2XFSA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 138
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xfsA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xfsA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xfsA02
4QY6A 4Q8IA 1DJAA 2C5WB 2EX2A 5FAOA 2ZQ7A 4K91A 3BFGA 4DXBA 1SKFA 4FH2A 2G2WA 4PM9A 3BECA 3E2KA 4PM8A 4WELA 3ITAA 1FSWA 1I5QA 2EX9A 2HP9A 4C75A 4KZBA 2A49A 5HARA 3WRZA 5KSCA 5AQAA 3RXWA 3OPRA 3CMZA 1NZOA 4DE0A 1E4DA 3VP2A 5F82A 2JBFA 3LEZA 4OOLA 1YLZA 1BLSA 4E3OA 2WKIA 3C4PA 1FSYA 1IKGA 4HBUA 1GHPA 4KZ9A 2ZM2A 1W7FA 1K57A 2ZQDA 1TVFA 4YINA 1LI9A 1C3BA 1LLBA 3W4PA 4OKPA 4U3TA 2H0TA 1IYQA 3JYIA 3HUMA 3N7WA 3NBLA 5DF9A 3WS2A 4UA7A 5E43A 2WK0A 3SOIA 2V20A 5FI2A 3OCNA 5KZHA 4IBXA 4R4SA 1ZG4A 5E2GA 3IF6B 2Y2JA 3Q82A 1L0FA 3P09A 4JXVA 5EVIC 4ZAMA 1IKIA 1XA7A 4JXGA 3VSKA 2PBYA 1EWZA 1KE3A 4KZ6A 4S2PA 4S2KA 3SS4A 1I2WA 3V50A 2WZZA 3ZDJA 4LV2A 4NK3A 1GCEA 1FR1A 1L0DA 4UA9A 2XGNA 1FR6A 1SHVA 3LO7A 3N6IA 5D3OA 1XKZA 4S2OA 2XFSA 1G68A 3BEBA 3UPNA 2VGJA 2Y55A 4X69A 5EECA 1H8YA 1M40A 2EFXA 4KZ4A 3RXXA 5FI7A 3OCLA 4BD0A 4R0QA 3N8RA 3SH8A 1K54C 3MFDA 1WYCA 3BFDA 4DE1A 5A91A 3IH8A 4FD8A 5J8XA 4MEZA 1H8ZA 3AGEA 3ZG9B 3HUOA 1MXOA 4OLGA 4JXWA 3S4XA 2GDNA 1DJBA 2X71A 4MBHA 4DF6A 2FFYA 1MKIA 1XGJA 4KG2A 1XPBA 4OLDA 3N8SA 4PM6A 3CG5A 1KE0A 5CGSA 3GQZA 2UWXA 2BLSA 3GV9A 4ZBEA 2WGWB 1YLTA 4O7DA 3UE3A 3MBZA 4ID4A 4JXSA 3HL9A 3VMAA 1ONGA 4HEFA 3GMWA 2EFUA 4DRTA 3UPOA 3A3JA 4FSFA 4N9LA 1K25A 4XXRA 2R9WA 3VP1A 1K55A 4X6TA 2XF3A 3HLDA 5TGFA 3WS5A 1VM1A 4K0XA 4GD8A 5FASA 3G2YA 2Q9NA 3PBTA 5FI6A 1LL5A 4XUXA 3MXRA 5TR7A 5CXWA 1RGYA 3IXGA 4EUZA 4K0WA 4L0LA 5JYOA 4LV3A 1MWSA 1WYBA 3A3EA 5G18A 3M2JA 4IEDA 5GLAA 2DCFA 2JE5A 2J9OA 4LV0A 4WYYA 4X55A 4B4ZA 1CEFA 5KMWA 4P6BA 1YLWA 2HP6A 1H5XA 1K38A 5HAIA 4R1GA 4C3QA 1SCWA 3G4PA 4RVAA 1GHIA 4EBLA 4JF4A 4X53A 1CK3A 3N8LA 4E6XA 5TFQA 4X56A 2I72A 2ZQ9A 2IWDA 3NIAA 3ZGAB 1ZKJA 2Y2GA 3IXDA 2X02A 1LHYA 4UHUA 1O7EA 2ZQAA 2EXAA 3V3SA 4UAAA 4OQGA 4OP5A 1IYPA 1JWPA 4E6WA 5I94A 3IHAA 5FQIA 3TSGA 2ZC4B 1YLPA 4ZJ2A 4GOGA 1TEMA 1PWDA 4OQHA 1XGIA 3FZCA 4S2NA 2QPNA 4JF6A 3UY6A 1PYYA 4KG6A 4XUZA 4B4XA 3SH7A 4B88A 1BLHA 3B3XA 4E3NA 4F94A 2HDUA 4LCLA 2J9PA 1FCMA 3BRMA 4P85A 3CJMA 3BM6A 1W5DA 1S0WA 4JKTA 4DDSA 3IH9A 2Y59A 1IYOA 3M6HA 1PI5A 2J7VA 2WUQA 4BQMA 3IF6C 3C5AA 1K56D 3IT9A 2ZC6B 1W79A 3O88A 1LL9A 1RGZA 2RCXA 1BT5A 4Y7PA 4MBKA 3WRTA 1XXMA 1TDLA 3DWKA 1JWVA 4CJNA 4QD4A 3S1YA 4GZBA 5DTTA 5CEDA 1NJ4A 2WAEA 3A3FA 1ESUA 4P0MA 3C7VA 4R3BA 3IQAA 4IVIA 5U47A 1Y54A 1QMFA 4HBTA 1I2SA 3C7UA 3ZVWA 3ITBA 5GL9A 2IWBA 1K4FA 3OPPA 4OVDA 3BFFA 5FA7A 5A92A 4GNUA 1AXBA 3WS1A 3AGDA 3ISGA 4E3JA 3UDFA 4JPMA 4BLMA 3HBRA 3ZNYA 1BSGA 2ZJ9A 1ERMA 2XK1A 2XDMA 4QB8A 4YFMA 5HX9A 3E2LA 3Q7VA 3NI9A 4GDNA 5CEBA 1KDWA 5EOOA 2XFTA 2WZXA 3UDXA 4E3KA 1BZAA 5HL1A 5CTNA 4EBNA 1N9BA 5FQQA 1CEGA 5EOEA 5FQ9A 2JCHA 3NDGA 2A3UA 1PWGA 4H8RA 4WMCD 3OPLA 1Q2PA 5AQ9A 2HP5A 2WAFA 3QNCA 5HFOA 1XP4A 4EV4A 3ZG0A 4U0TA 1OMEA 5E2FA 4R3JA 5EVIA 1E3UA 5CHUA 4DDYA 4JF5A 3FV7A 5CECA 4OQ0A 2OLUA 4E3IA 5M19A 1JWZA 1EROA 4Y0OA 4GDBA 5FQMA 2X01A 1K4EA 2Y2LA 3BFEA 4WEKA 3IXHA 2H5SA 4LENA 3HLEA 2PU2A 3N4IA 4A5RA 2Z2LB 1QMEA 2R9XA 5KSHA 1RCJA 3W8KA 4OONA 3WS4A 2XLNA 3C4OA 2Z2MB 2J8YA 2XD1A 4IBRA 4Z9QA 4N1XA 1K57C 1HTZA 3GSGA 4KZ7A 3I7JA 3HUNA 4WZ5C 2ZM8A 1NYMA 2B5RA 4WZ4A 2CC1A 1HD8A 1W8QA 1PI4A 5GHXA 3ZG5A 4DKIA 4FH4A 3ZNTA 2WGWA 4M3KA 2ZMAA 1NYYA 3O3VA 4BD1A 3DW0A 1WE4A 3NDEA 5CTMA 1SDNA 1ERQA 2JC7A 2WYXA 4QHCA 4RX2A 2Y2KA 3RJUA 3VFHA 3CZDA 2OLVA 1KGGA 3ZVTA 3PBRA 1VQQA 4OP8A 1M6KA 3PBOA 1J9MA 3UNWA 1YM1A 3QNBA 3A3DA 5CRFA 4BJPA 3Q7ZA 4BENA 1KVLA 1YMXA 5IHVA 1FOFA 1LI0A 4KENB 1PZPA 1XA1A 3IXBA 4KZ8A 4EWFA 1G6AA 4WM9A 3UE1A 1JVJA 1K54A 2ZQ8A 3EQUA 2XD5A 4FCFA 4OPZA 2C6WB 3G34A 5DTKA 5GLCA 4S2LA 4P87A 1GHMA 1Z6FA 1Q2QA 3SH9A 3DTMA 1NZUA 3OPHA 4ZDXA 1MWTA 1ES2A 1PW1A 5DVAA 3UN7A 3UE0A 2QMIA 3M2KA 4Y0UA 4OPYA 4PPRA 1KVMA 4GB7A 3O86A 4ZJ1A 1E25A 4DE3A 3IF5A 3P98A 2Y4AA 1ALQA 1K6SA 3G32A 5DF8A 1ES4A 5FSRA 4WEJA 5A93A 4HESA 4LCMA 4OQIA 1KGEA 1K6RA 2ZLYA 1K55C 3Q7VB 4KQRA 3V3RA 3FKVA 2WGVA 3OC2A 1YLJA 2ZC3B 3TG9A 3DWZA 3MKEA 4OOYA 5CHMA 1ES3A 5L2FA 3AGFA 5FQJA 3HLFA 3IWQA 1PZOA 5M1AA 4QY5A 1E3UD 1YQSA 5FAPA 5GLBA 1L0GA 2Y2NA 2V2FF 1S6RA 3IHBA 3VSLA 1ZG6A 3BYDA 1L2SA 2ZC5B 4LV1A 2ZD8A 1DJCA 3Q07A 3MXSA 5EVID 5JYPA 4D2OA 4E3LA 5HAPA 5GHYA 5FAQA 1L0EA 4X68A 5HW3A 1PWCA 4OOMA 4KZAA 1YLYA 4OH0A 1BUEA 3PAGA 4MLLA 2XR0A 2WKHA 5E2HA 3V39A 3ZG7B 1ZC2A 5DTSA 4EBPA 4R4RA 2OSUA 4GKUA 4IVKA 5FQKA 1IELA 5A90A 2Y2PA 4KZ5A 3VP4A 1SDEA 4MNRA 4KG5A 2XH9A 3HVFA 3NCKA 2WADA 1NRFA 4E3MA 4N9KA 1IEMA 1BTLA 3W4QA 1FCOA 3BFCA 3TOIA 3Q81A 3ZG8B 2OV5A 3WS0A 3ZFZA 1ESIA 3LY3A 1HVBA 3G31A 5EVLA 4S2JA 3UDIA 5BOHA 2HDRA 3S22A 3GVBA 5E2EA 2H10A 2WGIA 3NC8A 3OZHA 4RYEA 4QU3A 1KE4A 5DF7A 5EPHA 4BL3A 4PMAA 4C6YA 1PIOA 4RX3A 4N92A 4BL2A 2HDQA 1TDGA 3IF6A 3MZEA 4KZ3A 3QHYA 4S2IA 2FFFB 3PBSA 4GN2A 5GLDA 3SS5A 1GA0A 5EE8A 2V1ZA 4OPQA 4UA6A 1MY8A 3FKWA 3GR2A 3HLBA 1K56A 