2LBCA

Solution structure of tandem uba of usp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain Analysis Reveals That a Deubiquitinating Enzyme USP13 Performs Non-Activating Catalysis for Lys63-Linked Polyubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
total genus 27
structure length 126
sequence length 126
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA01
1AIPC 1Q02A 3H4JA 1DO0A 1C7YA 3E46A 1DO2A 1NV9A 2CP8A 2LVQD 1YLAA 2O25A 2KNZA 2QSFX 2JZ0A 1VG5A 1NV8A 2DAGA 1VQ1A 1G4AE 2LVPC 2HAKA 1T6OA 1E94E 2DAEA 1PGYA 3GLGE 2MGWA 2DNAA 2WZJA 1VEJA 1WGLA 1GO5A 1MN3A 4WP2A 4F1IA 2JZ1A 1HT1E 2BWBA 1HJPA 3GLHE 4Q7JA 2MROB 2DI0A 3FE3A 3GLIE 2R0IA 1ZV1A 2OOBA 1EFUB 1WIVA 2QNJA 5JI2E 1R4GA 2DENA 3B89A 1VEKA 1DV0A 2JY7A 2K0BX 3LCVB 1OTRA 1WHCA 2DZLA 4UN2B 2BWEA 2DAIA 3GLFE 1ZMWA 2EJSA 1IFYA 2JY6B 2JNHA 1XB2B 2LTUA 2JY5A 4G3OA 3T6PA 2JUJA 1G3IA 3K9OA 1HQYE 2CWBA 1KYIA 2DKLA 3IHPA 2MR9A 2LVAA 1F4IA 2HWJA 2DAMA 3K9PA 1IM2A 2MJ5B 2L2DA 1UFZA 4F2LA 2EKFA 2L4EA 2JY8A 3F92A 1ZMUA 2OOAA 3LCUA 1VDLA 1XXHE 2JP7A 1Y8GA 1G41A 2RRUA 1HT2E 1CUKA 3FRIA 1QZEA 2G3QA 2LVOC 2KNAA 1OKSA 3IECA 2KHHA 1VEGA 4DBGB 2QHOB 1ZMVA 2LBCA 1TTEA 3MMPA 1WR1B 2DHYA 2DAKA 1WJ7A 2L4FA 1BVSA 1OAIA 2B3TA 2EKKA 2LVNC 1T43A 4HEOA 2K9DA 1P3QQ 2ZTDA 1V92A 2ZTCA 1A5TA 1SG9A 2KNVA 1IXSA 5DFLA 1JR3E 3BBZA 2OO9A 3FRHA 1OQYA 1TR8A 3E21A 4GEWA 2H5XA 1WGNA 4R71A
chains in the Genus database with same CATH superfamily
1AIPC 3SMPA 1S3SA 3D8BA 3GLIB 1QAOA 5EXPA 4LF9M 3A98B 4JI0M 2F5QA 4KHPM 4LFBM 2LVQD 4B7FA 2CE7A 4GIPA 4KLNA 1R6BX 2MH8A 1IN6A 2I7PA 4RNAA 1YUBA 4MGKE 4NL4H 3U5ZA 3MJ5A 4FCWA 4A3VB 4LJ5A 2CUZA 4LF4M 1J09A 2FE8A 1KSFX 3B9PA 1K3XA 1TH2A 4NRVA 2VF8A 1VEJA 2QP9X 3J2PB 3U6EA 4CISA 2XLJA 4FWHA 3AFHA 4Z8XA 3W67A 1D0LA 1MN3A 1NJFA 1I4WA 3J80S 1EIJA 3LQQA 4AG5A 1Q3BA 3Q8XA 3GLHE 3I04M 4DV2M 1VDDA 4PT5A 3SHGB 1G71A 2W82A 4LJAA 2R0IA 3HX3A 2F5SA 4FVMA 1WIVA 2QNJA 1N36M 3AL0C 1QVRA 2DENA 4QOSA 1QDTA 4OVZA 2ZAMA 1OIZA 2CFOA 2JY7A 3C9PA 3QAUA 2K0BX 3LCVB 4MGIE 4ZPXA 3RE8A 4DV3M 4OVZB 2ZANA 2DWLA 2VDBB 2BWEA 2D7HA 2DAIA 1ZMWA 3HKPA 4LJ8A 2LWXA 3U61B 1PJTA 2JY6B 3J7BA 5KO3A 3SAUA 1N34M 2XFTA 3HHWA 3T6PA 5FTJA 5IWAM 2XFSA 4MGZE 1NJGA 3L27A 4II7A 3K9OA 3EIEA 1IBMM 5FTNA 5KQ8A 2LH0A 2DXIA 1XMOM 1I94M 3DZDA 4Z6YA 4L15A 4HLQA 3WHLA 2HWJA 2I7NA 4MGYE 4F2LA 1PJJA 3D8LA 4X62M 2KZSA 3VDUA 1PJQA 1DGBA 1XXHB 2UUBM 3LCUA 4IBJA 2KZUA 1VDLA 5FLXS 3GQ4A 2J7NA 2WSFF 4JN6A 4KO8A 2M5ZA 3U5ZB 1E9RA 1Y8GA 3CF2A 4IBGA 1JQJC 4QNMA 4D80A 1IBKM 4JI1M 1GLNA 1HT2E 2YQZA 1HNZM 1CUKA 3GPUA 3Q8GA 2CEAA 3KS4A 3TWLA 4Y28F 5GKNA 2AHMA 5EXXA 2LHGA 2KHHA 3PNYA 5A2QS 3GPPA 3U6SA 2C98A 