2XFSA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 138
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xfsA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xfsA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xfsA02
1GCEA 3PAEA 3O3VA 3SH7A 1KE0A 2XF3A 1SDEA 4GKUA 4BD1A 5CTNA 2H0TA 1CI9A 3SOIA 4UA9A 1ESIA 3IH8A 3MXSA 4S2NA 4UHUA 2B5RA 5CGXA 3V3RA 1Q2QA 1ES5A 4QY6A 1ONGA 1NXYA 1YM1A 1GHIA 2ZC7A 5TR7A 1K54C 1YT4A 2EXAA 4IEDA 3IWIA 5EVIC 2ZLYA 4GDBA 4N1XA 4KQOA 4LV2A 1G6AA 3N6IA 3OC2A 4Y0TA 1TDLA 4U3TA 1IKIA 5CEBA 2ZM2A 2A3UA 3V50A 2CC1A 1KVLA 5HX9A 3VP0A 4KZ5A 1ES2A 1LHYA 2DNSA 3AGDA 4MBKA 5EE8A 3IF6C 1YMXA 2WGIA 2DRWA 1W79A 1BLCA 2ZM0A 3A3DA 3A3IA 4S2JA 1FR1A 4LENA 4UA6A 3Q81A 4GOGA 4WEKA 3E2KA 1GA0A 3SS4A 2EXBA 3ITAA 1VM1A 2DCFA 1SHVA 1WYBA 4KQRA 5FA7A 4DDSA 2X02A 3UE3A 4EBPA 3HLEA 1O7EA 1ZC2A 3PBRA 1KGFA 4NETA 4B4XA 3HLBA 3GR2A 1H5XA 5E2GA 1FR6A 2ZM8A 3UPNA 1M40A 5FQKA 1KDWA 2R9XA 3FKVA 3EQUA 1MPLA 1PWCA 2FFYA 2H0YA 3IXHA 1BLPA 4KZ3A 5HFOA 3FWLA 3BFEA 1ESUA 1PWDA 3NDEA 2RCXA 3N4IA 2Z2MB 4RX3A 4YFMA 3P09A 5GLCA 3UDIA 2X01A 4JXSA 2JE5A 3NIAA 3PBNA 4JF6A 3UN7A 3G4PA 1CEGA 1NYMA 1Y54A 3UPOA 5IHVA 2H10A 3S1YA 1QMEA 1KGEA 1ERMA 5FAOA 2PU2A 5JYOA 1L2SA 5A93A 2WKIA 3Q07A 4Y0OA 3BRMA 2OLUA 3IF5A 4HBTA 3G32A 4OQHA 5FAPA 5HAPA 1EROA 4F94A 5D3OA 3OPPA 3IXBA 4IVIA 5E2FA 4DXBA 5AQAA 3G2ZA 1HVBA 4DDYA 4ZAMA 1K57A 1ALQA 2V2FF 4X53A 3NC8A 3VP1A 3HBRA 3WWXA 3GMWA 5A92A 2Q9NA 4OQGA 5GHXA 1E4DA 4XUXA 1BTLA 1YLTA 4R4SA 2WYXA 4L0LA 5EOEA 2P9VA 1XA7A 4FSFA 3TOIA 4JPMA 5EPHA 2XR0A 3CMZA 5M19A 3BLMA 3ZNYA 1BSGA 1H8ZA 2HP6A 3MZEA 3A3JA 3M2JA 1L0FA 4C3QA 2R9WA 5DF9A 1YLPA 1XX2A 1YMSA 5EECA 4KQQA 2XFSA 5EVID 3OPHA 4LCLA 3FYZA 3PBQA 3VP2A 5CERA 4OVDA 2ZQ9A 4DF6A 1WYCA 4BENA 1BLSA 3A3FA 1NY0A 3O87A 4R1GA 1YQSA 4JKTA 5CGSA 5EOOA 4E3KA 3UO9A 3M6BA 4OOLA 2ZMAA 4B88A 3LY4A 1FSYA 3Q7ZA 5EUAA 3VP3A 3DWZA 3QHYA 4X68A 2BLSA 4BL2A 4DRTA 3BFGA 1AXBA 4GN2A 4WBGA 5TGFA 3VMAA 2Z2LB 2HDSA 3HLWA 1SDNA 4CJNA 1MWRA 3MFDA 4MLLA 3MZDA 2WGWA 4MNRA 3W8KA 4NK3A 5FI6A 4DE2A 2PBYA 4OOMA 2QMIA 3IQAA 1O07A 3CG5A 3MKFA 2J9OA 4KZ4A 4LV3A 3TG9A 5F83A 5GLAA 1XGIA 1YLJA 2OV5A 4DE0A 1M6KA 3VOZA 4E3LA 3NY4A 1ERQA 3BFCA 1JTDA 2EX8A 4GD8A 1MXOA 3LO7A 1JVJA 4MBFA 5AQBA 5GHZA 4E3OA 3IXDA 3BFFA 3NCKA 4S2NC 2ZC4B 2XQZA 4HBUA 1PZOA 2QPNA 5KSHA 5EVIA 4CPKA 1E25A 3IXGA 3Q82A 3HLDA 4K0WA 1KE4A 1BLHA 1N4OA 5GLDA 1XGJA 3GVBA 5HW3A 2XH9A 3V39A 3G35A 3FZCA 5CHMA 3M2KA 3CZDA 4QD4A 4S2MA 3ZDJA 3MBZA 4WEJA 4QB8A 1S6RA 4RVAA 4C6YA 5CECA 5CTMA 2H5SA 2P9VB 2BG1A 5M1AA 4A5RA 3UDXA 4U0TA 1JWZA 4S2KA 1NYYA 1I2SA 3OZHA 2WKEA 5A91A 2J7VA 4OPYA 3QNCA 5FQIA 3HLCA 5FI7A 2Y2LA 1XKZA 4RA7A 1W7FA 4OPRA 1JWVA 4U0XA 4FCFA 3NBLA 4WYYA 2WKHA 1DY6A 2E8IA 2EX2A 4PM9A 5JYPA 3WRZA 1L0EA 2C5WB 3IWOA 3WS1A 3G30A 4DXCA 3JYIA 1VQQA 5F82A 1PZPA 2P74A 3ZVTA 4E3MA 2Y2HA 4P0MA 5AQ7A 1NJ4A 1YLWA 2QZ6A 4IBXA 4X6TA 1PWGA 2Y2GA 1ES3A 1LL5A 4O7DA 3VOYA 3IHAA 4K0XA 3BYDA 4KG5A 4R0QA 5DTKA 1DJAA 3WRTA 3ZG5A 3AGFA 2WZXA 1PI5A 3HLGA 4QHCA 2WGWB 5CGWA 4ZDXA 3ZG0A 1C3BA 2ZQ7A 2V20A 4FH2A 3FKWA 3M6HA 4D2OA 2Y2NA 4R4RA 2JBFA 1RGZA 4OP8A 5E43A 4X69A 1L0DA 4R3JA 5CHUA 4PM6A 4HEFA 5FQQA 4KZBA 1GHPA 5FSRA 4JXVA 2G2WA 3LCEA 1K57C 3PAGA 4PM8A 2Y4AA 3SH9A 2Y2IA 4WMCD 4YINA 3SS3A 3VSKA 4BJPA 5KZHA 1ONHA 1FQGA 3AGEA 3NI9A 4KZ6A 4N92A 4UA7A 5EVIB 5FQ9A 3ZG9B 1K55A 3OCNA 5HAQA 4IBRA 2Y2QA 3IHBA 3N7WA 5CHJA 1DJBA 3O86A 4Y0UA 4EQIA 1IYSA 3NDGA 1CI8A 3PBSA 3N8SA 4H8RA 2ZQDA 1XP4A 2OLVA 3IF6B 5DF8A 1FSWA 2HP9A 3C7VA 1XXMA 4OQIA 1IYPA 3SS5A 2ZQ8A 2XFTA 3MZFA 3PTEA 2XEPA 3GQZA 3IT9A 4OKPA 3GV9A 2XLNA 5FQMA 3HLFA 2A49A 1BULA 1Z6FA 3N8RA 4PM7A 4IVKA 3E2LA 5DF7A 3G31A 3DWKA 2EX9A 3WS0A 4N1HA 4LV0A 2HDUA 3C4OA 2WAEA 1PYYA 2XGNA 2VGJA 2J9PA 3GRJA 4WZ5A 4S2IA 3VP4A 3LEZA 1K4FA 2Y2MA 3UPPA 4E3JA 4PPRA 3W4OA 1XPBA 2IWDA 1JWPA 1CK3A 3V5MA 5U47A 3HUMA 3G2YA 4B4ZA 2WZZA 1K4EA 5BOHA 2ZC5B 3OPLA 1MWSA 4JLFA 3UE0A 5CRFA 3WS5A 4KZAA 3VSLA 4ZJ1A 3ZGAB 4EBNA 2ZD8A 4HESA 2EFUA 4OLGA 1PI4A 1YLZA 2Q9MA 1L0GA 2UWXA 5J8XA 4WMCA 1FCNA 3I7JA 1CEFA 4OQ0A 3TSGA 4Q8IA 1BUEA 5F1FA 3D4FA 4XUZA 3W4QA 4UAAA 1Q2PA 1FOFA 2WGVA 1IYQA 1K54A 3EQVA 5FDHA 1NZUA 4EBLA 1TVFA 5TFQA 2HP5A 4Z9QA 4N9LA 2I72A 3UDFA 2WUQA 4LV1A 3S22A 1PW8A 1MWTA 3GTCA 1MBLA 1TEMA 3BLSA 3ISGA 4WELA 4MEZA 3OPRA 3RXXA 5L2FA 4OPZA 2C6WB 3IF6A 3ZNTA 4OH0A 1MY8A 5GLBA 4JXGA 5F1GA 4C75A 4PM5A 4KENB 3DTMA 3ITBA 4KG6A 3ZG7B 1I5QA 4OLDA 4KZ9A 2Y59A 3BM6A 5GHYA 2WADA 1SCWA 2XD5A 1K25A 2Y2PA 3OCLA 1FCOA 4FH4A 1LI9A 3UNWA 3SH8A 3Q7VB 4PMAA 4OP5A 4QY5A 3WS4A 1ES4A 3ZCZA 1RGYA 4ID4A 2Y2JA 5E2HA 2G2UA 4P87A 4R23A 4BLMA 4MBHA 4ZJ2A 1K6SA 1HTZA 2IWBA 4R3BA 4EUZA 4WM9A 3P98A 3BECA 5CEDA 2Y2KA 1MKIA 5G18A 4EWFA 4S2PA 4GNUA 2IWCA 2V1ZA 4BD0A 1G68A 1HZOA 4X56A 1RP5A 3B3XA 4OOYA 4FD8A 1W8YA 3UY6A 3QNBA 1KVMA 1I2WA 1E3UD 2ZC3B 3VFHA 5FAQA 1MWUA 4S2OA 1LLBA 4GZBA 1J9MA 3DW0A 3O88A 3HL9A 2ZC6B 2EFXA 4K91A 5I94A 2Y91A 1SKFA 3IH9A 4Y7PA 3RJUA 1IELA 2HDQA 3S4XA 4JBFA 2PU4A 3PBTA 3VFFA 1EI5A 5GL9A 