3FTDA

Crystal structure of a. aeolicus ksga at 1.44-angstrom resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
240
structure length
240
Chain Sequence
b'SFGQHLLVSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDREMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIENTVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPPRFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIPEELLKEAGINPDARVEQLSLEDFFKLYRLIEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 83
structure length 240
sequence length 240
ec nomenclature ec 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ftdA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ftdA01
4XCXA 2YR0A 2XYQA 5FQOA 4P7FA 2JH8A 3TPZA 3KQVA 4DQ0A 1ZG3A 2IPXA 3SXJA 9MHTA 1N7IA 1KR5A 3MCZA 1HMYA 5E1DA 2P3QA 1O54A 3UZUA 2B9EA 4QPPA 5EMKA 4YUYA 2AVNA 5DSTA 5IH3A 3HCEA 3LKZA 1D2CA 1XVAA 2HTEA 1R00A 2LD4A 2PXAA 4ISCA 3TKYA 1X1DA 3GRVA 5HIIA 3SVZA 1TPYA 2C7QA 2OY0A 5K0GA 4ER3A 2UYHA 2V74B 4FSXA 2P8JA 3P97A 1JSXA 3UJAA 3I9FA 2BZGA 1SVUA 1ZGAA 2GAFA 2GLUA 5EEHA 3NVKI 3FPHA 5EG5A 4KVZA 5F2OA 2BR5A 2ZIEA 4F85A 2ZWAA 1B42A 3EVFA 4EQZA 2ZTHA 4YMHA 3EVAA 1RJDA 1X1CA 5T67A 4HTFB 4RVGA 4R8SA 2ONYA 3NMUF 5FWDA 1BHJA 2AOTB 2XVAA 2HNKA 3REOA 4CKCA 5K05A 3LBFA 2C7PA 1EAMA 3PT9A 2KW5A 1X19A 4QTTB 3T0IA 5EKXA 4E2XA 4YV1A 4RTRA 3AY0A 2GH1A 3V97A 3CBGA 2AOUA 3NVMB 3TQSA 2OZVA 1R74A 4GEKA 1D2HA 3EVDA 4A6DA 2FHPA 5E9QA 1R18A 2IFTA 3PVCA 1NT2A 4GOLD 1OR8A 2PXCA 3R24A 3M70A 4F86A 4RTNA 4PYNA 3B5IA 4DM3A 3BWYA 3B3GA 2OBFA 3EGIA 4PYOA 2FYTA 2CWWA 3FTCA 2EFJA 3MERA 3FUXA 4XUCA 5E2BA 4HC4A 4GF5A 5DXAA 5EHIA 3T7TA 1O9HA 1FP2A 2PV0A 2Y1WA 3TKAA 4YUWA 1G8AA 2I9KA 1XXLA 3THRA 5CCXA 2EX4A 3BWCA 3CC8A 3KQWA 5C9ZA 3Q87B 1YF3A 5E9WA 2G70A 5FHRA 4KIGA 4X41A 3BXOA 3BT7A 4BY9E 2AOWA 1FP1D 4GBED 4ER6A 2O06A 4AZVA 1YUBA 5FQNA 3OE5A 2IH5A 5DLYA 1X1BA 3ME5A 5EEGA 3O31A 2BH2A 5FCDA 4RSRA 2PSSA 1YZHA 3VYWA 1G60A 2R6ZA 2NP6A 1VBFA 2PX5A 5EVJA 5EGSA 3UA4A 3I5UA 4DZRA 2CMHA 1XTPA 3DLCA 3QV2A 1JG1A 4E32A 3GNLA 1ORIA 1VIDA 1YB2A 1V39A 1X1AA 3MQ2A 5FADA 1UFKA 3HVIA 4YMGA 2UYCA 3NDIA 1BKYA 5HFJA 2O57A 3LDUA 3A7EA 4QVGA 4EK9A 4KWCA 4ER5A 4PIMA 2ZZMA 1P91A 1O9GA 3A7DA 3GGDA 2EJTA 1M0EA 3IHTA 3EEOA 2WK1A 5E8JA 4PYQA 3OFKA 4CKEA 1SUSA 5F2NA 2AOXA 3OFJA 2XBMA 5DRTA 2ZZNA 5E2AA 4BLWA 1DCTA 3UJ8A 4EMSA 1NW3A 2XYRA 3ELUA 5E9JA 3QOWA 3VC2A 1AQIA 4GC5A 3BGVA 3ERCA 2ZW9A 1L9KA 1MJFA 4AZSA 5MHTA 1WG8A 5DM1A 4ER7A 5DX1A 5DM0A 1QAOA 3FTDA 4ATNA 2WA1A 4ER0A 2IGTA 1WY7A 1I4WA 2UYQA 3SMQA 1P1BA 3GXOA 3LCUA 3P2KA 5EKUA 2C7RA 1KP9A 2BM9A 4QDJA 3KQTA 3R0QA 2OYRA 2F8LA 5K0EA 2GS9A 3CJRA 4HH4A 3M4XA 4P7GA 3KQSA 4QQNA 3HCBA 4YUXA 4BLUA 5DM4A 5KS2A 3LECA 3FUVA 3CVOA 2O05A 2NNWB 5EZQA 3HVHA 5EMJA 5ICFA 3G7UA 1JQDA 4OQDA 3RODA 5JUWA 1VP9A 5K0BA 5EOVA 2Z6AA 2ZSUA 3KPYA 4AX8A 4V0RA 3LHDA 3AXTA 3GWZA 2G1PA 2IP2A 5DM2A 1EIZA 4G56A 3UJDA 1KXZA 1AV6A 2CKDA 3DOUA 3KQPA 4R8RA 2JH9A 4V0QA 4POOA 2ZIGA 2ZCJA 3TRKA 3TM5A 1SUIA 2ERCA 1RI1A 3D2LA 5FUBA 4C05A 5ERGB 2UYOA 3THSA 2QY6A 1D2GA 2OB2A 3GRZA 4E33A 3AXSA 4C03A 4RVDA 3SX0A 4WXHA 4DCMA 2PX4A 2EJUA 4PCLA 2AOVA 4GOOD 4PYKA 5GWXA 3FPGA 3HA3A 5P8WA 2ZZKA 4PGGA 1T43A 2JHCA 1FBNA 4X60A 2E5WA 3FPFA 3SSOA 3P2EA 1NKVA 1N7JA 1BC5A 4IV8A 1QYRA 3PX2A 2P3LA 1KHHA 4QPNA 4IV0A 2BM8A 2BR3A 2ONZA 3GO4A 3HEMA 5HIKA 5HZMA 3FYCA 3TMAA 3DLIA 3HP7A 2A14A 2GPYA 3Q7EA 1QAMA 3KPUA 5KYGA 4PIPA 5DWQA 3FTFA 2ZFUA 3KHKA 2HMYB 3MAGA 4XUDA 2ESRA 2AS0A 2ADMA 2VP3A 3V8VA 2AN5A 2YTZA 3P9CA 4KDRA 3CCFA 4RWZA 3GRRA 3OU6A 4GOND 1QZZA 3VC1A 3GU3A 1VP3A 1WXWA 2P3OA 3DH0A 4P7KA 1R6AA 3E7PA 3LPMA 3SGLA 2FRXA 4LWOA 3P9IA 3OZSA 3PTAA 3C3PA 4M36A 3PS9A 5EPEA 4DA4A 4OA5A 3ELYA 4CKBA 2C7OA 2B78A 3LSTA 4AUKA 4DF3A 3PLAE 5EHGA 1ORHA 2H11A 1L3CA 3B3FA 4FT4A 3OU2A 4GUAA 5FHQA 1KYZA 1DL5A 3HCAA 2P40A 5K8VA 3UBTA 4MHTA 5K0JA 3C6KA 3EVCA 1QAQA 3PFGA 3DULA 4H0NA 2YX1A 1N2XA 2FCAA 1IM8A 3NTVA 1PJZA 3PB3A 4HTFA 3RW9A 3M33A 3SM3A 5M5BA 4PWYA 2AOTA 3MHTA 2O0LA 3EGVA 3HVKA 1AF7A 1KYWA 2I7CA 3KR9A 3A26A 3C0KA 1TW3A 4EKIA 3FUTA 2Z6QA 2R3SA 4FSDA 3NWEA 1Q0SA 1ZGJA 5DRYA 3DXYA 5T64A 4HGYA 3I53A 4RX1A 2ZLBA 3L8DA 1UWVA 5CM2Z 1VL5A 3FPJA 4DMGA 5EZSA 2JHPA 3JWIA 5E8RA 3HNRA 3ELWA 4X61A 3LCVB 3BKXA 4C07A 5HOQA 3P8ZA 4E31A 3DMHA 4CTKA 1R8XA 3AJDA 1G55A 2YXLA 5C1IA 1EJ0A 1PRYA 4PCAA 2IH2A 4RTKA 4E2YA 3UFBA 1IY9A 4HG2A 2P35A 3TOSA 2AR0A 3KR1A 2XYVA 5CVVA 5DTMA 4XUEA 2HR1A 2G8NA 2ZIFA 3DTNA 5E1OA 3DUWA 1FPQA 3GCZA 4BP1A 4BLVA 5DPMA 1NW8A 2GA9A 5HIMA 4FZVA 2YUIA 1P39A 4RTSA 3MCTA 5EIWA 2FPOA 2P7IA 3E05A 3MTIA 4LG1A 5BW5A 2PBFA 1RJEA 3HM2A 1SQGA 2IIPA 2OB1A 2QRVB 3IYLW 4KIFA 4FGZA 3OU7A 4U7PB 5LQCA 4HSGA 3UJCA 3BKWA 3UA3A 3HTXA 4YV0A 5D1NA 1L3BA 3DMFA 1JSZA 2ZBPA 4FP9A 3TR6A 1YFJA 1EJ6A 2PLWA 4GOMD 3K6RA 4IWNA 5D1HA 4R05A 3EMBA 1M6YA 4P7JA 1NV8A 8MHTA 4Y30A 2PXXA 3ELDA 3G8BA 4KRGA 3ORHA 5C0OE 3M6XA 3FYDA 4UOEA 1EG2A 2VZ9A 1NBHA 4AZTA 3G2MA 5CVDA 5K01A 3UWPA 1Y8CA 5T6BA 4YUZA 3BZBA 2VDUE 5HEKA 1AQJA 3KPWA 4MWZA 4M7RA 5DTQA 2NXJA 3LGAA 2ZULA 4RV9A 2YQZA 4PYMA 4PGHA 3FZGA 5U4XA 3DMGA 4DCGA 2PWPA 