2Z7JA 4DV7M 1VEGA 2QHOB 1ZMVA 2LBCA 1TTEA 2F5NA 2NQ8C 2DAKA 1TGUA 2KXEA 4I4LA 4G4RA 4B3MM 1NO1A 1DGGA 3SC3A 1IXSB 4NXMM 4JI8M 3M6AA 2KA6B 4YY3M 1IN5A 1T43A 1V33A 3B7QA 4HEOA 3T38A 1N32M 1OFIA 2RGOA 2ZTDA 3TPZA 2BJWA 2ZTCA 4B08A 4B7GA 2ZM6M 4DV6M 2CRUA 4LJ6A 4LJ9A 1JR3E 2O5RA 4G4OA 3ILKA 3GO8A 4R3DA 3GLFA 3TWKA 3U6QA 1IBLM 3E21A 4GHAA 2C9CA 1GABA 1R4GA 2X4AA 1NHGC 1DO0A 4AW4A 4AQYM 2KRKA 4IBEA 2CP8A 3U6CA 3FTFA 4MGHA 1HQCA 3AV0A 3RGPA 3GRRA 1XC8A 3J81S 1OIPA 3W0FA 2JZ0A 3NBXX 3FTEA 2C99A 4MB7A 2QENA 1JB0F 3QWLA 4OU7A 2UU9M 1LV7A 3VKHA 3GLGE 3JAMS 4X66M 1IXZA 3BOSA 3GLGB 4TUWA 5ITUA 4DUZM 2FS1A 2VIIA 3TWMA 3PFIA 3C3DA 3CTWB 5EP4A 1V34A 4WP2A 4F1IA 4ITQA 2JZ1A 4XGIA 3ZC7B 2XSZD 2HHHM 1IN7A 1TDZA 4BBAA 4JYAM 3B74A 3UK6A 5ITRA 4BLCA 2R65A 3HU1A 4QNRA 1NNJA 3RFWA 2ERCA 1GL6A 1ZV1A 2OOBA 1EFUB 4JI6M 4B3RM 4LRSA 1LTMA 5JI2E 4LF8M 1GL7A 3FYCA 5KPTA 3B89A 3AOEC 1QQWA 2CV1A 1VEKA 2BJVA 2LHCA 1IN4A 1OTRA 1WHCA 2QQ8A 3HU2A 3KVWA 4DR4M 1JR3A 1NVMA 5EP3A 3GPYA 2XGNA 3GLFE 5F3WA 3FYDA 3VKGA 3R9XB 1SXJD 3W68A 4B7HA 2JNHA 1GJSA 2JWSA 1DGHB 3QYEA 5L8RF 2A5YB 4G3OA 3FTDA 4WW0A 3LMMA 4X64M 4FWDA 4LF7M 2EUCA 3PXGA 1E9SA 1PRBA 2DKLA 2MR9A 3T1HM 5ITTA 1IY1A 2L7IA 2LVAA 2F5PA 4DR2M 4B3TM 2DAMA 3GQ5A 4FCVA 1IM2A 2MJ5B 5EXSA 4DR7M 4JXJA 1XNQM 4FW9A 4PD2A 4NRWA 2L4EA 2EKFA 4REZA 3GLFB 3LQRA 2XSZA 3GQ3A 1QZMA 2R45A 1XXHE 3SASA 1ZAEA 2K6BA 4JI3M 3K2LA 4LZJA 4M9ZA 4QOZC 4IBCA 2Z3XA 2EO2A 3UGJA 4FWGA 4LFCM 2BNKA 4DR1M 2G3QA 2LVOC 4LRTA 4P17A 4DV5M 2FNAA 8CATA 1Z59A 2KNAA 1OKSA 1Q39A 2UUAM 5IREB 3HGIA 4DBGB 1RU3A 3DFZA 2Y20A 3FUWA 5KQDA 3MMPA 4GRIA 3U6PA 1QUTA 2L4FA 1JR3D 2H1RA 2B3TA 3M7GA 3L28A 3UMMA 4DR3M 3U6LA 1NY5A 1QANA 1P3QQ 4NSRA 1V92A 1XWIA 2XZUA 5EQTA 3SFZA 3AJIB 3PNVA 1YSYA 3A46A 1SG9A 1GVNA 2DZOB 1PJIA 2L09A 2VQEM 3BBZA 1XXHA 2DWZB 3UZUA 3FUTA 4AG6A 4L78A 2WSEF 2XF3A 4JI4M 2R4JA 1ZQ9A 2DWNA 3ZCBB 2H5XA 5LMNM 4GKJM 2E5LM 1Q02A 1NHWC 1C7YA 1ORYB 3E46A 5C1BA 1DO2A 2F4VM 1NV9A 1L1TA 3U6DA 3LVVA 4DV4M 4GH9A 1D0MA 3JR4A 2G5GX 2QSFX 3THGA 3A42A 3E9SA 4BB9A 2DAGA 1VQ1A 3QYBA 4GC9A 2DVWB 1OAOC 4LGYA 1T6OA 1R2ZA 1E94E 2DAEA 1PGYA 4M9SA 2MGWA 1KFVA 4W5WA 1WGLA 1NNUC 4LG2A 2OPFA 3HWSA 2DWMA 4AKHA 3ZH9B 5JI3E 2QCUA 3MK6A 4XK8F 1HT1E 2J7OA 5FTLA 3KOXE 4GMQA 4OW0A 2KDLA 5BR8M 1N77A 4LJ4A 1Z5AA 4D81A 2J5YA 3FE3A 2VQFM 3GLIE 4R7GA 3TE6A 2C96A 5KPZA 4IJEA 3T15A 3K8ZA 1OFHA 2DHRA 2EA0A 3CF0A 5EXTA 2V1CA 2Y0TA 3U61A 3VFDA 3NWLA 2CHQA 3GRYA 5EJCA 1L2BA 1TH4A 4IJFA 2APLA 5FSWA 3B7NA 2R4EA 4UN2B 2WSCF 2CV2A 3HJSA 3KOZE 4GITA 1C1KA 1IY2A 1W5SA 1J7KA 2FFJA 4AZFA 1GJTA 5LMUM 4RF0A 2KEBA 3WHKA 5E6JA 2JUJA 3VK7A 1MX0A 7CATA 3GP1A 4AKIA 4JI7M 4QHTA 1KYIA 