1DY6A 2HPBA 3ZCZA 1YT4A 1JTGA 4S2NC 3G35A 3G2ZA 4ZJ3A 2RL3A 4DE2A 4U0XA 3ZHHA 2XEPA 2EX6A 4KQOA 2PU4A 4CPKA 2Y2HA 1FCNA 3PBNA 5AQ7A 5CHJA 5CGXA 1GA9A 2QZ6A 4WBGA 1U60A 3MZDA 1ES5A 2DNSA 3FYZA 3VP3A 3HLWA 1NXYA 3O87A 2Q9MA 3IWIA 1N4OA 3PTEA 3SS3A 3MKFA 3Q1FA 3PAEA 3D4FA 5GHZA 2P74A 1YMSA 3M6BA 4JLFA 4KQQA 1RP5A 2WKEA 2P9VA 4GD6A 5F83A 2VGKA 1MPLA 3HREA 3HLCA 4EQIA 1JTDA 2EXBA 2Y2MA 3GRJA 1BLCA 3UPPA 2ZC7A 2XQZA 2Y2IA 4PM7A 5HAQA 1KGFA 2ZM0A 3IWOA 5CGWA 3VP0A 2IWCA 1CI8A 2P9VB 3EQVA 3GTCA 3VFFA 3BLMA 1ONHA 1MWUA 3FWLA 5FDHA 4PM5A 3HLGA 1BLPA 3LCEA 2Y2OA 4N1HA 2Y91A 5CERA 2E8IA 4ZTKA 5M18A 1PW8A 2H0YA 1IYSA 3PBQA 1HZOA 3UO9A 4OPRA 2BG1A 4MBFA 3LY4A 3W4OA 5F1GA 4S2MA 2HDSA 1XX2A 5FATA 2EX8A 3BLSA 4WMCA 4R23A 3VOZA 2Y2QA 3WWXA 3V5MA 2G2UA 1MWRA 5F1FA 1CI9A 1EI5A 1MBLA 4JBFA 4QJGA 1O07A 3MZFA 1FQGA 4NETA 1BULA 2DRWA 1W8YA 5AQBA 5EVIB 4DXCA 2ZQCA 4Y0TA 1NY0A 1KDSA 4RA7A 3VOYA 3G30A 4WZ5A 3A3IA 5EUAA 3NY4A
chains in the Genus database with same CATH superfamily
1WR1B 3MQOA 2C5WB 1L3LA 4R6LA 4IIAA 1YHQ3 2IYJA 2G2WA 3CC23 1Q42A 3BECA 4WELA 4NHFA 2HP9A 3TWMA 1UGUA 3HHYA 4C75A 3WRZA 3LZAA 3HCYA 4R3AA 1G59A 4FWDA 5F82A 3U1WA 3LEZA 2CE7A 2KNVA 1LV7A 3F8HA 3LW5F 3E98A 4HBUA 3GZYB 3QP5A 2J3WA 2GEXA 1K57A 2FZ0A 2IA2A 4YINA 4DV5M 1LLBA 4HP4A 2Y79A 1MOLA 2C98A 3LIEA 1SQWA 2WKQA 4XT2A 2WK0A 2KAAA 5FI2A 2KZSA 4AKGA 3OCNA 4IBXA 2NUPC 5KZHA 1OQYA 1QJGA 2QWSA 4W5WA 3IF6B 2UX0A 2ML5A 2HJ9C 1OPXA 3KOXE 3K9PA 1XA7A 3VE4A 3K9OA 3D8BA 3ILKA 1F5MA 1KE3A 1RU3A 3MG1A 4S2KA 3SS4A 3V50A 3ZDJA 4LV2A 3LCUA 5ITYA 1FR1A 3SHGB 1GCEA 4GLQA 5DKKA 3N6IA 2L4RA 4GKKM 1LXEA 4B7GA 2MF7A 4MMXB 4Z1WA 3T4QA 4EEUA 3GPPA 3WMDA 5BU4A 2DNAA 3UPNA 3AOGA 4JI3M 2CV1A 1QAFA 4G4RA 1MN3A 3E21A 5HPFA 3RXXA 5FI7A 1BSDA 4BD0A 3SH8A 3MFDA 2I7NA 1NVMA 3GLGE 3BFDA 4FD8A 5ITXA 3CTWB 3HUOA 2M7OA 5EP1A 2PD7A 3T1YM 1GY7A 2EJSA 4O3VA 1MKIA 1UDII 2R41A 1VQ93 2V6ZM 3CG5A 1NNJA 3IECA 4B3RM 2M60A 5EM1A 1T1CA 1S4SA 5AJGA 4JGQA 3WA3A 4X2OA 3HJKA 4JXSA 3MSOA 1ONGA 2A5YB 5CK6A 3KS4A 3UB6A 2EFUA 1Y4KA 3LT8A 1ULIB 2R46A 1GY5A 3J7AS 5F68A 2CV2A 5AIIA 3CLOA 4X6TA 3HLDA 1ISKA 1TF1A 3AHSA 1VM1A 4AQYM 4GIPA 1FGQA 2OCTA 2Q9NA 1TTEA 8CHOA 2ML6A 3R7WB 4ANRA 4G6ZA 1RGYA 2RSXA 5JYOA 4FWHA 5G4ZA 3TE6A 1N9OA 2KA6B 3ZC7B 2WOFA 3UMMA 4EU0A 1LTMA 4IEDA 3VDUA 3U61A 2AAEA 3X3YA 4WYYA 3SAUA 3OOVA 5KMWA 1CEFA 1UW1A 5CF2A 2OWPA 4TUWA 4IBGA 2CG1A 1H5XA 5HAIA 1EG9B 3V67A 4GW9A 3C3DA 1W00A 3NQZA 5AYSC 4RVAA 1PY3A 2W82A 4HVNA 3N8LA 4R4KA 4EXRA 1RGAA 3FG4A 4NXFA 2I72A 2MROB 4GHIB 2IWDA 1OF5B 2CWTA 3MHEA 1M1XB 1FUWA 2Y20A 5C1BA 4DR3M 1F9IA 4Z8XA 1UM8A 1JWPA 3IHPA 5LMNM 5FTMA 1I8VA 5FQIA 1W6YA 3DGLA 1ZQ9A 3H4MA 2DMWA 3ULFA 1RSNA 1TEMA 4MGKE 1I3IA 4BBAA 1TFOA 3FZCA 2KF5A 4JRFA 3NWLA 4B88A 2V0UA 5I5LA 3F1PB 5HD5A 2FNQA 3X42A 1BLHA 3B3XA 4LCLA 4PDGA 1TTOA 4BTYA 1FCMA 5L10A 5E26A 3GAXA 1TGUA 4DR2M 3RGRA 1NDOB 3ROBA 3BM6A 4CJ6A 3IH9A 4F1IA 4IHQA 1STZA 3T15A 1PI5A 4DR1M 2J7VA 2Z4SA 3THGA 2WUQA 2R44A 3IF6C 3V98A 3AL0C 4EW7A 3NUVA 3A45A 3GLIE 4HBRA 2KRUA 4R38A 3G6OA 3EX9A 3N8BA 1BT5A 4XBXA 5IEPA 3WRTA 1TDLA 4HZ9B 3DWKA 1JWVA 3L28A 4AKZA 3SBJA 3X41A 1P3QQ 3K3DA 1X1UA 3WA2X 5DTTA 5CEDA 3B8LA 1W01A 1NJ4A 2F5NA 2WAEA 3IX3A 2GNOA 3UGJA 1TS8A 1RJOA 1QZMA 1UWPX 1VQN3 5U47A 1I2SA 5TGNA 3LFVA 2IWBA 2F5WA 1VQ73 1YIT3 3T4SA 1BVIA 3RGSA 2R0IA 3LIDA 1X1YA 4RZMA 5A92A 5EFWA 2OQ4A 3LIBA 1N9NA 3LR0A 3WS1A 4E3JA 1H8MA 2CHGA 2CFWA 5IG4A 4O01A 3PS8A 3LIFA 3MQQA 2OQEA 1IT8A 2H0GA 4K1UA 1M1K4 1BUJA 1T5YA 1W5ZA 2XSHB 4QHSA 4IBCA 1ERMA 1BRHA 1XJ3A 4LF7M 3T1XA 1GVNA 1B2XA 4R70A 1NNUC 2LTUA 1Z1SA 2LXEA 1CYVA 4GDNA 1AIPC 4QHTA 1VEJA 2A15A 2Q2EB 2KXGA 1FUSA 1I3FA 3F9SA 3PZWA 2K31A 4KFDA 9RNTA 1BVSA 1OTIA 3VE3A 5HL1A 4L9EA 2CH9A 1N9BA 1W2B2 3BQ8A 1RNTA 5FQ9A 2L4FA 1BU4A 1BNGA 2XRXB 2H0IA 4H8RA 1Q2PA 2WAFA 1XP4A 5EVIA 4R3JA 1HLUP 1L8QA 4IPBA 5CHUA 1OFIA 5CXOA 5TJJA 1G71A 1D06A 3L0RA 1XB2B 4GDBA 4LFCM 4HM1B 1K4EA 4X25A 3CF2A 2C96A 3BFEA 1WIVA 1Q814 2BNKA 4B3MM 1UUWB 3KSHA 3F8XA 3UB1A 1KSFX 2EA0A 3F7SA 5FEFA 2JDIH 2GJ3A 2G7UA 2R65A 2XLNA 3DTKA 4Z9QA 2L1MA 2DZNB 1W63Q 4FCZA 3X40A 4N1XA 4FW9A 4I81A 4WZ5C 2QSFX 1NLYA 3EN8A 4Y15A 4KT0F 1OIZA 1W8QA 5GHXA 3B4OA 3G0KA 4DUZM 2VA0A 4FH4A 3ZNTA 3KP1E 2ZMAA 1NYYA 5KP3A 2O99A 4BD1A 2IA7A 5HOHA 3FUXA 3G16A 2GXFA 1WE4A 1V92A 1RMSA 1SDNA 1Q39A 2LB9A 3I4YA 5KP1A 5EQTA 2P0MA 2Y2KA 3VFHA 3IBRA 6STDA 3PBRA 4OP8A 1M6KA 2OOAA 1V9YA 3FF2A 3UNWA 4HJ4A 5CRFA 5L07A 5EM0A 1BSEA 3GLHE 4II7A 1GMPA 1KVLA 1OHOA 5LMUM 1WMOA 1FOFA 2QA43 3TW8A 4KENB 1XA1A 3IXBA 4EWFA 1S67L 1L1ZA 1TFKA 4I5SA 3MWZA 3VGNA 2XD5A 4FCFA 2YX9A 1T6OA 4S2LA 2CHCA 1P9RA 2LH0A 2QYBA 4KO8A 3JR5A 4XK8F 1E94E 4B93A 4ZDXA 2ZL1A 1Q824 1J3WA 3UN7A 3S29A 2QMIA 3UL6A 3UE0A 1OUNA 1I2EA 2V1AA 4EBGA 1IU7A 2QEX3 1RGEA 1NV9A 3B47A 3IF5A 3P98A 2Y4AA 4ARZA 1K6SA 5DF8A 3URPA 5FSRA 5A93A 2J5YA 1Q7Y4 5L8RF 2HMLB 4HESA 4OQIA 1KGEA 2L2DA 1K6RA 2ZLYA 3CME3 1VQ83 1G5UA 1R4YA 4X66M 2WGVA 3BOSA 3OC2A 2ZC3B 4G3VA 1N32M 1Y8GA 3DWZA 3JUMA 4OOYA 5DFYA 3I0YA 2OTJ3 4LGWA 