2KXEA

N-terminal domain of the dp1 subunit of an archaeal d-family dna polymerase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
molecule keywords DNA polymerase II small subunit
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.800 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kxeA00
2KXEA
chains in the Genus database with same CATH superfamily
1WHCA 3CGWA 1R2YA 4FCTA 4X65M 5KQDA 1IN6A 2KNVA 4JI3M 2QHOB 3FUUA 1TH4A 1Q3BA 4MGHA 3E9SA 3I01M 1RU3A 3MMPA 2JP7A 4MGYE 1Z6TA 4QOSA 1VDLA 4EIWA 5KPZA 3GPUA 4LF6M 3U61A 5BPVA 4DV1M 4JI6M 3SMPA 4JI4M 2DWZB 5EXPA 3VK8A 5IT9S 3HU3A 1HNWM 1DV0A 4L8RC 3A98B 3GRUA 4ANRA 3U6MA 1OAOC 1HNXM 1XNQM 4LF5M 1GO5A 3J2PB 4F1IA 1R2ZA 4JI5M 2LWXA 3HJQA 4G4NA 4A3VB 5F3WA 3QYEA 3IG5A 4GH9A 4NSRA 3U6LA 3KP1E 3LCUA 3MJ5A 4DBGB 1D0LA 4M0DA 1NO1A 2BJVA 2QENA 3K1JA 3C3EA 4R3DA 1NHGC 2R44A 1GL6A 2VIIA 3FRIA 5EXSA 1WJ7A 3GLFE 3B7NA 3K2LA 4KODA 5EXXA 3I04M 3B7ZA 4MGZE 1DGFA 4DV5M 1IM2A 3VLFB 1XWIA 2R45A 3HJSA 3JR5A 1GLNA 4PDIA 4LF9M 4K0KM 4GC5A 3RE8A 4DR7M 4OVZA 5FTKA 2RGHA 2OOBA 4OW0A 3SAVA 1L2BA 3CF6E 1NHWC 1T6OA 2KHHA 3K9PA 3HY5A 4HLQA 3U6PA 1EFUB 1TH3A 4IBDA 3U5ZA 4NL4H 1IY1A 1L2DA 2CE7A 3V76A 2QSFX 3AL0C 5FTJA 2WSCF 1XMQM 3GLHA 3L29A 2YFQA 4X66M 1DO2A 4LJ5A 1J7KA 1XB2B 4LFAM 2J7NA 2LVNC 4KO8A 5FTLA 1SXJD 2G8LA 4AKIA 3J7BA 3LQQA 4I8OA 4II7A 2DVWB 3DFZA 2DZNB 1IY0A 1JR3D 3TWMA 5KQ8A 3U6QA 1E94E 2L6OA 3SMSA 4AG6A 1IN4A 3H4MA 4KLNA 3GQ3A 2CHGA 4GITA 1OKSA 2KDLA 3TPZA 1HT1E 2JUJA 4JI8M 2AHMA 2LNHC 3KOWE 2C5RA 1DGBA 1X37A 1TTEA 5EJCA 4LRTA 1Y8GA 1ZMUA 4AQYM 3LVWA 2DAIA 1C7YA 2HAKA 3HU1A 2L7HA 1QDTA 3HJ8A 2KNAA 4B3RM 3AKZA 2M60A 4FWGA 3Q8GA 5DFLA 3KOZE 3GPXA 3HZJA 3FYDA 1OIPA 1PGYA 2L09A 1XXHB 3ZH9B 2J5YA 4I4LA 4JN6A 1L1ZA 4AKGA 1IY2A 3K9OA 5H37D 2G3QA 5E26A 3JR4A 5IWAM 1Z5AA 1MN3A 2XZUA 4D81A 3B7QA 4LJ8A 4BLCA 3HGIA 4B08A 2CV2A 1DO0A 1OFIA 5JI3E 1G59A 5IZ7D 3R8FA 4LZJA 3THGA 3NWLA 2DNAA 1SXJC 2GNOA 1YE9A 4W5WA 2I7NA 2D7EA 4DV0M 3NBXX 1EE8A 4G4OA 3MHVC 2WSFF 2APLA 3J27B 3ZC7B 1NVMA 4LCBA 1IFYA 2N35A 2OOAA 4DV3M 3FTCA 2JA2A 1GJTA 4MH0E 1VEJA 2JZ0A 1TR8A 3L27A 2XSZD 3AV0A 4XGIA 2KW0A 2K47A 4IBGA 4F2LA 4LJ4A 2B3TA 2XZFA 1IXSB 2R65A 1N32M 3B89A 4D80A 3VK7A 3GPYA 3M7GA 1R4GA 2DAGA 4IBJA 3KP0E 3DZDA 4CISA 2LVAA 4AI6A 2XF3A 1Q39A 3B9PA 2LVOC 2L4EA 4M9XA 4RKUF 1K3WA 4I81A 2V1CA 1PJQA 4FCVA 4NOOB 2VF8A 1VG5A 1WXQA 2QNJA 5EXTA 3WHLA 1IBKM 3NBIA 2XFTA 1TF0B 2E5LM 4GKJM 3KSJA 4FVMA 1N78A 1FJGM 2CEAA 2XH9A 3K8ZA 4IBFA 2HKJA 3GLIE 1MJGM 2EA0A 4IBIA 2LXEA 3BBZA 4DV4M 4JI1M 3RGPA 2JWSA 1HT2E 5L8RF 2UXBM 4RF0A 1EIJA 4I5SA 1V34A 1TGUA 3PVSA 1R7RA 2X49A 1N36M 2WZJA 3AOEC 1QAMA 2CWBA 3CTWB 4P17A 4PCZA 1SXJA 1E9SA 2CFOA 2FS1A 4B7HA 3J80S 4DUYM 3SATA 4NC6A 1NY6A 2F5SA 3LQRA 3L25A 2NQ8C 1NNJA 1NSFA 2EUCA 2R6FA 2XSZA 1D0KA 2DENA 2JNHA 2DWLA 4S12A 1JR3E 3QYBA 3J81S 2VQEM 1NV9A 1N77A 3T38A 3SHGB 3D8LA 3UZUA 3ZQJA 3B74A 3KOXE 4B7FA 3C9PA 1SG9A 2KNZA 2Y21A 2R18A 1E32A 2EO2A 1XC8A 1YUBA 2Z8YM 4DR1M 1QAOA 4WP2A 3DA1A 5EQTA 5EP4A 2FFJA 1TH2A 2D7HA 2ERCA 3AOGA 2JY6B 1W5SA 3FE3A 4YHHM 1ZMVA 4HL4A 3FUVA 1XXHA 2MROB 4LGMA 4AW4A 4B3TM 3U6OA 2QBYA 5FTMA 1QUSA 3M6AA 4WURA 2HCBA 4LFCM 1OFHA 1QANA 2H1RA 2YQZA 1OIZA 2ZM6M 4CJ6A 5E6JA 1Q3CA 1QVRA 1YSYA 1Z5BA 2X4AA 4M9ZA 2CP8A 4QNRA 5ITQA 2X8AA 2OPFA 2QPAA 3QWLA 1G3IA 4OU7A 1TDHA 4DR6M 4QOZC 4R7GA 3SASA 2XLJA 1L2CA 1VEGA 3CF0A 1D2NA 3W67A 2Y0TA 3FTDA 1PJTA 3T1HM 2HL7A 1NNUC 2L7IA 4CHTB 4P16A 1KFVA 2BWBA 1J09A 4LJ7A 4WW0A 4B7GA 4MGIE 2KZSA 1K3XA 5C18A 3T6PA 3LW5F 