2XFSA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
427
structure length
420
Chain Sequence
b'VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 138
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xfsA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xfsA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xfsA02
2J8YA 5TR7A 1FCNA 2WKHA 3A3DA 3NDGA 4E6XA 2DRWA 1BUEA 4WBGA 3HBRA 4QB8A 3GQZA 5HAPA 1ONGA 3ZCZA 3G2ZA 5CHMA 2G2WA 3VP4A 3UDFA 1MWSA 4MBKA 4S2JA 3VSLA 2Y2MA 3IWQA 4GDNA 3OPHA 4KZ7A 3AGDA 3FZCA 4BLMA 1VQQA 1L0DA 5JYOA 5CTNA 1ZKJA 3HLBA 1NRFA 3HLEA 3S22A 3SS3A 3N8RA 5M19A 3MKFA 1NYYA 4ID4A 3G2YA 3BFDA 4S2NC 1IYQA 3B3XA 3MZDA 3MZEA 1PWCA 5CGSA 4C3QA 2IWDA 2HP9A 3IF6A 5FAQA 1K56D 3PAGA 3Q7VA 2ZC6B 2ZQ9A 4IEDA 2XFTA 2XF3A 3LCEA 4HEFA 3UPNA 3P09A 4R3JA 2B5RA 5FAPA 2CC1A 2Y2GA 3Q82A 4BJPA 1MWRA 4ZDXA 4LV3A 1PWGA 4E3IA 2HP6A 1YT4A 2WKIA 4MBFA 4P0MA 1E4DA 1M6KA 4EQIA 3GV9A 5EUAA 2J9OA 1FSYA 1NZOA 1DJBA 1FR6A 1RCJA 3IH9A 4KZ4A 4UHUA 1LLBA 5GL9A 3ZVTA 3Q1FA 5E2FA 3IXBA 5CERA 4UAAA 4E6WA 5KSHA 4R1GA 2HDSA 4WEKA 1U60A 1JWZA 1E3UA 2PU4A 3A3FA 4XXRA 3OZHA 2H10A 1TVFA 1K25A 2ZM0A 1DJAA 4QU3A 2WGVA 4RVAA 1ZC2A 1YMXA 4NETA 3IXDA 3TOIA 5FI2A 4OVDA 3BFCA 2C6WB 2P9VB 3ZG0A 1WE4A 4JXSA 3SS5A 4HBUA 1GA9A 2ZMAA 3G30A 4YFMA 2I72A 1ALQA 4XUZA 1PI5A 4QY5A 5CHUA 2JC7A 5TFQA 4Y0TA 2XH9A 5F82A 4E3MA 5FI7A 3LY4A 2H0YA 3A3JA 1E25A 3JYIA 3UDIA 3VP3A 3QNCA 4BQMA 1K55C 3VSKA 3N8LA 4A5RA 4EWFA 3UY6A 3V3SA 1ES2A 3O3VA 1CI9A 1CEGA 4X56A 2E8IA 1BZAA 1WYBA 3V39A 4CPKA 4DE3A 1BLSA 5GHXA 4MEZA 1VM1A 1EROA 1J9MA 5GLCA 5EOEA 3FYZA 1PW1A 1K56A 5L2FA 1RP5A 3HLWA 3UE0A 1YLPA 2Y2OA 2PBYA 3BLMA 3MXRA 2JBFA 1K4EA 3WRZA 4GNUA 1ES4A 4KQQA 3LEZA 4PM6A 1IYPA 5FATA 3SOIA 3UE1A 2QZ6A 3S4XA 1PW8A 3S1YA 2HP5A 3NIAA 2WKEA 3QNBA 4BENA 4GD8A 2ZC3B 1SKFA 3GR2A 3ZFZA 4PM7A 5CTMA 1DJCA 4R23A 3Q81A 5FDHA 3RXXA 4WELA 4R4SA 4KZ8A 1KE4A 4GN2A 4BD1A 4N92A 4QD4A 4KZ9A 1K38A 4LV2A 3C7VA 1BTLA 4U3TA 2Y55A 3BM6A 4KZ6A 3G32A 5F83A 1CI8A 3G34A 1TDLA 3N8SA 2XGNA 5GLBA 1HTZA 4RX2A 4DXCA 3HVFA 5CXWA 4OQIA 1XPBA 3VOZA 3M2JA 3ZG9B 2Z2LB 5IHVA 4RX3A 1EI5A 5FQ9A 4P6BA 4JKTA 4CJNA 3P98A 2ZJ9A 4JBFA 5FAOA 5FQKA 5GLDA 5AQ7A 1NYMA 4DDSA 2WYXA 4ZTKA 4LV1A 3AGEA 1W8QA 5EVID 2QMIA 3V5MA 2Y2IA 4BL3A 3OC2A 1RGZA 1IKGA 1K54A 3NC8A 4FCFA 1G6AA 4RYEA 1W7FA 4DXBA 1FCMA 1YQSA 2R9XA 3PBRA 2VGJA 4UA7A 1ES5A 4LCLA 2R9WA 5A93A 4OONA 2ZD8A 4X68A 3M6BA 4Q8IA 1H5XA 3VP1A 5CEBA 1K57C 3E2KA 3O88A 5E2GA 4FH2A 3RXWA 4PM8A 3WS2A 1MPLA 2XQZA 4S2PA 2EFUA 3ZGAB 1M40A 1LI0A 3SH7A 1I2SA 3OPRA 4L0LA 2WUQA 1GCEA 2Z2MB 4GKUA 3W8KA 2EX8A 4WZ5A 2EXBA 3MBZA 3OPLA 4H8RA 4EV4A 5CEDA 2OV5A 4OPQA 3VOYA 4MBHA 1MWUA 4OH0A 1DY6A 2ZLYA 2HDRA 1PWDA 4PMAA 3ZG8B 1TEMA 2ZC4B 4OKPA 1JWPA 1CEFA 3HLFA 3RJUA 3UNWA 4ZBEA 5M18A 1O07A 4R0QA 5TGFA 3BLSA 1K6RA 1PZOA 4OQGA 5A92A 3EQVA 3PBTA 2XFSA 2Y2JA 3PTEA 5CRFA 2ZM8A 3W4QA 5CHJA 3IH8A 1KGFA 4DE0A 4WYYA 4P85A 3WRTA 3BFFA 1W5DA 2OSUA 4JLFA 4EBLA 5I94A 1RGYA 3FKVA 4R4RA 4X69A 1FQGA 4KQOA 4GZBA 5AQAA 4EBPA 2BLSA 3PAEA 5HW3A 5EPHA 3IF6C 1K6SA 4B4XA 3N6IA 3ZVWA 2Q9MA 2RL3A 3IF6B 1BLPA 4Y7PA 3Q7VB 4B88A 5HFOA 4DKIA 2WGWA 5F1FA 3IQAA 5E2EA 1ZG6A 3LO7A 1Q2PA 3AGFA 2PU2A 3IHAA 4XUXA 5EVIA 4D2OA 1KVMA 1C3BA 3MKEA 1ONHA 3G35A 4GOGA 4LENA 1MXOA 4K0XA 1TDGA 1SCWA 3ZDJA 4E3LA 1FOFA 3I7JA 4R3BA 1Z6FA 2C5WB 5JYPA 1I2WA 1ERMA 2Q9NA 2XDMA 3A3IA 1XGJA 3IWIA 4FD8A 5HAIA 1QMFA 1N9BA 5CGXA 5HL1A 4F94A 5AQBA 3MZFA 4QJGA 3UO9A 2GDNA 1N4OA 1O7EA 1L0GA 2EX2A 3VFHA 3N4IA 1L0EA 4E3OA 2JCHA 2X71A 2P74A 2Y2QA 1PYYA 3DWZA 5A91A 2WGWB 1BLHA 3DTMA 5CGWA 3HL9A 4K91A 3DWKA 4S2OA 1NJ4A 5GHYA 4S2KA 1HVBA 4KZ5A 3Q07A 3GMWA 1LL9A 3A3EA 5FQMA 1I5QA 3LY3A 5FI6A 4EUZA 2WAFA 2Y2NA 3BFEA 2OLUA 1L0FA 1GHPA 1JTDA 5D3OA 4DE1A 1PIOA 4X55A 1XGIA 1XA7A 1OMEA 1ESIA 1L2SA 1LI9A 3IXHA 3WS1A 4LCMA 1YM1A 3W4OA 5A90A 3NY4A 1IEMA 4U0TA 2WZZA 4Y0OA 2V20A 3WS5A 3VP2A 2ZQ7A 1KGGA 3HUOA 4KZAA 4C6YA 1BT5A 1SDEA 1YLTA 2ZQ8A 3CG5A 1ESUA 3ZG7B 4WMCD 1IYOA 1XKZA 3DW0A 1IKIA 4KZBA 3UDXA 3OCLA 4PM5A 5HAQA 3ISGA 3CMZA 3PBOA 3OPPA 4JF4A 2EX9A 3PBSA 2XR0A 4P87A 5FQJA 3GSGA 1MWTA 5J8XA 2EFXA 4WM9A 4FSFA 4E3JA 3HUNA 1KE0A 5GHZA 2XLNA 4OQHA 1JTGA 3FV7A 4S2NA 5F1GA 3MXSA 4K0WA 4OPZA 4N1XA 4KG5A 3HLCA 4OQ0A 4WZ4A 1PZPA 5DF7A 1HZOA 2ZQDA 2EXAA 2XK1A 5E43A 2J7VA 2FFFB 2WK0A 3IXGA 1CK3A 3NDEA 2WZXA 4KG2A 1S6RA 4RA7A 2ZC7A 3PBNA 1AXBA 3GTCA 4JXGA 1JVJA 1EWZA 2DNSA 3NBLA 1GA0A 3GRJA 4S2IA 4IVKA 4BL2A 2HDUA 4QHCA 4GB7A 4ZAMA 3FWLA 4N9KA 5FA7A 3C5AA 1K54C 3Q7ZA 4WEJA 1KE3A 3BECA 2IWBA 1WYCA 2X01A 3VP0A 5DTKA 4S2MA 3C4PA 1JWVA 1BSGA 3M2KA 1S0WA 5EECA 5DF8A 5DTSA 4Z9QA 1KGEA 3HREA 4JF6A 2Y2HA 1ZG4A 1KDSA 4PM9A 4JXVA 4UA9A 1XX2A 4OOLA 2H5SA 5DVAA 4GDBA 2P9VA 5EOOA 4JPMA 5GLAA 4N1HA 5KMWA 5M1AA 1Y54A 4DF6A 4OPRA 5U47A 3V50A 1MKIA 1BLCA 1HD8A 2HDQA 2HPBA 3MFDA 1MY8A 3D4FA 3QHYA 4JF5A 4WZ5C 3SH9A 4OP8A 4KQRA 4M3KA 4C75A 1KDWA 3G31A 4LV0A 4WMCA 4FH4A 4KG6A 1IYSA 2Y2PA 2JE5A 1K55A 1LHYA 2WADA 1YLWA 2UWXA 1FSWA 3IWOA 3BYDA 4Y0UA 3N7WA 4YINA 4KZ3A 1IELA 