2KXEA

N-terminal domain of the dp1 subunit of an archaeal d-family dna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase II small subunit
publication title Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.800 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kxeA00
2KXEA
chains in the Genus database with same CATH superfamily
1KSFX 2L7IA 3C58A 1F4IA 2XZFA 3D8BA 2F5PA 2VDBB 1HQYE 3A46A 2XFSA 3FTCA 5BPVA 4I8OA 4P17A 4MGYE 2LVNC 4IBGA 1IN4A 1IN8A 4HLQA 4QHSA 2HCBA 3T1HM 1YUBA 1K3XA 2UU9M 2XSZA 3SATA 2JNHA 4B3TM 4CISA 2DENA 1Q39A 4GKKM 3DOAA 4GH9A 7CATA 3B7ZA 3JAMS 1IXZA 1NHGC 1C7YA 2EO2A 2RGHA 1VEKA 4L8RC 4B7HA 2YR0A 1H6UA 2KNZA 4I4LA 3KS8A 1NJGA 2D7EA 5BR8M 4XGIA 1A5TA 3DZDA 3KOZE 3L29A 3I4VA 4MGKE 2E5LM 3M7GA 4LJ5A 3VLFB 2KNVA 3U6EA 1LV7A 2DWZB 4D81A 3CF0A 1YSYA 4I81A 4B08A 4G4RA 1TDZA 1MX0A 2H5XA 3FYCA 3C3DA 3J81S 2JA2A 1WIVA 3J7BA 1SG9A 1E32A 2O5RA 3GRVA 3QYEA 4IBBA 2Z4RA 4S12A 5E6JA 3THGA 5FLXS 1R2YA 2DXIA 2UXCM 2G8LA 2XF3A 3SC3A 2BNKA 5FTLA 3HU2A 1V33A 1ZMWA 3B74A 4LF4M 2BWBA 2MJ5B 2V1CA 2ZAOA 2FOIC 2QCUA 4FD2A 1NO1A 3HHYA 3U6CA 3U5ZA 4LFCM 5FTMA 1IN5A 2LBCA 1XC8A 1GABA 4AKGA 1XXHA 1TR8A 3J80S 4GMQA 2QHOB 4DV0M 4IBDA 4G4QA 3GRUA 5F3WA 3NWLA 1VQ1A 1GO5A 1DGFA 4KLNA 5EP1A 5LMNM 1L1ZA 2DWMA 1KYIA 3M0EA 2OOBA 2ZM6M 3EIEA 4UN2B 2L6OA 1WR1B 5JI2E 1N77A 3GLIA 1Z6TA 2JP7A 3B89A 2UUCM 3B9PA 2X4AA 2A5YB 3GQ3A 1N36M 2J5YA 2NQ8C 1QZMA 3GPUA 5FTNA 2OO9A 1RU3A 5KPZA 1R5LA 4YHHM 3EIHA 3U6LA 2RRUA 4FWGA 3BXWA 3D8LA 3I51A 3LQRA 3KP0E 3U61A 1NVMA 3KS4A 2KA6B 4FCVA 2WSEF 1E9RA 2M5ZA 4JI6M 1V34A 1Q3CA 3HU1A 3FE3A 4B7GA 3RGSA 1DO0A 4EIWA 5L8RF 1NY5A 3KVWA 1QUSA 3DA1A 3U6PA 1VDDA 2ZBKB 4KT0F 1ORYB 5EP3A 2LH0A 3K8ZA 1QANA 1XMOM 4DBGB 3GLFB 4DUYM 1PGYA 4XK8F 2DAGA 2DVWB 3KOWE 1R2ZA 4B3SM 1J5EM 3NBIA 1N75A 2KXEA 4XBOA 5EXSA 3LQQA 1IQPA 1IXSA 3K92A 4MGIE 4NC6A 3W0FA 1XB2B 2JUJA 1PJSA 4LF7M 3CTWB 3J27B 3PNYA 4IBKA 3U6SA 2K9DA 3L28A 1JQJC 4LJ8A 2Y0TA 3LCUA 3AFHA 3U6DA 1ZQ9A 1E9SA 3MMPA 3FUXA 4LRTA 1MU5A 2FE8A 4CGYB 2CV1A 4DR3M 2EKFA 2ZTCA 4FWHA 3KXEC 3TQSA 2C96A 2OPFA 4Z8XA 2G5GX 1GVNA 4R3DA 3IG8A 3SAWA 4HL4A 2D7HA 1EFUB 2KZSA 3U6OA 3SASA 4B3MM 3BOSA 1TH3A 4II7A 2DNAA 1IBMM 1NSFA 1OJLA 5H37D 2XGNA 3UGJA 2ERCA 4NXNM 3KP1E 4AG6A 3HHXA 3GLGB 3U6MA 1JR3E 3GQ4A 2UUAM 1GLNA 2K47A 1AIPC 1PRBA 4BB9A 3TL4X 3KOYE 1HNWM 1R6BX 1D0MA 2OOAA 1EIJA 4JYAM 1T6OA 2R65A 3U5ZB 1D0KA 1VEJA 1WXQA 4YY3M 1HT1E 3ILKA 3KSXA 1Z59A 2HWJA 2KHHA 3NBXX 4LJAA 1T3TA 4LY6A 1GKIA 4NSOB 4OVZB 3GLFE 3SBJA 1MJGM 4Y28F 1J09A 2FNAA 3T38A 3DFZA 3AV0A 4LJ4A 2BWEA 2L09A 2LVQD 4I5SA 1XNQM 2QPAA 1HQCA 3HU3A 4MGHA 1S3SA 1TF0B 2Q2EB 1JR3D 3SAUA 4ITQA 1CUKA 3CGWA 1ZAEA 3R8FA 4FVMA 3U60B 1G41A 3FRHA 3QAUA 4LRSA 3ZQJA 2C5RA 2B3TA 1QAQA 4X66M 3KOXE 2I7NA 1HT2E 2C98A 4M9ZA 4QNRA 3ZC7B 1N34M 3C3EA 4QOSA 5C18A 1FJGM 4IJEA 4JI4M 4CHTB 2QBYB 3SFZA 4M9SA 1GJSA 2J7NA 4IBCA 1WGLA 1L2CA 1HNZM 1WGNA 4JV5M 5DYGA 4R71A 4AKHA 2CP8A 2DAMA 2X49A 3PFIA 2CUZA 3SMSA 2ZAMA 2KW0A 1PJTA 3HWSA 3I04M 1N78A 1V92A 2CWBA 3K1JA 4L78A 1I4WA 3U6QA 1PJJA 4DR5M 1E94E 2R18A 3HHZA 3L27A 2JXNA 3VK7A 3WHLA 4JI2M 2APLA 3KSJA 4L6V6 4JI0M 4AW4A 1SXJB 4IJFA 1UFZA 3GLGE 1OIPA 2R6FA 3CF6E 4D80A 3AOEA 4FWDA 2P5TA 4JN6A 1P3QQ 2LHGA 3FTEA 5FTJA 4PT5A 2JY6B 4WW0A 3GLHB 1IN6A 2R4EA 3BBZA 4MM3B 4F2LA 1G59A 4LF8M 4BLCA 4GHLA 4RF1A 3TPZA 2V6ZM 2O25A 1GJTA 3HZJA 1UM8A 4GIPA 2QENA 4M9XA 4JI3M 3AOEC 2JZ0A 5KQDA 2O01F 2Z8YM 3HGIA 3LVWA 4LZZA 4IIWA 4Q7JA 2F5SA 4PD2A 1XHBA 4PDGA 3RGPA 1EE8A 5ITQA 3I4YA 1K3WA 