2XFSA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 138
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xfsA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xfsA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xfsA02
4OQHA 4ZJ2A 3GMWA 3SS5A 4EQIA 3VOYA 1ERQA 4JKTA 4PM6A 2Z2LB 4FH4A 3SH7A 3BFGA 3LY3A 3CJMA 2RCXA 4OPRA 1KE4A 3LCEA 4UA9A 3N6IA 3UPNA 4N1XA 4KZ6A 5A91A 2H5SA 1GA0A 3A3EA 4YINA 4E3NA 3BECA 4ZTKA 3WS4A 2XFTA 1FCMA 2J7VA 4S2JA 1IKIA 2IWDA 2X71A 2H10A 3FKVA 3ZG8B 3DWKA 4XUZA 4C6YA 4B88A 4FD8A 4DRTA 1LLBA 4P6BA 4R1GA 3V3RA 4C3QA 2Y59A 2EX6A 3M2JA 1JWVA 3Q07A 3GQZA 1QMFA 2XFSA 3RXWA 5HFOA 1VQQA 4GB7A 5EPHA 5F1GA 1YMSA 5IHVA 2GDNA 4EUZA 1FQGA 1L0EA 1PWGA 1NZOA 3NY4A 3G34A 4ZBEA 1GCEA 1TDLA 1GA9A 5AQ9A 1C3BA 1S0WA 3O88A 5EVID 4EV4A 1E4DA 5KZHA 3ITAA 4KQRA 3NI9A 3IXGA 2A49A 3BYDA 2Y2OA 5TFQA 3VP0A 1E25A 1ZG4A 3VP2A 5E2FA 1K56D 1XX2A 3GVBA 2WAFA 3M2KA 2ZC4B 5HAPA 3IF6B 4PMAA 3O87A 1BLCA 2HDRA 2B5RA 3LY4A 2R9WA 4RX3A 1KE0A 1FSYA 3QNBA 3WS0A 5A92A 1PW1A 2Y2MA 4WM9A 3IXDA 1BLPA 1YT4A 3MXRA 2XEPA 4N92A 4UA6A 3V50A 3HLGA 3RXXA 3MZEA 3GV9A 4MBKA 4EWFA 4JXVA 4N9LA 4QHCA 3IH9A 5FI2A 3WWXA 4OOMA 3C5AA 1MKIA 3HLDA 4LV0A 1MWUA 1XA7A 1YMXA 3LO7A 3NDGA 3FWLA 3VP4A 3BLMA 5E2EA 4DDSA 3AGDA 1KGFA 1K57C 2Y2JA 4QD4A 1K55C 1I5QA 3ZG9B 4GDNA 1FOFA 2H0YA 4JF4A 5EOOA 1BT5A 4QU3A 4XUXA 1FR1A 4KG2A 5FQJA 4QJGA 4MBHA 3G32A 2P9VA 3UO9A 4E6WA 3SOIA 5FQ9A 5L2FA 3UPOA 2EFUA 2HPBA 4R4SA 5AQBA 1NXYA 3UDXA 4E3IA 1H8YA 3GSGA 4S2NC 3NC8A 4DKIA 2XK1A 4X6TA 4NETA 2ZC3B 2IWBA 1IYSA 1K6SA 1KVLA 1W7FA 3C7UA 3A3JA 1H8ZA 5HW3A 4HBUA 3I7JA 4JF6A 2ZJ9A 3IF6C 1AXBA 3IHBA 3Q1FA 3Q7VA 5CHMA 4E3KA 4X53A 2JE5A 3GTCA 5DF7A 3BFFA 4KZAA 1ZG6A 3SH9A 5TR7A 1I2SA 4EBNA 1K25A 1DJBA 3G4PA 1FCNA 1CEGA 1RGYA 3RJUA 5CEBA 1K4EA 3ISGA 5J8XA 1BLHA 1O7EA 4WMCA 4PM7A 2ZQ7A 5HX9A 3FYZA 1GHMA 5A93A 2WK0A 4U3TA 1L0DA 4OVDA 3ZG7B 1EI5A 1ES3A 3IT9A 5FQKA 3SH8A 3ZFZA 5CGWA 2DNSA 4WYYA 3PBRA 3ZNYA 4OOYA 1JTGA 4E3LA 2QMIA 3AGFA 4R0QA 2XQZA 2ZC7A 2OV5A 1Q2PA 1RCJA 3E2LA 5CERA 3ZGAB 1KDSA 1W8QA 1YLPA 4S2PA 5DTTA 4DE0A 5FAQA 1ALQA 3ITBA 5EUAA 4K0WA 2X01A 3AGEA 2G2WA 3IXBA 4NK3A 1MWTA 4OQ0A 3MXSA 5FI6A 5DVAA 4ZAMA 2ZM0A 2ZQAA 2PU4A 3N8LA 2J8YA 4R3JA 2HP6A 2Q9MA 5FDHA 4DXCA 5E43A 1FCOA 1U60A 4U0XA 3HBRA 3SS4A 3G35A 4S2MA 3UDIA 1K38A 2J9OA 3E2KA 3ZG5A 2ZM8A 1M6KA 3S4XA 4LCLA 1TDGA 3ZNTA 5A90A 4ZDXA 4R23A 3HLWA 3OZHA 2EXAA 1E3UD 2WGWB 3FKWA 5EOEA 2ZM2A 2HP5A 4PM5A 1NYYA 4XXRA 3M6BA 4MBFA 3V3SA 5FASA 3GR2A 3UE0A 4JLFA 1GHPA 2XR0A 1HD8A 4Q8IA 1SHVA 2XF3A 3WS2A 1L0FA 1XGIA 4OQGA 4WEJA 1YLTA 4X69A 4M3KA 3P09A 2XD5A 2XDMA 3PAGA 1L0GA 5FQIA 5EVIC 1BLSA 4ZJ1A 4UHUA 2Y2QA 3WS5A 4Y0TA 2C6WB 2DRWA 3WRTA 3ZHHA 4LV2A 4KZ3A 3IWIA 4S2OA 4E3OA 2Y2NA 1PI4A 2JCHA 1VM1A 2Y2GA 3N4IA 4MEZA 4OPYA 3UY6A 3W8KA 4DE2A 3BFEA 4PM8A 4Z9QA 1CEFA 1JWZA 5EVIA 1ONGA 5FQQA 1LI9A 3QHYA 2WKEA 5CGSA 4JXGA 4JXWA 1KDWA 3N8SA 1KVMA 1K56A 4C75A 1DY6A 3EQVA 4UA7A 3OCNA 4K91A 1HTZA 1DJAA 1KE3A 2FFFB 2WKHA 2IWCA 3TOIA 4RVAA 1Q2QA 2VGKA 4HBTA 3W4OA 1KGGA 1RP5A 3IHAA 4LENA 1O07A 2XGNA 1IELA 4WBGA 3PTEA 1JTDA 2ZMAA 5JYOA 5M18A 3OPPA 4DF6A 2WZXA 3BM6A 5FA7A 4KG6A 4KQOA 1Z6FA 5GHYA 2JC7A 2WADA 2QZ6A 1BUEA 1HZOA 1CI8A 2V1ZA 4KQQA 3UDFA 3S1YA 4E3MA 3IWQA 1K57A 4OPZA 5FI7A 1K55A 5E2HA 1IYOA 2X02A 3G31A 3CZDA 5CGXA 2UWXA 4GD6A 1M40A 1PWCA 1CK3A 5HL1A 1H5XA 5AQAA 2Y2IA 1XA1A 5FQMA 4IBRA 2EX2A 4JF5A 1PIOA 4DE3A 2ZLYA 3CMZA 4EBLA 5JYPA 3HLFA 4D2OA 1IYQA 3N8RA 4S2NA 4BENA 5GHXA 3ZDJA 4MLLA 3W4QA 4BL3A 5F1FA 1J9MA 3JYIA 3MKEA 1XP4A 2DCFA 5CRFA 5FATA 4U0TA 3ZVWA 4F94A 2Y2PA 5M1AA 1HVBA 4WMCD 4P0MA 3IF6A 3ZG0A 2Y2KA 1FSWA 2Y55A 1WE4A 3A3FA 4BL2A 3GRJA 2VGJA 1ZC2A 5DF8A 2ZQCA 4IVKA 4O7DA 4S2LA 4IVIA 5F82A 2A3UA 3HUNA 3S22A 3G2ZA 3PBNA 2HDQA 4OOLA 4YFMA 3Q7ZA 5AQ7A 4JPMA 1IEMA 5TGFA 3C7VA 1ESIA 1ZKJA 2HDUA 3MFDA 4E6XA 1YM1A 2FFYA 1MWSA 1ES2A 3A3DA 3D4FA 1LL9A 5CHUA 3M6HA 4FH2A 4BD0A 1QMEA 4IBXA 3B3XA 2ZC6B 4HESA 2WZZA 3HL9A 3C4PA 5GLAA 2JBFA 2Y2HA 4N9KA 1SDEA 4RX2A 4BD1A 1ESUA 5KMWA 5E2GA 2ZC5B 3BRMA 4FCFA 3VFFA 4WEKA 1YLYA 3CG5A 2BG1A 3UPPA 1TVFA 4OKPA 1G68A 3NBLA 4P85A 3DW0A 5G18A 5GLBA 3ZCZA 4X68A 2HDSA 5GLCA 4A5RA 1IKGA 4GNUA 1WYCA 1XGJA 3VSLA 2Y2LA 2R9XA 2ZD8A 4H8RA 4JXSA 1BSGA 3O3VA 4KZ9A 1IYPA 1ONHA 2G2UA 1XPBA 2WYXA 4QY6A 4DE1A 5EVLA 3HUOA 3VP3A 3TG9A 4ID4A 4B4ZA 1Y54A 3LEZA 3TSGA 2J9PA 4KZ4A 2XH9A 5DTSA 2V2FF 3VP1A 4KZBA 2P9VB 4L0LA 4Y7PA 1ERMA 2PBYA 4PM9A 5FAPA 5GL9A 2PU2A 5CTMA 1LHYA 3UN7A 5EECA 4OLGA 2BLSA 1MY8A 2Y91A 4R3BA 3W4PA 1YLWA 3PBTA 1YLJA 4X56A 4DXBA 3HUMA 5FSRA 2V20A 3OC2A 1E3UA 1EROA 4WELA 4QB8A 1YQSA 4BJPA 3Q81A 4N1HA 4S2IA 1NRFA 2QPNA 3NIAA 3NCKA 5HAIA 1SKFA 4OPQA 4CJNA 3Q7VB 5U47A 2XLNA 1SDNA 2ZQDA 3OPRA 5D3OA 3N7WA 3HLCA 4GOGA 2P74A 3MKFA 3PBSA 3UE3A 5FAOA 3VOZA 3BFCA 3BLSA 5GHZA 2EFXA 2WKIA 2OLVA 4B4XA 1XKZA 2CC1A 1GHIA 5CXWA 3HLEA 3SS3A 2OLUA 2Y4AA 3A3IA 2I72A 5M19A 4GN2A 4LV1A 3NDEA 2WAEA 3IXHA 4JBFA 4KZ5A 3BFDA 3IWOA 1I2WA 4OLDA 2WUQA 3WS1A 5HAQA 3BEBA 5EE8A 3ZVTA 4LCMA 3IH8A 