2LBCA

Solution structure of tandem uba of usp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
b'DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
publication title Domain Analysis Reveals That a Deubiquitinating Enzyme USP13 Performs Non-Activating Catalysis for Lys63-Linked Polyubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 126
sequence length 126
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA01
5DFLA 1WGNA 3MMPA 2MR9A 1OAIA 1XXHE 2KHHA 1E94E 1MN3A 1ZMVA 3IHPA 2KNZA 2EKKA 3K9PA 2JNHA 2H5XA 1ZV1A 2HAKA 2QSFX 1VEKA 1NV9A 1SG9A 3F92A 2JY8A 2JZ1A 2LVOC 2DAMA 2OO9A 3GLHE 2LVPC 1XB2B 1PGYA 1IXSA 1JR3E 1A5TA 2K0BX 3H4JA 4R71A 1ZMUA 3B89A 2LVAA 3FRHA 3GLFE 1G3IA 2G3QA 2LBCA 3FE3A 1VEJA 2R0IA 2QHOB 2DAIA 2JY7A 3GLIE 2LTUA 1C7YA 4DBGB 3FRIA 2JY5A 2DHYA 1UFZA 1GO5A 2CWBA 1WR1B 2RRUA 2JZ0A 2DAGA 1VEGA 4UN2B 2OOBA 1HT1E 2BWBA 4Q7JA 2JP7A 2JY6B 3BBZA 2JUJA 1G4AE 2HWJA 2QNJA 1P3QQ 2B3TA 1KYIA 1IM2A 1T6OA 1WGLA 2L2DA 3E21A 3E46A 2CP8A 2LVNC 1R4GA 2MROB 4GEWA 3GLGE 1VDLA 3LCUA 1WIVA 2KNAA 2MGWA 1OTRA 1OKSA 2K9DA 2ZTCA 2EJSA 2DAKA 1Q02A 3T6PA 1HQYE 1QZEA 4G3OA 4WP2A 2BWEA 2DI0A 3IECA 1DV0A 1DO0A 1G41A 1V92A 4F2LA 1CUKA 4F1IA 1HJPA 1OQYA 2MJ5B 2OOAA 2DZLA 1VQ1A 2L4FA 1AIPC 2KNVA 2L4EA 1TR8A 2EKFA 1VG5A 2ZTDA 2DENA 2DNAA 3LCVB 1TTEA 2WZJA 1NV8A 2DAEA 1ZMWA 4HEOA 1BVSA 1EFUB 1F4IA 2O25A 3K9OA 1DO2A 2LVQD 1WJ7A 1T43A 1YLAA 1Y8GA 1IFYA 5JI2E 1WHCA 1HT2E 2DKLA
chains in the Genus database with same CATH superfamily
3MJ5A 3VK8A 5EXXA 1FJGM 3THGA 2ZBKB 5FTMA 4NXNM 1OJLA 1YUBA 1L1ZA 4GKJM 3SAWA 1OAIA 3LMMA 4BBAA 2H1RA 2WSEF 2CHQA 4FWDA 3RFWA 4LCBA 3RGPA 1R2YA 1E94E 1YE9A 3DZDA 4K0KM 3VKHA 1Z5AA 4B08A 1Q3CA 5L8RF 2C9CA 3AKZA 1X37A 1VEKA 3M0EA 2ZAMA 4ZPXA 2UU9M 3K2LA 4MB7A 2CHVA 2DAMA 3J80S 5KO3A 5EXTA 1PJJA 2XFTA 3FTCA 5EXSA 3T1HM 1JR3E 4JI2M 3FUXA 4IBFA 4D82A 4HLQA 1GVNA 1PJTA 5A2QS 1NY6A 4M0WA 5KQDA 2KZUA 3GRRA 1SXJE 1DGHA 4LFAM 3GLFE 1G3IA 2G3QA 2LBCA 2DAIA 1HNXM 1TF0B 3FTEA 4B7GA 1XMOM 2JY5A 4LJAA 4JN6A 4G4NA 3HZJA 1IXZA 3M7GA 4DR6M 2CWBA 1WR1B 2R65A 1IN7A 3JAMS 4IBBA 3KP1E 3FTFA 2V1CA 2JZ0A 1OIZA 3U6OA 4L4UA 4MM3B 1QUSA 3V76A 1GL7A 2OOBA 1G71A 3KSXA 1HT1E 2BWBA 1OAOC 2ZAOA 3ZQJA 2UXDM 4OVZB 1L2CA 2JY6B 2QNJA 3L25A 1P3QQ 4LGMA 3EIHA 2B3TA 4MGKE 1IM2A 1T6OA 1WGLA 1I4WA 4RNAA 4FD2A 1QQWA 2LVNC 1QDRA 3VDUA 2M60A 2QP9X 4KLNA 2K47A 1IBLM 1TH2A 2YFQA 3QYEA 4RKUF 3GLGE 1VDLA 3LCUA 4D80A 3UK6A 1LTMA 1WIVA 1E9SA 4Y28F 4NXMM 2QCUA 4KT0F 4A3VB 2KZSA 2APLA 4QOZC 1NVMA 2DAKA 3CF2A 4P16A 1N75A 4PT5A 1QAMA 3VDPA 3QYBA 3NBIA 5EP1A 2HKJA 3FUWA 1EE8A 2AHMA 1IY1A 2R18A 4IBIA 3VK7A 5C1BA 1TDZA 4WP2A 2J7OA 2P5TA 4G3OA 2DI0A 