1I4WA

The crystal structure of the transcription factor sc-mttfb offers intriguing insights into mitochondrial transcription
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
322
Chain Sequence
PIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEWPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the transcription factor sc-mtTFB offers insights into mitochondrial transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MITOCHONDRIAL REPLICATION PROTEIN MTF1
total genus 108
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i4wA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i4wA01
2ZVJA 4CWAA 3B3FA 1AF7A 3UJBA 2PWPA 1WXXA 3GNLA 3P71T 4AX8A 3LDFA 5IKMA 4EKGA 1L3IA 3UJDA 5DPMA 2P3LA 2XVMA 4EKIA 3UBTA 3SVZA 1R8XA 5KS2A 3UWPA 1RI3A 4DKJA 3KR0A 2E5WA 5FADA 5F2NA 4MTLA 3I5UA 2GB4A 5F2OA 3THSA 1JSZA 3MCTA 3SMQA 1BHJA 2XYQA 5E8JA 5E1DA 5JR3A 2B3TA 2R3SA 3R24A 5HIIA 3CGGA 2GAFA 5FQOA 3ERCA 3UA4A 2GS9A 3G8AA 3ME5A 2ORED 1JSXA 2B25A 2CKDA 1X1DA 2O57A 4CKBA 2AOTB 2I7CA 2YQZA 3DUWA 4YUWA 3D2LA 4R6WA 1L3BA 3EGVA 1QAOA 3I53A 4XUCA 1R00A 3FPJA 4RTLA 2AN3A 1AV6A 3G8BA 2YTZA 3A7EA 2GPYA 3FUUA 3SSOA 1D2GA 1NBIA 3G7UA 5E1BA 5EZQA 2FYTA 2P41A 3JWJA 3I64A 1KPIA 2AOXA 1NT2A 1VE3A 3EVFA 1R18A 3GRUA 4PYMA 3UZUA 4HGZA 2PVCA 5CCXA 4PYNA 2VZ9A 2G8NA 3EMDA 5IH3A 5E9WA 2I6GA 2QRVA 1IY9A 3SSMA 1YF3A 1EG2A 1YZ3A 3KQTA 3KQSA 2ZTHA 3DXXA 3BGIA 1NBHA 3G2MA 5E1MA 1SQFA 3HVJA 5GIOE 5K0GA 4RTSA 2YXEA 4PONA 4P7GA 1JG3A 4RTNA 2Y1XA 3MTIA 5F2KA 4OX9Y 4B17A 5KQSA 3FUVA 4E31A 4PYOA 2NP7A 5E2BA 3LX6A 4E33A 3C0KA 3ELYA 3LSTA 4GF5A 3HEMA 5ICCA 1P91A 3UJCA 1YZHA 1R8YA 5CCBA 2I62A 4GC9A 3GRVA 3F4KA 4X60A 5DM0A 3EEOA 3U81A 3FPGA 2ZCJA 1NW5A 1XTPA 4H0NA 3MQ2A 4UOEA 5DSXA 4GOLD 1L3CA 3G89A 1JQEA 2WA1A 1KYZA 1L9KA 4KVZA 3P8ZA 4U7PB 5DX1A 5E1OA 3TM4A 5K0JA 3A26A 2V74B 3OZTA 5DRTA 4E2WA 2O07A 3UJAA 4R8SA 5LR6A 3FTFA 5CIYA 2ZZKA 3OPNA 2G70A 1DL5A 1G8AA 4X1OA 1P39A 4R8RA 4MWZA 3O31A 3NTVA 4RTJA 5DM4A 2PSSA 4GOND 5EQJB 3K6RA 4KIGA 2OXTA 2OB2A 4MIKA 4PYQA 3R9XB 5P8WA 3PX2A 4BP3A 3GRRA 5FWAA 4YMHA 3MHTA 1O9HA 1XDSA 1G38A 4EQZA 3UJ6A 9MHTA 3BUSA 3FYCA 3FRIA 3PFHA 2YVLA 3NVMB 4C08A 2H11A 4O29A 3P9CA 1Q0SA 3MGGA 4OA5A 5EMLA 2P3QA 2ZBQA 5FCDA 5LQNA 1VL5A 3IEIA 3BWCA 2R6ZA 3KPVA 4CKCA 2IH2A 3A4TA 4K6MA 1FPQA 3PB3A 5GM2A 2Z6UA 2FK8A 2ZIFA 4PINA 5HZMA 3EVCA 2BR4A 5HEKA 3T7TA 3CCFA 4DCGA 4CTJA 2PGXA 3V8VA 1KHHA 4YV1A 1KYWA 1G6Q1 1NV9A 1PRYA 2AZTA 3CVOA 5HIMA 2UYOA 2JG3A 2XYRA 5K0NA 4KRGA 5DXAA 2JHPA 2PJDA 2VDVE 3HCFA 3P2EA 4DQ0A 1O54A 1O9GA 3ELWA 3LHDA 1JR4A 3RW9A 3ER8A 1N2XA 2G72A 2HMYB 3FPHA 3H2BA 4RTPA 2OYRA 3NDJA 4HTFB 5EC8A 3FYDA 2Y1WA 4BLWA 2ONYA 3KQPA 5FULA 2PX5A 3LCCA 4FSDA 5K01A 3FUXA 3EVAA 3OCJA 2VS1A 3FRHA 3B89A 1PJZA 3EEYA 3GGDA 3TKYA 4C03A 5K0FA 3FUTA 5LQAA 5K0EA 2UYHA 1R6AA 2F8LA 5FQNA 1XCJA 3DULA 3KPUA 4EK9A 1RJGA 3EVGA 3LBYA 5M5BA 3VSEA 2NXNA 5BP7A 1T43A 3IV6A 4OA8A 3OU6A 3TOSA 3MTEA 4RVHA 5DWQA 3UJ7A 3LECA 2CMHA 5EMJA 3DLCA 5FWDA 1VIDA 1NW8A 2AN5A 4PYIA 2PXAA 4XCXA 3CBGA 2AOUA 5DTMA 3SR4A 4AZSA 4CTKA 1I9GA 4PGHA 3CJQA 2PXXA 1UIRA 1ZHFA 3LGAA 4FT2A 4PYLA 4EMSA 2NNWB 2O0LA 3PT9A 2EX4A 4AUKA 2LD4A 4PIPA 1N7IA 8MHTA 3CJTA 3DLIA 3HM2A 4HGYA 4C05A 3LBFA 5EHIA 1YFLA 3VC1A 2UYCA 2I9KA 5KQRA 3B7PA 2GH1A 4E70A 1Q0TA 1KIAA 1TW3A 4KDRA 4PCAA 5EG5A 2JH8A 3SM3A 1M0EA 4DF3A 3KQWA 1UWVA 5C0OE 5KVAA 5EZSA 5LQCA 4ATNA 1N7JA 3TPZA 1M6YA 1B42A 3BWYA 2QYOA 3BGVA 3KKZA 3UA3A 4DA4A 3ELDA 5ICEA 2HV9A 4QPNA 3GRYA 3GDHA 5HIKA 5T64A 4ZTBA 3KQQA 1JTFA 4M37A 1KXZA 2OY0A 5DTQA 4XUDA 5DTRA 1FP2A 1ZGJA 