2EXBA 4ZJ3A 2HP9A 1BULA 3HLBA 4MNRA 5KSCA 1PZPA 3Q82A 4OONA 1OMEA 1PYYA 4OP8A 4PPRA 1PWDA 1BZAA 4GZBA 3MBZA 4RYEA 2H0TA 4BLMA 2C5WB 4KZ7A 4GD8A 5DF9A 1LI0A 4S2KA 5CTNA 3VMAA 4LV3A 1PZOA 4KENB 3IF5A 2EX8A 4WZ4A 4EBPA 2RL3A 1K4FA 2EX9A 4WZ5C 3VSKA 5DTKA 1ES5A 3PAEA 4X55A 2WGWA 3OCLA 4CPKA 1JVJA 3EQUA 1N9BA 3MZDA 3G2YA 3FZCA 5KSHA 4P87A 1SCWA 3IQAA 1MXOA 2OSUA 1K54C 1PI5A 4WZ5A 1BTLA 1NY0A 3DTMA 1CI9A 3HREA 4K0XA 1EWZA 1JWPA 3PBOA 4QY5A 1N4OA 4KZ8A 4OH0A 1KGEA 2ZQ8A 3PBQA 4HEFA 1K6RA 4Y0UA 4E3JA 4OQIA 4RA7A 1MPLA 1NJ4A 2Z2MB 3DWZA 1K54A 5CEDA 3UNWA 1TEMA 1RGZA 5HARA 2WGIA 2XD1A 1WYBA 3C4OA 1W5DA 4GKUA 4KG5A 4BQMA 5BOHA 1MWRA 3QNCA 1NZUA 4Y0OA 4GDBA 5F83A 1ES4A 1G6AA 3HVFA 3MZFA 2Q9NA 1NYMA 3WRZA 4OP5A 3V5MA 1W79A 4DDYA 3OPHA 2ZQ9A 1YLZA 4R4RA 1L2SA 3P98A 5GLDA 1S6RA 5CHJA 1PW8A 5EVIB 4FSFA 3UE1A 4UAAA 1DJCA 4IEDA 5I94A 3OPLA 3FV7A 3G30A 1FR6A 3O86A 1W8YA 1MBLA 2WGVA 3VFHA 3V39A 5CECA 1XXMA 2E8IA 1LL5A
chains in the Genus database with same CATH superfamily
1BGSA 1G8PA 5DKKA 4XDWA 1GY7A 4JKTA 2Z2LB 5G1LA 4Y15A 1DO2A 4DR7M 1D6ZA 2CMNA 3CJMA 3UPNA 2GEYA 1W63Q 4WP2A 1BRNL 2OQEA 2H5SA 3A3EA 4J9AA 3BECA 1PJTA 4O2HA 2HHHM 4O3VA 1ISKA 3E0YA 3T4KA 1IKIA 2O9BA 3FKVA 4X64M 3BQ8A 3H82B 4O01A 4WURA 3RGPA 4DV7M 4XUZA 1NVMA 2IMJA 4P6BA 1H6UA 4YOFA 7CATA 1L1ZA 2EX6A 3M2JA 3Q07A 1ASKA 1KD14 3GQZA 1L5GB 2R46A 1JBTA 1QMFA 3K2NA 4DR5M 1XJ3A 5HFOA 1VQQA 3U2AA 5EPHA 1FQGA 1L8QA 3NY4A 3W0LB 4G4RA 1JB0F 5AQ9A 2JUJA 1C3BA 1PFPA 1WHCA 3SAWA 3T4JA 3FGYA 4L8OA 2PHYA 3O88A 5EVID 1L2CA 3A5EA 3EBYA 5A8BA 4KQRA 3AGOA 2Z4SA 3F9SA 2GU3A 1FNNA 2A49A 2OOLA 3BYDA 5MC7A 1NLYA 1K56D 3GVBA 3HWSA 2ZC4B 1FGQA 4W5WA 3O87A 3LUQA 2CX1A 2K47A 2CE7A 2IY2A 2HDRA 3LY4A 2IA2A 2FE8A 2R9WA 3D5IA 2DAEA 2Q07A 3AOEC 3B33A 4XB5A 5A92A 1QANA 3E46A 1PW1A 2QEX3 2Z77A 4WM9A 4I5SA 3WHLA 1YT4A 4HI4A 4N92A 3K3CA 5EXTA 3HLGA 2PDRA 4HJ4A 5FTNA 1TUHA 2E8JA 4QHCA 2XZUA 4L4UA 4CQHA 3I51A 3GLFB 2BIRA 3AKZA 4N6MA 5KP1A 1J3WA 5FI2A 3VGNA 3GZXB 1MKIA 4LV0A 5EV0A 3AV0A 3VP4A 3C3DA 2W3HA 3VE3A 3UB8A 3J7AS 4HNBA 2KA6B 1TS7A 1YE9A 1R7RA 4OX9M 3KCHA 3UL6A 5EJCA 1TRPA 1SZVA 3ZG9B 4LFBM 2C5RA 1I3IA 1W2ZA 1XC8A 1DE3A 1NV9A 4XUXA 4KG2A 3BWLA 5J4EA 3OWSA 2JKGA 1D6UA 2UUBM 3UO9A 2K0BX 4E6WA 5FQ9A 3DY5A 4O8GA 1RGGA 4EXRA 3WA3A 1ZV1A 4QHTA 2HPBA 1QAKA 1RJOA 5BPVA 1LL8A 3GSGA 3AMOA 1WGLA 4MMZB 4EC6A 2HMJB 4R38A 1K6SA 1DGHA 5EXXA 1YJN3 1TJDA 4EU0A 1H8ZA 5HW3A 2ACGA 2ZJ9A 5CHMA 3Q1FA 1W2B2 1J09A 3WR2A 3FRIA 4BBAA 3GTCA 2VV6A 1HNWM 5DF7A 4XBOA 1FGRA 3Q8GA 1ZG6A 4I38A 1I2SA 4HBRA 3FTCA 1IQYA 1MZUA 3LTCA 1DJBA 5CEBA 2OQ4A 1LOWA 1CEGA 2L7IA 3GLHE 4CJ6A 2VF7A 3MS6A 3NM7A 3ISGA 1BLHA 2N35A 1O7EA 1TP6A 4PM7A 2O3OA 3CTWB 1JBRA 3KE7A 5IENA 2BWBA 3SASA 4OVDA 4PDGA 1P9RA 4KLNA 3ZFZA 3CCM3 2DNSA 4E3LA 3AGFA 2CWTA 3IX4A 1F98A 4KVHA 5CERA 3DTEA 3CUEA 2ZA4A 3D4AA 3CXC2 3NBIA 4JI5M 1E3VA 4L8PA 1MJGM 2HV1A 2V9AA 4S2PA 4DE0A 5EUAA 2X01A 1TH2A 5IG4A 1X1YA 3AGEA 4BBVA 2G2WA 2JZ0A 4JI7M 3IXBA 2PYRA 1CYUA 3SAVA 2LVNC 3NM2A 3NQYA 1JB2A 5FDHA 2HP6A 2HMNB 1FCOA 4LRTA 1U60A 3SS4A 5LMNM 3FF0A 2CFWA 3OX9A 3UE6A 2CV1A 3MQ0A 2JY8A 1P9WA 2J9OA 3PXPA 2W3GA 1HZ1A 4ILFA 2W3DA 2ZM8A 3S5CA 4RNYA 3S4XA 1N9LA 3QYBA 4N6NB 4LCLA 2ZTDA 5IG5A 2MROB 2E5LM 5EP3A 1Q40B 3HLWA 3T4QA 1C1KA 1E3UD 3E4PA 3FKWA 5IT5A 2ZM2A 2HP5A 3LCUA 1UGUA 2JXNA 5J7EA 5FW5A 3V3SA 3GR2A 3SBJA 1AUAA 1O7HB 3MHEA 2L7HA 1AVKA 3NBJA 2XR0A 3KIIA 4XT2B 1HD8A 4RNZA 3WS2A 3IECA 1XGIA 3B47A 2F5WA 3T38A 2XSZA 1TRQA 4X69A 1SXJC 1IY1A 5IREB 1J2BA 5I97A 2DAKA 2L4VA 2OWHA 2FZ0A 1BLSA 1NDOB 5DFXA 4MGHA 3ZQ5A 4I8OA 2Y2QA 3BXWA 2MJ5B 1GO5A 3WS5A 3R8FA 1IYYA 1WA9A 4PT5A 2BTFP 1QVRA 3QWLA 1G3IA 1OQYA 3UY6A 1UM8A 3LIEA 2WGQA 4Z9QA 1LI9A 1N5PA 4D80A 1OHOA 4R3AA 1IU7A 2ZBBA 2WKEA 1KDWA 1YHQ3 3SVAA 4C75A 2A15A 3UGJA 2X8AA 2XSHB 2LHGA 4K91A 1YIJ3 5ITRA 4CLCC 1HTZA 1DJAA 1B2MA 1BUJA 3L26A 1Q864 5LC6A 1TU5A 3ZH9B 3L29A 1O07A 2XGNA 4QNRA 4X1MA 3TPZA 1I0XA 2BWEA 1U5OA 3H3HA 4HHDA 2ZMAA 4HOIA 5JYOA 1UCJA 1VHMA 2JP7A 1JKGA 3BM6A 1CJFA 4PD2A 4GKJM 1AWIA 3D9YA 3WA2X 3SC3A 4CGYB 3EHCA 3JPUA 4PCZA 4OPZA 4UQIS 1IN7A 1CUKA 1Q02A 2CHGA 3I4VA 4IBCA 4X66M 1W6CA 3JR4A 1IYOA 3DA1A 1XJ2A 2X02A 3B7QA 5DJTA 3CZDA 1G28A 4GD6A 4HVNA 1PWCA 2B95A 3GQ4A 4HJ6A 1N9JA 2Y2IA 2W1TA 4R7GA 4HJ3A 4GW9A 4LGMA 1AV4A 1N5HA 1LOXA 3G8ZA 2QWSA 4DE3A 1B21A 4HH3A 5DKLA 1T2HA 3SYUA 3FRHA 1W00A 3KS8A 3N8RA 4S2NA 5GHXA 3ZDJA 3W4QA 4R9LA 1J9MA 4G3WA 3LYGA 4U0TA 2Y2PA 2P08A 3IF6A 1FSWA 3UB5P 1A2KA 1ZC2A 1OFHA 2HGVA 2H28A 4J5KA 4O7DA 5F82A 2INWA 1VDDA 3S22A 1NY6A 1PJQA 3G2ZA 1TR8A 4YFMA 4OOLA 3MK6A 3EB8A 4HM7B 2VQEM 2R41A 5AQ7A 1IEMA 2HF6A 2OTJ3 3GECA 1BRIA 1ZKJA 3BLZA 2G8LA 3SLUA 4E6XA 1RCLA 2YX9A 2FFYA 1ES2A 5EVEA 3CCQ3 3S7OA 3A3DA 4GHIA 1PY3A 1T43A 4IBXA 5EM0A 4WW0A 4LSOA 3C4PA 4DMZA 1G6OA 3U5ZB 4I81A 3EE1A 4N9KA 2OQEC 1I3FA 1ODVA 4BD1A 1ESUA 3IPTA 4D60A 2ZC5B 3BRMA 3K1JA 1DGGA 1YLYA 4RF1A 3GLGA 3F14A 3LTDA 1V34A 4OKPA 3NBLA 2D1WA 4P85A 2XA7M 2P5TA 2LVPC 4N6OB 1KFVA 4GNUA 3IG8A 2R9XA 2R0IA 4KZ9A 2NQ8C 1X1WA 4DBGB 