4G4RA 2XLJA 1V92A 2FS1A 1GJTA 2RKOA 3B7QA 3KOWE 4S12A 1NHGC 1J5EM 1S3SA 3TPZA 4II7A 3GPXA 2F5SA 3KXEC 1VQ1A 2DZLA 3QWLA 1OFHA 3WHKA 3E9SA 1QVRA 2DVWB 3C9PA 2X4AA 2X8AA 4PDIA 1QAQA 1VG5A 3K92A 3KW6A 5F3WA 1PJIA 2ZTDA 3HX3A 3GQ5A 1UM8A 2DENA 2DZOB 4LJ8A 3L28A 3VFDA 2XGNA 4YY3M 2DZNB 3IG5A 2BJWA 4L8RC 5KPZA 1PM5A 3DOAA 5ITTA 4IBGA 3FTDA 3LCVB 1PRBA 1TTEA 2R4EA 1NV8A 4FWGA 1EFUB 1RU3A 1DO2A 3R9XB 1WJ7A 2R4JA 1MX0A 2D7EA 2FOIC 3FUUA 4IBEA 1IFYA 2Y20A 4EIWA 4KODA 4P17A 3KS4A 2JWSA 4I4LA 1WGNA 3HGIA 3MMPA 2F4VM 4LJ6A 3SFZA 3I4VA 2KHHA 1IN6A 3HU2A 1L2DA 1EIJA 4B3TM 1MN3A 1ZMVA 3IHPA 2NQ8C 4I81A 1IN8A 1LV7A 1TDHA 2EKKA 2YQZA 3PFIA 1XNQM 5BPVA 3TWLA 2Z3XA 2XF3A 1ZV1A 2CHGA 4NC6A 4ITQA 4GIPA 1W5TA 2QSFX 3IG8A 4R3DA 3MK6A 3U6DA 1XXHA 3F92A 4LY6A 4DV1M 1XNRM 2JZ1A 3DA1A 3U6SA 2DWMA 4DR7M 3HJ8A 1PGYA 2HL7A 3MHVC 2VF8A 3CGWA 5FTNA 1I94M 3KOZE 1A5TA 3FYDA 4AQYM 1G8PA 1Z5CA 1TGUA 1ZMUA 2XZUA 3Q8XA 1Z5BA 3GLHA 5IT9S 2G8LA 1VEJA 5DYIA 2QHOB 1QANA 4ANRA 4L6V6 3W67A 3PXGA 2Q2EB 1IY2A 3BOSA 4DV7M 4AI6A 3VKGA 2J5YA 3AOGA 2RRUA 3SHFA 2DAGA 3KSJA 1DGGA 5ITXE 1V33A 5E26A 3GLIA 1VEGA 2CV1A 2L09A 3SARA 4Q7JA 4R7GA 2JP7A 5EQTA 4PCZA 2JUJA 5IZ7D 4LZJA 1MJGM 1KYIA 2LHCA 1GLNA 3HHXA 3E46A 4QNRA 5LMNM 4DV0M 2CP8A 2D7HA 4IBJA 3U6EA 4JV5M 4DR2M 3FUVA 1JR3D 5ITUA 2MROB 2XFSA 4DUZM 5KPTA 4GEWA 1NNUC 2QBYA 1ORYB 3I51A 1AUAA 2KNAA 1SXJD 2Y0QA 1C1KA 2BNKA 2D7GA 1OKSA 2K9DA 2ZTCA 2ZANA 3W0LB 3HWSA 4KHPM 3PNYA 3T6PA 4CIZA 4QHSA 3U6PA 1Z6TA 1XXHB 2KRKA 3NWLA 3KS8A 2RGHA 3DFZA 2V1UA 4LJ4A 4NSRA 4JI6M 2VF7A 3IECA 4L15A 1L1TA 1T3TA 2XH9A 4MGIE 4F2LA 2CE7A 3KFUG 4FCVA 1CUKA 1OIPA 2O01F 1R5LA 3PVSA 4B3SM 5EP3A 4JI4M 2L6OA 1L8QA 3GLHB 2N35A 5LMUM 2L4FA 1SXJC 1XC8A 2Z4RA 1AIPC 4DV3M 1Q39A 2EUCA 3I4YA 1TR8A 4QHTA 4QOSA 3AJIB 1ZQ9A 2JXNA 4BLCA 3EIEA 4CGYB 3LVWA 3FUTA 3H4MA 4DR4M 3GLIB 2LNHC 2Z8YM 2WZJA 3AV0A 3ZC7B 4LF9M 1BVSA 1F4IA 2CEAA 2O25A 3ZCBB 1N34M 3A46A 3SYLA 3FD9A 3HHWA 5KQ8A 1H6UA 4KO8A 4LJ7A 1KFVA 2KRUA 1NNJA 1YLAA 1IQPA 4W5WA 5DNYA 3SBJA 5JI2E 1WHCA 5FSWA 2E5LM 3GO8A 3A45A 3T38A 1JB0F 1NO1A 1PJSA 1DGBA 8CATA 4IJFA 2QPAA 4DR1M 5C18A 2XZFA 2QBYB 2CRUA 4MGYE 1R7RA 5DYGA 1IY0A 3GRUA 3SC3A 3W0FA 2KNZA 2DHRA 2A5YB 3K9PA 2KDLA 2CV0A 2JNHA 2I7PA 2H5XA 3GPYA 3HKPA 3NBXX 4NL4H 5ITRA 4LFBM 1NSFA 2HAKA 3J2PB 1QAOA 3LQQA 4NSOB 1IBMM 4CISA 2LVPC 1N32M 4MGZE 1HQCA 2FH0A 4JI8M 3GPPA 2C99A 4JXJA 4WW0A 2X49A 3GPUA 4R71A 4DV4M 4DR3M 2LVAA 3RE8A 3U6MA 3K1JA 1D2NA 1XMQM 4IJEA 2F5OA 4LRTA 2R0IA 2FFJA 4GITA 2HHHM 1JR3A 2LTUA 3AL0C 3SMSA 3ILKA 4DBGB 1N36M 1GL6A 4GC9A 4LF6M 1UFZA 5FTJA 1SXJA 3UGJA 3GLFA 4LJ5A 4GKKM 1IXRC 2M5ZA 1XHBA 2R46A 4GRIA 1IN4A 2LXEA 1IN5A 4IBCA 5GKNA 