2KXEA

N-terminal domain of the dp1 subunit of an archaeal d-family dna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase II small subunit
publication title Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.800 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kxeA00
2KXEA
chains in the Genus database with same CATH superfamily
4LF9M 3W0FA 4FWDA 3GRYA 3FTCA 4DR6M 4FCVA 1OIPA 1WJ7A 1GL6A 3NBIA 2XH9A 1D0KA 1VEGA 4QNRA 2RKOA 4RF1A 3ZC7B 3GPPA 4GHAA 5H37D 4IBKA 4OVZA 4KODA 2EUCA 2N35A 2DWMA 2KRKA 1DO0A 3J7BA 1VDLA 3QYEA 1L2CA 5E6JA 1ZMVA 1QAMA 3MHVC 4NL4H 2VF7A 1NNJA 1G59A 3HZJA 1HJPA 3Q8GA 4I8OA 2V1CA 3EIEA 2R6FA 3U6MA 2R4JA 1UM8A 1N77A 1Z5AA 1NVMA 4X66M 1NHGC 1J7KA 2DI0A 2J7NA 2QPAA 4II7A 1Z59A 4DV7M 3L25A 4AKGA 4CISA 3VK7A 4GH9A 3WHKA 8CATA 2X4AA 5DNYA 2KDLA 1J09A 3ZH9B 3LVVA 3GLGB 3C3DA 4M0WA 3SATA 1IY1A 4QOSA 4MB7A 1WGNA 2Z3XA 3JR5A 1PJQA 2CHGA 4LZJA 4LJ9A 3ZCBB 3E4RA 1QYRA 2OPFA 4Z6YA 3RE8A 3AFHA 4OW0A 2GNOA 1NO1A 4R3DA 4CHTB 3JAMS 3SC3A 5BR8M 5LMNM 1G71A 2DXIA 1C7YA 4LGYA 5C18A 3FD9A 2D7GA 5FTJA 4F1IA 2LH0A 1N75A 1HNWM 4PCZA 2CV0A 3KFUG 2M60A 3I01M 3SMSA 3HKPA 4PDIA 2CV1A 2APLA 1QDTA 2H5XA 1OKSA 2M5ZA 2YR0A 3M0EA 4GC5A 3F92A 1IY2A 1TTEA 2QBYB 1XXHB 3HHZA 2KNAA 2KZUA 2CE7A 2MR9A 1R6BX 1L1TA 4IJFA 1E9SA 4AG5A 2FNAA 4MH0E 3J7AS 2ZAOA 3KOWE 1OQYA 5DYIA 1K3XA 2JY7A 3CGWA 2KA6B 3HHWA 3MK6A 4LGMA 1Z6TA 3B7ZA 1KSFX 4HLQA 2ZM6M 3GP1A 4X65M 3VDPA 2CWBA 4IBJA 2L7IA 4M9ZA 2XSZA 3FUXA 2FE8A 3J2PB 3SMPA 1IN6A 3U6QA 1PJIA 4NSOB 1C1KA 2FH0A 1IXSB 1JR3A 3PNYA 1R2ZA 3HU1A 3FTEA 5KPZA 4LF4M 4I81A 4X62M 4GITA 4S12A 1R5LA 4KO8A 5EP3A 4XK8F 3RGSA 4JI2M 2CRUA 2J5YA 4NOOB 4L8RC 4GC9A 1NV8A 1CUKA 3TE6A 4JYAM 2UUBM 5F3WA 2KNZA 2DHYA 1OJLA 1MJGM 1SXJD 4L4UA 3FE3A 3T15A 3HU3A 2DWLA 4FWHA 4G3OA 1D0LA 2CUZA 1IQPA 3SHGB 5EP4A 1XMOM 5KPRA 1OAOC 2BWBA 3KP0E 1I4WA 4X64M 3UK6A 7CATA 3GLIA 3J81S 2DZOB 4WP2A 2ZAMA 3UGJA 1IN8A 2OO9A 4HEOA 1NV9A 4GEWA 3CF2A 2DAMA 2Y20A 4HL4A 2DNAA 4MGHA 3UJNA 1NHWC 1OAIA 2VQFM 2UUAM 2BWEA 4LJ6A 3W68A 4YHHM 3SAUA 4LJ8A 2LTUA 3GPUA 1VEKA 1S3SA 1G41A 2QNJA 3GLFA 2JY5A 3HHYA 3GPXA 4DV1M 5A2QS 1P3QQ 3AV0A 1PJJA 1TH2A 1JR3E 3A46A 1XXHA 1IXRC 4CJ6A 4BBAA 1D2NA 1VEJA 3GLHB 1QUSA 3VK8A 1OFHA 1PGYA 3B89A 5BPVA 5E26A 2WZJA 1R7RA 4K0KM 3IG8A 4CIZA 5KQ8A 1PM5A 4LFCM 3FKEA 4A3VB 4B7HA 4JI3M 4Y28F 2B3TA 4JV5M 4AKIA 4KT0F 4LF6M 4B3TM 3U60A 2C98A 2FS1A 1DGBA 3SYLA 4B7GA 2CEAA 3R9XB 3UZUA 2R4EA 1QUTA 3H4JA 3FYDA 3KS4A 3I51A 4JI0M 3GLIE 3TL4X 2BJVA 4AZFA 3AKZA 4DUZM 1GL7A 3FUTA 5KO3A 2F5NA 4F2LA 1GJSA 5FSWA 1IXZA 2DAGA 5IWAM 2HKJA 1X37A 1RU3A 3KSXA 2DKLA 1N34M 1V92A 2VIIA 4QNMA 2L4EA 4JI1M 2UUCM 4GKJM 2JP7A 3JR4A 2R18A 3CF0A 1QAOA 5ITYA 2L09A 3GLFE 4L16A 1SXJB 4NRWA 2D7HA 4LJ5A 4M0DA 1L8QA 3T1HM 4DV5M 4IJEA 1I94M 1XXHE 3VDUA 3LMMA 4DR4M 1ZAEA 3B7QA 2EKKA 4TUWA 1GVNA 1TR8A 2JUJA 2JNHA 2A5YB 2V6ZM 2UXBM 1TDZA 4D82A 3KW6A 3U6LA 3C58A 1Z5CA 2HL7A 3FRHA 4FW9A 2NQ8C 4NSRA 4NC6A 4DV6M 1OIZA 4PD2A 1ZQ9A 2ZTCA 4P17A 4LJ7A 4QHTA 4JI8M 1JQJC 1WIVA 2QP9X 2R44A 3AOGA 3U6PA 3EIHA 1XC8A 3L29A 2VQEM 4PDGA 3E21A 1MN3A 2Z7JA 2G3QA 4Z8XA 3U6OA 3J80S 1IN5A 2OOBA 4MM3B 3U5ZA 1E94E 1T43A 1KFVA 3FTFA 4IBBA 2VF8A 1IN7A 2UXDM 3E9SA 4R71A 1KYIA 1N78A 1H6UA 3LVWA 3B9PA 4IBIA 2KW0A 3FTDA 2G5GX 4CGYB 1HT1E 3I4YA 5FTMA 1IBMM 4DV4M 2HAKA 1L2DA 1TH3A 3U61B 3T38A 5EXTA 5FTLA 2CV2A 2JZ1A 2KNVA 2LVAA 3C3EA 3Q8XA 1GKIA 1XWIA 1IBKM 2LXEA 5FTKA 4EIWA 3SASA 1NY5A 3SYKA 5C1BA 4LF7M 3I4VA 2O01F 4B3MM 4L6V6 1N33M 1LV7A 1AUAA 5EJCA 2K6BA 2EO2A 