2LBCA

Solution structure of tandem uba of usp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
publication title Domain Analysis Reveals That a Deubiquitinating Enzyme USP13 Performs Non-Activating Catalysis for Lys63-Linked Polyubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 126
sequence length 126
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA01
1G4AE 1MN3A 2KHHA 1C7YA 2CWBA 2QSFX 1QZEA 1JR3E 1OKSA 1VQ1A 1Q02A 2WZJA 2DI0A 1ZV1A 2DAKA 1VG5A 2BWBA 3E21A 1P3QQ 1F4IA 1BVSA 1KYIA 3GLGE 1R4GA 1WGLA 2KNZA 2ZTCA 2L4FA 4R71A 2LVNC 3GLFE 1VEJA 4UN2B 2QHOB 3H4JA 2QNJA 1PGYA 2DAIA 1TTEA 2DKLA 2L4EA 2JZ1A 1GO5A 1HJPA 2EJSA 1SG9A 4HEOA 1G3IA 1IM2A 2L2DA 2DNAA 1DO0A 1A5TA 1T43A 1ZMWA 3FRHA 3FRIA 2BWEA 1TR8A 3F92A 2OOBA 4F2LA 2DHYA 3IHPA 2LBCA 4G3OA 1NV8A 1ZMUA 2DAGA 2DENA 3GLIE 1DO2A 1NV9A 1WGNA 2EKKA 3K9PA 2O25A 2MJ5B 1CUKA 5DFLA 1XXHE 2DAMA 3E46A 4Q7JA 1DV0A 1AIPC 2R0IA 1EFUB 2LTUA 1OQYA 3GLHE 1OTRA 4F1IA 5JI2E 2HWJA 1XB2B 2JY7A 2LVPC 4GEWA 3LCVB 3IECA 2JUJA 3FE3A 1HQYE 2DZLA 2K0BX 2MROB 3LCUA 4WP2A 1T6OA 2OOAA 1WIVA 1UFZA 2HAKA 2H5XA 2JY5A 3MMPA 1HT1E 1G41A 2DAEA 1ZMVA 2JY6B 1YLAA 1WJ7A 2K9DA 2LVAA 2JZ0A 1E94E 2B3TA 2JP7A 2KNAA 1V92A 1WR1B 2ZTDA 1IFYA 2G3QA 2OO9A 2LVQD 2MGWA 1IXSA 2JY8A 3K9OA 1WHCA 3BBZA 2JNHA 2EKFA 1HT2E 1Y8GA 1VEGA 3T6PA 2MR9A 3B89A 1VDLA 2KNVA 2CP8A 1OAIA 1VEKA 2RRUA 2LVOC 4DBGB
chains in the Genus database with same CATH superfamily
1MN3A 2RGOA 3JAMS 2D7EA 2KHHA 3VDUA 4G4NA 3QYBA 3KSXA 5KPRA 2CWBA 2OQ4A 1FJGM 2M60A 1GVNA 2X8AA 4IBDA 3AOGA 3E9SA 3UJNA 4PCZA 2WZJA 5IREB 1NY5A 3HU1A 2LNHC 1E9RA 2BWBA 4LZZA 2KW0A 2FFJA 3ZCBB 2XZFA 3TPZA 4LJ5A 3U6QA 4X64M 4OU7A 2DXIA 1F4IA 3FYDA 1XNQM 1KYIA 3FUXA 5ITXA 4B7FA 2R62A 3I51A 2UXDM 5EP2A 3J80S 2DVWB 3THGA 3AKZA 3GQ3A 1Z5CA 5FLXS 4JI8M 3LVWA 2KDLA 4JI7M 2DZNB 4YY3M 1SXJB 3BXWA 3I4YA 3JR4A 4B7HA 1K82A 2QNJA 1TTEA 4KODA 1SXJA 3C58A 2VF7A 4PT5A 4NXMM 3FTEA 1XNRM 1OIZA 3VLFB 2DNAA 1A5TA 1ZMWA 3FRHA 3KOYE 1XXHB 2YQZA 2BWEA 3PNVA 4WW0A 2OPFA 2Z3XA 1D0KA 2R18A 2UUBM 3DOAA 2CUZA 2RGHA 3PXGA 4D81A 2XFTA 4RF1A 1Z6TA 3T1HM 1I4WA 3IHPA 2J5YA 3KDSE 2F5PA 4AW4A 1NV8A 1TDHA 1TGUA 4BB9A 4B3SM 4M9ZA 3GLIE 3GPXA 2O01F 4LF6M 4GC5A 1D0MA 1WGNA 3FD9A 1TH2A 4XGIA 5EXPA 1IQPA 3VKHA 2MJ5B 1TF0B 2Y0TA 1HNWM 2F5QA 3GRVA 5DFLA 3U60A 3E46A 3SBJA 3L26A 4TUWA 5EP4A 5IWAM 5DNYA 4LFCM 1KSFX 3BOSA 2QQ8A 5ITXE 1EFUB 1E9SA 2LTUA 4LJ7A 3GRYA 3UMMA 2L7IA 5JI2E 2HWJA 4QNRA 4L6V6 4REZA 4DR2M 1NO1A 2JY7A 2LVPC 4GEWA 1JR3A 4AKIA 1SXJE 3FE3A 4FCTA 4G6ZA 2K0BX 3LCUA 2MROB 1IN5A 3C3DA 1N33M 1T6OA 2HAKA 2JY5A 2H5XA 1R2ZA 2VIIA 2FOIC 2R4JA 3GLGB 4B3RM 3AJIB 2C9OA 1WJ7A 2K9DA 1N75A 