4IBKA 3LW5F 1N75A 4PDIA 1Z5BA 1NY6A 1TDHA 3UJNA 2JXNA 3GPXA 3GLIA 3K9PA 3LVWA 2L2DA 1UFZA 2FH0A 4RF1A 2QZ4A 3VDPA 2XEPA 1N78A 1D0KA 1QDRA 1SXJE 2OOAA 3HZJA 3C3EA 3I51A 2ZBKB 5ITYA 1L1ZA 5DNYA 1G41A 3OTOM 1XHBA 2RRUA 4NXNM 3ZQJA 5H37D 2UXCM 1G8PA 3KXEC 5C18A 1QZEA 2R44A 4DUYM 1UM8A 1L2CA 1OJLA 1YE9A 2Y0QA 4G6ZA 4JI2M 1WXQA 2P5TA 3I4YA 1MU5A 4LJ7A 3IECA 2RKOA 1TF0B 2X49A 3GLHB 2GNOA 3HU3A 1WR1B 3KP0E 3KDSE 4DV1M 4OX9M 2K47A 3FTCA 1OAIA 2EKKA 3HY5A 1GKIA 4EIWA 2LVNC 4NOOB 3SARA 1J5EM 5FTMA 3SBJA 4DR6M 2K9DA 4FD2A 2C9OA 2M60A 4M9XA 4RKUF 2QPAA 3HHZA 1A5TA 4G4QA 2KNVA 5DFLA 3SAVA 3SYKA 2D7GA 2QBYA 3K1JA 4LF6M 2OO9A 3FUUA 3FRHA 1OQYA 3KSXA 3VK8A 4GKKM 2X8AA 4L4UA 2UXBM 4CHTB 3I01M 1WGNA 4R71A 4HL4A 3H4JA 3I4VA 3IG8A 2VF7A 1QYRA 4NC6A 1R7RA 3HHXA 1W5TA 4L6V6 2HKJA 4DV0M 1YLAA 1FJGM 2YR0A 3EIHA 1IXRC 4IBBA 2DZNB 2Q2EB 2O25A 2KNZA 4IBIA 3KS8A 1VG5A 1T3TA 1NV8A 3E4RA 3M0EA 5FTKA 1SXJA 3HHYA 1G4AE 2LVPC 2HAKA 3R8FA 4L8RC 2D7EA 4FCTA 3GRVA 2Y21A 3KW6A 3W0LB 3H4MA 3BXWA 3DOAA 5EP2A 1G59A 1SXJC 2DNAA 2WZJA 3U60B 1N33M 1PM5A 4WURA 3SHFA 4MH0E 1TH3A 4PCZA 2LXEA 1K82A 3FD9A 1HNXM 2V1UA 1GO5A 3U6OA 3KP1E 5ITQA 4G4NA 2BWBA 2GQFA 2LNHC 2L7HA 3A45A 1HJPA 4Q7JA 2MROB 2OQ4A 4M0WA 1R2YA 3RGSA 2DI0A 2XH9A 3TQSA 3AKZA 4IBDA 3L26A 4IIWA 2R6FA 3J7AS 1DGHA 3SMSA 4M0DA 2HL7A 2FOIC 4S12A 2F5OA 2CHVA 4ANRA 4AI6A 1QAQA 4CGYB 1DV0A 2KRUA 3HJ8A 3FKEA 5KPRA 2G8LA 2DZLA 1AUAA 2RGHA 1D2NA 1PJSA 1IN8A 4D82A 2EJSA 3JR5A 3U60A 4PDGA 2UUCM 4LF5M 1IFYA 4K0KM 4DR5M 2R18A 3B7ZA 1XB2B 2LTUA 2JY5A 2R62A 4CIZA 5E26A 1HNWM 3VLFB 1FNNA 5ITXE 4I81A 4LZZA 1G3IA 2N35A 2HCBA 1HQYE 3PVSA 4LY6A 4IBFA 3DA1A 1Z5CA 2CWBA 3SATA 5IT9S 2XZFA 2YFQA 3IHPA 5DYGA 4JI5M 2ZAOA 3C58A 1F4IA 4L16A 2Z4RA 1R5LA 2O01F 1EE8A 4I5SA 2YNMD 3AOEA 3CF6E 3SAWA 4CJ6A 3GLGA 1NSFA 4AKGA 3HJQA 3F92A 2JY8A 2CV0A 1ZMUA 2KW0A 4LGMA 3KFUG 2QBYB 1SXJB 2JP7A 4NSOB 3CGWA 2L6OA 1HR0M 3SYLA 4GHLA 1IY0A 3FRIA 4YHHM 4LCBA 4JV5M 2UXDM 1L8QA 3KSJA 4LFAM 4B3SM 1DGFA 5DYIA 3V76A 2C5RA 5BPVA 3T1YM 4X65M 5ITXA 3FUXA 3KOWE 4QHSA 2V6ZM 3MHVC 1K3WA 1XNRM 4I8OA 5IZ7D 2DHYA 2Z8YM 1IQPA 1Q3CA 3L2AA 1WJ7A 4KT0F 1BVSA 2JA2A 3NBIA 3IG5A 3AOGA 4MM3B 4XBOA 1Z6TA 2CHGA 3K92A 3U6MA 1L2DA 4P16A 3L29A 1H6UA 3GRUA 1XMQM 3J27B 1X37A 1IXSA 3L25A 1MJGM 2Z4SA 3TL4X 1QAMA 5EP1A 1E32A 3GLHA 3FUVA 1QUSA 1TR8A 3KOYE 4GEWA 4GC5A 2R46A 4KODA
chains in the Genus database with same CATH topology
