2KXEA

N-terminal domain of the dp1 subunit of an archaeal d-family dna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords DNA polymerase II small subunit
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.800 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kxeA00
2KXEA
chains in the Genus database with same CATH superfamily
3H4JA 2K47A 5FTJA 2EJSA 3DFZA 4Y28F 1SXJA 1HT1E 4LJ8A 5KO3A 1NNJA 2XEPA 1JR3A 4R7GA 1JR3D 2EA0A 2F5SA 3FYDA 3T38A 3KS8A 2KW0A 1N77A 1D0LA 3L28A 8CATA 3U6LA 3EIEA 2ZTDA 4GEWA 4CIZA 2CEAA 1TH4A 4ZPXA 3THGA 3U5ZB 3B74A 2KRUA 3E21A 1IFYA 3LW5F 3KOXE 3K1JA 1NV8A 3HU2A 5EXSA 1L2BA 1W5TA 1DGHB 1F4IA 4OX9M 2G3QA 3K9OA 2V1UA 2R6FA 4AG5A 1OAIA 3BBZA 3SFZA 5BPVA 3VK8A 2BJWA 4X64M 2DXIA 1XHBA 4DV5M 3BXWA 1DGHA 3AOEA 4YHHM 2F5QA 1OKSA 2UXBM 2H5XA 1WR1B 3KS4A 1IN7A 4MGYE 3K2LA 4KLNA 1J09A 4IJEA 4PDIA 3HU3A 1E9SA 4MH0E 3GLFA 4G4QA 1J5EM 2UUCM 4JV5M 1IBLM 2JY5A 2KZSA 2CP8A 4Z8XA 2VIIA 4DBGB 2XF3A 2KRKA 3C9PA 4OW0A 3SHGB 3KOYE 3T6PA 1VEGA 4B3RM 3KOZE 4DUZM 3TPZA 2WSFF 2DAKA 4KO8A 1PRBA 2G8LA 2OOBA 2A5YB 3LQQA 3TWKA 4R71A 2LHCA 3A46A 4DV4M 3SMPA 2LVAA 1JR3E 2CHQA 4DV3M 2HHHM 2OPFA 4D80A 2VF7A 5KPRA 4YY3M 4CGYB 1L1ZA 4LJ5A 5DYIA 5IWAM 4IBBA 5FTKA 1E94E 1VEJA 2R62A 2DAMA 3W67A 1GL6A 3AOGA 2XSZD 3UMMA 3FUUA 2QZ4A 3JR5A 1D2NA 1GLNA 2XSZA 4DV2M 3HZJA 1SXJC 5KPTA 1QUSA 2L2DA 4BBAA 3U5ZA 4GKJM 3VKHA 4GHLA 2JXNA 3I4VA 2L7HA 4NRWA 4DR4M 3CTWB 4GC5A 1GL7A 4TUWA 2R44A 4AI6A 1NVMA 1GO5A 3AJIB 2EKFA 2R46A 3B7QA 4LF6M 3GO8A 5DNYA 1KFVA 4NXNM 1IN5A 1L2DA 5KPZA 1MU5A 4XGIA 2YFQA 4FD2A 3GPXA 4AW4A 4NXMM 3DA1A 3ILKA 1NO1A 1N78A 4IBDA 4HEOA 3GQ3A 1ORYB 1T3TA 1S3SA 2HAKA 1PM5A 4OVZB 4DV7M 1VG5A 3GRRA 2KNVA 5FTLA 3HX3A 3WHLA 1CUKA 2P5TA 3GP1A 5E26A 1OIZA 2BJVA 4GC9A 4I8OA 3V76A 3LVWA 4B7HA 3GLGB 3HJQA 2VQFM 1PJQA 3U6CA 3E4RA 3B7NA 3GPYA 1GJSA 1PJSA 1MN3A 3AKZA 1Z5BA 2O5RA 3GLIE 1IBMM 1R6BX 4LFBM 4JI6M 1WIVA 2QCUA 2LVOC 4WP2A 3LCUA 1Z5CA 1ZMWA 2JA2A 4P17A 1IN8A 1LV7A 2DZLA 3GLHE 1GJTA 4NSOB 1XMQM 4JI1M 3KFUG 3ZQJA 3GLFE 1TH2A 1XXHB 3E9SA 1R2ZA 4P16A 1K82A 1QVRA 2KNAA 1IY0A 4QHSA 3W68A 4JI5M 4R3DA 4XK8F 3E46A 1N33M 1XMOM 4JI7M 3L25A 2LVQD 2Z7JA 3U6OA 4F2LA 3SYKA 2O25A 2ZANA 4B3TM 3SHFA 1Z5AA 4LJ6A 3SYLA 5ITXE 4AKHA 2C9CA 1WXQA 2R0IA 3KXEC 1N36M 2AHMA 2Q2EB 2N35A 1QQWA 4DV1M 2QBYA 1AIPC 1N32M 4LFCM 2V6ZM 4L4UA 2JP7A 4OVZA 5BR8M 2WSEF 2DHRA 2L6OA 2GNOA 3I01M 2VF8A 1HNWM 2CUZA 3U6PA 2R45A 5EXPA 3VDUA 3UK6A 2UUBM 1NHGC 3W0LB 2JY7A 4DUYM 5FTMA 3NWLA 4L8RC 5FTNA 4QHTA 1YLAA 2DENA 2LHGA 2RGOA 3AOEC 4IBEA 1XNRM 2XGNA 3F92A 5DFLA 3RGPA 2HCBA 4IBJA 3VDPA 5JI2E 3H4MA 2F4VM 1K3XA 1A5TA 4AG6A 1Y8GA 3IG5A 2XFSA 3FTEA 3B7ZA 3KP1E 1X37A 4DV0M 3AL0C 3U60B 2J7NA 1TGUA 2QP9X 1IXSB 1XB2B 2C96A 3JAMS 3OTOM 4I5SA 4X62M 3FUWA 1XWIA 4IBGA 4QNMA 2HL7A 4LJ7A 3QWLA 3K8ZA 4IBKA 2Y0QA 3HY5A 4FCTA 3UJNA 1K3WA 1EE8A 3FRIA 1OFHA 2M60A 5L8RF 1R2YA 3GRUA 4LF8M 2BWBA 4M9ZA 3HJ8A 3A45A 4JN6A 1I4WA 1FNNA 3TWMA 3UGJA 4JI8M 1QAOA 4FW9A 3WHKA 1NY5A 2JUJA 3FE3A 3M0EA 3KW6A 1SXJE 1IN4A 4S12A 3ZC7B 1QDTA 4B08A 3GLIB 3J80S 4G4OA 2R4JA 1PGYA 2ZAMA 1VEKA 1G71A 2G5GX 1DGBA 3KP0E 3GLGE 3PNVA 5H37D 4MGHA 3JR4A 2KNZA 4Q7JA 3Q8XA 3SASA 2XH9A 1MX0A 4A3VB 3SC3A 2RRUA 2JNHA 2LTUA 2Z3XA 1HNXM 4LF4M 1AUAA 3D8BA 3U6MA 4GRIA 3SAUA 3T1HM 1T6OA 2CRUA 1NNUC 4G4RA 5EXXA 2RGHA 4DR7M 1J7KA 4IBFA 3KSJA 3QYEA 2Y21A 7CATA 1DGGA 2KXEA 2QSFX 3MMPA 3MK6A 3U61B 4LF7M 2JZ0A 3J2PB 4REZA 1R5LA 1TDZA 2FFJA 3HKPA 2LVPC 1PJTA 1IBKM 1HT2E 3B89A 4RKUF 1C7YA 2UXCM 1QZMA 1WGLA 