3T15A 4PDIA 2OQ4A 4NXMM 2RGOA 1PJIA 2YNMD 3L2AA 3K2LA 3FTFA 3TWKA 3HX3A 2MH8A 4D82A 1DGHB 4JI1M 3FUTA 1MN3A 4AQYM 2X8AA 3T6PA 1ZMUA 4JXJA 1OKSA 4DR4M 2UUBM 2DWNA 3JR5A 3GPXA 3E9SA 1QQWA 2AHMA 5LMUM 2JZ1A 3SYKA 1QDTA 2V1UA 4QHTA 5EXXA 4MH0E 3AKZA 3Q8GA 4L4UA 2XLJA 4G4NA 2CV2A 3LCVB 1QDRA 5FTKA 4X65M 3UJNA 5KPTA 3V76A 1IBLM 2VIIA 1VDLA 4KODA 1QVRA 4DR7M 4IBJA 1GL7A 2JY5A 3GLHE 1WJ7A 1XWIA 2W82A 2DI0A 2C99A 3HJQA 4AKIA 3UZUA 2C9OA 2CE7A 4LGMA 2GQFA 2WSFF 3SYLA 4IBIA 4NRWA 1K82A 2L2DA 1IM2A 4DR2M 2LXEA 3K9PA 1G8PA 1HNXM 1JB0F 4LFBM 3B7QA 5A2QS 2G3QA 1SXJD 3VFDA 4X64M 4DV7M 3PVSA 1VG5A 1X37A 2C9CA 1PJQA 1OQYA 1TH2A 1IN7A 2QNJA 4GEWA 4W5WA 1NV8A 3LVVA 3W0LB 3AL0C 2DZLA 2HAKA 2VQEM 2XEPA 2EKKA 3L26A 1C1KA 3FUWA 1NNUC 5JI3E 1R4GA 2CHGA 3AJIB 4REZA 4LJ6A 4WP2A 2K0BX 4KHPM 3B7NA 5EQTA 4NSRA 3F92A 1VEGA 1XNRM 2R4JA 3AOGA 3JR4A 2YFQA 4AI6A 2QQ8A 1IY2A 4DV3M 5DNYA 2DWLA 1W5SA 1I94M 2R44A 1QYRA 5ITXE 1BVSA 2DAIA 4NRVA 2HHHM 4B3RM 2QZ4A 2UXDM 1XXHB 1T43A 1IXRC 2Y20A 3HY5A 3ZCBB 1L1TA 1IY1A 2LVPC 4L16A 1PM5A 4MB7A 3CF2A 1NNJA 4G4OA 1XMQM 4GITA 1JR3A 4LF9M 4QOZC 1OIZA 5EXPA 4LF6M 5EXTA 3HJ8A 1TDHA 4FCWA 4CJ6A 4TUWA 2QSFX 2KNAA 3W67A 2F5NA 4JI8M 3VKGA 2DZOB 5ITXA 3GLFA 3GLIB 2Y0QA 5ITUA 1FNNA 2Y21A 4L15A 2BJWA 2QP9X 3FUVA 1ZV1A 2F5OA 3IHPA 3T1YM 5EP4A 3HHWA 2F4VM 2JY7A 3PNVA 2XFTA 3IECA 4AG5A 3GO8A 4K0KM 2GNOA 2KZUA 3GQ5A 3U61B 4LF5M 2CRUA 1Y8GA 4LJ9A 1J7KA 2R45A 3UMMA 3QYBA 3MK6A 4M0DA 5KO3A 2Z4SA 4DUZM 4GC9A 1DV0A 2XSZD 3VKHA 3GPYA 3WHKA 1TH4A 3FKEA 3KDSE 5E26A 4BBAA 1N33M 3OTOM 1DGBA 1QAOA 2MR9A 2YQZA 3H4MA 2N35A 2D7GA 4X62M 1L2DA 4G3OA 4GC5A 4F1IA 4Z6YA 2DKLA 4DV1M 1D0LA 2VF7A 5ITRA 3E46A 4LJ7A 4DR6M 1IXSB 3PXGA 3L25A 1XXHE 3GRRA 2LWXA 2MROB 1NHWC 2CHVA 3LMMA 1IFYA 1TGUA 3GLGA 3E4RA 5C1BA 5ITYA 5IWAM 2UXBM 2J7OA 3HJSA 2FH0A 4FCTA 1NJFA 4G6ZA 5IT9S 1IBKM 2KRUA 4IBFA 1AUAA 1L8QA 3SARA 4JI5M 3A98B 3RE8A 4OVZA 4RF0A 4RNAA 5EJCA 3GLIE 3MHVC 4KO8A 2L4FA 2EUCA 1KFVA 3ZH9B 4OX9M 3FD9A 3QWLA 2KRKA 1OFHA 2LTUA 3W68A 4B7FA 3GP1A 1OTRA 2LHCA 2CV0A 3Q8XA 2ZTDA 4DR1M 4LG2A 2EA0A 3J2PB 1D2NA 4M0WA 3M6AA 4DV4M 1OFIA 1HR0M 3U60A 2DAEA 1Z5AA 4DV6M 1L2BA 1Z5BA 3UK6A 2I7PA 2XH9A 4A3VB 2MGWA 3SHGB 2F5QA 2L7HA 2FFJA 4P16A 3H4JA 4GRIA 3RFWA 3VK8A 2QBYA 1R7RA 2KEBA 3A45A 4PCZA 1QAMA 1TTEA 1SXJE 2R46A 3KW6A 1Z5CA 3KFUG 4LFAM 1G71A 3J7AS 4GHAA 1IY0A 3SHFA 2JY8A 1NY6A 5GKNA 3FTDA 1OAOC 1G4AE 1YE9A 3FRIA 4QNMA 3TE6A 2BJVA 4DV2M 4CIZA 1NV9A 2LVAA 4LZJA 1SXJA 5ITTA 3VDPA 3MJ5A 4MGZE 1Q02A 1W5TA 2EJSA 5IZ7D 2VQFM 4WURA 4FW9A 5EP2A 4JI7M 1WHCA 2CEAA 1YLAA 3GLHA 4ANRA 2L4EA 8CATA 5KPRA 2FS1A 5FSWA 4NOOB 1SXJC 3LW5F 1ZMVA 2JWSA 2LVOC 2CFOA 5IREB 4NL4H 1DGGA 1OAIA 4OU7A 4GKJM 3SAVA 1QZEA 2R0IA 4LGYA 2WSCF 1QUTA 5DFLA 2ZANA 2HL7A 3GRYA 3FYDA 3I01M 1DO2A 2H1RA 2HKJA 2XZUA 1N32M 2DHYA 4HEOA 3TWLA 4DV5M 2DHRA 2M60A 4AZFA 2RKOA 2DAKA 1Q3BA 3VDUA 1DGHA 3TWMA 2Z7JA 3R9XB 3C9PA 4LCBA 5DYIA 2Z3XA 2CHQA 2WZJA 3HKPA 1HJPA 5KQ8A 3A42A 2LNHC 2K6BA 4R7GA 4OW0A 3K9OA 4IBEA 3GPPA 2DZNB 4ZPXA 1GL6A 3E21A 1LTMA 2VF8A 2KDLA 1G3IA 3FUUA 3IG5A 3SMPA 4RKUF 2R62A
chains in the Genus database with same CATH topology
