1I4WA

The crystal structure of the transcription factor sc-mttfb offers intriguing insights into mitochondrial transcription
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
322
Chain Sequence
PIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEWPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MITOCHONDRIAL REPLICATION PROTEIN MTF1
publication title Crystal structure of the transcription factor sc-mtTFB offers insights into mitochondrial transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 108
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i4wA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i4wA01
2AS0A 3B89A 2YXLA 2Z6QA 5EPEA 4M36A 3FRHA 2YVLA 3DR5A 2VS1A 4M38A 4OX9Y 5LQJA 1VP9A 3I58A 4BP3A 2VP3A 3MTEA 1FP2A 2QY6A 3T7TA 5HIMA 1YB2A 1WY7A 4KRGA 4P7FA 5IH3A 3C6MA 2AOTB 2IBTA 3OZSA 1QAOA 3MCZA 4IV8A 3UJ7A 3UWPA 3KPJA 3G89A 2PLWA 2OPBA 5P8WA 1L3BA 4QVKA 4GEKA 5HEKA 2QRVB 2BH2A 3EVZA 3UBTA 1VIDA 4PYKA 2B78A 5FHRA 4RTRA 1L1EA 2OB1A 3KPWA 5GM1A 3DOUA 1F3LA 2CMGA 3A27A 3OU6A 4F84A 1XXLA 1NW6A 1X1CA 2G71A 1JTEA 2VDVE 4IKPA 5D1NA 3MHTA 4RVFA 2B9EA 2QRVA 3LKDA 4M37A 5E9WA 3KR1A 3DMFA 3RIEA 1YFJA 4A6EA 1KPIA 5FTWA 3F4KA 4PYJA 4PINA 1T43A 2OB2A 2BR5A 2PKWA 3PFHA 4FSDA 3IV6A 3C0KA 2ZZKA 4GUAA 3BWMA 3ERCA 1XDZA 4L7VA 4QVGA 1SVUA 3G5TA 4AZVA 1MHTA 4PWYA 5M5BA 2BR3A 5T6BA 5C0OE 1JTFA 2C7OA 3OZRA 2PX2A 1MJFA 2YUIA 2ADMA 2FCAA 2AOXA 1G8SA 1FBNA 2P35A 2ZIEA 3HCAA 1TPYA 3U81A 4E30A 5CIYA 4FZVA 4QPPA 3I5UA 3DTNA 2PWYA 5FULA 4DF3A 2OKCA 2Z6UA 5E1DA 4GC9A 4LWPA 3BZBA 1JG2A 3M33A 2FYTA 1Z3CA 5K0GA 1XVAA 2PSSA 2I7CA 3KQOA 4RVGA 2AVNA 3FPFA 4YUZA 3NWBA 5ICFA 4RTJA 2EX4A 4BLWA 1YFLA 3EVFA 2P3LA 2GA9A 3M6UA 4R8RA 4E70A 1ZGAA 4QTUB 5FA5A 3THSA 4DCMA 5KQRA 1JSXA 2I62A 3AXSA 2WA1A 3P2EA 3X0DA 3NDJA 3OPNA 4LWOA 3G8AA 5DTQA 4KVZA 3LECA 4RX1A 4RTKA 3NVKI 3FZGA 2WA2A 5DM1A 4HGZA 4RVHA 4WXHA 2JG3A 2PX8A 1NT2A 1VQ1A 3UJ9A 5T64A 3MQ2A 1G38A 4C04A 3DLIA 4OBWA 1JG4A 2Y1WA 4EKGA 4X61A 4Z2YA 1R6AA 3NDIA 3QV2A 3ELUA 1ZHFA 3LBYA 4DQ0A 3EVDA 2HR1A 5EHGA 3TMAA 1R18A 3ELWA 3LDFA 3I64A 2NP7A 4PYIA 3NW9A 3JWJA 1DCTA 3ER8A 4V0QA 3DP7A 3EVBA 5CVJA 1VE3A 5FUBA 2PBFA 5E2BA 3UJAA 3G5LA 3KPUA 5GINE 2O0LA 2OZVA 3BWCA 1R8XA 3M4XA 2UYOA 3BWBA 3GO4A 5FADA 2PWPA 4B17A 1JQEA 3HVJA 1AF7A 4FT2A 1FP1D 1R74A 1ZGJA 5EMLA 4PYNA 2NP6A 3V8VA 3OE4A 2JJQA 3LCVB 4AUKA 1JG1A 1WZNA 3TQSA 4PIMA 3UZUA 2EJUA 3HVKA 3S68A 5K0NA 4EKIA 4YUYA 2NNWB 2GH1A 3CBGA 4PCLA 3ME5A 2PY6A 3EGEA 1RJDA 2PV0A 5DSXA 2ORED 2ZSUA 5DXJA 3LDGA 5EKUA 2JH9A 3P9KA 4R05A 5FCDA 5FWDA 3C3PA 3D2LA 1D2GA 1X19A 3L8DA 2GAFA 3B7PA 3BXOA 5GP1A 3G2PA 1N7JA 4XCXA 2OBFA 1UIRA 2V74B 2N47A 5C9ZA 3FPGA 1SQFA 2BZGA 2EFJA 3ELDA 2ZWAA 5DRTA 1G60A 3HA5A 3KKZA 4OQEA 5HFJA 4U7PB 4X1OA 3BKXA 5K0FA 3A7DA 2C7RA 1UWVA 2IBSA 2R6ZA 3SXJA 5ICEA 4HSGA 1VPTA 3BGIA 5EOVA 3SGLA 3MGGA 2PX4A 3M6WA 3LX6A 4RSRA 3FUUA 3GXOA 5DXAA 5GOZA 3TRKA 1NKVA 1Y8CA 4XUCA 1AQIA 3NTVA 5DTRA 2XYQA 2OO3A 2WK1A 3A26A 3P9NA 4MTLA 1JR4A 3DXXA 4RVDA 5DX0A 3EGIA 2CL5A 3V97A 5LQNA 3LKZA 2ZBPA 3R6TA 2AOWA 3CC8A 2JHPA 3EGVA 3MCTA 3BGVA 3CJQA 4KIGA 4LECA 1FPQA 4OBXA 2UZ4A 1M0EA 3EMBA 1R00A 2ZLBA 1M6EX 3DMGA 2HTEA 3WSTA 1SG9A 2GPYA 3SM3A 4FT4A 3A4TA 3TKAA 2Z6AA 2AR0A 3C6KA 1X1AA 2BR4A 4X41A 5KS2A 4GF5A 5E9JA 4E31A 1OR8A 4PYQA 5FQOA 5HIIA 3IYLW 1AQJA 1DL5A 1XJ5A 2AN5A 3CJTA 3P9CA 2G8NA 1HNNA 5GWXA 4DMGA 1O54A 1NW3A 2IIPA 3DXYA 5EHIA 4AZTA 1BC5A 1IXKA 3GRRA 3KU1A 3BGDA 5EKXA 2ZTHA 3KQSA 4DZRA 5KVAA 4R6WA 3TFWA 2OY0A 5DM0A 1NV9A 1KP9A 5DPMA 4RTQA 1YF3A 5E2AA 3TLJA 8MHTA 4PGGA 4BLUA 3B3FA 4C06A 3GRZA 3SX0A 4C03A 2QM3A 3BWYA 3OFJA 3GU3A 5DTMA 1SKMA 3GJYA 5CUQA 5EMKA 1JQ3A 3OCJA 1DUSA 3MTIA 3MERA 3NWEA 2IGTA 2ZULA 5DX1A 2P40A 1EJ6A 2VDWA 2OXTA 2YR0A 1NW5A 1ORIA 3HCEA 4RTSA 3LCUA 1AV6A 4R6XA 4HC4A 5DT2A 4ZTBA 4R8SA 4C07A 5K01A 4RTMA 2V7EA 3HTXA 5E1MA 2B2CA 4RYLA 4X63A 3UA4A 2YXEA 3GGDA 3ID6C 3SSMA 2ZZMA 2YQZA 3G2MA 4GBED 3KQWA 1VL5A 5LR6A 4BLVA 1ZG3A 3BKWA 3EEOA 2JHAA 5EC8A 3LSTA 1FJXA 1KHHA 5HILA 5EQJB 1U2ZA 3RW9A 2C7QA 2G70A 2XVAA 1JSZA 1RI5A 2UYQA 3CVOA 3P71T 4E33A 4U7TB 2IH2A 4OQDA 3REOA 2VDUE 1VBFA 3G7UA 3PX3A 4PYLA 3B5IA 4MIKA 2XVMA 5F2OA 3Q7EA 4RWZA 1QAQA 3VYWA 5K0EA 3B3GA 4DM3A 1I1NA 2PJDA 3JWGA 1YZHA 5KYGA 5DRYA 1I9GA 3FPEA 1XCLA 4KDCA 1M6YA 4YUVA 2CWWA 3E23A 3TM5A 3P97A 3A25A 1RJEA 3FUXA 4P58A 2P3QA 2F8LA 3FUWA 3UFBA 5GIOE 4BY9E 1L3CA 5CCBA 4E32A 3FTFA 4EQZA 5LQRA 2XYVA 5HZMA 5EEGA 2XBMA 4O29A 3O31A 3MB5A 4E2ZA 1NW8A 2IP2A 3CCFA 3GWZA 1IY9A 3LCCA 5LQUA 5T67A 3RODA 2HNKA 3KQPA 2P8JA 2FHPA 2P7HA 4FGZA 2ZIFA 2AVDA 5D1HA 2A14A 3M70A 2VZ9A 3GDHA 4QPNA 4BP1A 1BOOA 5G02A 4CXMA 1EQAA 2ESRA 5ICGA 3M6XA 5E8RA 4QDJA 3BUSA 3ELYA 3BT7A 5LQAA 3C3YA 5ICCA 2DPMA 3HA7A 1BKYA 2PX5A 3H2BA 1QZZA 4LG1A 3PLAE 3OFKA 3GIWA 3P2IA 3SSOA 2XYRA 2YX1A 4C4AA 4RTOA 4QTTB 2AN4A 4MHTA 4ER3A 3DULA 5HOQA 5BXYA 3PTAA 1D2CA 1YZ3A 4KDRA 2NYUA 1RI4A 3SSNA 1O9HA 1VP3A 3UJ8A 1VLMA 1RI3A 3HVIA 3FPJA 3I9FA 2AN3A 1R8YA 1X1DA 3FTCA 3G2OA 4GOMD 2IFTA 1O9GA 4Y2HA 3UA3A 1Q0SA 2P41A 2ZCJA 2PT6A 4PYOA 5FQNA 4HH4A 