1YSYA 2ZANA 4LJ4A 1HNXM 1IFYA 4D81A 2C96A 3HY5A 1V34A 1G8PA 1T3TA 4NXNM 5ITQA 3A42A 2XGNA 3LW5F 2L2DA 4LRSA 1Y8GA 1G4AE 1WGLA 2CP8A 4M9SA 3W67A 2R62A 1DGHB 2LWXA 3AOEC 1W5TA 5KPTA 3L26A 3ZQJA 2O5RA 2YFQA 2XF3A 3GRUA 4L15A 1Z5BA 2Y21A 4G4NA 2L4FA 1Q39A 1XNRM 1HQYE 2QENA 2RGOA 3DZDA 2C99A 3GLGA 4DR2M 3IG5A 1UFZA 4JI7M 1QZMA 1OTRA 2EKFA 4DV0M 3T6PA 2C5RA 5DFLA 2X49A 3MMPA 5EXSA 2UXCM 1WR1B 1ZV1A 3DA1A 3GQ4A 4IBFA 3WHLA 1PJSA 1L1ZA 2KRUA 2JZ0A 4UN2B 2LBCA 2MJ5B 4OVZB 4AG6A 5IREB 4JI5M 4DR3M 1MU5A 1PJTA 5IZ7D 2XSZD 3QWLA 2G8LA 3QAUA 1QVRA 1TH4A 4FVMA 1R2YA 4FD2A 3IHPA 2YNMD 1T6OA 2WSFF 4LY6A 3VLFB 2QBYA 2BNKA 4QOZC 4MGIE 2KEBA 1LTMA 2MH8A 4D80A 3MJ5A 1GJTA 2JXNA 5DYGA 1DGFA 5ITRA 2L6OA 4JI4M 4LG2A 3L2AA 2UU9M 2LVQD 2QQ8A 3D8BA 3GLGE 1NJGA 1VQ1A 1XMQM 3K2LA 4WURA 1G3IA 2QHOB 5JI3E 3SFZA 1IXSA 1ORYB 1JB0F 2H1RA 2FOIC 1E9RA 4B7FA 2CHVA 4LF5M 4XBOA 1W5SA 3BBZA 3TQSA 2DWNA 1SG9A 3LCUA 3ILKA 2Z4SA 1SXJC 4GHLA 1ZMUA 3E46A 5IT9S 3K9OA 3T1YM 4DUYM 2DAEA 3M7GA 1MX0A 3NWLA 4XGIA 4M9XA 3TWMA 3SHFA 1IN4A 3HGIA 2JWSA 1YUBA 4RNAA 2DHRA 4KHPM 3HJ8A 3AOEA 4AW4A 4DBGB 4RKUF 1HNZM 4NXMM 5EQTA 2AHMA 3KVWA 5L8RF 3GPYA 1NJFA 3AJIB 2OOAA 1Q3BA 4MGKE 2ERCA 2XZFA 5FLXS 2P5TA 2X8AA 5ITXA 2F5PA 1EE8A 3HHXA 3KOZE 2KXEA 5EP2A 4LZZA 4AI6A 1IBLM 1XHBA 3KP1E 3FYCA 2DAIA 3KSJA 4ZPXA 2DZLA 2Z8YM 1OFIA 1YE9A 1GO5A 1GABA 3DFZA 2Y0TA 2DAKA 3LQQA 1DO2A 2W82A 3GO8A 2E5LM 3CF6E 3RGPA 1NNUC 2R0IA 1QAQA 3HWSA 5EXXA 2LHCA 3VKHA 4GMQA 3B7NA 3GLHA 3K92A 3GQ5A 4B3RM 2LHGA 2Z4RA 4LF8M 2XLJA 5FTNA 4IBDA 3KOYE 1HQCA 3VKGA 4Q7JA 2KZSA 4DR5M 2F5SA 1NY6A 3VFDA 4G6ZA 2R65A 5ITUA 3J27B 5GKNA 4GRIA 1DV0A 3QYBA 1Q3CA 4IIWA 3PXGA 2V1UA 1DGGA 2R45A 2DWZB 4JN6A 3GQ3A 4DR1M 1YLAA 2DENA 2Y0QA 3U6SA 3M6AA 3GLIB 2JY8A 4LJAA 4G4QA 3BXWA 2QCUA 3K8ZA 3H4MA 1R4GA 5ITXE 3OTOM 3PFIA 4I5SA 2GQFA 3LCVB 1BVSA 4AQYM 3U6EA 3GRVA 1SXJA 3A45A 1NSFA 4ITQA 4KLNA 4L78A 3GLFB 1N36M 4OU7A 4JI6M 3SAVA 1FJGM 2K0BX 2K47A 2MROB 4REZA 4WW0A 2LNHC 1V33A 4IBCA 2DVWB 2F5OA 3W0LB 4B3SM 3GLHE 3BOSA 1QDRA 1HR0M 2D7EA 1IY0A 2XFTA 3KXEC 3SAWA 1L2BA 2I7PA 1D0MA 3DOAA 4DV3M 4PT5A 2JA2A 1XB2B 5EXPA 2HCBA 4FCTA 4FCWA 2EJSA 3AL0C 3NBXX 3TWLA 3U60B 2Q2EB 4P16A 1FNNA 4G4OA 3RFWA 3LQRA 2BJWA 4MGZE 3KDSE 2C9OA 3FUWA 3GRRA 3PVSA 4RF0A 2C9CA 3FRIA 3HJSA 4BB9A 5ITTA 2XZUA 3HU2A 1K3WA 1TGUA 4LFAM 2CFOA 1GLNA 4YY3M 2HWJA 4LCBA 4LFBM 4G4RA 1XNQM 4NRVA 2LVPC 1HT2E 1Q02A 3I04M 3TWKA 3KOXE 2RRUA 2I7NA 1QZEA 3R8FA 2FFJA 1SXJE 2ZBKB 1A5TA 4R7GA 3KS8A 4BLCA 1EFUB 1JR3D 1PRBA 3D8LA 3PNVA 2JY6B 2F4VM 4AKHA 1VG5A 4W5WA 1VDDA 3U61A 1IM2A 4DR7M 2HHHM 2L7HA 4DV2M 2F5QA 3SBJA 1N32M 5KQDA 1QQWA 1ZMWA 4IBEA 5JI2E 1J5EM 3K9PA 5EP1A 2OQ4A 5LMUM 2K9DA 1K82A 4MGYE 2R46A 3V76A 3TPZA 1WXQA 2WSEF 2XEPA 4I4LA 2ZTDA 2LVNC 4GIPA 4ANRA 3L28A 3FUVA 2YQZA 2QSFX 3A98B 3HJQA 2MGWA 3FUUA 3C9PA 2RGHA 1TDHA 2O25A 3UMMA 1AIPC 3SARA 1DGHA 1WHCA 1QANA 2QZ4A 3B74A 2WSCF 2DZNB 4OX9M 3U5ZB 1EIJA 4B08A 4IBGA 4GKKM 3CTWB 3HX3A 2VDBB 4JXJA 3THGA 4QHSA 2LVOC 2XFSA 2EA0A 1E32A 3U6DA 1F4IA 3K1JA 3L27A 3IECA 2CHQA 2J7OA 4FWGA 2KHHA 4LRTA 1TF0B 3U6CA
chains in the Genus database with same CATH topology
