2KXEA

N-terminal domain of the dp1 subunit of an archaeal d-family dna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords DNA polymerase II small subunit
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.800 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kxeA00
2KXEA
chains in the Genus database with same CATH superfamily
2LVQD 1V92A 1OTRA 3W68A 1JR3E 4LCBA 4GIPA 1IXZA 2MJ5B 2JA2A 2E5LM 2VF8A 4R7GA 2DWLA 1QZMA 2CFOA 4IIWA 1C7YA 1N78A 4L15A 3FD9A 3FUTA 5FTMA 2Y0QA 1XMQM 2APLA 4LJ8A 2R46A 2CHGA 3PXGA 2BJWA 3H4JA 3GPPA 1HNWM 4LF9M 1Z5CA 2LXEA 3QYEA 1N36M 4G6ZA 3BXWA 3BBZA 2CUZA 1ZAEA 1ZMWA 4NRVA 4G4OA 4PT5A 3EIHA 4I81A 4CGYB 3SFZA 2F5SA 2CWBA 3H4MA 3TWKA 2DNAA 3JR5A 4B3MM 3VKGA 1E9RA 3K9OA 3I51A 1IM2A 4JI5M 3U5ZA 4I5SA 2Y0TA 4XBOA 1IBMM 4LF6M 2JNHA 5FTKA 2RGHA 3HY5A 2L2DA 3SMSA 5FTNA 3J27B 1D0LA 3VDUA 4LFAM 3B7QA 2WSEF 1XXHB 1AIPC 3U6MA 1GABA 1L2CA 3HZJA 3HJ8A 1NHGC 2OO9A 4B7HA 2BWBA 5KQDA 3WHLA 4AW4A 1EE8A 1C1KA 2DZOB 2KA6B 3RE8A 2C5RA 3LCUA 5KPRA 3U61B 4DV7M 3HGIA 2EA0A 1GO5A 3UGJA 1QAOA 3FUVA 5ITTA 3AOEA 2JP7A 2QENA 1NSFA 4LF5M 3I4YA 4WW0A 3UZUA 1IFYA 3KFUG 4RF0A 1NV8A 3PNYA 2KNAA 1IN8A 2XF3A 4LJ5A 2XSZA 2EUCA 2XZFA 1D2NA 1NJGA 4NSOB 4M0WA 4KO8A 3NBXX 5A2QS 1G41A 3A42A 3KDSE 3GLHE 2D7HA 1NNUC 4DR1M 1NV9A 4QNRA 1G8PA 4M9ZA 1HNZM 5EXPA 1SXJE 3DOAA 3K8ZA 2X8AA 2LHGA 3LVWA 2UUBM 2LVOC 1HR0M 4DUYM 2ZTCA 2OOAA 2XGNA 3KP0E 2JXNA 4DV2M 1MJGM 3E4RA 2MROB 4HEOA 2ZANA 1G3IA 3W67A 1SG9A 3EIEA 3SAVA 5KPTA 1XMOM 2UXDM 1JR3A 4FWGA 1BVSA 4WP2A 2XFSA 3KVWA 4GC9A 4HLQA 5GKNA 4OVZA 1FJGM 1J09A 1S3SA 1VEGA 4KLNA 4D81A 2DWZB 1SXJA 2H5XA 2V1CA 3HU2A 2QP9X 2QBYA 3L2AA 2Y21A 1GLNA 2L7IA 4LZJA 2BWEA 4CISA 3TQSA 3CF6E 2DAGA 3TPZA 1OJLA 2C9OA 2K47A 3MJ5A 4G4QA 2DKLA 2YQZA 3QAUA 4PDIA 4B7GA 1WXQA 2MH8A 3C58A 3KW6A 2Z4RA 3HJQA 1XHBA 1N77A 3FTCA 2DAKA 5DYGA 2F5QA 1ZMUA 2JZ0A 1QANA 5C18A 2G5GX 3IG5A 3K2LA 1L2BA 4HL4A 3U6SA 2VIIA 4R3DA 1IN7A 5EXSA 1XNQM 4JI3M 4B3TM 2LVNC 3LQQA 3I4VA 3ZCBB 3AFHA 4IBKA 2XH9A 1RU3A 1GL7A 1DGBA 1NO1A 2FNAA 2KDLA 1E94E 3I04M 4X62M 4XK8F 3K92A 3M0EA 4FD2A 2K9DA 3J80S 2C96A 3AV0A 3TL4X 4DR6M 3GLIA 2UUAM 1MN3A 1WR1B 4GMQA 2DENA 2CHVA 3MMPA 4PCZA 2J7OA 5KPZA 2GNOA 3HHWA 2VQFM 3HX3A 3GLIE 2KHHA 3KOYE 5LMNM 1D0MA 2DWNA 3GP1A 2ERCA 2LH0A 4LRSA 4IBEA 1HT2E 2DWMA 4P17A 3JAMS 2CRUA 4MH0E 4PDGA 2ZM6M 1LTMA 3B89A 2Z3XA 3HWSA 2OQ4A 2ZAOA 3RGPA 3A46A 1SXJB 1VQ1A 2UXBM 4JI4M 4QOZC 3VKHA 4FVMA 1Z5AA 2ZTDA 3L29A 4KT0F 3SHGB 1WIVA 4JYAM 4MGKE 2YFQA 4II7A 5EXXA 4IBCA 4X64M 4EIWA 1OAOC 1V34A 3U6QA 1VEJA 3KS4A 2AHMA 2UUCM 1P3QQ 1HQCA 1ZQ9A 4LFCM 2R18A 2L4EA 5DNYA 3U60A 3SHFA 4B7FA 2F5OA 3Q8XA 4AI6A 3GQ4A 2Z8YM 1T6OA 3HJSA 5EXTA 5ITUA 2QBYB 3THGA 3R8FA 2KW0A 2V6ZM 5BR8M 2QPAA 2X4AA 4GHAA 2EKKA 3W0LB 4AKGA 4ANRA 1DGGA 5EJCA 1NY5A 4BB9A 3J81S 3ILKA 1KFVA 2NQ8C 3L25A 2D7EA 3GPUA 1OAIA 1R2YA 2ZBKB 3MK6A 2FH0A 3KXEC 3DA1A 3LVVA 3NWLA 1E9SA 4JXJA 7CATA 3GLHB 5FSWA 3GPXA 4JI7M 3F92A 4LRTA 1TH3A 4X66M 1XB2B 2LTUA 1XNRM 4RKUF 4GHLA 1OKSA 3UJNA 4GKKM 1GKIA 2FOIC 4PD2A 2M5ZA 4UN2B 2FS1A 2EKFA 4JV5M 3GRUA 1GL6A 2F4VM 3Q8GA 3CGWA 4NXMM 1T3TA 5KQ8A 4JI2M 3B7ZA 2W82A 3ZQJA 4DV1M 1TF0B 1Q3CA 3FUUA 3LW5F 4IJFA 2M60A 1IY1A 3KOWE 1TH4A 2O25A 5DYIA 4DV6M 1QUTA 4D80A 5EP4A 4RNAA 2XFTA 2RRUA 2ZAMA 2VDBB 2QQ8A 1VG5A 3U6EA 5ITQA 4AG6A 2FE8A 2JY7A 4L6V6 1XXHA 4LJAA 3U6OA 3GRRA 3FUWA 3FE3A 4G4RA 1PJJA 3AOGA 1IXSB 4OW0A 1GVNA 3T15A 5IZ7D 3UMMA 1R4GA 3AL0C 3GLHA 4IBJA 4NSRA 3GO8A 1YSYA 5ITRA 4LGMA 5FLXS 1SXJD 3NBIA 3U60B 2CE7A 