1I4WA

The crystal structure of the transcription factor sc-mttfb offers intriguing insights into mitochondrial transcription
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
322
Chain Sequence
b'PIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEWPFKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL REPLICATION PROTEIN MTF1
publication title Crystal structure of the transcription factor sc-mtTFB offers insights into mitochondrial transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 108
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i4wA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i4wA01
1RJGA 4PIMA 4QDJA 2V7EA 5E1MA 1X19A 1NW3A 3KR1A 4YUVA 3SM3A 1RI2A 3KQYA 2BR5A 4Z2YA 3SGLA 5EG5A 2CMGA 2PGXA 2PVCA 5DSXA 3AJDA 5T64A 4FS8A 3SVZA 2AOTA 4LG1A 1DL5A 4BP1A 4Y2HA 5BW4A 3GWZA 1JQ3A 3PFHA 1JTFA 2BM9A 1X1AA 5K0LA 2B9EA 2OY0A 1BKYA 3P71T 5DRTA 3UJAA 4ER6A 3LSTA 2AOWA 3UFBA 1ZGAA 2F8LA 1JSZA 4GUAA 1VLMA 1P91A 2JH9A 2EJTA 3GRVA 2OB2A 4FR0A 3RW9A 3IV6A 1KHHA 5FQOA 4P7KA 1F3LA 2E5WA 1ZG3A 4C08A 4YV2A 2XYRA 1VE3A 5KQRA 2ZWVA 2IDJA 4PONA 3EVFA 2JHAA 3BWMA 3BUSA 1U2ZA 1IY9A 3EVAA 3A26A 4FSDA 4RV9A 5E1DA 1NE2A 3R9XB 3TM4A 4E33A 4CKCA 4R8RA 2KW5A 4FT4A 3MTIA 3LCCA 4GOLD 2EG5A 1KYWA 4KDRA 1G8AA 4EQZA 1M6YA 1FP1D 2Z6AA 2YTZA 3NVKI 5EKUA 2ORED 5K0GA 4B17A 2CMHA 3B3GA 3SSOA 3HCAA 5D1NA 3LX6A 1JQDA 3C6MA 4PNEA 4PYKA 2PXXA 3G8AA 1G60A 4PYJA 3PVCA 3CVOA 2JHCA 5IH3A 3ORHA 3HP7A 5DRYA 5DXAA 2PBFA 4E2YA 1O54A 2QYOA 3UZUA 2IGTA 3BKWA 3E7PA 2IDKA 2UYOA 3QOWA 2ZZMA 4BLUA 1VL5A 1NBIA 2B2CA 4PYQA 2PKWA 1R18A 4KW7A 2IIPA 2YXDA 2AOXA 3LKZA 5E2AA 2YVLA 1RJEA 4EK9A 1TW3A 2GB4A 2NXCA 3LHDA 5EMMA 3ER8A 2PWPA 3BWBA 1JR4A 2AN3A 4GC9A 3LPMA 1WY7A 1PJZA 3NWEA 1M0EA 1SUSA 3FTFA 3EGEA 3OE4A 3UJBA 5FA5A 1DCTA 3HCCA 4M36A 4AZVA 3LDFA 4KWCA 3TOSA 3NMUF 4XUDA 2AVDA 4RVFA 4KIGA 4IV8A 4DKJA 4MQ4A 1EIZA 2ONZA 2JJQA 1EG2A 4PWYA 3K6RA 5C1IA 3FUXA 4LECA 5EIWA 5MHTA 3LGAA 2ZZNA 4L7VA 3M4XA 1RJDA 2AS0A 3I9FA 3KPUA 3R3HA 3Q87B 3KQVA 2GPYA 2P7HA 1N7IA 1R8YA 3UJ8A 4YV1A 5DLYA 2GA9A 3FPEA 1JG1A 3T7RA 3ER9A 4QDKA 5DTRA 5DX1A 1SUIA 3PFGA 4PYOA 1KPGA 4F86A 2O05A 3LCUA 1RJFA 1SQFA 5E1BA 8MHTA 1KIAA 1I1NA 3Q7EA 4KDCA 3BWYA 4F85A 3OPNA 3KQWA 4RTRA 5DXJA 4ER0A 1SVUA 5K0FA 1JG2A 3HEMA 5T6BA 3LCVB 3EMBA 2Y1XA 2C7QA 2NP6A 1ZHFA 3BT7A 3FYDA 5HIKA 3H2BA 4CKEA 4DA4A 4RTOA 5C9ZA 1ORIA 1KXZA 3PLAE 3UJ6A 1YFLA 3B3JA 3LBFA 2ZTHA 5BXYA 1FJXA 1WZNA 4IKPA 3ANXA 3F4KA 3HCEA 3GNLA 2YXLA 4E32A 4QTTB 3FTCA 1FP2A 2UYQA 3P2EA 4KVZA 5FULA 3VC1A 1G38A 1XCJA 3DXXA 3G89A 3DMGA 3P2IA 3JWIA 3AXTA 4PGGA 4E2XA 1FBNA 4YMGA 3G5LA 3LKDA 5FA8A 2PX4A 2AR0A 3ME5A 3FUWA 1N2XA 2I9KA 4X41A 2BR3A 2ZFUA 3KR0A 2GH1A 2AOVA 4RVHA 3RODA 3B5IA 3CJTA 2ERCA 3DUWA 4RTQA 3IHTA 1YUBA 2ZBRA 3VYWA 3KPJA 5HFJA 5BW5A 1ORHA 1AF7A 1O9HA 3BGDA 3OU6A 2G1PA 2G72A 1P1BA 3AXSA 3EVCA 2PX5A 2IH4A 1UWVA 2G70A 2O07A 3LECA 3I64A 4EMSA 3TKYA 2N47A 3SX0A 3KKZA 4AZTA 3TPZA 2CKDA 3CCFA 2XVMA 3T7TA 2PWYA 1YZ3A 5DX0A 1MJFA 2EJUA 1NW5A 1ZGJA 2YX1A 4GQBA 3SSMA 4HRAA 3WSTA 3MCZA 4P7GA 4RTPA 2ZZKA 2P8JA 3EGVA 2UZ4A 3I53A 3FUUA 3P9IA 4E70A 4MWZA 1D2GA 4OBXA 5E9QA 5E2BA 4FSXA 3UJDA 4M38A 2Z6QA 4AZSA 2VDWA 4RTNA 1QAQA 4X61A 3M6VA 4ATNA 2C7OA 5K8VA 1EQAA 1NKVA 3CJQA 3MAGA 2VP3A 5GM2A 5LQKA 2ADMA 4GC5A 2FRXA 2P7IA 2AN5A 4FT2A 3KQOA 4EVIA 2OO3A 2OXTA 1VQ1A 5FADA 3O31A 4RTMA 4P7FA 2UYHA 3BGVA 1XCLA 3HCDA 1NBHA 3BXOA 1ZKDA 3MB5A 4MTLA 5DPMA 4R8SA 4YUZA 3A27A 2QM3A 3AWIA 3M6UA 2QE6A 3SSNA 2IH5A 4QQNA 4HSGA 5F2OA 4RYLA 3OCJA 4H0NA 1JG3A 2PLWA 4GOOD 3PX3A 3FZGA 5CIYA 1B42A 4C03A 4DF3A 3D2LA 4K6MA 2XBMA 2BZGA 1SG9A 2WK1A 4U7PB 5DM2A 4RTKA 3TLJA 2PSSA 3GRRA 3NWBA 5K03A 2NXJA 2HR1A 3CC8A 2H00A 4RSRA 5ERGB 3DMHA 3KPVA 3CBGA 1AQJA 4XUEA 4V0RA 5LQCA 1UIRA 3NTVA 3R6TA 3G2OA 2NP7A 1UFKA 5EMKA 4CXMA 2C7RA 5GOZA 2BM8A 4IWNA 2B3TA 2EX4A 4GEKA 3CKKA 1QAMA 2GLUA 2R3SA 3GCZA 3TFWA 3DLIA 5LQAA 3DXZA 5EC8A 5LR6A 2PY6A 3E05A 4QPPA 3FTDA 3KU1A 1BOOA 1Z3CA 5DM1A 4YUYA 5K05A 5KYGA 1O9GA 4RX1A 4QVKA 3G88A 2UYCA 5K0EA 3BGIA 3GGDA 1SKMA 4E2WA 3GIWA 4WXHA 4UOEA 5HOQA 4M7RA 3REOA 4X63A 3EEYA 5EEGA 3R0QA 1X1CA 3HCFA 1JG4A 3PT9A 3EGIA 3AY0A 2HV9A 3UA4A 3X0DA 5IKMA 2P40A 5BP7A 4PYLA 4GBED 4OQDA 3OZTA 5EZSA 5CVEA 5E9JA 2A14A 3GRUA 2HMYB 5EVJA 1JSXA 2OZVA 3MQ2A 3T7SA 2O0LA 3MTEA 1RI1A 3LBYA 3EVEA 4E31A 2IBTA 4PYIA 1XDSA 1F38A 1X1DA 4OBWA 1NW6A 1XDUA 3M33A 3P2KA 3C3PA 4QQKA 1WXWA 4U7TB 5HIMA 3ELYA 4KRGA 3ID6C 3KR2A 5DM4A 4E30A 1OR8A 3OE5A 5HZMA 3JWGA 1Q0TA 2ZLBA 5F2NA 3I5UA 3P9KA 3NJRA 3PS9A 1QAOA 5EIFA 3THSA 3QV2A 4E2ZA 2CWWA 2WA1A 2VDVE 1RI5A 5KQSA 4EKIA 3MERA 1JTEA 5DTMA 2CL5A 3TQSA 4MHTA 2ZWAA 2VS1A 4HGZA 2FPOA 2PXCA 3E23A 1EAMA 1L3CA 3V8VA 5DX8A 4QPNA 4BY9E 2P3LA 5GIOE 2BR4A 3PB3A 4C04A 1MHTA 4R6XA 4KIFA 2AOUA 3EVBA 3U81A 5LQUA 5G02A 3SMQA 3NW9A 4HC4A 3DH0A 2I7CA 2FCAA 2NXEA 5U4XA 4RVGA 3UBTA 3ERCA 5D1HA 1L9KA 1PRYA 5DTQA 3DXYA 3GU3A 3OFKA 3FPFA 4GOMD 2AVNA 5LQNA 4OA5A 1H1DA 4DCGA 5ICEA 5M5BA 2HTEA 3C3YA 3MGGA 4MIKA 4AZWA 1L3IA 4F84A 3BZBA 1XDZA 4RVDA 5EEHA 3KQMA 4NECA 3DR5A 1FPQA 