3PX3A 1M6EX 5FULA 4PYJA 3M6UA 4F84A 4RTJA 4QQKA 3UJ6A 4RTQA 2B3TA 5KVAA 5CVJA 5FA8A 3OCJA 4GC9A 3VSEA 3BWBA 1JQ3A 2AVDA 2FK7A 2V7EA 3CJQA 3OE4A 4FS8A 5CUQA 3TFWA 10MHA 5GM1A 1YZ3A 2PJDA 5GP1A 5F2KA 1U2ZA 3EEYA 1NE2A 1VQ1A 3I58A 5KQSA 3ER8A 4Z2YA 4BP3A 5IKMA 2B25A 2PWYA 2G72A 2H1RA 3FTEA 3SSMA 2I6GA 3O4FA 1RI4A 5LSAA 3KQYA 3HCDA 1DUSA 1NW6A 2H00A 3LKDA 3MTEA 1XCLA 3OZRA 5FA5A 1I9GA 5HIJA 4RTMA 1YFLA 2P7HA 3C3YA 4OX9Y 3M6VA 1P1CA 2I62A 3EVEA 5B1SA 4X63A 4C04A 3ER9A 5FWAA 5E1MA 3P9NA 3LDFA 2IBSA 2QYOA 2HWKA 2XVMA 3MGGA 3UJ9A 3TM4A 3G5LA 2AN4A 2PT9A 5GIPE 5LQUA 3A25A 1JQEA 4NECA 3RIEA 2IDJA 3P71T 3WSTA 3KKZA 2PX8A 2QE6A 4O29A 4PYIA 3FRIA 2YVLA 1NW5A 2Q41A 3JWGA 2K4MA 4PONA 3PFHA 4K6MA 4M37A 5EC8A 4HGZA 5CIYA 3EMDA 1SKMA 4L7VA 4CTJA 2AOUB 3B7PA 3DP7A 3EVGA 2N47A 3G89A 3KR0A 3QOXA 3SR4A 1SQFA 1TW2A 3KQQA 2YXDA 3BUSA 4B17A 2PY6A 4CXMA 1Q0TA 1JG4A 4X1OA 3BGIA 3E23A 2PT6A 3A4TA 4PINA 1JTFA 2PGXA 4CWAA 4C08A 2UZ4A 1SG9A 3BGDA 3K0BA 2FK8A 1RJGA 4MIKA 5K0CA 2JHAA 5DSXA 3UJ7A 5CD1A 2OO3A 1QANA 4E30A 3U81A 1IXKA 1VLMA 1WZNA 1XJ5A 3G2QA 3OPNA 5DX0A 5GIOE 2CMGA 3FUWA 1INLA 3E8SA 2PX2A 4C06A 3X0DA 1JG3A 3EVZA 3KU1A 2NYUA 3AWIA 4KDCA 4M38A 4HRAA 2GB4A 3R6TA 2NXEA 3KPJA 1G38A 3P9KA 4RYLA 1H1DA 3R3HA 3F4KA 3GRUA 2EG5A 4RTPA 4RVHA 4KW7A 3HA7A 1VE3A 3FRHA 3HCCA 3SSNA 1ZKDA 4Y2HA 3FPEA 5LR6A 2AZTA 4R6WA 3B3JA 1BOOA 4EKGA 5LQNA 4RTLA 5GINE 3KQMA 2JJQA 5BP7A 1UIRA 5DTRA 3LL7A 1G8SA 4EVIA 2HV9A 4JXJA 3M6WA 5K0NA 1JTEA 3OZTA 5HILA 5LQAA 3GJYA 5DT2A 3G8AA 3G2OA 3A27A 1RJFA 3EPPA 4AZWA 5CVEA 5LQJA 4E2ZA 2OPBA 2CL5A 1R8YA 4R6XA 5CVUA 2IH4A 4C4AA 1RI3A 3NWBA 2O07A 5K0FA 5K0LA 7MHTA 3IV6A 2G71A 3HVJA 5GOZA 5DXJA 2JG3A 4QTUB 4LECA 3GDHA 3R9XB 1I1NA 3IEIA 3G5TA 3KR2A 4OQEA 3UJBA 2IDKA 1WXXA 1ZHFA 5FTWA 2ZBRA 4YUVA 2IBTA 2BR4A 3CJTA 2P41A 3DXZA 3HCFA 5BXYA 1MHTA 5EMMA 3EGEA 4OBXA 4OA8A 3LDGA 5LQRA 3HA5A 1L1EA 2B2CA 5KQRA 4QVKA 3CGGA 1FJXA 3CKKA 4PYLA 1NV9A 1Z3CA 5GM2A 4E2WA 1XCJA 4WVLA 2ORED 2NP7A 3DR5A 2VDWA 2WA2A 5EMLA 1RI5A 3P2IA 3JWJA 4PNEA 3G2PA 3ANXA 4RTOA 2DULA 5ICEA 5BW4A 2VS1A 3BWMA 4MQ4A 3FUUA 3GRYA 3T7RA 3KPVA 4QDKA 1NW7A 2OKCA 1RI2A 1XDUA 4MTLA 3GIWA 1KPHA 2NXCA 2ZWVA 3NDJA 5E1BA 4ZTBA 2QRVA 5K03A 2AN3A 1JR4A 3I64A 1F38A 1NBIA 2NXNA 4U7TB 3S68A 2PKWA 1JG2A 1HNNA 3G88A 2ZVJA 3ID6C 1KIAA 3KQOA 4A6EA 4RVFA 4FR0A 5ICCA 3TLJA 3NW9A 5K09A 3LBYA 1F3LA 1XDZA 5EIFA 3EVBA 2QM3A 5DX8A 2ZBQA 3H2BA 4OBWA 2Z6UA 2YXEA 5LQKA 1G6Q1 2P1DA 3MB5A 3JWHA 1VPTA 2VDVE 4FT2A 4IKPA 5EQJB 5H02A 3O7WA 4DKJA 3NJRA 2OXTA 5CCBA 4P58A 2PVCA 1KPIA 2DPMA 4E70A 4YV2A 4LWPA 1L3IA 3LX6A 4GQBA 2Y1XA 1XDSA 3DXXA 3LCCA 3C6MA 3T7SA 5ICGA 5G02A 1WS6A 1KPGA 3B89A 1ZQ9A 5JR3A 1EQAA
chains in the Genus database with same CATH superfamily
5FQOA 4LBYA 2VYCA 2NUPA 2VF5X 3D81A 3MCZA 5BO5A 4W5RA 5BMOA 2BUCA 3H11A 5LUAA 1HYQA 2O7QA 1FDIA 2VSYA 3ILSA 4MOWA 3KLOA 3B2NA 1Z56C 1HKUA 4YA6A 3MTGA 1WKCA 4GEKA 2KWIA 3DOJA 2GNAA 3KT6A 3B3GA 4ZU1X 5ADWA 2RI6A 1WQ3A 3CR3C 1E3EA 1QQAA 2ZB8A 3A6EA 1FUIA 5C8YF 3RS9A 5EXTA 2RGXA 1IJFA 1SU8A 3OECA 1VJ0A 1AXRA 3GT4A 4HCJA 1ZICA 1Y3IA 1QR6A 1M7BA 5ARBA 2VDPB 3GL9A 4B3MB 4AWXA 4ER5A 4BTLA 3R7LA 1W87A 5DGIA 4MMYB 4NPCA 1JMYA 5DBGA 2ZPTX 3L2AA 5EKUA 5EKSA 4EUKA 5LZ9A 5ITYA 5ILQA 2BFCB 3CVOA 3RUDA 4IJKA 4RPIA 2ZTLA 3LFTA 1KSGA 1KXZA 4E1AA 2JH9A 3SM9A 2JIPA 2PX4A 4UMFA 2JHGA 5EJFA 2P4HX 2A4MA 1FBNA 4JAVC 4CM8B 4BYMA 3VSBA 1JDUA 1JIUA 1IOWA 1NVWQ 1ORVA 3GO4A 4MR8B 1IPHA 2XE7A 2DPXA 3KJHA 3EZ7A 5GJBA 4E5PA 2VQ3A 2FJ0A 1GAEO 3GJTA 3RG2A 3IKJA 4INOA 4AF7A 4EP1A 1HYBA 1LBTA 3W2EA 4P83A 2AC2A 4CW7A 1J2RA 4AKIA 3CRRA 4OD0A 4Y1RB 3JVIA 3M7IA 4JBXA 3CHYA 2BOVA 1ML4A 3VZRA 3RYFA 3LTNC 4MWEA 1QPZA 3AT1A 3F7MA 2QHOB 3ZIUA 4BKMA 2CJXA 4TLAA 1T9AA 4GOJA 4IH1A 3QJ5A 4YTEA 2XQJA 1QK3A 5LU8A 5B3JA 4JR0A 4Q82A 2PH3A 2HA4A 2NUPB 3WISA 3ESYA 1ACLA 2G72A 4JI6B 3TWOA 1Z5VA 1GTG1 4LPSA 1C9JA 1EVEA 2ACKA 4BNJA 3ZDCA 3NEJA 2K4MA 3WLFA 3OAAD 4RSGA 1KYIA 4KFRA 2X0FA 2KA6B 3VHQA 3IC5A 1F4IA 3K0BA 2W48A 3D64A 5EKTA 1NXTA 3IILA 2JK1A 2W2KA 1KNXA 1ST2A 1VRVA 5DCLA 2W7TA 4FOPA 4CKWA 1JFSA 3KZKA 2Q2OA 1T5HX 2OR3A 4JXJA 1G7RA 5UKDA 4I1PA 1GKUB 1ZL2A 3T0FA 1KP2A 3PRYA 4V0MA 3B60A 3CH4B 3VLFB 1ZD4A 1QYWA 1UZMA 2HADA 2IBTA 2OBLA 1M83A 4MINA 1VIMA 1RAIA 4J0IA 5H83A 1D6SA 1W2WB 2UZAA 4XLLA 4LWQA 4DDHA 1WB9A 2VS1A 1NW7A 2FFQA 4YB8A 3NDJA 4F4DA 2VSNA 3S3TA 2VPPA 1I7QB 5A3VA 2LCQA 1RVDA 4LVOA 3P0RA 2FPXA 2C7BA 4O1MA 3TAUA 1JU9A 5TV2A 3T7SA 1LK0A 4QPPA 1RFLA 3K9NA 4PWZA 4KHPM 1BRMA 3TKYA 2H5EA 1VBKA 1KU0A 1GPUA 2Y67A 3THGA 4RL4A 1NMQA 5IVKA 2R2GA 5T67A 2HWUA 1QOQB 2DBZA 2RMKA 3V2UA 3ZCXA 5H4GA 1DU4A 5I8ZA 2Q3FA 2AUNA 2EF1A 2R25B 1O5IA 4RA9A 2GUWA 4U7FA 1AHPA 2LUOA 1XXLA 4QJIA 4CM4A 3Q5DA 3COJA 2RG7A 3BT7A 1U5CA 1IXZA 2GRJA 4GBED 3RYFB 4KR9A 1RU3A 1TZJA 4CM5A 3DOIA 4J7CA 1VBFA 2GEKA 2F9MA 3NBFA 3I2JA 1V39A 4HS4A 3SHOA 2RAUA 1ZV1A 2EVWX 2EL9A 2EJTA 3IHTA 3BFKA 1L1RA 3W77A 4JVLA 3TX2A 3L1VA 3F97A 3RWBA 4YBRA 3ZY3A 2GSDA 1P7VA 4PC7A 3DDUA 5K0EA 3TIXB 3VK7A 3RVPA 4PS1A 3NBKA 3L7NA 4OQDA 3HGMA 1FLDA 3B6MA 1HYGA 4YJFA 1CEQA 1Z4MA 