1AIPC 1Q02A 3H4JA 1DO0A 1C7YA 3E46A 1DO2A 1NV9A 2CP8A 2LVQD 1YLAA 2O25A 2KNZA 2QSFX 2JZ0A 1VG5A 1NV8A 2DAGA 1VQ1A 1G4AE 2LVPC 2HAKA 1T6OA 1E94E 2DAEA 1PGYA 3GLGE 2MGWA 2DNAA 2WZJA 1VEJA 1WGLA 1GO5A 1MN3A 4WP2A 4F1IA 2JZ1A 1HT1E 2BWBA 1HJPA 3GLHE 4Q7JA 2MROB 2DI0A 3FE3A 3GLIE 2R0IA 1ZV1A 2OOBA 1EFUB 1WIVA 2QNJA 5JI2E 1R4GA 2DENA 3B89A 1VEKA 1DV0A 2JY7A 2K0BX 3LCVB 1OTRA 1WHCA 2DZLA 4UN2B 2BWEA 2DAIA 3GLFE 1ZMWA 2EJSA 1IFYA 2JY6B 2JNHA 1XB2B 2LTUA 2JY5A 4G3OA 3T6PA 2JUJA 1G3IA 3K9OA 1HQYE 2CWBA 1KYIA 2DKLA 3IHPA 2MR9A 2LVAA 1F4IA 2HWJA 2DAMA 3K9PA 1IM2A 2MJ5B 2L2DA 1UFZA 4F2LA 2EKFA 2L4EA 2JY8A 3F92A 1ZMUA 2OOAA 3LCUA 1VDLA 1XXHE 2JP7A 1Y8GA 1G41A 2RRUA 1HT2E 1CUKA 3FRIA 1QZEA 2G3QA 2LVOC 2KNAA 1OKSA 3IECA 2KHHA 1VEGA 4DBGB 2QHOB 1ZMVA 2LBCA 1TTEA 3MMPA 1WR1B 2DHYA 2DAKA 1WJ7A 2L4FA 1BVSA 1OAIA 2B3TA 2EKKA 2LVNC 1T43A 4HEOA 2K9DA 1P3QQ 2ZTDA 1V92A 2ZTCA 1A5TA 1SG9A 2KNVA 1IXSA 5DFLA 1JR3E 3BBZA 2OO9A 3FRHA 1OQYA 1TR8A 3E21A 4GEWA 2H5XA 1WGNA 4R71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIP C;  1Q02 A;  3H4J A;  1DO0 A;  1C7Y A;  3E46 A;  1DO2 A;  1NV9 A;  2CP8 A;  2LVQ D;  1YLA A;  2O25 A;  2KNZ A;  2QSF X;  2JZ0 A;  1VG5 A;  1NV8 A;  2DAG A;  1VQ1 A;  1G4A E;  2LVP C;  2HAK A;  1T6O A;  1E94 E;  2DAE A;  1PGY A;  3GLG E;  2MGW A;  2DNA A;  2WZJ A;  1VEJ A;  1WGL A;  1GO5 A;  1MN3 A;  4WP2 A;  4F1I A;  2JZ1 A;  1HT1 E;  2BWB A;  1HJP A;  3GLH E;  4Q7J A;  2MRO B;  2DI0 A;  3FE3 A;  3GLI E;  2R0I A;  1ZV1 A;  2OOB A;  1EFU B;  1WIV A;  2QNJ A;  5JI2 E;  1R4G A;  2DEN A;  3B89 A;  1VEK A;  1DV0 A;  2JY7 A;  2K0B X;  3LCV B;  1OTR A;  1WHC A;  2DZL A;  4UN2 B;  2BWE A;  2DAI A;  3GLF E;  1ZMW A;  2EJS A;  1IFY A;  2JY6 B;  2JNH A;  1XB2 B;  2LTU A;  2JY5 A;  4G3O A;  3T6P A;  2JUJ A;  1G3I A;  3K9O A;  1HQY E;  2CWB A;  1KYI A;  2DKL A;  3IHP A;  2MR9 A;  2LVA A;  1F4I A;  2HWJ A;  2DAM A;  3K9P A;  1IM2 A;  2MJ5 B;  2L2D A;  1UFZ A;  4F2L A;  2EKF A;  2L4E A;  2JY8 A;  3F92 A;  1ZMU A;  2OOA A;  3LCU A;  1VDL A;  1XXH E;  2JP7 A;  1Y8G A;  1G41 A;  2RRU A;  1HT2 E;  1CUK A;  3FRI A;  1QZE A;  2G3Q A;  2LVO C;  2KNA A;  1OKS A;  3IEC A;  2KHH A;  1VEG A;  4DBG B;  2QHO B;  1ZMV A;  2LBC A;  1TTE A;  3MMP A;  1WR1 B;  2DHY A;  2DAK A;  1WJ7 A;  2L4F A;  1BVS A;  1OAI A;  2B3T A;  2EKK A;  2LVN C;  1T43 A;  4HEO A;  2K9D A;  1P3Q Q;  2ZTD A;  1V92 A;  2ZTC A;  1A5T A;  1SG9 A;  2KNV A;  1IXS A;  5DFL A;  1JR3 E;  3BBZ A;  2OO9 A;  3FRH A;  1OQY A;  1TR8 A;  3E21 A;  4GEW A;  2H5X A;  1WGN A;  4R71 A; 
#chains in the Genus database with same CATH topology