4GC9A 3A42A 4IJFA 2CRUA 3KSXA 1P3QQ 2MH8A 3FYCA 1PJIA 1QZMA 3L28A 4PDGA 4L16A 1AUAA 3SAWA 2DZLA 2DWNA 2P5TA 3T1YM 1IBMM 3TL4X 3SBJA 2F4VM 1GABA 1XXHE 1HNZM 1NJFA 3BOSA 1D0MA 2L4FA 2EKFA 4AZFA 4FCWA 2RGOA 3I51A 2XGNA 3GRYA 3I4YA 1R5LA 1IBLM 4G3OA 4GIPA 4HEOA 5DYGA 3TWLA 4CGYB 2XFSA 3HHZA 4OVZB 3HU2A 2RRUA 4DV7M 3GQ4A 4L4UA 4REZA 3HHYA 2MGWA 4Z6YA 4MM3B 1OQYA 3GPPA 4GHAA 2EKKA 3SYKA 1F4IA 2DXIA 4L6V6 3SAUA 4LF7M 1IXSA 1CUKA 3FUWA 1SXJE 3M0EA 1E9RA 1UFZA 2RKOA 4PT5A 3ILKA 3LVVA 2V6ZM 2QBYB 3FUTA 3BXWA 4NXNM 3TE6A 3MK6A 4ITQA 1HR0M 1G4AE 4LF4M 3KDSE 4JI7M 1JR3A 1QYRA 2R4JA 3A45A 3A46A 3QAUA 2CUZA 4NXMM 3F92A 1OJLA 1NY5A 2O5RA 1Z59A 2WSEF 1N33M 1QQWA 3W68A 3KXEC 2Y0QA 1G41A 2Y20A 3LMMA 5ITXA 4DUZM 2ZAMA 4MB7A 2FNAA 4DV2M 4DR2M 4NSOB 4PD2A 1R6BX 4LJAA 3C58A 3U61B 4XK8F 4KT0F 2ZTDA 2ZANA 3VDPA 3U60A 3KOYE 1V33A 2H5XA 2MJ5B 4L15A 1PJJA 3GLHB 3HHXA 5FLXS 5EP3A 1XHBA 3FUXA 3GLHE 1AIPC 1QZEA 3GLIB 4IJEA 3UJNA 4G6ZA 2FH0A 1GJSA 1DGGA 2QQ8A 2A5YB 4DR3M 5ITXE 1T3TA 2C98A 2JZ1A 2DHYA 1L1TA 3AJIB 1DGHB 5GKNA 1A5TA 1IN7A 2DI0A 2ZBKB 3AOEA 1PM5A 4IBBA 3GRVA 8CATA 1K82A 3HWSA 2O01F 3PXGA 3FRHA 2KZUA 1ZMWA 2LH0A 2UUCM 3U6CA 1IQPA 1PRBA 2LTUA 5LMUM 2R62A 4QHTA 5IREB 3SARA 3GO8A 3KW6A 3VDUA 4LJ6A 5KPTA 3GLGE 1QUTA 4FWDA 4LGYA 2Z3XA 1J5EM 2KRUA 1I94M 1N75A 2FOIC 2KXEA 2HWJA 2YR0A 3SHFA 4GMQA 4UN2B 2K0BX 1JQJC 4RF1A 2C96A 2XEPA 2F5OA 5EP1A 2Z4RA 1LV7A 4GRIA 4LRSA 4LZZA 1C1KA 1MX0A 5DYIA 3IHPA 3VFDA 4B3SM 3U6SA 3L2AA 4BB9A 1WGLA 2Z7JA 2VF7A 3W0LB 4B3MM 2F5NA 1N34M 3GP1A 2GQFA 2DKLA 1V92A 1IN5A 2EJSA 2KA6B 3E46A 2F5QA 2LBCA 4IIWA 3TQSA 2LVPC 4FWHA 3GLGB 3GLIA 4JI2M 4FW9A 1T43A 3RGSA 2KRKA 2LVQD 1NJGA 3H4JA 2DWMA 3FKEA 4IBCA 5C1BA 1FNNA 2UXDM 4IBKA 4G4RA 3KFUG 1VEKA 3FTFA 5ITRA 2G5GX 4M9SA 1ZQ9A 4IBEA 2DHRA 2R0IA 2Q2EB 2ZTCA 3UMMA 2LHCA 5BR8M 5KPRA 3EIHA 1L8QA 2QCUA 3WHKA 3KS8A 2I7PA 4LFBM 4Q7JA 2VDBB 1Q02A 4NRVA 4DR5M 4X64M 1VDDA 5LMNM 3E4RA 4XBOA 2CV1A 3E21A 1VQ1A 4R71A 3OTOM 2LHGA 2QP9X 4LJ9A 4DR4M 4JYAM 2V1UA 2KEBA 5JI2E 2F5PA 2O25A 3L26A 5KO3A 4Y28F 3SC3A 1OTRA 4L78A 1GVNA 1I4WA 1XMOM 1KSFX 3UK6A 4ZPXA 4M0WA 3W0FA 3ZCBB 3UGJA 3GLFB 3CF2A 2VQFM 3FD9A 2DZOB 1GL7A 2C9CA 4NRWA 1HQCA 5ITYA 5A2QS 1JB0F 2HHHM 7CATA 1MU5A 3HKPA 2CV0A 2BJWA 1PJSA 2JY7A 3VKGA 1HJPA 4FD2A 1YLAA 2J7OA 1OAIA 3I4VA 2C9OA 1IXRC 3PNVA 4MGKE 2UU9M 1ZV1A 4AKHA 4G4QA 2K9DA 3PFIA 1G8PA 1ORYB 1H6UA 3KVWA 4LF8M 2JY8A 1SXJB 4JXJA 2UUAM 4LG2A 3VKHA 4LY6A 2L2DA 1Z5CA 4QNMA 3Q8XA 3GQ5A 4JV5M 1S3SA 1W5TA 1KYIA 2DAEA 3DOAA 4CIZA 2QZ4A 2R46A 2JXNA 4D82A 2BWEA 3GLGA 4DV6M 1WGNA 2UXCM 1QDRA 4GHLA 2FE8A 3HHWA 5EP2A 1G71A 2BNKA 3U5ZB 4X62M 1XNRM 3FTEA 4YY3M 1QAQA 2UUBM 3SFZA 2K6BA 1WIVA 1IXZA 3TWKA 3U6EA 2M5ZA 3D8BA 2MR9A 4TUWA 3IG8A 3RFWA 1IN8A 3IECA 5FSWA 4AG5A 4JI0M 1HQYE 2Z4SA 5DNYA 2D7GA 3HX3A 4KHPM 1GKIA 2JY5A 3GLFA 1BVSA 5ITTA 2YNMD 4RNAA 2OQ4A 5FTNA 1WR1B 4GEWA 2R4EA 3LCVB 3JAMS 2ZAOA 3J7AS 3R9XB 1DGHA 1UM8A 3U6DA 1NV8A 3EIEA 3PNYA 3AFHA 2CHQA 5ITUA 2C99A 3C3DA 3T15A 4OX9M 3K92A 1TDZA 4BBAA 2DAMA 2W82A 4GKKM 3KS4A 3SYLA 2OO9A 4Z8XA 2DAKA 3GRRA 4QHSA 2CHVA 1ZAEA 3U60B 1LTMA
chains in the Genus database with same CATH topology