1XDUA 5C1IA 4DCGA 4YMGA 4FR0A 4FS8A 2EJTA 2AZTA 3LHDA 5F2NA 2GS9A 3PS9A 3GNLA 1SUIA 1EIZA 5E9QA 4YV2A 4E2YA 1N7IA 2JHCA 2PXAA 5F2KA 4FSXA 4AZWA 5DM4A 4YV1A 1EG2A 4QDKA 1TW2A 3HCFA 1RI1A 4PYMA 5BW5A 2G1PA 3NVMB 3QOWA 1ORHA 3SVZA 3T7RA 4AX8A 5BW4A 2H1RA 1ZKDA 2AOVA 1L9KA 3TM4A 1NV8A 3GRUA 3KHKA 2FPOA 5EMMA 3KR9A 1PRYA 3OZTA 3HP7A 5CVVA 2UYCA 2NXCA 2Y1XA 4ER0A 4ER6A 2ONZA 5KQSA 1XDSA 4RTLA 3HCDA 1V39A 1QYRA 3P9IA 2JH8A 5JUWA 4FP9A 2C7PA 5K8VA 4DKJA 1NW7A 5GIPE 2I9KA 1KIAA 2YTZA 3G88A 4GOND 2LD4A 2ZBRA 1QAMA 2IPXA 3G8BA 5DX8A 2B25A 3KPYA 2E5WA 3DMHA 4KW7A 4MQ4A 4HTFB 5CCXA 2ZZNA 5U4XA 3P8ZA 3T7SA 3EVEA 4C05A 4XUDA 5K0BA 3T0IA 1IM8A 3O4FA 3UJBA 2ZW9A 3R0QA 3GCZA 1SQGA 2ZWVA 4HGYA 4P7GA 4MWZA 2IDJA 3ANXA 5BP7A 2AOTA 2IDKA 1Q0TA 4GC5A 4H0NA 4X60A 2ZFUA 4HTFA 2H11A 5DWQA 1P1CA 5CM2Z 1KPGA 2Q41A 3R9XB 4ATNA 1ZQ9A 2KW5A 1G6Q1 5DSTA 1YUBA 3B3JA 5H02A 2HMYB 2FRXA 3IEIA 4OA5A 2UYHA 2FK7A 5HIKA 4PCAA 1WS6A 3KQYA 4IV0A 5HIJA 3K6RA 4KWCA 10MHA 3EEYA 4PONA 3TR6A 3AWIA 1EJ0A 3HNRA 4EVIA 2NXJA 2FK8A 3KQMA 5DM2A 3CKKA 3OU2A 4RTNA 3FYCA 3NMUF 5E8JA 3DLCA 1UFKA 1D2HA 3MAGA 3M6VA 1INLA 1QANA 3FUVA 2CMHA 2PXCA 2R3SA 3HA3A 2NXNA 3Q87B 4XUEA 3THRA 3AY0A 3G2QA 3LDUA 2OYRA 3VSEA 4YMHA 4CKBA 4YV0A 4GQBA 4P7KA 5CD1A 3GRYA 3E8SA 3QOXA 4HRAA 1WXXA 3JWHA 5EIFA 5EIWA 3UJDA 2I6GA 3HCBA 2BM8A 1KYZA 3VC1A 1JQDA 4C08A 5JR3A 5LSAA 5MHTA 3VC2A 9MHTA 5B1SA 5K05A 3DUWA 4YUXA 3CGGA 4JXJA 2GLUA 4CKCA 4YUWA 4E2XA 1L3IA 3KPVA 4P7JA 3FUTA 3E7PA 4HG2A 3EVCA 5K0JA 1SUSA 4ISCA 4PNEA 3SMQA 5K03A 3TPZA 5CVUA 3KQQA 2P3OA 4A6DA 3FTEA 1NBIA 1XTPA 4ER5A 3PB3A 3PFGA 5LQCA 2PT9A 4G56A 1H1DA 3AXTA 1TW3A 5EZQA 5GM2A 1KR5A 3CJRA 5CVDA 5K09A 2G72A 3GRVA 2O06A 3SR4A 4DA4A 3EVGA 1JG3A 2ONYA 4AZSA 4POOA 4F85A 3LGAA 3UJCA 3R3HA 4K6MA 3ER9A 3FTDA 4CKEA 4WVLA 3A7EA 3DH0A 4M7RA 3EMDA 4E2WA 3FRIA 3OE5A 1HMYA 5E1BA 1RI2A 1WXWA 2PVCA 2AOUB 5DLYA 5EGSA 5ERGB 1F38A 1G55A 4CTKA 2QE6A 5FHQA 2P7IA 1KXZA 2O07A 1RJFA 4OA8A 3UJ6A 2EG5A 5K0CA 1KPHA 2K4MA 2O57A 2B3TA 3HCCA 3I53A 5EVJA 2ERCA 4V0RA 2GB4A 2YXDA 2DULA 2BM9A 3TKYA 1PJZA 2AOUA 3HM2A 3PX2A 5FWAA 3EPPA 2P1DA 2QYOA 5EEHA 1P1BA 3FYDA 4EMSA 3PT9A 3HVHA 1B42A 4PIPA 4ER7A 2ZVJA 3KQTA 5FA8A 7MHTA 4F86A 3TOSA 4RTPA 3KR2A 3P2KA 1KYWA 4KIFA 1N2XA 3K0BA 3OU7A 3FPHA 3ORHA 3JWIA 3LBFA 4QQKA 1P39A 5IKMA 3AJDA 3KR0A 3LPMA 2NXEA 3KQVA 2CKDA 5EZSA 5E1OA 3IHTA 3EVAA 4QQNA 4CTJA 4EK9A 1NE2A 1I4WA 3NJRA 1P91A 4IWNA 4RV9A 5CVEA 4UOEA 4GOOD 1G8AA 1X1BA 3DXZA 4NECA 1NBHA 4Y30A 1RJGA 1XCJA 2IH4A 1BHJA 3R24A 4CWAA 2HWKA 2O05A 1EAMA 2PXXA 2HV9A 2ZIGA 2PGXA 3PVCA 3E05A 5LQKA 5K0LA 3O7WA 2IH5A 1WG8A 2H00A 2ZBQA 3LL7A 4GOLD 4PGHA 5EMJA 5EG5A 3HEMA
chains in the Genus database with same CATH superfamily
3GVPA 5KWSA 4ZT4A 1VL2A 4H1UA 1L4GA 4P5PA 2XZFA 4RORA 3RJMA 3RRYA 2CXOA 5ES3A 1QHGA 2ZUTA 3UB4A 2VUSA 3FHOA 1WUKS 1EDEA 3G5AA 3WYBA 2PAAA 3PPIA 2TRSB 3HHEA 1CG6A 1LC3A 2GHQA 2PX2A 4LZNA 5B2EA 5FULA 2CHQA 4MKHA 1Z17A 1AKMA 3I6YA 4ND8B 1UZAA 1VDZA 3EVFA 4F2PA 2YYAA 3PR2B 1HRKA 1PI3A 1N33M 1CSEE 4QDOA 4UXJA 4DVJA 4YRGA 3GRFA 2HR1A 4UMEA 3D3KA 1HFWA 2PX6A 3UMCA 4OHZA 2PBFA 4QLBA 2PVPA 4EZEA 2QG6A 3S1SA 3M82A 4PYNA 3V8VA 1X13A 3BULA 2O54A 8CATA 5I9BA 3MB8A 4OYRA 4MYRA 3TJZA 2NVBA 1I7NA 2FP3A 4A03A 4D6YA 1ZZGA 3UJHA 2GBLC 3D6AA 5L95A 4TRNA 3MWGA 2D8MA 3BL5A 2FN8A 1E1YA 3BICA 4RVDA 2CVPA 1DIAA 2R4JA 1B0AA 2XGJA 1RZVA 3ACDA 4NRDA 5HIIA 2R751 3O90A 3IEKA 4ICIA 3FVTA 8ADHA 3DLHA 3ZDRA 1ODSA 1DFIA 2QAJA 2HU5A 1MN6A 2CLHB 4JELA 3NHPA 4A73A 1I4TD 1YS2X 1SWWA 3LCUA 5CNKA 1OH8A 1XD9A 2PUDA 9LDTA 1LEHA 1UT8A 3WGNA 3SXPA 4KWIA 4LI3X 5TQVA 1TRHA 2XVAA 2Q8QA 4KQHA 2Z3WA 2V9CA 3KL4A 4DLZA 5SY4A 1Z0DA 1YFZA 4F8JA 4BO7A 4XQEA 3FUWA 4AKEA 3WS7A 3WOVA 1TMGE 3W2FA 3F47A 1N8TA 1YJAA 3U7HB 4KKVA 2XITA 2FWAA 3I4FA 1QZZA 1UJ4A 3NCHA 1D6MA 3DBVO 2XGSA 1HDEA 2CBZA 3PTAA 4LSGA 2FG5A 1JQAA 4X1IA 1KMMA 3JASB 1YZTA 2K2WA 4QWWA 4F2GA 2J3DA 3ADPA 1RYBA 1XZQA 2IGBA 1O4WA 3VH1A 1ICEA 4TV8F 4TMFA 3AY6A 1IWBB 1CVRA 3KYDA 1PGNA 1Y7LA 3ABOB 3CINA 1NNSA 1QRTA 2ET6A 1IQUA 5KBYA 2Y0PA 2XRZA 3SDSA 3WKDA 5JRJA 5JYEA 1A9PA 4X44A 1TK2A 2ZWVA 4HTFA 4Z4GA 2QCUA 4OUKX 1XQYA 1H6BA 5G0WA 3MWLA 1Q0UA 1EKXA 4JLAA 5EHQA 1BEZA 1R9MA 4FIZA 1HDRA 3HA3A 2QG9A 3LWNA 2BEKA 2Z2KA 1Y48E 4GICA 3DV9A 3KPVA 3IIEA 2X3FA 1KETA 1K7SN 1ZRHA 4WBXC 3NPMA 1PR4A 4V03A 2YZ7A 2REOA 1M67A 1EXMA 3VI3B 1XAHA 3ZQKA 1NJ6A 1E92A 2C7VA 2P7IA 4Q18A 1A69A 2GN1A 4G9BA 1PWEA 5CMLA 2XTNA 3N2GB 4W9MC 4WZAE 1Z73A 3T1VA 5CLFA 1MENA 1VIVA 4ARZA 3RYFA 1L1RA 1OWPA 2PTGA 1RYFA 3PQDA 5LZ9A 2YJNA 1L7RA 1K27A 1B8PA 2HA2A 4FWTA 2RCNA 2ZBQA 3HEMA 4MKIA 1VP9A 1Z29A 2B4AA 3HU5A 4B7XA 1DGHB 3QPBA 3HJAA 1KP3A 1MABA 1P19A 2JNWA 1LDGA 2G71A 4WUTA 2GCGA 4RJTA 5DLEA 1K88A 1EA5A 3AVPA 3RVQA 3TRDA 4L7VA 4Z51A 3A6LA 3BRWA 1UKEA 2GK3A 1DFGA 2MSNA 2AOXA 1RMYA 3LPCA 4HEJA 4MVJH 3WK8A 2V5UA 6ADHA 4DCCA 3J81A 3H17A 4ZHQA 3KQOA 5M3BA 2ZSDA 3MD0A 4CT0A 4O25A 4EB3A 4UEJA 2XDQB 3Q7PA 3RRBA 3D8BA 4JJIA 3C1OA 2R48A 3TEJA 5DM60 2RK3A 3VKUA 5JJIA 3OECA 4U63A 3NR2A 5LBTA 3UICA 3E18A 3K5PA 1SCIA 3H19A 1UK6A 3A9VA 3QUTA 