4JXJA 3R9XB 1G59A 3HGIA 1HQCA 1IM2A 2JY6B 2DNAA 1C1KA 3VLFB 1QZEA 4MM3B 2H1RA 3SARA 5EQTA 3FYCA 1SXJD 1N34M 3L29A 4MGKE 5EP3A 1UM8A 3U6DA 3L2AA 3GPUA 4LRSA 4IJFA 1QUTA 2KHHA 2V1CA 3CF0A 1D0KA 2BNKA 3IHPA 1KYIA 4LZZA 3ZH9B 3VKGA 2K0BX 2JWSA 4FWDA 3HHZA 2KA6B 1Z6TA 1OFIA 1HNZM 1ZMUA 3EIHA 4GMQA 4HLQA 2XFTA 2ZTCA 1MJGM 3LMMA 4M9XA 1H6UA 5EP2A 2CE7A 1EIJA 4GH9A 4B7FA 4LGMA 2CFOA 4FCVA 3M6AA 4GHAA 5ITXA 2UXDM 1E32A 1NHWC 4ANRA 2R65A 5ITUA 2KEBA 3A98B 1NJFA 2DAEA 4DR2M 3NBXX 4LZJA 1P3QQ 2CHVA 4KHPM 1Q3CA 2L09A 2W82A 1IY2A 2F5OA 3SBJA 2YNMD 2D7HA 3GQ4A 4WURA 2ZAOA 4L6V6 2XZUA 1L2CA 2F5NA 3FUVA 4FCWA 1XXHE 5A2QS 1WHCA 2CHGA 4WW0A 4JI2M 1SG9A 4MGZE 3HWSA 4PDGA 5E6JA 2XLJA 1G4AE 2CV0A 1YSYA 4QNRA 3C3EA 2C99A 3C58A 1TR8A 1ZAEA 2O01F 1Q02A 1TH3A 2HKJA 3FRHA 3LVVA 4DR3M 2C5RA 1SXJB 1JB0F 1GABA 1IXZA 4B3MM 3IECA 2VDBB 1N75A 2WSCF 3QAUA 2ZM6M 2C9OA 3UZUA 1NJGA 1DO0A 4X66M 1NV9A 2DI0A 4MB7A 3RGSA 5ITQA 2I7NA 1V34A 1XXHA 5FSWA 3A42A 2EO2A 2K9DA 1YUBA 2BWEA 2DHYA 4G6ZA 1NY6A 1KSFX 1W5SA 3DZDA 1YE9A 1OAOC 4L78A 4UN2B 1R7RA 2Z8YM 2M5ZA 3U6EA 1T43A 2UUAM 2FS1A 1QYRA 2B3TA 1R4GA 4BB9A 3VK7A 4MGIE 3T1YM 4AQYM 1QAQA 5EXTA 2OQ4A 2Y20A 3HJSA 1E9RA 4KODA 1G3IA 4W5WA 4DR6M 1WJ7A 2CWBA 4PD2A 2QBYB 4OU7A 1WGNA 3SAWA 4CHTB 4NRVA 2DZOB 4IIWA 2DWLA 4HL4A 2R4EA 2DKLA 1HJPA 1TTEA 2KDLA 4LJ9A 3GLGA 4DR5M 1I94M 1VDDA 1PJIA 3TL4X 5LMUM 5KQDA 1IQPA 4F1IA 2VQEM 5C18A 4ITQA 3FUTA 3TE6A 3GRVA 1DV0A 3SMSA 2DAIA 2R18A 3RFWA 1VDLA 2X8AA 1ZQ9A 4XBOA 2JZ1A 2J5YA 2QENA 1TF0B 2DZNB 4QOSA 3GPPA 5LMNM 1G41A 3K9PA 4M0WA 4M0DA 2CV2A 1OQYA 3U6QA 1GVNA 3KVWA 3LQRA 5IREB 3T15A 2WZJA 3PFIA 3PVSA 3HHWA 1V33A 2Y0TA 3B9PA 4GIPA 3ZCBB 3R8FA 3FTFA 2HWJA 1IXRC 1ZV1A 3FUXA 2APLA 3CF6E 3HU1A 2MGWA 5EP1A 3TQSA 3VFDA 3GQ5A 2FE8A 2L4FA 4I81A 2ERCA 1BVSA 3KSXA 3J27B 3KOWE 2E5LM 1NSFA 3J7BA 4RF0A 4AZFA 4JYAM 4KT0F 3FKEA 4LGYA 3GLHA 1UFZA 3C3DA 3CF2A 2NQ8C 2OOAA 4NL4H 3BOSA 2X49A 2YQZA 3QYBA 1IY1A 3GLIA 1D0MA 2MROB 1JQJC 1OJLA 3NBIA 5DYGA 5C1BA 3HHXA 1TDHA 2DWZB 2FH0A 3AV0A 4Z6YA 4B3SM 4DV6M 4L16A 4I4LA 2EUCA 4CISA 3RE8A 4LJAA 1PJJA 2LBCA 3K92A 3U6SA 4JI3M 4DR1M 2LH0A 2D7EA 1GKIA 1Z59A 1XNQM 1IXSA 1Q3BA 3I04M 4LFAM 2XZFA 1QDRA 1HQYE 3LCVB 1HR0M 1QAMA 1XC8A 4G4NA 4LCBA 2MH8A 2F5PA 3FTDA 2LWXA 3I51A 4AKGA 1V92A 1G8PA 3KDSE 4QOZC 1IN6A 3L27A 4IBIA 3U60A 4B7GA 3L26A 3CGWA 2DVWB 2MJ5B 2C98A 3IG8A 4PCZA 1L1TA 4L15A 2J7OA 3W0FA 4X65M 3HHYA 4LRTA 5GKNA 1EFUB 2QNJA 1Q39A 4LG2A 1ZMVA 2DWMA 2K6BA 5EP4A 3SAVA 4NOOB 2CV1A 4LY6A 4NSRA 5JI3E 2ZBKB 3GLHB 3DOAA 2L7IA 3AFHA 3J7AS 2OO9A 3PNYA 3PXGA 5F3WA 4LF5M 2DWNA 1OIPA 4K0KM 4D81A 3FD9A 4LJ4A 4RF1A 2X4AA 4GITA 4GKKM 1DGFA 4JI0M 2QQ8A 3FTCA 5IT9S 4JI4M 3MHVC 2QHOB 2FNAA 2D7GA 3GRYA 2KZUA 4PT5A 3TWLA 2Z4RA 2DAGA 5IZ7D 3I4YA 2UU9M 3J81S 4CJ6A 4IBCA 1QANA 1LTMA 2GQFA 3MJ5A 1DO2A 5ITYA 2JY8A 4G3OA 4NC6A 4M9SA 4LF9M 2MR9A 2LVNC 4BLCA 3GLFB 4D82A 3D8LA 2LXEA 2YR0A 3M7GA 2LNHC 3SATA 2I7PA 3U61A 2Z4SA 5ITTA 1RU3A 1OTRA 2EKKA 1L8QA 2QPAA 5KQ8A 5FLXS 5ITRA 4EIWA 2FOIC 4FVMA 5EJCA 4FWGA 2L4EA 1FJGM 4FWHA 2RKOA 3Q8GA 4II7A 4RNAA 4AKIA 1VQ1A
chains in the Genus database with same CATH topology