1R2YA 4FCTA 4X65M 5KQDA 1IN6A 4JI3M 3FUUA 1TH4A 1Q3BA 4MGHA 3E9SA 4MGYE 1Z6TA 4QOSA 4EIWA 3GPUA 5KPZA 4LF6M 3U61A 5BPVA 4DV1M 4JI6M 3SMPA 4JI4M 2DWZB 5EXPA 3VK8A 5IT9S 3HU3A 1HNWM 4L8RC 3A98B 3GRUA 3U6MA 1XNQM 1HNXM 4LF5M 3J2PB 1R2ZA 4JI5M 2LWXA 3HJQA 4G4NA 4A3VB 5F3WA 3IG5A 4GH9A 4NSRA 3U6LA 3KP1E 3MJ5A 4M0DA 3K1JA 2BJVA 2QENA 4R3DA 1NHGC 1GL6A 2VIIA 5EXSA 3K2LA 4KODA 5EXXA 4MGZE 1DGFA 4DV5M 1IM2A 3VLFB 1XWIA 2R45A 3HJSA 3JR5A 1GLNA 4PDIA 4LF9M 4K0KM 4GC5A 3RE8A 4DR7M 4OVZA 5FTKA 2RGHA 4OW0A 3SAVA 1L2BA 3CF6E 1NHWC 4HLQA 3U6PA 1TH3A 4IBDA 3U5ZA 4NL4H 1IY1A 1L2DA 2CE7A 3AL0C 5FTJA 1XMQM 3GLHA 3L29A 2YFQA 4X66M 1DO2A 4LJ5A 1J7KA 4LFAM 2J7NA 4KO8A 5FTLA 1SXJD 2G8LA 4AKIA 3J7BA 3LQQA 4I8OA 4II7A 2DVWB 3DFZA 2DZNB 1IY0A 1JR3D 3TWMA 5KQ8A 3U6QA 1E94E 2L6OA 3SMSA 4AG6A 1IN4A 3H4MA 4KLNA 3GQ3A 2CHGA 4GITA 3TPZA 1HT1E 4JI8M 2AHMA 2LNHC 3KOWE 2C5RA 1DGBA 1X37A 5EJCA 4LRTA 4AQYM 3LVWA 3HU1A 2L7HA 3HJ8A 4B3RM 3AKZA 2M60A 4FWGA 3KOZE 3GPXA 3FYDA 2L09A 1XXHB 3ZH9B 1L1ZA 4I4LA 4JN6A 4AKGA 1IY2A 5H37D 5E26A 3JR4A 5IWAM 1Z5AA 2XZUA 4D81A 4LJ8A 4BLCA 3HGIA 4B08A 2CV2A 1DO0A 1OFIA 5JI3E 1G59A 5IZ7D 3R8FA 4LZJA 3THGA 3NWLA 1SXJC 1YE9A 4W5WA 2I7NA 2D7EA 4DV0M 1EE8A 4G4OA 3MHVC 3J27B 3ZC7B 1NVMA 4LCBA 4DV3M 3FTCA 2JA2A 4MH0E 4XGIA 3L27A 2XSZD 3AV0A 2KW0A 2K47A 4IBGA 4LJ4A 2XZFA 1IXSB 2R65A 1N32M 4D80A 3VK7A 3GPYA 3M7GA 4IBJA 3KP0E 3DZDA 4CISA 4AI6A 2XF3A 1Q39A 3B9PA 4M9XA 1K3WA 4I81A 2V1CA 4NOOB 4FCVA 3WHLA 1WXQA 5EXTA 1IBKM 3NBIA 2XFTA 2E5LM 4GKJM 3KSJA 4FVMA 1N78A 1FJGM 2CEAA 2XH9A 3K8ZA 4IBFA 2HKJA 4JI1M 2EA0A 4IBIA 2LXEA 4DV4M 3RGPA 2UXBM 1HT2E 4RF0A 4I5SA 1N36M 1TGUA 3PVSA 1R7RA 2X49A 4PCZA 3AOEC 1QAMA 3CTWB 1SXJA 1E9SA 2CFOA 4B7HA 4DUYM 3J80S 3SATA 1NY6A 2F5SA 3LQRA 3L25A 2NQ8C 1NNJA 1NSFA 2EUCA 2XSZA 2DWLA 4S12A 3J81S 2VQEM 1N77A 3T38A 3SHGB 3D8LA 3UZUA 3KOXE 4B7FA 2Y21A 2R18A 1E32A 2EO2A 1XC8A 1YUBA 4DR1M 1QAOA 3DA1A 5EQTA 5EP4A 2FFJA 1TH2A 2D7HA 2ERCA 3AOGA 1W5SA 4YHHM 4HL4A 3FUVA 1XXHA 4LGMA 4AW4A 4B3TM 3U6OA 2QBYA 5FTMA 3M6AA 4WURA 2HCBA 4LFCM 1OFHA 1QANA 2H1RA 2YQZA 2ZM6M 5E6JA 1Q3CA 1QVRA 1YSYA 1Z5BA 2X4AA 4M9ZA 4QNRA 5ITQA 2X8AA 2OPFA 2QPAA 3QWLA 1G3IA 4OU7A 1TDHA 4DR6M 4QOZC 4R7GA 3SASA 2XLJA 1L2CA 3CF0A 1D2NA 3FTDA 2Y0TA 3T1HM 2HL7A 1NNUC 2L7IA 4CHTB 4P16A 1KFVA 1J09A 4LJ7A 4WW0A 4B7GA 4MGIE 2KZSA 1K3XA 5C18A 4GC9A 3A42A 4IJFA 3KSXA 3FYCA 1PJIA 1QZMA 3L28A 4PDGA 4L16A 3SAWA 2DWNA 2P5TA 3T1YM 1IBMM 3TL4X 3SBJA 2F4VM 1HNZM 1NJFA 3BOSA 4AZFA 4FCWA 2RGOA 3I51A 2XGNA 3GRYA 3I4YA 1IBLM 4GIPA 3TWLA 5DYGA 4CGYB 2XFSA 3HHZA 4OVZB 3HU2A 4DV7M 3GQ4A 4L4UA 4REZA 3HHYA 4Z6YA 4MM3B 3GPPA 4GHAA 3SYKA 2DXIA 3SAUA 4LF7M 3FUWA 1SXJE 3M0EA 1E9RA 2RKOA 4PT5A 3ILKA 3LVVA 2V6ZM 2QBYB 3FUTA 4NXNM 3TE6A 3MK6A 4ITQA 1HR0M 1G4AE 4LF4M 3KDSE 4JI7M 1JR3A 1QYRA 2R4JA 3A45A 3A46A 3QAUA 2CUZA 4NXMM 1OJLA 1NY5A 2O5RA 1Z59A 1N33M 1QQWA 3KXEC 2Y0QA 1G41A 2Y20A 3LMMA 5ITXA 4DUZM 2ZAMA 4MB7A 2FNAA 4DV2M 4DR2M 4NSOB 4PD2A 1R6BX 4LJAA 3C58A 3U61B 2ZANA 3VDPA 3U60A 3KOYE 4L15A 1PJJA 3GLHB 3HHXA 5FLXS 5EP3A 1XHBA 3FUXA 3GLIB 4IJEA 3UJNA 4G6ZA 1DGGA 2A5YB 4DR3M 5ITXE 1T3TA 2C98A 1L1TA 3AJIB 1DGHB 5GKNA 1IN7A 2ZBKB 3AOEA 1PM5A 4IBBA 3GRVA 8CATA 1K82A 3HWSA 3PXGA 2KZUA 2LH0A 2UUCM 3U6CA 1IQPA 5LMUM 2R62A 4QHTA 5IREB 3SARA 3GO8A 3KW6A 3VDUA 4LJ6A 5KPTA 2Z3XA 4FWDA 4LGYA 1J5EM 2KRUA 1I94M 1N75A 2FOIC 2KXEA 3SHFA 2YR0A 4GMQA 1JQJC 4RF1A 2C96A 2XEPA 2F5OA 5EP1A 2Z4RA 1LV7A 4GRIA 4LRSA 4LZZA 1C1KA 1MX0A 5DYIA 3VFDA 4B3SM 3U6SA 3L2AA 4BB9A 2Z7JA 3W0LB 4B3MM 2F5NA 1N34M 3GP1A 1IN5A 2KA6B 2F5QA 4IIWA 3TQSA 4FWHA 3GLGB 3GLIA 4JI2M 4FW9A 3RGSA 2KRKA 1NJGA 2DWMA 3FKEA 4IBCA 5C1BA 1FNNA 2UXDM 4IBKA 4G4RA 3KFUG 3FTFA 5ITRA 2G5GX 4M9SA 1ZQ9A 4IBEA 2DHRA 2Q2EB 3UMMA 5BR8M 5KPRA 3EIHA 1L8QA 2QCUA 3WHKA 3KS8A 2I7PA 4LFBM 4NRVA 4DR5M 4X64M 1VDDA 5LMNM 3E4RA 4XBOA 2CV1A 3OTOM 4DR4M 4LJ9A 2QP9X 4JYAM 