1ZUWA 2WVHA 2YH2A 2WIFA 1MHPA 2EQ5A 3E7XA 3HN2A 3FKJA 4G4GA 5CX1A 3T7CA 4IYJA 5J1TB 5JYBA 2XV1A 3IS3A 3K35A 3UMMA 4X7PA 3MJDA 4NAHA 2YMMA 5AHWA 4YO7A 1PSZA 2YYYA 3E22B 2O3QA 3P1JA 1Z5NA 1XJCA 3LE8A 3ZE7A 2XMSA 2GKOA 4IFBA 2XF3A 2BFBB 1DT5A 3GLRA 2FB9A 1PJCA 2F8SA 3CLSC 1L5VA 4GHLA 5C53B 1V48A 3EASA 4TLLB 4C03A 2R11A 1N5LA 3ANNA 5JHHB 2IGTA 5I7WA 5JQGB 1E9CA 5TXGA 4RMJA 1Z7WA 1HQDA 3X2SA 1FYVA 4WZBA 3OOWA 1UZLA 3PDJA 3IQDB 2ZPAA 3UB2A 5LQSA 3KJGA 4I50B 3SP1A 4ILKA 1JJFA 3VGPA 3EG9B 4I9NA 1T3HA 2Q2NA 3NHKA 3SCZA 5A3JA 3NIFB 3J81k 1N6HA 1F6WA 2OHVA 1E98A 4FDVA 3KJQA 1VSBA 3JQBA 4LBWA 1T2NA 2VZ9A 2ZJ2A 4F38A 3I2JA 2WNIA 1SUCA 3UCEA 1H2BA 4CQMA 1SIOA 2HK8A 5CNIA 3STUA 2Z83A 4IDPA 3M5CA 3OY7A 2R6FA 1VBKA 4QDZA 3U6DA 4ZPJA 4D5EA 3EWAA 4AZWA 2WFMA 4W7SA 1Y8RA 2Y92A 3I1IA 4N5MA 2GBPA 1QIIA 2Z43A 3EY4A 3E6AA 4CG2A 1AXRA 4ENVA 4ENPA 4UKDA 4B4VA 2WP0A 3OP4A 4JV5M 2VF5X 5FNZA 2HLHA 1R0YA 3K5IA 2Z08A 1W0JA 1SPBS 2L17A 5DWQA 5BSUA 1O6CA 1NMXA 4EY7A 3N8NA 5IZCC 4YI5A 2DNAA 5EJ7A 4XVUA 4WA8A 1JYFA 1TA0A 1HLFA 3PGXA 1GPAA 2HWUA 4MP3A 2O20A 2WAXA 2FZEA 3JWHA 3VC1A 4IIYA 3GDGA 3WWYA 2AN1A 4LBYA 2XE6A 3A1WA 3Q85A 4WDQA 3VH3A 1QHHB 3OC0A 3S5UA 4UARA 2RHMA 2EHJA 1XZHA 2BGKA 1P1FA 2MR9A 2J0SA 4K05A 5K3FA 4PS0A 2XB9A 2II6A 3SIXA 4OSOA 1D4FA 3HCCA 1YHNA 2RKBA 4LY6A 1OWLA 3F1LA 4MZXA 5IKMA 4RY2A 1PTJA 3FYSA 2HIGA 4GBMA 4KMMA 1HNWM 1QK5A 2FOIA 3O7WA 1SU8A 4BGIA 3B89A 2B1JA 3CZQA 3ZYCA 3RUIA 3GPXA 4MHOA 2GJ4A 3EYAA 4IV8A 3FNHA 3LCRA 2IZ7A 2BH2A 1IRXA 4RKFA 5IT9A 2CMGA 3GR6A 4MW1A 2KBFA 1GKKA 4U1RA 1IEXA 1WUYA 1F14A 3DBHA 4O08A 3KXLA 2CYCA 2KMLA 3C14C 1IBCA 4KPEC 2ID8A 1JTFA 1PL6A 2KYRA 4XFDA 3ABRB 1U4SA 4U0JA 1A96A 5K20A 4MW5A 4XWAA 1FFYA 1RNLA 4HXEB 1L4FA 2GERA 4XXHA 5L8VA 4QO7A 2A3NA 3ER8A 4PN7A 3P32A 5E2BA 3GVXA 5K8TA 4FYJA 3VR6A 4K1LA 2UYOA 2OWEA 5JPDA 2PWPA 4L50A 1DINA 4UQLA 4DV5M 1OT5A 3QEKA 1E20A 4R40A 4ZT2A 3OQBA 1FSZA 2XSZD 1U2DA 4EHBA 2FFBA 2FHSA 4FWBA 3E9YA 1HTWA 2DWMA 1GR0A 4F56A 3BK2A 2HRRA 1VLLA 5C51B 1QIFA 3IKMB 4YRQA 2AMYA 1MDBA 1GZHB 1SOVA 4P8RA 3HVRA 1G2PA 4O1HA 3W2GA 2GRUA 1SHZA 3EZYA 4JUFA 2H3EA 2GX6A 5CT6A 3M1AA 3LI2A 5KDDA 2N46A 1M0TA 3ZOZA 5FQOA 4R31A 1WMFA 2ERYA 3K9HA 4XCVA 4DZTA 2ZRDA 2CFTA 3GLHA 1RQXA 4AZTA 3KU1A 2MYPA 1HQKA 2UZ0A 4J90A 3L8MA 1GN9A 3G23A 1NM5A 2OGWA 1XPOA 4JI6B 1VHQA 5DNYB 4BNWA 4D80A 4IQGA 3VNQA 3GBPA 4EW6A 3I5MA 2A0XA 3GV0A 4CTMA 4V39A 1NZDA 3SEFA 4M0WA 4BV8A 4CYMA 1EUZA 1WW3A 3REOA 3PX3A 1KFCB 4DUZB 3HBJA 3DC7A 4NCNA 3HLKA 1IXRC 5KJEA 3FPCA 4CM4B 4ZO6A 3PTZA 1VCIA 3MLAA 1K06A 3KT3A 2DECA 1AKVA 2NIPA 1IAQA 3ZW9A 4MCAA 5GOTA 1QP4A 4QXAA 4AMUA 1Z5WA 4TSRA 1EQAA 4W6ZA 5DI3A 4HL4A 3AGQA 3D59A 4B73A 4L74A 3QF7A 1TAHA 1XMVA 4WK4B 4OEHA 4IHAA 2XOKA 3WP0A 4Y2XA 1IY0A 2ZI6A 1ZEMA 1U8XX 4X85A 4EYSA 3LHDA 1UFVA 3OX2A 3UHAA 4HUTA 1LK0A 1XDDA 1UQRA 1RI1A 3ZHSA 4B3HA 1WF3A 2G1JA 3GDOA 1LW6E 4OHPA 4OJKA 4QLOA 4HK4A 4OM7A 3V1NA 3C5EA 4DIEA 2I65A 3RIXA 2Q4OA 1M2HA 2Y0CA 5D6OA 2N75A 3TQFA 4C05A 3UTDA 1DO2A 3BDAA 2X5KO 1YVEI 1IHDA 2QRHA 4NFLA 2QTVB 1ISRA 5I01A 2VPQA 2BFAA 1W44A 2JZ1A 5LQMA 2ZE5A 3H8SA 4MV3A 4ZGGA 5JS7A 4R1PA 4RGQA 4ANFA 5F7JA 2CW5A 3W5VA 3FYCA 1JLMA 3SZUA 4UAGA 3JSAA 3VJMA 1HFEL 1UC4B 3GUZA 3KQUA 1LKZA 1AKNA 2WWFA 1E9EA 4FKMA 3FVWA 4DCOA 1CRZA 4CKCA 3AHEA 1XNJA 1GCUA 2W4MA 1EVKA 4FNOA 2PT9A 3LDAA 1MT3A 5C1DA 5AXDA 2ZYIA 1KYQA 2IYPA 3KVYA 3DOIA 2IHNA 4UEQA 2XXAB 4K3VA 4REOA 4F1JA 1Q50A 1LJLA 2VJNA 5DGHA 5IN5A 3S2FA 3ZG6A 5FBVB 3ZLTA 4CKWA 4RHUA 3THYA 3JQFA 2RHHA 2VG8A 2QLFA 1JA9A 1XMPA 4ZAXA 2Y77A 1NVTA 4UVGA 1OI7A 4AO8A 1AGPA 1K0UA 4X7RA 3ZDQA 2DP4E 5FWXA 3STVA 3SE7A 3DE6X 1PVOA 2GRJA 3MWFA 2MSCB 2L4EA 5LMNB 4QU0A 3D0RA 1M1NB 3CPEA 1EG7A 4X84A 1OLSB 3IQXA 2EEZA 1VSQA 3AP3A 5AHXA 2JIQA 3EAGA 4M37A 3RHTA 4FSDA 5FBKA 3AM3A 3RK1A 5F9FA 3D6NB 3K9BA 2NZVG 1V7QA 4MVXA 5CIYA 1IC6A 3I5UA 3IDFA 2Y1FA 4C7OB 2VQFM 4M86A 1P9LA 4DXHA 1Z3CA 1EFUA 3E61A 3GLFA 1R64A 5BURA 5H37D 5FA5A 9LDBA 3LQ4A 2A1UB 2FSFA 1Z2EA 2FMXA 4AF8A 3LXMA 3FMFA 2ZIUB 1XKLA 2KEBA 3HJCA 2CLMB 1CP3A 4MNTA 2M1XA 1S7GA 3ZDCA 4BNDA 3SXUA 1II8B 1EVZA 4NMHA 1C7JA 2FP4B 3AX6A 2JHGA 2X1LA 4AZ3A 5TMDA 1YQWA 2MINB 4HY3A 5IASA 2J59A 3IJPA 4ZQCB 4M1MA 1BDHA 4L0QA 3RS5A 3BGIA 4AAYA 3I0MA 1NDHA 1YONA 1SKQA 5T4HA 2PCLA 5F7XA 2JAUA 2PUWA 1G5IA 3FGZA 2J5QA 4EYKA 2A88A 3HHYA 2QRJA 1PG0A 3IJ5A 1UOPA 3C3JA 2HSGA 2DFLA 3BB1A 3JRWA 3NBUA 2PEYA 2O7NA 2FWRA 1CF4A 5A5VA 1O87A 4J0FA 5KO2A 3MFYA 4ITVA 1K9VF 3W5AA 4JYAM 1WA5A 4ILEA 4NE2A 2BOVA 1ISMA 4R81A 2F00A 4KE8A 1KYVA 1I01A 4U8GA 3HLYA 3CEPB 2HHJA 2BE7A 2BKVA 2XJ9A 4J16C 1ZU4A 5HTKA 3HFGA 3B12A 5T5QA 5EEGA 1ND5A 2WYIA 1Y5RA 2VDPB 1XK6A 4UBMA 4RHFA 4EMTA 2FQ1A 5ICSA 1NF8A 4AKHA 1UH5A 5EQFA 3OEHD 2W2MA 2XEDA 3PFCA 1ZLXA 5GV8A 3ROXA 3JQ7A 2OCYC 3E5MA 4LIPD 1KEEB 3KBOA 3R5FA 3QF4B 3GG9A 3I9FA 4PYOA 1SKYB 3GPDG 3MK6A 2QB5A 1N2CB 4EIWA 3FUCA 3H5AA 5AUPB 4PYMA 2BFMA 4F7DA 3QMPA 1PEKE 1NZJA 1NJ8A 1JR2A 4N9QA 3M2TA 1LTHR 3IAS6 2IUTA 1Q0LA 2YTZA 4U2CA 1PQPA 2BTOA 2L19A 1RM5A 5LQDA 4OQPA 5G2OA 3IVRA 1UQTA 4GEGA 4CL3A 3IB6A 2P1RA 1R6XA 2DGDA 5K0SA 