1ZO2A 3AGNA 5HGRA 1W63M 3G6E3 2QCUA 1PM5A 4LFCM 5FTKA 1V33A 4R70A 4X25A 2V2FF 1NO3A 1OTDA 3RFWA 4PM9A 1EUIC 2PU2A 1M9GA 5EVHA 2F5SA 4P6ZS 4JI4M 5EECA 2OOBA 3EIEA 1MY8A 3E99A 2RGOA 3W4PA 1LRAA 1YLWA 5HZHA 1YLJA 4K0KM 2F99A 2V20A 2JQ5A 3KO6A 4LJ6A 3L27A 3U61B 2W0NA 1NRFA 3C8CA 4DR6M 3MYTA 4OPQA 2QPAA 3Q7VB 3C2WA 3ROBA 3NULA 5K5BA 2ZQDA 1K9M4 3OPRA 3KW6A 8CHOA 2CFDA 3HLCA 4PKYA 4UEYA 5D3OA 3BLSA 1OH0A 1GSPA 2E2VA 2E2TA 2M60A 4B4XA 4K08A 3OW22 1BSEA 1XMQM 1BSDA 1IXZA 3MSHA 4MN5A 3RH8B 8CATA 3E98A 2I72A 4EEPA 2V8FA 3NDEA 4IPBA 4LV1A 3KOYE 2VK3A 3CPOA 4OLDA 3WS1A 3H9WA 5EE8A 3ZVTA 1UCLA 3GPUA 2D7EA 1BNEA 1VQ83 2R44A 5IW9A 4AKHA 4KFEA 1BSCA 5AIIA 1PZPA 7GSPA 3Q82A 4WYKA 4PPRA 2F5OA 4GZBA 4BTWA 3MBZA 4I39A 4KZ7A 2W9PA 2PR5A 4P17A 2P09A 5DF9A 2Y73A 5CTNA 3RTYA 2LVAA 1ZGXA 4STDA 1PZOA 2A24A 1IM2A 3CC73 3OLOA 4KENB 4WZ4A 3KOXE 2HMKB 4BJPA 5AJGA 9RNTA 4JGQA 2CG0A 3AHSA 1WXQA 2CWBA 1GD4A 1M904 2M7OA 4X55A 2WGWA 1PRBA 3OCLA 2O9UX 2W3FA 4CIZA 4EV5A 3FZCA 4P87A 3A0RA 2KF5A 1IV7A 3BNDA 1SCWA 3FYDA 4BBTA 3FF2A 1X1UA 4G3OA 3DGYA 3PNYA 2WO0A 4WZ5A 3W67A 5TBMB 4JI6M 2F5MA 1DMQA 4LG2A 4LMIA 5LBRA 2WSFF 2GJ3A 4FCTA 1BNFA 3PBOA 3J2PB 1RNTA 4Y0UA 4KT0F 2Y20A 4KHPM 2J8XB 1TF1A 1MC0A 4E3JA 5EFWA 1S1YA 2CV2A 2ZL1B 1US1A 3UB1A 1NJ4A 2RFRA 2IA7A 1W5SA 3L0RA 3CD63 2Y0QA 4O0PA 2XD1A 1S3SA 1DP9A 3PHYA 1W5DA 2HCBA 5J3WA 1FGTA 3L7HA 4FMBA 1IXSA 1G6AA 2K9DA 1TFOA 4HM1B 3MZFA 1V58A 1KQS2 2LB9A 3UB9A 3KSJA 2QGUA 4OP5A 3V5MA 3O5YA 1PJSA 3HJIA 3CPTB 3QK9A 1YGEA 4BWIA 4Y5FA 2ZDJA 2K3DA 5CHJA 3T0UA 5EVIB 4FSFA 5I94A 3I01M 1VQ43 3U6OA 3E9SA 2BJWA 1IN5A 2JHEA 1XWIA 1BNSA 4FD2A 2NUPC 2VV8A 1UWPX 1CEWI 2CW9A 5CECA 2E8IA 3GLGE 4OQHA 1ROAA 3SS5A 4EQIA 1ZMWA 2GNOA 4JI2M 1DP6A 2JY7A 4RNTA 4FH4A 2GU1A 2RCXA 1HT2E 4UA9A 3I04M 2KHHA 4BIRA 3T15A 4KZ6A 1Q3CA 3LMMA 1GA0A 1RN7A 4YINA 3D9RA 1V9YA 3GWRA 3GQ3A 1IDPA 3L2AA 3AHWA 3EEAA 3N54B 3JUNA 1FCMA 2J7VA 5IF6A 5HD5A 3GLIA 2XSZD 2LXEA 2X71A 2H10A 2DKLA 4DV2M 4AFIA 1T2IA 4ANRA 1UUGB 2VV7A 4DRTA 4MGIE 4R1GA 3NWLA 1H8MA 3DGOA 2Y59A 5DFYA 3X3YA 2VF8A 3SYLA 1JRQA 3OWUA 4HYZA 1RGKA 5F1GA 2ZBKB 3KYZA 3HY5A 4TX4A 1YMSA 5IHVA 4EUZA 1L0EA 3B4PA 2CHQA 3G34A 2I9WA 1VQ63 4JYAM 5KZHA 3B89A 4KO8A 1QAQA 1OF5A 1KSIA 2JKRM 2MGWA 2JY6B 1W6GA 3DM8A 1ZAEA 3VP0A 4N3VA 1XX2A 3SMPA 2Z6CA 2LWXA 3D3LA 3DMCA 2B5RA 2I9VA 6RNTA 5HL6A 1KE0A 1NNVA 1FSYA 3OXAA 3QNBA 4FWDA 5HPIA 4ESPA 2Y2MA 4KFDA 3MXRA 2AHMA 2DWNA 4LFUA 1LTMA 2FNQA 1RKYA 3FPWA 1W7CA 4NHFA 3MZEA 3HK4A 4H6JA 4EWFA 1XXHB 3EOIA 4JXVA 4MN6A 1NHGC 3BU4A 1N9EA 1YAXA 3C58A 2FXTA 3IH9A 4NOOB 1IBMM 2Z6BA 4OOMA 5LMUM 1RRLA 3F1PA 4EETB 2JA2A 3QP1A 3KP1E 1RRHA 4WFOA 2QJ7A 1OPXA 5FL3A 1QMAA 3NQZA 4LRXC 2C9CA 1AR0A 1WMOA 2VKSA 1TTOA 1DYUA 4JI3M 3FE3A 2XZFA 2C9OA 1K55C 3CU3A 3UNLA 2J7OA 1P3QQ 2Y74A 2BMQB 1FOFA 2BMRB 5JPPA 3ICYA 4IHQA 4QJGA 1JZDA 3K0ZA 3SXXA 4GL6A 4FUWA 4MBHA 2P9VA 4DV3M 2GX5A 3SOIA 2QNJA 3HIIA 5HD3A 2UU9M 5AQBA 3NBBA 4XM4A 1NXYA 3UDXA 3AOGA 3LW5F 4LJ5A 4KFFA 1H8YA 5KPZA 3J81S 1OJ5A 4S2NC 1N8R4 2H0GA 4LF5M 4DKIA 1VEJA 2P05A 2IWBA 4QPRA 3U97A 3E4RA 3LI9A 4NSRA 2CEAA 2XLJA 4HBUA 2EUCA 3IF6C 4QNMA 1BANA 1QDRA 5KP3A 1ACFA 4AG6A 4HOHA 4K61A 3R7WB 4REZA 3NBXX 3SH9A 1TFKA 1FCNA 4LCBA 1K4EA 1XFNA 2UXDM 4U13A 1IVVA 4FW9A 1K3XA 1VQN3 3GRVA 5HX9A 3S7QA 3GZRA 2WK0A 2FGTA 3UB6A 3ZG7B 1EI5A 1C7YA 5CGWA 3B74A 4OOYA 2HOHA 3PYPA 1YJ93 4WLAA 3HHWA 1NU3A 1SKOB 1K28A 1YLPA 4HM8B 4NEED 4DR3M 1G5UA 4Q53A 2CK3H 5DTTA 4LF4M 3O8YA 2LNHC 3EF8A 4K0WA 4I4KA 3IMAB 4QWTA 4ARZA 2VZWA 4DJ2A 2YFLB 1MWTA 4OQ0A 4R4KA 3MXSA 2ZM0A 3NOUC 3FLJA 3N8LA 2J8YA 2L4FA 4DXCA 3GLIE 3LZAA 1O7WB 5AIGA 4U0XA 5C5KA 4CLCB 4NXGA 2YR0A 3ZYTA 4S12A 1XNQM 2RGQA 1FIKA 4I3AA 4E04A 3X3XA 3TW8A 1G71A 4NXNM 4G1MB 4AKIA 4X65M 2F4VM 4QOSA 3DAVA 4LLOB 4LPZA 4PM5A 4BLCA 2KDLA 4XXRA 3J80S 4XK8F 5BR8M 4JLFA 2Q2EB 4B93A 2GNXA 4Q8IA 2XF3A 1OAIA 3WODG 2WOFA 1VEUA 4LFAM 4LF8M 1D0MA 3P09A 2XD5A 2FNAA 2EA9A 3WMDA 3PAGA 1QAFA 4HLQA 1HNZM 5EVIC 1HT1E 4ZJ1A 3HX3A 2QBYA 3VF1A 3GZYB 3DOAA 2UGIA 2L1SA 1NJGA 4IBFA 2KRTA 3CCS3 3J7Yd 1QZMA 3CCL3 3T1QB 3WRTA 3ZHHA 2HZ5A 3IWIA 1CF0A 4LRZE 1PU4A 1YVSA 4MEZA 3QP5A 4OPYA 3W8KA 3IX3A 2V1AA 3BFEA 4MB7A 1CEFA 4Y2FA 5FQQA 2J3TD 3CC43 1YLAA 3QHYA 1SG9A 3M6AA 2JDIH 2L6OA 3RGSA 4IBBA 4G4OA 3GLHB 4JXWA 3N8SA 1BVIA 2J3TC 1NWZA 1QUTA 1DY6A 1VQ53 4UA7A 5AIFA 3B4OA 3EQQB 1BYWA 2O9AA 1K0KA 2C96A 5ITTA 3OTOM 4RVAA 3WOFB 2VGKA 3W4OA 1RP5A 4LENA 1O7NB 1GYBA 3KYQA 4KUKA 2KZUA 1IELA 2RRUA 3PTEA 2R62A 3Q8XA 3NJAA 3BW6A 4GH9A 1T18A 4KG6A 1K41A 3UZUA 1PRQA 2QZ6A 1HZOA 2C98A 3PCRA 1CI8A 3SOAA 4KQQA 5CLKA 3V92A 1VQ1A 3UDFA 3G16A 3IWQA 1RTUA 1VETA 1C54A 3VKHA 4DN0A 5G4YA 2PAVP 4I3IA 1Q40A 2ML6A 4X2OA 3DBAA 5CGXA 1M40A 2Q0OA 1H5XA 5FQMA 1Z5BA 4IBJA 4B3TM 1OT6A 4B9OA 3CC23 1YIT3 5JYPA 2CFOA 1OTBA 3TE8A 4K1UA 3HLFA 2L09A 4BENA 2JKTI 1UI7A 4MLLA 1BSBA 5F1FA 3MKEA 1XP4A 2DCFA 5FATA 2UX0A 2M7VA 5M1AA 1HVBA 1FZUA 1EE8A 2F86B 1Q39A 2Y55A 3GRJA 2PRFA 1BUQA 3BQAA 4GC9A 5D83A 5DF8A 2F98A 3TQSA 4RBNA 1OTAA 4S2LA 3OBFA 4FMAA 1PFLA 