3OTOM 1HNWM 4UN2B 4JI3M 3GP1A 2C98A 1N78A 1IXSB 5EP4A 3PNVA 4BB9A 2VQEM 3C58A 1QZMA 2XEPA 3GRYA 5ITQA 3T1YM 2HWJA 2UUBM 2LWXA 2YR0A 4B3MM 3E21A 2WSCF 4I5SA 2VDBB 4DV6M 2R44A 4LFCM 2UUCM 3B7ZA 3QAUA 5KPRA 2KA6B 2Z7JA 3HHYA 1TH4A 4B7FA 3D8BA 2Z4SA 2EJSA 3AFHA 1Q02A 3A42A 4REZA 5EXPA 3LW5F 3LVVA 3RGSA 2GQFA 2QZ4A 3GLGA 3J27B 3SAVA 1HQYE 4AZFA 4NRVA 2MH8A 4GC5A 2C96A 4HL4A 3I04M 4DV2M 1DV0A 4YHHM 4GHLA 1E9RA 4M0DA 1NJFA 4OX9M 5ITYA 1OQYA 5FTLA 4Z8XA 2OOAA 2KEBA 3J7BA 1FNNA 2OQ4A 3I01M 3B9PA 2VQFM 4CJ6A 5EP2A 2CV2A 3CTWB 2EKFA 2UXBM 3GQ4A 1SXJB 3GLFB 4FVMA 1WXQA 4OU7A 4LRSA 4JI0M 1OFIA 2CFOA 4L16A 1MU5A 1V34A 2L7IA 4AKHA 4AG6A 2ERCA 2LVQD 2J7NA 3J7AS 2DWNA 4X65M 1K3XA 1Y8GA 4RF1A 2ZM6M 1GJSA 3JR5A 3A98B 1J09A 3HJSA 2G5GX 2KW0A 4GH9A 5DFLA 2EO2A 1R2ZA 1YSYA 1E32A 2MR9A 1D0MA 1XXHE 4X62M 2WSFF 3JR4A 4GMQA 4I8OA 4LGYA 2LHGA 3AOEC 4XGIA 4XK8F 4B3RM 4LF8M 4NOOB 1D0LA 3GLGB 1TH3A 2FNAA 4MGHA 1NV9A 1SG9A 2R45A 2XSZD 2JY8A 2OO9A 2LVOC 1N77A 3GLHE 3KDSE 4Z6YA 1QYRA 2DXIA 1XB2B 4X64M 2JA2A 1IXSA 3SAUA 4JYAM 1XWIA 2K0BX 3FYCA 4OW0A 3HY5A 3H4JA 3C3EA 3U5ZA 4CHTB 3U60A 3B89A 3FRHA 4DV5M 4DR5M 2C5RA 3FE3A 2UXCM 1VDDA 1Z59A 2GNOA 4QNMA 2DWLA 2JY7A 3C3DA 3GLIE 3TL4X 1C7YA 3SMPA 2OPFA 4PD2A 3FRIA 1NJGA 4JI5M 2DHYA 1W5SA 2DWZB 5JI3E 1GO5A 3LQRA 1K82A 3L29A 3L2AA 2VIIA 3U6QA 4IBKA 1PJQA 2Y21A 3L26A 4DUYM 3W68A 4B7HA 3U6CA 2BJVA 1QUTA 4M9XA 4L78A 3BBZA 3FKEA 3KVWA 2R6FA 4FCWA 1IBKM 4LF7M 4TUWA 1G59A 1G4AE 3B7NA 3TE6A 3U61A 4X66M 4NRWA 5ITXA 1J7KA 1DGHB 4GHAA 3M6AA 2L2DA 3UJNA 1NY5A 3GQ3A 4AKGA 4D81A 2RGOA 2QENA 1R4GA 2EA0A 2F5PA 4AKIA 1HNZM 2F5QA 1KSFX 1N33M 2V6ZM 2FE8A 2QQ8A 5E6JA 3TWKA 2MGWA 2HCBA 1OTRA 2R62A 5FLXS 5BR8M 1ZAEA 7CATA 5FTKA 1QDTA 3D8LA 4IIWA 1L2BA 4FWHA 2YNMD 2Y0TA 4LZZA 4MH0E 3GRVA 2LH0A 4LF4M 4G4QA 3AOEA 3BXWA 3HU3A 3HHZA 1QZEA 2BWEA 3WHLA 2F5NA 1DO0A 2CUZA 1G41A 4M9ZA 4LG2A 5EJCA 3SATA 3SASA 2KXEA 2K6BA 3J81S 4RF0A 4F1IA 1HJPA 3U5ZB 3U60B 4LF5M 2MJ5B 3U6LA 5IREB 3TWMA 3Q8GA 1HR0M 3T15A 2KNVA 2L4EA 2W82A 3CF0A 2I7NA 4PDGA 3K8ZA 2L7HA 4G4OA 3TQSA 1NHWC 3CF6E 1D0KA 3VLFB 4AW4A 2DNAA 2C9OA 4G6ZA 3B74A 3L27A 2O5RA 1R6BX 3UZUA 4LJ9A 3ZH9B 4AG5A 1K3WA 3UMMA 4JI7M 4HEOA 2XSZA 3KOXE 2DAEA 1ZMWA 4JI1M 3E4RA 3KP0E 2UUAM 3K9OA 3HU1A 5IWAM 3HJQA 4OVZA 1Q3BA 1T43A 4XBOA 1GKIA 4IBDA 4WURA 5H37D 4M9SA 3U61B 3SYKA 1DGFA 1JQJC 3R8FA 1GABA 4FCTA 1HT2E 3SHGB 4FW9A 3KOYE 2DKLA
chains in the Genus database with same CATH topology