5FTJA 2K47A 3DFZA 1SXJA 1HT1E 4LJ8A 5KO3A 1NNJA 2XEPA 1JR3A 4R7GA 1JR3D 2EA0A 2F5SA 3FYDA 3T38A 3KS8A 2KW0A 1N77A 3L28A 8CATA 3U6LA 3EIEA 2CEAA 1TH4A 4ZPXA 3THGA 3U5ZB 2KRUA 3KOXE 3K1JA 3HU2A 5EXSA 1L2BA 1W5TA 1DGHB 4OX9M 2V1UA 4AG5A 5BPVA 3VK8A 3SFZA 2BJWA 4X64M 2DXIA 1XHBA 1DGHA 3AOEA 4YHHM 2F5QA 2UXBM 3KS4A 1IN7A 4MGYE 3K2LA 4KLNA 1J09A 4IJEA 4PDIA 3HU3A 1E9SA 4MH0E 3GLFA 4G4QA 1J5EM 2UUCM 1IBLM 2KZSA 4Z8XA 2VIIA 2XF3A 2KRKA 4OW0A 3SHGB 3KOYE 4B3RM 3KOZE 4DUZM 3TPZA 4KO8A 3LQQA 2G8LA 3A46A 2A5YB 3TWKA 4DV4M 4JV5M 3SMPA 2CHQA 4DV3M 2HHHM 2OPFA 4D80A 5KPRA 4YY3M 4CGYB 1L1ZA 4LJ5A 5DYIA 5IWAM 4IBBA 5FTKA 1E94E 2R62A 1GL6A 3AOGA 2XSZD 3UMMA 3FUUA 2QZ4A 3JR5A 1D2NA 1GLNA 2XSZA 4DV2M 1SXJC 5KPTA 4GKJM 4BBAA 3U5ZA 3VKHA 4GHLA 3I4VA 4DR4M 2L7HA 4NRWA 3CTWB 4GC5A 1GL7A 4TUWA 4AI6A 1NVMA 3AJIB 2R46A 4LF6M 3GO8A 5DNYA 1KFVA 4NXNM 1IN5A 1L2DA 5KPZA 1MU5A 4XGIA 2YFQA 4FD2A 3GPXA 4AW4A 4NXMM 3DA1A 3ILKA 1N78A 4IBDA 3GQ3A 1ORYB 1T3TA 1S3SA 1PM5A 4OVZB 4DV7M 3GRRA 5FTLA 3WHLA 3GP1A 2P5TA 5E26A 2BJVA 4GC9A 4I8OA 3LVWA 4B7HA 3GLGB 3HJQA 2VQFM 3U6CA 3E4RA 3GPYA 3AKZA 4LFBM 1Z5BA 2O5RA 1IBMM 1R6BX 4JI6M 2QCUA 1Z5CA 2JA2A 1IN8A 1LV7A 4JI1M 1XMQM 4NSOB 3KFUG 1TH2A 1XXHB 3E9SA 1R2ZA 4P16A 1K82A 1QVRA 1IY0A 4QHSA 4JI5M 4R3DA 1N33M 1XMOM 4JI7M 3L25A 2Z7JA 3U6OA 3SYKA 2ZANA 4B3TM 3SHFA 1Z5AA 4LJ6A 3SYLA 5ITXE 4AKHA 2C9CA 1WXQA 3KXEC 1N36M 2AHMA 2Q2EB 1QQWA 4DV1M 2QBYA 1N32M 4LFCM 2V6ZM 4L4UA 4OVZA 5BR8M 1HNWM 2DHRA 2L6OA 2CUZA 3U6PA 2R45A 5EXPA 3VDUA 3UK6A 2UUBM 1NHGC 3W0LB 4DUYM 5FTMA 3NWLA 4L8RC 5FTNA 4QHTA 2RGOA 3AOEC 4IBEA 1XNRM 2XGNA 2F4VM 3RGPA 2HCBA 4IBJA 3VDPA 5JI2E 3H4MA 1K3XA 4AG6A 3IG5A 2XFSA 3KP1E 1X37A 4DV0M 3AL0C 3U60B 2J7NA 1TGUA 2QP9X 1IXSB 2C96A 3JAMS 3OTOM 4I5SA 4X62M 3FUWA 1XWIA 4IBGA 4QNMA 2HL7A 4LJ7A 3QWLA 3K8ZA 4IBKA 2Y0QA 4FCTA 3UJNA 1K3WA 1EE8A 1OFHA 2M60A 1R2YA 3GRUA 4LF8M 4M9ZA 3HJ8A 3A45A 4JN6A 1I4WA 1FNNA 3TWMA 3UGJA 4JI8M 1QAOA 4FW9A 3WHKA 1NY5A 3M0EA 4S12A 4DV5M 3KW6A 1SXJE 1IN4A 3ZC7B 3FTEA 4B08A 3GLIB 3J80S 4G4OA 2R4JA 2ZAMA 2G5GX 1DGBA 3KP0E 3PNVA 5H37D 4MGHA 3JR4A 3Q8XA 3SASA 2XH9A 1MX0A 4A3VB 3SC3A 1HNXM 2Z3XA 4LF4M 3U6MA 3D8BA 4GRIA 3SAUA 3T1HM 1NNUC 4G4RA 5EXXA 2RGHA 4DR7M 1J7KA 4IBFA 3KSJA 7CATA 2Y21A 1DGGA 2KXEA 3MK6A 3U61B 4LF7M 3J2PB 4REZA 1TDZA 2FFJA 3HKPA 1IBKM 1HT2E 2UXCM 1QZMA 4JXJA 3R9XB 1G59A 3HGIA 1HQCA 1IM2A 1C1KA 3VLFB 4MM3B 2H1RA 3SARA 5EQTA 3FYCA 1SXJD 1N34M 3L29A 4MGKE 5EP3A 1UM8A 3U6DA 3L2AA 3GPUA 4LRSA 4IJFA 2XZUA 2V1CA 3CF0A 3VKGA 2BNKA 4LZZA 1KYIA 3ZH9B 4FWDA 3HHZA 2KA6B 1Z6TA 1OFIA 1HNZM 3EIHA 4GMQA 4HLQA 2XFTA 3LMMA 4M9XA 1H6UA 5EP2A 2CE7A 4GH9A 4B7FA 4LGMA 2CFOA 4FCVA 3M6AA 4GHAA 5ITXA 2UXDM 1E32A 1NHWC 2R65A 5ITUA 2KEBA 3A98B 1NJFA 4DR2M 4LZJA 2CHVA 4KHPM 1Q3CA 2L09A 2W82A 1IY2A 2F5OA 3SBJA 2YNMD 2D7HA 3GQ4A 4WURA 2ZAOA 2F5NA 1L2CA 3FUVA 4FCWA 5A2QS 2CHGA 4WW0A 4JI2M 4MGZE 3HWSA 4PDGA 5E6JA 2XLJA 1G4AE 2CV0A 1YSYA 4QNRA 2C99A 3C58A 1ZAEA 2HKJA 1TH3A 4DR3M 3LVVA 2C5RA 1SXJB 1IXZA 4B3MM 1N75A 3QAUA 2ZM6M 2C9OA 3UZUA 1NJGA 1DO0A 4X66M 4MB7A 3RGSA 5ITQA 2I7NA 1XXHA 5FSWA 3A42A 2EO2A 1YUBA 4G6ZA 1NY6A 1KSFX 1W5SA 3DZDA 1YE9A 4L78A 1R7RA 2M5ZA 3U6EA 2UUAM 1QYRA 4BB9A 3VK7A 4MGIE 3T1YM 4AQYM 1QAQA 5EXTA 2OQ4A 2Y20A 3HJSA 1E9RA 4KODA 1G3IA 4W5WA 4DR6M 4PD2A 2QBYB 4OU7A 3SAWA 4CHTB 4NRVA 2DZOB 4IIWA 2DWLA 4HL4A 2R4EA 4DR5M 1I94M 3GLGA 4LJ9A 1VDDA 1PJIA 3TL4X 5LMUM 5KQDA 1IQPA 2VQEM 5C18A 4ITQA 3FUTA 3TE6A 3GRVA 3SMSA 2R18A 3RFWA 2X8AA 1ZQ9A 4XBOA 2QENA 2DZNB 4QOSA 3GPPA 5LMNM 1G41A 4M0WA 4M0DA 2CV2A 3U6QA 1GVNA 3KVWA 3LQRA 5IREB 3T15A 3PFIA 3PVSA 3HHWA 2Y0TA 4GIPA 3B9PA 3ZCBB 3R8FA 3FTFA 1IXRC 3HU1A 3FUXA 5EP1A 3CF6E 3TQSA 3GQ5A 3VFDA 2FE8A 4I81A 2ERCA 3KSXA 3J27B 3KOWE 2E5LM 1NSFA 3J7BA 4RF0A 4AZFA 4JYAM 3FKEA 4LGYA 3GLHA 4NL4H 3CF2A 2NQ8C 3BOSA 2X49A 2YQZA 1IY1A 3GLIA 3NBIA 1JQJC 1OJLA 5DYGA 5C1BA 3HHXA 1TDHA 2DWZB 