3M6AA 5H37D 1PJSA 4I4LA 4GC5A 8CATA 2QHOB 3FTDA 4B3SM 3J7BA 4JI8M 2VQEM 3T38A 1R5LA 3R9XB 1G71A 1TH2A 3CF2A 2EO2A 1IN6A 3FTFA 4DV0M 3FUXA 3SASA 2JY6B 1W5TA 5JI3E 1EIJA 3BOSA 5FTJA 1G4AE 2KRKA 2Z4SA 4DV4M 1VDDA 2C9CA 4LG2A 1L1ZA 3U61A 3LCVB 2O01F 2WSFF 2LVPC 3SATA 4B08A 3SAWA 1T43A 3OTOM 2X49A 3B9PA 4D82A 1QDTA 1ZV1A 1DV0A 3SARA 4NL4H 2CV1A 4OVZB 2QCUA 4AG5A 2YNMD 1PRBA 4IBIA 3KS8A 3VK8A 5L8RF 5EP3A 2JZ1A 4JN6A 4DV3M 3QWLA 1WJ7A 2KEBA 1Z5BA 2KZSA 3C3EA 5ITXA 4IBFA 3SMPA 2OOBA 3HHZA 3KOXE 3U5ZB 2HL7A 5IT9S 2G3QA 2HAKA 3SYKA 3VLFB 5ITYA 1J5EM 1TDHA 2B3TA 3I01M 1IY0A 1G59A 5E26A 3GRYA 3GLFE 2L4FA 4KHPM 1DGFA 2QSFX 5BPVA 4F2LA 1OFHA 4AZFA 4LJ6A 3GLIB 4YY3M 1QUSA 4OU7A 1N34M 1Q02A 1TGUA 4LJ7A 4LJ4A 1NHWC 3GLFA 4DBGB 5C1BA 1R2ZA 1F4IA 2F5PA 3FYDA 2BJVA 4LGYA 3C9PA 2CHQA 2R45A 2DXIA 4BLCA 3U6PA 3TWMA 3VK7A 2G8LA 2RKOA 3VDPA 1QVRA 1I94M 2V1UA 2C99A 1WHCA 1YLAA 1V33A 3FRHA 3T1HM 1TDZA 2C98A 4B3RM 2FFJA 4GITA 3U6DA 5ITXE 2DZNB 2GQFA 3KSJA 3U6LA 4FCTA 3LMMA 1PGYA 5KO3A 1QAQA 4JI0M 2R4EA 1MU5A 1OIZA 2KNVA 3VFDA 4S12A 1HNXM 1KSFX 3LQRA 3K9PA 2XLJA 2DHYA 3L26A 1PJIA 4MGZE 4X65M 1NJFA 4TUWA 2HKJA 3J7AS 1N75A 1IBKM 1UM8A 4L4UA 4CJ6A 1I4WA 4MM3B 1QZEA 1L1TA 3D8LA 4QHSA 1QQWA 5IWAM 3GQ5A 2RGOA 2MR9A 1QDRA 3GRVA 2XEPA 3JR4A 4QHTA 1XWIA 3GLGB 3U6CA 1OQYA 4FWHA 3MHVC 2DHRA 3GLGE 3ZC7B 3C3DA 2LWXA 3E46A 2CV0A 4IJEA 1XXHE 4REZA 3V76A 3WHKA 1K3XA 2A5YB 1JR3D 4LY6A 4BBAA 1H6UA 2JY5A 2LHCA 3AOEC 2HCBA 4NXNM 3GLFB 1MX0A 1XC8A 1IBLM 1HJPA 1JB0F 2L09A 3A45A 2Y20A 1YUBA 2OPFA 1NNJA 3KOZE 4GH9A 4CIZA 1HQYE 4M9XA 4GEWA 4NOOB 3SAUA 2UXCM 1GJSA 2LVAA 2HHHM 4JI6M 3K1JA 1OIPA 4LZZA 4IBDA 2J5YA 2L7HA 2J7NA 4G3OA 4QNMA 2QNJA 1W5SA 4K0KM 2DAEA 4FCWA 3UK6A 3TE6A 5LMUM 1HT1E 2Z7JA 2K6BA 2N35A 2D7GA 4ITQA 4IBBA 1DO0A 5EQTA 3HKPA 2EJSA 2DVWB 1QYRA 1K3WA 2JY8A 1TTEA 3CTWB 2R0IA 1X37A 1OFIA 4FW9A 3IG8A 4AKHA 2O5RA 5F3WA 2WZJA 2Q2EB 1LV7A 4L8RC 2R6FA 4Z6YA 1WGNA 1NVMA 4RF1A 4Y28F 2YR0A 3HHYA 4DUZM 5EP2A 2XZUA 5IREB 4GRIA 3E21A 3GQ3A 1TR8A 3PFIA 3T6PA 3FYCA 3E9SA 1K82A 2L6OA 2LNHC 2R44A 2KZUA 3AKZA 4GKJM 4LF8M 4LFBM 4MB7A 1ZMVA 4DR2M 1Z59A 2LBCA 1IY2A 3D8BA 3A98B 2R4JA 4MGIE 4AQYM 2R62A 4F1IA 3GLGA 2I7NA 3HU1A 3PNVA 4AKIA 1IXSA 3B7NA 4WURA 3T1YM 1IQPA 1PJTA 1R7RA 2WSCF 2I7PA 1IXRC 3SBJA 4LF4M 4LF7M 4W5WA 3IECA 4ZPXA 2H1RA 5EP1A 3HHXA 3PVSA 1PJQA 3DFZA 3QYBA 2P5TA 3KP1E 1VDLA 2QZ4A 4M0DA 3RGSA 2DI0A 2CP8A 2VF7A 4G4NA 4DR5M 3KSXA 1DO2A 1EFUB 1JQJC 1UFZA 3FRIA 4NRWA 4DR4M 4NC6A 2HWJA 1WGLA 2KXEA 4KODA 4A3VB 4DV5M 1FNNA 1R6BX 4OX9M 4FCVA 1L8QA 1N33M 2CEAA 3J2PB 1Q39A 4DR3M 1Z6TA 3AJIB 2K0BX 5DFLA 1IN4A 1KYIA 2XSZD 3B74A 1QAMA 1DGHB 3CF0A 4YHHM 1J7KA 4XGIA 2F5NA 1PM5A 2UU9M 2DAIA 3IHPA 3SYLA 3ZH9B 3GPYA 4R71A 3HU3A 3TWLA 4M9SA 1DGHA 3L28A 4I8OA 1Y8GA 1E32A 1SXJC 2KNZA 4Q7JA 2KRUA 1VEKA 4CHTB 1Q3BA 4QOSA 5JI2E 4LJ9A 2CV2A 1YE9A 2R65A 3SC3A 4DR7M 2JWSA 4Z8XA 2MGWA 4JI1M 3DZDA 2BNKA 3W0FA 1NY6A 1N32M 4L16A 3RFWA 3FKEA 3M7GA 2DZLA 2DAMA 4P16A 5E6JA 4FWDA 1ORYB 1IN5A 1D0KA 3FTEA 5FTLA 1A5TA 1AUAA 4IBGA 1L2DA 3L27A 1GJTA 4L78A 2JUJA 4MGHA 1CUKA 4MGYE
chains in the Genus database with same CATH topology