2QY6A 4HH4A 5EKUA 3HCEA 3DXYA 3UJ8A 4AZVA 5K05A 5ERGB 5ICFA 1XCLA 3REOA 2PKWA 1VP9A 2P7HA 3NVKI 4DZRA 3GIWA 1QYRA 1L1EA 2HWKA 2PBFA 3BKXA 4IV0A 5K03A 1RI4A 3VC2A 2PT6A 3SGLA 5BW4A 7MHTA 4X63A 5E9QA 5FHRA 5BW5A 3NW9A 4HRAA 4IV8A 5CUQA 3I9FA 4YUVA 5EPEA 1XXLA 3AXSA 3M4XA 1XVAA 1JTEA 3MCZA 4HSGA 3RIEA 1Y8CA 4RWZA 3M6WA 3TQSA 2O06A 4FR0A 3VYWA 3EGIA 1FJXA 2ZW9A 1TW2A 2ZWAA 3LDGA 3SX0A 4M7RA 2ZWVA 2P40A 3JWHA 3UJ9A 4X61A 4Z2YA 4CXMA 1MJFA 2EJUA 5EKXA 5ICGA 2CWWA 4HG2A 2PT9A 3KR9A 1QAMA 3HNRA 1XJ5A 1IM8A 3NDIA 4E2XA 1JQDA 2C7QA 5LQUA 1SG9A 2NYUA 1WZNA 4RSRA 4HTFA 5DRYA 2FK7A 5K8VA 1EJ6A 3DOUA 3RODA 4HC4A 3HVIA 4AZWA 3FTDA 3BKWA 1SVUA 4PYJA 4QDJA 4QQNA 3OU2A 4YUYA 1FBNA 4XUEA 1X19A 1HNNA 3MB5A 2PWYA 5DLYA 3LCVB 3HA3A 3P9IA 4PGGA 5HIJA 4Y2HA 3SSNA 3O7WA 5JUWA 5FA8A 4MQ4A 3FPFA 1OR8A 2FPOA 4Y30A 1V39A 1NW6A 2H1RA 2AN4A 3LL7A 3HCBA 3TM5A 2UZ4A 5K0BA 3M6XA 4C4AA 2V7EA 1IXKA 3KQVA 2K4MA 3OZSA 3AJDA 3L8DA 2HR1A 3GRZA 3P2KA 2YXDA 4BP1A 2IGTA 3G88A 3G2PA 3DXZA 4OQEA 4PCLA 2P35A 4RTOA 4FZVA 5K0CA 2BR3A 1QZZA 3KR1A 2IH4A 3BT7A 4KW7A 5C9ZA 2AR0A 2EG5A 2IH5A 1BOOA 1ZGAA 1WY7A 1D2CA 1XDUA 2BM9A 3OFJA 4P7KA 2ZULA 4QPPA 5BXYA 1F3LA 1JQ3A 2ZSUA 4WVLA 3CC8A 5DXJA 5FA5A 4NECA 2Z6QA 2WK1A 1BKYA 3BGDA 3M6VA 4M38A 4R05A 2ZBRA 4GBED 3KQMA 5EMKA 3HCAA 4IWNA 3M6UA 2N47A 2OZVA 3KQYA 2NXCA 5EVJA 4KWCA 1D2HA 4RTMA 2G1PA 3FUWA 5EIWA 2P8JA 4FS8A 5GOZA 2AVDA 4C04A 3B3JA 2VP3A 3KR2A 5LSAA 3LKZA 4FP9A 3S68A 4GEKA 1X1AA 3ER9A 1X1BA 1YB2A 2CMGA 5LQJA 3GO4A 3EGEA 3UFBA 4DM3A 2DPMA 5CM2Z 1SKMA 4V0QA 2OB1A 4OBWA 2FHPA 1KR5A 2IFTA 4QVGA 1INLA 1H1DA 3E7PA 3TMAA 2ESRA 3TR6A 2AS0A 2ZIEA 3C6KA 3LDUA 3AY0A 5E9JA 5FTWA 4FSXA 3A27A 2NP6A 3GCZA 2C7PA 2ZLBA 3NWEA 3DTNA 2IBSA 3B5IA 3EPPA 3BWBA 4PWYA 3KPJA 5CVJA 2ZFUA 5D1NA 2ONZA 4GOOD 3THRA 5E2AA 3ELUA 2XVAA 2JH9A 3HCDA 4F85A 1NW3A 4ER0A 4ER3A 3P2IA 1EAMA 1NV8A 3IHTA 5GWXA 3R0QA 1MHTA 2G71A 1NW7A 10MHA 2QRVB 3I58A 5HILA 4BLUA 4KIFA 4LWPA 4YV2A 3SXJA 2UYQA 3PS9A 4E2ZA 2KW5A 2IBTA 2B2CA 3EMBA 4PYKA 3EVZA 5D1HA 5DX0A 5CVUA 2QM3A 2GLUA 2VDUE 3KPWA 5EHGA 3WSTA 3TLJA 4ER7A 5DM2A 4QTTB 1VBFA 3PX3A 5G02A 5DSTA 3V97A 1QAQA 3DMFA 3C3YA 3DMGA 3C3PA 1ZQ9A 1ZKDA 4RVGA 4WXHA 2FRXA 3Q87B 3A25A 3KHKA 2JHCA 4L7VA 4RYLA 4CKEA 1I1NA 1ORHA 3M33A 3G2OA 3JWGA 3X0DA 4C06A 2BM8A 1SUSA 2XYVA 3P9NA 2AOTA 1R74A 2OBFA 4V0RA 2PX8A 3BZBA 4BLVA 4P7FA 4X41A 1Z3CA 1WS6A 3AXTA 5T6BA 4YUXA 3G5TA 2AVNA 3G5LA 3HVKA 5EGSA 3DH0A 3FZGA 3HCCA 3LCUA 5H02A 2OO3A 1G8SA 5DT2A 4ER5A 5KYGA 4E32A 3HP7A 4FGZA 3E05A 1ORIA 2PX2A 2JHAA 1VLMA 2OPBA 2YXLA 3PVCA 3FTEA 1P1BA 4RX1A 4YV0A 2P1DA 1G55A 2ZIGA 4RTRA 2O05A 1ZG3A 2NXEA 3P97A 4GQBA 3FTCA 1BC5A 3CJRA 2PX4A 3NMUF 2IP2A 1KP9A 3P9KA 2HNKA 4GC5A 1JG2A 1XDZA 3LPMA 3QOXA 3PTAA 4ISCA 4OQDA 3EVDA 1P1CA 1NE2A 1RJEA 3DR5A 4RVFA 5B1SA 4EVIA 3QOWA 3MAGA 1FP1D 1EQAA 3T0IA 4ER6A 4LG1A 2XBMA 3OZRA 2FCAA 2C7OA 3HA7A 3OU7A 2PY6A 2Q41A 3G2QA 4QQKA 5DM1A 4F86A 3KU1A 5C1IA 2EFJA 1YUBA 2ERCA 2PLWA 1DUSA 1X1CA 3B3GA 3K0BA 2AOUB 3JWIA 4G56A 3Q7EA 2YR0A 3MERA 3NJRA 5GIPE 3OE4A 4RV9A 4U7TB 5EEHA 3GJYA 4LWOA 5E8RA 5GM1A 3T7RA 4POOA 5EIFA 5LQRA 3GXOA 2IDKA 2IPXA 4PIMA 1HMYA 5CVDA 3TFWA 3PFGA 2OKCA 5K0LA 5GP1A 1I4WA 2YUIA 4JXJA 3TKAA 3HA5A 4IKPA 3LKDA 4C07A 5LQKA 3A7DA 3OE5A 4RTKA 3M70A 2Z6AA 2BZGA 1EIZA 5CVVA 4A6DA 2IIPA 3O4FA 3FPEA 4QTUB 3GU3A 4E2YA 2WA2A 2B9EA 4OBXA 5U4XA 3R6TA 4GOMD 2HTEA 3T7SA 3BWMA 2BH2A 1KPHA 2PXCA 5CVEA 2CL5A 2QE6A 1RJDA 1TPYA 2B78A 3DMHA 1VPTA 1G60A 3R3HA 4QDKA 4YMGA 3CKKA 4DMGA 1JG1A 1VQ1A 1SUIA 3HVHA 2NXJA 2P3OA 3OFKA 2ZBPA 3C6MA 4YUZA 3E8SA 5MHTA 