2KXEA

N-terminal domain of the dp1 subunit of an archaeal d-family dna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase II small subunit
publication title Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.800 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kxeA00
2KXEA
chains in the Genus database with same CATH superfamily
1UFZA 3NBIA 3L27A 1OTRA 1G8PA 2C96A 4LFAM 3ZC7B 1Z5CA 1T6OA 2G8LA 2ZAOA 1ORYB 3GLIE 2H1RA 2DAKA 5C1BA 1KSFX 3J27B 5JI3E 1VQ1A 3Q8XA 4DR7M 5EXTA 5ITYA 1IY1A 3ZQJA 4Z6YA 1YSYA 1GJTA 2R4JA 3A45A 4X65M 2LBCA 2OOBA 4HL4A 3B7ZA 4LRSA 3VLFB 2LWXA 5FTKA 4Y28F 3J81S 4TUWA 3AJIB 2RGOA 2Z4RA 3HJSA 2QQ8A 3TL4X 3QYBA 1HNWM 2L4FA 1Z6TA 4XGIA 3GLGB 1DV0A 4NC6A 4LJ6A 1TDZA 1SG9A 2DHYA 2R45A 3HJQA 1R6BX 2CE7A 2BJWA 3SAVA 1D0KA 1Z5BA 2Y20A 1J5EM 3GLFA 3KP1E 4M0WA 2EUCA 3KSJA 2J7OA 4LG2A 4OU7A 3WHKA 1PJIA 3NWLA 4I4LA 4DBGB 2CHQA 1R2YA 4L15A 2ZTCA 4LJ4A 1IXRC 4BLCA 2JA2A 1QUSA 4JXJA 4DR6M 1OJLA 3U6OA 3M7GA 4LY6A 2KXEA 3GRRA 1JB0F 1WIVA 4LCBA 3C3EA 2DAEA 3K2LA 2XZFA 4UN2B 1ZAEA 5E26A 1XMQM 3L25A 2M5ZA 4R71A 5EXPA 1RU3A 1IY0A 1IM2A 3U60A 4LF5M 5EJCA 1DGGA 4CHTB 4DV7M 2KNAA 4JV5M 3HZJA 1DGFA 2FS1A 2LNHC 2XFSA 2D7HA 2WSFF 1Q02A 3B89A 3Q8GA 4GITA 4FCVA 1ZMUA 3LMMA 3VDPA 3U6EA 3FUVA 4AKGA 3BXWA 4LZJA 2R65A 3AFHA 3VFDA 5DFLA 1SXJE 1TR8A 7CATA 4IBJA 3UMMA 3SHGB 1GABA 5C18A 3E46A 3CTWB 2LVQD 1QYRA 4YHHM 3U6DA 1KFVA 4PDIA 1IN4A 4LZZA 5FTLA 4G4OA 1FJGM 2DHRA 2KNVA 1SXJA 2DAMA 1GO5A 1HJPA 3B74A 3UJNA 3LVWA 3GPUA 1OKSA 2KDLA 3I01M 4OW0A 2VF7A 1OIPA 2KHHA 3F92A 2LTUA 3HGIA 2YFQA 2WZJA 5KPZA 3KOWE 3VK7A 2HCBA 1C1KA 1YLAA 4MGHA 1GKIA 1LV7A 1Q3BA 2DZLA 2KZSA 2CUZA 3FRIA 4FVMA 2O01F 4QNMA 2O5RA 2XSZA 4RF0A 3KW6A 4NRVA 1IBMM 2EJSA 3GPYA 4M9SA 2VDBB 3HHXA 5IWAM 4OX9M 4GC5A 1EIJA 4JI6M 2CFOA 3U5ZB 2XZUA 2RGHA 3PFIA 3TWKA 3AKZA 3A42A 2DXIA 4B3SM 4W5WA 1JR3E 2JY7A 1LTMA 1MU5A 4AG6A 1K3WA 1NY5A 3PNVA 1HQCA 2FE8A 3AOEC 4JI3M 2GNOA 1MN3A 5ITTA 3VDUA 2F5NA 4FW9A 4R7GA 1XNQM 3HU3A 1QAQA 2D7GA 5FTNA 3AL0C 5E6JA 1G71A 1NVMA 1VEJA 3W0LB 3KXEC 4AQYM 3FE3A 4JI8M 1PJJA 4MGKE 2MH8A 1I94M 3C9PA 3IECA 2HAKA 3H4JA 1DO2A 1A5TA 1EFUB 2KRUA 3I04M 3ILKA 3E4RA 4I5SA 4Z8XA 2LVPC 2NQ8C 3ZH9B 1NNJA 3HHZA 4B7HA 3TWMA 4M9XA 1XNRM 1XWIA 2V6ZM 1IXZA 4IBFA 1R7RA 4FCTA 3GRVA 4AKHA 1JQJC 4PT5A 5KPTA 2HKJA 2LVAA 2DWZB 2BJVA 2R4EA 1T43A 3K9PA 1D2NA 1XXHA 4M0DA 1Y8GA 3ZCBB 1S3SA 4AI6A 1QUTA 1DO0A 1V92A 4D80A 3GLIB 4BB9A 2G3QA 1N75A 3AV0A 1L1ZA 4NL4H 4LFBM 4JYAM 1N78A 5LMUM 1IFYA 2JP7A 3TPZA 4AG5A 4GHLA 2X49A 2L7HA 3A98B 3SBJA 1C7YA 2L09A 2ZTDA 4FD2A 2WSCF 3FUUA 3KVWA 5BPVA 2DI0A 2C9CA 4LJ9A 1IY2A 3RGPA 4CIZA 1QDRA 1IXSB 3HX3A 3A46A 4IBIA 3GLFE 4DUYM 4GIPA 1HT2E 3U6CA 2UUCM 4QOSA 3UK6A 2K6BA 3MHVC 2F5QA 3HY5A 3V76A 3KDSE 1L1TA 1TTEA 1ZQ9A 1TGUA 3J2PB 1IN5A 5KQDA 3IG8A 3QAUA 4KO8A 1L2DA 2CV2A 2CV1A 4AW4A 4QHSA 8CATA 3M6AA 2FH0A 1N33M 1PJSA 3CF2A 4GRIA 3PNYA 5ITXA 4JI1M 2CRUA 2QCUA 4F2LA 5EP2A 3T15A 1WHCA 2JY6B 4DV4M 3KS4A 4GHAA 1R2ZA 2Y0QA 1V33A 2KEBA 3FYDA 2A5YB 4L16A 2DWMA 2UXCM 2XH9A 2R6FA 4IBKA 2EO2A 4LJ5A 1NHWC 4DV1M 1HQYE 2CHGA 2KA6B 2MR9A 3DZDA 2UUBM 2HWJA 3D8BA 4IBDA 5FSWA 5ITQA 2CEAA 3M0EA 4LGMA 1W5SA 2Q2EB 3RGSA 3GLGA 3H4MA 2DWLA 4KHPM 3D8LA 3QYEA 4KODA 2K47A 3VKHA 4GMQA 1VEKA 4B3RM 3KFUG 3JR5A 5DNYA 2H5XA 4WW0A 2GQFA 1TH2A 2YNMD 2LXEA 3LCUA 1Z5AA 2XF3A 3GQ3A 2LHGA 1G3IA 3W68A 1N77A 4DV6M 4NOOB 1MJGM 3SFZA 1SXJB 2CWBA 3SMSA 1NHGC 2RRUA 1TF0B 5IREB 3I51A 3R9XB 3U6LA 1OQYA 1H6UA 3SAWA 1OFHA 4B08A 4CGYB 1NV8A 5FTJA 3U6MA 3TWLA 