2XFSA

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGAAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGSSPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 138
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xfsA03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xfsA01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xfsA02
4WMCD 4EBNA 5CGXA 4X53A 4WM9A 4YFMA 5GLDA 4HEFA 4E3MA 2IWDA 4ID4A 4Y0UA 1FR1A 3LEZA 5EECA 3D4FA 4QY6A 1BT5A 3HUMA 4S2NA 2XLNA 5M19A 1XXMA 2OSUA 1BULA 1BTLA 3WS1A 3N8LA 1LI9A 3HL9A 5DF8A 1NY0A 3FKWA 3HLGA 3O87A 3LO7A 1ERQA 1W8YA 4KG6A 3P09A 4MEZA 1ZG4A 1L2SA 3PBTA 1BLHA 1K56A 1ZG6A 3IH8A 1XKZA 2B5RA 3PBSA 1SCWA 5DF7A 4KG5A 1RGZA 3G2ZA 3NDEA 4OQGA 4Y0TA 1BLCA 2Y2KA 4CPKA 5HAQA 5GLCA 4X56A 2WGIA 5GHYA 3AGDA 5D3OA 4JKTA 5F1FA 1H8YA 2XQZA 5CEDA 2G2WA 2ZQAA 4KQQA 4GOGA 4DE3A 1CI9A 4JXGA 4E6WA 1L0GA 1SHVA 4IVIA 5E2GA 4U0XA 4JXSA 3C7VA 5EPHA 1MXOA 1IELA 3IXHA 3M2JA 4LV3A 3BM6A 3SOIA 4XXRA 3BLMA 4NETA 1TDLA 4E3KA 3BFFA 1FSWA 4ZTKA 4L0LA 3OC2A 3DWKA 1LI0A 1ZC2A 4LCMA 5DVAA 4H8RA 2VGJA 3HLEA 4R1GA 3WS0A 3O88A 2CC1A 4KZ9A 5CTMA 2WZXA 3HLFA 5IHVA 1ES3A 4P87A 3UPOA 5KMWA 1K54A 3Q81A 2IWBA 2IWCA 3IHBA 3C5AA 3SH8A 3VOYA 4KG2A 2FFYA 3C4PA 4OQ0A 4E3NA 1ONHA 3HBRA 2EX8A 3FWLA 4OQIA 5DTSA 4QU3A 4WBGA 4JPMA 4KENB 2G2UA 1DY6A 2ZD8A 1YLZA 3IF6B 3I7JA 3O86A 3RXWA 4DE2A 4QJGA 3VP0A 4R4SA 3NBLA 4DDYA 4DXCA 5FQIA 3PTEA 3OPHA 1PZOA 1K25A 4S2JA 1KVMA 3V3SA 3BYDA 3N4IA 4QD4A 4WYYA 2EFUA 1YLTA 1EWZA 5HAIA 4OH0A 2ZC5B 3N6IA 3IWIA 3SH7A 5M18A 2C6WB 2XGNA 3LY3A 1L0EA 4XUZA 5CERA 3UN7A 4ZDXA 1NZUA 2V2FF 1KVLA 3A3DA 3QHYA 3NI9A 1KGFA 1NRFA 4K0XA 1PW8A 4P6BA 3Q82A 5CXWA 4EBPA 4JF6A 2XEPA 3DW0A 2PU2A 1VQQA 1YLJA 4PM8A 1MWTA 3A3IA 4OPYA 1K54C 1VM1A 2UWXA 3HUOA 3UPPA 1RGYA 4BQMA 4K91A 2X02A 1FQGA 1BLSA 4RVAA 3IF5A 1LHYA 2WGVA 2ZLYA 5EE8A 5DF9A 4WELA 4FSFA 1W79A 1CEGA 2HDQA 3NIAA 3ZCZA 1XPBA 5CHJA 4UA7A 3NC8A 4FD8A 2ZQ8A 3LCEA 4PM5A 1IYSA 1XP4A 4N92A 5EOEA 2JCHA 1W8QA 5E2EA 5CRFA 5EVID 1IYOA 1JWZA 1NYMA 3BLSA 2WYXA 5CECA 3ZDJA 4OPRA 4GD8A 4JBFA 4JXVA 4S2OA 1E25A 1GCEA 1DJAA 1LL5A 1YMSA 1K57A 1FR6A 2Y2LA 2WKEA 3TOIA 1IKIA 4KZBA 5EVIC 2WGWB 4KQRA 3WS5A 4PM7A 5GL9A 4UA6A 2WUQA 4N9LA 1CEFA 1DJCA 1EI5A 4WEKA 4DE1A 4OOYA 3HLWA 3SS3A 2A49A 2WAEA 3OCLA 2EX6A 4E3OA 4QB8A 3VFHA 2P9VA 2XK1A 5TR7A 5L2FA 3GQZA 1QMEA 3DWZA 4IBXA 1TDGA 3BFDA 1K55A 1JTDA 2Y2NA 5BOHA 5DTKA 5U47A 4P0MA 5AQ7A 3G35A 2OLUA 3W4OA 1Q2QA 5TFQA 3VFFA 3IF6A 2A3UA 3TG9A 3MZEA 4XUXA 1ONGA 4B4XA 1KE4A 4GN2A 4DRTA 3VSKA 4HBTA 3SS5A 3GSGA 3GV9A 3Q7VA 5E43A 3ZG0A 3OZHA 4KZ3A 4WZ4A 3BECA 4KQOA 4LCLA 1MPLA 2HDRA 3PBRA 5CGSA 3OPPA 5AQAA 4S2LA 5FDHA 2H0TA 5EVLA 5HL1A 5G18A 1XX2A 3HREA 1NXYA 4Y7PA 3ITAA 4IBRA 3UDIA 1GA0A 3BFGA 3G34A 2R9XA 4RX2A 3RXXA 3HLDA 3V39A 4QY5A 1YLPA 4QHCA 2X01A 1NZOA 4S2NC 5HX9A 1PW1A 1WYCA 2ZM2A 3CMZA 4K0WA 1KE3A 1SDEA 1K56D 3IXDA 1ESUA 1GHPA 1SDNA 1GHMA 4KZAA 5FA7A 4CJNA 3Q7ZA 3M2KA 1E4DA 1K55C 3IXGA 4E6XA 4F94A 1PIOA 2XR0A 4IVKA 4P85A 4X6TA 5A93A 1IYPA 1RP5A 2XH9A 2ZM8A 3HVFA 4JXWA 3DTMA 1IKGA 4LV0A 1SKFA 1K6RA 2E8IA 5FQMA 1E3UA 3C4OA 1PWDA 4YINA 3UPNA 3WS4A 5CHMA 1K6SA 1JVJA 3CZDA 1IEMA 1WYBA 5CTNA 5JYOA 3IT9A 1I2SA 5JYPA 4OQHA 5CHUA 4OKPA 4KZ8A 4S2MA 4BJPA 4B88A 3WRTA 1BZAA 3ISGA 2V20A 2OV5A 1DJBA 1M40A 1HZOA 1AXBA 2ZQCA 2ZM0A 3PAEA 3UNWA 4C6YA 1NJ4A 4EV4A 2HP9A 2J8YA 3A3EA 1MY8A 3FYZA 1G68A 1I5QA 1TEMA 3A3JA 2JC7A 3IHAA 4WZ5A 2BLSA 3RJUA 4OVDA 1MWUA 1CK3A 2XD1A 4KZ5A 5FI6A 1XA7A 4FH2A 2WKIA 5FI2A 5GLAA 3MXRA 3UE1A 2HDSA 1ES5A 3VP2A 5HFOA 4LV1A 2XFSA 2RL3A 3QNCA 2ZQ7A 1E3UD 1M6KA 3VOZA 4OLDA 4OP5A 4EBLA 1KDSA 3IWQA 1FCOA 2Y2GA 1L0DA 4GB7A 3VMAA 1HTZA 3MFDA 2Z2MB 2H10A 3O3VA 2JE5A 2V1ZA 4MBKA 4JF5A 1XGIA 3HUNA 3MBZA 4GDNA 4ZAMA 4O7DA 4BL2A 1ZKJA 3IWOA 1LL9A 2XDMA 3G32A 5FATA 1YT4A 2PU4A 3PAGA 5E2FA 3VSLA 1QMFA 5FI7A 1MWRA 2WADA 4EWFA 2HP5A 3AGFA 1C3BA 5FAPA 3W4QA 1S0WA 4M3KA 4GNUA 1L0FA 3QNBA 2XFTA 3ZG9B 2EFXA 3VP1A 4DXBA 1OMEA 3E2LA 4OOMA 4S2IA 1EROA 4R3JA 1IYQA 4NK3A 3ZHHA 3OCNA 3ZG5A 1ES2A 4Y0OA 4HBUA 4RX3A 1N4OA 3GTCA 4BL3A 4DKIA 3ZVWA 2J9OA 2Q9NA 5AQ9A 4C3QA 2DNSA 3UE0A 1LLBA 3FZCA 3GRJA 5GHZA 3MXSA 4PM6A 3OPLA 3M6HA 3ZVTA 4HESA 4DDSA 2ZQDA 2EX9A 1U60A 3ZGAB 5F1GA 1KE0A 2Y2MA 5FAQA 1HVBA 1PI5A 4ZBEA 3Q1FA 1YLWA 1ES4A 3PBNA 3BFCA 3UDFA 1N9BA 1ERMA 2HP6A 3S22A 1YM1A 5A90A 3MKEA 4WEJA 2OLVA 5TGFA 3IQAA 3S1YA 3PBQA 5I94A 5KSCA 2Y59A 4PPRA 4N1XA 2EXBA 3W4PA 2H5SA 3BEBA 1CI8A 3NY4A 5FQ9A 5AQBA 4UA9A 3E2KA 1KGGA 5EVIB 4DE0A 1HD8A 5F83A 4KZ7A 1PWGA 4JLFA 2ZC4B 4A5RA 4MNRA 4EQIA 5KZHA 4DF6A 3AGEA 4OPZA 3WS2A 1K4FA 1K38A 1K57C 4ZJ1A 2ZC3B 5FQQA 2Y2JA 2J9PA 2QZ6A 2Z2LB 4PMAA 5FAOA 5FSRA 3UO9A 3C7UA 2FFFB 4B4ZA 5FQKA 4R4RA 1S6RA 1I2WA 4E3LA 1YMXA 3Q07A 1PI4A 4OLGA 2Y2IA 3GR2A 1PWCA 3N8SA 2PBYA 4BENA 2ZC6B 3CJMA 1H8ZA 3NCKA 3HLBA 3ZNYA 1G6AA 4OOLA 2QMIA 3G31A 5E2HA 5A91A 3GVBA 4N9KA 4X68A 2EX2A 1K4EA 3IF6C 4E3JA 1ESIA 4S2KA 1KDWA 4JF4A 3G30A 5GHXA 4GD6A 3SS4A 2P74A 2J7VA 4X55A 3V50A 3A3FA 1JWPA 3NDGA 5DTTA 3ZG8B 5CGWA 2WKHA 