2V1UA 2KEBA 5JI2E 2F5PA 3L26A 5KO3A 3SC3A 4L78A 1GVNA 1I4WA 1XMOM 1KSFX 3UK6A 4ZPXA 4M0WA 3W0FA 3ZCBB 3UGJA 3GLFB 3CF2A 2VQFM 3FD9A 2DZOB 1GL7A 2C9CA 4NRWA 1HQCA 5ITYA 5A2QS 2HHHM 7CATA 1MU5A 3HKPA 2CV0A 2BJWA 3VKGA 4FD2A 2J7OA 3I4VA 2C9OA 1IXRC 3PNVA 4MGKE 2UU9M 4AKHA 4G4QA 3PFIA 1G8PA 1ORYB 1H6UA 3KVWA 4LF8M 1SXJB 4JXJA 2UUAM 4LG2A 3VKHA 4LY6A 1Z5CA 4QNMA 3Q8XA 3GQ5A 4JV5M 1S3SA 1W5TA 1KYIA 3DOAA 2QZ4A 2R46A 4D82A 3GLGA 4DV6M 2UXCM 4GHLA 2FE8A 3HHWA 5EP2A 2BNKA 3U5ZB 4X62M 1XNRM 3FTEA 4YY3M 1QAQA 2UUBM 3SFZA 1IXZA 3TWKA 3U6EA 2M5ZA 3D8BA 4TUWA 3IG8A 3RFWA 1IN8A 5FSWA 4AG5A 4JI0M 1HQYE 2Z4SA 5DNYA 2D7GA 4KHPM 1GKIA 3GLFA 5ITTA 2OQ4A 2YNMD 4RNAA 5FTNA 2R4EA 3JAMS 3J7AS 2ZAOA 3R9XB 1DGHA 1UM8A 3U6DA 3EIEA 3PNYA 3AFHA 2CHQA 5ITUA 2C99A 3T15A 4OX9M 3K92A 1TDZA 4BBAA 2W82A 4GKKM 3KS4A 3SYLA 4Z8XA 3GRRA 4QHSA 2CHVA 1ZAEA 3U60B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXE A; 
#chains in the Genus database with same CATH topology
 1WHC A;  3CGW A;  1R2Y A;  4FCT A;  4X65 M;  5KQD A;  1IN6 A;  2KNV A;  4JI3 M;  2QHO B;  3FUU A;  1TH4 A;  1Q3B A;  4MGH A;  3E9S A;  3I01 M;  1RU3 A;  3MMP A;  2JP7 A;  4MGY E;  1Z6T A;  4QOS A;  1VDL A;  4EIW A;  5KPZ A;  3GPU A;  4LF6 M;  3U61 A;  5BPV A;  4DV1 M;  4JI6 M;  3SMP A;  4JI4 M;  2DWZ B;  5EXP A;  3VK8 A;  5IT9 S;  3HU3 A;  1HNW M;  1DV0 A;  4L8R C;  3A98 B;  3GRU A;  4ANR A;  3U6M A;  1OAO C;  1HNX M;  1XNQ M;  4LF5 M;  1GO5 A;  3J2P B;  4F1I A;  1R2Z A;  4JI5 M;  2LWX A;  3HJQ A;  4G4N A;  4A3V B;  5F3W A;  3QYE A;  3IG5 A;  4GH9 A;  4NSR A;  3U6L A;  3KP1 E;  3LCU A;  3MJ5 A;  4DBG B;  1D0L A;  4M0D A;  1NO1 A;  2BJV A;  2QEN A;  3K1J A;  3C3E A;  4R3D A;  1NHG C;  2R44 A;  1GL6 A;  2VII A;  3FRI A;  5EXS A;  1WJ7 A;  3GLF E;  3B7N A;  3K2L A;  4KOD A;  5EXX A;  3I04 M;  3B7Z A;  4MGZ E;  1DGF A;  4DV5 M;  1IM2 A;  3VLF B;  1XWI A;  2R45 A;  3HJS A;  3JR5 A;  1GLN A;  4PDI A;  4LF9 M;  4K0K M;  4GC5 A;  3RE8 A;  4DR7 M;  4OVZ A;  5FTK A;  2RGH A;  2OOB A;  4OW0 A;  3SAV A;  1L2B A;  3CF6 E;  1NHW C;  1T6O A;  2KHH A;  3K9P A;  3HY5 A;  4HLQ A;  3U6P A;  1EFU B;  1TH3 A;  4IBD A;  3U5Z A;  4NL4 H;  1IY1 A;  1L2D A;  2CE7 A;  3V76 A;  2QSF X;  3AL0 C;  5FTJ A;  2WSC F;  1XMQ M;  3GLH A;  3L29 A;  2YFQ A;  4X66 M;  1DO2 A;  4LJ5 A;  1J7K A;  1XB2 B;  4LFA M;  2J7N A;  2LVN C;  4KO8 A;  5FTL A;  1SXJ D;  2G8L A;  4AKI A;  3J7B A;  3LQQ A;  4I8O A;  4II7 A;  2DVW B;  3DFZ A;  2DZN B;  1IY0 A;  1JR3 D;  3TWM A;  5KQ8 A;  3U6Q A;  1E94 E;  2L6O A;  3SMS A;  4AG6 A;  1IN4 A;  3H4M A;  4KLN A;  3GQ3 A;  2CHG A;  4GIT A;  1OKS A;  2KDL A;  3TPZ A;  1HT1 E;  2JUJ A;  4JI8 M;  2AHM A;  2LNH C;  3KOW E;  2C5R A;  1DGB A;  1X37 A;  1TTE A;  5EJC A;  4LRT A;  1Y8G A;  1ZMU A;  4AQY M;  3LVW A;  2DAI A;  1C7Y A;  2HAK A;  3HU1 A;  2L7H A;  1QDT A;  3HJ8 A;  2KNA A;  4B3R M;  3AKZ A;  2M60 A;  4FWG A;  3Q8G A;  5DFL A;  3KOZ E;  3GPX A;  3HZJ A;  3FYD A;  1OIP A;  1PGY A;  2L09 A;  1XXH B;  3ZH9 B;  2J5Y A;  4I4L A;  4JN6 A;  1L1Z A;  4AKG A;  1IY2 A;  3K9O A;  5H37 D;  2G3Q A;  5E26 A;  3JR4 A;  5IWA M;  1Z5A A;  1MN3 A;  2XZU A;  4D81 A;  3B7Q A;  4LJ8 A;  4BLC A;  3HGI A;  4B08 A;  2CV2 A;  1DO0 A;  1OFI A;  5JI3 E;  1G59 A;  5IZ7 D;  3R8F A;  4LZJ A;  3THG A;  3NWL A;  2DNA A;  1SXJ C;  2GNO A;  1YE9 A;  4W5W A;  2I7N A;  2D7E A;  4DV0 M;  3NBX X;  1EE8 A;  4G4O A;  3MHV C;  2WSF F;  2APL A;  3J27 B;  3ZC7 B;  1NVM A;  4LCB A;  1IFY A;  2N35 A;  2OOA A;  4DV3 M;  