3HUNA 1UUVB 2PZVA 4BB9A 2HMOB 2DENA 2ZMFA 4IBIA 1GMRA 4JPMA 1STDA 5TGFA 4FCWA 3K63A 4HP4A 1MGRA 2R4EA 3T1YM 1ESIA 4GB5A 1GD3A 1OIZA 2Z3XA 3HHXA 3CITA 3D4FA 4GJ4A 4N6V0 2C99A 2ZC6B 3HL9A 1D0KA 2XSSA 1F9IA 2YQZA 2H0HA 2OCTA 2WKPA 5KMWA 1FUSA 3QP2A 1OJGA 2LHCA 4DV1M 2BG1A 1ZHHB 5STDA 3FTFA 3F1NA 1MX0A 4WP5A 5GLCA 3GP1A 3LYXA 1STZA 3HJQA 1IFYA 2Y79A 1WYCA 3VSLA 2JKTM 3DZLA 1IN8A 2DVWB 2ZD8A 2EJSA 1IYPA 4PHTA 5KIZA 4UN2B 1LVNA 4EW7A 1IY0A 2W56A 3BBZA 4OW0A 3UL5A 1A90A 3VP3A 1IQXA 4B4ZA 2G3QA 3LEZA 2J9PA 3LXUX 2XH9A 5DTSA 2IYJA 4HM5B 2CV0A 5FAPA 1OTEA 1HYFA 3WHKA 3ZQJA 5CTMA 2BT3A 1IVXA 4OVMA 5IG3A 2OOVA 2DXIA 3L28A 4R3BA 1RGFA 3PBTA 1NJI4 4X56A 4GKKM 2APLA 4FR9A 4LY6A 1IY2A 5AIHA 1T6OA 3QRDA 1DGHB 1JBSA 1OCVA 3SATA 1BNRA 1EROA 1YQSA 3MQQA 3NIAA 2X49A 3Q81A 5HAIA 4MMNA 5BU4A 2QYBA 3H7WA 5GSPA 1SDNA 2V0UA 4Q7JA 2D7HA 1ZS7A 3UE3A 2O5RA 3BFCA 3LVWA 1B2ZA 4Q0HA 1JN5A 4LJAA 5KP4A 2OLVA 1IT8A 4EYCA 3HLEA 4YY3M 3A3IA 3T1SA 2OOAA 1BNIA 1N32M 2UUGC 2QSFX 1TF0B 3SFZA 3X42A 2WAEA 3IWOA 2WUQA 1HJPA 5HAQA 3BEBA 3KYEA 4EW5A 1PNEA 3IH8A 1RGHA 3U60A 2MH8A 2EXBA 1H0MA 2HP9A 1BULA 4LF9M 2YNMD 5KSCA 2P0MA 3U5ZA 3CWFA 2QA43 4X62M 1SJWA 3FUUA 4BLMA 3F92A 1R4YA 3K5TA 1EEJA 3NOPC 2HAKA 5JBSA 1LI0A 2PYPA 3T4LA 3VMAA 4LV3A 2OTL3 1NSFA 1T5YA 4ME4A 4EBPA 2RL3A 2L2DA 2UXCM 3WHOA 5DTKA 2AAEA 1CQSA 4EEUA 3BY9A 1ES5A 3VE4A 2IUKA 4YHHM 3EIHA 4CPKA 2ZMVA 1HQCA 2O0YA 4F1IA 1XFQA 3EQUA 3LT8A 1N9BA 3U6CA 3RNTA 2INXA 3HJSA 2EO2A 3VDUA 3IQAA 1MXOA 3PS8A 3U6QA 1VQK3 3VK8A 1K54C 1FW7A 1F8NA 1NY0A 1D6YA 1JZOA 1N8QA 2CFGA 3ER7A 1S1ZA 1CI9A 1GSVA 2QKPA 3DTMA 3FPVA 2QZ4A 4FMDA 4AI6A 1G41A 4GCZA 1T3BA 5IU1A 1BRJA 1JWPA 1N75A 2O9CA 4QY5A 5FGOA 1S66L 1KGEA 1B2XA 2ZQ8A 4PAUA 4Z1WA 5FEFA 4OQIA 2ERCA 1GS3A 5CEDA 4HZBB 1TEMA 1IBKM 5HARA 3LIFA 5BXQA 4GKUA 4WN5A 2LVOC 4OUQA 2EWWA 6GSPA 5BOHA 2EKFA 1ES4A 3HVFA 1AIPC 1TD5A 4ETZA 1TS0A 4DDYA 5L8RF 4GC5A 2ZQ9A 2K2NA 3PR6A 4HM2B 2F4YA 1L2SA 3ILKA 3P98A 5F5YA 3C38A 3MPHA 4LZIA 1QQWA 5TGNA 3FCSB 4UAAA 2RGHA 2PR6A 2QP9X 4G6ZA 4M4XA 1WMNA 1FR6A 4OK0A 2GXFA 1W8YA 1GMQA 1YGWA 2BMOB 2XRXB 4R1KA 3EWKA 3T4TA 3V39A 3VFHA 3LQRA 1MPLA 3HCYA 1LL5A 5AVFA 2LTUA 4JN6A 3GMWA 2ZTCA 2X4AA 3VOYA 1B27A 4CCVA 1ERQA 1F5MA 4PM6A 3FTEA 4MH0E 1AVLA 3T4OA 3BFGA 3LY3A 4MGZE 1V74A 5ITQA 4OPRA 2QENA 4RNAA 1KWIA 3N6IA 4MN7A 5D82A 3JVCA 5A91A 1RMSA 2BNGA 4HY8A 3PGBA 4ZTKA 3WS4A 2HMLB 3JUMA 3T12B 2BU4A 3MJ5A 2L4RA 3FC7A 2IWDA 5FLXS 3S67A 3HGIA 1VQ73 2HJEA 3ZG8B 3DWKA 4G4QA 4Y28F 1DVCA 3EGXC 2F5QA 4C6YA 4B88A 4FD8A 4JV5M 4C3QA 3EC9A 2Z7AA 1BOXA 3THGA 1LSXA 2XFSA 4GB7A 2W1RA 5ELJA 2W1TB 4ZBEA 1TDLA 1GA9A 5KQ8A 1A2PA 1QALA 1NV8A 4NRWA 1S0WA 1KOUA 1E4DA 3ITAA 2CG1A 4WWUC 3EN1B 2DNAA 3IXGA 1ZMVA 3X41A 1E25A 3KS4A 3VP2A 4GITA 2YFIB 1DVDA 2WAFA 3DUKA 3M2KA 5HAPA 3IF6B 3SEDA 3D8LA 1DO0A 2P0XA 1D7EA 3NBRA 2EKKA 2QQ8A 1Y28A 4K90B 1HR0M 4RX3A 4IBDA 1VQP3 2JWSA 4B7GA 3UJMA 5BIRA 1X1XA 2W3EA 4Z8XA 1BLPA 1RGEA 2XEPA 4MM3B 4UA6A 5CF2A 2HL7A 3CF0A 3F7SA 3RXXA 3CF6E 2O25A 1S4SA 4MGKE 4QWOA 4DUZM 1XMOM 1QJGA 3F7XA 2OAQ1 2L1MA 2DWMA 1E97A 3A0VA 5ITXE 4LGWA 4PKYG 1RGCA 5HSQA 3BNCA 3BLMA 1IXRC 5E2EA 3I563 4LJ9A 3AGDA 2DI0A 3SAUA 4J8TA 3CCE3 2Y2JA 4BTXA 5L07A 1FA3A 5EP2A 3K9MC 1I5QA 3EGDC 3JUOA 3KVWA 3D8BA 3TE6A 4GDNA 3NV0A 3GLGB 1BT5A 1NB3I 1X0OA 2Z76A 5EOOA 3T8NA 2LYXA 1FR1A 5FQJA 1WTHA 4AEQA 3I0YA 5HDSA 1MGWA 2KEBA 1P0ZA 3B42A 3LR3A 1NHWC 4GS9A 1UGIA 5L2FA 2EFUA 3B9PA 4OVZA 1G4AE 4F3LA 5JI2E 1YKDA 4R9KA 4K1VA 5F68A 1R4CA 2W2CA 5G4ZA 3HX8A 4IT7A 2XK1A 3DTIA 1UDII 5AEWB 3C7UA 3DGNA 3MG2A 1JB4A 4JF6A 3KSXA 1ROVA 1Q824 4E3KA 4MMXB 1XJ6A 4X53A 3CNXA 4M0WA 3BFFA 1N78A 3LI8A 5TR7A 4IIAA 5DFLA 1Z59A 4JRFA 1K25A 3RJUA 1RDSA 3CUEC 1NNUC 1W6YA 3STDA 3F8XA 2F56A 5IEPA 2MR9A 1D06A 1IFQA 3S29A 5A0OB 4U3TA 1L0DA 2J7NA 2B24B 1NNJA 1NRJA 3IT9A 5FQKA 4X1LA 3IS2A 3SH8A 3D79A 4AG5A 4FMCA 3PBRA 4HH2A 3Q1CA 3ZNYA 1JTGA 4R0QA 1ZQ9A 2O01F 4GHAA 1B2UA 2ZC7A 4L9FA 1RCJA 3E2LA 3T8UA 2BASA 3LOYA 2LB5A 3F1OA 1ALQA 2KCDA 2FOIC 2HKJA 4LF6M 5GKNA 3FD9A 1AQZA 5FI6A 1OTRA 5DVAA 4IJGA 2ZQAA 2Y0TA 2F5PA 3L25A 2PU4A 2KNZA 4R3JA 4WYKB 2Q9MA 5E43A 3HBRA 1IBLM 4NXMM 2V6ZM 5H37D 3LCVB 2Z4RA 5IZ7D 3E2KA 3L9KA 2A24B 3T6PA 1FGMA 1M6KA 4KT3B 3J27B 1YVBI 1QVG2 4DV0M 5A90A 4ZDXA 4R23A 3SYKA 3OZHA 2WGWB 5EOEA 4NPBA 1XB2B 3CMA3 4DUYM 3CME3 3ECFA 1Y8GA 2J5YA 1ZMUA 1NYYA 4LYLB 3WOEB 4MBFA 3HOHA 2WGOA 3UE0A 3U1WA 3T50A 2AADA 2KLIA 1GHPA 1H3QA 3V76A 1SHVA 2VQFM 1L0FA 4JF8A 1OT9A 3FYCA 4D82A 4WEJA 1YI23 4YWZA 3PZWA 4M3KA 2PD8A 2D7GA 3IHPA 2KOIA 1LNIA 1LXEA 1L0GA 1JNUA 2VX8A 2B3TA 3FUWA 3FZWA 3KXEC 4UHUA 4LJ7A 2LVQD 1SIHA 4Y0TA 2GZAA 2C6WB 2DRWA 3NXJA 4LV2A 4P6ZM 4KZ3A 5JI3E 5CX7A 1X37A 4L16A 7STDA 2R78A 4S2OA 1SXJA 1TTEA 5ELUA 1E94E 2QHKA 4NG2A 2Y2NA 2JCHA 2Y2GA 1ULJB 1VM1A 3N4IA 3OOVA 3OWYA 3LR5A 3LT9A 2V1BA 4NKPA 1IXSB 2W04A 2R4JA 5FEGA 2GBWB 2JY5A 5IG0A 1BVSA 2KF6A 5CGSA 4NXBA 3IG5A 4I5QA 1KVMA 3FUTA 3EQVA 2W0QA 3VFDA 2RCDA 3KZTA 1M1K4 3OCNA 2CX0A 3UB7A 2FFFB 3NECA 2KRKA 4DV6M 5FTMA 3MFXA 3IHAA 5AYSC 