3FV7A 1FCNA 1MBLA 3BFEA 1FSYA 1RCJA 1WE4A 4BD0A 2Q9MA 2Y55A 2WGWA 4C75A 5CEBA 2DRWA 1O07A 3EQVA 3FKVA 2P9VB 1JTGA 2Y4AA 3G2YA 4ZJ2A 1YLYA 3ZG7B 1PYYA 2EXAA 4RYEA 3V5MA 1TVFA 4N1HA 5FQJA 4EUZA 3S4XA 2GDNA 3UDXA 4FCFA 3UY6A 5HW3A 2WZZA 5J8XA 4UHUA 2XD5A 2Y2PA 3B3XA 3LY4A 2RCXA 3VP3A 3CG5A 2I72A 2R9WA 4BLMA 5KSHA 1XGJA 5HARA 4ZJ3A 1BUEA 5M1AA 3GMWA 2VGKA 2WAFA 4R3BA 3VP4A 3Q7VB 1FOFA 2DCFA 2Y2HA 3MZDA 1Y54A 3HLCA 3W8KA 3G4PA 4S2PA 5EUAA 1O7EA 4MBFA 4PM9A 1YQSA 2C5WB 1MWSA 1GA9A 2Y2QA 2HDUA 3WRZA 5EVIA 1FCMA 2Y2OA 4U3TA 3IH9A 4D2OA 1J9MA 3WWXA 3TSGA 3JYIA 5GLBA 4GDBA 2JBFA 2ZMAA 1Z6FA 1PZPA 2X71A 4UAAA 1BLPA 4WMCA 3ITBA 3ZNTA 1Q2PA 3IXBA 3M6BA 4MBHA 5FASA 1ALQA 3ZFZA 4IEDA 4OONA 1W5DA 1KGEA 4LV2A 3BRMA 5EOOA 1BSGA 3MZFA 5A92A 2BG1A 4WZ5C 2ZC7A 4Q8IA 1H5XA 1NYYA 2QPNA 2ZQ9A 3OPRA 3PBOA 4GZBA 4R23A 3V3RA 1XA1A 3N8RA 4X69A 4Z9QA 4RA7A 4U0TA 4KZ6A 1GHIA 3P98A 4R0QA 5F82A 2ZJ9A 1W7FA 2XF3A 4OP8A 2H0YA 4FH4A 3UE3A 2Y91A 4KZ4A 3N7WA 4LENA 1MKIA 3MKFA 4GKUA 5HAPA 4OPQA 3SH9A 4BD1A 2HPBA 2WK0A 3EQUA 4MLLA 1JWVA 4E3IA
chains in the Genus database with same CATH superfamily
6RNTA 3GWRA 1BRNL 5I97A 1CQAA 4OVZB 4EV5A 5GLDA 4EBNA 4Y0UA 3CITA 1RGEA 2VF7A 1WQLB 3D4FA 5FGOA 4QY6A 2R62A 2CFLA 1BT5A 3HUMA 4F3LA 2KNAA 1XXMA 3WS1A 2C9OA 3IG5A 5D82A 4HP9A 4UN2B 5DF8A 5HWVA 1XHBA 3LO7A 3MKIA 3B4PA 3EQQB 3MPHA 1F9IA 4KG6A 2R4EA 4FWGA 4WFOA 1HLUP 4MEZA 4P6ZS 1ZG4A 3J81S 1BLHA 1K56A 1NJI4 4GCZA 4NL4H 5DF7A 1UI7A 3RFBA 3NDEA 3GZXB 3PXPA 3FUUA 5HSQA 2Y2KA 3GQ4A 1BVIA 3CUEC 2WKPA 1ZMWA 1QAOA 1Q9EA 5D3OA 4JKTA 3JUMA 2MF7A 2DZNB 3LT8A 5IG3A 3EGDC 5HWWA 3S67A 4GOGA 1YI23 3KS4A 1O7WB 4HM4B 3CCS3 1L0GA 2APLA 3EX9A 3B7ZA 2V1CA 3DBAA 4I3AA 4IVIA 1UDII 1RRHA 1UCIA 4JGPA 3T6PA 5ELJA 1QVG2 4U0XA 1IELA 3CPW2 2O5RA 5EXXA 1VEUB 4Q0JA 4LV3A 3ZCBB 4FMAA 4YY3M 3KX0X 1Z1SA 2W3HA 2L1SA 4XXRA 1PNEA 5F6AA 2HCBA 2RRUA 3UGJA 2QA43 1LI0A 4LLOB 1ZC2A 1V92A 4G1MB 4GJ4A 4GB5A 4O01A 2RGOA 2CC1A 3SFZA 3HHYA 3CI6A 2XROA 1DRMA 1N32M 3LYXA 3DZDA 1W6GA 1CUKA 1ES3A 2PD7A 4P87A 3CME3 2IMJA 3U61B 4MB7A 3CTWB 3H9WA 1XXHE 2IWBA 5ITRA 3QYEA 3SH8A 2DAMA 2CEAA 1BRJA 4KG2A 5BIRA 2HL7A 2FFYA 3C4PA 4OQ0A 1ONHA 2LHCA 4CLCD 1AIPC 3A0VA 4JPMA 4KENB 2A24A 1R4GA 1XJ6A 2ZD8A 1YLZA 3DY5A 4G4NA 1Y28A 1SXJB 4JGRA 4R4SA 2G5GX 3NBLA 2EA0A 3KCHA 3SYUA 4DXCA 1QAKA 3F8XA 4UQIM 2R46A 2G7UA 4QD4A 1RN1A 4K90B 1Q40B 2CWTA 3SZTA 3N6IA 1IM2A 5J3WA 1UGUA 3LY3A 5KPTA 2P0XA 3KYQA 1YE9A 2V2FF 1GLNA 2LXEA 3QHYA 3NI9A 1EE8A 1NRFA 3FG8A 2IUJA 7RNTA 1BNSA 1QDRA 2XEPA 3WA3A 3DW0A 2YNMD 4X25A 4X66M 1E97A 1A90A 4L9GA 3UB5P 1VQ93 2Z6CA 1K54C 2H28A 4LRZE 5EXTA 2QNJA 1TU5A 1L5GB 3UPPA 4O2HA 4BQMA 2HZ5A 2PR5A 3I4YA 4AKGA 1VQ43 1SZVA 2X02A 3NBRA 3D9YA 4G3KA 1BLSA 4HOIA 2CKFB 2JY5A 1LHYA 2QENA 2ZANA 2XRNA 4HHDA 3GRUA 4LJ8A 1B2ZA 1JR3E 5EE8A 2LB9A 4CLCB 2ZA4A 3JPUA 1W79A 2HDQA 4FSFA 3LW5F 3ZCZA 2HMLB 1XPBA 2BMOB 2C11A 4IUHA 1WGNA 5LC6A 3NC8A 4UA7A 3LCEA 4PM5A 1IYSA 3W67A 1YAXA 1O7NB 2PYRA 1W8QA 4KHPM 5FTJA 1LRAA 5CRFA 1JWZA 3NUVA 4O0PA 3BB9A 4GD8A 1Y4KA 1SPUA 3HOHA 5ITUA 1AQZA 1HQYE 1LOXA 2L4VA 1DJAA 1K57A 1YMSA 2Y2LA 1I0XA 1R7RA 4WW0A 4GHIA 3WS5A 2MC8A 4ZPXA 1DJCA 1K0KA 1STDA 2F98A 4J9AA 3MYTA 4DE1A 4OOYA 3HLWA 4MM3B 2EX6A 5EM1A 2VV8A 5JI3E 3CCQ3 4QB8A 1OFIA 4NXNM 1T5YA 5G4YA 3CU3A 4DV2M 3A45A 2FH5A 1RGKA 2HWJA 2BT3A 4MN7A 1JTDA 5BOHA 5DTKA 4P17A 2OOVC 1Z5BA 5HD5A 3ALAA 5JPUA 4B4XA 3UL5A 4XUXA 1KE4A 4PDGA 2V0WA 4GN2A 3WODG 1QAMA 3KW6A 1XJ2A 3ZG0A 4XDVA 2CK3H 4KZ3A 4KQOA 4LCLA 4ESPA 4LF9M 1TD5A 2KA6B 4IBBA 2G8LA 3LIDA 4J5KA 5AQAA 2ACGA 4HEOA 1EW0A 4S2LA 1FNNA 5G18A 3MR0A 5IWAM 1GOVA 1P9WA 3ITAA 4IBRA 2W9PA 2BNKA 2O01F 4Q0HA 2R9XA 3GQ5A 2FOIC 3P01A 3RXXA 2ZL1B 1DGHA 2YX9A 4BU4A 1R5LA 1QVRA 5KQDA 3NJAA 3U6DA 2ERCA 2KRUA 3UK6A 3RGSA 2ZL8A 4B7GA 2OAQ1 1C1KA 3W68A 4KVHA 2B95A 5F3WA 1SDEA 1ROVA 4AKZA 1ESUA 1GSWA 1K56D 3T1HM 3PFIA 1GHMA 2VJWA 5DJTA 2ZBKB 3TWKA 3Q7ZA 2DHRA 2DAGA 5L8RF 2MGWA 3NX0A 2IY2A 4MJDA 3GDIA 5A93A 3VFHA 1C7YA 5AIFA 1NJGA 1SKFA 3LR3A 3PVSA 1B2UA 4AQYM 4GL6A 2QEX3 4LF7M 1OTBA 3HCYA 3KZTA 2J5YA 1X1XA 1TH3A 2PDRA 1JVJA 3CZDA 1KQS2 4I8OA 5AEUB 5CHUA 3X42A 3E4OA 2VX8A 4KZ8A 2FXTA 3R7WA 1NLYA 2CV1A 2V1BA 3SYKA 2QPAA 3A0SA 1YSYA 5IEOA 2OQ4A 2HV1A 1G68A 3E0YA 3HJIA 3PCSA 3UJNA 3E46A 1STFI 4QNRA 1XC8A 3LFVA 4Y5FA 1GD3A 3KN4A 1UM8A 2BLSA 4OVDA 3LR4A 1MWUA 3HZPA 2Z7JA 5FI2A 4FH2A 2F5NA 3E99A 3MXRA 1ES5A 3VP2A 2K2NA 4DR2M 2DWNA 2XSOB 2P05A 4L6V6 3S7PA 2EA9A 1NNVA 4OLDA 3EF8A 3FRHA 4LEHA 3U5ZA 1YSPA 4E04A 3SMPA 2D02A 1K8A4 4LPZA 2Y79A 4N6V0 4Z8XA 2KHHA 3CCU3 4P16A 3G32A 1RGLA 1L2BA 3PAGA 3VSLA 5FI7A 3B7QA 1TTEA 1OF5B 3K9PA 3S28A 3BY9A 1C3BA 3D9RA 4RNYA 1S0WA 1XXHA 3S7NA 1HR0M 1L0FA 3QNBA 3BY8A 1N36M 5LMUM 4KO8A 5FEGA 1WMPA 3HJQA 2L09A 1Q7HA 4R3JA 4NK3A 3ZHHA 3OCNA 5IEPA 3PCRA 1VG5A 3OWUA 4RX3A 2UX0A 1P9RA 1OTIA 2J9OA 2Q9NA 4ETXA 3J2PB 7CATA 3JR5A 2QHKA 1LQGC 2SBLA 3RGRA 2CHVA 1FJGM 5GHZA 3MXSA 3DGLA 5HPIA 2P04A 3ZVTA 4DDSA 1MOLA 4XBOA 3T1RA 2ZDJA 3WOEB 2CIUA 1PI5A 3Q1FA 1YLWA 2LHGA 4EV2A 3UDFA 1IY1A 1N5PA 3NBXX 2A24B 