5FTWA 4LWPA 2XVAA 5CVDA 4P58A 3MHTA 4PCAA 3GDHA 3PX2A 9MHTA 1L1EA 4PGHA 5CCBA 1YF3A 5T67A 3P9NA 4DMGA 5EMLA 5ICCA 3G2PA 1INLA 4DCMA 3A7EA 3DTNA 1QZZA 4G56A 3CJRA 5H02A 2O06A 2PX8A 2G71A 4Y30A 3GJYA 2O57A 3G7UA 5K0NA 3HA3A 3BWCA 3DOUA 3MCTA 3A25A 4HG2A 3EEOA 1TPYA 1QANA 4HTFB 5F2KA 4LWOA 5E1OA 5CM2Z 2XYQA 5EHGA 2AN4A 4ER7A 3FUTA 4C4AA 3KR9A 2ZBQA 3QOXA 4HGYA 5DT2A 4EKGA 3O7WA 2OKCA 2P41A 5CCXA 1D2HA 1P1CA 3HVJA 4RWZA 5GM1A 3G2QA 3ELDA 3KHKA 3P97A 4FGZA 1VP9A 5CD1A 1KPHA 3FRIA 3T0IA 2P1DA 5E8RA 3GXOA 3NDJA 3NDIA 4HTFA 2YXEA 3SXJA 1R74A 3FPGA 4CWAA 4V0QA 1YFJA 3S68A 3DULA 4OX9Y 1BC5A 3JWJA 5GINE 1BHJA 3IYLW 3P8ZA 3UJCA 5LQRA 4R05A 3FPJA 2OYRA 1NV8A 5FHQA 5E8JA 4IV0A 4CTKA 2IP2A 3NVMB 4M37A 4PYNA 2HWKA 3KQSA 3G2MA 4JXJA 3M70A 1N7JA 2ZIFA 3OFJA 4POOA 1G6Q1 5EGSA 4ER5A 3V97A 5FWDA 5EZQA 2JH8A 4BP3A 1QYRA 1HMYA 2GS9A 2B25A 2ZIEA 2HNKA 3FPHA 2NNWB 3EVGA 3HVKA 5DSTA 5EHIA 3TKAA 5FCDA 3KQTA 3KQPA 1HNNA 3EVDA 1R00A 2PT9A 2ZBPA 1KYZA 4BLWA 2Y1WA 3TRKA 4QVGA 2FYTA 3M6WA 5HIIA 4X60A 1AV6A 1D2CA 3DMFA 4PIPA 1XTPA 1P39A 2PXAA 1KPIA 2ZSUA 3HVHA 3GO4A 4PCLA 3KPWA 3LDGA 3LL7A 4YUWA 1AQIA 4GOND 2XYVA 3UA3A 2DULA 4RTSA 2R6ZA 3B89A 3FUVA 3P9CA 3K0BA 3FYCA 5EMJA 3TR6A 4CTJA 3BKXA 3PTAA 3IEIA 5FUBA 5FHRA 1R8XA 3SR4A 3TMAA 3HM2A 3UJ9A 2PT6A 3EMDA 4PYMA 3L8DA 4XCXA 4YUXA 4RTJA 2VZ9A 2WA2A 3KPYA 1SQGA 3HNRA 5EOVA 4BLVA 5ICFA 2PX2A 1I4WA 4CKBA 2AZTA 1XXLA 3THRA 1R6AA 4C07A 3GRYA 1EJ0A 4FP9A 4P7JA 5FWAA 5EQJB 1TW2A 3HA7A 2IFTA 4ZTBA 3RIEA 5GIPE 3DLCA 3HTXA 3EVZA 2EFJA 1NW7A 2ESRA 2P3OA 2JHPA 2V74B 3C6KA 5E9WA 5KS2A 2AOUB 3A7DA 5KVAA 5LSAA 10MHA 2ZULA 2IPXA 2OB1A 3HCBA 5CVVA 2ZVJA 1T43A 5K0BA 4OA8A 1XVAA 3M6XA 3JWHA 2ZCJA 4DZRA 5GP1A 2JG3A 4C05A 3E8SA 2P3QA 3DP7A 3FRHA 3HA5A 1I9GA 3ELUA 2YQZA 1M6EX 2K4MA 5HILA 1V39A 4ER3A 5EKXA 3G5TA 5DM0A 5ICGA 4OQEA 2Q41A 3I58A 3ELWA 3FTEA 1X1BA 5CVJA 2ZW9A 1NV9A 5FQNA 1WXXA 1VBFA 2P35A 4AUKA 5DWQA 1KP9A 2IBSA 5K01A 2I6GA 4FZVA 4O29A 1IM8A 2H11A 3KQQA 2VDUE 3OZRA 5GWXA 2OPBA 3LDUA 5P8WA 1L3BA 5LQJA 2PV0A 2YUIA 4ISCA 3UWPA 4X1OA 5K0CA 5K09A 1G8SA 2G8NA 4HH4A 4YV0A 1Y8CA 3B7PA 1Q0SA 3OZSA 5JR3A 1RI4A 2ONYA 4QTUB 5EPEA 1KR5A 3CGGA 4XUCA 3C0KA 4GF5A 2FHPA 1NT2A 2QRVB 4DM3A 3VC2A 3OU2A 7MHTA 1RI3A 2C7PA 1VIDA 3G8BA 2H1RA 4RTLA 1WG8A 3O4FA 3VSEA 4DQ0A 2IH2A 3GRZA 5C0OE 2B78A 1WS6A 4WVLA 2DPMA 1YZHA 5CUQA 4PINA 1VP3A 3A4TA 2FK7A 3TM5A 1NW8A 5HEKA 2PJDA 4AX8A 2I62A 4A6EA 3B3FA 3EPPA 2QRVA 4YMHA 5B1SA 2BH2A 2Z6UA 2ZIGA 1YB2A 2QY6A 3UJ7A 2GAFA 1JQEA 5CVUA 1XJ5A 2YR0A 1ZQ9A 1VPTA 2FK8A 2OBFA 3OU7A 5JUWA 2LD4A 3HVIA 2AOTB 5HIJA 5K0JA 1DUSA 1EJ6A 3R24A 2NXNA 1IXKA 4R6WA 1G55A 4C06A 4A6DA 2NYUA
chains in the Genus database with same CATH superfamily
3HX3A 3R5KA 3IE1A 1YZGA 4PFKA 2FS1A 4CL8A 4NNJA 4P16A 1FYDA 1D1SA 1XLTA 2E5WA 2VDKB 1UJ5A 3ETGA 2YV1A 3QEOA 2PU5A 1T35A 3A6PC 3LRXA 3FMFA 2XUIA 3B3QA 3IJEB 1O0CA 1W93A 3AERA 4GI2A 5JYBA 4E2YA 4YCCA 3R0IA 4NY1A 5NLLA 3HNOA 2R79A 2D00A 3ZWCA 2UUBM 4UM7A 1F7UA 3AESA 1GDTA 3SF8B 2X7XA 2UZ1B 1G4AE 4KFCA 4JV5B 2Z8XA 3U4GA 1BSVA 4D4HA 1II8B 3HWSA 1A95A 2VPIA 1PZFA 5TV2A 3QWAA 5LOVF 3B78A 2O05A 2Z5FA 4LZJA 4C0AC 2ZJ5A 4BZXA 1SU8A 2YFKA 3WGLA 2JI8A 1K3TA 5BXYA 1FJXA 5KDOA 4KVZA 2Q9BA 2O0MA 5DHSA 3HPRA 5F98A 3HZRA 4XPIA 2RE8A 2P5YA 5HFJA 4CGYB 2XUQA 1Q0PA 5HQTA 1E2IA 2J9RA 3SX0A 1SEPA 2VBCA 3T7TA 3CW8X 4FILA 5KNBD 1SZPA 3IT1A 2QTNA 3HN2A 5AO9A 4UMDA 2DUMA 1NMEA 1ABEA 4MTLA 3B7NA 2ZJ2A 4WNYA 2RK6A 1EAYA 3E9EA 3PE3A 4OJTA 2NUTA 4RE5A 1L7AA 4BMDA 4MGYR 3TLEA 3DNPA 2H4YA 4BQIA 4YRGA 4QREA 2E4YA 1N2CB 3ZGXA 2HEIA 4FNAA 3KU1A 4DOMA 4UFOA 1YB5A 5KDLA 3DDZX 4AC9A 3EUAA 4REQA 4HEA1 4L8WB 2DWMA 3NPAA 4K9PA 1U98A 4O1MA 4GFDA 2EWMA 3KAQA 4IOJA 3LYLA 2LXEA 4JYCA 5JYCA 2WA1A 5DW0A 3LQFA 2X9NA 1M6VB 4XCQA 1ZR4A 4WL0A 4FCTA 1YQQA 4K2AA 1TA4A 3GJ6A 4V0NA 3X2FA 1XDZA 3COVA 3PX2A 5DEIA 3S4YA 5EMLA 3G2PA 5G2OA 4BJ1A 3KEFA 3A7EA 3OKCA 4B0OA 3BWCA 2IYRA 1QO7A 2ET6A 1TLLA 4WXEA 5EWJB 3FPLA 3LV8A 1DOZA 2BTOA 4OOFA 1FFHA 1XP8A 3B1KA 4G89A 1L5GB 4ARZB 5LBIA 3CSDA 1Z45A 4P32A 4PXSA 2ZUCA 2D2IA 3GFBA 3AUYA 4CDNA 4D8WA 1GSOA 3RC8A 1YQGA 3EOAI 4LQ4A 3MS4A 4NBLA 4WJZA 4OX9B 3I6BA 1K27A 4LHYA 1NAIA 3WNDA 5DLDA 3KLPX 2BZ0A 3KAJA 5BMVF 3PQDA 4KQFA 4N5LA 1B26A 2CVZA 1XEXA 5JIBA 2ZI6A 5IT5A 1EDEA 2P2CA 1H4SA 1A9XB 1C9KA 1N6OA 1LBIA 3ANMA 2CZGA 2PGNA 3O94A 4JEUA 4NBUA 2IV2X 4JBHA 3C3JA 4HNTA 4M9UA 3HK2A 3O8QA 4KOAA 3E5HA 3ABQB 1SB8A 3I0NA 4M0PA 1TM7E 2WQ6A 4URZR 1BVUA 3JAKB 1P77A 3NHMA 3IP5A 5FTNA 2OWDA 3HBAA 4KHPM 3O0TA 4FQ7A 5H81A 2JLBA 4EPXA 4P4SB 3F5QA 4FEYA 4KE8A 4MGIR 3QUTA 4NENB 2XEXA 1JQAA 1BJKA 2X7HA 2EX1A 2EHJA 1W6RA 5L4LA 3VDQA 3GARA 4EYEA 5FPYA 3VI3B 1QGOA 3JASA 2BOVA 3DKVA 2FZ5A 4G09A 1GA1A 4ZAYA 4TUYB 5BYAA 5EIXA 1JFTA 5LXTB 5KOHB 4I8XA 2QDXA 3I39X 1OCEA 1TB4A 4J91A 4Q1FA 1M10A 4QYIA 4D9BA 2C2GA 2VRNA 4BO3A 3TFQA 4QQFA 3JAMS 4LPKA 1XNJA 1ZL2A 3LQ4A 1L5HB 4P3YA 2J9GA 5I47A 1A5AB 2W6PA 1S6YA 2HWXA 2PMCA 1W36D 1VI2A 1OXUA 5AI9A 3GY0A 2H7YA 3C5WP 1PFVA 5EJGA 1IK6A 1HL7A 1XJCA 1PUIA 1E89A 1E7QA 1C5KA 1XL1A 1ZD4A 4W5RA 4HQ0A 4J4BA 3DYVA 