 1AIP C;  3SMP A;  1S3S A;  3D8B A;  3GLI B;  1QAO A;  5EXP A;  4LF9 M;  3A98 B;  4JI0 M;  2F5Q A;  4KHP M;  4LFB M;  2LVQ D;  4B7F A;  2CE7 A;  4GIP A;  4KLN A;  1R6B X;  2MH8 A;  1IN6 A;  2I7P A;  4RNA A;  1YUB A;  4MGK E;  4NL4 H;  3U5Z A;  3MJ5 A;  4FCW A;  4A3V B;  4LJ5 A;  2CUZ A;  4LF4 M;  1J09 A;  2FE8 A;  1KSF X;  3B9P A;  1K3X A;  1TH2 A;  4NRV A;  2VF8 A;  1VEJ A;  2QP9 X;  3J2P B;  3U6E A;  4CIS A;  2XLJ A;  4FWH A;  3AFH A;  4Z8X A;  3W67 A;  1D0L A;  1MN3 A;  1NJF A;  1I4W A;  3J80 S;  1EIJ A;  3LQQ A;  4AG5 A;  1Q3B A;  3Q8X A;  3GLH E;  3I04 M;  4DV2 M;  1VDD A;  4PT5 A;  3SHG B;  1G71 A;  2W82 A;  4LJA A;  2R0I A;  3HX3 A;  2F5S A;  4FVM A;  1WIV A;  2QNJ A;  1N36 M;  3AL0 C;  1QVR A;  2DEN A;  4QOS A;  1QDT A;  4OVZ A;  2ZAM A;  1OIZ A;  2CFO A;  2JY7 A;  3C9P A;  3QAU A;  2K0B X;  3LCV B;  4MGI E;  4ZPX A;  3RE8 A;  4DV3 M;  4OVZ B;  2ZAN A;  2DWL A;  2VDB B;  2BWE A;  2D7H A;  2DAI A;  1ZMW A;  3HKP A;  4LJ8 A;  2LWX A;  3U61 B;  1PJT A;  2JY6 B;  3J7B A;  5KO3 A;  3SAU A;  1N34 M;  2XFT A;  3HHW A;  3T6P A;  5FTJ A;  5IWA M;  2XFS A;  4MGZ E;  1NJG A;  3L27 A;  4II7 A;  3K9O A;  3EIE A;  1IBM M;  5FTN A;  5KQ8 A;  2LH0 A;  2DXI A;  1XMO M;  1I94 M;  3DZD A;  4Z6Y A;  4L15 A;  4HLQ A;  3WHL A;  2HWJ A;  2I7N A;  4MGY E;  4F2L A;  1PJJ A;  3D8L A;  4X62 M;  2KZS A;  3VDU A;  1PJQ A;  1DGB A;  1XXH B;  2UUB M;  3LCU A;  4IBJ A;  2KZU A;  1VDL A;  5FLX S;  3GQ4 A;  2J7N A;  2WSF F;  4JN6 A;  4KO8 A;  2M5Z A;  3U5Z B;  1E9R A;  1Y8G A;  3CF2 A;  4IBG A;  1JQJ C;  4QNM A;  4D80 A;  1IBK M;  4JI1 M;  1GLN A;  1HT2 E;  2YQZ A;  1HNZ M;  1CUK A;  3GPU A;  3Q8G A;  2CEA A;  3KS4 A;  3TWL A;  4Y28 F;  5GKN A;  2AHM A;  5EXX A;  2LHG A;  2KHH A;  3PNY A;  5A2Q S;  3GPP A;  3U6S A;  2C98 A;  2Z7J A;  4DV7 M;  1VEG A;  2QHO B;  1ZMV A;  2LBC A;  1TTE A;  2F5N A;  2NQ8 C;  2DAK A;  1TGU A;  2KXE A;  4I4L A;  4G4R A;  4B3M M;  1NO1 A;  1DGG A;  3SC3 A;  1IXS B;  4NXM M;  4JI8 M;  3M6A A;  2KA6 B;  4YY3 M;  1IN5 A;  1T43 A;  1V33 A;  3B7Q A;  4HEO A;  3T38 A;  1N32 M;  1OFI A;  2RGO A;  2ZTD A;  3TPZ A;  2BJW A;  2ZTC A;  4B08 A;  4B7G A;  2ZM6 M;  4DV6 M;  2CRU A;  4LJ6 A;  4LJ9 A;  1JR3 E;  2O5R A;  4G4O A;  3ILK A;  3GO8 A;  4R3D A;  3GLF A;  3TWK A;  3U6Q A;  1IBL M;  3E21 A;  4GHA A;  2C9C A;  1GAB A;  1R4G A;  2X4A A;  1NHG C;  1DO0 A;  4AW4 A;  4AQY M;  2KRK A;  4IBE A;  2CP8 A;  3U6C A;  3FTF A;  4MGH A;  1HQC A;  3AV0 A;  3RGP A;  3GRR A;  1XC8 A;  3J81 S;  1OIP A;  3W0F A;  2JZ0 A;  3NBX X;  3FTE A;  2C99 A;  4MB7 A;  2QEN A;  1JB0 F;  3QWL A;  4OU7 A;  2UU9 M;  1LV7 A;  3VKH A;  3GLG E;  3JAM S;  4X66 M;  1IXZ A;  3BOS A;  3GLG B;  4TUW A;  5ITU A;  4DUZ M;  2FS1 A;  2VII A;  3TWM A;  3PFI A;  3C3D A;  3CTW B;  5EP4 A;  1V34 A;  4WP2 A;  4F1I A;  4ITQ A;  2JZ1 A;  4XGI A;  3ZC7 B;  2XSZ D;  2HHH M;  1IN7 A;  1TDZ A;  4BBA A;  4JYA M;  3B74 A;  3UK6 A;  5ITR A;  4BLC A;  