4LF9M 3W0FA 4FWDA 3GRYA 3FTCA 4DR6M 4FCVA 1GL6A 3NBIA 2XH9A 4QNRA 4RF1A 2RKOA 3ZC7B 4GHAA 3GPPA 5H37D 4IBKA 4OVZA 4KODA 2EUCA 2DWMA 2KRKA 1DO0A 3J7BA 1L2CA 5E6JA 1QAMA 3MHVC 4NL4H 1NNJA 1G59A 4I8OA 2V1CA 3EIEA 3U6MA 2R4JA 1UM8A 1N77A 1Z5AA 1NVMA 4X66M 1NHGC 1J7KA 2J7NA 2QPAA 4II7A 1Z59A 4DV7M 3L25A 4AKGA 4CISA 3VK7A 4GH9A 3WHKA 8CATA 2X4AA 5DNYA 1J09A 3ZH9B 3LVVA 3GLGB 4M0WA 3SATA 1IY1A 4QOSA 4MB7A 2Z3XA 3JR5A 4LZJA 2CHGA 4LJ9A 3ZCBB 3E4RA 1QYRA 2OPFA 4Z6YA 3RE8A 3AFHA 4OW0A 4R3DA 4CHTB 3JAMS 3SC3A 5BR8M 5LMNM 2DXIA 4LGYA 5C18A 3FD9A 2D7GA 5FTJA 2LH0A 1N75A 1HNWM 4PCZA 2CV0A 3KFUG 2M60A 3SMSA 3HKPA 4PDIA 2CV1A 2M5ZA 2YR0A 3M0EA 4GC5A 1IY2A 2QBYB 1XXHB 3HHZA 2KZUA 2CE7A 1R6BX 1L1TA 4IJFA 1E9SA 4AG5A 2FNAA 4MH0E 3J7AS 2ZAOA 3KOWE 5DYIA 1K3XA 4LGMA 2KA6B 3HHWA 3MK6A 1Z6TA 2ZM6M 1KSFX 4HLQA 3GP1A 4X65M 3VDPA 4IBJA 2L7IA 4M9ZA 2XSZA 3FUXA 2FE8A 3J2PB 3SMPA 1IN6A 3U6QA 1PJIA 4NSOB 1C1KA 3PNYA 1IXSB 1JR3A 1R2ZA 3HU1A 3FTEA 5KPZA 4LF4M 4I81A 4X62M 4GITA 4S12A 4KO8A 3RGSA 5EP3A 4JI2M 4L8RC 4NOOB 4GC9A 4JYAM 3TE6A 2UUBM 5F3WA 1OJLA 1SXJD 3T15A 4L4UA 2DWLA 3HU3A 4FWHA 2CUZA 1IQPA 3SHGB 5EP4A 1XMOM 5KPRA 3KP0E 1I4WA 4X64M 3UK6A 7CATA 3GLIA 3J81S 2DZOB 2ZAMA 3UGJA 1IN8A 3CF2A 2Y20A 4HL4A 4MGHA 3UJNA 1NHWC 2UUAM 2VQFM 4LJ6A 4YHHM 3SAUA 4LJ8A 3GPUA 1S3SA 1G41A 3GLFA 3HHYA 3GPXA 4DV1M 5A2QS 1PJJA 3AV0A 1TH2A 3A46A 1XXHA 1IXRC 4BBAA 1D2NA 3GLHB 3VK8A 1OFHA 5BPVA 5E26A 1R7RA 4K0KM 3IG8A 5KQ8A 1PM5A 4LFCM 3FKEA 4A3VB 4B7HA 4JI3M 4JV5M 4AKIA 4LF6M 4B3TM 3U60A 2C98A 3SYLA 1DGBA 4B7GA 2CEAA 3R9XB 3UZUA 2R4EA 3FYDA 3KS4A 3I51A 4JI0M 3TL4X 2BJVA 4AZFA 3AKZA 4DUZM 1GL7A 3FUTA 5KO3A 2F5NA 5FSWA 1IXZA 5IWAM 2HKJA 1X37A 3KSXA 1N34M 2VIIA 4QNMA 4JI1M 2UUCM 4GKJM 3JR4A 2R18A 3CF0A 1QAOA 5ITYA 2L09A 4L16A 1SXJB 4NRWA 2D7HA 4LJ5A 4M0DA 1L8QA 3T1HM 4DV5M 4IJEA 1I94M 3VDUA 3LMMA 4DR4M 1ZAEA 4TUWA 1GVNA 2A5YB 2V6ZM 2UXBM 1TDZA 4D82A 3KW6A 3U6LA 3C58A 1Z5CA 2HL7A 4FW9A 4NSRA 2NQ8C 4DV6M 4PD2A 1ZQ9A 4JI8M 4LJ7A 4QHTA 1JQJC 3AOGA 2QP9X 3U6PA 1XC8A 3EIHA 3L29A 2VQEM 4PDGA 2Z7JA 4Z8XA 3U6OA 3J80S 1IN5A 4MM3B 3U5ZA 1E94E 3FTFA 1KFVA 4IBBA 1IN7A 2UXDM 3E9SA 1KYIA 1N78A 1H6UA 3LVWA 3B9PA 4IBIA 2KW0A 3FTDA 2G5GX 4CGYB 1HT1E 3I4YA 5FTMA 1IBMM 4DV4M 1L2DA 1TH3A 3U61B 3T38A 5EXTA 5FTLA 2CV2A 3Q8XA 1GKIA 1XWIA 1IBKM 2LXEA 5FTKA 4EIWA 3SASA 1NY5A 3SYKA 5C1BA 4LF7M 3I4VA 4B3MM 1N33M 1LV7A 5EJCA 2EO2A 1YSYA 2ZANA 4LJ4A 1HNXM 4D81A 2C96A 1G8PA 1T3TA 4NXNM 5ITQA 3A42A 2XGNA 4LRSA 1G4AE 4M9SA 5KPTA 2R62A 1DGHB 2LWXA 3AOEC 1W5TA 3L26A 2O5RA 2YFQA 2XF3A 3GRUA 4L15A 1Z5BA 2Y21A 4G4NA 1XNRM 1Q39A 1HQYE 2QENA 2RGOA 3DZDA 2C99A 3GLGA 4DR2M 3IG5A 4JI7M 1QZMA 4DV0M 2C5RA 2X49A 5EXSA 2UXCM 3GQ4A 4IBFA 3WHLA 1L1ZA 2KRUA 4OVZB 4AG6A 5IREB 4JI5M 4DR3M 1MU5A 5IZ7D 2XSZD 3QWLA 2G8LA 3QAUA 1QVRA 1TH4A 4FVMA 1R2YA 4FD2A 2YNMD 4LY6A 3VLFB 2QBYA 2BNKA 4QOZC 4MGIE 2KEBA 4D80A 3MJ5A 5DYGA 5ITRA 1DGFA 4JI4M 2L6OA 4LG2A 3L2AA 2UU9M 3D8BA 1NJGA 1XMQM 3K2LA 4WURA 1G3IA 5JI3E 3SFZA 1ORYB 2H1RA 2FOIC 1E9RA 4B7FA 2CHVA 4LF5M 4XBOA 1W5SA 3TQSA 2DWNA 3ILKA 2Z4SA 1SXJC 4GHLA 5IT9S 3T1YM 4DUYM 3M7GA 1MX0A 3NWLA 4XGIA 4M9XA 3TWMA 3SHFA 1IN4A 3HGIA 1YUBA 4RNAA 2DHRA 4KHPM 3HJ8A 3AOEA 4AW4A 1HNZM 4NXMM 5EQTA 2AHMA 3KVWA 3GPYA 1NJFA 3AJIB 1Q3BA 4MGKE 2ERCA 2XZFA 5FLXS 2P5TA 2X8AA 5ITXA 2F5PA 1EE8A 3HHXA 3KOZE 2KXEA 5EP2A 4LZZA 4AI6A 1IBLM 1XHBA 3KP1E 3FYCA 3KSJA 4ZPXA 1OFIA 1YE9A 3DFZA 2Y0TA 3LQQA 1DO2A 2W82A 3GO8A 2E5LM 3CF6E 3RGPA 1NNUC 3HWSA 1QAQA 5EXXA 3VKHA 4GMQA 3GLHA 3K92A 3GQ5A 4B3RM 2Z4RA 4LF8M 2XLJA 5FTNA 4IBDA 3KOYE 1HQCA 3VKGA 2KZSA 4DR5M 2F5SA 1NY6A 3VFDA 4G6ZA 2R65A 5ITUA 3J27B 5GKNA 4GRIA 1Q3CA 4IIWA 3PXGA 2V1UA 1DGGA 2R45A 2DWZB 4JN6A 3GQ3A 4DR1M 2Y0QA 3U6SA 3M6AA 3GLIB 4LJAA 4G4QA 2QCUA 3K8ZA 3H4MA 5ITXE 3OTOM 3PFIA 4I5SA 4AQYM 3U6EA 3GRVA 1SXJA 3A45A 1NSFA 4ITQA 4KLNA 4L78A 3GLFB 1N36M 4OU7A 4JI6M 3SAVA 1FJGM 2K47A 