3ZYTA 3S22A 4B9OA 4NXEA 4IBFA 1GL6A 1HYFA 3STDA 4WEJA 3G6OA 1Y4OA 3GPUA 3L28A 3S1YA 3HGIA 4PPRA 3VOLA 4N3VA 4BBAA 3E4QA 4N6UA 3T4LA 4B3RM 3C9PA 4OU7A 2BU4A 2CWBA 1BNFA 5EVIB 4MGKE 2DWMA 4OK0A 4DE0A 1JR3A 3NULA 2NUTC 2ZC4B 4MNRA 1EA2A 4HM0B 4EEPA 3W2ZA 1IVVA 1K4FA 1K57C 5A8BA 4B93A 5ITXA 3AL0C 2J9PA 2QZ6A 4PMAA 1SARA 3DGYA 1OT9A 3UO9A 1VEKA 2FFFB 1IN5A 1YPRA 3SOAA 4R4RA 3Q07A 4CGYB 5KO3A 4OLGA 3NBIA 3PNYA 4BENA 4LZJA 2LNHC 3CJMA 2STDA 3I04M 1WIVA 3ZNYA 1G6AA 2R45A 1IVWA 4EW5A 4OOLA 2FFJA 5I5LA 1Z59A 2KRKA 2F56A 3JUNA 1ZAEA 1GJSA 4OVMA 3G31A 1UCKA 5EVEA 2LVAA 4B3TM 4S2KA 1I2FA 2CUZA 4HJ4A 4KLNA 1R4YA 2XLJA 2HJEA 3LXUX 3Q2PA 3NDGA 2W1RA 1Z6TA 1JBTA 3FV7A 4GHIB 2YR0A 2ML6A 1RCJA 4MGHA 3B4OA 2KF5A 3LI8A 4EU0A 2WGWA 3TE8A 1W63Q 5CEBA 1N9LA 3N9HA 4FCVA 1VQL3 2XZFA 4HNBA 3IG8A 1ZO2A 2F5OA 2BMQB 1PU4A 1TVFA 2GDNA 1NY5A 4MLLA 3UDXA 4FCFA 4NXGA 4H6JB 3UY6A 1W00A 2GU3A 4UHUA 2XD5A 3LY4A 2RCXA 4FUWA 5KSHA 2VGLS 4FWDA 1PM5A 1BUEA 4CCVA 4NXBA 1P0ZA 3U6MA 1W6YA 2ZOIA 2I9WA 3G8ZA 1W01A 4NXFA 3W8KA 2L0WA 2Y2HA 3NOUC 1RN4A 2EO2A 3BBZA 3X3YA 2W6JH 5EUAA 1SJWA 5DRVA 5EXSA 3F8HA 3CWFA 4HJLB 1IN7A 4LSOA 3IH9A 4O3VA 1S67L 1I70A 1J9MA 3KP0E 1DYUA 2H0IA 3G4S3 1ROAA 5GLBA 5AVFA 1AUAA 1DGHB 1EIJA 2CG1A 4DR3M 1X1UA 1BLPA 4IEDA 4OONA 2JP7A 1DVCA 2E5LM 2N35A 2DWZB 1BSGA 1J2BA 3MZFA 1UGIA 4WP2A 1EG9B 1ORYB 5AI1A 1S1ZA 3LIFA 2DAKA 1H5XA 4I39A 3ZH9B 2QPNA 3PBOA 1IFQA 4HH2A 4X62M 5MC7A 4Z9QA 2AHMA 1KFVA 4KZ6A 2I7PA 1JNUA 2W3FA 2ZJ9A 3CUEA 2XF3A 4XT2A 4R9KA 2UU9M 1CYUA 5HD3A 2JXNA 2WSCF 4FH4A 2Y91A 2O99A 3EHCA 1AY7A 1TRQA 3N7WA 4LENA 3NHQA 2BJVA 4LY6A 4GKUA 3N54B 3R7WB 5HPFA 5BR8M 3KFUG 2HPBA 2WK0A 3EQUA 1I2EA 3LTAA 5AYRB 3HIIA 4WMCD 3FYCA 3CMA3 5CGXA 4YFMA 3Q8XA 2IWDA 4ID4A 3T1XA 1FR1A 3CF6E 3CNXA 4D81A 5A0OB 1FZUA 4L78A 3FPWA 1OKSA 1BNJA 3KSED 4JI3M 5M19A 5D81A 1BTLA 3SYLA 1V34A 1ZQ9A 3UE6A 3N8LA 2WSEF 1LI9A 3HL9A 3MK6A 2Z77A 1NY0A 3HHZA 2KF4A 2M1CA 2O25A 3O87A 3LIEA 2CP8A 5TJJA 2VV6A 2VEAA 1WJ7A 2WOFA 1NNUC 3PBTA 3D8BA 5ITQA 3S7QA 1XKZA 3HX8A 5KPZA 1IN6A 3G2ZA 4MGZE 4OQGA 4CQHA 3QAUA 5HAQA 5GLCA 3GLFE 4LGMA 4JGOA 5G2GA 2Z6BA 4DV6M 1G8PA 1H8YA 3FCSB 3L0RA 3QP6A 3URPA 1TF1A 4KUKA 3GAXA 1XXHB 4LGQA 4DE3A 1CI9A 1GSVA 4E6WA 5E26A 4AEQA 2RCDA 1SHVA 4NRWA 2Z7AA 1RU3A 3A46A 1JR3D 1MXOA 1O7PB 4RQ9A 3M2JA 3LVVA 1CF0A 2HOHA 4Z6YA 5D83A 1IK3A 3DZLA 1FUTA 3BLMA 4I3JA 4NETA 4JXJA 1YVSA 1FSWA 4E3KA 4L0LA 5FTNA 3HU3A 1TH4A 3K7CA 4HP4A 5DVAA 3GRVA 3JUQA 2VGJA 4H8RA 3WS0A 3O88A 4MMZB 2W56A 4KZ9A 2WKQA 1S4SA 2WZXA 1US1A 5IHVA 1Q864 1A2PA 4B7FA 1L2CA 1G02A 1NNJA 1K54A 2Q2EB 2HMNB 4LFCM 3NM7A 1Z5CA 3E4RA 1D6UA 3QK9A 3I563 4LJ7A 4KQDA 3FG4A 3WMDA 3FH1A 2AVXA 3FWLA 3KSFA 5DTSA 4QU3A 4WBGA 1JQJC 4PAUA 1IQ8A 5ELUA 9RNTA 3J80S 1VZZA 3IF6B 3I7JA 3GSPA 3F7XA 3O86A 2E2VA 2D7GA 1HU9A 3VP0A 3SBJA 1PZOA 1KVMA 3NHXA 5AJGA 3V3SA 3BYDA 2JWSA 1RGHA 3CGWA 3K3DA 1RCLA 1AVLA 3EN8A 1EWZA 1BUQA 2B02A 3JVCA 1X0OA 5HAIA 5IT5A 3IWIA 1IXZA 3LT9A 2C6WB 3SH7A 1IBLM 3UN7A 1PJSA 1NZUA 3SC3A 4L9FA 4GIPA 4P6BA 4K0XA 3R9XB 1GMQA 2F86B 3Q82A 1OHSA 5CXWA 4EBPA 4JF6A 1YLJA 3K9OA 1T43A 2R4JA 3BXWA 1NB5I 4IBDA 2OOAA 4I3IA 1IY2A 1U5OA 4K91A 3HHWA 2DWLA 5BVBA 3C3DA 2ZLYA 1K3WA 4I4KA 4IJGA 2ZM6M 5DF9A 3D72A 4IBIA 2HMOB 3A5EA 3FUVA 5EEOA 5CHJA 1NO1A 4K1VA 2AAEA 1NHGC 1NO3A 2JCHA 5E2EA 1C7HA 2P38A 1FGMA 3IMAB 1IYOA 2FNQA 3PYPA 3IS2A 4S2OA 1E25A 3PHYA 1LL5A 4HZBB 3QP1A 1VQO3 1FR6A 1IFYA 1BSAA 3CNMA 2AADA 4KZBA 2WGWB 4IBEA 3RGPA 2CMNA 4W5WA 3SATA 3TL4X 4L8RC 4WEKA 3OOVA 1BSDA 4GKJM 4II7A 2WAEA 3OCLA 4FW9A 2B18A 2RFRA 1ODVA 1OHPA 3ER7A 4E3OA 2DZLA 3LQQA 1JNQA 2QCUA 5HWTA 4LF8M 1LV7A 3DWZA 4IBXA 4XDWA 4I81A 2LQVA 4M0DA 3RDEA 1K82A 3PYJA 3T12B 2XRXB 5U47A 4P0MA 3PZWA 3H82A 3QYBA 4XBXA 2OLUA 1XNRM 1Z09A 3NOPC 3CD63 3AKZA 3MZEA 1ONGA 1JZDA 4IHQA 2I7NA 2D7HA 3BQ8A 4BWIA 1A67A 1FIKA 1E32A 4XK8F 2VIIA 4PCZA 4AKHA 3OZHA 1J7KA 1JN5A 4QHSA 1MPLA 3EB8A 4EXOA 5FTLA 3UNLA 2INWA 2UUAM 1G0TA 4NREA 2KEBA 3FZWA 3OPPA 1TGUA 5HL1A 4LMIA 1BNRA 1XX2A 3HREA 3HX3A 1WMNA 1NXYA 3FG3A 4DV5M 4EETB 1GO5A 3HHXA 1UCLA 4G4OA 2OCTA 4HL4A 3V39A 2K7SA 4DV0M 4QY5A 2BWBA 2CE7A 1V33A 4R9LA 5FTKA 5HX9A 3CMZA 1I3IA 1Q824 2A15A 2D01A 1KE3A 3T1SA 3IXDA 2UXDM 2K47A 4DN0A 2F5PA 4G3WA 3IX4A 4EW7A 1OFHA 4JI1M 1K55C 4F94A 4E6XA 1TP6A 3X3ZA 1D0LA 1UUGB 1X37A 1ISKA 1OIZA 2EWVA 4X6TA 3HVFA 1UW1A 3UJMA 3LCUA 1F4IA 2DI0A 3FD9A 3FF2A 3C4OA 1PWDA 3IBRA 4YINA 3UPNA 1W5TA 5CHMA 4R3AA 2FH0A 1BAOA 5KPRA 1OTEA 3FGYA 3OTOM 4YWZA 1IEMA 5JYOA 4HI4A 3IT9A 1I2SA 5JYPA 1T19A 3T4JA 4OKPA 1VETA 2OWPA 1G59A 1P97A 2JKTI 4BJPA 1BZAA 2C4BA 4JI6M 3K2LA 1NJFA 1RJOA 3UNWA 2ZM0A 4C6YA 5EP2A 4EV4A 2HP9A 3GLFA 1LQMB 1GS3A 3M6AA 1OUNA 2KXGA 1VQN3 1TEMA 4DJ2A 1N8R4 3L2AA 1R4CA 2UUBM 4XBYA 2DXIA 3O5YA 5IT9S 3CPTA 2HJ9C 3FUXA 1GY7A 2JHEA 1MGRA 1CK3A 1DGGA 1BGSA 4K1UA 5FI6A 2ZMFA 5GLAA 5HFOA 2ZQ7A 3GZRA 3K3CA 4X2OA 1KDSA 2VV7A 3VMAA 1SG9A 2Z2MB 1LNIA 1MKMA 3D3OA 1T6OA 3B42A 5EP4A 3UB9A 4BL2A 4O7DA 3IWOA 1TRPA 2M7UA 3T4KA 1IVUA 3GRDA 2W82A 1YT4A 2R18A 2PU4A 2W9QA 2EWWA 4MMNA 