4RX2A 5CXWA 1ZKJA 3BEBA 1K56D 4M3KA 3WS2A 3FV7A 4GDNA 3ZVWA 2HDRA 1IYOA 2EX6A 3GSGA 2HPBA 3ZG8B 4BL3A 1ZG6A 5FQJA 1PIOA 4S2LA 4ZBEA 4EV4A 1K38A 1S0WA 4JF4A 2OSUA 1OMEA 1YLYA 1HD8A 1KE3A 3RXWA 3Q7VA 3Q1FA 4ZJ3A 5DVAA 1PW1A 5E2EA 2J8YA 1W5DA 1ZG4A 4DE3A 1BT5A 4JXWA 3V3SA 2RL3A 4OONA 4QU3A 4X55A 4E3NA 1U60A 1RCJA 1LL9A 3ZHHA 1KGGA 5HAIA 1H8YA 5M18A 3HUOA 1K55C 2ZJ9A 4E6WA 5FATA 3BFDA 2Y2OA 1IEMA 4GB7A 1XA1A 3HVFA 3N8LA 5DTSA 2JC7A 4KZ7A 4LCMA 1KDSA 2XD1A 1E3UA 4E6XA 1WE4A 4P85A 4JF5A 4BQMA 4QJGA 1QMFA 2XDMA 1W8QA 3IWQA 2X71A 1IKGA 2JCHA 3LY3A 3PBOA 4N9KA 3A3EA 4ZTKA 2XK1A 5FASA 3C5AA 3CJMA 4XXRA 5KSCA 1GA9A 1LI0A 4OPQA 4DE1A 5EVLA 4E3IA 3C4PA 5AQ9A 5FI2A 3W4PA 1FCMA 4RYEA 3ZFZA 1TDGA 3G34A 5DTTA 1EWZA 4DKIA 1K56A 4GD6A 1GHMA 2FFFB 4KG2A 4WZ5C 5HL1A 2ZQCA 1JTGA 3UE1A 1DJCA 2WK0A 2VGKA 3C7UA 5HARA 5KMWA 3MKEA 1N9BA 1NRFA 1BZAA 3HUNA 2GDNA 2ZQAA 4KZ8A 3HREA 3MXRA 5A90A 4P6BA 2WAFA 1K6RA 1NZOA 2Y55A 4WZ4A
chains in the Genus database with same CATH superfamily
2YR0A 5IT9S 3BWLA 3SH7A 3MHVC 2XF3A 4O8SA 2UUGC 1CI9A 2L1MA 1XFNA 1ESIA 3MXSA 2R41A 5KPRA 1DMQA 3KCHA 3H82A 2CIUA 4QY6A 3CC73 1HYFA 2B24B 4EXOA 2ZC7A 5ELUA 1HU9A 3SOYA 4GDBA 4N1XA 3DTKA 4R38A 4U3TA 4CDLA 2A3UA 2XSZD 1NJGA 2K7SA 3VP0A 4KZ5A 3T4OA 4DR1M 1ES2A 5EE8A 5F6AA 3HY5A 2CFWA 4IPBA 4LEHA 3GQ3A 1S5AA 1YMXA 2DRWA 4WURA 1D0LA 1W79A 2CV1A 4LJ5A 4I81A 2L0WA 4EEPA 3C3DA 4PKYA 3Q8GA 1UCLA 4YWZA 3Q2PA 1WMPA 1GA0A 1MOLA 3ZYTA 1OTIA 1IT8A 3U5ZB 1BRSA 1SHVA 1T3TA 3GLFE 5BU4A 3J7BA 3BNCA 1D6UA 3K2LA 2A2LA 5FA7A 3MG3A 5BR8M 1T2HA 3CME3 3EWKA 3UE3A 1IFQA 3PBRA 4NETA 4B4XA 4BTXA 1IK3A 3FTEA 4LZJA 1FR6A 3B7NA 2R62A 3UPNA 3GO8A 1WIVA 1NNUC 2C4BA 3TWKA 1M40A 2OOBA 3FKVA 4RZMA 2KXEA 1J3WA 1D6YA 3J2PB 1PWCA 4KZ3A 3WHKA 5HFOA 3MPHA 1OAIA 1FNNA 1ESUA 1PWDA 1N34M 1DP9A 4MH0E 4NHFA 1W5SA 3P09A 1IBLM 5EQLA 3K0ZA 2JE5A 3V67A 3UN7A 4N6OB 1CEGA 2W6JH 3MQOA 1T19A 1BGSA 1LVNA 2MF7A 1LQGC 3DGLA 3AV0A 3GZYB 1OTBA 1UWPX 4LPZA 1KGEA 4P17A 1BOXA 2Z77A 1ERMA 5JYOA 1TUHA 5A93A 3PGBA 3X41A 4Y0OA 3IF5A 2L4EA 4WYKB 1TR8A 3G32A 5HAPA 3CWFA 3CMA3 4II7A 1J7KA 4HJLB 4ILFA 4ZRRA 2VZWA 4NEED 5D3OA 1VZZA 3PYPA 2SBLA 4L9FA 5AQAA 4E04A 2L4VA 1WHCA 1JB5A 1SKOA 1DE3A 1FUWA 4XBYA 2GU1A 1Q40A 5A92A 4IBIA 2Q9NA 1LRAA 4OQGA 3Q90A 2GX5A 1X1WA 4GLQA 1I8VA 2OOAA 2Z7JA 4DV5M 5JPPA 1Q3CA 4IJGA 4KO8A 5DREA 5C1BA 3MF0A 5EOEA 4STDA 2P9VA 1S1ZA 2DXIA 4I5QA 1YKDA 4FOFA 4JPMA 5EPHA 3B8LA 5M19A 3BNDA 1BSGA 1H8ZA 4QNMA 3M2JA 1L0FA 4G6ZA 3HKPA 5DNYA 1YMSA 4KQQA 7CATA 1N9EA 4IBBA 4LCLA 1IBKM 3VP2A 2ZQ9A 1GSPA 4BENA 3O87A 4RKUF 1NY0A 5CGSA 5EOOA 3CTWB 3B4OA 4KLNA 3UO9A 5LC6A 1NO1A 3LY4A 5EUAA 3Q7ZA 3VP3A 4KQDA 1TS6A 3QHYA 4DRTA 2OOLA 2ZHXB 3BFGA 3TWLA 5TGFA 1Z5CA 4LY6A 4X64M 4GHOA 4XBXA 1T1AA 2HDSA 4GHIB 1MN3A 1RGFA 2FOIC 2GNXA 2O99A 4CLCA 4MJDA 2JKGA 4LFUA 3KZTA 1L5GB 2PD8A 3MYTA 3TWMA 3SARA 2C5RA 4GSPA 5FI6A 4DE2A 4B93A 2PBYA 4L9GA 3VGNA 1O07A 1ZMVA 1LOYA 3CG5A 1SXJD 2CG1A 5F83A 2OV5A 1XGIA 4BLCA 3L0RA 2YFIB 3KP0E 4BIRA 2DWMA 4J9AA 3NY4A 1FYSA 1ERQA 2EX8A 4MBFA 2EA0A 1AUAA 1Q824 4YY3M 1JVJA 1MXOA 3FUWA 3GECA 1G71A 5EM0A 3IXDA 4MGIE 5IW9A 3BFFA 1G5UA 4OK0A 3OV4A 4HBUA 5EVIA 3IXGA 1YIT3 1N4OA 4O0PA 2VQFM 2LVPC 1QAKA 1Y4OA 3UB1A 2QNJA 4GC9A 4BB9A 1OT9A 3FZCA 3G35A 3GLHE 3M2KA 3QRDA 4QD4A 2HMKB 3MSOA 4LLOB 3RTYA 3V92A 5HZHA 3DTIA 3TPZA 4LF6M 2BG1A 5M1AA 4A5RA 2KA6B 2QHKA 3DBAA 3UDXA 1STDA 4S2KA 3SMSA 3FYDA 3OWUA 1G41A 1RKYA 2STDA 1GY5A 5HPFA 2J7VA 1VETB 3QNCA 4M0DA 2Y2LA 3R7WA 4MGHA 3AFHA 2R6FA 1JWVA 1DV0A 3E4QA 5LMUM 3PNYA 4WYYA 1DY6A 4DBGB 5JYPA 1E32A 3LT8A 2HF6A 4MMZB 4M0WA 1NV8A 1BRGA 1VQQA 3LFVA 5F82A 3ZVTA 4E3MA 3F92A 2DI0A 4MB7A 1A2KA 2M1CA 3BLZA 1NJ4A 3LI9A 4XGIA 3LMLA 3T1RA 1PWGA 4FCZA 5AIGA 4JGPA 1O7MB 4D81A 3NBJA 4K0XA 3BYDA 4R0QA 2F5QA 2RCDA 1DJAA 3WRTA 2HKJA 3DGYA 3AGFA 1HJPA 3MQQA 2EKFA 4FMCA 3EGXC 3HLGA 2ZL8A 4M9SA 2WGWB 1CYVA 2WKRA 3I0YA 1VEKA 1EFUB 5EP4A 3IG8A 2NUPC 4K61A 3QP2A 5JI3E 1F5MA 1VQK3 1R5LA 1TDZA 1RGZA 4X69A 4BTWA 4M9XA 4FCJA 1O7PB 4KZBA 4EV5A 1T6OA 3KSGA 1D7EA 4JXVA 2KZUA 2LVNC 4MGYE 3K9OA 1PJJA 4YINA 2CWUA 4AEQA 1ONHA 3NI9A 3AGEA 4KZ6A 1VETA 4N92A 3G6E3 3ZG9B 3WODG 4TX4A 4LFBM 2QKPA 3O86A 4EQIA 1ULJB 5HDCA 1IN8A 4MGKE 2PAVP 4YOFA 1GYBA 2WKQA 5A2QS 1FSWA 2HP9A 1J09A 4FW9A 2VF8A 3C7VA 1IYPA 1IFYA 2XFTA 3IECA 1LL8A 2PYRA 1VG5A 4OKPA 4HLQA 5FQMA 4QWOA 2O25A 1Z6FA 1X1YA 4PM7A 4P6BA 3B33A 4IVKA 1UDII 2E2VA 1VQM3 3U1WA 5DF7A 1A67A 4IHQA 4KODA 2B1XB 3IJEB 3IX3A 4NRWA 4DR4M 1G28A 2WAEA 2WSEF 1Z1SA 1DP8A 2KDLA 4M9ZA 3HZPA 3RGAA 2J9PA 2ZMFA 1YJ93 3T1SA 1KQS2 2W9QA 3AOEA 1R2YA 1K4FA 3H51A 4DV6M 1LTMA 3MK6A 3FE3A 1SXJB 3DFZA 3MXQA 1SIHA 2BU4A 3F9SA 4FMBA 3V5MA 3K63A 2P08A 3HUMA 4K1VA 1XFQA 2O9CA 1Z5AA 4JLFA 3WS5A 4KZAA 3I553 4EBNA 1QAMA 2ZD8A 4HESA 5J8XA 1L0GA 2B3TA 2QYBA 3CGWA 4OQ0A 4DR5M 5F1FA 3WOEB 5HDSA 5EP3A 1FOFA 3FG8A 3KN4A 3D4AA 1MU5A 1K54A 3EQVA 5FDHA 4ETZA 1NLZA 3UMMA 1X0OA 2MROB 1W2ZA 2QZ4A 2GBXB 2K9DA 4O2HA 4LJ7A 4LV1A 2MJ6A 4QHTA 2YFJB 3RNTA 5ELJA 4WELA 4MEZA 5L2FA 5DRVA 5CF1A 