2INXA 1QZEA 4KZ1A 1GOVA 4KODA 3MXQA 3B7NA 1BRIA 1E3UD 2KCDA 5GLBA 4G3KA 3J81S 2FH0A 2C4BA 1OTAA 2O9AA 1ZG6A 1D6YA 1B27A 1GYBA 2ZC5B 4LV1A 3MXSA 6RNTA 4LF9M 4LF6M 4E3LA 5HAPA 2ZL1B 1ZTUA 3CC73 2XSZD 1SG9A 3GPUA 1LNHA 1PWCA 1NY5A 3MMPA 3PAGA 2E8JA 5G4YA 5J4EA 2KEBA 5DTSA 3CCM3 1BRNL 4EBPA 4LJAA 3FGYA 4I3IA 4WP2A 3PNVA 4R4RA 3K5TA 2BJWA 4GKUA 4WF0A 4IVKA 1J09A 3P7NA 5FQKA 2D7EA 1O7PB 2Y2PA 1TDZA 2X49A 4B3TM 3NCKA 2JKGA 4PKYG 3L29A 1RGFA 2GU3A 1FCOA 4WN5A 1IN6A 1DGFA 4GMQA 3WS0A 1SXJD 2VV7A 1PJSA 5JI3E 1XFQA 3UDIA 2D1WA 7GSPA 4HM8B 3A0RA 4I5QA 1I2FA 3GVBA 2VX8A 3G8ZA 2ZMVA 2H10A 3NC8A 4QU3A 5EPHA 3BWLA 4PMAA 3NHQA 4RX3A 4Y13A 5LC6A 1TDGA 3IF6A 2QENA 4I8OA 2E2UA 4DJ2A 3LVWA 2FFFB 1GA0A 4DMZA 5EE8A 1ROAA 3FTEA 1DP9A 1VHMA 1MY8A 2HMJB 1KC84 1P0ZA 1V74A 1D2NA 1S4RA 3DMCA 5EQLA 2V1UA 5EXPA 1YSYA 2F5SA 1FCNA 3N9HA 2L4VA 1HNWM 3ECFA 3SW1A 4P6ZM 4PKYA 2QZ6A 2UXBM 1IM2A 3VP3A 3HLWA 2HMMB 3H3HA 3KDSE 3PTEA 1JJ22 3MKFA 2OOBA 4NXBA 3D4FA 4Z6YA 2F5QA 4Y28F 3FZWA 4JLFA 2OAP1 1RP5A 1TS6A 2WKEA 3FPWA 3HHWA 5EXTA 3HREA 1US1A 3HLCA 2QHKA 2Y2MA 1ZMVA 1BLCA 3KYEA 4O8SA 2HMOB 2C9OA 1GD4A 1U5OA 1G6OA 3ALAA 1W5SA 3GO8A 4K1VA 3UB8A 2W3EA 3MFXA 1LOVA 1N75A 1DGHA 2VLGA 4LJ9A 3LCEA 4N1HA 3GSPA 4UN2B 1XNQM 4ZTKA 2GBWB 4PAUA 2H0YA 3UO9A 4WHAA 3LY4A 2PBDP 4S2MA 4CGYB 3WHKA 3SX1A 2A24B 4NSOB 2I7PA 2EX8A 1JB2A 4WMCA 4R23A 1FNNA 5FTLA 1GSVA 3I04M 3IG5A 1LSVA 3L2AA 4FCTA 1MWRA 1H3QA 2G2UA 5F1FA 2EKFA 2O3OA 3MZFA 1LRAA 3FYCA 1BULA 3PCSA 3LOYA 1SXJC 3ZYTA 4Y0TA 3HJIA 2Z3XA 2GZAA 3MHVC 3A3IA 3G30A 1O7MB 3IG8A 4H6JB 1O7GB 5A2QS 2D01A 3U6OA 4BBTA 4OW0A 3LXUX 4DXBA 1YGEA 1L2BA 2LVNC 3H51A 3ITAA 2H0HA 1I5QA 2EX9A 1W7CA 2QHOB 1T19A 2A49A 3JUQA 3DAVA 4LMIA 5HARA 1KD14 3CMZA 3FUTA 4WW0A 5ELUA 4M0WA 2JBFA 3EE1A 2WKIA 1UCKA 1IKGA 3JVVA 4QWTA 3LTBA 3LI9A 2ZM2A 4CLCB 1YVSA 3MYTA 2YQZA 2LNHC 2R62A 1S66L 3J7Yd 2VGLM 4U3TA 4DN0A 1EA2A 5GSPA 3JYIA 5DF9A 4LRSA 4IBJA 3KP0E 3WS2A 5G1KA 4UA7A 1YJN3 2Z6BA 3L9KA 3CCJ3 4G4OA 1C7YA 1HU9A 3HJSA 3QP8A 1R7RA 2BTFP 4R4SA 4JI7M 2YNMD 3LI8A 2W03A 2HCBA 3K2NA 2JY8A 3SMPA 1VEGA 1EWZA 3E0YA 3E4OA 2W3HA 4JI4M 4R9LA 1GL7A 5AIHA 3MSHA 1PGYA 2VF8A 5BPVA 1BNFA 4FTXA 1DMQA 3EGDC 3LTDA 1NO3A 1IN8A 2XFSA 1G68A 4WP5A 3BEBA 4D80A 3Q3FA 4U13A 4I4LA 2VGJA 3EOIA 1DGGA 4X69A 1H8YA 1OGZA 3AHWA 3FG8A 1N36M 4NC6A 1BSBA 3N8RA 3LR3A 1K54C 1RKYA 1I0XA 3IH8A 5A91A 1H8ZA 3AGEA 4H6JA 4JXWA 2WSFF 2GDNA 4ME4A 2VGLS 3U5ZA 2W1RA 2FFYA 1J2BA 1JQJC 3N8SA 4MMZB 1G0TA 1TU5A 1IY1A 2AVXA 3GV9A 2DWZB 5HDCA 2WGWB 4L8PA 4LZJA 2VJWA 1YLTA 2CV0A 1RGLA 4LEHA 3CC43 3UE3A 3MBZA 3OW22 3HL9A 3VMAA 3RGPA 4HEFA 3N54B 1OGXA 1E9RA 3KIIA 3A3JA 1B3SA 4UEYA 4N9LA 1XWIA 4XXRA 2R9WA 4RBNA 3AJIB 5FTJA 1K55A 2QP9X 3FRHA 5DFLA 1QVG2 2CC3A 5TGFA 2Y8HA 3UK6A 4K0XA 4GD8A 2FNAA 1IXSB 2KDLA 3JAMS 2QJ7A 3CCR3 3G2YA 2XSZA 1LVNA 3PBTA 3CCV3 4NRVA 5TR7A 4TX4A 3RE8A 3HGIA 1W6GA 2E2VA 3IXGA 4K0WA 3GWRA 2OOVA 2C99A 1K28A 4EUZA 4LV3A 2JN7A 5G18A 3U6PA 5HWWA 3NJAA 4LJ6A 3Q2PA 1FJGM 2JE5A 4LV0A 4X55A 4HJLB 1SCWA 3U5ZB 3G4PA 2YKFA 4EBLA 2JNHA 1GHIA 4JF4A 3CWFA 1CK3A 4JGPA 4J8TA 1N34M 2PDRA 4X56A 2O9BA 5TFQA 4FMCA 1NSFA 1IOUA 4KHPM 2BMRB 2Y2GA 2M5ZA 3IXDA 2X02A 3TWKA 1O7EA 2P05A 1EFUB 2EXAA 5I94A 4UAAA 1IYPA 3IHAA 1N9JA 1OHPA 4XT2B 2M7VA 2J7OA 4F2LA 3SYUA 3BB9A 3PVSA 2RKOA 1IXZA 5AEWB 4ZJ2A 2UXDM 3D9RA 3OLOA 4GOGA 3ZQ5A 1SJWA 3RDEA 1BNJA 4OQHA 4EERA 4IBKA 4JF6A 4WLAA 3V76A 4Y2FA 1WNHA 4XUZA 3EEHA 4GHOA 3SH7A 2V0WA 4STDA 1G41A 2HDUA 1IV7A 3KYZA 4RNZA 5AVEA 2ZTDA 3BRMA 3VOLA 3GECA 4JKTA 3C58A 1V34A 3F1NA 2V8FA 4PDIA 3AGNA 5EV0A 3M6HA 4DUYM 4BQMA 2F99A 3IT9A 2DVWB 1W79A 3O88A 1HT1E 2RCXA 1F8NA 4Y7PA 4MBKA 5KP4A 3D3OA 3HOHA 4GS9B 1IY2A 4CJNA 1IBMM 4H61A 3GLHA 3CCE3 4GZBA 3S1YA 5BXQA 1QAMA 4P0MA 3SATA 2KRKA 1A67A 3LH4A 1G3IA 4JYAM 1EQKA 1JKGA 2C5RA 2CFDA 3OPPA 4UQIS 1HQYE 1DE3A 2LB5A 1QAOA 4LG2A 1MC0A 2XRNA 4O02B 4ETXA 3AGDA 3UDFA 4G3WA 4JPMA 1OJGA 2ZJ9A 1QUTA 1B2UA 2G3QA 2O25A 2W0QA 2CP8A 2DWMA 1MKMA 2XDMA 1N33M 2F4YA 5HX9A 2LVPC 3E2LA 3Q7VA 3NI9A 2OAQ1 3JR4A 5EOOA 2XFTA 3B9PA 1IV9A 1LOXA 1BUQA 1DVCA 4FCMA 4ORLA 5IW9A 1CEGA 3EBTA 1DRMA 3NDGA 2L6OA 2QJ5A 5EOEA 5TBMA 1PM5A 3BBZA 1DO2A 4FMDA 4BU4A 3NBXX 5KPTA 2HP5A 1ZAEA 4AFIA 3GQ5A 3B33A 2LVOC 1E3UA 4MN7A 3W68A 4Q7JA 2GSPA 3EEAA 1A90A 3DTIA 4JF5A 3B7QA 3FV7A 4L9GA 5CECA 4E3IA 1JR3E 4BTXA 1JWZA 4Y0OA 2ZBKB 4AG6A 2GQFA 3ER7A 4EYCA 3GLFE 2Y2LA 1OAOC 4UQIM 2Y21A 4WEKA 4CDLA 3S27A 3ZQJA 1AR0A 3HLEA 4BMWA 4RNYA 1QMEA 2UGIA 4LFAM 2W56A 4OONA 2IMJA 3DH2A 1IFYA 3EB8A 3C4OA 4OVZB 2J8YA 1RN4A 3R9XB 4HZBB 1F98A 2FE8A 4B3SM 1K57C 7RNTA 1HTZA 3PFIA 3GSGA 5LBRA 3HUNA 3NBIA 1GL6A 4MEIA 2GU1A 2B5RA 2W0NA 4NG2A 3M0EA 3CCS3 1HD8A 5C18A 3FCSB 5EVHA 1PI4A 1SKOB 1OTDA 3ZG5A 1BSCA 4HKVB 1ASKA 1Z59A 3FYDA 2BJVA 3O3VA 5HD3A 1PU4A 4CQHA 3C3EA 4HI4A 1QQWA 1VZZA 2P04A 4QOSA 5CTMA 4M9ZA 3GQ3A 3I553 1FYSA 4RX2A 3CNMA 3WHOA 3RJUA 1IK3A 3CZDA 1VEUA 3ZVTA 1DYUA 1WJ7A 3X3XA 4X62M 2HGVA 3F1NB 2G5GX 8CATA 3JUOA 3CUEA 1PRBA 1BRJA 4BLCA 3LUQA 2XZUA 1PFLA 3K1JA 3LYGA 3L25A 