5E2FA 2WADA 5F68A 1L1TA 1RHLA 2HP5A 3AGFA 2CW9A 1EFUB 4EWFA 5FAPA 1GL7A 1H6UA 1MNLA 4M3KA 1N9JA 4IJFA 4BTXA 2Z8YM 1KSIA 5ITXE 2L7IA 4HM2B 1WMOA 4D60A 2DENA 1LOVA 1OMEA 2A5YB 4R1KA 3E2LA 4OOMA 1XJ4A 3EWKA 1IYQA 4RBNA 4X1MA 3ZG5A 4FWHA 4Y0OA 4HBUA 1N4OA 4Y15A 3ZVWA 2HMJB 5AQ9A 1S5AA 2W56B 3D5IA 4ORLA 2GXFA 1IV9A 5L07A 4M9ZA 4R6LA 3FE3A 2SARA 4PM6A 3UMEA 1FGRA 3K1JA 8CHOA 1Q3CA 2ZQDA 1Q39A 4AW4A 4LFBM 4PEJA 1HVBA 4ZBEA 1FGTA 1GY5A 4XB5A 1ES4A 1OT6A 3BFCA 1RDSA 1WHCA 1ERMA 2HP6A 4Q53A 5A90A 3MKEA 3TJZC 4I5QA 3M7GA 1OH0A 3FKAA 2QYBA 1IBMM 5IZ7D 2YQZA 2KZSA 5EP3A 2KLIA 2OLVA 1J5EM 2MJ5B 3GPYA 1L1ZA 1JBSA 1UUVB 2EXBA 2ZAMA 2H5SA 4JV5M 1CI8A 3NY4A 4N6LA 3U6PA 5FQ9A 4CJ6A 5AQBA 1F8NA 2Z6DA 2F4YA 4B08A 3FLJA 3FPVA 1RNBA 2P5TA 4BLCA 3BQAA 4DF6A 1A5TA 4NPBA 2Y0TA 3UZUA 5AVEA 4ZJ1A 3WS2A 3SOYA 2ZC3B 3AOGA 5JI2E 1LL8A 2Y2JA 5EQTA 2MR9A 2F5QA 2Y20A 3GRYA 1ASKA 1IY0A 4D80A 3U97A 1BUJA 2L4RA 1FYSA 1MZUA 4NEED 5CXOA 2GEYA 5FQKA 4AI6A 2UGIA 3LYGA 5GSPA 1S6RA 4B7HA 2KX6A 2ZBBA 1DGBA 1SIIA 3N8SA 1PGYA 2XSHB 2PBYA 1L2DA 3FTFA 2ZC6B 2CWUA 4CDLA 5FTMA 2V0UA 4HOHA 2FE8A 2OWJA 3FC7A 2Y0QA 1R2YA 4WURA 1N77A 3U6EA 4H3UA 1BRIA 3MMHA 1PFLA 1J3WA 4QOZC 2WO0A 4JI4M 3T4SA 4JF4A 3U6QA 3CPOA 1PJQA 1OACA 1T1AA 2JKFA 3IS2B 4X55A 3V50A 3A3FA 4GHAA 3OBFA 3L29A 1MBLA 3BFEA 2HAKA 3GZBA 3HWSA 4NSOB 4O02B 1I0VA 3ICYA 3SVAA 4R7GA 2P0MA 3J7Yd 2DNAA 3MG1A 4F3LB 1ACFA 3I01M 3G2YA 4ZJ2A 4LF5M 3SHGB 3ZG7B 4RYEA 2JZ0A 4N1HA 4Y17A 4MDZA 3S4XA 3IX8A 4AG5A 4B3MM 4QHTA 1T3BA 2DHYA 4STDA 3LQRA 3G713 3H82B 5HW3A 5J8XA 2PRFA 1QZEA 2UV0E 2Y2PA 3B3XA 2JQ5A 1BOXA 1XGJA 2W0NA 4BBTA 3EBTA 3GMWA 3MHVC 2VGKA 3DTKA 5G1LA 2R6FA 4RNTA 4LF4M 2WOHA 1JN5B 1MN3A 4DR4M 4MBFA 1GA9A 3WRZA 4I5SA 1IQPA 2CFWA 2J8XB 1QANA 2WGOA 4D2OA 3S27A 3LI9A 5G4ZA 3NQZA 3VLFB 3T15A 2JDIH 3VF1A 1XFNA 4GDBA 2YFJB 1IXRC 2GEXA 5IG5A 5BPVA 3B89A 2X71A 4DMZA 5DFYA 4WMCA 1QAFA 2JA2A 3U6CA 2VLGA 4O8SA 3KS8A 3GP1A 5EOOA 1KWIA 1GYBA 1T1CA 2M5ZA 4EIWA 2QJ7A 5A92A 1J09A 3JUOA 4ILFA 4JI7M 3OPRA 4EQ1A 1Q42A 3CC43 2CH9A 4GSPA 1YUBA 4RA7A 4X69A 3UMDA 5EP1A 3HU1A 3ILKA 3OV4A 3P98A 3DTIA 4R0QA 1MC0A 1W5ZA 2H0YA 2KDLA 1FGOA 1N75A 4O8GA 1HKXA 3PS8A 1MKIA 3KOYE 3NOTC 5HAPA 2C99A 1VQK3 4OPQA 2JKRI 3L26A 3GQ3A 1VQM3 3X41A 4MGYE 1G28A 3HJKA 2KNZA 2LYXA 2J80A 3GLFB 4E3MA 2X4AA 4ITQA 3CXC2 5HGRA 1VHMA 2JKTM 1Q02A 1LSWA 2K31A 2B3TA 2GSPA 2CX0A 3CPTB 1BULA 1XNQM 3JVUA 1IT8A 3HLGA 2GBXB 3L9KA 1W8YA 2O9CA 4LJ6A 3BNEA 3P09A 4AZFA 2M60A 1IT7A 6STDA 4D82A 5DREA 1YJ93 3H4MA 2B5RA 1SCWA 4KG5A 3BIRA 3EBYA 4KT0F 4FCTA 1PJTA 4AKYA 4Y0TA 2INXA 1BLCA 2YFQA 4CPKA 2CX1A 1KC84 3DA1A 2GBWB 2WGIA 4X56A 1ZMUA 5GHYA 1OTDA 3R4KA 3AGDA 3D3LA 3IPTA 2L4EA 3I553 2XQZA 2FNAA 1LOWA 1WTHA 4QWTA 2QJ5A 5CEDA 2G2WA 3BWLA 2KNVA 1JB4A 2W1TA 5L8MA 3A98B 1IV7A 4HYZA 4DBGB 5KP1A 2OAP1 3KSHA 4JXSA 5FL3A 3C7VA 3CLOA 3IXHA 1OGZA 4KT3B 3SOIA 4GC9A 2CFGA 1F5MA 5EQLA 1FILA 3OC2A 4UEYA 1H0MA 3I51A 2O9BA 4DV3M 5LMNM 1W02A 2MH8A 3T38A 1T2HA 3NECA 1OHOA 3QWLA 2C5RA 1VQ73 3E98A 1O7HB 1BVSA 3HLFA 3CCE3 1G4AE 3UPOA 3Q81A 3KOXE 1SQWA 1BANA 1LSVA 4QOSA 2IWCA 3IHBA 3C58A 3AFHA 3VGNA 3LCVB 2OQEC 1QMAA 5L09A 1OGXA 4OQIA 3IBJA 2YKHA 1C54A 2MJ6A 3GLHE 4AFIA 1VQ83 1IN8A 4HM8B 1DY6A 4FMCA 3F1OA 5FLXS 4QJGA 2V1LA 5FQIA 3SEDA 3DMCA 5KP3A 3PTEA 3P7NA 3WR2A 2C10A 1AWIA 3N4IA 4WYYA 4LZIA 2EFUA 3F7SA 4OW0A 4MN5A 2IA2A 4DUYM 2HF6A 4PKYA 3D4AA 4PDIA 4R71A 2V8FA 1YIJ3 2HGVA 2R44A 4MCWA 3J7AS 4JI5M 1KVLA 1KGFA 1PW8A 2V1UA 1LXEA 3C2WA 3CC23 1VQQA 3MQ0A 4L16A 1XMOM 2Q07A 3A3IA 4OPYA 3DM8A 1YVBI 1VM1A 5TBMA 1H8MA 3HUOA 4RF1A 1HT2E 1RGYA 1FQGA 1M1K4 1A2KA 3TQSA 3IF5A 1B21A 1EEJA 1NU3A 1YGEA 3O8YA 2F5SA 2LVNC 2W0QA 4IPBA 3PXGA 5G1KA 1CEGA 2KCDA 3KVWA 4FD8A 3FYDA 2BMRB 2ZQ8A 3K8ZA 4I4LA 2KXEA 1V74A 3LZAA 3AMOA 5EOEA 2K0MA 4L9EA 1IBKM 1KYIA 5CECA 2K0BX 4OPRA 3ZDJA 3LVWA 1H3QA 1EUIC 4MMXB 4F1IA 3GECA 4GHLA 3TOIA 2ZTDA 1IKIA 4KQRA 4UA6A 2O3OA 1XB2B 2RGHA 1RMSA 1EI5A 1GVNA 5DFXA 3KSGA 2Y73A 1G41A 4GKKM 2OOLA 3T4QA 3U1WA 1HNZM 1B3SA 4ZRRA 4IBCA 2P9VA 5L2FA 3GQZA 2IA7A 4NRVA 4RF0A 1QMEA 3V98A 1KSFX 2QWSA 4JI8M 2OTL3 1F98A 4UQIS 1IDPA 1NWZA 3UB8A 1K55A 2Y2NA 1BNGA 1T2IA 3GRRA 3WDGB 2V8CA 3LTBA 3EN1B 5AQ7A 2OOBA 3U5ZB 3G35A 3VDUA 4L7KA 2EJSA 1ZS7A 1Q2QA 5TFQA 3VDPA 3TG9A 2W04A 2Z4RA 3BNCA 1NRJA 2BIRA 1VQP3 4GMQA 3EIHA 3J27B 2GNOA 3B7CA 3HY5A 4FCMA 4K61A 2HDRA 4J5GA 3PBRA 4BMWA 2Z4SA 3PR6A 3MSOA 1E3VA 2DAEA 4JF8A 1GOYA 2H0TA 5EVLA 5FDHA 1WA9A 3Q1CA 1XMQM 4WF0A 3UDIA 1GA0A 5ITTA 3G34A 4LJ4A 5J4EA 5A2QS 1E3RA 1W63M 1DP6A 1YLPA 4QHCA 3N8BA 2ZTCA 1BSCA 4HQAA 1W4NA 1YLAA 3DXOA 1PW1A 3ZQJA 1G3IA 2E2UA 3IJEB 3KO6A 1BNIA 1I2GA 4KZAA 2R0IA 4CJNA 1TJDA 5FA7A 1GY6A 2H5XA 2F99A 5BU4A 1YHQ3 2RNTA 3M2KA 8CATA 3IXGA 2W3EA 1PIOA 3SX1A 4IVKA 4P85A 5IF6A 5KQ8A 2O9UX 5HDDA 2XH9A 4JXWA 4DV7M 4LV0A 4HM5B 2CHCA 1IKGA 1K6RA 5FQMA 5DYIA 3H4JA 2R65A 3D5GA 3LTDA 1YSQA 5FSWA 1D0MA 2W03A 3WS4A 1K6SA 3A0RA 2LBCA 1IVXA 4JYAM 3MG2A 1WYBA 5CTNA 4MN6A 2JNHA 5F69A 4WWUC 3TRCA 4OQHA 1D7EA 2J3TD 4LYLB 4M4XA 1N8QA 4XBTA 1G6OA 3ISGA 3WRTA 