3WL4A 3MZ0A 3RHZA 2I33A 3SS9X 4EG0A 1V34A 2WPNA 3I6QA 1IXRC 3V8RA 1TNDA 2P3SA 3TQQA 5COBA 1O9HA 3L7DA 4OQQA 1VJDA 4BNHA 4DLWA 2PUGA 2OCYC 1I10A 5BMOA 1V1MB 2HBYA 3CZAA 3H2ZA 2CDBA 2ZB3A 2CC2A 1MC4A 3HUDA 3THGA 3ACCA 1HDGO 3SAJA 2BGLA 4I19A 1SZJG 2XWQA 1LNQA 4B32A 1C8BA 1XDWA 2J5YA 2J6CA 1TGYA 3K16A 2TS1A 4CG0A 4YJHA 2VNSA 1D4FA 2V9CA 3BFXA 4KGVA 5CJPA 1UIRA 5M29A 1HJPA 3BXFA 4B8ZA 4UPVA 2GNOA 4GPZA 2XF8A 4JUIA 4KGDA 3IT2A 4XAQA 5J9FA 1S2IA 2VHZA 1DHRA 1L4YA 3GMIA 2EZ8A 3NQ41 3FHTA 3GRUA 2P79A 3FKSA 3W9UA 1G42A 1M0WA 1BCRB 3IIKA 5ITYA 4HNRA 1RRMA 4D0NA 2WM2A 3Q2IA 2X6QA 1DI0A 2ECKA 4TMWA 2FWPA 3AV0B 3PXXA 2OAEA 2Z2XA 3OZAA 3RABA 2W2XA 1JWAB 4XB6B 2MINA 4YXWA 2GVNA 4AMGA 1JMKC 3QI7A 2XCUA 2C1XA 1I2AA 2O7NA 4G1CA 3I9OA 3NXKA 2FW9A 1ZD9A 3EW7A 2W98A 3IBTA 4AG5A 4MIOA 1OJLA 5CVCA 2YJ3A 4W5TA 2NGRA 4X95A 2OGZA 1OGYA 4EUNA 1HA3A 2X14A 3ZDYB 1YDHA 3WLMA 3B85A 5F4ZA 1CZLA 2C07A 1BHJA 2I29A 4ZDIA 4Q1CA 5TY0A 4XR4A 2IA5A 3SYNA 1XQVA 5C1OA 4XGNA 2I22A 2EF0A 3SQOA 1NAHA 4B85A 4X1IA 2MYTA 2RI0A 5LIPA 4JFRA 1M83A 3QE3A 5CT4A 4DCJA 5DE3A 2VRWA 2JGRA 4AK9A 4MVJF 4LJKA 4ZHQA 1U7XA 4X97A 2Y0EA 5BSKA 3BB3A 3W5BA 1U9CA 1C1HA 1WSDA 4X6YA 3MBIA 3PK0A 2LVPC 3OPXA 3G82C 4R2LA 1V39A 2BI4A 3KDAA 1DU4A 4HFRA 1G21B 3GEMA 2DQSA 1R6VA 3DVLA 4FFMA 1Q0LA 3QHPA 4U9IS 1PJAA 4PQFA 4Q3EA 1BVHA 2OBBA 2FN4A 2FK7A 3P4XA 1FNMA 2QT1A 3GOHA 5ADUS 1LSUA 4HUTA 2Q1WA 1Y9DA 4GDFA 1JP7A 3HJRA 3T99A 3H4MA 3PYLA 4F85A 3PC3A 3D6MA 3I2JA 3D6NB 1FFSA 2AZ4A 2KE5A 5CM9C 3WXBA 2JA1A 3G49A 2CLHB 2V1CA 1PM5A 3I6ZA 4DR3M 2JY7A 2QYOA 3G59A 4ZRDA 2BKUA 5LYJF 1OUMA 4KW7A 4D4LA 1HEIA 5AKXA 3RWBA 3Q3HA 4TWBA 3LPMA 3U49A 1MVLA 2BBSA 2R1ZA 1PNTA 4D8VA 3LDFA 3KUCA 4O8ZA 2IC5A 3HV2A 1Y1SA 3K8OE 4Z7NB 4H3SA 1R64A 3UJ8A 1VE9A 3BC1A 3AY6A 3BWYA 3C8HA 5AW7A 3HEMA 2PT7A 3G2JA 1AC5A 5GV8A 1ZUNB 1ESDA 7GPBA 5AP9A 2N35A 2EUCA 1FNSA 3MJTA 2XODA 1VSBA 1K0FA 3GPCA 2DPXA 3ACBA 3IC5A 3QBVA 3KTAA 2Q9AA 3P27A 3OUTA 1A8QA 5JAHA 2WJGA 3F4BA 1LRJA 3GEDA 2W4IA 4Y0AA 4AZTA 4WEQA 1OFVA 1KI2A 2QUKA 3GRFA 4MR9B 1XPJA 1A9OA 4QQ8A 1YULA 4JMLA 1VHQA 3MT0A 1RWVA 1OQYA 1P45A 2VOJA 1Z2AA 4FPXA 3D8LA 3R5TA 1QU3A 3ZVRA 4WFQA 4Q4CA 1XZPA 1PWXA 5B58T 3KPVA 3ZXIA 2CB9A 2YN2A 3KSXA 1TX4B 4D0LB 5HCIA 5EC8A 1XDDA 3ZXYA 4B33A 3S81A 4Z1MA 2ZTMA 3K0AA 4I9NA 5G0UA 5KYKA 1MVNA 1PL7A 1H8HD 1OD6A 3JYHA 3QKWA 3V1KA 3PQFA 2CFCA 1JYFA 3TIGA 3H5LA 5H4GA 2GOYA 6PFKA 4N5MA 4B3RM 4G0YA 1Y89A 2PPVA 5F3RA 1QQ7A 2ZWAA 4XW2A 2VJCA 2XF3A 3OX3A 1AUQA 1HYQA 1M2NA 3AVQA 1GM5A 2QQ0A 3AJAA 3DFZA 3ZDAA 1SUBA 1P3QQ 4ALLA 4GQAA 2CLMB 3GNQA 3MSCA 4G4GA 1S3FA 4GI7A 1DV1A 1VRCA 1YRYE 2OE2A 3ZHBA 4ZVRA 1OREA 1AXEA 4Y2QA 3ZHRA 3NDIA 4K0RA 3V00A 4B3BA 4J1NA 5KNCH 3AYXB 2GFHA 5IWAM 2C3OA 2HWYA 4A15A 2ZUWA 4ARUA 2R8PA 1PJCA 4N7RA 1M2OB 2GCOA 1K8ZB 2Q21A 5GZ6A 4H7IA 3UIEA 5DLEA 3RC1A 3GLHE 3UA3A 1F2VA 3G9UA 1TF0B 3W8DA 3D0OA 4J7XA 2AFHE 3INGA 4LK3A 1LCIA 1W49A 4WWHA 5DNYB 1RQPA 1AS2A 4NP6A 3C3WA 1OWOA 3AW8A 3TKLA 1AZLA 1BWPA 1GGVA 1G8SA 3CNOA 3CRMA 1UPUA 3MWYW 2N75A 2ZWPA 4LJYA 1XRLA 1Q2XA 4B8YA 5AKYA 2QLMA 2DX7A 3IUEA 2FPPA 4EX6A 3VSEA 4Z4FA 4C7JA 1PYDA 3OBBA 5AKIA 2JY6B 3T1OA 2GN1A 2CXNA 3HDYA 2P65A 2BAGA 4ZEOA 4G1FA 2CZQA 4CV1A 4FWHA 4HYTA 2CK3D 2NTEA 3DM5A 4QDJA 2AX4A 1Z18A 3RM3A 1I94M 1X87A 5BUCA 1R16A 5JH7F 1KMQA 1ZGBA 4PZEA 2XMRA 1VBNA 4RH3A 2O3UA 1EFTA 4NCNA 2DWPA 1R8SA 3S7ZA 5L3QA 3ET5A 4Y1RB 2RB4A 3T34A 4EYKA 3QMPA 3GX1A 2I0FA 3U0VA 4IF4A 2IGTA 4CMEA 2AWOA 4TKVA 1MOSA 4KPUB 2RBEA 3M6AA 5EIBD 5HTKA 3M0EA 1C50A 5F7OA 5KAMA 3DBRB 2YUTA 1G17A 2BCJQ 3FLMA 1EG2A 3MD0A 3M5DA 2HU2A 4N12A 3M4XA 1I2MA 1W8IA 4XOUA 2ZRCA 1X9HA 1QUFA 2NVOA 3C6ZA 1HG1A 5JAPA 4CCYA 2FP4B 4RD6A 1L4EA 2HHLA 3B52X 2OZLB 4WEOA 3UJ6A 2H17A 1E2EA 1G38A 3X1KA 2RKWA 1G5PA 1GNLA 2Q99A 2Q3CA 1KK1A 4OI0A 2W70A 4O4IB 3ROGA 3CJTA 1KFEB 1U2RA 3Q8XA 3L4EA 4EMSA 4RPHA 1XR3A 1B8UA 1E3JA 1IZ0A 3THWA 3OM0A 1RHQA 2AYXA 5K8UA 4RNDB 3TE7A 3DLBA 3F92A 4ETIA 4UTOA 1OIVA 4HP8A 4ZAWA 4ENQA 4D6YA 4DLKA 1XGKA 1SQSA 1I51A 4LC0A 3W4JA 2Z9CA 4QUEA 2JJ2A 4XA8A 4GR9A 3NGXA 1E2BA 4P8RA 1NJ2A 1CR1A 1JW9B 3BGVA 2MSCB 4GP6A 4CW7A 3AHCA 4MRSA 1IPHA 4Z4GA 5GOTA 3WGJA 2AL7A 3TLJA 2P1RA 2ZXEA 1X86B 3HU3A 4DUZB 4C0KA 1KZYC 2QMZA 2GK4A 1Q1ZA 4R9SA 1JHQA 1QP0A 1T0BA 1A1VA 1X7DA 2W6QA 4OATA 1VJRA 1VMAA 1XQYA 1Z06A 4D98A 1T2VA 5EZSA 2XWJI 3T7SA 2GRUA 1K82A 3UC5A 5CNIA 3HUEA 5C35A 5F2NA 3SC2A 3P2MA 1JJFA 4YACA 1L5VA 3QYPA 2GSDA 2Q2OA 4E46A 4MHTA 4LG2A 2GPJA 4GVPA 5BQFA 1MHPA 2VYQA 2QHXA 4P2GA 1CNMA 1M5UA 4BQPA 4GKBA 2H7CA 1DNPA 4L8LA 3U4IA 5IULC 1RXIA 3TL4X 2BEWA 2H9IA 1TYAE 1Z8DA 3CNLA 3OLCX 1V9LA 1E0AA 4UVGA 3M1LA 1Z0FA 3JR3A 5F21A 1DEKA 1EGMB 1WDTA 5EUCA 3TB4A 4G0MA 1JLRA 3W5UA 1X0XA 2ZRDA 1U3UA 4XYLA 5JRZA 2VYVD 4LF7B 3TQRA 1ND5A 1WUIS 4R8VA 2CL7X 4J07A 4CT4B 5JNVA 3DA1A 4JLJA 3HL0A 3NBKA 5LQMA 4CIZA 5JNLA 4IDPA 3HCOA 3PNMA 3A42A 3ZKWB 4IDCA 2YWRA 6REQA 4ENRA 3TRHA 1J70A 1J1IA 4N5HX 1K66A 2MJ5B 4ALNA 1U9IC 4WOJA 4NCXA 2NAPA 1YVDA 5DBHX 3BB4A 5D84A 2DVMA 1HDYA 2FZWA 1EP2B 2H31A 3D81A 3TB6A 1TF2A 3RSHA 4PV7A 2FSUA 4DMCA 4E03A 3ANTA 4U0JA 