2XFSA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 138
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xfsA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xfsA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xfsA02
1YLTA 4UA6A 4S2MA 4Y0TA 3DTMA 4OOYA 4PM9A 1FCMA 4GDBA 2OSUA 5EECA 3IWIA 2B5RA 2X71A 4UHUA 3AGDA 5E2HA 4JKTA 1KDWA 1FSYA 3VFHA 5F1GA 3ZGAB 4R4RA 5AQ9A 1MWRA 2RL3A 1U60A 1HTZA 1K56A 3BRMA 2WZZA 3VP4A 3P98A 4E6XA 3TSGA 4U0XA 2V20A 3VP0A 1E3UA 1FCOA 2QMIA 1YQSA 5DF9A 3FYZA 3N8LA 5CGXA 5CECA 1IEMA 1XXMA 3FV7A 3WS0A 3VSLA 1BT5A 4MNRA 1G6AA 1K55C 1O07A 1OMEA 2WGIA 4WEKA 3GSGA 1ONGA 2HDQA 1PW8A 3UO9A 4F94A 3Q81A 4RVAA 5FASA 1QMFA 3FZCA 4PM7A 5HARA 1SDNA 2H0YA 3BYDA 1LLBA 1FR1A 2PU4A 4S2JA 4JF6A 2JBFA 2Z2MB 2X01A 4Y0UA 2ZC5B 5F83A 3O86A 1M6KA 1I2SA 4B4ZA 4LV0A 4MBFA 1Y54A 3O87A 2HDSA 3Q82A 2WKEA 4JXGA 4ZBEA 3B3XA 4Q8IA 5CEBA 3OPLA 1BZAA 2FFFB 1K56D 4OQHA 1BSGA 1JVJA 1L0EA 3C4OA 5EVLA 3S1YA 2QZ6A 4WZ5A 4RX3A 3UE3A 2Y2KA 1K57A 3IHBA 4UA7A 3SS3A 3ZG9B 1N9BA 3D4FA 2C6WB 1L0DA 3MFDA 4KQQA 1YLPA 1E3UD 3LEZA 3ZG7B 4NK3A 5CHJA 3CZDA 1KDSA 1NRFA 2XR0A 2Y91A 1PWDA 3BFDA 3BFGA 1IYPA 3BFCA 3HLGA 4S2IA 5M1AA 5KSHA 4E3NA 3NBLA 5FQJA 1WYCA 3MXSA 5EOEA 3ISGA 4C6YA 3MZEA 1KVMA 1ZG4A 5I94A 3AGEA 4HEFA 5FAPA 3IXHA 5E2GA 4QY6A 2WZXA 3HLDA 3PBRA 2OV5A 3VOYA 2XFSA 3LY3A 1MBLA 4WMCA 5E2EA 5EVIB 3SH8A 1CEFA 3HVFA 3OCLA 4OH0A 4EWFA 2Z2LB 2C5WB 1XGIA 3HUMA 5FQKA 4DE2A 1MWUA 3NI9A 5TFQA 5JYPA 3IF5A 4X68A 5G18A 1ERMA 4RA7A 3WS2A 5CTMA 1XPBA 3M6BA 3MZFA 4Z9QA 3GRJA 4S2NA 2H5SA 1SHVA 4OOMA 3V5MA 5FSRA 5GHZA 1O7EA 1MY8A 2Y2HA 1TEMA 1KE3A 1PI5A 4E3MA 5GHXA 3EQUA 1NZOA 4IVKA 3ZG0A 4PM8A 2ZQ9A 4XUZA 4DE1A 5FI6A 3GQZA 1IYSA 4OPRA 4WZ5C 1SKFA 3G31A 4Y7PA 4BLMA 4ZTKA 1ESIA 3VOZA 4OP5A 3A3JA 2ZC6B 2XLNA 4OQIA 1HD8A 4KZ7A 3UDIA 2ZD8A 2IWDA 3W4QA 4BENA 4N9KA 4X53A 3SS4A 3NDGA 1W7FA 2EX2A 1FQGA 4OLGA 3IQAA 2WADA 4BD0A 1GA0A 3P09A 4QB8A 2CC1A 3UE1A 4WMCD 5L2FA 4JF4A 4OOLA 4HBTA 3TG9A 2ZQ7A 5A93A 2Q9MA 2WUQA 3VFFA 3HREA 3UPPA 2IWBA 3Q1FA 3W4PA 4EBNA 1SCWA 1J9MA 3IWQA 3IHAA 5HAIA 3V39A 4CPKA 1NYYA 3N8RA 1CI8A 1WYBA 2Y4AA 4OKPA 1MWTA 2ZQAA 4JF5A 3HBRA 4N1HA 4IBRA 5FAOA 2BG1A 4P85A 3UNWA 3WWXA 1L0FA 4MBHA 1GHPA 5D3OA 5GLBA 3WS5A 5GLAA 4DXCA 1VQQA 2XFTA 4EUZA 1IELA 4FCFA 5DVAA 3O88A 1YLZA 3LY4A 3IXDA 3NC8A 4DKIA 5IHVA 4FD8A 4WYYA 5HL1A 1NY0A 1XX2A 1NZUA 4KZ6A 1JTDA 3S4XA 4E3OA 2EXBA 2XD5A 3GMWA 3PBTA 4WM9A 5KSCA 1NYMA 4R0QA 1DJBA 3I7JA 4S2KA 1CI9A 1E25A 3IF6A 2WKIA 3NIAA 4KG2A 4BL2A 1G68A 2DRWA 3Q7ZA 1FSWA 5CERA 4ZJ2A 3Q7VB 4OVDA 2ZQ8A 1RCJA 2HP5A 3N8SA 4KQRA 4LCMA 4S2NC 2HDUA 1PZOA 3M2JA 3NY4A 4OQGA 2P74A 4WELA 5DTSA 1ES4A 2Y2QA 1XA1A 2WKHA 5FQMA 2WAEA 3NDEA 1C3BA 3UY6A 1IKGA 1KGEA 1Z6FA 2WYXA 4LV3A 4R3JA 5FQIA 4HESA 4IBXA 2XDMA 4XUXA 4X56A 2ZQCA 3QHYA 4FH2A 2DCFA 3N4IA 1BUEA 2ZLYA 3DWKA 3G2ZA 3PAEA 5CGWA 4CJNA 5M18A 2G2WA 2HP6A 2ZQDA 3HLCA 1JTGA 1FR6A 2FFYA 4DDSA 4EV4A 3ZVWA 5EUAA 3VSKA 2GDNA 2Y2MA 4C75A 4E3JA 2VGKA 2Y2IA 2Y55A 4ZAMA 4OLDA 5A91A 3ZVTA 3RXWA 1JWZA 1MXOA 4R4SA 4KENB 4H8RA 5M19A 1RGZA 2XQZA 3BLSA 4R1GA 4GDNA 4LCLA 1XP4A 3GVBA 3ITBA 4E6WA 3G30A 1RGYA 1DJAA 3ZCZA 4XXRA 1H8ZA 1GCEA 4WEJA 1CK3A 5EPHA 1RP5A 2EX6A 1HVBA 3C7VA 1PZPA 1BULA 5AQAA 3DWZA 2OLVA 2R9WA 5HAQA 1MPLA 3V3RA 1K6SA 1ES3A 1H5XA 1ESUA 1JWVA 2H10A 2Y2JA 5EVIC 3UE0A 1Q2PA 4DRTA 1GHIA 3WRZA 3ZFZA 2Y2OA 5GLCA 1EWZA 2HPBA 5FAQA 1LL9A 5HW3A 3HLWA 3OPRA 1ERQA 3UPOA 5E2FA 3PBQA 4OPZA 5CGSA 3NCKA 2ZM2A 3IXGA 3VP3A 4QY5A 4D2OA 1XA7A 4FSFA 4OPYA 3MKEA 4K0WA 3WS1A 4KQOA 3BLMA 1DY6A 5E43A 3G34A 3C7UA 3HLEA 1LI0A 1BLPA 1VM1A 5FATA 3CG5A 4KG6A 4GZBA 4KZ8A 4O7DA 2XK1A 1IYOA 2A49A 1BLCA 1K4FA 3CMZA 1K38A 3W8KA 4PMAA 2Y2PA 2X02A 2XGNA 1TVFA 1ES2A 1ZC2A 1YLWA 2H0TA 3G32A 2WGWB 4B4XA 1XKZA 5KMWA 3SS5A 3HL9A 1ZKJA 4DDYA 2V2FF 4DE0A 3E2KA 4K0XA 3MKFA 4KZ9A 3O3VA 1WE4A 1K55A 1KVLA 4KZ3A 3IH9A 4WBGA 3G2YA 5A92A 3G35A 4P87A 3Q07A 4OP8A 4GKUA 3SH9A 3ZG8B 3G4PA 3HUNA 4MBKA 3GR2A 4OPQA 3BECA 3UN7A 1YM1A 1ES5A 1TDLA 1GHMA 1W8YA 4GB7A 1AXBA 2J9OA 3MZDA 5CTNA 5FA7A 4A5RA 5FI2A 5CRFA 4JXVA 5DF7A 1I5QA 1PYYA 4OONA 5EVID 5EOOA 2ZMAA 4BL3A 2OLUA 3FKWA 2WGVA 2RCXA 2ZC4B 2J7VA 3A3IA 1ZG6A 2BLSA 3C4PA 5GL9A 1M40A 1S0WA 3SH7A 1YMXA 3N6IA 4UAAA 3OCNA 3W4OA 3ZHHA 1W8QA 2V1ZA 2Y59A 3IH8A 4GNUA 4EBPA 4QJGA 1YT4A 4KG5A 2WGWA 1IKIA 3N7WA 5J8XA 4MLLA 1H8YA 1YLJA 4M3KA 4BQMA 3V50A 4KZ4A 2XD1A 2ZC7A 2PU2A 3HLFA 2WK0A 3CJMA 3OPPA 4S2OA 4JLFA 4PM6A 4UA9A 2XF3A 4JBFA 4KZ5A 4RYEA 1NXYA 3S22A 3UDFA 3OZHA 4GN2A 3AGFA 4N9LA 1KE0A 3IXBA 1L2SA 2JCHA 4N1XA 5A90A 3A3DA 3HLBA 4IVIA 1ONHA 4X55A 4KZBA 2JE5A 1QMEA 3GTCA 3ITAA 4ID4A 3BM6A 5FQ9A 5FDHA 4FH4A 2Q9NA 1TDGA 4S2LA 1LHYA 1N4OA 1EROA 2A3UA 4ZJ3A 3EQVA 3M2KA 5CHUA 1YLYA 4LV2A 4DE3A 3QNBA 1JWPA 4GOGA 3PBOA 2QPNA 1HZOA 2Y2LA 2ZC3B 3IF6C 2ZJ9A 4K91A 5TR7A 1L0GA 4EBLA 4U3TA 3BFFA 2J9PA 1K25A 4S2PA 3ZG5A 2DNSA 4YFMA 5DTKA 4LENA 3V3SA 1LL5A 3LCEA 1E4DA 3QNCA 3RJUA 4GD6A 4JXWA 3LO7A 4JXSA 4PPRA 3TOIA 1IYQA 3C5AA 1KGFA 4MEZA 3ZNYA 5KZHA 3Q7VA 4Y0OA 