2F4VM 4R80A 1M40A 1NVMA 2CG0A 2G3QA 1TDZA 1HZOA 1NJ4A 2J8YA 1ZMVA 1VQ1A 2D7EA 2D1WA 1BYWA 2JKRM 3GLIE 1MY8A 2J3TC 4BIRA 1AV4A 4LJAA 1TTOA 3LR5A 1I5QA 3A76A 3SASA 1DE3A 2C98A 4LJ5A 3A3JA 2JC7A 3JAMS 3MFXA 3IHAA 4WZ5A 4HJ3A 3RJUA 1GOUA 4JI0M 4FD2A 2XD1A 4GITA 3VSYA 3JR4A 4DR6M 1XA7A 3UE1A 3AJIB 2HDSA 2Q0OA 2XFSA 1E3UD 1M6KA 3VOZA 1JB5A 4HAAA 4OP5A 1UUWB 4EESA 1S3SA 3DAVA 1MJGM 1G71A 3TE6A 1HQCA 1B2MA 1HTZA 4DJ3A 3U6OA 4HLQA 2JE5A 2BASA 2V1ZA 4JGQA 3X40A 1XGIA 3HKPA 4MBKA 1XWIA 4X64M 1D1JA 3MBZA 3T8UA 4X1LA 2CWVA 1B20A 2H0GA 3H51A 2BWEA 3FUTA 2W1TB 1FA3A 5FATA 4EC6A 1WR1B 3T1QB 1A0KA 1GMRA 2MROB 1MWRA 4HM1B 1R6BX 4MGIE 4GNUA 3NWLA 5IG4A 2EFXA 2DZOB 2VDBB 1S723 4CHTB 3VP1A 4TX4A 1YJW3 2XSZD 4BB9A 1GABA 4XGIA 4S2IA 1EROA 4PHTA 1I3FA 4M9XA 5AIGA 1ES2A 3GLHA 4LRTA 1GSXA 5E6JA 3GTCA 4DKIA 1NV9A 4LGWA 1NWWA 2Y21A 5L10A 4C3QA 2KDKA 1GD4A 3UE0A 2VK3A 1OJ5A 3FZCA 5EM0A 1NSFA 3AOEC 3GRJA 2LB5A 1N33M 3OPLA 3M6HA 3VK7A 3CCR3 4HESA 1M1XB 5RNTA 2Z76A 3KSPA 1V57A 1U60A 3F9SA 5F1GA 1KE0A 2Y2MA 3ZGAB 3SHFA 3GLGE 3DGNA 3B8LA 4LRYC 2NQ8C 2ZHXB 3T0UA 1YM1A 1D6YA 1DO2A 3IECA 2BNGA 1HNWM 3FSDA 5TGFA 1G5UA 4LRXC 5EJCA 4IJEA 3BNBA 1LVNA 2Y59A 1XFQA 4BTWA 1UWPX 2E8JA 3W4PA 2V9AA 1D0KA 2LVQD 4QNMA 1UI8A 3EEHA 4ETZA 1CQSA 4LG2A 4HZ9B 1KGGA 2HMMB 3TW8A 4FVMA 1JB2A 2VGLM 2NUPC 3B9PA 4A5RA 1F2KA 5KZHA 3BOSA 5EXPA 3U6LA 3AGEA 1OJLA 4OPZA 1IOUA 3RFWA 1AVKA 1E9RA 1O7GB 1VQ63 4U13A 4FCJA 2BO9B 3F92A 2Z2LB 5FSRA 2J7OA 5FAOA 1JJ22 1DETA 3KSXA 3BNDA 4FCWA 3ZQ5A 5TBMB 3CCV3 3C7UA 3S5CA 2DAIA 4GS9A 1I2WA 1YMXA 3FG1A 1I4WA 2Y2IA 3GR2A 1W2ZA 1PWCA 5DYGA 1HT1E 3EC9A 3NCKA 2WKRA 3HLBA 3DUKA 1GJTA 4M9SA 1SXJD 2QMIA 3SAWA 3HJSA 1RGFA 4XT2B 5E2HA 1OF5A 3AMOB 3FRIA 1T3TA 2OPFA 3LMLA 4N9KA 4X68A 2EX2A 1K4EA 2GQFA 4E3JA 1N9NA 1KDWA 5GHXA 2EKFA 1SXJC 4GD6A 5C1BA 3SS4A 2P74A 3L27A 3WA2X 2J7VA 3CHWP 2V1AA 1JWPA 2JN7A 5K5BA 4Z1WA 3ZG8B 2WKHA 1FCNA 1JZOA 4GH9A 4Y28F 1LOYA 1FSYA 3MJ5A 1TUHA 2W2CA 1WXQA 1K734 2GX5A 3TDGA 4EXRA 3OXAA 2LWXA 4KZ1A 4BD0A 2Q9MA 2Y55A 2DRWA 2VQFM 1O07A 1B27A 3EQVA 2KZUA 3T50A 2P9VB 1ZTUA 2A2LA 2Y4AA 3TWLA 1BNEA 4IT7A 1YLYA 5AIHA 1VB6A 1Y8GA 4PD2A 4LJ9A 3V5MA 3MF0A 1TR8A 5FQJA 4IBGA 4HBRA 1RCKA 4YNRA 1K3XA 1V9ZA 2M7OA 4IIWA 2XZUA 3VKHA 1D06A 4AG6A 1S66L 3CG5A 5HARA 5JPPA 4CLCC 3OLOA 4PT5A 5DKKA 5FDSA 4R3BA 2F5MA 3VP4A 2PZVA 2PR6A 4WUJA 1Y54A 3G4PA 1OCVA 4S2PA 4L15A 1O7EA 4PM9A 1YQSA 2C5WB 1MWSA 2Y2QA 3LEQA 1PY3A 5DNYA 4IBKA 5EVIA 2LVPC 3C8CA 3AGNA 3QP4A 5BXQA 3WWXA 2JBFA 1PZPA 1M9GA 4LF6M 3FKEA 5C5KA 2PNCA 1RNTA 4AKIA 3B47A 2LH0A 3ITBA 3IXBA 4MBHA 3VKGA 1OAOC 7STDA 1W5DA 1OQYA 1ZGXA 1KGEA 3DFZA 3BRMA 3FF0A 3QP5A 4LV2A 4H61A 1MU5A 1V9YA 4BBVA 3CAXA 3K9MC 2BG1A 3U60A 4WZ5C 4Q8IA 1T1BA 4R23A 1RTUA 4FTXA 3V3RA 3GLIA 1XA1A 3N8RA 4G3OA 2FZ0A 1GHIA 1UWNX 1KOUA 5F82A 3RH8B 1QYRA 1W7FA 4MEIA 4HJ6A 2OO9A 3I4VA 5CF2A 4Y2FA 2D42A 2P08A 3UE3A 3S7OA 1FW7A 4KZ4A 1I8VA 6GSPA 1TS6A 3MKFA 4LFUA 3SH9A 4BD1A 1N9EA 1PYLA 2WZJA 2YKFA 2QKPA 3L25A 3B74A 5ITYA 4X53A 3MQQA 4WM9A 3C3EA 4JI2M 1TS7A 2XA7M 4HEFA 1K9M4 4L4UA 3LEZA 5IS1A 3B7NA 5EECA 5HL6A 4GEWA 2CV0A 4S2NA 3GZYB 4FMBA 1SKOA 2XLNA 2OSUA 2QGUA 3RE8A 3TPZA 2IYJA 1STZA 3FKWA 1ERQA 4QWOA 1JKGA 5H37D 1L2SA 1FGQA 2LVOC 4H6JA 1ZG6A 3IH8A 2BJWA 2B1XB 3PBSA 4R4KA 2O9AA 1GSPA 3BJNA 1RGZA 2UXBM 4NXMM 2OQEA 2VKSA 4GW9A 4DR7M 4WLAA 2GJ3A 5KP4A 4DR1M 5IG0A 2GZAA 4B3SM 5F1FA 3MXQA 2XGLA 3HI7A 2ZQAA 4KQQA 1NY6A 4JXGA 1IQYA 1X1WA 3KFQC 1QVF2 2KW0A 4KFFA 5DKLA 5E2GA 3EJVA 4EEUA 5EPHA 3GLGA 1DMNA 3NBJA 4NHFA 2UUCM 1YIT3 3KP1E 3GLHB 2UXCM 3BM6A 3T8NA 4LFAM 4A3VB 2KRTA 1IQXA 4RNAA 1YGWA 3KIIA 1TDLA 4GHOA 3BFFA 4ZTKA 1CJFA 1QUSA 3DWKA 2K3DA 5HDCA 4LCMA 4R3DA 3LTCA 3M8CA 3HLEA 4R1GA 5CTMA 2KF3A 1OTAA 5KMWA 1PRBA 4HM3B 3C5AA 1UGHI 3VOYA 4EERA 1MGWA 1ULIB 3LMMA 5AIIA 3RNTA 4GRIA 4E3NA 3SAVA 3HBRA 2EX8A 1NHWC 4HKVB 1NDOB 3FTEA 3K2NA 2G2UA 4R70A 3HK4A 4ARZA 3ECFA 1RGCA 3T1YM 1WNHA 2PYPA 2XSSA 3RXWA 4DE2A 2HHHM 4OX9M 3NV0A 3RGAA 4DDYA 3UB7A 5C18A 1N5HA 4G6ZA 3OPHA 1RRLA 3F1NA 1K25A 4S2JA 5FEFA 1HZ1A 3U2AA 1YKDA 3L7HA 1BSBA 1YLTA 4P6ZM 4ZM8A 1X1YA 4OH0A 2ZC5B 5M18A 4OUQA 2XGNA 1QALA 1L0EA 1IXSA 2QBYA 4XUZA 1D2NA 5CERA 4ZDXA 1HJPA 4N6NB 3A3DA 2OTJ3 1W5SA 1A2VA 2I9VA 3E9SA 1L8QA 3LR0A 1VQ53 3B33A 2PU2A 4GS9B 4PM8A 1AR0A 1MWTA 3HJ8A 2BTFP 2Y74A 3WHOA 3NQYA 2L2DA 1SXJE 4EBGA 2UWXA 3EEAA 4HY8A 3FTCA 4RVAA 3E21A 4HM6B 2WGVA 3DGOA 1LTMA 2ZMVA 5F5YA 2J7NA 3KSJA 1ULJB 4WELA 1TF0B 4EYCA 4KFEA 1SIHA 3NIAA 3T4OA 3QP8A 3BW6A 2JUJA 1LNHA 3HIGA 2QP9X 5FW5A 3LOYA 1B2XA 3BU4A 1XP4A 4N92A 1WGLA 1PFPA 3Q8GA 4XM4A 5EVID 1NYMA 3BLSA 2OWHA 2WYXA 3K92A 3EOIA 1TDHA 3MSHA 4Y13A 2PHYA 2XR8B 3MS6A 4JBFA 4JXVA 1VETB 3SARA 1GCEA 1QDTA 2W3DA 3FTDA 2YFLB 1JV2B 2WKEA 3MWZA 3U4LP 5EVIC 1U8CB 4PM7A 5GL9A 3F14A 2WUQA 4N9LA 1CEFA 4R38A 4FMDA 1NB3I 2W27A 3SS3A 2QHOB 4CLCE 1RGGA 2A49A 3X3XA 1BRHA 3G16A 3LUQA 3AGOA 2VA0A 3JVVA 2XK1A 5TR7A 1K41A 4FOFA 4ME4A 1OPYA 1TFKA 2JY8A 4CISA 3KE7A 1TDGA 2ZOHA 3BLZA 2L6OA 3BFDA 5EVHA 2L7HA 1HNXM 1IN4A 5HOHA 3R8FA 2KAAA 3W4OA 3VFFA 