1EJ0A 4GUAA 5EMMA 2C7RA 4PNEA 1U2ZA 4LECA 2AOVA 4P58A 2EJTA 4A6EA 2VDWA 3IYLW 4M36A 2IDJA 1YFJA 2GA9A 3NWBA 3EVBA 5FHQA 1RI5A 2H00A 1NKVA 3HTXA 4AZTA 3KPYA 1KPGA 2P7IA 5K09A 4BY9E 5EOVA 1M6EX 2ZZMA 3PLAE 1WG8A 4KDCA 1SQGA 2ZZNA 5DX8A 1VP3A 5T67A 4MHTA 3GWZA 3EVEA 1QANA 1RJFA 1WXWA 1UFKA 4RVDA 3KQOA 5HOQA 5GINE 2BR5A 4F84A 1RI2A 2ADMA 2YX1A 3ID6C 5EEGA 4P7JA 3E23A 4DCMA 2A14A 3BXOA 4E30A 5FUBA 5CD1A 3QV2A 1RI1A 2PV0A 3TRKA 4R6XA 4QVKA 3AWIA 1AQIA 4RTQA 1AQJA 1DCTA 1F38A 3ANXA 2JJQA 3DP7A 3ORHA 2DULA 4FT4A 5HFJA 1JG4A 2AOWA
chains in the Genus database with same CATH superfamily
3PTLA 3HXTA 1IM2A 5HW0A 4Z2AA 2XCLA 4C3UA 2OOBA 1I4DD 3BSYA 3OTIA 4DEXA 1EZZA 4MO2A 3RVMA 3R4VA 1C1KA 1OBCA 4L78A 3IKMB 4ZT2A 3SEFA 4DT1A 4LJ4A 3H2KA 4DKJA 3OWHA 2DUUA 1XZFA 3CPHA 3DAHA 4Y9UA 3WLAA 2PD6A 2I2FA 1JSZA 1ENZA 2QUIA 3C5CA 1TO2E 3GT3A 2I2XB 1F6DA 1N5MA 4JODA 3ESXA 5G0UA 2RRUA 3DEFA 2GA8A 1HGXA 1IN8A 2YOHA 4KE8A 3V1NA 3ZGVA 1TJ5A 5GZ6A 1L1TA 1PWHA 4KU4A 2WF5A 3A0UA 3JQ8A 3MWKA 4ZA2A 4D8TA 2GFIA 2ORED 1CF4A 5CAEB 3RO7A 2UVPA 1JWBB 1C8BA 2PGIA 2O57A 3NOVA 3VU9B 1ISJA 1X8LA 2A9KA 2WG0A 2IV7A 4BNJA 1RBYA 4EI7A 3KALA 1R2ZA 4TLMB 4NFHA 1GADO 1VL1A 3EIWA 3I53A 2NZ2A 3KDSE 4LGMA 4L50A 5KUTA 4UUQA 2Q4BA 2JY8A 2GPYA 3KQUA 4KLNA 3IEVA 3VV3A 2VA9A 2OV2A 2QYSA 2C2HA 421PA 1KPIA 1IWBB 1PFYA 3P2YA 4RHXA 2YV3A 4MTCA 4NAHA 4C6TA 3PNPA 4P4LA 2UUAM 3UN1A 3JZDA 5HK8A 4PGMA 1YS6A 2DWCA 2YJGA 2OGZA 3DFUA 1WZ2A 3GRPA 5DP1A 1XG5A 4K3UA 2I6GA 4C0JA 8LDHA 1LLDA 3AV3A 3UMCA 3PNYA 4MV3A 4FZJA 4LNUB 4OXQA 5LA6F 3DXXA 1NBHA 3DDCA 4QHSA 4L6AA 1W25A 4MPPA 2YN0A 2Y1XA 5AXAA 1AK9A 1QIMA 1XXHA 2O5VA 3A06A 3FNBA 4WJKB 4BV9A 2CLCX 1CUWA 2CNKA 2Q07A 2OVBA 3HHPA 2WJVA 1ZMOA 2RC5A 4KN5A 5DYIA 5ICCA 3ZY6A 4DY4A 3B13B 3W0FA 4JP3A 1NXTA 3DCIA 4QNMA 3F71A 3V4SA 1TQ2A 3CNEA 4LK2A 5FTKA 3AI2A 4NJMB 4PC6A 3TSZA 1G71A 3KXEC 5IZ7D 2DC1A 2KLHA 4WCDA 2EUCA 3H97A 2QRZA 2J3IA 2VAWA 3AIIA 1M6NA 3GCDA 4ZALA 5AW1A 2I29A 4D3YA 3LC1O 5EUQB 1H23A 2G3YA 1GCAA 2HMTA 4RK0A 2HU7A 3VR6A 2Z98A 4JNKA 4TWIA 4DCPA 2NV2B 5HHTA 1Q92A 3N5KA 1BX3A 3KJIA 3NO4A 5J1TB 1Y1KE 3EIQA 4NZ9A 4J1QA 5CIYA 3NP7A 5BR4A 3A37A 3INRA 1R64A 4B9EA 3HJUA 5I3CA 2IYLD 2NOAA 5GJBA 3QX8A 4BLPA 5TSDA 2IYWA 2HCRA 5K3FA 5BSWA 4MR7B 1OZ0A 1E0KA 1DOAA 1GQQA 3GOQA 1BQ3A 1J6UA 3QRWA 1E7YA 3NYQA 4MUGA 3B7ZA 2WTNA 3E9RA 3AIKA 3ANTA 3PHHA 1VKOA 5FOUA 1DKPA 4FX2A 3KSAC 3PX2A 1ZOSA 5A7HA 1TF7A 5AVRA 5AOVA 4CFZA 1XDSA 4M87A 1ZQ1A 2JIRA 2ZB2A 3GJXC 5F64A 1MDBA 2PL1A 4RL4A 4I5DA 4V38A 1T15A 1XDWA 2NO5A 3NKLA 1CRWG 4O29A 1A9QA 3HDHA 4DIOA 3EVTA 4FB5A 3KPVA 4WZBB 3LKVA 1H69A 3NBZC 3PGLA 3FYUA 3LCRA 2W6JD 4OHOA 3PB3A 5GM2A 3E61A 4MGZR 2EF0A 4DDKA 4NI5A 1F4LA 5D3MA 4AP9A 4PG8A 2PJUA 4KGVA 3CG0A 5HEKA 1IN5A 1IMOA 4O25A 3VR4H 2X9GA 2AI1A 3N2ZB 3OKCA 1M2GA 1TGYA 4H77A 4JQSA 4OGFA 4V39A 3ZDEA 4DR1B 1XYYA 2V7BA 4PPYA 1V92A 3HCFA 2OT3B 2C8JA 1VBMA 1XRSB 2LP4Y 3P2EA 1JFSA 3ELWA 4R1PA 2FOIC 4Q4LA 2QZSA 4I8OA 3Q1LA 3K1JA 1QO9A 2B5VA 1JR4A 5JPCA 2IHTA 2Y0TA 2H4WA 1Q22A 3W1WA 1WIVA 1ZAEA 1YAHA 3VV2A 1U1GA 1KY3A 4LE1A 2ONYA 3VKVA 3T0GA 4NATA 3WBJA 1I6KA 3CB2A 3TQQA 4CCWA 2ZXFA 5KKCA 3RHZA 3ZWAA 4IDDA 1PJZA 2H4YA 2ID7A 2D3TA 1A97A 2LE0A 4IH9A 5K3CA 5K0EA 2DYKA 4NEQA 4WXPA 3WOHA 1P7CA 4DMKA 5A7FA 2FNAA 2Q5HA 3KOOA 4H15A 3VU3A 2WLTA 1MFZA 2JCBA 4OA8A 2XUPA 3IV6A 3AILA 3N8KA 3PDJA 4QOZC 1VRCA 3R40A 3VHRA 2I0FA 3TDNA 2GAIA 2JLQA 3DHWC 1H4VB 3KJGA 1VKNA 4AZSA 1RJ9A 4PGHA 3HEBA 4U7HA 3TJZA 2KHZA 2QV0A 3VBEA 2RHDA 3PDHA 4AF7A 2H18A 1Z7EA 4D9MA 3LPAA 1XRPA 1NI4A 1ZCJA 4AUKA 1IEQA 4P3YA 3ZDXB 