3C8DA 5HBGA 4DCOA 5MN4A 1ZC3A 1XKLA 4UBMA 2V74B 4TYPA 4YRTA 4QEZA 3FHOA 3HZJA 5IVPA 5KPTA 2XKAA 1DQSA 3RJMA 3BERA 2PZKA 5GWXA 2W4MA 2ISCA 1ZWLA 3IJPA 3VHRA 1R6BX 4P33A 5JADA 2PANA 3A1NA 1GKKA 3JYLA 1W4RA 1NVGA 3GRZA 2ZBDA 4RM2A 3OIFA 3LUCA 1KDYA 1A4RA 4ND6A 1WDKA 1XPOA 4C1BA 1YZLA 2EXXA 3P9YA 3QY9A 5YASA 4C06A 3UENA 4EAAA 3I0MA 5AM5A 2DPHA 5B36A 1YK0A 4AIIA 2WD7B 1VKOA 4EHHA 1E61A 5B2EA 2W2LA 5A2QS 5FLYA 4KR6A 2HWUA 3KAKA 3JQAD 3G23A 4GM1A 1LBSA 1DPFA 3R8FA 3EVAA 1OA0A 4MRVA 3I5YA 1NE2A 2IHBA 1N2CE 1BNCA 2M1XA 3Q7PA 5MFPA 2R4EA 2F5OA 2FW7A 1IHPA 4XK8F 2OAP1 1DS6A 3QOWA 3SMPA 5BNZA 4RZ3A 4D1YA 2V7GA 1NQ5A 2XJ4A 2GB4A 5IDXA 4FFRA 2C2ZA 3LVBA 3T41A 2V65A 1W2WB 2QN6A 5KNCA 1F2UB 1GSAA 4N49A 3NHLA 4W5OA 1RRFA 3UOGA 3VFDA 3W2FA 1QHHA 1MR3F 2R7AA 4GPD1 3NJ4A 1NQTA 4MP6A 2P4EA 2X8BA 5LP6B 4OQFA 4C4XA 4MW5A 1J5XA 2GEJA 3F5MA 4ZCPA 3AUFA 5G1NA 4LKOA 2JC3A 2JIMA 5KYTA 2H3EA 1L4GA 1W75A 4RTQA 2BGIA 3T6KA 1O0SA 3EEIA 3UB4A 2IX3A 2JFYA 2VRBA 4PZUA 4GX5A 1VXRA 3FDJA 5KVSA 1RRPA 1Z5UA 3VDUA 4RTPA 3VZDA 2GKGA 3B6KA 3I6YA 2PZ8A 1NN1A 3D6TB 2QD2A 4WKBA 1DXYA 3L8FA 2QW8A 4AJ9A 2ZJYA 1G41A 3A27A 4Q9DA 1SIOA 2ZUDA 2PSSA 4XTCS 4PHHA 4P80A 3V33A 4V0RA 4BNDB 3BSSA 2DAPA 4OXNA 3EIUA 4Z9XA 4PZDA 1SXJA 4HDNA 1FP6A 2XOEA 4ACBA 2FW0A 5EWMB 2F1KA 1XFAA 2P5SA 1CU1A 1E9AA 1IBMM 3C3KA 2OUKA 4M60A 4A5SA 1PV1A 3R20A 3QBDA 4QHTA 1NXPA 3VO9A 3PCTA 5E3HA 4B4VA 4IMPA 2DFNA 5D3MB 4YAEA 3IAM6 3L84A 4CUJA 1A8HA 4OI4A 2J7PD 2AQIA 1T1SA 5KSYA 3RV3A 3L7AA 3KT0A 3WK4A 3TAHA 4CGZA 1TQ8A 5TLSA 2V6ZM 5LQDA 1CERA 4UHFA 2PEYA 1Q0RA 3DTNA 1FFYA 5F5NA 1PAUA 1QDRA 4S3MA 3EEOA 2HCFA 3RVKA 3P5BA 4MJ7A 4I50B 4TLDA 3TZCA 1EVKA 4QOSA 3D7NA 4G26A 3RF6A 1AB5A 1XNGA 2ASEA 4MWDA 2LW7A 2CE2X 3TLGB 2OYSA 3OJCA 4BP3A 1HMYA 4FDUA 2HNKA 1IHDA 2NNWB 3HVKA 3N1UA 3OEYA 2CW5A 4YRJA 3RS7A 3FRJA 3IUJA 3UNXA 1SRQA 3ROXA 3RSOA 1U1GA 3GYGA 5F7ZA 3F78A 4G1EB 3OP4A 5G4LA 5KQGA 3TGPA 4HFJA 4WKOA 1OB2A 4CMCA 3WKDA 2P62A 2KRUA 2W93A 1XYVA 1DEOA 2OB1A 5HDBB 5FPPA 2VTBA 4ZOLF 4R1QA 1A98A 4TSFD 3WRXC 2GN0A 1W9HA 1EWVA 4YP7A 1XZLA 4A2WA 3A1SA 4MW6A 4HTAA 4K1XA 1PJTA 1T34A 1NDHA 1DKUA 2DQYA 1RRKA 2HQBA 2WOOA 5EKTA 5JOQA 2J7KA 3IE0A 4LXTA 1NMSA 1I30A 2B78A 1WKCA 1OLXA 5JZOA 1GPKA 1DC5A 1MW9X 5LZ7A 2WHQA 4YFVA 3UUEA 1FJGB 4ZAFA 1ZCZA 2O52A 4TXLA 1M1YA 3VKFA 4IGIA 4Q3LA 4MQ6A 1NUAA 4NDZA 3HGTA 2YY6A 1CS0A 2IOYA 2EW1A 4BLPA 4WW0A 3V32A 2PWAA 4FCWA 1B43A 4WJLA 1U28C 4LSGA 5JCJD 3H3JA 4JK3A 2H1IA 4WLEA 1AU9A 3SSOA 2RK3A 5JPIA 1ZITA 3LQ2A 3A4NA 5IMSA 2QNJA 4UBOA 2MSLA 4I8OA 3TW6A 3MUEA 1DIAA 1HRKA 2YJGA 4OGLA 4U3JA 2XWPA 4IV8A 4EHLA 1L7EA 1O96B 3G7SA 1KMHA 2J4CA 1HFJA 1ZVMA 2QX4A 1UDAA 1UDRA 1WUHS 1T6OA 2WFMA 3Q9LA 2RH5A 1SU7A 3OZ7A 4BCDA 3DBIA 3P2IA 3A6HA 4NBRA 2C8VA 4X41A 3KR0A 2F5NA 4IIJF 2JATA 1J0XO 3UGKA 4GKAA 4FOLA 4G4NA 2V4UA 5JYEA 1MRSA 3MOIA 5HVNA 4AUNA 1ZK4A 4MWZA 2ODEA 4PWZA 1O57A 4IHJF 4R2KA 5AW5A 1EH5A 5JBIA 2YY7A 3MAGA 5FWNA 4JWKA 4ZFNA 4XSGA 3W5CA 4DXAA 4DUYB 1JKJA 4NJOA 1YHYA 3LQ1A 3VAZA 3ESZA 2R00C 2F1JA 3AJIB 1A96A 5H8WA 1GQQA 3FTNA 3RFCA 5TDHA 3F6YA 2WAOA 3ZJUA 4XDGA 1RYMA 2PUVA 1A88A 3IVRA 1Y4UA 4NE2A 5HZMA 1G21E 4Y9SA 2I4MA 1DFIA 4YBZA 3W2IA 3U6BA 3E7FA 1NU6A 3VZRA 4NATA 2PXCA 2VQ3A 3UATA 3ZQ4A 4C4RA 1WAMA 2OZPA 4FHCA 4X66B 4DC9A 2QZ4A 1KL7A 3GCWA 3OLWA 3N8HA 1A8PA 3UQZA 2PZEA 1FS4A 5BSFA 4X64M 3R7SA 2H1LA 1R5JA 3TGWA 2PRZA 2Z8YM 3GZJA 5FKJA 4MUHA 3MCTA 5ABPA 1ULTA 5CM2Z 3BILA 3O2SB 1N5IA 3C6YA 2QTVA 5E7MA 4F9GA 3QEMB 2WY2D 3O1LA 3OX1A 1X7YA 1OLOA 3D0QA 5K2MA 3W2GA 1E1RD 4A0QA 4CEJB 2QRZA 2XNDD 3U16A 4I8DA 4KXVA 3PDIB 5CLHA 4OP3A 3PDUA 1JR3A 3W5IA 3NIWA 4RLFA 3JV7A 1VL8A 4M55A 4Y1EA 2UXBM 2FMUA 2R7MA 3V6LA 1TC2A 4RK1A 5LLSA 3T4EA 3LWNA 4F3YA 2EGUA 4ZAZA 4PBTA 3FYCA 4H18A 5K8LA 2VDNB 1R0BA 1JS1X 3QGMA 3ZCVA 5AUNB 4O2RA 4RNCA 2BLLA 3IOYA 3GEEA 4RLQA 3GLHB 3RIEA 1BXGB 3OTOB 5CA1B 4BHTA 2TMDA 2CYBA 3HV0A 3BCUA 5KWJA 4MS1B 4JYAM 1N8NA 2PH5A 5F3DA 2R6FA 3FTEA 3MCVA 4C14A 2AYYA 2R96A 4DV1M 1IM8A 1I6LA 4E07A 3WGMA 2YYZA 4GL2A 1ZD3A 1D5CA 1SD5A 3EFBA 2I78A 1DGHB 3EIQA 3KKEA 5FNVB 3DTVB 1KEEB 3VTZA 4DDKA 4H60A 2PD3A 3FI0A 2AR7A 2NO7A 2J85A 2XGMA 3G7NA 1NVAA 3ZZ1A 4CJXA 4R2WA 5AM1A 4D92A 4LCJA 2QF7A 3F1LA 4HYEA 5K3DA 1M8FA 4IEFB 3K0KA 1DKOA 4ZREA 2XJ9A 4KZPA 5ALIA 3CWCA 4M7WA 2ZRAA 5G0VA 1H1LB 4I5SA 4BFZA 2AMLA 3RWMB 4K26A 5IJ0B 5IT4A 5IW8A 3C8ZA 2PUTA 1A72A 2PHZA 4YB8A 3L8CA 4CKCA 3PWTA 4P22A 4JJZA 3FWZA 1H05A 2Y93A 3CZPA 4CT5A 3WK9A 2IOFK 1RAHA 4H7KA 4ZC1A 5KYWB 4CEHA 7ADHA 4K86A 4DDMA 2BKLA 3TNFA 1D8TA 1RHJA 1K9SA 2MYNA 4XWYA 1XZBA 1MA0A 2AZMA 2P9YA 3GGGA 2PLFA 3D9QX 2FN8A 3DCYA 1HSOA 3Q3EA 4QDUA 4XM0A 1Y3IA 4ZOEA 3UK1A 1K5DA 5K0FA 3LX4A 4OLFA 2D2XA 2B8NA 4HB0A 2X9QA 3QPBA 2HSJA 4D45A 3AVXA 1TDJA 4OYLA 4D0RA 5HKKD 2XGJA 2WQ7A 1Y42X 1BD3A 1N2XA 1Q91A 3WGVA 4FGUA 1MX5A 2HK8A 2ZE6A 4NDAA 1ITZA 5BWBA 3ILHA 2VDWB 1Z0JA 4C1NA 1NW5A 3OOJA 5CT5A 3EC2A 5LA6A 3A28A 1HETA 5LWQA 3IDFA 4CFSA 3PVSA 2L82A 4ZVQA 2C9YA 4UZEA 4FS3A 4FT2A 4G1MB 3EIWA 2FLWA 3HFGA 4ND3A 3W05A 5TGZA 4YCDA 1LTQA 3G9ZA 4Q3NA 2ZRPA 4DR5M 3QQPA 4DMHA 5KTYA 2PRSA 