4LCBA 4GIPA 1IXZA 2JA2A 2E5LM 4R7GA 2DWLA 1N78A 1QZMA 2CFOA 4IIWA 4L15A 3FD9A 3FUTA 5FTMA 2Y0QA 1XMQM 4LJ8A 2R46A 2CHGA 3PXGA 2BJWA 3GPPA 1HNWM 4LF9M 1Z5CA 2LXEA 1N36M 4G6ZA 2CUZA 1ZAEA 4NRVA 4G4OA 4PT5A 3EIHA 4I81A 4CGYB 3SFZA 2F5SA 4B3MM 3H4MA 3TWKA 3JR5A 3VKGA 1E9RA 3I51A 1IM2A 4JI5M 3U5ZA 4I5SA 2Y0TA 4XBOA 1IBMM 4LF6M 5FTKA 2RGHA 3SMSA 5FTNA 3J27B 3VDUA 4LFAM 1XXHB 3U6MA 1L2CA 3HJ8A 1NHGC 4B7HA 5KQDA 3WHLA 4AW4A 1EE8A 1C1KA 2DZOB 2KA6B 3RE8A 2C5RA 5KPRA 3U61B 4DV7M 3HGIA 2EA0A 3UGJA 1QAOA 3FUVA 5ITTA 3AOEA 2QENA 1NSFA 4LF5M 3I4YA 4WW0A 3UZUA 3KFUG 4RF0A 3PNYA 1IN8A 2XF3A 4LJ5A 2XSZA 2EUCA 2XZFA 1D2NA 1NJGA 4NSOB 4M0WA 4KO8A 5A2QS 1G41A 3A42A 3KDSE 2D7HA 1NNUC 4DR1M 4QNRA 1G8PA 4M9ZA 1HNZM 5EXPA 1SXJE 3DOAA 3K8ZA 2X8AA 3LVWA 2UUBM 1HR0M 4DUYM 2XGNA 3KP0E 4DV2M 3E4RA 2ZANA 1G3IA 3EIEA 3SAVA 5KPTA 1XMOM 2UXDM 1JR3A 4FWGA 2XFSA 3KVWA 4GC9A 4HLQA 5GKNA 4OVZA 1FJGM 1J09A 1S3SA 4KLNA 4D81A 2DWZB 1SXJA 2V1CA 2QBYA 3HU2A 2QP9X 3L2AA 2Y21A 1GLNA 2L7IA 4LZJA 4CISA 3TQSA 3CF6E 3TPZA 1OJLA 2C9OA 2K47A 3MJ5A 4G4QA 2YQZA 3QAUA 4PDIA 4B7GA 1WXQA 3C58A 3KW6A 2Z4RA 3HJQA 1XHBA 1N77A 3FTCA 5DYGA 2F5QA 1QANA 5C18A 2G5GX 3IG5A 3K2LA 1L2BA 4HL4A 3U6SA 2VIIA 4R3DA 1IN7A 5EXSA 1XNQM 4JI3M 4B3TM 3LQQA 3I4VA 3ZCBB 3AFHA 4IBKA 2XH9A 1GL7A 1DGBA 4X62M 2FNAA 1E94E 3K92A 3M0EA 4FD2A 3J80S 2C96A 3AV0A 3TL4X 4DR6M 3GLIA 2UUAM 4GMQA 2CHVA 4PCZA 2J7OA 5KPZA 3HHWA 2VQFM 3KOYE 5LMNM 2DWNA 3GP1A 2ERCA 2LH0A 4LRSA 4IBEA 1HT2E 2DWMA 3JAMS 4MH0E 4PDGA 2ZM6M 2Z3XA 3HWSA 2OQ4A 2ZAOA 3RGPA 3A46A 1SXJB 2UXBM 4JI4M 4QOZC 3VKHA 4FVMA 1Z5AA 3SHGB 3L29A 4JYAM 4MGKE 2YFQA 4II7A 5EXXA 4IBCA 4X64M 4EIWA 3U6QA 3KS4A 2AHMA 2UUCM 1ZQ9A 1HQCA 4LFCM 2R18A 5DNYA 3U60A 2F5OA 3SHFA 4B7FA 3Q8XA 4AI6A 3GQ4A 3HJSA 5EXTA 5ITUA 2QBYB 3THGA 3R8FA 2KW0A 2V6ZM 5BR8M 2QPAA 2X4AA 3W0LB 4AKGA 1DGGA 5EJCA 1NY5A 4BB9A 3J81S 3ILKA 1KFVA 2NQ8C 3L25A 2D7EA 3GPUA 1R2YA 2ZBKB 3MK6A 3KXEC 3LVVA 3DA1A 3NWLA 4JXJA 1E9SA 7CATA 5FSWA 3GLHB 3GPXA 4JI7M 4LRTA 1TH3A 4X66M 1XNRM 4GHLA 3UJNA 4GKKM 1GKIA 2FOIC 4PD2A 2M5ZA 4JV5M 3GRUA 1GL6A 2F4VM 4NXMM 1T3TA 5KQ8A 4JI2M 2W82A 4DV1M 1Q3CA 3FUUA 4IJFA 2M60A 1IY1A 3KOWE 1TH4A 5DYIA 4DV6M 4D80A 5EP4A 4RNAA 2XFTA 2ZAMA 3U6EA 5ITQA 4AG6A 2FE8A 1XXHA 4LJAA 3U6OA 3GRRA 3FUWA 4G4RA 1PJJA 3AOGA 1IXSB 4OW0A 1GVNA 3T15A 5IZ7D 3UMMA 3AL0C 3GLHA 4IBJA 4NSRA 3GO8A 1YSYA 5ITRA 4LGMA 5FLXS 1SXJD 3NBIA 3U60B 2CE7A 3M6AA 5H37D 4I4LA 4GC5A 8CATA 3FTDA 4B3SM 3J7BA 4JI8M 2VQEM 3T38A 3R9XB 1TH2A 3CF2A 2EO2A 1IN6A 3FTFA 4DV0M 3FUXA 3SASA 1W5TA 5JI3E 3BOSA 5FTJA 1G4AE 2KRKA 2Z4SA 4DV4M 1VDDA 2C9CA 4LG2A 1L1ZA 3U61A 3SATA 4B08A 3SAWA 3OTOM 2X49A 3B9PA 4D82A 3SARA 4NL4H 2CV1A 4OVZB 2QCUA 4AG5A 2YNMD 4IBIA 3KS8A 3VK8A 5EP3A 4JN6A 4DV3M 3QWLA 2KEBA 1Z5BA 2KZSA 5ITXA 3SMPA 4IBFA 3HHZA 3KOXE 3U5ZB 2HL7A 5IT9S 3SYKA 3VLFB 5ITYA 1J5EM 1TDHA 1G59A 1IY0A 5E26A 3GRYA 4KHPM 1DGFA 5BPVA 1OFHA 4AZFA 4LJ6A 3GLIB 4YY3M 4OU7A 1N34M 1TGUA 4LJ7A 4LJ4A 1NHWC 3GLFA 5C1BA 1R2ZA 2F5PA 3FYDA 2BJVA 4LGYA 2CHQA 2R45A 2DXIA 4BLCA 3U6PA 3TWMA 3VK7A 2G8LA 2RKOA 3VDPA 1QVRA 1I94M 2V1UA 2C99A 1TDZA 3T1HM 2C98A 4B3RM 2FFJA 4GITA 3U6DA 5ITXE 2DZNB 3KSJA 3U6LA 4FCTA 3LMMA 5KO3A 1QAQA 4JI0M 2R4EA 1MU5A 3VFDA 4S12A 1HNXM 1KSFX 3LQRA 2XLJA 3L26A 1PJIA 4MGZE 4X65M 1NJFA 4TUWA 2HKJA 3J7AS 1N75A 1IBKM 1UM8A 4L4UA 1I4WA 4MM3B 1L1TA 3D8LA 4QHSA 1QQWA 5IWAM 3GQ5A 2RGOA 3GRVA 2XEPA 3JR4A 4QHTA 1XWIA 3GLGB 3U6CA 4FWHA 3MHVC 2DHRA 3ZC7B 2LWXA 2CV0A 4IJEA 4REZA 1K3XA 3WHKA 2A5YB 1JR3D 4LY6A 4BBAA 1H6UA 3AOEC 2HCBA 4NXNM 3GLFB 1MX0A 1XC8A 1IBLM 3A45A 2L09A 1NNJA 2Y20A 1YUBA 2OPFA 3KOZE 4GH9A 1HQYE 4M9XA 4NOOB 3SAUA 2UXCM 2HHHM 4JI6M 3K1JA 4LZZA 4IBDA 2L7HA 2J7NA 4QNMA 1W5SA 4K0KM 4FCWA 3UK6A 3TE6A 5LMUM 1HT1E 2Z7JA 2D7GA 4ITQA 4IBBA 1DO0A 5EQTA 3HKPA 1K3WA 2DVWB 1QYRA 3CTWB 1X37A 1OFIA 4FW9A 3IG8A 4AKHA 2O5RA 5F3WA 2Q2EB 1LV7A 4L8RC 4Z6YA 1NVMA 4RF1A 