2Q0OA 4GIPA 1VQN3 1MY8A 1WA9A 5F1GA 4PM5A 3SW1A 3DTMA 5D81A 3ZG7B 5MC7A 2PNCA 4LGWA 2F5PA 1TF0B 1ZV1A 4D60A 2XD5A 1GJSA 4PAUA 1OT6A 1YUBA 2K3DA 4OP5A 2P5TA 3WS4A 5DFYA 1CUKA 3KS4A 3JUNA 2Y2JA 1JN5A 2PR5A 1T43A 2K31A 1HTZA 1K734 4XDVA 4R3BA 5KP1A 4IJFA 1A90A 4MMNA 2BTFP 3BECA 4ANRA 5CEDA 1IU7A 4GNUA 2BNGA 2I7PA 4XT2B 3QWLA 1BRIA 3CHWP 4PDIA 1RCLA 4FD8A 1RSNA 3I04M 4DV1M 1UGIA 1KOUA 1KVMA 2PR6A 3QNBA 4OUQA 4OW0A 4RQ9A 2DAKA 4LFCM 1V92A 4J8TA 4S2OA 3WR2A 3FPWA 1YSYA 1N9OA 2LVAA 1A2VA 4GZBA 1J9MA 1BNSA 2ZC6B 1VHMA 2W1TB 3K2NA 3B7ZA 2Y91A 2K2NA 3RJUA 3T12B 2HDQA 1L1TA 3PNVA 4DJ2A 3NJAA 1N5HA 1UI7A 5CXWA 3JVVA 1K56D 1VEUB 3FV7A 1VQ43 3QP6A 4NXEA 3EX9A 1B27A 1I2GA 4B7FA 4WN5A 1PIOA 3T1YM 3KW6A 3PVSA 2M7VA 1ODVA 4HKVB 1OMEA 3E46A 4OVMA 1G3IA 2HZ5A 1ULIB 3D9RA 3LYXA 4ZJ3A 3LTAA 2PD7A 5E2EA 2LVOC 3V3SA 1IQPA 1OTRA 1TTEA 3U61B 1QVG2 3VSYA 3LVWA 1FGRA 3ZHHA 2VA0A 5HAIA 3TE6A 1XXHB 1GY6A 2LB5A 3UB9A 2X4AA 3X3YA 3QP4A 4XT2A 2F56A 4GB7A 3CCM3 1XA1A 2W82A 4KZ7A 4LCMA 4DR2M 2E2UA 4A3VB 1KDSA 2XD1A 1E3UA 3MJQA 4DV0M 4LJ9A 3URPA 1WE4A 4P85A 4I8OA 1TDHA 3K1JA 1H0MA 3C8CA 4QJGA 4Z8XA 4HM4B 3ZQJA 1V9YA 5ITXA 1I70A 1YIJ3 1NDOB 3A3EA 1MX0A 1QYRA 2VLGA 2R18A 1B21A 2DNAA 4BWIA 2W1TA 1RGGA 4P16A 2UV0E 5EVLA 3CF0A 3QYEA 5H37D 3C4PA 4X66M 2ZOIA 4GEWA 1RN4A 3A5EA 5IG3A 2RNTA 4BMWA 1F98A 2ZMVA 4AZFA 3OTOM 2XZUA 3LR0A 3UNLA 2WK0A 3C7UA 3UMDA 2DAIA 4X65M 1LNHA 5AIFA 3FUXA 1NRFA 1BZAA 3LR5A 3HUNA 5AEWB 3HJIA 3HREA 2Y73A 1NVMA 3QK9A 1K6RA 3S27A 1NRJA 2Y55A 2YFQA 1NWZA 4QNRA 4PKYG 1H3QA 3FKAA 2W03A 3F1NA 3O3VA 4BD1A 5KP4A 3HHWA 1ZHHB 3TRCA 3T4SA 1YVSA 3FSDA 3IH8A 3S7OA 1RNBA 1KSIA 2B5RA 4R3DA 3D72A 2W9PA 2CG0A 4XBOA 1RU3A 1OHPA 3SHFA 3FZWA 2HGVA 5AYRB 1K54C 2EXAA 2ZLYA 4PT5A 3N6IA 3FUVA 1TDLA 3RGRA 3UJMA 1IKIA 5CEBA 1O7WB 4I5SA 2ZM2A 4HM5B 3EEHA 2UXDM 2R65A 3WA2X 2BASA 3CLOA 3T4QA 5HX9A 3CCQ3 2EWWA 4GB5A 1GVNA 3K3DA 2ML6A 4GS9A 2WGIA 3C30A 2QBYB 2DMWA 1A2PA 2ZM0A 4WEKA 3G4S3 1BRHA 1JR3A 3E2KA 2H1RA 4RBNA 3SS4A 2EXBA 3NV0A 3GQ5A 4HM2B 4J5GA 2AAEA 3ITAA 3T4JA 4HJ3A 4RNAA 4LZIA 3GPXA 5I5LA 1OIZA 1G02A 2HCBA 1N8QA 1EE8A 3ROBA 2X02A 2V8CA 4Y28F 2DAGA 1ZC2A 3W0LB 4MGZE 1Q7Y4 5E2GA 2F99A 3SFZA 1SXJC 1IV9A 5G1LA 1MPLA 3L2AA 2F5MA 4G1MB 4ITQA 2CUZA 4OVZA 2RCXA 4RX3A 4LJAA 4YFMA 2V0WA 3HWSA 3LVVA 4LJ6A 3IBRA 5GLCA 1OF5A 2RKOA 4AG6A 1S723 3NIAA 4JXSA 2L2DA 3LIBA 1N33M 1NYMA 2WSCF 2CK3H 4LMIA 2RGHA 3J81S 1BRNL 3FG1A 4HY8A 3S1YA 1TU5A 2IA7A 2DAMA 5FAOA 2PU2A 3MWZA 4HEOA 3Q07A 3BRMA 2RGOA 4Y5FA 4OQHA 3CNXA 1EROA 1B2XA 1D6ZA 3H4MA 1HNXM 4F94A 3J7AS 2B95A 1QDRA 3OPPA 4IVIA 2BMQB 5G4ZA 5L09A 2UUCM 4CLCD 1KD14 2KCDA 2QBYA 1YE9A 1HVBA 1FUTA 1ALQA 4FCWA 4NOOB 2AVXA 2V2FF 3HBRA 2MC8A 3LOYA 3CITA 3L27A 5GHXA 1E4DA 2KNAA 4XUXA 3NHXA 3D8BA 2P7JA 4JI5M 4JYAM 2WGOA 1AR0A 1IM2A 4FSFA 2HMNB 2XR0A 3CMZA 1IN6A 2DVWB 5EXXA 3MMPA 3ZNYA 1B20A 4IBKA 1V58A 4C3QA 1MGRA 2V1BA 1A5TA 1OHOA 1YLPA 2LHGA 1YI23 2XFSA 5EVID 3OPHA 3FYZA 4KUKA 4OVDA 1L2DA 1BANA 4GL6A 4DF6A 1WYCA 2GZAA 1TFKA 3IX8A 1BLSA 1GOVA 3A3FA 4HAAA 3V76A 4E3KA 2ZL1B 4IUKA 1LOWA 1BSCA 4I4LA 1BSBA 4OOLA 1XWIA 5IREB 2M5ZA 5CX7A 1OUNA 4LF5M 4BL2A 2BLSA 1AXBA 3AKZA 4WBGA 4HM7B 5BIRA 1IV7A 1DGGA 1OPXA 5DYGA 2FNQA 3BY8A 4CJNA 4PDGA 1FGOA 2LBCA 4B3RM 1AY7A 1K3XA 1GABA 3G713 3MFDA 4HI4A 4MLLA 1OTDA 1K0KA 3CAXA 4KFDA 3W8KA 3DZLA 5KQDA 3D5GA 4GRIA 4OOMA 1TS8A 4JGRA 1T3BA 4LV3A 3RE8A 5GLAA 1UM8A 1YLJA 4DE0A 4KFEA 3NOPC 1M6KA 3HZJA 5BVBA 1Q3BA 2WZJA 3UMEA 4K0KM 4EBGA 3VOZA 3DZDA 5JI2E 4E3LA 3EIEA 3I4YA 4GD8A 4B7HA 2IA2A 3HJKA 1XNQM 1SPUA 1VQ63 3T8NA 1STFI 1AIPC 3HHXA 4E3OA 4NKPA 3B89A 2BJWA 4LF4M 1P97A 5L10A 1IN7A 2R4JA 4N3VA 3RDEA 2LHCA 3SYLA 2UXCM 1GO5A 1CQAA 2XLJA 1PZOA 1YAXA 1W5ZA 4AW4A 3Q82A 2LXEA 2CP8A 4CHTB 3JUPA 4LYLB 1BUJA 3HLDA 1SKOB 1OPYA 5IG5A 4K0WA 3HIGA 5GLDA 1IN5A 2Q2EB 2IUKA 1N5PA 2XH9A 2K0MA 2ZBBA 1Q40B 5FL3A 3KVWA 5CHMA 4FCTA 1WNHA 4HYZA 3CZDA 1OIPA 2ZL1A 4HH3A 3ZDJA 2OQEC 3MBZA 1DGBA 2H5SA 1Q814 1ZMWA 2JY6B 2P9VB 2V1CA 3PHYA 3BBZA 4GW9A 1MNLA 2V1LA 1I2SA 5A91A 1Z6TA 1LT0A 1LSVA 1T1CA 1RRLA 1SXJE 2OOVC 3FPVA 4RA7A 5KPTA 2ZDJA 1W7FA 4OPRA 5J7EA 3CU3A 3SLUA 1ZGXA 3EC9A 3ILKA 2LH0A 3FUTA 2E8IA 2EX2A 4G3VA 2Z3XA 3PCSA 3B4PA 1EA2A 2C5WB 3WS1A 5E26A 3G30A 2BNKA 2ZTDA 1DGHA 2Y2HA 4P0MA 1TH4A 1NLYA 4IBXA 4R9KA 4GKKM 1B2ZA 1NY5A 1LL5A 4O7DA 1HQYE 3IHAA 4KG5A 5J3WA 3B47A 2JDIH 3LTDA 3NQYA 3ZG5A 3F1PA 5IG0A 4CLCB 4WP5A 1PI5A 2WZXA 3AL0C 1LV7A 1PU4A 5CGWA 1FJGM 2ACGA 5AVEA 2KOIA 5EP2A 2CW9A 2X49A 3W2ZA 2V6ZM 3I4VA 1YHQ3 2I9VA 2V20A 3M6HA 4D2OA 3Q1CA 3WMDA 1PFPA 1WR1B 2JBFA 1JRQA 3JVUA 3HX8A 4R4RA 5E43A 5CHUA 3PFIA 3TQSA 2CHGA 4GCZA 3C2WA 1NNJA 1HLUP 3CCL3 1LNIA 3OWYA 5FSRA 4MDZA 4PM8A 3C9PA 5EVEA 3SS3A 5I97A 3VSKA 1EKMA 1MZUA 1FQGA 2XA7S 1FGMA 1RMSA 5FQ9A 5EVIB 5HAQA 3SVAA 5GKNA 3U6DA 1K55A 4LJ8A 1VQ83 3OCNA 1DMNA 2Y2QA 3NULA 3UB5P 4R71A 2BHMA 4FWDA 1RGLA 4Y0UA 1JKGA 4AG5A 4LGYA 1BNEA 5RNTA 4L78A 3R9XB 4H8RA 2ZQDA 1PRQA 1XP4A 3QP8A 1IQYA 5LMNM 2LQVA 1RGAA 2JY7A 6GSPA 3KSED 1OHSA 2L7HA 2ZQ8A 2KNVA 4LJ4A 