCA 4E2ZA 1PO7A 3KXEC 4QPNA 3GGDA 2OCXA 2OZEA 2C2WA 3COWA 1CJUC 4RZXA 5D51S 3WAGA 1BIFA 4QBKA 3BJRA 1GNLA 1W85A 3DBOB 1KMHA 2PS9A 4P81A 4QXMA 3DTVB 1TFUA 4LTDA 3E53A 1CJMA 3GLFB 4XB6B 4YUYA 4RMGA 3MCZA 2GAOA 3SS9X 1V8PA 1LRJA 4W6QA 2V5AA 3QXXA 1DBRA 4Y6PA 3QOFA 3A6PC 5D85A 2ODTX 2OM6A 3I0ZA 1XEAA 4P82A 2A30A 3W0FA 3DBIA 4JL8A 2G17A 4MV0A 3PNYA 2XVYA 4GR5A 1YOBA 3IUNA 4NYIQ 3ES9A 5HYVA 1EGAA 4JOQA 4K5QA 2IU6A 3R5FA 2C83A 3AFIA 1KZGB 3UGKA 3TOCA 4A0HA 1EX9A 5M29A 1TRHA 1JLLB 4QDTA 4Z4HA 4MW7A 4RJJA 3ZJUA 4WJZA 4LRSA 2VJCA 4UFOA 5JWOA 4MVJA 9GPBA 2B21A 2OQ2A 1RACA 2OXFA 1ONSA 1NDUA 4EGQA 4YAOA 5BXQC 1X7YA 1EFUA 1SUBA 1X86B 3O2NA 2I7TA 3GDGA 1SKAA 5G53C 2JH3A 4IIGA 4OD0A 5K4AA 1J2JA 3ML1A 2OP1A 4MS3B 3H1EA 1ZSNA 1UK7A 1JFRA 3TFWA 2Z4TA 4G67A 2P41A 3OJEA 3CLHA 4Q3AA 5I9LA 2KLBA 1N5DA 1QHEA 5B3JC 3TTVA 1Y9EA 4PPFA 3FWNA 5C4GB 2IUYA 4HUQB 4C6TA 4KR3A 2G80A 5KJ6A 3K3PA 3HU5A 4URXR 1G3UA 3TQFA 5EESA 3R9WA 4LJ8A 1K9VF 4ZHQB 4FYYA 3HKBA 1M2OB 4B3RB 2CF5A 2J5BA 3OUTA 1LKZA 2P9QA 4RCYA 2AIRA 4D74A 1FFDA 1URPA 3IXQA 2REXB 1GGKA 1Z28A 3SJAA 1Q1EA 4RGVA 3COVA 1RM5A 4FVTA 4XYMA 1QH1B 2EHDA 4JN6A 1O5IA 4X85A 3TCXB 2JDID 4Y6QA 3T7SA 1WG8A 2XRMA 3Q9SA 3HKCB 2FEPA 1CR6A 3GELA 1V11B 2KRKA 4M1YA 1JJFA 2EO2A 3TN7A 2II6A 2B34A 2YIDA 2GA9A 1A98A 4RPHA 4X1IB 1M1XB 2FR8A 3TBFA 2WSFF 1ZK3A 3LDAA 4MLDA 1SUPA 5DHQA 3GA0A 4PCUA 2CMDA 5SV2A 3EC1A 1R2ZA 3AV3A 2YCLA 1VE6A 2ONJA 4IV0A 1IVSA 4WCVA 3QU5A 2J45A 4JLDA 3IECA 3GUHA 2VHZA 3IT1A 2BE9A 2HWYA 1OBHA 1P60A 2DX7A 3ZDBA 4HYEA 3EEBA 2YBEA 4XFKA 2JIBA 4F2LA 3AZPA 2XD9A 1XRMA 5LP6F 4QYIB 1VLHA 2ESRA 3LPLA 3JXEA 1E2EA 3EOAI 2EXXA 1MDBA 1TTPB 1N7IA 1KJNA 3NTQA 2IYPA 3O90A 1RKUA 2ATIA 1NFRA 1HMYA 2NPIA 3ISVA 1E2IA 1M0EA 2H1IA 3UJCA 4XQ0A 2W2LD 2VDJA 1SOVA 3ECAA 3G2OA 4K6MA 3AHCA 2PUDA 1NYRA 3LT4A 3LP8A 2VNSA 1XYYA 4F45A 3LI2A 4PR3A 1Z83A 4RENA 3X0DA 2J3KA 4US2R 3D7LA 4MKHA 5EJ2A 1TF2A 1N9KA 1TYAE 1YGYA 2ZYGA 5A0TA 2B1JA 3KYCA 5HM8A 4KRGA 4GGMX 1NVWQ 2DUJA 3GFVA 2E6UX 3FR8A 3EVCA 5GJVC 3L1KA 1NUQA 1TDJA 1IK4A 3BT7A 1BWPA 4ZOLB 1YRWA 2FQQA 5BXYA 4TUYF 3U6CA 4IYJA 1XFAA 1RRPA 2WLTA 2BD0A 3O4HA 2XNDD 3EOZA 3ABZA 4R1SA 4H6WA 2B61A 1LD3A 2PWYA 5HZKA 3ZK7A 4WD3A 5F7XA 1ZOLA 1NNUC 1QE5A 1WNFA 3IRUA 5EE3A 1S89A 2QR5A 1QO0D 4OMCA 3LAWA 5LBIA 1G5IA 1XK7A 3KT3A 5KPTA 5HX7A 4JYBA 2NXEA 5CAEB 1Q50A 2C96A 1K6IA 3M4ZA 4IIJF 5C7IO 3UB2A 4YRTA 2VJLA 1F12A 1I10A 1FDSA 2VQDA 3HHZA 3V48A 2WWRA 2VJPA 4HFMA 4LCEA 3GLGB 1YFJA 2XADA 1QK4A 4HFRA 4TL6A 4PQYA 5EPUA 5C8YF 1WXDA 3TWOA 3CLTC 1BEZA 2PGIA 3KOXA 2A5GA 4WPGA 1GLNA 1YC5A 3T7RA 5FP0A 3TWLA 4C5AA 1TLTA 4UBOA 1HDYA 3BHJA 4FX5A 4YCMA 1UWVA 1G4UR 1NRJB 4AW9A 4YHBA 1VI6A 4EATA 2NU9A 2G9NA 2B78A 4R1LA 3MRXA 2AOVA 3KE8A 5BVHB 1WXEA 4KVFA 1S7CA 3TSOA 3U6DA 3VYUB 1ZK0A 3FMVA 4G56A 2JJ8A 2QVGA 1PZGA 4CFZA 1L4NA 4XVRA 3OMLA 1IULA 1U0BB 5K0CA 2R6CA 4P32A 5DYGA 1I01A 4QBTA 2DERA 1BGVA 5EC8A 1RI4A 5F2NA 4O2BB 3AM3A 3WK6A 4YR9A 1AO0A 1THGA 2OAEA 2BFMA 4U9IS 5AQEA 4ZKDA 1SHLA 3UH1A 4CBVA 3U6SA 4Y0VA 3OKAA 1HT2E 4GSYA 4HPJB 1GDHA 4TYQA 3QEKA 3JU3A 1U31A 2YWHA 1MO6A 1KZ6A 2NU6B 3TL6A 4Q00A 4PIPA 4LHXA 2JXNA 1IN8A 3FWHA 2CK3D 3NOVA 4O25A 3T3IA 4RHFA 4HNUA 5GP1A 1KP9A 2WC1A 2HMTA 3EARA 