2YR0A 3HHYA 4DUZM 5EP2A 2XZUA 5IREB 4GRIA 3GQ3A 3PFIA 3FYCA 3E9SA 1K82A 2L6OA 2LNHC 2KZUA 3AKZA 4GKJM 4LF8M 4LFBM 4MB7A 4DR2M 1Z59A 1IY2A 3D8BA 3A98B 2R4JA 4MGIE 4AQYM 2R62A 3GLGA 2I7NA 3HU1A 3PNVA 4AKIA 4WURA 3T1YM 1IQPA 1R7RA 4LF4M 4LF7M 2I7PA 1IXRC 3SBJA 4W5WA 4ZPXA 2H1RA 5EP1A 3PVSA 3HHXA 3DFZA 4M0DA 2P5TA 3KP1E 2QZ4A 3RGSA 4G4NA 4DR5M 4GHAA 3KSXA 1DO2A 1JQJC 4NRWA 4DR4M 2KXEA 4KODA 4A3VB 4DV5M 1FNNA 1R6BX 4OX9M 4FCVA 1L8QA 1N33M 2CEAA 3J2PB 1Q39A 4DR3M 1Z6TA 3AJIB 1IN4A 1KYIA 2XSZD 1QAMA 1DGHB 3CF0A 4YHHM 1J7KA 4XGIA 2F5NA 1PM5A 2UU9M 3SYLA 3ZH9B 3GPYA 3HU3A 3TWLA 4M9SA 1DGHA 3L28A 4I8OA 1E32A 1SXJC 2KRUA 4CHTB 1Q3BA 4QOSA 5JI2E 4LJ9A 2CV2A 1YE9A 2R65A 3SC3A 4DR7M 4Z8XA 4JI1M 3DZDA 2BNKA 3W0FA 1NY6A 1N32M 4L16A 3RFWA 3FKEA 3M7GA 4P16A 5E6JA 4FWDA 1ORYB 1IN5A 3FTEA 5FTLA 4IBGA 1L2DA 3L27A 4L78A 4MGHA 4MGYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXE A; 
#chains in the Genus database with same CATH topology
 2LVQ D;  1V92 A;  1OTR A;  3W68 A;  1JR3 E;  4LCB A;  4GIP A;  1IXZ A;  2MJ5 B;  2JA2 A;  2E5L M;  2VF8 A;  4R7G A;  2DWL A;  1QZM A;  2CFO A;  4IIW A;  1C7Y A;  1N78 A;  4L15 A;  3FD9 A;  3FUT A;  5FTM A;  2Y0Q A;  1XMQ M;  2APL A;  4LJ8 A;  2R46 A;  2CHG A;  3PXG A;  2BJW A;  3H4J A;  3GPP A;  1HNW M;  4LF9 M;  1Z5C A;  2LXE A;  3QYE A;  1N36 M;  4G6Z A;  3BXW A;  3BBZ A;  2CUZ A;  1ZAE A;  1ZMW A;  4NRV A;  4G4O A;  4PT5 A;  3EIH A;  4I81 A;  4CGY B;  3SFZ A;  2F5S A;  2CWB A;  3H4M A;  3TWK A;  2DNA A;  3JR5 A;  4B3M M;  3VKG A;  1E9R A;  3K9O A;  3I51 A;  1IM2 A;  4JI5 M;  3U5Z A;  4I5S A;  2Y0T A;  4XBO A;  1IBM M;  4LF6 M;  2JNH A;  5FTK A;  2RGH A;  3HY5 A;  2L2D A;  3SMS A;  5FTN A;  3J27 B;  1D0L A;  3VDU A;  4LFA M;  3B7Q A;  2WSE F;  1XXH B;  1AIP C;  3U6M A;  1GAB A;  1L2C A;  3HZJ A;  3HJ8 A;  1NHG C;  2OO9 A;  4B7H A;  2BWB A;  5KQD A;  3WHL A;  4AW4 A;  1EE8 A;  1C1K A;  2DZO B;  2KA6 B;  3RE8 A;  2C5R A;  3LCU A;  5KPR A;  3U61 B;  4DV7 M;  3HGI A;  2EA0 A;  1GO5 A;  3UGJ A;  1QAO A;  3FUV A;  5ITT A;  3AOE A;  2JP7 A;  2QEN A;  1NSF A;  4LF5 M;  3I4Y A;  4WW0 A;  3UZU A;  1IFY A;  3KFU G;  4RF0 A;  1NV8 A;  3PNY A;  2KNA A;  1IN8 A;  2XF3 A;  4LJ5 A;  2XSZ A;  2EUC A;  2XZF A;  1D2N A;  1NJG A;  4NSO B;  4M0W A;  4KO8 A;  3NBX X;  5A2Q S;  1G41 A;  3A42 A;  3KDS E;  3GLH E;  2D7H A;  1NNU C;  4DR1 M;  1NV9 A;  4QNR A;  1G8P A;  4M9Z A;  1HNZ M;  5EXP A;  1SXJ E;  3DOA A;  3K8Z A;  2X8A A;  2LHG A;  3LVW A;  2UUB M;  2LVO C;  1HR0 M;  4DUY M;  2ZTC A;  2OOA A;  2XGN A;  3KP0 E;  2JXN A;  4DV2 M;  1MJG M;  3E4R A;  2MRO B;  4HEO A;  2ZAN A;  1G3I A;  3W67 A;  1SG9 A;  3EIE A;  3SAV A;  5KPT A;  1XMO M;  2UXD M;  1JR3 A;  4FWG A;  1BVS A;  4WP2 A;  2XFS A;  3KVW A;  4GC9 A;  4HLQ A;  5GKN A;  4OVZ A;  1FJG M;  1J09 A;  1S3S A;  1VEG A;  4KLN A;  4D81 A;  2DWZ B;  1SXJ A;  2H5X A;  2V1C A;  3HU2 A;  2QP9 X;  2QBY A;  3L2A A;  2Y21 A;  1GLN A;  2L7I A;  4LZJ A;  2BWE A;  4CIS A;  3TQS A;  3CF6 E;  2DAG A;  3TPZ A;  1OJL A;  2C9O A;  2K47 A;  3MJ5 A;  4G4Q A;  2DKL A;  2YQZ A;  3QAU A;  4PDI A;  4B7G A;  1WXQ A;  2MH8 A;  3C58 A;  3KW6 A;  2Z4R A;  3HJQ A;  1XHB A;  1N77 A;  3FTC A;  2DAK A;  5DYG A;  2F5Q A;  1ZMU A;  2JZ0 A;  1QAN A;  5C18 A;  2G5G X;  3IG5 A;  3K2L A;  1L2B A;  4HL4 A;  3U6S A;  2VII A;  4R3D A;  1IN7 A;  5EXS A;  1XNQ M;  4JI3 M;  4B3T M;  2LVN C;  3LQQ A;  3I4V A;  3ZCB B;  3AFH A;  4IBK A;  2XH9 A;  1RU3 A;  1GL7 A;  1DGB A;  1NO1 A;  2FNA A;  