3V3RA 5KSCA 3ZNYA 3UN7A 4IVIA 5HARA 3O86A 4E3KA 3BRMA 5FASA 1H8ZA 3CJMA 3WWXA 2A3UA 4X53A 5EE8A 3VFFA 2DCFA 3CZDA 4N9LA 2QPNA 2Y91A 4X6TA 2WAEA 1W8YA 1G68A 3ITAA 2Y59A 3VMAA 3IHBA 2BG1A 3BFGA 3HLGA 4U0XA 3GVBA 3PBQA 1H8YA 3ITBA 3C4OA 3FKWA 3IF5A 5HX9A 1XP4A 3UE3A 4QY6A 3TSGA 1PI4A 3EQUA 1MBLA 2OLVA 5G18A 2IWCA 4OPYA 5EVIC 3WS0A 3IT9A 5EVIB 4DDYA 2V2FF 5CECA 2ZQCA 4JXWA 1GHMA 2Y2KA 3SS4A 4O7DA 1YLYA 2EX6A 4ZJ3A 4MLLA 1SDNA 3E2LA 3HLDA 4OLGA 1BULA 3BEBA 1LL5A 3ZHHA 5DTTA 1YLJA 3C7UA 2FFYA 3OCNA 3WS4A 5EVLA 2XEPA 1FR1A 4IBXA 1QMEA 1W79A 5DF9A 3ZNTA 4HBTA 4KENB 3SH8A 2VGKA 1XXMA 1GHIA 2J9PA 1NZUA 5KZHA 3UPPA 4EBNA 1SHVA 2ZM2A 4E3NA 3UPOA 5E2HA 1YMSA 3W4PA 1NY0A 4GD6A 1Q2QA 4BD0A 1ES3A 4MNRA 4OOYA 4DE2A 2XD5A 5BOHA 4OOMA 1KVLA 5FQIA 3NI9A 1XA1A 2XD1A 4ZJ2A 1FCOA 1NXYA 2RCXA 2ZC5B 3NCKA 3O87A 2A49A 1K57A 2Y4AA 3G4PA 4S2LA 5FSRA 4OLDA 4ZJ1A 4NK3A 1YLZA 4OP5A 2G2UA 3TG9A 1E3UD 1ERQA 3M6HA 5AQ9A 5FQQA 4PPRA 4IBRA 4B4ZA 3ZG5A 1K4FA 2H0TA 4HESA 2ZQAA 2V1ZA 3HUMA 2Y2LA 4UA6A 2WGIA 4DRTA 2X02A
chains in the Genus database with same CATH superfamily
2J8YA 2FE8A 2WKHA 5TR7A 2JWSA 4P16A 1RGAA 4IT7A 4NHFA 3NDGA 2DRWA 4E6XA 4KZ1A 1VETA 2JXNA 3LVVA 2P38A 3OXAA 1XJ3A 1RGHA 4EW5A 1ONGA 2F5MA 3AOEC 3VP4A 4DR6M 3PCRA 2A24B 3VSLA 1SJWA 3LI8A 1T18A 1BRKA 1V33A 1VQ73 1L0DA 4EXOA 3SFZA 1ZKJA 1GJSA 3GQ4A 2P04A 1P9RA 3CC23 1A2PA 4IBCA 3BNCA 3NBBA 3N8RA 2K9DA 1IT8A 1RRLA 1QANA 5AEWB 3ALAA 1QAOA 2CG0A 2ZM6M 2F5WA 3CCQ3 2J3WA 2IWDA 2UXCM 1WJ7A 3LMMA 5HDCA 3SBJA 5FTKA 3JUOA 1BSEA 2XF3A 3LTCA 4HEFA 2YQZA 3HHZA 4DV2M 1XFQA 4BTYA 2CC1A 1AQZA 1L8QA 1IOUA 3BB9A 2OOVC 4FCJA 2HHHM 1MWRA 3FG1A 4IPBA 3LR3A 3EIHA 2OOLA 1YT4A 2WKIA 1E4DA 3IX4A 3DFZA 1ZS7A 4EXRA 1A0KA 3GV9A 2J9OA 2K31A 3KOZE 3IH9A 1FR6A 2DVWB 3U6OA 3FG3A 3U6EA 2XR8B 3IXBA 3HJKA 1VZZA 4UAAA 1N9NA 2HDSA 3T4OA 4X66M 1E3UA 2GU3A 1IQ8A 1S5AA 3CD63 1K25A 1TVFA 1V74A 1C1KA 3U6CA 2SBLA 1UGUA 1JNUA 1YMXA 4NETA 3HU1A 1QAMA 4DJ3A 3PVSA 3BFCA 3ZG0A 1WGLA 2P9VB 2XROA 3UMMA 1P97A 1NLYA 4JXSA 4HBUA 1GA9A 4HEOA 2V1UA 4R71A 4FTXA 1XB2B 3GWRA 2I72A 4YFMA 2WGOA 4NC6A 1VQ43 1WGNA 4NL4H 3JR4A 3NECA 2XH9A 4E3MA 1E9SA 2RRUA 3GPUA 3JYIA 3VP3A 3QNCA 3NX0A 2C11A 2ZL1A 1Y4OA 3GLIB 5EM1A 2B3TA 1I3IA 4LPZA 3PR6A 3MSOA 2JZ0A 5AIFA 3V3SA 1ES2A 2CWBA 2V1LA 3UMEA 2UUBM 3B74A 3IBJA 3PNVA 1WYBA 5CF1A 4DE3A 5E26A 4IJFA 1VM1A 5GLCA 1J9MA 4FW9A 3K0ZA 3GP1A 1FGMA 3DTIA 3U97A 2V6ZM 1G0TA 4GHLA 4MN7A 2PBYA 3T6PA 4XDWA 3UNLA 2PD8A 1IVWA 4EV2A 1IYPA 2QZ6A 3S1YA 3NIAA 3MHVC 2WKEA 5ITQA 4BENA 4DV7M 3ZFZA 4L8OA 3EGXC 4EEUA 4G4RA 1AUAA 2DZOB 1YJW3 3G4S3 5FDHA 4WELA 4FD2A 4KZ8A 2XSHB 3URPA 1TDZA 4W5WA 4LV2A 3C7VA 2Y55A 1SKOA 2C96A 3BM6A 2KNVA 5F83A 3UZUA 1SIIA 4FWDA 2R46A 5GLBA 4N6MA 2WKQA 5CXWA 1K3WA 2VGLS 4RX3A 1VEGA 1L3LA 3D9RA 4JGOA 3FG4A 1AWIA 1C7HA 2ZJ9A 3MG1A 3DMCA 5AQ7A 4DDSA 2RGQA 3WA3A 1YKDA 2WYXA 4ZTKA 1RGKA 3T4KA 1I3FA 4FWHA 2SARA 5EVID 2F5QA 3V5MA 3LH4A 2W1TB 1OQYA 4N6NB 4FCFA 4IHQA 1W7FA 4DXBA 1YQSA 1CJFA 2C99A 2WGQA 1ES5A 2JKGA 3B7CA 3FUXA 2ZANA 3TWMA 2YKFA 4OONA 4DUZM 4O0PA 2X49A 3E2KA 5E2GA 2C10A 3T1YM 1TFOA 3OLOA 1N9EA 1SXJA 4MH0E 2XQZA 3ZGAB 2V8CA 3OWYA 1M40A 1IQXA 1ZMVA 2BWBA 2K6BA 1W2B2 4L0LA 5HDSA 4QNRA 2XSZD 5DNYA 3UB5P 5HZHA 1FGRA 1US1A 2ZBBA 1W00A 1BVSA 2EKKA 2EX8A 2EXBA 3MBZA 3MXQA 1G59A 1M9GA 5AVFA 4JI7M 2VLGA 3KDSE 1KFVA 3LYGA 1O7PB 4OPQA 4NSOB 4H6JA 4LCBA 2ZLYA 4R9KA 1JV2B 1PY3A 3ULFA 3HLFA 3UNWA 1HLUP 3JVVA 3K9MC 3BLSA 1HNZM 4GJ4A 3GQ3A 3DBAA 1K6RA 2D7EA 1PZOA 1DYUA 5CRFA 2XFSA 1LSXA 4MGYE 3ZC7B 4II7A 3VV4A 3B4PA 3W4QA 4WYYA 3BNBA 3V67A 1IVXA 5IS1A 1FUWA 1OPYA 1FQGA 3S7QA 1N34M 1EA2A 3CC43 2XGLA 1TH3A 5AQAA 4EBPA 2I9VA 1IYYA 3LZAA 3KSJA 2R4JA 1F98A 2WKPA 4JI6M 2Z6BA 3CPTA 4DKIA 3IF6B 4B88A 4M0DA 4G3OA 3IQAA 5E2EA 1QUTA 2PU2A 3IHAA 5KPZA 5G4ZA 2JY6B 4K0XA 3ZQ5A 3O8YA 1Q39A 4NPBA 1RGGA 1QVF2 3FRIA 1FOFA 4R3BA 1I2WA 2Q9NA 3DY5A 5DFLA 3KYZA 1N32M 3IWIA 4FD8A 2BT3A 2FNQA 3T50A 3E4RA 1N9BA 2PNCA 1D0MA 4I8OA 2E5LM 2O99A 3MZFA 5GSPA 2ZMFA 4L9EA 4KUKA 4HP9A 3BY9A 3VFHA 3N4IA 1D7EA 4HM6B 1OAIA 4D81A 1L2CA 1K8A4 5LC6A 2OWHA 5IF6A 4ANRA 3DUKA 1HNWM 1BLHA 2UUGC 4M9XA 5CGWA 4WW0A 2PBDP 1IQPA 3RFBA 4HM2B 2CEAA 2QCUA 1RMSA 2F5OA 1E9RA 1NJ4A 1B2MA 3SAVA 4NXBA 4S2OA 4KZ5A 4EERA 3Q07A 3H51A 2LTUA 4HL4A 3PXGA 2WAFA 1VEUB 5FI6A 1T2IA 3BFEA 2IMJA 2OLUA 4GLQA 1GHPA 5HDDA 1PM5A 1PIOA 3F1OA 1QAQA 4B3MM 3L29A 1HZ1A 2ML5A 1XA7A 1TH2A 2L1MA 1XNRM 5F6AA 4YWZA 5HSQA 1SARA 1J5EM 1JR3E 4LCMA 3F1NA 3CCU3 3V76A 4KFEA 1YM1A 4Y3IA 4F3LA 1Q40B 4IIWA 1TS8A 5BVBA 3L28A 5IW9A 4PHTA 4ESPA 3HU3A 3MPHA 2R62A 4LF5M 3H9WA 3VP2A 2ZQ7A 1KGGA 3EEHA 3J81S 1BT5A 4L16A 3LTBA 4MJDA 2PYPA 3CG5A 3ZG7B 3KCHA 3AOEA 2HOHA 4KODA 1IKIA 1Q3CA 1IFYA 2NUPC 2L1SA 5G1LA 2DAEA 4JN6A 4Y28F 4K90B 3PFIA 4B7GA 3E4OA 5KPTA 2XR0A 3UK6A 3K9OA 3RFWA 3SARA 3U61A 4OUQA 4Y17A 1IBLM 3EF8A 3NM2A 3KS8A 1NNUC 3W0LB 3GZXB 5GHZA 1PJQA 1JTGA 6RNTA 2D42A 3F7XA 2ZTCA 4N1XA 1UCIA 1G8PA 3VOLA 3HHWA 1DRMA 1PZPA 3FTEA 3EOIA 1HZOA 2P08A 2XK1A 5E43A 1NWZA 2GEXA 2WK0A 3I553 1CK3A 