4OLHA 4YFYA 5DHAA 2AI3A 4RVOA 4BVKA 4KQIA 4F12A 3S2UA 3R7SA 3TTYA 3N59A 3U4CA 2W2KB 1HDIA 3CG4A 2A14A 4ZJZA 1U99A 2D7EA 2AN5A 4LVUA 3FWPA 2IZ7A 5A02A 3LPMA 2XRFA 4CKWB 1U8ZA 4GQAA 2PFKA 3EVCA 1N7GA 1XZKA 2OP0A 2QD4A 4H0NA 4R16A 5M5BA 5ABPA 2PZKA 3EY9A 3C0KA 3ZQKA 3SJUA 4YI3A 1XT6A 3WXMA 1ZK0A 2KDLA 3EZ2A 3W2IA 1IFYA 1ND6A 1YKGA 2Z5VA 2XQVA 5ELLA 4H7DA 3ITNA 1URPA 3IT2A 2B34A 2PBFA 3H8JA 5HFAA 1QVWA 1NV8A 3HFRA 5I4CA 3CY6A 2TRSB 3C3JA 4EI8A 3DEKA 1NVBA 3A9WA 5LKAA 2H2DA 4A1OA 5DO9A 5CDUA 2JLUA 1A50B 4D42A 3K5HA 5T4EA 2IK8A 2IODA 3E3LA 4FD3A 2V5AA 5JHHB 1N9GA 4LMBA 2YS6A 4YQZA 1R4MA 2EDAA 4JR1A 3BVPA 2NV0A 4RHXA 3ZE6A 3WSTA 4IUCS 3H5WA 1QH9A 4FD2A 4RMNA 4KVGA 3FLMA 4RA9B 3WL8A 4CM4B 3FCOA 4RE5A 5A7HA 1EGMB 4AICA 3G2LA 3HV0A 1DG1G 4M38A 2G25A 2N42A 2JLYA 4CN9A 4XSHA 1T0JB 1PFUA 5ISMA 3ZWOA 1C2TA 1LY1A 1UMDA 1PV2A 2M32A 5C5DA 2P6OA 5TGDA 3L7KA 4Q02A 2DI0A 3AVPA 2JVJA 2AG0A 4CU2A 3GDHA 1NUPA 1J0CA 2VATA 1LVUA 2QY9A 2EUCA 4FX5A 2OZPA 4I1SA 4I9UA 5TE9A 3CLUC 2YWRA 4KLNA 3C7KA 3EAQA 4Q47A 2HEIA 4EKNB 2NXCA 5CIQA 1NHWA 4WURA 3LUAA 4TL8A 5KTMA 5CB8A 3LE8A 1ZA1A 4A10A 3G2IA 4KLRA 1LI4A 2XKBA 2M9MA 5KYKA 1FMFA 1V3QE 4CKCB 4ZDIA 3SQLA 3LKZA 1CUVA 4YDHB 3VYUB 1A69A 1QO0A 3V8NA 1C7RA 1ADCA 1XROA 2WV7A 4I19A 1BRTA 2J7PA 2F64A 5JY6A 2IZ1A 3ZKAA 3EQ6A 2OP1A 3T15A 3AUFA 4YUWA 3HWX1 2FQWA 2PV0A 1A7UA 5ERYA 3ZN2A 1G8AA 4J8PA 5JMPA 4C88A 3I01M 4KFCA 1MNQA 4NBVA 3OE5A 3EXIA 2EKKA 5AK0A 5HMMA 1I8TA 1MFPA 1PS9A 2EA0A 3RARA 2JRCA 1M8FA 4D4KA 3QVMA 1CULC 4ENVA 6ABPA 1KR2A 2XOKA 4ATNA 1K8QA 2C5BA 3ILYA 4U9IS 5K0ZA 1OPRA 1R4MB 1XKLA 4E22A 1PR5A 3K53A 4M60A 5FNVF 5CBKA 1XZIA 2AMVA 4U2FA 5MF6A 4M1KA 3MNFA 5FFFA 3JYHA 5FUBA 4LE1A 1YONA 2G0TA 5CXQA 5BYBA 2BE7A 2KI5A 3PSHA 4I2NA 1I51A 2Z2IA 1G2IA 4BNWA 3G0BA 4KI0A 3T3MB 3IX7A 4E46A 1RAAA 1C2YA 3T4PA 3JQCA 3KFVA 2JY7A 2CLIB 4PXSA 2V54A 2WU0A 4C4OA 1AUAA 4OI4A 5AJUA 1U7TA 1FJGB 2NAFA 4WXRA 4AULA 2H1IA 2WG0A 3BC1A 2PYIA 3FWNA 2DU8A 3TIGA 3OIGA 1W88A 1KJJA 3UGQA 3GEPA 4X66M 4WBNA 4KUGA 1TCUA 4KRYA 1ZD5A 1IOVA 4MI1A 1S9DA 3Q11A 3BREA 5JD5A 4MWZA 2B1GA 2EXXA 2RHCA 3P9RA 3A6JA 2MSWA 1M6EX 4W5OA 4Q1CA 4UCFA 5AT1A 5LA6F 5A05A 5GOTA 5F2KA 3IHPA 2HT1A 2VHQA 1GN9A 4EYOA 2R2AA 1SHZA 3VR6D 4ETNA 4FOTA 1SIUA 3V00A 4FB5A 3IDFA 1JGTA 3URMA 1K5PA 4MVYA 2JKVA 2VJDA 1NDUA 3A4LA 3I52A 2FMFA 4Q15A 1H0RA 3A2NA 3IR7A 5JAQA 3EY4A 3EXIB 1NY5A 1OH8A 3H2SA 3QPDA 1WL8A 3B3JA 4F92B 2ZJFA 3W1EA 2CSUA 2P1ZA 4I1VA 2ZT6A 3AKDA 1HL3A 2VTBA 4OQMA 2POCA 2JP7A 4HNHA 2DFKB 3Q8LA 2QLTA 1L1EA 3CZRA 4W5QA 1U0HC 1N3LA 1Y8QA 3HXTA 2IUYA 4QJ4A 5FB3A 5AWFC 2I67A 5G0VA 4FNMA 4TVSA 4EGSA 3V1KA 1OBFO 4GBMA 3DHEA 1SCJA 4DR2M 3T0GA 1TH4A 3O21A 1TLLA 3IE2A 1G6HA 5LQKA 4ILEA 5REQA 4NQZA 1KPIA 1O89A 2P6NA 1YCDA 3B52X 1NQVA 1TF0B 3PT5A 2RJ3A 4I1IA 5G02A 2RGGA 2XB4A 1KSFX 1ESMA 3F6PA 1Q83A 1FUEA 4NE9A 3VO8A 2XW6A 1SEPA 2RIRA 3OZDA 2IHUA 1YDGA 5TLSA 4FWTA 4YIKA 2V5UA 2AXNA 2VFAA 1QS0A 1UL1X 3WGGA 4CM7A 1R5OA 2HAKA 4QU5A 2PN1A 1D0KA 4M76B 2CL0X 3E3OA 5AKJA 5C18A 4TS1A 1AN9A 2XTNA 3M4JA 1O97C 2C3UA 3U26A 2QVBA 1O9HA 1AKTA 2RG1A 1E4OA 1EHCA 3F6RA 4IRMA 3E03A 4BQFA 1W88B 3C5HA 3NBMA 3M5WA 4ZI2A 2OEPA 2NWQA 5FCDA 3HB7A 1RJ9A 1G60A 3MG9A 4WBNB 1NN0A 1V0JA 4C5CA 1QLJA 4AJ4A 4FOLA 4WKNA 1AF4A 1MQ9A 2VH1A 1BROA 1ZJ6A 1MO4A 2DSNA 4HGOA 4DV5B 2B92A 3PBKA 2BRUC 2BCEA 3U4GA 1L9KA 1KDYA 5I51A 2QTZA 1VJ5A 1E3LA 3SMQA 1DO2A 3UN1A 2V1UA 3LECA 4WK6A 2G07A 1FDOA 1KJ8A 1V7PC 2FZCA 1ORYB 2DUWA 4S1OA 3UC5A 1SG6A 1GAJA 3GRZA 1BO6A 1XRLA 1TM1E 2HXGA 4A91A 2EJUA 2W82A 1YR7A 4XJTA 2FV8A 4ME6A 2JHCA 1WCYA 5A71A 1NBME 1KDOA 2BMDA 3M83A 3ED5A 3RRFA 2FN7A 2IQ5A 5CBPB 1WLSA 5C4GB 4KDRA 2O3QA 2I3ZA 2PX3A 2B30A 5F5XA 3UHAA 3N53A 3NQ41 3CKLA 4KO4S 4MUKA 1VEKA 4DR3B 1FJHA 3KJZA 1YDEA 3I3OA 1PTJC 2HQRA 4EFMA 3W0LB 2FY8A 2P30A 2VTBB 3JQQA 3TLMA 3OAAA 2Z3VA 3CR8A 4HGYA 1Z7GA 4Z6YA 5BYAA 2CFSA 1Y8QB 1VLJA 1Y6JA 3ONDA 4C76A 3D3KA 4BO8A 5B5SA 3VA7A 2G8NA 1MQSA 3EDCA 1R7RA 1VZ3A 4H6XA 5IC4A 4DG9A 1SQGA 3AC0A 4L5YA 2XXJA 1QRDA 5KAPA 2I66A 1ADJA 4XVCA 3TLXA 3T54A 5REQB 3DCNA 3DTYA 4OQXA 3TXAA 3EMKA 1OHHD 4G1BA 2JFOA 1Q5PA 2FWRA 2YIDA 2H52A 3BWBA 1CLUA 1I94M 2H16A 3T7EA 3WGTA 1PZEA 3AUKA 1E9AA 4JDUA 4UTXA 3PFWO 3ROPA 3OJXA 5JW6A 1CR6A 2JLVA 1C4WA 4G4SP 4C7OA 5H3LA 4ZYYA 1MG0A 5EXXA 2NOAA 1J25A 1CX9B 1CZUA 4DMCA 1UAYA 3D4NA 3OF3A 4DCOA 3HDYA 5AIAA 1ESZA 1WZCA 3L7AA 1GJTA 3IA7A 3GCDA 5TPZD 1OI2A 4FSHA 4QEKA 1V6SA 2DOKA 1WXDA 1TLTA 1ONBA 5LIPA 1RJ9B 2QTVA 1GWNA 5JDIA 1CY2A 1DIHA 5JC8A 1YZUA 4R6WA 2CDBA 1HNZB 1IXRC 3A58B 3KZXA 4P4LA 1FLNA 3DZCA 4PFSA 1UFRA 4DANA 4DLTA 1HFWA 1IHOA 3S2GA 4FDLA 1IZ9A 4O4JA 1MG5A 3UXHA 1QHFA 4TLDA 4J16C 2KMLA 3GEHA 4N5NA 4MB7A 3NIFB 1SELA 3QJYA 5HA5A 1XCJA 5BN4A 1MB3A 5EFZA 1YCFA 2BFFA 4PQYA 1E2QA 3N8NA 4G0MA 3THXB 3HR7A 2KZSA 1IXSA 5DNEA 2CN1A 4BQQA 1AK9A 1QB7A 3V1TC 5D7BA 5DX8A 4KAAA 5AM0A 4AYTA 2XZLA 3NHUA 1GPYA 2XIJA 2C1ZA 3Q0TA 4UU1A 4LY9A 4WCFB 3P4YA 2Z1MA 4HYYA 5AW0A 4JI0B 1DVRA 4KQKA 3ZS9A 1MRSA 4HZIA 3ZIDA 3A46A 2L7IA 1B42A 2KW0A 5B37A 5C8ZA 2UVPA 1XZ8A 4M0DA 5EKXA 5ALRA 2VI5A 1R74A 5FWNA 3X44A 