5E6JA 4QOZC 2QCUA 2ZAMA 4LJ8A 4GITA 3HU2A 1E94E 2BJWA 3GLGA 1Q3BA 1J5EM 2KNAA 3CGWA 1J09A 1S3SA 1DGGA 4MH0E 3TE6A 4GHLA 3GRUA 3U5ZB 1YSYA 1FNNA 1QANA 1WR1B 3KS4A 4NRWA 4K0KM 3R8FA 1IFYA 2WSFF 3LW5F 2F5NA 2OO9A 4LJ4A 4HL4A 4ITQA 2JY8A 3W68A 3E4RA 4DR1M 1Z5BA 2YFQA 3BBZA 4L4UA 1QAOA 4Y28F 2EKFA 4WURA 3U6DA 4LF7M 4Z6YA 3FTCA 1KFVA 3TL4X 1LTMA 1MU5A 2YNMD 2L6OA 2CEAA 1K3XA 1IN7A 4IBFA 4JI3M 1VEKA 1QDTA 2C98A 1AUAA 3KP1E 3VK8A 3AOEA 3MK6A 4JXJA 3W67A 4GMQA 4HLQA 4CJ6A 5ITYA 1NNUC 4OW0A 1JR3E 1OKSA 3J2PB 1VQ1A 4I4LA 3TWLA 1ORYB 5EJCA 3ZQJA 1D0LA 4DV4M 4FCVA 1VG5A 4LRSA 4LGYA 4JN6A 5DYIA 3GLHB 3NWLA 4MGIE 1BVSA 1NVMA 1Z59A 2JA2A 4GIPA 2F5SA 3GLGE 3HGIA 1WGLA 4LGMA 2JWSA 4FWDA 1DGHB 2ZTCA 1TH4A 5JI3E 2L4FA 3GRRA 4EIWA 1N32M 4AZFA 2UUAM 3B7QA 1EE8A 1GLNA 1PGYA 1ZAEA 3DA1A 1GO5A 3KS8A 2L4EA 4FWGA 3C9PA 7CATA 1NHGC 4AG6A 1IBKM 2I7PA 4IIWA 5C1BA 1EIJA 1QQWA 2L2DA 2KXEA 4W5WA 4X65M 3H4MA 1HR0M 2LXEA 4MGHA 3M7GA 1PJIA 3TWMA 1IN6A 2CHQA 3RE8A 1PRBA 3B9PA 3HY5A 3ILKA 2F4VM 4JI6M 4JI2M 3Q8XA 1Q39A 3AOEC 5ITUA 1L1ZA 3A98B 5E26A 4G3OA 5FTLA 2KRKA 2LHGA 2EUCA 4FD2A 4NSRA 1NSFA 1L8QA 1NV9A 2EKKA 3B7ZA 3PVSA 3KOXE 3VFDA 4B7GA 3J7BA 2O25A 4L15A 2VQFM 5EP1A 3HWSA 2CV0A 4MGYE 5FTNA 2WSEF 3RFWA 4DV7M 2UU9M 1IBLM 4Q7JA 1GABA 3HJSA 3SHGB 5EP3A 3VKGA 2APLA 1YUBA 2QZ4A 3FUTA 1OQYA 2CV1A 3GLHE 1IY2A 4S12A 1NY6A 4F1IA 1GL7A 4AG5A 3U61B 3LCVB 3FTDA 3LMMA 3IECA 3U6OA 1OAOC 2DZLA 1GJSA 1GJTA 3QYEA 4MGKE 2FH0A 2OOAA 4X62M 2L09A 3U61A 2KZUA 3MMPA 5C18A 5ITQA 2KA6B 4OVZA 2P5TA 5EXXA 3U60B 4LF5M 2JY6B 1YLAA 3FUWA 3FUUA 2ZAOA 1IXRC 2B3TA 2JP7A 4GHAA 4LJ9A 2C5RA 3SAVA 2XGNA 3OTOM 3HU3A 3L28A 4NOOB 4XBOA 2ZM6M 3GLFA 4M0WA 2G8LA 4IBBA 2BNKA 3T38A 2ZTDA 1SXJD 2G3QA 2LVQD 3UK6A 1IXSA 3SASA 3PFIA 2Z4RA 1DGFA 1WHCA 5FTJA 2XZUA 2CV2A 1XMQM 1MX0A 2GQFA 2QPAA 1L2BA 4MB7A 1PM5A 2C96A 4I81A 2C9CA 3CF2A 2Y21A 4LF9M 2CP8A 2I7NA 2MH8A 3LQQA 4CIZA 5H37D 3J7AS 4DBGB 4DV6M 4DR3M 3QAUA 3VDPA 2V1UA 1QZEA 4M0DA 4AI6A 3K2LA 2FNAA 3WHLA 1T3TA 4IBJA 4D82A 1N34M 1JB0F 1Q02A 4CHTB 2XFSA 5BPVA 2DI0A 1OFHA 2R4EA 1V34A 3E21A 4FW9A 1P3QQ 1QAMA 1X37A 2J7OA 2H1RA 2QP9X 3A45A 5KPTA 5KQ8A 1HNXM 3EIHA 3SMSA 4GH9A 1R4GA 2N35A 4AQYM 1K3WA 2UXCM 4ZPXA 4R71A 1MJGM 3GLFE 4BBAA 2QHOB 4NXNM 3HKPA 3GPYA 1N77A 3UZUA 2UXBM 1JR3D 2KEBA 2DAIA 3K1JA 2XSZD 2XH9A 1J7KA 1SG9A 4B3TM 1PJTA 1W5SA 4KLNA 3KP0E 1IM2A 3HHWA 3ZC7B 1T43A 1YE9A 4X66M 2R6FA 1V33A 3FRIA 1QZMA 4IBEA 3K92A 2K6BA 1TR8A 4DR4M 4ANRA 1G71A 3MJ5A 1N78A 3F92A 2OOBA 3W0LB 4GC9A 3I04M 2DHYA 2HCBA 3JR5A 4QHSA 4KHPM 5LMUM 4KT0F 4JI5M 2CE7A 2DAGA 2R65A 2WSCF 4DV2M 1L1TA 1D2NA 3TQSA 3L25A 3IG5A 1DO2A 3D8LA 2Z8YM 3SARA 2V1CA 3LQRA 