1K3XA 4OVZB 4NXMM 1IN7A 4IJFA 4Q7JA 4DV2M 1E32A 1WGNA 1D0MA 1G4AE 4D82A 3HHWA 1OAIA 3LCVB 3AOGA 4RKUF 3FKEA 3FRHA 2DWNA 1NJGA 2WSEF 1X37A 2B3TA 2DAIA 4IBCA 4QHTA 3GPXA 3JR4A 4G4RA 2Y0TA 1DGBA 4I81A 3TQSA 3FTEA 1VDLA 2EKFA 1XHBA 2QPAA 1TH3A 3K1JA 2XEPA 4B7GA 2Y21A 3AOEA 3SAUA 5EXSA 4G4NA 1DGHB 3GLHE 1GL7A 1YE9A 3LW5F 3GPPA 1T3TA 3B7NA 3GO8A 4AKIA 2X8AA 2Z8YM 3B7QA 4MGYE 3GLHA 4LF9M 3J7BA 4II7A 2R44A 1IQPA 2I7PA 2DZOB 3FTCA 5EP3A 3KOZE 1QQWA 3U6PA 4FWHA 4QNRA 2UU9M 4K0KM 2DVWB 2UXBM 2Z4SA 4IBEA 1XMOM 4KLNA 1QZEA 2JZ0A 4MH0E 3SC3A 1AUAA 1PRBA 2XGNA 2CHVA 3I4VA 2OOAA 4IBBA 4L4UA 3LQRA 4X66M 3HWSA 1XXHE 3T1HM 1NJFA 5DYIA 1MX0A 1HNXM 3U5ZA 1VG5A 3SASA 4S12A 2F5SA 3CF6E 2ERCA 1NSFA 2VF8A 3W0FA 1L2BA 1E94E 3VKGA 4A3VB 1WR1B 4CJ6A 4JI4M 3RFWA 1R4GA 2BWEA 2LVNC 1EE8A 3B9PA 4I8OA 2LHCA 3KS8A 1VDDA 2QBYA 3THGA 4NRWA 3SHFA 4F1IA 1HNZM 3LQQA 2OO9A 4REZA 4DV3M 5ITRA 4GC9A 1PJQA 4HLQA 4M9ZA 3PVSA 1IN6A 3OTOM 3U61B 3DOAA 2FOIC 3RE8A 4B3MM 3HJ8A 2D7EA 4LF6M 2ZAMA 2DENA 2VQFM 1WGLA 2ZBKB 1G59A 3MK6A 5KQ8A 1OIZA 1VEGA 2JY8A 3L28A 3GLFB 3VK8A 4JN6A 3FTFA 4D81A 5KPRA 1OAOC 1TDHA 2KZUA 3HKPA 4DR5M 1IN8A 4JI2M 3J7AS 1GVNA 2JZ1A 2FFJA 4P16A 1WJ7A 5ITXE 2L4EA 1QANA 2FNAA 3U6SA 1XB2B 4P17A 2OPFA 4IJEA 3J80S 3CGWA 2KRKA 1QDTA 3GLIA 1J09A 1Q3CA 4L78A 2L7IA 2MJ5B 5IZ7D 5H37D 1YUBA 1WXQA 4GKKM 1HT1E 2I7NA 4NSOB 5ITUA 3GP1A 2JWSA 3I4YA 2YR0A 4BBAA 3GLGE 3C3DA 1NV9A 2MROB 2R0IA 3KP0E 3U60B 2VIIA 3EIHA 3BOSA 4XBOA 1CUKA 1R5LA 5IT9S 4ITQA 3GQ4A 3CF0A 1IXSA 3DA1A 1G41A 3K8ZA 2RKOA 2VQEM 1L2CA 4RNAA 2UXDM 3HU1A 4L6V6 4XK8F 3L26A 2R46A 4DV0M 5L8RF 4DR3M 2J7NA 2YQZA 4NSRA 1AIPC 4G6ZA 5KO3A 1P3QQ 2HHHM 3GRUA 1E9RA 3DFZA 4MGIE 3HU2A 3T1YM 4FCWA 3R8FA 4B3TM 4LFCM 2QP9X 2P5TA 1GL6A 4LF7M 4G4QA 4LGYA 2DZNB 2CP8A 4JI0M 5F3WA 3FUWA 5EP4A 4RF1A 1IBKM 1HR0M 1UM8A 4ZPXA 3HHYA 1ZV1A 4L8RC 4NXNM 1D0LA 1XC8A 3EIEA 1TH4A 2AHMA 2XFTA 2Z7JA 3BBZA 4LRTA 3FTDA 1QZMA 3C58A 3KOXE 2HL7A 3E21A 4YY3M 3TE6A 1L8QA 4FWDA 1PM5A 2N35A 2ZANA 5BR8M 2G5GX 2R18A 4WP2A 2C5RA 1PGYA 1SXJD 2QNJA 2K9DA 4CISA 1W5TA 2V1UA 2L6OA 2QENA 3L29A 2X4AA 2DNAA 2DAGA 4HEOA 4GKJM 5JI2E 4QOZC 3IHPA 4PDGA 5A2QS 4LF4M 4B7FA 3T38A 4JI5M 2XLJA 4AZFA 4MM3B 3GLHB 3W67A 2XSZD 2BNKA 4IIWA 1Q39A 4DR1M 4LJAA 5FLXS 4X64M 4FWGA 1Z59A 5GKNA 1SXJC 3GQ5A 5DYGA 3FYCA 2EA0A 4DV5M 4OVZA 4DR4M 4LJ8A 1KYIA 3FD9A 3JAMS 4GH9A 3SYLA 2JY5A 1QAMA 2C99A 1NNUC 2QSFX 2W82A 2R62A 3NBXX 3K92A 2L2DA 3PXGA 2BWBA 2F5OA 5FTMA 2F5PA 4GEWA 3SARA 5EQTA 3SATA 4ANRA 1E9SA 1ZMWA 2K0BX 2QZ4A 3UZUA 4DUZM 2E5LM 1V34A 2CV0A 1IBLM 1JR3D 1FNNA 1I4WA 1NO1A 3MJ5A 3UGJA 2APLA 1F4IA 3IG5A 4MB7A 4KT0F 1XXHB 2DKLA 4MGZE 2OQ4A 1N34M 1PJTA 2O25A 2V1CA 2MGWA 1NY6A 4EIWA 4JI7M 1N32M 1DGHA 3FUXA 1N36M 2QHOB 3LVVA 1ZMVA 1GJSA 2ZM6M 2QBYB 3KOYE 3T6PA 1JR3A 3KSXA 3L2AA 3MMPA 4G3OA 2JNHA 2F4VM 3FUTA 3U6QA 3SYKA 4LJ7A 3WHLA 2KNZA 2M60A 2C98A 4WURA 4IBGA 4X62M 1K82A 1GLNA 4DR2M 2UUAM 1QAOA 2JUJA 5EXXA 5EP1A 2C9OA 4PD2A 3SMPA 2J5YA 2EKKA 2KW0A 3QWLA 1BVSA 2JXNA 4R3DA 5LMNM 2LH0A 4PCZA 3GRYA 3K9OA 1QVRA 1OFIA 4LF8M 2LVOC 1J7KA 3U61A 3E9SA 2Z3XA
chains in the Genus database with same CATH topology