2UYGA 3O4VA 4GOLD 3D7SA 2FW8A 3R24A 3LY8A 2RD2A 4V2UA 3T9FA 1EAYA 1P61B 4CN8A 1TJ5A 4LCBA 4DR5B 2L42A 2PSSA 4EPXA 2JGKA 3NHFA 3ROTA 3I51A 2O52A 4U9UA 5FADA 3LHIA 1UBKS 4MKFA 4FWBA 3AEXA 3LBIA 2NO5A 3NJ8A 5C4IA 5I3CA 1NBOA 2W2VA 1DT5A 4IBEA 3IDAA 2V6FA 4JCCA 3NASA 1XN1A 1R6DA 4EG3A 2VTKA 1XPUA 1I4WA 4F9GA 4TT3A 3MQ4A 1XEWY 1R88A 1HFEL 4AKSA 2Y6VA 4BGIA 3S5UA 4RNCA 1AS2A 3IAFA 5LLDA 3ZI0A 3N6RA 3INGA 1U5BA 4C05A 3KOOA 5AFSA 4ARVA 2XTAA 4IWXA 4RVDA 2RAVA 3IA2A 4B40A 3O4RA 4X60A 3LSYA 3F9RA 2WILA 2WJGA 1DJQA 4HQNA 2GJ9A 4YR7A 1OH5A 1VB3A 4P98A 5C52B 3IXQA 3E53A 1CUXA 1QQ5A 2C07A 3IGFA 2J0QA 4DJ5X 2QTVB 4MGKE 3TS1A 4Y8VA 2ILVA 1Z4LA 5HSGA 1GEEA 4CF5A 2HZBA 1XWIA 1WP9A 2DWQA 2ZQZA 1XQ6A 4A8JC 1CU1A 4ZXFA 2AW5A 5BV2P 1J09A 3KR9A 5KEIA 1RM3A 3V80A 3WLNA 3PRKE 3COYA 3KWLA 4X45A 4DREA 2R4TA 3OLYA 5BN4B 4BMDA 4RTKA 13PKA 1UC4B 2BFFB 2Y0EA 2VAPA 1XIVA 4RTSA 1IXSB 2C9ZA 3LA8A 4GKKM 4B3TB 2O2SA 3VO9A 4FEYA 1UXHA 2G40A 1W0CA 4PSUA 2RGRA 1MR3F 3H5LA 4IKEA 3JV7A 3V5NA 2PKYX 2XH9A 1QV9A 4M7RA 4D56A 4R1UA 3LY7A 3VDRA 1HPLA 3HPRA 1QGOA 5L4LA 1BU8A 2G83A 5IZ7D 5TSDA 1NE2A 3OPYI 4RBNA 3MOSA 4QQFA 3DZJA 2NG1A 4D4MA 2X86A 1ACJA 3ODGA 4HGPA 3RHZA 2W6NA 1PZHA 3MWEA 1UIMA 2AK2A 3SJBA 1LB1B 2ZSEA 1A97A 2VZ8A 3W5HA 2UVPB 5DASA 3QEBZ 1ZUNA 1LFAA 2G0NA 4Y2VA 5H37D 3KP1A 2R0QC 2PGOA 5BQ5A 3WBKA 5KI6A 4G4SO 2AG1A 2CYAA 3A36A 1UPTA 2VPQA 4U8HA 1S8AA 3AZQA 3KKMA 1H2FA 4OJTA 3RUPA 3LX4A 1TVKA 1NMYA 3FCEA 2HFJA 1EDOA 5FLKA 1I0LA 3KC2A 3G79A 2QZJA 5ALJA 2HA2A 4QODA 4OJYA 4KN9S 2Q6LA 2QVXX 5AUQA 3WLLA 1MN6A 3QXCA 1P5HA 4KT0F 4R8LA 2WABA 1SBCA 3R41A 3I4CA 3MIIA 5BW4A 3DEYX 3GAZA 4MTLA 4MK4A 1U5BB 3PDWA 2J3DA 1S3GA 2C9YA 3QPBA 4DTCA 3JWHA 2VDVE 2QOEA 3IT1A 1WHTA 4LWPA 4BFWA 9LDBA 2OQ4A 5JRDS 4ADSG 4AZ3A 5ITTA 1TK3A 2W9XA 4IXMA 1N7IA 5E1DA 5F52A 4F1WA 2E5LM 2ZOSA 4LJYA 1Y4AE 2AJBA 4HB3A 4NZPA 5F2OA 2V9ZA 4IDOA 3SK0A 4QOEA 4X7RA 4ARSA 3N2GA 4N18A 1QWSA 3F5MA 4NR0A 1EX9A 3VU0A 2Z4TA 1DTSA 4BRSA 5DCUA 3OEWA 5CAEA 4J29A 2WR8A 4CT4B 3U6LA 3LPDA 3OKFA 1H2YA 1E2HA 1F9EA 2XUDA 4OGLA 2EFYA 1IWOA 5D8DA 3MMNA 4UHJA 1YBAA 3SFZA 4D9NA 4JFRA 2J87A 1LGYA 3PD1A 3OA2A 2GGSA 2ATVA 3ZHOA 1YNSA 1QUTA 1ZAKA 2VK8A 3C4QA 5E2AA 5E7MA 2Z7JA 1JFTA 3ZVKA 1MJFA 4WFKA 2FB9A 3G0CA 3VR3D 5JI2E 1L4EA 1OFUX 2RHWA 2XFTA 3ILVA 1BG6A 4EX7A 3MWEB 3T5TA 1ZUNB 1SHUX 1PK7A 3T06B 4LHSA 2OBYA 2W6MA 3IB3A 1QZ3A 1T4GA 4WX2B 3P5BA 5GWXA 2VUTA 4KAXA 2I6FA 4G3OA 4KSCA 2Q8PA 1OI3A 1F4VA 2ZWOA 1PX0A 2BM8A 4D9FA 4EHBA 5HZMA 4Y6LA 4BNYA 4ONEA 1UP6A 3MBOA 4RESA 2HK9A 2V7UA 1TZKA 1PJ3A 5JSQA 1E9SA 1E7RA 4FYKA 4A73A 5BRNA 1VA5A 4BO0A 1GFWA 4HRXA 2XRYA 4ANRA 1T9CA 2WM2A 3MHTA 3VR6A 3SEFA 5BOVA 1WR1B 3RTEA 1MMFB 4NDAA 3DDSA 4W9RA 2J3HA 1DBRA 4L07A 2JBHA 3EYWA 3HJBA 2R8XA 1NF2A 1W8IA 1VSQA 3ZGNA 1EDBA 2PU5A 4ZEOA 2J45A 4WFQA 1NUHA 2W6CX 1EG7A 1W5EA 4KYVA 3OURA 4ZQHA 8ADHA 1VZ2A 1V9SA 3BX1A 2NMVA 1NJ1A 4KRGA 1RYBA 3IKTA 2D7GA 4JQOA 3U5ZA 1WHTB 1T6YA 1Y80A 1KFVA 4AZ3B 3K6KA 5FBZA 1JG7A 1NNEA 5LYJA 3AR2A 4YEDA 4ZC8A 1T5LA 1L4NA 1Z6GA 4FGJA 3GUVA 4HI0E 5KPJA 4LFBM 5CJPA 2Y66A 1ZGCA 4BNIA 2ASEA 4ZCPA 3IIMA 3RV3A 1DCKA 1L5LA 2Z9CA 2YBDA 3N2GB 3STVA 2A84A 4AO8A 3HYLA 2PD6A 4HAOA 1KZ1A 2I2AA 1P72A 1CRPA 3QW4B 4PINA 3SPXA 3LZDA 5CAEB 2FZ4A 3BTOA 2D7CA 4MQUA 5DX0A 4JNCA 4K05A 2YY5A 3I6QA 5B1YA 3A1TA 2GB4A 5KWIA 3M4NA 1C7ZA 1DFIA 3FTPA 4D41A 2HOQA 1CQIA 4FJ0A 2YW2A 2JJQA 5BP7A 3LPNA 5CNKA 5ES4B 2JFXA 1G0NA 4PS0A 4AQ7A 5IM5A 2CL7X 2WM8A 4E2ZA 2PUGA 3ZLTA 2JJ2D 3VRHA 1Z36A 2AQHA 1R16A 1Q15A 5FTWA 2H18A 2ADOA 3N0RA 2OKGA 4U7HA 2ZB2A 1FB5A 2IL1A 1QG2A 4MNTA 3GDWA 4YRFA 1K0UA 4BGDA 4Z9AA 4ZAZA 4AWBA 1JHUA 3PFIA 3H4VA 2JASA 1GL7A 1YB6A 1TU0A 3I9LA 1E1LA 3QH4A 5CA1A 1E69A 5I7FA 4L8GA 4S1WA 2GX6A 3L41A 1P1FA 4M8KA 2J7PD 2VJCA 5J2TF 2FDXA 3OEED 1G8PA 2G1PA 1EXWA 1QZXA 4FIDA 1ZOIA 1A2KC 4EQZA 1MT3A 3O2NA 4E5MA 5EQFA 3NATA 3C3BA 5T8KA 2VJBA 4TMTA 1XQVA 2W6PA 2WKQA 5KNCH 5FBRB 3EWNA 1DGGA 1PJQA 5KQ8A 3JRNA 3U9SA 4DM3A 4DC9A 4O3MA 1UEXC 3TD9A 3L05A 2CNOA 3LVWA 2UUCM 4TKZA 4F72A 3ZTWA 1VGVA 1XZJA 3HL0A 2D13A 1BNCA 3TW0A 4KFSA 1JE1A 2BMJA 5CM9C 2HPZA 4P6VF 1UH5A 1R6UA 4A3SA 5JBIA 3GOHA 3TUZC 3U5ZB 2CGEA 1D1PA 3RWMB 4BMSA 5ALQA 4XIFA 2Q4BA 5LYJB 1RYNA 2J5BA 4UKDA 1IG3A 4ZDKA 4RD1A 1AKMA 4ERXA 3QTBA 5LMZA 1UXKA 4B7UA 5E4FA 3GBVA 3JW8A 3U4DA 1CNMA 4TOIA 3SDZA 1MA0A 4JEUA 3QE0A 3CF0A 1UPFA 3KJEA 5L45A 3PDUA 5JCJD 3MRXA 4AG6A 2I71A 4C43A 4DHEA 3AGPA 1AUXA 1QUEA 5JNWA 1EFCA 2L09A 3QYFA 4A6PA 1OREA 4B3CA 1CQIB 2EFDB 2P27A 1PFKA 2MR5A 4MHTA 3UT5A 1NUAA 1J2JA 3IVRA 2B35A 1YQEA 3CUTA 3EJ6A 3KCNA 2Z98A 3ND6A 5FEMA 2Z6QA 3HHPA 1IQUA 2ORVA 2PU7A 5K3FA 4MLZA 2XNJA 4KAJA 4EZEA 1EE1A 3LCVB 2PD3A 2QN3A 1R0BA 1EJ0A 4HBGA 4BQPA 3G5MA 2ERXA 1IWPB 2V8OA 4RJ2A 5TPZA 3RE1A 2GA9A 3CX6A 3MCTA 5EIWA 1QF7A 3I0ZA 1VC2A 1CDZA 3FDIA 4I8IA 4JC8A 2PLWA 3D6JA 4JA2A 5CA1B 2JCVA 3RAFC 4AZTA 3IG8A 2WYHA 3T4XA 5JPDA 3NPAA 4JSRA 2HHLA 4BNVA 3LC1O 2C4VA 3TFWA 2BFEA 4QULA 2QUHA 3AF5A 4WLEA 2C4KA 1BGVA 2Y9PB 2I6GA 1OFIA 1CY6A 3L82B 3L6UA 1GLGA 3VOAA 1Y1PA 2FUEA 3A25A 1PEDA 3IAHA 3ZU2A 3FRIA 4E5SA 2OVBA 