5DFLA 1WGNA 3MMPA 2MR9A 1OAIA 1XXHE 2KHHA 1E94E 1MN3A 1ZMVA 3IHPA 2KNZA 2EKKA 3K9PA 2JNHA 2H5XA 1ZV1A 2HAKA 2QSFX 1VEKA 1NV9A 1SG9A 3F92A 2JY8A 2JZ1A 2LVOC 2DAMA 2OO9A 3GLHE 2LVPC 1XB2B 1PGYA 1IXSA 1JR3E 1A5TA 2K0BX 3H4JA 4R71A 1ZMUA 3B89A 2LVAA 3FRHA 3GLFE 1G3IA 2G3QA 2LBCA 3FE3A 1VEJA 2R0IA 2QHOB 2DAIA 2JY7A 3GLIE 2LTUA 1C7YA 4DBGB 3FRIA 2JY5A 2DHYA 1UFZA 1GO5A 2CWBA 1WR1B 2RRUA 2JZ0A 2DAGA 1VEGA 4UN2B 2OOBA 1HT1E 2BWBA 4Q7JA 2JP7A 2JY6B 3BBZA 2JUJA 1G4AE 2HWJA 2QNJA 1P3QQ 2B3TA 1KYIA 1IM2A 1T6OA 1WGLA 2L2DA 3E21A 3E46A 2CP8A 2LVNC 1R4GA 2MROB 4GEWA 3GLGE 1VDLA 3LCUA 1WIVA 2KNAA 2MGWA 1OTRA 1OKSA 2K9DA 2ZTCA 2EJSA 2DAKA 1Q02A 3T6PA 1HQYE 1QZEA 4G3OA 4WP2A 2BWEA 2DI0A 3IECA 1DV0A 1DO0A 1G41A 1V92A 4F2LA 1CUKA 4F1IA 1HJPA 1OQYA 2MJ5B 2OOAA 2DZLA 1VQ1A 2L4FA 1AIPC 2KNVA 2L4EA 1TR8A 2EKFA 1VG5A 2ZTDA 2DENA 2DNAA 3LCVB 1TTEA 2WZJA 1NV8A 2DAEA 1ZMWA 4HEOA 1BVSA 1EFUB 1F4IA 2O25A 3K9OA 1DO2A 2LVQD 1WJ7A 1T43A 1YLAA 1Y8GA 1IFYA 5JI2E 1WHCA 1HT2E 2DKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DFL A;  1WGN A;  3MMP A;  2MR9 A;  1OAI A;  1XXH E;  2KHH A;  1E94 E;  1MN3 A;  1ZMV A;  3IHP A;  2KNZ A;  2EKK A;  3K9P A;  2JNH A;  2H5X A;  1ZV1 A;  2HAK A;  2QSF X;  1VEK A;  1NV9 A;  1SG9 A;  3F92 A;  2JY8 A;  2JZ1 A;  2LVO C;  2DAM A;  2OO9 A;  3GLH E;  2LVP C;  1XB2 B;  1PGY A;  1IXS A;  1JR3 E;  1A5T A;  2K0B X;  3H4J A;  4R71 A;  1ZMU A;  3B89 A;  2LVA A;  3FRH A;  3GLF E;  1G3I A;  2G3Q A;  2LBC A;  3FE3 A;  1VEJ A;  2R0I A;  2QHO B;  2DAI A;  2JY7 A;  3GLI E;  2LTU A;  1C7Y A;  4DBG B;  3FRI A;  2JY5 A;  2DHY A;  1UFZ A;  1GO5 A;  2CWB A;  1WR1 B;  2RRU A;  2JZ0 A;  2DAG A;  1VEG A;  4UN2 B;  2OOB A;  1HT1 E;  2BWB A;  4Q7J A;  2JP7 A;  2JY6 B;  3BBZ A;  2JUJ A;  1G4A E;  2HWJ A;  2QNJ A;  1P3Q Q;  2B3T A;  1KYI A;  1IM2 A;  1T6O A;  1WGL A;  2L2D A;  3E21 A;  3E46 A;  2CP8 A;  2LVN C;  1R4G A;  2MRO B;  4GEW A;  3GLG E;  1VDL A;  3LCU A;  1WIV A;  2KNA A;  2MGW A;  1OTR A;  1OKS A;  2K9D A;  2ZTC A;  2EJS A;  2DAK A;  1Q02 A;  3T6P A;  1HQY E;  1QZE A;  4G3O A;  4WP2 A;  2BWE A;  2DI0 A;  3IEC A;  1DV0 A;  1DO0 A;  1G41 A;  1V92 A;  4F2L A;  1CUK A;  4F1I A;  1HJP A;  1OQY A;  2MJ5 B;  2OOA A;  2DZL A;  1VQ1 A;  2L4F A;  1AIP C;  2KNV A;  2L4E A;  1TR8 A;  2EKF A;  1VG5 A;  2ZTD A;  2DEN A;  2DNA A;  3LCV B;  1TTE A;  2WZJ A;  1NV8 A;  2DAE A;  1ZMW A;  4HEO A;  1BVS A;  1EFU B;  1F4I A;  2O25 A;  3K9O A;  1DO2 A;  2LVQ D;  1WJ7 A;  1T43 A;  1YLA A;  1Y8G A;  1IFY A;  5JI2 E;  1WHC A;  1HT2 E;  2DKL A; 
#chains in the Genus database with same CATH topology