5FQQA 1Q2QA 4E3KA 5F1FA 5JYOA 5GLDA 3BEBA 3FKVA 4DXBA 1BTLA 3PAGA 5CEDA 2E8IA 4OQ0A 1PW1A 4X69A 3SOIA 4N92A 2R9XA 2I72A 3OC2A 3DW0A 1PWGA 4IEDA 5EE8A 2P9VA 3JYIA 1PI4A 2PBYA 1ALQA 4RX2A 2EXAA 2EX8A 1DJCA 2Y2NA 5FI7A 3WRTA 5CXWA 2ZM8A 3ZNTA 3IWOA 4WZ4A 1W5DA 1XGJA 2JC7A 3PBSA 4P0MA 4KZAA 1I2WA 4R3BA 4ZJ1A 1FCNA 2XH9A 1K54A 4B88A 2ZM0A 5AQ7A 4R23A 1KE4A 2P9VB 3MXRA 1BLSA 3MBZA 1K4EA 3RXXA 4LV1A 2HP9A 5BOHA 4E3IA 3UPNA 3BFEA 4X6TA 5GHYA 1KGGA 2EFXA 1BLHA 5HX9A 1YMSA 4E3LA 3HUOA 3PBNA 4HBUA 4NETA 4QHCA 1NJ4A 5HAPA 4QU3A 4BJPA 4ZDXA 5HFOA 4EQIA 4GD8A 1CEGA 4P6BA 2IWCA 2J8YA 3WS4A 1GA9A 1SDEA 2VGJA 3PTEA 4L0LA 4BD1A 1K54C 3A3FA 3E2LA 3VP2A 3FWLA 5CHMA 1PWCA 2XEPA 3M6HA 3VMAA 1W79A 4YINA 5AQBA 5TGFA 2UWXA 5U47A 1K57C 1MWSA 1MKIA 1S6RA 4C3QA 3GV9A 3VP1A 3A3EA 5DTTA 4PM5A 5F82A 2Y2GA 5DF8A 1PIOA 5EVIA 4JPMA 2WAFA 2G2UA 3OPHA 4DF6A 2EX9A 1K6RA 4U0TA 3UDXA 3IT9A 3ZDJA 1FOFA 1EI5A 1LI9A 3IF6B 2EFUA 2HDRA 4QD4A
chains in the Genus database with same CATH superfamily
1YLTA 4S2MA 2F5OA 3AJIB 2ZANA 1RNTA 1MGWA 1UCIA 3S27A 3F1PB 5EECA 4XDWA 3IWIA 2LWXA 2L4RA 2L0WA 2R65A 3SC3A 4O3VA 1W5ZA 4NXMM 1M1XB 1FSYA 1A5TA 1PFPA 2CFKA 3MG3A 1XJ2A 1RGAA 5AQ9A 2M7OA 1O7GB 2RL3A 1FGTA 2WKQA 3TSGA 1UUVB 2V20A 1OH0A 2QMIA 3MR0A 1GKIA 4MN6A 3T1QB 3FYZA 2QIYA 5CECA 3S7PA 2XR8B 1XXMA 3FCSB 4KT3B 4WYKB 5F6AA 3JVVA 1F5MA 1O07A 4L6V6 5I97A 1NNUC 1N9LA 3N9HA 2APLA 2V1AA 5DRVA 1IN5A 2K54A 3Q81A 1QMAA 3CPW2 4PM7A 3KZTA 3HWSA 2C10A 2H0YA 3NBIA 1FR1A 1RGLA 5HWTA 5G4ZA 1RMSA 3EBTA 3QP4A 3E98A 2X01A 4MB7A 5F83A 3O86A 2FZ0A 2YKHA 2IA2A 5IF6A 2WKEA 1PJJA 3B3XA 4MMZB 1K56D 1ZMWA 2Z4SA 2I7PA 1QYRA 1MC0A 2Q2EB 4H6JA 2CW9A 1L0EA 3S1YA 4EXRA 4QOZC 3TL4X 2DWZB 2Z77A 4PDGA 4RX3A 3R7WA 2J80A 3B7CA 4NREA 4UA7A 1PYLA 1N9BA 4CLCB 3VKHA 1CH0A 1SG9A 3LEZA 3ZG7B 1EUIC 3U2AA 3TE6A 1RTUA 3L29A 5CHJA 3BFGA 4BTYA 4S2IA 1CYUA 3BFCA 5M1AA 4X62M 1V92A 2VF7A 3U6QA 1W6CA 3RGAA 2F5SA 3MXSA 2CWBA 1DP8A 3ISGA 1YJ93 4C6YA 5HSQA 1FILA 4N3VA 1SARA 3BY9A 1LV7A 3NWLA 5FAPA 3D9RA 5E2GA 1O7HB 2OV5A 3PBRA 4N6UA 3U97A 3CCU3 2W2CA 4WMCA 5EVIB 3V67A 3HVFA 4UEYA 2KAAA 4OH0A 4B7FA 3QK9A 1UUWB 1BUQA 1XGIA 2C11A 4LGWA 4NXBA 4BB9A 3CCV3 2PRFA 3J27B 2M1CA 1AV4A 5BR8M 4GH9A 2F4VM 1W6GA 2W56B 2CMNA 5G18A 1ERMA 1G6OA 1W00A 3WS2A 4FCJA 3FUTA 1VQM3 3C9PA 5CTMA 2ERCA 2V8FA 1R4YA 3NHQA 3VDPA 1ASKA 3FF2A 4IUHA 2GNOA 3F1NB 1PI5A 3IJEB 1NWWA 3EQUA 4KFEA 3ZG0A 2I7NA 2PT7A 1W63M 3AHSA 1SKFA 3T1XA 3G31A 5JPUA 4Y7PA 4DV6M 3LIDA 1EW0A 4MGYE 1KOUA 3K0ZA 1RGGA 4OP5A 1W5TA 3A3JA 2RGQA 2KRTA 2ZTCA 5EP1A 1PRQA 1KC84 2ZC6B 3U60B 2KX6A 1OPXA 5HD5A 4RNZA 2KXEA 4P17A 3NDGA 3W68A 3BNEA 5EEOA 1T19A 2EX2A 1FQGA 3IQAA 4DR5M 1WGLA 2K6BA 3EE1A 1B20A 2W56A 4QB8A 3IS2B 1IQYA 3UE1A 3DFZA 4X65M 4WMCD 1SXJA 3W0LB 1QZEA 4GHIA 1Q9EA 4IT7A 1P9WA 2WUQA 1HKXA 3SX1A 3R8FA 3B89A 3HHWA 3CCS3 3T4JA 3UL5A 4I38A 2VGLS 3T4OA 4CPKA 2BNGA 3BW6A 4FCZA 3N8RA 3CGWA 2X8AA 2GXFA 1JZDA 2ZQAA 4FR9A 4AFIA 2EFUA 4CQHA 1VHMA 4BBUA 4RKUF 4AKYA 4GB5A 3IBRA 1OKSA 4IBFA 5EXSA 4ETXA 1TRQA 1BU4A 2DZNB 5D81A 1D7EA 4HEOA 1JB4A 5KP3A 3WR2A 2PYPA 5CX7A 3CD63 3VE3A 3HIGA 4KZ6A 4XDVA 2XD5A 2DKLA 1BNJA 1HYFA 3A0RA 5KSCA 1GMPA 1NYMA 4IUKA 4R0QA 4S2KA 3EF8A 1IVWA 4KZ1A 3LIBA 1N9NA 2WKIA 3NIAA 3ILKA 3M7GA 2DRWA 3Q7VB 1IT7A 4OVDA 4P6ZM 2ZQ8A 1RCJA 3N8SA 4DJ2A 3GQ5A 4JI2M 2P74A 4L9GA 5ITQA 2Y2QA 1XA1A 2WKHA 5FQMA 1TU5A 2WAEA 3B42A 4M0WA 1C54A 3FRHA 4DV0M 1Z6FA 3U6PA 4R3JA 3C30A 3MF0A 4IBXA 4CLCE 4X56A 1FUSA 3K9OA 3N4IA 2I9WA 3G2ZA 5CGWA 1D6UA 4NL4H 4KFDA 3CXC2 3W2ZA 2G2WA 1OT6A 3GLIB 3DGOA 1L3LA 2C4BA 4EV4A 3ZVWA 5EUAA 4R9LA 3H82B 2VGKA 4ZAMA 5TBMA 5FTLA 5IT9S 1JWZA 1MXOA 4LFAM 5I5LA 2EWVA 5M19A 1RGZA 2AADA 1R7RA 4R1GA 3SHGB 1S66L 3LMLA 2ZL1B 1XP4A 3ITBA 3G30A 2Z6CA 3ZCZA 4OVZB 1PZPA 4LCBA 3U61B 2ZL8A 1WIVA 3QP1A 5A0OB 1MPLA 1UWPX 3V3RA 2B24B 2OO9A 2Y2JA 1ESUA 1RGHA 2VIIA 4TX4A 3X42A 1GHIA 2B95A 3ZFZA 4LRSA 1GJSA 1LQGC 2RRUA 4JGQA 2PD7A 5HDSA 3RFBA 2DWLA 3OPRA 2J7NA 4OPZA 4I4KA 3NCKA 2ZM2A 3VP3A 4D2OA 2QENA 3SBJA 1XA7A 3MSHA 4K0WA 3WS1A 1JR3E 4RBNA 4KQOA 3C8CA 3MQQA 4Y5FA 3JAMS 1OTEA 1JB0F 3G34A 1DGHA 2WKRA 3C7UA 4D80A 2JZ0A 4BTXA 3FYCA 1IV7A 5EJCA 3V76A 3NQZA 1W2B2 1LI0A 2VK3A 4KG6A 3FTCA 2XK1A 2A49A 1K4FA 1UDII 3CMZA 1MNLA 1K38A 8CHOA 3W8KA 4R38A 3KOZE 1GOVA 3I563 2XGNA 1GMQA 3U6MA 2YFIB 4LRTA 1CQAA 1OTAA 5KMWA 5ITTA 2CHQA 3UMMA 4DDYA 2CRUA 4JI0M 1PM5A 2R4EA 3D8LA 2CWVA 4K0XA 3UB6A 4CLCC 2K9DA 1ZV1A 3SXXA 3O3VA 4X1MA 3KSED 1AR0A 1LSVA 2B18A 2HMJB 3VKGA 4WBGA 3EB8A 4GSPA 3G35A 4DJ3A 3Q07A 2HMLB 2RBIA 2LB9A 3ZG8B 3G4PA 2IMJA 2QZ4A 4QNRA 3BECA 2LNHC 4M9XA 1GHMA 3CUEC 2J9OA 7RNTA 3P7NA 3A45A 5FI2A 3V99A 5CRFA 2P05A 5CF2A 4JXVA 1IQPA 5BXQA 2CG1A 7CATA 1BRHA 3GPUA 3C58A 4BL3A 1K8A4 1FUWA 1YGWA 3SYUA 3FKWA 2RCXA 2W3EA 2KRKA 3U61A 5ELUA 3SH7A 1M40A 4Y15A 1YMXA 4MGIE 2YNMD 1B2XA 1GSWA 2PHYA 1WMOA 3N6IA 4UAAA 2MGWA 4NHFA 3ZHHA 4PD2A 5FGOA 3OX9A 2Y59A 4KG5A 2E2TA 3EN8A 5IW9A 2VEAA 4NXNM 1SZVA 1F4IA 3V50A 3MS6A 2ZC7A 3NULA 1S3SA 1SKOB 1Z09A 4Z8XA 3KS4A 2L6OA 3A46A 