2LBCA

Solution structure of tandem uba of usp13
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
126
structure length
126
Chain Sequence
DIDESSVMQLAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 13
publication title Domain Analysis Reveals That a Deubiquitinating Enzyme USP13 Performs Non-Activating Catalysis for Lys63-Linked Polyubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 126
sequence length 126
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA02
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lbcA01
3FE3A 1XXHE 2CP8A 1WGNA 1HT2E 3E46A 1XB2B 2DAMA 1JR3E 2JNHA 3LCUA 3IHPA 2JY7A 3FRHA 1VEKA 1VEGA 3LCVB 2L4FA 1NV9A 2QSFX 2K0BX 2OOAA 2MJ5B 1YLAA 1HQYE 1KYIA 2JY8A 1CUKA 1HT1E 1T43A 2DAGA 2WZJA 2CWBA 2JZ0A 1VG5A 1IXSA 3K9OA 2LVOC 2G3QA 1MN3A 1OKSA 3K9PA 1ZMUA 1EFUB 1ZMVA 2LBCA 2ZTDA 4DBGB 1OTRA 2QHOB 4Q7JA 2R0IA 2DI0A 2EKFA 1P3QQ 3B89A 5DFLA 3F92A 1WHCA 1UFZA 2BWEA 1T6OA 2K9DA 2LVPC 1ZV1A 1DO2A 3IECA 2EJSA 1GO5A 1DO0A 2LVQD 2LVNC 4UN2B 1WGLA 1WJ7A 1NV8A 3MMPA 1OQYA 1VDLA 3H4JA 2KNAA 3GLHE 4F1IA 1WIVA 3GLIE 1E94E 2DAKA 2JUJA 3GLGE 2DAEA 2MGWA 1C7YA 1IM2A 1HJPA 4F2LA 1IFYA 2DHYA 2KNVA 1BVSA 4G3OA 1G4AE 2KHHA 2MROB 2QNJA 2RRUA 2LVAA 2HWJA 3E21A 1WR1B 1VEJA 3GLFE 3T6PA 2JP7A 2HAKA 2DKLA 1TTEA 2DZLA 1VQ1A 2JY6B 2B3TA 2H5XA 2JZ1A 2L4EA 2DNAA 2EKKA 1SG9A 2KNZA 4HEOA 2BWBA 1TR8A 4WP2A 3BBZA 1AIPC 2O25A 1Y8GA 4GEWA 2MR9A 2ZTCA 1G41A 4R71A 2DENA 2OOBA 2LTUA 3FRIA 5JI2E 2OO9A 2JY5A 1ZMWA 1R4GA 1G3IA 1OAIA 1A5TA 1QZEA 1PGYA 1F4IA 2DAIA 1V92A 1DV0A 1Q02A 2L2DA
chains in the Genus database with same CATH superfamily
4NXMM 2R18A 3KOYE 3M6AA 1HT2E 3E46A 1XB2B 3FTDA 2D7GA 4MB7A 2EO2A 2KA6B 2VF7A 2CV0A 5C1BA 1R7RA 1L1ZA 1VEKA 4II7A 4B7GA 2KRKA 4IBIA 3JAMS 3KSXA 3TPZA 5EXPA 3SASA 1XNQM 5KPTA 1N78A 3Q8XA 3QYBA 2R4JA 3L29A 2Y21A 2K0BX 3HJ8A 4JXJA 2OOAA 4LJ6A 4BB9A 1YLAA 3M7GA 1HQYE 1Z5CA 2ZAMA 3AV0A 5EP2A 2X4AA 2E5LM 3HGIA 1HT1E 1QZMA 3L26A 4IJEA 3NBIA 3GRYA 2WZJA 4Y28F 3GLIA 1TH4A 3GLGA 1L2DA 1IXSA 3U5ZB 1R6BX 3K9OA 3SC3A 3U6OA 2UUBM 2G3QA 1IBKM 5ITUA 1GL7A 2ZTDA 4DBGB 4MH0E 3AOEA 1N32M 1IBLM 1OIPA 1OTRA 3FUTA 1J7KA 3GLFB 3FUXA 2XZUA 2LWXA 1ORYB 2DI0A 7CATA 3GP1A 3GQ5A 4X62M 2CRUA 4L8RC 4AG5A 1MX0A 1QYRA 3AFHA 3FTCA 3KP1E 4DR6M 2DHRA 1XXHB 2FOIC 4QNMA 1UFZA 2UXBM 1SXJE 1T6OA 4XK8F 2QCUA 1YE9A 4QHSA 4LZZA 1LTMA 3AOGA 1DO2A 3IECA 3K1JA 4DV4M 1QDTA 1NSFA 2N35A 1N36M 3PNVA 5EP3A 1DO0A 2LH0A 2LVQD 3PFIA 1N75A 4GMQA 3NWLA 3TL4X 3FUUA 1WGLA 3H4JA 2JXNA 4MGYE 4JI0M 3RGSA 4PDGA 1G8PA 3GLHE 4MGKE 4CIZA 2DAKA 3SMSA 2K47A 5EP4A 3U5ZA 1HR0M 2DAEA 1XNRM 4I81A 1IY0A 4IBDA 2KRUA 3KP0E 1BVSA 2R6FA 1G4AE 3W0FA 4P16A 3W67A 3UMMA 