3FTC A;  2JA2 A;  1GJT A;  4MH0 E;  1VEJ A;  2JZ0 A;  1TR8 A;  3L27 A;  2XSZ D;  3AV0 A;  4XGI A;  2KW0 A;  2K47 A;  4IBG A;  4F2L A;  4LJ4 A;  2B3T A;  2XZF A;  1IXS B;  2R65 A;  1N32 M;  3B89 A;  4D80 A;  3VK7 A;  3GPY A;  3M7G A;  1R4G A;  2DAG A;  4IBJ A;  3KP0 E;  3DZD A;  4CIS A;  2LVA A;  4AI6 A;  2XF3 A;  1Q39 A;  3B9P A;  2LVO C;  2L4E A;  4M9X A;  4RKU F;  1K3W A;  4I81 A;  2V1C A;  1PJQ A;  4FCV A;  4NOO B;  2VF8 A;  1VG5 A;  1WXQ A;  2QNJ A;  5EXT A;  3WHL A;  1IBK M;  3NBI A;  2XFT A;  1TF0 B;  2E5L M;  4GKJ M;  3KSJ A;  4FVM A;  1N78 A;  1FJG M;  2CEA A;  2XH9 A;  3K8Z A;  4IBF A;  2HKJ A;  3GLI E;  1MJG M;  2EA0 A;  4IBI A;  2LXE A;  3BBZ A;  4DV4 M;  4JI1 M;  3RGP A;  2JWS A;  1HT2 E;  5L8R F;  2UXB M;  4RF0 A;  1EIJ A;  4I5S A;  1V34 A;  1TGU A;  3PVS A;  1R7R A;  2X49 A;  1N36 M;  2WZJ A;  3AOE C;  1QAM A;  2CWB A;  3CTW B;  4P17 A;  4PCZ A;  1SXJ A;  1E9S A;  2CFO A;  2FS1 A;  4B7H A;  3J80 S;  4DUY M;  3SAT A;  4NC6 A;  1NY6 A;  2F5S A;  3LQR A;  3L25 A;  2NQ8 C;  1NNJ A;  1NSF A;  2EUC A;  2R6F A;  2XSZ A;  1D0K A;  2DEN A;  2JNH A;  2DWL A;  4S12 A;  1JR3 E;  3QYB A;  3J81 S;  2VQE M;  1NV9 A;  1N77 A;  3T38 A;  3SHG B;  3D8L A;  3UZU A;  3ZQJ A;  3B74 A;  3KOX E;  4B7F A;  3C9P A;  1SG9 A;  2KNZ A;  2Y21 A;  2R18 A;  1E32 A;  2EO2 A;  1XC8 A;  1YUB A;  2Z8Y M;  4DR1 M;  1QAO A;  4WP2 A;  3DA1 A;  5EQT A;  5EP4 A;  2FFJ A;  1TH2 A;  2D7H A;  2ERC A;  3AOG A;  2JY6 B;  1W5S A;  3FE3 A;  4YHH M;  1ZMV A;  4HL4 A;  3FUV A;  1XXH A;  2MRO B;  4LGM A;  4AW4 A;  4B3T M;  3U6O A;  2QBY A;  5FTM A;  1QUS A;  3M6A A;  4WUR A;  2HCB A;  4LFC M;  1OFH A;  1QAN A;  2H1R A;  2YQZ A;  1OIZ A;  2ZM6 M;  4CJ6 A;  5E6J A;  1Q3C A;  1QVR A;  1YSY A;  1Z5B A;  2X4A A;  4M9Z A;  2CP8 A;  4QNR A;  5ITQ A;  2X8A A;  2OPF A;  2QPA A;  3QWL A;  1G3I A;  4OU7 A;  1TDH A;  4DR6 M;  4QOZ C;  4R7G A;  3SAS A;  2XLJ A;  1L2C A;  1VEG A;  3CF0 A;  1D2N A;  3W67 A;  2Y0T A;  3FTD A;  1PJT A;  3T1H M;  2HL7 A;  1NNU C;  2L7I A;  4CHT B;  4P16 A;  1KFV A;  2BWB A;  1J09 A;  4LJ7 A;  4WW0 A;  4B7G A;  4MGI E;  2KZS A;  1K3X A;  5C18 A;  3T6P A;  3LW5 F;  4GC9 A;  3A42 A;  4IJF A;  2CRU A;  3KSX A;  1P3Q Q;  2MH8 A;  3FYC A;  1PJI A;  1QZM A;  3L28 A;  4PDG A;  4L16 A;  1AUA A;  3SAW A;  2DZL A;  2DWN A;  2P5T A;  3T1Y M;  1IBM M;  3TL4 X;  3SBJ A;  2F4V M;  1GAB A;  1XXH E;  1HNZ M;  1NJF A;  3BOS A;  1D0M A;  2L4F A;  2EKF A;  4AZF A;  4FCW A;  2RGO A;  3I51 A;  2XGN A;  3GRY A;  3I4Y A;  1R5L A;  1IBL M;  4G3O A;  4GIP A;  4HEO A;  5DYG A;  3TWL A;  4CGY B;  2XFS A;  3HHZ A;  4OVZ B;  3HU2 A;  2RRU A;  4DV7 M;  3GQ4 A;  4L4U A;  4REZ A;  3HHY A;  2MGW A;  4Z6Y A;  4MM3 B;  1OQY A;  3GPP A;  4GHA A;  2EKK A;  3SYK A;  1F4I A;  2DXI A;  4L6V 6;  3SAU A;  4LF7 M;  1IXS A;  1CUK A;  3FUW A;  1SXJ E;  3M0E A;  1E9R A;  1UFZ A;  2RKO A;  4PT5 A;  3ILK A;  3LVV A;  2V6Z M;  2QBY B;  3FUT A;  3BXW A;  4NXN M;  3TE6 A;  3MK6 A;  4ITQ A;  1HR0 M;  1G4A E;  4LF4 M;  3KDS E;  4JI7 M;  1JR3 A;  1QYR A;  2R4J A;  3A45 A;  3A46 A;  3QAU A;  2CUZ A;  4NXM M;  3F92 A;  1OJL A;  1NY5 A;  2O5R A;  1Z59 A;  2WSE F;  1N33 M;  1QQW A;  3W68 A;  3KXE C;  2Y0Q A;  1G41 A;  2Y20 A;  3LMM A;  5ITX A;  4DUZ M;  2ZAM A;  4MB7 A;  2FNA A;  4DV2 M;  4DR2 M;  4NSO B;  4PD2 A;  1R6B X;  4LJA A;  3C58 A;  3U61 B;  4XK8 F;  4KT0 F;  2ZTD A;  2ZAN A;  3VDP A;  3U60 A;  3KOY E;  1V33 A;  2H5X A;  2MJ5 B;  4L15 A;  1PJJ A;  3GLH B;  3HHX A;  