1LV7A 3NDEA 5HGRA 2B1XB 3KVWA 3K63A 1JRQA 2OOVA 3R7WB 4LRZE 3F14A 3PBNA 2VA0A 3GTCA 4ARZA 1HYFA 3GRJA 3B4OA 5D83A 4BIRA 2L7HA 4IVKA 1RRHA 1S1ZA 2DHYA 2MF7A 6GSPA 4BU4A 1R4YA 4N9KA 4WEJA 1B2XA 2M7OA 1SPUA 1S723 5EFWA 1NRJA 4E04A 4S2MA 2JY5A 5D81A 3C4PA 4R3DA 3M2KA 1OTAA 4M4XA 5DF8A 2Y8HA 4Z9QA 3DOAA 4KHPM 4HM4B 1ZG4A 3A5EA 2DWZB 3U6QA 4JXVA 1XX2A 4OOLA 3T1XA 1Q864 4GDBA 4I81A 1B2UA 3QK9A 4JPMA 1GO5A 5A0OB 4G3KA 4N1HA 5IERA 1FILA 4DF6A 4JI1M 3EBYA 1BLCA 2HPBA 3QHYA 3SH9A 3U60B 4WZ5C 2UX0A 3U4LP 4M3KA 1TJDA 4C75A 4LFBM 3AJIB 4WMCA 2PAVP 4CLCE 1E94E 3T12B 2RFRA 1OTBA 3GRYA 1QVG2 1T6OA 1FIKA 3N7WA 3DH2A 4IBKA 1YJN3 1DO0A 1IELA 3H7WB 3DGMA 3O5YA 4G4NA 3KOXE 2QBYB 3E21A 1NHGC 3JR5A 3LCVB 1H8ZA 1R2YA 2M7VA 2HAKA 3WWXA 3E99A 4OX9M 3VFFA 4REZA 2L4RA 3TE6A 2D7GA 1BRSA 3KN4A 2QPNA 2XSSA 4DN0A 2WAEA 4LJ6A 3ITAA 2F5SA 1NO3A 3VMAA 1NNVA 4CLCD 3HLGA 2R45A 2CV2A 3VK7A 3GVBA 2LVQD 4Z1WA 3C4OA 3C58A 2F4YA 2HMNB 1UWPX 5KP4A 5L09A 2WOHA 2MR9A 4LGMA 2KOIA 2VF7A 5JI3E 3TSGA 3NV0A 2OLVA 3BQ8A 2IWCA 4OPYA 1CH0A 4PKYA 5EVIB 1NWWA 3Q3FA 4WLAA 5LMNM 2DXIA 2LVPC 2PZVA 4JXWA 3SOYA 5CF2A 2CX1A 2VK3A 3SS4A 1YLYA 3HWSA 1JBSA 1SDNA 3HCYA 1LL8A 4OLGA 1SXJD 3LW5F 3I4YA 2UU9M 3TWKA 2K2NA 4IBFA 1BRHA 3D79A 3ZHHA 3C7UA 3AKZA 3ZCBB 3OCNA 3WS4A 2XEPA 1FR1A 5DF9A 1QMEA 2Z7JA 5IT5A 4HBTA 3LCUA 1XXMA 3FKEA 4EBNA 5FTNA 1SHVA 3MWZA 4NRWA 3KFUG 4E3NA 5KP3A 2FXTA 1YMSA 2W0NA 4WWUC 4MN6A 4BD0A 3A42A 5EQLA 4GMQA 1HKXA 2FOIC 2HMJB 5TBMB 2H28A 4NOOB 2XD1A 3K92A 1O7NB 4ZJ2A 2FH5A 1NXYA 5F3WA 2RCXA 1OFIA 1A2VA 4F1IA 1K0KA 2Y4AA 1ULIB 4ZJ1A 4FCTA 3JUPA 5IG4A 1VEJA 2H5XA 4QHSA 4RBNA 4PT5A 5AQ9A 4MGZE 3MG2A 4MGIE 5DRVA 2GXFA 2H0TA 1MN3A 3KYQA 4JV5M 3KZTA 4YY3M 4X2HA 2V1ZA 1TF0B 2W56B 3KO6A 1EIJA 3H3HA 3H82A 3F9SA 3A3DA 4CISA 1PJIA 3PGBA 1BUEA 3MHEA 5A8BA 4Q0HA 3T1RA 4QB8A 2DI0A 5HAPA 3X40A 3QP5A 2FNAA 3UGJA 3A46A 2CK3H 1WQLB 4HVNA 5CHMA 3UE6A 1OF5B 7STDA 3UB1A 1MWSA 4S2JA 2GJ3A 3HZPA 4KZ7A 2D01A 3OWUA 3AGDA 1IM2A 4BLMA 5GKNA 5CTNA 3HLEA 1NRFA 1S4SA 3HY5A 4R3AA 4H3UA 2B95A 4GS9A 3MJQA 1NYYA 1JB0F 1DP8A 2K7SA 3BFDA 3MMPA 1IYQA 3W0FA 3MZDA 5CGSA 2JZ1A 1UWNX 2QSFX 1EEJA 2O5RA 2HP9A 3PAGA 2OWJA 8CATA 2CFGA 2ZC6B 2I9WA 1KWIA 1OUNA 2XFTA 3IS2A 3L9KA 3BY8A 3LCEA 4BMWA 3EE1A 5FAPA 3TQSA 1UM8A 3Q82A 1O7MB 3R9XB 1XJ2A 5ITXA 4GIPA 2KF5A 4MGHA 1YVSA 2BMOB 3GZBA 1PWGA 3J80S 2HP6A 4E3IA 3FH1A 3PCSA 1YGWA 4DJ2A 1FSYA 3F7SA 3NXJA 3EN8A 1NZOA 1RCJA 4XBOA 3RGSA 1L1ZA 3VK8A 3DXOA 4CHTB 3Q1FA 2HWJA 5EXXA 3V98A 3VFDA 5CERA 3E46A 3V92A 5KSHA 1W4NA 1YPRA 4RQ9A 4R70A 1J7KA 3QYEA 4CGYB 2L09A 1IY1A 1DJAA 4R1KA 3RTYA 3T4QA 1SQWA 2KEBA 3FTFA 3IXDA 4JGPA 3FTDA 3BLZA 4I39A 2BNGA 2L4FA 2GEYA 4JI0M 1PFLA 2QWSA 1DGHA 3EN1B 4XDVA 1PJJA 1I2GA 4XUZA 4MMXB 5IG5A 2O0YA 2JC7A 4IBDA 4Q0IA 4Y0TA 2R44A 3WA2X 5FI7A 4IBIA 3M6AA 2VIIA 3SHFA 2HGVA 2F5NA 3UDIA 1K28A 1CEWI 1XJ4A 4EC6A 4FUWA 1IN7A 3FZWA 1YIJ3 4A5RA 3HU2A 3D5GA 1CF0A 2INWA 4EWFA 2DZNB 4EQ1A 1JZOA 1OJLA 1R2ZA 1R4GA 5EXTA 2AADA 2MH8A 1BSCA 3ZH9B 3ZQJA 4UQIM 3TL4X 2QENA 4IBJA 4GC9A 1HNXM 2UGIA 4M9SA 5ITYA 1GD4A 5CXOA 4CPKA 4YOFA 3V39A 1BLSA 5KP1A 3EJVA 1EROA 2V8FA 1T5YA 3FYZA 1PW1A 4KQDA 1K56A 3CHWP 2L2DA 2GBXB 5AIGA 3B7ZA 1YLPA 3MXRA 1VDLA 3BLMA 2Z76A 5K5BA 1J2BA 1BUJA 1ES4A 3LEZA 2YX9A 3JVCA 4KQQA 4PM6A 5DJTA 3F92A 1IU7A 3UE1A 1PW8A 4G3VA 2P5TA 1GVNA 3AHWA 1SKFA 1YSQA 3GR2A 2DNAA 1MC0A 4FWGA 3GO8A 1OTDA 5HD5A 3ECFA 1K734 2VKSA 3G6OA 3LI9A 1KE4A 1G02A 2QJ5A 2L4VA 3ER7A 3CXC2 2Z6CA 4BBTA 1TDLA 5LC7A 3CPOA 3G0KA 2QEX3 1KC84 5F69A 2Z2LB 1A90A 3L2AA 1IVVA 1RCKA 3GLHE 4KFFA 1W2ZA 1DP9A 3SAWA 2R41A 2QYBA 4JBFA 2YNMD 4FVMA 1G96A 4OVMA 3SASA 4B93A 3AGEA 3FGYA 1W8QA 5AI1A 2PD7A 3T4LA 4BL3A 3M8CA 4BTWA 2XA7S 2XRNA 3OC2A 1Q9EA 1G6AA 4O02B 2KA6B 2R9XA 2C4BA 2VGJA 2Y73A 3CF0A 2CP8A 2I7PA 4XB5A 5A93A 1OIPA 4QOZC 2MROB 3LXUX 1G71A 1IXRC 1H5XA 2OAQ1 4ETZA 3O88A 2RBIA 4BBAA 1ZHHB 4MDZA 3WS2A 2HL7A 2OQ4A 2Q2EB 4K0KM 2IY2A 1P9WA 4NREA 1MPLA 2ZAOA 5FEGA 4S2PA 2EFUA 4LF6M 5IWAM 1D1JA 4GHOA 4WYKB 1BOXA 1GCEA 2GSPA 4DV6M 5FTJA 1DVDA 2J3TC 2Z2MB 4GKUA 1P0ZA 4CLCB 2QIYA 3SAUA 3W68A 1I2EA 4EBGA 4WZ5A 3U6SA 2WSEF 1TFKA 2JY8A 3A0RA 1MWUA 4HM5B 1N77A 1PWDA 2UXDM 3TPZA 5BPVA 2IUKA 1CQAA 1JWPA 4OKPA 3RJUA 1YE9A 1QAFA 4JXJA 4BB9A 5M18A 1K41A 1O07A 3FC7A 3DTEA 5TGFA 4KT0F 2L6OA 4J9AA 3BQAA 4HJ3A 2QNJA 4GHAA 3CCJ3 3PBTA 4N6LA 4GCZA 1PNEA 4NXMM 5CHJA 1KGFA 4DE0A 2I7NA 3WRTA 1T1CA 3BFFA 1W5DA 2OSUA 4JLFA 4EBLA 5HPIA 1RGYA 1GMQA 3S7OA 5I94A 1UW1A 2STDA 2W04A 4KQOA 3GZYB 2CFKA 1IN6A 3CWFA 3I0YA 3WHOA 2BLSA 5HW3A 3IF6C 2RGOA 4AFIA 3T38A 2VF8A 4Y7PA 4PDIA 3Q7VB 5HFOA 1IK3A 2WGWA 4ETXA 3LO7A 1U5OA 4ILFA 3RGRA 3KSGA 3PYPA 3DGOA 1KVMA 4FCZA 4GOGA 1L1TA 1MXOA 1LOXA 4B9OA 1Z59A 3U5ZB 4E3LA 1QDRA 1AY7A 2BTFP 2C5WB 1B20A 1JKGA 3CUEC 3GLGA 2XDMA 2EWVA 4GHIB 3AMOB 1V92A 1BUQA 4LJ7A 2GQFA 1VQ53 4YNRA 5AQBA 1NO1A 3UO9A 1N4OA 1GY6A 3KSED 3CCR3 3A98B 1OIZA 1YUBA 2ZDJA 4E3OA 4GRIA 1TRPA 1X1WA 4ITQA 2Y2QA 1PYYA 2D02A 3H4MA 1H3QA 4L7KA 1GD3A 4LZIA 1YSYA 3P7NA 4I5QA 3LT9A 3HL9A 4K91A 1RN7A 2KRUA 3TWLA 