1M2VB 1WB9A 3HM2A 4D82A 1Q7TA 3AY3A 4HGYA 2OFOA 3FFWA 5EHIA 1Q16A 5FOSA 2B1GA 3RC1A 3VPGA 1Z6YA 4E4TA 2VTBA 4AKEA 2WR8A 5CDYA 5EG5A 3OIGA 3I8SA 2QK4A 3AVXA 4LV5B 2DPYA 4EF4A 4ATNA 4QQRA 2XBLA 2J6BA 4IIEA 3AFNA 4G63A 2LNHC 1LQTA 2Q9AA 1R27A 4XVRA 1W5SA 2O54A 1ZUIA 1P60A 2B69A 1ZRMA 3JTEA 4X84A 4Y18A 1SVSA 2ODAA 1AKYA 2AE2A 1XCGB 2QY6A 4CG2A 5KJ6A 4BFYA 3QU7A 2BFNA 3ZWQA 4ARZB 4DQXA 5JZMA 1EM6A 5KPRA 2ZDHA 2P7HA 3KKQA 4MWOA 1M0SA 2GD2A 3IUEA 4U0JA 1TM3E 4MGZE 2I6QA 4R9RA 3R3JA 3NYIA 4X94A 1XTRA 4MWGA 4Q3NA 4ENWA 4FXPA 2NAFA 1FTNA 1VMIA 4DR7B 3SHVA 1XF9A 2OBBA 4JYCA 3CG4A 4N3NA 4XEUA 3SWWA 2LZ0A 4IDGA 5IKXA 4KQCA 4X65B 2WSLA 2NPFA 1WD7A 3RU3A 3K92A 2CNDA 1S7GA 2PCLA 4E09A 2IYRA 1W85A 1Y5NA 3M6WA 5I7VA 4YONB 5LD2C 1OMOA 3R6GA 2FSGA 5JQWA 1VC2A 4ARSA 4RE5A 1V45E 3H2JA 3R3ZA 4R7TA 3LVQE 2CV2A 4DQVA 5A6SA 2UZ1B 5BW8A 4JVSB 4YJ3F 3DC2A 3FLMA 2HADA 2LNDA 2VK1A 3MLAA 4HRVA 2DY1A 2JZ1A 4FJ0A 2C3OA 4ENQA 2IEAA 3U3MA 3HSSA 3V42A 2VWGA 2ZTVA 3O8OA 5J2TA 1OIWA 1NQXA 1TZJA 1VSQA 1YQDA 2ATVA 1BS1A 4HEHA 1UT6A 1NPDA 4XLTA 3E6AA 5BQPA 1WW3A 4OQPA 4K1XA 5K0SA 2G4CA 4LXGA 3IA7A 4QDJA 2R7NA 1SHJA 4R3WA 5EYPA 4U4AA 4CEHA 1Q3KA 1SULA 5E7MA 3B5JA 5TRTA 4PD2A 3ADBA 4QGHA 2O3JA 2YXBA 5TQJA 2VN8A 4AJOA 3DAOA 2W2KA 4EJMA 4BKRA 2XSZD 1HH4A 5IFLA 2OSBA 3A6HA 1VJGA 1JDTA 5BN3B 3O4GA 5KQLA 3SF0A 4W8OA 1AMUA 3PSAA 2HU8A 3BFPA 2Z8YA 1NYRA 3F6YA 4B82A 2XZLA 3KQLA 1CFZA 1JZQA 2K4MA 3KD3A 4F4CA 3L8DA 3T5AA 1W0JA 4NS4A 2WSSA 5IVHA 1ORYB 3DXZA 3U3RA 3L79A 1SD1A 4CQLB 1VLQA 4XX0B 3U3JA 3AW9A 1QB8A 5D7BA 3B1JA 4G0PA 2B9VA 1C3OB 1LSUA 2QUJA 3UAOA 4A23A 1MTZA 2OQRA 2CJWB 4EFNA 4LRQA 1Y1QA 3NBIA 1P5ZB 1PZNA 3RM3A 3WYGA 2QVGA 3BQ9A 5FOXA 4UM7A 3KB6A 2C7GA 2CVZA 4YRMA 3OCWA 1L7PA 3PC4A 3W1EA 1QMPA 2YJNA 4MX8A 3TWMA 2NO1A 3BXEA 3LFHA 4JD5A 4YP7A 3O0TA 2PU5A 3N8NA 4HDMB 3QW4B 4LJ8A 3BB3A 4KWCA 4QU5A 2PUGA 1G41A 1ZGCA 3D7LA 2NYAA 4PR0A 4NJEB 4LOJA 4HH1A 5JSUA 4PY2A 3KXKA 1PFUA 4AS1A 4I1RA 1XA3A 2C20A 3PIDA 3E48A 4DQDA 1C7FA 4YRLA 5CYOA 3R5HA 4GO1A 4WLOA 3ADPA 3AMVA 1NXWA 4CUKA 4DXAA 1M8FA 1I51A 1CB7A 1JLHA 4JP8A 4NAVA 3GQBB 4LAFA 4XDZA 4YBZA 5C53B 3KQKA 3OX1A 2GXSA 3AUJB 1TDJA 2FPIB 3KKEA 1TM2A 3Q3GE 4HR7A 3GPIA 1HI9A 3HMKA 4ZEWA 3EXEA 2Y1LA 1SBCA 4ZEXA 3JU3A 1YE9A 1UBNA 3D4BA 4HNSA 1U2GC 2QRLA 3WK6A 3OE7D 3ZE6A 3SEQA 4IFEA 4TUWA 1VJ1A 3ZQ4A 3OT1B 4BMZA 3TM5A 4AMYA 2ONCA 2RC6A 3FRJA 1G4AE 2KQUA 3GFGA 4JI5B 3KZNA 2UUBM 1TGVA 4P08A 1LBQA 2PQ6A 3IP9A 3IHKA 1JQBA 2W4MA 1Q0UA 3HRHA 3I30X 4M1OA 4XIGS 4QRDA 4O2AB 4ER3A 3VR6H 1OKKA 2B8JA 2QQEA 4LDJA 1Q39A 5DW0A 5H4GA 2Y68A 5C5EA 2FR8C 1CY1A 2G71A 5DGTA 2O8BA 1QV7A 4NFSA 4NX2A 1JFRA 2FDCA 4F2PA 3IA2A 3I4YA 3I2YX 2Z4SA 1JKJA 3TI7A 3AHGA 4OG2A 4PX3A 2J5XA 2YNMD 4RW0A 5DX0A 4ZOCA 3O26A 1VLLA 3E9CA 4IY1A 1QKIA 2JVIA 3K8QA 4MUKA 2MT9A 4L4UA 2PLFA 4MI3A 1M8JA 2ZIAA 2ZT5A 1VI6A 5DSTA 2A0WA 1FP4B 3ZD7A 3KSUA 5LDHA 5JWRA 4K0KM 3WJ2A 1N1MA 4ZIRB 2DHQA 2QLLA 3A46A 5G0WA 2V0GA 4XARA 3KC2A 3ANLA 3DD5A 3T99A 4OM8A 4Y6QA 3P9NA 3THYA 1NFQA 4L2IB 4IICA 4G2NA 5I9BA 1KETA 3AOEC 1GDTA 1YB5A 4M8IA 4MW0A 4N8SA 1B0PA 3CSUA 5EWMA 3DAYA 1IBMB 1ZOIA 3BK2A 3GFRA 4LRSB 3ZKWB 5HS4A 5JVDA 5DI3A 1UWCA 4JI7B 4MXDA 4DJTA 3QWLA 1JVSA 2JLAA 4FHDA 4QASA 3TW8A 1LLQA 4X6UA 1MB2A 1USKA 3NJ8A 1GCGA 2AJDA 4P80A 3RUDA 4DJJA 2YXLA 4FXOA 1L5HA 2HXYA 4JQOA 1R0SA 2IVFA 4GD3Q 4YRGA 1EFAA 3D6JA 1Y3CE 2PKQP 2YZGA 2GEUA 4PGAA 3DFKA 1W2WB 4FYPA 2NU8A 4DVJA 2DAPA 4GC5A 1XDZA 4XYMA 1G8JA 3PFFA 2HZ7A 4OQDA 2FUG6 2OCXA 3FIJA 4O5AA 2SBTA 4C7OA 1RJEA 4XRRA 3AKYA 2DVMA 5F2EA 2DOKA 4H4CA 4JB3A 3R0VA 4LQDA 