 3MJ5 A;  3VK8 A;  5EXX A;  1FJG M;  3THG A;  2ZBK B;  5FTM A;  4NXN M;  1OJL A;  1YUB A;  1L1Z A;  4GKJ M;  3SAW A;  1OAI A;  3LMM A;  4BBA A;  2H1R A;  2WSE F;  2CHQ A;  4FWD A;  3RFW A;  4LCB A;  3RGP A;  1R2Y A;  1E94 E;  1YE9 A;  3DZD A;  4K0K M;  3VKH A;  1Z5A A;  4B08 A;  1Q3C A;  5L8R F;  2C9C A;  3AKZ A;  1X37 A;  1VEK A;  3M0E A;  2ZAM A;  4ZPX A;  2UU9 M;  3K2L A;  4MB7 A;  2CHV A;  2DAM A;  3J80 S;  5KO3 A;  5EXT A;  1PJJ A;  2XFT A;  3FTC A;  5EXS A;  3T1H M;  1JR3 E;  4JI2 M;  3FUX A;  4IBF A;  4D82 A;  4HLQ A;  1GVN A;  1PJT A;  5A2Q S;  1NY6 A;  4M0W A;  5KQD A;  2KZU A;  3GRR A;  1SXJ E;  1DGH A;  4LFA M;  3GLF E;  1G3I A;  2G3Q A;  2LBC A;  2DAI A;  1HNX M;  1TF0 B;  3FTE A;  4B7G A;  1XMO M;  2JY5 A;  4LJA A;  4JN6 A;  4G4N A;  3HZJ A;  1IXZ A;  3M7G A;  4DR6 M;  2CWB A;  1WR1 B;  2R65 A;  1IN7 A;  3JAM S;  4IBB A;  3KP1 E;  3FTF A;  2V1C A;  2JZ0 A;  1OIZ A;  3U6O A;  4L4U A;  4MM3 B;  1QUS A;  3V76 A;  1GL7 A;  2OOB A;  1G71 A;  3KSX A;  1HT1 E;  2BWB A;  1OAO C;  2ZAO A;  3ZQJ A;  2UXD M;  4OVZ B;  1L2C A;  2JY6 B;  2QNJ A;  3L25 A;  1P3Q Q;  4LGM A;  3EIH A;  2B3T A;  4MGK E;  1IM2 A;  1T6O A;  1WGL A;  1I4W A;  4RNA A;  4FD2 A;  1QQW A;  2LVN C;  1QDR A;  3VDU A;  2M60 A;  2QP9 X;  4KLN A;  2K47 A;  1IBL M;  1TH2 A;  2YFQ A;  3QYE A;  4RKU F;  3GLG E;  1VDL A;  3LCU A;  4D80 A;  3UK6 A;  1LTM A;  1WIV A;  1E9S A;  4Y28 F;  4NXM M;  2QCU A;  4KT0 F;  4A3V B;  2KZS A;  2APL A;  4QOZ C;  1NVM A;  2DAK A;  3CF2 A;  4P16 A;  1N75 A;  4PT5 A;  1QAM A;  3VDP A;  3QYB A;  3NBI A;  5EP1 A;  2HKJ A;  3FUW A;  1EE8 A;  2AHM A;  1IY1 A;  2R18 A;  4IBI A;  3VK7 A;  5C1B A;  1TDZ A;  4WP2 A;  2J7O A;  2P5T A;  4G3O A;  2DI0 A;  4G4R A;  2XLJ A;  1V92 A;  2FS1 A;  1GJT A;  2RKO A;  3B7Q A;  3KOW E;  4S12 A;  1NHG C;  1J5E M;  1S3S A;  3TPZ A;  4II7 A;  3GPX A;  2F5S A;  3KXE C;  1VQ1 A;  2DZL A;  3QWL A;  1OFH A;  3WHK A;  3E9S A;  1QVR A;  2DVW B;  3C9P A;  2X4A A;  2X8A A;  4PDI A;  1QAQ A;  1VG5 A;  3K92 A;  3KW6 A;  5F3W A;  1PJI A;  2ZTD A;  3HX3 A;  3GQ5 A;  1UM8 A;  2DEN A;  2DZO B;  4LJ8 A;  3L28 A;  3VFD A;  2XGN A;  4YY3 M;  2DZN B;  3IG5 A;  2BJW A;  4L8R C;  5KPZ A;  1PM5 A;  3DOA A;  5ITT A;  4IBG A;  3FTD A;  3LCV B;  1PRB A;  1TTE A;  2R4E A;  1NV8 A;  4FWG A;  1EFU B;  1RU3 A;  1DO2 A;  3R9X B;  1WJ7 A;  2R4J A;  1MX0 A;  2D7E A;  2FOI C;  3FUU A;  4IBE A;  1IFY A;  2Y20 A;  4EIW A;  4KOD A;  4P17 A;  3KS4 A;  2JWS A;  4I4L A;  1WGN A;  3HGI A;  3MMP A;  2F4V M;  4LJ6 A;  3SFZ A;  3I4V A;  2KHH A;  1IN6 A;  3HU2 A;  1L2D A;  1EIJ A;  4B3T M;  1MN3 A;  1ZMV A;  3IHP A;  2NQ8 C;  4I81 A;  1IN8 A;  1LV7 A;  1TDH A;  2EKK A;  2YQZ A;  3PFI A;  1XNQ M;  5BPV A;  3TWL A;  2Z3X A;  2XF3 A;  1ZV1 A;  2CHG A;  4NC6 A;  4ITQ A;  4GIP A;  1W5T A;  2QSF X;  3IG8 A;  4R3D A;  3MK6 A;  3U6D A;  1XXH A;  3F92 A;  4LY6 A;  4DV1 M;  1XNR M;  2JZ1 A;  3DA1 A;  