2TMGA 3A14A 4YCDA 2ZU0C 1A50B 1ECCA 4YGXB 1F8FA 4ZARA 3EUEA 4BBPA 3A05A 1PFQA 3RGWS 4AQYB 1YDEA 2O5VA 3K1YA 1ODTC 3GJRA 4MH0E 2V8OA 4TTVA 3NDIA 4MARA 1ZCFA 2ZYIA 5DTEA 4ZIRA 3QNWA 2HU5A 5KC8A 3OETA 3SVTA 4GYYA 4JI2M 1CJSA 3OOJA 4AMZA 1JG6A 2W6CX 4HHEA 2JATA 4KCGA 3KQMA 4Q34A 3LVQE 3EFHA 3SR3A 4CIWA 4L8RC 2BFBB 2EYUA 1T1RA 2HCJB 4RKUF 3JTEA 4BMXA 3TIXB 2COUA 4XXHA 2OPHA 4RH0A 3NZEA 3Q9NA 1IM5A 3ONVA 3X1WA 1SD2A 1TX4B 3ENKA 2BAGA 5ALVA 4RPJA 1NO1A 5JS6A 3WL6A 2QBYA 3JYQA 4TV9B 1RQXA 5K0NA 2BMEA 4A3SA 3GLKA 4JLNA 2JRLA 5LMUM 2VT7A 2NLOA 1ZHFA 2KHZA 4ZJZA 3IDOA 2DPGA 4FHEA 1DRWA 1ESEA 1N1EA 5IVKA 4MLPA 1T1SA 1YS2X 4C14A 4FJ0A 4UCWA 2XQGA 4MVXA 3U6PA 2I29A 5HQTA 2XLCA 2Z3VA 3K35A 1MB0A 4MCIA 4EQ6A 4NMXB 1NW9B 3IUJA 3BC1A 5F3WB 2BFEA 3HHPA 2XRZA 2JLVA 1OAOA 1WIVA 5E26A 1Z16A 2DQZA 5HA5A 4MX8A 3SE0A 4H9GA 3T7AA 3U5TA 4F6LA 4FOSA 4OL9A 1E2NA 1FDUA 3SZGA 1CDDA 4JP1A 2JVJA 1M2WA 1YR2A 4CKCB 4ZQFA 3NO4A 2KNAA 2G25A 4ND2A 1D2MA 1RXUA 4YBZA 2F3SA 4JKYA 2ZYAA 3OJ0A 3HP1A 4C4AA 3IPCA 2WA1A 4DR3M 2QK4A 2OB2A 4P98A 1C7JA 4JH0A 3B51X 1TEHA 2DQSA 4NNPA 4FK8A 1S9DA 3K7EA 3BGVA 1TE2A 1MXFA 1C2TA 4EKIA 2H1LA 4QOJA 3GPYA 2EW1A 4Z4GA 1ZMOA 4TLCA 3GRVA 3FBGA 2IYZA 1PVDA 4DGSA 1NMQA 4YBRA 3U26A 3BCHA 2HIHA 3N87A 1P39A 2OHHA 4DVJA 1L1FA 4ZXFA 1DKMA 3LLSA 1ESDA 2W2TA 1H4TA 4KV7A 3A3OA 2O6LA 3LO8A 4YTEA 4M1ZA 2AJDA 4OY3A 3VUEA 2C5RA 1ZD8A 2ISQA 2NZVG 4MQEB 4PYKA 3QLVA 2XSZD 2E7ZA 5EMHA 2H1OA 2PGXA 5F64A 1WY7A 4IEFB 3RSOA 3SZMA 3F4BA 3ADCA 4LV6A 3WG9A 1ZH6A 4IHJF 1JWAB 2ZVQX 4FUTA 2JFGA 2F5SA 4OK5A 2C4WA 2PRKA 3EVBA 5L3SA 2GKSA 4FS3A 4C4SA 2QRLA 1RWKA 1OX6A 2X22A 3DKPA 3S81A 3X43A 1B0UA 3KFVA 2BFCB 4UAGA 1L7OA 4GKBA 1S2NA 3VKWA 1XZLA 1E0KA 5BT8A 1OAOC 2EJCA 5CEFA 2WHPA 2IW3A 5AW9A 2LDBA 2FN8A 2A3NA 3DONA 1XOIA 4FFSA 2NPOA 4U6SA 3S1AB 1WGNA 5AK5A 1E8MA 4RVDA 3NNNA 3OQHA 4YECA 4CKEA 3JR4A 1GWNA 1F8UA 5KKNB 2KNVA 2Z58A 2WILA 3FTPA 2OQ4A 4LYYA 5CXQA 4RVHA 4G0XA 1HQCA 2HA3A 3UB4A 5I7HA 2Q41A 4D0SA 3KKPA 5EEHA 1OI4A 1D6NA 8ATCA 1R0LA 2AYXA 1A2KC 1LH0A 3LSYA 1BE0A 2JUJA 4U63A 4DADA 4EB8A 2IYEA 1WVGA 3I73A 1Q6ZA 2KW0A 4GR4A 4TXLA 2O8EA 3UAZA 4YAJA 5EZYB 3RJMA 3S5UA 3NYRA 2GN8A 3OC6A 1CF9A 1DKPA 4I4TA 4J3NA 3QLJA 3GVCA 2LKCA 4FYXA 1J0DA 1A76A 3DL0A 2WHRA 4I9UA 4OFXA 4UM9D 2XMRA 3ZDDA 1P2UA 1P9OA 5EQJB 3KQYA 2FMIA 3U4HA 1UOOA 3OWXA 3QLVC 1IPHA 4PYNA 2W2KA 3LOPA 4MIEA 4D9BA 2OA0A 3O0DA 3WL8A 1NXWA 2X9QA 4I8IA 1NIJA 3OURA 1SR8A 4HXEB 5KQPA 3QKSA 2A9RA 4JBGA 2VLIA 2VH5R 1IXZA 1QE3A 4FSHA 3K8ZA 3W5HA 2PY6A 4KOAA 4C22A 4ZFNA 1PX0A 4PG7A 1PR0A 3WMWA 1RRKA 3BWCA 1ZEJA 1P3Y1 1C0PA 4BUZA 2KXEA 4Q6WA 2O0HA 5EMJA 4Z0TA 1JSZA 4W82A 1NY6A 4KR7A 1QG0A 1S2OA 5F1YA 4NOLA 2VBFA 1KDYA 1GV0A 1QCZA 2NZYA 4FMDB 4LYFA 1BCSB 3VV2A 3G0IA 3W3AA 3PGVA 1TIPA 4W8GA 4MPTA 1NULA 2FR1A 3RW9A 2YL2A 3WBKA 4JR0A 4P7GA 4UFNA 3G2JA 1Q7BA 3M9LA 3P8ZA 1YDMA 4JDPA 4DQXA 3WADA 4ZODA 1S2IA 3QHPA 1JALA 4O4LA 3KLOA 2IU4A 1XDGA 3NM6B 2EFHB 2JLSA 5C31A 2JPDA 3FXAA 1X9IA 5FNZA 2C7PA 2OCIA 1EAMA 1F9EA 3EODA 2YJNA 3H1BA 3M6VA 1N7GA 1PJBA 4AZFA 4QTXA 3P9XA 2V55B 4BVHA 5CW1A 5A2GA 4XGRA 4GAEA 3DQPA 3VDNB 5AOCA 3LLUA 5ICFA 5GZ6A 4R1QA 1QFSA 1R00A 2R1VA 3Q2OA 4XRGA 2G1KA 5BT9A 2OV4A 4RNDB 3ZY6A 