2Q5FA 4F5WA 2R47A 4BGUA 2CL7X 3AM5A 3SF8A 2DR2A 1QXSA 4JSTA 4FBLA 2G17A 1VL1A 3COJA 1B0ZA 1N9GB 1IPHA 1QH8A 2G80A 4JI1M 5CBPB 4OX9M 3EXEB 4FEGA 3GJRA 4EJMA 1TAGA 2OD9A 2SICE 2YV1A 7ADHA 1PS0A 4A2QA 2C2HA 3GW8A 4NCBA 3ZZUA 5EE5B 1XA0A 2IS6A 1K4MA 4CISA 3QPUA 4NEHB 1SB9A 4IUDS 2B6HA 1L2CA 3HG7A 4P4SB 3N0VA 2H65A 4YRJA 4Y30A 3UANA 4IBJA 4QWMA 2AN9A 2F8MA 4JSYA 3VPXA 1O97C 1QRAA 4MW2A 4RXMA 3PPXA 1LBEA 2B35A 5IH3A 1KKMA 3N0WA 1N5IA 1YH3A 4BYMA 5C46F 3Q7SA 5BOSA 4G9EA 3ZZTA 4CQNA 3HH8A 2CWDA 4MR8B 3S8EA 3EIHA 1BS1A 1JXAA 3T3PB 4U4AA 3DLPX 3MWYW 5T4EA 2QPTA 1NVMB 1UWKA 4QVGA 5I7HA 4AZVA 2W71A 4YUAA 2XCRB 3NBAA 4V3CA 1R0BA 4IX1A 3ZDDA 1CETA 4RF1A 4FINA 2BN4A 4MUGA 4BQSA 4WESA 3HJFA 4Y1EA 2D0DA 2A9PA 1MRSA 1TJ3A 4V0NA 2HPHA 1N2ZA 3CBQA 3VV2A 2XLJA 3KZMA 3DAGA 3RVOA 2BMJA 1VE3A 4EB8A 1SPXA 3X1DA 4EX7A 5FADA 4NL4H 4QREA 1JLHA 4QUDA 1LQ2A 5D6NA 2IYWA 3PFBA 2O1XA 4NJEA 1D4OA 3AEKB 2B36A 3P9PA 5DXJA 4D3SA 1OBFO 4Q4JA 3I9MA 3SLRA 2ZWAA 3AB7A 4X1OA 5CM8B 2OORC 2QRPA 3SQLA 2G0TA 4PLCA 3NCTA 1Q7CA 1V96A 3PUKA 2GPYA 2XI4A 2H5IA 5AXBA 1QE5A 4GKBA 4EGJA 1W52X 3PHHA 3FCOA 4C9BA 4MR7A 1ZHHA 1EZ4A 4ZRDA 3VR2A 3KKQA 3E82A 4BFTA 1WLSA 4LV5B 2N42A 4G0ZA 3TIVA 1EJ6A 1CNEA 3IODA 1Z6AA 2MYTA 4DZZA 2J3HA 3VVLA 4H15A 4OVZB 3DZKA 1V3QE 4B4KA 1IFXA 1J42A 3R8XA 3SR0A 2GZ1A 1EXDA 2DWOA 4CLRA 1PJIA 1V37A 1LD3A 3S55A 5CP8A 3QEJA 1P7VA 4Q4HB 3VPDA 1OH6A 4OMCA 4HN4B 1E94E 1XVTA 4QAJA 2VAVA 4TVOA 2I1LA 1UWLA 1OWMA 5CH5A 1X92A 4L9RA 1R2YA 2D7DA 4TSFD 2QVBA 4H4DA 1UAYA 3I83A 2CK3A 1NM5C 1R66A 1ORRA 1Z75A 4Q39A 2E49A 4QYTA 4Q24A 5CB4F 1ZA1A 3F6RA 2BBWA 3FSGD 3SD7A 4NSNA 1PJ3A 1S4MA 4JNCA 1ZKDA 2X42A 4LTDA 5JG7A 2PIAA 2X3UA 4R1LA 1QKJA 2X1HA 4H6WA 3KVRA 5DX8A 2XADA 2ZZNA 4KMRA 1RYZA 4CG1A 3NBXX 1W1WA 2PZFA 4KLZA 4HWTA 1M5UA 4ZFNA 2OV2A 3NMUF 4JOQA 2EU8A 3E2PA 4DXDA 3CLTC 1NN0A 3IT2A 5SZKB 3GI1A 3HXMA 3GA7A 1VI5A 1JHMA 3BL6A 1G8MA 3UTCA 1B26A 3BSYA 3AXTA 4R2IA 4O02B 4LSMA 2NADA 4QBKA 1JG3A 3T9CA 3T9BA 5TY0A 2NXWA 2I71A 3W5CA 3V6MA 3GQBB 1BGWA 4ZMBA 3OJWA 1U6KA 1IDOA 3ZJ5A 3F5SA 5HMLA 3KR2A 3R3YA 5BNWA 1XVIA 2HHAA 4NMWA 4L5BA 3M2PA 2LUOA 1GJSA 3OPXA 2W4IA 2EFEB 4DUYB 3R3JA 2F4NA 5TSDA 4QOHA 3LYUA 4KHZA 1IIRA 3EE6A 3CF4G 1IG3A 3I2GA 5D3KA 1MC8A 1RZUA 5KX5B 1TZJA 4M88A 4CIDA 1KI6A 4QOFA 3AZOA 1JFFB 2X5NA 3UC5A 3QE3A 5ALXA 4DRZA 3E9EA 2GCOB 4Q03A 4FFMA 1ZMXA 2I6XA 4YJ3A 3O4VA 1XVUA 4UDNA 5M2QA 4I9FA 2O4UX 4UQPA 3IGFA 5I48A 3GLUA 3KELA 4FFRA 1V3UA 4CCYB 3RAEC 2PV7A 4DLPA 5J40A 1U2TA 4CETA 2DAMA 3DVSX 3OF2A 4RTKA 3QVGA 4HNTA 1VQ1A 2ZRHA 3ND7A 3PCRB 3LDHA 3QHQA 5CDUA 4ZK6A 2DT8A 3BFJA 1ZRSA 4MHSA 4N6OA 2DQKA 1GRRA 3ZK7A 4ALJA 3K15A 4FM9A 3O91A 1HYHA 4W5OA 2QQ0A 2Y68A 3W04A 1DIGA 1WHTA 1NFRA 2QIOA 2QGZA 4BWVA 4ASUA 4JX8A 5EP1A 2ZRJA 1KFJB 2B82A 4DV4B 2F6RA 4D9MA 1R5JA 2IHTA 2O5EA 3AU8A 3DYIA 3P19A 2DU8A 3TRKA 2WG1A 3LNCA 3GUYA 4QSMA 4C0BA 2PS1A 2QD4A 2GJ8A 3WWPA 3FDJA 2NZ8A 4BQOA 5CFZA 4GF5A 2VAWA 4RQBA 2DZNB 2G8NA 4DMGA 1O54A 4DEXA 1GJTA 4DV7M 3K1AA 4EYEA 2ZWPA 5EXTA 4Y2GA 2P1ZA 3ZBPA 4O2BA 3IIJA 4UU0A 3N2KB 5FTJA 1J9EA 2XE7A 2ZIXB 5B6JA 1TM3E 4CCWA 1ORIA 3KLOA 3C5CA 4HAZA 4J29A 1II9A 5DHAA 1NKSA 5K3DA 3S6JA 4Y6QA 2C94A 2CNKA 2K7ZA 1IDN1 1FRNA 1M34E 2VTBB 2AQ8A 3PQ2A 3FDZA 3OZIA 1Y63A 4ZWNA 5KOJB 3WOHA 2KNVA 1W35A 3P9ZA 4FGZA 2QP4A 2GETA 4BMZA 4N3CA 1LLQA 3KOUA 4GITA 2OVFA 3NTOA 3T0FA 3CB2A 1EX6A 2OFPA 1W5EA 1AKWA 4DRXB 4KQXA 1ST2A 1VOTA 1H1LB 1BSVA 4LZOA 1L0BA 3IA7A 1GGVA 1NXVA 5KYTA 1Y3AA 3A4VA 5U1PA 3RYIA 4DV1M 4I9HA 1ZR2A 3ZIDA 2UVPA 3LHKA 5GZ1A 1FS5A 4B74A 1UDXA 1M2OA 7REQA 4QKQA 2G5CA 5H8WA 2H8GA 3PXDA 2JW5A 2VJAA 4AXBA 1BN7A 4RMIA 1C1XA 3U7IA 2OCGA 1NUQA 2ODQA 2MSLA 3EVEA 2JFZA 5CYGA 1FA9A 4DR6M 5FA6A 1SU6A 3IP3A 4ZREA 3ASVA 3NG1A 3S2YA 5B64A 4CT4B 4JDPA 3WSVA 1MXFA 1LQUA 4RFSA 4DWWA 2VJMA 4YRLA 4EGCB 3ASZA 1B3RA 5BMVB 4D6XA 4P31A 1DPFA 4PF1A 1A27A 3UH1A 4OFBA 3C4VA 3N1UA 3MBKA 1XP5A 1Q1AA 4C0AC 2WF6A 1WE2A 4B81A 3I6MA 2LP4Y 1U2SA 5IBRA 2EFDB 1JQJC 1UPXA 4G56A 3DBRA 5ITWA 4CU2A 3FMVA 1MNAA 1RKXA 1XDWA 3D4OA 3D6FA 3LGAA 1Q7GA 3RIMA 4HQLA 1C4KA 4BFUA 1RS0A 4KSBA 1E9RA 4QBGB 5EVJA 2X8AA 3TKYA 5J4YA 3CRW1 1SUPA 3A6ZA 2F62A 1T8WA 3RJ9A 3WXMA 3JWIA 4XDHA 2CJWB 3ZTTA 1GN8A 5IC5A 3OIDA 3ESRA 2ZYSA 5CBKA 1C0IA 1DC6A 4Z9AA 2RCYA 1TK9A 5PGMA 4C7JA 3IPAA 3C8UA 2C5FA 4M36A 4MS1A 2D0OB 3HJUA 3GLGE 1NBAA 2PZEA 2F4VB 4YRRA 4H16A 1XTQA 4D3ZA 3GX1A 3OZSA 2I4IA 3W06A 4BKMA 5KYYB 5DLPA 4DABA 2IY9A 4NENB 1GZVA 2PSJA 1H93A 4JWKA 1YR8A 1NHWC 1IUKA 2WWGA 3CS3A 4ZEWA 3KNZA 3FOFC 3U62A 4DEYA 4LRQA 4F2DA 4XGQA 5E1DA 1K86A 1E2BA 1NYTA 4GPEA 3D81A 3UOAB 2WYWA 1NMZA 2O8CB 1X80B 3VK7A 1R6BX 1VYHA 3ZE2B 1EFPB 3P2EA 2GPAA 4X54A 4D56A 1LVHA 2R44A 3CEMA 4E12A 4NV3A 3SX4A 5ALSA 4JJGA 1F2VA 4IIGA 4C5AA 4TTSA 3S2UA 5IZCA 4GI2A 3VV3A 2YJ6A 4B17A 4DLYA 3VDXA 2HT1A 1CDDA 5SY6A 5LIPA 2OGTA 621PA 2ZTLA 3EMVA 1I1QB 5E0KB 2EKQA 2OL4A 5K3AA 3ELDA 1AUPA 3IE2A 4PAMA 3D7KA 3VZCA 1CZHA 2IRWA 4GRDA 4EHNA 4YPFA 1N6KA 3RYHB 4CNQA 2Y4OA 2XGNA 3A26A 1W5SA 2PD3A 3VHQA 4LF4M 2W7TA 3HFRA 5FLYA 2YZ2A 1N5OX 1DTSA 1W73A 1NVGA 4RIEA 2BRUA 2XNDD 