4LFBM 1ZQ9A 5A2QS 5LMNM 1IN8A 2NQ8C 2DAMA 4RKUF 1TDZA 1R5LA 2DWZB 3HJ8A 5FTMA 1C1KA 1DV0A 2FE8A 1DGBA 4IBKA 2DWMA 2R45A 3PNYA 3VK7A 4LJ6A 3AFHA 1OTRA 3L27A 1OJLA 3KW6A 3QWLA 2ZANA 4IBCA 1H6UA 2YR0A 4RF0A 4JV5M 5IT9S 2A5YB 1R2YA 2QBYA 3GPPA 2F5OA 3AL0C 1HQYE 5KPZA 2HKJA 2CRUA 2K47A 1NHWC 3J27B 1L2CA 1OFIA 2R44A 4DV3M 2CHVA 1UM8A 3KVWA 5FTKA 4L16A 2G5GX 2W82A 4MM3B 4G4OA 2DAEA 1RU3A 2L7HA 3A46A 3HZJA 1E32A 4MGZE 3GP1A 2LVAA 2CHGA 2DWNA 1QYRA 3GLIA 4M9SA 4R3DA 3KXEC 4R7GA 1XMOM 1HQCA 2FS1A 3WHKA 4P17A 2LWXA 4LFAM 4JI4M 4BLCA 1R6BX 2HHHM 4I5SA 2DWLA 4DV0M 5EXTA 2HL7A 5FSWA 2MGWA 3K9OA 3SAUA 1PJSA 2M5ZA 5BR8M 1W5TA 3L29A 1TH3A 2JNHA 1QUSA 1HT2E 3M6AA 3I01M 3T6PA 2MR9A 3KOWE 1IY0A 4OVZB 3L2AA 4Z8XA 3SYLA 3UGJA 4DUYM 3B89A 3V76A 4DR7M 2O5RA 2KNVA 4LF8M 3TWKA 2XEPA 1OAIA 2DHRA 1LV7A 2E5LM 2J7NA 3RGPA 1G4AE 3GLFB 2LHCA 1C7YA 2QSFX 4L78A 3MHVC 3CTWB 4CGYB 1OIPA 4B08A 4IBIA 2EA0A 1NJGA 3HHZA 1G59A 1IXSB 1JQJC 3NBXX 3DZDA 4OX9M 1ZV1A 1XWIA 2DAKA 1XXHA 4M9XA 3SC3A 1NNJA 4B3MM 2Y20A 3R9XB 4NL4H 2D7HA 3SMPA 2V6ZM 4AKGA 3HJQA 4QOSA 4GRIA 2KNZA 2XLJA 1XC8A 4LF4M 3U6SA 4LJAA 5KO3A 2LVNC 1VEJA 3HHYA 4UN2B 3CF6E 3H4JA 3K8ZA 1Q3CA 2JXNA 2KZSA 3KSJA 4FCWA 4LCBA 2DKLA 2JZ1A 4L8RC 1HJPA 2EJSA 3U6PA 3C3EA 4HEOA 1G3IA 2GNOA 1DO0A 1XHBA 3SHFA 4NRVA 3EIEA 2VDBB 3IG8A 4FVMA 3NBIA 5L8RF 1QUTA 1IXZA 1G8PA 3SYKA 3D8BA 4DV1M 2D7GA 4XK8F 4F2LA 4PD2A 1SXJC 3B74A 2Z7JA 3T15A 2LBCA 2XSZA 1NJFA 5IZ7D 1ZMUA 4LRTA 4DUZM 2DENA 2KRUA 3T1YM 1L2DA 2X4AA 2Y0QA 4IJFA 1PJJA 4P16A 3K9PA 2Q2EB 2LH0A 3ZH9B 3I4VA 4JI0M 4G4RA 1CUKA 4G4QA 2UUCM 1N36M 1XXHE 4NC6A 4FWHA 3FTFA 3Q8GA 1IN4A 4LZJA 2C99A 2VF8A 2XF3A 1AIPC 2R0IA 2QENA 3CF0A 3FUVA 4DR6M 3RGSA 3GQ4A 4GKKM 1QDRA 4IJEA 3U5ZA 3U6CA 5GKNA 1XB2B 4JI1M 3W0FA 4II7A 2ERCA 1WXQA 2JUJA 3KOZE 1GL6A 5EQTA 4A3VB 4I8OA 8CATA 1I94M 2ZBKB 4NSOB 4WP2A 4PDGA 1WIVA 1UFZA 5EXSA 4DV5M 2CFOA 3AV0A 4PDIA 1HT1E 1G41A 1IY1A 2EO2A 1ZMVA 3HHXA 4IBGA 3FKEA 4LY6A 5ITTA 3GPUA 1R7RA 2JZ0A 3SFZA 1VDDA 3SAWA 5F3WA 3HX3A 3SATA 5DYGA 3U6LA 1V92A 2RKOA 4QHTA 4CISA 4RNAA 5ITRA 1GKIA 2Z4SA 5KQDA 1PJQA 3GO8A 4D80A 1IBMM 2QBYB 4GKJM 3DFZA 3U6MA 3GQ5A 1QAQA 4JYAM 3LVVA 3KFUG 1Y8GA 3GLHA 1VEGA 1Z5AA 4YHHM 2DZOB 3J81S 4DR5M 1QVRA 3FYCA 4LG2A 2R46A 1VDLA 2BJVA 2X49A 3A42A 4QNMA 3U6EA 1DGHA 4KO8A 2RRUA 2AHMA 3M0EA 2VQEM 2LVOC 1HNZM 4AKHA 3GLIB 3B7NA
chains in the Genus database with same CATH topology