3U6S A;  2DWM A;  4DR7 M;  3HJ8 A;  1PGY A;  2HL7 A;  3MHV C;  2VF8 A;  3CGW A;  5FTN A;  1I94 M;  3KOZ E;  1A5T A;  3FYD A;  4AQY M;  1G8P A;  1Z5C A;  1TGU A;  1ZMU A;  2XZU A;  3Q8X A;  1Z5B A;  3GLH A;  5IT9 S;  2G8L A;  1VEJ A;  5DYI A;  2QHO B;  1QAN A;  4ANR A;  4L6V 6;  3W67 A;  3PXG A;  2Q2E B;  1IY2 A;  3BOS A;  4DV7 M;  4AI6 A;  3VKG A;  2J5Y A;  3AOG A;  2RRU A;  3SHF A;  2DAG A;  3KSJ A;  1DGG A;  5ITX E;  1V33 A;  5E26 A;  3GLI A;  1VEG A;  2CV1 A;  2L09 A;  3SAR A;  4Q7J A;  4R7G A;  2JP7 A;  5EQT A;  4PCZ A;  2JUJ A;  5IZ7 D;  4LZJ A;  1MJG M;  1KYI A;  2LHC A;  1GLN A;  3HHX A;  3E46 A;  4QNR A;  5LMN M;  4DV0 M;  2CP8 A;  2D7H A;  4IBJ A;  3U6E A;  4JV5 M;  4DR2 M;  3FUV A;  1JR3 D;  5ITU A;  2MRO B;  2XFS A;  4DUZ M;  5KPT A;  4GEW A;  1NNU C;  2QBY A;  1ORY B;  3I51 A;  1AUA A;  2KNA A;  1SXJ D;  2Y0Q A;  1C1K A;  2BNK A;  2D7G A;  1OKS A;  2K9D A;  2ZTC A;  2ZAN A;  3W0L B;  3HWS A;  4KHP M;  3PNY A;  3T6P A;  4CIZ A;  4QHS A;  3U6P A;  1Z6T A;  1XXH B;  2KRK A;  3NWL A;  3KS8 A;  2RGH A;  3DFZ A;  2V1U A;  4LJ4 A;  4NSR A;  4JI6 M;  2VF7 A;  3IEC A;  4L15 A;  1L1T A;  1T3T A;  2XH9 A;  4MGI E;  4F2L A;  2CE7 A;  3KFU G;  4FCV A;  1CUK A;  1OIP A;  2O01 F;  1R5L A;  3PVS A;  4B3S M;  5EP3 A;  4JI4 M;  2L6O A;  1L8Q A;  3GLH B;  2N35 A;  5LMU M;  2L4F A;  1SXJ C;  1XC8 A;  2Z4R A;  1AIP C;  4DV3 M;  1Q39 A;  2EUC A;  3I4Y A;  1TR8 A;  4QHT A;  4QOS A;  3AJI B;  1ZQ9 A;  2JXN A;  4BLC A;  3EIE A;  4CGY B;  3LVW A;  3FUT A;  3H4M A;  4DR4 M;  3GLI B;  2LNH C;  2Z8Y M;  2WZJ A;  3AV0 A;  3ZC7 B;  4LF9 M;  1BVS A;  1F4I A;  2CEA A;  2O25 A;  3ZCB B;  1N34 M;  3A46 A;  3SYL A;  3FD9 A;  3HHW A;  5KQ8 A;  1H6U A;  4KO8 A;  4LJ7 A;  1KFV A;  2KRU A;  1NNJ A;  1YLA A;  1IQP A;  4W5W A;  5DNY A;  3SBJ A;  5JI2 E;  1WHC A;  5FSW A;  2E5L M;  3GO8 A;  3A45 A;  3T38 A;  1JB0 F;  1NO1 A;  1PJS A;  1DGB A;  8CAT A;  4IJF A;  2QPA A;  4DR1 M;  5C18 A;  2XZF A;  2QBY B;  2CRU A;  4MGY E;  1R7R A;  5DYG A;  1IY0 A;  3GRU A;  3SC3 A;  3W0F A;  2KNZ A;  2DHR A;  2A5Y B;  3K9P A;  2KDL A;  2CV0 A;  2JNH A;  2I7P A;  2H5X A;  3GPY A;  3HKP A;  3NBX X;  4NL4 H;  5ITR A;  4LFB M;  1NSF A;  2HAK A;  3J2P B;  1QAO A;  3LQQ A;  4NSO B;  1IBM M;  4CIS A;  2LVP C;  1N32 M;  4MGZ E;  1HQC A;  2FH0 A;  4JI8 M;  3GPP A;  2C99 A;  4JXJ A;  4WW0 A;  2X49 A;  3GPU A;  4R71 A;  4DV4 M;  4DR3 M;  2LVA A;  3RE8 A;  3U6M A;  3K1J A;  1D2N A;  1XMQ M;  4IJE A;  2F5O A;  4LRT A;  2R0I A;  2FFJ A;  4GIT A;  2HHH M;  1JR3 A;  2LTU A;  3AL0 C;  3SMS A;  3ILK A;  4DBG B;  1N36 M;  1GL6 A;  4GC9 A;  4LF6 M;  1UFZ A;  5FTJ A;  1SXJ A;  