2CG0A 4G3VA 2KEBA 3H51A 1YAXA 4GN2A 1KE0A 4N6OB 3IXBA 1L2SA 1G4AE 2WSEF 3MWZA 5J7EA 3NBXX 1ONHA 5CK6A 1I0VA 3FYDA 5FQ9A 4GEWA 5BU4A 3DGMA 5CXOA 1YLAA 1ULJB 2A24B 3ZQ5A 4PKYA 1J5EM 1SXJD 3H4JA 1OPYA 3GLHE 3IG5A 1LHYA 1N4OA 3EQVA 5CHUA 4ZJ3A 3ULFA 4AEQA 4II7A 3AOEA 1JWPA 4GOGA 2QPNA 4K91A 2DZOB 1I2GA 4X25A 5EP2A 1PY3A 5RNTA 1STDA 1OCVA 5TJJA 4ME4A 1I0XA 4S2PA 1QQWA 5BIRA 3DTIA 3LCEA 3TRCA 1E4DA 1G96A 1JZOA 4JXWA 2BO9B 3HJ8A 3TOIA 1JQJC 2JXNA 4JI8M 1AVKA 1PJIA 1RDSA 3ZNYA 5KZHA 4KLNA 4ETZA 3PXMA 1Q2QA 2KLIA 5F1FA 5JYOA 1ZTUA 3BEBA 3NXJA 4DXBA 3PAGA 2J3TC 3CTWB 2E8IA 5F68A 1PW1A 1CYVA 1ZAEA 5ITXA 1LNHA 1JR3D 3SOIA 5IG0A 2PD8A 4UN2B 2KZSA 2GEYA 4KT0F 3OC2A 4LRXC 3B74A 3FUVA 2P9VA 1PI4A 2PBYA 1ALQA 2H5XA 2IY2A 2EXAA 3W67A 3HU3A 2C96A 3KYQA 2ZM8A 3ZNTA 3IWOA 1W5DA 3LIFA 2LVPC 2F5NA 2VV7A 4KZAA 1I2WA 4ZJ1A 4W5WA 2OQ4A 3L26A 1FCNA 1K54A 1ORYB 2FH0A 1GOUA 3Q90A 4WN5A 4LJ8A 2ZA4A 1BLSA 1K4EA 1RGEA 2HP9A 3AOGA 4BBAA 3WMDA 3K8ZA 3LYGA 1T1BA 1XFQA 4X6TA 4E3IA 2OCTA 1WMNA 2AVXA 3K92A 3PBNA 4NETA 3GRDA 2UGIA 3E99A 4WWUC 4BJPA 4ITQA 3CC23 4WLAA 4EQIA 4WUJA 3MJ5A 2X4AA 2IWCA 3CCJ3 1T1AA 2J8YA 3WS4A 3HZJA 4FMAA 4N6MA 4LZIA 1GA9A 2VGJA 3PTEA 2WZJA 3LR3A 4L0LA 3T4LA 2R62A 1K54C 3L2AA 3A3FA 1JBSA 4K90B 2D7HA 1O7MB 1IYYA 3FWLA 3T12B 1NO3A 1W79A 5AQBA 1AQZA 5AYSC 3A42A 1VQK3 1HQYE 1GL6A 1JR3A 1K734 1K57C 2VV6A 3TQSA 5EXTA 1MKIA 2UU9M 2B3TA 4MMYB 2IUJA 2QWSA 5AJGA 3EIEA 5IERA 4EC6A 1OUNA 5F82A 1PIOA 5EVIA 5JBSA 1IV9A 4DF6A 3J80S 3C2WA 3T4SA 4LG2A 2ZM6M 2DHRA 4EEPA 1OHOA 2XSHB 3GPPA 3IF6B 2W0QA 2VKSA 1VEJA 2O01F 4KFFA 1BVSA 3DGNA 3T1HM 3OW22 1KQS2 4UA6A 4PM9A 1FCMA 3LFVA 4HM3B 2A15A 1LSWA 1PJTA 2X71A 5MC7A 4HNBA 2W3GA 2QPAA 1UCKA 2JKTI 2F98A 4F1IA 2D1WA 1QALA 2FOIC 3LXUX 5F1GA 3EEAA 4EV2A 2BMOB 4R4RA 3ZQJA 1MWRA 2Z3XA 2KOIA 3BRMA 3P98A 4E6XA 1L1ZA 4LGQA 3VSYA 1S1ZA 1P0ZA 3VP0A 1UI8A 3ZH9B 1E3UA 2BASA 3ICYA 3KW6A 3F14A 5CGXA 3A76A 5F69A 5G2GA 4CLCA 3CNXA 2RFRA 1H8MA 1OHSA 3LT8A 3DXOA 3F1OA 3FUXA 2B02A 4DMZA 2OWJA 1JB5A 3U6OA 1OT9A 1G71A 1TS7A 1PW8A 1ZQ9A 2K0MA 2HDQA 3UO9A 4F94A 3BQAA 4RVAA 2XRNA 5FASA 3CUEA 4LF4M 2WGQA 1SDNA 1RGKA 3BYDA 1LLBA 3LQQA 3LI9A 4IPBA 2XROA 1SXJB 4CGYB 4GKJM 1VQL3 2HGVA 5IS1A 5EVEA 2F56A 2VX8A 3LEQA 1JNQA 4MBFA 4R6LA 5IU1A 3CCE3 2HDSA 4GL6A 2O9AA 3K2NA 2FFFB 2PZVA 2LQVA 3H3HA 3C4OA 2QZ6A 3BLZA 3KYZA 4WZ5A 1W2ZA 3IECA 1JV2B 3UJNA 1W6YA 1K57A 3IHBA 4MJDA 1E9SA 3N54B 4GC9A 3L0RA 1IY0A 3GLFB 1BNEA 1NU3A 3LH4A 2HCBA 4LF7M 1SJWA 1YLPA 3IS2A 4HM7B 2HKJA 1Q7Y4 2OTL3 4HL4A 3HJKA 1QVRA 1NRFA 4G6ZA 1DGHB 2YKFA 1GO5A 4HP4A 1OFHA 4QOSA 1N5PA 2ZOIA 4E3NA 1VDDA 1BRSA 5FQJA 4CLCD 1WYCA 1OF5B 1KVMA 3HJIA 4G4OA 1WA9A 3AGEA 4HEFA 1V34A 4B7GA 1QJGA 1XXHA 2WZXA 3HLDA 2XFSA 1XNRM 1CEFA 2UXBM 2LHCA 3U6SA 1O7NB 3CME3 3Q2PA 5A2QS 2H0IA 2W1RA 3HUMA 3MMHA 5FQKA 1JB2A 2ZMVA 4NXFA 1SIIA 2BTFP 3MSOA 4JXJA 2INWA 3KX0X 4BBVA 2HMKB 3T1YM 4GCZA 1WR1B 2G8LA 3MZFA 1IN6A 1UGIA 4X1LA 4S2NA 1LNIA 2H5SA 3RH8B 3PZWA 1PRBA 2OOVA 5GHZA 1O7EA 1N36M 3S67A 2Y2HA 1TEMA 1Z5BA 2L7HA 4NKPA 5GHXA 2BT3A 2QGUA 1NZOA 3DAVA 4IVKA 3KS8A 1MGRA 4DE1A 3M6AA 3GQZA 3JR4A 2LTUA 2KNVA 3MHEA 5KIZA 5IG3A 1IN8A 3BJNA 7STDA 3FG8A 2F86B 3QP8A 4WFOA 4O02B 4L7KA 4R4KA 4OQIA 1BVIA 1Q40B 3NM7A 2QEX3 2ZD8A 3W4QA 3K9PA 3U6CA 2EO2A 2ZHXB 1EEJA 3S28A 2JKRM 4OLGA 1YSQA 4BD0A 1BIRA 1GA0A 2W3HA 1H6UA 3B8LA 4L16A 1HR0M 1GSVA 2CC1A 4GIPA 4PKYG 2STDA 3FUWA 1WTHA 1IOUA 4LFBM 2ZQ7A 5A93A 2Q9MA 2EWWA 3HREA 2KDLA 1OJLA 1G3IA 3HOHA 1LOYA 2XA7M 1N8QA 4IBCA 2K7SA 3W4PA 4L4UA 1J9MA 5HAIA 2CE7A 3MQ0A 2JNHA 5FTKA 3KCHA 3PGBA 1BUJA 1WYBA 2M60A 1O7PB 4X66M 1MWTA 4JF5A 2PAVP 3R7WB 4N1HA 1OACA 2PBDP 4IBRA 1N77A 5FAOA 1B21A 1L0FA 2VA0A 3W0FA 4QWTA 3LCUA 3NECA 2CFOA 3J7BA 1BSBA 1OJ5A 1W02A 1IELA 1UCJA 1YSYA 3FTEA 4Q0JA 4DUZM 5E6JA 3AHWA 1LOXA 1N32M 4DKIA 2R44A 1YPRA 3LY4A 3KSFA 3G6OA 3KFQC 3MPHA 4FD8A 1NY0A 3GECA 1JTDA 3S4XA 2EXBA 3GMWA 3PBTA 4WM9A 3I04M 5C1BA 3C38A 2HAKA 3I7JA 2JKGA 3IF6A 2BWBA 4KG2A 4BL2A 3OXAA 1YHQ3 1BRJA 3IHPA 3E21A 1RHLA 4FVMA 4LCMA 4S2NC 2CKFB 2HDUA 1PZOA 2JWSA 1OAIA 3M2JA 2OOVC 4WELA 5L10A 3MKIA 3G16A 2A5YB 1IFQA 5EFWA 2QJ7A 3TWKA 1C3BA 2Y21A 3J7AS 4DV7M 3UY6A 4R71A 1QDTA 3UMEA 3HCYA 3WODG 4LV3A 3L28A 1WMPA 2W6JH 4MGKE 4MMXB 3T8NA 3HK4A 4IBGA 5EM0A 1N9JA 3T8UA 3BQ8A 3T38A 4CJNA 1BUEA 1G59A 1V74A 3EHCA 2JUJA 2ZLYA 3BIRA 1T2HA 1KFVA 2FE8A 1BSCA 5K5BA 2XGLA 4RZMA 4GKKM 1CUKA 4NC6A 4X64M 3RGRA 4IJEA 2F99A 3VSKA 1Y4OA 1WXQA 3EQQB 4IBJA 1TFKA 4C75A 1YIT3 3QWLA 2Y55A 2NUTC 4OLDA 4UQIM 2W9QA 1G8PA 2Z76A 1JBTA 3ZC7B 2CC3A 1RRHA 4ZRRA 1G02A 3CU3A 4GDNA 4B3MM 4LCLA 4AG5A 3JVUA 1K3WA 4KVHA 4E6WA 4O8GA 4R1KA 1RGYA 3IX3A 4XXRA 2ZAMA 1L8QA 1RP5A 3C7VA 1HVBA 1K3XA 2XLJA 1HU9A 4HOHA 5CF1A 3DWZA 5DKLA 1VQO3 3FH1A 1JKGA 5HAQA 4NEED 4JI4M 4D81A 1H5XA 1ZS7A 1JWVA 1K6SA 4MGZE 4RF0A 5EVIC 3UE0A 5HZHA 5F5YA 3WRZA 2Y2OA 1L2BA 4N6LA 5GLCA 1XXHE 1EWZA 2HPBA 4Z6YA 1VZZA 4I4LA 3HLWA 4LFUA 2JQ5A 1YVSA 3UPOA 3CPTB 3MKEA 3K1JA 3MQOA 3IX8A 5E43A 7GSPA 3CCL3 3GLIE 1TJDA 2ML6A 3HLEA 1ULIB 5FATA 