3NBIA 3L27A 1G8PA 2C96A 4LFAM 3ZC7B 1Z5CA 2G8LA 2ZAOA 1ORYB 2H1RA 5C1BA 1KSFX 3J27B 5JI3E 3Q8XA 4DR7M 5EXTA 5ITYA 1IY1A 4Z6YA 3R8FA 1YSYA 3A45A 2R4JA 4X65M 4DR6M 4HL4A 4LRSA 3VLFB 2LWXA 5FTKA 3J81S 4TUWA 3AJIB 2RGOA 2Z4RA 3HJSA 3TL4X 1HNWM 1Z6TA 4XGIA 3GLGB 4LJ6A 1TDZA 2R45A 3HJQA 1R6BX 2CE7A 2BJWA 3SAVA 1Z5BA 2Y20A 1J5EM 3GLFA 3KP1E 4M0WA 2EUCA 3KSJA 2J7OA 4LG2A 4OU7A 3WHKA 1PJIA 3NWLA 4I4LA 2CHQA 1R2YA 4L15A 4LJ4A 1IXRC 4BLCA 2JA2A 4JXJA 1OJLA 3U6OA 3M7GA 4LY6A 2KXEA 3GRRA 4LCBA 3K2LA 2XZFA 1ZAEA 5E26A 1XMQM 3L25A 2M5ZA 5EXPA 1IY0A 1IM2A 3U60A 4LF5M 5EJCA 1DGGA 4CHTB 4DV7M 4JV5M 1DGFA 2LNHC 2XFSA 2D7HA 4GITA 4FCVA 3LMMA 3VDPA 3U6EA 3FUVA 4AKGA 4LZJA 2R65A 3AFHA 3VFDA 1SXJE 7CATA 4IBJA 3UMMA 3SHGB 5C18A 3CTWB 3U6DA 1QYRA 4YHHM 1KFVA 4PDIA 1IN4A 4LZZA 5FTLA 4G4OA 1FJGM 2DHRA 1SXJA 3UJNA 3GPUA 3LVWA 4OW0A 3HGIA 2YFQA 5KPZA 3KOWE 3VK7A 2HCBA 1C1KA 4MGHA 1GKIA 1LV7A 1Q3BA 2KZSA 2CUZA 4FVMA 4QNMA 2O5RA 2XSZA 4RF0A 3KW6A 4NRVA 1IBMM 3GPYA 4M9SA 5IWAM 3HHXA 4OX9M 4GC5A 4JI6M 2CFOA 3U5ZB 2XZUA 2RGHA 3PFIA 3TWKA 3AKZA 3A42A 2DXIA 4B3SM 4W5WA 1MU5A 4AG6A 1K3WA 1NY5A 3PNVA 1HQCA 2FE8A 3AOEC 4JI3M 5ITTA 3VDUA 2F5NA 4FW9A 4R7GA 1XNQM 3HU3A 1QAQA 2D7GA 5FTNA 3AL0C 5E6JA 1NVMA 3W0LB 4JI8M 3KXEC 4AQYM 1PJJA 4MGKE 1I94M 3ILKA 1DO2A 2KRUA 3E4RA 4I5SA 4Z8XA 2NQ8C 3ZH9B 1NNJA 3HHZA 4B7HA 3TWMA 4M9XA 1XNRM 1XWIA 2V6ZM 1IXZA 4IBFA 1R7RA 4FCTA 3GRVA 4AKHA 1JQJC 4PT5A 5KPTA 2HKJA 2DWZB 2BJVA 2R4EA 1D2NA 1XXHA 4M0DA 3ZCBB 1S3SA 4AI6A 1DO0A 4D80A 3GLIB 4BB9A 4JYAM 1N75A 3AV0A 1L1ZA 4NL4H 4LFBM 1N78A 5LMUM 3TPZA 4AG5A 4GHLA 2X49A 2L7HA 3A98B 3SBJA 2L09A 4FD2A 3FUUA 3KVWA 5BPVA 2C9CA 4LJ9A 1IY2A 3RGPA 1IXSB 3A46A 4IBIA 4DUYM 4GIPA 1HT2E 3U6CA 2UUCM 4QOSA 3UK6A 3MHVC 2F5QA 3KDSE 1L1TA 1ZQ9A 1TGUA 3J2PB 1IN5A 5KQDA 3IG8A 3QAUA 4KO8A 1L2DA 2CV2A 2CV1A 4AW4A 4QHSA 8CATA 3M6AA 1N33M 3CF2A 4GRIA 3PNYA 5ITXA 4JI1M 2QCUA 5EP2A 3T15A 4DV4M 4GHAA 3KS4A 1R2ZA 2Y0QA 2KEBA 3FYDA 2A5YB 4L16A 2DWMA 2UXCM 2XH9A 4IBKA 2EO2A 4LJ5A 1NHWC 4DV1M 1HQYE 2CHGA 2KA6B 3DZDA 2UUBM 3D8BA 4IBDA 5FSWA 5ITQA 2CEAA 3M0EA 4LGMA 1W5SA 2Q2EB 3RGSA 3GLGA 3H4MA 2DWLA 4KHPM 3D8LA 4KODA 2K47A 3VKHA 4GMQA 3KFUG 3JR5A 5DNYA 4WW0A 1TH2A 2YNMD 2LXEA 3GQ3A 1Z5AA 2XF3A 1G3IA 1N77A 4DV6M 4NOOB 3SFZA 1SXJB 3SMSA 1NHGC 5IREB 3I51A 3R9XB 3U6LA 1H6UA 3SAWA 1OFHA 4B08A 4CGYB 5FTJA 3U6MA 3TWLA 1K3XA 4OVZB 4NXMM 1IN7A 4IJFA 4DV2M 1E32A 4D82A 1G4AE 3HHWA 3AOGA 3FKEA 2DWNA 1NJGA 4G4RA 1X37A 4IBCA 4QHTA 3GPXA 3JR4A 2Y0TA 1DGBA 4I81A 3TQSA 3FTEA 1XHBA 2QPAA 1TH3A 3K1JA 2XEPA 4B7GA 2Y21A 3AOEA 3SAUA 5EXSA 4G4NA 1DGHB 1GL7A 1YE9A 3GPPA 1T3TA 3GO8A 4AKIA 2X8AA 4MGYE 3GLHA 4LF9M 3J7BA 4II7A 1IQPA 2I7PA 2DZOB 3FTCA 5EP3A 3KOZE 1QQWA 3U6PA 4FWHA 4QNRA 2UU9M 4K0KM 2DVWB 2UXBM 2Z4SA 4IBEA 1XMOM 4KLNA 4MH0E 3SC3A 2XGNA 3U61B 2CHVA 3I4VA 4IBBA 4L4UA 3T1HM 3LQRA 4X66M 3HWSA 1NJFA 5DYIA 1MX0A 1HNXM 3U5ZA 3SASA 4S12A 2F5SA 3CF6E 2ERCA 1NSFA 1L2BA 3W0FA 1E94E 3VKGA 4A3VB 4JI4M 3RFWA 1EE8A 3B9PA 4I8OA 3KS8A 1VDDA 2QBYA 3THGA 4NRWA 3SHFA 1HNZM 3LQQA 4REZA 4DV3M 5ITRA 4GC9A 4HLQA 4M9ZA 3PVSA 1IN6A 3OTOM 3DOAA 2FOIC 3RE8A 4B3MM 3HJ8A 2D7EA 2ZAMA 2VQFM 2ZBKB 1G59A 3MK6A 5KQ8A 3FTFA 3L28A 3GLFB 3VK8A 4JN6A 4D81A 5KPRA 1TDHA 2KZUA 3HKPA 4DR5M 4JI2M 1IN8A 3J7AS 1GVNA 4P16A 2FFJA 5ITXE 1QANA 2FNAA 3U6SA 2OPFA 4IJEA 3J80S 2KRKA 3GLIA 1J09A 1Q3CA 4L78A 2L7IA 5IZ7D 5H37D 1YUBA 1WXQA 4GKKM 1HT1E 2I7NA 4NSOB 5ITUA 3GP1A 3I4YA 2YR0A 4BBAA 3KP0E 3U60B 2VIIA 3EIHA 3BOSA 4XBOA 5IT9S 4ITQA 3GQ4A 3CF0A 3DA1A 1G41A 3K8ZA 2RKOA 2VQEM 1L2CA 4RNAA 2UXDM 3HU1A 3L26A 2R46A 4DV0M 4DR3M 2J7NA 2YQZA 4NSRA 4G6ZA 5KO3A 2HHHM 3GRUA 1E9RA 3DFZA 4MGIE 3HU2A 3T1YM 4FCWA 4B3TM 4LFCM 2QP9X 2P5TA 1GL6A 4LF7M 4G4QA 4LGYA 2DZNB 4JI0M 5F3WA 3FUWA 5EP4A 4RF1A 1IBKM 1HR0M 1UM8A 4ZPXA 3HHYA 4L8RC 4NXNM 1XC8A 3EIEA 1TH4A 2AHMA 2XFTA 2Z7JA 4LRTA 3C58A 3FTDA 1QZMA 3KOXE 2HL7A 4YY3M 3TE6A 