1KSFX 2L7IA 3C58A 2XZFA 3D8BA 2F5PA 1HQYE 3A46A 2XFSA 3FTCA 5BPVA 4I8OA 4MGYE 4IBGA 1IN4A 1IN8A 4HLQA 4QHSA 2HCBA 3T1HM 1YUBA 1K3XA 2UU9M 2XSZA 3SATA 4B3TM 4CISA 4LF9M 4GKKM 1Q39A 3DOAA 4GH9A 7CATA 3JAMS 1IXZA 1NHGC 2EO2A 2RGHA 4L8RC 4B7HA 2YR0A 1H6UA 4I4LA 3KS8A 1NJGA 2D7EA 5BR8M 4XGIA 3DZDA 3KOZE 3L29A 3I4VA 4MGKE 2E5LM 3M7GA 4LJ5A 3VLFB 3U6EA 1LV7A 2DWZB 4D81A 3CF0A 1YSYA 4I81A 4B08A 4G4RA 1TDZA 1MX0A 3FYCA 3J81S 2JA2A 3J7BA 3GRVA 1E32A 2O5RA 4IBBA 4S12A 3THGA 2Z4RA 5E6JA 5FLXS 2UXCM 2DXIA 1R2YA 2G8LA 2XF3A 3SC3A 2BNKA 5FTLA 3HU2A 4LF4M 2V1CA 2ZAOA 2FOIC 2QCUA 4FD2A 3HHYA 3U6CA 3U5ZA 4LFCM 5FTMA 1IN5A 1XC8A 4AKGA 1XXHA 3J80S 4GMQA 4DV0M 4IBDA 4G4QA 3GRUA 5F3WA 3NWLA 1DGFA 4KLNA 5EP1A 5LMNM 1L1ZA 2DWMA 1KYIA 3M0EA 2ZM6M 3EIEA 2L6OA 5JI2E 1N77A 3GLIA 1Z6TA 2UUCM 3B9PA 2X4AA 2A5YB 3GQ3A 1N36M 2NQ8C 1QZMA 3GPUA 5FTNA 5KPZA 4YHHM 3EIHA 3U6LA 4FWGA 3D8LA 3I51A 3LQRA 3KP0E 3U61A 1NVMA 3KS4A 2KA6B 4FCVA 1E9RA 2M5ZA 4JI6M 1Q3CA 3HU1A 4B7GA 3RGSA 1DO0A 4EIWA 1NY5A 3KVWA 3DA1A 3U6PA 1VDDA 2ZBKB 1ORYB 5EP3A 2LH0A 3K8ZA 1QANA 1XMOM 3GLFB 4DUYM 2DVWB 3KOWE 1R2ZA 4B3SM 1J5EM 3NBIA 1N75A 2KXEA 4XBOA 5EXSA 3LQQA 1IQPA 3K92A 4MGIE 3W0FA 4LF7M 3CTWB 3J27B 3PNYA 4IBKA 3U6SA 3L28A 1JQJC 4LJ8A 2Y0TA 3AFHA 1ZQ9A 1E9SA 4LRTA 3FUXA 1MU5A 2FE8A 4CGYB 2CV1A 4DR3M 4FWHA 3KXEC 3TQSA 2C96A 2OPFA 4Z8XA 2G5GX 1GVNA 4R3DA 3IG8A 3SAWA 4HL4A 2D7HA 2KZSA 3U6OA 3SASA 4B3MM 3BOSA 1TH3A 4II7A 1IBMM 1NSFA 1OJLA 5H37D 2XGNA 3UGJA 2ERCA 4NXNM 3KP1E 4AG6A 3HHXA 3GLGB 3U6MA 3GQ4A 2UUAM 1GLNA 2K47A 4BB9A 3TL4X 3KOYE 1HNWM 1R6BX 4JYAM 2R65A 3U5ZB 1WXQA 1HT1E 3ILKA 3KSXA 1Z59A 4NSOB 4LY6A 4LJAA 4OVZB 1T3TA 3PXGA 1GKIA 3SBJA 1J09A 2FNAA 3T38A 3DFZA 3AV0A 4LJ4A 2L09A 4I5SA 1XNQM 2QPAA 1HQCA 3HU3A 4MGHA 1S3SA 2Q2EB 3SAUA 1JR3D 4ITQA 1ZAEA 3R8FA 4FVMA 3U60B 1G41A 3QAUA 4LRSA 2C5RA 1QAQA 4X66M 3KOXE 2I7NA 1HT2E 2C98A 4M9ZA 4QNRA 3ZC7B 1N34M 4QOSA 5C18A 1FJGM 4IJEA 4JI4M 4CHTB 2QBYB 3SFZA 4M9SA 2J7NA 4IBCA 1L2CA 1HNZM 4JV5M 5DYGA 4AKHA 2X49A 3PFIA 2CUZA 3SMSA 2ZAMA 2KW0A 3HWSA 1N78A 3K1JA 4L78A 1I4WA 3U6QA 1PJJA 4DR5M 1E94E 2R18A 3HHZA 3L27A 3VK7A 3WHLA 4JI2M 3KSJA 4JI0M 4AW4A 1SXJB 4IJFA 3CF6E 4D80A 3AOEA 4FWDA 2P5TA 4JN6A 3FTEA 5FTJA 4PT5A 4WW0A 3GLHB 1IN6A 2R4EA 1G59A 4MM3B 4LF8M 4BLCA 4GHLA 4RF1A 3TPZA 2V6ZM 3U6DA 4YY3M 1UM8A 4GIPA 2QENA 4M9XA 4JI3M 3AOEC 5KQDA 3HGIA 3LVWA 4LZZA 4IIWA 2F5SA 4PD2A 1XHBA 4PDGA 3RGPA 1EE8A 5ITQA 3I4YA 1K3WA 3T15A 4PDIA 2OQ4A 4NXMM 2RGOA 1PJIA 2YNMD 3L2AA 3K2LA 3FTFA 3TWKA 4D82A 1DGHB 4JI1M 3FUTA 4AQYM 2X8AA 4JXJA 4DR4M 2UUBM 2DWNA 3JR5A 3GPXA 3E9SA 1QQWA 2AHMA 5LMUM 3SYKA 2V1UA 4QHTA 5EXXA 4MH0E 3AKZA 4L4UA 2XLJA 4G4NA 2CV2A 5FTKA 4X65M 3UJNA 5KPTA 1IBLM 2VIIA 4KODA 1QVRA 4DR7M 4IBJA 1GL7A 1XWIA 2W82A 2C99A 3HJQA 4AKIA 3UZUA 2C9OA 2CE7A 4LGMA 3SYLA 4IBIA 4NRWA 1K82A 1IM2A 4DR2M 2LXEA 1HNXM 1G8PA 4LFBM 5A2QS 1SXJD 3VFDA 4X64M 4DV7M 3PVSA 1X37A 2C9CA 1TH2A 1IN7A 3AL0C 4W5WA 3LVVA 3W0LB 2VQEM 2XEPA 3L26A 1C1KA 3FUWA 1NNUC 5JI3E 2CHGA 3AJIB 4REZA 4LJ6A 4KHPM 5EQTA 4NSRA 1XNRM 2R4JA 3AOGA 3JR4A 2YFQA 4AI6A 1IY2A 4DV3M 5DNYA 2DWLA 1W5SA 1I94M 1QYRA 5ITXE 4NRVA 4B3RM 2UXDM 2HHHM 2QZ4A 1XXHB 3ZCBB 1IXRC 2Y20A 1L1TA 4JI8M 1IY1A 4L16A 1PM5A 4MB7A 3CF2A 1NNJA 4G4OA 1XMQM 4GITA 1JR3A 4QOZC 4LF6M 5EXPA 5EXTA 3HJ8A 1TDHA 4FCWA 4TUWA 2F5NA 3VKGA 2DZOB 5ITXA 3GLFA 3GLIB 2Y0QA 5ITUA 1FNNA 2Y21A 4L15A 2BJWA 2QP9X 3FUVA 2F5OA 3T1YM 5EP4A 3HHWA 2F4VM 3PNVA 4AG5A 2XFTA 3GO8A 4K0KM 2KZUA 3GQ5A 3U61B 4LF5M 4LJ9A 1J7KA 2R45A 3UMMA 3MK6A 4M0DA 5KO3A 2Z4SA 4DUZM 4GC9A 2XSZD 3VKHA 3GPYA 3WHKA 1TH4A 3FKEA 3KDSE 5E26A 4BBAA 1N33M 3OTOM 1DGBA 1QAOA 2YQZA 3H4MA 2D7GA 4X62M 1L2DA 4GC5A 4Z6YA 4DV1M 5ITRA 4LJ7A 4DR6M 1IXSB 3L25A 3GRRA 2LWXA 1NHWC 2CHVA 3LMMA 1TGUA 3GLGA 3E4RA 5C1BA 5ITYA 5IWAM 2UXBM 2J7OA 3HJSA 4FCTA 1NJFA 4G6ZA 5IT9S 1IBKM 2KRUA 4IBFA 1L8QA 3SARA 4JI5M 3A98B 3RE8A 4OVZA 4RF0A 