3GLFA 5LMNM 1XC8A 4IBEA 3AJIB 4LZJA 4MGHA 2DWLA 1WR1B 4JN6A 1HQCA 1VEJA 4MGIE 2Z7JA 1XXHA 3C3DA 1NNJA 5FTNA 3CGWA 2DVWB 2ERCA 2R46A 2DZLA 2DWNA 3OTOM 4DV3M 2JY6B 3J2PB 3LVVA 4PT5A 3C3EA 4CHTB 2CV2A 2B3TA 4GIPA 4M0DA 4G4OA 2WSEF 1FJGM 2R4EA 3SYLA 3B7ZA 1TH2A 1KFVA 1DGFA 1TR8A 4OVZB 2NQ8C 3BBZA 4WP2A 2O25A 2ZAOA 4OX9M 3BXWA 2KEBA 3A46A 3KSJA 4JI8M 3RFWA 1SXJC 1N77A 2CHVA 4JI3M 3VDPA 2XLJA 4NSOB 1PJQA 3SFZA 4LG2A 4RF1A 4IBBA 4R7GA 2OO9A 1XMOM 3GPUA 1ZMWA 3GO8A 1R4GA 1OFIA 3PVSA 1G3IA 4FWDA 5EQTA 3KFUG 1F4IA 1D0KA 1VDDA 2V6ZM 1GKIA 2F4VM 5EP1A 2XFSA 4KODA 4IJFA 2F5QA 4B7FA 1Z5BA 3VK8A 4GKJM 1WGNA 3H4MA 4X64M 3SYKA 2LHCA 2RGOA 3QAUA 1H6UA 4D82A 3GPYA 4LFBM 2JNHA 1ZAEA 3IHPA 4NOOB 3T15A 1V33A 4LJ9A 3A98B 3FRHA 1Q3BA 1QANA 2JWSA 1DGGA 2A5YB 5DYGA 4G4NA 4X65M 1QQWA 4DR5M 1OIZA 3GRRA 4DV7M 4L15A 3PXGA 2F5NA 2WSCF 3L25A 2CE7A 2CFOA 3W0LB 5FTMA 2J7OA 3GLIB 4LF9M 2AHMA 4Z6YA 3GLGB 4TUWA 2GQFA 4DUZM 1IXSB 4GKKM 5JI3E 3SATA 4B3MM 1T3TA 2CHQA 3GQ4A 2LXEA 4LF6M 4PDIA 2R44A 4IBGA 1N34M 2FE8A 3HJSA 1GJTA 3D8LA 3DZDA 3PNYA 4NSRA 3NBXX 3TWMA 1OKSA 4LJ7A 4PCZA 1ZMUA 1UM8A 1ZMVA 2I7PA 3UZUA 4REZA 3C58A 1HNZM 3RGPA 2VIIA 3ZH9B 5A2QS 3HKPA 3KDSE 4IIWA 3B7QA 2R0IA 3AKZA 3J7BA 1J5EM 3CF6E 4IBJA 5EJCA 4B08A 3WHKA 3CF0A 4FCTA 3HZJA 4OW0A 2CHGA 5KQDA 1I4WA 5DFLA 3F92A 1WHCA 3LQRA 3SARA 5IT9S 1NY5A 2LVPC 2Y0QA 1NNUC 2LHGA 3FTFA 3IG5A 4JI7M 3VKGA 1ZV1A 2G8LA 2QZ4A 2FNAA 2KW0A 2R65A 3W68A 2O5RA 2Z3XA 1Z6TA 4L4UA 2V1CA 3SHFA 3FTEA 5GKNA 2VDBB 4UN2B 1WJ7A 3K8ZA 4NRWA 1OQYA 1VDLA 3MJ5A 1PJJA 2KNAA 2F5SA 5ITXA 4F1IA 2JUJA 2Q2EB 1GVNA 2LNHC 4X66M 3VFDA 2C9OA 4W5WA 2MGWA 1C1KA 4JI5M 3J80S 1HJPA 1W5TA 2BNKA 4F2LA 3U6PA 2Z8YM 3KVWA 1IN5A 2DHYA 4LF5M 1IFYA 1DGBA 5KO3A 4IBCA 2MROB 2RRUA 2LVAA 4L6V6 3GPPA 1PM5A 2HWJA 1R5LA 2YR0A 5KPRA 4EIWA 1D2NA 3GLFE 1XHBA 2QPAA 3A45A 4S12A 3FUWA 3TE6A 2HAKA 2DXIA 2APLA 1G71A 3DOAA 4JI2M 3KXEC 2L09A 2JZ1A 4M9SA 4JV5M 3ZCBB 5KQ8A 4ANRA 4M9XA 3K2LA 4LJ8A 1HNWM 2BWBA 4HLQA 3I01M 3SAUA 4QOSA 3VKHA 4FVMA 4HL4A 1Y8GA 1FNNA 3AOEC 3LVWA 2MR9A 2ZTCA 2HHHM 3ILKA 2DENA 1N33M 3HHWA 3TWLA 3GLHB 4LJAA 3GRVA 3IG8A 2YNMD 3FKEA 4D81A 1L1TA 2LTUA 4G6ZA 3B7NA 4LRSA 2JY5A 4KLNA 1DGHA 4D80A 1A5TA 3HHYA 3T1YM 5LMUM 4LFAM 3FD9A 3LQQA 2VQFM 5FTKA 2DAIA 1IQPA 1V92A 3HJQA 2XFTA 3K92A 1Q02A 2L2DA 3BOSA 5DNYA 2C5RA 3FE3A 5FSWA 2CP8A 3R9XB 4G4QA 4LGYA 4DUYM 3LW5F 2C98A 1JR3E 3GPXA 3LCUA 4BLCA 2EUCA 5ITQA 5L8RF 2JY7A 3SMPA 4MM3B 3U6DA 2OQ4A 3LCVB 1QAQA 1TGUA 4LJ4A 4M0WA 5FTJA 2UUAM 1Z5AA 2QSFX 1K3WA 3DA1A 4FW9A 2Z4SA 3JR5A 1KYIA 2JY8A 2CEAA 1IN7A 3B74A 1CUKA 5E26A 4GC5A 2CWBA 2JZ0A 3GLHA 1QAOA 2C9CA 2QENA 4NXNM 3HU1A 4M9ZA 1PJSA 4YHHM 1GJSA 4LJ5A 2LVOC 1V34A 1L2BA 