1G4AE 1MN3A 2KHHA 1C7YA 2CWBA 2QSFX 1QZEA 1JR3E 1OKSA 1VQ1A 1Q02A 2WZJA 2DI0A 1ZV1A 2DAKA 1VG5A 2BWBA 3E21A 1P3QQ 1F4IA 1BVSA 1KYIA 3GLGE 1R4GA 1WGLA 2KNZA 2ZTCA 2L4FA 4R71A 2LVNC 3GLFE 1VEJA 4UN2B 2QHOB 3H4JA 2QNJA 1PGYA 2DAIA 1TTEA 2DKLA 2L4EA 2JZ1A 1GO5A 1HJPA 2EJSA 1SG9A 4HEOA 1G3IA 1IM2A 2L2DA 2DNAA 1DO0A 1A5TA 1T43A 1ZMWA 3FRHA 3FRIA 2BWEA 1TR8A 3F92A 2OOBA 4F2LA 2DHYA 3IHPA 2LBCA 4G3OA 1NV8A 1ZMUA 2DAGA 2DENA 3GLIE 1DO2A 1NV9A 1WGNA 2EKKA 3K9PA 2O25A 2MJ5B 1CUKA 5DFLA 1XXHE 2DAMA 3E46A 4Q7JA 1DV0A 1AIPC 2R0IA 1EFUB 2LTUA 1OQYA 3GLHE 1OTRA 4F1IA 5JI2E 2HWJA 1XB2B 2JY7A 2LVPC 4GEWA 3LCVB 3IECA 2JUJA 3FE3A 1HQYE 2DZLA 2K0BX 2MROB 3LCUA 4WP2A 1T6OA 2OOAA 1WIVA 1UFZA 2HAKA 2H5XA 2JY5A 3MMPA 1HT1E 1G41A 2DAEA 1ZMVA 2JY6B 1YLAA 1WJ7A 2K9DA 2LVAA 2JZ0A 1E94E 2B3TA 2JP7A 2KNAA 1V92A 1WR1B 2ZTDA 1IFYA 2G3QA 2OO9A 2LVQD 2MGWA 1IXSA 2JY8A 3K9OA 1WHCA 3BBZA 2JNHA 2EKFA 1HT2E 1Y8GA 1VEGA 3T6PA 2MR9A 3B89A 1VDLA 2KNVA 2CP8A 1OAIA 1VEKA 2RRUA 2LVOC 4DBGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4A E;  1MN3 A;  2KHH A;  1C7Y A;  2CWB A;  2QSF X;  1QZE A;  1JR3 E;  1OKS A;  1VQ1 A;  1Q02 A;  2WZJ A;  2DI0 A;  1ZV1 A;  2DAK A;  1VG5 A;  2BWB A;  3E21 A;  1P3Q Q;  1F4I A;  1BVS A;  1KYI A;  3GLG E;  1R4G A;  1WGL A;  2KNZ A;  2ZTC A;  2L4F A;  4R71 A;  2LVN C;  3GLF E;  1VEJ A;  4UN2 B;  2QHO B;  3H4J A;  2QNJ A;  1PGY A;  2DAI A;  1TTE A;  2DKL A;  2L4E A;  2JZ1 A;  1GO5 A;  1HJP A;  2EJS A;  1SG9 A;  4HEO A;  1G3I A;  1IM2 A;  2L2D A;  2DNA A;  1DO0 A;  1A5T A;  1T43 A;  1ZMW A;  3FRH A;  3FRI A;  2BWE A;  1TR8 A;  3F92 A;  2OOB A;  4F2L A;  2DHY A;  3IHP A;  2LBC A;  4G3O A;  1NV8 A;  1ZMU A;  2DAG A;  2DEN A;  3GLI E;  1DO2 A;  1NV9 A;  1WGN A;  2EKK A;  3K9P A;  2O25 A;  2MJ5 B;  1CUK A;  5DFL A;  1XXH E;  2DAM A;  3E46 A;  4Q7J A;  1DV0 A;  1AIP C;  2R0I A;  1EFU B;  2LTU A;  1OQY A;  3GLH E;  1OTR A;  4F1I A;  5JI2 E;  2HWJ A;  1XB2 B;  2JY7 A;  2LVP C;  4GEW A;  3LCV B;  3IEC A;  2JUJ A;  3FE3 A;  1HQY E;  2DZL A;  2K0B X;  2MRO B;  3LCU A;  4WP2 A;  1T6O A;  2OOA A;  1WIV A;  1UFZ A;  2HAK A;  2H5X A;  2JY5 A;  3MMP A;  1HT1 E;  1G41 A;  2DAE A;  1ZMV A;  2JY6 B;  1YLA A;  1WJ7 A;  2K9D A;  2LVA A;  2JZ0 A;  1E94 E;  2B3T A;  2JP7 A;  2KNA A;  1V92 A;  1WR1 B;  2ZTD A;  1IFY A;  2G3Q A;  2OO9 A;  2LVQ D;  2MGW A;  1IXS A;  2JY8 A;  3K9O A;  1WHC A;  3BBZ A;  2JNH A;  2EKF A;  1HT2 E;  1Y8G A;  1VEG A;  3T6P A;  2MR9 A;  3B89 A;  1VDL A;  2KNV A;  2CP8 A;  1OAI A;  1VEK A;  2RRU A;  2LVO C;  4DBG B; 
#chains in the Genus database with same CATH topology