4RNAA 5EJCA 3MHVC 4KO8A 2EUCA 1KFVA 3ZH9B 4OX9M 3FD9A 3QWLA 2KRKA 1OFHA 4B7FA 3GP1A 2CV0A 3Q8XA 4LG2A 4DR1M 2EA0A 3J2PB 1D2NA 4M0WA 3M6AA 4DV4M 1OFIA 1HR0M 3U60A 1Z5AA 4DV6M 1L2BA 1Z5BA 3UK6A 2I7PA 2XH9A 4A3VB 3SHGB 2F5QA 2L7HA 2FFJA 4P16A 4GRIA 3RFWA 3VK8A 2QBYA 1R7RA 2KEBA 3A45A 4PCZA 1QAMA 3KW6A 1SXJE 2R46A 1Z5CA 3KFUG 4LFAM 3J7AS 4GHAA 1IY0A 3SHFA 1NY6A 5GKNA 3FTDA 1G4AE 1YE9A 3TE6A 4QNMA 2BJVA 4DV2M 4LZJA 1SXJA 5ITTA 3VDPA 3MJ5A 4MGZE 5IZ7D 1W5TA 2VQFM 4WURA 4FW9A 5EP2A 4JI7M 2CEAA 3GLHA 8CATA 5KPRA 5FSWA 4NOOB 1SXJC 2CFOA 5IREB 4NL4H 1DGGA 4OU7A 4GKJM 3SAVA 4LGYA 2ZANA 3GRYA 2HL7A 3FYDA 1DO2A 2H1RA 2HKJA 2XZUA 1N32M 3TWLA 4DV5M 2DHRA 2M60A 4AZFA 2RKOA 1Q3BA 3VDUA 1DGHA 3TWMA 2Z7JA 3R9XB 4LCBA 5DYIA 2Z3XA 2CHQA 3HKPA 5KQ8A 3A42A 2LNHC 4R7GA 4OW0A 4IBEA 3GPPA 2DZNB 4ZPXA 1GL6A 1G3IA 3FUUA 3IG5A 3SMPA 2R62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXE A; 
#chains in the Genus database with same CATH topology
 1KSF X;  2L7I A;  3C58 A;  1F4I A;  2XZF A;  3D8B A;  2F5P A;  2VDB B;  1HQY E;  3A46 A;  2XFS A;  3FTC A;  5BPV A;  4I8O A;  4P17 A;  4MGY E;  2LVN C;  4IBG A;  1IN4 A;  1IN8 A;  4HLQ A;  4QHS A;  2HCB A;  3T1H M;  1YUB A;  1K3X A;  2UU9 M;  2XSZ A;  3SAT A;  2JNH A;  4B3T M;  4CIS A;  2DEN A;  1Q39 A;  4GKK M;  3DOA A;  4GH9 A;  7CAT A;  3B7Z A;  3JAM S;  1IXZ A;  1NHG C;  1C7Y A;  2EO2 A;  2RGH A;  1VEK A;  4L8R C;  4B7H A;  2YR0 A;  1H6U A;  2KNZ A;  4I4L A;  3KS8 A;  1NJG A;  2D7E A;  5BR8 M;  4XGI A;  1A5T A;  3DZD A;  3KOZ E;  3L29 A;  3I4V A;  4MGK E;  2E5L M;  3M7G A;  4LJ5 A;  3VLF B;  2KNV A;  3U6E A;  1LV7 A;  2DWZ B;  4D81 A;  3CF0 A;  1YSY A;  4I81 A;  4B08 A;  4G4R A;  1TDZ A;  1MX0 A;  2H5X A;  3FYC A;  3C3D A;  3J81 S;  2JA2 A;  1WIV A;  3J7B A;  1SG9 A;  1E32 A;  2O5R A;  3GRV A;  3QYE A;  4IBB A;  2Z4R A;  4S12 A;  5E6J A;  3THG A;  5FLX S;  1R2Y A;  2DXI A;  2UXC M;  2G8L A;  2XF3 A;  3SC3 A;  2BNK A;  5FTL A;  3HU2 A;  1V33 A;  1ZMW A;  3B74 A;  4LF4 M;  2BWB A;  2MJ5 B;  2V1C A;  2ZAO A;  2FOI C;  2QCU A;  4FD2 A;  1NO1 A;  3HHY A;  3U6C A;  3U5Z A;  4LFC M;  5FTM A;  1IN5 A;  2LBC A;  1XC8 A;  1GAB A;  4AKG A;  1XXH A;  1TR8 A;  3J80 S;  4GMQ A;  2QHO B;  4DV0 M;  4IBD A;  4G4Q A;  3GRU A;  5F3W A;  3NWL A;  1VQ1 A;  1GO5 A;  1DGF A;  4KLN A;  5EP1 A;  5LMN M;  1L1Z A;  2DWM A;  1KYI A;  3M0E A;  2OOB A;  2ZM6 M;  3EIE A;  4UN2 B;  2L6O A;  1WR1 B;  5JI2 E;  1N77 A;  3GLI A;  1Z6T A;  2JP7 A;  3B89 A;  2UUC M;  3B9P A;  2X4A A;  2A5Y B;  3GQ3 A;  1N36 M;  2J5Y A;  2NQ8 C;  1QZM A;  3GPU A;  5FTN A;  2OO9 A;  1RU3 A;  5KPZ A;  1R5L A;  4YHH M;  3EIH A;  3U6L A;  2RRU A;  4FWG A;  3BXW A;  3D8L A;  3I51 A;  3LQR A;  3KP0 E;  3U61 A;  1NVM A;  3KS4 A;  2KA6 B;  4FCV A;  2WSE F;  1E9R A;  2M5Z A;  4JI6 M;  1V34 A;  1Q3C A;  3HU1 A;  3FE3 A;  4B7G A;  3RGS A;  1DO0 A;  4EIW A;  5L8R F;  1NY5 A;  3KVW A;  1QUS A;  3DA1 A;  3U6P A;  1VDD A;  2ZBK B;  4KT0 F;  1ORY B;  5EP3 A;  2LH0 A;  3K8Z A;  1QAN A;  1XMO M;  4DBG B;  3GLF B;  4DUY M;  1PGY A;  4XK8 F;  2DAG A;  2DVW B;  3KOW E;  1R2Z A;  4B3S M;  1J5E M;  3NBI A;  1N75 A;  2KXE A;  4XBO A;  5EXS A;  3LQQ A;  1IQP A;  1IXS A;  3K92 A;  4MGI E;  4NC6 A;  3W0F A;  1XB2 B;  2JUJ A;  1PJS A;  4LF7 M;  3CTW B;  3J27 B;  3PNY A;  4IBK A;  3U6S A;  2K9D A;  3L28 A;  1JQJ C;  4LJ8 A;  2Y0T A;  3LCU A;  3AFH A;  3U6D A;  1ZQ9 A;  1E9S A;  3MMP A;  3FUX A;  4LRT A;  1MU5 A;  2FE8 A;  4CGY B;  2CV1 A;  4DR3 M;  2EKF A;  