4JI6M 2XLNA 3BNEA 1MKMA 2A49A 3HLFA 4NG2A 4R7GA 3N8RA 4HOIA 2VX8A 2G8LA 4JI7M 4MN7A 3EN1B 1LOXA 4N1HA 2JWSA 2HDUA 3R7WB 2OWJA 4JI4M 1VQO3 3PXMA 3FD9A 3VF1A 2H0GA 1RNTA 2ZOHA 4FD2A 2L6OA 4AKGA 2Y2MA 1QVRA 2GQFA 4B08A 3UPPA 1YPRA 2XRXB 1S67L 3H3HA 2RSXA 3LYGA 2IWDA 1WXQA 3U6MA 2CHCA 5U47A 4DV2M 1SIIA 4NC6A 4B4ZA 2WZZA 1YGEA 4HM3B 1R4CA 4N6UA 1QDTA 4EW7A 4AKZA 5CRFA 3GAXA 4EC6A 1PI4A 1YLZA 1GLNA 2QQ8A 3T1XA 1FCNA 3B74A 2Z7AA 2C10A 1CEFA 2KLIA 3CF2A 3D4FA 3SZTA 1CJFA 1BYWA 4UAAA 4H6JA 3NQZA 1F4IA 3F7SA 4LGMA 2O9UX 3LTCA 2IY2A 3KO6A 1TVFA 4GC5A 2YNMD 3W0FA 1V74A 3UDFA 1PGYA 1XXHE 1XMOM 4N6LA 3F14A 1UWNX 2WUQA 3KX0X 1UCKA 3LIAA 2FE8A 3BIRA 1MBLA 2O9AA 3BLSA 1E94E 3BQ8A 4HP4A 1W6GA 3ZH9B 2GEXA 1S4RA 2PRFA 5GLBA 3ECFA 3H9WA 3GPPA 2J8XB 4KG6A 2FGTA 2VGLM 4G4QA 3A42A 2Y59A 1GOUA 3U6LA 1ORYB 1QQWA 1K25A 1GMPA 2Y2PA 4NXGA 3X42A 1JJ22 4FH4A 2KF6A 1LI9A 3T4LA 3LIFA 3SH8A 3Q7VB 4PMAA 4QY5A 1B2SA 1ES4A 5C5KA 1RGYA 4P6ZS 2G2UA 4P87A 2E2TA 3WHLA 1K6SA 1T18A 1GD3A 3FTFA 5CK6A 2AADA 3B42A 4MMXB 3EIHA 1W6YA 2FS1A 4S2PA 2IWCA 3AHSA 1S1YA 1BNJA 1HZOA 2V1ZA 4BD0A 2KF5A 1RP5A 4REZA 1R7RA 2EA9A 2W04A 3EBTA 2F98A 3GLGE 1E3UD 3LUQA 3SBJA 3KYQA 4X62M 5FEGA 2QENA 3P7NA 4GJ4A 3O88A 1IBMM 1B3SA 2WOFA 3HOHA 2W1RA 2W3DA 2EFXA 1TF1A 2JP7A 2QHOB 1IELA 2APLA 2R45A 1B2UA 4JRFA 4AI6A 7STDA 2PU4A 3VFFA 4L8PA 2KNZA 1ZQ9A 1CYUA 1XHBA 3BEBA 4B3TM 3IBJA 4I3IA 3WS2A 4EU0A 1OJLA 1IYOA 3RFWA 2C9OA 1ZG6A 2GXFA 1UCIA 1QMAA 2OTL3 2JY5A 1V57A 4EYCA 2OSUA 3E4OA 1QVF2 1KE3A 5GSPA 3LICA 2VQEM 3Q7VA 1Q02A 3U6SA 1UW1A 2KAAA 5IS1A 5DVAA 4ARZA 1PW1A 2J8YA 4JGQA 1W00A 4LGQA 3SAVA 1YJW3 1BT5A 4HBRA 4OONA 1IQ8A 4QU3A 1BVSA 1HNZM 1U60A 1YVBI 1GJTA 2CHVA 3T38A 3DH2A 3JR5A 1RCJA 5FEFA 3GLIE 4LF8M 1H8YA 5M18A 1ZTUA 4MM3B 1K55C 2ZJ9A 3EBYA 3CCE3 1YNVX 5IENA 3BFDA 3Q8XA 5FATA 1O7GB 2HMMB 1FILA 3N8LA 5DTSA 1XJ6A 5DFLA 4I3AA 2LB9A 4E6XA 2FH0A 2EO2A 1DETA 1SZVA 1IKGA 2JCHA 5L8MA 1JN5B 1D2NA 4ZTKA 3KXEC 3C5AA 1G8PA 2R46A 1GA9A 1JR3D 4IBDA 3SXXA 4OPQA 4HVNA 3VDUA 4JI1M 2ZAMA 1HR0M 3NM7A 4GKJM 1FCMA 3NM2A 1Z5BA 1OH0A 4DKIA 5FQKA 3PS8A 4CLCC 2ZQCA 5C18A 1SQWA 3LH4A 3X3ZA 3IS2A 2CX1A 2CWTA 3GLFB 2VGKA 7GSPA 1N9BA 3DOAA 5FTJA 1ROAA 3EGDC 1TIJA 3CNMA 5A90A 4GH9A 2HL7A 2WAFA 3GRVA 5EFWA 3EEAA 3GRYA 2DHRA 4Y15A 1N78A 4Y13A 3L26A 1SDEA 3L7HA 4GKUA 3UB7A 3ZQ5A 3D8LA 4UA9A 1GMRA 3SOIA 2OWHA 2BWEA 1EQKA 4S2NA 4UHUA 3V3RA 1Q2QA 4K90B 1NWWA 1RGKA 2W56A 1ES5A 1ONGA 1NXYA 1YM1A 2W3GA 3HCYA 3FG4A 5TR7A 4R70A 1YT4A 3L29A 3IWIA 5EVIC 1D0MA 4KQOA 1N32M 4LV2A 1DVDA 4JI2M 3OC2A 4XBTA 4Y0TA 1RN1A 2CC1A 1KVLA 1VQ1A 2ZM6M 5G4YA 1LHYA 2DNSA 1E9RA 2NQ8C 1EUIC 1TS7A 1UGHI 3L28A 3THGA 3GZXB 3A3IA 3A3DA 4S2JA 2A5YB 3KSXA 1FR1A 2MR9A 4LENA 3Q81A 4GOGA 2D1WA 4FR9A 1NY6A 4DV3M 3MS6A 1WYBA 8CHOA 4DDSA 2WGQA 3B7CA 4EBPA 3NWLA 2F86B 3HLEA 2CFKA 1O7EA 1KGFA 4FTXA 1XB2B 1VQP3 3GLFA 3GR2A 1H5XA 2ZM8A 2O01F 3GQ4A 2L09A 4L16A 3GZBA 1KDWA 1VQ93 2R9XA 1Q39A 4R3AA 2FFYA 2A15A 2XSSA 1BLPA 3FGYA 2QEX3 2QWSA 3NDEA 3N4IA 4BBAA 4G4OA 2ZA4A 5TGNA 1GMQA 1BNGA 2X01A 1JQJC 4NXNM 1NJFA 4RNZA 1LSWA 3G4PA 2I9WA 2HV1A 4HZBB 1Y54A 2H10A 1O7HB 3HHZA 3GRRA 3HU2A 1U5OA 2QSFX 1L2SA 2C98A 5LC7A 1T5YA 2P05A 5ITYA 4HBTA 2BO9B 5FAPA 1MGWA 3E4RA 1XJ4A 2VV6A 1OGZA 1QAFA 4DXBA 5FGOA 2Z6DA 3G2ZA 1WQLB 3F1NB 4DDYA 5F3WA 1M1K4 4X53A 1L2CA 3FKEA 3WWXA 1G4AE 2JZ0A 2UUAM 3PZWA 4G4NA 3SAUA 4XM4A 4JI8M 1ZS7A 1YSQA 2F5WA 1BTLA 1YLTA 5KIZA 4R4SA 2Y21A 2B02A 2WYXA 2UU9M 4WHAA 3TOIA 1XA7A 1TTOA 1OQYA 3EOIA 1YJN3 1F9IA 2W27A 2Y20A 9RNTA 3MZEA 2HP6A 2O0YA 1I94M 3A3JA 5EXSA 1EG9B 3T0UA 2P04A 3C38A 4GS9B 4LRTA 3S7QA 3M7GA 2RFRA 2VDBB 1NHWC 1QZMA 1I3IA 2VEAA 4EESA 2VGLS 3H7WA 4R1GA 3LQQA 4KZ1A 2BWBA 1RN7A 1LSXA 1YQSA 5KQ8A 4GHAA 1PYLA 5E6JA 3NV0B 1J2BA 3PXPA 1GL7A 1W2B2 2HAKA 1IVXA 1HT1E 2L7IA 2KZSA 2ZMAA 4B88A 1QUTA 2BMRB 5KP3A 1FSYA 2YQZA 1FW7A 4CLCE 2PYPA 1IN4A 1E9SA 1GD4A 1RDSA 4ORLA 3AOEC 2D02A 3VMAA 1FZUA 3S67A 4L9EA 3KOXE 3HLWA 3X40A 1SDNA 5KO3A 4OX9M 1MWRA 3J7Yd 1IT7A 1H8MA 3CCU3 3GRUA 1NJI4 4MNRA 4OVZB 2XSHB 2ZTCA 3V98A 3IMAB 4DR3M 2H28A 4HL4A 3ICYA 2JHEA 4G4RA 4L4UA 3MG2A 2LTUA 1OF5B 3IQAA 4KZ4A 1FUSA 3STDA 3VKHA 3LW5F 1K28A 3LIEA 4IBCA 1T1BA 3A98B 1O7NB 3BNBA 2UGIA 2JZ1A 4LF9M 2J3TC 5AQBA 1E97A 4FMAA 1IY2A 4PD2A 2OTJ3 3NCKA 4S2NC 3EE1A 4JXJA 2W3FA 3NOUC 2XQZA 5EP1A 5FSWA 4B7GA 2CV0A 1C7YA 4WWUC 1BLHA 3W68A 4K1UA 1IOUA 5HW3A 2QGUA 3TDGA 1WMOA 1ZMUA 3LTBA 5ITTA 2D42A 3O8YA 3TL4X 1Q42A 1S6RA 3KP1E 1JNUA 4BBUA 4C6YA 5CECA 2O9BA 1JBRA 5HSQA 3GLHA 2PHYA 2ZBKB 5BPVA 4HQAA 3FF0A 3LZAA 4R1KA 4DMZA 3OZHA 1W7CA 5AEUB 5FQIA 1N75A 2PDRA 4IBFA 1XKZA 2VK3A 3MQ0A 4HJ6A 4I3JA 3UL5A 4DJ3A 4CGYB 4FCFA 2W0NA 1BRKA 2WKHA 2C99A 3U6QA 3JAMS 4GMQA 1C54A 3E0YA 1L8QA 1L0EA 4Q0IA 5IEOA 4N6NB 2OPFA 4DXCA 3T4KA 2Z76A 1PZPA 1JNQA 4AKHA 3JUOA 5AQ7A 2HWJA 5CXOA 4HIAA 1YLWA 4X6TA 3LEQA 2Y2GA 1ES3A 1VDDA 2LVQD 3T8UA 1A0KA 5TBMA 4RNTA 4QHCA 4L8OA 1Y28A 3HI7A 1GY7A 4ZDXA 4GHLA 1IY1A 3LGOA 1C3BA 1ZX2A 4IT7A 3FKWA 3OLOA 4EXRA 3CCR3 3L9KA 1PJSA 1XC8A 4LCBA 2Y2NA 5FLXS 