1ZUWA 2OL4A 4KR7A 3DZ8A 4FC7A 3DDZX 5K0CA 4ZJPA 3T94A 3IQHX 2REBA 1IUOA 1GYQA 2NYUA 4FNAA 2C8VA 3M49A 3QLUC 3HA7A 2NGRA 3UWSA 1MAWA 2OV8A 4B3GA 3UENA 3IH5A 4Q3NA 1W44A 3Q3HA 4PDGA 1S4MA 1L5GB 5EP4A 1C80A 2C5RA 1CJBA 1ABBA 3SC4A 5B64A 2P4SA 2AJLI 3LQ4A 2DAMA 1KBZA 1G0OA 1D9ZA 1JVSA 2XE6A 4GXRA 4XJXA 1EHIA 3AHFA 5GJVC 4M0UA 3WGZA 1E2EA 1MX1A 4XA8A 4ZT7A 5I5EA 2R46A 1DKQA 1YOBA 4EY6A 1XKTA 3C16C 1R15A 1UK6A 1UPCA 4N01A 2IPMA 1EHYA 3S2EA 5IANA 3ZVLA 3ZLUA 4X90A 3F5SA 4OX9B 4FCVA 1QIEA 3CRVA 1YS2X 4N5IX 1CUKA 4EKDA 3FROA 3UT5B 2VF4X 4BFSA 1W19A 1MVOA 2XCIA 1G9SA 1Q3BA 2CJFA 3TDNA 2O59A 4KQMA 4MQFA 1ZS9A 2AKYA 4LXHA 4HYQA 5K3FB 1TK9A 4XPZA 1T5TA 4J0GA 3K70D 4KQJA 2Q5JA 4U2KA 2YZMA 2W2MA 4GHWA 1A7AA 2VWHA 4ER6A 3W67A 1VE5A 3N8HA 2X2FA 5ETJA 1JDJA 1NYLA 3STYA 2E85A 2CBZA 3TD6A 2OCKA 3T12A 4OM7A 4FCWA 3MBKA 1RQ2A 5JS2A 3BGVA 2BJWA 4A2WA 1Z5GA 2BFEB 1DKOA 3GXOA 1OX6A 1J9GA 3NS7A 2WJ6A 3ZDXB 2ZK7A 2X9VA 1IK4A 1GV1A 3CINA 4YXWD 3G9UA 5L9AA 4MRRA 3W06A 4B8YA 1JDNA 1NPDA 3UCEA 2AOVA 5BPFA 5B6IA 4N7BA 3KL2A 1VI2A 4NOOB 2A59A 4MUGA 1P1JA 1SKQA 3DE6X 2ZJ5A 4IFEA 2HRDA 4WWHA 3WGVA 1WEKA 1Z5PA 3D7LA 4DSNA 3V8VA 2V9PA 4Z2AA 1QVVA 3KUUA 1QFJA 5J9FA 2WTAA 1XA3A 4TROA 3UYLA 3BEDA 1Q6YA 2X1HA 3WZLA 4GNRA 1XCGB 3O1JC 5BQ3A 1TQ4A 2ZE5A 2FOLA 2EOAA 4U02A 1TDZA 2G88A 5LB2A 4YGYA 2QIPA 4IDFA 4K9SA 1KBQA 3A6KA 3T1HB 3X2SA 1F20A 3GJ0A 4TZTA 2J33A 1GU0A 3QX9A 4MUAA 1G63A 2XF8A 1J5EB 3RUFA 4OLFA 1YE5A 1Z7BA 4LNHA 3NRCA 4AAYA 4X92A 2J3JA 1YQXA 2HAEA 4UTRA 5AVQA 3CJQA 3ZZ1A 3PWTA 5JSZA 4G4OA 2K47A 4IGFA 3C74A 2Q41A 4TQAA 4MQFB 1IN6A 4BAGA 1U0SY 3EOBI 5EYPA 5JYDA 3WLJA 1N32B 3OX3A 1A1SA 1C50A 2N1BA 5BNZA 2JXNA 1RHUA 3QK7A 1P5JA 4GLBA 2H4ZA 2OCDA 4EW2A 2IYEA 4X94A 2ZBFA 3IEUA 1OY1A 2ECPA 2GM9A 5JLJA 3GRUA 2GZ1A 2X8BA 4DW8A 1QU2A 4K6FA 3OA0A 1QRAA 2GAOA 5DBEX 3HUEA 1XZFA 1C0LA 2JAUA 3IUNA 3FOEC 1P1HA 3KAJA 3G0HA 4H1VA 1VLZA 1EE9A 1RI3A 4HVAA 2LVQD 1Q7CA 3W3AD 4M54A 3NC4A 4CL2A 3Q8WA 4J4BA 2M5ZA 2BGLA 5GM2A 3A06A 4JYCA 4UBKA 3JWJA 1RQGA 2VLIA 4NDZA 2IS4A 2YCBA 1RI2A 3WMXA 5A4KA 3ONFA 1UANA 5HM6A 4N6GA 1KJIA 5DI9A 1B1CA 3K9HA 3TLJA 3QUTA 4U1RA 2QW8A 3PEWA 1GFIA 3WGYA 1TXGA 2CLDX 5F4ZA 3ETCA 4II3A 2HH9A 4Z0TA 3SS8A 1LC3A 1O54A 3UZUA 3C2QA 4WINA 3WYCA 4A5OA 5HR5A 3TOZA 1VBNA 3DDOA 3VR3A 3GJ7A 3MEQA 1HOXA 4ZVQA 5CFZA 4IHJF 3I0NA 2AMJA 2WYVA 2KLHA 4R8SA 3K0KA 4MSUA 4CKCA 3SIPA 5J5VA 3WGNA 3WOVA 1QSGA 4Q24A 4C0KA 2DZDA 2HQSA 4BFZA 4BVLA 5FYDA 5CX1B 1P2FA 5DOZA 1VEJA 1TMGE 4KGVA 1OX4A 3A6ZA 1RQLA 4B5LA 3QQPA 4EL5A 4WZ6A 4DR6M 4TT3D 3RGSA 1GOTA 3QENA 1E9BA 1Y4DE 2V98A 2AH5A 1RP7A 4C0QC 1FEZA 2CLFB 5CFPA 5EXSA 2XT0A 2BUAA 2KS6A 4S3MA 4XB2A 2ZRPA 5JISA 1EDEA 3VC3A 3AF1A 2X7XA 2KNVA 1JR2A 4YP1A 1L7EA 3ENQA 3PUYA 4Z7OB 4I8DA 3VDQA 5TQVA 3RVSA 3GFRA 4KFUA 5JSZB 2GCPA 2FN8A 4UTOA 1ZPDA 1I13A 5G1NA 4MYHA 1PD1A 5EYPB 1NJ5A 3RBZA 1ZZEA 4WL0A 3NOOA 4DDMA 2HQ1A 4L5BA 4EGCB 5BMVA 3KPUA 3UJNA 4U2DA 4C3ZA 4BECA 2VP3A 5L4NA 1I6MA 1OMOA 1I36A 1ND5A 5JMTA 1CPYA 2IKQA 3AW8A 2IKSA 3B3FA 4CQJA 2EFEB 3E5RA 1A4RA 3O8LA 3MMZA 5DWDA 1NXVA 2CW5A 4LRQA 2V55B 1G2OA 2PSJA 2AJTA 1V34A 4AN0A 1XZMA 1WO8A 4DNFA 2PUCA 2DPLA 1S2IA 5CLJA 4HPXB 3CUSA 2OUIA 1YB4A 2YCLA 3UK7A 4V1CA 2IYNA 1CJCA 1XRPA 2DT8A 3VJKA 4TS9A 1XALA 1HDCA 1AB6A 5K7SA 4C3OB 2Q1TA 1E3IA 4FGZA 1K3WA 2ZXEA 3B7ZA 4FYIA 4KYTA 3L4BC 1X8KA 1CW2B 3PUVA 5C0OE 3ZNPA 3NWOA 1TD1A 1E9DA 3GVPA 5EZ6B 2JBWA 3MPOA 4F9EA 1D1SA 3CVJA 4DR4M 2JRLA 1YUMA 2FP3A 2EX1A 4XX1A 1Q20A 3OE4A 4XVRA 2JJ2A 4EHJA 3M4ZA 2O01F 3ZCSA 4ML3A 3BXFA 2WT9A 1JIVA 2E48A 4KXFB 1CS0A 1VFPA 4I55F 4FFMA 3K0CA 3HCOA 1I7PA 3BD8A 4GGPA 3K0FA 2NPIA 5CVTA 1JPNA 3EEFA 3D3EA 1E1CA 5LWHA 3ND5A 4XYLA 4NZZA 3KO8A 3VR5H 2XEDA 1FYFA 2ASVA 4BTVA 3RHSA 1OX4B 3A9CA 4GP9A 3IAEA 3T3IA 3PFFA 5H68A 3CX4A 4E5VA 3CUUA 4HWKA 1ADGA 3OEEA 3MLBA 2W8ZA 1KOFA 3DWIA 1FVHA 2XUGA 2I1VB 2IXDA 1FXWF 2ZS7A 4YQFA 3SHGB 3G8AA 1Q1GA 3FNGA 4BRUA 3NFRA 5IVIA 1JDPA 2M2IA 3NO4A 3N0XA 3DVQX 3TSYA 3G6KA 3WDKA 1W8DA 5JJ5A 3KKNA 3ZY4A 5B58T 2BFNA 1WBDA 3DB2A 4X62M 3CWZA 2LE0A 4E5DA 4OSEA 1ZNWA 3C4VA 2HIGA 4HBZA 3UIEA 2VBCA 3T61A 1LBIA 2HF8A 1HLPA 2ZVJA 2AJ8A 4BWGA 3D54D 1NSFA 5A2QA 4GVLA 2DHDA 4C0BA 3HG7A 1G6Q1 5A4AA 3LZCA 1IHYA 2Y1KA 2H9IA 2QNBA 5BMVB 4FHEA 4F93B 4WOJA 5EL0A 1Z0SA 3EXG2 1D6NA 3H86A 1AKYA 1I14A 2WOOA 4P5PA 3O75A 3MJVA 1ML3A 3CO5A 1G16A 2DHCA 1TA4A 1NWCA 4I5GA 2BBTA 4AM8A 4UVEA 4CMCA 1K8XB 3O3CA 1PHRA 1TIBA 2IYVA 5JDCA 4HFJA 3T5PA 4EVRA 2X9QA 3KUKA 3SS9X 1X42A 3KJFA 4D3FA 2D0DA 2Q3BA 4TWRA 4CF3A 4JI8B 1G8HA 1UXIA 4O4HA 4OJKA 3E7DA 5CFLA 4V1CB 5JCJA 4H08A 1UODA 2QS9A 3DL4A 4YJGB 4BY9E 5JALA 4AZVA 1XLTA 4OG2A 1A2BA 1M2JA 1QVRA 3V7NA 3OZ7A 4AMVA 2NP6A 3EDYA 2GO1A 4RY0A 4EZBA 2WU4A 4WOKA 3JYLA 4U6QA 3IAAA 4KWIA 2ZZNA 1OYVA 2XMSA 1R9GA 2CLOB 4IXNA 3UKOA 1PJ4A 5B3JC 4D2IA 1YH3A 2I9PA 3F7OA 5JCOA 4IBDA 1V9CA 4CF4A 3GWZA 1CS0B 3J7AC 5FFMA 3NM6B 1NLFA 2BP7A 4EA8A 2GKOA 5ERXA 3K0FB 3SBOA 1F51E 3DLAA 1E1CB 3BXPA 2WTEA 2ZAMA 1LRKA 3JSXA 5CU7A 3TD2A 4KGDA 3RSQA 1G9XA 4DV4M 4PLZA 3E7PA 2XMGA 4DUYB 4N3AA 4KVFA 3D2AA 1YI1A 4NYJQ 4BBAA 2HJWA 