4IBFA 2LBCA 3M0EA 3UJNA 3U6QA 5F3WA 2QHOB 2DWZB 4Q7JA 1IXRC 2VF8A 2R62A 1OFHA 4AI6A 5BPVA 1QDRA 3U6SA 1GL6A 3FUVA 1P3QQ 2Y20A 4NC6A 4ZPXA 5E6JA 4NL4H 2XF3A 4LGMA 3MK6A 2BWEA 2K9DA 2CV1A 2Y0TA 2KXEA 4I4LA 3VDUA 2K6BA 3Q8GA 1WXQA 3KOZE 5IWAM 4WURA 1TDZA 1W5SA 2UUCM 1NV8A 3I04M 1GLNA 1NVMA 4OU7A 1KSFX 3FYDA 2XZFA 3I4YA 1NO1A 1WIVA 3GLIE 4AKHA 1E94E 3GLGE 1J09A 2GNOA 4DV1M 3FYCA 1QAMA 5EXTA 1QUSA 3UGJA 1TF0B 2DZNB 1C7YA 2O01F 4DR3M 3C9PA 4B3TM 1IY2A 3E4RA 2FS1A 3SAVA 2ZBKB 4G3OA 4AKIA 2QP9X 2M5ZA 2QBYB 1X37A 1Q39A 3E21A 4FD2A 4KHPM 1MU5A 8CATA 3JR4A 3E9SA 2HL7A 3HWSA 4DV6M 1RU3A 2DWMA 1IN8A 1NJFA 5C18A 4JI4M 2JP7A 3EIEA 2DKLA 3LMMA 4LF4M 4WW0A 2RGHA 1GABA 2L4EA 2D7HA 1SXJD 1PRBA 1ZQ9A 3CTWB 4DV5M 4DV0M 4RKUF 4HEOA 1NHWC 2L6OA 1XWIA 1YUBA 3QWLA 4AZFA 1AIPC 3ZC7B 4QOZC 3HHZA 3T1HM 5FLXS 4FCVA 4L16A 2F5OA 1IBMM 1DGHB 3U6LA 1HNXM 1IN6A 4GHAA 2D7EA 2OOBA 5KPZA 4NRVA 5ITRA 3J27B 3DFZA 3QYEA 2YQZA 3HX3A 5JI2E 2ZM6M 1OAIA 2QBYA 3I4VA 3KOWE 4Z8XA 1S3SA 5EXXA 3SHGB 3I51A 3U6CA 2DZOB 3VK7A 1SXJB 2F5PA 2BJWA 1XXHE 3RE8A 4JI1M 2DAMA 2VQEM 2J5YA 2L7HA 3HY5A 3KW6A 4GITA 4P17A 1K3XA 3J81S 4KO8A 3GRUA 4BBAA 1VEGA 5H37D 2L4FA 1NV9A 3D8BA 1MJGM 1G59A 3U61B 2J7NA 2X8AA 1TDHA 2MJ5B 2C96A 3L27A 3U6EA 1NY6A 1T43A 2I7NA 4FCWA 2DAGA 1JR3D 5BR8M 4I8OA 4DV2M 3SAWA 1VG5A 4DR4M 2OPFA 4FWHA 2R45A 2CUZA 3GQ3A 4AKGA 3L28A 4DR2M 3T38A 4DR7M 2RKOA 1MN3A 1E9RA 4K0KM 3K9PA 1I94M 1EFUB 3U60B 1IN4A 4FWGA 4LCBA 1IXZA 4YY3M 4GC9A 2XGNA 4QNRA 1SXJA 2EKFA 4B7HA 2FFJA 2XSZD 1EE8A 1Q3CA 1PJIA 1D0LA 1K82A 3B89A 1L8QA 3TWKA 3B9PA 3HU3A 1L2CA 1QUTA 1YSYA 3A42A 1OAOC 1NHGC 1AUAA 4AW4A 1OJLA 4G4RA 1QVRA 3ZQJA 2EJSA 4R3DA 5FTLA 1LV7A 4LF8M 4RF0A 3U61A 3R8FA 2UXCM 1GO5A 1JQJC 3AL0C 2LVNC 3KS8A 4B3SM 3VLFB 3MMPA 2EA0A 5ITYA 2BJVA 4L78A 4XGIA 1EIJA 2KDLA 4AG6A 4JI6M 5IZ7D 2KZUA 2HKJA 1R2ZA 2C99A 1IM2A 4KT0F 4CGYB 2ZANA 3KS4A 2KZSA 2UXDM 2L7IA 2KNVA 2XEPA 3SBJA 3U60A 2QNJA 2KHHA 4LF7M 3CF2A 1XMQM 3J7AS 4LRTA 3UK6A 3WHLA 2JA2A 5ITTA 4LFCM 1IY1A 3KOXE 4PD2A 3T6PA 4A3VB 4AQYM 4GH9A 4B3RM 3U6MA 1TTEA 1VQ1A 1JR3A 4MGZE 1Z59A 3THGA 1D0MA 1JB0F 5EXSA 1NJGA 2H5XA 5IREB 2P5TA 1E9SA 2DNAA 2EKKA 2QQ8A 4ITQA 2FH0A 3MHVC 3TQSA 1SG9A 2HCBA 2KNZA 4RNAA 1PJTA 4DR1M 1E32A 4GEWA 3L2AA 5ITXE 3EIHA 1G41A 3HU2A 4I5SA 4R71A 2H1RA 2XSZA 3V76A 4LY6A 4OVZA 4XBOA 2MH8A 5DYIA 2YFQA 2Z4RA 3FRIA 4CISA 2X49A 2UU9M 4CJ6A 2G5GX 4GRIA 2M60A 2V1UA 2W82A 4IBKA 3HHXA 1QZEA 1R2YA 1PGYA 4QHTA 2XH9A 2WSFF 4JYAM 4GHLA 1DV0A 1TH3A
chains in the Genus database with same CATH topology