2ZTC A;  4FWH A;  3KXE C;  3TQS A;  2C96 A;  2OPF A;  4Z8X A;  2G5G X;  1GVN A;  4R3D A;  3IG8 A;  3SAW A;  4HL4 A;  2D7H A;  1EFU B;  2KZS A;  3U6O A;  3SAS A;  4B3M M;  3BOS A;  1TH3 A;  4II7 A;  2DNA A;  1IBM M;  1NSF A;  1OJL A;  5H37 D;  2XGN A;  3UGJ A;  2ERC A;  4NXN M;  3KP1 E;  4AG6 A;  3HHX A;  3GLG B;  3U6M A;  1JR3 E;  3GQ4 A;  2UUA M;  1GLN A;  2K47 A;  1AIP C;  1PRB A;  4BB9 A;  3TL4 X;  3KOY E;  1HNW M;  1R6B X;  1D0M A;  2OOA A;  1EIJ A;  4JYA M;  1T6O A;  2R65 A;  3U5Z B;  1D0K A;  1VEJ A;  1WXQ A;  4YY3 M;  1HT1 E;  3ILK A;  3KSX A;  1Z59 A;  2HWJ A;  2KHH A;  3NBX X;  4LJA A;  1T3T A;  4LY6 A;  1GKI A;  4NSO B;  4OVZ B;  3GLF E;  3SBJ A;  1MJG M;  4Y28 F;  1J09 A;  2FNA A;  3T38 A;  3DFZ A;  3AV0 A;  4LJ4 A;  2BWE A;  2L09 A;  2LVQ D;  4I5S A;  1XNQ M;  2QPA A;  1HQC A;  3HU3 A;  4MGH A;  1S3S A;  1TF0 B;  2Q2E B;  1JR3 D;  3SAU A;  4ITQ A;  1CUK A;  3CGW A;  1ZAE A;  3R8F A;  4FVM A;  3U60 B;  1G41 A;  3FRH A;  3QAU A;  4LRS A;  3ZQJ A;  2C5R A;  2B3T A;  1QAQ A;  4X66 M;  3KOX E;  2I7N A;  1HT2 E;  2C98 A;  4M9Z A;  4QNR A;  3ZC7 B;  1N34 M;  3C3E A;  4QOS A;  5C18 A;  1FJG M;  4IJE A;  4JI4 M;  4CHT B;  2QBY B;  3SFZ A;  4M9S A;  1GJS A;  2J7N A;  4IBC A;  1WGL A;  1L2C A;  1HNZ M;  1WGN A;  4JV5 M;  5DYG A;  4R71 A;  4AKH A;  2CP8 A;  2DAM A;  2X49 A;  3PFI A;  2CUZ A;  3SMS A;  2ZAM A;  2KW0 A;  1PJT A;  3HWS A;  3I04 M;  1N78 A;  1V92 A;  2CWB A;  3K1J A;  4L78 A;  1I4W A;  3U6Q A;  1PJJ A;  4DR5 M;  1E94 E;  2R18 A;  3HHZ A;  3L27 A;  2JXN A;  3VK7 A;  3WHL A;  4JI2 M;  2APL A;  3KSJ A;  4L6V 6;  4JI0 M;  4AW4 A;  1SXJ B;  4IJF A;  1UFZ A;  3GLG E;  1OIP A;  2R6F A;  3CF6 E;  4D80 A;  3AOE A;  4FWD A;  2P5T A;  4JN6 A;  1P3Q Q;  2LHG A;  3FTE A;  5FTJ A;  4PT5 A;  2JY6 B;  4WW0 A;  3GLH B;  1IN6 A;  2R4E A;  3BBZ A;  4MM3 B;  4F2L A;  1G59 A;  4LF8 M;  4BLC A;  4GHL A;  4RF1 A;  3TPZ A;  2V6Z M;  2O25 A;  1GJT A;  3HZJ A;  1UM8 A;  4GIP A;  2QEN A;  4M9X A;  4JI3 M;  3AOE C;  2JZ0 A;  5KQD A;  2O01 F;  2Z8Y M;  3HGI A;  3LVW A;  4LZZ A;  4IIW A;  4Q7J A;  2F5S A;  4PD2 A;  1XHB A;  4PDG A;  3RGP A;  1EE8 A;  5ITQ A;  3I4Y A;  1K3W A;  3T15 A;  4PDI A;  2OQ4 A;  4NXM M;  2RGO A;  1PJI A;  2YNM D;  3L2A A;  3K2L A;  3FTF A;  3TWK A;  3HX3 A;  2MH8 A;  4D82 A;  1DGH B;  4JI1 M;  3FUT A;  1MN3 A;  4AQY M;  2X8A A;  3T6P A;  1ZMU A;  4JXJ A;  1OKS A;  4DR4 M;  2UUB M;  2DWN A;  3JR5 A;  3GPX A;  3E9S A;  1QQW A;  2AHM A;  5LMU M;  2JZ1 A;  3SYK A;  1QDT A;  2V1U A;  4QHT A;  5EXX A;  4MH0 E;  3AKZ A;  3Q8G A;  4L4U A;  2XLJ A;  4G4N A;  2CV2 A;  3LCV B;  1QDR A;  5FTK A;  4X65 M;  3UJN A;  5KPT A;  3V76 A;  1IBL M;  2VII A;  1VDL A;  4KOD A;  1QVR A;  4DR7 M;  4IBJ A;  1GL7 A;  2JY5 A;  3GLH E;  1WJ7 A;  1XWI A;  2W82 A;  2DI0 A;  2C99 A;  3HJQ A;  4AKI A;  3UZU A;  2C9O A;  2CE7 A;  4LGM A;  2GQF A;  2WSF F;  3SYL A;  4IBI A;  4NRW A;  1K82 A;  2L2D A;  1IM2 A;  4DR2 M;  2LXE A;  3K9P A;  1G8P A;  1HNX M;  1JB0 F;  4LFB M;  3B7Q A;  5A2Q S;  2G3Q A;  1SXJ D;  3VFD A;  4X64 M;  4DV7 M;  3PVS A;  1VG5 A;  1X37 A;  2C9C A;  1PJQ A;  1OQY A;  1TH2 A;  1IN7 A;  2QNJ A;  4GEW A;  4W5W A;  1NV8 A;  3LVV A;  3W0L B;  3AL0 C;  2DZL A;  2HAK A;  2VQE M;  2XEP A;  2EKK A;  3L26 A;  1C1K A;  3FUW A;  1NNU C;  5JI3 E;  1R4G A;  2CHG A;  3AJI B;  4REZ A;  4LJ6 A;  4WP2 A;  2K0B X;  4KHP M;  3B7N A;  5EQT A;  4NSR A;  3F92 A;  1VEG A;  1XNR M;  2R4J A;  3AOG A;  3JR4 A;  2YFQ A;  4AI6 A;  