4PO8A 4RD1A 3TIVA 2V6IA 4HXFB 4EOGA 4Z5XA 5BVGA 4BUZA 1JG7A 2Z3ZA 3F6RA 3IMKA 5IC5A 9ABPA 1IMJA 3NOQA 1T5HX 1R37A 2IUFA 3CURA 4K40A 2O6HA 5DGDA 3RYFA 1ZHHA 2DLCX 1XAGA 2HYIC 4NYJQ 4WOCA 3IHLA 1WMAA 3NT5A 4IVNA 3STVA 4X1IB 4ZDWA 5JWHA 3ORSA 2ZJ6A 2GO1A 3HY6A 4Y6GB 4F9FA 5IMSA 5SY9A 2RBGA 2OORC 2YUTA 4HBGA 2ZYAA 2NSYA 2LW7A 1XZAA 1BVYF 1CUDA 1ZFNA 3BGOS 4PSUA 2IHUA 3SLRA 3WO1A 2ZUVA 5LMNB 2I1QA 2ZAMA 1P0CA 1GZ6A 2C4HA 1AHHA 2G25A 2CZGA 4IF4A 4FWBA 2VHQA 2VF2A 2CUNA 3KP0E 3P1JA 3Q88A 4DMGA 3HB5X 4M8NE 3UJNA 5AI5A 1HKHA 2C8KA 2Q4OA 4I1IA 1MZVA 3L1KA 1S6YA 4YUZA 1L4MA 1SBIA 3UT5A 2FSUA 4NBVA 4GUAA 2F4NA 2QRUA 3KWMA 3MMXA 5BSHA 2IS6A 2GRJA 3O4JA 4R98A 1MKYA 3RS0A 4YRKA 4D0RA 4PCVA 3FLEA 2AW3A 4Y2VA 1JHOA 1XPJA 2RHLA 1A82A 3BHJA 1DRUA 2FV8A 2GA9A 2X23A 4IV5A 4QXPA 1RI5A 1RXWA 2J4CA 5F9HA 4Q9IA 1SA0A 5HRAA 2C1EA 3OF3A 3QM1A 3NYWA 4AF8A 1G6HA 2I7PA 1X7GA 3B1ZA 3EY4A 1FFHA 2D2XA 3C6BA 4KK4A 2GVZC 4OTZA 2QRHA 2Q5CA 5H3LA 3BRWD 3DLTA 3AM1A 3KFLA 2QL6A 2C5SA 1WAMA 3GWZA 1N7HA 4LDAA 1I7QB 1GG8A 1QANA 2L17A 3I5YA 4HAOA 5CMLA 4E5DA 3C8UA 5H80A 4BYMA 4DLBA 1H93A 2ADMA 2GEBA 2AEJA 1FDWA 3W77A 1OGJA 1MB3A 5ECGC 4CLXA 4D7AA 4YQFA 1DC3A 2PPVA 1PWYE 1S2IA 1W0KA 3CSDA 2P2ZA 4E1AA 1EQUA 3RTGA 3M4YA 5FBLB 2ET6A 1AQJA 1XGKA 4JP2A 1CJSA 3RRMA 2X8BA 2RJNA 1P81A 4ENUA 2E2WA 4MS3A 1OXKB 4ND7A 4QBFA 1FYFA 2ZSHA 3KTAB 2FZVA 4QC2A 1PSWA 4WA7A 3CLRC 1L5LA 1FDTA 2ZQZA 4L0QA 3HBLA 1JDBB 3JQRA 4JLWA 1E66A 3PQCA 3FFAA 3UQYS 2FPWA 1GJRA 1L3IA 1TM5E 1PHRA 3NGLA 1NDQA 4X7MA 5TQ0B 3SVZA 1QBGA 3N8IA 3A3NA 4GX0A 4HBZA 3FE2A 3AVYA 3G1WA 3HDQA 4GMFA 1U8TA 2GLXA 3Q9LA 4A9AA 4AG5A 4KQKA 3DEYX 3OTOB 2WC1A 4CTOA 2XYQA 3AGPA 1N36M 1WZIA 4TWRA 4AKSA 4MVWA 3LI2A 5CA0B 4ZGGA 3JQ9A 4BV3A 3LPDA 4L5CA 3M83A 1U0RA 5JAQA 1P4AA 5AH0A 2GS9A 4LF5B 2F1HA 2ZBEA 1I0ZA 2DZLA 3WYAA 1J7KA 3E1KA 4AI6A 5EMHA 2OBXA 2WKQA 5G4KA 1UFZA 2YQZA 2VT3A 3OTHA 3IEXA 1BVRA 1W44A 4QOJA 5EE0A 2DAKA 3HRKA 1CNMA 4LYGA 3TVYA 2MSWA 3BXPA 4ZDIA 1XEWX 1ITZA 1RYMA 4EP1A 1PBTA 5T4BA 1C81A 4ECEA 4PBRA 2HDNB 1PV1A 2I67A 2PO7A 4D74A 3T7IA 3D7NA 3I64A 5KSOA 3PGVA 1LVUA 3AYXB 3UM9A 1XK7A 2H57A 1XZPA 4XJXA 1LQUA 4DJFC 3WKAA 1Z5UA 1P5JA 2LCFA 2YWBA 3H8VA 4PS1A 2AG8A 2MSCB 3AV0B 4RY2A 1GU7A 2DFPA 3HN7A 3MG9A 4FLEA 2Y05A 1E5TA 2VNSA 3ZUPA 3L43A 5AQ1A 3LUJA 5CGQB 3UIEA 1TI7A 2O2SA 3A32A 1UFQA 1A72A 2PQ0A 2QRGA 3VVLA 2F9LA 4RTNA 4OMDA 1ADYA 1IN7A 2NP7A 5KWIA 4AO6A 3COYA 5CH5A 3JW8A 8ADHA 4D46A 5C5IA 1ZJ5A 3F8WA 4KKXB 4YQEA 1Y9EA 1R8SA 3NH6A 4A16A 2OSVA 3Q9NA 1V6CA 1ZR2A 4P32A 2CLOB 3B1WA 3DA8A 3V4OA 5L40A 3G7NA 1YR2A 4TWZA 1W36B 4UQLA 4CQMD 3VHXA 3TLXA 4BB0A 2V1UA 2GFHA 3E82A 3O2SB 3HB9A 5JXWA 2L19A 3SZGA 2Q3HA 3ETLA 4DLLA 3D5TA 3AHFA 4J2TA 4V1CB 1QUTA 4B7HA 1C7QA 4R1OA 2C54A 3L8HA 2UUPA 3CRVA 3P8ZA 2NSHA 2WTMA 1ULAA 1HZZA 2IF0A 2WI8A 5E1OA 2NUAB 5AXDA 1HR0B 2CHEA 4CGYA 2R8BA 2V9CA 3I1FA 5CM9C 1LWOA 1XPOA 5B55A 2CY0A 2B5OA 2QZ4A 2Z6VA 3IALA 3OPNA 4IDNA 5DWDA 2ZS9A 1NFRA 3UW1A 1DL5A 1U0LA 3V7NA 2WMNB 2XWQA 2OO9A 2P90A 4URHA 4DS3A 1U5AA 4E08A 1UC4B 1GRCA 3SI7A 1JR3E 1DBVO 1AQ6A 4NNPA 3WGHA 3WV4A 1ZGBA 1F4VA 4HJRA 2EHJA 4ILEA 1Q95A 5JJBA 5L6LB 2OXTA 4TQ9A 4MIKA 1J5PA 4OY3A 4MKGA 4R31A 1PS0A 3BPSA 1ECJA 1EVEA 1G5PA 4XJSA 4FPXA 3VR6D 4QTYA 4DAOA 2MTBA 3QJYA 2Q5OA 3JQ7A 4MR9B 5I9MA 3G0IA 4HFNA 3PFHA 5E4FA 4B9AA 3MYRA 1GCOA 4JI6M 3JQEA 4RSHA 5K45A 5FCDA 5JDCA 1VL5A 3E2MA 3OIFA 4B3IA 4L4SA 5ECWA 3GDOA 2GCIA 3AOEA 2ZIFA 3AIMA 1D0IA 3HPQA 5ENVA 3GNQA 4L76A 3VGJA 4PCZA 1KHHA 1NF3A 3VO1A 1T9DA 1CULC 2FP4A 2QNBA 3C41J 4KRGA 2JNHA 1Z4MA 1QUEA 4KRXA 1T1JA 3T34A 