3MHVC 1B2SA 4WBGA 1LNHA 1JTDA 2UV0E 1BU4A 1Q7HA 5M18A 3PFIA 4DF6A 2FFJA 1YNVX 4CLCA 1Z6FA 2OO9A 3H82A 4JI0M 1W4NA 2JC7A 1EIJA 1BUEA 2WADA 2V1ZA 3C3EA 3W68A 3JR5A 5CXOA 3BNBA 1T1BA 3S1YA 1K57A 2YFQA 3UJNA 4F2LA 3FG3A 4P16A 3SW1A 2RNTA 1OACA 2E2UA 1JQJC 2KF4A 1BAOA 1I8VA 1V57A 2UWXA 3A46A 1XJ4A 3LICA 3TDGA 4MMYB 3EJVA 1CK3A 5HL1A 1JNQA 4KZ1A 1XA1A 1Q9EA 4JF5A 4L9EA 1PIOA 3TWLA 4EBLA 2VGLM 2M5ZA 1I94M 1GABA 1EA2A 4D2OA 3LFVA 4NSOB 1IYQA 1TGUA 3E4QA 4NXFA 2BHMA 4BL3A 4M9XA 3JYIA 2YKFA 1HU9A 4WMCD 2KNAA 3ZG0A 1NWWA 3B8LA 4BL2A 3SHFA 1WE4A 3A3FA 2VGJA 2R18A 3B7NA 2ZQCA 4IVIA 2K7SA 1LSWA 3FUXA 4N6UA 2Y21A 2A3UA 4HEOA 1OF5B 3Q7ZA 1DMNA 1IQPA 3LGOA 4J5GA 2H5XA 2V1CA 2HDUA 3MFDA 3A42A 2CWVA 1YM1A 1MWSA 3GLFA 4IJFA 3TWMA 4IIWA 2P38A 2LQVA 1LL9A 4B3RM 1BRGA 1QMEA 3U6SA 3GQ5A 2B18A 3KKGA 4A3VB 7RNTA 2WZZA 4HESA 5GLAA 3D5GA 3CAXA 3EX9A 3KSIA 4N6TA 1LQMB 2RSXA 2Y2HA 1SDEA 2PBDP 4H6JB 1N77A 2P04A 2Y8HA 3P01A 3UMEA 4FCFA 3VFFA 1R2YA 1KSFX 3CG5A 4BTYA 3F1PB 4RF0A 4LJ4A 1GL7A 1OGZA 1G68A 5GLBA 5G18A 2B1XB 2HDSA 3SHGB 2DZLA 2CKFB 4G3KA 4H3UA 1XHBA 2XSOB 2MJ6A 1BSGA 5C1BA 1ONHA 2G2UA 2GEXA 1XPBA 2WYXA 5FDSA 1YUBA 5AVEA 4QY6A 3FKEA 1ZX2A 3TG9A 3D72A 1TDHA 1YPRA 4XDVA 4ID4A 1LT0A 2QJ5A 3TSGA 4KZ4A 3CCV3 3VP1A 4KZBA 3KP0E 1V9ZA 2P9VB 1ERMA 3WDGB 3HJKA 4DV4M 2JN7A 3MJQA 4KUOA 3UN7A 4OLGA 2BLSA 1Q3BA 5DYGA 3CF2A 4DXBA 2W82A 1K3WA 1VQM3 4L8RC 3LIBA 2PT7A 2VJWA 4QB8A 4N1HA 2DAMA 1IQ8A 1SXJE 2QPNA 3NCKA 2MF7A 4CJNA 5EQLA 1I2FA 4LGYA 1GSWA 1K82A 1UWNX 3GRRA 2XLNA 4GOGA 2KF3A 5FAOA 3VOZA 1BRHA 2DHYA 1MKMA 3CLOA 2R65A 4LF7M 1WNHA 1GHIA 2CC1A 4ZRRA 2OLUA 3CCR3 2GSPA 4Z6YA 3I4YA 1HLUP 3IXHA 3LTBA 4JBFA 3JAMS 3BFDA 3HZPA 4N6LA 4B7HA 4O8SA 3I553 1VG5A 3QYEA 5FSWA 4ZJ3A 3MG3A 4BU4A 1TS8A 4RZMA 2C4BA 1GVNA 1KC84 5EEOA 1L2DA 1OMEA 1PYYA 2EWVA 4O02B 1PWDA 1BZAA 4OP8A 4L15A 4GRIA 5DJUA 3ULFA 3KSED 4CLCE 1CYVA 1EQKA 2DAGA 3SX1A 2XGLA 2ZANA 4GD8A 4S2KA 1JR3A 1OHPA 2XR8B 4ARZB 1QAMA 4WZ5C 4GHLA 5L09A 3VSKA 3KSHA 3V67A 1PJIA 2JNHA 3X40A 4Y13A 4DR1M 4B08A 4Q0JA 3MMPA 3MZDA 3RDEA 3HKPA 3NHXA 5KSHA 4XT2A 1T1AA 4MDZA 3N8BA 4ORLA 3U6LA 2OSUA 3TRCA 2SARA 3HREA 2FS1A 4K0XA 2MC8A 3T1XA 4AKGA 1Y4KA 1EWZA 1KYIA 1PGYA 1N4OA 1DETA 4KZ8A 4OH0A 4HEFA 4L9GA 4Q0IA 4L78A 4YNRA 2KDKA 3MSOA 2Z2MB 4RA7A 1C7HA 1VEUB 3UNWA 1QVF2 3CHWP 3Q90A 1E9RA 5IEOA 1WYBA 5IS1A 3JUPA 4JI1M 3KFUG 5CF1A 3U6DA 4BQMA 4I4LA 5C18A 4Y0OA 5F83A 1VZZA 1UGHI 1NZUA 3W0FA 2SBLA 2QBYB 4JI8M 4GDBA 4ZPXA 2KX6A 4LEHA 3WRZA 3Q3FA 4HZ9B 1IVUA 1N9OA 5ITYA 4M9SA 1VB6A 3GLFE 1GOYA 2YFJB 1OGXA 1YLZA 3GZBA 1QYRA 5GLDA 3CCJ3 4NXEA 1S6RA 3VK7A 1S67L 1SPUA 4X2HA 2CWUA 2D02A 3F40A 3LMLA 3UE1A 1DJCA 4IEDA 6STDA 3PXMA 4JGPA 4FOFA 3G30A 3G713 2CRUA 3HI7A 3UMDA 3O86A 1MBLA 2WGVA 2XA7S 3H51A 4RQ9A 5EP4A 1TS6A 4ZJ2A 5HDCA 3IX8A 1SQWA 4WF0A 3SARA 1N9NA 2DZOB 3SH7A 2R4IA 4BBUA 1KE4A 1LV7A 3LCEA 1L3LA 1Y4OA 3JVVA 4N1XA 4WL9A 2ZHXB 1BIRA 2ZOHA 4E3NA 2CP8A 2XFTA 4S2JA 1LOYA 3Q2PA 4NRVA 2CHCA 3J7BA 3RGRA 1YSPA 2B02A 4CHTB 2RKOA 1CH0A 1LLBA 3V3RA 3HJ8A 4AW4A 4ETXA 4AKZA 1VETB 2JKFA 1JWVA 3K9PA 1A67A 1N36M 2XRNA 3RXWA 1Q814 3V99A 4MGYE 3AMOB 3MF0A 5G2GA 2GDNA 1IN6A 5FTJA 2HMMB 3U6PA 1SXJD 1GY5A 1NZOA 1O7PB 1PWGA 2D42A 1GCEA 3VDPA 3PYJA 2DZNB 3GO8A 2ZOIA 4EV4A 2PNCA 1VQ93 4D81A 2P7JA 1T3TA 3NI9A 2LH0A 1FYSA 2Y2OA 5TFQA 1F2KA 1ZG4A 3KOWE 2GBXB 2DMWA 2V1LA 5E2FA 3K9OA 1E9SA 2STDA 4PMAA 1T1CA 1BLCA 1OAOC 2V1UA 3RE8A 1BNJA 4XGIA 1NB5I 2ZAMA 4JGOA 3WS0A 3GPXA 4MJDA 3IXDA 1DV0A 4IBEA 3V50A 1XNRM 2I7NA 2K6BA 2C10A 1J5EM 3GV9A 4MBKA 8RNTA 4EBGA 4N9LA 4CLCD 3BOSA 1GY6A 1NO1A 2OPFA 1JR3E 1TDZA 3WWXA 2EA0A 1RSNA 3HHYA 3C5AA 3HLDA 4AZFA 1MWUA 1XA7A 1YMXA 5ITXA 3LO7A 3FWLA 3NDGA 3PCSA 1JJ22 1RCKA 4DDSA 3M8CA 3HU2A 4H61A 1KGFA 1K57C 4QD4A 2K0MA 2W03A 3AJIB 3LR0A 2VDBB 5KPTA 4FCMA 1K8A4 2H0YA 4HQAA 4JF4A 4QU3A 2C11A 1EW0A 3F1NB 1RU3A 3G32A 2K31A 4MCWA 1MN3A 2BJVA 1IVWA 3UPOA 1GLNA 4LZZA 4G4NA 4R4SA 4GEWA 1N33M 5HWVA 4B7FA 2W56B 4E3IA 4IBKA 4CDLA 3DGLA 3NC8A 4X6TA 2WZJA 4NETA 2ZC3B 3GPYA 3KDSE 1IYSA 1KVLA 3U61A 1W5TA 3EN8A 3IJEB 1W7FA 3A3JA 1VQL3 3VV4A 3DH2A 1LOVA 3I7JA 3IHBA 1AXBA 3Q7VA 4FTXA 3KOZE 5KPRA 2JE5A 1O7GB 3DTKA 1STFI 1I4WA 4KZAA 3SOYA 3IBJA 2GQFA 4LJ8A 4EBNA 3G4PA 1RGYA 1VDLA 3MXQA 3NUVA 1W01A 1MU5A 3PVSA 5J8XA 1OKSA 4WMCA 3LVVA 2ZQ7A 3H7WB 3FYZA 1GHMA 1M1XB 3LTAA 5A93A 2F5NA 3TWKA 1D1JA 1ES3A 4WYYA 1DRMA 4R3DA 1JN5B 5DRVA 2QMIA 2XQZA 2OV5A 5IT9S 1Q2PA 3VKGA 3ZGAB 1KDSA 2L4EA 4HP9A 1OFIA 1W8QA 1GMPA 1NJFA 1VEGA 4FCJA 3R9XB 3PXGA 1W02A 3LR4A 5KO3A 5FAQA 5DREA 3ITBA 3S7PA 3D3OA 4R71A 3TL4X 1RN1A 2OWJA 4I3JA 4NK3A 4Y3IA 3U60B 2DWLA 4R6LA 4ZAMA 4FVMA 2Z8YM 1WMPA 3FSDA 3NX0A 4WHAA 4IJEA 4M9ZA 1JKGB 4LGQA 1Q7Y4 3MQOA 1K55A 3S27A 1SIIA 3G35A 4S2MA 3UDIA 1ZTUA 1K38A 2BNKA 2ZAOA 2G5GX 5KQDA 3ZG5A 3QP6A 3MG1A 3K2LA 5DYIA 2IUJA 5E6JA 1UW1A 4DR2M 4M0DA 3VOLA 5TBMA 1TDGA 3ZNTA 3QP8A 2HWJA 3N9HA 2EXAA 2DWZB 4QHSA 5HDDA 3M6BA 4L6V6 5FASA 1NY5A 3A45A 1Z09A 3MMHA 4LZJA 5EQTA 1A5TA 2PD7A 2ZL1A 4OQGA 1YLTA 1IT7A 2WKQA 2FH5A 4B3SM 