3FE3A 1XXHE 2CP8A 1WGNA 1HT2E 3E46A 1XB2B 2DAMA 1JR3E 2JNHA 3LCUA 3IHPA 2JY7A 3FRHA 1VEKA 1VEGA 3LCVB 2L4FA 1NV9A 2QSFX 2K0BX 2OOAA 2MJ5B 1YLAA 1HQYE 1KYIA 2JY8A 1CUKA 1HT1E 1T43A 2DAGA 2WZJA 2CWBA 2JZ0A 1VG5A 1IXSA 3K9OA 2LVOC 2G3QA 1MN3A 1OKSA 3K9PA 1ZMUA 1EFUB 1ZMVA 2LBCA 2ZTDA 4DBGB 1OTRA 2QHOB 4Q7JA 2R0IA 2DI0A 2EKFA 1P3QQ 3B89A 5DFLA 3F92A 1WHCA 1UFZA 2BWEA 1T6OA 2K9DA 2LVPC 1ZV1A 1DO2A 3IECA 2EJSA 1GO5A 1DO0A 2LVQD 2LVNC 4UN2B 1WGLA 1WJ7A 1NV8A 3MMPA 1OQYA 1VDLA 3H4JA 2KNAA 3GLHE 4F1IA 1WIVA 3GLIE 1E94E 2DAKA 2JUJA 3GLGE 2DAEA 2MGWA 1C7YA 1IM2A 1HJPA 4F2LA 1IFYA 2DHYA 2KNVA 1BVSA 4G3OA 1G4AE 2KHHA 2MROB 2QNJA 2RRUA 2LVAA 2HWJA 3E21A 1WR1B 1VEJA 3GLFE 3T6PA 2JP7A 2HAKA 2DKLA 1TTEA 2DZLA 1VQ1A 2JY6B 2B3TA 2H5XA 2JZ1A 2L4EA 2DNAA 2EKKA 1SG9A 2KNZA 4HEOA 2BWBA 1TR8A 4WP2A 3BBZA 1AIPC 2O25A 1Y8GA 4GEWA 2MR9A 2ZTCA 1G41A 4R71A 2DENA 2OOBA 2LTUA 3FRIA 5JI2E 2OO9A 2JY5A 1ZMWA 1R4GA 1G3IA 1OAIA 1A5TA 1QZEA 1PGYA 1F4IA 2DAIA 1V92A 1DV0A 1Q02A 2L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE3 A;  1XXH E;  2CP8 A;  1WGN A;  1HT2 E;  3E46 A;  1XB2 B;  2DAM A;  1JR3 E;  2JNH A;  3LCU A;  3IHP A;  2JY7 A;  3FRH A;  1VEK A;  1VEG A;  3LCV B;  2L4F A;  1NV9 A;  2QSF X;  2K0B X;  2OOA A;  2MJ5 B;  1YLA A;  1HQY E;  1KYI A;  2JY8 A;  1CUK A;  1HT1 E;  1T43 A;  2DAG A;  2WZJ A;  2CWB A;  2JZ0 A;  1VG5 A;  1IXS A;  3K9O A;  2LVO C;  2G3Q A;  1MN3 A;  1OKS A;  3K9P A;  1ZMU A;  1EFU B;  1ZMV A;  2LBC A;  2ZTD A;  4DBG B;  1OTR A;  2QHO B;  4Q7J A;  2R0I A;  2DI0 A;  2EKF A;  1P3Q Q;  3B89 A;  5DFL A;  3F92 A;  1WHC A;  1UFZ A;  2BWE A;  1T6O A;  2K9D A;  2LVP C;  1ZV1 A;  1DO2 A;  3IEC A;  2EJS A;  1GO5 A;  1DO0 A;  2LVQ D;  2LVN C;  4UN2 B;  1WGL A;  1WJ7 A;  1NV8 A;  3MMP A;  1OQY A;  1VDL A;  3H4J A;  2KNA A;  3GLH E;  4F1I A;  1WIV A;  3GLI E;  1E94 E;  2DAK A;  2JUJ A;  3GLG E;  2DAE A;  2MGW A;  1C7Y A;  1IM2 A;  1HJP A;  4F2L A;  1IFY A;  2DHY A;  2KNV A;  1BVS A;  4G3O A;  1G4A E;  2KHH A;  2MRO B;  2QNJ A;  2RRU A;  2LVA A;  2HWJ A;  3E21 A;  1WR1 B;  1VEJ A;  3GLF E;  3T6P A;  2JP7 A;  2HAK A;  2DKL A;  1TTE A;  2DZL A;  1VQ1 A;  2JY6 B;  2B3T A;  2H5X A;  2JZ1 A;  2L4E A;  2DNA A;  2EKK A;  1SG9 A;  2KNZ A;  4HEO A;  2BWB A;  1TR8 A;  4WP2 A;  3BBZ A;  1AIP C;  2O25 A;  1Y8G A;  4GEW A;  2MR9 A;  2ZTC A;  1G41 A;  4R71 A;  2DEN A;  2OOB A;  2LTU A;  3FRI A;  5JI2 E;  2OO9 A;  2JY5 A;  1ZMW A;  1R4G A;  1G3I A;  1OAI A;  1A5T A;  1QZE A;  1PGY A;  1F4I A;  2DAI A;  1V92 A;  1DV0 A;  1Q02 A;  2L2D A; 
#chains in the Genus database with same CATH topology