4EW5A 1QAMA 4AZFA 4KZ8A 4WURA 2P38A 3PYJA 4Q53A 2W27A 3A0SA 1BLCA 1BNRA 2WOHA 3SMSA 2ZMFA 2C5RA 2KF3A 3H4MA 2X02A 4PDIA 2KF6A 1HT1E 1MN3A 1FGQA 4N6TA 2KF4A 3LCVB 2H0TA 1XKZA 2OQEC 1U5OA 1H3QA 5J4EA 2PNCA 3HI7A 3LW5F 3KSIA 2V2FF 1DP9A 1WJ7A 2R6FA 3PS8A 3LYXA 3AMOB 2V9AA 3GLGB 3I4VA 4BMWA 3S7NA 3J2PB 2IUKA 3MJQA 4P87A 4F2LA 3SH9A 4O0PA 2HMNB 1W4NA 4OPQA 2JY6B 1AXBA 4Y13A 2DAGA 4DR2M 1DO0A 4HM4B 3CC73 1RU3A 3EIHA 1UCLA 1B3SA 4LYLB 2XSZA 5DF7A 5HPIA 1ZMUA 2UUCM 4HY8A 1A2VA 4OVMA 2OQEA 5EOOA 2ZMAA 1PGYA 2RGHA 1UFZA 1DV0A 2O25A 3SEDA 2WGVA 1PNEA 2Y8HA 4HJ3A 4LF8M 3A3IA 1MKMA 3C4PA 3TPZA 2OAQ1 4I8OA 4YHHM 2GBXB 5HGRA 3OCNA 2PDRA 4GNUA 1A0KA 1EG9B 3DZDA 1MU5A 1DETA 3N7WA 1H8YA 1G28A 4M3KA 4KZ4A 1AVLA 2XD1A 2KW0A 3HLFA 3PR6A 3HX8A 2VZWA 3GQ3A 4Q0HA 1BRNL 2QBYB 3LMMA 1EA2A 4PM6A 1OFIA 1FW7A 4KUOA 1NXYA 2JKTM 1RN7A 2FNAA 2W0NA 4KHPM 1DMQA 2XZUA 4N1XA 2LVNC 4WL9A 5A90A 3LVWA 1S723 1ISKA 2YFQA 3BOSA 4DR3M 4R9KA 1M904 4X55A 1TS6A 1NJFA 1QMEA 2JE5A 3GTCA 5EP4A 3BM6A 3ITAA 4ID4A 1IVUA 4LGYA 3JUMA 2F4YA 5D83A 2DAKA 1BAOA 2B1XB 2IA7A 1E32A 3PFIA 3GLFE 5FEGA 2CV0A 1TDGA 1EROA 4QHTA 4BIRA 2A3UA 3M2KA 1TIJA 1YLYA 4FCTA 2ZC3B 2Y2LA 4DR7M 2DMWA 1L0GA 4B9OA 4U3TA 2KF5A 3O8YA 2J9PA 3LQRA 3BB9A 1YJW3 5LBRA 1Q3BA 3CITA 5ELJA 3X3XA 3ZG5A 2DNSA 1QAOA 4J5GA 3NX0A 3I51A 2UXDM 3QNCA 3RJUA 3ZCBB 4GD6A 2VGLM 4GS9B 4LJAA 4DR4M 4JXSA 4PPRA 1J7KA 2DVWB 3HHYA 3C5AA 4HJ4A 2HZ5A 3A5EA 4MEZA 3MHVC 3L25A 1P3QQ 4Y0OA 1HJPA 2EKKA 4P6ZS 3BWLA 4HJLB 4B3SM 4HM2B 5GLDA 3AKZA 1BRIA 1OTIA 4OQ0A 3UNLA 3OLOA 4X69A 2LYXA 5L09A 1VB6A 2JKRI 2I72A 3NBJA 1TR8A 3H7WB 4B3RM 3GRRA 5DYIA 3JUPA 4HM1B 4EW7A 4LRYC 1I3IA 4DV2M 4KUKA 1TDZA 1HQCA 1OQYA 5FI7A 4FD2A 4NRWA 1B2SA 4IBKA 3NBBA 4NXEA 2GX5A 4R3BA 5J3WA 2XH9A 2F5PA 1HLUP 3GZXB 1XNQM 1NVMA 1YE9A 3MBZA 3RXXA 2Q0OA 1BNGA 1C7YA 2L7IA 3BFEA 5GHYA 1LRAA 1KGGA 2KCDA 5GSPA 1YMSA 3HUOA 2Y74A 3GPXA 1KSFX 4ZDXA 1LQMB 4AKHA 4GD8A 2CV1A 1J09A 4LSOA 4PHTA 3CLOA 5G4YA 4BD1A 3GRVA 1GOYA 4I5QA 3URPA 1XFNA 4I3JA 2JZ1A 2V1BA 1PWCA 3EGXC 4I5SA 2ZBBA 2JY5A 3LZAA 1N8R4 5TGFA 5BPVA 3KSXA 4LPZA 2A2LA 4CHTB 3E9SA 1MJGM 4PM5A 5DFXA 2Y2GA 2YFJB 5DF8A 5FDSA 2G2UA 1Z6TA 2EX9A 1I94M 1K6RA 3UB9A 2HMOB 2ZAOA 2R4IA 3KP0E 3OWYA 1N9EA 3IT9A 5KPTA 3DGLA 1Z5AA 4AKGA 4X2HA 3ZDJA 1EI5A 1XMQM 1LI9A 4OQGA 4JI1M 1TF1A 3FKAA 4Y0TA 5FLXS 3DTMA 3FE3A 1Q864 4OOYA 3U60A 4A3VB 1UW1A 2F5WA 4GDBA 2LB5A 5A8BA 1AUAA 2JY8A 2B5RA 2F5MA 3CHWP 3KVWA 1FJGM 3HHZA 3AGDA 3UJMA 2D7EA 3T1RA 3MXQA 3CPTA 5IT5A 1KDWA 3WDGB 4M0DA 3LTAA 2BU4A 1HTZA 4NG2A 2WZZA 4HOIA 1BRGA 4G4QA 1FIKA 3K9MC 5DF9A 1YQSA 3N8LA 3FV7A 3WS0A 3AGNA 4K0KM 1JKGB 3VSLA 4CCVA 3ECFA 3X40A 1BT5A 1G6AA 4MNRA 2QYBA 5HDCA 4BU4A 4PT5A 1L1TA 3CCM3 4DV1M 1IK3A 2KDKA 4WEKA 3D8BA 3F40A 1ONGA 2RGOA 2OOAA 1VEUA 1IXSA 1N5HA 4BTWA 5HARA 4MGHA 1IVXA 1D1JA 3LOYA 1BNIA 3VOLA 4FTXA 3OTOM 4S2JA 2BMRB 2UUGC 4JGRA 2M7VA 2XZFA 2OWHA 3SVAA 4YY3M 3S29A 1F2KA 2DHYA 2ZC5B 4Y0UA 2L2DA 2PR6A 4B4ZA 3WOFB 2NQ8C 3DOAA 3V98A 4LV0A 2R18A 3GLFA 1UGHI 1X1WA 1BZAA 4OQHA 2DI0A 3SAVA 3TW8A 4LJ5A 2DWMA 1JVJA 3QAUA 1E3RA 4H3UA 3T4KA 1NV8A 5ITRA 1N78A 1JN5A 4Z1WA 3H82A 3ZG9B 3SS3A 3D4FA 1I4WA 3PXPA 4XBOA 1L0DA 2C6WB 2K3DA 1E3UD 1UI7A 3CPOA 3TDGA 4CIZA 4NK3A 4HKVB 2Y91A 2XR0A 3HLGA 3BFDA 3R9XB 3B7ZA 1IYPA 4ESPA 3AV0A 1FGRA 1X1YA 4MN5A 3FG4A 3NBLA 1IU7A 1TGUA 4OVZA 1GY7A 1WQLB 3PNYA 3GLIA 4HBRA 4PEJA 1QZMA 2WGOA 3IXHA 3VOYA 1SXJC 2J7OA 3SH8A 3QYBA 2RCDA 1MBLA 3LY3A 5E2EA 1GY6A 4IBEA 4KODA 3OCLA 4H61A 2DNAA 4LLOB 2Z2LB 4IIAA 2C5WB 1YI23 3NM2A 1FNNA 3GRYA 4LJ4A 4DE2A 1VG5A 2CV2A 1MWUA 1N34M 1UWNX 1PJSA 1KYIA 4GHLA 5JYPA 3L7HA 2JY7A 3U4LP 1IBKM 1D06A 3D5GA 1N75A 1NSFA 1XPBA 3M6BA 3FUUA 4Z9QA 3PVSA 2N35A 2X49A 2HDRA 4HVNA 4HIAA 1TH2A 4OOMA 4JI3M 2KNZA 3V5MA 5DJTA 1MY8A 4RNAA 3SLUA 1KE3A 3LICA 2GSPA 2ZTDA 2ZQ9A 3SASA 1Q3CA 1ZHHB 2INXA 5FI6A 3PNVA 4OPRA 3SMPA 3DTEA 5AVFA 4WYKA 2AAEA 4BLMA 1SQWA 3VOZA 2WSFF 4ARZB 3VFDA 2XLNA 3FTFA 1HD8A 4KZ7A 3UDIA 4BENA 2CK3H 4N9KA 3SS4A 1NB3I 3RGSA 3BNBA 1SKOA 5DJUA 4OU7A 2Z7JA 5C18A 4J9AA 4AI6A 2WADA 3B47A 3HU1A 4QNMA 1GY5A 5L2FA 2DXIA 4ANRA 1DGGA 3GPYA 3LGOA 4HBTA 4EU0A 5KO3A 1IBLM 1R2YA 2VDBB 3Q1FA 3HX3A 3FGYA 2HJEA 2HV1A 4EQ1A 1SCWA 2V1CA 3IWQA 2VJWA 2E5LM 4GRIA 4J5KA 2JA2A 3NQYA 2Y4AA 2O0YA 3RFWA 3B33A 3HBRA 5EXPA 3THGA 1NNJA 1SPUA 4ZPXA 4F3LB 2BG1A 3UNWA 1LOVA 2M7UA 3WWXA 4HHDA 3PXGA 1GHPA 4MBHA 5D3OA 2P09A 5GLBA 2CIUA 5GLAA 4OX9M 4DXCA 3IX4A 4EUZA 4MN7A 4FCFA 5DVAA 4EETB 1L2CA 5IG5A 1FZUA 1DP6A 2Z6DA 1R2ZA 2DENA 2LBCA 1S67L 3EWKA 1YNVX 1NZUA 4M9ZA 4EEUA 3MMPA 4Q0IA 4R7GA 1QAKA 2W04A 3K3DA 2QNJA 1CI9A 1E25A 2CFGA 1FGMA 1G68A 4IBDA 4XBTA 3FTDA 3HHXA 2KXGA 3UL6A 3DH2A 5AIFA 1VQ73 1NWZA 4GHOA 2D42A 3NY4A 1DO2A 1I3FA 2RSXA 4CISA 4OK0A 2XA7S 1T3BA 3KSPA 1QUTA 3F9SA 1D0MA 3FRIA 1BSEA 3NDEA 4MBKA 2BHMA 1JNUA 4NOOB 1KGEA 2WYXA 5FQIA 4XUXA 4Y28F 3T1SA 2ZQCA 3QHYA 3VGNA 3U6DA 4IJGA 4FH2A 1FYSA 1GS3A 3DWKA 3BBZA 4FCVA 3FG3A 5M18A 3IBJA 3PAEA 4Y3IA 1ACFA 2HP6A 2ZQDA 3F1OB 1K0KA 1JTGA 1FR6A 3F1NA 4DDSA 5HWVA 