4WW0A 4REZA 2LNHC 4IBCA 2DVWB 2F5OA 3W0LB 4B3SM 3BOSA 1HR0M 2D7EA 1IY0A 2XFTA 3KXEC 3SAWA 1L2BA 2I7PA 3DOAA 4DV3M 4PT5A 2JA2A 5EXPA 2HCBA 4FCTA 4FCWA 3AL0C 3TWLA 3U60B 2Q2EB 4P16A 1FNNA 4G4OA 3RFWA 3LQRA 2BJWA 4MGZE 3KDSE 2C9OA 3FUWA 3GRRA 3PVSA 4RF0A 2C9CA 3HJSA 4BB9A 5ITTA 2XZUA 3HU2A 1K3WA 1TGUA 4LFAM 2CFOA 1GLNA 4YY3M 4LCBA 4LFBM 4G4RA 1XNQM 4NRVA 1HT2E 3TWKA 3KOXE 2I7NA 3R8FA 2FFJA 1SXJE 2ZBKB 4R7GA 3KS8A 4BLCA 1JR3D 3D8LA 3PNVA 2F4VM 4AKHA 4W5WA 1VDDA 3U61A 1IM2A 4DR7M 2HHHM 2L7HA 4DV2M 2F5QA 3SBJA 1N32M 5KQDA 1QQWA 4IBEA 5JI2E 1J5EM 5EP1A 2OQ4A 5LMUM 1K82A 4MGYE 2R46A 3TPZA 1WXQA 2XEPA 4I4LA 4GIPA 3L28A 3FUVA 2YQZA 3A98B 3HJQA 3FUUA 2RGHA 1TDHA 3UMMA 3SARA 1DGHA 2QZ4A 1QANA 2DZNB 4OX9M 3U5ZB 4B08A 4IBGA 4GKKM 3CTWB 4JXJA 3THGA 4QHSA 2XFSA 2EA0A 1E32A 3U6DA 3K1JA 3L27A 2CHQA 2J7OA 4FWGA 4LRTA 3DA1A 3U6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXE A; 
#chains in the Genus database with same CATH topology
 4LF9 M;  3W0F A;  4FWD A;  3GRY A;  3FTC A;  4DR6 M;  4FCV A;  1OIP A;  1WJ7 A;  1GL6 A;  3NBI A;  2XH9 A;  1D0K A;  1VEG A;  4QNR A;  2RKO A;  4RF1 A;  3ZC7 B;  3GPP A;  4GHA A;  5H37 D;  4IBK A;  4OVZ A;  4KOD A;  2EUC A;  2N35 A;  2DWM A;  2KRK A;  1DO0 A;  3J7B A;  1VDL A;  3QYE A;  1L2C A;  5E6J A;  1ZMV A;  1QAM A;  3MHV C;  4NL4 H;  2VF7 A;  1NNJ A;  1G59 A;  3HZJ A;  1HJP A;  3Q8G A;  4I8O A;  2V1C A;  3EIE A;  2R6F A;  3U6M A;  2R4J A;  1UM8 A;  1N77 A;  1Z5A A;  1NVM A;  4X66 M;  1NHG C;  1J7K A;  2DI0 A;  2J7N A;  2QPA A;  4II7 A;  1Z59 A;  4DV7 M;  3L25 A;  4AKG A;  4CIS A;  3VK7 A;  4GH9 A;  3WHK A;  8CAT A;  2X4A A;  5DNY A;  2KDL A;  1J09 A;  3ZH9 B;  3LVV A;  3GLG B;  3C3D A;  4M0W A;  3SAT A;  1IY1 A;  4QOS A;  4MB7 A;  1WGN A;  2Z3X A;  3JR5 A;  1PJQ A;  2CHG A;  4LZJ A;  4LJ9 A;  3ZCB B;  3E4R A;  1QYR A;  2OPF A;  4Z6Y A;  3RE8 A;  3AFH A;  4OW0 A;  2GNO A;  1NO1 A;  4R3D A;  4CHT B;  3JAM S;  3SC3 A;  5BR8 M;  5LMN M;  1G71 A;  2DXI A;  1C7Y A;  4LGY A;  5C18 A;  3FD9 A;  2D7G A;  5FTJ A;  4F1I A;  2LH0 A;  1N75 A;  1HNW M;  4PCZ A;  2CV0 A;  3KFU G;  2M60 A;  3I01 M;  3SMS A;  3HKP A;  4PDI A;  2CV1 A;  2APL A;  1QDT A;  2H5X A;  1OKS A;  2M5Z A;  2YR0 A;  3M0E A;  4GC5 A;  3F92 A;  1IY2 A;  1TTE A;  2QBY B;  1XXH B;  3HHZ A;  2KNA A;  2KZU A;  2CE7 A;  2MR9 A;  1R6B X;  1L1T A;  4IJF A;  1E9S A;  4AG5 A;  2FNA A;  4MH0 E;  3J7A S;  2ZAO A;  3KOW E;  1OQY A;  5DYI A;  1K3X A;  2JY7 A;  3CGW A;  2KA6 B;  3HHW A;  3MK6 A;  4LGM A;  1Z6T A;  3B7Z A;  1KSF X;  4HLQ A;  2ZM6 M;  3GP1 A;  4X65 M;  3VDP A;  2CWB A;  4IBJ A;  2L7I A;  4M9Z A;  2XSZ A;  3FUX A;  2FE8 A;  3J2P B;  3SMP A;  1IN6 A;  3U6Q A;  1PJI A;  4NSO B;  1C1K A;  2FH0 A;  1IXS B;  1JR3 A;  3PNY A;  1R2Z A;  3HU1 A;  3FTE A;  5KPZ A;  4LF4 M;  4I81 A;  4X62 M;  4GIT A;  4S12 A;  1R5L A;  4KO8 A;  5EP3 A;  4XK8 F;  3RGS A;  4JI2 M;  2CRU A;  2J5Y A;  4NOO B;  4L8R C;  4GC9 A;  1NV8 A;  1CUK A;  3TE6 A;  4JYA M;  2UUB M;  5F3W A;  2KNZ A;  2DHY A;  1OJL A;  1MJG M;  1SXJ D;  4L4U A;  3FE3 A;  3T15 A;  3HU3 A;  2DWL A;  4FWH A;  4G3O A;  1D0L A;  2CUZ A;  1IQP A;  3SHG B;  5EP4 A;  1XMO M;  5KPR A;  1OAO C;  2BWB A;  3KP0 E;  1I4W A;  4X64 M;  3UK6 A;  7CAT A;  3GLI A;  3J81 S;  2DZO B;  4WP2 A;  2ZAM A;  3UGJ A;  1IN8 A;  2OO9 A;  4HEO A;  1NV9 A;  4GEW A;  3CF2 A;  2DAM A;  2Y20 A;  4HL4 A;  2DNA A;  4MGH A;  3UJN A;  1NHW C;  1OAI A;  2VQF M;  2UUA M;  2BWE A;  4LJ6 A;  3W68 A;  4YHH M;  3SAU A;  