3AV0A 4Z6YA 4B3SM 4DV6M 4L16A 4I4LA 2EUCA 4CISA 3RE8A 4LJAA 1PJJA 3K92A 3U6SA 4JI3M 4DR1M 2LH0A 2D7EA 1GKIA 1Z59A 1XNQM 1Q3BA 4LFAM 2XZFA 1HQYE 1HR0M 1QAMA 1XC8A 4G4NA 4LCBA 2F5PA 3FTDA 2LWXA 3I51A 4AKGA 1G8PA 3KDSE 4QOZC 1IN6A 3L27A 4IBIA 3U60A 4B7GA 3L26A 3IG8A 2DVWB 2C98A 1L1TA 4PCZA 4L15A 2J7OA 3W0FA 4X65M 3HHYA 4LRTA 5GKNA 1Q39A 4LG2A 2DWMA 5EP4A 3SAVA 4NOOB 2CV1A 4LY6A 4NSRA 5JI3E 2ZBKB 3GLHB 3DOAA 2L7IA 3AFHA 3J7AS 3PXGA 3PNYA 5F3WA 4LF5M 2DWNA 4K0KM 4D81A 3FD9A 4LJ4A 4RF1A 2X4AA 4GITA 4GKKM 1DGFA 4JI0M 3FTCA 5IT9S 4JI4M 3MHVC 2FNAA 2D7GA 3GRYA 2KZUA 4PT5A 3TWLA 2Z4RA 5IZ7D 3I4YA 2UU9M 3J81S 4IBCA 1QANA 3MJ5A 1DO2A 5ITYA 4M9SA 4LF9M 4BLCA 3GLFB 4D82A 3D8LA 2LXEA 2YR0A 3M7GA 2LNHC 3SATA 2I7PA 3U61A 2Z4SA 5ITTA 1L8QA 2QPAA 5KQ8A 5FLXS 5ITRA 4EIWA 2FOIC 4FVMA 5EJCA 4FWGA 1FJGM 4FWHA 2RKOA 4II7A 4RNAA 4AKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXE A; 
#chains in the Genus database with same CATH topology
 3H4J A;  2K47 A;  5FTJ A;  2EJS A;  3DFZ A;  4Y28 F;  1SXJ A;  1HT1 E;  4LJ8 A;  5KO3 A;  1NNJ A;  2XEP A;  1JR3 A;  4R7G A;  1JR3 D;  2EA0 A;  2F5S A;  3FYD A;  3T38 A;  3KS8 A;  2KW0 A;  1N77 A;  1D0L A;  3L28 A;  8CAT A;  3U6L A;  3EIE A;  2ZTD A;  4GEW A;  4CIZ A;  2CEA A;  1TH4 A;  4ZPX A;  3THG A;  3U5Z B;  3B74 A;  2KRU A;  3E21 A;  1IFY A;  3LW5 F;  3KOX E;  3K1J A;  1NV8 A;  3HU2 A;  5EXS A;  1L2B A;  1W5T A;  1DGH B;  1F4I A;  4OX9 M;  2G3Q A;  3K9O A;  2V1U A;  2R6F A;  4AG5 A;  1OAI A;  3BBZ A;  3SFZ A;  5BPV A;  3VK8 A;  2BJW A;  4X64 M;  2DXI A;  1XHB A;  4DV5 M;  3BXW A;  1DGH A;  3AOE A;  4YHH M;  2F5Q A;  1OKS A;  2UXB M;  2H5X A;  1WR1 B;  3KS4 A;  1IN7 A;  4MGY E;  3K2L A;  4KLN A;  1J09 A;  4IJE A;  4PDI A;  3HU3 A;  1E9S A;  4MH0 E;  3GLF A;  4G4Q A;  1J5E M;  2UUC M;  4JV5 M;  1IBL M;  2JY5 A;  2KZS A;  2CP8 A;  4Z8X A;  2VII A;  4DBG B;  2XF3 A;  2KRK A;  3C9P A;  4OW0 A;  3SHG B;  3KOY E;  3T6P A;  1VEG A;  4B3R M;  3KOZ E;  4DUZ M;  3TPZ A;  2WSF F;  2DAK A;  4KO8 A;  1PRB A;  2G8L A;  2OOB A;  2A5Y B;  3LQQ A;  3TWK A;  4R71 A;  2LHC A;  3A46 A;  4DV4 M;  3SMP A;  2LVA A;  1JR3 E;  2CHQ A;  4DV3 M;  2HHH M;  2OPF A;  4D80 A;  2VF7 A;  5KPR A;  4YY3 M;  4CGY B;  1L1Z A;  4LJ5 A;  5DYI A;  5IWA M;  4IBB A;  5FTK A;  1E94 E;  1VEJ A;  2R62 A;  2DAM A;  3W67 A;  1GL6 A;  3AOG A;  2XSZ D;  3UMM A;  3FUU A;  2QZ4 A;  3JR5 A;  1D2N A;  1GLN A;  2XSZ A;  4DV2 M;  3HZJ A;  1SXJ C;  5KPT A;  1QUS A;  2L2D A;  4BBA A;  3U5Z A;  4GKJ M;  3VKH A;  4GHL A;  2JXN A;  3I4V A;  2L7H A;  4NRW A;  4DR4 M;  3CTW B;  4GC5 A;  1GL7 A;  4TUW A;  2R44 A;  4AI6 A;  1NVM A;  1GO5 A;  3AJI B;  2EKF A;  2R46 A;  3B7Q A;  4LF6 M;  3GO8 A;  5DNY A;  1KFV A;  4NXN M;  1IN5 A;  1L2D A;  5KPZ A;  1MU5 A;  4XGI A;  2YFQ A;  4FD2 A;  3GPX A;  4AW4 A;  4NXM M;  3DA1 A;  3ILK A;  1NO1 A;  1N78 A;  4IBD A;  4HEO A;  3GQ3 A;  1ORY B;  1T3T A;  1S3S A;  2HAK A;  1PM5 A;  4OVZ B;  4DV7 M;  1VG5 A;  3GRR A;  2KNV A;  5FTL A;  3HX3 A;  3WHL A;  1CUK A;  2P5T A;  3GP1 A;  5E26 A;  1OIZ A;  2BJV A;  4GC9 A;  4I8O A;  3V76 A;  3LVW A;  4B7H A;  3GLG B;  3HJQ A;  2VQF M;  1PJQ A;  3U6C A;  3E4R A;  3B7N A;  3GPY A;  1GJS A;  1PJS A;  1MN3 A;  3AKZ A;  1Z5B A;  2O5R A;  3GLI E;  1IBM M;  1R6B X;  4LFB M;  4JI6 M;  1WIV A;  2QCU A;  2LVO C;  4WP2 A;  3LCU A;  1Z5C A;  1ZMW A;  2JA2 A;  4P17 A;  1IN8 A;  1LV7 A;  2DZL A;  3GLH E;  1GJT A;  4NSO B;  1XMQ M;  4JI1 M;  3KFU G;  3ZQJ A;  3GLF E;  1TH2 A;  