1YMXA 2I9VA 3PYJA 5IHVA 4HOHA 1LI0A 2QZ4A 3HHXA 3UE1A 3T1RA 1IT7A 1WXQA 1OACA 2STDA 3UNLA 4L16A 3AMOB 1K54A 5JI2E 2ZQ8A 3EQUA 4MGIE 2LBCA 2K3DA 4P87A 1GHMA 3K0ZA 3OWSA 2JY6B 1Z6FA 1GO5A 3MG3A 1Q2QA 3GRDA 5IREB 3DTMA 4BWIA 4IBEA 1MWTA 1K8A4 2CFOA 2R4IA 4AEQA 1LT0A 3BW6A 2F86B 3E4QA 4GB7A 1TRQA 3FE3A 5IZ7D 1YJW3 4DR4M 4DE3A 2K7SA 5DFXA 5ITXE 2L1SA 1V33A 4WYKB 3ZCBB 2WGOA 2EUCA 2BO9B 2R4EA 4LCMA 1GMQA 1T3BA 3GRVA 3FPVA 1HZ1A 2MGWA 1JN5A 3IPTA 4NSRA 1VQM3 3V3RA 4NL4H 1YKDA 2OWHA 3S67A 2BHMA 3TG9A 1SIHA 3F1PA 5CHMA 5L2FA 1B21A 1TH3A 1RCLA 5FQJA 5IERA 3IWQA 4XGIA 1X1WA 1TH2A 2VDBB 5GKNA 1PZOA 1RGGA 4QY5A 7CATA 3AKZA 3B7CA 2QQ8A 4DBGB 1S6RA 1GS3A 3Q8GA 2Y0QA 1BYWA 3IHBA 3SLUA 3JVCA 1L2SA 3DGYA 1DJCA 1I70A 3U4LP 5EVID 4GS9A 2HOHA 5GHYA 1DV0A 5FAQA 4IBDA 1QYRA 3D79A 3NOPC 1Q3CA 4KZAA 3MJ5A 3JPUA 4IBIA 4MLLA 2WKHA 1I4WA 3ZG7B 4L6V6 2BWBA 3E9SA 3FSDA 1RN1A 1ODVA 1CUKA 2OSUA 2KF3A 3KKGA 1DMMA 1KWIA 1MU5A 3VP4A 4MNRA 5KSHA 2XH9A 3HVFA 4E3MA 2WADA 1OFHA 3A0VA 2JWSA 3W4QA 2PR5A 3BXWA 2PYRA 5D82A 3Q81A 1JB0F 1FA3A 1ESIA 3U6QA 2D42A 3LY3A 3G31A 4LRZE 2HJEA 1RGCA 1TUHA 2QGUA 4NXMM 5BOHA 3T1SA 1IDPA 2BNGA 4KVHA 3OZHA 3CI6A 1KE4A 2W27A 2A2LA 3EIEA 2HDQA 4S2IA 1UCLA 3AOEA 3NBJA 3GLFA 4LCBA 1A0KA 4GN2A 1WGLA 1MX0A 4MH0E 3O8YA 4N6MA 1QVF2 2V1ZA 3GR2A 4DR6M 4NOOB 3TE8A 2HPBA 1HT2E 4JI2M 5AI1A 1W6CA 1R4GA 1JTGA 1YT4A 3H7WB 4S2NC 3G2ZA 1IXRC 5G1LA 2RL3A 4LFUA 3ZHHA 1WMNA 1NB3I 1XMOM 2PU4A 5FEGA 4CPKA 2K0MA 2CMNA 2FXTA 1BNIA 5ITRA 5DRVA 1NHGC 2C10A 4AG5A 3SXXA 1U60A 3HY5A 3MZDA 3DBAA 2WO0A 2Y74A 1VQO3 2Q9MA 1STDA 1BNSA 3IBJA 3SS3A 3LVVA 4CLCE 1AWIA 5BR8M 3VKHA 3M6BA 1A2KA 4KQQA 2UUBM 1O7WB 3OXAA 2MC8A 1OJ5A 4GD6A 5F83A 3DA1A 4EQIA 5ELJA 4HYZA 2L7IA 1BRGA 1OAIA 5FGOA 3IX4A 1PJIA 5ITQA 4I4KA 1KGFA 3DGNA 1JBSA 3IWOA 5CGWA 3VP0A 2O0YA 3UL5A 5IF6A 3MR0A 2IWCA 3GTCA 1DMNA 1NWZA 2HMKB 3HI7A 4LGYA 3FWLA 3ZH9B 1UUGB 3DZLA 1BLPA 2CX1A 2Y2OA 3KOZE 1YVBI 3CF6E 4K61A 5M18A 1BGSA 1IYSA 1WQLB 2BASA 3NULA 3FG1A 3CF0A 4HAAA 3VK8A 2OOLA 3FTFA 2JY7A 3KXEC 1P9WA 3BLSA 3TQSA 3VOZA 2Y2QA 4D81A 4NREA 2HKJA 1ZO2A 3CPTA 1AV4A 1MBLA 4Q0JA 4DJ3A 4QJGA 1O07A 1FQGA 4NETA 2ZM6M 2B3TA 1W2ZA 2DRWA 1IQXA 3RNTA 1W8YA 2V1CA 3Q8XA 3AFHA 3T4KA 2RGQA 1EIJA 2CWVA 1NY0A 1KDSA 4RA7A 2P7JA 2GBXB 3OWUA 2XR8B 2Y0TA 4WZ5A 1Z5AA 5EUAA 1BNEA 3NY4A 4G4NA 4EEPA 4QY6A 1DJAA 3EJVA 2JKRM 1VQ1A 2IUJA 2ZQ7A 3BFGA 2M7UA 5EEOA 4FH2A 3KE7A 2V8CA 1TDHA 4RF1A 4PM9A 3E2KA 1GSXA 1E3RA 3EGXC 5FL3A 3T4LA 1FSWA 3OTOM 2VQFM 5FW5A 1OTEA 2KDKA 1SZVA 4PCZA 1N8QA 5D83A 5KSCA 5AQAA 3RXWA 2CFLA 4WURA 3FTCA 1QVRA 4DE0A 2OQEC 1GD3A 2CFGA 4B7FA 3VP2A 5IG0A 3WOFB 3I01M 1F2KA 4E3OA 1BLSA 4EW5A 2HV1A 5FDSA 5BVBA 1FSYA 2DKLA 1VQ53 1GHPA 4KZ9A 1W7FA 2ZQDA 3F1OB 4HM4B 4R80A 4GC9A 2CG0A 1C3BA 3W4PA 2UU9M 3CUEC 1Q3BA 1M9GA 2J3TC 3MQ0A 2H0TA 1IQYA 2RGOA 3HUMA 3N7WA 3T50A 1IBLM 5E43A 1HKXA 2VKSA 2V20A 1NV8A 3PNYA 2EKKA 5LC7A 1ZG4A 5CX7A 1M904 2MJ5B 1BOXA 4CISA 1L0FA 3P09A 5EVIC 4DV3M 1D0LA 2Z77A 3WDGB 3A0SA 5MC7A 2PBYA 4KZ6A 4MJDA 1LOYA 3GZXB 3BJNA 1C1KA 3FUUA 5FTKA 3I563 1L0DA 3UB7A 1FR6A 3AV0A 1SHVA 3HZPA 4XBYA 5D3OA 1XKZA 1U8CB 4D60A 4N6UA 4RQ9A 3PXPA 4R9KA 4X1MA 3VLFB 4IT7A 4IIWA 2C9CA 1KSIA 4KZ4A 5HL6A 2R4JA 3SZTA 4XM4A 1P97A 3M6AA 4FUWA 1R2YA 2CRUA 2PAVP 2W3GA 1A2PA 1MXOA 3FUVA 3S4XA 1DJBA 4MBHA 4DF6A 1K82A 4LGQA 4CLCD 5I97A 1XPBA 5HDDA 1I0VA 1RN7A 3UB9A 2BIRA 1KE0A 1XMQM 5CGSA 3GQZA 2UWXA 2BLSA 3I4VA 1D1JA 4CLCC 4P6ZS 4H3UA 3C8CA 4ID4A 1VQ63 5HPIA 4IJFA 4LFBM 3GMWA 3UPOA 3IX8A 2RRUA 4FSFA 2J80A 4L7KA 1K25A 3VP1A 2ZAMA 1LSXA 1YSQA 3B7ZA 3L27A 2PZVA 2IUKA 5FASA 3KOWE 3R7WA 2Z7JA 2M1CA 1V57A 1LL5A 1N77A 2P0XA 4IBBA 3U6LA 3EIHA 2O5RA 1MWSA 1WYBA 4MMYB 4AZFA 1QANA 3FKEA 3BQAA 2CK3H 4EESA 4P6BA 4MN6A 3DGMA 2HP6A 4C3QA 4HNBA 4R1GA 2LQVA 1VDLA 5KO3A 4X53A 3DM8A 1PFPA 3QP6A 1E32A 4E6XA 2INWA 2ZQ9A 3ZGAB 3E46A 4ILFA 1YAXA 4LSOA 5KQ8A 3PR6A 4E6WA 4OU7A 1ZHHB 1QAKA 2W2CA 2UUCM 1YLPA 2W9PA 2B18A 2D7GA 4JI5M 3E4RA 1QAQA 1XGIA 4S2NA 2QPNA 3MK6A 4HL4A 3TDGA 2Q0OA 4HOIA 4E3NA 4JV5M 1IN7A 2HZ5A 4F94A 1YJ93 4Y5FA 4G4QA 4OX9M 5AYRB 1WTHA 2EWWA 1J7KA 2WOHA 3S7QA 3U60A 3CJMA 4JGRA 1W5DA 1RRLA 1EE8A 3NHXA 1IYOA 3BIRA 3GLHB 1UGIA 4K90B 4JI8M 1LQMB 3B74A 1S1YA 1W02A 3MPHA 1K56D 2Z76A 1GSPA 5JPPA 1T1AA 1LL9A 3OBFA 3K2LA 5HGRA 2PNCA 1JV2B 2XROA 5STDA 4NKPA 4QD4A 3H4JA 5AIFA 4O8GA 1OH0A 4HP9A 1JBRA 3VK7A 4EUVA 2KNAA 3G4S3 4R3BA 3IQAA 3T4OA 1AQZA 1N8R4 4YOFA 4LF5M 3M8CA 5DKLA 3SYLA 3ZVWA 1DO0A 3ITBA 1O7HB 1Q40A 1LOWA 3GRUA 4OVDA 3TPZA 3BFFA 3A46A 1E97A 1TS7A 1AXBA 3CMA3 4MB7A 5G2GA 1G02A 4J5KA 2EWVA 1GABA 2VZWA 5F69A 3HBRA 1E9SA 3ZNYA 2P09A 3VF1A 2V1LA 5JPUA 3LR5A 4EV5A 2XK1A 3FG3A 4B7HA 4LJ4A 4QB8A 4ETZA 4HM7B 5EP4A 5RNTA 1TH4A 1KDWA 2K54A 1ZV1A 4WYKA 2JA2A 1B2MA 4J5GA 4E3KA 4EBNA 3GQ4A 3S7OA 5FQQA 3EHCA 5IG3A 5ITUA 2QBYA 4N6TA 3JUNA 3SAWA 4LF8M 1NU3A 5AQ9A 3NM7A 5HFOA 4EV4A 2DWLA 1Y4OA 4U0TA 1OMEA 4R3DA 3NBRA 4DDYA 4JI0M 1RNBA 1OTBA 4OQ0A 3EN1B 2ZBBA 3CPTB 1EROA 4M9SA 2H1RA 2Z6DA 5FQMA 2X01A 5D81A 3MF0A 1DETA 3LTAA 