3P7NA 2XDMA 1A2VA 4ITQA 3SMSA 3GRDA 3U6MA 5AI1A 4HM0B 5IERA 1UUWB 1PYLA 4AQYM 2WKRA 5FQIA 1GKIA 1I2GA 1A0KA 2O99A 1VEKA 3CGWA 4EERA 3QP4A 1Z5AA 1YSQA 4WUJA 4GMQA 2VEAA 4E3OA 3CPTA 1PI4A 1PJJA 4DE2A 5EXSA 3FTDA 3U6EA 3C9PA 1RGAA 5DNYA 2I7PA 1JWZA 4GLQA 3GAXA 1ONGA 4PM8A 2V0WA 5EVIA 5F69A 3OV4A 1O7MB 1E3RA 3LH4A 1WJ7A 3FG4A 4JXGA 2KXEA 1EG9B 3FH1A 3G0KA 4R80A 4KODA 1JR3D 1S5AA 4GHIB 4HIAA 3V98A 1K56A 1W5ZA 3AOEA 1JB5A 3KN4A 1GOUA 1Q42A 1KE3A 2WKHA 1DP8A 3TOIA 2IWCA 3UK6A 1Q2QA 2H0IA 4HBTA 5EM1A 1R4GA 1WGNA 2OWPA 1YSYA 1KGGA 1LSVA 1OJLA 1WQLB 1V92A 3LIAA 1BRKA 1L2BA 1LQGC 5TJJA 2DHRA 2ML5A 1R2ZA 4XBTA 3H4MA 3OPPA 5F6AA 2WZXA 2KNVA 2LBCA 5FA7A 3BY8A 3K8ZA 4KQOA 5GHYA 3HU3A 1RNBA 1S4RA 1G96A 4TUWA 1BNGA 4XBYA 4E3MA 2BO9B 3HIGA 3B7ZA 5IWAM 1QDTA 2KAAA 5FI7A 5E2HA 1DGFA 4LRYC 1FJGM 3G31A 1G59A 2L0WA 1Z5CA 1DMMA 2VGLS 4UQIM 1RHLA 2K54A 4G3VA 4JGRA 4HM4B 5AQAA 4DV5M 4IBRA 1OPYA 3QAUA 1SARA 2EX2A 3BJNA 3M0EA 2ZLYA 3CMZA 3ZC7B 3B7CA 3ZVWA 2W9QA 5CRFA 4F94A 1FILA 2J3WA 1IN4A 4P0MA 5AYRB 2Y2KA 3R4KA 3GSPA 2OAP1 4KQDA 1N34M 2HJ9C 5L10A 1EFUB 4EESA 3A76A 4IVKA 3M7GA 3T1HM 4B3MM 3MWZA 3FG8A 3HZJA 3PBNA 2HDQA 2KRUA 1D2NA 5AEUB 1HKXA 4HM3B 3W2ZA 2W6JH 4HJLB 3C7VA 1IV9A 1U8CB 4Y17A 4NL4H 1B3SA 2V8CA 4FWGA 1XXHA 1QZEA 1TIJA 1R6BX 2WSCF 4HM6B 5CHUA 3M6HA 4FH2A 2M7UA 1TH4A 4BD0A 5HWTA 3B3XA 2NUTC 3VLFB 1OUNA 2JBFA 3KFQC 4IBGA 4RX2A 2JKRI 3RFBA 2H1RA 5E2GA 2KW0A 2UUCM 4CISA 3CNMA 5BVBA 4WEKA 1IK3A 3GRUA 3UPPA 1TVFA 3U4LP 4JXJA 4DJ3A 5G1KA 3DW0A 3ZCZA 4X68A 1QUSA 4NC6A 4A5RA 1IKGA 4FCZA 1XGJA 2G7UA 2M1CA 5EXPA 2VLGA 2Y2LA 4H8RA 2RBIA 3O3VA 4JXSA 2OOVC 1Z6TA 1DGBA 1GJTA 1I0VA 4GSPA 3HUOA 1FGOA 1WR1B 5F3WA 5EVLA 4DE1A 3NV0B 2D01A 2J80A 4ZM8A 1HQYE 1Y54A 3E4OA 3MR0A 1CQAA 5I5LA 4HKVB 3CCU3 5GL9A 4L0LA 4Y7PA 3E21A 2PBYA 4GS9B 3BNEA 4PEJA 4OVZB 1LHYA 5A2QS 3F8HA 1T19A 2Y91A 1EKMA 4F3LB 1I2EA 3R7WA 4EXOA 3HUMA 1BSAA 5FSRA 1RN4A 1RGLA 3JUQA 1E3UA 3OC2A 1RLSA 4WELA 2QIYA 5CK6A 4S2IA 3T4SA 1UFZA 2KZSA 1SKFA 2CUZA 5U47A 3T1RA 3G4S3 3FG1A 3RGAA 5FTLA 3URPA 3LIDA 3N7WA 2P74A 3MKFA 5D81A 3PBSA 4II7A 1BRSA 1OHSA 3UMMA 1AY7A 4LRSA 5GHZA 3GPPA 2DAIA 2WSEF 2EFXA 2W27A 2WKIA 1XKZA 4PDIA 5CXWA 3LEQA 5JPUA 3SS3A 1SKOA 3A98B 3GRYA 3G6OA 2Y4AA 3K7CA 5M19A 4GN2A 3BB9A 2CIUA 1GSXA 4KZ5A 4XBXA 1WIVA 3DFZA 1I2WA 2UXBM 2ZL8A 1Z1SA 3FUVA 3IS2B 4LCMA 1QAOA 1JV2B 2YKHA 1R5LA 2Z7JA 2AVXA 2FH0A 3EEHA 1UCIA 3HLBA 4MNRA 3KSFA 1FUTA 2A2LA 4OONA 3GDIA 1OTIA 1MOLA 4FCVA 3F1OB 2H0TA 1G02A 4RYEA 2C5WB 1J7KA 1HNXM 4EIWA 2A5YB 4DR4M 1G0TA 3NHQA 2CH9A 4EV2A 5HPFA 3IF5A 2EX8A 1K4FA 2EX9A 5RNTA 1VQO3 3HHZA 3PAEA 5L8MA 2JZ1A 1UCKA 1OIPA 2CFKA 1JVJA 4EQ1A 5EP1A 3GLIB 2KXGA 3KSGA 4IUKA 3G2YA 4HAAA 2CC3A 3FKAA 2VIIA 3JVUA 1P97A 4L7KA 3S28A 1YJW3 1PI5A 4QOZC 3H4JA 3K3DA 1ULIB 1BTLA 1K734 3EBTA 3NOTC 4OU7A 4RKUF 3CI6A 1UI8A 3BIRA 3DGMA 1GL6A 1L1TA 1I70A 1B20A 1ORYB 2QHOB 3AFHA 2UUAM 3LQQA 3PBQA 1K6RA 1D0LA 2WOHA 5HOHA 3IBRA 3DWZA 3TJZC 1NLZA 1K54A 4IUHA 1IOUA 1GJSA 1RGZA 2Z6DA 2WGIA 3C4OA 4KG5A 4HL4A 3C30A 2XROA 1MWRA 4GHOA 2R45A 1GOVA 2CFLA 5LC7A 3QNCA 3HU1A 2CHVA 3AL0C 4EUVA 2Q9NA 3SZTA 4FWHA 1TH3A 1XXHE 4GIPA 1NYMA 3CPW2 1W79A 3GLHA 3OPHA 1FUWA 5ITUA 3MKIA 3VSYA 4AKYA 1SXJB 4R4RA 5HWWA 1E32A 4BMWA 4MEIA 1S723 1MNLA 3DXOA 1F4IA 3PNVA 2VA0A 1PW8A 2ZM6M 3S7NA 3ALAA 3OPLA 3FV7A 3KSPA 3X3ZA 5E26A 4NREA 3DZDA 3K92A 3A0SA 2R6FA 3KX0X 1XXMA 3ZCBB
chains in the Genus database with same CATH topology
1G8PA 4XDWA 1GY7A 4JKTA 2Z2LB 1DO2A 4DR7M 1D6ZA 3CJMA 3UPNA 2GEYA 2OQEA 2H5SA 3A3EA 4J9AA 3BECA 4O2HA 2HHHM 4O3VA 1ISKA 1IKIA 3FKVA 4X64M 4WURA 3RGPA 4DV7M 4XUZA 1NVMA 2IMJA 4P6BA 1H6UA 7CATA 1L1ZA 2EX6A 3M2JA 3Q07A 1ASKA 1KD14 3GQZA 1L5GB 2R46A 1QMFA 4DR5M 5HFOA 1VQQA 5EPHA 1FQGA 1L8QA 3NY4A 3W0LB 4G4RA 5AQ9A 1C3BA 1PFPA 3SAWA 3FGYA 4L8OA 3O88A 5EVID 1L2CA 3EBYA 4KQRA 2Z4SA 3F9SA 2GU3A 1FNNA 2A49A 3BYDA 1K56D 3GVBA 3HWSA 2ZC4B 1FGQA 4W5WA 3O87A 2K47A 2CE7A 2HDRA 3LY4A 2FE8A 2R9WA 2Q07A 3AOEC 4XB5A 5A92A 1QANA 1PW1A 2QEX3 2Z77A 4WM9A 4I5SA 3WHLA 1YT4A 4N92A 5EXTA 3HLGA 5FTNA 1TUHA 4QHCA 2XZUA 4L4UA 3I51A 3GLFB 3AKZA 4N6MA 5KP1A 5FI2A 3VGNA 3GZXB 1MKIA 4LV0A 3VP4A 3AV0A 3J7AS 2KA6B 1YE9A 1R7RA 4OX9M 3UL6A 5EJCA 3ZG9B 4LFBM 2C5RA 1W2ZA 1XC8A 4XUXA 4KG2A 3OWSA 1D6UA 2UUBM 3UO9A 4E6WA 5FQ9A 3DY5A 3WA3A 4EXRA 4QHTA 2HPBA 1QAKA 1RJOA 5BPVA 3GSGA 3AMOA 4MMZB 4EC6A 2HMJB 1K6SA 1DGHA 5EXXA 1YJN3 1H8ZA 5HW3A 2ZJ9A 5CHMA 3Q1FA 1W2B2 1J09A 3GTCA 4BBAA 5DF7A 1HNWM 4XBOA 1FGRA 1ZG6A 1I2SA 4HBRA 3FTCA 1IQYA 3LTCA 1DJBA 5CEBA 2OQ4A 1CEGA 2L7IA 3NM7A 3ISGA 1BLHA 1O7EA 1TP6A 4PM7A 2O3OA 3CTWB 3KE7A 5IENA 3SASA 4OVDA 4PDGA 4KLNA 3CCM3 3ZFZA 2DNSA 4E3LA 3AGFA 2CWTA 4KVHA 5CERA 3CXC2 3NBIA 4JI5M 1E3VA 4L8PA 4S2PA 4DE0A 5EUAA 2X01A 1TH2A 5IG4A 3AGEA 2G2WA 4JI7M 3IXBA 1CYUA 3SAVA 3NM2A 3NQYA 1JB2A 5FDHA 2HP6A 2HMNB 1FCOA 4LRTA 1U60A 3SS4A 5LMNM 3FF0A 2CFWA 3OX9A 2CV1A 2J9OA 2ZM8A 3S5CA 4RNYA 3S4XA 4N6NB 4LCLA 5IG5A 2E5LM 5EP3A 1Q40B 3HLWA 1C1KA 1E3UD 3FKWA 2ZM2A 2HP5A 5FW5A 3V3SA 3GR2A 3SBJA 