4JI5M 1TP6A 3C3EA 2GDNA 3VDUA 3JUNA 5A91A 3ZVTA 5EM1A 1SXJE 2LVAA 3RXWA 4R4SA 4KENB 2W03A 2XQZA 4JRFA 3BLSA 4ARZA 2P0MA 2BJWA 3GVBA 3T50A 4N6V0 1DJAA 1R4GA 1GCEA 4WEJA 2E8JA 2EX6A 1BULA 5AQAA 1AY7A 2OLVA 2R9WA 4CDLA 1NLZA 3L27A 4GW9A 1LTMA 4R70A 2J8XB 1ES3A 2C99A 3OWUA 4DRTA 3VE4A 5HL6A 2CP8A 3FLJA 4EYCA 4XT2A 2E2VA 5HW3A 1NRJA 2QQ8A 3I553 1CQSA 1QANA 2Q07A 1UUGB 1ERQA 1GMRA 3KE7A 3PBQA 5E2FA 3GRUA 3IXGA 4QY5A 4FSFA 4OPYA 2JN7A 3K5TA 2OOLA 1DY6A 3I0YA 5BVBA 4K1VA 5IG4A 5HWWA 3LR4A 4GZBA 2D01A 2V0UA 1YVBI 4EV5A 2V1LA 4PMAA 2O3OA 2MF7A 1M1K4 4LJ9A 3HIIA 3ALAA 1ES2A 1VDLA 3UK6A 1ZC2A 4JF8A 4HJ6A 1EIJA 3B7QA 4B4XA 4HM5B 1YKDA 2CFLA 4GJ4A 3H9WA 3E2KA 3EN1B 3RDEA 2MJ6A 3MKFA 4KZ9A 5EXXA 3U5ZA 1WE4A 1K55A 1AWIA 3T0UA 2EKFA 1GJTA 4KZ3A 1X37A 3F8HA 3SOAA 2RNTA 5A92A 4GKUA 2EA0A 1A2KA 3MG2A 3SFZA 2UV0E 2W3DA 1HNXM 1YM1A 4HYZA 1ES5A 1TDLA 3GR2A 3UZUA 3UN7A 3UMDA 5FA7A 4XGIA 2V1UA 2R46A 1XXHB 3T15A 2V8CA 4OW0A 1J3WA 1Q7HA 3P01A 1H0MA 5EVID 1T18A 4O01A 1IXSB 1RJOA 1Z1SA 3GQ4A 2ZC4B 3OV4A 5AIHA 2J7VA 3KSHA 1ZG6A 2BLSA 1ZX2A 5GL9A 5D82A 1S0WA 3JUQA 3W4OA 1W8QA 1DVCA 3IH8A 4EBPA 4QJGA 2VV8A 1YT4A 3PCRA 3KO6A 2ZOHA 3F7XA 3KSJA 1M9GA 4BQMA 2J3TD 3WOEB 2V6ZM 3KFUG 3L9KA 4S2OA 4RNYA 2O9BA 3IMAB 1L5GB 2H0HA 2G7UA 2XF3A 2QHKA 4JLFA 4KZ5A 4UA9A 2K31A 4RYEA 4HAAA 3UDFA 3OZHA 3GSPA 4AW4A 2JKFA 2JCHA 4NRVA 4AKIA 3A3DA 3HLBA 1VQP3 2CUZA 3F92A 5JPPA 4MDZA 2W82A 3CF2A 1RGFA 4I81A 4K1UA 2QBYA 4DR1M 4FH4A 2Q9NA 4L15A 1IQXA 4RNTA 5EV0A 2UUBM 3ROBA 3LUQA 1O7WB 4KQDA 4LV2A 5DFYA 3NHXA 1E9RA 5TR7A 4XB5A 2JHEA 2ZJ9A 1C1KA 4YNRA 1OGXA 3SW1A 1F98A 4NXGA 5ITYA 3EEHA 1K25A 3NUVA 3HY5A 5DTKA 1LL5A 1QAFA 2P7JA 4J8TA 3DA1A 3CCR3 1TF0B 5ITUA 3D79A 3T4QA 2R45A 3M8CA 4DV4M 3TWMA 3EJVA 2FGTA 4STDA 3Q7VA 5TBMB 2ZDJA 4NSOB 2GU3A 2W1TB 2HJ9C 4IHQA 4HM8B 3FKVA 4AKZA 1Y4KA 3U1WA 5DKKA 2L1SA 3U5ZB 3SARA 6GSPA 2LVOC 2R9XA 1NJI4 4G3WA 1IY1A 3NOUC 2MC8A 1HNWM 3DW0A 3KSGA 1GL7A 2FS1A 2G5GX 4QWOA 4CJ6A 2F5QA 4M9SA 3JUOA 4K61A 2EX8A 1A67A 3KOYE 2C9CA 2HOHA 4L8PA 1TTEA 5CLKA 1YIJ3 4WZ4A 1BANA 1XGJA 1I2EA 4P0MA 1QAQA 1NNVA 4L8RC 2P0XA 3RGPA 5STDA 4LJ7A 1NJGA 4DN0A 1W01A 1ROAA 1VQN3 2C98A 1C7HA 1KE4A 4R23A 4DR6M 5L8MA 1LSXA 3G0KA 1T2IA 3MFXA 1NV9A 3Q3FA 4L9EA 4LV1A 4O8SA 3UPNA 4GITA 2EFXA 5HX9A 4E3LA 3U6LA 3KYEA 4HBUA 3UB1A 4LGMA 2MROB 4QU3A 1HT2E 1UM8A 2ZBKB 1BGSA 5IWAM 3JPUA 4P6BA 3D9YA 1JBRA 1LT0A 2H1RA 2CFDA 3WHOA 5AIIA 1SDEA 2MH8A 2QP9X 1OJGA 2CEAA 3D3OA 1B2MA 2V0WA 3E2LA 1F8NA 3WHLA 3FSDA 3NBRA 5CHMA 2XEPA 3U6EA 2GEXA 3M6HA 6RNTA 4YINA 2K47A 1V58A 3G6E3 1OF5A 2UWXA 1MWSA 2WSCF 4GLQA 4G4RA 4JYAM 1G0TA 3FC7A 3TJZC 4C3QA 4R3AA 1V33A 4YOFA 2P04A 2UUAM 3MK6A 4JPMA 1VQ53 2WAFA 3G8ZA 3VV4A 4GHIB 3DUKA 1LOWA 2YR0A 1XB2B 2CWTA 1GVNA 1FOFA 4DBGB 2HF6A 3WA3A 1F9IA 2M5ZA 4B7HA 1B2UA 2KNAA 2OSUA 2PYRA 3G4S3 4ILFA 3AOEC 3HGIA 4UHUA 4EIWA 4LF5M 2KZUA 5E2HA 4JKTA 1PJQA 1TDHA 3VFHA 3E4PA 2EUCA 1Q42A 1E3VA 3ZGAB 1X0OA 4IIWA 3QYEA 4LRZE 4RQ9A 5JI2E 3T4TA 1U60A 4BBTA 3VP4A 1K56A 5C5KA 3MYTA 3OOVA 3Q1CA 4U0XA 2D7GA 1FCOA 2MR9A 4GC5A 3A98B 1IEMA 4HM0B 1GABA 3N8BA 4EERA 2LXEA 1RN1A 4NSRA 1RRLA 1K55C 5L07A 1OMEA 1A2PA 1OIPA 2WGIA 3FKEA 1X1XA 5KP1A 3GSGA 3RE8A 1IFYA 1DRMA 3IPTA 1S1YA 2GJ3A 4B93A 3EGDC 2MJ5B 1K41A 1QMFA 3FZCA 4FW9A 2IYJA 2L4VA 1PU4A 1T3TA 1XJ3A 5FTMA 4EXOA 2PU4A 4L78A 3DM8A 3OBFA 3FG1A 4JF6A 2JBFA 2Z2MB 3TE8A 4FCMA 5KQ8A 1D0LA 4U13A 1M6KA 1I2SA 2CWUA 3X3ZA 3NJAA 2GBWB 1Y54A 3O87A 3Q82A 1TUHA 2GU1A 4JXGA 4R3DA 4ZBEA 2J5YA 4Q8IA 3CF6E 1L2DA 5CEBA 3OPLA 1XMOM 4P16A 1BSGA 1T1CA 1QUSA 5EVLA 5HPFA 5HDDA 3E46A 3D5IA 3FPWA 5DREA 3BU4A 3UE3A 2Y2KA 4IBBA 3QP2A 1YUBA 5TGNA 1IVVA 2SARA 4JI7M 4LMIA 3SHFA 2L4EA 1NHGC 1BNSA 3MFDA 3BNCA 2YQZA 4I3IA 4KQQA 1DGFA 1Q39A 1OAOC 4GHAA 4REZA 3CZDA 1RN4A 3C3DA 1KDSA 2A24A 1PWDA 3STDA 1WNHA 5KSHA 1E97A 1E94E 8RNTA 5AI1A 5KPRA 1LL8A 3LR5A 5EOEA 3MZEA 3I4YA 3B4OA 1ZG4A 4BLCA 1XWIA 2VQFM 5IEOA 1VQ83 5I94A 2XRXB 4TUWA 4QY6A 4FWHA 1J2BA 2Z7AA 5G1LA 3BXWA 3CF0A 3SATA 1IDPA 4EWFA 2CH9A 2UX0A 1IN4A 4FCWA 1VQ1A 2P08A 4HP9A 1RCKA 3R4KA 1Q814 3NI9A 5TFQA 4FUWA 5E26A 3IF5A 3B7NA 2QJ5A 3GWRA 4XBXA 4X68A 4MMNA 3F1PA 4RA7A 1QVF2 1Z59A 3GRJA 1D6YA 2E2UA 4BWIA 3K2LA 4E04A 3NV0A 3VK8A 2GZAA 1SHVA 5LC6A 5LC7A 2QCUA 5FSRA 1NDOB 1OTBA 3HU2A 4FMCA 2XSOB 4XBYA 3V92A 4B3TM 4E3MA 1BSAA 3K7CA 1DMNA 1FUTA 4PM8A 4XUZA 1IYSA 4FWDA 3GZYB 4LFCM 4WZ5C 5AYRB 4GS9A 9RNTA 3FF0A 2GNXA 4ZTKA 3LT9A 1ESIA 1GLNA 3SYKA 4MEIA 5EVHA 1S5AA 3EC9A 4G3KA 5FSWA 4QPRA 2IWDA 3LTCA 4JGPA 4X53A 3SAUA 1W7FA 4HI4A 3KXEC 4FMDA 1D0KA 1FGOA 3DTKA 3X41A 3P09A 3KOWE 1Q824 3D3LA 3H7WA 4JF4A 3NOTC 5FTNA 3D4AA 3FZWA 4OOLA 3TG9A 2LHGA 4F3LA 4X2OA 3VFFA 3J81S 3UPPA 2IWBA 2JP7A 3DZLA 4WP2A 1OHPA 1U8CB 4EBNA 3UB8A 3IHAA 3V39A 3GLHA 1W7CA 1NYYA 5AEUB 4LF6M 4HZ9B 4JN6A 1CI8A 1KWIA 4OKPA 3HZPA 3QP5A 4N6NB 4P85A 2R78A 1BOXA 3GDIA 3WS5A 1VQQA 3WHKA 2R4JA 2XFTA 3EOIA 1DGBA 4G1MB 3GLHB 4GMQA 3O88A 1YLZA 3J7Yd 3CCQ3 3CNMA 5FEFA 3IXDA 3NC8A 2AHMA 4DUYM 4G4NA 1RNBA 1VETA 4WYYA 5IHVA 1TRPA 5HL1A 1DMMA 