1L8QA 4FWDA 1PM5A 2ZANA 5BR8M 4LF6M 2G5GX 2R18A 2C5RA 4B3RM 1SXJD 4CISA 1W5TA 2V1UA 2L6OA 2QENA 3L29A 2X4AA 4GKJM 5JI2E 4QOZC 4PDGA 5A2QS 4LF4M 4B7FA 3T38A 4JI5M 2XLJA 4AZFA 4MM3B 3GLHB 2XSZD 2BNKA 4IIWA 1Q39A 4DR1M 4LJAA 5FLXS 4X64M 4FWGA 1Z59A 5GKNA 1SXJC 3GQ5A 5DYGA 3FYCA 2EA0A 4DV5M 4OVZA 4DR4M 4LJ8A 1KYIA 3FD9A 3JAMS 4GH9A 3SYLA 1QAMA 2C99A 1NNUC 2W82A 2R62A 3K92A 3PXGA 2F5OA 5FTMA 2F5PA 3SARA 5EQTA 3SATA 1E9SA 2QZ4A 3UZUA 4DUZM 2E5LM 2CV0A 1IBLM 1JR3D 1FNNA 1I4WA 3MJ5A 3UGJA 3IG5A 4MB7A 1XXHB 4MGZE 2OQ4A 1N34M 2V1CA 1NY6A 4EIWA 4JI7M 1N32M 1DGHA 3FUXA 1N36M 3LVVA 2ZM6M 2QBYB 3KOYE 1JR3A 3KSXA 3L2AA 2F4VM 3FUTA 3U6QA 3SYKA 4LJ7A 3WHLA 4WURA 2M60A 2C98A 4X62M 4IBGA 1K82A 2UUAM 1GLNA 4DR2M 1QAOA 5EXXA 5EP1A 2C9OA 4PD2A 3SMPA 2KW0A 3QWLA 5LMNM 4R3DA 2LH0A 4PCZA 3GRYA 1QVRA 1OFIA 4LF8M 1J7KA 3U61A 3E9SA 2Z3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXE A; 
#chains in the Genus database with same CATH topology
 1UFZ A;  3NBI A;  3L27 A;  1OTR A;  1G8P A;  2C96 A;  4LFA M;  3ZC7 B;  1Z5C A;  1T6O A;  2G8L A;  2ZAO A;  1ORY B;  3GLI E;  2H1R A;  2DAK A;  5C1B A;  1KSF X;  3J27 B;  5JI3 E;  1VQ1 A;  3Q8X A;  4DR7 M;  5EXT A;  5ITY A;  1IY1 A;  3ZQJ A;  4Z6Y A;  1YSY A;  1GJT A;  2R4J A;  3A45 A;  4X65 M;  2LBC A;  2OOB A;  4HL4 A;  3B7Z A;  4LRS A;  3VLF B;  2LWX A;  5FTK A;  4Y28 F;  3J81 S;  4TUW A;  3AJI B;  2RGO A;  2Z4R A;  3HJS A;  2QQ8 A;  3TL4 X;  3QYB A;  1HNW M;  2L4F A;  1Z6T A;  4XGI A;  3GLG B;  1DV0 A;  4NC6 A;  4LJ6 A;  1TDZ A;  1SG9 A;  2DHY A;  2R45 A;  3HJQ A;  1R6B X;  2CE7 A;  2BJW A;  3SAV A;  1D0K A;  1Z5B A;  2Y20 A;  1J5E M;  3GLF A;  3KP1 E;  4M0W A;  2EUC A;  3KSJ A;  2J7O A;  4LG2 A;  4OU7 A;  3WHK A;  1PJI A;  3NWL A;  4I4L A;  4DBG B;  2CHQ A;  1R2Y A;  4L15 A;  2ZTC A;  4LJ4 A;  1IXR C;  4BLC A;  2JA2 A;  1QUS A;  4JXJ A;  4DR6 M;  1OJL A;  3U6O A;  3M7G A;  4LY6 A;  2KXE A;  3GRR A;  1JB0 F;  1WIV A;  4LCB A;  3C3E A;  2DAE A;  3K2L A;  2XZF A;  4UN2 B;  1ZAE A;  5E26 A;  1XMQ M;  3L25 A;  2M5Z A;  4R71 A;  5EXP A;  1RU3 A;  1IY0 A;  1IM2 A;  3U60 A;  4LF5 M;  5EJC A;  1DGG A;  4CHT B;  4DV7 M;  2KNA A;  4JV5 M;  3HZJ A;  1DGF A;  2FS1 A;  2LNH C;  2XFS A;  2D7H A;  2WSF F;  1Q02 A;  3B89 A;  3Q8G A;  4GIT A;  4FCV A;  1ZMU A;  3LMM A;  3VDP A;  3U6E A;  3FUV A;  4AKG A;  3BXW A;  4LZJ A;  2R65 A;  3AFH A;  3VFD A;  5DFL A;  1SXJ E;  1TR8 A;  7CAT A;  4IBJ A;  3UMM A;  3SHG B;  1GAB A;  5C18 A;  3E46 A;  3CTW B;  2LVQ D;  1QYR A;  4YHH M;  3U6D A;  1KFV A;  4PDI A;  1IN4 A;  4LZZ A;  5FTL A;  4G4O A;  1FJG M;  2DHR A;  2KNV A;  1SXJ A;  2DAM A;  1GO5 A;  1HJP A;  3B74 A;  3UJN A;  3LVW A;  3GPU A;  1OKS A;  2KDL A;  3I01 M;  4OW0 A;  2VF7 A;  1OIP A;  2KHH A;  3F92 A;  2LTU A;  3HGI A;  2YFQ A;  2WZJ A;  5KPZ A;  3KOW E;  3VK7 A;  2HCB A;  1C1K A;  1YLA A;  4MGH A;  1GKI A;  1LV7 A;  1Q3B A;  2DZL A;  2KZS A;  2CUZ A;  3FRI A;  4FVM A;  2O01 F;  4QNM A;  2O5R A;  2XSZ A;  4RF0 A;  3KW6 A;  4NRV A;  1IBM M;  2EJS A;  3GPY A;  4M9S A;  2VDB B;  3HHX A;  5IWA M;  4OX9 M;  4GC5 A;  1EIJ A;  4JI6 M;  2CFO A;  3U5Z B;  2XZU A;  2RGH A;  3PFI A;  3TWK A;  3AKZ A;  3A42 A;  2DXI A;  4B3S M;  4W5W A;  1JR3 E;  2JY7 A;  1LTM A;  1MU5 A;  4AG6 A;  1K3W A;  1NY5 A;  3PNV A;  1HQC A;  2FE8 A;  3AOE C;  4JI3 M;  2GNO A;  1MN3 A;  5ITT A;  3VDU A;  2F5N A;  4FW9 A;  4R7G A;  1XNQ M;  3HU3 A;  1QAQ A;  2D7G A;  5FTN A;  3AL0 C;  5E6J A;  1G71 A;  1NVM A;  1VEJ A;  3W0L B;  