2KDL A;  1E94 E;  3I04 M;  4X62 M;  4XK8 F;  3K92 A;  3M0E A;  4FD2 A;  2K9D A;  3J80 S;  2C96 A;  3AV0 A;  3TL4 X;  4DR6 M;  3GLI A;  2UUA M;  1MN3 A;  1WR1 B;  4GMQ A;  2DEN A;  2CHV A;  3MMP A;  4PCZ A;  2J7O A;  5KPZ A;  2GNO A;  3HHW A;  2VQF M;  3HX3 A;  3GLI E;  2KHH A;  3KOY E;  5LMN M;  1D0M A;  2DWN A;  3GP1 A;  2ERC A;  2LH0 A;  4LRS A;  4IBE A;  1HT2 E;  2DWM A;  4P17 A;  3JAM S;  2CRU A;  4MH0 E;  4PDG A;  2ZM6 M;  1LTM A;  3B89 A;  2Z3X A;  3HWS A;  2OQ4 A;  2ZAO A;  3RGP A;  3A46 A;  1SXJ B;  1VQ1 A;  2UXB M;  4JI4 M;  4QOZ C;  3VKH A;  4FVM A;  1Z5A A;  2ZTD A;  3L29 A;  4KT0 F;  3SHG B;  1WIV A;  4JYA M;  4MGK E;  2YFQ A;  4II7 A;  5EXX A;  4IBC A;  4X64 M;  4EIW A;  1OAO C;  1V34 A;  3U6Q A;  1VEJ A;  3KS4 A;  2AHM A;  2UUC M;  1P3Q Q;  1HQC A;  1ZQ9 A;  4LFC M;  2R18 A;  2L4E A;  5DNY A;  3U60 A;  3SHF A;  4B7F A;  2F5O A;  3Q8X A;  4AI6 A;  3GQ4 A;  2Z8Y M;  1T6O A;  3HJS A;  5EXT A;  5ITU A;  2QBY B;  3THG A;  3R8F A;  2KW0 A;  2V6Z M;  5BR8 M;  2QPA A;  2X4A A;  4GHA A;  2EKK A;  3W0L B;  4AKG A;  4ANR A;  1DGG A;  5EJC A;  1NY5 A;  4BB9 A;  3J81 S;  3ILK A;  1KFV A;  2NQ8 C;  3L25 A;  2D7E A;  3GPU A;  1OAI A;  1R2Y A;  2ZBK B;  3MK6 A;  2FH0 A;  3KXE C;  3DA1 A;  3LVV A;  3NWL A;  1E9S A;  4JXJ A;  7CAT A;  3GLH B;  5FSW A;  3GPX A;  4JI7 M;  3F92 A;  4LRT A;  1TH3 A;  4X66 M;  1XB2 B;  2LTU A;  1XNR M;  4RKU F;  4GHL A;  1OKS A;  3UJN A;  4GKK M;  1GKI A;  2FOI C;  4PD2 A;  2M5Z A;  4UN2 B;  2FS1 A;  2EKF A;  4JV5 M;  3GRU A;  1GL6 A;  2F4V M;  3Q8G A;  3CGW A;  4NXM M;  1T3T A;  5KQ8 A;  4JI2 M;  3B7Z A;  2W82 A;  3ZQJ A;  4DV1 M;  1TF0 B;  1Q3C A;  3FUU A;  3LW5 F;  4IJF A;  2M60 A;  1IY1 A;  3KOW E;  1TH4 A;  2O25 A;  5DYI A;  4DV6 M;  1QUT A;  4D80 A;  5EP4 A;  4RNA A;  2XFT A;  2RRU A;  2ZAM A;  2VDB B;  2QQ8 A;  1VG5 A;  3U6E A;  5ITQ A;  4AG6 A;  2FE8 A;  2JY7 A;  4L6V 6;  1XXH A;  4LJA A;  3U6O A;  3GRR A;  3FUW A;  3FE3 A;  4G4R A;  1PJJ A;  3AOG A;  1IXS B;  4OW0 A;  1GVN A;  3T15 A;  5IZ7 D;  3UMM A;  1R4G A;  3AL0 C;  3GLH A;  4IBJ A;  4NSR A;  3GO8 A;  1YSY A;  5ITR A;  4LGM A;  5FLX S;  1SXJ D;  3NBI A;  3U60 B;  2CE7 A;  3M6A A;  5H37 D;  1PJS A;  4I4L A;  4GC5 A;  8CAT A;  2QHO B;  3FTD A;  4B3S M;  3J7B A;  4JI8 M;  2VQE M;  3T38 A;  1R5L A;  3R9X B;  1G71 A;  1TH2 A;  3CF2 A;  2EO2 A;  1IN6 A;  3FTF A;  4DV0 M;  3FUX A;  3SAS A;  2JY6 B;  1W5T A;  5JI3 E;  1EIJ A;  3BOS A;  5FTJ A;  1G4A E;  2KRK A;  2Z4S A;  4DV4 M;  1VDD A;  2C9C A;  4LG2 A;  1L1Z A;  3U61 A;  3LCV B;  2O01 F;  2WSF F;  2LVP C;  3SAT A;  4B08 A;  3SAW A;  1T43 A;  3OTO M;  2X49 A;  3B9P A;  4D82 A;  1QDT A;  1ZV1 A;  1DV0 A;  3SAR A;  4NL4 H;  2CV1 A;  4OVZ B;  2QCU A;  4AG5 A;  2YNM D;  1PRB A;  4IBI A;  3KS8 A;  3VK8 A;  5L8R F;  5EP3 A;  2JZ1 A;  4JN6 A;  4DV3 M;  3QWL A;  1WJ7 A;  2KEB A;  1Z5B A;  2KZS A;  3C3E A;  5ITX A;  4IBF A;  3SMP A;  2OOB A;  3HHZ A;  3KOX E;  3U5Z B;  2HL7 A;  5IT9 S;  2G3Q A;  2HAK A;  3SYK A;  3VLF B;  5ITY A;  1J5E M;  1TDH A;  2B3T A;  3I01 M;  1IY0 A;  1G59 A;  5E26 A;  3GRY A;  3GLF E;  2L4F A;  4KHP M;  1DGF A;  2QSF X;  5BPV A;  4F2L A;  1OFH A;  4AZF A;  4LJ6 A;  3GLI B;  4YY3 M;  1QUS A;  4OU7 A;  1N34 M;  1Q02 A;  1TGU A;  4LJ7 A;  4LJ4 A;  1NHW C;  3GLF A;  4DBG B;  5C1B A;  1R2Z A;  1F4I A;  2F5P A;  3FYD A;  2BJV A;  4LGY A;  3C9P A;  2CHQ A;  2R45 A;  2DXI A;  4BLC A;  3U6P A;  3TWM A;  3VK7 A;  2G8L A;  2RKO A;  3VDP A;  1QVR A;  1I94 M;  