4AJEA 3U6KA 2W2OA 2O5CA 5IVIA 4G5FA 3QNUA 2HT1A 1JAYA 1QO0A 2WDPA 1Y8RB 4AIRA 1DC3A 3P52A 1XTZA 4IIFA 1CUFA 4KIUA 1UCFA 4E31A 4TYYA 1KKUA 1P7YA 3JY6A 4PPFA 5A4AA 2Z6VA 3TG2A 3N86A 2OGSA 4WN3A 4TQGA 3W6ZA 5EXEA 1ZGHA 4AG6A 5I7FA 5E26A 4EJSC 2ZRFA 3SZRA 4HQRA 3FHLA 5SICE 4FFSA 4B3IA 2J9XB 4RVSA 3ZIAD 4XM2A 1DQNA 1OT3A 3ZW7A 4OLHA 5LC1A 2EAUA 2O5VA 3L0OA 1P4AA 5CXUA 3EF0A 3GJYA 2VYNA 4DADA 5JD4A 3WP0A 4JI8M 4TSRA 4N3CA 2XQJA 3PF9A 4PZCA 5EE1A 4RVUA 4EUFA 1WP9A 1LVGA 3VSBA 3X3HA 3ZCPA 1GTVA 5JJLA 3L0SA 1NY6A 3VR3D 3KQUA 2ILTA 2VP0A 1HYBA 5EZYA 3PDCA 2O1WA 2X9GA 5AWFC 4OAOA 3QVJA 5EP4A 4ZU3A 1BS9A 3D6FA 2OFWA 4QRHA 4HEA6 5JJCA 5BSTA 1GQYA 2HF7A 3V4FA 4UEKA 4AJJA 2RK4A 3IT0A 2MTBA 3EB9A 1Q83A 3J7TA 3P94A 4DQVA 1MXFA 5LYYA 2XNHA 5K0BA 1E4EB 3DPIA 3QSGA 4DHEA 1I9GA 3B7QA 2QJFA 2Q3FA 4F4JA 2I6GA 3N59A 1WM1A 3AR6A 4PRZA 1RHKA 3UCXA 2XMSA 4XWWA 3TD9A 4PYRA 1XALA 3TLCA 3RREA 4MUXA 4MCIA 1NZFA 4DDUA 2QX9A 5DCUA 4AO6A 1QP7A 4YRNA 1L2TA 4NMXB 3TW4A 1NBME 3VC3A 3G17A 3NGLA 3OOWA 1XAJA 4JEHA 4JLSA 3QLUC 4CUZA 1Y8AA 1ZVJA 4FBGA 4IKOA 4CF3A 3DAYA 2R84A 1ZOPA 5JMTA 5AKHA 2ANBA 4YALA 2QUHA 3NG1A 1UC9A 1HDIA 1C81A 1O89A 1USWA 4FINA 2J4DA 2QN9A 4CM5A 2NXCA 3O3MB 4L85A 4JA0A 3TUIC 2O8CB 5MDHA 3NASA 2JCGA 3IR7A 2AVDA 1W85B 4L3WA 2ONZA 4TUYF 2QD1A 1ELOA 2DEUA 2HSWA 5FIUA 3E5RA 5JWHA 2XGGA 1T0JB 1KPGA 2BMEA 3KSRA 2XUKA 1Y1PA 3QM1A 1LLFA 4OJNA 1LTHR 3PENA 4S0ZA 4E32A 2QPAA 1M2HA 3FWPA 2VFAA 2C2KA 3K9PA 3ZU6A 2MDTA 1YUMA 2FQWA 2HDNB 3PNKA 4RS4A 1J2RA 1O5TA 3U7HB 2IYVA 4Z4QA 1XTBA 4YUAA 3FNEA 3T3OA 3NTRA 5EQFA 2O1EA 1KTVA 1CQIA 3T9FA 1KYTA 3PNVA 2WM3A 2H5XA 3IP1A 1KOGA 4OBXA 1T8PA 3OLXA 4ZVKA 1W19A 3AHIA 5EE5B 5ALPA 4FX2A 1C3EA 1SB9A 2RGXA 4BIIA 3AEUA 3RD5A 4M1MA 3ETNA 2W0MA 4BV9A 2IV3A 1TAHA 2DBZA 4ZYUA 4BJ6A 1LVUA 1J00A 3ZWPA 2OOBA 5JANA 3TI7A 3R6TA 3UK2A 4CXMA 5JS1A 3CH7A 5DYGA 3UAVA 2ZYRA 3HSSA 5LR6A 4BMCA 4QG3A 2HIGA 3QFTA 3RB8A 3L05A 3NEYA 4N01A 3BZUA 4UNPA 3W04A 4LRXA 3OZEA 4DARA 2WSSA 1U0LA 1T13A 3SX2A 2EKZA 3K1AA 3AIKA 1E2LA 3NJRA 4I6GA 1Q14A 4P3PA 2XADA 4LISA 2CL5A 4DLBA 1Z29A 3AP1A 3I8XA 2IS4A 4G97A 4MYSA 1IAVA 5FP0A 1XLUA 5EINA 2GZAA 3PGKA 3DV9A 3H1AA 4IGAA 1JILA 4O4HA 4PGHA 4U00A 4C3OB 4DCMA 5KI6A 4LJRA 2WSCF 1NNI1 1SCBA 2V03A 2XHEA 4S12A 1YB1A 3ICVA 3RU2A 4PG8A 3L0ZA 5JW6A 4UD2A 1BXRB 5DGXA 1LLUA 2OV3A 3O1JC 1NC3A 4Q1BA 5K2OA 1S4MA 4XASA 3MWGA 1RWQA 3BMQB 2AXEA 3F6BX 8GPBA 5TVGA 4KQEA 5JXJA 2XE7A 3QE4A 1JALA 1J5EM 2Z9BA 3A36A 1T5DX 4WLVA 3KPWA 2MROB 1DKQA 1E1DA 5DI9A 5JSFA 4E2FA 4L4YA 2PSHA 3KSUA 2VRCD 3HDVA 1FUYB 1IIRA 2ZB7A 4IJWA 3GRAA 4X90A 2DKLA 1IZYA 3K7EA 5ALFA 4UJ3A 2ROQA 1DADA 3O8RA 4BN4A 3T9DA 4LC1A 3DL4A 2VJQA 2ZT5A 3ZJ4A 1PS0A 3DE3X 2RBKA 4N4AA 1YRLA 1DAPA 1QQ5A 4QD3A 1GCIA 2VTEA 5EY5B 4EB0A 4X5OA 1U3FA 2GEDA 3LFUA 1GTJ1 4NPHA 5HMMA 1TK3A 1B00A 3D3WB 2XNSA 3GLRA 3OZDA 4L78A 4QQRA 2V55B 1TJPB 4OP1A 2YJ4A 4ZEVA 3LJKA 1NBWB 5REQB 3WL3A 1P4SA 4WVLA 5DFAA 4PLHA 4G6ZA 1KDTA 2E9SA 1E5XA 1CZUA 2ZVQX 2FW1A 4QJIA 3WBFA 3LRPA 4L8FA 3ONVA 3HXPA 1W5SA 3IQWA 3LCVB 5DWDA 1M2WA 2D7JA 5A9SA 1GHTA 2R751 1K06A 4WLUA 1SG0A 1CUJA 3LOUA 5HTOA 3H5RA 4XLTA 3LSTA 3IJRA 5IYZA 3NHPA 2C59A 1CHDA 1IB0A 3U6EA 1L0BA 3D4BA 1WCWA 2IZZA 3A26A 3K8QA 2JF0A 2VXOA 1XB2A 1NJ1A 1VCMA 2X3YA 3ESXA 4FT4A 2GZDA 2P2ZA 1ZUD1 3GHYA 1P2TA 3H84A 2OQVA 4EP1A 2XE6A 3EFOB 3BWVA 1S3SA 3T1YB 3D6UA 5E2AA 4MUFA 5A06A 1WPGA 4F2WA 4H9GA 3LHDA 4FLMA 3WDMA 3O8CA 4EUKA 3DF9A 4GSLA 1RCFA 3FYHA 4X62M 1GPAA 1G5FA 4C6TB 3B1FA 2VSYA 4G07A 1IN7A 4GM0A 1ZVKA 5JQGA 3VAYA 4R2MA 4B45A 1GRCA 4I5GA 5AVZA 3H7IA 3NHAA 3GNLA 1CDDA 4F3RA 2QWXA 4LE2A 4IWYA 5AHXA 4RCZA 2J5QA 2Q4RA 2FPIA 5DKFA 5L7YA 2AKAB 4N0DA 4JR1A 1NVVQ 3SIXA 3CIOA 3FDZB 3GA0A 2IHYA 4UUNA 1DT3A 5FAXA 3X1MA 3U6SA 4P7GA 1Z82A 1WPRA 4UTRA 4G2NA 1MBZA 5EJ8A 3UV7A 3PHJA 2B37A 6NULA 1Y3DE 3TL2A 1ZKDA 4WGGA 4S2UA 3GRRA 3C85A 1IFXA 2P4HX 4HQLA 4O2BB 2QV7A 1JLLB 3AEQB 5TQ0A 2A1TR 2HW8A 3AW9A 3IODA 3F3SA 3CVJA 3FJOA 1NHGA 3S44A 3KOXA 1G71A 3B8HA 1AK9A 1XU4A 1Z2CA 3I3OA 1LS6A 3OEWA 2GHIA 1ZH0A 4TZ0A 1I7SB 4F5YA 4NQRA 2Q1SA 3RVDA 1JPVA 4HUQB 1S96A 1O77A 3LT5A 4YP6A 5FBZA 1YVUA 4ZEXA 4PBSA 1AQYA 3U4CA 1TTEA 4MQUA 4WXMA 1Y3HA 1X7WB 1N9ZA 4MYRA 4GXNA 2KHZA 3WNQA 3CRW1 4QULA 3CO5A 1MGPA 3HLTA 1II9A 1SNYA 3PUYA 3LDAA 1EFHA 4TS9A 5JARA 4FJ0A 4IVRA 5CCXA 1YTUA 3T0IA 2YXEA 4F1WA 4CV2A 2HF8A 1M7BA 2ZT8A 3R7BA 3P8ZA 3N7TA 3BD9A 1X7XA 4F1JA 2DSTA 3ONNA 3OCCA 1SHTX 2QQFA 4RKEA 1WUKS 5ILGA 2HIAA 1D8AA 4OPMA 1NLMA 1DZIA 5EQTA 5I5EA 2C84A 5C5CA 5CB8A 3PEFA 1C7FA 2QTFA 3NANA 4WIAA 1KO5A 3URKA 3HM2A 2HHCA 3U2QA 4X20B 3E7XA 1BJTA 2AOUB 4KR7A 2OHIA 4HNHA 4JS0A 3MJ5A 1JJIA 4KN6A 4YO7A 3C74A 4O2LA 1Q92A 4LNHA 3WHIA 4JQCA 3OSZA 3JAWA 2CLIB 1TIPA 3ENNA 3NHZA 2K6GA 1T4DA 2BFEB 4Q3DA 4DV0M 3IKJA 3B74A 1YO6A 3G8BA 2L4FA 2Q5QA 3R2JA 4DQ0A 4C0BA 1QYIA 2GYYA 2DTXA 2OZEA 3ZV6A 1PR6A 1Z5PA 2YFQA 2G5CA 13PKA 2JIPA 3KJFA 3A37A 1ZM2A 1E3IA 1AHIA 3U61A 2EZUA 1KBQA 5T64A 1LV8A 3JQ7B 1CUBA 1VJ0A 2E48A 3KYCA 4FKMA 4QC2A 5G0WA 3BMNB 1F3LA 2ZI3A 4YQFA 3DFFA 3PFFA 2HPZA 4FSDA 3V8PA 2DT5A 4ZT6A 3JRXA 