2GBWB 2MJ5B 5L8RF 2D7GA 4R3JA 4PM6A 5FQQA 3JPUA 1Z59A 4O01A 1GHPA 1EIJA 3K9MC 3VK7A 3CPW2 2G2WA 2OO9A 2F5NA 1VQ73 3CC43 3F1OA 3SH9A 2DKLA 1N36M 2PBDP 2OWPA 2GU3A 3NBRA 5HDDA 4BJPA 1VDLA 2J80A 3AMOA 3BOSA 1BSAA 3VOLA 5ITQA 3IPTA 3VK8A 4IBRA 4GITA 1CQSA 1PM5A 3N7WA 5CHJA 1QZEA 2JXNA 2C9CA 1IYSA 3NDGA 5AI1A 3U2AA 2JQ5A 3UGJA 1CI8A 2AHMA 4MMYB 1NHGC 3N8SA 3T6PA 3DGNA 4Q7JA 1RGCA 4KT3B 2R78A 3IF6B 4X2OA 3RH8B 3FG3A 3ULFA 4OQIA 3SS5A 3MZFA 1BSEA 4HM6B 3PTEA 3GQZA 1KFVA 1KYIA 3ZCBB 3N54B 1BULA 3OXAA 3T1HM 3NHQA 1TRPA 2KW0A 3IHPA 3GLIA 2KF3A 3DWKA 2EX9A 3WS0A 1DVCA 4Y17A 1IXZA 4XK8F 4J5KA 2XGNA 2L1SA 1PYYA 5DKKA 5DKLA 2A24A 3GRJA 4S2IA 1AVKA 3LEZA 1CF0A 2KRTA 4TUWA 5D82A 3UZUA 2K47A 3EJVA 4RNYA 4PPRA 3W4OA 3GRDA 3U6EA 1DYUA 3JVCA 1DP6A 1XPBA 1GOYA 1JWPA 1CK3A 2HOHA 4EEUA 1U8CB 3NXJA 1DGFA 3G2YA 1K4EA 1DGHB 3U6CA 3FYCA 2ZC5B 4HH2A 3S7NA 3J80S 1NB3I 3OPLA 1MWSA 3U6PA 1EW0A 1SJWA 4HZ9B 3ZGAB 2W2CA 4IBJA 2Q9MA 2YX9A 3KSJA 2UWXA 4WMCA 1KWIA 1BUEA 2Y8HA 2HMOB 3BY9A 3F1PB 1HT2E 4WP2A 1W4NA 4Y3IA 4B9OA 1AQZA 2Y79A 5TFQA 2HP5A 3MMHA 4Z9QA 1KC84 4WF0A 2Z8YM 2I72A 3EF8A 3ZC7B 2O3OA 2DENA 1G96A 4U13A 4X25A 3LQRA 3N9HA 1LOVA 1P9RA 1TEMA 1XJ3A 3NOTC 3UL6A 3P01A 5DFXA 5TJJA 3M6AA 1S66L 4OPZA 3IF6A 3ZNTA 3OBFA 4R6LA 2R44A 4JXGA 1WJ7A 2LWXA 1JB4A 1RGEA 2QJ5A 3ITBA 4OU7A 1IY0A 2Z4SA 4HP9A 1MC0A 4HHDA 5GHYA 1SCWA 1RCKA 4FCMA 2BT3A 4IBEA 3BU4A 1OKSA 3EB8A 4G3OA 3UNWA 3CXC2 2KHHA 5AVFA 4JF8A 1G6OA 3CPTA 4UQIM 1JKGB 4MBHA 1P0ZA 4ZJ2A 1IVUA 3HU1A 3KOWE 4MCWA 3CCS3 4LFAM 3K5TA 3X3XA 4WLAA 3BB9A 4XDWA 2GSPA 3DM8A 3NUVA 4BBVA 2G5GX 1MKIA 1F8NA 1D0KA 2ML5A 4EWFA 2WKPA 3AHWA 3E99A 4XB5A 2R4EA 3B3XA 3ALAA 3EQQB 4JI0M 1FGQA 4X56A 2G7UA 2CRUA 3E4PA 3UY6A 3KSHA 5FTLA 4O02B 1I2WA 3CCV3 1QJGA 3RGPA 2ZC3B 3PR6A 3VFHA 2QA43 5DYIA 4Q53A 1XMQM 1TGUA 1LLBA 4EV2A 3HL9A 2JNHA 4K91A 4Y7PA 2Q07A 2D7EA 4IJEA 5DJTA 5EVHA 5EJCA 2XROA 1TS0A 3HX3A 1EI5A 4CCVA 5GL9A 1ISKA 1D06A 4AKYA 4NPBA 1H6UA 4LRSA 2YFLB 3MHEA 4M3KA 3VV4A 4HJ4A 3SHGB 1N9LA 2EX6A 2L4FA 1NO3A 4HNBA 3KOYE 4WFOA 3SX1A 1OTEA 4QWTA 1XJ2A 2LYXA 5ITUA 1YLYA 4H6JB 3D9YA 4FWHA 2CFOA 1QAOA 2J3TD 1I2FA 5IZ7D 2Z6CA 5A8BA 3WHOA 4L8RC 3A45A 1BVIA 1W5DA 2DWZB 4RF0A 4JXWA 2RL3A 2CHQA 1GS3A 3NBBA 3KIIA 1WTHA 3U5ZA 1LL9A 4I39A 5HWTA 3JR4A 3Q3FA 2RBIA 3QP5A 4E6WA 2UUBM 2E8JA 3T50A 1AVLA 1IEMA 1GSWA 5ITXE 3CUEA 3HVFA 1US1A 3HIIA 4L7KA 1BU4A 1TRQA 3HK4A 4BQMA 3KYEA 2KRKA 2XDMA 3OWSA 1W8QA 2X71A 3LY3A 4KT0F 4Z6YA 4O8GA 4PHTA 3MSHA 2GNOA 2XK1A 4IIWA 1ZO2A 3MG1A 4XXRA 2EKKA 2G3QA 1FA3A 4E3IA 3IG5A 2F4YA 1RTUA 3SYUA 2Y0TA 3ZFZA 4RYEA 3VDPA 1UUWB 2ERCA 7RNTA 3G34A 5DTTA 4Z1WA 4WW0A 1GL6A 2FFFB 2FNAA 1NV9A 1JTGA 2YKFA 3UE1A 3FUUA 2J7OA 5HARA 3MKEA 1C7HA 4R9LA 4WYKA 2W0QA 1OFHA 1IDPA 2P0MA 4H61A 4KZ8A 5HL6A 3MXRA 1D1JA 1I0VA 4WZ4A 3FTCA 2CFDA 1GCEA 3PAEA 3DY5A 1KE0A 2CH9A 5CTNA 4B3SM 3KFQC 1PNEA 2H0TA 5IU1A 1XNRM 5CGXA 3NECA 2V1UA 1UFZA 1SARA 1OCVA 4WUJA 1GHIA 2VKSA 1R4YA 3U60B 3GSPA 3D3OA 6STDA 1AV4A 2JY8A 4IEDA 5IF6A 2EUCA 1G6AA 4ME4A 2I7NA 1QALA 3V50A 2IYJA 1JR3E 5K5BA 1PJIA 3AGDA 4MBKA 2F5OA 3IF6C 4QOSA 5KPZA 5EV0A 1BLCA 4ARZB 3WA3A 4S12A 4KUOA 4UA6A 1E3VA 2KF4A 2IMJA 1BNIA 4FCVA 1VM1A 2DCFA 4MN5A 5EXPA 3T1QB 3LCUA 2CE7A 4KQRA 5IWAM 2Z4RA 1UGUA 2JKTM 3V99A 8RNTA 2QP9X 3K7CA 2JKTI 4W5WA 3HLBA 4HM8B 5AYSC 2MGWA 3SOAA 1STZA 4GHIA 6RNTA 4NXFA 3TW8A 3EQUA 2H0YA 5EXTA 3IXHA 3O5YA 1I2EA 3BFEA 4KFFA 3FWLA 5HPIA 1YLAA 2Z2MB 1TFOA 2PZVA 3UDIA 4D82A 4X1MA 3LXUX 1IXSB 3DGMA 1HZ1A 2BMOB 5F5YA 1LXEA 3PBNA 4JF6A 2C11A 2XRNA 3I51A 4D80A 2HJ9C 3M8CA 5J4EA 5IHVA 1QMEA 3J27B 1WMNA 2FXTA 1V34A 3U60A 3G6OA 3E21A 3IS2B 1JB0F 1M9GA 1BAOA 1OACA 3FLJA 5STDA 1Z09A 1BNFA 2WKIA 2OLUA 2E5LM 2XSZA 2CWVA 4NXBA 1IVVA 5JPUA 3IXBA 4FMDA 1ZAEA 3A0SA 5E2FA 4O3VA 2CFGA 4DR6M 1Q864 2HJEA 4ZAMA 1K57A 3K9PA 4MN6A 4AQYM 2CC3A 3G0KA 3NC8A 3WOFB 3VP1A 3OW22 3GMWA 1W63Q 3CD63 1GKIA 2W56B 2BJVA 3AOGA 3KSIA 1GSXA 2INXA 1VB6A 1IYYA 5LBRA 4L0LA 3K3CA 4LG2A 1I4WA 2CWBA 4QOZC 4WL9A 1BRJA 1JBSA 4DN0A 3BLMA 3MR0A 3DA1A 4I38A 1EEJA 2QCUA 3U6OA 3I01M 2R9WA 5DF9A 3FC7A 1XX2A 5EECA 1NSFA 4NL4H 3PBQA 1S3SA 2XZFA 5CERA 2FFJA 3A0VA 1GSVA 2FH5A 5FW5A 3QAUA 3WDGB 4JKTA 3CUEC 1IXSA 2K0BX 1Q9EA 3M6BA 3DGOA 5ITRA 1W6CA 2YKHA 3S5CA 2UXBM 2XSOB 3FCSB 3U97A 3DWZA 4X68A 3S29A 4UN2B 4JN6A 2DWLA 4KVHA 4GN2A 3A76A 4UQIS 3KOZE 4HM0B 2Z2LB 4Q0JA 3KSFA 2M7UA 4EETB 2D01A 2P38A 1NB5I 3RGSA 1K41A 3AJIB 4LZZA 3MZDA 4IUHA 2WGWA 1KSFX 1PRBA 3LT9A 4NK3A 1I0XA 3QP1A 2QMIA 2VV8A 3MKFA 2J9OA 3TG9A 3JUQA 3MJ5A 3IX4A 1L3LA 2OAP1 3D5IA 1TH3A 2H5XA 2LNHC 3VFDA 1K82A 2N35A 4H3UA 1JTDA 3BFCA 5GHZA 3LO7A 4F3LB 2QIYA 3D3LA 1TD5A 1MJGM 1G0TA 1Q7HA 2HHHM 5G1KA 2ZC4B 2QPNA 5KSHA 2HMJB 1X1XA 4CPKA 3MFXA 1E25A 3SMPA 4CJ6A 3GPUA 3HJQA 1KE4A 2CX0A 4DR7M 3DTEA 1XGJA 3UJNA 5FTKA 4CISA 5HGRA 3GVBA 3UPOA 2DZOB 4I4KA 3V39A 1BNRA 2V8FA 1YGWA 2QPAA 1DO0A 2IUJA 2INWA 2QJ7A 4S2MA 1M1XB 4WEJA 4QB8A 4RVAA 1FGTA 5CTMA 4EUVA 3DXOA 1PFLA 3C3EA 4NSRA 2M60A 3KKGA 1ROVA 1DO2A 1NU3A 3HJ8A 4JV5M 5EEOA 1W63M 4U0TA 