3KXE C;  4AQY M;  3FE3 A;  4JI8 M;  1PJJ A;  4MGK E;  2MH8 A;  1I94 M;  3C9P A;  3IEC A;  2HAK A;  3H4J A;  1DO2 A;  1A5T A;  1EFU B;  2KRU A;  3I04 M;  3ILK A;  3E4R A;  4I5S A;  4Z8X A;  2LVP C;  2NQ8 C;  3ZH9 B;  1NNJ A;  3HHZ A;  4B7H A;  3TWM A;  4M9X A;  1XNR M;  1XWI A;  2V6Z M;  1IXZ A;  4IBF A;  1R7R A;  4FCT A;  3GRV A;  4AKH A;  1JQJ C;  4PT5 A;  5KPT A;  2HKJ A;  2LVA A;  2DWZ B;  2BJV A;  2R4E A;  1T43 A;  3K9P A;  1D2N A;  1XXH A;  4M0D A;  1Y8G A;  3ZCB B;  1S3S A;  4AI6 A;  1QUT A;  1DO0 A;  1V92 A;  4D80 A;  3GLI B;  4BB9 A;  2G3Q A;  1N75 A;  3AV0 A;  1L1Z A;  4NL4 H;  4LFB M;  4JYA M;  1N78 A;  5LMU M;  1IFY A;  2JP7 A;  3TPZ A;  4AG5 A;  4GHL A;  2X49 A;  2L7H A;  3A98 B;  3SBJ A;  1C7Y A;  2L09 A;  2ZTD A;  4FD2 A;  2WSC F;  3FUU A;  3KVW A;  5BPV A;  2DI0 A;  2C9C A;  4LJ9 A;  1IY2 A;  3RGP A;  4CIZ A;  1QDR A;  1IXS B;  3HX3 A;  3A46 A;  4IBI A;  3GLF E;  4DUY M;  4GIP A;  1HT2 E;  3U6C A;  2UUC M;  4QOS A;  3UK6 A;  2K6B A;  3MHV C;  2F5Q A;  3HY5 A;  3V76 A;  3KDS E;  1L1T A;  1TTE A;  1ZQ9 A;  1TGU A;  3J2P B;  1IN5 A;  5KQD A;  3IG8 A;  3QAU A;  4KO8 A;  1L2D A;  2CV2 A;  2CV1 A;  4AW4 A;  4QHS A;  8CAT A;  3M6A A;  2FH0 A;  1N33 M;  1PJS A;  3CF2 A;  4GRI A;  3PNY A;  5ITX A;  4JI1 M;  2CRU A;  2QCU A;  4F2L A;  5EP2 A;  3T15 A;  1WHC A;  2JY6 B;  4DV4 M;  3KS4 A;  4GHA A;  1R2Z A;  2Y0Q A;  1V33 A;  2KEB A;  3FYD A;  2A5Y B;  4L16 A;  2DWM A;  2UXC M;  2XH9 A;  2R6F A;  4IBK A;  2EO2 A;  4LJ5 A;  1NHW C;  4DV1 M;  1HQY E;  2CHG A;  2KA6 B;  2MR9 A;  3DZD A;  2UUB M;  2HWJ A;  3D8B A;  4IBD A;  5FSW A;  5ITQ A;  2CEA A;  3M0E A;  4LGM A;  1W5S A;  2Q2E B;  3RGS A;  3GLG A;  3H4M A;  2DWL A;  4KHP M;  3D8L A;  3QYE A;  4KOD A;  2K47 A;  3VKH A;  4GMQ A;  1VEK A;  4B3R M;  3KFU G;  3JR5 A;  5DNY A;  2H5X A;  4WW0 A;  2GQF A;  1TH2 A;  2YNM D;  2LXE A;  3LCU A;  1Z5A A;  2XF3 A;  3GQ3 A;  2LHG A;  1G3I A;  3W68 A;  1N77 A;  4DV6 M;  4NOO B;  1MJG M;  3SFZ A;  1SXJ B;  2CWB A;  3SMS A;  1NHG C;  2RRU A;  1TF0 B;  5IRE B;  3I51 A;  3R9X B;  3U6L A;  1OQY A;  1H6U A;  3SAW A;  1OFH A;  4B08 A;  4CGY B;  1NV8 A;  5FTJ A;  3U6M A;  3TWL A;  1K3X A;  4OVZ B;  4NXM M;  1IN7 A;  4IJF A;  4Q7J A;  4DV2 M;  1E32 A;  1WGN A;  1D0M A;  1G4A E;  4D82 A;  3HHW A;  1OAI A;  3LCV B;  3AOG A;  4RKU F;  3FKE A;  3FRH A;  2DWN A;  1NJG A;  2WSE F;  1X37 A;  2B3T A;  2DAI A;  4IBC A;  4QHT A;  3GPX A;  3JR4 A;  4G4R A;  2Y0T A;  1DGB A;  4I81 A;  3TQS A;  3FTE A;  1VDL A;  2EKF A;  1XHB A;  2QPA A;  1TH3 A;  3K1J A;  2XEP A;  4B7G A;  2Y21 A;  3AOE A;  3SAU A;  5EXS A;  4G4N A;  1DGH B;  3GLH E;  1GL7 A;  1YE9 A;  3LW5 F;  3GPP A;  1T3T A;  3B7N A;  3GO8 A;  4AKI A;  2X8A A;  2Z8Y M;  3B7Q A;  4MGY E;  3GLH A;  4LF9 M;  3J7B A;  4II7 A;  2R44 A;  1IQP A;  2I7P A;  2DZO B;  3FTC A;  5EP3 A;  3KOZ E;  1QQW A;  3U6P A;  4FWH A;  4QNR A;  2UU9 M;  4K0K M;  2DVW B;  2UXB M;  2Z4S A;  4IBE A;  1XMO M;  4KLN A;  1QZE A;  2JZ0 A;  4MH0 E;  3SC3 A;  1AUA A;  1PRB A;  2XGN A;  2CHV A;  3I4V A;  2OOA A;  4IBB A;  4L4U A;  3LQR A;  4X66 M;  3HWS A;  1XXH E;  3T1H M;  1NJF A;  5DYI A;  1MX0 A;  1HNX M;  3U5Z A;  1VG5 A;  3SAS A;  4S12 A;  2F5S A;  3CF6 E;  2ERC A;  1NSF A;  2VF8 A;  3W0F A;  1L2B A;  1E94 E;  3VKG A;  4A3V B;  1WR1 B;  4CJ6 A;  4JI4 M;  3RFW A;  1R4G A;  2BWE A;  2LVN C;  1EE8 A;  3B9P A;  4I8O A;  2LHC A;  3KS8 A;  1VDD A;  2QBY A;  3THG A;  4NRW A;  3SHF A;  4F1I A;  1HNZ M;  3LQQ A;  