2QQ8 A;  1IY2 A;  4DV3 M;  5DNY A;  2DWL A;  1W5S A;  1I94 M;  2R44 A;  1QYR A;  5ITX E;  1BVS A;  2DAI A;  4NRV A;  2HHH M;  4B3R M;  2QZ4 A;  2UXD M;  1XXH B;  1T43 A;  1IXR C;  2Y20 A;  3HY5 A;  3ZCB B;  1L1T A;  1IY1 A;  2LVP C;  4L16 A;  1PM5 A;  4MB7 A;  3CF2 A;  1NNJ A;  4G4O A;  1XMQ M;  4GIT A;  1JR3 A;  4LF9 M;  4QOZ C;  1OIZ A;  5EXP A;  4LF6 M;  5EXT A;  3HJ8 A;  1TDH A;  4FCW A;  4CJ6 A;  4TUW A;  2QSF X;  2KNA A;  3W67 A;  2F5N A;  4JI8 M;  3VKG A;  2DZO B;  5ITX A;  3GLF A;  3GLI B;  2Y0Q A;  5ITU A;  1FNN A;  2Y21 A;  4L15 A;  2BJW A;  2QP9 X;  3FUV A;  1ZV1 A;  2F5O A;  3IHP A;  3T1Y M;  5EP4 A;  3HHW A;  2F4V M;  2JY7 A;  3PNV A;  2XFT A;  3IEC A;  4AG5 A;  3GO8 A;  4K0K M;  2GNO A;  2KZU A;  3GQ5 A;  3U61 B;  4LF5 M;  2CRU A;  1Y8G A;  4LJ9 A;  1J7K A;  2R45 A;  3UMM A;  3QYB A;  3MK6 A;  4M0D A;  5KO3 A;  2Z4S A;  4DUZ M;  4GC9 A;  1DV0 A;  2XSZ D;  3VKH A;  3GPY A;  3WHK A;  1TH4 A;  3FKE A;  3KDS E;  5E26 A;  4BBA A;  1N33 M;  3OTO M;  1DGB A;  1QAO A;  2MR9 A;  2YQZ A;  3H4M A;  2N35 A;  2D7G A;  4X62 M;  1L2D A;  4G3O A;  4GC5 A;  4F1I A;  4Z6Y A;  2DKL A;  4DV1 M;  1D0L A;  2VF7 A;  5ITR A;  3E46 A;  4LJ7 A;  4DR6 M;  1IXS B;  3PXG A;  3L25 A;  1XXH E;  3GRR A;  2LWX A;  2MRO B;  1NHW C;  2CHV A;  3LMM A;  1IFY A;  1TGU A;  3GLG A;  3E4R A;  5C1B A;  5ITY A;  5IWA M;  2UXB M;  2J7O A;  3HJS A;  2FH0 A;  4FCT A;  1NJF A;  4G6Z A;  5IT9 S;  1IBK M;  2KRU A;  4IBF A;  1AUA A;  1L8Q A;  3SAR A;  4JI5 M;  3A98 B;  3RE8 A;  4OVZ A;  4RF0 A;  4RNA A;  5EJC A;  3GLI E;  3MHV C;  4KO8 A;  2L4F A;  2EUC A;  1KFV A;  3ZH9 B;  4OX9 M;  3FD9 A;  3QWL A;  2KRK A;  1OFH A;  2LTU A;  3W68 A;  4B7F A;  3GP1 A;  1OTR A;  2LHC A;  2CV0 A;  3Q8X A;  2ZTD A;  4DR1 M;  4LG2 A;  2EA0 A;  3J2P B;  1D2N A;  4M0W A;  3M6A A;  4DV4 M;  1OFI A;  1HR0 M;  3U60 A;  2DAE A;  1Z5A A;  4DV6 M;  1L2B A;  1Z5B A;  3UK6 A;  2I7P A;  2XH9 A;  4A3V B;  2MGW A;  3SHG B;  2F5Q A;  2L7H A;  2FFJ A;  4P16 A;  3H4J A;  4GRI A;  3RFW A;  3VK8 A;  2QBY A;  1R7R A;  2KEB A;  3A45 A;  4PCZ A;  1QAM A;  1TTE A;  1SXJ E;  2R46 A;  3KW6 A;  1Z5C A;  3KFU G;  4LFA M;  1G71 A;  3J7A S;  4GHA A;  1IY0 A;  3SHF A;  2JY8 A;  1NY6 A;  5GKN A;  3FTD A;  1OAO C;  1G4A E;  1YE9 A;  3FRI A;  4QNM A;  3TE6 A;  2BJV A;  4DV2 M;  4CIZ A;  1NV9 A;  2LVA A;  4LZJ A;  1SXJ A;  5ITT A;  3VDP A;  3MJ5 A;  4MGZ E;  1Q02 A;  1W5T A;  2EJS A;  5IZ7 D;  2VQF M;  4WUR A;  4FW9 A;  5EP2 A;  4JI7 M;  1WHC A;  2CEA A;  1YLA A;  3GLH A;  4ANR A;  2L4E A;  8CAT A;  5KPR A;  2FS1 A;  5FSW A;  4NOO B;  1SXJ C;  3LW5 F;  1ZMV A;  2JWS A;  2LVO C;  2CFO A;  5IRE B;  4NL4 H;  1DGG A;  1OAI A;  4OU7 A;  4GKJ M;  3SAV A;  1QZE A;  2R0I A;  4LGY A;  2WSC F;  1QUT A;  5DFL A;  2ZAN A;  2HL7 A;  3GRY A;  3FYD A;  3I01 M;  1DO2 A;  2H1R A;  2HKJ A;  2XZU A;  1N32 M;  2DHY A;  4HEO A;  3TWL A;  4DV5 M;  2DHR A;  2M60 A;  4AZF A;  2RKO A;  2DAK A;  1Q3B A;  3VDU A;  1DGH A;  3TWM A;  2Z7J A;  3R9X B;  3C9P A;  4LCB A;  5DYI A;  2Z3X A;  2CHQ A;  2WZJ A;  3HKP A;  1HJP A;  5KQ8 A;  3A42 A;  2LNH C;  2K6B A;  4R7G A;  4OW0 A;  3K9O A;  4IBE A;  3GPP A;  2DZN B;  4ZPX A;  1GL6 A;  3E21 A;  1LTM A;  2VF8 A;  2KDL A;  1G3I A;  3FUU A;  3IG5 A;  3SMP A;  4RKU F;  2R62 A; 
#chains in the Genus database with same CATH homology