4ZVQA 1MNAA 4GI7A 2ZTDA 1I2MA 2M60A 1N0HA 2R1ZA 3QFFA 1SXJD 4GMGA 3WFJA 3R8CA 2ONKA 2HA4A 1QYWA 5AD1A 2ZTSA 3EWSA 3OOWA 3PFCA 5I51A 4O08A 4DEVA 1HDCA 1K6EA 4P3YA 2O7VA 4U2DA 3EZ6A 4E07A 2R6ZA 1FVOA 1C30B 4DWOA 3ONEA 3T1HM 1HKUA 3CVVA 5AYVA 3DSRA 4WURA 1AGRA 2NTNA 4JXKA 1WCXA 3MWDA 1I94M 4OQYA 3JQBA 2R8BA 1JDTA 2JLXA 4ZVRA 4ZI7B 3CWQA 2H16A 2VDWA 3DNMA 2C0QA 1KU6A 3Q2IA 2X19A 3VTAA 4F2DA 2HWJA 1JA9A 1HTWA 3D8SA 1C9NA 3T9FA 4M9RA 2WLSA 2VDUE 2XMPA 1P1KA 4CM4A 2Y99A 4PG6A 3EXHC 3OZBA 4EJMA 1HE2A 3E5HA 2DFTA 3LY9A 4H3SA 4YCAA 5IH3A 1O6BA 1PJ8A 4Q24A 1D2AA 2OXRA 3PLRA 4BLWA 1Y9JA 2A92A 4MB0A 3A6LA 3P2KA 4IBBA 3MMPA 3CKKA 2YFKA 4GLBA 1T0HB 1JG1A 4NXNB 2GAJA 1P5JA 1PD1A 4L27A 3BGIA 4LHVA 5CX1B 5C3MA 2UXCM 5KJ1A 4EJSB 2R18A 3KPWA 1N5KA 3UH0A 3K16A 4P3XA 3QMWA 2K7ZA 3TQSA 3P71T 4M99A 1OJLA 1IHYA 1MH9A 1KY2A 2E4UA 1OU4A 1HE4A 2GYUA 3ZVMA 2J7KA 3C7AA 1CUYA 2BZ1A 4ZYUA 3Q40A 3DTYA 2ECOA 4IVQA 1HFKA 3OOEA 3DJYA 2WG0A 1Q91A 2BTOA 3SC4A 2FMXA 4ZMBA 4DBLE 4J0EA 3H13A 3HCPA 2N1BA 3RBXA 3EVFA 2ZYDA 4RK4A 4L3VA 4KH1A 4MVYA 3UJ8A 1YFZA 2VHYA 5L40A 3UPDA 4DSZA 3OIYA 4C0XA 5IFLA 1Q02A 1NX9A 2VF8A 4ZYXA 1H23A 2Z5VA 5JYDA 2NO7A 2J5RA 3ICQB 2PBRA 2P7HA 3UC5A 4AQ7A 1CZLA 1AT1A 2FGKA 1JDPA 1OTHA 2FSHA 4UAJA 5LQSA 1RADA 3PDHA 3FFBA 3PQEA 3FCCA 1P0FA 4UHJA 2ZJBA 1YHNA 4UBLA 4W5OA 1QQTA 1EVQA 3GEGA 4EB6A 2P6OA 4Q7QA 3JYNA 1R8YA 2KBEA 2FR0A 4PC3A 4C2AA 1NPTO 3GZTB 1F2TA 2FVXA 4IW3B 1WP4A 3T3HA 2JVIA 3QELB 1KI1A 1J8VA 4TV8F 1RBQA 1RYDA 4TT3A 2FUEA 5CB4A 2QAJA 3TUJC 3U56A 1X1DA 3GH3A 4XIJA 2Q49A 3ZIDA 4UMDA 4IX1A 2AN3A 4YIKA 1YQTA 3V7YA 4HVTA 5C9ZA 3QUCA 2IEIA 3UAXA 3V7NA 2BM1A 3AIOA 3HFGA 2IYVA 3QHAA 4XJXA 4DILA 1D09A 4WFKA 3NEPX 4MR9A 1NN3A 4FPXA 3SVZA 4C2BA 4RD2A 4HO1X 1BROA 1NUAA 3UWDA 4CMKA 3EXIA 4M9SA 3WMXA 1ZU5A 2EDCA 2R66A 2G1PA 4UNSA 4K86A 2DY1A 5B1DA 4ZZ0A 1AMOA 4B3SM 5JFOA 4PO9A 5EPOA 2C04A 3HCEA 1N36M 1HNWM 1FA9A 4J3FA 3OESA 1NSYA 4LXXA 4C0WA 3KCQA 4B4DA 4JI7B 3LH5A 3LCRA 4Z99A 2VS1A 1BVYF 3JX9A 3KU1A 3HNPA 3GBVA 3NT4A 3QI2A 4HMQA 3K9OA 2Z4SA 2PCLA 3D6FA 3W6ZA 2CUTA 4B4OA 3V42A 5AVTA 2I2WA 4FFOA 3FCAA 3ROXA 1GPLA 1P3DA 4KPEC 3DM9B 4BBAA 2D1TA 1EWVA 3GMDA 2P2LA 1HQDA 4JDUA 5K6AA 1ZSYA 3TTTA 1U0LA 2CJYA 2ERXA 2GEBA 1RR6A 1BCRB 3LBIA 3KJXA 5EHNA 5DULA 1PS9A 1Y4AE 1US8A 4MAMA 4CM9D 2VHUA 3B52X 4GMQA 1C50A 1HOXA 1H2FA 1YCHA 3ZHRA 1GTMA 3ZGVA 3LNTA 4M1KA 4ISCA 1AKVA 1ZHHA 1X87A 1XNQM 4O2BF 4G4QA 1CJKC 5EMKA 1HT1E 4KG7A 1K6JA 4Y28F 3V8EA 3IQHX 1LS1A 5T6BA 1XZKA 3O26A 2VJAA 5KWIA 3A9UA 2FHSA 3BX1A 3F6BX 3ECSA 1JJ7A 1XMXA 1FZQA 4TMTA 3I01M 1QONA 2WHYA 4DSAA 1L7QA 2W7TA 4NICA 1HPLA 1G3IA 2L17A 2O3RA 1M6HA 3CISA 4ZRMA 3TRFA 1O94C 4GEKA 4JKIA 2BFDB 1PR2A 2FH0A 2P7IA 3EDOA 1RXWA 2R1TA 1DAOA 4RKYA 1Y33E 1UIRA 1X7ZA 2R5WA 3DAYA 4X8LA 3BMXA 1ZM4A 1VGRA 2KZUA 3MTQA 3LX6A 1TO6A 4MYUA 3ROQA 4EY3A 2ZJ6A 4MYDA 2QIOA 2A9OA 4R1PA 4BCCA 4COOA 1JFFA 1ZN8A 4BL5A 3RFWA 1ZV1A 3HKEB 3TGLA 1E5XA 1BS2A 1JHYA 4MGYE 1Y4ZA 4PF1A 2YZKA 4HWKA 5E3HA 2WKQA 4MZXA 4TV9F 2EL7A 3RK0A 1AA9A 4R3DA 2DTXA 5JTTA 1LC0A 2FP3A 5KMGA 3DDOA 4DUGD 3PQ3A 3EZNA 2O8BB 3TKYA 1K4KA 1T9AA 3KZKA 4WKNA 2YJZA 4PINA 1JKJB 4IGKA 5AOBA 1Q0QA 3WLRA 1CHDA 2G08A 3WL7A 3CO5A 2VP5A 3HJQA 4DV6M 