2OO9 A;  4REZ A;  4DV3 M;  5ITR A;  4GC9 A;  1PJQ A;  4HLQ A;  4M9Z A;  3PVS A;  1IN6 A;  3OTO M;  3U61 B;  3DOA A;  2FOI C;  3RE8 A;  4B3M M;  3HJ8 A;  2D7E A;  4LF6 M;  2ZAM A;  2DEN A;  2VQF M;  1WGL A;  2ZBK B;  1G59 A;  3MK6 A;  5KQ8 A;  1OIZ A;  1VEG A;  2JY8 A;  3L28 A;  3GLF B;  3VK8 A;  4JN6 A;  3FTF A;  4D81 A;  5KPR A;  1OAO C;  1TDH A;  2KZU A;  3HKP A;  4DR5 M;  1IN8 A;  4JI2 M;  3J7A S;  1GVN A;  2JZ1 A;  2FFJ A;  4P16 A;  1WJ7 A;  5ITX E;  2L4E A;  1QAN A;  2FNA A;  3U6S A;  1XB2 B;  4P17 A;  2OPF A;  4IJE A;  3J80 S;  3CGW A;  2KRK A;  1QDT A;  3GLI A;  1J09 A;  1Q3C A;  4L78 A;  2L7I A;  2MJ5 B;  5IZ7 D;  5H37 D;  1YUB A;  1WXQ A;  4GKK M;  1HT1 E;  2I7N A;  4NSO B;  5ITU A;  3GP1 A;  2JWS A;  3I4Y A;  2YR0 A;  4BBA A;  3GLG E;  3C3D A;  1NV9 A;  2MRO B;  2R0I A;  3KP0 E;  3U60 B;  2VII A;  3EIH A;  3BOS A;  4XBO A;  1CUK A;  1R5L A;  5IT9 S;  4ITQ A;  3GQ4 A;  3CF0 A;  1IXS A;  3DA1 A;  1G41 A;  3K8Z A;  2RKO A;  2VQE M;  1L2C A;  4RNA A;  2UXD M;  3HU1 A;  4L6V 6;  4XK8 F;  3L26 A;  2R46 A;  4DV0 M;  5L8R F;  4DR3 M;  2J7N A;  2YQZ A;  4NSR A;  1AIP C;  4G6Z A;  5KO3 A;  1P3Q Q;  2HHH M;  3GRU A;  1E9R A;  3DFZ A;  4MGI E;  3HU2 A;  3T1Y M;  4FCW A;  3R8F A;  4B3T M;  4LFC M;  2QP9 X;  2P5T A;  1GL6 A;  4LF7 M;  4G4Q A;  4LGY A;  2DZN B;  2CP8 A;  4JI0 M;  5F3W A;  3FUW A;  5EP4 A;  4RF1 A;  1IBK M;  1HR0 M;  1UM8 A;  4ZPX A;  3HHY A;  1ZV1 A;  4L8R C;  4NXN M;  1D0L A;  1XC8 A;  3EIE A;  1TH4 A;  2AHM A;  2XFT A;  2Z7J A;  3BBZ A;  4LRT A;  3FTD A;  1QZM A;  3C58 A;  3KOX E;  2HL7 A;  3E21 A;  4YY3 M;  3TE6 A;  1L8Q A;  4FWD A;  1PM5 A;  2N35 A;  2ZAN A;  5BR8 M;  2G5G X;  2R18 A;  4WP2 A;  2C5R A;  1PGY A;  1SXJ D;  2QNJ A;  2K9D A;  4CIS A;  1W5T A;  2V1U A;  2L6O A;  2QEN A;  3L29 A;  2X4A A;  2DNA A;  2DAG A;  4HEO A;  4GKJ M;  5JI2 E;  4QOZ C;  3IHP A;  4PDG A;  5A2Q S;  4LF4 M;  4B7F A;  3T38 A;  4JI5 M;  2XLJ A;  4AZF A;  4MM3 B;  3GLH B;  3W67 A;  2XSZ D;  2BNK A;  4IIW A;  1Q39 A;  4DR1 M;  4LJA A;  5FLX S;  4X64 M;  4FWG A;  1Z59 A;  5GKN A;  1SXJ C;  3GQ5 A;  5DYG A;  3FYC A;  2EA0 A;  4DV5 M;  4OVZ A;  4DR4 M;  4LJ8 A;  1KYI A;  3FD9 A;  3JAM S;  4GH9 A;  3SYL A;  2JY5 A;  1QAM A;  2C99 A;  1NNU C;  2QSF X;  2W82 A;  2R62 A;  3NBX X;  3K92 A;  2L2D A;  3PXG A;  2BWB A;  2F5O A;  5FTM A;  2F5P A;  4GEW A;  3SAR A;  5EQT A;  3SAT A;  4ANR A;  1E9S A;  1ZMW A;  2K0B X;  2QZ4 A;  3UZU A;  4DUZ M;  2E5L M;  1V34 A;  2CV0 A;  1IBL M;  1JR3 D;  1FNN A;  1I4W A;  1NO1 A;  3MJ5 A;  3UGJ A;  2APL A;  1F4I A;  3IG5 A;  4MB7 A;  4KT0 F;  1XXH B;  2DKL A;  4MGZ E;  2OQ4 A;  1N34 M;  1PJT A;  2O25 A;  2V1C A;  2MGW A;  1NY6 A;  4EIW A;  4JI7 M;  1N32 M;  1DGH A;  3FUX A;  1N36 M;  2QHO B;  3LVV A;  1ZMV A;  1GJS A;  2ZM6 M;  2QBY B;  3KOY E;  3T6P A;  1JR3 A;  3KSX A;  3L2A A;  3MMP A;  4G3O A;  2JNH A;  2F4V M;  3FUT A;  3U6Q A;  3SYK A;  4LJ7 A;  3WHL A;  2KNZ A;  2M60 A;  2C98 A;  4WUR A;  4IBG A;  4X62 M;  1K82 A;  1GLN A;  4DR2 M;  2UUA M;  1QAO A;  2JUJ A;  5EXX A;  5EP1 A;  2C9O A;  4PD2 A;  3SMP A;  2J5Y A;  2EKK A;  2KW0 A;  3QWL A;  1BVS A;  2JXN A;  4R3D A;  5LMN M;  2LH0 A;  4PCZ A;  3GRY A;  3K9O A;  1QVR A;  1OFI A;  4LF8 M;  2LVO C;  1J7K A;  3U61 A;  3E9S A;  2Z3X A; 
#chains in the Genus database with same CATH homology