 1KSF X;  2L7I A;  3C58 A;  2XZF A;  3D8B A;  2F5P A;  1HQY E;  3A46 A;  2XFS A;  3FTC A;  5BPV A;  4I8O A;  4MGY E;  4IBG A;  1IN4 A;  1IN8 A;  4HLQ A;  4QHS A;  2HCB A;  3T1H M;  1YUB A;  1K3X A;  2UU9 M;  2XSZ A;  3SAT A;  4B3T M;  4CIS A;  4LF9 M;  4GKK M;  1Q39 A;  3DOA A;  4GH9 A;  7CAT A;  3JAM S;  1IXZ A;  1NHG C;  2EO2 A;  2RGH A;  4L8R C;  4B7H A;  2YR0 A;  1H6U A;  4I4L A;  3KS8 A;  1NJG A;  2D7E A;  5BR8 M;  4XGI A;  3DZD A;  3KOZ E;  3L29 A;  3I4V A;  4MGK E;  2E5L M;  3M7G A;  4LJ5 A;  3VLF B;  3U6E A;  1LV7 A;  2DWZ B;  4D81 A;  3CF0 A;  1YSY A;  4I81 A;  4B08 A;  4G4R A;  1TDZ A;  1MX0 A;  3FYC A;  3J81 S;  2JA2 A;  3J7B A;  3GRV A;  1E32 A;  2O5R A;  4IBB A;  4S12 A;  3THG A;  2Z4R A;  5E6J A;  5FLX S;  2UXC M;  2DXI A;  1R2Y A;  2G8L A;  2XF3 A;  3SC3 A;  2BNK A;  5FTL A;  3HU2 A;  4LF4 M;  2V1C A;  2ZAO A;  2FOI C;  2QCU A;  4FD2 A;  3HHY A;  3U6C A;  3U5Z A;  4LFC M;  5FTM A;  1IN5 A;  1XC8 A;  4AKG A;  1XXH A;  3J80 S;  4GMQ A;  4DV0 M;  4IBD A;  4G4Q A;  3GRU A;  5F3W A;  3NWL A;  1DGF A;  4KLN A;  5EP1 A;  5LMN M;  1L1Z A;  2DWM A;  1KYI A;  3M0E A;  2ZM6 M;  3EIE A;  2L6O A;  5JI2 E;  1N77 A;  3GLI A;  1Z6T A;  2UUC M;  3B9P A;  2X4A A;  2A5Y B;  3GQ3 A;  1N36 M;  2NQ8 C;  1QZM A;  3GPU A;  5FTN A;  5KPZ A;  4YHH M;  3EIH A;  3U6L A;  4FWG A;  3D8L A;  3I51 A;  3LQR A;  3KP0 E;  3U61 A;  1NVM A;  3KS4 A;  2KA6 B;  4FCV A;  1E9R A;  2M5Z A;  4JI6 M;  1Q3C A;  3HU1 A;  4B7G A;  3RGS A;  1DO0 A;  4EIW A;  1NY5 A;  3KVW A;  3DA1 A;  3U6P A;  1VDD A;  2ZBK B;  1ORY B;  5EP3 A;  2LH0 A;  3K8Z A;  1QAN A;  1XMO M;  3GLF B;  4DUY M;  2DVW B;  3KOW E;  1R2Z A;  4B3S M;  1J5E M;  3NBI A;  1N75 A;  2KXE A;  4XBO A;  5EXS A;  3LQQ A;  1IQP A;  3K92 A;  4MGI E;  3W0F A;  4LF7 M;  3CTW B;  3J27 B;  3PNY A;  4IBK A;  3U6S A;  3L28 A;  1JQJ C;  4LJ8 A;  2Y0T A;  3AFH A;  1ZQ9 A;  1E9S A;  4LRT A;  3FUX A;  1MU5 A;  2FE8 A;  4CGY B;  2CV1 A;  4DR3 M;  4FWH A;  3KXE C;  3TQS A;  2C96 A;  2OPF A;  4Z8X A;  2G5G X;  1GVN A;  4R3D A;  3IG8 A;  3SAW A;  4HL4 A;  2D7H A;  2KZS A;  3U6O A;  3SAS A;  4B3M M;  3BOS A;  1TH3 A;  4II7 A;  1IBM M;  1NSF A;  1OJL A;  5H37 D;  2XGN A;  3UGJ A;  2ERC A;  4NXN M;  3KP1 E;  4AG6 A;  3HHX A;  3GLG B;  3U6M A;  3GQ4 A;  2UUA M;  1GLN A;  2K47 A;  4BB9 A;  3TL4 X;  3KOY E;  1HNW M;  1R6B X;  4JYA M;  2R65 A;  3U5Z B;  1WXQ A;  1HT1 E;  3ILK A;  3KSX A;  1Z59 A;  4NSO B;  4LY6 A;  4LJA A;  4OVZ B;  1T3T A;  3PXG A;  1GKI A;  3SBJ A;  1J09 A;  2FNA A;  3T38 A;  3DFZ A;  3AV0 A;  4LJ4 A;  2L09 A;  4I5S A;  1XNQ M;  2QPA A;  1HQC A;  3HU3 A;  4MGH A;  1S3S A;  2Q2E B;  3SAU A;  1JR3 D;  4ITQ A;  1ZAE A;  3R8F A;  4FVM A;  3U60 B;  1G41 A;  3QAU A;  4LRS A;  2C5R A;  1QAQ A;  4X66 M;  3KOX E;  2I7N A;  1HT2 E;  2C98 A;  4M9Z A;  4QNR A;  3ZC7 B;  1N34 M;  4QOS A;  5C18 A;  1FJG M;  4IJE A;  4JI4 M;  4CHT B;  2QBY B;  3SFZ A;  4M9S A;  2J7N A;  4IBC A;  1L2C A;  1HNZ M;  4JV5 M;  5DYG A;  4AKH A;  2X49 A;  3PFI A;  2CUZ A;  3SMS A;  2ZAM A;  2KW0 A;  3HWS A;  1N78 A;  3K1J A;  4L78 A;  1I4W A;  3U6Q A;  1PJJ A;  4DR5 M;  1E94 E;  2R18 A;  3HHZ A;  3L27 A;  3VK7 A;  3WHL A;  4JI2 M;  3KSJ A;  4JI0 M;  4AW4 A;  1SXJ B;  4IJF A;  3CF6 E;  4D80 A;  3AOE A;  4FWD A;  2P5T A;  4JN6 A;  3FTE A;  5FTJ A;  4PT5 A;  4WW0 A;  3GLH B;  1IN6 A;  2R4E A;  1G59 A;  4MM3 B;  4LF8 M;  4BLC A;  4GHL A;  4RF1 A;  3TPZ A;  2V6Z M;  3U6D A;  4YY3 M;  1UM8 A;  4GIP A;  2QEN A;  4M9X A;  4JI3 M;  3AOE C;  5KQD A;  3HGI A;  3LVW A;  4LZZ A;  4IIW A;  2F5S A;  4PD2 A;  1XHB A;  4PDG A;  3RGP A;  1EE8 A;  5ITQ A;  3I4Y A;  1K3W