4JASB 3E1GA 4K9MA 5CLLA 2XQVA 3GLIA 2E37A 5IFKA 3B3GA 3TCNA 3X1XA 2H2IA 2ZPUA 4LZOA 3C1TA 4IG9A 5KX5A 4IDNA 4TMVA 5AKZA 2HRQA 3GGOA 2E7ZA 1LQUA 5KOJA 4TRRA 1WY7A 2ZM6M 2P90A 3HVRA 3K8ZA 2CUNA 4BMSA 2I6XA 3KALA 4BLRA 1JIUA 3K94A 3U60B 1ISHA 4JB0A 4L2IA 4ID3A 1JFFA 4B4UA 1OJ7A 3HLKA 4P4GA 3U5ZA 1QC5A 2IYTA 3Q6MA 5E1BA 3C41J 1SCQA 2ORWA 4AJIA 3FKQA 1IN6A 3MRTA 5FBRB 1CZRA 4X1YB 2Z4TA 3ICQB 2D5LA 4POAA 5FYQA 4HWSA 2FPGB 4QFBA 4HSEA 5BT8A 2ZFUA 4DMMA 2XCRB 5FOVA 1TGUA 2VPTA 5JAQA 3GCXA 2GAOA 3GLKA 3TX2A 3NBUA 4YDQA 4X91A 2W22A 3AMVA 4OHMA 3D4IA 4MB2A 4C0XA 5KSPA 3R6GA 2NTYC 2UXCB 3LVVA 3Q3IA 4YRAA 1C1XA 3SC4A 3L0BA 4KT0F 4O5OA 3OURA 2BH9A 5GJVC 2H1CA 1TQ2A 4IY1A 4Q18A 4KXMA 1CRZA 3ZW8A 3AERB 2UUOA 5HDQA 1E3LA 4NQZA 4RYLA 1MOPA 3ZX5A 3O75A 5PGMA 2H00A 2VT7A 5J3JA 4V38A 2OP1A 1FVHA 4DB2A 4RZQA 3CKKA 3IEMA 1B8VA 3EGDA 5EYPA 2YMQA 1ZR2A 4RX1A 2VJLA 3AFGA 3V3TA 1RM5A 4WURA 2H63A 1UDBA 1JSXA 3OZWA 1O03A 3Q9UA 4UQOA 4QQKA 1KO8A 1ZW6A 3N7UA 2DR3A 1VA4A 1LB1B 3OO0A 2EKLA 1NLUA 4XPIB 5ECDA 4B3TM 1DHTA 1BGXT 1UANA 1CJVC 4KI0A 2IHNA 4RHYA 1PRYA 1G4UR 2Z1MA 1KR2A 3OWOA 1L5LA 3BSYA 3SFZA 4ZI7A 5ALOA 4RY8A 1PJLA 1L1EA 1KI3A 1HC7A 4Q7KA 4I0WB 5KPJA 4R1LA 3U37A 2EZ4A 3RU7A 1V5WA 2W2MA 4YRFA 2I2CA 1RFGE 1VKJA 2YL2A 1KVSA 4HGYA 3UH0A 4CU5A 3WZMA 3VU0A 3UWDA 2DR2A 1KI1A 3AYZB 3MJ4A 1LRKA 2NUTB 2C9CA 5CW2A 2DHQA 3FMGA 2LBCA 5C32A 1R0WA 4NOKA 3WIBA 1TU3A 5DWVA 3UM9A 4I66A 3CF6E 3V4ZA 1W4CA 1GADO 1RXEA 4QG7A 3K5HA 1W52X 2PUEA 2DERA 1HXHA 3M34A 4H6VA 4L16A 4PQGA 2GDZA 1ZJ5A 2IVFA 3GJQA 5FTLA 9LDTA 3UMJA 1I4WA 1U3WA 1THGA 3FGNA 2C3PA 1BMFA 2LBPA 3ZI0A 2C03A 3R40A 1U7HA 1UADA 3H13A 4R3UC 4OL9A 4WHMA 4I1UA 5DLPA 3VPBA 4DPLA 5JFTA 2B1GA 3DM9B 1NI3A 3O82A 3AFMA 5H82A 3N3BC 4E5PA 2XEPA 3D43A 2YUIA 3UWPA 4TXMA 3CT6A 3WL6A 4AS2A 5ILQA 5IAAA 3ND7A 5H4HA 1DAIA 1W0KA 4QBFA 1NPYA 4Y18A 1N2OA 1I3LA 1GDHA 1WS6A 4RA9A 4II3A 2ONCA 1MEOA 2X1MA 4X8MA 2ZIGA 3I4VA 5KSOA 2QTLA 4BFUA 4Y28F 4IGEA 5JNUA 3RVMA 4K9OA 2NX2A 1UL1X 3PX7A 1P0MA 4I9GA 1FYXA 4KQKA 5J2UA 2IELA 4FFBA 2WWHA 4YMTA 4NSOB 4QO7A 3TL6A 3D5EA 2JLWA 1PQPA 3EW9A 2IDJA 3QLVC 4COOA 4XJSA 5B1HA 5CEFA 2PD6A 3DEAA 4MVJD 3OH8A 3FAZA 1BMTA 3A4IA 2QRMA 1U6JA 3I2KA 4MI6A 5EKUA 1XQXA 3TK1A 1XEXB 4PNEA 5ARDA 1L2BA 4HDCA 3DEZA 3B6ZA 5LPNA 1KYQA 1KGSA 3PGLA 1MCZA 1WJ7A 3KXIA 1E94E 1Z56C 4MDEA 2ID8A 3O8QB 2QIOA 5FA5A 2ECQA 3TOSA 5B7NA 3I1FA 1I4LD 3KZCA 5TGDA 1HT3A 4NR0A 5KWVA 3DW3X 3EQ2A 4FCCA 3R3ZA 1RQ7A 4X85A 2Y0BA 1C1DA 4KV7A 4RFSB 3G89A 4H1TA 1UDCA 1I80A 4ZT2A 4FNMA 7MDHA 3WSVA 2P68A 1PF7E 2E89A 3HGMA 5DVZA 4J9UE 1NNJA 2XCQA 2KB0A 3JASB 5JO0A 4MZXA 4YPVA 3LW5F 4UFPA 3EWNA 5FRDA 3PEUA 2C5LA 1TEZA 2J1LA 2OO3A 4L8VA 2G9UA 5FOUA 2UYHA 2QW1A 1IEVA 1XTUA 3L01A 4DJAA 2CNKA 3GJZA 2IS2A 1KFJB 3KJQA 2JBAA 2RG7A 1I3CA 4RFVA 3CE9A 3QRWA 1E0KA 4CTMA 1AD2A 2HWWA 3DLIA 5CIWA 4UDXX 2AUTA 4GQIA 3IOBA 1N32B 2XBUA 5FEUA 3U6LA 1RZRA 4G1BA 2X3FA 3AKEA 3H3XA 4B40A 2JIBA 2A30A 3NYIA 1J07A 3RAJA 2FFHA 5CAEA 4TMKA 3DOCA 3UGTA 4LF6B 1B23P 3LBNA 2GXUA 4BVLA 3FN4A 5IBRA 4QTYA 3SLGA 2P11A 4TTPA 1H1DA 1Z62A 1SUPA 1X2EA 2JDIA 4M9ZA 1DAMA 1EVIA 1RWPA 3ADDA 4P5DA 4GL4A 1TQ4A 4MH0R 1PJ3A 1X1QA 5ES3A 1B41A 3VR2A 2OCLA 3E2PA 5TGTA 2VJDA 1VKHA 3QXXA 3WLKX 4RPKA 4YJHB 3I2IA 3MS7A 2YCLA 1IWOA 4XUGB 2W8ZA 4OK3A 4FM9A 3H4JA 4DA8A 5AUOB 3WP1B 5HKBA 1TK2A 2HWKA 3G2MA 4MUEA 4MKZA 2NO9A 3W06A 2QUZA 4H3KB 2F4VM 3EVGA 3FYUC 4NSRA 3KQPA 1MIHA 2CLFB 1XZCA 4I50F 4HAUA 1UXHA 3GPYA 3VISA 2QXUA 1Y34E 5B7GA 4ILEA 3VU9A 3OHMA 2IUFA 3ZNPA 2DCMA 1W4AA 3J27B 2LHGA 1REQA 4C0WA 1M2VB 2X3UA 3THRA 2QT0A 4TUWA 3DLCA 3RNLA 2HJGA 1KFKB 4QA9A 5KVAA 2Q4EA 3HCBA 3VSAA 1V5IA 3VNVA 1PGOA 3AR9A 1WCYA 1GGMA 2MINB 4GM4A 1NW9B 2O48X 2QY9A 1V8FA 3K9BA 2JZ0A 3DNFA 1ML3A 2QL6A 4YV0A 1Q0SA 2DWOA 4GIPA 1OV6A 1C9DB 2RH4A 1KGDA 2DPMA 1H2AS 1MX9A 1Q0ZA 3L0YA 3TM5A 2IP1A 4XLLA 3WZLA 2K5UA 5A4IS 2QN8A 1NURA 3TUJC 3HJHA 2MMGA 3ROPA 2YVKA 4EFLA 3Q7TA 3H4IA 5K0LA 4REOA 1JSZA 2IF2A 3C3BA 3EXFA 1V7CA 2X0EA 2ZTVA 1M76A 1H6BA 1ZK1A 5CDTA 1Z3IX 4Q4DA 1V3UA 4R8RA 1BD4A 1VB5A 2X22A 3EN0A 3GV0A 4RXTA 2RAPA 1WCV1 3G6WA 4C4ZA 4ZHQB 3PHCA 1KO1A 3DZJA 4RJ2A 4IH9A 2MGWA 4HN4B 1RWWA 3N28A 3RLIA 3ENWA 2B2CA 2J3KA 4RZ2A 2ZU6A 3Q5GA 4F8EA 4KNYA 1ZQ1A 2BCGY 4R1SA 3NMUF 1ZI6A 1MENA 4QECA 1GNPA 2PZLA 2WKSA 4GZ3A 1AT1A 2FOXA 1JQBA 1J8YF 3K9GA 5MGNA 2WYWA 1T9GS 2E4AA 2J9FA 5CNKA 4E5NA 1M1YE 4YCNA 2B4AA 2OOSA 5HIKA 2FRDC 2OQRA 3WO0A 1FLDA 3M8KA 4YR7A 5KO3A 1DEXA 3SBXA 2B3DA 5BN5A 2YXBA 4K0KM 4DNFA 1WXEA 3DWFA 4Q4JA 3IQZA 4TQUS 3A1UA 3OQBA 3C3MA 4K03A 2PPLA 3DUWA 3FNIA 1ZXXA 1EFRA 3EK2A 5A6SA 5AVWA 3UJNA 1Q11A 2YWFA 1C9NA 2Y1GA 5LIRA 3TS1A 1U3CA 4L4UA 4YRSA 2FZGA 1DC8A 1Y8GA 1YU6A 4LYAA 4Z3KA 1B16A 3W90A 2RH8A 3O3CA 2Q5CA 3CEJA 3CTMA 4A73A 4IJMA 4D6PA 1GT6A 4C0JA 3DUFA 2QTGA 5FFFA 3F90A 5ECWA 1G8KA 2VQFM 4EG5A 4MR8A 4EI9A 2XOKA 2OCPA 2CLDX 1GZ6A 4EYGA 4URFA 1I4OA 4C4TA 3ZGNA 4RMGA 3RIMA 4FUQA 2CFRA 5JCPA 1UJCA 5LQAA 3AIIA 5EL0A 3IOMA 1J56A 4PX2A 1RMQA 4QUBA 4C30A 4N18A 4H7JA 1F2TA 1CV2A 2A14A 5CT9A 2HMYB 5HRCA 3MB8A 4KVGA 3UCFA 2NYAA 3E15A 5CUQA 