3UJHA 4EO9A 5KNCA 4WH0A 1LVGA 3CH6A 3QY9A 5HP4A 2VNKA 1FYVA 5HUHA 2ISCA 2PGLA 3MB8A 1E79A 3KAJA 2LWXA 1CHDA 4OV6B 2A57A 2AMLA 2FZ4A 1J1IA 3O9VA 4I14A 2FAXA 9GPBA 3AP1A 3BQMB 4WNIA 2GEFA 1ORWA 5CNMA 1DV1A 3F3SA 3FUXA 4M0DA 1CE8B 3NIFB 5F76A 4G81A 3R7DA 4DAEA 5ITZB 2BFOA 1WKBA 1CUXA 3C3BA 4G5GA 1X7DA 3WKEA 1A8PA 4PU0A 1N9KA 3I2GA 4Q9LA 4ZRMA 3X1WA 4QYMA 3DULA 4X97A 5A5GA 4KG7A 4DLAA 4CM4B 1JLRA 4Z54A 2MSKA 5ITVA 1B76A 2LR0A 4J0QA 4Z8YA 3R9KA 3OU6A 4Q4JA 5CA1A 4AUMA 1RCTE 4JEHA 1GV1A 2AOUA 3O4RA 3JAMS 2G1JA 2FW0A 4GYWA 1G3RA 1VB3A 2GN9A 2JH3A 4DG8A 3KE9A 2R79A 2QD1A 4N0DA 1NP7A 4YRTA 3F74A 2VQFM 1PFGA 2IZOA 3OSZA 4Q9AA 5D5QA 1WU8A 2V6MA 4YIHA 3AFHA 1P3QQ 3SFTA 4MLCA 3QYAA 4FIZA 4HQKA 5LXTB 3RBZA 4RIIA 2QF7A 1YE3A 3UAWA 5LZ2A 5B2EA 3ZZNA 1C1DB 2QMEA 3FNRA 3IS3A 3EA0A 5I9TA 3SYKA 2TSYB 4NHOA 4PHHA 2Z95A 5KAPA 5DK4A 1EVQA 3GARA 4GFDA 5LYYA 1JPJA 4F2WA 1H22A 3DJYA 2IQIA 5ENZA 2DAIA 2A1UB 2GQ0A 1I24A 4GU5A 4OFXA 3SQXA 3AVVA 3SJAA 3SOZA 1QHSA 3HKDA 2Q7OE 1XT6A 3V3KA 3RHFA 2OCBA 1QTNA 4EA6A 5ESDA 3RNLA 3D7KA 4HH4A 1ISGA 1HDIA 3PZRA 5EKUA 3DXYA 2NZUG 3LDAA 5D3QA 4EJSC 4M9UA 4GGPA 4TKVA 2F9FA 1THZA 4F21A 4ZGBA 2ENUA 3DKPA 2ANCA 2X5NA 1CFJA 2B8TA 4NXMM 4D6YA 3JRNA 1QYRA 3MQFA 1CY4A 4K81B 2HRZA 3T1HM 4N9WA 3EMVA 7ABPA 3OQ1A 2ZTMA 3KQNA 2BJVA 1DBWA 3BVPA 4V2IA 1NN1A 2CF6A 5FHRA 1E2UA 2X22A 2Q9BA 5BSTA 5FTNA 1E18A 2R87A 1EDDA 1HEUA 1ZNQO 3DBHA 4QXOA 4RPHA 4MJ7A 4FR0A 1U5BB 1YDFA 3QUAA 2HBRA 1CJVC 1MMFB 5COAA 2NPIA 4J0EA 4W4TA 3WX0A 3EEQA 2PNFA 2HKJA 2JD2A 2CN1A 2VRNA 3OIUA 4OLHA 5SY4A 2ZSJA 3TN7A 3WLQA 2R25B 3BDIA 4FHZA 3VO2A 3HKBB 4MLDA 2YJ6A 3G2JA 3ZCSA 3A58B 3RTBA 3H1TA 1C9KA 5K8VA 1NF8A 3L7AA 1UPUA 2X0FA 4JLJA 2EQ5A 2F43B 3LXRA 2KWIA 3CH4B 1NF9A 4DR3M 1ZVKA 3KCQA 4Q18A 1P1IA 4YI5A 1JZTA 3JQGB 3KXIA 2FUG1 1YKSA 3ZTWA 1BXGA 3H17A 3KKNA 3ONVA 2ATXA 2X15A 2BFDA 4NOMA 2B21A 1RYZA 2OGWA 1GLGA 4M86A 3IX7A 1V7QA 1XA4A 3O3NB 3OZ7A 5AW5A 1E3WB 4S2UA 5AOBA 3BD7A 4CUJA 3KS9A 1D1TA 1VIVA 3LTNC 4IP0A 4WKPA 1EE9A 4JI7M 1FU4A 1M9NA 1MV8A 2W8BB 3HYTA 4HFRA 5G0VA 1JN0A 4N82A 3MJVA 3NIGB 1R66A 2NO9A 1LGYA 3VC3A 4EHKA 4Q7KA 1C7YA 2IGTA 3I04A 4OGKA 1RZRA 2ZIXA 4LJ7A 1X38A 1YIDA 2J46A 2WAMA 4FZVA 1ABBA 1FFSA 3C14C 2OUKA 4M9QA 1M10A 2J0SA 1JHRA 2B94A 3C1TA 2YY5A 2HYDA 1LWNA 3Q98A 5KYNA 5DNYB 4W9NA 1J8VA 5DXJA 3WWPA 1X92A 2WSCF 2ORYA 3R41A 3THWA 3ND9A 1QU2A 1T3TA 1FZTA 4D79A 2O59A 3PIRA 1ZAKA 4G0QA 7GPBA 4NONA 1PT7A 5C51B 2DI0A 2REBA 3EODA 1JAHA 3SZ3A 3FMIA 3JQBC 1D4ZA 4ZN6A 5I4IA 4B3XA 1N8TA 1T4MA 1W4BA 1NVKA 3DOHA 3ETCA 3KR2A 3ZZUA 1NUPA 5DIFA 4CMKA 2G83A 3ER9A 5EXPA 4IJWA 1V4NA 4D9BA 1M66A 1F0KA 2Y99A 4F3NA 2QB5A 3KKMA 2XZPA 1B15A 1J21A 3IMGA 3LHSA 3X1ZA 4BGEA 1ZITA 2BELA 5CNJA 1I2AA 4RLFA 3GRFA 1NHGC 4TV8B 8GPBA 3MSXA 5HM6A 3W2IA 1GEEA 1KQNA 3E21A 1U3GA 4BZZA 4YPOA 4A1FA 2WYWA 2HL7A 3KPJA 1UJBA 4OQLA 4MI6A 4O0MA 5FEUA 1YQXA 1XZCA 3DE2X 2C3PA 5AR1A 4NC6A 3A11A 3AM5A 4KXNA 4TL9A 4DCOA 2QX6A 4XJVA 2UU9B 1QHXA 1WHSB 3FOEC 3S8MA 3IBSA 2OO5C 5JALA 1OB2A 3WYBA 4ZFNA 3EF3A 3U37A 2GCOA 1NIJA 1BDJA 2AC4A 1GUZA 1UPBA 2B2CA 3PQ2A 1QGED 2BFWA 2GPNA 1AH2A 5I6DA 2XLJA 2X14A 3L7KA 4URZR 5B6IA 3A3PA 1KO5A 5G02A 3LJKA 3V97A 3T1QA 4RWEA 3QNUA 4JYPA 3SZRA 1E32A 1JBQA 1T2NA 2HO4A 2QQ0A 1WJ7A 2GETA 3GLTA 4CIYA 2I4RA 4JVNA 5GJCA 2RKOA 4ZJPA 2DFTA 1KWGA 4OIMA 1J8DA 1CUEA 3K1TA 1C9MA 4ASUD 1I5RA 4V0RA 2ATEA 2CZQA 2GZSA 2YVKA 3A04A 4BJHB 2DGDA 2QA5A 4LNHA 1AA6A 1Z59A 1JT2A 4EW6A 3M4JA 3IBGA 1O87A 4CIDA 4ND8B 1MPXA 5KTYA 3QHQA 5JECA 5H02A 1Z0KA 4L9SA 3RQIA 3BEOA 1K4KA 1QGYA 4R1TA 4IOKA 1Q6YA 2IYFA 5AKGA 