 1MN3 A;  2RGO A;  3JAM S;  2D7E A;  2KHH A;  3VDU A;  4G4N A;  3QYB A;  3KSX A;  5KPR A;  2CWB A;  2OQ4 A;  1FJG M;  2M60 A;  1GVN A;  2X8A A;  4IBD A;  3AOG A;  3E9S A;  3UJN A;  4PCZ A;  2WZJ A;  5IRE B;  1NY5 A;  3HU1 A;  2LNH C;  1E9R A;  2BWB A;  4LZZ A;  2KW0 A;  2FFJ A;  3ZCB B;  2XZF A;  3TPZ A;  4LJ5 A;  3U6Q A;  4X64 M;  4OU7 A;  2DXI A;  1F4I A;  3FYD A;  1XNQ M;  1KYI A;  3FUX A;  5ITX A;  4B7F A;  2R62 A;  3I51 A;  2UXD M;  5EP2 A;  3J80 S;  2DVW B;  3THG A;  3AKZ A;  3GQ3 A;  1Z5C A;  5FLX S;  4JI8 M;  3LVW A;  2KDL A;  4JI7 M;  2DZN B;  4YY3 M;  1SXJ B;  3BXW A;  3I4Y A;  3JR4 A;  4B7H A;  1K82 A;  2QNJ A;  1TTE A;  4KOD A;  1SXJ A;  3C58 A;  2VF7 A;  4PT5 A;  4NXM M;  3FTE A;  1XNR M;  1OIZ A;  3VLF B;  2DNA A;  1A5T A;  1ZMW A;  3FRH A;  3KOY E;  1XXH B;  2YQZ A;  2BWE A;  3PNV A;  4WW0 A;  2OPF A;  2Z3X A;  1D0K A;  2R18 A;  2UUB M;  3DOA A;  2CUZ A;  2RGH A;  3PXG A;  4D81 A;  2XFT A;  4RF1 A;  1Z6T A;  3T1H M;  1I4W A;  3IHP A;  2J5Y A;  3KDS E;  2F5P A;  4AW4 A;  1NV8 A;  1TDH A;  1TGU A;  4BB9 A;  4B3S M;  4M9Z A;  3GLI E;  3GPX A;  2O01 F;  4LF6 M;  4GC5 A;  1D0M A;  1WGN A;  3FD9 A;  1TH2 A;  4XGI A;  5EXP A;  1IQP A;  3VKH A;  2MJ5 B;  1TF0 B;  2Y0T A;  1HNW M;  2F5Q A;  3GRV A;  5DFL A;  3U60 A;  3E46 A;  3SBJ A;  3L26 A;  4TUW A;  5EP4 A;  5IWA M;  5DNY A;  4LFC M;  1KSF X;  3BOS A;  2QQ8 A;  5ITX E;  1EFU B;  1E9S A;  2LTU A;  4LJ7 A;  3GRY A;  3UMM A;  2L7I A;  5JI2 E;  2HWJ A;  4QNR A;  4L6V 6;  4REZ A;  4DR2 M;  1NO1 A;  2JY7 A;  2LVP C;  4GEW A;  1JR3 A;  4AKI A;  1SXJ E;  3FE3 A;  4FCT A;  4G6Z A;  2K0B X;  3LCU A;  2MRO B;  1IN5 A;  3C3D A;  1N33 M;  1T6O A;  2HAK A;  2JY5 A;  2H5X A;  1R2Z A;  2VII A;  2FOI C;  2R4J A;  3GLG B;  4B3R M;  3AJI B;  2C9O A;  1WJ7 A;  2K9D A;  1N75 A;  5E6J A;  4QOZ C;  2QCU A;  2ZAM A;  4LJ8 A;  4GIT A;  3HU2 A;  1E94 E;  2BJW A;  3GLG A;  1Q3B A;  1J5E M;  2KNA A;  3CGW A;  1J09 A;  1S3S A;  1DGG A;  4MH0 E;  3TE6 A;  4GHL A;  3GRU A;  3U5Z B;  1YSY A;  1FNN A;  1QAN A;  1WR1 B;  3KS4 A;  4NRW A;  4K0K M;  3R8F A;  1IFY A;  2WSF F;  3LW5 F;  2F5N A;  2OO9 A;  4LJ4 A;  4HL4 A;  4ITQ A;  2JY8 A;  3W68 A;  3E4R A;  4DR1 M;  1Z5B A;  2YFQ A;  3BBZ A;  4L4U A;  1QAO A;  4Y28 F;  2EKF A;  4WUR A;  3U6D A;  4LF7 M;  4Z6Y A;  3FTC A;  1KFV A;  3TL4 X;  1LTM A;  1MU5 A;  2YNM D;  2L6O A;  2CEA A;  1K3X A;  1IN7 A;  4IBF A;  4JI3 M;  1VEK A;  1QDT A;  2C98 A;  1AUA A;  3KP1 E;  3VK8 A;  3AOE A;  3MK6 A;  4JXJ A;  3W67 A;  4GMQ A;  4HLQ A;  4CJ6 A;  5ITY A;  1NNU C;  4OW0 A;  1JR3 E;  1OKS A;  3J2P B;  1VQ1 A;  4I4L A;  3TWL A;  1ORY B;  5EJC A;  3ZQJ A;  1D0L A;  4DV4 M;  4FCV A;  1VG5 A;  4LRS A;  4LGY A;  4JN6 A;  5DYI A;  3GLH B;  3NWL A;  4MGI E;  1BVS A;  1NVM A;  1Z59 A;  2JA2 A;  4GIP A;  2F5S A;  3GLG E;  3HGI A;  1WGL A;  4LGM A;  2JWS A;  4FWD A;  1DGH B;  2ZTC A;  1TH4 A;  5JI3 E;  2L4F A;  3GRR A;  4EIW A;  1N32 M;  4AZF