4LYLB 3IXHA 2JP7A 2H5SA 3C38A 1NJGA 2N35A 3KSXA 3N4IA 4LENA 2Z2LB 2R9XA 3W8KA 2MJ6A 1MZUA 1Q7HA 2FGTA 2Z2MB 4G3OA 3RFBA 3CPOA 2YKHA 3T8UA 3D5IA 1FGMA 4G1MB 4N6V0 2K47A 3R8FA 3L26A 1Q02A 1L2DA 4QOZC 4WZ4A 2CC1A 3E99A 2CEAA 1IN5A 4HIAA 1FGOA 3VKGA 2MR9A 4M3KA 3T4TA 4BB9A 3HX8A 3DW0A 1D6ZA 4KLNA 2XZFA 2XGLA 3FLJA 1ERQA 2JC7A 4QHCA 3KSFA 2JZ1A 1KGGA 3SYKA 1NO1A 1YI23 3HWSA 5FTNA 1VQQA 2E2TA 4OVMA 3F1OA 1H0MA 3PBOA 2K9DA 3GLIA 3AGOA 1IVWA 3MKIA 1J9MA 3TJZC 5KIZA 3NM2A 3A3DA 3QNBA 4BJPA 4GHLA 3DGOA 2A24A 2W3DA 3Q7ZA 4E04A 4BENA 4KFEA 1RGHA 3O5YA 3K8ZA 4KZ8A 1PZPA 1JKGB 1NY6A 4DV7M 3B89A 1G6AA 1RDSA 4WM9A 5L09A 4OPZA 5GLCA 4QPRA 3SEDA 3NV0A 3PGBA 4MN5A 4J9AA 1D6UA 3PXGA 3SH9A 4I3JA 5HWVA 2F4VM 1NZUA 2W3FA 2KHHA 3C30A 4RNTA 2EA9A 1YPRA 1NJI4 1PW1A 5DVAA 2Z7AA 4LZZA 5F3WA 4PEJA 3M2KA 4HJ6A 5E6JA 4Y0UA 2J8XB 4FD2A 4PPRA 3C2WA 4CLCA 1R2ZA 2UXCM 1E25A 3VV4A 1G8PA 2QNJA 4P16A 3WODG 2B95A 2DAEA 1ALQA 2ZL8A 4FMAA 3G32A 4X1LA 4LJ5A 4XDWA 1GLNA 2J7NA 1IVUA 3FD9A 1B2ZA 1AY7A 4EXOA 1K55C 2H5XA 2R45A 5IT9S 4R71A 2O9UX 5CLKA 3LIAA 3Q7VB 3T12B 4Q0HA 3LICA 3KVWA 1ES3A 4WFOA 1Z6TA 3SMSA 4F3LA 3VDPA 5M1AA 1XFNA 1YQSA 1BANA 5FAPA 1N9LA 1L0GA 2DZLA 2KW0A 5EXSA 2V2FF 5ITTA 3FRIA 5AIGA 1KQS2 2Y2NA 5KQDA 1BRSA 3VSLA 4GEWA 4FOFA 1FUTA 1HYFA 1K3WA 2ZD8A 3Q07A 2FFJA 2WGQA 5JYPA 4D2OA 2DAGA 2ZDJA 2JZ0A 3SASA 4X68A 5HW3A 2I9WA 4OOMA 3HZJA 1YLYA 4OH0A 1BUEA 3NV0B 4WUJA 4IJGA 1IXSA 2ZMFA 5E2HA 1ZC2A 4M9XA 3T1HM 1R4CA 2K6BA 2OPFA 1IELA 5A90A 2DI0A 4P17A 3F14A 3BNCA 2KF6A 4KZ5A 2F5PA 2WKPA 4NRWA 4GRIA 1HNXM 1NRFA 1BTLA 4CIZA 4N9KA 2UUAM 4MGZE 1BIRA 1X37A 3ZG8B 2CUZA 2L09A 3CGWA 2DWNA 3D4AA 3ZFZA 4JI1M 1HVBA 2JKTI 5EVLA 3PXMA 1RGKA 1K3XA 1FGRA 3A5EA 4XB5A 3CCU3 4NXGA 2B24B 3FUWA 5DF7A 1Q864 2PT7A 4I3AA 1JR3A 4C6YA 3X3ZA 1K734 1PIOA 4I39A 5KPZA 4N92A 3MZEA 1MJGM 3QHYA 5L8MA 3GZRA 5GLDA 3PBSA 3SS5A 4NXEA 4KFFA 2O9CA 4OPQA 4UA6A 3HJQA 5IG5A 3EQQB 3HLBA 5AVFA 2HMNB 1K56A 1QALA 3ZCZA 4X64M 3DXOA 1B20A 2B1XB 5DJUA 1G28A 4DE2A 4U0XA 2VIIA 1NJFA 2AADA 1GSWA 2R78A 1CEWI 4NXNM 2WSCF 4FR9A 5BIRA 3SC3A 5AQ7A 3W0FA 1VDDA 1Q9EA 5CGXA 4PD2A 1TJDA 4HH3A 2DNSA 3BY8A 3FYZA 4L9FA 1D0MA 1NXYA 1S723 4GKJM 3CXC2 3O87A 2CWBA 3WR2A 3KSGA 3IWIA 3D72A 3PAEA 3GZBA 3UMDA 3H82B 4ARZB 1PJTA 1YMSA 2CIUA 2G8LA 1SXJB 3BY9A 3QK9A 4Q0IA 1MPLA 1OT9A 4O2HA 2KX6A 2LVQD 1S5AA 4QWOA 5HAQA 3DY5A 1K41A 1UUVB 3W2ZA 3GPYA 5C5KA 1T43A 4DV4M 4LRYC 1PYLA 1OF5A 1ONHA 1MWUA 2OWJA 2EO2A 1IY0A 1G4AE 4ZRRA 3KCHA 3HLGA 2YFQA 2KOIA 1UFZA 2Y91A 3STDA 5CERA 2JKFA 1LSWA 1PW8A 1XXHA 5F5YA 4OPRA 2BG1A 4MBFA 4OK0A 1DGBA 1JN5B 1TP6A 5F1GA 4WWUC 2HDSA 4QNRA 4IJEA 4B08A 2W6JH 2AHMA 3H9WA 5FATA 1PNEA 3OWYA 3JVUA 3FTDA 2Q07A 1CI9A 3KFQC 1EI5A 1RRHA 4JBFA 3A42A 2E5LM 4WL9A 5EXXA 4KUKA 1KYIA 5AQBA 2DAMA 8RNTA 1JZOA 2ZQCA 5FSWA 2XSSA 1ZMUA 2Y73A 1K0KA 2VQEM 3KZTA 1D7EA 4Q8IA 2EX2A 2SBLA 4AKHA 5FAOA 4DV1M 2ACGA 4K91A 1SKFA 1NHWC 4X65M 1CH0A 3AMOA 2W1TA 1FZUA 1OCVA 2OO9A 1XJ6A 4PM8A 2LWXA 4K0KM 4XBOA 4YY3M 1N5HA 3OX9A 3ICYA 4KZBA 2WZJA 3OPRA 4LY6A 2F98A 1NZOA 1E4DA 1NWWA 3KO6A 1NLZA 1FILA 2FOIC 1YLZA 4OOLA 2CHQA 2K0BX 3SVAA 2KLIA 5HSQA 3C4PA 2CX0A 3LGOA 1TVFA 1DVDA 1LI9A 4OKPA 3HKPA 1IYQA 4RNAA 1SKOA 2DHRA 1GOUA 3NBLA 4AKIA 1YIJ3 3SOIA 4BBUA 3KW6A 1DP8A 5E2GA 5IU1A 5J3WA 1GJTA 3TWLA 2Y2JA 3Q82A 4JXVA 3GRYA 1IKIA 4ZAMA 3HU3A 3GPXA 3GLGB 1EW0A 4JXGA 3VSKA 1LQGC 4S2PA 1I2WA 4FCJA 2WZZA 4F3LB 3FH1A 4NK3A 3CU3A 4UA9A 3D3LA 2XGNA 1HNZM 3LO7A 1A2VA 7STDA 1N78A 3RTYA 3D8LA 2JQ5A 3LYXA 1JB4A 4S2OA 1I94M 1OKSA 1ORYB 1MGWA 2Y55A 1VQ43 1OTRA 3EBYA 1M40A 2R6FA 4L8RC 5EECA 2EFXA 1DP6A 2W1TB 3VSYA 1YLAA 1PRQA 3Q90A 1GOYA 3MJQA 3DZDA 1PJJA 3OCLA 4R0QA 3UB5P 2RNTA 2KZUA 1Q40B 1WYCA 4DE1A 5J8XA 2XA7S 4MEZA 3ZG9B 4OLGA 3SOYA 3M7GA 2X71A 4RF0A 3KFUG 3V92A 1GMRA 1XGJA 4KG2A 4OLDA 4PM6A 3D9YA 1WMPA 3NECA 3G6E3 3LMMA 4ZBEA 4O7DA 1UCIA 2CW9A 1XC8A 4LRXC 4IUHA 2QIYA 3AOEC 4DRTA 5IEOA 4EETB 1BSAA 3NBBA 2QPAA 1FGTA 1CF0A 4MGHA 1V9ZA 2VEAA 2QBYB 2LYXA 1UCJA 3F7XA 2ZTCA 2XF3A 1BAOA 4HY8A 2JHEA 3WS5A 3UZUA 4HJ3A 2P5TA 1I2GA 5FI6A 2HAKA 2W56B 1EKMA 4XUXA 3MXRA 4EQ1A 4L15A 5CXWA 1JRQA 2IY2A 1JB5A 2KRTA 4L0LA 3I51A 1L2CA 1MGRA 4KQDA 3A3EA 3TRCA 3M2JA 4LJ8A 5GLAA 3U6SA 2DCFA 2BMOB 2J9OA 4B4ZA 2DENA 1XJ4A 3HK4A 1YLWA 1K38A 1F4IA 4YNRA 4HEOA 1IQPA 1FW7A 3H82A 2RCDA 1VQP3 1WA9A 2UUGC 3NIAA 1R6BX 3BU4A 1ZKJA 1LHYA 3FC7A 4UHUA 2BWEA 2ZQAA 3V3SA 1SXJE 3SARA 4OP5A 4OQGA 5K5BA 4LRTA 1JNQA 3TSGA 1JR3D 2ZC4B 1OJLA 3HX3A 4Y17A 2Z4RA 5TBMB 2FS1A 1W4NA 1PWDA 1IYYA 6GSPA 1IFQA 4AI6A 2DHYA 3UY6A 4JF8A 3UJMA 1PYYA 4KG6A 2ZANA 4B4XA 3LCVB 2J9PA 1ZMWA 1XXHB 2Z6CA 4P85A 4A3VB 1S0WA 4DDSA 4JI6M 4BIRA 3KOYE 2Y59A 3J80S 4FWGA 1QDTA 2BT3A 2DAKA 2JKTM 3W67A 4NEED 3NQYA 2DXIA 3C5AA 3IS2B 5HDSA 2ZC6B 1A5TA 4HM3B 4DR7M 3KN4A 2VK3A 1C7HA 2ERCA 2CHVA 1RGZA 1HQCA 1XXMA 1X1XA 3EC9A 2XA7M 3EF8A 1S1ZA 3V99A 1H6UA 1YUBA 2UV0E 2FH5A 1ESUA 3A3FA 4MM3B 3GRRA 3C7VA 2OTL3 4IVIA 1J5EM 1QMFA 1Y54A 4O0PA 1NB5I 4HBTA 4L78A 4ITQA 2F56A 3C7UA 3QAUA 4OVZA 4GC5A 3UMEA 1TIJA 