1JWZA 4FWGA 2CV2A 3GPYA 1K8A4 1NYYA 4DUZM 2WKEA 4LF7M 2Z6BA 3G8ZA 3LIDA 4OPYA 3HLCA 1N9JA 4AKIA 5FI7A 4KHPM 3K92A 2UX0A 2B18A 1PJTA 4U0XA 3NBLA 1JBTA 4B3MM 5FDSA 1IXRC 3H7WB 4PM9A 2HMLB 3WRZA 4N6V0 1SXJA 3UK6A 1V33A 3IWOA 3GP1A 3JYIA 3RFBA 2P74A 4YNRA 5CLKA 3KFUG 3BXWA 1P9WA 3EN8A 2QZ6A 5L07A 4F3LA 4NRVA 4N6TA 5HD5A 3VOYA 3FH1A 5DTKA 2X8AA 1VQ53 2CMNA 2XR8B 5HD3A 4ZPXA 3DMCA 5A0OB 1VEJA 3SC3A 3KYZA 4G3KA 8CATA 2CEAA 2CKFB 3ZG0A 1N9NA 2ZQ7A 1OFIA 2V1AA 3LR4A 4EW5A 4FH2A 2RRUA 2JKFA 2JUJA 1PY3A 4UEYA 1DRMA 1R4GA 1L1ZA 4Q0HA 3S7PA 4OP8A 3PYJA 1M904 3SAWA 1L0DA 2H0HA 2GEYA 3VE4A 4HEFA 2R0IA 2P09A 4X1LA 4IIAA 3F8HA 4BTYA 1N8R4 3FTDA 1IVWA 3LCEA 2KEBA 1K57C 4LSOA 3PAGA 3NBXX 1FIKA 5AIHA 2Y4AA 3OOVA 1ACFA 2Y2IA 4WMCD 4Y2FA 3VE3A 1JZDA 1AWIA 3UE6A 5KZHA 5IERA 4UA7A 4R4KA 1ASKA 3IHBA 2DZLA 3JUMA 1PJQA 1Y4KA 1DJBA 3S28A 3E98A 3PBSA 3VKGA 1VEGA 3BQAA 1Y8GA 5DF8A 2OLVA 3BW6A 1XXMA 3CCJ3 2XEPA 3AGOA 2CFLA 2K54A 3GWRA 2KX6A 3GV9A 3IT9A 5F69A 3SYKA 4IBGA 4EERA 1RRHA 1OJGA 2J5YA 1OJ5A 3GLHB 1BUQA 3KSPA 4K08A 1X1UA 3E2LA 3G31A 1JV2B 1P3QQ 3NX0A 2V9AA 4LV0A 3C4OA 5IEPA 3PCRA 2VGJA 2DZNB 4WZ5A 3I563 1CEWI 3VP4A 2J7NA 4FVMA 4FUWA 4E3JA 2JKRM 3TJZC 2Y0QA 2JKRI 2VIIA 4JGOA 4QPRA 1TP6A 4ESPA 1UUVB 2RGQA 3FF2A 1WGNA 1K3WA 5BOHA 1X37A 1W01A 1W02A 4CIZA 3CC23 4ZM8A 2VV7A 3UE0A 1VEUA 3VSLA 4G3WA 4ZJ1A 3KS8A 2OAQ1 4OLGA 2EFUA 4DV4M 2D7HA 4X2HA 1OAOC 1G59A 5HWVA 3I7JA 4PCZA 4LRXC 2P0XA 3TSGA 1TH2A 4Q8IA 3F8XA 4XUZA 5TBMB 5FTMA 5HOHA 3W4QA 1Q2PA 2WGVA 3R4KA 4F1IA 1IYQA 5AIIA 1QUSA 1NZUA 2L4RA 4EBLA 3HU3A 3CI6A 2F5SA 3T15A 4N9LA 2KDKA 2WSFF 2V0UA 3S22A 3GLGB 1PW8A 2XA7M 4R80A 1MWTA 3SEDA 3GTCA 3U61A 1IQXA 3ISGA 3M0EA 1DMMA 3OPRA 3RXXA 1UI8A 2C6WB 4CQHA 4RF1A 3LI8A 4OH0A 2WO0A 1XXHA 5EQTA 4C75A 1UUGB 1E3RA 4KENB 3UB6A 4NXMM 5DJUA 1I5QA 4LRZE 4OLDA 4KZ9A 3FRHA 3F1OB 3BM6A 2WADA 3HHYA 1N77A 2OQEA 3OCLA 1FCOA 3AMOB 3HJSA 4BU4A 3DUKA 3GZRA 1W5TA 3KE7A 4AFIA 3ZCZA 4ID4A 5E2HA 3GDIA 4L6V6 4R23A 4BLMA 3DAVA 2IWBA 4EUZA 1RHLA 4L15A 2OOVA 4WM9A 1B2MA 3P98A 1LQMB 2Y2KA 3HGIA 5G18A 3PXGA 4JI3M 1J5EM 5FTNA 1G68A 2WOHA 2JN7A 4OOYA 3GLIB 1W8YA 3L25A 4YHHM 5AJGA 1RLSA 1UCJA 1CH0A 4MEIA 1HKXA 2W3EA 2DHYA 3TE8A 3AGNA 4NSOB 2SARA 4BBTA 3W67A 5FAQA 2A24B 1MWUA 3CF6E 2J3WA 5JBSA 3DW0A 2O5RA 2F4VM 3F40A 5IG4A 2JA2A 5I94A 3NBIA 1SKFA 3GLGA 3IH9A 3D79A 2MH8A 3KDSE 1R2ZA 2K6BA 3S4XA 4JBFA 3PBTA 1QAQA 3U4LP 4RX2A 4HOHA 4EQ1A 1ZKJA 2R4IA 1QANA 3R8FA 3E9SA 5EM1A 4GDNA 3ZVWA 3CPOA 2HDRA 3GSGA 4BL3A 3ZG8B 5FQJA 4ETXA 3SASA 4S2LA 4ZBEA 4EV4A 1K38A 4QHSA 3EHCA 1S0WA 4JF4A 2VF7A 1TJDA 1S4SA 1HD8A 3RXWA 2BIRA 3BJNA 3VLFB 3Q1FA 2EWVA 1BIRA 1WGLA 3A46A 3F7XA 3H4JA 3QYBA 3N8BA 2OCTA 2ZANA 1ZG4A 3SATA 2NUTC 4DE3A 1L2BA 1RJOA 3H82B 4X55A 2DWNA 4E3NA 3G16A 3K8ZA 4P6ZM 2PT7A 2W3HA 1KGGA 2KXGA 4EIWA 1NNVA 3HUOA 2KRUA 1BSDA 3T4TA 1OGXA 3LCVB 3LR3A 2XGLA 2Y2OA 2FZ0A 3UB8A 5BXQA 4PEJA 3C58A 1F2KA 1HNWM 2JC7A 1V9ZA 2M7OA 1T2IA 5IT5A 5D83A 2EJSA 4JF5A 3OX9A 1QMFA 2GJ3A 3IWQA 4DUYM 3CPTB 4DV7M 2C96A 3PBOA 4LRYC 4N9KA 5G2GA 1OTAA 5FASA 5CF2A 5F68A 1RGHA 3ER7A 1JZOA 3CJMA 5KSCA 4DE1A 4N6MA 1LI0A 1YSPA 4M4XA 1VQL3 5AQ9A 3W4PA 5FI2A 4HM1B 3MKIA 2ZAOA 1TDGA 1EWZA 1K9M4 3LMMA 1K56A 4GD6A 1GHMA 4WZ5C 4KG2A 5HL1A 2Y74A 3B9PA 2OQ4A 1JB2A 3A0RA 5HWWA 1DJCA 5KMWA 2VJWA 3B7QA 1HQCA 1I3FA 4F2LA 2H0IA 2GDNA 2DAEA 2ZQAA 1R6BX 3FRIA 1SG9A 2HPBA 4NREA 1NZOA 1C1KA
chains in the Genus database with same CATH topology
2YR0A 5IT9S 3SH7A 3MHVC 2XF3A 4O8SA 1CI9A 1ESIA 3MXSA 5KPRA 1DMQA 2CIUA 4QY6A 3CC73 2B24B 2ZC7A 5ELUA 1HU9A 3SOYA 4GDBA 4N1XA 4U3TA 4CDLA 2A3UA 2XSZD 1NJGA 3VP0A 4KZ5A 4DR1M 1ES2A 5EE8A 4IPBA 2CFWA 4LEHA 3GQ3A 1S5AA 1YMXA 2DRWA 4WURA 1W79A 2CV1A 4LJ5A 4I81A 3Q2PA 1WMPA 1GA0A 1MOLA 1IT8A 3U5ZB 1SHVA 1T3TA 3J7BA 3BNCA 1D6UA 3K2LA 5FA7A 3MG3A 5BR8M 3UE3A 3CME3 3PBRA 4NETA 4B4XA 4BTXA 1IK3A 3FTEA 4LZJA 1FR6A 2R62A 3UPNA 3GO8A 1M40A 1NNUC 5FQKA 3TWKA 3FKVA 4RZMA 2KXEA 1D6YA 3J2PB 1PWCA 4KZ3A 3WHKA 5HFOA 3MPHA 1FNNA 1ESUA 1PWDA 1N34M 4MH0E 4NHFA 1W5SA 3P09A 1IBLM 5EQLA 3K0ZA 2JE5A 3UN7A 4N6OB 1CEGA 2W6JH 1LVNA 2MF7A 3DGLA 3GZYB 3UPOA 3AV0A 1KGEA 1ERMA 2Z77A 5JYOA 1TUHA 5A93A 3PGBA 3X41A 4Y0OA 3IF5A 4WYKB 3G32A 5HAPA 3CMA3 4II7A 1J7KA 4HJLB 5D3OA 1VZZA 2SBLA 5AQAA 2L4VA 1JB5A 1FUWA 4XBYA 2GU1A 1Q40A 5A92A 4IBIA 2Q9NA 4OQGA 3Q90A 2Z7JA 4DV5M 5JPPA 1Q3CA 4KO8A 5DREA 5C1BA 5EOEA 4STDA 2P9VA 2DXIA 4JPMA 5EPHA 3B8LA 5M19A 3BNDA 1BSGA 1H8ZA 4QNMA 3M2JA 1L0FA 4G6ZA 3HKPA 5DNYA 1YMSA 4KQQA 7CATA 1N9EA 4IBBA 4LCLA 1IBKM 3VP2A 2ZQ9A 4BENA 3O87A 1NY0A 5CGSA 5EOOA 3CTWB 3B4OA 4KLNA 3UO9A 5LC6A 3LY4A 5EUAA 3Q7ZA 3VP3A 3QHYA 4DRTA 3BFGA 3TWLA 5TGFA 1Z5CA 4LY6A 4X64M 4XBXA 2HDSA 2FOIC 4MJDA 3KZTA 1L5GB 3MYTA 3TWMA 3SARA 2C5RA 5FI6A 4DE2A 2PBYA 3VGNA 1O07A 3CG5A 1SXJD 2CG1A 5F83A 2OV5A 1XGIA 4BLCA 3L0RA 2YFIB 3KP0E 2DWMA 4J9AA 3NY4A 1ERQA 4MBFA 2EX8A 2EA0A 1Q824 1MXOA 4YY3M 1JVJA 3FUWA 3IXDA 4MGIE 5IW9A 3BFFA 4OK0A 3OV4A 4HBUA 5EVIA 3IXGA 1YIT3 1N4OA 2VQFM 1QAKA 3UB1A 4GC9A 4BB9A 3FZCA 3G35A 