A;  2UUA M;  3B7Q A;  1EE8 A;  1GLN A;  1PGY A;  1ZAE A;  3DA1 A;  1GO5 A;  3KS8 A;  2L4E A;  4FWG A;  3C9P A;  7CAT A;  1NHG C;  4AG6 A;  1IBK M;  2I7P A;  4IIW A;  5C1B A;  1EIJ A;  1QQW A;  2L2D A;  2KXE A;  4W5W A;  4X65 M;  3H4M A;  1HR0 M;  2LXE A;  4MGH A;  3M7G A;  1PJI A;  3TWM A;  1IN6 A;  2CHQ A;  3RE8 A;  1PRB A;  3B9P A;  3HY5 A;  3ILK A;  2F4V M;  4JI6 M;  4JI2 M;  3Q8X A;  1Q39 A;  3AOE C;  5ITU A;  1L1Z A;  3A98 B;  5E26 A;  4G3O A;  5FTL A;  2KRK A;  2LHG A;  2EUC A;  4FD2 A;  4NSR A;  1NSF A;  1L8Q A;  1NV9 A;  2EKK A;  3B7Z A;  3PVS A;  3KOX E;  3VFD A;  4B7G A;  3J7B A;  2O25 A;  4L15 A;  2VQF M;  5EP1 A;  3HWS A;  2CV0 A;  4MGY E;  5FTN A;  2WSE F;  3RFW A;  4DV7 M;  2UU9 M;  1IBL M;  4Q7J A;  1GAB A;  3HJS A;  3SHG B;  5EP3 A;  3VKG A;  2APL A;  1YUB A;  2QZ4 A;  3FUT A;  1OQY A;  2CV1 A;  3GLH E;  1IY2 A;  4S12 A;  1NY6 A;  4F1I A;  1GL7 A;  4AG5 A;  3U61 B;  3LCV B;  3FTD A;  3LMM A;  3IEC A;  3U6O A;  1OAO C;  2DZL A;  1GJS A;  1GJT A;  3QYE A;  4MGK E;  2FH0 A;  2OOA A;  4X62 M;  2L09 A;  3U61 A;  2KZU A;  3MMP A;  5C18 A;  5ITQ A;  2KA6 B;  4OVZ A;  2P5T A;  5EXX A;  3U60 B;  4LF5 M;  2JY6 B;  1YLA A;  3FUW A;  3FUU A;  2ZAO A;  1IXR C;  2B3T A;  2JP7 A;  4GHA A;  4LJ9 A;  2C5R A;  3SAV A;  2XGN A;  3OTO M;  3HU3 A;  3L28 A;  4NOO B;  4XBO A;  2ZM6 M;  3GLF A;  4M0W A;  2G8L A;  4IBB A;  2BNK A;  3T38 A;  2ZTD A;  1SXJ D;  2G3Q A;  2LVQ D;  3UK6 A;  1IXS A;  3SAS A;  3PFI A;  2Z4R A;  1DGF A;  1WHC A;  5FTJ A;  2XZU A;  2CV2 A;  1XMQ M;  1MX0 A;  2GQF A;  2QPA A;  1L2B A;  4MB7 A;  1PM5 A;  2C96 A;  4I81 A;  2C9C A;  3CF2 A;  2Y21 A;  4LF9 M;  2CP8 A;  2I7N A;  2MH8 A;  3LQQ A;  4CIZ A;  5H37 D;  3J7A S;  4DBG B;  4DV6 M;  4DR3 M;  3QAU A;  3VDP A;  2V1U A;  1QZE A;  4M0D A;  4AI6 A;  3K2L A;  2FNA A;  3WHL A;  1T3T A;  4IBJ A;  4D82 A;  1N34 M;  1JB0 F;  1Q02 A;  4CHT B;  2XFS A;  5BPV A;  2DI0 A;  1OFH A;  2R4E A;  1V34 A;  3E21 A;  4FW9 A;  1P3Q Q;  1QAM A;  1X37 A;  2J7O A;  2H1R A;  2QP9 X;  3A45 A;  5KPT A;  5KQ8 A;  1HNX M;  3EIH A;  3SMS A;  4GH9 A;  1R4G A;  2N35 A;  4AQY M;  1K3W A;  2UXC M;  4ZPX A;  4R71 A;  1MJG M;  3GLF E;  4BBA A;  2QHO B;  4NXN M;  3HKP A;  3GPY A;  1N77 A;  3UZU A;  2UXB M;  1JR3 D;  2KEB A;  2DAI A;  3K1J A;  2XSZ D;  2XH9 A;  1J7K A;  1SG9 A;  4B3T M;  1PJT A;  1W5S A;  4KLN A;  3KP0 E;  1IM2 A;  3HHW A;  3ZC7 B;  1T43 A;  1YE9 A;  4X66 M;  2R6F A;  1V33 A;  3FRI A;  1QZM A;  4IBE A;  3K92 A;  2K6B A;  1TR8 A;  4DR4 M;  4ANR A;  1G71 A;  3MJ5 A;  1N78 A;  3F92 A;  2OOB A;  3W0L B;  4GC9 A;  3I04 M;  2DHY A;  2HCB A;  3JR5 A;  4QHS A;  4KHP