5FLX S;  5EP3 A;  1XHB A;  3FUX A;  3GLH E;  1AIP C;  1QZE A;  3GLI B;  4IJE A;  3UJN A;  4G6Z A;  2FH0 A;  1GJS A;  1DGG A;  2QQ8 A;  2A5Y B;  4DR3 M;  5ITX E;  1T3T A;  2C98 A;  2JZ1 A;  2DHY A;  1L1T A;  3AJI B;  1DGH B;  5GKN A;  1A5T A;  1IN7 A;  2DI0 A;  2ZBK B;  3AOE A;  1PM5 A;  4IBB A;  3GRV A;  8CAT A;  1K82 A;  3HWS A;  2O01 F;  3PXG A;  3FRH A;  2KZU A;  1ZMW A;  2LH0 A;  2UUC M;  3U6C A;  1IQP A;  1PRB A;  2LTU A;  5LMU M;  2R62 A;  4QHT A;  5IRE B;  3SAR A;  3GO8 A;  3KW6 A;  3VDU A;  4LJ6 A;  5KPT A;  3GLG E;  1QUT A;  4FWD A;  4LGY A;  2Z3X A;  1J5E M;  2KRU A;  1I94 M;  1N75 A;  2FOI C;  2KXE A;  2HWJ A;  2YR0 A;  3SHF A;  4GMQ A;  4UN2 B;  2K0B X;  1JQJ C;  4RF1 A;  2C96 A;  2XEP A;  2F5O A;  5EP1 A;  2Z4R A;  1LV7 A;  4GRI A;  4LRS A;  4LZZ A;  1C1K A;  1MX0 A;  5DYI A;  3IHP A;  3VFD A;  4B3S M;  3U6S A;  3L2A A;  4BB9 A;  1WGL A;  2Z7J A;  2VF7 A;  3W0L B;  4B3M M;  2F5N A;  1N34 M;  3GP1 A;  2GQF A;  2DKL A;  1V92 A;  1IN5 A;  2EJS A;  2KA6 B;  3E46 A;  2F5Q A;  2LBC A;  4IIW A;  3TQS A;  2LVP C;  4FWH A;  3GLG B;  3GLI A;  4JI2 M;  4FW9 A;  1T43 A;  3RGS A;  2KRK A;  2LVQ D;  1NJG A;  3H4J A;  2DWM A;  3FKE A;  4IBC A;  5C1B A;  1FNN A;  2UXD M;  4IBK A;  4G4R A;  3KFU G;  1VEK A;  3FTF A;  5ITR A;  2G5G X;  4M9S A;  1ZQ9 A;  4IBE A;  2DHR A;  2R0I A;  2Q2E B;  2ZTC A;  3UMM A;  2LHC A;  5BR8 M;  5KPR A;  3EIH A;  1L8Q A;  2QCU A;  3WHK A;  3KS8 A;  2I7P A;  4LFB M;  4Q7J A;  2VDB B;  1Q02 A;  4NRV A;  4DR5 M;  4X64 M;  1VDD A;  5LMN M;  3E4R A;  4XBO A;  2CV1 A;  3E21 A;  1VQ1 A;  4R71 A;  3OTO M;  2LHG A;  2QP9 X;  4LJ9 A;  4DR4 M;  4JYA M;  2V1U A;  2KEB A;  5JI2 E;  2F5P A;  2O25 A;  3L26 A;  5KO3 A;  4Y28 F;  3SC3 A;  1OTR A;  4L78 A;  1GVN A;  1I4W A;  1XMO M;  1KSF X;  3UK6 A;  4ZPX A;  4M0W A;  3W0F A;  3ZCB B;  3UGJ A;  3GLF B;  3CF2 A;  2VQF M;  3FD9 A;  2DZO B;  1GL7 A;  2C9C A;  4NRW A;  1HQC A;  5ITY A;  5A2Q S;  1JB0 F;  2HHH M;  7CAT A;  1MU5 A;  3HKP A;  2CV0 A;  2BJW A;  1PJS A;  2JY7 A;  3VKG A;  1HJP A;  4FD2 A;  1YLA A;  2J7O A;  1OAI A;  3I4V A;  2C9O A;  1IXR C;  3PNV A;  4MGK E;  2UU9 M;  1ZV1 A;  4AKH A;  4G4Q A;  2K9D A;  3PFI A;  1G8P A;  1ORY B;  1H6U A;  3KVW A;  4LF8 M;  2JY8 A;  1SXJ B;  4JXJ A;  2UUA M;  4LG2 A;  3VKH A;  4LY6 A;  2L2D A;  1Z5C A;  4QNM A;  3Q8X A;  3GQ5 A;  4JV5 M;  1S3S A;  1W5T A;  1KYI A;  2DAE A;  3DOA A;  4CIZ A;  2QZ4 A;  2R46 A;  2JXN A;  4D82 A;  2BWE A;  3GLG A;  4DV6 M;  1WGN A;  2UXC M;  1QDR A;  4GHL A;  2FE8 A;  3HHW A;  5EP2 A;  1G71 A;  2BNK A;  3U5Z B;  4X62 M;  1XNR M;  3FTE A;  4YY3 M;  1QAQ A;  2UUB M;  3SFZ A;  2K6B A;  1WIV A;  1IXZ A;  3TWK A;  3U6E A;  2M5Z A;  3D8B A;  2MR9 A;  4TUW A;  3IG8 A;  3RFW A;  1IN8 A;  3IEC A;  5FSW A;  4AG5 A;  4JI0 M;  1HQY E;  2Z4S A;  5DNY A;  2D7G A;  3HX3 A;  4KHP M;  1GKI A;  2JY5 A;  3GLF A;  1BVS A;  5ITT A;  2YNM D;  4RNA A;  2OQ4 A;  5FTN A;  1WR1 B;  4GEW A;  2R4E A;  3LCV B;  3JAM S;  2ZAO A;  3J7A S;  3R9X B;  1DGH A;  1UM8 A;  3U6D A;  1NV8 A;  3EIE A;  3PNY A;  3AFH A;  2CHQ A;  5ITU A;  2C99 A;  3C3D A;  3T15 A;  4OX9 M;  3K92 A;  1TDZ A;  4BBA A;  2DAM A;  2W82 A;  4GKK M;  3KS4 A;  3SYL A;  2OO9 A;  4Z8X A;  2DAK A;  3GRR A;  4QHS A;  2CHV A;  1ZAE A;  3U60 B;  1LTM A; 
#chains in the Genus database with same CATH homology