5GL9A 1YGWA 1K4FA 5HWTA 3K3CA 3A98B 2CFKA 1L5GB 1GKIA 4L4UA 2PHYA 4GNUA 1FIKA 4KUOA 5FA7A 4PT5A 3PHYA 3KSED 3ISGA 5F6AA 4BLMA 1W63M 4YWZA 3HU2A 1T18A 3U6EA 1BSGA 3UE6A 3LQRA 3BLZA 2XLJA 1W5TA 2K2NA 2LVAA 4GHIA 4S12A 3J27B 3KSPA 4YFMA 3HJ8A 1CJFA 5CEBA 2RGHA 2PR6A 4L8OA 2WZXA 3UDXA 1XJ2A 1BZAA 5CTNA 5EP2A 2J3TD 4AKYA 1AVLA 3JUPA 1VQL3 1IVXA 2CWUA 4GJ4A 2JCHA 1OPYA 2NUTC 2A3UA 4HM6B 1PWGA 1OHSA 4WMCD 1ZX2A 3SOAA 3OPLA 1T2HA 4LLOB 3QNCA 2ZOIA 3A76A 1IN4A 3ZG0A 4BTWA 1V58A 1AUAA 5E2FA 3D5GA 1GJSA 4XDVA 3KSJA 2VV6A 1AVKA 2APLA 2GX5A 2OLUA 3K92A 5M19A 2ZHXB 1MNLA 2ZAOA 3T4JA 2P08A 5DYGA 1VETB 2D7HA 4GCZA 3NOUC 1IVVA 4MDZA 2PU2A 3GP1A 4A5RA 4M0DA 3CITA 1RCJA 1ZS7A 4HM2B 2YR0A 1C54A 3WS4A 2GEYA 3IMAB 5J7EA 4IBRA 2QKPA 2XD1A 2Z8YM 3CCQ3 1VQK3 3QP2A 1KFVA 1QDRA 1SXJA 4KZ7A 1WHCA 3QYBA 3I7JA 3RGAA 2DAIA 2ZM8A 4QNMA 1NYMA 2VV8A 3QRDA 3LTCA 3F92A 4D82A 2X8AA 4DKIA 4B9OA 4CHTB 4YHHM 1RTUA 3J7BA 3LMLA 2WGWA 2GNXA 4LJ7A 4BBVA 2PYPA 1S3SA 2XSOB 1UI7A 5A0OB 2JUJA 3NDEA 1LNIA 2WYXA 3IJEB 3CAXA 2ZOHA 3IS2A 2VF7A 2OLVA 3DOAA 1E3VA 4DV0M 1T3TA 3RFWA 1ZGXA 1TS0A 1YM1A 1RCKA 3NX0A 3KX0X 4FMBA 3T0UA 3SHFA 1YNVX 1TRPA 3LEQA 4K08A 1SARA 1JNUA 2W9QA 3S28A 2NQ8C 3DUKA 4JGOA 3DTEA 2PRFA 3KYQA 3CCL3 4DR5M 4M4XA 1N5PA 1JVJA 2HL7A 3HU1A 2C6WB 4GSPA 3G34A 4RKUF 1NNVA 2F5MA 5KPRA 2KXEA 3FKAA 3OPHA 2CKFB 2X4AA 2HHHM 1ES2A 3P01A 3T6PA 5A8BA 5DNYA 3Q1CA 2HF6A 4OPYA 1KVMA 1HR0M 5FLXS 2YFLB 3O86A 4ZM8A 2RFRA 4ZJ1A 2C11A 3UJNA 1CQSA 4NPBA 4FVMA 4PHTA 2PD8A 3WOEB 1ES4A 3OV4A 4WEJA 1VB6A 1STFI 3CPW2 1VEUB 4DV6M 4OUQA 5DYIA 4LGMA 1SPUA 4KQRA 3FKVA 4HM5B 4HLQA 4EC6A 1YLJA 3PYPA 3MKEA 4EIWA 2LHCA 3DFZA 4GH9A 3GLFB 1Y28A 3WHLA 3AGFA 3HLFA 4HHDA 3U97A 3U6CA 5IS1A 2KF4A 1QUSA 1T2IA 5AEUB 3FF0A 1VETA 1XXHE 1O7NB 3K63A 1OIPA 3BYDA 1BRKA 1BNRA 2O01F 1SIIA 5DREA 1ACFA 1L0EA 3LQQA 4X2HA 4REZA 2XR0A 3U2AA 3PCRA 3V39A 3U61B 2L7HA 3J2PB 4N6NB 2H28A 4HQAA 2MH8A 3T1QB 4LPZA 1Z5CA 1SDEA 3R4KA 4KG5A 1T1BA 3LR4A 1IEMA 5H37D 3BFCA 3TOIA 4LF4M 1VEKA 3F40A 1TF0B 3S7NA 4MMNA 1TD5A 2OV5A 1ROVA 3QP1A 2P38A 3B42A 4ESPA 4S2JA 1CYUA 5DJTA 2D02A 3QWLA 2BMQB 2HDRA 3S22A 1PJQA 4GHAA 2SARA 4MCWA 5E2EA 2WGIA 4RYEA 3QP4A 4BL3A 3BNBA 3SFZA 4GB5A 3KSIA 4R1KA 4BL2A 4KZ3A 1TR8A 4EV2A 4CCVA 4DV2M 3GLGA 1GY6A 1UWNX 2V1BA 2W04A 1JZDA 3K7CA 3VFDA 1HJPA 3FKWA 5IWAM 5CF1A 3S5CA 1ULJB 3BNDA 1DY6A 3GLIB 2JXNA 4IUKA 4MGYE 1IQ8A 4N6LA 3G35A 3C9PA 4ZJ3A 2LHGA 3CNXA 1UI8A 2XEPA 2EX6A 4KQOA 1Z09A 4GL6A 2Y2HA 3PBNA 4ZPXA 2OOVC 3KS8A 4Q53A 1XNRM 4AW4A 5CHJA 1GA9A 2L4EA 4WBGA 2B02A 1ES5A 5EJCA 4I38A 1XHBA 3TL4X 1EEJA 1Z5BA 4GITA 1L1TA 1JBTA 1LL8A 1CQAA 1N4OA 1NRJA 4Y3IA 3Q1FA 3T38A 3K9MC 5GHZA 3QYEA 2P74A 2V9AA 4N3VA 1X0OA 3GDIA 2P9VA 1YSPA 2VGKA 2KNZA 4KT3B 3EWKA 1D0KA 3U6MA 4R7GA 1JTDA 2EXBA 1RHLA 3GRJA 3NOTC 4HH2A 3UPPA 5JBSA 4HM0B 2ZC7A 2XQZA 2Y2IA 4PM7A 2ZM0A 4LZIA 2QCUA 5IENA 2P9VB 1CI8A 3EQVA 1N9EA 3SAVA 1OT6A 3BLMA 3VFFA 2YFJB 3CD63 3NXJA 4PM5A 5FDHA 3G713 1UGHI 3LT9A 2L0WA 3U6DA 4JXJA 2JY5A 4IBFA 1IBKM 2DZOB 1YE9A 4XBTA 3T8NA 2E8IA 3BNEA 3L7HA 3U60B 3MMHA 3PBQA 1HZOA 5EP3A 3MG2A 1R5LA 3HIGA 5HZHA 3RH8B 3W4OA 2YFIB 1DGHB 1XX2A 1EUIC 3S7PA 3H7WA 2WSEF 3B4PA 1WGNA 3WWXA 2F5OA 1KOUA 3V5MA 2RBIA 1G96A 3HHZA 3HIIA 4N6OB 3E4PA 3CHWP 1VG5A 4FCVA 2HWJA 5IT5A 5EVEA 1QMAA 2ZA4A 1RLSA 5EVIB 4DXCA 2BU4A 4FCWA 2WKRA 2JKRI 4JN6A 3MS6A 3VOYA 3W0LB 2R18A 1B2SA 5DTKA 1K9M4
chains in the Genus database with same CATH topology
2C5WB 4IIAA 1YHQ3 2G2WA 3CC23 1Q42A 3BECA 4WELA 4NHFA 2HP9A 3TWMA 3HHYA 4C75A 3WRZA 3LZAA 1G59A 4FWDA 5F82A 3U1WA 3LEZA 2CE7A 1LV7A 3F8HA 4HBUA 3GZYB 2GEXA 1K57A 4YINA 4DV5M 1LLBA 1MOLA 2C98A 1SQWA 2WK0A 5FI2A 2KZSA 4AKGA 3OCNA 4IBXA 5KZHA 1QJGA 4W5WA 3IF6B 2UX0A 2ML5A 3KOXE 1XA7A 3D8BA 3ILKA 1KE3A 4S2KA 3SS4A 3MG1A 3V50A 3ZDJA 4LV2A 1GCEA 5ITYA 1FR1A 3SHGB 3N6IA 4GKKM 1LXEA 4B7GA 2MF7A 4MMXB 3GPPA 3WMDA 3UPNA 3AOGA 4JI3M 2CV1A 1QAFA 4G4RA 3RXXA 5FI7A 4BD0A 3SH8A 3MFDA 2I7NA 1NVMA 3BFDA 4FD8A 5ITXA 3CTWB 3HUOA 2M7OA 5EP1A 3T1YM 1GY7A 4O3VA 1MKIA 1VQ93 2V6ZM 3CG5A 1NNJA 4B3RM 2M60A 3WA3A 4X2OA 4JXSA 3MSOA 1ONGA 2A5YB 5CK6A 3KS4A 2EFUA 1Y4KA 3LT8A 1ULIB 2R46A 1GY5A 3J7AS 2CV2A 5AIIA 4X6TA 3HLDA 1ISKA 1VM1A 4AQYM 4GIPA 1FGQA 2OCTA 2Q9NA 8CHOA 2ML6A 4G6ZA 1RGYA 2RSXA 5JYOA 4FWHA 3TE6A 2KA6B 3ZC7B 2WOFA 3UMMA 4IEDA 3VDUA 3U61A 3X3YA 4WYYA 3SAUA 5KMWA 1CEFA 1UW1A 5CF2A 2OWPA 4TUWA 4IBGA 2CG1A 1H5XA 5HAIA 1EG9B 3NQZA 1W00A 5AYSC 4RVAA 2W82A 4HVNA 3N8LA 4R4KA 4EXRA 3FG4A 2I72A 2IWDA 1OF5B 2CWTA 3MHEA 1M1XB 1FUWA 2Y20A 5C1BA 4DR3M 4Z8XA 1UM8A 1JWPA 5FQIA 5LMNM 5FTMA 3DGLA 1W6YA 1ZQ9A 3H4MA 1TEMA 4MGKE 4BBAA 1TFOA 3FZCA 4JRFA 3NWLA 4B88A 2FNQA 3X42A 1BLHA 3B3XA 4LCLA 4PDGA 4BTYA 1FCMA 5E26A 3GAXA 1TGUA 4DR2M 3RGRA 1NDOB 3ROBA 3BM6A 3IH9A 3T15A 1PI5A 4DR1M 2J7VA 2Z4SA 3THGA 2WUQA 3IF6C 3V98A 3AL0C 3NUVA 3A45A 4HBRA 2KRUA 3EX9A 3N8BA 1BT5A 4XBXA 5IEPA 3WRTA 1TDLA 4HZ9B 3DWKA 1JWVA 3L28A 4AKZA 3SBJA 3X41A 3WA2X 5DTTA 5CEDA 3B8LA 1W01A 1NJ4A 2F5NA 2WAEA 3UGJA 1RJOA 1QZMA 1VQN3 5U47A 