3CV3A 3A2MA 1RNLA 4XIJA 2VDVE 3OZBA 2Z9DA 2LP4Y 3V8VA 2DT8A 1Q7GA 3V7WA 3TRFA 1QOPB 1QUTA 3R77A 2W90A 3L9WA 5G40A 4OM7A 5BO5A 3PF8A 1A77A 2DWUA 2XVAA 3LLVA 2XFTA 1B2LA 2VF5X 1AKQA 4MGHA 1SVNA 3TZHA 4EUHA 1OFUX 5I4CA 1T1EA 2BFCB 2C8KA 4NU6A 2PTGA 2ZYHA 5EXXA 4S1VA 2EJBA 2E2WA 3IPCA 4G0WA 1XELA 4JJ8A 4CM4B 1GXSB 1WVGA 4FNOA 1VP9A 2E18A 2BCEA 1GPBA 3H9CA 4F7WA 4W82A 3JVDA 4Z54A 2XSZD 4DREA 3OD5A 2H0RA 3TECE 4FVTA 1IN4A 2IPNA 3F6SA 4ER5A 4FMBB 3FPHA 1J2YA 5K51A 4RV4A 3TWKA 3I2FA 3EDOA 1KNQA 3K0AB 3RV4A 1D3AA 3RTEA 4KIWA 1WIVA 4TZTA 1XTPA 4GGOA 4GOND 5EHXA 3DEKA 3QU9A 3KZXA 2RG1A 1T4BA 1JKIA 2P2LA 4QUAA 4NU0A 1LLDA 2YDXA 2GF9A 4TS1A 2WYHA 2QVYX 1FOEB 1WXFA 3I2HA 4PCUA 1T43A 4RHUA 5ILOA 4M0CA 4BO2A 1VSTA 4IP0A 4EO7A 4ER3A 5AOVA 1C3OB 4DV4M 3ONEA 3SXUA 4B6OA 4GOJA 4D4IA 1YBMA 4N5IX 3DQPA 5FBHA 4F6RB 2IPOA 2Z56A 2H2HA 3E27A 4BJHB 3EIEA 1A3CA 1U80A 2APJA 3T3PB 4CM9A 1QHYA 5A4MS 3T5DA 5L4SA 4R1TA 1MGOA 4V3CA 4AX8A 2B94A 2YWBA 1NOIA 1ZIPA 1LQ2A 2BFMA 1LBQA 4P5EA 4LFBB 2AOTB 1JMYA 1ABBA 2QR3A 4ALJA 1X19A 2O4UX 2J0VA 4TMFA 1NI4A 2GEFA 2GCOB 1JIKA 3A9WA 2A0YA 1XRPA 2LWIA 2V8OA 4G0UA 1QX3A 1F20A 3EASA 2QQ5A 1B0UA 1RYDA 2OG1A 5BR8M 4B6EA 1Y5RA 5D6OA 4PLCA 1MO4A 3V42A 2XF2A 4I55A 2R6DA 1GQRA 4WRRA 2WF9A 4XTRA 1RQXA 3VNAA 2YIMA 4H6PA 5KTNA 1FFDA 4D0SA 2Q62A 2F2TA 2F55A 4D3SA 1Y6ZA 1OT5A 3QXSA 4KWCA 3HUUA 3DBVO 1ZCAA 2FXVA 2P9TA 2BHNA 4OVZB 3VLFB 1U4OA 3FDIA 1F8YA 4KQJA 3VAAA 1DG9A 1NRXA 4WK6A 2AHMA 4M7PA 4NH4A 3VH2A 3FYDA 2RARA 2ZXUA 2JBHA 3ANXA 1NLZA 3BBLA 5DJ5A 4E5SA 4CF4A 2BI8A 4LQLA 2YHSA 3ZHXA 1U9IA 2G40A 1Y5MA 5KNDD 1KMNA 4UHDA 4Q7LA 1E32A 2DJIA 5IM4F 4MV9A 3NONA 2R85A 2ZJ3A 1WF3A 3RTDA 1E3WB 4X45A 1XDBA 4YLEA 3P9XA 1BAPA 2Y71A 3E84A 3S2EA 4ANFA 4WSOA 5ISMA 5FLXA 2GGSA 1UOEA 5AW1A 4RLSA 3UTDA 3ZWOA 3GCDA 3OA2A 5K03A 1GUDA 1UIMA 2Q45A 1YA8A 1P74A 3A9CA 1JQKA 3W79A 2YRFA 3HG7A 4H4DA 3B2QA 3BRCA 3OT1A 2QRQA 5HOQA 1PI3A 1PX0A 3ETHA 4DJTA 4F6LA 1Z12A 2A5YB 3KWFA 2V7PA 3RGWS 2POCA 1VL2A 4WH0A 4GUDA 4BUZA 3SFVA 3ZE1B 3K09A 4CQMD 2BRUA 1U7OA 4OH7A 4II7A 3Q0TA 4EPTA 3RTBA 5TQ2A 2AW3A 2C4MA 3NYQA 2C29D 3F1KA 4U7JA 3L8YA 2PUFA 1YI8A 2RHGB 4YBRA 1XHEA 3VO1A 1FUKA 5CDHA 3THWB 1PJ8A 4ZKDA 4TYQA 2ZJ8A 2B9VA 1XQ1A 3CX4A 3KHUA 5DH9A 3RS5A 5K0NA 2XZFA 4L4XA 5CLQA 1ZZEA 2NVUA 3MGKA 3ILVA 1XYGA 2NACA 1E3TA 1Z5ZA 3FRIA 4JL8A 1JI0A 4R7TA 5DBEX 4G23A 5KHOC 1ZLYA 5JVDF 4W7SA 2O2ZA 4M99A 3G5UA 2FR0A 2QPTA 4LBVA 2JI6A 3ZXXA 5HF9A 3EY9A 5DNVA 1S9DA 2WWIA 2Q7OE 1KRXA 5AK3A 4QPCA 5JT1A 4TMXA 1BMDA 4S24A 1PIWA 1WU7A 2QMUA 1PQUA 2OCAA 1VDZA 2E5LB 1R6AA 4DTCA 4EFNA 4PZAA 2XZPA 1ORRA 2JARA 4GKKM 3TL3A 1NL3A 1KQPA 5CVJA 2XFSA 2OR3A 2I34A 4N5DA 3IFSA 4HDSB 1W5TA 4V0OA 3L7NA 3K70B 1Q3BA 1JU3A 1GD1O 4Y9DA 1JA9A 1XZJA 4Q7QA 4LWQA 4LF4B 4IBDA 4Y1FA 5E6RA 4WXYB 1CFJA 1QOZA 2C97A 2A9OA 1XCPA 1ETUA 4Q37A 4Q9LA 2VP2A 3HVIA 3OQIB 1D1QA 3MLBA 1XWFA 4NWIA 1XIVA 2Q1XA 4DXDA 4GBMA 3DFMA 1I5EA 4AMYA 1EDOA 3FGZA 2JK1A 3JVUA 2AF4C 4W7HA 2G0NA 3SXPA 3BTUA 5IAJA 3WHKA 3UB3A 3OUUA 1AF4A 1J39A 1D0VA 2JY8A 4FWDA 1TZKA 1H4QA 4MGZE 5EMNA 3UT5B 4Q4HA 1T8WA 3O83A 4MO2A 3BKWA 2L09A 2IWHA 4BNKA 3MWEB 3ONFA 4RIIA 2MMCA 3P4YA 5AVQA 1YMVA 5GAJA 3T3GA 1RCUA 3K6RA 3L43A 5DHUA 2ISSD 1U81A 1H9BA 4O33A 2ACKA 1LJUA 4LUCA 1KDZA 2Y4NA 3DEHA 4Q02A 4XWAA 4J0CA 1CUIA 3HUFA 3KQWA 1YA4A 3F49S 5AOAA 1K3WA 3Q88A 3PLAE 3UKJA 4DM7A 3L4KA 3ZD9A 5AFSA 5SZJA 5ADWA 1VPLA 2JD0A 2IXEA 2PL1A 1HNWB 1VMIA 1IDN1 2YZMA 4Z8YA 3RF7A 2I7NA 3IAAA 2BFPA 2VP4A 2SBTA 1N8TA 2CUKA 2R46A 2CNWD 4IFEA 3UEOA 4HPWA 1XYYA 1D2GA 1Y6GA 1NY5A 1ES9A 3J81S 5GADl 2B5WA 5HPYB 1PVVA 3WRXA 2A9VA 4KO8A 4JI2B 4XE5A 3M6UA 2I4RA 2QE6A 2B5OA 4U9HS 2JBWA 3V76A 3BGOS 2O8DA 3TJZA 2NLOA 5K1ZA 4HQOA 4V02A 2XCLA 4XUEA 1DJQA 3ZHYA 4M0FA 1F17A 5DYIA 4A3SA 1COWA 3FROA 2CT8A 1QHHB 3KFLA 4OLJA 4RUKA 3O4GA 4TLEA 2BTEA 1Y3AA 1COZA 2IJGX 2VHEA 2NUAB 2Q7DA 4NMMA 1DMRA 2J3HA 4ITRC 4MWGA 2A9QA 5BOSA 1ZNZA 4MUGA 3ZJYA 4CISA 2DZOB 2OV8A 1L7VC 5LD2C 2VDPB 2XV1A 4I5EA 4BFYA 3GJ0A 3LI2A 3DOAA 3B1YA 2MIIA 4ZPJA 2PH1A 2NXEA 2H59A 2DH6A 2ZG6A 4HK4A 1U28A 3KSZO 4MLCA 1R4NA 2APLA 4PG4A 3GT0A 5GJBA 1GCOA 4P3NA 2Q5FA 3FWKA 1YCDA 2ZS7A 1PFQA 3WMFA 1KSGA 1RRVA 2EX0A 5I51A 4HI0E 1O8CA 3VR4A 5L6MB 3WYEA 1OZ0A 4QWMA 3E9RA 1EX7A 3QSYA 1U8YA 2R6CA 1XC7A 3RSFA 3AUAA 3PEVA 4HDNB 1USKA 2WI8A 2JAQA 1MB9A 3CN9A 3QU2A 4RJLA 3O91A 1QIMA 5I8PA 4QYXA 2F17A 3N6XA 5F76A 2GF0A 2JKZA 4QFDA 4FJ1A 4LJAA 1L4KA 4UHHA 1WV0A 4TLCA 3UWSA 3VZQA 4W9MC 1CIJA 4O4LA 3A9RA 4YRCA 2G67A 5ECGC 1WDWB 3T5PA 2IYPA 3U26A 1XMQB 2IVZA 5LXTF 3RT1A 5CNMA 3AFIA 3ZY5A 2WNHA 1K2VN 1NV9A 1C4KA 3LVWA 1ZJYA 4AX4A 4M0KA 2Z0MA 3AQ4A 5JAUA 4B79A 2RMKA 1H5UA 4U7GA 1CJUC 1UBJS 1N9GA 1U2DA 1R5LA 1TOAA 2GBCA 2QY6A 4C5AA 1W73A 4IVPA 5DGTA 2PN1A 4M86A 2C20A 1DUSA 3ROZA 4DQUA 1FSZA 1PW7A 4XIGS 3K5PA 2F6RA 4JLNA 4Y6GB 4N8EA 1XRMA 2VJAA 1IN5A 2EJTA 1YRBA 4C4OA 2CDRA 2VC2B 1JG7A 5AW4A 3TNLA 2C7GA 3L2OB 3BK1A 2XKBA 3LCCA 4RYDA 1YMQA 5LZ9A 4M88A 4YAJA 4GLLA 4RETA 1ENOA 1S3IA 2CDAA 4O25A 2GN2A 4XVHA 1VI6A 3GLQA 1OHHD 1JH8A 4J0IA 4EDHA 4N3NA 4GMGA 1TJ5A 1AE1A 