3UGJ A;  3GLF A;  4LJ5 A;  4GKK M;  1IXR C;  2M5Z A;  1XHB A;  2R46 A;  4GRI A;  1IN4 A;  2LXE A;  1IN5 A;  4IBC A;  5GKN A;  3OTO M;  1HNW M;  4UN2 B;  4JI3 M;  3GP1 A;  2C98 A;  1N78 A;  1IXS B;  5EP4 A;  3PNV A;  4BB9 A;  2VQE M;  3C58 A;  1QZM A;  2XEP A;  3GRY A;  5ITQ A;  3T1Y M;  2HWJ A;  2UUB M;  2LWX A;  2YR0 A;  4B3M M;  3E21 A;  2WSC F;  4I5S A;  2VDB B;  4DV6 M;  2R44 A;  4LFC M;  2UUC M;  3B7Z A;  3QAU A;  5KPR A;  2KA6 B;  2Z7J A;  3HHY A;  1TH4 A;  4B7F A;  3D8B A;  2Z4S A;  2EJS A;  3AFH A;  1Q02 A;  3A42 A;  4REZ A;  5EXP A;  3LW5 F;  3LVV A;  3RGS A;  2GQF A;  2QZ4 A;  3GLG A;  3J27 B;  3SAV A;  1HQY E;  4AZF A;  4NRV A;  2MH8 A;  4GC5 A;  2C96 A;  4HL4 A;  3I04 M;  4DV2 M;  1DV0 A;  4YHH M;  4GHL A;  1E9R A;  4M0D A;  1NJF A;  4OX9 M;  5ITY A;  1OQY A;  5FTL A;  4Z8X A;  2OOA A;  2KEB A;  3J7B A;  1FNN A;  2OQ4 A;  3I01 M;  3B9P A;  2VQF M;  4CJ6 A;  5EP2 A;  2CV2 A;  3CTW B;  2EKF A;  2UXB M;  3GQ4 A;  1SXJ B;  3GLF B;  4FVM A;  1WXQ A;  4OU7 A;  4LRS A;  4JI0 M;  1OFI A;  2CFO A;  4L16 A;  1MU5 A;  1V34 A;  2L7I A;  4AKH A;  4AG6 A;  2ERC A;  2LVQ D;  2J7N A;  3J7A S;  2DWN A;  4X65 M;  1K3X A;  1Y8G A;  4RF1 A;  2ZM6 M;  1GJS A;  3JR5 A;  3A98 B;  1J09 A;  3HJS A;  2G5G X;  2KW0 A;  4GH9 A;  5DFL A;  2EO2 A;  1R2Z A;  1YSY A;  1E32 A;  2MR9 A;  1D0M A;  1XXH E;  4X62 M;  2WSF F;  3JR4 A;  4GMQ A;  4I8O A;  4LGY A;  2LHG A;  3AOE C;  4XGI A;  4XK8 F;  4B3R M;  4LF8 M;  4NOO B;  1D0L A;  3GLG B;  1TH3 A;  2FNA A;  4MGH A;  1NV9 A;  1SG9 A;  2R45 A;  2XSZ D;  2JY8 A;  2OO9 A;  2LVO C;  1N77 A;  3GLH E;  3KDS E;  4Z6Y A;  1QYR A;  2DXI A;  1XB2 B;  4X64 M;  2JA2 A;  1IXS A;  3SAU A;  4JYA M;  1XWI A;  2K0B X;  3FYC A;  4OW0 A;  3HY5 A;  3H4J A;  3C3E A;  3U5Z A;  4CHT B;  3U60 A;  3B89 A;  3FRH A;  4DV5 M;  4DR5 M;  2C5R A;  3FE3 A;  2UXC M;  1VDD A;  1Z59 A;  2GNO A;  4QNM A;  2DWL A;  2JY7 A;  3C3D A;  3GLI E;  3TL4 X;  1C7Y A;  3SMP A;  2OPF A;  4PD2 A;  3FRI A;  1NJG A;  4JI5 M;  2DHY A;  1W5S A;  2DWZ B;  5JI3 E;  1GO5 A;  3LQR A;  1K82 A;  3L29 A;  3L2A A;  2VII A;  3U6Q A;  4IBK A;  1PJQ A;  2Y21 A;  3L26 A;  4DUY M;  3W68 A;  4B7H A;  3U6C A;  2BJV A;  1QUT A;  4M9X A;  4L78 A;  3BBZ A;  3FKE A;  3KVW A;  2R6F A;  4FCW A;  1IBK M;  4LF7 M;  4TUW A;  1G59 A;  1G4A E;  3B7N A;  3TE6 A;  3U61 A;  4X66 M;  4NRW A;  5ITX A;  1J7K A;  1DGH B;  4GHA A;  3M6A A;  2L2D A;  3UJN A;  1NY5 A;  3GQ3 A;  4AKG A;  4D81 A;  2RGO A;  2QEN A;  1R4G A;  2EA0 A;  2F5P A;  4AKI A;  1HNZ M;  2F5Q A;  1KSF X;  1N33 M;  2V6Z M;  2FE8 A;  2QQ8 A;  5E6J A;  3TWK A;  2MGW A;  2HCB A;  1OTR A;  2R62 A;  5FLX