3VNAA 3P27A 4O0MA 1IBMB 4DLAA 2QJTA 2E3JA 5AVSA 3GLHA 5BRAA 3P32A 1Q39A 1MIOB 5SICE 4QZVA 2GEJA 4BFLA 3T3EA 5CBPA 2XDAA 4DOMA 2D2IA 2A9KA 5KWJA 4PSAA 3QAUA 3IURA 4MJ7A 3MJHA 1K92A 2J7OA 5CJJA 3CX8A 2BZ1A 3SZRA 3KUXA 1RAEA 4C20A 4OHZA 2AR0A 3LLMA 2HWWA 1Z26A 1N7HA 1L8OA 1VHLA 4XK8F 1UWLA 1U2DA 4LV5B 1C7IA 4K9RA 3OU7A 4YCJA 3UA3A 5BUSA 3FPCA 3V9AA 1XRRA 4A03A 8MHTA 1AGPA 3U17A 4E08A 2Q2VA 3FB4A 4KXYA 1KMCA 2WJWA 3PX7A 1BCSB 2PG3A 2ODEA 1QYXA 2H4XA 3IERA 4BLTA 2RGWA 4XYEA 4LMRA 2PDAA 4BB9A 4GWKA 2P8SA 3MFYA 1U0TA 1HE1C 5I9MA 5AVTA 4KNVA 2DMRA 3U09A 1DV2A 4YJ3F 1T13A 3A11A 5AM2A 3FR7A 4DIFA 3RKUA 2F9FA 2XVMA 2VXOA 4PTYA 2YHUA 2PYDA 1LNSA 2PSHA 4XQ0A 5KTYA 2HRBA 4HAWA 3EMDA 4BRWA 1UOQA 2XTZA 4O4HB 5LDHA 1HDOA 4BU1A 1TLFA 4D8YA 3PNKA 3E4CA 4KUHA 2E4YA 5H3HA 3RVMA 3TR0A 4JB2A 5CK5A 2G1AA 3B48A 1QG0A 2DVWB 3PENA 1M8KA 4D0LB 4Y9TA 1PYDA 5AKHA 4ZCLA 3JZDA 5I9LA 5DLEA 4JI1M 4FI3C 3R0JA 3B1FA 1TTQB 3BBZA 5L7YA 4XTCS 1K3XA 1XO1A 1W46A 3PNQA 4EHIA 2N1MA 1JQAA 2NSLA 3ROXA 1LA2A 5AW8A 3AF0A 3TJRA 4M1EA 2GCIA 4QVKA 3SEQA 2WD7B 4KJXA 3V2HA 2XMBA 2XUKA 3BWMA 3P5SA 2BP7B 1KDPA 1DQYA 2Z2ZA 3EASA 3AG5A 2QT0A 3GLKA 1Z18A 3ZJVA 2ZS9A 3H0CA 3U48A 4LSWA 1W49A 4CR8A 5EQJB 3MIZA 2XNCA 2DAEA 5I9SA 2YMMA 1KDTA 3THXA 1QCCA 4J0KA 4UUQA 2QJFA 1NR5A 5BUZA 5HK9A 2ZRAA 4ISCA 3RR2A 2D8MA 4NOMA 4UJ5A 1J0DA 1IEQA 2IOFK 1JE0A 4U6SA 1TQHA 3GLHB 5H5JA 3UXMA 4NMHA 3KAKA 2AR7A 2LPMA 4RVGA 3F4LA 4LV8B 4YXWA 3U62A 2FWNA 3ZJTA 3TXYA 4WCFA 1RHRA 1L4KA 2HV8A 4LDPA 3SDSA 2V3VA 5EAIA 3GQ3A 2BF4A 1CWUA 5DOVA 2CE2X 3BWYA 1NMSA 3H8WA 1VIYA 4NFLA 5GZ3A 4EJMA 2GVZC 2ZVPX 4YK7A 4JASB 4IL5A 1S2OA 1U98A 4IOLA 1YZNA 4L5JA 2COKA 3HSYA 2EHDA 3H5RA 1Z88A 4YO7A 2PSEA 3AEUA 3CXUA 4Y2UA 1U0OC 3BXXA 3NYWA 3I0MA 4BJHB 3CLRC 5AW4A 2CE7A 3GDGA 3UJ8A 4I4TA 2E7ZA 3BPSA 3OFND 5BWOA 4IDHA 4DWJA 2J30A 1Z0DA 2VDBB 3O1HB 1PR9A 3TBHA 2W11A 1GXSA 2ZIAA 1FDTA 1RI1A 2ONKA 2EWMA 4IFTA 1BEEA 2XODA 3ZZ0A 4MVJF 3OIFA 4BATA 3N39C 5DTEA 4MVJH 4M89A 5AXDA 2PVSA 2GYVA 5FO1A 4REMA 4ZPXA 3FYHA 1KRHA 3OU6A 2ZRDA 1HNXB 1KI7A 1HE2A 4KIUA 5K8CA 4JI4M 4MUJA 1JILA 3AIKA 1GNQA 2IEGA 3Q3JB 2WHQA 6NULA 4TL6A 5LZ5A 3G8CA 5IT0A 1A9RA 3SYKA 3QNMA 8ATCA 4QJ5A 4DLLA 3K70B 2XOEA 3N7TA 3HBMA 1QRRA 5IYZA 1PHPA 2IIVA 4F3KA 1JSRA 4GI5A 3UMGA 5EIBD 2R97A 3ZU4A 3B13B 3PXAA 2NQ2C 4OM8A 5HXAA 3EQ7A 2PKQP 4F8YA 2PXXA 1P1KA 4QYIA 4FFRA 1Y1RA 1OYWA 4TM7A 2QN2A 3J7TA 4PFQA 3ZIAD 3L1JA 1LEHA 1NHWC 1EVYA 4IVNA 3TWMA 2CHQA 5U4XA 4L9RA 5FULA 3RRYA 5JAUA 3MRSA 2PRZA 1SCBA 4NBTA 2ST1A 4LF4B 3W3AA 1GZ3A 1BXRB 3D6FA 5CLHA 4PQEA 4MGYE 5B1SA 2FPPA 4QASA 4F5EA 1IMOA 3ROMA 1QHNA 1JKJA 4J1SA 3WL4A 5LQUA 4CG2A 3ZJUA 1DAKA 2Q4TA 4TUYA 4AG3A 4ZN6A 3G89A 3GRKA 4JLAA 1B0PA 2Q6TA 1DGFA 4N6OA 3K2BA 4FE3A 1PFWA 2GN6A 4WK2B 4CM6A 3IAS6 1VLMA 2R7MA 5DK6A 4WNIA 3FUWA 1WKBA 3SHQA 2R8YA 4A5SA 4FHDA 4TSRA 2E4VA 1P45A 1PJBA 1TDJA 1TRHA 4PC3A 1QOPB 3GLGA 3AEUB 3KKEA 1ZJYA 3FOAA 3BXEA 4WEOA 4JI3M 3NH6A 4YWJA 3H3JA 1EUCA 1LI5A 2YRWA 4I4TB 4Y6PA 1IB0A 1KEWA 1B76A 4H7JA 4CRWB 3IEIA 4F9FA 1P1RA 1YZKA 2J5XA 1XZEA 4EG8A 3W7AA 4NSNA 2MDTA 2BBWA 4L0MA 4CTNA 5EMLA 1VMDA 1KI3A 1GXSB 1T0UA 3ND8A 1SA0A 3RBVA 4ENPA 1I24A 3DP9A 3S7ZA 4R8VA 2ZJAA 3LBYA 5IMSA 5LMUM 5BSUA 1GG2A 1XMSA 3SIXA 2BI8A 3AU9A 2BL4A 3DJYA 5FWYA 2HA7A 1QZTA 5B7GA 3Q1KA 3QVGA 3AIMA 1SVWA 2Y0BA 5LC1A 4P8RA 3RS4A 5JS1A 2VAMA 4F3TA 5TQJA 4DCJA 1T2NA 2O2GA 4EDHA 4EBFA 1ODTC 2QU8A 2D7HA 4IEFB 3T1OA 4B2IA 3O7MA 4BWYA 1K75A 3AM5A 1BEUB 1PUXA 2JIMA 4MRMB 1Q1QA 3NHPA 3K3PA 3PKIA 2NYRA 1XAIA 3L7OA 2CFTA 2FSVA 2AOWA 5IYZB 5LLSA 3CNQS 4YPFA 1OYYA 4H59A 2PUWA 1DJNA 1W34A 3QHQA 4AXBA 2EF0A 1YDMA 3TZQA 4JLPA 1C29B 5KVCA 4D8VA 4GLFA 4QYIB 5I48A 3IEPA 1I32A 3MAAC 3FDXA 3OQNA 3WL5A 4F4UA 4EHFA 4B4UA 3F6BX 3D0KA 2WA1A 3L7IA 5H1YA 2P5YA 3VKWA 2A1TR 2O2DA 4NAHA 5CYGA 2AD1A 1BTOA 4C6TB 1FX0A 3VXKA 2FPPB 3IAM6 3WWCA 4LNAA 2GEDA 1JKJB 4BX2A 3HU2A 3BN3A 2C2KA 4IOKA 2XXBA 2AKAB 4TUYB 3G59A 4DWOA 2IY7A 5LBTA 4DV3M 3FPFA 4KU4A 3LM8A 3E46A 9GPBA 2DXIA 4Z3DA 3TMAA 4KO8A 1NRJB 1KS9A 1GSAA 1WWKA 3ENVA 1JJBA 3HB0A 1NDHA 3LUGA 3ESQA 3GLGB 3OZIA 4GX5A 3RKRA 1PQYA 2B83A 4L51A 5TPWA 5LN1A 4J90A 4MW5A 4BKUA 1EUCB 3R4CA 1IPEA 1VG1A 1Z34A 3C41J 3KRTA 2GHQA 3OZEA 3AY6A 4QARA 2KLBA 3C3WA 4LXQA 4TLLB 1NW4A 3WWEA 2O1EA 1IBCA 2Q4DA 4M0MA 3TOSA 5K2MA 1SA0B 2FSSA 3MHPA 4HY3A 1GQQA 1LDGA 4TTJA 4XVHA 1B23P 3K0HA 2NO9A 4EFDA 1U3DA 4G0QA 3M6XA 4HK4A 3FHTA 5DW0A 1SC3A 4CDMA 2XHZA 2ZDGA 3VPCA 5FWYB 1KK2A 2YJTD 3FW1A 2PKQO 1XLUA 5EP3A 4YFVA 3RFXA 1L5HB 3QVGB 5IC5A 1ZA2A 4FU0A 4A23A 4EO9A 5TGZA 1SVMA 3A6GA 1J97A 5DLQC 4FR2A 4G85A 2OCXA 3HHEA 1WU7A 1EK1A 2QTGA 4EL0A 4ZPJA 5ILOA 1K5DA 1TQ2A 1SQFA 1E9RA 4Q3DA 4D4HA 1F8FA 2WZQA 1WW8A 1N6HA 4B3SM 2V0GA 3EC7A 4FLEA 4QDXA 3TL2A 2VJLA 2VOEA 2YZKA 3KPJA 4EPYA 4K8OA 1PWZA 5KPZA 2LVPC 1IZYA 2W4MA 4YP9A 2BMAA 3ZE9A 2F1OA 4XQEA 3V1LA 3NTOA 1P2SA 4PCUA 2OFWA 4DSAA 1NSTA 3GLTA 3ZHUA 1G2QA 2P11A 4I5DA 5KVSA 4QM7A 4W82A 5FPSA 1QH8B 3ZKWA 4KIJA 2B5OA 1FU7A 3L43A 1E5XA 4WVLA 2ADFA 1FX0B 1EGHA 4Z3KA 3WP0A 1COZA 4XWGA 5B3AA 4IDGA 2OBNA 4P7BA 2WF5A 1US8A 