4XAQA 2FF7A 3EVTA 1RP7A 5H0IA 4M0KA 4GI2A 1PR9A 1VMAA 1G7CA 1XTQA 3E9EA 1NRXA 4G37A 4OUKX 4BNWA 3RJZA 1UC9A 3SQLA 4RXTA 1VL2A 4I19A 3V6MA 3ORFA 2MSEB 3OCUA 4LF6M 1DKLA 2WNSA 1IN4A 4I1SA 4CN8A 3BCUA 1Q19A 3EE6A 3HO8A 1V8DA 3WAKA 4GC9A 3W90A 3FTCA 4JLVA 1O96A 1VLZA 4N76A 1DNPA 1AB5A 3LLVA 1BQ3A 3C3AA 3TX6A 4WMLA 4OUDA 4IVNA 1XDZA 1MRZA 3VDUA 4ARVA 2HHCA 4GPIB 4CDGA 1UKVY 2ZS7A 1NE2A 4HNRA 4LFCM 1FDRA 4ZI2A 1O1YA 4N12A 3KQSA 4ZVUA 5JMPA 4GG1A 3LU1A 3GR6A 4EHAA 1WV1A 2R44A 3ETNA 3GK3A 4X6LA 1NKSA 3KEOA 2ACKA 2F4VB 3F7TA 4RU1A 4MEAA 4HQFA 3OFJA 3OQPA 1XVLA 2H5XA 5JJIA 1IBRA 2YWJA 3G17A 4L8WB 4MDEA 2Y67A 5CT8A 1C29B 1JBEA 3ZZ1A 1KSFX 4BEVA 1TZBA 2G9UA 3C39A 5K0EA 5AT1A 5BPVA 3KWJA 1J0BA 2G1JA 3HR4A 2Q0HA 1B6RA 3AXTA 4EG3A 2ANCA 5DE3A 2CNWD 4LFAM 2XE6A 1SQGA 2ZIVB 3FKJA 4DWWA 1B0ZA 1GGJA 3J7BA 1EK5A 4OBBA 3Q8MA 2MIIA 4QPZA 3UQYS 3P9KA 4MP3A 2XZTA 1N2CB 3ZWPA 1D2GA 3WOHA 4LDQA 4QWMA 4QFBA 4O4IB 2WU3A 5LIRA 2ZB7A 3PNQA 3IUPA 3AI3A 1KO4A 3H2YA 3NWLA 2O2ZA 1N0VC 3FMPB 4I1IA 4YRQA 3SFVA 3CG4A 2CVPA 3T0GA 4HNAB 2IU3A 5IKPA 1QAMA 4IEIA 1PUJA 4QGFA 5EJMA 4CCYA 3GLHB 1JHVA 3IBCA 4MS4B 1GR0A 1JLKA 3HJUA 1TUBA 3A0RB 1GCOA 2MOKA 3ZDFA 4YMIA 4NMMA 1OWNA 4D9JA 1B2LA 3E5RA 3BHNA 1KR5A 2AOUB 3E18A 1NWHA 1SXGA 3C5HA 1RKQA 1ELOA 3WKBA 3C8UA 3PD1A 1VFPA 1D0KA 5B30A 1SHTX 2O54A 1QIHA 1PF7E 1X1SA 3ZC3A 3O3NB 2NZXA 3A36A 1EUDA 3KT8A 4QOEA 3IESA 5JY1A 5EJ8A 2WIBA 3MMZA 3HU3A 1R27A 5KIAA 3RVPA 1IQRA 1LDMA 3L8FA 1ID1A 4BNGA 3HXQA 3F71A 4GPTA 4B47A 4M8SA 3EG5A 4MR7A 3D6NB 3FVTA 3SNHA 2BKUA 2OBLA 3K0EA 1J33A 3UKJA 3TVDA 4MUGA 2OFWA 3PCXA 3DLCA 2OGUA 1Q3KA 1QZ3A 3QVMA 3BXOA 4AP6A 1VHDA 1PS8A 2MINA 4HWOA 5FBQB 1NTRA 2H7XA 5DBOA 4C43A 2LWXA 2VYVA 1VSVA 1UBGA 5FWXA 1XTSA 2AQHA 4JLWA 2XD4A 4L0CA 3LD9A 1CS0B 5HJ5A 1LUAA 3VU8A 1L5LA 5IKEA 2GN6A 2P9HA 4AKIA 3TLGA 2IYRA 3RGGA 3P0FA 5F2EA 1IIRA 5BMOA 1ZHOA 1TJNA 3KQHA 3MJEA 5E8RA 1FSGA 3QEJA 1H5QA 1G5TA 2OBFA 3RROA 1D04A 3IIEA 1Z5WA 2EX0A 4NCIA 3PUHA 2DECA 5JZMA 5C34B 3FCXA 1BEEA 3PGMA 2FMFA 3S7TA 4YACA 2OBXA 2WPNA 4LVUA 4GZ5A 4I5IA 5KO2A 1JZQA 1VIYA 1TUIA 4FZRA 2YV1A 5BW6B 2ZWOA 2DSTA 4FMDF 5JNRA 4JQYA 1TFRA 3PU6A 1DI0A 1W6RA 4DMKA 3I8XA 1M74A 1Y63A 2ON6A 2WQZA 5FPQA 1XALA 4F85A 1P3QQ 1XPUA 5TY0A 3RFFA 1P31A 3M83A 4R84A 3AEUA 2QE6A 1RJDA 4EO4A 2OQVA 3VNQA 1AUXA 4Y6SA 4Y98A 2LIVA 5T8KA 3IRVA 2KE5A 5LZ7A 2VTDA 3IILA 4MVJM 3KO8A 3B6MA 4FWIB 3DKRA 1DV2A 3E2MA 2QTVA 3QXSA 1LDEA 2CE2X 2P90A 3U31A 4MV5A 2CFTA 4G0YA 5DN6D 2XMCA 1N5JA 1V3VA 1K5DA 1W2GA 2WYUA 1RPNA 2DETA 3EZFA 1TCUA 1GGFA 2GEKA 3RUIA 3MCAA 3ZCSA 4C0SA 3N05A 2AKEA 5ICSA 2ROQA 4ND4A 3MCTA 4RV9A 5IK2D 1GNRA 3AY3A 4NBUA 4P7FA 2FGJA 3MYRA 3H2GA 1CY8A 3KQQA 5EOVA 2EUCA 2OG1A 3PUYA 3CZ9A 5I7FA 2G7ZA 5GINE 2H52A 4I6JA 5FEMA 3KFXA 4IBJA 2Z30A 1A9TA 3GNTA 1OMOA 3B74A 2W6OA 3RG8A 1TJ4A 2I0FA 5MDHA 2HU7A 2RK3A 2A0UA 1EGHA 4UHKA 1UL1X 1UMCA 1H8HD 5ALPA 1HL3A 1RRMA 3ADPA 3ISJA 2OP0A 4Y2QA 2K7FA 3PXBA 3FNBA 4XGIA 3F3SA 5K2OA 1FUEA 4HNQA 3ITDA 4V2IA 4NZPA 1BU5A 4RJTA 3K4PA 3ANLA 5TDHA 2X1LA 3LKZA 1M2HA 5HKLA 3HGIA 5B4UA 3VOBA 4MQ6A 1QF7A 1UAGA 2IOYA 4GKVA 4HLQA 3MCWA 1P5FA 2QRVA 3CR8A 3ZU6A 2B9VA 3SK0A 2D54A 4L9AA 1YQWA 3VYTB 5U9CA 3ZOZA 4KO1S 2WUWE 5E3JA 