S;  5BR8 M;  1ZAE A;  7CAT A;  5FTK A;  1QDT A;  3D8L A;  4IIW A;  1L2B A;  4FWH A;  2YNM D;  2Y0T A;  4LZZ A;  4MH0 E;  3GRV A;  2LH0 A;  4LF4 M;  4G4Q A;  3AOE A;  3BXW A;  3HU3 A;  3HHZ A;  1QZE A;  2BWE A;  3WHL A;  2F5N A;  1DO0 A;  2CUZ A;  1G41 A;  4M9Z A;  4LG2 A;  5EJC A;  3SAT A;  3SAS A;  2KXE A;  2K6B A;  3J81 S;  4RF0 A;  4F1I A;  1HJP A;  3U5Z B;  3U60 B;  4LF5 M;  2MJ5 B;  3U6L A;  5IRE B;  3TWM A;  3Q8G A;  1HR0 M;  3T15 A;  2KNV A;  2L4E A;  2W82 A;  3CF0 A;  2I7N A;  4PDG A;  3K8Z A;  2L7H A;  4G4O A;  3TQS A;  1NHW C;  3CF6 E;  1D0K A;  3VLF B;  4AW4 A;  2DNA A;  2C9O A;  4G6Z A;  3B74 A;  3L27 A;  2O5R A;  1R6B X;  3UZU A;  4LJ9 A;  3ZH9 B;  4AG5 A;  1K3W A;  3UMM A;  4JI7 M;  4HEO A;  2XSZ A;  3KOX E;  2DAE A;  1ZMW A;  4JI1 M;  3E4R A;  3KP0 E;  2UUA M;  3K9O A;  3HU1 A;  5IWA M;  3HJQ A;  4OVZ A;  1Q3B A;  1T43 A;  4XBO A;  1GKI A;  4IBD A;  4WUR A;  5H37 D;  4M9S A;  3U61 B;  3SYK A;  1DGF A;  1JQJ C;  3R8F A;  1GAB A;  4FCT A;  1HT2 E;  3SHG B;  4FW9 A;  3KOY E;  2DKL A; 
#chains in the Genus database with same CATH homology
 5DFL A;  1WGN A;  3MMP A;  2MR9 A;  1OAI A;  1XXH E;  2KHH A;  1E94 E;  1MN3 A;  1ZMV A;  3IHP A;  2KNZ A;  2EKK A;  3K9P A;  2JNH A;  2H5X A;  1ZV1 A;  2HAK A;  2QSF X;  1VEK A;  1NV9 A;  1SG9 A;  3F92 A;  2JY8 A;  2JZ1 A;  2LVO C;  2DAM A;  2OO9 A;  3GLH E;  2LVP C;  1XB2 B;  1PGY A;  1IXS A;  1JR3 E;  1A5T A;  2K0B X;  3H4J A;  4R71 A;  1ZMU A;  3B89 A;  2LVA A;  3FRH A;  3GLF E;  1G3I A;  2G3Q A;  2LBC A;  3FE3 A;  1VEJ A;  2R0I A;  2QHO B;  2DAI A;  2JY7 A;  3GLI E;  2LTU A;  1C7Y A;  4DBG B;  3FRI A;  2JY5 A;  2DHY A;  1UFZ A;  1GO5 A;  2CWB A;  1WR1 B;  2RRU A;  2JZ0 A;  2DAG A;  1VEG A;  4UN2 B;  2OOB A;  1HT1 E;  2BWB A;  4Q7J A;  2JP7 A;  2JY6 B;  3BBZ A;  2JUJ A;  1G4A E;  2HWJ A;  2QNJ A;  1P3Q Q;  2B3T A;  1KYI A;  1IM2 A;  1T6O A;  1WGL A;  2L2D A;  3E21 A;  3E46 A;  2CP8 A;  2LVN C;  1R4G A;  2MRO B;  4GEW A;  3GLG E;  1VDL A;  3LCU A;  1WIV A;  2KNA A;  2MGW A;  1OTR A;  1OKS A;  2K9D A;  2ZTC A;  2EJS A;  2DAK A;  1Q02 A;  3T6P A;  1HQY E;  1QZE A;  4G3O A;  4WP2 A;  2BWE A;  2DI0 A;  3IEC A;  1DV0 A;  1DO0 A;  1G41 A;  1V92 A;  4F2L A;  1CUK A;  4F1I A;  1HJP A;  1OQY A;  2MJ5 B;  2OOA A;  2DZL A;  1VQ1 A;  2L4F A;  1AIP C;  2KNV A;  2L4E A;  1TR8 A;  2EKF A;  1VG5 A;  2ZTD A;  2DEN A;  2DNA A;  3LCV B;  1TTE A;  2WZJ A;  1NV8 A;  2DAE A;  1ZMW A;  4HEO A;  1BVS A;  1EFU B;  1F4I A;  2O25 A;  3K9O A;  1DO2 A;  2LVQ D;  1WJ7 A;  1T43 A;  1YLA A;  1Y8G A;  1IFY A;  5JI2 E;  1WHC A;  1HT2 E;  2DKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...