M;  5LMU M;  4KT0 F;  4JI5 M;  2CE7 A;  2DAG A;  2R65 A;  2WSC F;  4DV2 M;  1L1T A;  1D2N A;  3TQS A;  3L25 A;  3IG5 A;  1DO2 A;  3D8L A;  2Z8Y M;  3SAR A;  2V1C A;  3LQR A;  4LFB M;  1ZQ9 A;  5A2Q S;  5LMN M;  1IN8 A;  2NQ8 C;  2DAM A;  4RKU F;  1TDZ A;  1R5L A;  2DWZ B;  3HJ8 A;  5FTM A;  1C1K A;  1DV0 A;  2FE8 A;  1DGB A;  4IBK A;  2DWM A;  2R45 A;  3PNY A;  3VK7 A;  4LJ6 A;  3AFH A;  1OTR A;  3L27 A;  1OJL A;  3KW6 A;  3QWL A;  2ZAN A;  4IBC A;  1H6U A;  2YR0 A;  4RF0 A;  4JV5 M;  5IT9 S;  2A5Y B;  1R2Y A;  2QBY A;  3GPP A;  2F5O A;  3AL0 C;  1HQY E;  5KPZ A;  2HKJ A;  2CRU A;  2K47 A;  1NHW C;  3J27 B;  1L2C A;  1OFI A;  2R44 A;  4DV3 M;  2CHV A;  1UM8 A;  3KVW A;  5FTK A;  4L16 A;  2G5G X;  2W82 A;  4MM3 B;  4G4O A;  2DAE A;  1RU3 A;  2L7H A;  3A46 A;  3HZJ A;  1E32 A;  4MGZ E;  3GP1 A;  2LVA A;  2CHG A;  2DWN A;  1QYR A;  3GLI A;  4M9S A;  4R3D A;  3KXE C;  4R7G A;  1XMO M;  1HQC A;  2FS1 A;  3WHK A;  4P17 A;  2LWX A;  4LFA M;  4JI4 M;  4BLC A;  1R6B X;  2HHH M;  4I5S A;  2DWL A;  4DV0 M;  5EXT A;  2HL7 A;  5FSW A;  2MGW A;  3K9O A;  3SAU A;  1PJS A;  2M5Z A;  5BR8 M;  1W5T A;  3L29 A;  1TH3 A;  2JNH A;  1QUS A;  1HT2 E;  3M6A A;  3I01 M;  3T6P A;  2MR9 A;  3KOW E;  1IY0 A;  4OVZ B;  3L2A A;  4Z8X A;  3SYL A;  3UGJ A;  4DUY M;  3B89 A;  3V76 A;  4DR7 M;  2O5R A;  2KNV A;  4LF8 M;  3TWK A;  2XEP A;  1OAI A;  2DHR A;  1LV7 A;  2E5L M;  2J7N A;  3RGP A;  1G4A E;  3GLF B;  2LHC A;  1C7Y A;  2QSF X;  4L78 A;  3MHV C;  3CTW B;  4CGY B;  1OIP A;  4B08 A;  4IBI A;  2EA0 A;  1NJG A;  3HHZ A;  1G59 A;  1IXS B;  1JQJ C;  3NBX X;  3DZD A;  4OX9 M;  1ZV1 A;  1XWI A;  2DAK A;  1XXH A;  4M9X A;  3SC3 A;  1NNJ A;  4B3M M;  2Y20 A;  3R9X B;  4NL4 H;  2D7H A;  3SMP A;  2V6Z M;  4AKG A;  3HJQ A;  4QOS A;  4GRI A;  2KNZ A;  2XLJ A;  1XC8 A;  4LF4 M;  3U6S A;  4LJA A;  5KO3 A;  2LVN C;  1VEJ A;  3HHY A;  4UN2 B;  3CF6 E;  3H4J A;  3K8Z A;  1Q3C A;  2JXN A;  2KZS A;  3KSJ A;  4FCW A;  4LCB A;  2DKL A;  2JZ1 A;  4L8R C;  1HJP A;  2EJS A;  3U6P A;  3C3E A;  4HEO A;  1G3I A;  2GNO A;  1DO0 A;  1XHB A;  3SHF A;  4NRV A;  3EIE A;  2VDB B;  3IG8 A;  4FVM A;  3NBI A;  5L8R F;  1QUT A;  1IXZ A;  1G8P A;  3SYK A;  3D8B A;  4DV1 M;  2D7G A;  4XK8 F;  4F2L A;  4PD2 A;  1SXJ C;  3B74 A;  2Z7J A;  3T15 A;  2LBC A;  2XSZ A;  1NJF A;  5IZ7 D;  1ZMU A;  4LRT A;  4DUZ M;  2DEN A;  2KRU A;  3T1Y M;  1L2D A;  2X4A A;  2Y0Q A;  4IJF A;  1PJJ A;  4P16 A;  3K9P A;  2Q2E B;  2LH0 A;  3ZH9 B;  3I4V A;  4JI0 M;  4G4R A;  1CUK A;  4G4Q A;  2UUC M;  1N36 M;  1XXH E;  4NC6 A;  4FWH A;  3FTF A;  3Q8G A;  1IN4 A;  4LZJ A;  2C99 A;  2VF8 A;  2XF3 