1XX2A 4Y2FA 2XSSA 4HH2A 3KN4A 4E3OA 1DJBA 2QA43 1X1UA 1B2ZA 2Y73A 3GAXA 4HLQA 1FSWA 1RKYA 1XJ6A 2R0IA 3Q7ZA 1IY2A 1EE8A 4ZJ2A 5CERA 1IBMM 2HP5A 4KQRA 1JRQA 1VEUB 3PYPA 1TS0A 1TS8A 2WOFA 1V9YA 1IT8A 5DTSA 1ES4A 1R4CA 4FOFA 1PFLA 1NY6A 5HOHA 4HZBB 1RLSA 5LMNM 1MX0A 1IM2A 1WHCA 4O2HA 1HZ1A 4IBIA 3VF1A 6STDA 2H28A 1IKGA 3FD9A 2BMQB 2XDMA 4HESA 1CEWI 3IG8A 3NV0B 2CHVA 2DCFA 4XT2B 4WF0A 4IJFA 2Z8YM 2KHHA 1IXRC 4S12A 2ML5A 1OIZA 2HL7A 3DMCA 4RF1A 1SIHA 4EESA 3HLCA 2FFYA 3GLGA 2Y0QA 4EUVA 3KOXE 2Y2MA 1OGZA 3E4QA 4E3JA 2Y2IA 2PR5A 1RGCA 5ITXE 5IZ7D 5FW5A 3HJSA 5EQLA 5G1KA 4H8RA 2O9UX 3DY5A 3E4RA 1I70A 2FNQA 1G5UA 2FH5A 2W3FA 1WGNA 2Y79A 1T5YA 2CX1A 1EFUB 2C9OA 1H8ZA 5DYGA 1CK3A 5EPHA 2FXTA 4WP5A 1ZO2A 1A90A 5KQDA 5DNYA 4JGOA 1GSPA 3LI8A 1OTRA 1K28A 1OTDA 2H10A 4I3AA 3T6PA 4LJ6A 2R41A 4FWGA 1Q2PA 2D02A 4XK8F 1NLYA 2W1TA 2EJSA 1JN5B 3MG1A 5FAQA 1LL9A 2VF8A 2L4FA 5CGSA 3B4PA 4AQYM 3VK7A 1QVG2 2NUPC 2I9VA 3BLMA 2K2NA 3CC43 1DVDA 1Z5CA 3OWSA 2W9PA 4K08A 1BLPA 1VM1A 3CG5A 3RNTA 1EQKA 3EX9A 4O7DA 1IYOA 3DBAA 1R5LA 1RSNA 3CI6A 5FTJA 2Y2PA 2QHOB 2EA9A 1GD4A 1STFI 4LZJA 1TVFA 1YLWA 3G32A 2WGWB 3SS5A 3HL9A 1ZKJA 4PAUA 2H0GA 2P5TA 1K9M4 1ROVA 1CJFA 4DE0A 1JJ22 2SBLA 3Q8XA 3NOPC 3E4OA 3WA2X 1KSIA 3KDSE 3BNDA 1KVLA 3QP6A 3IH9A 4XM4A 2OWPA 3G2YA 1R6BX 4OP8A 3HUNA 1NB5I 3A0VA 3CMA3 4LEHA 3F7SA 1W8YA 4OUQA 3M0EA 4GB7A 5GKNA 3HKPA 3MZDA 2KA6B 5CTNA 1VEGA 4A5RA 2BNKA 4FMBA 4DV5M 2O9CA 1B27A 1I5QA 1PYYA 5L8RF 1YGEA 2ZL1A 1V9ZA 3I01M 4OONA 1K82A 1TTOA 3G713 3GZRA 1UGUA 3KP1E 2OLUA 1NY5A 1V57A 4MH0E 1BYWA 2OOBA 1EKMA 1P9RA 1Y8GA 4UQIS 4R80A 5KP4A 2V1ZA 2Z4RA 5IEPA 3E0YA 1CF0A 2UXCM 1IKIA 2WGWA 2K0BX 4YWZA 5J8XA 4MLLA 1YLJA 4I39A 1N33M 2HWJA 3RTYA 2PU2A 2WK0A 3CJMA 3UB7A 3OPPA 1ODVA 2Z6BA 4H6JB 4JBFA 3S22A 1BSDA 1IN7A 3AGFA 4WHAA 4N9LA 1Q02A 3LVVA 1HNZM 2Y20A 4IVIA 5AIGA 3CWFA 3TWLA 2ACGA 2WKPA 3LTDA 2OTJ3 1BNFA 1P97A 4HQAA 4KZBA 2KRUA 1S4RA 1IQ8A 1TH3A 5FDHA 1AIPC 4M4XA 4S2LA 1IXZA 1NHWC 2J3WA 4B08A 1N9OA 2OAP1 2CX0A 3S7OA 4DE3A 2JDIH 3QNBA 3PBOA 3IF6C 1HZOA 4EBLA 4MCWA 2DAMA 1G41A 2XSZD 1GD3A 1LVNA 3BFFA 2L09A 2LVQD 1Y28A 4LF9M 3KIIA 2DWNA 3B9PA 5IREB 8CATA 4YFMA 3V3SA 4LENA 1VEKA 2QSFX 3LIEA 1T6OA 3KKGA 4ZM8A 3FPVA 3S7QA 4Y17A 3LO7A 3ER7A 4D82A 1S4SA 1IYQA 3GO8A 4Q7JA 5LMUM 1KGFA 1XC8A 3SAWA 4HH3A 1D2NA 3HJQA 2DZLA 1BRKA 5FQQA 4L9FA 4JV5M 4E3KA 3K63A 3PCSA 1GSXA 2DAIA 2O99A 1BTLA 5CEDA 1I8VA 1YJN3 2GQFA 4D60A 2WO0A 2DAEA 1W5SA 5AVEA 3AMOA 3JVCA 4N92A 5DFLA 3F8XA 3X3YA 1VQ63 2VLGA 3GP1A 1DE3A 2FFJA 2YFLB 3BY8A 5HD3A 3D72A 1ZMVA 4MM3B 1PWGA 2G3QA 3SYLA 4IEDA 3SOYA 3JYIA 5EE8A 3GLGE 1YSPA 4RX2A 1LXEA 1DJCA 2Y2NA 3WRTA 5CXWA 2O5RA 1VQ43 1XHBA 1XJ4A 2JC7A 3PBSA 1Q40A 3VLFB 1MOLA 4B88A 3S5CA 3DGYA 2CHGA 2ZM0A 4G3OA 1D6ZA 3UGJA 5AQ7A 1VQ93 2LH0A 2P9VB 2RKOA 3MXRA 2VQEM 1TFOA 3EBYA 3K3CA 3PHYA 5JI3E 2CFWA 5EP3A 4L8OA 4EBGA 5BOHA 4QHSA 3O5YA 1RCLA 3ZYTA 1BLHA 3AFHA 4QHCA 4LZZA 2YX9A 4DV3M 1NJ4A 3CAXA 3UB5P 3LR0A 5HAPA 4WW0A 1VETB 1NO1A 1US1A 5HFOA 1CEGA 1T43A 3AL0C 4AG6A 3Q8GA 2Y0TA 1DYUA 5FL3A 5EQTA 4JI6M 3VP2A 4LY6A 3AGOA 4NPBA 4PCZA 3VMAA 1KD14 1MZUA 2BJVA 1FA3A 1I2FA 5U47A 3SZTA 2HMMB 4KO8A 5AEWB 1S6RA 1W63Q 3GV9A 3VP1A 2OPFA 3A3EA 2CHCA 5DTTA 5H37D 4HM6B 1QDRA 3LTBA 3GZBA 1GYBA 1ZGXA 3QRDA 3OPHA 3UE6A 2BWEA 5F3WA 3LIAA 4ORLA 4U0TA 3UDXA 1TH4A 1TD5A 2L1MA 5KPZA 4QD4A 2QKPA 3JR5A 5IENA 1STZA 2HHHM 2BIRA
chains in the Genus database with same CATH topology
1YLTA 4S2MA 2F5OA 3AJIB 2ZANA 3S27A 5EECA 4XDWA 3IWIA 2LWXA 2R65A 3SC3A 4O3VA 1W5ZA 4NXMM 1M1XB 1FSYA 1PFPA 2CFKA 3MG3A 5AQ9A 2M7OA 1O7GB 2RL3A 1FGTA 3TSGA 1UUVB 2V20A 1OH0A 2QMIA 1GKIA 3FYZA 2QIYA 5CECA 2XR8B 1XXMA 3FCSB 4WYKB 1O07A 5I97A 1NNUC 3N9HA 5DRVA 1IN5A 2K54A 3Q81A 1QMAA 3CPW2 4PM7A 3KZTA 3HWSA 2C10A 2H0YA 3NBIA 1FR1A 3EBTA 2X01A 4MB7A 5F83A 3O86A 5IF6A 2WKEA 1PJJA 3B3XA 4MMZB 1K56D 2Z4SA 2I7PA 1QYRA 2Q2EB 2CW9A 1L0EA 3S1YA 4EXRA 4QOZC 3TL4X 2DWZB 2Z77A 4PDGA 4RX3A 3B7CA 4NREA 4UA7A 1N9BA 3VKHA 3LEZA 3ZG7B 3TE6A 3L29A 5CHJA 3BFGA 4BTYA 4S2IA 1CYUA 3BFCA 5M1AA 4X62M 3RGAA 3U6QA 1W6CA 2F5SA 3MXSA 3ISGA 4C6YA 1YJ93 4N3VA 1LV7A 3NWLA 5FAPA 3D9RA 5E2GA 1O7HB 2OV5A 3PBRA 4N6UA 3U97A 3CCU3 2W2CA 4WMCA 5EVIB 3HVFA 4OH0A 4B7FA 3QK9A 1UUWB 1BUQA 1XGIA 2C11A 4BB9A 3CCV3 3J27B 1AV4A 5BR8M 4GH9A 2F4VM 1W6GA 2W56B 5G18A 1ERMA 1W00A 3WS2A 4FCJA 3FUTA 1VQM3 5CTMA 2ERCA 3VDPA 1ASKA 3FF2A 1PI5A 3IJEB 1NWWA 3EQUA 4KFEA 3ZG0A 2I7NA 1SKFA 3G31A 5JPUA 4Y7PA 4DV6M 4MGYE 3K0ZA 4OP5A 1W5TA 3A3JA 2RGQA 2KRTA 2ZC6B 5EP1A 1KC84 3U60B 4RNZA 2KXEA 3NDGA 5EEOA 3BNEA 2EX2A 1FQGA 3IQAA 4DR5M 3EE1A 2W56A 4QB8A 1IQYA 3UE1A 3DFZA 4X65M 4WMCD 1SXJA 3W0LB 4IT7A 2WUQA 1HKXA 3SX1A 3R8FA 3HHWA 3CCS3 3UL5A 4CPKA 2BNGA 4FCZA 3N8RA 2GXFA 2X8AA 2ZQAA 4FR9A 2EFUA 4AKYA 4GB5A 4IBFA 5EXSA 2DZNB 5D81A 1JB4A 5KP3A 3CD63 3HIGA 4KZ6A 4XDVA 2XD5A 5KSCA 1NYMA 4R0QA 4S2KA 3EF8A 1IVWA 4KZ1A 2WKIA 3NIAA 3M7GA 3ILKA 2DRWA 3Q7VB 1IT7A 4OVDA 2ZQ8A 1RCJA 3N8SA 3GQ5A 4JI2M 2P74A 5ITQA 2Y2QA 1XA1A 2WKHA 5FQMA 1TU5A 2WAEA 