1VYVA 3H9CA 5C7YA 2DNAA 2DR0A 1SIOA 4MV6A 2NTEA 2YNMD 4JLJA 3IAS1 2BI4A 1ZX1A 4NYMQ 4KQFA 4PO1A 4FZ5A 5HF8A 3M9XA 3F4BA 3E82A 4N5LA 1GQFA 1ZNXA 3GPDG 4YP5A 2PO7A 3LQYA 4L08A 2BVNA 1XP8A 4QD3A 2ZYRA 3AX6A 5TPWB 1GJSA 4BVHA 4DA8A 4H6PA 2RI0A 1VSBA 2QTTA 2WTBA 2Y77A 1AKWA 1EVLA 5FORA 3Q8XB 3IS3A 1OR8A 2NPOA 4HRVA 2QQFA 3GEBA 3KSXA 5CCBA 3LY5A 1WCWA 2H2FA 4MUHA 3B1ZA 1RRVA 3KTAA 3GLFA 1NVMA 4PFJA 1ZVJA 1ZH6A 4TLCA 4D9CA 3N7AA 4N65A 1UINA 3CNLA 3O82A 1U1FA 1A4UA 1H5NA 1MC5A 3PYMA 2HSZA 3GYBA 4PPYA 1K8RA 2WG1A 2VNHA 4B47A 1SD2A 2NSDA 5DCYA 3CKMA 3OY2A 4JENA 4DXHA 5KOHA 5C81A 1R4GA 1GG5A 3ZR4B 5EN4A 5ADHA 2BCJQ 2Z3XA 3H5IA 3QNUA 2WWRA 4TWJA 1PUJA 4CV3A 1TUBA 1LTHR 4ZALA 2XBLA 1ZGBA 4EPVA 4DCMA 3JYQA 4JI5M 1DBIA 1PJ2A 5AKZA 5F73A 5GV8A 4RPJA 3WYAA 3AEZA 1JHRA 2ONZA 2VR1A 3DQQA 3N1UA 2DQKA 1F6WA 4MGHA 1APBA 5C46F 3U7EB 4FGWA 4LNUA 4YT4A 4I1RA 5JD4A 1VL1A 2NT3A 1KORA 1U3GA 5EJ7A 3L8FA 3KFLA 5JDIC 1GU1A 5SZIA 4M4SA 3JAMA 1FS5A 5FO0A 5IP5A 3E9NA 2YFKA 2XGNA 2HC9A 3C87A 1NQTA 5KU1A 4HEA6 3FUTA 4YMVA 4DCNA 1PNTA 3MGBA 1WZUA 3ZKWB 4IO1A 5IRCD 4U0KA 1EBBA 1BMQA 5KQMA 4F1JA 4ITUA 3IAM1 4PLPA 3E9ZA 2Q6OA 4NU0A 4HAIA 3QIVA 3OCVA 1XTVA 1GUBA 1US8B 1HKHA 2FQYA 3FWHA 2ZTSA 2FFJA 4HSGA 2CF5A 1YL6A 4X65B 3NOXA 3KXDA 3LHFA 4BNHA 2C0QA 3A37A 5B2ZA 1FNMA 1RM5A 4Z4IA 1STOA 3ND9A 3F3SA 1ZOSA 2GAIA 1W4BA 1U3TA 4M9QA 1NZJA 3OESA 4BO5A 4LZNA 4ZRMA 1EM8A 2X0IA 1DV0A 3AFIA 3T41A 3IBGA 4CLXA 3UANA 5AVVA 5HKKD 5I3ZA 3PFNA 1QHSA 4W4TA 4UC0A 2ZJ2A 2QYOA 2C29D 1ZM3A 2Y27A 3ZYZA 3DAHA 2P5TB 3AJ8A 1BE1A 4FFSA 4I46A 4KPGA 4WY5A 4DLSA 3A4IA 3DG9A 3HYSA 4HUJA 3H2IA 1DIOB 1P5ZB 1KP3A 3CF4A 3LBAA 4B6QA 1CRLA 2HD4A 1TJYA 4C87A 3UFXA 3NWPA 1YT5A 4COKA 2O23A 3M6AA 3V4ZA 3ZBTA 3KTAB 5C8YB 3GLFB 1I0ZA 3R6TA 3KXKA 3CR7A 1NVMB 2ZE8A 2NM0A 2QUIA 1ZM4A 2VDLB 1E1YA 5LXTF 2Q3EA 3A6HA 4A8HA 3H5NA 2RGYA 1A71A 3I6YA 3BF7A 3FWYA 4MH0E 1X7ZA 3K9FC 1W75A 4BWVA 1VIVA 3WYDA 5KOHB 3WOHA 1DC6A 2ZBRA 3SG0A 4CJ6A 3NALA 3STTA 3ROEA 1JEAA 1ORDA 1X13A 2WJPA 3P2IA 3L79A 3V3KA 2MTBA 1TUBB 1PL0A 4FKZA 4F6LA 3KWFA 1F38A 1NBIA 3GJZA 3OLXA 2PUBA 4RJJA 5K09A 4B81A 1Z82A 3PZRA 1LV8A 3BDIA 3G5UA 1AK2A 4DXAA 3ZC7B 2H2AA 4P9NA 1PSDA 3C6MA 4JT2A 4LNUB 4HT3B 1JQKA 3C15C 4DDTA 4FFWA 3WNCA 5EMKA 3KSBC 3G1WA 5DNDA 2QLFA 3OFNA 1H1TA 5EVCA 1SIWA 3V4RA 1GL3A 4WCVA 1DADA 3EVAA 4OXXA 2CVFA 5F7OA 3V1YA 1JB1A 3LVQE 3AM1A 4Y0AA 3WLIA 4TTTS 3WL3A 3CN7A 3ESXA 3Q15C 3TCXB 4WE3A 4EBBA 2FGJA 2PCLA 3DB1A 3NDRA 1CP3A 3EX7C 4R40A 3N9IA 2R6DA 3NNNA 3T5GA 1MH9A 1ZCAA 3ET4A 2XUQA 4KSBA 3OKPA 1YUBA 4CCAA 1T0IA 2VK1A 2FRVA 2FR0A 1R1DA 4IM7A 1YE9A 3BOSA 4CFYA 4PGFA 3UA4A 3QF4A 2CMHA 3FMGA 1XTPA 5BSWA 2BFDA 4TWZA 2UYCA 1FRVA 2WAAA 4UNSA 2QLLA 3L93A 4BX8A 1PEAA 1BOFA 3M4YA 2Y0TA 2J6CA 3GQBA 4K7JA 5BT8A 3QEMA 3VDXA 2JCSA 4U8GA 3R9XA 1QAOA 1EM8B 3N05A 3TEMA 4JU9A 4IZ6A 5J47A 2IX3A 2HO4A 3PQ7A 3Q8MA 1X38A 2PRKA 4R1NA 2IP2A 3HKDA 5B2EA 3WDLA 2WT4A 2O1SA 5DE3A 2HCBA 1K8YB 1QF6A 4GOOD 4LFAM 4CV1A 3ZHTA 1GD1O 5LD2B 3KDSE 2VQEB 1BC5A 4O02B 3ZI7A 1SU7A 1I1OA 4HVTA 1V1RA 3ZIAA 4KODA 3UFXB 3CS3A 3DE2X 4BO7A 2W83A 2XUAA 4XUDA 3S1AA 4H1WA 4ZMBA 1G20A 3I45A 3PTAA 2YVQA 4IQGA 4D44A 3B7GA 2Q5FA 1ONSA 2WMYA 3S2FA 5FOQA 3PHIA 5DYGA 4YHHM 5EY5B 4BE4A 1X7ZB 4RDHA 2HCJB 1MZPA 1HDEA 3CH7A 1DPFA 5DRYA 1W94A 1YASA 5FAXA 1N5IA 5E3JA 2AXPA 1IWBB 1GPLA 3RC7A 3JWIA 5KBYA 3NGLA 5BSGA 1JU3A 1Y4SA 5FUYA 3EARA 3HCWA 3KYJB 3P2YA 1U9JA 2NZUG 1ZIOA 4Z4HA 3E4RA 2X5OA 4N41A 1GTZA 3NHYA 3S5JA 2RHBA 4E4RA 3U3XA 4P7JA 4AMYA 3P0FA 4B7AA 4AG5A 3IIIA 3CISA 4MDEA 5FA8A 3CEMA 1BWQA 2PJDA 2GJSA 3SSMA 3C70A 1U7ZA 3PQFA 1EP1B 1PGYA 3SZMA 1SH7A 2BYTA 3PKZA 2IDJA 4XDHA 5CMLA 1IATA 3GPLA 3PFHA 4HEA1 1MORA 3YASA 1AGXA 1X7WA 4QO7A 1TW2A 1GA6A 5AKKA 1SQ5A 4Y28F 2PGIA 1R12A 3ST7A 2I2BA 1OAOA 1XMOB 1BFUA 2R48A 4HDOB 2FZEA 4H3SA 1M1XB 2VJMA 4FUQA 1FTGA 4NSOB 3FRHA 3HCCA 1T8PA 2OHOA 4GITA 3QF4B 1NN1A 1GUAA 4WEQA 2BFDB 2FOXA 5LYYA 2QN6A 1GFSA 2WZDA 2IVZA 3ORFA 4E7PA 2DWLA 2PQ0A 2WVAA 3GQBB 4FFNA 2OGTA 3QEMB 1E6CA 3D8LA 3R9XB 3UJBA 2ZKLA 5BR8M 4MW1A 2B7LA 3DMDA 5M04A 2VJNA 2AXQA 3HKDB 4TYQA 3Q3CA 4IXTA 3D2CA 3OTIA 1L5MA 3Q7IA 4EYKA 3KSMA 1NG9A 3O2JA 1FTNA 5HYVA 2Z6UA 4U39A 3ZE2B 1V1RB 1DOAA 1DCMA 5DYIA 3IOCA 1FNNA 2WINI 3S1AB 2WVHA 1OGJA 3BBPA 1G7CA 2HSJA 2JI6A 2GF9A 3WTBA 3VHLB 3V32A 1BS9A 1G20B 1D2CA 5AK3A 2OM2A 1TPYA 2WNIA 3RRNA 1Q1NA 4C4YA 1WSAA 1I2AA 5BSTA 5CYFA 1HT3A 2QGNA 4F2WA 1DDOA 5DBHX 5K3BA 2YRFA 1GARA 4RACA 2QMOA 1ICIA 1DIRA 5CHYA 4TS3A 4X1KA 4ZQGA 4V0ME 5EJ5A 4HC4A 4E88A 5ALEA 4L22A 4NC6A 3AYXB 3K30A 2ZI7A 2BH2A 3TINA 4UPDA 1YMQA 3NEPX 3QEJA 3UJPA 3ZGLA 1RCTE 5CX1A 1RRMA 3O3NB 2BFBA 5A4FS 3ODPA 1MB4A 3C85A 1JHDA 3OIYA 4DB4A 4WVFA 2IXEA 1FW8A 1TQDA 4B5KA 5I4BA 4D9JA 1SUSA 1W9HA 4QA9A 1VEGA 1P1BA 2Q8NA 3TNYA 2ZI6A 4LF6M 5EZQA 1HG1A 2ZREA 3GRFA 4M46A 2JI4A 4S1VA 4DSZA 1QNFA 1NR7A 4FPXA 2UYOA 2G4CA 4RM3A 4TRNA 1X7WB 4YRMA 1JEOA 4H1TA 1V16A 2P4QA 1B3RA 1B41A 3FNFA 3IO5A 2JA2A 4E09A 5ALFA 4GHLA 4W7IA 3EPRA 1L4LA 2VJMB 4LRYA 3GRRA 4HSEA 1U90A 3LU1A 5DFAA 1E9VA 2QT9A 3KZNA 5EHGA 2MYNA 1JXQA 1OZAA 4HO1X 