2YFIB 3G0KA 3IF6A 2A3UA 1VDDA 3CCL3 4DRTA 4NC6A 3VSKA 5TGNA 4I38A 1BRGA 2M7VA 4HBTA 4GC5A 3SS5A 3GSGA 3GV9A 3LIAA 3Q7VA 5E43A 3WHLA 1KD14 3F1PA 3C38A 3WHKA 3BECA 4WZ4A 2VF8A 5CGSA 3AV0A 1K28A 2Y8HA 4WYKA 3SMSA 3LICA 1BIRA 4NOOB 1TS0A 2L4FA 3V92A 5GKNA 2C96A 1OTRA 4RNZA 4Y7PA 3BFGA 3CF2A 5CK6A 5DJUA 2H1RA 4RX2A 2CFOA 4DUZM 3HLDA 1N34M 2QIYA 3TWMA 1JBRA 2X01A 1VEGA 1NZOA 3THGA 3U60B 4S2NC 1WYCA 1YJN3 2ZM2A 4K0WA 2H0HA 3GPPA 1DGFA 1CEWI 1GHPA 1SDNA 3NM2A 2R78A 3GLIB 2E2TA 2HMKB 5IREB 8RNTA 4K0KM 3UB6A 3K63A 1E4DA 1Q7Y4 1LSXA 3MQOA 2XR0A 1VDLA 1IYPA 1RP5A 2ZM8A 1R2ZA 3DTMA 3H7WA 3AHWA 2GNXA 4F2LA 2E8IA 1I94M 3Q90A 2P09A 1E3UA 3RTYA 5DFLA 3V76A 1BRKA 3CC73 3I0YA 1Q3BA 2FS1A 1Z5AA 4S2MA 1S1YA 3W0FA 4B88A 2B24B 2V20A 2OV5A 4L8OA 1DJBA 1XJ3A 1M904 1AXBA 3G6E3 2ZQCA 3PAEA 1VEJA 1TIJA 5KIZA 4BTYA 1RLSA 3A3EA 4OVZA 1CYVA 1SKOB 2W3GA 3FYZA 3KXEC 3UMMA 2CV2A 3MG3A 3V99A 1IYYA 2XSZA 4WN5A 3OWSA 2EUCA 4NSRA 1JKGB 3AOEA 1RGAA 1O7MB 2PD8A 4KZ5A 1OPXA 1OIPA 3UL6A 4DV1M 2WKIA 4YHHM 4LV1A 2RL3A 3QNCA 5AYSC 3KYZA 5CX7A 4EBLA 4G3VA 1P3QQ 3IWQA 1FCOA 2Y2GA 1L0DA 4GB7A 1RKYA 1Q814 1CH0A 1PRQA 3MFDA 4HVNA 2H10A 1OJGA 3O3VA 2EKKA 1QQWA 2VZWA 4JF5A 3M0EA 3HUNA 4ZAMA 4TUWA 4GDNA 1TS8A 1N78A 2CFDA 1ZKJA 1LL9A 3EIEA 2XDMA 1LT0A 1E9SA 1QMFA 1BRSA 1QJGA 4LCBA 3ROBA 3W4QA 3GLGB 3OW22 1EQKA 1UCJA 2XFTA 3ZG9B 2ZAOA 3SXXA 3HZJA 2KF6A 4DXBA 2K9DA 3MMPA 2X49A 4HIAA 1E94E 1VEUA 3HU2A 5STDA 3PXMA 4M0WA 3MHEA 4BL3A 5CF1A 4BBUA 2GU1A 5LBRA 3DH2A 3OWYA 3PNVA 2DNSA 1BU4A 1LLBA 4N6MA 2K6BA 3EGXC 3PGBA 4WHAA 2CRUA 1DP9A 4RKUF 4JRFA 3U61A 1DO0A 2EX9A 4N6OB 3C30A 5FAQA 2DKLA 3PBNA 3F40A 1N9BA 4MH0E 4FCZA 4ARZB 3CF0A 1W7CA 4KUOA 4EUVA 4KFDA 3NV0B 5HDSA 3KKGA 3IQAA 1ZV1A 2PAVP 2QZ4A 3PBQA 5LC7A 4KODA 2QQ8A 1YNVX 1QAQA 4IIAA 5I94A 5KSCA 3F1NB 2F5WA 4N1XA 4N6TA 2JZ1A 1V58A 3E4PA 3BEBA 1SXJA 2BHMA 3DGMA 2O0YA 1G96A 2K54A 3V67A 5IERA 3E2KA 4UA9A 3GO8A 2CHGA 1DMQA 3AHSA 1HD8A 5F83A 4KZ7A 4G4RA 1PWGA 4JLFA 4EQIA 1IXSB 2QBYB 1S4RA 5IENA 3ULFA 1Q40A 3U6SA 1K38A 1L3LA 5FQQA 4X2HA 3KOWE 3FUWA 4REZA 2FGTA 4NG2A 3QRDA 4DR5M 5EV0A 4B4ZA 1FUSA 4E3LA 1BSEA 4K08A 2CC3A 3WOFB 1PI4A 2UUGC 3SLUA 2CFKA 3K5TA 1H8ZA 4Q7JA 4HM7B 3SAUA 1NV8A 1IU7A 2ML5A 5IU1A 2HKJA 1B2SA 3J7BA 4DV4M 1UFZA 4CLCA 4HH3A 4YOFA 3KOZE 4PKYG 5A91A 2RKOA 3QP2A 3GVBA 1QUTA 1DP8A 4IUKA 1TH2A 3IF6C 1GKIA 3EE1A 4RZMA 1ESIA 4QPRA 3G30A 4LGYA 5DTTA 3IX3A 4IBJA 5CGWA 2L1MA 2JKGA 3KYEA 3CCJ3 7GSPA 2V6ZM 2R4IA 3OX9A 1WE4A 3VV4A 1RN7A 2Z3XA 4C75A 4S12A 1DV0A 3D8LA 3FKVA 1JTGA 3LH4A 3UB1A 1PJJA 1W6CA 5AEWB 5JBSA 2LTUA 1MX0A 1PYYA 2EXAA 2X8AA 2XA7S 4EUZA 5J7EA 4FR9A 2JY6B 1JRQA 5HZHA 2WZZA 3VP3A 4CIZA 4BLMA 2I72A 2R9WA 4ZJ3A 3S29A 2QSFX 5M1AA 2DVWB 1N9OA 1T18A 4LZZA 2WAFA 3A42A 3Q7VB 1FOFA 2RBIA 2DCFA 3MZDA 1W2B2 3HLCA 3F1PB 5CLKA 4WP5A 2IUKA 3D79A 3GPXA 2PBDP 1JB0F 3NBBA 4WYKB 2HDUA 1FCMA 1EKMA 3W0LB 2Y2OA 4U3TA 3SW1A 1PJIA 3K0ZA 1GMPA 5EFWA 2WGQA 3TSGA 3VK8A 2C9CA 3H3HA 4L8PA 3JYIA 3KSIA 2VQEM 1TFOA 1Z6FA 3KDSE 2ZMAA 3VE4A 2RGQA 3DTEA 1QZMA 4UAAA 1D6ZA 2CHQA 3ZNTA 1Q2PA 2J3WA 3M6BA 3T4TA 5FASA 3ZFZA 1ALQA 2PT7A 4MMYB 2ZL1A 1DMMA 4JN6A 1OAIA 3CCM3 1RSNA 4Y3IA 3VFDA 2RSXA 4G4QA 1NLZA 2KOIA 2ZC7A 2DMWA 2JY7A 1NYYA 2OOVA 3LIBA 2ZQ9A 4GZBA 4NKPA 3NXJA 3H7WB 4LRSA 3ZC7B 4U0TA 4X65M 4GLQA 3DOAA 3Q3FA 4ANRA 4OP8A 2P7JA 2R41A 1FUWA 1ZX2A 3MJQA 1ZHHB 3IHPA 5IW9A 3VE3A 4Q0IA 3JUPA 3F1OB 4J8TA 1DVDA 2WSFF 3LGOA 4WL9A 1JWVA 4E3IA
chains in the Genus database with same CATH topology
3GWRA 4EBNA 5I97A 4OVZB 4EV5A 5GLDA 4Y0UA 1WQLB 3D4FA 5FGOA 4QY6A 2R62A 2CFLA 1BT5A 3HUMA 1XXMA 3WS1A 2C9OA 3IG5A 5D82A 5DF8A 1XHBA 3LO7A 3MKIA 3B4PA 3EQQB 3MPHA 4KG6A 2R4EA 4FWGA 4WFOA 4MEZA 1ZG4A 3J81S 1BLHA 1K56A 1NJI4 4NL4H 5DF7A 1UI7A 3NDEA 3GZXB 3FUUA 2Y2KA 3GQ4A 1QAOA 5D3OA 4JKTA 3JUMA 2MF7A 2DZNB 3LT8A 5IG3A 3S67A 4GOGA 1YI23 3KS4A 1O7WB 4HM4B 3CCS3 1L0GA 3EX9A 2V1CA 4IVIA 1RRHA 5ELJA 1QVG2 4U0XA 1IELA 3CPW2 2O5RA 5EXXA 4LV3A 3ZCBB 4FMAA 4YY3M 1Z1SA 4XXRA 2HCBA 1LI0A 3UGJA 2QA43 1ZC2A 4G1MB 4GB5A 2RGOA 2CC1A 3SFZA 3HHYA 1N32M 3DZDA 1W6GA 1ES3A 4P87A 3CME3 2IMJA 3U61B 4MB7A 3CTWB 2IWBA 3SH8A 5ITRA 2CEAA 4KG2A 2HL7A 2FFYA 3C4PA 4OQ0A 1ONHA 4JPMA 4KENB 2ZD8A 1YLZA 3DY5A 4G4NA 1SXJB 4R4SA 2G5GX 3NBLA 2EA0A 4DXCA 1QAKA 3F8XA 2R46A 4QD4A 4K90B 1Q40B 2CWTA 3N6IA 1IM2A 3LY3A 5KPTA 2P0XA 1YE9A 2V2FF 1GLNA 2LXEA 3QHYA 3NI9A 1EE8A 1NRFA 2IUJA 2XEPA 3WA3A 3DW0A 2YNMD 4X66M 1E97A 1A90A 1VQ93 1K54C 5EXTA 1TU5A 1L5GB 3UPPA 4O2HA 4BQMA 3I4YA 4AKGA 1VQ43 2X02A 3NBRA 1BLSA 2CKFB 1LHYA 2QENA 2ZANA 3GRUA 4LJ8A 5EE8A 4FSFA 1W79A 2HDQA 3ZCZA 2HMLB 1XPBA 2BMOB 2C11A 4UA7A 3NC8A 5LC6A 3LCEA 4PM5A 1IYSA 1O7NB 1W8QA 4KHPM 5FTJA 5CRFA 1JWZA 3NUVA 3BB9A 4GD8A 1Y4KA 1SPUA 5ITUA 1HQYE 1LOXA 2L4VA 1DJAA 1K57A 1YMSA 2Y2LA 1R7RA 4WW0A 3WS5A 2MC8A 4ZPXA 1DJCA 1STDA 2F98A 4J9AA 3MYTA 4DE1A 4OOYA 3HLWA 4MM3B 2EX6A 5JI3E 3CCQ3 4QB8A 1OFIA 4NXNM 1T5YA 3CU3A 4DV2M 3A45A 2BT3A 5BOHA 1JTDA 5DTKA 2OOVC 1Z5BA 3ALAA 5JPUA 4B4XA 3UL5A 4XUXA 1KE4A 4PDGA 4GN2A 3WODG 1QAMA 3KW6A 