 4NXM M;  2R18 A;  3KOY E;  3M6A A;  1HT2 E;  3E46 A;  1XB2 B;  3FTD A;  2D7G A;  4MB7 A;  2EO2 A;  2KA6 B;  2VF7 A;  2CV0 A;  5C1B A;  1R7R A;  1L1Z A;  1VEK A;  4II7 A;  4B7G A;  2KRK A;  4IBI A;  3JAM S;  3KSX A;  3TPZ A;  5EXP A;  3SAS A;  1XNQ M;  5KPT A;  1N78 A;  3Q8X A;  3QYB A;  2R4J A;  3L29 A;  2Y21 A;  2K0B X;  3HJ8 A;  4JXJ A;  2OOA A;  4LJ6 A;  4BB9 A;  1YLA A;  3M7G A;  1HQY E;  1Z5C A;  2ZAM A;  3AV0 A;  5EP2 A;  2X4A A;  2E5L M;  3HGI A;  1HT1 E;  1QZM A;  3L26 A;  4IJE A;  3NBI A;  3GRY A;  2WZJ A;  4Y28 F;  3GLI A;  1TH4 A;  3GLG A;  1L2D A;  1IXS A;  3U5Z B;  1R6B X;  3K9O A;  3SC3 A;  3U6O A;  2UUB M;  2G3Q A;  1IBK M;  5ITU A;  1GL7 A;  2ZTD A;  4DBG B;  4MH0 E;  3AOE A;  1N32 M;  1IBL M;  1OIP A;  1OTR A;  3FUT A;  1J7K A;  3GLF B;  3FUX A;  2XZU A;  2LWX A;  1ORY B;  2DI0 A;  7CAT A;  3GP1 A;  3GQ5 A;  4X62 M;  2CRU A;  4L8R C;  4AG5 A;  1MX0 A;  1QYR A;  3AFH A;  3FTC A;  3KP1 E;  4DR6 M;  2DHR A;  1XXH B;  2FOI C;  4QNM A;  1UFZ A;  2UXB M;  1SXJ E;  1T6O A;  4XK8 F;  2QCU A;  1YE9 A;  4QHS A;  4LZZ A;  1LTM A;  3AOG A;  1DO2 A;  3IEC A;  3K1J A;  4DV4 M;  1QDT A;  1NSF A;  2N35 A;  1N36 M;  3PNV A;  5EP3 A;  1DO0 A;  2LH0 A;  2LVQ D;  3PFI A;  1N75 A;  4GMQ A;  3NWL A;  3TL4 X;  3FUU A;  1WGL A;  3H4J A;  2JXN A;  4MGY E;  4JI0 M;  3RGS A;  4PDG A;  1G8P A;  3GLH E;  4MGK E;  4CIZ A;  2DAK A;  3SMS A;  2K47 A;  5EP4 A;  3U5Z A;  1HR0 M;  2DAE A;  1XNR M;  4I81 A;  1IY0 A;  4IBD A;  2KRU A;  3KP0 E;  1BVS A;  2R6F A;  1G4A E;  3W0F A;  4P16 A;  3W67 A;  3UMM A;  3GLF A;  5LMN M;  1XC8 A;  4IBE A;  3AJI B;  4LZJ A;  4MGH A;  2DWL A;  1WR1 B;  4JN6 A;  1HQC A;  1VEJ A;  4MGI E;  2Z7J A;  1XXH A;  3C3D A;  1NNJ A;  5FTN A;  3CGW A;  2DVW B;  2ERC A;  2R46 A;  2DZL A;  2DWN A;  3OTO M;  4DV3 M;  2JY6 B;  3J2P B;  3LVV A;  4PT5 A;  3C3E A;  4CHT B;  2CV2 A;  2B3T A;  4GIP A;  4M0D A;  4G4O A;  2WSE F;  1FJG M;  2R4E A;  3SYL A;  3B7Z A;  1TH2 A;  1KFV A;  1DGF A;  1TR8 A;  4OVZ B;  2NQ8 C;  3BBZ A;  4WP2 A;  2O25 A;  2ZAO A;  4OX9 M;  3BXW A;  2KEB A;  3A46 A;  3KSJ A;  4JI8 M;  3RFW A;  1SXJ C;  1N77 A;  2CHV A;  4JI3 M;  3VDP A;  2XLJ A;  4NSO B;  1PJQ A;  3SFZ A;  4LG2 A;  4RF1 A;  4IBB A;  4R7G A;  2OO9 A;  1XMO M;  3GPU A;  1ZMW A;  3GO8 A;  1R4G A;  1OFI A;  3PVS A;  1G3I A;  4FWD A;  5EQT A;  3KFU G;  1F4I A;  1D0K A;  1VDD A;  2V6Z M;  1GKI A;  2F4V M;  5EP1 A;  2XFS A;  4KOD A;  4IJF A;  2F5Q A;  4B7F A;  1Z5B A;  3VK8 A;  4GKJ M;  1WGN A;  3H4M A;  4X64 M;  3SYK A;  2LHC A;  2RGO A;  3QAU A;  1H6U A;  4D82 A;  3GPY A;  4LFB M;  2JNH A;  1ZAE A;  3IHP A;  4NOO B;  3T15 A;  1V33 A;  4LJ9 A;  3A98 B;  3FRH A;  1Q3B A;  1QAN A;  2JWS A;  1DGG A;  2A5Y B;  5DYG A;  4G4N A;  4X65 M;  1QQW A;  4DR5 M;  1OIZ A;  3GRR A;  4DV7 M;  4L15 A;  3PXG A;  2F5N A;  2WSC F;  3L25 A;  2CE7 A;  2CFO A;  3W0L B;  