3DULA 1XTQA 2WSLA 1OYOA 2BE9A 2PS3A 2ZG6A 4NH4A 2I8LA 5H82A 3D8HA 1Y5LA 4I5FA 3UK6A 1U3WA 1EA7A 2NTVA 1G8MA 1UBOS 1VL5A 2Q9BA 1MU5A 4Q4CA 3RIXA 4LJSA 3NTRA 1PRYA 5TGTA 3A45A 1PV1A 2OT3B 4DLBA 2J46A 1Y89A 1SBZA 5E1OA 1WW2A 5A0VA 4LZOA 3H9QA 5LDGA 2BF7A 2ECFA 3MTIA 2WWWA 3OBIA 1Z07A 1G3QA 5K1ZA 4Z0PA 1YJ8A 5AO9A 1Z5OA 5AW6A 3TLGA 3VDPA 1YAJA 4JBIA 1Q0RA 3IP9A 4YY3B 2EBUA 2K0BX 3O5AA 4ZHSA 5KVAA 1EVIA 4G01B 1E79D 1HQYE 4CU5A 2I1LA 3JARA 4L5CA 1DDGA 4AY6A 4RO0A 3ZW9A 1U1GA 3KT8A 4ESOA 2ZIWB 1BJRE 1H22A 4MXDA 1DGBA 4DDUA 1K88A 4YPOA 1GILA 3T7IA 3E61A 3M6MD 5FUWA 4FKMA 1NDQA 4X1KB 5T8KC 1C3OA 2W37A 4XW2A 2FW9A 2RHDA 1DXOA 5DCWA 2IRWA 1M6HA 1L1QA 3GP3A 4RGYA 2YNMA 1LZKA 4UTPA 3KT0A 2R60A 4MVCA 4HS9A 2PX0A 3TTSA 3VC7A 3ROZA 1MDFA 5DNCA 4EYEA 2BFBB 2Y0PA 5JXIA 1BX1A 1FW6A 3TCKA 3V8PA 5BV0A 5BY2A 3F7TA 2XE4A 4CIAA 3P45A 1QM5A 1G7TA 3MLEA 1I3OA 3N75A 3Q3EA 4OHWA 1Z45A 1Q7EA 1XDBA 1YBHA 1B8PA 4M0LA 4TYYA 1TDHA 4PG7A 1Q92A 4KMRA 1TCCA 1EEHA 2DAKA 5BR1A 3B53X 1V16B 2REOA 2F00A 2Q6IA 1HM5A 3MVEA 2QM3A 3GJ5A 2GTPA 3NJ4A 3KETA 3C5VA 3GYGA 2ZTUA 3EGWA 4YAJA 4CQNA 4D6XA 2B8WA 4OP3A 5CDTA 3TRIA 5TMPA 1IN5A 3ANNA 5KYTA 2KJQA 1G5PA 2JGDA 3GG2A 3B1YA 4JP8A 2J4CA 5BSKA 1WTCA 2OV2A 4UAJA 1W4AA 1MRNA 4MARA 2BMWA 4DNXA 1K6MA 3L46A 1AZTA 4EHHA 2ZJBA 3AY0A 3ZEAA 2RKBA 4RU1A 3VNRA 4PPGA 4BO6A 3G2HA 3OX2A 5MGNA 1RXCA 3A10A 3K6JA 3Q87B 2V7TA 1V11A 1LSOA 3N0TA 2X77A 2CB9A 2V6BA 2R6ZA 2AX4A 1TAUA 3C3XA 1D6MA 1L7RA 3ZY6A 1IPFA 4UM9D 1LLUA 4N54A 3TLGB 2H6EA 4YJGA 5E8JA 2RHMA 2BNKA 4IRUB 5AKLA 4FONA 3WHPA 1ZGHA 2I2CA 4KXXA 4GIPA 4M6WB 4GIBA 3JARB 1AC5A 3MJDA 3HXQA 3RIMA 4D9BA 1XQWA 1ZMXA 3WQHA 4DAEA 2Q0XA 2NNWB 1JQDA 4GMHA 3HI6A 1KBOA 3PCXA 4JJFA 1OWLA 4BV3A 2BFPA 5J1SB 4HGRA 2PMEA 2WV9A 1P2UA 3C7TA 1C3OB 4B3RM 4LBVA 4RZHA 1D0MA 2CUKA 1JDSA 2GLTA 3FGNA 4N3GA 3WFJA 1TQ6A 2X0KA 4XFJA 4W5NA 2HHAA 1P4HA 3B6KA 4G3XA 4QEDA 4FYWA 1H0SA 1XTKA 3PQEA 5CD9A 3HDQA 2JS7A 1MW8X 1QV6A 2YMPA 5HKKA 5K8VA 5H4HA 1NF8A 3KELA 4D9EA 4BNNA 1W2HA 4PX5A 4TV9F 5BN1A 1XNRM 2ODNA 1HR0B 2O0LA 3QVVA 2B69A 3B74A 4FBMA 1DEKA 3AUJB 4ZGGA 3N6XA 1M0SA 3H2HA 4EJSA 1JECA 4INZA 1O6BA 4AIRA 4PCAA 1MIOA 3KR1A 3OIVA 3LXRA 3CIFA 2VJOA 5FUVA 4B87A 4DCVA 4BLWA 5IF3A 4UBIA 1HBJA 4AYXA 1DFGA 2IOHA 3K20A 3M5CA 4BTEA 5HKBA 4OP1A 2Q28A 4LI3X 4O1HA 4TMZA 1E5TA 2OHJA 3EIUA 1ZJWA 1PT8A 1D2MA 2PMCA 4ICIA 2JGDB 1LLFA 3ER8A 5F64A 1YR2A 1V3UA 5FA5A 4BBJA 3C3YA 3M6VA 3LY9A 1I4DD 5MDHA 2RJNA 2PZAA 3LRXA 1BCSA 3DL7A 2FR8A 2YQ4A 2FUKA 2X42A 2RJOA 5KHLB 3QX8A 2Q29A 4NY1A 2YFQA 2BGGA 3N86A 4JT4A 4KNWA 1EB8A 1E96A 5L3ZA 1T4DA 4O4LF 3IL2A 1KAEA 4LYEA 1QE3A 4PO3X 1D4FA 1V11B 1CEYA 4N3NA 4WK4B 4JYBA 4ZI7F 3LYAA 1IDN1 3D4IA 4BVGA 3C4JA 4ZCSA 2C58A 1G5QA 2BSQA 5JPCA 3QE9Y 3U0BA 3NBUA 8ABPA 3ILHA 4PQFA 3IRVA 4HMQA 3BS4A 3RD5A 2FZVA 2JIDA 1N1DA 5FXMA 5IREB 2E1PA 4LHWA 1J21A 1ZJ4A 1SOUA 4MDHA 2UU9B 2JD0A 2ENUA 4GI1A 3RS3A 3AM4A 3ZVMA 3WNDA 4IBBA 4ZEWA 3GRYA 4URVR 4IVRA 4NG4A 3BIJA 3DM9B 2PM8A 3IDSA 3FKEA 2WD7A 2QV7A 3BB3A 2XQFA 1E3TA 4FK8A 1U80A 2VSXA 3GH3A 4ZV4A 4Z6KA 1U4NA 1KR5A 5IAEA 3QW2A 3K0SA 3MCVA 3QE2A 5EKDA 1SIBE 3K1JA 4URUR 3D31A 2WJ3A 1Z4PX 4IBFA 4NMWA 1KWGA 2WWFA 3F9CA 2XZTA 4LHXA 4CVNA 3BSSA 4US0R 1XMQB 3T0IA 3ZE8A 1WXEA 2YICA 2EZ4A 1I3KA 4NCNA 1UPXA 3VVLA 4U6NA 1QVZA 4EJSB 3DEJA 3W8NA 2ZR9A 5KTRA 2DUNA 4TN1A 3KDAA 3W0FA 2BIFA 3K4QA 4RKUF 2HBQA 2V4UA 4O63O 3R7NA 4JV5M 2D5LA 4XIJA 5H59A 4K8RB 3K9CA 1X80A 2FI1A 2BGJA 3ZNQA 3DL0A 4K9QA 2CXTA 4B7CA 4QYXA 4D1YA 4DHWA 3TNLA 1MGOA 2FSGA 2I2XB 4WLFA 4FYYA 4AKHA 2PMKA 3L07A 3IJPA 1IUPA 1SXIA 5I7HA 4E12A 3KQSA 1NKTA 4X71A 3DR3A 4X00A 4EDFA 4F4HA 3Q7PA 4TSFD 1G71A 1B14A 3MT9A 2E2WA 1MAUA 3H5TA 4XD2A 4AS1A 2X8AA 1X15A 1U2GA 3EULA 1USKA 3T6KA 2M6LA 2H17A 5AW2A 1UK9A 3CWCA 2W2XA 3AO0B 3PLNA 4KWHA 1C1XA 1KHHA 3KSDO 1R66A 1TZMA 1VECA 1L7MA 2QR3A 4Y6OA 2NYVA 3Q12A 4QOIA 2P6RA 4PXAA 2DWOA 1XZPA 1G4AE 3PV0A 1YQUA 1XD9A 1H4VB 4ZAYA 5EA2A 2OSBA 4XEUA 4TWIA 4J2OA 1C3XA 2PUTA 1TTHA 3QMVA 3PB3A 3PNPA 3FFXA 3IQWA 2JWSA 1Q0UA 1QQTA 4LF5B 5HP4A 2WYWA 2AJCA 1JUDA 2O2HA 2G36A 3DZIA 1R2QA 5IDXA 4DG8A 2XCTB 4ZMRA 2LVBA 2NU6B 4E31A 3DBLA 4WXPA 2B6HA 1LQ2A 3R5XA 3QKIA 4R3WA 4EB0A 4RLSA 4II2A 3FHOA 2P7IA 1QP8A 4PC2A 2FF5A 4GLOA 1WAMA 5D1NA 5DB4A 4E5KA 3IV7A 1T8YA 3TPFA 3PC2A 1U7PA 4HWOA 5IEJA 3RU2A 3THYA 3VU8A 2Q99A 3FETA 3BZBA 3PGA1 5WRFA 5EMHA 3OCUA 1D7AA 2HA5A 3B2EA 1H66A 3I9MA 3A9RA 4EG7A 1Q1EA 4OSPA 5JNLA 3D1JA 3DE1X 4FDMA 4B3FX 1GTRA 2R1ZA 5B58C 2HW8A 2AN4A 1JHXA 1ZMVA 1BXGA 1SKMA 1NMXA 1HLFA 1BXRA 5FFNA 2EKBA 4MUIA 2PMWB 2QVCA 3RK4A 2FK8A 1MX0A 4Q4LA 3I9KA 3U7HB 3A1DA 5C8DA 4JOSA 4EJ0A 3AWIA 3ABSB 3V2GA 4O33A 1MX3A 4FN4A 2X0JA 1T9KA 2QR5A 1P81A 4MB2A 4WDQA 1U3VA 1X80B 2ENWA 3LPLA 4BX3A 3U6PA 5DT2A 4KDFA 4QYTA 3O1IC 1S9HA 1Z5BA 2H5LA 4J7UA 3QUBA 2FGKA 3OJEA 4HL6A 3TLKA 1QDLB 1XUOA 1O95D 3GQ4A 1QGYA 1M6VA 1RQNA 2A9QA 1I1HA 2RGCA 2H5XA 1IBKM 3SKXA 3KJQA 5IJAA 1ISIA 4TXMA 4IF6A 4LPKA 3Q0IA 3ZWMA 1FIUA 1U63A 4N5MA 4NYJR 4EEXA 4E15A 1Z6YA 1C1XB 3TEFA 5HK8A 1EVQA 1JX6A 4ASUA 1VDDA 2IPXA 1CJVC 2O8FB 5ADUS 2BKUA 3BAZA