1O7HB 3MHEA 2L7HA 1AVKA 3NBJA 2XR0A 3KIIA 1HD8A 4RNZA 3WS2A 1XGIA 3T38A 2XSZA 4X69A 1SXJC 1IY1A 5IREB 1J2BA 5I97A 2L4VA 1BLSA 1NDOB 4MGHA 4I8OA 2Y2QA 3WS5A 3R8FA 4PT5A 1QVRA 3QWLA 1G3IA 3UY6A 1UM8A 4Z9QA 2WGQA 1LI9A 1N5PA 4D80A 1OHOA 1IU7A 2WKEA 1KDWA 1YHQ3 3SVAA 4C75A 2A15A 3UGJA 2X8AA 2XSHB 4K91A 1YIJ3 5ITRA 1HTZA 1DJAA 3L26A 1Q864 5LC6A 1TU5A 3ZH9B 3L29A 1O07A 2XGNA 4QNRA 3TPZA 1U5OA 3H3HA 5JYOA 2ZMAA 1JKGA 3BM6A 4PD2A 4GKJM 3WA2X 3SC3A 4CGYB 3EHCA 4PCZA 4OPZA 1W6CA 1IN7A 2CHGA 3I4VA 4IBCA 4X66M 1IYOA 1K55A 3JR4A 3DA1A 2X02A 3CZDA 4GD6A 4HVNA 1PWCA 3GQ4A 1N9JA 2Y2IA 4R7GA 4LGMA 1AV4A 1N5HA 1LOXA 3G8ZA 4DE3A 1W00A 3KS8A 3N8RA 4S2NA 5GHXA 3ZDJA 3W4QA 4R9LA 1J9MA 3LYGA 4U0TA 2Y2PA 3IF6A 1FSWA 1A2KA 1ZC2A 1OFHA 5F82A 4O7DA 1VDDA 3S22A 1NY6A 3G2ZA 4YFMA 4OOLA 3MK6A 3EB8A 4HM7B 2VQEM 5AQ7A 1IEMA 2OTJ3 1ZKJA 3BLZA 2G8LA 3SLUA 4E6XA 2YX9A 2FFYA 1ES2A 3CCQ3 3A3DA 4IBXA 4WW0A 4LSOA 3C4PA 3U5ZB 4I81A 3EE1A 4N9KA 2OQEC 4BD1A 1ESUA 3IPTA 2ZC5B 3BRMA 3K1JA 1DGGA 1YLYA 4RF1A 3GLGA 3F14A 3LTDA 4OKPA 4P85A 3NBLA 2D1WA 2P5TA 4N6OB 1KFVA 4GNUA 3IG8A 2R9XA 4KZ9A 2NQ8C 1ZO2A 5HGRA 3G6E3 2QCUA 1PM5A 4LFCM 5FTKA 2V2FF 1NO3A 3RFWA 4PM9A 2PU2A 1M9GA 5EVHA 2F5SA 4JI4M 5EECA 3EIEA 1MY8A 3E99A 2RGOA 3W4PA 1YLWA 1YLJA 4K0KM 2F99A 2V20A 2JQ5A 4LJ6A 3L27A 3U61B 1NRFA 4DR6M 3MYTA 4OPQA 2QPAA 3Q7VB 3ROBA 2ZQDA 1K9M4 3OPRA 3KW6A 8CHOA 2CFDA 3HLCA 5D3OA 3BLSA 1OH0A 2E2VA 2E2TA 2M60A 4B4XA 3OW22 1XMQM 1IXZA 8CATA 2I72A 4LV1A 3NDEA 4IPBA 3KOYE 3CPOA 4OLDA 3WS1A 5EE8A 3ZVTA 3GPUA 2D7EA 1VQ83 5IW9A 4AKHA 4KFEA 5AIIA 1PZPA 3Q82A 4WYKA 4PPRA 2F5OA 4GZBA 4BTWA 3MBZA 4KZ7A 2W9PA 2P09A 5DF9A 2Y73A 5CTNA 1PZOA 4STDA 4KENB 1IM2A 3CC73 4WZ4A 3KOXE 2HMKB 2CG0A 1WXQA 1GD4A 1M904 2M7OA 4X55A 2WGWA 3OCLA 2O9UX 4EV5A 3FZCA 4P87A 1SCWA 1IV7A 3BNDA 3FYDA 3FF2A 3PNYA 2WO0A 4WZ5A 4JI6M 1DMQA 4LG2A 4LMIA 4FCTA 3PBOA 3J2PB 4Y0UA 4E3JA 2Y20A 4KHPM 2CV2A 1US1A 3UB1A 1NJ4A 2RFRA 2IA7A 1W5SA 3L0RA 3CD63 2Y0QA 2XD1A 1S3SA 1W5DA 2HCBA 1FGTA 4FMBA 1G6AA 1TFOA 4HM1B 3MZFA 1KQS2 3KSJA 2QGUA 4OP5A 3V5MA 3QK9A 1YGEA 2ZDJA 5CHJA 3T0UA 5EVIB 4FSFA 5I94A 1VQ43 3U6OA 3E9SA 2BJWA 1IN5A 1XWIA 4FD2A 1CEWI 2CW9A 5CECA 2E8IA 4OQHA 1ROAA 3SS5A 4EQIA 4JI2M 4FH4A 2GU1A 2RCXA 1HT2E 4UA9A 3T15A 4KZ6A 1Q3CA 3LMMA 1GA0A 1RN7A 4YINA 3D9RA 3GWRA 3GQ3A 1IDPA 3L2AA 3N54B 3JUNA 1FCMA 2J7VA 5IF6A 3GLIA 2XSZD 2LXEA 2X71A 2H10A 4DV2M 4DRTA 4MGIE 4R1GA 3NWLA 3DGOA 2Y59A 3X3YA 3SYLA 1JRQA 3OWUA 4HYZA 5F1GA 2ZBKB 4TX4A 1YMSA 5IHVA 4EUZA 1L0EA 3B4PA 2CHQA 3G34A 2I9WA 1VQ63 4JYAM 5KZHA 4KO8A 1QAQA 1OF5A 1KSIA 1W6GA 3DM8A 1ZAEA 3VP0A 4N3VA 1XX2A 3SMPA 2LWXA 3D3LA 3DMCA 2B5RA 1KE0A 1FSYA 3OXAA 3QNBA 4FWDA 2Y2MA 4KFDA 3MXRA 2AHMA 2DWNA 1RKYA 2FNQA 1W7CA 4NHFA 3MZEA 3HK4A 4EWFA 1XXHB 4JXVA 1NHGC 1N9EA 3C58A 2FXTA 3IH9A 4NOOB 1IBMM 2Z6BA 4OOMA 5LMUM 1RRLA 2JA2A 3KP1E 1RRHA 4WFOA 1QMAA 3NQZA 2C9CA 1AR0A 1WMOA 1DYUA 4JI3M 2XZFA 2C9OA 1K55C 3CU3A 3UNLA 2J7OA 2Y74A 2BMQB 1FOFA 2BMRB 5JPPA 4QJGA 3SXXA 3K0ZA 4GL6A 4MBHA 2P9VA 4DV3M 3SOIA 3HIIA 2UU9M 5AQBA 3NBBA 4XM4A 1NXYA 3UDXA 3AOGA 4LJ5A 4KFFA 1H8YA 5KPZA 3J81S 4S2NC 1N8R4 4LF5M 4DKIA 2P05A 2IWBA 3U97A 3E4RA 4NSRA 2CEAA 2XLJA 4HBUA 2EUCA 3IF6C 4QNMA 5KP3A 4AG6A 4K61A 3SH9A 4REZA 1TFKA 1FCNA 4LCBA 1K4EA 2UXDM 4U13A 1IVVA 4FW9A 1K3XA 1VQN3 3GRVA 5HX9A 3GZRA 2WK0A 2FGTA 3ZG7B 1EI5A 5CGWA 4OOYA 1YJ93 3HHWA 1NU3A 1K28A 1YLPA 4HM8B 4DR3M 4Q53A 2CK3H 5DTTA 4LF4M 3O8YA 2LNHC 3EF8A 4K0WA 4I4KA 3IMAB 4QWTA 2YFLB 1MWTA 4OQ0A 4R4KA 3MXSA 2ZM0A 3FLJA 3N8LA 2J8YA 4DXCA 4U0XA 3LZAA 1O7WB 5AIGA 2YR0A 4S12A 1XNQM 2RGQA 3X3XA 4NXNM 4G1MB 4AKIA 4X65M 2F4VM 4QOSA 4PM5A 4BLCA 4XXRA 3J80S 5BR8M 4JLFA 2Q2EB 4Q8IA 2XF3A 3WODG 2WOFA 4LFAM 4LF8M 3P09A 2XD5A 2FNAA 3WMDA 3PAGA 1QAFA 4HLQA 1HNZM 5EVIC 1HT1E 4ZJ1A 3VF1A 2QBYA 3GZYB 3DOAA 1NJGA 4IBFA 2KRTA 3CCS3 3J7Yd 1QZMA 3CCL3 3WRTA 3ZHHA 3IWIA 1PU4A 4MEZA 4OPYA 3W8KA 3BFEA 4MB7A 1CEFA 5FQQA 3CC43 3QHYA 3M6AA 2JDIH 2L6OA 3RGSA 4IBBA 4G4OA 3GLHB 4JXWA 3N8SA 1DY6A 1VQ53 4UA7A 5AIFA 3B4OA 3EQQB 2C96A 5ITTA 3OTOM 4RVAA 3WOFB 2VGKA 3W4OA 1RP5A 4LENA 1O7NB 1GYBA 2KZUA 1IELA 3PTEA 2R62A 3Q8XA 4GH9A 4KG6A 1K41A 3UZUA 2QZ6A 1HZOA 2C98A 3PCRA 1CI8A 3SOAA 4KQQA 5CLKA 3V92A 3UDFA 3G16A 3IWQA 3VKHA 1Q40A 2ML6A 4X2OA 5CGXA 1M40A 1H5XA 5FQMA 1Z5BA 4IBJA 4B3TM 3CC23 1YIT3 5JYPA 2CFOA 4K1UA 3HLFA 2L09A 4BENA 1UI7A 4MLLA 5F1FA 3MKEA 1XP4A 2DCFA 5FATA 2UX0A 5M1AA 1HVBA 1EE8A 2F86B 1Q39A 2Y55A 3GRJA 1BUQA 5DF8A 4GC9A 5D83A 2F98A 3TQSA 4RBNA 4S2LA 4FMAA 3HUNA 1UUVB 2PZVA 4BB9A 2HMOB 4IBIA 4JPMA 1STDA 5TGFA 4FCWA 3K63A 2R4EA 3T1YM 1ESIA 4GB5A 1GD3A 2Z3XA 3HHXA 3D4FA 4N6V0 2C99A 2ZC6B 3HL9A 2YQZA 2OCTA 5KMWA 4DV1M 2BG1A 5STDA 3FTFA 1MX0A 4WP5A 5GLCA 3GP1A 3HJQA 1WYCA 3VSLA 3DZLA 1IN8A 2DVWB 2ZD8A 1IYPA 1LVNA 1IY0A 2W56A 4OW0A 3UL5A 1A90A 3VP3A 1IQXA 4B4ZA 3LEZA 2J9PA 3LXUX 2XH9A 5DTSA 4HM5B 2CV0A 5FAPA 3WHKA 5CTMA 2BT3A 1IVXA 4OVMA 5IG3A 2OOVA 2DXIA 3L28A 4R3BA 3PBTA 1NJI4 4X56A 4GKKM 4FR9A 4LY6A 1IY2A 5AIHA 3QRDA 1EROA 1DGHB 1YQSA 1OCVA 3SATA 