2CHCA 3KSIA 1DMQA 1R5LA 4JI3M 2JKRI 5FQMA 1LOWA 1I5QA 3B42A 4ORLA 1CYUA 2Y2NA 1L0FA 3EEAA 2KW0A 4X55A 3IMAB 4X2OA 1TP6A 1ESIA 2Y0TA 1LI9A 3S7NA 4J5KA 4XBXA 3JPUA 3IXHA 2B02A 5AYRB 1DE3A 5A90A 2E2VA 3T8NA 1UGIA 4OVZB 3CAXA 1YHQ3 2WZZA 1QALA 4R6LA 4NSRA 1DETA 1W6YA 2LYXA 4Y0OA 2V1CA 1ZQ9A 1UUVB 5HWWA 3BNEA 4KZAA 4C6YA 1SDEA 1YLTA 2HMOB 2XSOB 3QYBA 2ZQ8A 1IVUA 1PU4A 3GLFB 3GSPA 1SZVA 5ITUA 2EKFA 3DW0A 4HY8A 3UDXA 2A24A 3OCLA 4X25A 1BNJA 3ISGA 1EG9B 1XXHB 4AZFA 5G2GA 3CMZA 3OPPA 3IBRA 4BTXA 3KFQC 2EX9A 3B7QA 2K47A 4XGIA 2BMRB 4NXEA 5JPUA 1MWTA 2W6JH 5J8XA 2HKJA 2BHMA 2WO0A 1I4WA 1MU5A 2EFXA 4WM9A 1N5HA 4HM1B 3FE3A 3HUNA 1KE0A 4OQHA 1CQSA 3FV7A 4K0WA 3K8ZA 4GITA 2BU4A 7GSPA 4HM0B 4OPZA 2Y79A 3TE8A 4WZ4A 3JAMS 5DF7A 3HKPA 3GECA 2BASA 4B4XA 2L0WA 2JA2A 1FZUA 3S5CA 3G713 1SG9A 1RGLA 1BNRA 2VV6A 1S6RA 2ZC7A 4Q0JA 3C38A 3IG8A 4RF1A 3DZLA 2VX8A 5ELUA 1HQYE 4LRXC 2W0QA 3FWLA 5ITTA 3JVUA 1QZEA 1KE3A 1N75A 3NOUC 3U6LA 1F8NA 1IN4A 3GZRA 1W5TA 2DWNA 1MZUA 3NUVA 1JB5A 2XLJA 3AGOA 4EIWA 5DTSA 2X8AA 3SEDA 2JKTI 3HREA 2ZTDA 4XK8F 3DM8A 2Y2HA 2C9OA 1Y4KA 2KDLA 4UA9A 2F5PA 5DVAA 2P9VA 5GLAA 5FSWA 2OOAA 3LQRA 5KMWA 5M1AA 1Y54A 5U47A 3V50A 2KX6A 3J27B 2PYRA 4LJAA 3PZWA 1HD8A 3ZCZA 1PJTA 3D4FA 4EW7A 3MR0A 1KSIA 1KDWA 2LH0A 3L25A 1XMQM 3BXWA 2Y2PA 2YFQA 1W5ZA 1LHYA 4AKHA 4UEYA 3IWOA 4HI4A 4N6OB 3GLIA 4Y0UA 3V3RA 4RZMA 2W3EA 3SXXA 5KSCA 3ZNYA 4B3SM 5HARA 1VQL3 2V0WA 5FASA 3IX8A 1V34A 3CJMA 1I0VA 4X53A 4ZPXA 2VEAA 2DCFA 3X3YA 5J7EA 4LRTA 3VKGA 2Y91A 4NRVA 2O9UX 3CPW2 1V9ZA 4HAAA 1WMOA 2W3GA 2KF4A 3GRDA 1OKSA 3BFGA 4LZZA 4BBVA 4IIAA 1H8YA 3FKWA 3IF5A 5F68A 4IBEA 2C98A 5HX9A 1RLSA 1O7WB 1VB6A 4QY6A 1OHPA 1PI4A 3EQUA 3L27A 3MQOA 3NJAA 2JKFA 5EVIC 3WOFB 4PAUA 5AIHA 1YGEA 3FUWA 4TUWA 3HOHA 3U2AA 3CGWA 2CV0A 2LBCA 2EX6A 3B8LA 1EQKA 4Y5FA 4MLLA 3DTKA 3E2LA 1BSAA 4GKJM 3GLHB 4QHTA 2P0MA 1IV9A 2R4EA 2JDIH 3A0SA 2FFYA 3QP1A 3T4TA 2UV0E 5EVLA 1Z6TA 4IBXA 3SH8A 2KAAA 4JGRA 3SYLA 1Q3BA 2AAEA 4RNAA 4YHHM 4EV5A 1GHIA 1U8CB 2LWXA 4HJ4A 1F4IA 1TDHA 1EE8A 1WNHA 2W1TA 4Z8XA 3NOTC 3W4PA 1NY0A 4MMYB 1ES3A 4MNRA 1X37A 4OOYA 2CWVA 1OT6A 5FQIA 3UL6A 3NI9A 3SMPA 2Z4RA 2UUCM 1FCOA 4MCWA 2A49A 3P01A 5FSRA 4O8SA 4OP5A 4RNYA 1ZMUA 4NXNM 4LGQA 4I3AA 1E3UD 2QHKA 3H4JA 1D06A 4J5GA 4QNMA 2Y74A 4IBRA 4B4ZA 1GKIA 3ZG5A 1K4FA 3FRHA 1VQK3 1WXQA 3T1QB 1XC8A 2NQ8C 2QHOB 1FCNA 1GS3A 3D8BA 5FTMA 4WBGA 1S66L 4EU0A 4QWTA 3HBRA 3GQZA 3OW22 4FR9A 1G5UA 1C54A 3UMDA 3FKAA 1UCJA 3UDFA 4EESA 2Y2MA 4GEWA 1WR1B 2CG1A 3GDIA 1BNIA 1D6UA 2VQEM 4DUYM 5JYOA 3MJ5A 4RKUF 3SHGB 4HM8B 3HLBA 3S22A 3FUTA 3J7AS 1OACA 3SS3A 4OK0A 5M19A 2R0IA 3NBJA 4B3RM 1HJPA 1TU5A 4ID4A 4O01A 2LNHC 1LOVA 4S2NC 3MZEA 4L15A 1PWCA 3HX8A 4C3QA 3KKGA 4Y2FA 3IF6A 1AV4A 4PDGA 1IN8A 1LT0A 3GPPA 3BU4A 3P09A 2B5RA 1PRBA 5AEUB 3ILKA 2Y2GA 2M1CA 1JB2A 2MC8A 4BJPA 3CLOA 4AKZA 4LV3A 4MBFA 2GU1A 3NQZA 1M6KA 1ISKA 4B7FA 1TTEA 3CCV3 1N78A 3LOYA 3KSHA 3IHPA 5EUAA 4UHUA 4KZ4A 5HWVA 1K3XA 2KXEA 2EO2A 3ZVTA 4GC5A 3CUEA 3VE4A 4H61A 4I3JA 2FZ0A 4G4OA 3N9HA 3HIIA 3OTOM 3KOWE 2PR5A 1U60A 1DV0A 1GSXA 3A3FA 3OZHA 5KQDA 2OAP1 5LMUM 3R8FA 2RGHA 1NY6A 4RVAA 3TOIA 3FCSB 1TR8A 4OVDA 2OQEC 1TF1A 3HX3A 4LYLB 2C6WB 2W3FA 1STFI 3CNXA 1X1YA 3SS5A 4L8PA 1FYSA 4KFDA 2O9BA 1J09A 1SXJE 2FH0A 3J7Yd 2VV7A 3G30A 4QPRA 4QY5A 1VQ93 4TX4A 5F82A 5C18A 3CC73 2KF6A 2CFLA 1RJOA 1VEUA 3HIGA 4BQMA 4DMZA 2EJSA 3V99A 3VSKA 1OTRA 1N5PA 3K5TA 4QWOA 2CRUA 4P6ZM 3UY6A 1YI23 1T19A 1IQYA 3O3VA 2O01F 1CEGA 2H1RA 1Q40A 2OOBA 3MK6A 2E8IA 1BZAA 2ZHXB 1EW0A 3E4PA 4LFUA 4MEZA 5EOEA 1GMRA 4HP4A 5L2FA 1RP5A 4AKGA 2OO9A 2PHYA 2Y2OA 1BNGA 4UN2B 3NQYA 5BIRA 3WRZA 1UUGB 1OTIA 3NHXA 1IXZA 3SOIA 3THGA 3UJNA 1N8QA 4PM7A 2HMLB 5CTMA 1DJCA 1HT1E 4R23A 2C9CA 3Q81A 1RGCA 5FL3A 1OHOA 3FPVA 4R4SA 4BD1A 4QD4A 2ACGA 1BRGA 1W5SA 4KZ9A 2CC3A 1BTLA 3QP6A 3OV4A 1JN5B 3UL5A 2JP7A 5IEOA 3X3ZA 4Q53A 4KZ6A 2GBWB 1IXSB 1CI8A 3N8SA 1NJI4 1HTZA 1X1XA 2K0BX 4RX2A 4DXCA 2B24B 3J7BA 3F1PB 4OQIA 1XNQM 2CW9A 3M2JA 3QWLA 2WOFA 1EI5A 5FQ9A 4P6BA 4JKTA 3R7WA 4CJNA 1ZO2A 1GSVA 3C3EA 1G28A 1NYMA 1FGTA 5EV0A 4K08A 3OWSA 4LV1A 1LNHA 1Z09A 4LJ5A 1I2FA 1ACFA 2QMIA 2Y2IA 2E2UA 1IKGA 1GOUA 3NC8A 3LYXA 4RYEA 1MGWA 3JUQA 2EA9A 2CE7A 3PBRA 1IY0A 4UA7A 4IBBA 4EUVA 4LCLA 1YAXA 2HJEA 3BIRA 4AW4A 4LSOA 2RCDA 9RNTA 5FLXS 3GLFE 4X68A 3M6BA 5CEBA 2CUZA 1K57C 3J2PB 3DGNA 3PYJA 1NVMA 2H0GA 3C30A 3RXWA 4WF0A 1XXHE 2F99A 3FSDA 4D82A 1L5GB 1GJTA 5JBSA 3T1HM 4B7HA 3KIIA 1GMPA 1LI0A 3SH7A 1B21A 3D72A 4XT2B 2ERCA 3QAUA 4CLCC 3U60A 1UI8A 1OT9A 4X65M 5EVEA 4HHDA 3OPLA 3CCE3 4H8RA 2KCDA 4EV4A 5CEDA 2OV5A 3VOYA 2G5GX 1WHCA 4U13A 1QMAA 2OPFA 3DGYA 1NLZA 4OH0A 3ZG8B 4FCVA 1F9IA 2CFDA 1TEMA 2ZC4B 1VETB 4LZJA 2Z7AA 1MKMA 2QKPA 3H7WA 4XM4A 3Q90A 2QBYA 1HT2E 3PHYA 1LVNA 2IA7A 1O7GB 5A92A 1FUSA 3PTEA 1AIPC 2Y2JA 3LIAA 3DA1A 3FG8A 1HU9A 1QAKA 2DWLA 3TJZC 3IH8A 2PDRA 5EPHA 4HLQA 1SXJC 3KSXA 4LF9M 1Z5BA 5DKKA 4GZBA 1JJ22 1K6SA 5J4EA 3N6IA 3ZVWA 2RL3A 2F98A 5HPFA 1BLPA 1TGUA 3CI6A 4MM3B 1KQS2 4QOSA 3SLUA 3AGFA 4XUXA 1L2BA 5EVIA 1C3BA 3N54B 1GYBA 