1XXH B;  3E9S A;  1R2Z A;  4P16 A;  1K82 A;  1QVR A;  2KNA A;  1IY0 A;  4QHS A;  3W68 A;  4JI5 M;  4R3D A;  4XK8 F;  3E46 A;  1N33 M;  1XMO M;  4JI7 M;  3L25 A;  2LVQ D;  2Z7J A;  3U6O A;  4F2L A;  3SYK A;  2O25 A;  2ZAN A;  4B3T M;  3SHF A;  1Z5A A;  4LJ6 A;  3SYL A;  5ITX E;  4AKH A;  2C9C A;  1WXQ A;  2R0I A;  3KXE C;  1N36 M;  2AHM A;  2Q2E B;  2N35 A;  1QQW A;  4DV1 M;  2QBY A;  1AIP C;  1N32 M;  4LFC M;  2V6Z M;  4L4U A;  2JP7 A;  4OVZ A;  5BR8 M;  2WSE F;  2DHR A;  2L6O A;  2GNO A;  3I01 M;  2VF8 A;  1HNW M;  2CUZ A;  3U6P A;  2R45 A;  5EXP A;  3VDU A;  3UK6 A;  2UUB M;  1NHG C;  3W0L B;  2JY7 A;  4DUY M;  5FTM A;  3NWL A;  4L8R C;  5FTN A;  4QHT A;  1YLA A;  2DEN A;  2LHG A;  2RGO A;  3AOE C;  4IBE A;  1XNR M;  2XGN A;  3F92 A;  5DFL A;  3RGP A;  2HCB A;  4IBJ A;  3VDP A;  5JI2 E;  3H4M A;  2F4V M;  1K3X A;  1A5T A;  4AG6 A;  1Y8G A;  3IG5 A;  2XFS A;  3FTE A;  3B7Z A;  3KP1 E;  1X37 A;  4DV0 M;  3AL0 C;  3U60 B;  2J7N A;  1TGU A;  2QP9 X;  1IXS B;  1XB2 B;  2C96 A;  3JAM S;  3OTO M;  4I5S A;  4X62 M;  3FUW A;  1XWI A;  4IBG A;  4QNM A;  2HL7 A;  4LJ7 A;  3QWL A;  3K8Z A;  4IBK A;  2Y0Q A;  3HY5 A;  4FCT A;  3UJN A;  1K3W A;  1EE8 A;  3FRI A;  1OFH A;  2M60 A;  5L8R F;  1R2Y A;  3GRU A;  4LF8 M;  2BWB A;  4M9Z A;  3HJ8 A;  3A45 A;  4JN6 A;  1I4W A;  1FNN A;  3TWM A;  3UGJ A;  4JI8 M;  1QAO A;  4FW9 A;  3WHK A;  1NY5 A;  2JUJ A;  3FE3 A;  3M0E A;  3KW6 A;  1SXJ E;  1IN4 A;  4S12 A;  3ZC7 B;  1QDT A;  4B08 A;  3GLI B;  3J80 S;  4G4O A;  2R4J A;  1PGY A;  2ZAM A;  1VEK A;  1G71 A;  2G5G X;  1DGB A;  3KP0 E;  3GLG E;  3PNV A;  5H37 D;  4MGH A;  3JR4 A;  2KNZ A;  4Q7J A;  3Q8X A;  3SAS A;  2XH9 A;  1MX0 A;  4A3V B;  3SC3 A;  2RRU A;  2JNH A;  2LTU A;  2Z3X A;  1HNX M;  4LF4 M;  1AUA A;  3D8B A;  3U6M A;  4GRI A;  3SAU A;  3T1H M;  1T6O A;  2CRU A;  1NNU C;  4G4R A;  5EXX A;  2RGH A;  4DR7 M;  1J7K A;  4IBF A;  3KSJ A;  3QYE A;  2Y21 A;  7CAT A;  1DGG A;  2KXE A;  2QSF X;  3MMP A;  3MK6 A;  3U61 B;  4LF7 M;  2JZ0 A;  3J2P B;  4REZ A;  1R5L A;  1TDZ A;  2FFJ A;  3HKP A;  2LVP C;  1PJT A;  1IBK M;  1HT2 E;  3B89 A;  4RKU F;  1C7Y A;  2UXC M;  1QZM A;  1WGL A;  4JXJ A;  3R9X B;  1G59 A;  3HGI A;  1HQC A;  1IM2 A;  2JY6 B;  2DNA A;  1C1K A;  3VLF B;  1QZE A;  4MM3 B;  2H1R A;  3SAR A;  5EQT A;  3FYC A;  1SXJ D;  1N34 M;  3L29 A;  4MGK E;  5EP3 A;  1UM8 A;  3U6D A;  3L2A A;  3GPU A;  4LRS A;  4IJF A;  1QUT A;  2KHH A;  2V1C A;  3CF0 A;  1D0K A;  2BNK A;  3IHP A;  1KYI A;  4LZZ A;  3ZH9 B;  3VKG A;  2K0B X;  2JWS A;  4FWD A;  3HHZ A;  2KA6 B;  1Z6T A;  1OFI A;  1HNZ M;  1ZMU A;  3EIH A;  4GMQ A;  4HLQ A;  2XFT A;  2ZTC A;  1MJG M;  3LMM A;  4M9X A;  1H6U A;  5EP2 A;  2CE7 A;  1EIJ A;  4GH9 A;  4B7F A;  4LGM A;  2CFO A;  4FCV A;  3M6A A;  4GHA A;  5ITX A;  2UXD M;  1E32 A;  1NHW C;  4ANR A;  2R65 A;  5ITU A;  2KEB A;  3A98 B;  1NJF A;  2DAE A;  4DR2 M;  3NBX X;  4LZJ A;  1P3Q Q;  2CHV A;  4KHP M;  1Q3C A;  2L09 A;  2W82 A;  1IY2 A;  2F5O A;  3SBJ A;  2YNM D;  2D7H A;  3GQ4 A;  4WUR A;  2ZAO A;  4L6V 6;  2XZU A;  1L2C A;  2F5N A;  3FUV A;  4FCW A;  1XXH E;  5A2Q S;  1WHC A;  2CHG A;  4WW0 A;  4JI2 M;  1SG9 A;  4MGZ E;  3HWS A;  4PDG A;  5E6J A;  2XLJ A;  1G4A E;  2CV0 A;  1YSY A;  4QNR A;  3C3E A;  2C99 A;  3C58 A;  1TR8 A;  1ZAE A;  2O01 F;  1Q02 A;  1TH3 A;  2HKJ A;  3FRH A;  3LVV A;  4DR3 M;  2C5R A;  1SXJ B;  1JB0 F;  1GAB A;  1IXZ A;  4B3M M;  3IEC A;  2VDB B;  1N75 A;  2WSC F;  3QAU A;  2ZM6 M;  