2R65 A;  3HU1 A;  4QNR A;  1NNJ A;  3RFW A;  2ERC A;  1GL6 A;  1ZV1 A;  2OOB A;  1EFU B;  4JI6 M;  4B3R M;  4LRS A;  1LTM A;  5JI2 E;  4LF8 M;  1GL7 A;  3FYC A;  5KPT A;  3B89 A;  3AOE C;  1QQW A;  2CV1 A;  1VEK A;  2BJV A;  2LHC A;  1IN4 A;  1OTR A;  1WHC A;  2QQ8 A;  3HU2 A;  3KVW A;  4DR4 M;  1JR3 A;  1NVM A;  5EP3 A;  3GPY A;  2XGN A;  3GLF E;  5F3W A;  3FYD A;  3VKG A;  3R9X B;  1SXJ D;  3W68 A;  4B7H A;  2JNH A;  1GJS A;  2JWS A;  1DGH B;  3QYE A;  5L8R F;  2A5Y B;  4G3O A;  3FTD A;  4WW0 A;  3LMM A;  4X64 M;  4FWD A;  4LF7 M;  2EUC A;  3PXG A;  1E9S A;  1PRB A;  2DKL A;  2MR9 A;  3T1H M;  5ITT A;  1IY1 A;  2L7I A;  2LVA A;  2F5P A;  4DR2 M;  4B3T M;  2DAM A;  3GQ5 A;  4FCV A;  1IM2 A;  2MJ5 B;  5EXS A;  4DR7 M;  4JXJ A;  1XNQ M;  4FW9 A;  4PD2 A;  4NRW A;  2L4E A;  2EKF A;  4REZ A;  3GLF B;  3LQR A;  2XSZ A;  3GQ3 A;  1QZM A;  2R45 A;  1XXH E;  3SAS A;  1ZAE A;  2K6B A;  4JI3 M;  3K2L A;  4LZJ A;  4M9Z A;  4QOZ C;  4IBC A;  2Z3X A;  2EO2 A;  3UGJ A;  4FWG A;  4LFC M;  2BNK A;  4DR1 M;  2G3Q A;  2LVO C;  4LRT A;  4P17 A;  4DV5 M;  2FNA A;  8CAT A;  1Z59 A;  2KNA A;  1OKS A;  1Q39 A;  2UUA M;  5IRE B;  3HGI A;  4DBG B;  1RU3 A;  3DFZ A;  2Y20 A;  3FUW A;  5KQD A;  3MMP A;  4GRI A;  3U6P A;  1QUT A;  2L4F A;  1JR3 D;  2H1R A;  2B3T A;  3M7G A;  3L28 A;  3UMM A;  4DR3 M;  3U6L A;  1NY5 A;  1QAN A;  1P3Q Q;  4NSR A;  1V92 A;  1XWI A;  2XZU A;  5EQT A;  3SFZ A;  3AJI B;  3PNV A;  1YSY A;  3A46 A;  1SG9 A;  1GVN A;  2DZO B;  1PJI A;  2L09 A;  2VQE M;  3BBZ A;  1XXH A;  2DWZ B;  3UZU A;  3FUT A;  4AG6 A;  4L78 A;  2WSE F;  2XF3 A;  4JI4 M;  2R4J A;  1ZQ9 A;  2DWN A;  3ZCB B;  2H5X A;  5LMN M;  4GKJ M;  2E5L M;  1Q02 A;  1NHW C;  1C7Y A;  1ORY B;  3E46 A;  5C1B A;  1DO2 A;  2F4V M;  1NV9 A;  1L1T A;  3U6D A;  3LVV A;  4DV4 M;  4GH9 A;  1D0M A;  3JR4 A;  2G5G X;  2QSF X;  3THG A;  3A42 A;  3E9S A;  4BB9 A;  2DAG A;  1VQ1 A;  3QYB A;  4GC9 A;  2DVW B;  1OAO C;  4LGY A;  1T6O A;  1R2Z A;  1E94 E;  2DAE A;  1PGY A;  4M9S A;  2MGW A;  1KFV A;  4W5W A;  1WGL A;  1NNU C;  4LG2 A;  2OPF A;  3HWS A;  2DWM A;  4AKH A;  3ZH9 B;  5JI3 E;  2QCU A;  3MK6 A;  4XK8 F;  1HT1 E;  2J7O A;  5FTL A;  3KOX E;  4GMQ A;  4OW0 A;  2KDL A;  5BR8 M;  1N77 A;  4LJ4 A;  1Z5A A;  4D81 A;  2J5Y A;  3FE3 A;  2VQF M;  3GLI E;  4R7G A;  3TE6 A;  2C96 A;  5KPZ A;  4IJE A;  3T15 A;  3K8Z A;  1OFH A;  2DHR A;  2EA0 A;  3CF0 A;  5EXT A;  2V1C A;  2Y0T A;  3U61 A;  3VFD A;  3NWL A;  2CHQ A;  3GRY A;  5EJC A;  1L2B A;  1TH4 A;  4IJF A;  2APL A;  5FSW A;  3B7N A;  2R4E A;  4UN2 B;  2WSC F;  2CV2 A;  3HJS A;  3KOZ E;  4GIT A;  1C1K A;  1IY2 A;  