1RN1A 2R78A 3G35A 4LENA 2L4EA 1RCLA 3KP1E 5KPRA 1Q7HA 3HI7A 3ZDJA 2MGWA 2CMNA 5JYPA 2Z8YM 1Q814 1W01A 2A5YB 2VDBB 1B27A 1UGHI 5ELJA 2WKRA 5ITRA 1QMFA 1X1UA 2GDNA 2VV8A 1M1XB 1L0GA 3LVWA 5G4YA 2EX2A 1IBKM 1DVCA 1D6YA 4FMCA 4AKIA 3Q8GA 1MNLA 1RNTA 3RGAA 1L0EA 2JCHA 2W3HA 2X71A 4IUHA 5DFYA 3DWZA 3CME3 2WGWB 5F5YA 2DAIA 3Q2PA 3DTMA 3IX3A 8CHOA 2BJVA 3ROBA 5HD3A 5TBMA 4RNZA 5HL6A 4EYCA 2YFIB 2QZ4A 5GHYA 4S2KA 1NNJA 3TRCA 3B7NA 2YFJB 3FF0A 3KP0E 1LL9A 2YFLB 4HJ6A 4EUZA 3A76A 4O3VA 1UCLA 3LT8A 7CATA 2QA43 1JTDA 2W1RA 2ZL1B 1T3TA 4LG2A 3BNDA 2VGLM 1OMEA 3FF2A 1L2SA 1UI7A 4L9GA 1R7RA 3WS1A 2WSFF 3VSYA 3D4AA 1JZDA 3NY4A 2QPAA 1ZGXA 2W56A 1IEMA 4U0TA 3BW6A 3GAXA 3B33A 2V20A 1RNBA 4L78A 3K7CA 3ZYTA 2LVAA 1IFQA 1QQWA 1RTUA 1CYVA 3NBRA 2PRFA 3HUOA 4NXGA 5IREB 1ESUA 2O3OA 3PS8A 1IYOA 4WMCD 1OF5A 2G7UA 3CCM3 3SATA 3PBOA 4JF4A 1VQ83 1XWIA 1LRAA 3PBSA 5FQJA 4FMAA 4HM7B 3HGIA 3SYKA 3SX1A 1VQ63 3CF6E 3GQ5A 3QP8A 2C5RA 1PFPA 2RSXA 2DAGA 1R4CA 4S2NA 1SKOB 3VLFB 5F1GA 3MXSA 3S7PA 2JQ5A 1Q7Y4 4LFCM 2JKRM 3HLCA 3F8XA 1E3VA 1E32A 2ZQDA 2CFWA 5IG0A 2GX5A 3Q1CA 4R9LA 1TS0A 3T8UA 1ASKA 2P0XA 1K9M4 2LB5A 4Y13A 4LGYA 4RA7A 1TUHA 1EWZA 5L10A 3CTWB 1N36M 4LF7M 1GA0A 3VDPA 2MJ6A 4S2IA 1ULJB 2EA0A 1OJGA 5LBRA 2Y20A 4GB7A 4GW9A 5FA7A 1K54C 5DJUA 2CWUA 1WA9A 3C9PA 3BECA 1H0MA 2FFJA 1D0KA 4FCWA 4CJ6A 2HV1A 1GSWA 4BBUA 1NU3A 5EECA 4N3VA 1W7CA 2KLIA 2Q07A 4JF6A 1FW7A 2BJWA 2P09A 1M904 1KDSA 3K3DA 3PNYA 1PYLA 2H5SA 1SXJB 4GKKM 2BO9B 2OQEA 1S4RA 3LFVA 1GOYA 4GH9A 1OPXA 1JNQA 3UB7A 2XRXB 1DGGA 1MY8A 4HKVB 3LUQA 2V1AA 4DV4M 3KXEC 1R6BX 4KQRA 4DR2M 3SMSA 5IENA 4FH4A 4KG6A 1IYSA 4H6JB 5IU1A 1JB4A 5BXQA 2WADA 2UWXA 1FSWA 1JR3A 3BYDA 4YINA 4PCZA 2DAKA 3LR5A 2PT7A 3T4SA 4BWIA 1MOLA 1WMPA 3UN7A 5CX7A 1GOVA 4L4UA 3JUMA 3MG3A 4R80A 3CZDA 4N9LA 2CFOA 1ZV1A 2B18A 1W8YA 1WTHA 1G68A 2UXBM 3LIDA 3VDUA 5FEFA 3FLJA 2BG1A 4NG2A 5J3WA 1Y28A 2OTJ3 3UJMA 4NXFA 1ZAEA 5EP2A 3ITBA 2R18A 1QZMA 3PXPA 1N33M 1UDII 2JKTM 1UUWB 4HM3B 3CPTB 4LGWA 1XP4A 4M0WA 2W3DA 4MMZB 2JNHA 5JPPA 1MBLA 1UCKA 3WS0A 2VZWA 3LQQA 3IT9A 1EUIC 2V2FF 2DHRA 2W9QA 1W63M 2ZQCA 5CECA 1OHSA 5AYSC 3L0RA 2Y2KA 4DV0M 1T3BA 5G1KA 1X0OA 3DGLA 4ZJ3A 2OWPA 5ITXE 3HLDA 1BAOA 1BULA 3BEBA 2J80A 1LL5A 3T4JA 4N6UA 1LTMA 1YLJA 3CMA3 5IG3A 4KUOA 4MN5A 5FGOA 3RNTA 5D82A 1S3SA 3RGPA 1W79A 4KENB 4UQIS 3SYUA 1ODVA 2YKHA 2J9PA 4HOHA 1NZUA 3NULA 1V57A 4L6V6 2ZM2A 2LHGA 4X1MA 3U6PA 3RDEA 2H0IA 4HIAA 3UPOA 3PXMA 5E2HA 5KIZA 4JI4M 2ML6A 3QP2A 3EC9A 2XD5A 5L8RF 4OOMA 1KVLA 5BOHA 1LQGC 2V9AA 2ZC5B 1EKMA 3NWLA 3O87A 1NB5I 1K57A 3G4PA 3MSHA 4S2LA 4OLDA 1TIJA 4MMNA 4KVHA 4NK3A 4ZM8A 2GZAA 1YLZA 2M60A 5CLKA 3F1OB 2J7NA 4OW0A 1V58A 1ERQA 4X64M 4WYKA 4MEIA 3S29A 3IPTA 2NUTC 5FQQA 4CLCA 1HR0M 3I01M 3F1NB 4HESA 4PEJA 4F3LB 3AV0A 2G8LA 4I5SA 3EB8A 2Y2LA 5EP1A 1BIRA 2KRTA 4DRTA 4HQAA 2W82A 2FS1A 4R38A 2XZFA 3A45A 3SOAA 1DMNA 4D60A 1FGOA 4I3IA 3AGNA 1QJGA 3K2NA 4LF8M 1I70A 1PGYA 4Q7JA 1BNFA 4WURA 1VQ1A 3G2ZA 2P7JA 5HOHA 2G2WA 3MQ0A 3RH8B 4MBKA 1OGZA 3IWQA 4GDNA 3OPHA 3S67A 3K3CA 2YR0A 3FZCA 1ZTUA 1VQQA 4HNBA 1XMOM 4STDA 1OCVA 3U61B 3MKFA 2R4IA 3G2YA 1VQN3 2BWEA 4AEQA 2DENA 3B3XA 3CCS3 1N9OA 5FAQA 4IJEA 1K56D 3Q7VA 2ZQ9A 1LQMB 3C3DA 4IEDA 4DR5M 4N6V0 4AG5A 5BU4A 3UPNA 1KD14 4R3JA 5DYIA 2LVOC 4LF4M 3BWLA 3Q8XA 3MKIA 1FA3A 2KRKA 5EXSA 3SVAA 2M7UA 1OAOC 4ZDXA 1A5TA 4EQIA 2O9CA 5IZ7D 3CF2A 2HF6A 4P0MA 4G3WA 4ARZB 3U5ZA 4HZBB 3SC3A 2GNXA 3AFHA 4WUJA 2CHQA 1DJBA 2Z6DA 1BYWA 3WR2A 1W6CA 3MMHA 1LLBA 5GL9A 1B3SA 3WODG 4K1VA 4R7GA 4GHIA 5E2FA 2Y0QA 3AMOA 1N8R4 4M9ZA 1OJ5A 4E6WA 4R1GA 4P17A 3HHYA 1T1AA 4WEKA 2PU4A 1JWZA 4XXRA 1ORYB 2H10A 4WP5A 2ZM0A 3FPWA 4QU3A 3HJSA 2WGVA 2LB9A 4MGKE 1ZC2A 1H6UA 5FI2A 1T43A 1DGFA 1JBRA 4JGQA 1WE4A 4NEED 3KE7A 4K1UA 1NSFA 3KSFA 2ZMAA 2KZSA 4GSPA 2BIRA 1ALQA 1PI5A 1Q42A 5CHUA 5TFQA 2ZBKB 3GPXA 3G16A 3GRVA 1D0LA 1VQM3 4OU7A 4LY6A 3LY4A 2H0YA 3A3JA 1VG5A 1E25A 5FTLA 2CHVA 3IG5A 1Q824 1NY5A 2QGUA 1K55C 2XZUA 1W02A 3N8LA 2LHCA 3VE3A 3HZJA 1NV9A 1LSWA 1IN5A 5IT9S 2D7HA 3N8BA 3G6E3 1QUSA 1CI9A 3LICA 1W63Q 1WIVA 3HJIA 4X56A 4OVZA 3NBIA 5AJGA 3QP4A 2KDKA 3LMLA 2E8JA 4I38A 5GHXA 3M0EA 3EBTA 2IYJA 4K61A 2AVXA 3HLWA 3UE0A 5L8MA 3VF1A 3GLFA 2F56A 1K4EA 3U6MA 2JBFA 3T0UA 3KSPA 3MFXA 4GNUA 5FATA 4B3TM 3S4XA 1OTEA 2HP5A 1IV7A 1XXHA 3QNBA 2F86B 3EX9A 1YIT3 2ZC3B 4GD8A 4LFAM 4IUKA 2KNZA 2K0MA 3EIEA 2LXEA 3NV0B 2IUJA 3RXXA 2HCBA 2H0HA 2DKLA 4GN2A 4N92A 5EP4A 1K38A 3I51A 4U3TA 1OH0A 5STDA 4O2HA 1UFZA 1DP6A 1GABA 1BU4A 1GY7A 2N35A 3WHLA 4GL6A 3G32A 3G34A 1NHWC 4JRFA 1D2NA 2J7OA 2XGNA 2HMKB 3HVFA 2HJ9C 1E97A 3AOGA 1RU3A 1XPBA 3VOZA 5AIIA 3ZG9B 5IHVA 2HZ5A 3S28A 3BJNA 3OOVA 4EEPA 3GLGE 3P98A 4JYAM 5FAOA 1ROAA 1QDTA 3WMDA 5FQKA 5GLDA 1F5MA 2E2TA 4WN5A 1MGRA 3D9YA 3B47A 1ZMWA 1CUKA 2APLA 1JR3D 1BVIA 4GB5A 5KQ8A 1RGZA 1K54A 4WL9A 1FCMA 4Z6YA 4FMDA 3GRRA 1RSNA 2R9WA 1XJ6A 1IT7A 2K54A 2ZD8A 4Q8IA 3VP1A 3KYEA 1RHLA 5DYGA 3OX9A 4FH2A 2FGTA 4PM8A 5H37D 1TD5A 1G3IA 4AQYM 3C8CA 3SZTA 1BSBA 5TGNA 4RNTA 4X62M 1I2SA 3OPRA 1YLAA 2VQFM 3I4VA 3FUUA 