 1R2Y A;  4FCT A;  4X65 M;  5KQD A;  1IN6 A;  4JI3 M;  3FUU A;  1TH4 A;  1Q3B A;  4MGH A;  3E9S A;  4MGY E;  1Z6T A;  4QOS A;  4EIW A;  3GPU A;  5KPZ A;  4LF6 M;  3U61 A;  5BPV A;  4DV1 M;  4JI6 M;  3SMP A;  4JI4 M;  2DWZ B;  5EXP A;  3VK8 A;  5IT9 S;  3HU3 A;  1HNW M;  4L8R C;  3A98 B;  3GRU A;  3U6M A;  1XNQ M;  1HNX M;  4LF5 M;  3J2P B;  1R2Z A;  4JI5 M;  2LWX A;  3HJQ A;  4G4N A;  4A3V B;  5F3W A;  3IG5 A;  4GH9 A;  4NSR A;  3U6L A;  3KP1 E;  3MJ5 A;  4M0D A;  3K1J A;  2BJV A;  2QEN A;  4R3D A;  1NHG C;  1GL6 A;  2VII A;  5EXS A;  3K2L A;  4KOD A;  5EXX A;  4MGZ E;  1DGF A;  4DV5 M;  1IM2 A;  3VLF B;  1XWI A;  2R45 A;  3HJS A;  3JR5 A;  1GLN A;  4PDI A;  4LF9 M;  4K0K M;  4GC5 A;  3RE8 A;  4DR7 M;  4OVZ A;  5FTK A;  2RGH A;  4OW0 A;  3SAV A;  1L2B A;  3CF6 E;  1NHW C;  4HLQ A;  3U6P A;  1TH3 A;  4IBD A;  3U5Z A;  4NL4 H;  1IY1 A;  1L2D A;  2CE7 A;  3AL0 C;  5FTJ A;  1XMQ M;  3GLH A;  3L29 A;  2YFQ A;  4X66 M;  1DO2 A;  4LJ5 A;  1J7K A;  4LFA M;  2J7N A;  4KO8 A;  5FTL A;  1SXJ D;  2G8L A;  4AKI A;  3J7B A;  3LQQ A;  4I8O A;  4II7 A;  2DVW B;  3DFZ A;  2DZN B;  1IY0 A;  1JR3 D;  3TWM A;  5KQ8 A;  3U6Q A;  1E94 E;  2L6O A;  3SMS A;  4AG6 A;  1IN4 A;  3H4M A;  4KLN A;  3GQ3 A;  2CHG A;  4GIT A;  3TPZ A;  1HT1 E;  4JI8 M;  2AHM A;  2LNH C;  3KOW E;  2C5R A;  1DGB A;  1X37 A;  5EJC A;  4LRT A;  4AQY M;  3LVW A;  3HU1 A;  2L7H A;  3HJ8 A;  4B3R M;  3AKZ A;  2M60 A;  4FWG A;  3KOZ E;  3GPX A;  3FYD A;  2L09 A;  1XXH B;  3ZH9 B;  1L1Z A;  4I4L A;  4JN6 A;  4AKG A;  1IY2 A;  5H37 D;  5E26 A;  3JR4 A;  5IWA M;  1Z5A A;  2XZU A;  4D81 A;  4LJ8 A;  4BLC A;  3HGI A;  4B08 A;  2CV2 A;  1DO0 A;  1OFI A;  5JI3 E;  1G59 A;  5IZ7 D;  3R8F A;  4LZJ A;  3THG A;  3NWL A;  1SXJ C;  1YE9 A;  4W5W A;  2I7N A;  2D7E A;  4DV0 M;  1EE8 A;  4G4O A;  3MHV C;  3J27 B;  3ZC7 B;  1NVM A;  4LCB A;  4DV3 M;  3FTC A;  2JA2 A;  4MH0 E;  4XGI A;  3L27 A;  2XSZ D;  3AV0 A;  2KW0 A;  2K47 A;  4IBG A;  4LJ4 A;  2XZF A;  1IXS B;  2R65 A;  1N32 M;  4D80 A;  3VK7 A;  3GPY A;  3M7G A;  4IBJ A;  3KP0 E;  3DZD A;  4CIS A;  4AI6 A;  2XF3 A;  1Q39 A;  3B9P A;  4M9X A;  1K3W A;  4I81 A;  2V1C A;  4NOO B;  4FCV A;  3WHL A;  1WXQ A;  5EXT A;  1IBK M;  3NBI A;  2XFT A;  2E5L M;  4GKJ M;  3KSJ A;  4FVM A;  1N78 A;  1FJG M;  2CEA A;  2XH9 A;  3K8Z A;  4IBF A;  2HKJ A;  4JI1 M;  2EA0 A;  4IBI A;  2LXE A;  4DV4 M;  3RGP A;  2UXB M;  1HT2 E;  4RF0 A;  4I5S A;  1N36 M;  1TGU A;  3PVS A;  1R7R A;  2X49 A;  4PCZ A;  3AOE C;  1QAM A;  3CTW B;  1SXJ A;  1E9S A;  2CFO A;  4B7H A;  4DUY M;  3J80 S;  3SAT A;  1NY6 A;  2F5S A;  3LQR A;  3L25 A;  2NQ8 C;  1NNJ A;  1NSF A;  2EUC A;  2XSZ A;  2DWL A;  4S12 A;  3J81 S;  2VQE M;  1N77 A;  3T38 A;  3SHG B;  3D8L A;  3UZU A;  3KOX E;  4B7F A;  2Y21 A;  2R18 A;  1E32 A;  2EO2 A;  1XC8 A;  1YUB A;  4DR1 M;  1QAO A;  3DA1 A;  5EQT A;  5EP4 A;  2FFJ A;  1TH2 A;  2D7H A;  2ERC A;  3AOG A;  1W5S A;  4YHH M;  4HL4 A;  3FUV A;  1XXH A;  4LGM A;  4AW4 A;  4B3T M;  3U6O A;  2QBY A;  5FTM A;  3M6A A;  4WUR A;  2HCB A;  4LFC M;  1OFH A;  1QAN A;  2H1R A;  2YQZ A;  2ZM6 M;  5E6J A;  1Q3C A;  1QVR A;  1YSY A;  1Z5B A;  2X4A A;  4M9Z A;  4QNR A;  5ITQ A;  2X8A A;  2OPF A;  2QPA A;  3QWL A;  1G3I A;  4OU7 A;  1TDH A;  4DR6 M;  4QOZ C;  4R7G A;  3SAS A;  2XLJ A;  1L2C A;  3CF0 A;  1D2N A;  3FTD A;  2Y0T A;  3T1H M;  2HL7 A;  1NNU C;  2L7I A;  4CHT B;  4P16 A;  1KFV A;  1J09 A;  4LJ7 A;  4WW0 A;  4B7G A;  4MGI E;  2KZS A;  1K3X A;  5C18 A;  4GC9 A;  3A42 A;  4IJF A;  3KSX A;  3FYC A;  1PJI A;  1QZM A;  3L28 A;  4PDG A;  4L16 A;  3SAW A;  2DWN A;  2P5T A;  3T1Y M;  1IBM