1W5S A;  1J7K A;  2FFJ A;  4AZF A;  1GJT A;  5LMU M;  4RF0 A;  2KEB A;  3WHK A;  5E6J A;  2JUJ A;  3VK7 A;  1MX0 A;  7CAT A;  3GP1 A;  4AKI A;  4JI7 M;  4QHT A;  1KYI A;  4IBK A;  3LW5 F;  1N75 A;  4PDI A;  1Z5B A;  1NY6 A;  1TDH A;  3UJN A;  2JXN A;  3GPX A;  3GLI A;  3K9P A;  3LVW A;  2L2D A;  1UFZ A;  2FH0 A;  4RF1 A;  2QZ4 A;  3VDP A;  2XEP A;  1N78 A;  1D0K A;  1QDR A;  1SXJ E;  2OOA A;  3HZJ A;  3C3E A;  3I51 A;  2ZBK B;  5ITY A;  1L1Z A;  5DNY A;  1G41 A;  3OTO M;  1XHB A;  2RRU A;  4NXN M;  3ZQJ A;  5H37 D;  2UXC M;  1G8P A;  3KXE C;  5C18 A;  1QZE A;  2R44 A;  4DUY M;  1UM8 A;  1L2C A;  1OJL A;  1YE9 A;  2Y0Q A;  4G6Z A;  4JI2 M;  1WXQ A;  2P5T A;  3I4Y A;  1MU5 A;  4LJ7 A;  3IEC A;  2RKO A;  1TF0 B;  2X49 A;  3GLH B;  2GNO A;  3HU3 A;  1WR1 B;  3KP0 E;  3KDS E;  4DV1 M;  4OX9 M;  2K47 A;  3FTC A;  1OAI A;  2EKK A;  3HY5 A;  1GKI A;  4EIW A;  2LVN C;  4NOO B;  3SAR A;  1J5E M;  5FTM A;  3SBJ A;  4DR6 M;  2K9D A;  4FD2 A;  2C9O A;  2M60 A;  4M9X A;  4RKU F;  2QPA A;  3HHZ A;  1A5T A;  4G4Q A;  2KNV A;  5DFL A;  3SAV A;  3SYK A;  2D7G A;  2QBY A;  3K1J A;  4LF6 M;  2OO9 A;  3FUU A;  3FRH A;  1OQY A;  3KSX A;  3VK8 A;  4GKK M;  2X8A A;  4L4U A;  2UXB M;  4CHT B;  3I01 M;  1WGN A;  4R71 A;  4HL4 A;  3H4J A;  3I4V A;  3IG8 A;  2VF7 A;  1QYR A;  4NC6 A;  1R7R A;  3HHX A;  1W5T A;  4L6V 6;  2HKJ A;  4DV0 M;  1YLA A;  1FJG M;  2YR0 A;  3EIH A;  1IXR C;  4IBB A;  2DZN B;  2Q2E B;  2O25 A;  2KNZ A;  4IBI A;  3KS8 A;  1VG5 A;  1T3T A;  1NV8 A;  3E4R A;  3M0E A;  5FTK A;  1SXJ A;  3HHY A;  1G4A E;  2LVP C;  2HAK A;  3R8F A;  4L8R C;  2D7E A;  4FCT A;  3GRV A;  2Y21 A;  3KW6 A;  3W0L B;  3H4M A;  3BXW A;  3DOA A;  5EP2 A;  1G59 A;  1SXJ C;  2DNA A;  2WZJ A;  3U60 B;  1N33 M;  1PM5 A;  4WUR A;  3SHF A;  4MH0 E;  1TH3 A;  4PCZ A;  2LXE A;  1K82 A;  3FD9 A;  1HNX M;  2V1U A;  1GO5 A;  3U6O A;  3KP1 E;  5ITQ A;  4G4N A;  2BWB A;  2GQF A;  2LNH C;  2L7H A;  3A45 A;  1HJP A;  4Q7J A;  2MRO B;  2OQ4 A;  4M0W A;  1R2Y A;  3RGS A;  2DI0 A;  2XH9 A;  3TQS A;  3AKZ A;  4IBD A;  3L26 A;  4IIW A;  2R6F A;  3J7A S;  1DGH A;  3SMS A;  4M0D A;  2HL7 A;  2FOI C;  4S12 A;  2F5O A;  2CHV A;  4ANR A;  4AI6 A;  1QAQ A;  4CGY B;  1DV0 A;  2KRU A;  3HJ8 A;  3FKE A;  5KPR A;  2G8L A;  2DZL A;  1AUA A;  2RGH A;  1D2N A;  1PJS A;  1IN8 A;  4D82 A;  2EJS A;  3JR5 A;  3U60 A;  4PDG A;  2UUC M;  4LF5 M;  1IFY A;  4K0K M;  4DR5 M;  2R18 A;  3B7Z A;  1XB2 B;  2LTU A;  2JY5 A;  2R62 A;  4CIZ A;  5E26 A;  1HNW M;  3VLF B;  1FNN A;  5ITX E;  4I81 A;  4LZZ A;  1G3I A;  2N35 A;  2HCB A;  1HQY E;  3PVS A;  4LY6 A;  4IBF A;  3DA1 A;  1Z5C A;  2CWB