4LJ8 A;  2LTU A;  3GPU A;  1VEK A;  1S3S A;  1G41 A;  2QNJ A;  3GLF A;  2JY5 A;  3HHY A;  3GPX A;  4DV1 M;  5A2Q S;  1P3Q Q;  3AV0 A;  1PJJ A;  1TH2 A;  1JR3 E;  3A46 A;  1XXH A;  1IXR C;  4CJ6 A;  4BBA A;  1D2N A;  1VEJ A;  3GLH B;  1QUS A;  3VK8 A;  1OFH A;  1PGY A;  3B89 A;  5BPV A;  5E26 A;  2WZJ A;  1R7R A;  4K0K M;  3IG8 A;  4CIZ A;  5KQ8 A;  1PM5 A;  4LFC M;  3FKE A;  4A3V B;  4B7H A;  4JI3 M;  4Y28 F;  2B3T A;  4JV5 M;  4AKI A;  4KT0 F;  4LF6 M;  4B3T M;  3U60 A;  2C98 A;  2FS1 A;  1DGB A;  3SYL A;  4B7G A;  2CEA A;  3R9X B;  3UZU A;  2R4E A;  1QUT A;  3H4J A;  3FYD A;  3KS4 A;  3I51 A;  4JI0 M;  3GLI E;  3TL4 X;  2BJV A;  4AZF A;  3AKZ A;  4DUZ M;  1GL7 A;  3FUT A;  5KO3 A;  2F5N A;  4F2L A;  1GJS A;  5FSW A;  1IXZ A;  2DAG A;  5IWA M;  2HKJ A;  1X37 A;  1RU3 A;  3KSX A;  2DKL A;  1N34 M;  1V92 A;  2VII A;  4QNM A;  2L4E A;  4JI1 M;  2UUC M;  4GKJ M;  2JP7 A;  3JR4 A;  2R18 A;  3CF0 A;  1QAO A;  5ITY A;  2L09 A;  3GLF E;  4L16 A;  1SXJ B;  4NRW A;  2D7H A;  4LJ5 A;  4M0D A;  1L8Q A;  3T1H M;  4DV5 M;  4IJE A;  1I94 M;  1XXH E;  3VDU A;  3LMM A;  4DR4 M;  1ZAE A;  3B7Q A;  2EKK A;  4TUW A;  1GVN A;  1TR8 A;  2JUJ A;  2JNH A;  2A5Y B;  2V6Z M;  2UXB M;  1TDZ A;  4D82 A;  3KW6 A;  3U6L A;  3C58 A;  1Z5C A;  2HL7 A;  3FRH A;  4FW9 A;  2NQ8 C;  4NSR A;  4NC6 A;  4DV6 M;  1OIZ A;  4PD2 A;  1ZQ9 A;  2ZTC A;  4P17 A;  4LJ7 A;  4QHT A;  4JI8 M;  1JQJ C;  1WIV A;  2QP9 X;  2R44 A;  3AOG A;  3U6P A;  3EIH A;  1XC8 A;  3L29 A;  2VQE M;  4PDG A;  3E21 A;  1MN3 A;  2Z7J A;  2G3Q A;  4Z8X A;  3U6O A;  3J80 S;  1IN5 A;  2OOB A;  4MM3 B;  3U5Z A;  1E94 E;  1T43 A;  1KFV A;  3FTF A;  4IBB A;  2VF8 A;  1IN7 A;  2UXD M;  3E9S A;  4R71 A;  1KYI A;  1N78 A;  1H6U A;  3LVW A;  3B9P A;  4IBI A;  2KW0 A;  3FTD A;  2G5G X;  4CGY B;  1HT1 E;  3I4Y A;  5FTM A;  1IBM M;  4DV4 M;  2HAK A;  1L2D A;  1TH3 A;  3U61 B;  3T38 A;  5EXT A;  5FTL A;  2CV2 A;  2JZ1 A;  2KNV A;  2LVA A;  3C3E A;  3Q8X A;  1GKI A;  1XWI A;  1IBK M;  2LXE A;  5FTK A;  4EIW A;  3SAS A;  1NY5 A;  3SYK A;  5C1B A;  4LF7 M;  3I4V A;  2O01 F;  4B3M M;  4L6V 6;  1N33 M;  1LV7 A;  1AUA A;  5EJC A;  2K6B A;  2EO2 A;  1YSY A;  2ZAN A;  4LJ4 A;  1HNX M;  1IFY A;  4D81 A;  2C96 A;  3HY5 A;  1V34 A;  1G8P A;  1T3T A;  4NXN M;  5ITQ A;  3A42 A;  2XGN A;  3LW5 F;  2L2D A;  4LRS A;  1Y8G A;  1G4A E;  1WGL A;  2CP8 A;  4M9S A;  3W67 A;  2R62 A;  1DGH B;  2LWX A;  3AOE C;  1W5T A;  5KPT A;  3L26 A;  3ZQJ A;  2O5R A;  2YFQ A;  2XF3 A;  3GRU A;  4L15 A;  1Z5B A;  2Y21 A;  4G4N A;  2L4F A;  1Q39 A;  1XNR M;  1HQY E;  2QEN A;  2RGO A;  3DZD A;  2C99 A;  3GLG A;  4DR2 M;  3IG5 A;  1UFZ A;  4JI7 M;  1QZM A;  1OTR A;  2EKF A;  4DV0 M;  3T6P A;  2C5R A;  5DFL A;  2X49 A;  3MMP A;  5EXS A;  2UXC M;  1WR1 B;  1ZV1 A;  3DA1 A;  3GQ4 A;  4IBF A;  3WHL A;  1PJS A;  1L1Z A;  2KRU A;  2JZ0 A;  4UN2 B;  2LBC A;  2MJ5 B;  4OVZ B;  4AG6 A;  5IRE B;  4JI5 M;  4DR3 M;  1MU5 A;  1PJT A;  5IZ7 D;  2XSZ D;  3QWL A;  2G8L A;  3QAU A;  1QVR A;  1TH4 A;  4FVM A;  1R2Y A;  4FD2 A;  3IHP A;  2YNM D;  1T6O A;  2WSF F;  4LY6 A;  3VLF B;  2QBY A;  2BNK A;  4QOZ C;  4MGI E;  2KEB A;  1LTM A;  2MH8 A;  4D80 A;  3MJ5 A;  1GJT A;  2JXN A;  5DYG A;  1DGF A;  5ITR A;  2L6O A;  4JI4 M;  4LG2 A;  3L2A A;  2UU9 M;  2LVQ D;  2QQ8 A;  3D8B A;  3GLG E;  1NJG A;  1VQ1 A;  1XMQ M;  3K2L A;  4WUR A;  1G3I A;  2QHO B;  5JI3 E;  3SFZ A;  1IXS A;  1ORY B;  1JB0 F;  2H1R A;  2FOI C;  1E9R A;  4B7F A;  2CHV A;  