2V1U A;  2C99 A;  1WHC A;  1YLA A;  1V33 A;  3FRH A;  3T1H M;  1TDZ A;  2C98 A;  4B3R M;  2FFJ A;  4GIT A;  3U6D A;  5ITX E;  2DZN B;  2GQF A;  3KSJ A;  3U6L A;  4FCT A;  3LMM A;  1PGY A;  5KO3 A;  1QAQ A;  4JI0 M;  2R4E A;  1MU5 A;  1OIZ A;  2KNV A;  3VFD A;  4S12 A;  1HNX M;  1KSF X;  3LQR A;  3K9P A;  2XLJ A;  2DHY A;  3L26 A;  1PJI A;  4MGZ E;  4X65 M;  1NJF A;  4TUW A;  2HKJ A;  3J7A S;  1N75 A;  1IBK M;  1UM8 A;  4L4U A;  4CJ6 A;  1I4W A;  4MM3 B;  1QZE A;  1L1T A;  3D8L A;  4QHS A;  1QQW A;  5IWA M;  3GQ5 A;  2RGO A;  2MR9 A;  1QDR A;  3GRV A;  2XEP A;  3JR4 A;  4QHT A;  1XWI A;  3GLG B;  3U6C A;  1OQY A;  4FWH A;  3MHV C;  2DHR A;  3GLG E;  3ZC7 B;  3C3D A;  2LWX A;  3E46 A;  2CV0 A;  4IJE A;  1XXH E;  4REZ A;  3V76 A;  3WHK A;  1K3X A;  2A5Y B;  1JR3 D;  4LY6 A;  4BBA A;  1H6U A;  2JY5 A;  2LHC A;  3AOE C;  2HCB A;  4NXN M;  3GLF B;  1MX0 A;  1XC8 A;  1IBL M;  1HJP A;  1JB0 F;  2L09 A;  3A45 A;  2Y20 A;  1YUB A;  2OPF A;  1NNJ A;  3KOZ E;  4GH9 A;  4CIZ A;  1HQY E;  4M9X A;  4GEW A;  4NOO B;  3SAU A;  2UXC M;  1GJS A;  2LVA A;  2HHH M;  4JI6 M;  3K1J A;  1OIP A;  4LZZ A;  4IBD A;  2J5Y A;  2L7H A;  2J7N A;  4G3O A;  4QNM A;  2QNJ A;  1W5S A;  4K0K M;  2DAE A;  4FCW A;  3UK6 A;  3TE6 A;  5LMU M;  1HT1 E;  2Z7J A;  2K6B A;  2N35 A;  2D7G A;  4ITQ A;  4IBB A;  1DO0 A;  5EQT A;  3HKP A;  2EJS A;  2DVW B;  1QYR A;  1K3W A;  2JY8 A;  1TTE A;  3CTW B;  2R0I A;  1X37 A;  1OFI A;  4FW9 A;  3IG8 A;  4AKH A;  2O5R A;  5F3W A;  2WZJ A;  2Q2E B;  1LV7 A;  4L8R C;  2R6F A;  4Z6Y A;  1WGN A;  1NVM A;  4RF1 A;  4Y28 F;  2YR0 A;  3HHY A;  4DUZ M;  5EP2 A;  2XZU A;  5IRE B;  4GRI A;  3E21 A;  3GQ3 A;  1TR8 A;  3PFI A;  3T6P A;  3FYC A;  3E9S A;  1K82 A;  2L6O A;  2LNH C;  2R44 A;  2KZU A;  3AKZ A;  4GKJ M;  4LF8 M;  4LFB M;  4MB7 A;  1ZMV A;  4DR2 M;  1Z59 A;  2LBC A;  1IY2 A;  3D8B A;  3A98 B;  2R4J A;  4MGI E;  4AQY M;  2R62 A;  4F1I A;  3GLG A;  2I7N A;  3HU1 A;  3PNV A;  4AKI A;  1IXS A;  3B7N A;  4WUR A;  3T1Y M;  1IQP A;  1PJT A;  1R7R A;  2WSC F;  2I7P A;  1IXR C;  3SBJ A;  4LF4 M;  4LF7 M;  4W5W A;  3IEC A;  4ZPX A;  2H1R A;  5EP1 A;  3HHX A;  3PVS A;  1PJQ A;  3DFZ A;  3QYB A;  2P5T A;  3KP1 E;  1VDL A;  2QZ4 A;  4M0D A;  3RGS A;  2DI0 A;  2CP8 A;  2VF7 A;  4G4N A;  4DR5 M;  3KSX A;  1DO2 A;  1EFU B;  1JQJ C;  1UFZ A;  3FRI A;  4NRW A;  4DR4 M;  4NC6 A;  2HWJ A;  1WGL A;  2KXE A;  4KOD A;  4A3V B;  4DV5 M;  1FNN A;  1R6B X;  4OX9 M;  4FCV A;  1L8Q A;  1N33 M;  2CEA A;  3J2P B;  1Q39 A;  4DR3 M;  1Z6T A;  3AJI B;  2K0B X;  5DFL A;  1IN4 A;  1KYI A;  2XSZ D;  3B74 A;  1QAM A;  1DGH B;  3CF0 A;  4YHH M;  1J7K A;  4XGI A;  2F5N A;  1PM5 A;  2UU9 M;  2DAI A;  3IHP A;  3SYL A;  3ZH9 B;  3GPY A;  4R71 A;  3HU3 A;  3TWL A;  4M9S A;  1DGH A;  3L28 A;  4I8O A;  1Y8G A;  1E32 A;  1SXJ C;  2KNZ A;  4Q7J A;  2KRU A;  1VEK A;  4CHT B;  1Q3B A;  4QOS A;  5JI2 E;  4LJ9 A;  2CV2 A;  1YE9 A;  2R65 A;  3SC3 A;  4DR7 M;  2JWS A;  4Z8X A;  2MGW A;  4JI1 M;  3DZD A;  2BNK A;  3W0F A;  1NY6 A;  1N32 M;  4L16 A;  3RFW A;  3FKE A;  3M7G A;  2DZL A;  2DAM A;  4P16 A;  5E6J A;  4FWD A;  1ORY B;  1IN5 A;  1D0K A;  3FTE A;  5FTL A;  1A5T A;  1AUA A;  4IBG A;  1L2D A;  3L27 A;  1GJT A;  4L78 A;  2JUJ A;  4MGH A;  1CUK A;  4MGY E; 
#chains in the Genus database with same CATH homology