3MVEA 1ZJWA 4R8VA 2OK7A 3V8MA 3E27A 2CLKB 1GU7A 3VPSA 4OBEA 3L2OB 3ROZA 4X64M 3MB8A 3Q7QA 1F6BA 2WMYA 2WUVA 1N34M 2AUNA 4EF5A 5HRAA 4IBFA 2PK3A 3U6LA 4G4SO 3DKIA 1B0AA 1K7XB 4UVEA 1ZIDA 3L1IA 4TL7A 1F0KA 3G6KA 5C51B 1WUJS 1TCVA 3L06A 1FSZA 3EXHB 4TTJA 3KHTA 4W9RA 2FPXA 4RIFA 3HSYA 2GJ8A 5A2QS 5A5GA 1F3OA 5B1IA 3O8RA 5FA6A 5A4FS 2GN9A 1YASA 1Z6ZA 2ZKLA 1T2UA 5EFOA 4UW9A 5IS2A 3PC4A 4Q1EA 5BR7A 2C5GA 1CZOA 4IBDA 3P1JA 2HRZA 2IX9A 2PZMA 1MOZA 1FP7A 1WMBA 4N0EA 3H4TA 2IH5A 4BMCA 2B5WA 3WA7A 1L7XA 1TKBA 1N7JA 1N2SA 1GKIA 4ZV7A 4GLOA 1FTNA 3H1PA 4I0WB 2Z8XA 5ELMA 2D4HA 4PTZA 3OFKA 1U9JA 5B6IA 3G1WA 4K9KA 4WVLA 1XEWX 5HJ2A 1KVRA 4CT0A 4G9EA 2EQAA 1M7GA 1TJ3A 2EJVA 1GNVA 4Q9HA 1RMQA 4N6OA 1K75A 5LIPA 4RO0A 3BHIA 4L5AA 1E7MA 1UFVA 4WERA 4KHPM 4KBYA 3QX3A 1HE1C 2IOFK 3B6ZA 3PNSA 1AG9A 3OCCA 4D41A 4PRYA 5KYXB 3DMTA 2GLXA 3HV0A 1NHGA 3OLYA 3B1YA 2IIVA 3IMCA 1NQXA 3PD0A 1P5RA 3C98A 4HDSA 3P32A 4XGKA 1CR2A 2NO0A 3KS8A 4EO7A 3DDHA 2C7VA 2JGJA 2PSSA 4H59A 4UHDA 3ZNOA 4AXXA 2IHUA 3SHTA 3FVWA 3VSAA 4B73A 2DYKA 2R62A 5CGZA 3VPXA 3VNRA 1IQ0A 2HF9A 5CPFA 3GX1A 1RCTE 1WF6A 3QF4B 4RVGA 4AJPA 3D3KA 4YHHB 3NP9A 3NAGA 1A5ZA 4EIWA 5JQGB 3MJHA 3ZCBB 2PT7A 1G3RA 3NAQA 3QIAA 1PG0A 1SGWA 1DWOA 2HU2A 4AG3A 4KYVA 4PYQA 4DV2B 1WVIA 1OBFO 1YZKA 3QMPA 1ZD4A 4B9EA 2V65A 4KLNA 1GUBA 4EG1A 3R77A 1FRNA 3SMPA 3P0HA 1A2BA 4OLJA 3DOIA 4DJFC 3IDFA 3STTA 1V1MB 3DNFA 3VNAA 1P4GA 2YXEA 2BSQA 1MA0A 7REQA 4DXHA 4BMSA 2LKDA 3ZWWA 2FPKA 3JY6A 1SULA 3KZNA 3CW9A 4QFCA 3NATA 1FMFA 3HY5A 1JTEA 3BWVA 1HI9A 3MBIA 2O3QA 2NO9A 2ZRKA 3LUKA 1UODA 2L2QA 2ZI7A 1N33B 2WABA 3OZWA 5I6DA 1NONA 3QFCA 3GAZA 2X4GA 3LG2A 5AVUA 5FFFA 5H3LA 5LYJB 1HORA 4FNMA 2ECKA 2R96A 4HFJA 3D7RA 3GL9A 3OPYI 4QECA 3CUEF 2VHWA 1HDRA 2Y0PA 1EMDA 4ALKA 2ZIXB 3DMTC 5J2TF 3W1VA 5IYZF 4PBSA 3WDKA 4JEMA 4GPZA 5DP1A 1QU2A 2D62A 1F8GA 1T8TA 4DJJA 1R50A 1K89A 1U2EA 4PCAA 1L7EA 3G59A 1VPLA 5THQA 1D2NA 4D3YA 3C4JA 1ZLYA 2WTNA 3DLPX 4OCZA 2DZNB 1T2EA 3RAGA 4K88A 1L3IA 3GRUA 1QDRA 3GEBA 4X60A 1XAJA 5IUNC 4PLWA 4OXYA 3WBBA 3GT4A 5J2UB 3P2MA 1DAFA 2F5PA 3QOWA 3CNHA 3PFIA 2FEAA 2G5CA 3SZRA 4D56A 4I2VA 3Q7TA 3IGFA 1CUZA 2JI9A 1V16B 3TEMA 4YAUA 4PX3A 4U00A 1GILA 2RFLA 4R2MA 2V7BA 2ZXFA 4I4LA 5AHOA 5ALNA 2FXVA 4CKBA 4HD8A 3TW0A 1I9CA 2HHHM 1XRJA 3AKCA 221PA 3OEHD 3KYDB 3KM0A 1LTMA 1I3KA 4QO8A 2LTAA 3SHVA 1JFTA 2HCBA 3G9ZA 3GZJA 3N1UA 5D87A 3GUZA 1JWBB 3A4NA 3BS4A 4H0FA 1JP7A 2PZKA 1NYTA 1XD2B 2WIKA 3O4GA 5KOYA 2GQFA 4U7FA 3IUBA 3R0ZA 2R45A 3ZE0B 1Q2UA 5A3VA 2FMUA 2HPHA 5LJLA 3AUJB 5LCXA 1ZL0A 3RVJA 1QPGA 3VH1A 4EHDA 1YRAA 4BMYA 3PHCA 4GXRA 3N74A 1WB5A 2FU5C 3D6VA 3PJFA 3GAMA 2FR8C 4B5KA 2SKEA 2ZTUA 1IZ8A 4JLSA 1U2SA 2PL3A 3KV1A 4JB2A 1E1RA 3ON5A 4X94A 2RGAA 2JIZD 1IK6A 2WIJA 1J6UA 4BNTA 1I4LD 3ID6C 4DIOA 3SMVA 1GPKA 1BOFA 3F49S 2J3QA 3COPA 2UYGA 5CG2A 3GN2A 4LMPA 1LJ8A 1CP3A 1LBQA 4MJXA 1BDHA 5DIZA 5GOTA 2ZGVA 1W19A 5C1IA 3ADDA 3NAMA 1N5IA 4IJ6A 3WLPA 5JBIA 4D4IA 3L92A 3O1LA 5HIMA 4HPXB 4KDEA 6Q21A 5IZ4A 1UEJA 2R11A 3U4QB 1NW4A 4EHLA 3HXLA 3TWKA 3ILSA 3KOZE 5IX8A 3HJFA 4LQCA 1PFVA 3NP7A 2Q5IA 4HN2A 3OE1A 2NWQA 1DU4A 4NTZA 2PLFA 1D7OA 2QLJA 1LDGA 1C3XA 3V4VB 4OQNA 1RYMA 1IU9A 1JFVA 4MYHA 4EKDA 3LY5A 3GRPA 1VQ1A 