4M0WA 4DV0M 1Z6FA 3U6PA 4R3JA 4IBXA 4X56A 3N4IA 2I9WA 3G2ZA 5CGWA 1D6UA 4NL4H 4KFDA 3CXC2 2G2WA 3GLIB 3DGOA 4EV4A 3ZVWA 5EUAA 4R9LA 2VGKA 4ZAMA 5FTLA 5IT9S 1JWZA 1MXOA 4LFAM 5M19A 1RGZA 1R7RA 4R1GA 3SHGB 3LMLA 1XP4A 3ITBA 3G30A 3ZCZA 4OVZB 1PZPA 4LCBA 3U61B 2ZL8A 5A0OB 1MPLA 3V3RA 2B24B 2Y2JA 1ESUA 2VIIA 4TX4A 3X42A 1GHIA 3ZFZA 4LRSA 2DWLA 3OPRA 2J7NA 4OPZA 4I4KA 3NCKA 2ZM2A 3VP3A 4D2OA 2QENA 3SBJA 1XA7A 4K0WA 3WS1A 4RBNA 4KQOA 3JAMS 3G34A 1DGHA 3C7UA 4D80A 4BTXA 3FYCA 1IV7A 5EJCA 3NQZA 1W2B2 1LI0A 4KG6A 3FTCA 2XK1A 2A49A 1K4FA 3CMZA 1MNLA 1K38A 8CHOA 3W8KA 3KOZE 3I563 2XGNA 3U6MA 2YFIB 4LRTA 5KMWA 5ITTA 2CHQA 3UMMA 4DDYA 4JI0M 1PM5A 2R4EA 3D8LA 2CWVA 4K0XA 3SXXA 3O3VA 3KSED 1AR0A 2HMJB 3VKGA 4WBGA 3EB8A 3G35A 3Q07A 2HMLB 3ZG8B 3G4PA 2IMJA 2QZ4A 4QNRA 3BECA 2LNHC 4M9XA 1GHMA 2J9OA 3A45A 5FI2A 3V99A 5CRFA 2P05A 5CF2A 4JXVA 1IQPA 5BXQA 2CG1A 7CATA 3GPUA 3C58A 1FUWA 1K8A4 4BL3A 3FKWA 2RCXA 2KRKA 3U61A 5ELUA 3SH7A 1M40A 1YMXA 4MGIE 2YNMD 3N6IA 4UAAA 1WMOA 4NHFA 3ZHHA 4PD2A 5FGOA 3OX9A 2Y59A 4KG5A 2E2TA 3EN8A 5IW9A 4NXNM 3V50A 2ZC7A 1S3SA 4Z8XA 3KS4A 2L6OA 3A46A 2CG0A 2KEBA 3H51A 4GN2A 1KE0A 4N6OB 3IXBA 1L2SA 1G4AE 3MWZA 1ONHA 5CK6A 3FYDA 5FQ9A 3DGMA 5CXOA 1ULJB 1J5EM 1SXJD 1LHYA 1OPYA 3IG5A 1N4OA 4ZJ3A 3EQVA 5CHUA 4AEQA 4II7A 3AOEA 1JWPA 4GOGA 2QPNA 4K91A 2DZOB 5EP2A 1STDA 1OCVA 4S2PA 1QQWA 3LCEA 1E4DA 1G96A 4JXWA 2BO9B 3HJ8A 3TOIA 1JQJC 4JI8M 1AVKA 1PJIA 3ZNYA 5KZHA 4KLNA 3PXMA 1Q2QA 5F1FA 5JYOA 3BEBA 3NXJA 4DXBA 3PAGA 3CTWB 2E8IA 1PW1A 1CYVA 1ZAEA 5ITXA 1LNHA 1JR3D 3SOIA 5IG0A 2KZSA 2GEYA 3OC2A 3FUVA 2P9VA 1PI4A 2PBYA 1ALQA 2EXAA 3HU3A 2C96A 2ZM8A 3ZNTA 3IWOA 1W5DA 2F5NA 4KZAA 1I2WA 4ZJ1A 4W5WA 2OQ4A 3L26A 1FCNA 1K54A 1ORYB 3Q90A 4LJ8A 1BLSA 1K4EA 2HP9A 3AOGA 4BBAA 3WMDA 3K8ZA 3LYGA 4E3IA 4X6TA 2OCTA 1WMNA 3K92A 3PBNA 4NETA 3GRDA 3E99A 4WWUC 4BJPA 4ITQA 3CC23 4EQIA 3MJ5A 2X4AA 2IWCA 3CCJ3 2J8YA 3WS4A 4FMAA 4N6MA 4LZIA 1GA9A 2VGJA 3PTEA 4L0LA 2R62A 1K54C 3L2AA 3A3FA 4K90B 2D7HA 1O7MB 3FWLA 1NO3A 1W79A 5AQBA 5AYSC 3A42A 1VQK3 1HQYE 1GL6A 1JR3A 1K734 1K57C 3TQSA 5EXTA 1MKIA 2UU9M 4MMYB 2IUJA 3EIEA 5IERA 4EC6A 1OUNA 5F82A 1PIOA 5EVIA 5JBSA 1IV9A 4DF6A 3J80S 4LG2A 2ZM6M 2DHRA 1OHOA 2XSHB 3GPPA 3IF6B 2W0QA 4KFFA 3DGNA 4UA6A 3T1HM 3OW22 1KQS2 4PM9A 1FCMA 4HM3B 2A15A 2X71A 2QPAA 2F98A 2D1WA 1QALA 2FOIC 3LXUX 5F1GA 4EV2A 2BMOB 4R4RA 1MWRA 2Z3XA 3BRMA 3P98A 4E6XA 1L1ZA 4LGQA 3VSYA 3VP0A 1UI8A 3ZH9B 1E3UA 3KW6A 3F14A 5CGXA 3A76A 5G2GA 3CNXA 2RFRA 1OHSA 3LT8A 3DXOA 3FUXA 1JB5A 3U6OA 2HDQA 1PW8A 1ZQ9A 2K0MA 3UO9A 4F94A 4RVAA 5FASA 4LF4M 2WGQA 1SDNA 3BYDA 1LLBA 3LQQA 4IPBA 1SXJB 4CGYB 4GKJM 1VQL3 4MBFA 1JNQA 3CCE3 2HDSA 4GL6A 2FFFB 2PZVA 2LQVA 3H3HA 3C4OA 2QZ6A 3BLZA 4WZ5A 1W2ZA 1JV2B 3UJNA 1W6YA 1K57A 3IHBA 4MJDA 1E9SA 3N54B 4GC9A 3L0RA 1IY0A 3GLFB 1NU3A 3LH4A 2HCBA 4LF7M 1SJWA 1YLPA 4HM7B 2HKJA 1Q7Y4 2OTL3 4HL4A 1QVRA 1NRFA 4G6ZA 1DGHB 1OFHA 4QOSA 1N5PA 4E3NA 1VDDA 5FQJA 1WYCA 1OF5B 1KVMA 4G4OA 3AGEA 4HEFA 4B7GA 1QJGA 1XXHA 2WZXA 3HLDA 2XFSA 1XNRM 1CEFA 2UXBM 3U6SA 1O7NB 3CME3 3Q2PA 5A2QS 3HUMA 5FQKA 1JB2A 1SIIA 3MSOA 4JXJA 2HMKB 3T1YM 2G8LA 3MZFA 1IN6A 4S2NA 2H5SA 3PZWA 2OOVA 5GHZA 1O7EA 1N36M 3S67A 2Y2HA 1TEMA 1Z5BA 2L7HA 5GHXA 2BT3A 2QGUA 1NZOA 4IVKA 3KS8A 4DE1A 3M6AA 3GQZA 3JR4A 3MHEA 5IG3A 1IN8A 7STDA 2F86B 4WFOA 4O02B 4L7KA 4R4KA 4OQIA 1Q40B 3NM7A 2QEX3 2ZD8A 3W4QA 3U6CA 2EO2A 3S28A 4OLGA 4BD0A 1GA0A 1H6UA 3B8LA 4L16A 1HR0M 2CC1A 4GIPA 2STDA 3FUWA 1WTHA 4LFBM 2ZQ7A 5A93A 2Q9MA 3HREA 1OJLA 1G3IA 1N8QA 4IBCA 3W4PA 4L4UA 1J9MA 5HAIA 2CE7A 5FTKA 3PGBA 1WYBA 2M60A 1O7PB 4X66M 1MWTA 4JF5A 4N1HA 1OACA 4IBRA 1N77A 5FAOA 1L0FA 3W0FA 4QWTA 2CFOA 3J7BA 1W02A 1IELA 1YSYA 3FTEA 4DUZM 5E6JA 1LOXA 1N32M 3LY4A 4DKIA 4FD8A 3KFQC 3MPHA 1NY0A 1JTDA 3S4XA 2EXBA 3GMWA 3PBTA 4WM9A 5C1BA 3I7JA 3IF6A 4KG2A 4BL2A 3OXAA 1YHQ3 4LCMA 4FVMA 4S2NC 2CKFB 2HDUA 1PZOA 3M2JA 2OOVC 4WELA 3MKIA 3G16A 2A5YB 3TWKA 1C3BA 2Y21A 3J7AS 4DV7M 3UY6A 3WODG 4LV3A 3L28A 1WMPA 2W6JH 4MGKE 4MMXB 3T8NA 3HK4A 4IBGA 1N9JA 3T8UA 3T38A 4CJNA 1BUEA 1G59A 1V74A 3EHCA 2ZLYA 1KFVA 2FE8A 2XGLA 4RZMA 4GKKM 4X64M 3RGRA 4IJEA 2F99A 3VSKA 1WXQA 3EQQB 4IBJA 1TFKA 4C75A 1YIT3 3QWLA 2Y55A 4OLDA 2W9QA 1G8PA 2Z76A 3ZC7B 2CC3A 1RRHA 3CU3A 4GDNA 4B3MM 4LCLA 4AG5A 1K3WA 4KVHA 4E6WA 4R1KA 1RGYA 4XXRA 2ZAMA 1L8QA 1RP5A 3C7VA 1HVBA 1K3XA 2XLJA 1HU9A 5CF1A 3DWZA 1VQO3 3FH1A 1JKGA 5HAQA 4JI4M 4D81A 1H5XA 1JWVA 1K6SA 5EVIC 4MGZE 4RF0A 3UE0A 3WRZA 2Y2OA 1L2BA 4N6LA 5GLCA 1EWZA 2HPBA 4Z6YA 1VZZA 4I4LA 3HLWA 2JQ5A 3UPOA 3MKEA 3K1JA 5E43A 3CCL3 2ML6A 3HLEA 1ULIB 5FATA 1QAMA 4AZFA 4KZ8A 4WURA 2P38A 3PYJA 4Q53A 1BLCA 2WOHA 3SMSA 2C5RA 3H4MA 2X02A 4PDIA 1HT1E 1FGQA 2H0TA 4N6TA 1XKZA 2OQEC 1U5OA 2PNCA 3HI7A 2V2FF 3PS8A 3AMOB 3GLGB 3I4VA 3J2PB 2IUKA 4P87A 3SH9A 2HMNB 1W4NA 4OPQA 1AXBA 4DR2M 1DO0A 4HM4B 3CC73 3EIHA 5DF7A 2XSZA 2UUCM 1A2VA 4OVMA 2OQEA 5EOOA 2ZMAA 2RGHA 3SEDA 2WGVA 4LF8M 3A3IA 3C4PA 3TPZA 4I8OA 4YHHM 2GBXB 5HGRA 3OCNA 4GNUA 1EG9B 3DZDA 1MU5A 3N7WA 1H8YA 4M3KA 4KZ4A 1AVLA 