1E1CB 3GN2A 2D0IA 5F3WA 4KR2A 2FMUA 3HKDB 4OQQA 2I6TA 1BCSB 2DZOB 1XOIA 4OXIA 4F60A 2A1UA 5G0TA 4DV0B 3P27A 2ST1A 3CR8A 5A3JA 5JCOA 4PLHA 1C7ZA 4P16A 1NBMD 1KEVA 3FOZA 3S1AA 1HYQA 1XN1A 4IKOA 2IWRA 1IOZA 1I4OA 1ONSA 1Q7CA 5LP6F 1ZJZA 4GIPA 1OOEA 3EIHA 2X8JA 4XSHA 5BXQC 1PGPA 2PLAA 4PLVA 3SATA 4KOAA 1R0XA 2HV8A 3FZNA 4KBYA 5K8TA 2VJQA 4L8FA 4AKTA 1IBMM 1MOQA 5EUBA 3T0IA 2PYZA 2ZJFA 4IGKA 3PQDA 3ZE1B 2JA2A 1R5JA 3F5FA 4HMQA 2W90A 3NEJA 1HORA 4KRFA 3U4AA 1XKXA 3ZS9A 1K2VN 1XU9A 2G06A 1JHQA 3KU1A 2AEEA 1HDGO 3LY9A 5HCNA 3W5IA 4BQNA 3UO8B 2AOUB 3JWIA 4P3PA 4PHGA 5BSUA 3ZQKA 5JNSA 3I4VA 1QFYA 4AN1A 4Y98A 5CA1B 2R5WA 2YWFA 2IPXA 2YFQA 3DKVA 3LC7O 3ZVKA 2W2LA 3PUKA 4G1MB 4DC9A 2OKCA 2IODA 1HF3A 2V5VA 4CM4A 4JXJA 4GMQA 2XNDD 1WPGA 3GHHA 2LIVA 3K2QA 3WNDA 2ZGVA 4MQBA 4DBVO 5JNVA 1D07A 1I3LA 3LUFA 4DHEA 4RTKA 5C3UA 2AG5A 3OIVA 1FE8A 4KVGA 5ITZA 5FR1A 3RVBA 2HLDD 2WVGA 4UE2A 5C4GB 1GNVA 1P9OA 2IVZA 1JXAA 1R2QA 4X8LA 4G1VA 4XDHA 2IZ1A 3UWDA 5A4AA 1PS9A 2B34A 3JR7A 5DI9A 4YMGA 4M0UA 2EZ9A 3SS9X 2IY8A 2CK3D 1CLUA 5A7GA 1F17A 4D4GA 3CLUD 3UK1A 3SHTA 3RAGA 5J4YA 4IZHA 2QPTA 4IDCA 3ZEIA 4B08A 4OHXA 2X5XA 2W4QA 1LPAB 4DDTA 3DT6A 4B2LA 4CM3A 1Y5RA 3S70A 3GAZA 2XB4A 3UGTA 2O8FA 3IHPA 2HZBA 3B78A 4TLEA 2CB0A 2IYYA 4YPVA 2ZYHA 1EE2A 1EFLA 3IQZA 4AJPA 3JASB 1P8JA 1KPGA 2W11A 4KXLA 4MZDA 2I6SA 4O4IF 4Y2GA 5EOVA 2BGIA 4DCVA 3WNZA 2A3NA 1LRJA 1D4AA 5FD8A 1J49A 2XRZA 5KSWB 1E7MA 2Q6KA 1W34A 4YMVA 3QMWA 1A7KA 1L5VA 3T15A 3BBPA 1TXGA 4MS4B 3G49A 1IN6A 2C5BA 3TQHA 4EUHA 3K05A 2J7KA 1X7XB 3E23A 5E0KB 1A2QA 1M76A 3COPA 5JNWA 3CNLA 4AYTA 4ND1A 4ZXPA 3UMFA 3RTEA 2PV0A 4QVKA 1YB7A 1RHMA 4MQEB 2VBFA 2NSJA 1PRBA 5ALGA 3RFXA 4BRUA 3QNMA 1TJ4A 2VP9A 3QMMA 4XI9A 3Q12A 1AF7A 1LTMA 1KJYA 4B8ZA 2GZ2A 3ASVA 1M1UA 2WM3A 1Q15A 3GNLA 1A5AB 3LDFA 4IJKA 4ZO7A 3VO9A 5FWXA 2NUBA 2PYIA 4BNUA 1EFHA 1I94M 1XD2A 2VHJA 3FWKA 1WMDA 2NUAA 5DPMA 3IP8A 2GN0A 4E5MA 1L2DA 4QUEA 4KO8A 1RI3A 1JX6A 1SUWA 2SKEA 4BQRA 3ZDFA 2VF7A 4Y3UA 5HYVA 5BV7A 1GILA 4TWAA 1FPMA 4XGKA 3B1VA 3H19A 1T9KA 3KUKA 4L4YA 4ERNA 5AP9A 5EE5B 2QZZA 3SEAA 2VJCA 4JOQA 2O8CB 3LFTA 3RS5A 2ODWA 3VHXB 4EW1A 1Q83A 3VI4B 4C01A 5DGHA 2FZKA 2BZSA 3R8FA 1AG9A 3UA4A 3C4QA 1RWNA 1FRVA 4KH0A 4JR2A 2DEUA 2EBWA 3DYBA 1T8YA 1OLSA 1X1DA 4QUDA 2D2FA 1LDGA 1S0UA 3H3FA 2H17A 3I9V1 4KXWA 2AOTB 4UXJA 1GPBA 4EI8A 4QPZA 2EFHB 3OCVA 4KX5A 4N40A 3H0CA 1FY2A 2X2PA 2YH2A 3R23A 4FM9A 4NABA 4PV7A 2WUVA 3O1LA 4C0SA 1JP7A 3G7UA 3OJEA 3TE6A 3H0EA 5ALEA 2XCIA 3F49S 4A0SA 3H04A 3B53X 4CDRA 4JJKA 2X40A 3J81k 1SVKA 4PYMA 4BNXA 3A2MA 4P4NA 1MBZA 2J6CA 1GZSA 3ORQA 4Q1FA 4TXJA 4PYNA 3T1OA 1G1MA 4YHHM 1NBOA 2EFGA 2R1ZA 2II6A 1R0YA 1PQYA 3D6TB 3WHLA 3KV3O 5GQSA 5JD4A 1IY9A 3FVWA 3KQSA 5B7PA 2V7UA 5A5EA 4WLVA 3W04A 3FGPA 2P5TA 2H54A 4D96A 1ESNA 1NP3A 2HA4A 2QRQA 4P7GA 1G1AA 1YKFA 3IT2A 4NPAA 4W6QA 4OX9Y 2QTNA 4KXMA 1Z26A 4OBBA 3L8CA 3CSSA 2D59A 1X0VA 4A0FA 3FCYA 4XFJA 2BE7A 3FSJX 3HEMA 4ZOEA 3BXZA 1P91A 3MGBA 1IH8A 3W9BA 4I1SA 2Z0MA 1GSOA 1KZ1A 4V0LA 4URXR 2H2IA 5JYEA 3JAMA 1K7SN 2AW5A 3SX4A 5IVPA 4OFBA 5KHLB 1AHPA 4NXMB 4LCBA 3A9RA 3RC8A 3NAZA 3X2SA 1NVXQ 3A9VA 1J33A 1WXFA 4MW6A 1ISIA 4JL6A 2IHYA 1KS2A 4G4OA 2Y6VA 3QELB 1DLJA 4RNAA 2N35A 3G2HA 3W5DA 2WD7A 3KVRA 2YMMA 4KWIA 3VOBA 4C3ZA 1UR5A 3IQDB 3D1LA 5FPHA 4JYZA 1HE4A 1UP6A 2CLHB 3DD1A 4B6OA 2VO1A 4RHUA 4Y2TA 3K2IA 3TM4A 4G67A 2YWGA 4XX1A 3U44B 1K97A 3NTRA 2O07A 4WOPA 4CKYA 3RIHA 2RGCA 5AW7A 1RW4A 4YWHA 3UFXA 2J0QA 1JDSA 2R48A 1I9CA 1NMQA 2QVBA 4W1PA 2NUTB 4KVFA 5FKJA 1ODJA 2BZ0A 3BH7A 4GPEA 2YYYA 1IN4A 2ERXA 1I0IA 1S96A 