A;  3SAT A;  5IT9 S;  2XZF A;  2YFQ A;  3IHP A;  5DYG A;  4JI5 M;  2ZAO A;  3C58 A;  1F4I A;  4L16 A;  2Z4R A;  1R5L A;  2O01 F;  1EE8 A;  4I5S A;  2YNM D;  3AOE A;  3CF6 E;  3SAW A;  4CJ6 A;  3GLG A;  1NSF A;  4AKG A;  3HJQ A;  3F92 A;  2JY8 A;  2CV0 A;  1ZMU A;  2KW0 A;  4LGM A;  3KFU G;  2QBY B;  1SXJ B;  2JP7 A;  4NSO B;  3CGW A;  2L6O A;  1HR0 M;  3SYL A;  4GHL A;  1IY0 A;  3FRI A;  4YHH M;  4LCB A;  4JV5 M;  2UXD M;  1L8Q A;  3KSJ A;  4LFA M;  4B3S M;  1DGF A;  5DYI A;  3V76 A;  2C5R A;  5BPV A;  3T1Y M;  4X65 M;  5ITX A;  3FUX A;  3KOW E;  4QHS A;  2V6Z M;  3MHV C;  1K3W A;  1XNR M;  4I8O A;  5IZ7 D;  2DHY A;  2Z8Y M;  1IQP A;  1Q3C A;  3L2A A;  1WJ7 A;  4KT0 F;  1BVS A;  2JA2 A;  3NBI A;  3IG5 A;  3AOG A;  4MM3 B;  4XBO A;  1Z6T A;  2CHG A;  3K92 A;  3U6M A;  1L2D A;  4P16 A;  3L29 A;  1H6U A;  3GRU A;  1XMQ M;  3J27 B;  1X37 A;  1IXS A;  3L25 A;  1MJG M;  2Z4S A;  3TL4 X;  1QAM A;  5EP1 A;  1E32 A;  3GLH A;  3FUV A;  1QUS A;  1TR8 A;  3KOY E;  4GEW A;  4GC5 A;  2R46 A;  4KOD A; 
#chains in the Genus database with same CATH homology
 1AIP C;  1Q02 A;  3H4J A;  1DO0 A;  1C7Y A;  3E46 A;  1DO2 A;  1NV9 A;  2CP8 A;  2LVQ D;  1YLA A;  2O25 A;  2KNZ A;  2QSF X;  2JZ0 A;  1VG5 A;  1NV8 A;  2DAG A;  1VQ1 A;  1G4A E;  2LVP C;  2HAK A;  1T6O A;  1E94 E;  2DAE A;  1PGY A;  3GLG E;  2MGW A;  2DNA A;  2WZJ A;  1VEJ A;  1WGL A;  1GO5 A;  1MN3 A;  4WP2 A;  4F1I A;  2JZ1 A;  1HT1 E;  2BWB A;  1HJP A;  3GLH E;  4Q7J A;  2MRO B;  2DI0 A;  3FE3 A;  3GLI E;  2R0I A;  1ZV1 A;  2OOB A;  1EFU B;  1WIV A;  2QNJ A;  5JI2 E;  1R4G A;  2DEN A;  3B89 A;  1VEK A;  1DV0 A;  2JY7 A;  2K0B X;  3LCV B;  1OTR A;  1WHC A;  2DZL A;  4UN2 B;  2BWE A;  2DAI A;  3GLF E;  1ZMW A;  2EJS A;  1IFY A;  2JY6 B;  2JNH A;  1XB2 B;  2LTU A;  2JY5 A;  4G3O A;  3T6P A;  2JUJ A;  1G3I A;  3K9O A;  1HQY E;  2CWB A;  1KYI A;  2DKL A;  3IHP A;  2MR9 A;  2LVA A;  1F4I A;  2HWJ A;  2DAM A;  3K9P A;  1IM2 A;  2MJ5 B;  2L2D A;  1UFZ A;  4F2L A;  2EKF A;  2L4E A;  2JY8 A;  3F92 A;  1ZMU A;  2OOA A;  3LCU A;  1VDL A;  1XXH E;  2JP7 A;  1Y8G A;  1G41 A;  2RRU A;  1HT2 E;  1CUK A;  3FRI A;  1QZE A;  2G3Q A;  2LVO C;  2KNA A;  1OKS A;  3IEC A;  2KHH A;  1VEG A;  4DBG B;  2QHO B;  1ZMV A;  2LBC A;  1TTE A;  3MMP A;  1WR1 B;  2DHY A;  2DAK A;  1WJ7 A;  2L4F A;  1BVS A;  1OAI A;  2B3T A;  2EKK A;  2LVN C;  1T43 A;  4HEO A;  2K9D A;  1P3Q Q;  2ZTD A;  1V92 A;  2ZTC A;  1A5T A;  1SG9 A;  2KNV A;  1IXS A;  5DFL A;  1JR3 E;  3BBZ A;  2OO9 A;  3FRH A;  1OQY A;  1TR8 A;  3E21 A;  4GEW A;  2H5X A;  1WGN A;  4R71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...