4LF5 M;  4XBO A;  1W5S A;  3BBZ A;  3TQS A;  2DWN A;  1SG9 A;  3LCU A;  3ILK A;  2Z4S A;  1SXJ C;  4GHL A;  1ZMU A;  3E46 A;  5IT9 S;  3K9O A;  3T1Y M;  4DUY M;  2DAE A;  3M7G A;  1MX0 A;  3NWL A;  4XGI A;  4M9X A;  3TWM A;  3SHF A;  1IN4 A;  3HGI A;  2JWS A;  1YUB A;  4RNA A;  2DHR A;  4KHP M;  3HJ8 A;  3AOE A;  4AW4 A;  4DBG B;  4RKU F;  1HNZ M;  4NXM M;  5EQT A;  2AHM A;  3KVW A;  5L8R F;  3GPY A;  1NJF A;  3AJI B;  2OOA A;  1Q3B A;  4MGK E;  2ERC A;  2XZF A;  5FLX S;  2P5T A;  2X8A A;  5ITX A;  2F5P A;  1EE8 A;  3HHX A;  3KOZ E;  2KXE A;  5EP2 A;  4LZZ A;  4AI6 A;  1IBL M;  1XHB A;  3KP1 E;  3FYC A;  2DAI A;  3KSJ A;  4ZPX A;  2DZL A;  2Z8Y M;  1OFI A;  1YE9 A;  1GO5 A;  1GAB A;  3DFZ A;  2Y0T A;  2DAK A;  3LQQ A;  1DO2 A;  2W82 A;  3GO8 A;  2E5L M;  3CF6 E;  3RGP A;  1NNU C;  2R0I A;  1QAQ A;  3HWS A;  5EXX A;  2LHC A;  3VKH A;  4GMQ A;  3B7N A;  3GLH A;  3K92 A;  3GQ5 A;  4B3R M;  2LHG A;  2Z4R A;  4LF8 M;  2XLJ A;  5FTN A;  4IBD A;  3KOY E;  1HQC A;  3VKG A;  4Q7J A;  2KZS A;  4DR5 M;  2F5S A;  1NY6 A;  3VFD A;  4G6Z A;  2R65 A;  5ITU A;  3J27 B;  5GKN A;  4GRI A;  1DV0 A;  3QYB A;  1Q3C A;  4IIW A;  3PXG A;  2V1U A;  1DGG A;  2R45 A;  2DWZ B;  4JN6 A;  3GQ3 A;  4DR1 M;  1YLA A;  2DEN A;  2Y0Q A;  3U6S A;  3M6A A;  3GLI B;  2JY8 A;  4LJA A;  4G4Q A;  3BXW A;  2QCU A;  3K8Z A;  3H4M A;  1R4G A;  5ITX E;  3OTO M;  3PFI A;  4I5S A;  2GQF A;  3LCV B;  1BVS A;  4AQY M;  3U6E A;  3GRV A;  1SXJ A;  3A45 A;  1NSF A;  4ITQ A;  4KLN A;  4L78 A;  3GLF B;  1N36 M;  4OU7 A;  4JI6 M;  3SAV A;  1FJG M;  2K0B X;  2K47 A;  2MRO B;  4REZ A;  4WW0 A;  2LNH C;  1V33 A;  4IBC A;  2DVW B;  2F5O A;  3W0L B;  4B3S M;  3GLH E;  3BOS A;  1QDR A;  1HR0 M;  2D7E A;  1IY0 A;  2XFT A;  3KXE C;  3SAW A;  1L2B A;  2I7P A;  1D0M A;  3DOA A;  4DV3 M;  4PT5 A;  2JA2 A;  1XB2 B;  5EXP A;  2HCB A;  4FCT A;  4FCW A;  2EJS A;  3AL0 C;  3NBX X;  3TWL A;  3U60 B;  2Q2E B;  4P16 A;  1FNN A;  4G4O A;  3RFW A;  3LQR A;  2BJW A;  4MGZ E;  3KDS E;  2C9O A;  3FUW A;  3GRR A;  3PVS A;  4RF0 A;  2C9C A;  3FRI A;  3HJS A;  4BB9 A;  5ITT A;  2XZU A;  3HU2 A;  1K3W A;  1TGU A;  4LFA M;  2CFO A;  1GLN A;  4YY3 M;  2HWJ A;  4LCB A;  4LFB M;  4G4R A;  1XNQ M;  4NRV A;  2LVP C;  1HT2 E;  1Q02 A;  3I04 M;  3TWK A;  3KOX E;  2RRU A;  2I7N A;  1QZE A;  3R8F A;  2FFJ A;  1SXJ E;  2ZBK B;  1A5T A;  4R7G A;  3KS8 A;  4BLC A;  1EFU B;  1JR3 D;  1PRB A;  3D8L A;  3PNV A;  2JY6 B;  2F4V M;  4AKH A;  1VG5 A;  4W5W A;  1VDD A;  3U61 A;  1IM2 A;  4DR7 M;  2HHH M;  2L7H A;  4DV2 M;  2F5Q A;  3SBJ A;  1N32 M;  5KQD A;  1QQW A;  1ZMW A;  4IBE A;  5JI2 E;  1J5E M;  3K9P A;  5EP1 A;  2OQ4 A;  5LMU M;  2K9D A;  1K82 A;  4MGY E;  2R46 A;  3V76 A;  3TPZ A;  1WXQ A;  2WSE F;  2XEP A;  4I4L A;  2ZTD A;  2LVN C;  4GIP A;  4ANR A;  3L28 A;  3FUV A;  2YQZ A;  2QSF X;  3A98 B;  3HJQ A;  2MGW A;  3FUU A;  3C9P A;  2RGH A;  1TDH A;  2O25 A;  3UMM A;  1AIP C;  3SAR A;  1DGH A;  1WHC A;  1QAN A;  2QZ4 A;  3B74 A;  2WSC F;  2DZN B;  4OX9 M;  3U5Z B;  1EIJ A;  4B08 A;  4IBG A;  4GKK M;  3CTW B;  3HX3 A;  2VDB B;  4JXJ A;  3THG A;  4QHS A;  2LVO C;  2XFS A;  2EA0 A;  1E32 A;  3U6D A;  1F4I A;  3K1J A;  3L27 A;  3IEC A;  2CHQ A;  2J7O A;  4FWG A;  2KHH A;  4LRT A;  1TF0 B;  3U6C A; 
#chains in the Genus database with same CATH homology