2C9O A;  3UZU A;  1NJG A;  1DO0 A;  4X66 M;  1NV9 A;  2DI0 A;  4MB7 A;  3RGS A;  5ITQ A;  2I7N A;  1V34 A;  1XXH A;  5FSW A;  3A42 A;  2EO2 A;  2K9D A;  1YUB A;  2BWE A;  2DHY A;  4G6Z A;  1NY6 A;  1KSF X;  1W5S A;  3DZD A;  1YE9 A;  1OAO C;  4L78 A;  4UN2 B;  1R7R A;  2Z8Y M;  2M5Z A;  3U6E A;  1T43 A;  2UUA M;  2FS1 A;  1QYR A;  2B3T A;  1R4G A;  4BB9 A;  3VK7 A;  4MGI E;  3T1Y M;  4AQY M;  1QAQ A;  5EXT A;  2OQ4 A;  2Y20 A;  3HJS A;  1E9R A;  4KOD A;  1G3I A;  4W5W A;  4DR6 M;  1WJ7 A;  2CWB A;  4PD2 A;  2QBY B;  4OU7 A;  1WGN A;  3SAW A;  4CHT B;  4NRV A;  2DZO B;  4IIW A;  2DWL A;  4HL4 A;  2R4E A;  2DKL A;  1HJP A;  1TTE A;  2KDL A;  4LJ9 A;  3GLG A;  4DR5 M;  1I94 M;  1VDD A;  1PJI A;  3TL4 X;  5LMU M;  5KQD A;  1IQP A;  4F1I A;  2VQE M;  5C18 A;  4ITQ A;  3FUT A;  3TE6 A;  3GRV A;  1DV0 A;  3SMS A;  2DAI A;  2R18 A;  3RFW A;  1VDL A;  2X8A A;  1ZQ9 A;  4XBO A;  2JZ1 A;  2J5Y A;  2QEN A;  1TF0 B;  2DZN B;  4QOS A;  3GPP A;  5LMN M;  1G41 A;  3K9P A;  4M0W A;  4M0D A;  2CV2 A;  1OQY A;  3U6Q A;  1GVN A;  3KVW A;  3LQR A;  5IRE B;  3T15 A;  2WZJ A;  3PFI A;  3PVS A;  3HHW A;  1V33 A;  2Y0T A;  3B9P A;  4GIP A;  3ZCB B;  3R8F A;  3FTF A;  2HWJ A;  1IXR C;  1ZV1 A;  3FUX A;  2APL A;  3CF6 E;  3HU1 A;  2MGW A;  5EP1 A;  3TQS A;  3VFD A;  3GQ5 A;  2FE8 A;  2L4F A;  4I81 A;  2ERC A;  1BVS A;  3KSX A;  3J27 B;  3KOW E;  2E5L M;  1NSF A;  3J7B A;  4RF0 A;  4AZF A;  4JYA M;  4KT0 F;  3FKE A;  4LGY A;  3GLH A;  1UFZ A;  3C3D A;  3CF2 A;  2NQ8 C;  2OOA A;  4NL4 H;  3BOS A;  2X49 A;  2YQZ A;  3QYB A;  1IY1 A;  3GLI A;  1D0M A;  2MRO B;  1JQJ C;  1OJL A;  3NBI A;  5DYG A;  5C1B A;  3HHX A;  1TDH A;  2DWZ B;  2FH0 A;  3AV0 A;  4Z6Y A;  4B3S M;  4DV6 M;  4L16 A;  4I4L A;  2EUC A;  4CIS A;  3RE8 A;  4LJA A;  1PJJ A;  2LBC A;  3K92 A;  3U6S A;  4JI3 M;  4DR1 M;  2LH0 A;  2D7E A;  1GKI A;  1Z59 A;  1XNQ M;  1IXS A;  1Q3B A;  3I04 M;  4LFA M;  2XZF A;  1QDR A;  1HQY E;  3LCV B;  1HR0 M;  1QAM A;  1XC8 A;  4G4N A;  4LCB A;  2MH8 A;  2F5P A;  3FTD A;  2LWX A;  3I51 A;  4AKG A;  1V92 A;  1G8P A;  3KDS E;  4QOZ C;  1IN6 A;  3L27 A;  4IBI A;  3U60 A;  4B7G A;  3L26 A;  3CGW A;  2DVW B;  2MJ5 B;  2C98 A;  3IG8 A;  4PCZ A;  1L1T A;  4L15 A;  2J7O A;  3W0F A;  4X65 M;  3HHY A;  4LRT A;  5GKN A;  1EFU B;  2QNJ A;  1Q39 A;  4LG2 A;  1ZMV A;  2DWM A;  2K6B A;  5EP4 A;  3SAV A;  4NOO B;  2CV1 A;  4LY6 A;  4NSR A;  5JI3 E;  2ZBK B;  3GLH B;  3DOA A;  2L7I A;  3AFH A;  3J7A S;  2OO9 A;  3PNY A;  3PXG A;  5F3W A;  4LF5 M;  2DWN A;  1OIP A;  4K0K M;  4D81 A;  3FD9 A;  4LJ4 A;  4RF1 A;  2X4A A;  4GIT A;  4GKK M;  1DGF A;  4JI0 M;  2QQ8 A;  3FTC A;  5IT9 S;  4JI4 M;  3MHV C;  2QHO B;  2FNA A;  2D7G A;  3GRY A;  2KZU A;  4PT5 A;  3TWL A;  2Z4R A;  2DAG A;  5IZ7 D;  3I4Y A;  2UU9 M;  3J81 S;  4CJ6 A;  4IBC A;  1QAN A;  1LTM A;  2GQF A;  3MJ5 A;  1DO2 A;  5ITY A;  2JY8 A;  4G3O A;  4NC6 A;  4M9S A;  4LF9 M;  2MR9 A;  2LVN C;  4BLC A;  3GLF B;  4D82 A;  3D8L A;  2LXE A;  2YR0 A;  3M7G A;  2LNH C;  3SAT A;  2I7P A;  3U61 A;  2Z4S A;  5ITT A;  1RU3 A;  1OTR A;  2EKK A;  1L8Q A;  2QPA A;  5KQ8 A;  5FLX S;  5ITR A;  4EIW A;  2FOI C;  4FVM A;  5EJC A;  4FWG A;  2L4E A;  1FJG M;  4FWH A;  2RKO A;  3Q8G A;  4II7 A;  4RNA A;  4AKI A;  1VQ1 A; 
#chains in the Genus database with same CATH homology