M;  3TL4 X;  3SBJ A;  2F4V M;  1HNZ M;  1NJF A;  3BOS A;  4AZF A;  4FCW A;  2RGO A;  3I51 A;  2XGN A;  3GRY A;  3I4Y A;  1IBL M;  4GIP A;  3TWL A;  5DYG A;  4CGY B;  2XFS A;  3HHZ A;  4OVZ B;  3HU2 A;  4DV7 M;  3GQ4 A;  4L4U A;  4REZ A;  3HHY A;  4Z6Y A;  4MM3 B;  3GPP A;  4GHA A;  3SYK A;  2DXI A;  3SAU A;  4LF7 M;  3FUW A;  1SXJ E;  3M0E A;  1E9R A;  2RKO A;  4PT5 A;  3ILK A;  3LVV A;  2V6Z M;  2QBY B;  3FUT A;  4NXN M;  3TE6 A;  3MK6 A;  4ITQ A;  1HR0 M;  1G4A E;  4LF4 M;  3KDS E;  4JI7 M;  1JR3 A;  1QYR A;  2R4J A;  3A45 A;  3A46 A;  3QAU A;  2CUZ A;  4NXM M;  1OJL A;  1NY5 A;  2O5R A;  1Z59 A;  1N33 M;  1QQW A;  3KXE C;  2Y0Q A;  1G41 A;  2Y20 A;  3LMM A;  5ITX A;  4DUZ M;  2ZAM A;  4MB7 A;  2FNA A;  4DV2 M;  4DR2 M;  4NSO B;  4PD2 A;  1R6B X;  4LJA A;  3C58 A;  3U61 B;  2ZAN A;  3VDP A;  3U60 A;  3KOY E;  4L15 A;  1PJJ A;  3GLH B;  3HHX A;  5FLX S;  5EP3 A;  1XHB A;  3FUX A;  3GLI B;  4IJE A;  3UJN A;  4G6Z A;  1DGG A;  2A5Y B;  4DR3 M;  5ITX E;  1T3T A;  2C98 A;  1L1T A;  3AJI B;  1DGH B;  5GKN A;  1IN7 A;  2ZBK B;  3AOE A;  1PM5 A;  4IBB A;  3GRV A;  8CAT A;  1K82 A;  3HWS A;  3PXG A;  2KZU A;  2LH0 A;  2UUC M;  3U6C A;  1IQP A;  5LMU M;  2R62 A;  4QHT A;  5IRE B;  3SAR A;  3GO8 A;  3KW6 A;  3VDU A;  4LJ6 A;  5KPT A;  2Z3X A;  4FWD A;  4LGY A;  1J5E M;  2KRU A;  1I94 M;  1N75 A;  2FOI C;  2KXE A;  3SHF A;  2YR0 A;  4GMQ A;  1JQJ C;  4RF1 A;  2C96 A;  2XEP A;  2F5O A;  5EP1 A;  2Z4R A;  1LV7 A;  4GRI A;  4LRS A;  4LZZ A;  1C1K A;  1MX0 A;  5DYI A;  3VFD A;  4B3S M;  3U6S A;  3L2A A;  4BB9 A;  2Z7J A;  3W0L B;  4B3M M;  2F5N A;  1N34 M;  3GP1 A;  1IN5 A;  2KA6 B;  2F5Q A;  4IIW A;  3TQS A;  4FWH A;  3GLG B;  3GLI A;  4JI2 M;  4FW9 A;  3RGS A;  2KRK A;  1NJG A;  2DWM A;  3FKE A;  4IBC A;  5C1B A;  1FNN A;  2UXD M;  4IBK A;  4G4R A;  3KFU G;  3FTF A;  5ITR A;  2G5G X;  4M9S A;  1ZQ9 A;  4IBE A;  2DHR A;  2Q2E B;  3UMM A;  5BR8 M;  5KPR A;  3EIH A;  1L8Q A;  2QCU A;  3WHK A;  3KS8 A;  2I7P A;  4LFB M;  4NRV A;  4DR5 M;  4X64 M;  1VDD A;  5LMN M;  3E4R A;  4XBO A;  2CV1 A;  3OTO M;  4DR4 M;  4LJ9 A;  2QP9 X;  4JYA M;  2V1U A;  2KEB A;  5JI2 E;  2F5P A;  3L26 A;  5KO3 A;  3SC3 A;  4L78 A;  1GVN A;  1I4W A;  1XMO M;  1KSF X;  3UK6 A;  4ZPX A;  4M0W A;  3W0F A;  3ZCB B;  3UGJ A;  3GLF B;  3CF2 A;  2VQF M;  3FD9 A;  2DZO B;  1GL7 A;  2C9C A;  4NRW A;  1HQC A;  5ITY A;  5A2Q S;  2HHH M;  7CAT A;  1MU5 A;  3HKP A;  2CV0 A;  2BJW A;  3VKG A;  4FD2 A;  2J7O A;  3I4V A;  2C9O A;  1IXR C;  3PNV A;  4MGK E;  2UU9 M;  4AKH A;  4G4Q A;  3PFI A;  1G8P A;  1ORY B;  1H6U A;  3KVW A;  4LF8 M;  1SXJ B;  4JXJ A;  2UUA M;  4LG2 A;  3VKH A;  4LY6 A;  1Z5C A;  4QNM A;  3Q8X A;  3GQ5 A;  4JV5 M;  1S3S A;  1W5T A;  1KYI A;  3DOA A;  2QZ4 A;  2R46 A;  4D82 A;  3GLG A;  4DV6 M;  2UXC M;  4GHL A;  2FE8 A;  3HHW A;  5EP2 A;  2BNK A;  3U5Z B;  4X62 M;  1XNR M;  3FTE A;  4YY3 M;  1QAQ A;  2UUB M;  3SFZ A;  1IXZ A;  3TWK A;  3U6E A;  2M5Z A;  3D8B A;  4TUW A;  3IG8 A;  3RFW A;  1IN8 A;  5FSW A;  4AG5 A;  4JI0 M;  1HQY E;  2Z4S A;  5DNY A;  2D7G A;  4KHP M;  1GKI A;  3GLF A;  5ITT A;  2OQ4 A;  2YNM D;  4RNA A;  5FTN A;  2R4E A;  3JAM S;  3J7A S;  2ZAO A;  3R9X B;  1DGH A;  1UM8 A;  3U6D A;  3EIE A;  3PNY A;  3AFH A;  2CHQ A;  5ITU A;  2C99 A;  3T15 A;  4OX9 M;  3K92 A;  1TDZ A;  4BBA A;  2W82 A;  4GKK M;  3KS4 A;  3SYL A;  4Z8X A;  3GRR A;  4QHS A;  2CHV A;  1ZAE A;  3U60 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...