5FTM A;  2J7O A;  3GLI B;  4LF9 M;  2AHM A;  4Z6Y A;  3GLG B;  4TUW A;  2GQF A;  4DUZ M;  1IXS B;  4GKK M;  5JI3 E;  3SAT A;  4B3M M;  1T3T A;  2CHQ A;  3GQ4 A;  2LXE A;  4LF6 M;  4PDI A;  2R44 A;  4IBG A;  1N34 M;  2FE8 A;  3HJS A;  1GJT A;  3D8L A;  3DZD A;  3PNY A;  4NSR A;  3NBX X;  3TWM A;  1OKS A;  4LJ7 A;  4PCZ A;  1ZMU A;  1UM8 A;  1ZMV A;  2I7P A;  3UZU A;  4REZ A;  3C58 A;  1HNZ M;  3RGP A;  2VII A;  3ZH9 B;  5A2Q S;  3HKP A;  3KDS E;  4IIW A;  3B7Q A;  2R0I A;  3AKZ A;  3J7B A;  1J5E M;  3CF6 E;  4IBJ A;  5EJC A;  4B08 A;  3WHK A;  3CF0 A;  4FCT A;  3HZJ A;  4OW0 A;  2CHG A;  5KQD A;  1I4W A;  5DFL A;  3F92 A;  1WHC A;  3LQR A;  3SAR A;  5IT9 S;  1NY5 A;  2LVP C;  2Y0Q A;  1NNU C;  2LHG A;  3FTF A;  3IG5 A;  4JI7 M;  3VKG A;  1ZV1 A;  2G8L A;  2QZ4 A;  2FNA A;  2KW0 A;  2R65 A;  3W68 A;  2O5R A;  2Z3X A;  1Z6T A;  4L4U A;  2V1C A;  3SHF A;  3FTE A;  5GKN A;  2VDB B;  4UN2 B;  1WJ7 A;  3K8Z A;  4NRW A;  1OQY A;  1VDL A;  3MJ5 A;  1PJJ A;  2KNA A;  2F5S A;  5ITX A;  4F1I A;  2JUJ A;  2Q2E B;  1GVN A;  2LNH C;  4X66 M;  3VFD A;  2C9O A;  4W5W A;  2MGW A;  1C1K A;  4JI5 M;  3J80 S;  1HJP A;  1W5T A;  2BNK A;  4F2L A;  3U6P A;  2Z8Y M;  3KVW A;  1IN5 A;  2DHY A;  4LF5 M;  1IFY A;  1DGB A;  5KO3 A;  4IBC A;  2MRO B;  2RRU A;  2LVA A;  4L6V 6;  3GPP A;  1PM5 A;  2HWJ A;  1R5L A;  2YR0 A;  5KPR A;  4EIW A;  1D2N A;  3GLF E;  1XHB A;  2QPA A;  3A45 A;  4S12 A;  3FUW A;  3TE6 A;  2HAK A;  2DXI A;  2APL A;  1G71 A;  3DOA A;  4JI2 M;  3KXE C;  2L09 A;  2JZ1 A;  4M9S A;  4JV5 M;  3ZCB B;  5KQ8 A;  4ANR A;  4M9X A;  3K2L A;  4LJ8 A;  1HNW M;  2BWB A;  4HLQ A;  3I01 M;  3SAU A;  4QOS A;  3VKH A;  4FVM A;  4HL4 A;  1Y8G A;  1FNN A;  3AOE C;  3LVW A;  2MR9 A;  2ZTC A;  2HHH M;  3ILK A;  2DEN A;  1N33 M;  3HHW A;  3TWL A;  3GLH B;  4LJA A;  3GRV A;  3IG8 A;  2YNM D;  3FKE A;  4D81 A;  1L1T A;  2LTU A;  4G6Z A;  3B7N A;  4LRS A;  2JY5 A;  4KLN A;  1DGH A;  4D80 A;  1A5T A;  3HHY A;  3T1Y M;  5LMU M;  4LFA M;  3FD9 A;  3LQQ A;  2VQF M;  5FTK A;  2DAI A;  1IQP A;  1V92 A;  3HJQ A;  2XFT A;  3K92 A;  1Q02 A;  2L2D A;  3BOS A;  5DNY A;  2C5R A;  3FE3 A;  5FSW A;  2CP8 A;  3R9X B;  4G4Q A;  4LGY A;  4DUY M;  3LW5 F;  2C98 A;  1JR3 E;  3GPX A;  3LCU A;  4BLC A;  2EUC A;  5ITQ A;  5L8R F;  2JY7 A;  3SMP A;  4MM3 B;  3U6D A;  2OQ4 A;  3LCV B;  1QAQ A;  1TGU A;  4LJ4 A;  4M0W A;  5FTJ A;  2UUA M;  1Z5A A;  2QSF X;  1K3W A;  3DA1 A;  4FW9 A;  2Z4S A;  3JR5 A;  1KYI A;  2JY8 A;  2CEA A;  1IN7 A;  3B74 A;  1CUK A;  5E26 A;  4GC5 A;  2CWB A;  2JZ0 A;  3GLH A;  1QAO A;  2C9C A;  2QEN A;  4NXN M;  3HU1 A;  4M9Z A;  1PJS A;  4YHH M;  1GJS A;  4LJ5 