3OLQA 1RXYA 3ZU2A 2FJ0A 3ONEA 1OGYA 3C6BA 1O8BA 4YRCA 3RG2A 3AJIB 4IRUB 3PC3A 1IM5A 5ESWA 4ZTBA 4W7IA 4YJHB 4HCJA 1RTTA 2Y1GA 4QJBA 3UMYA 5B2FA 1QZMA 4MA0A 2ARKA 2BI8A 2ODEA 4FQ7A 3EEOA 3N7TA 3AU9A 4YJGA 1JSZA 3SFVA 1G8PA 3OZGA 4YYZA 4WWHA 5IM4F 1I2AA 1ABBA 1DUIA 5KINB 2UZ1B 2ACVA 4PHFA 3TEFA 4KNVA 2W5UA 1YZGA 4YYEA 3NT2A 4UTRA 2P6OA 2B4QA 1ZR4A 3BAZA 3HJQA 3WLAA 1GNPA 5I5GA 2X22A 3WLTA 4QRIA 1XB2A 5D01A 4FR2A 3UQYS 1HEIA 5ER9A 2ZSAA 4A1OA 1KRHA 4IFIA 4OQLA 4DG9A 3EBPA 3ESDA 4URXR 4YCAA 4X90A 3SVLA 1NN1A 1TKCA 1NLZA 5KYUB 3HDTA 1MB0A 2V4MA 4EJSB 2YHIB 4QGHA 4XUDA 2Z57A 1NRWA 5K3SA 5DFLA 4KWHA 4ZU6X 2Q99A 3T5CA 3UAWA 3PNYA 2XGOA 1SAYA 2DLNA 4IS2A 2ETVA 2WSLA 2HMTA 1WB4A 4B3JA 1Q1BA 3DZFA 3QI2A 3ASUA 1O6BA 3HO8A 1E3LA 4TMTA 1L5FA 4LHYA 3UJDA 4P22A 5A4AA 3KXKA 3FJ1A 4XGNA 2J9FB 4PPGA 3TDKA 1ZO8A 3M1IA 4UAUA 1NBIA 2QVZX 3AILA 2HSWA 3QPCA 4CMAA 3AFGA 3JQQA 1S7CA 4DA4A 2BFDB 5G1NA 1PWXA 4WVLA 4PT5A 1KFVA 1W0KD 2FMUA 3IOYA 1OZ0A 1LXCA 3ZLBA 4C7KA 5DASA 4S0ZA 3V6LA 2VRWA 1P6XA 5AT1A 4M7WA 2JIOA 4QRHA 1EM6A 4B79A 1ULAA 1K4YA 4RKQA 4HDKB 1TE2A 2AZXA 4QECA 4B3GA 2O05A 3SBXA 3PP8A 3B7ZA 3W6UA 3SEZA 4HBGA 2H4JA 4Q6BA 4X20A 5E3JA 1NLUA 2BEUB 5JO9A 1XMOB 1H42A 4PHHA 3GHYA 2J33A 1XZAA 4GRIA 3OCWA 5CTJA 3RR2A 1WTAA 4Y3UA 4BVAA 4RF0A 1UC5B 1X7ZA 3YASA 2O25A 4P3XA 3WMGA 5A4DA 4Z86A 5KHOC 5F1OA 1JZQA 3ZGYA 1LVGA 2YUIA 4MA5A 4GC9A 5AW7A 4NR0A 1Z28A 4UTVA 4XQ9A 3LUGA 1PYDA 3EXIA 1T2VA 1QFYA 2A86A 3NVKI 3B3QA 1XMXA 2RGCA 5F3WB 3JZFA 3W5BA 3HKDB 3EVDA 2Z7JA 1X7WA 2HCJB 2XE8A 4EYGA 4LC9A 2VOJA 1WMBA 1P45A 5IJZA 1VG8A 3C87A 1MH9A 5A6SB 3UM9A 4YMSA 4CLHA 2OCLA 4DJEC 4PCLA 3RKSA 1M2WA 4TMXA 4G67A 2JVIA 3KZVA 1VBMA 3G5MA 1ZM3A 4GXQA 1VPTA 5FLXA 2GQFA 2WJYA 4PGMA 1XZGA 4A1FA 1PV2A 3TL2A 8AT1A 3SM3A 2FFHA 2CNNA 4FDAA 2OECA 1S4QA 1C4OA 1KQOA 3F3SA 3SLGA 3DE0X 4BP8A 4TLDA 3H2YA 5A5DA 4JX9A 3MTGA 2YJGA 4F11A 1TJ4A 1OZAA 3OFJA 1NLFA 1D6SA 4MPPA 2WFZA 2BF4A 2YR0A 2P6RA 2J09A 5F76A 1SCUB 4OI2A 2X1MA 1PGQA 3E8XA 5J2TA 4MKRA 1HNZB 2JGFA 4QBFA 3IKJA 3V7UA 5DHTA 2C83A 4OL0A 3PD7A 1PT8A 5CFLA 5CDHA 1KBOA 5SZIA 2QGNA 3DFUA 2PMBA 1KVQA 1N8NA 2DKNA 1Y7IA 3WLPA 1QIEA 4X66M 3VI4B 1FJGM 3RODA 4ND6A 2FHPA 3B5EA 1BHO1 3MT9A 5EJFA 3HV2A 4L2IB 3O8QB 3GA5A 3T5MA 4P98A 2V59A 2HXGA 1Z6PA 4PM4A 3LWDA 1FDUA 4HH0A 1E9BA 1Y1QA 3AEQA 1E99A 3PJRA 5LUBA 4RZIA 1I32A 4JLJA 4JT2A 4IIDA 4C76A 4K9QA 1XA3A 4NSOB 3FFTA 3HCFA 2R8EA 3MWDA 2C2MA 4NLLA 3Q6MA 5FBRB 4I19A 4AT1A 3NEJA 1XDSA 5JUWA 3LT0A 4FGKA 1XU9A 1ZNWA 4CLDA 1OU0A 4CUZA 2APLA 2ZYAA 3T7SA 3U1TA 3JYLA 2EKLA 4B3TM 2G04A 5E6UA 4O4LB 3K2LA 2C98A 4DJ5X 1F9EA 3N5KA 1X7XB 1DBQA 1SGWA 5J2UB 4IV0A 4DYDA 2OVBA 4CEIA 1T4CA 1OKKD 4G97A 2QLJA 1EVLA 1NMYA 1UT6A 3AR7A 1R15A 4OKNA 1SBIA 4B3XA 3TMYA 3WV5A 4PZPA 3S3TA 2YYZA 1BX0A 2P9FA 3GFSA 1WNTA 1F60A 4TOIA 3N2NA 3LGSA 3OX4A 3LP8A 1SR8A 1KR5A 5IVIA 5AW5A 3RYTC 5I9NA 3G79A 5FEUA 3FE2A 3LPNA 1LPSA 1I6LA 1D6NA 1ZH6A 2FN9A 2OZEA 2K6BA 4YCMA 4K9KA 4YIHA 1R0KA 3D8UA 4MS4B 2J3LA 4R0VA 2DC1A 3R4VA 2EP7A 2QSYA 3I62A 3DMDA 4RNDB 1UP7A 2Y05A 3HU2A 1BRMA 4P54A 4J16A 2C00A 4PGHA 3L40A 3I6QA 4K6HA 4YO8A 4H27A 3O9MA 2Q6LA 4L0DA 5DGCA 2BEWA 4I55F 4J3FA 1L1ZA 4BGDA 1TH3A 1SCNE 3HI4A 5HGJA 1NASA 4P4NA 3ZZ0A 4BVJA 3L41A 2XMQA 1ECBA 5AKGA 2ORYA 1RMTA 1YQGA 4FFSA 3KZ1E 1KU0A 1KAHA 1LX7A 3R76A 1MAUA 1OBHA 1RBZA 1E9VA 3FWHA 4LJ5A 4DTIA 2HKIA 4KGZA 1L5SA 5LC1A 4YUZA 1WR8A 5F77A 3OMXA 3MHPA 2PGNA 4CI9A 1OTYA 1CRWG 4YP0A 1XDBA 4ZKEA 1N2IA 3L0PA 2J9RA 3QQPA 2CSUA 1UAGA 1HE1C 1LDMA 4EP1A 3QLVC 1YOVA 3URKA 2H07A 1JPJA 2AV6A 3IVXA 2AXEA 4LZZA 1CJVC 5ELMA 3T3MB 3EARA 4HDRA 1EIJA 4L95C 3O4RA 1QKKA 2ZSUA 5KYNA 2GDJA 4ZCIA 2YWRA 2VTDA 3RF6A 3VHXB 1WEHA 4L76A 5KTKA 1SH7A 1T1RA 3RFCA 4JKIA 4E6EA 2OOAA 4I5SA 3ILHA 2C42A 5KPRA 4B4DA 1UBFA 2IU3A 4R9RA 3GJSA 3AETB 1I5EA 4IUCS 1N75A 2B5OA 3OIGA 3JR5A 1YU6A 3M81A 1BMFD 3X1WA 2PT7A 1TM5E 5DM0A 1HSZA 3WE7A 1JW9B 2YC4C 2LTUA 2FW8A 3BXGA 5ECDA 2ZUUA 1AX9A 3WAKA 2PZLA 5JAQA 4UHBA 5LL6P 3G2JA 2JKZA 3Q4GA 5BN5A 2YJZA 5DJ5A 4ZI3A 2Z9DA 1FJXA 4FGUA 2IH2A 4MCIA 4KH1A 5K0EA 1SNYA 1V1RB 5LLTA 2AW3A 4OHCA 3HMQA 3TRJA 1EMDA 3CUWA 4I2VA 3GLQA 4LJ7A 3SJUA 3P9XA 4KZPA 4JODA 3VYRB 3HWRA 1RRPA 3F6BX 4JVSB 5A9SA 1JEAA 1G5HA 3QJ5A 3HHZA 3LRPA 2J7KA 2BRUC 3W7AA 4O4JA 4M98A 3ZV5A 1R0RE 3IP8A 1TEXA 5HE8A 3Q7IA 3RTEA 1XQXA 4WY8A 1D04A 4HNVA 2H2AA 3FZNA 3N5CA 3Q7RA 2EJCA 2P27A 4IG9A 5BW5A 5J47A 4TSKA 5BW4A 2BDTA 3QYPA 2IV7A 4C4ZA 3KHKA 1G3MA 3K72B 5E7IA 5ED0A 3KTFA 2E4VA 2WV9A 1CUDA 4EECA 4AIRA 5HUHA 1YZQA 5ALYA 2XCIA 3R7LA 1NR5A 2WUWE 2R6GA 5JYCA 1ZQ9A 3HU1A 4J6FA 1H0KA 3IEIA 1MAVA 3S81A 2EYUA 2OORA 1OGIA 3AEXA 1W8IA 4RTNA 3F67A 4BEBA 2DHCA 1JBKA 1XNRM 1GU7A 3W4JA 1SIBE 4HFRA 3FUVA 4QFBA 2JLBA 1U3FA 3A9SA 4IEEA 3D0QA 2QD1A 4NCJA 2B1QA 5EIFA 2VTEA 2XB4A 3Q11A 4KAXA 3BH7A 4Z9XA 4KXYA 5F1KA 4M3NA 3HRIA 1U3WA 1AKTA 4L4SA 5KYXB 2RMKA 1ZUIA 3DBOB 4FN4A 3IPYA 3W4IA 4K0KB 1KARA 1Z4JA 1E64A 1MG5A 3PD1A 2MH8A 2WKWA 5KJFA 2VPIA 3H9UA 3DLBA 5JYDA 5IF9A 5MN4A 1B43A 4ZO4A 2R60A 1N32M 1KYWA 2PWZA 1LPOA 4K6GA 1KZ1A 5JADA 4G8CA 4N6NA 4IRXA 1X8JA 