 4LF9 M;  3W0F A;  4FWD A;  3GRY A;  3FTC A;  4DR6 M;  4FCV A;  1GL6 A;  3NBI A;  2XH9 A;  4QNR A;  4RF1 A;  2RKO A;  3ZC7 B;  4GHA A;  3GPP A;  5H37 D;  4IBK A;  4OVZ A;  4KOD A;  2EUC A;  2DWM A;  2KRK A;  1DO0 A;  3J7B A;  1L2C A;  5E6J A;  1QAM A;  3MHV C;  4NL4 H;  1NNJ A;  1G59 A;  4I8O A;  2V1C A;  3EIE A;  3U6M A;  2R4J A;  1UM8 A;  1N77 A;  1Z5A A;  1NVM A;  4X66 M;  1NHG C;  1J7K A;  2J7N A;  2QPA A;  4II7 A;  1Z59 A;  4DV7 M;  3L25 A;  4AKG A;  4CIS A;  3VK7 A;  4GH9 A;  3WHK A;  8CAT A;  2X4A A;  5DNY A;  1J09 A;  3ZH9 B;  3LVV A;  3GLG B;  4M0W A;  3SAT A;  1IY1 A;  4QOS A;  4MB7 A;  2Z3X A;  3JR5 A;  4LZJ A;  2CHG A;  4LJ9 A;  3ZCB B;  3E4R A;  1QYR A;  2OPF A;  4Z6Y A;  3RE8 A;  3AFH A;  4OW0 A;  4R3D A;  4CHT B;  3JAM S;  3SC3 A;  5BR8 M;  5LMN M;  2DXI A;  4LGY A;  5C18 A;  3FD9 A;  2D7G A;  5FTJ A;  2LH0 A;  1N75 A;  1HNW M;  4PCZ A;  2CV0 A;  3KFU G;  2M60 A;  3SMS A;  3HKP A;  4PDI A;  2CV1 A;  2M5Z A;  2YR0 A;  3M0E A;  4GC5 A;  1IY2 A;  2QBY B;  1XXH B;  3HHZ A;  2KZU A;  2CE7 A;  1R6B X;  1L1T A;  4IJF A;  1E9S A;  4AG5 A;  2FNA A;  4MH0 E;  3J7A S;  2ZAO A;  3KOW E;  5DYI A;  1K3X A;  4LGM A;  2KA6 B;  3HHW A;  3MK6 A;  1Z6T A;  2ZM6 M;  1KSF X;  4HLQ A;  3GP1 A;  4X65 M;  3VDP A;  4IBJ A;  2L7I A;  4M9Z A;  2XSZ A;  3FUX A;  2FE8 A;  3J2P B;  3SMP A;  1IN6 A;  3U6Q A;  1PJI A;  4NSO B;  1C1K A;  3PNY A;  1IXS B;  1JR3 A;  1R2Z A;  3HU1 A;  3FTE A;  5KPZ A;  4LF4 M;  4I81 A;  4X62 M;  4GIT A;  4S12 A;  4KO8 A;  3RGS A;  5EP3 A;  4JI2 M;  4L8R C;  4NOO B;  4GC9 A;  4JYA M;  3TE6 A;  2UUB M;  5F3W A;  1OJL A;  1SXJ D;  3T15 A;  4L4U A;  2DWL A;  3HU3 A;  4FWH A;  2CUZ A;  1IQP A;  3SHG B;  5EP4 A;  1XMO M;  5KPR A;  3KP0 E;  1I4W A;  4X64 M;  3UK6 A;  7CAT A;  3GLI A;  3J81 S;  2DZO B;  2ZAM A;  3UGJ A;  1IN8 A;  3CF2 A;  2Y20 A;  4HL4 A;  4MGH A;  3UJN A;  1NHW C;  2UUA M;  2VQF M;  4LJ6 A;  4YHH M;  3SAU A;  4LJ8 A;  3GPU A;  1S3S A;  1G41 A;  3GLF A;  3HHY A;  3GPX A;  4DV1 M;  5A2Q S;  1PJJ A;  3AV0 A;  1TH2 A;  3A46 A;  1XXH A;  1IXR C;  4BBA A;  1D2N A;  3GLH B;  3VK8 A;  1OFH A;  5BPV A;  5E26 A;  1R7R A;  4K0K M;  3IG8 A;  5KQ8 A;  1PM5 A;  4LFC M;  3FKE A;  4A3V B;  4B7H A;  4JI3 M;  4JV5 M;  4AKI A;  4LF6 M;  4B3T M;  3U60 A;  2C98 A;  3SYL A;  1DGB A;  4B7G A;  2CEA A;  3R9X B;  3UZU A;  2R4E A;  3FYD A;  3KS4 A;  3I51 A;  4JI0 M;  3TL4 X;  2BJV A;  4AZF A;  3AKZ A;  4DUZ M;  1GL7 A;  3FUT A;  5KO3 A;  2F5N A;  5FSW A;  1IXZ A;  5IWA M;  2HKJ A;  1X37 A;  3KSX A;  1N34 M;  2VII A;  4QNM A;  4JI1 M;  2UUC M;  4GKJ M;  3JR4 A;  2R18 A;  3CF0 A;  1QAO A;  5ITY A;  2L09 A;  4L16 A;  1SXJ B;  4NRW A;  2D7H A;  4LJ5 A;  4M0D A;  1L8Q A;  3T1H M;  4DV5 M;  4IJE A;  1I94 M;  3VDU A;  3LMM A;  4DR4 M;  1ZAE A;  4TUW A;  1GVN A;  2A5Y B;  2V6Z M;  2UXB M;  1TDZ A;  4D82 A;  3KW6 A;  3U6L A;  3C58 A;  1Z5C A;  2HL7 A;  4FW9 A;  4NSR A;  2NQ8 C;  4DV6 M;  4PD2 A;  1ZQ9 A;  4JI8 M;  4LJ7 A;  4QHT A;  1JQJ C;  3AOG A;  2QP9 X;  3U6P A;  1XC8 A;  3EIH A;  3L29 A;  2VQE M;  4PDG A;  2Z7J A;  4Z8X A;  3U6O A;  3J80 S;  1IN5 A;  4MM3 B;  3U5Z A;  1E94 E;  3FTF A;  1KFV A;  4IBB A;  1IN7 A;  2UXD M;  3E9S A;  1KYI A;  1N78 A;  1H6U A;  3LVW A;  3B9P A;  4IBI A;  2KW0 A;  3FTD A;  2G5G X;  4CGY B;  1HT1 E;  3I4Y A;  5FTM A;  1IBM M;  4DV4 M;  1L2D A;  1TH3 A;  3U61 B;  3T38 A;  5EXT A;  5FTL A;  2CV2 A;  3Q8X A;  1GKI A;  1XWI A;  1IBK M;  2LXE A;  5FTK A;  4EIW A;  3SAS A;  1NY5 A;  3SYK A;  5C1B A;  4LF7 M;  3I4V A;  4B3M M;  1N33 M;  1LV7 A;  5EJC A;  2EO2 A;  1YSY A;  2ZAN A;  4LJ4 A;  1HNX M;  4D81 A;  2C96 A;  1G8P