3GD7A 2BIFA 4AY3A 4ZCRA 4ZYTA 5LKRA 5F21A 1PVVA 5DGXA 3VR0A 3P27A 1N32B 3VU3A 2I7XA 4CM8A 5BQ5A 4K2AA 2H0QA 1BC5A 4PZEA 3U7JA 3G9TA 4ENUA 4P3KA 1P5ZB 2K5UA 1CQJA 5AUNB 5CU7A 2AQ8A 4U7TB 1VG9B 2WDPA 4QICA 2FE8A 3K9PA 1ZMUA 1K5PA 3QY0A 2C1EA 3SIWA 2WOOA 2MSCB 1NBMD 2Q3BA 4QLAA 2EAUA 2L7IA 1C9MA 1O8CA 4REZA 4QOSA 3QH4A 2QENA 4J0IA 1RNLA 3T3PB 1U11A 5AI6A 4UJ5A 1DAGA 4INZA 1JLRA 2V3VA 2C2BA 2HEIA 4CYMA 1FCJA 3U1TA 3NH6A 1VHQA 1HDZA 1V1RA 1WMSA 4GSLA 4ENSA 2YIMA 1VDZA 3N6VA 3JQ8B 4ML3A 1Y4DE 1R15A 4QGBA 2EEPA 5GMOA 4KXXA 1ZUNA 3SS7X 4HTFB 1PK7A 2FPPA 1WW8A 4ESHA 4MTLA 1E60A 4JSTA 5ALUA 4XOIA 3REGA 1JU3A 4O4JF 1GSAA 4M83A 4WN9B 2XEDA 4WK0B 2FPLA 4DCPA 3FOZA 2O1SA 4MQ5A 5JRJA 1BO6A 2HJGA 1Z68A 1PJQA 3WKCA 1EK1A 2Z6QA 4WBXC 2V7VA 3A8TA 1W0KA 5LU9A 4OAPA 4A6PA 5J43A 3AC0A 5BR8M 1E1NA 2JGDA 4L08A 3PPIA 4BMPB 4GE0A 1IMJA 2XNCA 1KYXA 5LC1A 4A0SA 2RGCA 3F6EX 4F8JA 3F7MA 4H1TA 4RA6A 2PLWA 2H3HA 3H4VA 3MK6A 3WB0A 5BMVA 1W2WB 3JRXA 1M3SA 4P5PA 5CYPA 1Y5RA 2JASA 1FOEB 5DDIP 4OB7A 4H35A 3AHEA 4GR9A 1ZD2P 2WB2A 2XTZA 3G1TA 1FUKA 1OIVA 3D3WA 4F60A 2EJWA 5E4FA 4NMHA 3ZGNA 1X39A 1KBQA 2GCOA 1Q3BA 4ZGBA 4CL2A 2XKAA 2WICA 5IUJC 2Y1CA 2RJ3A 4LY6A 1B00A 4UTRA 2F3PA 2Z3ZA 4RTRA 5EY5B 2C7QA 3MD0A 4QOIA 3H0EA 3HEMA 3A1VA 2AG0A 4IM7A 1RYHA 2HMUA 1OX5A 1SM4A 1CU1A 1JHRA 4KWTA 2VI5A 5CFRA 2PKYX 4EY5A 5KYYA 4O02B 4UXHA 1M9NA 2ZUDA 4OU4A 5J4VA 1VCIA 4QQ8A 1N0UA 2C4TA 3P9IA 4RH3A 1KBZA 5CRIA 1KJ9A 3ULKA 3D0KA 3TTSA 5EIBC 4NFYA 1J99A 1MPTA 5FO0A 5HJEA 2JHCA 4C7MA 2IWRA 2V7TA 2VPXA 5KTYA 2FW6A 5LOVA 4WQMA 1S3SA 4J0JA 1U8XX 4U3JA 2V98A 3PNKA 2J3IA 3UK6A 2GN0A 1YB6A 1B7GO 2IGBA 3O8OB 1H6CA 4F7WA 3S1LA 1DX6A 4GX5A 1UKAA 3U7QA 1H9CA 3UWMA 4FS8A 3P7MA 4KSBA 5TGDA 3CNOA 4GPAA 1GL3A 4PXSA 4FOPA 4YRNA 2P35A 1GZ4A 2P2YA 2AMVA 3HI6A 4JUIA 4HQNA 1ECPA 1OZ0A 4GMHA 2IGTA 2FP4A 4U2KA 1B3BA 3BXGA 5AKEA 3VI3B 3A4YA 3F6PA 4MRAA 2QJOA 4FGLA 5TQ2B 3KYBA 5BWBA 1KYWA 2XCSB 2FJ0A 3KKQA 5EKXA 2EZ9A 2FFJA 1X1QA 4BU0A 4DV3M 2VAWA 1TW2A 5E7JA 4LXYA 3K8QA 1W1WA 1V9LA 3VISA 1V47A 4JK3A 2Q9CA 2E18A 1G38A 3GO4A 1W34A 5AR1A 4EJFA 3WYCA 2VF7A 2AUTA 4YAKA 4OHRA 1MRNA 3F74A 4XVUA 2XFSA 2NXCA 4AW4A 3D3JA 1PR6A 3KBOA 2P5TA 5DXFA 1QGZA 2Q21A 4H60A 1MGOA 3L0CA 2DHEA 1Y5NA 2C98A 1N1MA 2PTHA 2Y1KA 1PVOA 5TPWA 3GEPA 4M0DA 4A26A 4FU0A 2A33A 1FB5A 3FW1A 2W4IA 1SUAA 2QMEA 1EXVA 1JWLA 3I4YA 1QDUA 1UPCA 2P6UA 2CN1A 4DJDC 4K0KM 2JRCA 3OU7A 3GJ0A 1Y89A 3OIUA 1SVMA 4AWAA 4QELA 3TNFA 4WA7A 3WHIA 2HC9A 2BGRA 2QN7A 4GBGA 3CVYA 3BDVA 1O58A 2RMKA 4DRXB 2B0CA 4BO4A 5KQRA 5F3DA 2WAAA 3MK31 3SXUA 3I32A 4B3MM 1P0MA 2Q1XA 1JR2A 5FXMA 3FOEC 1GPJA 5A7HA 4IXTA 2ZXEA 2FZ4A 3TB4A 1NMZA 2WFAA 2IP4A 5LQMA 3DMYA 3LUBA 1UK9A 1VDMA 2FZ5A 4OPMA 1I0ZA 1CCWA 4JU9A 1G9TA 4EZIA 3ZDZB 1G5QA 4FBLA 3VU0A 3ND6A 4HDCA 5K8CA 1KZ7B 1JNXX 1L8QA 3RT9A 4JP8A 3PTAA 1UZLA 1LWOA 5EEGA 4EI7A 4CV3A 1QHYA 3DEIA 3HSKA 5DW0A 3PUKA 4RJKA 3H75A 4Z6KA 3Q0TA 2DAGA 1OH8A 1R6TA 5F5XA 4PM4A 2GPNA 3OLQA 3ADKA 1FJGM 1RHMA 1TJPB 3AR9A 1K86A 1YS4A 5KOHA 4J8PA 3BJIC 4K6FA 4QD3A 1XZDA 2HJ9A 1ZU4A 3QW4B 2VJMA 4PTYA 2ZRBA 3ROEA 4BN0A 3JQ9A 2ERCA 4HFNA 2C00A 4B75A 3TQQA 3D7SA 2XAUA 1KK0A 3KOUA 5CB0A 3VO8A 3VOSA 4HS9A 2Q5OA 2WJJA 3L8GA 4YFYA 1K6XA 