1HKUA 3PUYA 4JLUA 2C4MA 2C4VA 4KN8A 3F3KA 5EWLA 1UPCA 1GG8A 4HAYA 3KETA 3E5NA 3RU7A 3EH2A 2Q6VA 2C2YA 4F2HA 2D74A 3DOOA 3EIEA 3CNLA 1I94B 4RZXA 2GLXA 1ZNYA 2PTHA 3G0CA 3F2VA 1K75A 3BE8A 1UBKS 2CHEA 1KXJA 2HU2A 1Y4UA 4LOJA 2D5LA 4EY4A 3MIZA 1JHZA 2C8LA 5FL3A 5JSZA 5F1YA 2P4QA 3WNCA 3R40A 1EFRD 2NUAB 3NAGA 1NBOA 3V34A 1USKA 4EG0A 1UBGA 1N2JA 2R79A 4BNUA 2G5GX 2K6GA 5CVJA 2FGKA 2YOGA 4JASB 5BPHA 1M2JA 4KQMA 3FKQA 5FLEX 4G4RA 4L08A 1N0HA 1FUEA 3V80A 1ZJZA 4KREA 2HSZA 1KRWA 1E1CA 1H6DA 3R5SA 1RXIA 2UVDA 4TWZA 3ZHZA 5FTMA 1FY2A 2UZ3A 4W99A 3R9KA 1YS9A 2P69A 1B2LA 2QS9A 2OQIA 2I22A 2H4YA 4G0UA 1WL8A 4DQVA 1J2RA 2BSQA 2HREA 2GCNA 2KHHA 2AG8A 2FWIA 3WIEA 3ETLA 3T54A 3BSFA 3JTMA 3QVTA 1KP9A 3VGJA 3TTUA 3B3FA 7CATA 3ND9A 4KFUA 3NYQA 1F3OA 4ZZIA 2B2XA 3GD7A 5J4VA 1Y81A 2L09A 1EVQA 4DM7A 4QIHA 3DMNA 721PA 1B15A 4INJA 2QT9A 1SOMA 2JIRA 3DE4X 4PSVA 3OCCA 3CWZA 4TWRA 4ZYTA 5ITZA 2CXPA 1RVV1 3PDIB 5AK0A 5IYZA 1P2DA 4EJ0A 4WQMA 1AXEA 2O1SA 3HWSA 2NZ2A 1T5OA 2UKDA 5GONF 3CX7A 2CCGA 3Q8LA 3ITEA 5FDFA 1QO9A 3IESA 1ECLA 1KJZA 3AHHA 1ISJA 4M1WA 3HNOA 4M60A 4CMEC 2R46A 1TQ4A 4HWSA 2A92A 3KOXA 4JGGA 4GOMD 1U7TA 3P5BA 3HUDA 3HXQA 1ZV1A 4YMVA 4R84A 4E2YA 3SKVA 1BW9B 2OPFA 2X58A 3OUUA 4HJXA 1Q57A 3CX8A 1SVWA 3P0RA 1DGQA 3E21A 1T15A 1AY0A 3WKEA 1RHJA 1ZRNA 4BMPB 3RC8A 2GAJA 4DMHA 2O0MA 5TEWA 1J1UA 2FUG1 4NC9A 2GPJA 2OQ2A 1Y1LA 2XOXA 4L5AA 3WMEA 2I6TA 3E3LA 1WBJB 4YMUA 1CC1S 3KSMA 1Z63A 4PX5A 4PLZA 4G8JA 3RB8A 2QN2A 3U13A 2XT9A 5E8JA 2O8FB 4DV6M 4BQPA 4DAOA 5B2ZA 3ZIAA 3K8ZA 3QOXA 3RPEA 2J85A 3ZNOA 4DNPA 4BXOB 3BJZA 5K03A 1ZUNB 4FJ2A 4JFRA 1RPAA 1U98A 1Q91A 1K0FA 2YNMC 1XRJA 3VR3A 2IV2X 2NX2A 3D5QA 5I7RA 3V32A 4YAIA 5DLYA 3JALA 2QLBA 1JSRA 4MB0A 1VPDA 1RQ2A 5CK5A 3PQ5A 2AOUA 3AI1A 2VHWA 3EPPA 4P84A 4WXYB 1P31A 1P39A 1EK5A 4XLLA 4YFYA 1TT7A 1NY5A 2FN7A 4NICA 1S96A 3NV7A 1QQ6A 2WFAA 3G8DA 3HRHA 3U5ZA 4R1OA 3MWEA 4Z9FA 3LT5A 2WOJA 2DWUA 1C9DB 4M9QA 2ZAOA 5TX7A 2MJ5B 1DXOA 2ZJYA 2JUJA 4TVKA 1ULZA 4IVPA 1OIVA 4K9LA 3ZXIA 3MXOA 1TT5A 2P9HA 2B7CA 1RADA 1VHDA 1TF2A 4CM1A 2ID9A 4UTZA 2OM6A 2QXUA 3RSLA 1QKIA 5M5BA 3H1EA 3HCAA 3ZGVA 3ZS9A 4HJRA 1VA5A 3NKVA 3DEJA 1C9KA 3WMXA 1YVRA 4I4TA 1P0QA 4XD2A 3H0KA 1QFMA 3U4MA 2VBIA 2CXUA 4R16A 2VDMB 3E7FA 1TQ6A 1SC6A 3W2EA 2DJ5A 3N2LA 1YE5A 2D6FA 1HNXM 3ABSB 4RCVA 1JEOA 1MOZA 4FX5A 3KKMA 1GPUA 4HZUA 5KNDD 4UBKA 4HAUA 3HB0A 3AMVA 1T9GR 5IKPA 4Y2RA 4ZOLB 3LO8A 2GN9A 2GXUA 3BGOS 2D7HA 1NQUA 2W8BA 3OHPA 2ZREA 1E2NA 1TZMA 5T6MA 1YBFA 1FPMA 2P4UA 3E3AA 5BPFA 4YWJA 1J7KA 3AV0A 4PANA 2B4RO 4WMLA 2BD0A 1J2UA 1WSAA 3A31A 3ESQA 8LDHA 1T3SA 2W6ZA 1DRVA 2ZJAA 4PO9A 3N2EA 4ZVQA 1MB2A 4FXOA 3AEYA 1L7XA 2IPNA 4Q48A 1RAFA 3O8BA 4DMKA 4MGYE 2C3UA 3EC1A 1T26A 3UW1A 3RASA 5TJ9A 3HJBA 3ISJA 5EZYA 1CTQA 1JBQA 3U6MA 5E4TA 4GOXA 2PMWB 4LK2A 5TT1A 1QAQA 1DXQA 1W87A 1QV6A 2IZZA 3ZWCA 4HAOA 4JJAA 2H57A 4KVAA 1CUWA 4MS3B 3FCYA 1M7BA 4EHFA 4EQZA 3KFVA 3DB2A 3JARB 5KPDA 1I7LA 4PCUA 2J7OA 1NHWA 5ICGA 3WDLA 4AJPA 2RHBA 2VXCA 4CHTA 3D1JA 2FFJA 3SSOA 4GLLA 4NBUA 4E5MA 3PEYA 1NT4A 3IPLA 2WSEF 1O9GA 5JH7A 1M2EA 1DBWA 2WWXA 5T41A 2YWHA 1P60A 1U8TA 2P2CA 2FZKA 1ORHA 1JKJA 1PEAA 3AF3A 3DE3X 4Z2AA 4H6VA 1EWKA 5BSMA 3VKFA 3HP7A 4ER0A 2F5OA 5H82A 1SCKA 4HPXB 5K6TA 1T8SA 4D5GA 1C1DB 3RVLA 1Z0AA 2DPXA 4IHJA 1ZM9A 3D2CA 5TMPA 4DPMA 2BJHA 4PQRA 2Q5IA 3CV3A 3V9PA 1JHVA 4ZIRA 2AW5A 3AWIA 1DAPA 3E2IA 3KZXA 1D2HA 3LVFO 4MUHA 1N36B 1EUDB 4O4HF 2HNBA 4WLEA 4ZALA 2AEJA 1JAXA 4BNKA 1X2BA 4F6LA 3VISA 2XA2A 2ACKA 3OOSA 4V38A 4OHOA 4ZCSA 5I7FA 3KEFA 4RHTA 5CR9A 3B9QA 5IBPA 4CTKA 1N5MA 2K4MA 2UUOA 5CDFA 3CZAA 3OLYA 4LQCA 4Q7MB 4BQIA 2HBRA 2ZVJA 2CVHA 4QYIB 3ETJA 2P2SA 4LF5B 1J49A 5CFPA 2YZKA 4F9EA 1Q3BA 3L0SA 4E3WA 2JGNA 4O5OA 2WSSD 2DFVA 1G8AA 3DXZA 1NBHA 3C3KA 3Q8WA 5KSYA 4W1RA 1WY7A 2FDCA 3EIXA 1EVIA 2JJMA 1V7PC 1KKLA 3KAQA 3LVVA 1KIMA 1JIXA 5L45A 4I4CA 5L3ZA 5CNJA 2DWPA 4A6EA 1X74A 4L5CA 1T43A 5AI8A 4PDGA 1V1MA 4EYOA 2HH9A 3L79A 5AKZA 1ODTC 1F2TA 1XAGA 3W1EA 4ETMA 4F04A 1JZTA 4GKKB 2AKEA 2XYHA 4QAQA 1D0SA 3HYCA 2OHGA 1CUBA 1HL3A 3OLXA 3L8ZA 4O2AA 4E70A 1RLOA 3K1YA 4XIIA 5T64A 1MAWA 4HADA 3IAS1 5JAUA 4B3MM 1TMKA 2B34A 1Z39A 4NABA 5KOHA 4PPYA 1IULA 1E2FA 4LXGA 2P5SA 1JG1A 2WRZA 5SYNA 5EKUA 5U4XA 1NMSA 3PC8A 3U0BA 4UU7A 3L7AA 5K0FA 2A33A 4EHAA 4N0MA 2JI6A 1AQIA 2OO3A 2JARA 3CRMA 3GT0A 1OLUA 4DSZA 2XTMA 2NU6B 4HQKA 4BQQA 4OUDB 1UKCA 2I8LA 1FRFS 3CWCA 2PGLA 3P9CA 3ACBA 4IXNA 3PHJA 1THMA 2LXEA 3C1TA 1JDNA 4Q66C 3ILSA 4BCBA 1ZD2P 4ZVSA 4WNIA 2GZHA 2ZE8A 4LF7B 3UBMA 2CHVA 3GGDA 4XQ0A 3NBIA 3D7RA 3DW3X 1UCFA 5HWSA 3LH5A 4DIBA 3UUEA 4ETIA 3ZDYB 1RQGA 5LQRA 1VL8A 4N4AA 1YC2A 1Z18A 1WDLA 4X1KA 3OA0A 1EBBA 3E53A 2IVFA 2ZBEA 1K4KA 3QP9A 3ES9A 2E21A 2WT8A 1O7JA 5J3JA 1BN6A 2CXTA 1UMDA 3R0JA 1LBIA 3SQDA 3QVVA 3KD2A 3F5FA 3WIDA 3QELA 2QV7A 1W0CA 4Q7JB 1N1GA 3QXGA 4HNUA 1Y98A 5HDQA 2HJHA 5TPWB 1NW7A 1PNRA 3RRMA 1H4SA 5EA2A 5KOIA 1BCRB 4I3GA 4EB6B 1N2EA 2IDKA 3CRNA 4B5KA 5CM2Z 1QDTA 2C9CA 1GNTA 4FFBB 4OGKA 2R6JA 1U90A 1ZIOA 1CR0A 2HMUA 4FNAA 2O52A 2NXNA 3GBVA 2RHOA 3PC2A 2Q45A 5DYWA 4IIJF 1Y6GA 2IYEA 3ED5A 