A;  1T3T A;  4NXN M;  5ITQ A;  3A42 A;  2XGN A;  4LRS A;  1G4A E;  4M9S A;  5KPT A;  2R62 A;  1DGH B;  2LWX A;  3AOE C;  1W5T A;  3L26 A;  2O5R A;  2YFQ A;  2XF3 A;  3GRU A;  4L15 A;  1Z5B A;  2Y21 A;  4G4N A;  1XNR M;  1Q39 A;  1HQY E;  2QEN A;  2RGO A;  3DZD A;  2C99 A;  3GLG A;  4DR2 M;  3IG5 A;  4JI7 M;  1QZM A;  4DV0 M;  2C5R A;  2X49 A;  5EXS A;  2UXC M;  3GQ4 A;  4IBF A;  3WHL A;  1L1Z A;  2KRU A;  4OVZ B;  4AG6 A;  5IRE B;  4JI5 M;  4DR3 M;  1MU5 A;  5IZ7 D;  2XSZ D;  3QWL A;  2G8L A;  3QAU A;  1QVR A;  1TH4 A;  4FVM A;  1R2Y A;  4FD2 A;  2YNM D;  4LY6 A;  3VLF B;  2QBY A;  2BNK A;  4QOZ C;  4MGI E;  2KEB A;  4D80 A;  3MJ5 A;  5DYG A;  5ITR A;  1DGF A;  4JI4 M;  2L6O A;  4LG2 A;  3L2A A;  2UU9 M;  3D8B A;  1NJG A;  1XMQ M;  3K2L A;  4WUR A;  1G3I A;  5JI3 E;  3SFZ A;  1ORY B;  2H1R A;  2FOI C;  1E9R A;  4B7F A;  2CHV A;  4LF5 M;  4XBO A;  1W5S A;  3TQS A;  2DWN A;  3ILK A;  2Z4S A;  1SXJ C;  4GHL A;  5IT9 S;  3T1Y M;  4DUY M;  3M7G A;  1MX0 A;  3NWL A;  4XGI A;  4M9X A;  3TWM A;  3SHF A;  1IN4 A;  3HGI A;  1YUB A;  4RNA A;  2DHR A;  4KHP M;  3HJ8 A;  3AOE A;  4AW4 A;  1HNZ M;  4NXM M;  5EQT A;  2AHM A;  3KVW A;  3GPY A;  1NJF A;  3AJI B;  1Q3B A;  4MGK E;  2ERC A;  2XZF A;  5FLX S;  2P5T A;  2X8A A;  5ITX A;  2F5P A;  1EE8 A;  3HHX A;  3KOZ E;  2KXE A;  5EP2 A;  4LZZ A;  4AI6 A;  1IBL M;  1XHB A;  3KP1 E;  3FYC A;  3KSJ A;  4ZPX A;  1OFI A;  1YE9 A;  3DFZ A;  2Y0T A;  3LQQ A;  1DO2 A;  2W82 A;  3GO8 A;  2E5L M;  3CF6 E;  3RGP A;  1NNU C;  3HWS A;  1QAQ A;  5EXX A;  3VKH A;  4GMQ A;  3GLH A;  3K92 A;  3GQ5 A;  4B3R M;  2Z4R A;  4LF8 M;  2XLJ A;  5FTN A;  4IBD A;  3KOY E;  1HQC A;  3VKG A;  2KZS A;  4DR5 M;  2F5S A;  1NY6 A;  3VFD A;  4G6Z A;  2R65 A;  5ITU A;  3J27 B;  5GKN A;  4GRI A;  1Q3C A;  4IIW A;  3PXG A;  2V1U A;  1DGG A;  2R45 A;  2DWZ B;  4JN6 A;  3GQ3 A;  4DR1 M;  2Y0Q A;  3U6S A;  3M6A A;  3GLI B;  4LJA A;  4G4Q A;  2QCU A;  3K8Z A;  3H4M A;  5ITX E;  3OTO M;  3PFI A;  4I5S A;  4AQY M;  3U6E A;  3GRV A;  1SXJ A;  3A45 A;  1NSF A;  4ITQ A;  4KLN A;  4L78 A;  3GLF B;  1N36 M;  4OU7 A;  4JI6 M;  3SAV A;  1FJG M;  2K47 A;  4WW0 A;  4REZ A;  2LNH C;  4IBC A;  2DVW B;  2F5O A;  3W0L B;  4B3S M;  3BOS A;  1HR0 M;  2D7E A;  1IY0 A;  2XFT A;  3KXE C;  3SAW A;  1L2B A;  2I7P A;  3DOA A;  4DV3 M;  4PT5 A;  2JA2 A;  5EXP A;  2HCB A;  4FCT A;  4FCW A;  3AL0 C;  3TWL A;  3U60 B;  2Q2E B;  4P16 A;  1FNN A;  4G4O A;  3RFW A;  3LQR A;  2BJW A;  4MGZ E;  3KDS E;  2C9O A;  3FUW A;  3GRR A;  3PVS A;  4RF0 A;  2C9C A;  3HJS A;  4BB9 A;  5ITT A;  2XZU A;  3HU2 A;  1K3W A;  1TGU A;  4LFA M;  2CFO A;  1GLN A;  4YY3 M;  4LCB A;  4LFB M;  4G4R A;  1XNQ M;  4NRV A;  1HT2 E;  3TWK A;  3KOX E;  2I7N A;  3R8F A;  2FFJ A;  1SXJ E;  2ZBK B;  4R7G A;  3KS8 A;  4BLC A;  1JR3 D;  3D8L A;  3PNV A;  2F4V M;  4AKH A;  4W5W A;  1VDD A;  3U61 A;  1IM2 A;  4DR7 M;  2HHH M;  2L7H A;  4DV2 M;  2F5Q A;  3SBJ A;  1N32 M;  5KQD A;  1QQW A;  4IBE A;  5JI2 E;  1J5E M;  5EP1 A;  2OQ4 A;  5LMU M;  1K82 A;  4MGY E;  2R46 A;  3TPZ A;  1WXQ A;  2XEP A;  4I4L A;  4GIP A;  3L28 A;  3FUV A;  2YQZ A;  3A98 B;  3HJQ A;  3FUU A;  2RGH A;  1TDH A;  3UMM A;  3SAR A;  1DGH A;  2QZ4 A;  1QAN A;  2DZN B;  4OX9 M;  3U5Z B;  4B08 A;  4IBG A;  4GKK M;  3CTW B;  4JXJ A;  3THG A;  4QHS A;  2XFS A;  2EA0 A;  1E32 A;  3U6D A;  3K1J A;  3L27 A;  2CHQ A;  2J7O A;  4FWG A;  4LRT A;  3DA1 A;  3U6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...