2YWDA 4J90A 1PR5A 1H2RS 3GN2A 4PPYA 4ZO8A 3HACA 1NKSA 3L25A 3KT8A 2Q0XA 5GV7A 4YHHB 1ILWA 4KQXA 2A7XA 3BSFA 2BGUA 2FJ0A 3VNQA 5I3ZA 2UYYA 4A5OA 4GSKA 2AC7A 1OLXB 3EZGA 4DA4A 1NUSA 1V47A 3L18A 2NOAA 1M72A 3EXG2 4MXDA 3ZHSA 4NK5A 4V0KA 1R0LA 1OX5A 3JWIA 1M1YB 1UBCA 1MRNA 2ENUA 4FOSA 3PRJA 4BAGA 2G06A 1IZ7A 3TF5A 4FFNA 4G4SP 1M5RA 2G72A 1CS0B 4FR2A 4X93A 2L18A 1K6JA 1WEKA 3ZCTA 3M4JA 2JGDA 4JLPA 3KVOA 2JJ1D 5KINB 3CYFA 3ODPA 3F5FA 4ZMBA 1VL6A 2VUSA 4CDRA 3FNRA 3OX4A 2JHFA 5DPMA 3MFYA 4D26A 4BVAA 1R0CA 1R7RA 1S02A 4PT5A 4J76A 2C04A 4QFMA 3ZS9A 4WESA 1LC3A 4U3JB 2V97A 1WCIA 1YZVA 2ERYA 4DIKA 4TL9A 1KMHB 1NVEA 4P81A 2G0AA 2IF0A 4UOEA 1CWUA 1TCVA 4L6V6 5IKMA 1M7GA 1ODLA 3FB4A 4BEVA 4CETA 1WXQA 1UBOS 4ACAA 4ND8A 2AEEA 4OKNA 5D7BA 4COKA 2H4HA 4ZT7A 5EJIA 5EIFA 4O2BF 1YZNA 1U5BA 2D0IA 2YS6A 2B36A 1DG1G 1BTOA 3EPJA 1N57A 2YNMA 1RMYA 3MJVA 4DGQA 1JIXA 2H2AA 4GDMA 4WUVA 5ICEA 1TCBA 2QI9F 3MN1A 1PT6A 2EWWA 3L6OO 3LS2A 3MOGA 2PX8A 4ZANA 4RKFA 4Z4IA 3ELBA 3RG2A 3A25A 3ODGA 3GNTA 2WBLC 1JHYA 2ADFA 2OKCA 3HCPA 1OVMA 3UPDA 5JV5A 4NV3A 2RI6A 4U2FA 3X44A 4M0DA 1XTQA 3V7UA 4MLPA 2W71A 3FPJA 4HX5A 4JJAA 1P5RA 4LXUA 4NU8X 1JDPA 5ITRA 4KH0A 1DRUA 4ARCA 4BLWA 2INGX 3PJDA 4RD3A 4IWXA 1JLKA 5KC8A 2L2QA 1MXHA 1GR1A 1L4FA 5JASA 3GFVA 4R1NA 2PBLA 3KP1A 3K31A 1SXPA 4KQIA 2REBA 5ITUA 1NQOA 3PE6A 4IMIB 2C4HA 4FDAA 2BI7A 4V0SA 4KTTE 4HX9A 4G2TA 3L7CA 5IH7A 2IPXA 2PRJA 1LW6E 1JECA 2NADA 1VFPA 4L57A 4XI9A 1QORA 3CE6A 3EG9A 1LTKA 3HRKA 4F9EA 1IVNA 2B0CA 6AT1A 1CYEA 2JFBA 2WLSA 4UOZA 1CB7A 2G6BA 1IM2A 2QT9A 4BMXA 3I1IA 4V2IA 2QE7A 3SHVA 3UPUA 4AQYM 2CVPA 2QTVB 2ONJA 1QDEA 3A6ZA 4IQFA 4GH9A 2PUAA 4UEWA 1DJLA 2CBZA 4KWIA 2A5GA 4TRMA 1EJ6A 2ZS9A 5GOZA 5FJJA 4LXGA 3N2YA 2JW5A 3HYTA 4WKPA 3DOIA 3MHPA 5DTJA 4AJ2A 2GEUA 4BVGA 2RGNC 2X58A 5A4DA 1E2GA 4IYRA 4GOXA 3B13B 2HXSA 4EJSA 9GPBA 1DAKA 3HB7A 4ZYLA 2C95A 1YDGA 2IYNA 3AOEC 1XTKA 4OMUA 5G0SA 1A5ZA 3STVA 3AUUA 1UKAA 3RS3A 3USCS 3QG5A 1CZNA 1LDBA 2M9MA 2PKWA 1O95D 4HWPA 3VDRA 4Q0MA 4EK9A 1YUNA 1EZZA 2ZYTX 1CB0A 1YRAA 2J08A 4MB7A 2WG2A 4M9QA 4M36A 3VC7A 2HO4A 1IBKM 1Z37A 4DVJA 5DNUA 2ICAA 3MINA 2GK6A 5JJBA 4H7DA 1XNRM 3WK5A 2C77A 3RVBA 4IDEA 2WLTA 3RH0A 1HI9A 4LCBA 3WRYC 4BTEA 3L27A 1BDJA 4BO5A 1MC5A 2BJVA 1KK3A 1Z68A 4LHZA 4FXOA 2DWZB 4JXZA 3WBKA 5DIFA 1Z6TA 1UOPA 4AWXA 4DR2B 3D8TA 1M2JA 3Q7RA 2LUOA 3EVCA 2QMYA 3GP3A 3IPAA 4K1LA 5AMXA 3ZS8A 3R6LA 3ZWAA 5BVHA 4U0KA 1J2EA 4JIGA 2Q6IA 4CKCB 1TCCA 2W00A 2AI2A 1QRSA 3IHPA 4IJUA 2XCOA 4Q16A 1Q1BA 2JIOA 5DN6D 4BATA 4CEHB 3V4RA 5A7HA 5HOEA 3R09A 2PLWA 1YS1X 1RBZA 1YQ9A 2XA2A 2ACEA 2Y05A 3WKAA 2BBTA 4G9GA 3I73A 4EELA 4P0TA 4XGQA 2GCEA 1XD2A 4RW0A 1NPTO 2R5WA 1QXSA 3L1JA 4MWEA 3Q8LA 1LH0A 3T5AA 4AG3A 2WWRA 2DHCA 1HOXA 1GQFA 4JH0A 1RW4A 1K88A 3DPUA 1XNQM 5BR7A 3AJEA 4E2ZA 4A8PA 4ZXFA 5ARBA 1FJHA 2FG6C 4KMOA 3QLUA 1D1PA 3EYWA 2A4KA 5CB0A 1QG0A 3E48A 1KSHA 4IBBA 4HZUA 1UKBA 4ZMSA 1FSSA 2BUBA 1T4CA 3OEEA 2HJ9A 2ZU0C 3H9UA 1KZ7B 3TE6A 5LA6B 3LK7A 5J2TB 4EEKA 3I8SA 1PR0A 2WDZA 3EIFA 5HKAA 1IONA 1VYTA 2JGEA 2PCJA 3RG8A 4FKZA 4KV9A 4EGCB 5GM1A 5KVVA 4FGZA 5C2JB 1ESEA 3UJCA 3TSCA 5LZ2A 1RZ3A 2BGRA 4ZO9A 3ZGOA 1E8MA 1XHFA 4N82A 5AW9A 5BURA 1M7HA 3AKZA 4O4JA 2OA0A 4ZEWA 3BCSA 2AE2A 3KKOA 4LOIA 3SJZA 3GPXA 2XA9A 1M5TA 2FYTA 1TT5A 3EZNA 2O5EA 1AQIA 5IABA 2CHGA 4B47A 3H2HA 3CRNA 4WV3A 5HIAA 1A8SA 4W63A 3EWSA 4F4UA 2C83A 1GRNA 4FFWA 3A2KA 4W6QA 3ZG6A 4MMXB 3KZOA 4ED9A 3IJ5A 4TN5A 5LBUA 3HKBA 1K5GA 2HTFA 1XTVA 4V03A 3MTGA 4MW4A 2LVBA 1QZEA 3SKVA 1VGQA 1CZHA 2R8XA 1FRNA 3FZQA 3QFCA 4GECA 4OYRA 2UU9M 3OE7D 2ZRJA 1RP1A 2CJWA 2WSBA 2R6JA 1ADYA 2EFGA 4QGGA 3HM9A 1P0QA 3JW8A 5J5AA 4HQFA 3V3KA 3OFVA 2IH2A 3NHWA 4ZK6A 4GYJA 2GM4A 1Z36A 1LSJA 4AECA 1HM5A 4LHSA 1Y4DE 4Y8VA 3RJTA 5JE8A 1U8AA 3CMMA 4MR7A 3KB8A 4DV2B 1P0IA 2ZE7A 2AK3A 5AW0A 1QIDA 2QJTA 4GICA 4NMLA 3CTPA 3SZ3A 2ZUTA 3UQYS 4II2A 3ZZNA 1MG5A 2OORC 1V6CA 2XQFA 2XI4A 2A5FA 3U3DA 3JQ8A 5KQRA 1UOOA 3U44A 1GZ4A 4O4IF 1V4BA 4B3HA 5F1KA 1OQAA 1GNVA 2F9FA 1U1CA 5D1NA 5ALYA 3M89A 3S6JA 3AESB 3BZWA 5ESDA 1ECPA 1WMAA 1T8TA 1GZVA 3JAMA 3TPFA 1ZZGA 1XVIA 2E0IA 1TD1A 2BD0A 5BV0A 3E9SA 1N77A 4KLZA 3KB1A 4LOAA 2FSIA 1MPTA 2P4SA 4ZZ3A 4FDMA 5IDVA 2GR9A 1YRQA 2VL7A 2O6LA 5B1IA 3HB9A 3IAUA 1WNFA 1Q1QA 4QDKA 2Y21A 4ZI5A 3JPWA 4UTPA 5J43A 4TROA 1M8JA 3SAVA 3Q98A 2J3IA 4EARA 4EY8A 3GG2A 3EDQA 1GKYA 1XZFA 5JSKA 1XVUA 4EB6A 1ZM3A 1X14A 4YEDA 2GH1A 1RWOA 3DLHA 4UCXA 1UWVA 4GPBA 2VQ6A 4F4IA 2R48A 3AINA 4Q93A 4CLHA 2AJBA 2WG0A 5EPUA 3G2NA 1V11A 4NCJA 4QT4A 1ZIDA 1W5BA 3ZHZA 2I76A 4MX8A 3KXPA 3ASVA 1CT9A 5WRFA 1YSCA 3I01M 3BSWA 3U6PA 3SSNA 3FZGA 5JY6A 3EPLA 5CU7A 5A3JA 1N0VC 5IKEA 1QYDA 2V6JA 1OXMA 5K05A 4REQB 4JI3B 2HNAA 4J7CA 3Q7QA 2ZTDA 2N0SA 2Z2YA 4G25A 3CG4A 2J5RA 3UF0A 5BP7A 4JENA 2R6AA 3QUBA 2D1SA 3N2EA 1RI1A 2GTPA 3OZIA 2ZYAA 5DM4A 2D2EA 1YXMA 3DE7X 1IY8A 1N6PA 1CR0A 2EGGA 4JI0M 1EFCA 2CVFA 4W1PA 2OFFA 5JEDA 3U81A 3G0BA 3LX8A 3AONB 5JI3E 5JCOC 1NFRA 1FQKA 4EHKA 4DDVA 2IXTA 1MX1A 3OC0A 4H31A 2F7SA 4H6WA 1Z08A 3MTDA 1CQIB 3VYVA 1X7GA 5H3LA 4LOJA 1TUEA 5IC4A 2UV8A 3L6EA 2BP7A 3DAHA