2WUQA 2KF3A 2WSCF 3W8KA 1Z5AA 5FW5A 4X1LA 1TS7A 2QP9X 4MBHA 5DKLA 1TTOA 4LJ8A 3FUVA 3H82B 1DY6A 2HDRA 1I0XA 4PMAA 4D80A 3GPYA 3WDGB 1B2ZA 1CEFA 3LEQA 1J3WA 4XBYA 3I04M 4ZBEA 2CIUA 5IEPA 1STDA 4R0QA 4HYZA 4HH3A 4I4LA 5EXPA 3EWKA 3JUNA 1W6GA 1AVKA 4OQGA 2K3DA 4CDLA 3EQVA 3D8LA 1IDPA 2W2CA 3EGDC 2ZM8A 3UB9A 4DR7M 4LEHA 4WHAA 1BSDA 4P85A 2P05A 1KYIA 4XBTA 4GS9B 1E3RA 3E0YA 3FKVA 4R4RA 1M1K4 4X69A 4PKYG 3BBZA 3CNMA 3PAEA 4LLOB 4L9FA 2Q9MA 3D5IA 2J8XB 3IS2B 5F1FA 4F2LA 1G41A 1ZG6A 4LJ4A 3L7HA 1Q2PA 4D2OA 1B2SA 1TRQA 4FOFA 2EWWA 2ZOIA 3LIBA 3MKEA 1ONHA 2DZLA 3UB6A 1TDGA 2KHHA 4AG6A 1RGEA 1SCWA 2INXA 3I7JA 1Z6FA 2CH9A 1QVRA 4JF8A 3GLHA 2DMWA 1BRNL 1ERMA 1G4AE 3BOSA 5MC7A 3A3IA 5HWTA 1XGJA 5HAIA 2D1WA 1TS6A 5CGXA 5HL1A 4WP2A 4F94A 1DGBA 1RKYA 4QJGA 3KS4A 3WHKA 1O7EA 2ZMVA 2ZA4A 3IJEB 1N9JA 2P74A 2OCTA 4RF0A 5DREA 5A91A 1VQO3 1C7YA 2JN7A 1P3QQ 3AL0C 3LTAA 2CV1A 1I94M 2F4VM 3F8HA 1BNEA 1DGHB 3X42A 1BANA 8RNTA 3DWKA 3LIEA 5C5KA 2Z3XA 4LMIA 3EQQB 1DO2A 1HVBA 1STZA 1S67L 3DAVA 2ZAMA 3GMWA 3A3EA 3LY3A 4CQHA 1VDDA 1LXEA 4DE1A 5D3OA 4ZRRA 5EEOA 5FDSA 3KOYE 7RNTA 1XGIA 2KZUA 2MJ5B 4AKYA 3LGOA 3UB8A 1HQCA 4LJ9A 3CU3A 3GRUA 1NV8A 2LVNC 3S27A 3FTCA 3GLIE 4DR3M 2RNTA 3EHCA 3W4OA 2EUCA 5I5LA 1RDSA 3AHSA 2O9AA 3NBXX 1ZX2A 1GL7A 3WS5A 2V0UA 3ICYA 2XA7M 5E6JA 2Y21A 3E9SA 5EP3A 3E4QA 1D6ZA 4PM5A 1IY2A 1ROVA 1Z1SA 1XKZA 4J8TA 4KZBA 5HAQA 4KT3B 4HOIA 1GL6A 3LTDA 3FYDA 4KLNA 3C2WA 4DV3M 3B9PA 4P87A 3GSGA 3MF0A 3E98A 3U1WA 3M7GA 3D3OA 4FSFA 4E3JA 1T1BA 4HZ9B 3OBFA 3LIFA 3HHXA 3TDGA 2XLNA 2IA2A 2J5YA 5DFXA 2W9PA 4KG5A 4OQ0A 4MB7A 3T1SA 2LQVA 2Z77A 1XFNA 2BNKA 1S1YA 2EXAA 4EETB 5RNTA 2J7VA 2BMQB 2FFFB 2R6FA 3IXGA 1GLNA 2HMMB 3CCL3 3MQQA 3FYCA 1DMMA 2WZXA 4KG2A 3SW1A 1AXBA 1FUTA 4JXGA 1AR0A 1JVJA 5AVEA 2DNSA 3NBLA 1JQJC 4BL2A 5C1BA 2HDUA 1YVBI 1F2KA 3MS6A 4QHCA 4ZAMA 1L2DA 4DBGB 4JI5M 1YNVX 3C5AA 3VKHA 5I97A 3Q7ZA 4G1MB 4PD2A 3QRDA 2IWBA 1WYCA 1Q02A 3IECA 4BLCA 2X01A 5DTKA 1XHBA 1GSPA 4HH2A 3FD9A 3VP0A 4FCMA 1JWVA 2GNOA 4L8RC 1BSGA 2WZJA 3B89A 1S0WA 2M5ZA 2O25A 1PJSA 2G3QA 1A2KA 3I563 1KGEA 2JUJA 3X3XA 1NB3I 1YJ93 2PR6A 2X02A 4NKPA 4PM9A 1GY5A 5L07A 2CX0A 2OTL3 2KXGA 5EOOA 1MX0A 3LR4A 4OPRA 1VEKA 1MKIA 4B08A 2HDQA 3MFDA 4IBGA 2Q0OA 3W67A 4JF5A 1H8MA 4OP8A 5KO3A 1WMNA 1N9LA 3G31A 4LV0A 1LNIA 1LOYA 1O7HB 4CCVA 1IBMM 5TJJA 1EFUB 2JE5A 1KSFX 4DR4M 1K55A 1YLWA 2AHMA 4KZ3A 2RKOA 4IVIA 3HJQA 3K9PA 4G4QA 2UUAM 3O86A 4E3KA 2JY7A 3U6DA 2W03A 1BRIA 3BRMA 3CITA 2A3UA 5EE8A 3D3LA 2QJ7A 3T15A 2VJWA 3RE8A 4G6ZA 4X6TA 2DAMA 4I4KA 5EVHA 2J3TD 2Y59A 3IHBA 2V1BA 4U0XA 4KO8A 3L26A 3PBQA 3NOPC 2XSZA 4N6TA 4IJGA 3NHQA 4JI8M 1K82A 1SIHA 1OFHA 2A15A 3UE3A 2L7IA 3KW6A 1AVLA 1BGSA 5G18A 4HBRA 5EM0A 2KNAA 5BR8M 4DDYA 5EJCA 1A67A 5JI2E 4LRYC 2A2LA 4Y15A 1JN5A 3LR0A 1GHMA 4O7DA 1T2HA 1IXSA 4R4KA 1Z5CA 3WOEB 1NDOB 3X41A 3KX0X 1VQP3 1V9YA 2R65A 3VGNA 5EQTA 1JKGB 1FJGM 1NJGA 3F1PA 3GLGB 5DTTA 3MYTA 4JI2M 4O8GA 4P6ZS 1LSVA 3K2LA 3W2ZA 4FMBA 5CK6A 3HJ8A 3ZNTA 1KOUA 1BRJA 3HK4A 2VGKA 3NM7A 2W27A 1VHMA 1G6OA 3STDA 1JBTA 1Y8GA 4ME4A 3UPPA 1FNNA 5KZHA 1NJFA 5A2QS 4DV5M 1QYRA 1PRQA 1YSPA 2ZOHA 4CIZA 4GD6A 1Q2QA 1RN4A 2QQ8A 2DWMA 3K1JA 4DE2A 2JHEA 4LRSA 3F40A 1XA1A 2CHGA 2Z4SA 3A0VA 3NCKA 4DV1M 6STDA 4A3VB 2CKFB 3G8ZA 2X4AA 3DZDA 1FGQA 1MJGM 4HJLB 1BNSA 2G2UA 2CWTA 3TG9A 2ZL8A 1I8VA 1OGXA 4XT2A 3TW8A 4DR1M 4WFOA 1RGFA 3R4KA 4PPRA 4AI6A 2ZQAA 3HUMA 4UA6A 3M6HA 2WGIA 1TH4A 4S12A
chains in the Genus database with same CATH topology
2J8YA 2FE8A 2WKHA 5TR7A 4P16A 3NDGA 4NHFA 4IT7A 4E6XA 2DRWA 4KZ1A 3LVVA 2P38A 3OXAA 1ONGA 3AOEC 3VP4A 4DR6M 3PCRA 3VSLA 1SJWA 1VQ73 1L0DA 3SFZA 1ZKJA 3GQ4A 3CC23 3BNCA 4IBCA 3NBBA 3N8RA 1IT8A 1RRLA 1QANA 5AEWB 3ALAA 1QAOA 2CG0A 2ZM6M 3CCQ3 2IWDA 2UXCM 3LMMA 3SBJA 5FTKA 3JUOA 2XF3A 3LTCA 4HEFA 2YQZA 3HHZA 4DV2M 4BTYA 2CC1A 1L8QA 3BB9A 2OOVC 4FCJA 2HHHM 3FG1A 4IPBA 1MWRA 3EIHA 1YT4A 2WKIA 1E4DA 3DFZA 4EXRA 3GV9A 2J9OA 3KOZE 3IH9A 1FR6A 2DVWB 3U6OA 3FG3A 3U6EA 2XR8B 3IXBA 1VZZA 4UAAA 2HDSA 4X66M 1E3UA 2GU3A 1IQ8A 1S5AA 3CD63 1K25A 1TVFA 1V74A 1C1KA 3U6CA 2SBLA 1YMXA 4NETA 3HU1A 1QAMA 3PVSA 3BFCA 2P9VB 3ZG0A 3UMMA 4JXSA 4HBUA 1GA9A 2V1UA 4YFMA 2I72A 3GWRA 2WGOA 1VQ43 4NL4H 3JR4A 2XH9A 4E3MA 1E9SA 3GPUA 3JYIA 3VP3A 3QNCA 3NX0A 2C11A 3GLIB 3MSOA 5AIFA 3V3SA 1ES2A 2V1LA 2UUBM 3PNVA 1WYBA 5CF1A 4DE3A 5E26A 4IJFA 1VM1A 5GLCA 1J9MA 4FW9A 3K0ZA 3GP1A 1FGMA 3U97A 2V6ZM 4GHLA 2PBYA 4XDWA 3UNLA 1IVWA 4EV2A 1IYPA 2QZ6A 3S1YA 3NIAA 3MHVC 2WKEA 5ITQA 4BENA 4DV7M 3ZFZA 4L8OA 4G4RA 2DZOB 1YJW3 3G4S3 5FDHA 4WELA 4FD2A 4KZ8A 2XSHB 1TDZA 4W5WA 4LV2A 3C7VA 2Y55A 2C96A 3BM6A 5F83A 3UZUA 1SIIA 4FWDA 2R46A 5GLBA 4N6MA 5CXWA 1K3WA 4RX3A 3D9RA 3FG4A 1C7HA 2ZJ9A 3MG1A 3DMCA 5AQ7A 4DDSA 2RGQA 3WA3A 2WYXA 4ZTKA 4FWHA 5EVID 2F5QA 3V5MA 3LH4A 4N6NB 4FCFA 1W7FA 4DXBA 1YQSA 2C99A 2WGQA 1ES5A 3B7CA 3FUXA 2ZANA 3TWMA 4OONA 4DUZM 2X49A 3E2KA 5E2GA 2C10A 3T1YM 1TFOA 1N9EA 1SXJA 4MH0E 2XQZA 3ZGAB 3OWYA 1M40A 1IQXA 1W2B2 4L0LA 4QNRA 2XSZD 5DNYA 1FGRA 1US1A 1W00A 2EX8A 2EXBA 3MBZA 1G59A 