 5FTJ A;  2K47 A;  3DFZ A;  1SXJ A;  1HT1 E;  4LJ8 A;  5KO3 A;  1NNJ A;  2XEP A;  1JR3 A;  4R7G A;  1JR3 D;  2EA0 A;  2F5S A;  3FYD A;  3T38 A;  3KS8 A;  2KW0 A;  1N77 A;  3L28 A;  8CAT A;  3U6L A;  3EIE A;  2CEA A;  1TH4 A;  4ZPX A;  3THG A;  3U5Z B;  2KRU A;  3KOX E;  3K1J A;  3HU2 A;  5EXS A;  1L2B A;  1W5T A;  1DGH B;  4OX9 M;  2V1U A;  4AG5 A;  5BPV A;  3VK8 A;  3SFZ A;  2BJW A;  4X64 M;  2DXI A;  1XHB A;  1DGH A;  3AOE A;  4YHH M;  2F5Q A;  2UXB M;  3KS4 A;  1IN7 A;  4MGY E;  3K2L A;  4KLN A;  1J09 A;  4IJE A;  4PDI A;  3HU3 A;  1E9S A;  4MH0 E;  3GLF A;  4G4Q A;  1J5E M;  2UUC M;  1IBL M;  2KZS A;  4Z8X A;  2VII A;  2XF3 A;  2KRK A;  4OW0 A;  3SHG B;  3KOY E;  4B3R M;  3KOZ E;  4DUZ M;  3TPZ A;  4KO8 A;  3LQQ A;  2G8L A;  3A46 A;  2A5Y B;  3TWK A;  4DV4 M;  4JV5 M;  3SMP A;  2CHQ A;  4DV3 M;  2HHH M;  2OPF A;  4D80 A;  5KPR A;  4YY3 M;  4CGY B;  1L1Z A;  4LJ5 A;  5DYI A;  5IWA M;  4IBB A;  5FTK A;  1E94 E;  2R62 A;  1GL6 A;  3AOG A;  2XSZ D;  3UMM A;  3FUU A;  2QZ4 A;  3JR5 A;  1D2N A;  1GLN A;  2XSZ A;  4DV2 M;  1SXJ C;  5KPT A;  4GKJ M;  4BBA A;  3U5Z A;  3VKH A;  4GHL A;  3I4V A;  4DR4 M;  2L7H A;  4NRW A;  3CTW B;  4GC5 A;  1GL7 A;  4TUW A;  4AI6 A;  1NVM A;  3AJI B;  2R46 A;  4LF6 M;  3GO8 A;  5DNY A;  1KFV A;  4NXN M;  1IN5 A;  1L2D A;  5KPZ A;  1MU5 A;  4XGI A;  2YFQ A;  4FD2 A;  3GPX A;  4AW4 A;  4NXM M;  3DA1 A;  3ILK A;  1N78 A;  4IBD A;  3GQ3 A;  1ORY B;  1T3T A;  1S3S A;  1PM5 A;  4OVZ B;  4DV7 M;  3GRR A;  5FTL A;  3WHL A;  3GP1 A;  2P5T A;  5E26 A;  2BJV A;  4GC9 A;  4I8O A;  3LVW A;  4B7H A;  3GLG B;  3HJQ A;  2VQF M;  3U6C A;  3E4R A;  3GPY A;  3AKZ A;  4LFB M;  1Z5B A;  2O5R A;  1IBM M;  1R6B X;  4JI6 M;  2QCU A;  1Z5C A;  2JA2 A;  1IN8 A;  1LV7 A;  4JI1 M;  1XMQ M;  4NSO B;  3KFU G;  1TH2 A;  1XXH B;  3E9S A;  1R2Z A;  4P16 A;  1K82 A;  1QVR A;  1IY0 A;  4QHS A;  4JI5 M;  4R3D A;  1N33 M;  1XMO M;  4JI7 M;  3L25 A;  2Z7J A;  3U6O A;  3SYK A;  2ZAN A;  4B3T M;  3SHF A;  1Z5A A;  4LJ6 A;  3SYL A;  5ITX E;  4AKH A;  2C9C A;  1WXQ A;  3KXE C;  1N36 M;  2AHM A;  2Q2E B;  1QQW A;  4DV1 M;  2QBY A;  1N32 M;  4LFC M;  2V6Z M;  4L4U A;  4OVZ A;  5BR8 M;  1HNW M;  2DHR A;  2L6O A;  2CUZ A;  3U6P A;  2R45 A;  5EXP A;  3VDU A;  3UK6 A;  2UUB M;  1NHG C;  3W0L B;  4DUY M;  5FTM A;  3NWL A;  4L8R C;  5FTN A;  4QHT A;  2RGO A;  3AOE C;  4IBE A;  1XNR M;  2XGN A;  2F4V M;  3RGP A;  2HCB A;  4IBJ A;  3VDP A;  5JI2 E;  3H4M A;  1K3X A;  4AG6 A;  3IG5 A;  2XFS A;  3KP1 E;  1X37 A;  4DV0 M;  3AL0 C;  3U60 B;  2J7N A;  1TGU A;  2QP9 X;  1IXS B;  2C96 A;  3JAM S;  3OTO M;  4I5S A;  4X62 M;  3FUW A;  1XWI A;  4IBG A;  4QNM A;  2HL7 A;  4LJ7 A;  3QWL A;  3K8Z A;  4IBK A;  2Y0Q A;  4FCT A;  3UJN A;  1K3W A;  1EE8 A;  1OFH A;  2M60 A;  1R2Y A;  3GRU A;  4LF8 M;  4M9Z A;  3HJ8 A;  3A45 A;  4JN6 A;  1I4W A;  1FNN A;  3TWM A;  3UGJ A;  4JI8 M;  1QAO A;  4FW9 A;  3WHK A;  1NY5 A;  3M0E A;  4S12 A;  4DV5 M;  3KW6 A;  1SXJ E;  1IN4 A;  3ZC7 B;  3FTE A;  4B08 A;  3GLI B;  3J80 S;  4G4O A;  2R4J A;  2ZAM A;  2G5G X;  1DGB A;  3KP0 E;  3PNV A;  5H37 D;  4MGH A;  3JR4 A;  3Q8X A;  3SAS A;  2XH9 A;  1MX0 A;  4A3V B;  3SC3 A;  1HNX M;  2Z3X A;  4LF4 M;  3U6M A;  3D8B A;  4GRI A;  3SAU A;  3T1H M;  1NNU C;  4G4R A;  5EXX A;  2RGH A;  4DR7 M;  1J7K A;  4IBF A;  3KSJ A;  7CAT A;  2Y21 A;  1DGG A;  2KXE A;  3MK6 A;  3U61 B;  4LF7 M;  3J2P B;  4REZ A;  1TDZ A;  2FFJ A;  3HKP A;  1IBK M;  1HT2 E;  2UXC M;  1QZM A;  4JXJ A;  3R9X B;  1G59 A;  3HGI A;  1HQC A;  1IM2 A;  1C1K A;  3VLF B;  4MM3 B;  2H1R A;  3SAR A;  5EQT A;  3FYC A;  1SXJ D;  1N34 M;  3L29 