3M2KA 3QRDA 4QD4A 2HMKB 3MSOA 3V92A 3TPZA 4LF6M 2BG1A 5M1AA 4A5RA 2KA6B 3UDXA 1STDA 4S2KA 3SMSA 3FYDA 3OWUA 1G41A 1RKYA 2STDA 1GY5A 2J7VA 3QNCA 4M0DA 2Y2LA 4MGHA 3AFHA 1JWVA 5LMUM 3PNYA 4WYYA 1DY6A 5JYPA 1E32A 3LT8A 4MMZB 4M0WA 1VQQA 5F82A 3ZVTA 4E3MA 4MB7A 1A2KA 3BLZA 1NJ4A 4XGIA 3LMLA 1PWGA 4FCZA 5AIGA 1O7MB 4D81A 3NBJA 4K0XA 3BYDA 4R0QA 2F5QA 2RCDA 1DJAA 3WRTA 2HKJA 3AGFA 4FMCA 3HLGA 2ZL8A 4M9SA 2WGWB 1CYVA 3I0YA 5EP4A 3IG8A 4K61A 5JI3E 1RGZA 1VQK3 1TDZA 4X69A 4BTWA 4M9XA 4FCJA 1O7PB 4KZBA 4EV5A 4JXVA 2KZUA 4MGYE 1PJJA 4YINA 2CWUA 4AEQA 1ONHA 3NI9A 3AGEA 4KZ6A 4N92A 3G6E3 3ZG9B 3WODG 4TX4A 4LFBM 3O86A 4EQIA 1ULJB 1IN8A 4MGKE 1GYBA 5A2QS 1FSWA 2HP9A 1J09A 4FW9A 3C7VA 1IYPA 2XFTA 4OKPA 4HLQA 5FQMA 1Z6FA 4PM7A 4P6BA 4IVKA 2E2VA 1VQM3 3U1WA 5DF7A 1A67A 4KODA 2B1XB 3IJEB 4NRWA 4DR4M 2WAEA 1Z1SA 4M9ZA 3HZPA 3RGAA 2J9PA 1YJ93 1KQS2 2W9QA 3AOEA 1R2YA 1K4FA 3H51A 4DV6M 3MK6A 1SXJB 3DFZA 1SIHA 3F9SA 4FMBA 3V5MA 3K63A 3HUMA 4K1VA 1Z5AA 4JLFA 3WS5A 4KZAA 3I553 4EBNA 1QAMA 2ZD8A 4HESA 5J8XA 1L0GA 4OQ0A 4DR5M 5F1FA 3WOEB 5EP3A 1FOFA 3KN4A 1K54A 1MU5A 3EQVA 5FDHA 3UMMA 1W2ZA 2QZ4A 2GBXB 4O2HA 4LJ7A 4LV1A 4QHTA 2YFJB 5ELJA 4WELA 4MEZA 5L2FA 5DRVA 5CF1A 4GIPA 1VQN3 1MY8A 5F1GA 4PM5A 3DTMA 5D81A 3ZG7B 2PNCA 2F5PA 2XD5A 1YUBA 4OP5A 2P5TA 3WS4A 3KS4A 3JUNA 2Y2JA 1JN5A 1HTZA 1K734 4XDVA 4R3BA 5KP1A 4IJFA 1A90A 3BECA 5CEDA 1IU7A 4GNUA 2BNGA 2I7PA 3QWLA 4PDIA 4FD8A 4DV1M 3QNBA 1KVMA 4OUQA 4OW0A 4LFCM 4J8TA 4S2OA 1YSYA 1A2VA 4GZBA 1J9MA 2ZC6B 2Y91A 3RJUA 2HDQA 1L1TA 3PNVA 1N5HA 1UI7A 5CXWA 1K56D 3FV7A 1VQ43 3EX9A 4B7FA 1PIOA 3T1YM 3KW6A 3PVSA 4HKVB 1OMEA 4OVMA 1G3IA 1ULIB 3D9RA 4ZJ3A 3LTAA 5E2EA 3V3SA 1IQPA 3U61B 1QVG2 3VSYA 3LVWA 1FGRA 3ZHHA 5HAIA 3TE6A 1XXHB 1GY6A 2X4AA 3X3YA 4GB7A 3CCM3 1XA1A 2W82A 4KZ7A 4LCMA 4DR2M 2E2UA 4A3VB 1KDSA 2XD1A 1E3UA 4DV0M 4LJ9A 1WE4A 4P85A 4I8OA 1TDHA 3K1JA 4QJGA 4Z8XA 4HM4B 5ITXA 1YIJ3 1NDOB 3A3EA 1MX0A 1QYRA 2R18A 4P16A 5EVLA 3CF0A 5H37D 3C4PA 4X66M 5IG3A 4AZFA 3OTOM 2XZUA 3UNLA 2WK0A 3C7UA 4X65M 1LNHA 5AIFA 3FUXA 1NRFA 1BZAA 3HUNA 5AEWB 3HREA 2Y73A 1NVMA 3QK9A 1K6RA 3S27A 2Y55A 2YFQA 4QNRA 3O3VA 3FKAA 2W03A 4BD1A 5KP4A 3HHWA 3FSDA 3IH8A 1KSIA 2B5RA 4R3DA 2W9PA 2CG0A 4XBOA 1OHPA 3FZWA 3SHFA 5AYRB 1K54C 2EXAA 2ZLYA 4PT5A 3N6IA 3FUVA 1TDLA 3RGRA 3UJMA 1IKIA 5CEBA 1O7WB 4I5SA 2ZM2A 4HM5B 2UXDM 2R65A 3WA2X 5HX9A 3CCQ3 4GB5A 1GVNA 2ML6A 2WGIA 2QBYB 2ZM0A 4WEKA 3G4S3 1JR3A 3E2KA 2H1RA 4RBNA 3SS4A 2EXBA 3NV0A 3GQ5A 4HM2B 3ITAA 4RNAA 4LZIA 3GPXA 2HCBA 1N8QA 1EE8A 3ROBA 2X02A 1ZC2A 3W0LB 4MGZE 1Q7Y4 5E2GA 2F99A 3SFZA 1SXJC 1IV9A 1MPLA 3L2AA 4G1MB 4ITQA 2CUZA 4OVZA 2RCXA 4RX3A 4LJAA 4YFMA 3HWSA 3LVVA 4LJ6A 5GLCA 1OF5A 2RKOA 4AG6A 1S723 3NIAA 4JXSA 1N33M 1NYMA 2CK3H 4LMIA 2RGHA 3J81S 3FG1A 3S1YA 1TU5A 2IA7A 5FAOA 2PU2A 3MWZA 3Q07A 3BRMA 2RGOA 4OQHA 3CNXA 1EROA 1D6ZA 3H4MA 1HNXM 4F94A 3J7AS 3OPPA 4IVIA 2BMQB 2UUCM 1KD14 2KCDA 2QBYA 1YE9A 1HVBA 1ALQA 4FCWA 4NOOB 2V2FF 3HBRA 2MC8A 3LOYA 3L27A 5GHXA 1E4DA 4XUXA 3NHXA 3D8BA 4JI5M 4JYAM 2WGOA 1AR0A 1IM2A 4FSFA 2HMNB 2XR0A 3CMZA 1IN6A 2DVWB 5EXXA 3ZNYA 4IBKA 4C3QA 1OHOA 1YLPA 1YI23 2XFSA 5EVID 3OPHA 3FYZA 4OVDA 1L2DA 4GL6A 4DF6A 1WYCA 1TFKA 1BLSA 3A3FA 4E3KA 4I4LA 4OOLA 1XWIA 5IREB 2M5ZA 1OUNA 4LF5M 2BLSA 4BL2A 1AXBA 3AKZA 4WBGA 4HM7B 1IV7A 1DGGA 5DYGA 2FNQA 3G713 4PDGA 1FGOA 4CJNA 4B3RM 3MFDA 1K3XA 4MLLA 4KFDA 3W8KA 3DZLA 5KQDA 4GRIA 4OOMA 4LV3A 3RE8A 5GLAA 1UM8A 1YLJA 4DE0A 4KFEA 1M6KA 5BVBA 1Q3BA 3VOZA 4K0KM 4EBGA 4E3LA 3DZDA 5JI2E 3EIEA 3I4YA 4GD8A 4B7HA 1XNQM 1SPUA 1VQ63 3T8NA 1STFI 4E3OA 3HHXA 2BJWA 4LF4M 1IN7A 2R4JA 4N3VA 3RDEA 3SYLA 2UXCM 1PZOA 2XLJA 1W5ZA 4AW4A 3Q82A 2LXEA 4CHTB 3JUPA 3HLDA 4K0WA 1OPYA 5IG5A 3HIGA 5GLDA 1IN5A 2Q2EB 2IUKA 1N5PA 2XH9A 2K0MA 1Q40B 3KVWA 5CHMA 4FCTA 1WNHA 4HYZA 3CZDA 3ZDJA 2OQEC 3MBZA 1DGBA 2H5SA 1Q814 2P9VB 2V1CA 1MNLA 2V1LA 1I2SA 5A91A 1Z6TA 1RRLA 1SXJE 2OOVC 4RA7A 5KPTA 2ZDJA 1W7FA 4OPRA 3CU3A 3SLUA 3EC9A 3ILKA 2LH0A 3FUTA 2E8IA 2EX2A 2Z3XA 3PCSA 3B4PA 1EA2A 2C5WB 3WS1A 5E26A 3G30A 2BNKA 1DGHA 2Y2HA 4P0MA 1TH4A 4IBXA 4R9KA 4GKKM 1NY5A 1LL5A 4O7DA 1HQYE 3IHAA 4KG5A 2JDIH 3LTDA 3NQYA 3ZG5A 5IG0A 4WP5A 1PI5A 2WZXA 3AL0C 1LV7A 1PU4A 5CGWA 1FJGM 5EP2A 2CW9A 2X49A 2V6ZM 3I4VA 1YHQ3 2V20A 3M6HA 4D2OA 3Q1CA 3WMDA 1PFPA 4R4RA 2JBFA 1JRQA 5E43A 3HX8A 5CHUA 3PFIA 3TQSA 2CHGA 1NNJA 3CCL3 3OWYA 5FSRA 4PM8A 3SS3A 5I97A 3VSKA 1EKMA 1FQGA 5FQ9A 1FGMA 5HAQA 5EVIB 3SVAA 5GKNA 3U6DA 1K55A 4LJ8A 1VQ83 3OCNA 1DMNA 2Y2QA 2BHMA 4FWDA 4Y0UA 1JKGA 4AG5A 4LGYA 4L78A 3R9XB 4H8RA 2ZQDA 1XP4A 1IQYA 5LMNM 2LQVA 3KSED 1OHSA 2L7HA 2ZQ8A 4LJ4A 4JI6M 2XLNA 3BNEA 3HLFA 2A49A 4R7GA 3N8RA 2G8LA 4JI7M 3EN1B 1LOXA 4N1HA 2HDUA 4JI4M 1VQO3 3PXMA 3FD9A 3VF1A 4FD2A 2L6OA 4AKGA 2Y2MA 1QVRA 4B08A 3UPPA 2XRXB 3H3HA 2RSXA 3LYGA 2IWDA 1WXQA 3U6MA 2CHCA 5U47A 4DV2M 1SIIA 4B4ZA 2WZZA 1YGEA 4HM3B 1R4CA 4N6UA 4AKZA 5CRFA 3GAXA 4EC6A 1PI4A 1YLZA 1GLNA 1FCNA 1CEFA 2Z7AA 2C10A 3CF2A 3D4FA 4UAAA 3NQZA 3F7SA 4LGMA 2O9UX 3LTCA 1TVFA 4GC5A 2YNMD 3W0FA 1V74A 3UDFA 