4QYSA 4LDJA 4U7WA 3VNUA 1QZXA 1MKYA 4HZUB 5GIOE 2BCEA 3K0FB 3MOIA 5EG5A 4OK6A 4S12A 4FWDA 2C2KA 1Z5UA 2IPMA 5F5NA 4OXNA 4BXOA 2DTEA 2BM8A 3HUTA 4A0FA 2F59A 1NG9A 4OSEA 1CX9B 4WNCA 4RQAA 3SIPA 4CL3A 4BMVA 3GG2A 2GPSA 3DV0A 3T3GA 5SYAA 1CY6A 4X97A 2XYVA 2BONA 1JZTA 2H4FA 3WJ1A 4PC6A 2PGJA 1GAWA 4X9XA 4PSCA 3EIFA 1G9SA 3FDFA 4KH0A 3D64A 4Y18A 2FPIB 3IQGX 1D0MA 2QAGA 4WL0A 4BP1A 3R0XA 3L0SA 4WZAE 5K4GA 2KX7A 3AUTA 2FPGA 4WA8A 1JQBA 1KWGA 4FN4A 2Q6TA 4ZHQF 2CXRA 4RW0A 1XCLA 3TNYA 2CCJA 1IZ7A 1OXTA 5EJEA 1QAQA 2Z1NA 2UXDM 3LM8A 5G0TA 3TMYA 2GVZC 4ETIA 1Y7LA 5DX8A 4BATA 1KEVA 3SLRA 1XK6A 1FFHA 4FI3C 5FJIA 5L9AA 1EPUA 2NSYA 4II2A 1U2DA 5IT0A 4MWBA 5JCXA 4OA5A 4L75A 5JSHA 5EVCA 2GZ1A 3R3JA 5HILA 1T3LA 5LYJF 2V6FA 3WIEA 1Z37A 3RC7A 5TS2A 1NQVA 1G1AA 1Y3AA 3RRFA 5E6UB 1Y6JA 3HN6A 4DV7B 4PQEA 4O3MA 3GLUA 5TQ0A 4ND8B 1DC6A 1QCCA 3ZGOA 3S2YA 1HDGO 2F1KA 5KEIA 4PNHA 4ZCSA 3EQZA 4MWDA 5TS3A 2XVXA 4DR5M 3O4RA 2E5WA 3OTOB 1W85B 1KMHB 4XX1A 5CTJA 1M6EX 4XUGB 1FBTA 3AEKA 1SKMA 1Y98A 1RD4A 3BKXA 2PT5A 3R09A 1ZN7A 2WG1A 1H65A 1VG1A 2X7XA 2MR6A 2OGTA 2VOEA 1YHYA 1PR1A 3OX1A 4BO3A 3J2PB 1ADYA 2JGNA 5J2UF 3E1KA 1D2RA 2MT9A 3LOUA 1AHIA 3LLCA 1NQAO 3HR7A 3EHDA 3FJOA 1WOMA 2B20A 3GLIE 1W6UA 5BSVA 4DLLA 2IDMA 1WBJB 4HL6A 2WIFA 3JQBC 1UBEA 4RZQA 2ZJ8A 5FTWA 2M6LA 1T5DX 1B8UA 2DUNA 2HREA 4XX0A 1PE0A 1R5LA 1JXAA 3E7FA 4GE3A 1P7PA 3VR5H 4DL9A 1U7TA 4E5MA 4HLNA 4I4IA 1V41E 5DT2A 4LRSB 5B1SA 4R2XA 3ZK8A 1XSEA 2DMRA 3ME5A 1NG1A 2HV9A 3RVSA 3CW8X 4B7ZA 1T2CA 5K3BA 5KQLA 3FR7A 1X7YB 3DBRA 1EFUB 1GFZA 2AWOA 3EPLA 4BVGA 5HCIA 1V9CA 5GJCA 4XASA 2JLBA 4ZOLF 4DB4A 1PQWA 4YV0A 5I47A 5SZIA 3LC0A 4Z7NB 2JIPA 3WGKA 1U2DC 1SNYA 4XR9A 3B82A 4KKXB 5F98A 3CUVA 4O8CA 3SEZA 5FBWB 3IVXA 1GRNA 2JWSA 4MJ3A 4GOJA 3TH5A 1CDEA 4I3FA 2P9EA 2ZZKA 4HX5A 1SHUX 3AHGA 1U1CA 3SOPA 5LBUA 3DT9A 2WU8A 1V3QE 4TS4A 3WWEA 4BZPA 4C6TB 5AW4A 3PPXA 3H7AA 2PLNA 3L25A 3GF4A 1KERA 3FUWA 2OUKA 1NOJA 1W76A 2F64A 2KSQA 2GB4A 1YK0A 2WSYB 3DOFA 3HKBB 3UA3A 4HNHA 2H6EA 3LE8A 4E12A 1Y3DE 4YRKA 1TKRA 4K03A 2QSYA 1AQYA 4PZLA 4I5SA 1KP2A 3NHJA 4LHYA 2UVDA 1GARA 1RWVA 1L5KA 3RRMA 3VPCA 4JN6B 1MO5A 4X62B 4DC1A 3IR5A 1BVRA 3R5SA 3EA4A 1UKEA 4E33A 4H7IA 1QH8A 3FWYA 3HLYA 2CXNA 3EMKA 3AU9A 1UXJA 4TXHA 4K8RB 1UFOA 3N7TA 4QAJA 5DNWA 2PS3A 2CFCA 4U39A 5AVXA 1GDTA 1R64A 2XB8A 3QXHA 4GYWA 2EP8A 1J23A 3AUKA 4EL0A 2QZPA 4YUWA 1TJYA 1SOMA 3N2EA 3F5MA 2I6XA 4AKSA 1UJ4A 3K5PA 3K94A 2CC2A 4LRTA 1WEHA 1PUXA 2VVTA 5HBGA 4OBWA 4LKRA 4L73A 5F77A 3PQ6A 1DGFA 4E6EA 4V0ME 3GB9A 2WDZA 3GMTA 4DF3A 2NN3C 3D3EA 4XYEA 3H2BA 4Y9SA 4IILA 1MEJA 4N3AA 3M4XA 4YYZA 4O2LA 4ZANA 3VX3A 3TZKA 2HZBA 1NASA 1EX7A 4EF4A 3WGIA 3PF9A 4EO9A 1ZY2A 2DENA 1K4YA 2ZCJA 3M70A 4EEXA 1H1DA 1MTZA 1ZGZA 1Z5CA 2L69A 1YAHA 3MG9A 3ESAA 4IP0A 3QI7A 3BFXA 4LWOA 5BWLA 1QJCA 1COWA 1E1MA 5B3AA 2Q7DA 5K8IA 2I3GA 2A5FA 2F8LA 2X77A 4EB0A 1U1FA 1CEYA 2OCBA 2Z2IA 5HF9A 3CWCA 4TKUA 3KYCB 1WRBA 2R6FA 4EEZA 4PHCA 1NT2A 3O2JA 4EX6A 2V4UA 3U6BA 1WF3A 2J59A 2GSWA 4OB6A 3ED5A 3QAUA 3PIDA 2PD4A 1FXWF 5HG0A 1OE0A 1P62B 1Z63A 3ELBA 2VHQA 3C6QA 4KPGA 5K6AC 4G1FA 3EZLA 3STYA 4BB0A 1D9XA 4WESA 5AVKA 1P2VA 1L5HB 1A3CA 5JCOA 1NJFA 3O21A 3LW8A 4WKBA 1R2YA 5BQPA 3W67A 2YXNA 4IJ5A 