A;  2LVO C;  1V34 A;  1L2B A;  4IBF A;  2LBC A;  3M0E A;  3UJN A;  3U6Q A;  5F3W A;  2QHO B;  2DWZ B;  4Q7J A;  1IXR C;  2VF8 A;  2R62 A;  1OFH A;  4AI6 A;  5BPV A;  1QDR A;  3U6S A;  1GL6 A;  3FUV A;  1P3Q Q;  2Y20 A;  4NC6 A;  4ZPX A;  5E6J A;  4NL4 H;  2XF3 A;  4LGM A;  3MK6 A;  2BWE A;  2K9D A;  2CV1 A;  2Y0T A;  2KXE A;  4I4L A;  3VDU A;  2K6B A;  3Q8G A;  1WXQ A;  3KOZ E;  5IWA M;  4WUR A;  1TDZ A;  1W5S A;  2UUC M;  1NV8 A;  3I04 M;  1GLN A;  1NVM A;  4OU7 A;  1KSF X;  3FYD A;  2XZF A;  3I4Y A;  1NO1 A;  1WIV A;  3GLI E;  4AKH A;  1E94 E;  3GLG E;  1J09 A;  2GNO A;  4DV1 M;  3FYC A;  1QAM A;  5EXT A;  1QUS A;  3UGJ A;  1TF0 B;  2DZN B;  1C7Y A;  2O01 F;  4DR3 M;  3C9P A;  4B3T M;  1IY2 A;  3E4R A;  2FS1 A;  3SAV A;  2ZBK B;  4G3O A;  4AKI A;  2QP9 X;  2M5Z A;  2QBY B;  1X37 A;  1Q39 A;  3E21 A;  4FD2 A;  4KHP M;  1MU5 A;  8CAT A;  3JR4 A;  3E9S A;  2HL7 A;  3HWS A;  4DV6 M;  1RU3 A;  2DWM A;  1IN8 A;  1NJF A;  5C18 A;  4JI4 M;  2JP7 A;  3EIE A;  2DKL A;  3LMM A;  4LF4 M;  4WW0 A;  2RGH A;  1GAB A;  2L4E A;  2D7H A;  1SXJ D;  1PRB A;  1ZQ9 A;  3CTW B;  4DV5 M;  4DV0 M;  4RKU F;  4HEO A;  1NHW C;  2L6O A;  1XWI A;  1YUB A;  3QWL A;  4AZF A;  1AIP C;  3ZC7 B;  4QOZ C;  3HHZ A;  3T1H M;  5FLX S;  4FCV A;  4L16 A;  2F5O A;  1IBM M;  1DGH B;  3U6L A;  1HNX M;  1IN6 A;  4GHA A;  2D7E A;  2OOB A;  5KPZ A;  4NRV A;  5ITR A;  3J27 B;  3DFZ A;  3QYE A;  2YQZ A;  3HX3 A;  5JI2 E;  2ZM6 M;  1OAI A;  2QBY A;  3I4V A;  3KOW E;  4Z8X A;  1S3S A;  5EXX A;  3SHG B;  3I51 A;  3U6C A;  2DZO B;  3VK7 A;  1SXJ B;  2F5P A;  2BJW A;  1XXH E;  3RE8 A;  4JI1 M;  2DAM A;  2VQE M;  2J5Y A;  2L7H A;  3HY5 A;  3KW6 A;  4GIT A;  4P17 A;  1K3X A;  3J81 S;  4KO8 A;  3GRU A;  4BBA A;  1VEG A;  5H37 D;  2L4F A;  1NV9 A;  3D8B A;  1MJG M;  1G59 A;  3U61 B;  2J7N A;  2X8A A;  1TDH A;  2MJ5 B;  2C96 A;  3L27 A;  3U6E A;  1NY6 A;  1T43 A;  2I7N A;  4FCW A;  2DAG A;  1JR3 D;  5BR8 M;  4I8O A;  4DV2 M;  3SAW A;  1VG5 A;  4DR4 M;  2OPF A;  4FWH A;  2R45 A;  2CUZ A;  3GQ3 A;  4AKG A;  3L28 A;  4DR2 M;  3T38 A;  4DR7 M;  2RKO A;  1MN3 A;  1E9R A;  4K0K M;  3K9P A;  1I94 M;  1EFU B;  3U60 B;  1IN4 A;  4FWG A;  4LCB A;  1IXZ A;  4YY3 M;  4GC9 A;  2XGN A;  4QNR A;  1SXJ A;  2EKF A;  4B7H A;  2FFJ A;  2XSZ D;  1EE8 A;  1Q3C A;  1PJI A;  1D0L A;  1K82 A;  3B89 A;  1L8Q A;  3TWK A;  3B9P A;  3HU3 A;  1L2C A;  1QUT A;  1YSY A;  3A42 A;  1OAO C;  1NHG C;  1AUA A;  4AW4 A;  1OJL A;  4G4R A;  1QVR A;  3ZQJ A;  2EJS A;  4R3D A;  5FTL A;  1LV7 A;  4LF8 M;  4RF0 A;  3U61 A;  3R8F A;  2UXC M;  1GO5 A;  1JQJ C;  3AL0 C;  2LVN C;  3KS8 A;  4B3S M;  3VLF B;  3MMP A;  2EA0 A;  