 3NBI A;  3L27 A;  1G8P A;  2C96 A;  4LFA M;  3ZC7 B;  1Z5C A;  2G8L A;  2ZAO A;  1ORY B;  2H1R A;  5C1B A;  1KSF X;  3J27 B;  5JI3 E;  3Q8X A;  4DR7 M;  5EXT A;  5ITY A;  1IY1 A;  4Z6Y A;  3R8F A;  1YSY A;  3A45 A;  2R4J A;  4X65 M;  4DR6 M;  4HL4 A;  4LRS A;  3VLF B;  2LWX A;  5FTK A;  3J81 S;  4TUW A;  3AJI B;  2RGO A;  2Z4R A;  3HJS A;  3TL4 X;  1HNW M;  1Z6T A;  4XGI A;  3GLG B;  4LJ6 A;  1TDZ A;  2R45 A;  3HJQ A;  1R6B X;  2CE7 A;  2BJW A;  3SAV A;  1Z5B A;  2Y20 A;  1J5E M;  3GLF A;  3KP1 E;  4M0W A;  2EUC A;  3KSJ A;  2J7O A;  4LG2 A;  4OU7 A;  3WHK A;  1PJI A;  3NWL A;  4I4L A;  2CHQ A;  1R2Y A;  4L15 A;  4LJ4 A;  1IXR C;  4BLC A;  2JA2 A;  4JXJ A;  1OJL A;  3U6O A;  3M7G A;  4LY6 A;  2KXE A;  3GRR A;  4LCB A;  3K2L A;  2XZF A;  1ZAE A;  5E26 A;  1XMQ M;  3L25 A;  2M5Z A;  5EXP A;  1IY0 A;  1IM2 A;  3U60 A;  4LF5 M;  5EJC A;  1DGG A;  4CHT B;  4DV7 M;  4JV5 M;  1DGF A;  2LNH C;  2XFS A;  2D7H A;  4GIT A;  4FCV A;  3LMM A;  3VDP A;  3U6E A;  3FUV A;  4AKG A;  4LZJ A;  2R65 A;  3AFH A;  3VFD A;  1SXJ E;  7CAT A;  4IBJ A;  3UMM A;  3SHG B;  5C18 A;  3CTW B;  3U6D A;  1QYR A;  4YHH M;  1KFV A;  4PDI A;  1IN4 A;  4LZZ A;  5FTL A;  4G4O A;  1FJG M;  2DHR A;  1SXJ A;  3UJN A;  3GPU A;  3LVW A;  4OW0 A;  3HGI A;  2YFQ A;  5KPZ A;  3KOW E;  3VK7 A;  2HCB A;  1C1K A;  4MGH A;  1GKI A;  1LV7 A;  1Q3B A;  2KZS A;  2CUZ A;  4FVM A;  4QNM A;  2O5R A;  2XSZ A;  4RF0 A;  3KW6 A;  4NRV A;  1IBM M;  3GPY A;  4M9S A;  5IWA M;  3HHX A;  4OX9 M;  4GC5 A;  4JI6 M;  2CFO A;  3U5Z B;  2XZU A;  2RGH A;  3PFI A;  3TWK A;  3AKZ A;  3A42 A;  2DXI A;  4B3S M;  4W5W A;  1MU5 A;  4AG6 A;  1K3W A;  1NY5 A;  3PNV A;  1HQC A;  2FE8 A;  3AOE C;  4JI3 M;  5ITT A;  3VDU A;  2F5N A;  4FW9 A;  4R7G A;  1XNQ M;  3HU3 A;  1QAQ A;  2D7G A;  5FTN A;  3AL0 C;  5E6J A;  1NVM A;  3W0L B;  4JI8 M;  3KXE C;  4AQY M;  1PJJ A;  4MGK E;  1I94 M;  3ILK A;  1DO2 A;  2KRU A;  3E4R A;  4I5S A;  4Z8X A;  2NQ8 C;  3ZH9 B;  1NNJ A;  3HHZ A;  4B7H A;  3TWM A;  4M9X A;  1XNR M;  1XWI A;  2V6Z M;  1IXZ A;  4IBF A;  1R7R A;  4FCT A;  3GRV A;  4AKH A;  1JQJ C;  4PT5 A;  5KPT A;  2HKJ A;  2DWZ B;  2BJV A;  2R4E A;  1D2N A;  1XXH A;  4M0D A;  3ZCB B;  1S3S A;  4AI6 A;  1DO0 A;  4D80 A;  3GLI B;  4BB9 A;  4JYA M;  1N75 A;  3AV0 A;  1L1Z A;  4NL4 H;  4LFB M;  1N78 A;  5LMU M;  3TPZ A;  4AG5 A;  4GHL A;  2X49 A;  2L7H A;  3A98 B;  3SBJ A;  2L09 A;  4FD2 A;  3FUU A;  3KVW A;  5BPV A;  2C9C A;  4LJ9 A;  1IY2 A;  3RGP A;  1IXS B;  3A46 A;  4IBI A;  4DUY M;  4GIP A;  1HT2 E;  3U6C A;  2UUC M;  4QOS A;  3UK6 A;  3MHV C;  2F5Q A;  3KDS E;  1L1T A;  1ZQ9 A;  1TGU A;  3J2P B;  1IN5 A;  5KQD A;  3IG8 A;  3QAU A;  4KO8 A;  1L2D A;  2CV2 A;  2CV1 A;  4AW4 A;  4QHS A;  8CAT A;  3M6A A;  1N33 M;  3CF2 A;  4GRI A;  3PNY A;  5ITX A;  4JI1 M;  2QCU A;  5EP2 A;  3T15 A;  4DV4 M;  4GHA A;  3KS4 A;  1R2Z A;  2Y0Q A;  2KEB A;  3FYD A;  2A5Y B;  4L16 A;  2DWM A;  2UXC M;  2XH9 A;  4IBK A;  2EO2 A;  4LJ5 A;  1NHW C;  4DV1 M;  1HQY E;  2CHG A;  2KA6 B;  3DZD A;  2UUB M;  3D8B A;  4IBD A;  5FSW A;  5ITQ A;  2CEA A;  3M0E A;  4LGM A;  1W5S A;  2Q2E B;  3RGS A;  3GLG A;  3H4M A;  2DWL A;  4KHP M;  3D8L A;  4KOD A;  2K47 A;  3VKH A;  4GMQ A;  3KFU G;  3JR5 A;  5DNY A;  4WW0 A;  1TH2 A;  2YNM D;  2LXE A;  3GQ3 A;  1Z5A A;  2XF3 A;  1G3I A;  1N77 A;  4DV6 M;  4NOO B;  3SFZ A;  1SXJ B;  3SMS A;  1NHG C;  5IRE B;  3I51 A;  3R9X B;  3U6L A;  1H6U A;  3SAW A;  1OFH A;  4B08 A;  4CGY B;  5FTJ A;  3U6M A;  3TWL A;  1K3X A;  4OVZ B;  4NXM M;  1IN7 A;  4IJF A;  4DV2 M;  1E32 A;  4D82 A;  1G4A E;  3HHW A;  3AOG A;  3FKE A;  2DWN