 4LCB A;  4GIP A;  1IXZ A;  2JA2 A;  2E5L M;  4R7G A;  2DWL A;  1N78 A;  1QZM A;  2CFO A;  4IIW A;  4L15 A;  3FD9 A;  3FUT A;  5FTM A;  2Y0Q A;  1XMQ M;  4LJ8 A;  2R46 A;  2CHG A;  3PXG A;  2BJW A;  3GPP A;  1HNW M;  4LF9 M;  1Z5C A;  2LXE A;  1N36 M;  4G6Z A;  2CUZ A;  1ZAE A;  4NRV A;  4G4O A;  4PT5 A;  3EIH A;  4I81 A;  4CGY B;  3SFZ A;  2F5S A;  4B3M M;  3H4M A;  3TWK A;  3JR5 A;  3VKG A;  1E9R A;  3I51 A;  1IM2 A;  4JI5 M;  3U5Z A;  4I5S A;  2Y0T A;  4XBO A;  1IBM M;  4LF6 M;  5FTK A;  2RGH A;  3SMS A;  5FTN A;  3J27 B;  3VDU A;  4LFA M;  1XXH B;  3U6M A;  1L2C A;  3HJ8 A;  1NHG C;  4B7H A;  5KQD A;  3WHL A;  4AW4 A;  1EE8 A;  1C1K A;  2DZO B;  2KA6 B;  3RE8 A;  2C5R A;  5KPR A;  3U61 B;  4DV7 M;  3HGI A;  2EA0 A;  3UGJ A;  1QAO A;  3FUV A;  5ITT A;  3AOE A;  2QEN A;  1NSF A;  4LF5 M;  3I4Y A;  4WW0 A;  3UZU A;  3KFU G;  4RF0 A;  3PNY A;  1IN8 A;  2XF3 A;  4LJ5 A;  2XSZ A;  2EUC A;  2XZF A;  1D2N A;  1NJG A;  4NSO B;  4M0W A;  4KO8 A;  5A2Q S;  1G41 A;  3A42 A;  3KDS E;  2D7H A;  1NNU C;  4DR1 M;  4QNR A;  1G8P A;  4M9Z A;  1HNZ M;  5EXP A;  1SXJ E;  3DOA A;  3K8Z A;  2X8A A;  3LVW A;  2UUB M;  1HR0 M;  4DUY M;  2XGN A;  3KP0 E;  4DV2 M;  3E4R A;  2ZAN A;  1G3I A;  3EIE A;  3SAV A;  5KPT A;  1XMO M;  2UXD M;  1JR3 A;  4FWG A;  2XFS A;  3KVW A;  4GC9 A;  4HLQ A;  5GKN A;  4OVZ A;  1FJG M;  1J09 A;  1S3S A;  4KLN A;  4D81 A;  2DWZ B;  1SXJ A;  2V1C A;  2QBY A;  3HU2 A;  2QP9 X;  3L2A A;  2Y21 A;  1GLN A;  2L7I A;  4LZJ A;  4CIS A;  3TQS A;  3CF6 E;  3TPZ A;  1OJL A;  2C9O A;  2K47 A;  3MJ5 A;  4G4Q A;  2YQZ A;  3QAU A;  4PDI A;  4B7G A;  1WXQ A;  3C58 A;  3KW6 A;  2Z4R A;  3HJQ A;  1XHB A;  1N77 A;  3FTC A;  5DYG A;  2F5Q A;  1QAN A;  5C18 A;  2G5G X;  3IG5 A;  3K2L A;  1L2B A;  4HL4 A;  3U6S A;  2VII A;  4R3D A;  1IN7 A;  5EXS A;  1XNQ M;  4JI3 M;  4B3T M;  3LQQ A;  3I4V A;  3ZCB B;  3AFH A;  4IBK A;  2XH9 A;  1GL7 A;  1DGB A;  4X62 M;  2FNA A;  1E94 E;  3K92 A;  3M0E A;  4FD2 A;  3J80 S;  2C96 A;  3AV0 A;  3TL4 X;  4DR6 M;  3GLI A;  2UUA M;  4GMQ A;  2CHV A;  4PCZ A;  2J7O A;  5KPZ A;  3HHW A;  2VQF M;  3KOY E;  5LMN M;  2DWN A;  3GP1 A;  2ERC A;  2LH0 A;  4LRS A;  4IBE A;  1HT2 E;  2DWM A;  3JAM S;  4MH0 E;  4PDG A;  2ZM6 M;  2Z3X A;  3HWS A;  2OQ4 A;  2ZAO A;  3RGP A;  3A46 A;  1SXJ B;  2UXB M;  4JI4 M;  4QOZ C;  3VKH A;  4FVM A;  1Z5A A;  3SHG B;  3L29 A;  4JYA M;  4MGK E;  2YFQ A;  4II7 A;  5EXX A;  4IBC A;  4X64 M;  4EIW A;  3U6Q A;  3KS4 A;  2AHM A;  2UUC M;  1ZQ9 A;  1HQC A;  4LFC M;  2R18 A;  5DNY A;  3U60 A;  2F5O A;  3SHF A;  4B7F A;  3Q8X A;  4AI6 A;  3GQ4 A;  3HJS A;  5EXT A;  5ITU A;  2QBY B;  3THG A;  3R8F A;  2KW0 A;  2V6Z M;  5BR8 M;  2QPA A;  2X4A A;  3W0L B;  4AKG A;  1DGG A;  5EJC A;  1NY5 A;  4BB9 A;  3J81 S;  3ILK A;  1KFV A;  2NQ8 C;  3L25 A;  2D7E A;  3GPU A;  1R2Y A;  2ZBK B;  3MK6 A;  3KXE C;  3LVV A;  3DA1 A;  3NWL A;  4JXJ A;  1E9S A;  7CAT A;  5FSW A;  3GLH B;  3GPX A;  4JI7 M;  4LRT A;  1TH3 A;  4X66 M;  1XNR M;  4GHL A;  3UJN A;  4GKK M;  1GKI A;  2FOI C;  4PD2 A;  2M5Z A;  4JV5 M;  3GRU A;  1GL6 A;  2F4V M;  4NXM M;  1T3T A;  5KQ8 A;  4JI2 M;  2W82 A;  4DV1 M;  1Q3C A;  3FUU A;  4IJF A;  2M60 A;  1IY1 A;  3KOW E;  1TH4 A;  5DYI A;  4DV6 M;  4D80 A;  5EP4 A;  4RNA A;  2XFT A;  2ZAM A;  3U6E A;  5ITQ A;  4AG6 A;  2FE8 A;  1XXH A;  4LJA A;  3U6O A;  3GRR A;  3FUW A;  4G4R A;  1PJJ A;  3AOG A;  1IXS B;  4OW0 A;  1GVN A;  3T15 A;  5IZ7 D;  3UMM A;  3AL0 C;  3GLH A;  4IBJ A;  4NSR A;  3GO8 A;  1YSY A;  5ITR A;  4LGM A;  5FLX S;  1SXJ D;  3NBI A;  3U60 B;  2CE7 A;  3M6A A;  5H37 D;  4I4L A;  4GC5 A;  8CAT