3G82C 5HZGA 1DELA 3TLBA 1YE3A 3TQHA 3LNTA 4PZ9A 5AICA 1HKHA 3HZRA 3ZZNA 4Y2PA 4L9WA 1FFXA 1HMYA 4NXNM 4YCNA 3UAOA 1VMIA 3AKEA 5F73A 2FMTA 4FZJA 1K7FB 4KQIA 4AZ0A 3K2BA 4DBVO 3GUVA 4ZMSA 3AM4A 4A10A 2OO9A 4IWNA 3I04A 3VBCA 3PICA 1LPNA 2J3IA 4B3RB 3PSHA 4BL5A 3GLHE 4WNCA 4O63O 2FZCA 3BK7A 3L6RA 13PKA 5BYJA 3WICA 3JQAD 3OQHA 2WWWA 3I9V6 1E4EA 4HDQB 4RPGA 1G7SA 2C3PA 1T34A 3RT1A 3HHWA 3EUAA 5IFLA 5WRFA 4GYJA 4TM8A 1US8A 3IO3A 5JAPA 1JEQB 4YI3A 1WULS 3PYMA 3DPSA 1CF9A 3PDHA 2VWHA 4OJQA 5EERA 4LMPA 2DH5A 5I3ZA 4IH1A 1Z5CA 2HN9A 3ET5A 5LXTB 3ZHUA 3IIIA 4DR1M 1AKYA 1ZVQA 3QSYA 3IQZA 2WR8A 4B83A 2PNFA 3NANA 2H54A 2PMDA 2WY2D 1OAAA 2P9BA 1U6JA 2YWEA 1GZUA 1JQEA 2R5FA 4M0MA 2JJQA 4M21A 3KS9A 1LBHA 3RE1A 3LA8A 3GK3A 3KJIA 4MB6A 1AHHA 2GVZC 1SXJC 2V74B 4FEYA 4BKOA 3KKZA 3N59A 3D31A 1OIWA 2E55A 1XAIA 4K6FA 4OX9Y 2RG1A 1ZMBA 2D1TA 4U3JA 3PHGA 3JVVA 2JY7A 1DOZA 2IEZA 2BEJA 3CH7A 3ZQ6A 4S35A 2NTJA 4D46A 1GSHA 1VLHA 4YQFA 1VL0A 3GJYA 4Z7QB 3NWEA 3DVQX 1ZP6A 2Z3XA 1JQBA 1Z83A 1GL9B 5HJ2A 4UBOA 2LIVA 4Y2QA 4BLTA 1WW8A 4EUKA 3SSMA 4DR7B 5K2MA 3U4CA 3IULA 1J8MF 4PYLA 5DP2A 2I03A 1YZHA 2CHFA 4CIVA 5ADUS 4F5YA 1P0CA 3HDJA 4ZDKA 1YAHA 3FFWA 3IE0A 2HD4A 4YXWA 2AK2A 3OWOA 1IONA 1XU7A 3OA2A 2NWQA 4ZC8A 4Z4IA 4XR9A 1IXYA 2P8JA 3TVDA 3TCNA 3U60A 1XMJA 4EHIA 1SBCA 4WZAB 3N3AC 3L8HA 2CD7A 3H9JA 1QOQB 4FI3C 2BNKA 1DAHA 1N4DA 3OFVA 4CGYB 5CYOA 5EYPA 3SEAA 1T25A 2OUIA 2UYYA 3SVZA 3IO5A 2GZMA 1C7RA 4GE3A 2JFFA 1SUDA 1UPBA 2C7PA 3TFQA 2WDZA 3QLVA 3RVKA 3SLKA 2WSMA 1CY8A 3O93A 5LOVA 1GAXA 5I3CA 3UJBA 4NU0A 2MSKA 4JLMA 3BF8A 5JAZA 4MVJF 2XKKA 4BUZA 2I3GA 2TYSB 1UBTS 3HUTA 5DN6A 2CXHA 2J7PD 4EVRA 4KR3A 3BB4A 1V8ZA 1N6PA 5KHAA 2YOHA 4ZAVA 3TSCA 2VQEB 4XFKA 4MQFA 4JL5A 2FS1A 4JT9A 5REQB 3JQAB 3A2LA 1ZJWA 3MMZA 2BL4A 4YJ2A 5AIAA 1S9DA 3T1QA 2HHCA 1Q1EA 3ZNQA 1XZCA 3TB4A 4BE4A 4TN5A 1E2KA 4M7RA 3ZV3A 2BCGY 3T5AA 3A0UA 3VU1A 4CEHA 3CZRA 4IYRA 1Z8HA 2XH9A 1OBCA 4L5JA 4DR5B 4PX2A 3O03A 3G0HA 3OLZA 3DPIA 4XBOA 3MRXA 3AC0A 4A0HA 3CIOA 5EZSA 2MWMA 4RJKA 4KIUA 4GI5A 4LYHA 3SJCA 1HG0A 3URMA 3L1VA 5D7BA 2B5VA 4KITB 3PVCA 3K30A 3NXKA 3OIFA 1TOAA 4MRMB 4NBLA 1GADO 5J5CA 3UK1A 3EXFA 3TNFA 4YHHB 1E1MA 3AW8A 3MCVA 3EDMA 2FPKA 4MW9A 1V11B 3DOUA 4Q4DA 1M2FA 2C20A 4LXHA 3F0TA 4XSGA 4B9EA 5EE3A 3U4QA 2IQIA 4XPIB 2IODA 2GEJA 5IRCD 3BMNA 4WINA 4G81A 2FYTA 4PICA 4G1MB 4XTCS 5EJGA 3M5PA 4W5JA 1Y8QB 5DTQA 4IWXA 2XTZA 4RVHA 3LP6A 4L27A 1B6SA 5ALQA 4OXKA 4US2R 2AG5A 4FR5A 3AK4A 2B69A 3ANTA 3ZDZB 3IUBA 1S8AA 3BK1A 3KYCB 1D4ZA 4D1YA 3H86A 4C2UA 4AUKA 1TCUA 4OKSA 3PUJA 3SK0A 4U00A 2C3OA 4WI1A 4Z54A 4OKIA 3LDGA 4NZ9A 1XRNA 5GGYA 1D1SA 1UMCB 4MR9B 5E6SA 3J7AC 2Z1DA 4Z0HO 3NTVA 1P7YA 3DV0B 2GNAA 5AJWA 5C81A 3MCTA 3GEIA 2LDBA 3HP1A 2HHHB 4BTLA 2J46A 4ZQHA 2EVWX 3DCIA 2QHOB 3HGTA 4QBTA 1KEPA 1R5NA 1GPMA 1XTIA 1CY0A 2CEKA 3VHRA 3DAYA 2JD1A 3ETNA 4U8HA 4RTQA 4ZV4A 4RADA 3VYSB 3W68A 4FZ3A 3M3HA 4UBNA 2R1VB 1U8EA 3QFSA 4XVRA 3UXHA 1TM2A 1T9CA 1XBTA 1ECGA 1ML4A 1VCOA 1QG6A 5E95A 1YRAA 2C2OA 3EIWA 5IHXA 4G4JA 3JAWB 1WU8A 1ZCJA 4UNRA 3TI7A 5ER6A 4E33A 3OQIA 2QBYA 2X8WA 4K9NA 3PC8C 1IEWA 5LFAA 4HH1A 1M9NA 3KAJA 3VR5A 4QPDA 4LTNA 3QUAA 4Q3OA 3DZCA 2YASA 1JPVA 1I3NA 2ZIFA 1EP3B 1NULA 3ZDBA 5E8RA 5BQ3A 1K7YA 1RRVA 3BUSA 3PC7A 4RESA 3THXA 4BVBA 3RBZA 1ZOLA 2MJLA 3TNDA 2M2IA 2ODPA 4R1UA 4W1SA 2E1PA 2WKRA 2LIPA 3A0RB 4E0BA 4YQZA 2V7PA 1KOFA 3COSA 1YSYA 1V5FA 1ZMVA 3NIBA 2DBZA 4G2TA 3J27B 3HYSA 4MRNA 2PXAA 1G66A 1LI7A 4D02A 3QX3A 1EX7A 4IOJA 1BX3A 4FJ0A 1PJSA 3PCTA 2DAEA 3OF5A 1Z13A 5K3BA 4TKUA 5SY9A 4C01A 3OPVA 4BNHA 4Q00A 4UC0A 1PX2A 2CVFA 4NOJA 2MSWA 4LHSA 1G8FA 1AM4D 3FGPA 3ANXA 2ZFUA 2XX3A 4L16A 2Z58A 3NHRA 1R27A 3ENQA 1AV7A 1HE8B 3HHPA 3N76A 2DSTA 3CEAA 5KJ1A 3TPFA 3GH3A 2Z3VA 1WXXA 4JS0A 2IYYA 4N39A 4L6IA 4FE3A 3KOZA 1W1IA 2VJKA 1UKAA 3TLGA 4Q93A 3PEFA 3DTTA 5LP6F 2Q5LA 2EEPA 2HTFA 1OXUA 3C3CA 5EE0A 1GTMA 4KFSA 4GMGA 4MV6A 5A3SA 2KSQA 4TVBA 4LK3A 3BM5A 3D7SA 2QRKA 5CX4A 2ID7A 3RVJA 2Z1NA 4X97A 4DR3M 3SZLA 4LJ9A 1DQSA 3VNRA 1P91A 4NHEA 3T3HA 4OLHA 4BFYA 3DEKA 1KEUA 4HD8A 5BQOA 3SM9A 1XI2A 3DKVA 5EP3A 1Y0BA 5IAJA 1WWKA 2Q62A 2VP3A 4KRYA 1TRKA 1H8HD 5AKKA 2QX9A 4JI7M 4WBNB 2ZJBA 1WKCA 3TAUA 4B0PA 1OYOA 1DEHA 3FMGA 3M3DA 4QPCA 1GG9A 1RWVA 1P9NA 4CMEA 4OH7A 4B6SA 2ZAMA 1G20A 2CFCA 2B1RA 4BFXA 4FIDA 1WEKA 2DAPA 2G5PA 2UU9M 1E79D 4RDHA 4LWPA 2QE7D 2VK1A 1CNMA 4JCCA 4KQEA 2D7GA 2ANCA 1NVUQ 2FR0A 1PF7E 4KR0A 3D64A 3QVWA 4A3SA 4H7DA 1MMFB 4D3XA 1SBTA 3ZGOA 2RHRA 4O4IB 3OM1A 4BKPA 2MR5A 1LRJA 5GVSA 1Z88A 3CLUC 1NQAO 1KMIY 1QO0D 1PU2A 3WYEA 3P52A 1QGUA 4D99A 1SC4A 3UGKA 1D09A 2XQVA 5LYJA 3TLXA 4IKOA 1SRQA 5CHYA 3IOEA 2HYDA 2KE5A 4WLVA 1ZNZA 2IJGX 4LJYA 4UBLA 4Q7LA 5CFQA 4KYUA 4X94A 1KOLA 4R01A 2PYDA 1I4EB 1J6UA 4Z3KA 3R6TA 5A06A 3BJMA 2VHTA 2YNMA 1B14A 1FLVA 1GVNA 3LBIA 3DGEC 2EKDA 5E9JA 4IDQA 1V5EA 4MVJM 4EMUA 4RETA 4XGIA 3S0JA 3G8YA 4MROA 4G23A 4GG1A 3ZBTA 1T0IA 2WJAA 4BNZA 3A1CA 3N53A 1JKXA 3ZE6A 2NAPA 3HCEA 1TDHA 3L02A 4ZO9A 3RFVA 4YLEA 4JC4A 4GBED 1KSHA 1E6UA 4XIGS 5C8ZA 5JS6A 4LXIA 1RI5A 5K99A 1SVOA 1XKXA 1Q39A 3J80A 3H1GA 4DM3A 