A;  1NJG A;  4G4R A;  1X37 A;  4IBC A;  4QHT A;  3GPX A;  3JR4 A;  2Y0T A;  1DGB A;  4I81 A;  3TQS A;  3FTE A;  1XHB A;  2QPA A;  1TH3 A;  3K1J A;  2XEP A;  4B7G A;  2Y21 A;  3AOE A;  3SAU A;  5EXS A;  4G4N A;  1DGH B;  1GL7 A;  1YE9 A;  3GPP A;  1T3T A;  3GO8 A;  4AKI A;  2X8A A;  4MGY E;  3GLH A;  4LF9 M;  3J7B A;  4II7 A;  1IQP A;  2I7P A;  2DZO B;  3FTC A;  5EP3 A;  3KOZ E;  1QQW A;  3U6P A;  4FWH A;  4QNR A;  2UU9 M;  4K0K M;  2DVW B;  2UXB M;  2Z4S A;  4IBE A;  1XMO M;  4KLN A;  4MH0 E;  3SC3 A;  2XGN A;  3U61 B;  2CHV A;  3I4V A;  4IBB A;  4L4U A;  3T1H M;  3LQR A;  4X66 M;  3HWS A;  1NJF A;  5DYI A;  1MX0 A;  1HNX M;  3U5Z A;  3SAS A;  4S12 A;  2F5S A;  3CF6 E;  2ERC A;  1NSF A;  1L2B A;  3W0F A;  1E94 E;  3VKG A;  4A3V B;  4JI4 M;  3RFW A;  1EE8 A;  3B9P A;  4I8O A;  3KS8 A;  1VDD A;  2QBY A;  3THG A;  4NRW A;  3SHF A;  1HNZ M;  3LQQ A;  4REZ A;  4DV3 M;  5ITR A;  4GC9 A;  4HLQ A;  4M9Z A;  3PVS A;  1IN6 A;  3OTO M;  3DOA A;  2FOI C;  3RE8 A;  4B3M M;  3HJ8 A;  2D7E A;  2ZAM A;  2VQF M;  2ZBK B;  1G59 A;  3MK6 A;  5KQ8 A;  3FTF A;  3L28 A;  3GLF B;  3VK8 A;  4JN6 A;  4D81 A;  5KPR A;  1TDH A;  2KZU A;  3HKP A;  4DR5 M;  4JI2 M;  1IN8 A;  3J7A S;  1GVN A;  4P16 A;  2FFJ A;  5ITX E;  1QAN A;  2FNA A;  3U6S A;  2OPF A;  4IJE A;  3J80 S;  2KRK A;  3GLI A;  1J09 A;  1Q3C A;  4L78 A;  2L7I A;  5IZ7 D;  5H37 D;  1YUB A;  1WXQ A;  4GKK M;  1HT1 E;  2I7N A;  4NSO B;  5ITU A;  3GP1 A;  3I4Y A;  2YR0 A;  4BBA A;  3KP0 E;  3U60 B;  2VII A;  3EIH A;  3BOS A;  4XBO A;  5IT9 S;  4ITQ A;  3GQ4 A;  3CF0 A;  3DA1 A;  1G41 A;  3K8Z A;  2RKO A;  2VQE M;  1L2C A;  4RNA A;  2UXD M;  3HU1 A;  3L26 A;  2R46 A;  4DV0 M;  4DR3 M;  2J7N A;  2YQZ A;  4NSR A;  4G6Z A;  5KO3 A;  2HHH M;  3GRU A;  1E9R A;  3DFZ A;  4MGI E;  3HU2 A;  3T1Y M;  4FCW A;  4B3T M;  4LFC M;  2QP9 X;  2P5T A;  1GL6 A;  4LF7 M;  4G4Q A;  4LGY A;  2DZN B;  4JI0 M;  5F3W A;  3FUW A;  5EP4 A;  4RF1 A;  1IBK M;  1HR0 M;  1UM8 A;  4ZPX A;  3HHY A;  4L8R C;  4NXN M;  1XC8 A;  3EIE A;  1TH4 A;  2AHM A;  2XFT A;  2Z7J A;  4LRT A;  3C58 A;  3FTD A;  1QZM A;  3KOX E;  2HL7 A;  4YY3 M;  3TE6 A;  1L8Q A;  4FWD A;  1PM5 A;  2ZAN A;  5BR8 M;  4LF6 M;  2G5G X;  2R18 A;  2C5R A;  4B3R M;  1SXJ D;  4CIS A;  1W5T A;  2V1U A;  2L6O A;  2QEN A;  3L29 A;  2X4A A;  4GKJ M;  5JI2 E;  4QOZ C;  4PDG A;  5A2Q S;  4LF4 M;  4B7F A;  3T38 A;  4JI5 M;  2XLJ A;  4AZF A;  4MM3 B;  3GLH B;  2XSZ D;  2BNK A;  4IIW A;  1Q39 A;  4DR1 M;  4LJA A;  5FLX S;  4X64 M;  4FWG A;  1Z59 A;  5GKN A;  1SXJ C;  3GQ5 A;  5DYG A;  3FYC A;  2EA0 A;  4DV5 M;  4OVZ A;  4DR4 M;  4LJ8 A;  1KYI A;  3FD9 A;  3JAM S;  4GH9 A;  3SYL A;  1QAM A;  2C99 A;  1NNU C;  2W82 A;  2R62 A;  3K92 A;  3PXG A;  2F5O A;  5FTM A;  2F5P A;  3SAR A;  5EQT A;  3SAT A;  1E9S A;  2QZ4 A;  3UZU A;  4DUZ M;  2E5L M;  2CV0 A;  1IBL M;  1JR3 D;  1FNN A;  1I4W A;  3MJ5 A;  3UGJ A;  3IG5 A;  4MB7 A;  1XXH B;  4MGZ E;  2OQ4 A;  1N34 M;  2V1C A;  1NY6 A;  4EIW A;  4JI7 M;  1N32 M;  1DGH A;  3FUX A;  1N36 M;  3LVV A;  2ZM6 M;  2QBY B;  3KOY E;  1JR3 A;  3KSX A;  3L2A A;  2F4V M;  3FUT A;  3U6Q A;  3SYK A;  4LJ7 A;  3WHL A;  4WUR A;  2M60 A;  2C98 A;  4X62 M;  4IBG A;  1K82 A;  2UUA M;  1GLN A;  4DR2 M;  1QAO A;  5EXX A;  5EP1 A;  2C9O A;  4PD2 A;  3SMP A;  2KW0 A;  3QWL A;  5LMN M;  4R3D A;  2LH0 A;  4PCZ A;  3GRY A;  1QVR A;  1OFI A;  4LF8 M;  1J7K A;  3U61 A;  3E9S A;  2Z3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...