1Z4KA 4WBSA 1W94A 1E0AA 1GKUB 1HFWA 2XLBA 2OCDA 4X6YA 3WBFA 4E7PA 1BZYA 3D6UA 1X70A 4TKVA 4OM7A 1XP5A 4M76B 4DN6A 2WWYA 1Q0HA 1FK8A 3RUDA 4B2PA 4H7KA 2XMZA 2C8JA 4WUTA 1R5BA 1G3MA 3K32A 4BMDA 3MB5A 3IFSA 4YRFA 3WI7A 2J9YB 4P3PA 2POCA 2OD9A 4ZGGA 2E89A 4P0PB 3DZBA 1K7CA 2C7RA 3HN7A 4QBIA 5KQDA 4C30A 4NCBA 4DBLC 2C3YA 3IL2A 2NU9B 1P7YA 3GVIA 2JL1A 3QUBA 5AVYA 1ABFA 5F23A 4EARA 4QTTB 4C2TA 3ZE6A 2G07A 4XIGS 5IU6A 3BGSA 3CPJB 4FLFA 4JC5A 5AM1A 5B1EA 3EDMA 2BOVA 1NWCA 2IUUA 4W5RA 3B6JA 4Q7EA 3MCUA 4QQRA 2FPRA 4RLFA 1U9CA 3GLTA 3VPBA 1IWPB 1MXHA 4MULA 3DKVA 4L9RA 4BE9A 1BKSB 3DCIA 3P4XA 3VK8A 3DHVA 1B42A 4D80A 1QU3A 5DM0A 1RPJA 4DXDA 1SVWA 1QRRA 1H22A 5ENDA 4R2LA 1YJCA 5F52A 4EW6A 3OCXA 5C5CA 2LP4Y 3SYLA 3A1UA 2Q1YA 4JBHA 4FXPA 1RKXA 3QSGA 5JCOC 1QDEA 2NUPA 4UUMA 3VYWA 1EDOA 3OJXA 4FD3A 3VJRA 3LTNC 5BN5A 4H2DA 3QBEA 2C78A 3BIOA 4BYMA 3U13A 1IB0A 1MAWA 4G85A 2F9FA 4ZIRB 2H5JA 2VSYA 1OHHA 1FZTA 2QY6A 3PI6A 1S6YA 2H8KA 5IJWA 1Y6FA 3QPAA 4EVIA 1NBHA 621PA 1WAMA 1YO6A 4ZO4A 4Q01A 4AZ0A 4C7JA 4C3VA 3H11A 3RVNA 1KQ3A 2JFQA 1QCDA 3UANA 4ES6A 1IY1A 1ZJYA 1WHCA 4QC2A 3AP2A 2WWVD 2WF9A 3P97A 2QBYB 3JYHA 3HKDB 1ORRA 4IDDA 1NBOA 3RANA 3K1TA 2ZE7A 2YCBA 5K01A 3T5AA 3SFZA 3MQFA 2XF3A 4DOMA 2HQBA 2VSXA 1IE3A 5TMDA 4AY6A 3NTLA 2OBYA 1U1DA 3PFGA 1JA0A 4UDYX 3IAM6 1VM6A 5EZYF 3LCMA 4EQ6B 1E4OA 5ENZA 3A4IA 4CUZA 4MB2A 2BFEB 2WM8A 3AFGA 5EE1A 2J0EA 4QOGA 1GTL1 4X5OA 2VP9A 1TUGA 3JVEA 1DELA 1K2WA 5WRFA 2C7OA 2G5PA 1KQPA 4TZKA 4V2UA 2EBWA 1G63A 4R1OA 3SQNA 1G5PA 4XWYA 3ONNA 3C3YA 3V76A 1T8YA 4RFLA 1FNDA 1SQFA 2RONA 2AKYA 1ZK4A 5B37A 2VAMA 3I39X 3JQRA 1YZFA 3X1JA 3ZGZA 3UCFA 1EH5A 3Q9LA 3ABQB 1VYHA 5FD8A 2F43A 3PDWA 3CE6A 3L7DA 1ZM9A 2ZAGA 3FFWA 3UUGA 4HBGA 2VNJA 5J4YA 4IUBS 1DWQA 3H9BA 3P5BA 1XEXA 3SMSA 2ZS9A 5IEBA 1X1CA 4NZNA 3FF4A 5ALOA 1P3JA 2HTFA 3BFPA 2PXAA 4KAXA 4YFVA 2Z04A 5EINA 1PWZA 4HCJA 3GDWA 3N59A 4JITA 1QK5A 2YWXA 3DPIA 1FNBA 4EPWA 3EQ2A 4IDQA 4WNIA 3BFJA 2MTBA 4LYAA 2JIRA 1AUQA 1QGYA 4AC9A 5A2QA 1ZCJA 1T3HA 1UP7A 2XUKA 2CCKA 3PR3A 4UVGA 1I4WA 3TAUA 3PFBA 4YP6A 1U4OA 2W83A 4OHFA 4INAA 1H3FA 1RAHA 5TMBA 2H1HA 3SE7A 1M0TA 1YUMA 2ZU6A 5A5FA 5L3SB 4HDRA 2VRWA 3HP4A 3TQHA 4CNQA 4D8YA 5HTOA 1SUIA 5BSHA 2QJRA 2X42A 3BE4A 3G8YA 2X0DA 5ALKA 2I54A 3OM8A 4QPPA 5GM1A 3SKYA 2I1LA 3LL7A 2WHPB 3FBTA 3NB0A 3RF6A 3R7AA 4IJMA 4MHTA 1CPYA 2J9RA 3FNFA 3A1TA 3I23A 1E2FA 3ITKA 1L7MA 4C0QC 1AS2A 3WLHA 1GADO 2VDNB 2WYHA 3AUAA 1OV6A 4CKEB 1N3IA 1Y3FE 1WDLA 4DUZM 5HF6A 3HEAA 4JSRA 2I6QA 3ZI7A 3S2FA 4WXEA 3RBZA 2VHTA 2QRGA 4B7GA 4ZI7F 4AMUA 2C77A 3T3DA 3LYLA 4IS3A 3IVAA 4QGGA 2FG5A 4O1IA 3ZN2A 5ARCA 5C7LO 2FJUA 5SZKB 2APLA 4JI3M 2ZBQA 2O8EB 4JI2B 4AKEA 2XT9A 4C9BA 1JR3E 1FFXA 1RPAA 3RUCA 2CB9A 1KORA 3NKFA 4LDNA 4I4TB 1NSFA 3B3FA 1ZUIA 2FUKA 2PRIA 1VE7A 4FKBA 5BV0A 1EFHA 3D6JA 4NH0A 3C3JA 4EHIA 4UCXA 1RLTA 1H5NA 1USVA 5LQJA 3NM5A 2W2KB 4DJ5X 4URHA 2Q2WA 1VMEA 2E48A 5ES3A 1QR2A 5LMUB 2OZKA 4BPBA 2H59A 4UZSA 1L5RA 2AHRA 4BDSA 4JQCA 5T8KC 3G7UA 5IP5A 3QKSB 3RGSA 2JGMA 2I7CA 3UJDA 3L7IA 2QSZA 1WMAA 2R6R1 2ZSDA 1E3DA 4FT2A 5I5GA 2HCFA 3DOHA 4GPD1 4M1SA 4ALIA 3LNCA 1Q0ZA 2VUTA 4F91B 1CS4C 2BEJA 4TN5A 2XKBA 4QE3A 2ZVDA 3ZIAD 4Z5XA 4BWYA 4JJ6A 5HMMA 1N9GA