3ZG0A 4XDVA 2CK3H 4KZ3A 4KQOA 4LCLA 4LF9M 2KA6B 4IBBA 2G8LA 5AQAA 4S2LA 1FNNA 5G18A 5IWAM 3ITAA 4IBRA 2W9PA 2BNKA 2R9XA 3GQ5A 2FOIC 3RXXA 1DGHA 2YX9A 1QVRA 5KQDA 3U6DA 2ERCA 2KRUA 3UK6A 3RGSA 2ZL8A 4B7GA 1C1KA 4KVHA 5F3WA 1SDEA 1ROVA 4AKZA 1ESUA 1K56D 3T1HM 3PFIA 1GHMA 2ZBKB 3TWKA 3Q7ZA 2DHRA 3NX0A 4MJDA 5A93A 3VFHA 5AIFA 1NJGA 1SKFA 3PVSA 4AQYM 4GL6A 2QEX3 4LF7M 3KZTA 1TH3A 1JVJA 3CZDA 1KQS2 4I8OA 5AEUB 5CHUA 3X42A 4KZ8A 2FXTA 2CV1A 3SYKA 2QPAA 1YSYA 5IEOA 2OQ4A 1G68A 3PCSA 3UJNA 1STFI 4QNRA 1XC8A 1GD3A 3KN4A 1UM8A 2BLSA 4OVDA 1MWUA 3HZPA 2Z7JA 5FI2A 4FH2A 2F5NA 3E99A 3MXRA 1ES5A 3VP2A 4DR2M 2DWNA 2XSOB 2P05A 4OLDA 3EF8A 4LEHA 3U5ZA 3SMPA 1K8A4 4N6V0 4Z8XA 3CCU3 4P16A 3G32A 1L2BA 3PAGA 3VSLA 5FI7A 1OF5B 3S28A 1C3BA 3D9RA 4RNYA 1S0WA 1XXHA 1HR0M 1L0FA 3QNBA 1N36M 5LMUM 4KO8A 1WMPA 3HJQA 2L09A 4R3JA 4NK3A 3ZHHA 3OCNA 5IEPA 3PCRA 3OWUA 4RX3A 2UX0A 2J9OA 2Q9NA 3J2PB 7CATA 3JR5A 2SBLA 3RGRA 2CHVA 1FJGM 5GHZA 3MXSA 3DGLA 3ZVTA 4DDSA 1MOLA 4XBOA 2ZDJA 3WOEB 2CIUA 1PI5A 3Q1FA 1YLWA 4EV2A 3UDFA 1IY1A 1N5PA 3S22A 4IBFA 1GL6A 3STDA 4WEJA 3GPUA 3L28A 3S1YA 3HGIA 4PPRA 4N3VA 4BBAA 4N6UA 4B3RM 4OU7A 5EVIB 4MGKE 2DWMA 4OK0A 4DE0A 1JR3A 2ZC4B 4MNRA 1EA2A 4HM0B 1IVVA 1K4FA 1K57C 5ITXA 3AL0C 2J9PA 2QZ6A 4PMAA 3UO9A 2FFFB 1IN5A 3SOAA 4R4RA 3Q07A 4CGYB 5KO3A 4OLGA 3NBIA 3PNYA 4BENA 4LZJA 2LNHC 3CJMA 2STDA 3ZNYA 1G6AA 2R45A 1IVWA 4OOLA 2FFJA 1Z59A 2KRKA 3JUNA 1ZAEA 3G31A 4OVMA 4B3TM 4S2KA 2CUZA 4KLNA 2XLJA 3LXUX 3Q2PA 3NDGA 1Z6TA 3FV7A 2YR0A 2ML6A 1RCJA 4MGHA 3B4OA 2WGWA 5CEBA 3N9HA 4FCVA 1VQL3 2XZFA 3IG8A 1ZO2A 2F5OA 2BMQB 1PU4A 1TVFA 2GDNA 1NY5A 4MLLA 3UDXA 4FCFA 3UY6A 1W00A 2GU3A 4UHUA 2XD5A 3LY4A 2RCXA 5KSHA 4FWDA 1PM5A 1BUEA 4CCVA 3U6MA 1W6YA 2I9WA 3G8ZA 1W01A 3W8KA 2Y2HA 2EO2A 3X3YA 2W6JH 5EUAA 1SJWA 5DRVA 5EXSA 3F8HA 4HJLB 1IN7A 4LSOA 3IH9A 4O3VA 1J9MA 3KP0E 1DYUA 3G4S3 1ROAA 5GLBA 1DGHB 2CG1A 4DR3M 1BLPA 4IEDA 4OONA 1DVCA 2E5LM 2DWZB 1BSGA 1J2BA 3MZFA 5AI1A 1EG9B 1ORYB 1H5XA 3ZH9B 2QPNA 3PBOA 4X62M 4Z9QA 2AHMA 1KFVA 4KZ6A 2I7PA 2ZJ9A 2XF3A 4R9KA 2UU9M 1CYUA 4FH4A 2Y91A 3EHCA 3N7WA 4LENA 2BJVA 4LY6A 4GKUA 3N54B 5BR8M 3KFUG 2HPBA 2WK0A 3EQUA 3LTAA 5AYRB 3HIIA 4WMCD 3FYCA 3CMA3 5CGXA 4YFMA 3Q8XA 2IWDA 4ID4A 1FR1A 3CF6E 3CNXA 4D81A 5A0OB 4L78A 3KSED 4JI3M 5M19A 5D81A 1BTLA 3SYLA 1ZQ9A 3N8LA 1LI9A 3HL9A 3MK6A 2Z77A 1NY0A 3HHZA 3O87A 2WOFA 1NNUC 3PBTA 3D8BA 5ITQA 1XKZA 3HX8A 5KPZA 1IN6A 3G2ZA 4MGZE 4OQGA 3QAUA 5HAQA 5GLCA 4LGMA 5G2GA 2Z6BA 4DV6M 1G8PA 1H8YA 3FCSB 3L0RA 3GAXA 1XXHB 4LGQA 4DE3A 1CI9A 4E6WA 5E26A 4AEQA 2RCDA 1SHVA 4NRWA 2Z7AA 3A46A 1JR3D 1MXOA 1O7PB 3M2JA 3LVVA 4Z6YA 5D83A 1IK3A 3DZLA 3BLMA 4NETA 4E3KA 4JXJA 1FSWA 4L0LA 5FTNA 3HU3A 1TH4A 3K7CA 5DVAA 3GRVA 3JUQA 2VGJA 4H8RA 3WS0A 3O88A 4MMZB 2W56A 4KZ9A 2WZXA 1US1A 5IHVA 1Q864 4B7FA 1L2CA 1NNJA 1K54A 2Q2EB 2HMNB 4LFCM 3NM7A 1Z5CA 3E4RA 1D6UA 3QK9A 3I563 4LJ7A 3FG4A 3WMDA 3FH1A 3FWLA 5DTSA 4QU3A 4WBGA 1JQJC 1IQ8A 5ELUA 3J80S 1VZZA 3IF6B 3I7JA 3O86A 3F7XA 2E2VA 2D7GA 1HU9A 3VP0A 3SBJA 1PZOA 1KVMA 3NHXA 3V3SA 3BYDA 1AVLA 3EN8A 1EWZA 1BUQA 3JVCA 5HAIA 3IWIA 1IXZA 3LT9A 2C6WB 3SH7A 1IBLM 3UN7A 1NZUA 3SC3A 4P6BA 4GIPA 4K0XA 3R9XB 2F86B 5CXWA 3Q82A 1OHSA 4EBPA 4JF6A 1YLJA 2R4JA 1NB5I 4IBDA 1IY2A 1U5OA 4K91A 3HHWA 2DWLA 5BVBA 2ZLYA 1K3WA 4I4KA 2ZM6M 5DF9A 4IBIA 2HMOB 3FUVA 5EEOA 5CHJA 4K1VA 1NHGC 1NO3A 2JCHA 5E2EA 1C7HA 2P38A 1FGMA 3IMAB 1IYOA 2FNQA 4S2OA 1E25A 1LL5A 4HZBB 1VQO3 1FR6A 3CNMA 4KZBA 2WGWB 4IBEA 3RGPA 4W5WA 3SATA 3TL4X 4L8RC 4WEKA 4GKJM 4II7A 2WAEA 3OCLA 4FW9A 2RFRA 4E3OA 1OHPA 3ER7A 3LQQA 1JNQA 2QCUA 4LF8M 1LV7A 3DWZA 4IBXA 4XDWA 4I81A 2LQVA 4M0DA 3RDEA 1K82A 3PYJA 2XRXB 5U47A 4P0MA 3PZWA 4XBXA 2OLUA 1XNRM 3CD63 3AKZA 3MZEA 1ONGA 2I7NA 2D7HA 1A67A 1E32A 2VIIA 4PCZA 4AKHA 3OZHA 1J7KA 1JN5A 4QHSA 1MPLA 3EB8A 5FTLA 3UNLA 2UUAM 4NREA 2KEBA 3FZWA 3OPPA 1TGUA 5HL1A 4LMIA 1XX2A 3HREA 1WMNA 1NXYA 3FG3A 4DV5M 3HHXA 4G4OA 2OCTA 4HL4A 3V39A 4DV0M 4QY5A 2CE7A 4R9LA 5FTKA 5HX9A 3CMZA 1Q824 2A15A 1KE3A 3IXDA 2UXDM 2K47A 2F5PA 1OFHA 4JI1M 1K55C 4F94A 4E6XA 1TP6A 3X3ZA 1X37A 1ISKA 4X6TA 3HVFA 1UW1A 3UJMA 3FD9A 3FF2A 3C4OA 1PWDA 4YINA 3UPNA 1W5TA 5CHMA 5KPRA 3FGYA 3OTOM 1IEMA 5JYOA 3IT9A 1I2SA 5JYPA 4OKPA 2OWPA 1G59A 4BJPA 1BZAA 4JI6M 3K2LA 1NJFA 1RJOA 3UNWA 2ZM0A 4C6YA 5EP2A 4EV4A 2HP9A 3GLFA 1GS3A 3M6AA 1OUNA 2KXGA 1VQN3 1TEMA 1N8R4 3L2AA 1R4CA 2UUBM 4XBYA 2DXIA 5IT9S 3FUXA 1GY7A 1CK3A 1DGGA 5FI6A 4K1UA 5GLAA 5HFOA 2ZQ7A 3GZRA 4X2OA 1KDSA 3VMAA 2Z2MB 5EP4A 4O7DA 4BL2A 3IWOA 1IVUA 3GRDA 2W82A 1YT4A 2R18A 2PU4A 2W9QA 5E2FA 2WADA 4EWFA 1L1TA 2HP5A 3AGFA 2CW9A 5FAPA 1GL7A 1H6UA 1MNLA 4M3KA 1N9JA 4IJFA 4BTXA 1KSIA 5ITXE 2L7IA 4HM2B 1WMOA 1OMEA 2A5YB 4R1KA 3E2LA 4OOMA 1IYQA 4RBNA 3ZG5A 4FWHA 4Y0OA 4HBUA 1N4OA 3ZVWA 2HMJB 5AQ9A 1S5AA 2W56B 4ORLA 2GXFA 1IV9A 4M9ZA 4PM6A 1FGRA 3K1JA 8CHOA 1Q3CA 2ZQDA 1Q39A 4AW4A 4LFBM 4PEJA 1HVBA 4ZBEA 1FGTA 1GY5A 4XB5A 1ES4A 3BFCA 1ERMA 2HP6A 4Q53A 5A90A 3MKEA 3M7GA 1OH0A 3FKAA 1IBMM 5IZ7D 2YQZA 2KZSA 5EP3A 2OLVA 1J5EM 3GPYA 1L1ZA 1UUVB 2EXBA 