3Q81A 4BJPA 3NIAA 2X49A 5HAIA 1SDNA 2D7HA 3UE3A 2O5RA 3BFCA 3LVWA 1JN5A 4LJAA 5KP4A 2OLVA 1IT8A 4EYCA 3HLEA 4YY3M 3A3IA 1N32M 2WAEA 3SFZA 3X42A 3IWOA 2WUQA 5HAQA 3BEBA 3IH8A 3U60A 2EXBA 2HP9A 1BULA 4LF9M 2YNMD 5KSCA 2P0MA 3U5ZA 2QA43 4X62M 1SJWA 3FUUA 4BLMA 3K5TA 5JBSA 1LI0A 3VMAA 4LV3A 2OTL3 1NSFA 1T5YA 4EBPA 2RL3A 2UXCM 5DTKA 1CQSA 1ES5A 2IUKA 4YHHM 3EIHA 4CPKA 1HQCA 3EQUA 3LT8A 1N9BA 3U6CA 2INXA 3HJSA 2EO2A 3VDUA 3IQAA 1MXOA 3PS8A 3U6QA 1VQK3 3VK8A 1K54C 1F8NA 1NY0A 1D6YA 2CFGA 1N8QA 3ER7A 3DTMA 1CI9A 2QZ4A 4FMDA 4AI6A 1G41A 1JWPA 1N75A 4QY5A 5FGOA 1KGEA 2ZQ8A 4OQIA 2ERCA 1GS3A 5CEDA 4HZBB 1TEMA 1IBKM 5HARA 5BXQA 4GKUA 4OUQA 5BOHA 1ES4A 3HVFA 4DDYA 4GC5A 2ZQ9A 4HM2B 1L2SA 3ILKA 3P98A 3MPHA 4LZIA 1QQWA 5TGNA 3FCSB 4UAAA 2RGHA 2QP9X 4G6ZA 1WMNA 1FR6A 4OK0A 2GXFA 1W8YA 2BMOB 2XRXB 3VFHA 4R1KA 3V39A 3LQRA 1MPLA 1LL5A 4JN6A 3GMWA 2X4AA 3VOYA 4CCVA 1ERQA 4PM6A 3FTEA 4MH0E 1AVLA 3BFGA 3LY3A 4MGZE 1V74A 5ITQA 4OPRA 2QENA 4RNAA 1KWIA 3N6IA 5D82A 3JVCA 5A91A 2BNGA 3PGBA 4ZTKA 3WS4A 2HMLB 3JUMA 3MJ5A 2IWDA 5FLXS 3S67A 3HGIA 1VQ73 3ZG8B 3DWKA 4G4QA 1DVCA 2F5QA 4C6YA 4B88A 4FD8A 4JV5M 4C3QA 3EC9A 2Z7AA 3THGA 2XFSA 4GB7A 5ELJA 4ZBEA 1TDLA 1GA9A 5KQ8A 1QALA 4NRWA 1S0WA 1E4DA 3ITAA 2CG1A 4WWUC 3EN1B 3IXGA 3X41A 1E25A 3KS4A 3VP2A 4GITA 2YFIB 1DVDA 2WAFA 3DUKA 3M2KA 5HAPA 3IF6B 3SEDA 3D8LA 1DO0A 2P0XA 3NBRA 4K90B 1HR0M 4RX3A 4IBDA 1VQP3 4B7GA 3UJMA 4Z8XA 1BLPA 2XEPA 4MM3B 4UA6A 5CF2A 2HL7A 3CF0A 3F7SA 3RXXA 3CF6E 4MGKE 4DUZM 1XMOM 1QJGA 3F7XA 2DWMA 1E97A 5ITXE 3BNCA 3BLMA 1IXRC 5E2EA 3I563 4LJ9A 3AGDA 3SAUA 4J8TA 3CCE3 2Y2JA 4BTXA 1FA3A 5EP2A 3K9MC 1I5QA 3JUOA 3KVWA 3D8BA 3TE6A 4GDNA 3NV0A 3GLGB 1BT5A 1NB3I 5EOOA 2Z76A 3T8NA 2LYXA 1FR1A 5FQJA 1WTHA 4AEQA 3I0YA 2KEBA 1NHWC 5L2FA 2EFUA 3B9PA 4OVZA 1G4AE 5JI2E 4R9KA 4K1VA 1R4CA 2W2CA 3HX8A 4IT7A 2XK1A 5AEWB 3C7UA 3DGNA 3MG2A 1JB4A 4JF6A 3KSXA 1ROVA 1Q824 4E3KA 4MMXB 4X53A 3CNXA 4M0WA 3BFFA 1N78A 5TR7A 4IIAA 1Z59A 4JRFA 1K25A 3RJUA 1NNUC 1W6YA 3STDA 3F8XA 5IEPA 3S29A 5A0OB 4U3TA 1L0DA 2J7NA 2B24B 1NNJA 3IT9A 5FQKA 3SH8A 4AG5A 4FMCA 3PBRA 3ZNYA 3Q1CA 1JTGA 4R0QA 1ZQ9A 4GHAA 2ZC7A 1RCJA 3E2LA 3T8UA 3LOYA 1ALQA 2KCDA 2FOIC 2HKJA 4LF6M 5GKNA 3FD9A 5FI6A 5DVAA 2ZQAA 2Y0TA 2F5PA 3L25A 2PU4A 4R3JA 4WYKB 2Q9MA 5E43A 3HBRA 1IBLM 4NXMM 2V6ZM 5H37D 2Z4RA 5IZ7D 3E2KA 1FGMA 1M6KA 3J27B 1YVBI 1QVG2 4DV0M 5A90A 4ZDXA 4R23A 3SYKA 3OZHA 2WGWB 5EOEA 3CMA3 4DUYM 3CME3 3ECFA 1NYYA 3WOEB 4MBFA 2WGOA 3UE0A 3U1WA 1GHPA 1SHVA 2VQFM 1L0FA 4JF8A 4WEJA 3FYCA 4D82A 1YI23 3PZWA 4M3KA 2D7GA 1LXEA 1L0GA 3FUWA 4UHUA 3FZWA 3KXEC 4LJ7A 1SIHA 4Y0TA 2C6WB 2DRWA 3NXJA 4LV2A 4KZ3A 5JI3E 1X37A 4L16A 7STDA 4S2OA 1SXJA 5ELUA 1E94E 2Y2NA 2JCHA 2Y2GA 1ULJB 1VM1A 3N4IA 3OWYA 3LT9A 1IXSB 2W04A 2R4JA 2GBWB 5IG0A 5CGSA 3IG5A 1KVMA 3FUTA 3EQVA 2W0QA 3KZTA 3VFDA 2RCDA 1M1K4 3OCNA 2FFFB 2KRKA 4DV6M 5FTMA 3IHAA 5AYSC 3MHVC 4WBGA 1LNHA 1JTDA 5M18A 3PFIA 4DF6A 2FFJA 1Z6FA 4JI0M 1W4NA 2JC7A 1BUEA 2WADA 2V1ZA 3S1YA 3JR5A 5CXOA 3BNBA 1K57A 2YFQA 3UJNA 3FG3A 4P16A 1OACA 2E2UA 1JQJC 2UWXA 3A46A 3TDGA 4MMYB 3EJVA 1CK3A 5HL1A 1JNQA 4KZ1A 1XA1A 4JF5A 1PIOA 3TWLA 4EBLA 2M5ZA 1I94M 4D2OA 1EA2A 4NSOB 1IYQA 1TGUA 2BHMA 4BL3A 4M9XA 3JYIA 1HU9A 4WMCD 3ZG0A 1NWWA 3B8LA 1WE4A 3SHFA 3A3FA 4BL2A 2VGJA 2R18A 2ZQCA 4IVIA 3FUXA 4N6UA 2Y21A 2A3UA 1OF5B 3Q7ZA 1DMNA 1IQPA 2V1CA 2HDUA 3MFDA 3A42A 2CWVA 1YM1A 1MWSA 3GLFA 4IJFA 3TWMA 4IIWA 2P38A 2LQVA 1LL9A 4B3RM 1QMEA 3U6SA 3GQ5A 4HESA 3KKGA 4A3VB 2WZZA 5GLAA 3EX9A 4N6TA 2RSXA 2Y2HA 1SDEA 1N77A 4FCFA 3VFFA 1R2YA 1KSFX 3CG5A 4BTYA 4RF0A 4LJ4A 1GL7A 1OGZA 1G68A 5GLBA 5G18A 2B1XB 2HDSA 3SHGB 2CKFB 4H3UA 1XHBA 2XSOB 1BSGA 5C1BA 1ONHA 2G2UA 2GEXA 1XPBA 2WYXA 1YUBA 4QY6A 3FKEA 1ZX2A 3TG9A 1TDHA 4ID4A 4XDVA 3TSGA 4KZ4A 3CCV3 3VP1A 4KZBA 3KP0E 2P9VB 1ERMA 3WDGB 4DV4M 3UN7A 4OLGA 2BLSA 1Q3BA 5DYGA 3CF2A 4DXBA 2W82A 1K3WA 1VQM3 4L8RC 4QB8A 4N1HA 1IQ8A 1SXJE 2QPNA 3NCKA 2MF7A 4CJNA 5EQLA 4LGYA 1K82A 3GRRA 2XLNA 4GOGA 5FAOA 3VOZA 2R65A 4LF7M 1WNHA 1GHIA 2CC1A 2OLUA 3CCR3 4Z6YA 3I4YA 3IXHA 3LTBA 4JBFA 3JAMS 3BFDA 3HZPA 4N6LA 4B7HA 4O8SA 3I553 5FSWA 4ZJ3A 3MG3A 4RZMA 1GVNA 1KC84 5EEOA 1L2DA 1OMEA 1PYYA 4OP8A 4O02B 1PWDA 1BZAA 4L15A 4GRIA 3KSED 1CYVA 1EQKA 3SX1A 4GD8A 2XGLA 2ZANA 4S2KA 1JR3A 1OHPA 2XR8B 1QAMA 4WZ5C 4GHLA 3VSKA 1PJIA 3X40A 4DR1M 4B08A 3MZDA 3RDEA 3HKPA 3NHXA 5KSHA 3N8BA 4ORLA 3U6LA 2OSUA 3HREA 4K0XA 2MC8A 4AKGA 1Y4KA 1EWZA 1KYIA 1N4OA 4KZ8A 4OH0A 4HEFA 4L78A 4RA7A 3MSOA 2Z2MB 1C7HA 3UNWA 1QVF2 3Q90A 1E9RA 5IEOA 1WYBA 3JUPA 4JI1M 3KFUG 5CF1A 3U6DA 4BQMA 4I4LA 5C18A 4Y0OA 5F83A 1VZZA 1NZUA 4GDBA 3W0FA 2SBLA 2QBYB 4JI8M 4ZPXA 4LEHA 3WRZA 4HZ9B 1IVUA 5ITYA 4M9SA 2YFJB 1YLZA 1OGXA 3GZBA 1QYRA 5GLDA 3CCJ3 1S6RA 3VK7A 1SPUA 4X2HA 2CWUA 3F40A 3LMLA 3UE1A 1DJCA 4IEDA 6STDA 3PXMA 3G30A 3G713 3HI7A 3O86A 1MBLA 2WGVA 3H51A 5EP4A 4ZJ2A 1SQWA 3SARA 2DZOB 3SH7A 2R4IA 1KE4A 1LV7A 3LCEA 4N1XA 4E3NA 2XFTA 4S2JA 3Q2PA 4NRVA 2CHCA 3J7BA 3RGRA 4CHTB 2RKOA 1LLBA 3V3RA 3HJ8A 4AW4A 4AKZA 1JWVA 1A67A 1N36M