A;  3FTD A;  4B3S M;  3J7B A;  4JI8 M;  2VQE M;  3T38 A;  3R9X B;  1TH2 A;  3CF2 A;  2EO2 A;  1IN6 A;  3FTF A;  4DV0 M;  3FUX A;  3SAS A;  1W5T A;  5JI3 E;  3BOS A;  5FTJ A;  1G4A E;  2KRK A;  2Z4S A;  4DV4 M;  1VDD A;  2C9C A;  4LG2 A;  1L1Z A;  3U61 A;  3SAT A;  4B08 A;  3SAW A;  3OTO M;  2X49 A;  3B9P A;  4D82 A;  3SAR A;  4NL4 H;  2CV1 A;  4OVZ B;  2QCU A;  4AG5 A;  2YNM D;  4IBI A;  3KS8 A;  3VK8 A;  5EP3 A;  4JN6 A;  4DV3 M;  3QWL A;  2KEB A;  1Z5B A;  2KZS A;  5ITX A;  3SMP A;  4IBF A;  3HHZ A;  3KOX E;  3U5Z B;  2HL7 A;  5IT9 S;  3SYK A;  3VLF B;  5ITY A;  1J5E M;  1TDH A;  1G59 A;  1IY0 A;  5E26 A;  3GRY A;  4KHP M;  1DGF A;  5BPV A;  1OFH A;  4AZF A;  4LJ6 A;  3GLI B;  4YY3 M;  4OU7 A;  1N34 M;  1TGU A;  4LJ7 A;  4LJ4 A;  1NHW C;  3GLF A;  5C1B A;  1R2Z A;  2F5P A;  3FYD A;  2BJV A;  4LGY A;  2CHQ A;  2R45 A;  2DXI A;  4BLC A;  3U6P A;  3TWM A;  3VK7 A;  2G8L A;  2RKO A;  3VDP A;  1QVR A;  1I94 M;  2V1U A;  2C99 A;  1TDZ A;  3T1H M;  2C98 A;  4B3R M;  2FFJ A;  4GIT A;  3U6D A;  5ITX E;  2DZN B;  3KSJ A;  3U6L A;  4FCT A;  3LMM A;  5KO3 A;  1QAQ A;  4JI0 M;  2R4E A;  1MU5 A;  3VFD A;  4S12 A;  1HNX M;  1KSF X;  3LQR A;  2XLJ A;  3L26 A;  1PJI A;  4MGZ E;  4X65 M;  1NJF A;  4TUW A;  2HKJ A;  3J7A S;  1N75 A;  1IBK M;  1UM8 A;  4L4U A;  1I4W A;  4MM3 B;  1L1T A;  3D8L A;  4QHS A;  1QQW A;  5IWA M;  3GQ5 A;  2RGO A;  3GRV A;  2XEP A;  3JR4 A;  4QHT A;  1XWI A;  3GLG B;  3U6C A;  4FWH A;  3MHV C;  2DHR A;  3ZC7 B;  2LWX A;  2CV0 A;  4IJE A;  4REZ A;  1K3X A;  3WHK A;  2A5Y B;  1JR3 D;  4LY6 A;  4BBA A;  1H6U A;  3AOE C;  2HCB A;  4NXN M;  3GLF B;  1MX0 A;  1XC8 A;  1IBL M;  3A45 A;  2L09 A;  1NNJ A;  2Y20 A;  1YUB A;  2OPF A;  3KOZ E;  4GH9 A;  1HQY E;  4M9X A;  4NOO B;  3SAU A;  2UXC M;  2HHH M;  4JI6 M;  3K1J A;  4LZZ A;  4IBD A;  2L7H A;  2J7N A;  4QNM A;  1W5S A;  4K0K M;  4FCW A;  3UK6 A;  3TE6 A;  5LMU M;  1HT1 E;  2Z7J A;  2D7G A;  4ITQ A;  4IBB A;  1DO0 A;  5EQT A;  3HKP A;  1K3W A;  2DVW B;  1QYR A;  3CTW B;  1X37 A;  1OFI A;  4FW9 A;  3IG8 A;  4AKH A;  2O5R A;  5F3W A;  2Q2E B;  1LV7 A;  4L8R C;  4Z6Y A;  1NVM A;  4RF1 A;  2YR0 A;  3HHY A;  4DUZ M;  5EP2 A;  2XZU A;  5IRE B;  4GRI A;  3GQ3 A;  3PFI A;  3FYC A;  3E9S A;  1K82 A;  2L6O A;  2LNH C;  2KZU A;  3AKZ A;  4GKJ M;  4LF8 M;  4LFB M;  4MB7 A;  4DR2 M;  1Z59 A;  1IY2 A;  3D8B A;  3A98 B;  2R4J A;  4MGI E;  4AQY M;  2R62 A;  3GLG A;  2I7N A;  3HU1 A;  3PNV A;  4AKI A;  4WUR A;  3T1Y M;  1IQP A;  1R7R A;  4LF4 M;  4LF7 M;  2I7P A;  1IXR C;  3SBJ A;  4W5W A;  4ZPX A;  2H1R A;  5EP1 A;  3PVS A;  3HHX A;  3DFZ A;  4M0D A;  2P5T A;  3KP1 E;  2QZ4 A;  3RGS A;  4G4N A;  4DR5 M;  4GHA A;  3KSX A;  1DO2 A;  1JQJ C;  4NRW A;  4DR4 M;  2KXE A;  4KOD A;  4A3V B;  4DV5 M;  1FNN A;  1R6B X;  4OX9 M;  4FCV A;  1L8Q A;  1N33 M;  2CEA A;  3J2P B;  1Q39 A;  4DR3 M;  1Z6T A;  3AJI B;  1IN4 A;  1KYI A;  2XSZ D;  1QAM A;  1DGH B;  3CF0 A;  4YHH M;  1J7K A;  4XGI A;  2F5N A;  1PM5 A;  2UU9 M;  3SYL A;  3ZH9 B;  3GPY A;  3HU3 A;  3TWL A;  4M9S A;  1DGH A;  3L28 A;  4I8O A;  1E32 A;  1SXJ C;  2KRU A;  4CHT B;  1Q3B A;  4QOS A;  5JI2 E;  4LJ9 A;  2CV2 A;  1YE9 A;  2R65 A;  3SC3 A;  4DR7 M;  4Z8X A;  4JI1 M;  3DZD A;  2BNK A;  3W0F A;  1NY6 A;  1N32 M;  4L16 A;  3RFW A;  3FKE A;  3M7G A;  4P16 A;  5E6J A;  4FWD A;  1ORY B;  1IN5 A;  3FTE A;  5FTL A;  4IBG A;  1L2D A;  3L27 A;  4L78 A;  4MGH A;  4MGY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...