5ITY A;  2BJV A;  4L78 A;  4XGI A;  1EIJ A;  2KDL A;  4AG6 A;  4JI6 M;  5IZ7 D;  2KZU A;  2HKJ A;  1R2Z A;  2C99 A;  1IM2 A;  4KT0 F;  4CGY B;  2ZAN A;  3KS4 A;  2KZS A;  2UXD M;  2L7I A;  2KNV A;  2XEP A;  3SBJ A;  3U60 A;  2QNJ A;  2KHH A;  4LF7 M;  3CF2 A;  1XMQ M;  3J7A S;  4LRT A;  3UK6 A;  3WHL A;  2JA2 A;  5ITT A;  4LFC M;  1IY1 A;  3KOX E;  4PD2 A;  3T6P A;  4A3V B;  4AQY M;  4GH9 A;  4B3R M;  3U6M A;  1TTE A;  1VQ1 A;  1JR3 A;  4MGZ E;  1Z59 A;  3THG A;  1D0M A;  1JB0 F;  5EXS A;  1NJG A;  2H5X A;  5IRE B;  2P5T A;  1E9S A;  2DNA A;  2EKK A;  2QQ8 A;  4ITQ A;  2FH0 A;  3MHV C;  3TQS A;  1SG9 A;  2HCB A;  2KNZ A;  4RNA A;  1PJT A;  4DR1 M;  1E32 A;  4GEW A;  3L2A A;  5ITX E;  3EIH A;  1G41 A;  3HU2 A;  4I5S A;  4R71 A;  2H1R A;  2XSZ A;  3V76 A;  4LY6 A;  4OVZ A;  4XBO A;  2MH8 A;  5DYI A;  2YFQ A;  2Z4R A;  3FRI A;  4CIS A;  2X49 A;  2UU9 M;  4CJ6 A;  2G5G X;  4GRI A;  2M60 A;  2V1U A;  2W82 A;  4IBK A;  3HHX A;  1QZE A;  1R2Y A;  1PGY A;  4QHT A;  2XH9 A;  2WSF F;  4JYA M;  4GHL A;  1DV0 A;  1TH3 A; 
#chains in the Genus database with same CATH homology
 3FE3 A;  1XXH E;  2CP8 A;  1WGN A;  1HT2 E;  3E46 A;  1XB2 B;  2DAM A;  1JR3 E;  2JNH A;  3LCU A;  3IHP A;  2JY7 A;  3FRH A;  1VEK A;  1VEG A;  3LCV B;  2L4F A;  1NV9 A;  2QSF X;  2K0B X;  2OOA A;  2MJ5 B;  1YLA A;  1HQY E;  1KYI A;  2JY8 A;  1CUK A;  1HT1 E;  1T43 A;  2DAG A;  2WZJ A;  2CWB A;  2JZ0 A;  1VG5 A;  1IXS A;  3K9O A;  2LVO C;  2G3Q A;  1MN3 A;  1OKS A;  3K9P A;  1ZMU A;  1EFU B;  1ZMV A;  2LBC A;  2ZTD A;  4DBG B;  1OTR A;  2QHO B;  4Q7J A;  2R0I A;  2DI0 A;  2EKF A;  1P3Q Q;  3B89 A;  5DFL A;  3F92 A;  1WHC A;  1UFZ A;  2BWE A;  1T6O A;  2K9D A;  2LVP C;  1ZV1 A;  1DO2 A;  3IEC A;  2EJS A;  1GO5 A;  1DO0 A;  2LVQ D;  2LVN C;  4UN2 B;  1WGL A;  1WJ7 A;  1NV8 A;  3MMP A;  1OQY A;  1VDL A;  3H4J A;  2KNA A;  3GLH E;  4F1I A;  1WIV A;  3GLI E;  1E94 E;  2DAK A;  2JUJ A;  3GLG E;  2DAE A;  2MGW A;  1C7Y A;  1IM2 A;  1HJP A;  4F2L A;  1IFY A;  2DHY A;  2KNV A;  1BVS A;  4G3O A;  1G4A E;  2KHH A;  2MRO B;  2QNJ A;  2RRU A;  2LVA A;  2HWJ A;  3E21 A;  1WR1 B;  1VEJ A;  3GLF E;  3T6P A;  2JP7 A;  2HAK A;  2DKL A;  1TTE A;  2DZL A;  1VQ1 A;  2JY6 B;  2B3T A;  2H5X A;  2JZ1 A;  2L4E A;  2DNA A;  2EKK A;  1SG9 A;  2KNZ A;  4HEO A;  2BWB A;  1TR8 A;  4WP2 A;  3BBZ A;  1AIP C;  2O25 A;  1Y8G A;  4GEW A;  2MR9 A;  2ZTC A;  1G41 A;  4R71 A;  2DEN A;  2OOB A;  2LTU A;  3FRI A;  5JI2 E;  2OO9 A;  2JY5 A;  1ZMW A;  1R4G A;  1G3I A;  1OAI A;  1A5T A;  1QZE A;  1PGY A;  1F4I A;  2DAI A;  1V92 A;  1DV0 A;  1Q02 A;  2L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...