2XD1A 2KW0A 3HLFA 3HX8A 3GQ3A 2QBYB 3LMMA 1EA2A 4PM6A 1OFIA 1NXYA 1RN7A 2FNAA 4KHPM 1DMQA 2XZUA 4N1XA 5A90A 3LVWA 1S723 1ISKA 2YFQA 3BOSA 4DR3M 4R9KA 1M904 4X55A 1NJFA 1QMEA 2JE5A 3GTCA 5EP4A 3BM6A 3ITAA 4ID4A 1IVUA 4LGYA 3JUMA 5D83A 2B1XB 2IA7A 1E32A 3PFIA 2CV0A 1TDGA 1EROA 4QHTA 2A3UA 3M2KA 1TIJA 1YLYA 4FCTA 2ZC3B 2Y2LA 4DR7M 1L0GA 4U3TA 3O8YA 2J9PA 3LQRA 3BB9A 1YJW3 1Q3BA 5ELJA 3X3XA 2DNSA 3ZG5A 1QAOA 3NX0A 3I51A 2UXDM 3QNCA 3RJUA 3ZCBB 4GD6A 4LJAA 4DR4M 4JXSA 4PPRA 1J7KA 2DVWB 3HHYA 3C5AA 4MEZA 3MHVC 3L25A 4Y0OA 4HJLB 4B3SM 4HM2B 5GLDA 3AKZA 4OQ0A 3UNLA 4X69A 2LYXA 2I72A 3NBJA 4B3RM 3GRRA 5DYIA 3JUPA 4HM1B 4DV2M 1TDZA 1HQCA 5FI7A 4FD2A 4NRWA 4IBKA 3NBBA 4R3BA 2XH9A 2F5PA 3GZXB 1XNQM 1NVMA 1YE9A 3MBZA 3RXXA 2L7IA 3BFEA 5GHYA 1KGGA 2KCDA 1YMSA 3HUOA 2Y74A 3GPXA 1KSFX 4ZDXA 4AKHA 4GD8A 2CV1A 1J09A 4LSOA 4BD1A 3GRVA 1PWCA 4I5SA 3LZAA 1N8R4 5TGFA 5BPVA 3KSXA 4CHTB 3E9SA 4PM5A 2Y2GA 2YFJB 5DF8A 2G2UA 1Z6TA 2EX9A 1I94M 1K6RA 2HMOB 2ZAOA 2R4IA 3KP0E 3OWYA 1N9EA 3IT9A 5KPTA 3DGLA 1Z5AA 4AKGA 4X2HA 3ZDJA 1EI5A 1XMQM 1LI9A 4OQGA 4JI1M 3FKAA 4Y0TA 5FLXS 3DTMA 4OOYA 1Q864 3U60A 4A3VB 1UW1A 4GDBA 2B5RA 3KVWA 1FJGM 3HHZA 3AGDA 3UJMA 2D7EA 1KDWA 3WDGB 4M0DA 3LTAA 1HTZA 2WZZA 4G4QA 3K9MC 5DF9A 1YQSA 3N8LA 3FV7A 3WS0A 4K0KM 1JKGB 3VSLA 4CCVA 3ECFA 3X40A 1BT5A 1G6AA 4MNRA 4PT5A 1L1TA 3CCM3 4DV1M 1IK3A 4WEKA 3D8BA 3F40A 1ONGA 2RGOA 1N5HA 4BTWA 5HARA 4MGHA 1IVXA 3LOYA 3OTOM 4S2JA 2BMRB 2XZFA 3SVAA 4YY3M 3S29A 2ZC5B 4Y0UA 4B4ZA 3WOFB 2NQ8C 3DOAA 3V98A 4LV0A 2R18A 3GLFA 1BZAA 4OQHA 3SAVA 4LJ5A 2DWMA 1JVJA 3QAUA 1E3RA 4H3UA 5ITRA 1N78A 1JN5A 3ZG9B 3SS3A 3D4FA 1I4WA 4XBOA 1L0DA 2C6WB 1E3UD 1UI7A 3CPOA 3TDGA 4NK3A 4HKVB 2Y91A 2XR0A 3HLGA 3BFDA 3R9XB 1IYPA 3AV0A 1FGRA 3FG4A 3NBLA 1IU7A 1TGUA 4OVZA 1GY7A 1WQLB 3PNYA 3GLIA 4HBRA 4PEJA 1QZMA 2WGOA 3IXHA 3VOYA 1SXJC 2J7OA 3SH8A 3LY3A 2RCDA 1MBLA 5E2EA 1GY6A 4IBEA 4KODA 3OCLA 4H61A 2Z2LB 4IIAA 2C5WB 1YI23 3NM2A 1FNNA 3GRYA 4LJ4A 4DE2A 2CV2A 1MWUA 1N34M 4GHLA 1KYIA 5JYPA 1IBKM 1N75A 1NSFA 1XPBA 3M6BA 3FUUA 4Z9QA 3PVSA 2X49A 2HDRA 4HVNA 1TH2A 4OOMA 4JI3M 3V5MA 1MY8A 4RNAA 3SLUA 1KE3A 2ZQ9A 3SASA 1Q3CA 5FI6A 2INXA 3PNVA 4OPRA 3SMPA 4WYKA 4BLMA 1SQWA 3VOZA 3VFDA 2XLNA 3FTFA 1HD8A 4KZ7A 3UDIA 4BENA 2CK3H 4N9KA 3SS4A 1NB3I 3RGSA 3BNBA 4OU7A 2Z7JA 5C18A 4J9AA 4AI6A 2WADA 3HU1A 4QNMA 1GY5A 5L2FA 2DXIA 1DGGA 3GPYA 4HBTA 5KO3A 1IBLM 1R2YA 3Q1FA 3FGYA 1SCWA 2V1CA 3IWQA 2E5LM 4GRIA 2JA2A 3NQYA 2Y4AA 3RFWA 3HBRA 5EXPA 3THGA 1NNJA 1SPUA 4ZPXA 2BG1A 3UNWA 3WWXA 4MBHA 3PXGA 1GHPA 5D3OA 5GLBA 2P09A 2CIUA 5GLAA 4OX9M 4DXCA 4EUZA 4FCFA 5DVAA 1L2CA 5IG5A 1R2ZA 1NZUA 4M9ZA 4R7GA 1QAKA 2W04A 1CI9A 1E25A 2CFGA 1FGMA 1G68A 4IBDA 4XBTA 3FTDA 3HHXA 2KXGA 3UL6A 5AIFA 1VQ73 2D42A 3NY4A 1DO2A 2RSXA 4CISA 4OK0A 3KSPA 3F9SA 3NDEA 2BHMA 4NOOB 1KGEA 2WYXA 5FQIA 4XUXA 2ZQCA 3QHYA 3VGNA 3U6DA 4FH2A 1GS3A 3DWKA 3PAEA 4FCVA 3FG3A 5M18A 2HP6A 2ZQDA 1JTGA 1FR6A 4DDSA 4JI5M 1TP6A 2GDNA 3VDUA 3JUNA 5A91A 3ZVTA 1SXJE 3RXWA 4R4SA 4KENB 2W03A 2XQZA 4JRFA 3BLSA 2P0MA 2BJWA 3GVBA 4N6V0 1DJAA 1GCEA 4WEJA 2EX6A 1BULA 5AQAA 2OLVA 2R9WA 4CDLA 3L27A 1ES3A 2C99A 3OWUA 4DRTA 3FLJA 4EYCA 2E2VA 5HW3A 3I553 1CQSA 1QANA 2Q07A 1ERQA 3KE7A 3PBQA 5E2FA 3GRUA 3IXGA 4QY5A 4FSFA 4OPYA 3K5TA 1DY6A 3I0YA 5BVBA 4K1VA 5IG4A 4GZBA 1YVBI 4EV5A 2V1LA 4PMAA 2O3OA 2MF7A 1M1K4 4LJ9A 3HIIA 3ALAA 1ES2A 3UK6A 1ZC2A 4JF8A 4B4XA 4HM5B 2CFLA 3E2KA 3EN1B 3RDEA 3MKFA 4KZ9A 5EXXA 3U5ZA 1WE4A 1K55A 3T0UA 4KZ3A 1X37A 3F8HA 3SOAA 5A92A 4GKUA 2EA0A 3MG2A 1A2KA 3SFZA 3GR2A 4MBKA 1HNXM 1YM1A 4HYZA 1ES5A 1TDLA 3UN7A 3UZUA 5FA7A 4XGIA 2V1UA 2R46A 1XXHB 3T15A 4OW0A 5EVID 1IXSB 1RJOA 1Z1SA 3GQ4A 2ZC4B 3OV4A 5AIHA 2J7VA 1ZG6A 2BLSA 1ZX2A 5GL9A 5D82A 1S0WA 3JUQA 3W4OA 1W8QA 1DVCA 3IH8A 4EBPA 4QJGA 1YT4A 3PCRA 3F7XA 3KSJA 1M9GA 4BQMA 3WOEB 2V6ZM 3KFUG 4S2OA 4RNYA 4JLFA 3IMAB 1L5GB 4UA9A 2XF3A 4KZ5A 4RYEA 3UDFA 3OZHA 4AW4A 2JCHA 4NRVA 4AKIA 3A3DA 3HLBA 1VQP3 2CUZA 5JPPA 2W82A 3CF2A 4I81A 4K1UA 2QBYA 4DR1M 4FH4A 2Q9NA 4L15A 1IQXA 2UUBM 3ROBA 1O7WB 4LV2A 3NHXA 1E9RA 5TR7A 4XB5A 2ZJ9A 1C1KA 1OGXA 5ITYA 1K25A 3NUVA 5DTKA 1LL5A 1QAFA 4J8TA 3DA1A 3CCR3 5ITUA 2R45A 3M8CA 4DV4M 3TWMA 3EJVA 2FGTA 4STDA 3Q7VA 2ZDJA 4NSOB 2GU3A 4HM8B 3FKVA 4AKZA 1Y4KA 3U1WA 3U5ZB 3SARA 2R9XA 1NJI4 1IY1A 2MC8A 1HNWM 3DW0A 1GL7A 2G5GX 2F5QA 4M9SA 3JUOA 4K61A 2EX8A 1A67A 3KOYE 2C9CA 4L8PA 5CLKA 1YIJ3 4WZ4A 1XGJA 4P0MA 1QAQA 4L8RC 2P0XA 3RGPA 5STDA 4LJ7A 1NJGA 1W01A 1ROAA 1VQN3 2C98A 1C7HA 1KE4A 4R23A 4DR6M 3G0KA 4LV1A 4O8SA 3UPNA 4GITA 2EFXA 5HX9A 4E3LA 3U6LA 4HBUA 3UB1A 4LGMA 4QU3A 1HT2E 1UM8A 2ZBKB 5IWAM 4P6BA 2H1RA 2CFDA 5AIIA 1SDEA 2QP9X 2CEAA 3E2LA 1F8NA 3WHLA 3FSDA 3NBRA 5CHMA 2XEPA 3U6EA 2GEXA 3M6HA 4YINA 2K47A 3G6E3 2UWXA 1OF5A 1MWSA 4G4RA 4JYAM 4C3QA 2UUAM 3MK6A 4JPMA 1VQ53 2WAFA 3G8ZA 3DUKA 2YR0A 2CWTA 1GVNA 1FOFA 3WA3A 2M5ZA 4B7HA 2OSUA 3G4S3 3AOEC 3HGIA 4UHUA 4EIWA 4LF5M 2KZUA 5E2HA 4JKTA 1TDHA 3VFHA 2EUCA 1Q42A 1E3VA 3ZGAB 4IIWA 5JI2E 1U60A 3VP4A 1K56A 3MYTA 3Q1CA 4U0XA 2D7GA