1M9GA 4JI7M 4OPQA 3KDSE 1KFVA 3LYGA 1O7PB 4NSOB 4LCBA 2ZLYA 4R9KA 1JV2B 3HLFA 3UNWA 3K9MC 3BLSA 1HNZM 3GQ3A 1K6RA 2D7EA 1PZOA 1DYUA 5CRFA 2XFSA 4MGYE 3ZC7B 4II7A 3W4QA 3B4PA 4WYYA 3BNBA 1IVXA 1FUWA 1OPYA 1FQGA 1N34M 1EA2A 3CC43 2XGLA 1TH3A 5AQAA 4EBPA 5EPHA 3LZAA 3KSJA 2R4JA 4B4XA 4JI6M 2Z6BA 3IF6B 4B88A 4DKIA 4M0DA 3IQAA 5E2EA 2PU2A 3IHAA 5KPZA 4K0XA 3O8YA 1Q39A 1QVF2 1FOFA 4R3BA 1I2WA 2Q9NA 3DY5A 1N32M 3IWIA 4FD8A 2BT3A 2FNQA 3E4RA 1N9BA 2PNCA 4I8OA 2E5LM 3MZFA 3VFHA 3N4IA 4HM6B 1K8A4 4D81A 1L2CA 5LC6A 5IF6A 3DUKA 1HNWM 1BLHA 4M9XA 5CGWA 4WW0A 1IQPA 4HM2B 2CEAA 2QCUA 1NJ4A 2F5OA 1E9RA 4S2OA 3SAVA 4KZ5A 3Q07A 3H51A 5FI6A 4HL4A 3PXGA 2WAFA 3BFEA 2IMJA 2OLUA 1GHPA 1PM5A 1PIOA 1QAQA 4B3MM 3L29A 2ML5A 1XA7A 1TH2A 1XNRM 1J5EM 4LCMA 3CCU3 4KFEA 1YM1A 1Q40B 4IIWA 5BVBA 3L28A 5IW9A 3HU3A 3MPHA 2R62A 4LF5M 3VP2A 2ZQ7A 1KGGA 3J81S 1BT5A 4L16A 3LTBA 4MJDA 3CG5A 3ZG7B 3AOEA 1IKIA 4KODA 1Q3CA 4JN6A 4K90B 3PFIA 4B7GA 5KPTA 2XR0A 3UK6A 3RFWA 3SARA 3U61A 4OUQA 1IBLM 3EF8A 3NM2A 3KS8A 1NNUC 3W0LB 3GZXB 5GHZA 1JTGA 2D42A 3F7XA 4N1XA 1G8PA 3HHWA 1PZPA 3FTEA 1HZOA 2XK1A 5E43A 2GEXA 2WK0A 3I553 1CK3A 1LV7A 3NDEA 5HGRA 2B1XB 3KVWA 3K63A 1JRQA 2OOVA 3F14A 3PBNA 3GTCA 3GRJA 3B4OA 5D83A 2L7HA 4IVKA 1RRHA 2MF7A 4N9KA 4WEJA 2M7OA 1SPUA 1S723 4S2MA 5D81A 3C4PA 4R3DA 3M2KA 5DF8A 4Z9QA 3DOAA 4KHPM 4HM4B 1ZG4A 2DWZB 3U6QA 4JXVA 1XX2A 4OOLA 1Q864 4GDBA 4I81A 3QK9A 4JPMA 5A0OB 4N1HA 5IERA 4DF6A 4JI1M 3EBYA 1BLCA 2HPBA 3QHYA 3SH9A 3U60B 4WZ5C 2UX0A 4M3KA 4C75A 4LFBM 3AJIB 4WMCA 1E94E 2RFRA 3GRYA 1QVG2 3N7WA 1IELA 4IBKA 1YJN3 1DO0A 3DGMA 4G4NA 3KOXE 2QBYB 1NHGC 3JR5A 1H8ZA 1R2YA 3WWXA 3E99A 4OX9M 3VFFA 4REZA 3TE6A 2D7GA 3KN4A 2QPNA 2WAEA 4LJ6A 3ITAA 2F5SA 1NO3A 3VMAA 3HLGA 2R45A 2CV2A 3VK7A 3GVBA 3C4OA 3C58A 2HMNB 5KP4A 2WOHA 4LGMA 5JI3E 3TSGA 3NV0A 2OLVA 2IWCA 4OPYA 5EVIB 1NWWA 5LMNM 2DXIA 2PZVA 4JXWA 3SOYA 5CF2A 3SS4A 1YLYA 3HWSA 1SDNA 4OLGA 1SXJD 3I4YA 2UU9M 3TWKA 4IBFA 3ZHHA 3C7UA 3AKZA 3ZCBB 3OCNA 3WS4A 2XEPA 1FR1A 5DF9A 1QMEA 2Z7JA 4HBTA 1XXMA 3FKEA 4EBNA 5FTNA 1SHVA 3MWZA 4NRWA 3KFUG 4E3NA 5KP3A 2FXTA 1YMSA 4WWUC 4BD0A 3A42A 5EQLA 4GMQA 1HKXA 2FOIC 2HMJB 4NOOB 2XD1A 3K92A 1O7NB 4ZJ2A 1NXYA 5F3WA 2RCXA 1OFIA 1A2VA 2Y4AA 1ULIB 4ZJ1A 4FCTA 3JUPA 5IG4A 4QHSA 4RBNA 4PT5A 5AQ9A 4MGZE 3MG2A 4MGIE 5DRVA 2GXFA 2H0TA 4JV5M 3KZTA 4YY3M 4X2HA 2V1ZA 2W56B 3H3HA 3F9SA 3A3DA 4CISA 1PJIA 3PGBA 1BUEA 3MHEA 4QB8A 5HAPA 3X40A 2FNAA 3UGJA 3A46A 2CK3H 1WQLB 4HVNA 5CHMA 1OF5B 7STDA 3UB1A 1MWSA 4S2JA 3HZPA 4KZ7A 3OWUA 3AGDA 1IM2A 4BLMA 5GKNA 5CTNA 3HLEA 1NRFA 4H3UA 1NYYA 3BFDA 1IYQA 3W0FA 3MZDA 5CGSA 2O5RA 2HP9A 3PAGA 8CATA 2CFGA 2ZC6B 2I9WA 1KWIA 2XFTA 1OUNA 3LCEA 3EE1A 5FAPA 3TQSA 1UM8A 3Q82A 1O7MB 3R9XB 5ITXA 4GIPA 3GZBA 4MGHA 2BMOB 1PWGA 2HP6A 3J80S 4E3IA 3FH1A 3PCSA 1FSYA 3F7SA 3NXJA 3EN8A 1NZOA 1RCJA 4XBOA 3DXOA 3RGSA 3VK8A 1L1ZA 4CHTB 3Q1FA 5EXXA 3V98A 3VFDA 5CERA 3V92A 5KSHA 1W4NA 1J7KA 4CGYB 2L09A 1IY1A 1DJAA 4R1KA 1SQWA 2KEBA 3FTFA 3IXDA 3FTDA 3BLZA 2BNGA 2GEYA 4JI0M 1DGHA 3EN1B 4XDVA 1PJJA 4XUZA 4MMXB 5IG5A 2JC7A 4IBDA 4Y0TA 3WA2X 5FI7A 4IBIA 3M6AA 2VIIA 3SHFA 2F5NA 3UDIA 1K28A 1CEWI 4EC6A 1IN7A 3FZWA 1YIJ3 4A5RA 3HU2A 4EWFA 2DZNB 1OJLA 1R2ZA 5EXTA 3ZH9B 3TL4X 2QENA 4IBJA 4GC9A 1HNXM 4M9SA 5ITYA 1GD4A 5CXOA 3V39A 4CPKA 1BLSA 5KP1A 3EJVA 1EROA 3FYZA 1T5YA 1PW1A 1K56A 2GBXB 5AIGA 1YLPA 3MXRA 3BLMA 2Z76A 1J2BA 1ES4A 4KQQA 3LEZA 2YX9A 3JVCA 4PM6A 3UE1A 1IU7A 1PW8A 2P5TA 1GVNA 1SKFA 3GR2A 4FWGA 3GO8A 3ECFA 1K734 1KE4A 2L4VA 3ER7A 3CXC2 1TDLA 5LC7A 3CPOA 3G0KA 2QEX3 1KC84 2Z2LB 1A90A 3L2AA 1IVVA 4KFFA 1W2ZA 3SAWA 4JBFA 2YNMD 4FVMA 1G96A 4OVMA 3SASA 3AGEA 3FGYA 1W8QA 5AI1A 4BL3A 3M8CA 4BTWA 3OC2A 1G6AA 4O02B 2KA6B 2R9XA 2VGJA 2Y73A 3CF0A 2I7PA 4XB5A 5A93A 4QOZC 3LXUX 1IXRC 1H5XA 3O88A 4BBAA 3WS2A 2HL7A 2OQ4A 2Q2EB 4K0KM 4NREA 1MPLA 2ZAOA 4S2PA 2EFUA 4LF6M 5IWAM 4WYKB 1GCEA 4DV6M 5FTJA 1DVDA 2Z2MB 4GKUA 2QIYA 3SAUA 4WZ5A 4EBGA 3U6SA 1TFKA 1MWUA 4HM5B 1N77A 1PWDA 2UXDM 3TPZA 5BPVA 2IUKA 4OKPA 1JWPA 3RJUA 1YE9A 1QAFA 4JXJA 4BB9A 5M18A 1K41A 1O07A 5TGFA 2L6OA 4J9AA 4GHAA 3CCJ3 3PBTA 4N6LA 4NXMM 5CHJA 1KGFA 4DE0A 2I7NA 3WRTA 3BFFA 1W5DA 2OSUA 4JLFA 4EBLA 5I94A 1RGYA 1UW1A 2STDA 2W04A 4KQOA 3GZYB 2CFKA 1IN6A 3I0YA 2BLSA 5HW3A 3IF6C 2RGOA 3T38A 4Y7PA 4PDIA 3Q7VB 5HFOA 1IK3A 2WGWA 3LO7A 1U5OA 3RGRA 3DGOA 1KVMA 4FCZA 4GOGA 1L1TA 1MXOA 1LOXA 1Z59A 3U5ZB 4E3LA 2C5WB 1JKGA 3GLGA 2XDMA 3AMOB 1BUQA 4LJ7A 1VQ53 5AQBA 3UO9A 1N4OA 1GY6A 3KSED 3CCR3 3A98B 1YUBA 2ZDJA 4E3OA 4GRIA 4ITQA 2Y2QA 1PYYA 3H4MA 4L7KA 1GD3A 4LZIA 1YSYA 3LT9A 3HL9A 4K91A 1RN7A 2KRUA 3TWLA 2CHCA 1DMQA 4JI3M 5FQMA 1I5QA 4ORLA 1CYUA 2Y2NA 1L0FA 2KW0A 4X55A 3IMAB 4X2OA 1TP6A 1ESIA 2Y0TA 1LI9A 4XBXA 3IXHA 5AYRB 5A90A 2E2VA 3T8NA 4OVZB 1YHQ3 2WZZA 1QALA 4NSRA 1W6YA 2LYXA 4Y0OA 2V1CA 1ZQ9A 1UUVB 3BNEA 4KZAA 4C6YA 1SDEA 1YLTA 2HMOB 2XSOB 2ZQ8A 1IVUA 1PU4A 3GLFB 5ITUA 3DW0A 3UDXA 3OCLA 3ISGA 1EG9B 1XXHB 4AZFA 5G2GA 3CMZA 3OPPA 4BTXA 3KFQC 2EX9A 2K47A 4XGIA 2BMRB 5JPUA 1MWTA 2W6JH 5J8XA 2HKJA 2BHMA 2WO0A 