A;  1AIP C;  2R0I A;  2QEN A;  3CF0 A;  3FUV A;  4DR6 M;  3RGS A;  3GQ4 A;  4GKK M;  1QDR A;  4IJE A;  3U5Z A;  3U6C A;  5GKN A;  1XB2 B;  4JI1 M;  3W0F A;  4II7 A;  2ERC A;  1WXQ A;  2JUJ A;  3KOZ E;  1GL6 A;  5EQT A;  4A3V B;  4I8O A;  8CAT A;  1I94 M;  2ZBK B;  4NSO B;  4WP2 A;  4PDG A;  1WIV A;  1UFZ A;  5EXS A;  4DV5 M;  2CFO A;  3AV0 A;  4PDI A;  1HT1 E;  1G41 A;  1IY1 A;  2EO2 A;  1ZMV A;  3HHX A;  4IBG A;  3FKE A;  4LY6 A;  5ITT A;  3GPU A;  1R7R A;  2JZ0 A;  3SFZ A;  1VDD A;  3SAW A;  5F3W A;  3HX3 A;  3SAT A;  5DYG A;  3U6L A;  1V92 A;  2RKO A;  4QHT A;  4CIS A;  4RNA A;  5ITR A;  1GKI A;  2Z4S A;  5KQD A;  1PJQ A;  3GO8 A;  4D80 A;  1IBM M;  2QBY B;  4GKJ M;  3DFZ A;  3U6M A;  3GQ5 A;  1QAQ A;  4JYA M;  3LVV A;  3KFU G;  1Y8G A;  3GLH A;  1VEG A;  1Z5A A;  4YHH M;  2DZO B;  3J81 S;  4DR5 M;  1QVR A;  3FYC A;  4LG2 A;  2R46 A;  1VDL A;  2BJV A;  2X49 A;  3A42 A;  4QNM A;  3U6E A;  1DGH A;  4KO8 A;  2RRU A;  2AHM A;  3M0E A;  2VQE M;  2LVO C;  1HNZ M;  4AKH A;  3GLI B;  3B7N A; 
#chains in the Genus database with same CATH homology
 1G4A E;  1MN3 A;  2KHH A;  1C7Y A;  2CWB A;  2QSF X;  1QZE A;  1JR3 E;  1OKS A;  1VQ1 A;  1Q02 A;  2WZJ A;  2DI0 A;  1ZV1 A;  2DAK A;  1VG5 A;  2BWB A;  3E21 A;  1P3Q Q;  1F4I A;  1BVS A;  1KYI A;  3GLG E;  1R4G A;  1WGL A;  2KNZ A;  2ZTC A;  2L4F A;  4R71 A;  2LVN C;  3GLF E;  1VEJ A;  4UN2 B;  2QHO B;  3H4J A;  2QNJ A;  1PGY A;  2DAI A;  1TTE A;  2DKL A;  2L4E A;  2JZ1 A;  1GO5 A;  1HJP A;  2EJS A;  1SG9 A;  4HEO A;  1G3I A;  1IM2 A;  2L2D A;  2DNA A;  1DO0 A;  1A5T A;  1T43 A;  1ZMW A;  3FRH A;  3FRI A;  2BWE A;  1TR8 A;  3F92 A;  2OOB A;  4F2L A;  2DHY A;  3IHP A;  2LBC A;  4G3O A;  1NV8 A;  1ZMU A;  2DAG A;  2DEN A;  3GLI E;  1DO2 A;  1NV9 A;  1WGN A;  2EKK A;  3K9P A;  2O25 A;  2MJ5 B;  1CUK A;  5DFL A;  1XXH E;  2DAM A;  3E46 A;  4Q7J A;  1DV0 A;  1AIP C;  2R0I A;  1EFU B;  2LTU A;  1OQY A;  3GLH E;  1OTR A;  4F1I A;  5JI2 E;  2HWJ A;  1XB2 B;  2JY7 A;  2LVP C;  4GEW A;  3LCV B;  3IEC A;  2JUJ A;  3FE3 A;  1HQY E;  2DZL A;  2K0B X;  2MRO B;  3LCU A;  4WP2 A;  1T6O A;  2OOA A;  1WIV A;  1UFZ A;  2HAK A;  2H5X A;  2JY5 A;  3MMP A;  1HT1 E;  1G41 A;  2DAE A;  1ZMV A;  2JY6 B;  1YLA A;  1WJ7 A;  2K9D A;  2LVA A;  2JZ0 A;  1E94 E;  2B3T A;  2JP7 A;  2KNA A;  1V92 A;  1WR1 B;  2ZTD A;  1IFY A;  2G3Q A;  2OO9 A;  2LVQ D;  2MGW A;  1IXS A;  2JY8 A;  3K9O A;  1WHC A;  3BBZ A;  2JNH A;  2EKF A;  1HT2 E;  1Y8G A;  1VEG A;  3T6P A;  2MR9 A;  3B89 A;  1VDL A;  2KNV A;  2CP8 A;  1OAI A;  1VEK A;  2RRU A;  2LVO C;  4DBG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...