1I2SA 5TGNA 2IWBA 1VQ73 1YIT3 3RGSA 4RZMA 5A92A 2OQ4A 3WS1A 4E3JA 2CHGA 2CFWA 5IG4A 3PS8A 2OQEA 1IT8A 4K1UA 1M1K4 1T5YA 1W5ZA 2XSHB 4QHSA 4IBCA 1ERMA 4LF7M 1GVNA 1NNUC 1Z1SA 2LXEA 1CYVA 4GDNA 4QHTA 2A15A 2Q2EB 2KXGA 3F9SA 3PZWA 4KFDA 5HL1A 2CH9A 1N9BA 1W2B2 5FQ9A 2XRXB 4H8RA 1Q2PA 2WAFA 1XP4A 5EVIA 4R3JA 1L8QA 4IPBA 5CHUA 1OFIA 5CXOA 3L0RA 4GDBA 4LFCM 4HM1B 1K4EA 3CF2A 2C96A 3BFEA 1Q814 2BNKA 4B3MM 1UUWB 3F8XA 3UB1A 1KSFX 2EA0A 3F7SA 2JDIH 2R65A 2XLNA 4Z9QA 2DZNB 4FCZA 3X40A 4N1XA 4FW9A 4I81A 4WZ5C 3EN8A 1W8QA 5GHXA 3B4OA 3G0KA 4DUZM 4FH4A 3ZNTA 3KP1E 2ZMAA 1NYYA 5KP3A 4BD1A 2IA7A 3FUXA 3G16A 2GXFA 1WE4A 1SDNA 1Q39A 3I4YA 5KP1A 5EQTA 2P0MA 2Y2KA 3VFHA 6STDA 3PBRA 4OP8A 1M6KA 3UNWA 3FF2A 5CRFA 4II7A 1KVLA 1OHOA 5LMUM 1WMOA 1FOFA 2QA43 4KENB 1XA1A 3IXBA 4EWFA 1L1ZA 1TFKA 4I5SA 3MWZA 3VGNA 2XD5A 4FCFA 2YX9A 4S2LA 2CHCA 2LH0A 4KO8A 3JR5A 1E94E 4ZDXA 1Q824 3UN7A 3S29A 2QMIA 3UL6A 3UE0A 1OUNA 4EBGA 1IU7A 2QEX3 3IF5A 3P98A 2Y4AA 1K6SA 5DF8A 5FSRA 5A93A 1Q7Y4 2HMLB 4HESA 4OQIA 1KGEA 1K6RA 2ZLYA 3CME3 1VQ83 4X66M 2WGVA 3BOSA 3OC2A 2ZC3B 1N32M 3DWZA 3JUMA 4OOYA 3I0YA 2OTJ3 2INXA 4KZ1A 4KODA 1E3UD 2KCDA 5GLBA 3J81S 1ZG6A 1D6YA 1GYBA 2ZC5B 4LV1A 3MXSA 4LF9M 4LF6M 4E3LA 5HAPA 3CC73 2XSZD 3GPUA 1LNHA 1PWCA 1NY5A 3PAGA 2KEBA 5DTSA 3CCM3 4EBPA 4LJAA 3FGYA 4R4RA 3PNVA 3K5TA 2BJWA 4GKUA 4IVKA 1J09A 5FQKA 2D7EA 1O7PB 2Y2PA 1TDZA 2X49A 4B3TM 3NCKA 3L29A 2GU3A 1FCOA 1IN6A 1DGFA 4GMQA 3WS0A 1SXJD 5JI3E 3UDIA 2D1WA 4HM8B 3GVBA 3G8ZA 2H10A 3NC8A 4QU3A 5EPHA 4PMAA 4RX3A 5LC6A 1TDGA 3IF6A 2QENA 4I8OA 2E2UA 3LVWA 2FFFB 1GA0A 5EE8A 1ROAA 3FTEA 1MY8A 2HMJB 1KC84 1V74A 1D2NA 3DMCA 5EQLA 2V1UA 5EXPA 1YSYA 2F5SA 1FCNA 3N9HA 2L4VA 1HNWM 3ECFA 2QZ6A 2UXBM 1IM2A 3VP3A 3HLWA 2HMMB 3H3HA 3KDSE 3PTEA 1JJ22 3MKFA 3D4FA 4Z6YA 2F5QA 3FZWA 4JLFA 1RP5A 2WKEA 3HHWA 5EXTA 3HREA 1US1A 3HLCA 2Y2MA 1BLCA 4O8SA 2HMOB 2C9OA 1GD4A 1U5OA 3ALAA 1W5SA 3GO8A 4K1VA 1N75A 1DGHA 3LCEA 4LJ9A 4N1HA 1XNQM 4ZTKA 2GBWB 2H0YA 3UO9A 4WHAA 3LY4A 4S2MA 4CGYB 3WHKA 3SX1A 4NSOB 2I7PA 2EX8A 1JB2A 4WMCA 4R23A 1FNNA 5FTLA 3IG5A 2G2UA 3L2AA 4FCTA 1MWRA 5F1FA 2O3OA 3MZFA 3FYCA 1BULA 3PCSA 3LOYA 1SXJC 4Y0TA 2Z3XA 3G30A 3MHVC 3A3IA 1O7MB 3IG8A 1O7GB 5A2QS 3U6OA 4OW0A 3LXUX 4DXBA 1YGEA 1L2BA 3H51A 3ITAA 1I5QA 2EX9A 1W7CA 2A49A 3JUQA 5HARA 4LMIA 1KD14 3CMZA 3FUTA 4WW0A 5ELUA 4M0WA 2JBFA 3EE1A 2WKIA 1IKGA 4QWTA 3LTBA 2ZM2A 3MYTA 2YQZA 2LNHC 2R62A 3J7Yd 4U3TA 1EA2A 3JYIA 5DF9A 4LRSA 4IBJA 3KP0E 3WS2A 4UA7A 1YJN3 2Z6BA 3CCJ3 4G4OA 1HU9A 3HJSA 1R7RA 4R4SA 4JI7M 2YNMD 2W03A 2HCBA 3SMPA 1EWZA 4JI4M 4R9LA 1GL7A 5AIHA 5BPVA 1DMQA 3LTDA 1NO3A 1IN8A 2XFSA 1G68A 4WP5A 3BEBA 4D80A 4U13A 4I4LA 2VGJA 1DGGA 4X69A 1H8YA 1OGZA 1N36M 3N8RA 1K54C 1RKYA 5A91A 3IH8A 1H8ZA 3AGEA 4JXWA 2GDNA 3U5ZA 2FFYA 1J2BA 1JQJC 3N8SA 4MMZB 1TU5A 1IY1A 3GV9A 2DWZB 2WGWB 4L8PA 4LZJA 1YLTA 2CV0A 4LEHA 3CC43 3UE3A 3MBZA 3OW22 3HL9A 3VMAA 3RGPA 4HEFA 3N54B 1OGXA 1E9RA 3KIIA 3A3JA 4N9LA 1XWIA 4XXRA 2R9WA 4RBNA 3AJIB 5FTJA 1K55A 2QP9X 1QVG2 2CC3A 5TGFA 3UK6A 4K0XA 4GD8A 2FNAA 1IXSB 3JAMS 3G2YA 3CCR3 2XSZA 1LVNA 3PBTA 3CCV3 4NRVA 5TR7A 4TX4A 3RE8A 3HGIA 1W6GA 2E2VA 3IXGA 4K0WA 3GWRA 2OOVA 2C99A 1K28A 4EUZA 4LV3A 5G18A 3U6PA 4LJ6A 3Q2PA 1FJGM 2JE5A 4LV0A 4X55A 4HJLB 1SCWA 3U5ZB 3G4PA 4EBLA 1GHIA 4JF4A 1CK3A 4J8TA 1N34M 4X56A 5TFQA 4FMCA 1NSFA 4KHPM 2BMRB 2Y2GA 2M5ZA 3IXDA 2X02A 3TWKA 1O7EA 2P05A 2EXAA 5I94A 4UAAA 1IYPA 3IHAA 1N9JA 1OHPA 2J7OA 3BB9A 3PVSA 2RKOA 1IXZA 5AEWB 4ZJ2A 2UXDM 3D9RA 4GOGA 1SJWA 3RDEA 4OQHA 4IBKA 4JF6A 4XUZA 1WNHA 3SH7A 4STDA 1G41A 2HDUA 1IV7A 4RNZA 3BRMA 4JKTA 3C58A 4PDIA 3M6HA 4DUYM 4BQMA 2F99A 3IT9A 2DVWB 1W79A 3O88A 1HT1E 2RCXA 1F8NA 4Y7PA 4MBKA 5KP4A 1IY2A 4CJNA 1IBMM 4H61A 3GLHA 3CCE3 4GZBA 3S1YA 5BXQA 1QAMA 4P0MA 3SATA 2KRKA 1A67A 3LH4A 1G3IA 4JYAM 1EQKA 1JKGA 2C5RA 2CFDA 3OPPA 1HQYE 1QAOA 4LG2A 4O02B 3AGDA 3UDFA 4JPMA 2ZJ9A 2W0QA 2DWMA 2XDMA 1N33M 5HX9A 3E2LA 3Q7VA 3NI9A 3JR4A 5EOOA 2XFTA 3B9PA 1IV9A 1LOXA 1BUQA 1DVCA 4FCMA 4ORLA 5IW9A 1CEGA 3EBTA 5EOEA 3NDGA 2L6OA 1PM5A 1DO2A 4FMDA 5KPTA 2HP5A 1ZAEA 3GQ5A 1E3UA 1A90A 4JF5A 3FV7A 5CECA 4E3IA 4BTXA 1JWZA 4Y0OA 2ZBKB 4AG6A 3ER7A 4EYCA 2Y2LA 4WEKA 2Y21A 4CDLA 3S27A 3HLEA 1AR0A 4RNYA 1QMEA 4LFAM 2W56A 4OONA 2IMJA 3EB8A 3C4OA 4OVZB 2J8YA 3R9XB 4HZBB 2FE8A 4B3SM 1K57C 1HTZA 3PFIA 3GSGA 3HUNA 3NBIA 1GL6A 4MEIA 2GU1A 2B5RA 3M0EA 3CCS3 1HD8A 5C18A 3FCSB 5EVHA 1PI4A 3ZG5A 4HKVB 1ASKA 1Z59A 3FYDA 2BJVA 3O3VA 1PU4A 1QQWA 1VZZA 4QOSA 5CTMA 4M9ZA 3GQ3A 3I553 4RX2A 3CNMA 3RJUA 1IK3A 3CZDA 3ZVTA 1DYUA 3X3XA 4X62M 2G5GX 8CATA 3JUOA 4BLCA 2XZUA 3K1JA 3LYGA 3L25A 1YMXA 3PYJA 5IHVA 1LI0A 2QZ4A 3HHXA 3UE1A 1IT7A 1WXQA 1OACA 2STDA 3UNLA 4L16A 3AMOB 1K54A 5JI2E 2ZQ8A 3EQUA 4MGIE 4P87A 1GHMA 3K0ZA 3OWSA 1Z6FA 3MG3A 1Q2QA 3GRDA 5IREB 3DTMA 4IBEA 1MWTA 1K8A4 2CFOA 2R4IA 4AEQA 2F86B 4GB7A 5IZ7D 1YJW3 4DR4M 4DE3A 5ITXE 4WYKB 3ZCBB 2WGOA 2EUCA 2BO9B 2R4EA 4LCMA 3GRVA 3IPTA 1JN5A 4NSRA 1VQM3 3V3RA 4NL4H 3S67A 2BHMA 3TG9A 1SIHA 5CHMA 5L2FA 5FQJA 1TH3A 5IERA 3IWQA 