A;  4MGK E;  5EP3 A;  1UM8 A;  3U6D A;  3L2A A;  3GPU A;  4LRS A;  4IJF A;  2XZU A;  2V1C A;  3CF0 A;  3VKG A;  2BNK A;  4LZZ A;  1KYI A;  3ZH9 B;  4FWD A;  3HHZ A;  2KA6 B;  1Z6T A;  1OFI A;  1HNZ M;  3EIH A;  4GMQ A;  4HLQ A;  2XFT A;  3LMM A;  4M9X A;  1H6U A;  5EP2 A;  2CE7 A;  4GH9 A;  4B7F A;  4LGM A;  2CFO A;  4FCV A;  3M6A A;  4GHA A;  5ITX A;  2UXD M;  1E32 A;  1NHW C;  2R65 A;  5ITU A;  2KEB A;  3A98 B;  1NJF A;  4DR2 M;  4LZJ A;  2CHV A;  4KHP M;  1Q3C A;  2L09 A;  2W82 A;  1IY2 A;  2F5O A;  3SBJ A;  2YNM D;  2D7H A;  3GQ4 A;  4WUR A;  2ZAO A;  2F5N A;  1L2C A;  3FUV A;  4FCW A;  5A2Q S;  2CHG A;  4WW0 A;  4JI2 M;  4MGZ E;  3HWS A;  4PDG A;  5E6J A;  2XLJ A;  1G4A E;  2CV0 A;  1YSY A;  4QNR A;  2C99 A;  3C58 A;  1ZAE A;  2HKJ A;  1TH3 A;  4DR3 M;  3LVV A;  2C5R A;  1SXJ B;  1IXZ A;  4B3M M;  1N75 A;  3QAU A;  2ZM6 M;  2C9O A;  3UZU A;  1NJG A;  1DO0 A;  4X66 M;  4MB7 A;  3RGS A;  5ITQ A;  2I7N A;  1XXH A;  5FSW A;  3A42 A;  2EO2 A;  1YUB A;  4G6Z A;  1NY6 A;  1KSF X;  1W5S A;  3DZD A;  1YE9 A;  4L78 A;  1R7R A;  2M5Z A;  3U6E A;  2UUA M;  1QYR A;  4BB9 A;  3VK7 A;  4MGI E;  3T1Y M;  4AQY M;  1QAQ A;  5EXT A;  2OQ4 A;  2Y20 A;  3HJS A;  1E9R A;  4KOD A;  1G3I A;  4W5W A;  4DR6 M;  4PD2 A;  2QBY B;  4OU7 A;  3SAW A;  4CHT B;  4NRV A;  2DZO B;  4IIW A;  2DWL A;  4HL4 A;  2R4E A;  4DR5 M;  1I94 M;  3GLG A;  4LJ9 A;  1VDD A;  1PJI A;  3TL4 X;  5LMU M;  5KQD A;  1IQP A;  2VQE M;  5C18 A;  4ITQ A;  3FUT A;  3TE6 A;  3GRV A;  3SMS A;  2R18 A;  3RFW A;  2X8A A;  1ZQ9 A;  4XBO A;  2QEN A;  2DZN B;  4QOS A;  3GPP A;  5LMN M;  1G41 A;  4M0W A;  4M0D A;  2CV2 A;  3U6Q A;  1GVN A;  3KVW A;  3LQR A;  5IRE B;  3T15 A;  3PFI A;  3PVS A;  3HHW A;  2Y0T A;  4GIP A;  3B9P A;  3ZCB B;  3R8F A;  3FTF A;  1IXR C;  3HU1 A;  3FUX A;  5EP1 A;  3CF6 E;  3TQS A;  3GQ5 A;  3VFD A;  2FE8 A;  4I81 A;  2ERC A;  3KSX A;  3J27 B;  3KOW E;  2E5L M;  1NSF A;  3J7B A;  4RF0 A;  4AZF A;  4JYA M;  3FKE A;  4LGY A;  3GLH A;  4NL4 H;  3CF2 A;  2NQ8 C;  3BOS A;  2X49 A;  2YQZ A;  1IY1 A;  3GLI A;  3NBI A;  1JQJ C;  1OJL A;  5DYG A;  5C1B A;  3HHX A;  1TDH A;  2DWZ B;  3AV0 A;  4Z6Y A;  4B3S M;  4DV6 M;  4L16 A;  4I4L A;  2EUC A;  4CIS A;  3RE8 A;  4LJA A;  1PJJ A;  3K92 A;  3U6S A;  4JI3 M;  4DR1 M;  2LH0 A;  2D7E A;  1GKI A;  1Z59 A;  1XNQ M;  1Q3B A;  4LFA M;  2XZF A;  1HQY E;  1HR0 M;  1QAM A;  1XC8 A;  4G4N A;  4LCB A;  2F5P A;  3FTD A;  2LWX A;  3I51 A;  4AKG A;  1G8P A;  3KDS E;  4QOZ C;  1IN6 A;  3L27 A;  4IBI A;  3U60 A;  4B7G A;  3L26 A;  3IG8 A;  2DVW B;  2C98 A;  1L1T A;  4PCZ A;  4L15 A;  2J7O A;  3W0F A;  4X65 M;  3HHY A;  4LRT A;  5GKN A;  1Q39 A;  4LG2 A;  2DWM A;  5EP4 A;  3SAV A;  4NOO B;  2CV1 A;  4LY6 A;  4NSR A;  5JI3 E;  2ZBK B;  3GLH B;  3DOA A;  2L7I A;  3AFH A;  3J7A S;  3PXG A;  3PNY A;  5F3W A;  4LF5 M;  2DWN A;  4K0K M;  4D81 A;  3FD9 A;  4LJ4 A;  4RF1 A;  2X4A A;  4GIT A;  4GKK M;  1DGF A;  4JI0 M;  3FTC A;  5IT9 S;  4JI4 M;  3MHV C;  2FNA A;  2D7G A;  3GRY A;  2KZU A;  4PT5 A;  3TWL A;  2Z4R A;  5IZ7 D;  3I4Y A;  2UU9 M;  3J81 S;  4IBC A;  1QAN A;  3MJ5 A;  1DO2 A;  5ITY A;  4M9S A;  4LF9 M;  4BLC A;  3GLF B;  4D82 A;  3D8L A;  2LXE A;  2YR0 A;  3M7G A;  2LNH C;  3SAT A;  2I7P A;  3U61 A;  2Z4S A;  5ITT A;  1L8Q A;  2QPA A;  5KQ8 A;  5FLX S;  5ITR A;  4EIW A;  2FOI C;  4FVM A;  5EJC A;  4FWG A;  1FJG M;  4FWH A;  2RKO A;  4II7 A;  4RNA A;  4AKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...