1I4WA 1MU5A 2EFXA 4WM9A 1N5HA 4HM1B 3HUNA 1KE0A 4OQHA 1CQSA 3FV7A 4K0WA 3K8ZA 4GITA 4OPZA 4HM0B 4WZ4A 3JAMS 5DF7A 3HKPA 2JA2A 3S5CA 3G713 1S6RA 2ZC7A 3IG8A 4RF1A 3DZLA 5ELUA 1HQYE 2W0QA 3FWLA 5ITTA 1KE3A 1N75A 3U6LA 1F8NA 1IN4A 3GZRA 1W5TA 2DWNA 3NUVA 1JB5A 2XLJA 4EIWA 5DTSA 2X8AA 3SEDA 3HREA 3DM8A 2Y2HA 2C9OA 1Y4KA 4UA9A 2F5PA 5DVAA 2P9VA 5GLAA 5FSWA 3LQRA 5KMWA 5M1AA 1Y54A 5U47A 3V50A 3ZCZA 3J27B 4LJAA 3PZWA 1HD8A 3D4FA 1KSIA 1KDWA 2LH0A 3L25A 1XMQM 2Y2PA 2YFQA 1W5ZA 1LHYA 4AKHA 3IWOA 4Y0UA 4N6OB 3GLIA 3V3RA 4RZMA 3SXXA 5KSCA 3ZNYA 4B3SM 5HARA 1VQL3 5FASA 3CJMA 4X53A 4ZPXA 2DCFA 3X3YA 4LRTA 3VKGA 2Y91A 4NRVA 2O9UX 3CPW2 1WMOA 3GRDA 3BFGA 4LZZA 4IIAA 1H8YA 3FKWA 3IF5A 4IBEA 2C98A 5HX9A 1O7WB 4QY6A 1OHPA 1PI4A 3EQUA 3L27A 5EVIC 3WOFB 5AIHA 1YGEA 3FUWA 4TUWA 2CV0A 2EX6A 3B8LA 1EQKA 4MLLA 3E2LA 4GKJM 3GLHB 4QHTA 2P0MA 1IV9A 2R4EA 2JDIH 2FFYA 5EVLA 1Z6TA 4IBXA 3SH8A 3SYLA 1Q3BA 4EV5A 4RNAA 4YHHM 1GHIA 1U8CB 2LWXA 1TDHA 1EE8A 1WNHA 4Z8XA 3W4PA 1NY0A 4MMYB 1ES3A 4MNRA 1X37A 4OOYA 2CWVA 5FQIA 3UL6A 3NI9A 3SMPA 2Z4RA 2UUCM 1FCOA 2A49A 5FSRA 4O8SA 4OP5A 4RNYA 4NXNM 4LGQA 1E3UD 4QNMA 2Y74A 4IBRA 4B4ZA 1GKIA 3ZG5A 1K4FA 1VQK3 1WXQA 1XC8A 2NQ8C 1FCNA 1GS3A 3D8BA 5FTMA 4WBGA 4QWTA 3HBRA 3GQZA 3OW22 4FR9A 3FKAA 3UDFA 2Y2MA 2CG1A 1D6UA 2VQEM 4DUYM 5JYOA 3MJ5A 3SHGB 4HM8B 3HLBA 3S22A 3FUTA 3J7AS 1OACA 3SS3A 4OK0A 5M19A 3NBJA 4B3RM 4ID4A 1TU5A 2LNHC 4S2NC 3MZEA 4L15A 1PWCA 3HX8A 4C3QA 3KKGA 3IF6A 1AV4A 4PDGA 1IN8A 3GPPA 3P09A 2B5RA 5AEUB 3ILKA 2Y2GA 1JB2A 2MC8A 4BJPA 4AKZA 4LV3A 4MBFA 2GU1A 3NQZA 1M6KA 1ISKA 4B7FA 3CCV3 1N78A 3LOYA 5EUAA 4UHUA 4KZ4A 1K3XA 2KXEA 2EO2A 3ZVTA 4GC5A 4H61A 4G4OA 3N9HA 3HIIA 3OTOM 3KOWE 1U60A 3A3FA 3OZHA 5KQDA 5LMUM 3R8FA 2RGHA 1NY6A 4RVAA 3TOIA 3FCSB 4OVDA 2OQEC 2C6WB 1STFI 3CNXA 3SS5A 4L8PA 4KFDA 1J09A 1SXJE 3G30A 3J7Yd 4QY5A 1VQ93 4TX4A 5F82A 5C18A 3CC73 2CFLA 1RJOA 3HIGA 4BQMA 3V99A 3VSKA 1N5PA 3K5TA 3UY6A 1YI23 1IQYA 3O3VA 1CEGA 2H1RA 1Q40A 3MK6A 2E8IA 1BZAA 4MEZA 5EOEA 5L2FA 1RP5A 4AKGA 2Y2OA 3NQYA 3WRZA 3NHXA 1IXZA 3SOIA 3THGA 3UJNA 1N8QA 4PM7A 2HMLB 5CTMA 1DJCA 1HT1E 4R23A 2C9CA 3Q81A 1OHOA 4R4SA 4BD1A 4QD4A 4KZ9A 1W5SA 2CC3A 1BTLA 3OV4A 1JN5B 3UL5A 3X3ZA 5IEOA 4Q53A 4KZ6A 2GBWB 1IXSB 1CI8A 3N8SA 1NJI4 1HTZA 4RX2A 4DXCA 2B24B 3J7BA 4OQIA 1XNQM 2CW9A 3M2JA 3QWLA 2WOFA 1EI5A 5FQ9A 4P6BA 4JKTA 4CJNA 1ZO2A 1NYMA 1FGTA 3OWSA 4LV1A 1LNHA 4LJ5A 2QMIA 2Y2IA 2E2UA 1IKGA 3NC8A 4RYEA 3JUQA 2CE7A 3PBRA 1IY0A 4UA7A 4IBBA 4LCLA 4AW4A 4LSOA 2RCDA 5FLXS 4X68A 3M6BA 5CEBA 2CUZA 1K57C 3PYJA 3J2PB 3DGNA 1NVMA 3RXWA 2F99A 3FSDA 4D82A 1L5GB 5JBSA 3T1HM 4B7HA 3KIIA 1LI0A 3SH7A 2ERCA 3QAUA 3U60A 1UI8A 4X65M 3OPLA 3CCE3 4H8RA 2KCDA 4EV4A 5CEDA 2OV5A 3VOYA 2G5GX 4U13A 1QMAA 2OPFA 4OH0A 3ZG8B 4FCVA 2CFDA 1TEMA 2ZC4B 4LZJA 2Z7AA 4XM4A 3Q90A 2QBYA 1HT2E 1LVNA 2IA7A 1O7GB 5A92A 3PTEA 2Y2JA 3DA1A 1HU9A 1QAKA 2DWLA 3IH8A 4HLQA 1SXJC 3KSXA 4LF9M 1Z5BA 4GZBA 1JJ22 1K6SA 3N6IA 3ZVWA 2RL3A 2F98A 1BLPA 1TGUA 4MM3B 1KQS2 4QOSA 3SLUA 3AGFA 4XUXA 1L2BA 5EVIA 1C3BA 3N54B 1GYBA 3G35A 4LENA 3KP1E 5KPRA 3HI7A 3ZDJA 5JYPA 1Q814 1W01A 2A5YB 5ELJA 5ITRA 1QMFA 2GDNA 1M1XB 1L0GA 3LVWA 2EX2A 1IBKM 1DVCA 1D6YA 4FMCA 4AKIA 1L0EA 1MNLA 3RGAA 2JCHA 2X71A 3DWZA 3CME3 2WGWB 3Q2PA 3DTMA 8CHOA 2BJVA 3ROBA 4RNZA 4EYCA 2YFIB 2QZ4A 5GHYA 4S2KA 1NNJA 2YFJB 3FF0A 3KP0E 1LL9A 2YFLB 4EUZA 3A76A 4O3VA 3LT8A 7CATA 2QA43 1JTDA 1T3TA 4LG2A 3BNDA 1OMEA 3FF2A 1L2SA 1UI7A 1R7RA 3WS1A 3VSYA 3NY4A 2QPAA 2W56A 1IEMA 4U0TA 3GAXA 2V20A 4L78A 3K7CA 1QQWA 1CYVA 3NBRA 3HUOA 5IREB 1ESUA 2O3OA 3PS8A 1IYOA 4WMCD 1OF5A 3CCM3 3SATA 3PBOA 4JF4A 1VQ83 1XWIA 3PBSA 5FQJA 4FMAA 4HM7B 3HGIA 3SYKA 3SX1A 1VQ63 3CF6E 3GQ5A 2C5RA 1PFPA 2RSXA 4S2NA 1R4CA 5F1GA 3VLFB 3MXSA 2JQ5A 1Q7Y4 4LFCM 3HLCA 3F8XA 1E3VA 1E32A 2ZQDA 2CFWA 5IG0A 3Q1CA 4R9LA 3T8UA 1ASKA 2P0XA 1K9M4 4LGYA 4RA7A 1TUHA 1EWZA 3CTWB 1N36M 4LF7M 1GA0A 3VDPA 4S2IA 1ULJB 2EA0A 2Y20A 4GB7A 5FA7A 1K54C 2CWUA 3BECA 2FFJA 4FCWA 1NU3A 5EECA 4N3VA 1W7CA 2Q07A 4JF6A 2BJWA 2P09A 1M904 1KDSA 3PNYA 2H5SA 1SXJB 4GKKM 2BO9B 2OQEA 4GH9A 1JNQA 2XRXB 1DGGA 1MY8A 4HKVB 4DV4M 3KXEC 1R6BX 4KQRA 4DR2M 3SMSA 5IENA 4FH4A 4KG6A 1IYSA 1JB4A 5BXQA 2WADA 2UWXA 1FSWA 1JR3A 3BYDA 4YINA 4PCZA 1MOLA 1WMPA 3UN7A 4L4UA 3JUMA 3MG3A 4R80A 3CZDA 4N9LA 2CFOA 1W8YA 1WTHA 1G68A 2UXBM 3VDUA 3FLJA 2BG1A 2OTJ3 3UJMA 1ZAEA 5EP2A 3ITBA 2R18A 1QZMA 1N33M 1UUWB 4HM3B 1XP4A 4M0WA 4MMZB 5JPPA 1MBLA 3WS0A 3LQQA 3IT9A 2V2FF 2DHRA 2W9QA 5CECA 2ZQCA 1OHSA 5AYSC 3L0RA 2Y2KA 4DV0M 3DGLA 4ZJ3A 2OWPA 5ITXE 3HLDA 1BULA 3BEBA 1LL5A 4N6UA 1YLJA 3CMA3 5IG3A 5FGOA 5D82A 1S3SA 3RGPA 1W79A 4KENB 2J9PA 1NZUA 2ZM2A 3U6PA 3RDEA 3UPOA 3PXMA 5E2HA 4JI4M 2ML6A 3EC9A 2XD5A 5BOHA 4OOMA 1KVLA 2ZC5B 1EKMA 3NWLA 3O87A 1NB5I 1K57A 3G4PA 4S2LA 4OLDA 1TIJA 4KVHA 4NK3A 4ZM8A 1YLZA 2M60A 5CLKA 2J7NA 4OW0A 1ERQA 4X64M 4WYKA 4MEIA 3S29A 3IPTA 5FQQA 1HR0M 4HESA 4PEJA 3AV0A 2G8LA 4I5SA 3EB8A 2Y2LA 5EP1A 2KRTA 4DRTA 2W82A 2XZFA 3A45A 3SOAA 1DMNA 1FGOA 1QJGA 4LF8M 4WURA 3G2ZA 2G2WA 4MBKA 1OGZA