A;  3T15 A;  4PDI A;  2OQ4 A;  4NXM M;  2RGO A;  1PJI A;  2YNM D;  3L2A A;  3K2L A;  3FTF A;  3TWK A;  4D82 A;  1DGH B;  4JI1 M;  3FUT A;  4AQY M;  2X8A A;  4JXJ A;  4DR4 M;  2UUB M;  2DWN A;  3JR5 A;  3GPX A;  3E9S A;  1QQW A;  2AHM A;  5LMU M;  3SYK A;  2V1U A;  4QHT A;  5EXX A;  4MH0 E;  3AKZ A;  4L4U A;  2XLJ A;  4G4N A;  2CV2 A;  5FTK A;  4X65 M;  3UJN A;  5KPT A;  1IBL M;  2VII A;  4KOD A;  1QVR A;  4DR7 M;  4IBJ A;  1GL7 A;  1XWI A;  2W82 A;  2C99 A;  3HJQ A;  4AKI A;  3UZU A;  2C9O A;  2CE7 A;  4LGM A;  3SYL A;  4IBI A;  4NRW A;  1K82 A;  1IM2 A;  4DR2 M;  2LXE A;  1HNX M;  1G8P A;  4LFB M;  5A2Q S;  1SXJ D;  3VFD A;  4X64 M;  4DV7 M;  3PVS A;  1X37 A;  2C9C A;  1TH2 A;  1IN7 A;  3AL0 C;  4W5W A;  3LVV A;  3W0L B;  2VQE M;  2XEP A;  3L26 A;  1C1K A;  3FUW A;  1NNU C;  5JI3 E;  2CHG A;  3AJI B;  4REZ A;  4LJ6 A;  4KHP M;  5EQT A;  4NSR A;  1XNR M;  2R4J A;  3AOG A;  3JR4 A;  2YFQ A;  4AI6 A;  1IY2 A;  4DV3 M;  5DNY A;  2DWL A;  1W5S A;  1I94 M;  1QYR A;  5ITX E;  4NRV A;  4B3R M;  2UXD M;  2HHH M;  2QZ4 A;  1XXH B;  3ZCB B;  1IXR C;  2Y20 A;  1L1T A;  4JI8 M;  1IY1 A;  4L16 A;  1PM5 A;  4MB7 A;  3CF2 A;  1NNJ A;  4G4O A;  1XMQ M;  4GIT A;  1JR3 A;  4QOZ C;  4LF6 M;  5EXP A;  5EXT A;  3HJ8 A;  1TDH A;  4FCW A;  4TUW A;  2F5N A;  3VKG A;  2DZO B;  5ITX A;  3GLF A;  3GLI B;  2Y0Q A;  5ITU A;  1FNN A;  2Y21 A;  4L15 A;  2BJW A;  2QP9 X;  3FUV A;  2F5O A;  3T1Y M;  5EP4 A;  3HHW A;  2F4V M;  3PNV A;  4AG5 A;  2XFT A;  3GO8 A;  4K0K M;  2KZU A;  3GQ5 A;  3U61 B;  4LF5 M;  4LJ9 A;  1J7K A;  2R45 A;  3UMM A;  3MK6 A;  4M0D A;  5KO3 A;  2Z4S A;  4DUZ M;  4GC9 A;  2XSZ D;  3VKH A;  3GPY A;  3WHK A;  1TH4 A;  3FKE A;  3KDS E;  5E26 A;  4BBA A;  1N33 M;  3OTO M;  1DGB A;  1QAO A;  2YQZ A;  3H4M A;  2D7G A;  4X62 M;  1L2D A;  4GC5 A;  4Z6Y A;  4DV1 M;  5ITR A;  4LJ7 A;  4DR6 M;  1IXS B;  3L25 A;  3GRR A;  2LWX A;  1NHW C;  2CHV A;  3LMM A;  1TGU A;  3GLG A;  3E4R A;  5C1B A;  5ITY A;  5IWA M;  2UXB M;  2J7O A;  3HJS A;  4FCT A;  1NJF A;  4G6Z A;  5IT9 S;  1IBK M;  2KRU A;  4IBF A;  1L8Q A;  3SAR A;  4JI5 M;  3A98 B;  3RE8 A;  4OVZ A;  4RF0 A;  4RNA A;  5EJC A;  3MHV C;  4KO8 A;  2EUC A;  1KFV A;  3ZH9 B;  4OX9 M;  3FD9 A;  3QWL A;  2KRK A;  1OFH A;  4B7F A;  3GP1 A;  2CV0 A;  3Q8X A;  4LG2 A;  4DR1 M;  2EA0 A;  3J2P B;  1D2N A;  4M0W A;  3M6A A;  4DV4 M;  1OFI A;  1HR0 M;  3U60 A;  1Z5A A;  4DV6 M;  1L2B A;  1Z5B A;  3UK6 A;  2I7P A;  2XH9 A;  4A3V B;  3SHG B;  2F5Q A;  2L7H A;  2FFJ A;  4P16 A;  4GRI A;  3RFW A;  3VK8 A;  2QBY A;  1R7R A;  2KEB A;  3A45 A;  4PCZ A;  1QAM A;  3KW6 A;  1SXJ E;  2R46 A;  1Z5C A;  3KFU G;  4LFA M;  3J7A S;  4GHA A;  1IY0 A;  3SHF A;  1NY6 A;  5GKN A;  3FTD A;  1G4A E;  1YE9 A;  3TE6 A;  4QNM A;  2BJV A;  4DV2 M;  4LZJ A;  1SXJ A;  5ITT A;  3VDP A;  3MJ5 A;  4MGZ E;  5IZ7 D;  1W5T A;  2VQF M;  4WUR A;  4FW9 A;  5EP2 A;  4JI7 M;  2CEA A;  3GLH A;  8CAT A;  5KPR A;  5FSW A;  4NOO B;  1SXJ C;  2CFO A;  5IRE B;  4NL4 H;  1DGG A;  4OU7 A;  4GKJ M;  3SAV A;  4LGY A;  2ZAN A;  3GRY A;  2HL7 A;  3FYD A;  1DO2 A;  2H1R A;  2HKJ A;  2XZU A;  1N32 M;  3TWL A;  4DV5 M;  2DHR A;  2M60 A;  4AZF A;  2RKO A;  1Q3B A;  3VDU A;  1DGH A;  3TWM A;  2Z7J A;  3R9X B;  4LCB A;  5DYI A;  2Z3X A;  2CHQ A;  3HKP A;  5KQ8 A;  3A42 A;  2LNH C;  4R7G A;  4OW0 A;  4IBE A;  3GPP A;  2DZN B;  4ZPX A;  1GL6 A;  1G3I A;  3FUU A;  3IG5 A;  3SMP A;  2R62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...