4XGIA 1TH2A 5GKNA 1PZOA 4QY5A 7CATA 3AKZA 3B7CA 1S6RA 1GS3A 3IHBA 2Y0QA 3SLUA 3JVCA 1L2SA 1DJCA 5EVID 5GHYA 5FAQA 4IBDA 1QYRA 1Q3CA 4KZAA 3MJ5A 4IBIA 4MLLA 2WKHA 1I4WA 3ZG7B 3E9SA 3FSDA 2OSUA 3KKGA 1DMMA 1KWIA 1MU5A 3VP4A 4MNRA 5KSHA 2XH9A 3HVFA 4E3MA 2WADA 1OFHA 3W4QA 5D82A 3Q81A 1FA3A 1ESIA 3U6QA 2D42A 3LY3A 3G31A 1TUHA 5BOHA 2QGUA 4NXMM 1IDPA 2BNGA 4KVHA 3OZHA 1KE4A 3EIEA 2HDQA 4S2IA 3AOEA 3NBJA 3GLFA 4LCBA 4GN2A 1MX0A 4MH0E 3O8YA 4N6MA 1QVF2 2V1ZA 3GR2A 4DR6M 4NOOB 2HPBA 1HT2E 4JI2M 5AI1A 1W6CA 1YT4A 1JTGA 4S2NC 3G2ZA 1IXRC 2RL3A 3ZHHA 1WMNA 1NB3I 1XMOM 2PU4A 4CPKA 2K0MA 2FXTA 5DRVA 5ITRA 1NHGC 2C10A 4AG5A 3SXXA 1U60A 3MZDA 2WO0A 2Y74A 1VQO3 2Q9MA 1STDA 3SS3A 3LVVA 5BR8M 3VKHA 3M6BA 1A2KA 4KQQA 2UUBM 1O7WB 3OXAA 2MC8A 4GD6A 5F83A 3DA1A 4EQIA 5ELJA 4HYZA 2L7IA 5FGOA 1PJIA 5ITQA 4I4KA 1KGFA 3DGNA 3IWOA 5CGWA 3VP0A 3UL5A 5IF6A 2IWCA 3GTCA 1DMNA 2HMKB 3HI7A 4LGYA 3FWLA 3ZH9B 3DZLA 1BLPA 2Y2OA 3KOZE 1YVBI 3CF6E 4K61A 5M18A 1IYSA 1WQLB 3FG1A 3CF0A 3VK8A 3FTFA 3KXEC 3BLSA 3TQSA 3VOZA 2Y2QA 4D81A 4NREA 2HKJA 1ZO2A 1AV4A 1MBLA 4QJGA 1O07A 1FQGA 4NETA 2ZM6M 1W2ZA 2DRWA 1IQXA 1W8YA 2V1CA 3Q8XA 3AFHA 2RGQA 2CWVA 1NY0A 1KDSA 4RA7A 2GBXB 3OWUA 2XR8B 2Y0TA 4WZ5A 1Z5AA 5EUAA 3NY4A 4G4NA 4QY6A 1DJAA 3EJVA 2IUJA 2ZQ7A 3BFGA 5EEOA 4FH2A 3KE7A 1TDHA 4RF1A 4PM9A 3E2KA 1E3RA 1FSWA 3OTOM 2VQFM 5FW5A 4PCZA 1N8QA 5D83A 5KSCA 5AQAA 3RXWA 2CFLA 4WURA 3FTCA 1QVRA 4DE0A 2OQEC 1GD3A 2CFGA 4B7FA 3VP2A 5IG0A 3WOFB 4E3OA 1BLSA 5BVBA 1FSYA 1VQ53 1GHPA 4KZ9A 1W7FA 2ZQDA 4HM4B 4R80A 4GC9A 2CG0A 1C3BA 3W4PA 2UU9M 1Q3BA 1M9GA 2H0TA 1IQYA 2RGOA 3HUMA 3N7WA 1IBLM 5E43A 1HKXA 2V20A 3PNYA 5LC7A 1ZG4A 1M904 4CISA 1L0FA 3P09A 5EVIC 4DV3M 2Z77A 3WDGB 2PBYA 4KZ6A 4MJDA 3GZXB 1C1KA 3FUUA 5FTKA 3I563 1L0DA 1FR6A 3AV0A 1SHVA 3HZPA 4XBYA 5D3OA 1XKZA 1U8CB 4N6UA 4R9KA 3VLFB 4IT7A 4IIWA 2C9CA 1KSIA 4KZ4A 2R4JA 4XM4A 3M6AA 1R2YA 1MXOA 3FUVA 3S4XA 1DJBA 4MBHA 4DF6A 1K82A 4LGQA 5I97A 1XPBA 1RN7A 1KE0A 1XMQM 5CGSA 3GQZA 2UWXA 2BLSA 3I4VA 4H3UA 4ID4A 1VQ63 4IJFA 4LFBM 3GMWA 3UPOA 4FSFA 4L7KA 1K25A 3VP1A 2ZAMA 3L27A 2PZVA 2IUKA 5FASA 3KOWE 2Z7JA 1LL5A 1N77A 2P0XA 4IBBA 3U6LA 3EIHA 2O5RA 1MWSA 1WYBA 4MMYB 4AZFA 1QANA 3FKEA 2CK3H 4P6BA 3DGMA 2HP6A 4C3QA 4R1GA 2LQVA 5KO3A 4X53A 3DM8A 1PFPA 1E32A 4E6XA 2ZQ9A 3ZGAB 4LSOA 5KQ8A 4E6WA 4OU7A 1QAKA 2W2CA 2UUCM 1YLPA 2W9PA 2D7GA 4JI5M 3E4RA 1QAQA 1XGIA 4S2NA 2QPNA 3MK6A 4HL4A 3TDGA 4E3NA 4JV5M 1IN7A 4F94A 1YJ93 4G4QA 4OX9M 5AYRB 1WTHA 1J7KA 2WOHA 3U60A 3CJMA 1W5DA 1RRLA 1EE8A 3NHXA 1IYOA 3GLHB 4K90B 4JI8M 1W02A 3MPHA 1K56D 2Z76A 5JPPA 1LL9A 3K2LA 5HGRA 2PNCA 1JV2B 5STDA 4QD4A 5AIFA 1OH0A 3VK7A 4R3BA 3G4S3 3IQAA 1N8R4 4LF5M 3M8CA 3SYLA 3ZVWA 1DO0A 3ITBA 1O7HB 1Q40A 3GRUA 4OVDA 3TPZA 3BFFA 3A46A 1E97A 1AXBA 3CMA3 4MB7A 5G2GA 3HBRA 1E9SA 3ZNYA 2P09A 3VF1A 2V1LA 5JPUA 4EV5A 2XK1A 3FG3A 4B7HA 4LJ4A 4QB8A 4HM7B 5EP4A 1KDWA 1TH4A 2K54A 4WYKA 4E3KA 2JA2A 4EBNA 3GQ4A 5FQQA 3EHCA 5IG3A 5ITUA 2QBYA 4N6TA 3JUNA 3SAWA 4LF8M 1NU3A 5AQ9A 3NM7A 5HFOA 4EV4A 2DWLA 4U0TA 1OMEA 4R3DA 3NBRA 4DDYA 4JI0M 4OQ0A 3EN1B 1EROA 4M9SA 2H1RA 5FQMA 2X01A 5D81A 3LTAA 3IXHA 2H5SA 4LENA 1NJGA 3KSXA 3N4IA 2Z2LB 2R9XA 3W8KA 2FGTA 2Z2MB 3CPOA 3T8UA 1FGMA 4G1MB 4N6V0 2K47A 3R8FA 3L26A 1L2DA 4QOZC 4WZ4A 2CC1A 3E99A 2CEAA 1IN5A 1FGOA 3VKGA 4M3KA 4BB9A 3HX8A 3DW0A 1D6ZA 4KLNA 2XZFA 2XGLA 3FLJA 1ERQA 2JC7A 4QHCA 1KGGA 3SYKA 1YI23 3HWSA 5FTNA 1VQQA 2E2TA 4OVMA 3PBOA 3GLIA 1J9MA 1IVWA 3MKIA 3NM2A 3A3DA 3QNBA 4BJPA 4GHLA 3DGOA 3Q7ZA 4BENA 4KFEA 3K8ZA 4KZ8A 1PZPA 1JKGB 1NY6A 4DV7M 1G6AA 4WM9A 4OPZA 5GLCA 3SEDA 3NV0A 3PGBA 4J9AA 1D6UA 3PXGA 3SH9A 2F4VM 1NZUA 1NJI4 1PW1A 5DVAA 2Z7AA 4LZZA 5F3WA 4PEJA 3M2KA 5E6JA 4Y0UA 4FD2A 4PPRA 1R2ZA 2UXCM 1E25A 1G8PA 4P16A 3WODG 1ALQA 2ZL8A 4FMAA 3G32A 4XDWA 4LJ5A 1GLNA 2J7NA 1IVUA 3FD9A 1K55C 5IT9S 2R45A 3Q7VB 5CLKA 2O9UX 3KVWA 1ES3A 4WFOA 1Z6TA 3SMSA 3VDPA 5M1AA 1YQSA 5FAPA 1L0GA 2KW0A 5EXSA 2V2FF 2Y2NA 5ITTA 5AIGA 1KQS2 5KQDA 3VSLA 1K3WA 2ZD8A 3Q07A 2FFJA 2WGQA 5JYPA 4D2OA 2ZDJA 3SASA 4X68A 5HW3A 2I9WA 4OOMA 1YLYA 4OH0A 1BUEA 3NV0B 5E2HA 1ZC2A 4M9XA 3T1HM 1R4CA 2OPFA 1IELA 5A90A 3F14A 3BNCA 4KZ5A 2F5PA 4NRWA 4GRIA 1HNXM 1NRFA 1BTLA 4N9KA 2UUAM 4MGZE 1X37A 3ZG8B 2CUZA 2L09A 2DWNA 3ZFZA 4JI1M 1HVBA 5EVLA 3PXMA 1K3XA 1FGRA 4XB5A 3CCU3 2B24B 3FUWA 5DF7A 1Q864 1JR3A 4C6YA 3X3ZA 1K734 1PIOA 4N92A 5KPZA 3MZEA 3QHYA 3GZRA 5GLDA 3PBSA 3SS5A 4KFFA 4OPQA 4UA6A 3HJQA 5IG5A 3EQQB 3HLBA 2HMNB 1K56A 1QALA 3ZCZA 4X64M 3DXOA 2B1XB 4DE2A 4U0XA 2VIIA 1NJFA 1CEWI 4NXNM 4FR9A 3SC3A 5AQ7A 3W0FA 1VDDA 5CGXA 4PD2A 2DNSA 3FYZA 1NXYA 1S723 4GKJM 3CXC2 3O87A 3IWIA 3PAEA 3GZBA 1YMSA 2CIUA 2G8LA 1SXJB 3QK9A 1MPLA 4O2HA 1S5AA 5HAQA 3DY5A 1K41A 1UUVB 3GPYA 4DV4M 1ONHA 1OF5A 1MWUA 2EO2A 1IY0A 1G4AE 3HLGA 2YFQA 2Y91A 3STDA 5CERA 1PW8A 1XXHA 4OPRA 2BG1A 4MBFA 4OK0A 1DGBA 1JN5B 1TP6A 5F1GA 4WWUC 2HDSA 4QNRA 4IJEA 4B08A 2W6JH 2AHMA 5FATA 3OWYA 3FTDA 2Q07A 1CI9A 3KFQC 1EI5A 1RRHA 4JBFA 3A42A 2E5LM 5EXXA 1KYIA 5AQBA 2ZQCA 5FSWA 2Y73A 2VQEM 3KZTA