3LHFA 5F35A 5BYAA 3A25A 2ZJ0A 4GLBA 2AUNA 4IAOA 5IJWA 4RL4A 3LCCA 2GNPA 1H85A 1A95A 3UMRA 1L5YA 1M1XB 2WLTA 3BT7A 4H0FA 2YW9A 3WLIA 3HR8A 4OGLA 4LG1A 2G76A 2W42A 2R86A 1E60A 2A67A 1HYGA 2JCBA 1WHSB 5EJEA 5EWMB 2FPGA 4KGVA 3T34A 1VJRA 4WBSA 2CUNA 1IBKM 4ZEVA 5E9QA 1A5BB 3SE0A 4M8KA 4FYWA 5DM4A 1K5HA 1TCBA 2KWIA 1EP2B 5HRAA 1FXWF 1RWNA 1Q1NA 3PQ6A 2VIIA 1NA5A 1I2MA 1I3MA 1WZCA 1S3FA 2AH5A 1VPEA 5DP1A 1TKBA 4GFDA 4ZA2A 2XCLA 2O8EA 3G7SA 1DU4A 3KB1A 4QM6A 4F4FA 1QONA 1NR1A 2E5FA 3DCNA 4GEWA 3KQMA 5DHPA 1VIMA 1PFVA 1UQUA 4EPWA 3FDXA 4F3YA 5EJCA 2BM8A 4QTZA 1PGJA 1KJIA 3WYCA 5EJ6A 1LI4A 3FOWA 1XIVA 1X0VA 5DNCA 1IBMM 3T4PA 1JDPA 4JUAA 5C5DA 4MI3A 3NOOA 1P9OA 4KSCA 1ZMUA 2DQZA 3NTXA 1UDCA 1UC9A 1X77A 3L6BA 3GAAA 5FA8A 1Y8GA 1F2UB 2FF7A 1PFKA 1KBZA 4MUEA 4MLPA 1ZN7A 1OIPA 2V6ZM 5LMUB 4PFKA 1NE2A 2GCIA 5ITTA 3L7OA 2TS1A 4TTAA 3OAAD 4RSMA 3MJ4A 5JJCA 3G1UA 2HJSA 4PC3A 3CZCA 5A5GA 3FTQA 5DEIA 2IQ5A 3I58A 3HJNA 3ZDFA 5I7VA 1UFRA 3IUPA 4XX1A 2Z1MA 2NO9A 2ZKLA 5AK5A 4H4CA 1C7QA 2JLSA 3A9UA 3F9CA 1TH2A 2QOEA 4LGYA 1U0JA 2F9MA 5FX2A 5BUCA 4X3CA 2FW9A 2K2QB 3H5NA 4F9GA 4LJAA 3NIGB 3IQIX 5G3YA 3LX5A 1AA9A 3LUPA 5HM6A 3MQ2A 2FWBA 3ROFA 1SUFA 3LBYA 5F1PA 5FBWB 4CRWB 4ESOA 3FX2A 3I42A 2ZQ5A 4KGDA 4ZAZA 2QP9X 4OHBA 4A8JC 3WNZA 1VMKA 3ICVA 3HS3A 4ZI7A 5AW8A 4ARSA 3PXAA 5FWNA 3H5LA 5H0IA 2QJWA 3FJYA 1MV8A 4HH3C 1A97A 4F5DA 1W19A 1CR1A 5BVHB 5K8JB 2RE8A 3AERB 4WP2A 3DXXA 1ORYB 3IXLA 3SATA 2YRFA 3L0CA 3EMBA 1XEFA 1SURA 1Q14A 2VP5A 5BSGA 1OI2A 2Q2WA 3E03A 1AURA 2BM1A 5L7YA 4CNBA 3UXYA 1KMQA 4FB5A 5KPJA 1J2TA 1GXSA 3U80A 2XOEA 2HBZA 3G1TA 2ORWA 1Z0FA 4BS9A 2W6IA 5BR8M 1CJTC 4RK6A 4S1TA 2ZIWB 3FPBA 3OUZA 3ROQA 2B83A 3QX7A 4PBRA 1JE0A 4WOBA 3DKRA 2KRKA 3Q8GA 3MLEA 2PZMA 2VT7A 4BMDA 2Q4DA 3NATA 3ITNA 1HZZC 2WKQA 1E3DA 2C0QA 1J8VA 1EGQA 5KTTA 3C6QA 2FVXA 4HV4A 2QAGC 4QE3A 6REQA 4QPNA 1U7HA 1Y82A 1A98A 3GLIA 3WB9A 2PX5A 4GSYA 1NJSA 1UZUA 4BMNA 3FZEA 1EM8A 1ISSA 3H97A 1VL6A 1B8UA 1HF3A 2V9ZA 1H2RS 4KQ1A 4E94A 1GNRA 1P6UA 3G2OA 4R2XA 4X62B 3LK6A 5F2NA 4KR2A 3SMVA 3EGDB 2GK4A 1T91A 3D9QX 4JAVC 3TUZC 4FFLA 4YK7A 2C8JA 2WU1A 2XHEA 2DERA 2D1QA 3RGWS 3B6EA 4JEMA 5AOAA 5LD2C 1XK7A 1YR6A 5A03A 1D7AA 5G0VA 5LVAA 1KY2A 5I4IA 3LY7A 3M49A 2H5LA 1XMIA 1Z45A 5FXMA 4F6CA 1D3AA 5H02A 3QWBA 1ABFA 2JGLA 4Q1VA 2AD1A 1XNQB 4WW0A 3G0OA 3DL2A 2XTAA 3PE3A 5I9LA 4F3NA 1U0HC 5HX7A 3KSRA 4GI3A 4IVNA 4Y6OA 2ATEA 3EGWA 3RS9A 1E0JA 1QH1B 2JATA 5J43A 2JH3A 4JGIA 3KCQA 2J5KA 4HG2A 3O1HB 4DLLA 4LDAA 2Q9CA 4RM2A 5KYKA 2NQ8C 2EZ9A 1JECA 4LMBA 3ER9A 2VRBA 3IX7A 2WAOA 3A7EA 1X39A 1VKZA 4MGIE 3PGKA 5H4GA 1PD0A 4GOKA 5HBRA 3E1GA 2G63A 1IWPB 4P0TA 4HO1X 1BFDA 3OESA 2WABA 2CLDX 1QF6A 3PDCA 1DB3A 2Y21A 2BP7A 1OUMA 1I30A 2AA3A 4ZCMA 2QT1A 4Q3AA 4A5OA 3U4IA 3NJRA 2OZLA 2PR2A 1ZGZA 1QUSA 4IH9A 4RF5A 3FLAA 5J23A 2FLKA 1KSFX 3ILKA 4BNJA 4MGYR 2Y1EA 1W6UA 4W82A 1ADYA 4DLWA 4O0LA 4G86A 1MGOA 2I7PA 2OV6A 4PIVA 4JI5B 4KAJA 3OU6A 4OBBA 1SG6A 3C8MA 3K2IA 4BVHA 1KPIA 1GCIA 1JFSA 4DJTA 2QX4A 2FZVA 1OHHD 1IB0A 1XDZA 3SF0A 5JZMA 4GX2A 2JZ0A 4YRFA 1ECPA 4WDRA 1XEWX 4PTYA 1UK7A 4EPXA 2I4OA 2JIZD 1QHFA 3ZW7A 4Q12A 1N4AA 4D4JA 4W5HA 2CFIA 2SHKA 1U1EA 4OFXA 2QI9C 1UBSB 5BWOA 4Z0TA 1PR3A 3IAUA 3TQTA 4CQLA 4WTOA 1R8XA 3H5TA 4LFAB 2C78A 5LKRA 3ZNNA 3MTDA 3U4GA 3CUSA 4LF6M 1II0A 4PG4A 3QZUA 1XT6A 4X00A 3W8EA 5CDYA 1ENPA 1I3KA 4OYHA 4RKWA 4RDIA 3AFHA 6LDHA 3RVMA 3FDIA 5JCXA 4MUIA 3FWZA 2VSQA 3DHEA 1CQZA 3FFAA 5JNVA 3DL4A 5AVTA 2ZYTX 3I9KA 4IJWA 3Q10A 1EP1B 2IUSA 2WEKA 5B6PA 2JD2A 1Z08A 1OF1A 5DBGA 4QDUA 3QKWA 1LI5A 1SK9A 5ERYA 1MU5A 1HFKA 4Z9BA 2WD9A 3U6BA 1DWUA 7GPBA 2W2LD 1MX9A 2QVLA 1SCDA 1V33A 1XVLA 1N3BA 4CKZA 3OBIA 4KNWA 5K8CA 2WTUA 5FUVA 3WGGA 4FQ8A 3FSEA 4P16A 1U2ZA 1C3XA 5BYBA 1UK9A 4TWJA 3SYMA 4F21A 2EFYA 3KSXA 1L7DA 5IEJA 1PR0A 2ECPA 3QEBZ 1ADJA 3D8TA 3NGLA 1SN7A 4B2PA 5AFSA 4GGOA 3U6LA 4V1CA 2P7HA 4IILA 1G8KA 1XTTA 2ZBUA 3S1LA 4BEWA 1PT9A 2NNLD 4AY2A 1KYYA 4FDMA 4J4BA 1G7TA 1E0DA 2ZXEA 5CGQB 4MLZA 1L7PA 1MQ8B 1R8YA 2J9ZB 5B1EA 2HJRA 4DMFA 3GNLA 1SUIA 1YZYA 1Z2DA 2G1PA 2MYUA 2VYQA 2ZBVA 4HL6A 1GQSA 1PR2A 3HUFA 3IB3A 2D2IA 3JW8A 3R6DA 5CW2A 1J5XA 3GF4A 1BU5A 3NBQA 1FQJA 4Q15A 3IP7A 4RDCA 1FDVA 4OXYA 3AGPA 1SXJA 1MOQA 4NBNA 4P83A 3HDYA 4KWCA 3EPLA 3GEEA 2ZAIA 2O0KA 5JARA 4NMXB 2HL7A 1I7QB 5LUAA 5EIBC 3KU4A 4Z1OA 2LCIA 1PW5A 4M6WB 1EK6A 3A4NA 3FUTA 2BZSA 3QLJA 3UJNA 1F9AA 1DEKA 1H0SA 2YV3A 4I5IA 2PBRA 3K70D 3KHUA 2NUTB 3U7QB 1RR6A 4WCFB 1COWD 5JZBA 1K6EA 2XD9A 1XKTA 4EDFA 4L8GA 5ED4A 1IYZA 3T7DA 3SI7A 3B3AA 1Z2NX 2ERCA 2AFHA 4W8GA 2YMLA 3AESB 1OFHA 2FSSA 4L4RA 4IGFA 5TC4A 4QQKA 5LA6F 4HGRA 4PHCA 4EBFA 1ZD3A 4S2EA 1BFUA 2GXQA 4POAA 3ZWVA 1ODKA 3QTTA 3K0FB 2C4HA 1BHJA 2ZCVA 4B3CA 4FYKA 3OLWA 1WXFA 3BH0A 1B16A 4XYMA 1JMVA 3T7TA 4PLWA 3HB1A 3OZXA 3MINB 3G89A 3CMCO 1T0HB 4G37A 4RE5A 3AUYA 1UBUS 2AIRA 4F84A 2NPOA 4NHOA 5A5FA 1PJQA 3NT4A 1AVTA 2CLIB 2VZ8A 3IBYA 5JTUA 2P4HX 3GXBA 5ALOA 5I51A 1YJBA 3CR3C 3SG0A 3DUFA 1WKBA 3FH0A 5ANRB 1PBNA 2BHLA 2ZJFA 5FI1B 4Y2UA 4TT3A 2Q07A 3RC9A 4H7FA 2FX2A 2PL9A 1QZXA 3WI7A 3IHPA 4I1OA 2GAOA 3VTZA 1BA2A