4N6LA 2WUQA 1XMOM 3F14A 2FE8A 1MBLA 3BLSA 1E94E 1W6GA 3ZH9B 2GEXA 5GLBA 3ECFA 3GPPA 4KG6A 2FGTA 4G4QA 3A42A 2Y59A 3U6LA 1ORYB 1QQWA 1K25A 2Y2PA 3X42A 1JJ22 4FH4A 1LI9A 3SH8A 3Q7VB 4PMAA 4QY5A 1ES4A 1RGYA 2G2UA 4P87A 2E2TA 3WHLA 1K6SA 1GD3A 3FTFA 5CK6A 4MMXB 3EIHA 1W6YA 4S2PA 2IWCA 2V1ZA 4BD0A 1HZOA 1RP5A 4REZA 1R7RA 2W04A 3EBTA 2F98A 1E3UD 3SBJA 4X62M 2QENA 3O88A 1IBMM 2WOFA 2EFXA 1IELA 2R45A 4JRFA 4AI6A 7STDA 2PU4A 3VFFA 4L8PA 1ZQ9A 1CYUA 1XHBA 3BEBA 4B3TM 3WS2A 1OJLA 1IYOA 3RFWA 2C9OA 1ZG6A 2GXFA 1QMAA 2OTL3 4EYCA 2OSUA 1QVF2 1KE3A 2VQEM 3Q7VA 3U6SA 1UW1A 5DVAA 1PW1A 2J8YA 1W00A 4LGQA 3SAVA 1YJW3 1BT5A 4HBRA 4OONA 1IQ8A 4QU3A 1HNZM 1U60A 1YVBI 1RCJA 2CHVA 3T38A 3JR5A 4LF8M 1H8YA 5M18A 4MM3B 1K55C 2ZJ9A 3EBYA 3CCE3 5IENA 3BFDA 3Q8XA 5FATA 1O7GB 2HMMB 3N8LA 5DTSA 4E6XA 2EO2A 1IKGA 2JCHA 1JN5B 1D2NA 4ZTKA 3KXEC 3C5AA 1G8PA 2R46A 1GA9A 1JR3D 4IBDA 3SXXA 4OPQA 4HVNA 3VDUA 4JI1M 2ZAMA 1HR0M 3NM7A 4GKJM 1FCMA 3NM2A 1Z5BA 1OH0A 4DKIA 3PS8A 2ZQCA 5C18A 1SQWA 3LH4A 3X3ZA 2CWTA 3GLFB 2VGKA 1N9BA 3DOAA 5FTJA 1ROAA 1TIJA 3CNMA 5A90A 4GH9A 2HL7A 2WAFA 3GRVA 3GRYA 2DHRA 1N78A 3L26A 1SDEA 4GKUA 3D8LA 4UA9A 3SOIA 4S2NA 1EQKA 4UHUA 3V3RA 1Q2QA 4K90B 1NWWA 2W56A 1ES5A 1ONGA 1NXYA 1YM1A 3FG4A 5TR7A 1YT4A 3L29A 3IWIA 5EVIC 4KQOA 1N32M 4LV2A 1DVDA 4JI2M 3OC2A 4XBTA 4Y0TA 2CC1A 1KVLA 2ZM6M 1LHYA 2DNSA 1E9RA 2NQ8C 3L28A 3THGA 3GZXB 3A3IA 3A3DA 4S2JA 2A5YB 3KSXA 1FR1A 4LENA 3Q81A 4GOGA 2D1WA 4FR9A 1NY6A 4DV3M 1WYBA 8CHOA 4DDSA 2WGQA 3B7CA 4EBPA 3NWLA 2F86B 3HLEA 2CFKA 1O7EA 1KGFA 1VQP3 3GLFA 3GR2A 1H5XA 2ZM8A 3GQ4A 2L09A 4L16A 3GZBA 1KDWA 1VQ93 2R9XA 1Q39A 2FFYA 2A15A 1BLPA 3FGYA 2QEX3 3NDEA 3N4IA 4BBAA 4G4OA 5TGNA 2X01A 1JQJC 4NXNM 1NJFA 4RNZA 3G4PA 2I9WA 4HZBB 1Y54A 2H10A 1O7HB 3HHZA 3GRRA 3HU2A 1U5OA 1L2SA 2C98A 5LC7A 1T5YA 2P05A 5ITYA 4HBTA 2BO9B 5FAPA 3E4RA 1OGZA 1QAFA 4DXBA 5FGOA 3G2ZA 1WQLB 4DDYA 5F3WA 1M1K4 4X53A 1L2CA 3FKEA 3WWXA 1G4AE 2UUAM 3PZWA 4G4NA 3SAUA 4XM4A 4JI8M 1BTLA 1YLTA 4R4SA 2Y21A 2WYXA 2UU9M 4WHAA 3TOIA 1XA7A 1YJN3 2Y20A 3MZEA 2HP6A 1I94M 3A3JA 5EXSA 1EG9B 3T0UA 4LRTA 3M7GA 2RFRA 1NHWC 1QZMA 4R1GA 3LQQA 4KZ1A 1YQSA 1RN7A 5KQ8A 4GHAA 3NV0B 5E6JA 1J2BA 1GL7A 1W2B2 1IVXA 2ZMAA 1HT1E 2L7IA 2KZSA 4B88A 2BMRB 5KP3A 1FSYA 2YQZA 1IN4A 1E9SA 1GD4A 4ORLA 3AOEC 3VMAA 3S67A 3KOXE 3HLWA 3X40A 1SDNA 5KO3A 4OX9M 3J7Yd 1MWRA 1IT7A 3CCU3 3GRUA 1NJI4 4MNRA 4OVZB 2XSHB 3V98A 3IMAB 4DR3M 4HL4A 4G4RA 4L4UA 3MG2A 1OF5B 3IQAA 4KZ4A 3STDA 3VKHA 1K28A 4IBCA 3A98B 1O7NB 3BNBA 4LF9M 5AQBA 1E97A 4FMAA 1IY2A 4PD2A 2OTJ3 3NCKA 4S2NC 3EE1A 4JXJA 2XQZA 5EP1A 5FSWA 4B7GA 2CV0A 4WWUC 1BLHA 4K1UA 5HW3A 2QGUA 3TDGA 1WMOA 3LTBA 5ITTA 2D42A 3O8YA 3TL4X 1Q42A 1S6RA 3KP1E 4C6YA 5CECA 3GLHA 2ZBKB 5BPVA 3FF0A 3LZAA 4R1KA 3OZHA 1W7CA 5AEUB 5FQIA 1N75A 4IBFA 1XKZA 3UL5A 4CGYB 4FCFA 2WKHA 2C99A 3U6QA 3JAMS 4GMQA 1L8QA 1L0EA 5IEOA 4N6NB 2OPFA 4DXCA 2Z76A 1PZPA 1JNQA 4AKHA 3JUOA 5AQ7A 5CXOA 1YLWA 4X6TA 2Y2GA 1ES3A 1VDDA 3T8UA 4QHCA 4L8OA 3HI7A 1GY7A 4ZDXA 4GHLA 1IY1A 1C3BA 1ZX2A 4IT7A 3FKWA 4EXRA 3CCR3 1XC8A 4LCBA 2Y2NA 5FLXS 2GBWB 2D7GA 4R3JA 4PM6A 5FQQA 1Z59A 1GHPA 3K9MC 3VK7A 3CPW2 2G2WA 2F5NA 1VQ73 3CC43 3SH9A 1N36M 2OWPA 2GU3A 3NBRA 4BJPA 3AMOA 3BOSA 5ITQA 3IPTA 3VK8A 4IBRA 4GITA 1CQSA 1PM5A 3N7WA 5CHJA 2C9CA 1IYSA 3NDGA 5AI1A 2JQ5A 3UGJA 1CI8A 2AHMA 4MMYB 1NHGC 3N8SA 3DGNA 3IF6B 4X2OA 3FG3A 4OQIA 3SS5A 3MZFA 3PTEA 4HM6B 3GQZA 1KFVA 1KYIA 3ZCBB 3N54B 1BULA 3OXAA 3T1HM 2KW0A 3GLIA 3DWKA 2EX9A 3WS0A 1DVCA 1IXZA 1PYYA 2XGNA 3GRJA 4S2IA 1AVKA 3LEZA 2KRTA 4TUWA 5D82A 3UZUA 2K47A 3EJVA 4RNYA 4PPRA 3W4OA 3GRDA 3U6EA 1DYUA 3JVCA 1XPBA 1JWPA 1CK3A 1U8CB 3NXJA 1DGFA 3G2YA 1K4EA 1DGHB 3U6CA 3FYCA 2ZC5B 3J80S 1NB3I 3OPLA 1MWSA 3U6PA 1SJWA 4HZ9B 3ZGAB 2W2CA 4IBJA 2Q9MA 2YX9A 3KSJA 2UWXA 4WMCA 1KWIA 1BUEA 2HMOB 1HT2E 1W4NA 5TFQA 2HP5A 4Z9QA 1KC84 2I72A 3EF8A 3ZC7B 2O3OA 1G96A 4U13A 3LQRA 3N9HA 1TEMA 3UL6A 3M6AA 4OPZA 3IF6A 3ZNTA 4JXGA 2LWXA 1JB4A 3ITBA 4OU7A 1IY0A 2Z4SA 5GHYA 1SCWA 4FCMA 2BT3A 4IBEA 3EB8A 3UNWA 3CXC2 4JF8A 1JKGB 4MBHA 4ZJ2A 1IVUA 3HU1A 3KOWE 3CCS3 4LFAM 3K5TA 3X3XA 3BB9A 4XDWA 3DM8A 3NUVA 2G5GX 1MKIA 1F8NA 2ML5A 4EWFA 3E99A 4XB5A 2R4EA 3B3XA 3ALAA 3EQQB 4JI0M 1FGQA 4X56A 3UY6A 5FTLA 4O02B 1I2WA 3CCV3 1QJGA 3RGPA 2ZC3B 3VFHA 2QA43 5DYIA 4Q53A 1XMQM 1TGUA 1LLBA 4EV2A 3HL9A 4K91A 4Y7PA 2Q07A 2D7EA 4IJEA 5EVHA 5EJCA 1EI5A 4CCVA 5GL9A 1ISKA 4AKYA 1H6UA 4LRSA 2YFLB 3MHEA 4M3KA 3SHGB 2EX6A 1NO3A 3KOYE 4WFOA 3SX1A 4QWTA 2LYXA 5ITUA 1YLYA 4FWHA 2CFOA 1QAOA 5IZ7D 4L8RC 3A45A 1W5DA 2DWZB 4RF0A 4JXWA 2RL3A 2CHQA 1GS3A 3NBBA 3KIIA 1WTHA 3U5ZA 1LL9A 3JR4A 4E6WA 2UUBM 1AVLA 1IEMA 5ITXE 3HVFA 1US1A 3HIIA 4L7KA 3HK4A 4BQMA 2KRKA 2XDMA 3OWSA 1W8QA 2X71A 3LY3A 4Z6YA 2XK1A 4IIWA 1ZO2A 3MG1A 4XXRA 1FA3A 4E3IA 3IG5A 2Y0TA 4RYEA 3ZFZA 3VDPA 1UUWB 2ERCA 3G34A 5DTTA 4WW0A 1GL6A 2FFFB 2FNAA 1JTGA 3UE1A 3FUUA 2J7OA 5HARA 3MKEA 1C7HA 4R9LA 4WYKA 2W0QA 1OFHA 1IDPA 2P0MA 4H61A 4KZ8A 3MXRA 4WZ4A 3FTCA 2CFDA 1GCEA 3PAEA 3DY5A 1KE0A 2CH9A 5CTNA 4B3SM 3KFQC