2ZAMA 2H5SA 4JV5M 1CI8A 3NY4A 4N6LA 3U6PA 5FQ9A 5AQBA 1F8NA 4B08A 3FLJA 2P5TA 4BLCA 4DF6A 3WS2A 2Y0TA 3UZUA 4ZJ1A 3SOYA 2ZC3B 3AOGA 5JI2E 2Y2JA 5EQTA 2F5QA 2Y20A 3GRYA 1ASKA 1IY0A 4D80A 3U97A 5CXOA 2GEYA 5FQKA 4AI6A 3LYGA 1S6RA 4B7HA 1DGBA 1SIIA 3N8SA 2XSHB 2PBYA 1L2DA 3FTFA 2ZC6B 2CWUA 4CDLA 5FTMA 2FE8A 2Y0QA 1R2YA 4WURA 1N77A 3U6EA 4H3UA 4QOZC 2WO0A 4JI4M 4JF4A 3U6QA 3CPOA 1OACA 4X55A 3V50A 3A3FA 4GHAA 3L29A 1MBLA 3BFEA 3GZBA 3HWSA 4NSOB 4O02B 3SVAA 4R7GA 2P0MA 3J7Yd 3MG1A 3G2YA 4ZJ2A 4LF5M 3SHGB 3ZG7B 4RYEA 4N1HA 3S4XA 4AG5A 4B3MM 4QHTA 4STDA 3LQRA 3G713 5HW3A 5J8XA 2Y2PA 3B3XA 2JQ5A 1XGJA 3EBTA 3GMWA 3MHVC 2VGKA 4LF4M 2WOHA 1JN5B 4DR4M 4MBFA 1GA9A 3WRZA 4I5SA 1IQPA 2CFWA 1QANA 2WGOA 4D2OA 3S27A 3NQZA 3VLFB 3T15A 2JDIH 3VF1A 4GDBA 2YFJB 1IXRC 2GEXA 5IG5A 5BPVA 2X71A 4WMCA 1QAFA 2JA2A 3U6CA 4O8SA 3KS8A 3GP1A 5EOOA 1KWIA 1GYBA 2M5ZA 4EIWA 5A92A 1J09A 3JUOA 4JI7M 3OPRA 1Q42A 3CC43 2CH9A 4X69A 1YUBA 4RA7A 5EP1A 3HU1A 3ILKA 3OV4A 3P98A 4R0QA 1W5ZA 2H0YA 1FGOA 1N75A 1HKXA 3PS8A 1MKIA 3KOYE 5HAPA 2C99A 1VQK3 4OPQA 3L26A 3GQ3A 1VQM3 3X41A 4MGYE 2LYXA 3GLFB 4E3MA 2X4AA 4ITQA 3CXC2 5HGRA 1BULA 1XNQM 1IT8A 3HLGA 2GBXB 1W8YA 4LJ6A 3BNEA 3P09A 4AZFA 2M60A 1IT7A 6STDA 4D82A 5DREA 1YJ93 3H4MA 2B5RA 1SCWA 4KG5A 3EBYA 4FCTA 4AKYA 4Y0TA 2INXA 1BLCA 2YFQA 4CPKA 1KC84 3DA1A 2GBWB 2WGIA 4X56A 5GHYA 3AGDA 3D3LA 3IPTA 3I553 2XQZA 2FNAA 4QWTA 1WTHA 5CEDA 2G2WA 1JB4A 3A98B 1IV7A 4HYZA 5KP1A 4JXSA 3C7VA 3IXHA 1OGZA 3SOIA 4GC9A 2CFGA 5EQLA 3OC2A 3I51A 4DV3M 5LMNM 1W02A 3T38A 1OHOA 3QWLA 2C5RA 1VQ73 3HLFA 1O7HB 3CCE3 1G4AE 3UPOA 3Q81A 3KOXE 1SQWA 2IWCA 4QOSA 3IHBA 3C58A 3AFHA 3VGNA 2OQEC 1QMAA 1OGXA 4OQIA 1VQ83 1IN8A 4HM8B 1DY6A 4FMCA 5FLXS 4QJGA 2V1LA 5FQIA 3SEDA 3DMCA 5KP3A 3PTEA 2C10A 3N4IA 4WYYA 4LZIA 2EFUA 3F7SA 4OW0A 4DUYM 4PDIA 1YIJ3 3J7AS 4JI5M 1KVLA 1KGFA 1PW8A 2V1UA 1LXEA 3CC23 1VQQA 4L16A 1XMOM 2Q07A 3A3IA 4OPYA 3DM8A 1YVBI 1VM1A 3HUOA 4RF1A 1HT2E 1RGYA 1FQGA 1M1K4 1A2KA 3TQSA 3IF5A 1NU3A 1YGEA 3O8YA 2F5SA 2W0QA 4IPBA 3PXGA 1CEGA 2KCDA 3KVWA 4FD8A 3FYDA 2BMRB 2ZQ8A 3K8ZA 4I4LA 2KXEA 1V74A 3LZAA 3AMOA 5EOEA 2K0MA 1IBKM 1KYIA 5CECA 3ZDJA 4OPRA 3LVWA 4MMXB 4GHLA 3TOIA 1IKIA 4KQRA 4UA6A 2O3OA 2RGHA 1EI5A 1GVNA 2Y73A 1G41A 4GKKM 3U1WA 1HNZM 4IBCA 2P9VA 5L2FA 3GQZA 2IA7A 4NRVA 4RF0A 1QMEA 3V98A 1KSFX 4JI8M 2OTL3 1IDPA 1K55A 2Y2NA 3GRRA 3WDGB 3LTBA 3EN1B 5AQ7A 3U5ZB 3G35A 3VDUA 4L7KA 1Q2QA 5TFQA 3VDPA 3TG9A 2W04A 2Z4RA 3BNCA 1VQP3 4GMQA 3EIHA 3J27B 3B7CA 4K61A 4FCMA 2HDRA 3PBRA 2Z4SA 3MSOA 1E3VA 4JF8A 5FDHA 2H0TA 5EVLA 3Q1CA 1XMQM 3UDIA 1GA0A 5ITTA 3G34A 4LJ4A 5A2QS 1E3RA 1YLPA 4QHCA 3N8BA 1W4NA 3DXOA 1PW1A 3IJEB 1G3IA 2E2UA 4KZAA 5FA7A 4CJNA 1GY6A 1YHQ3 2F99A 3M2KA 8CATA 3IXGA 1PIOA 3SX1A 4IVKA 4P85A 5IF6A 5KQ8A 2O9UX 2XH9A 4JXWA 4DV7M 4LV0A 4HM5B 2CHCA 1IKGA 1K6RA 5FQMA 5DYIA 2R65A 3LTDA 5FSWA 2W03A 3WS4A 1K6SA 1IVXA 4JYAM 3MG2A 1WYBA 5CTNA 4WWUC 4OQHA 1N8QA 4XBTA 3ISGA 3WRTA 2F4VM 4R80A 1M40A 1NVMA 2CG0A 1TDZA 1HZOA 1NJ4A 2J8YA 2D7EA 2D1WA 1MY8A 1AV4A 4LJAA 1I5QA 3A76A 3SASA 2C98A 4LJ5A 3A3JA 2JC7A 3JAMS 3IHAA 4WZ5A 3RJUA 4JI0M 4FD2A 2XD1A 4GITA 3VSYA 3JR4A 4DR6M 1XA7A 3UE1A 3AJIB 2HDSA 2XFSA 1E3UD 1M6KA 3VOZA 1JB5A 4OP5A 1UUWB 1S3SA 3TE6A 1HQCA 1HTZA 3U6OA 4HLQA 2JE5A 2V1ZA 4MBKA 3X40A 1XGIA 3HKPA 1XWIA 4X64M 3MBZA 3T8UA 2CWVA 3H51A 3FUTA 1FA3A 5FATA 4EC6A 1MWRA 4HM1B 1R6BX 4MGIE 4GNUA 3NWLA 5IG4A 2EFXA 2DZOB 1S723 4CHTB 3VP1A 4TX4A 1YJW3 2XSZD 4BB9A 4XGIA 4S2IA 1EROA 5AIGA 4M9XA 1ES2A 3GLHA 4LRTA 5E6JA 3GTCA 4DKIA 1NWWA 2Y21A 4C3QA 1GD4A 3UE0A 3FZCA 1NSFA 3AOEC 3GRJA 1N33M 3OPLA 3M6HA 3VK7A 3CCR3 4HESA 1M1XB 2Z76A 3KSPA 1U60A 3ZGAB 3F9SA 5F1GA 1KE0A 2Y2MA 3SHFA 3DGNA 3B8LA 2NQ8C 3T0UA 1YM1A 1D6YA 1DO2A 2BNGA 1HNWM 3FSDA 5TGFA 5EJCA 4IJEA 3BNBA 1LVNA 2Y59A 4BTWA 3W4PA 4QNMA 1UI8A 1CQSA 4LG2A 4HZ9B 1KGGA 2HMMB 4FVMA 1JB2A 5KZHA 3B9PA 4A5RA 3BOSA 5EXPA 3U6LA 3AGEA 1OJLA 4OPZA 3RFWA 1AVKA 1E9RA 1O7GB 1VQ63 4U13A 4FCJA 2BO9B 2Z2LB 5FSRA 2J7OA 5FAOA 1JJ22 3KSXA 3BNDA 4FCWA 3CCV3 3C7UA 3S5CA 1I2WA 1YMXA 3FG1A 1I4WA 2Y2IA 3GR2A 1W2ZA 1PWCA 5DYGA 1HT1E 3EC9A 3NCKA 3HLBA 3DUKA 4M9SA 1SXJD 2QMIA 3SAWA 3HJSA 5E2HA 1OF5A 3AMOB 1T3TA 2OPFA 3LMLA 4N9KA 4X68A 2EX2A 1K4EA 4E3JA 1KDWA 5GHXA 1SXJC 4GD6A 5C1BA 3SS4A 2P74A 3L27A 3WA2X 2J7VA 1JWPA 3ZG8B 2WKHA 1FCNA 4GH9A 1FSYA 3MJ5A 1TUHA 2W2CA 1WXQA 1K734 3TDGA 4EXRA 3OXAA 2LWXA 4KZ1A 4BD0A 2Q9MA 2Y55A 2DRWA 2VQFM 1O07A 3EQVA 2KZUA 2P9VB 2Y4AA 3TWLA 4IT7A 1YLYA 5AIHA 4PD2A 4LJ9A 3V5MA 5FQJA 4IBGA 4HBRA 1K3XA 2M7OA 4IIWA 2XZUA 3VKHA 4AG6A 3CG5A 5HARA 5JPPA 4PT5A 4R3BA 3VP4A 2PZVA 1Y54A 3G4PA 1OCVA 4S2PA 4L15A 1O7EA 4PM9A 1YQSA 2C5WB 1MWSA 2Y2QA 5EVIA 5DNYA 4IBKA 5BXQA 3WWXA 2JBFA 1PZPA 1M9GA 4LF6M 3FKEA 2PNCA 4AKIA 2LH0A 3ITBA 3IXBA 4MBHA 3VKGA 7STDA 1W5DA 1KGEA 4LV2A 3DFZA 3BRMA 3FF0A 4H61A 1MU5A 3K9MC 2BG1A 3U60A 4WZ5C 4Q8IA 4R23A 3V3RA 3GLIA 1XA1A 3N8RA 1GHIA 5F82A 1QYRA 1W7FA 4MEIA 3I4VA 5CF2A 2D42A 3UE3A 4KZ4A 3MKFA 3SH9A 4BD1A 1N9EA 3L25A 5ITYA 4X53A 4WM9A 4JI2M 4HEFA 1K9M4 4L4UA 3LEZA