2VYCA 1AK1A 1JRLA 1LPBB 2BY4A 3DCNA 4PYQA 4UU1A 5P8WA 2P4UA 4GMGA 2X58A 2X0EA 1VRWA 1R6XA 4NC9A 4B4UA 5CHYA 4NCIA 1OW3B 2RIRA 4WTOA 2HDHA 1EHIA 5HPYB 1R9MA 2HIMA 3A1UA 3BBLA 1PEAA 1OREA 3C8HA 1UXOA 2VQ6A 1DWOA 4CZ2A 4MPJA 3WGLA 3PJEA 4F06A 2XUZA 4RVCA 1YQ9A 2Q0SA 1UZMA 2AE1A 3GP5A 4IIJF 5DTEA 2AWNA 3TLGA 4JSYA 4A03A 3L06A 5EPUA 4YMLA 1Y37A 3NHLA 1SZDA 1E1RA 1LPMA 1NBEA 1K6XA 1W4RA 3NM5A 2ENWA 3TX2A 3UOWA 1D9XA 1YACA 3QPUA 1G6Q1 2GF9A 1BFUA 2E87A 2KMLA 3A1VA 3RRFA 3WL3A 4CT5A 3H5TA 4FNAA 4C0XA 2ZTSA 1XBTA 1U6IA 1RWOA 2VYNA 3UT5B 1RZ3A 4MQ5A 4BP8A 1NLYA 4BKQA 4IRXA 4PZPA 1EEHA 4E03A 3IKJA 2ECOA 3O75A 1NAIA 3VPXA 3MWYW 3L4SO 4WESA 1ZUWA 3AYZB 2JD0A 4DGQA 4IQGA 1GL9B 4EZBA 5C4IA 1FDSA 2VTVA 3F96A 4ZVQA 1Z15A 3GZTB 5IJAA 1SIOA 2P68A 1R6TA 2CNWD 1VOTA 3OIYA 2RGGA 3B9RA 1B26A 2RFLA 2Y1DA 3CCCA 4UDXX 1LLFA 4AAYA 1ZYUA 3O47A 1P7WA 2HQSA 4GICA 1A8UA 2DHYA 3JWEA 1NBME 5BR8B 1CYDA 3JQFA 1Z6PA 3MCUA 5JFTA 1TH4A 2LGJA 3HUDA 3RS7A 5DM70 2GILA 4MCIA 3WYCA 3UJ7A 2IYEA 2QWXA 1ESCA 3G5UA 4NRWA 2AQ8A 3NAGA 3NG1A 1NMYA 5JJ5A 3LXXA 4YTEA 3Q7SA 2AB0A 3RYFB 3CJQA 1UIRA 1ZHFA 2J85A 2YC2C 1A2KC 4HGOA 5J43A 2V3CC 4ZQFA 4ARVA 4R68A 4D4LA 3G6KA 3LUCA 1NJSA 4GNKA 1PG2A 3K31A 4WNAA 3HQ4O 4PIPA 2C4MA 2P4HX 5AM1A 3OJCA 1Q0QA 1W5FA 5GVRA 1JL3A 4CKEB 2VAVA 3IERA 3FDFA 2Z1NA 4LJRA 3K9OA 3IBYA 3QPVA 1EGHA 3I45A 4RJKA 1KC1A 2H1WA 2XQVA 3RTCA 1XNHA 2QUHA 2R00C 5BPFA 2BKAA 5IF3A 2NU8B 3KUDA 5CTJA 3JVIA 2J9XB 3VPDA 3ELDA 1BH6A 2HM7A 4MEBA 2MSNA 5BRNA 3M6LA 5MFZA 4GR9A 3GMDA 4DA0A 4AJ1A 1QKJA 3L27A 1L4YA 1TM1E 1N32M 3LY7A 2JCYA 4AZVA 4XYLA 3THXA 1KI4A 2OQ2A 1K3WA 1Z7WA 4FGUA 3DQQA 3D5EA 4LRSA 1C7IA 2ON6A 2FEMA 3GIWA 1W8DA 2X19A 4HQRA 4NCHA 3WB2A 5K03A 1QS0A 3CEHA 4P8RA 3R75A 4AJLA 4GX1A 1U7OA 4L2IA 4NKRA 3I34X 2WTAA 2HD4A 2E49A 5LM3A 2NADA 4V3CA 3OTGA 5EZ5A 4HRAA 2IRWA 1CLEA 3I4FA 4G86A 5ELMA 1H6CA 1ZH0A 4RQBA 1E0JA 3ZC7B 1X0XA 4MGEA 5TT0A 2OOSA 4ZIRA 3W3AA 2CHFA 2VA8A 4I55A 1N5RA 4UVDA 4DCJA 2J3JA 2ZWVA 5M04A 4R2HA 2P2SA 3UJ9A 1JJVA 3GBSA 3VSDA 4HHEA 2M1ZA 4F38A 7ADHA 3IFSA 1IM8A 3VSAA 1X2EA 4MW2A 1E59A 2B4YA 2MYNA 2O8BB 1F8FA 2CWBA 2FK7A 3RS3A 3DHNA 2ZB7A 3RODA 1WZEA 3MTBA 4PT5A 4O2AA 2IUUA 3STHA 4B6QA 4L51A 2CHQA 4GHLA 1XTKA 3LXMA 1DT5A 2XF8A 3I5AA 3MTDA 4DJAA 2VNIA 1OE0A 3IESA 2FN7A 5M34A 2PSDA 4ZJYA 1DG9A 3Q2KA 1RYYA 5HIJA 1KBOA 3C7DB 2IV3A 5HQTA 4ITQA 3PZBA 2BEWB 4HS4A 3B3AA 5EE3A 1PR6A 1IZ8A 3EX7C 5PNTA 1E2BA 2FPIA 2V7EA 1N4AA 1ONBA 3SKYA 1EUCB 1SRQA 5JVDF 1ZMBA 4GRDA 3GQBA 3U80A 4DDHA 4F2HA 2FG7C 4GITA 3PQ7A 5IBCA 4UOQA 4YALA 3SIWA 3WGZA 4AJHA 4HDSA 4GKKM 3D3NA 2YQ5A 1P33A 5LWQA 5DK6A 4GKJM 3ZWCA 2OM6A 2XMZA 4WY5A 3VZCA 4UUNA 4KW7A 2P91A 1QR2A 2WE8A 3G23A 3I62A 1RBZA 2PSHA 3D8SA 1GUAA 1VCNA 2BTQB 1UQTA 1D2CA 3L7DA 3Q3EA 2HT1A 5ELXA 3LZDA 1K08A 1YNOA 3KB2A 1F3LA 2YHSA 4GKBA 4U6SA 4UD6A 5D5PA 2RIPA 3Q8KA 2W7TA 1IBLB 4YO8A 3REQB 3PBKA 4RZXA 3IOCA 3PEWA 2Z6QA 4FW9A 1CUCA 4AFNA 1EU1A 5EMKA 2BRUC 3KKOA 2ZS8A 5FTMA 1KU0A 1UUFA 2IHZA 3KLBA 3KQYA 4LW8A 4HUTA 3U6BA 2I8LA 1F4PA 3ENZA 3C8DA 4R5HA 4LV6A 5EJAA 1TQ6A 4CISA 3K30A 3K5WA 4LF4M 3TVDA 3K7EA 1C3OA 4DYHA 1HFEL 2COKA 3I8XA 1PI3A 4QLBA 3Q3IA 1OZGA 4RMJA 4Q34A 2TS1A 3M2TA 4CQLA 4KO2S 1ECPA 2HK9A 4TTVA 3ETEA 2J09A 2PRZA 3I4CA 4TYYA 1FTYA 4V0QA 4PAQA 3EA5A 2YICA 1JH9A 1UBRS 2OBNA 3QXXA 4GVLA 3ABZA 3W3AD 3BEDA 2QV7A 5IDQA 1NASA 2W8ZA 3GO8A 4DDUA 1FXUA 1O77A 4GKKB 4CBVA 3ANMA 4X8MA 2X2FA 4ZAVA 2FPKA 1YXMA 3RLIA 1P2BA 4G4NA 2W43A 1W9HA 2X0NA 4N0EA 1SHLA 1DTEA 4OQMA 1GGKA 1RXCA 1DKUA 1UC9A 1MAVA 1UMCA 1BRTA 1XMSA 4B40A 4MWCA 5EYPB 3IDAA 4FWDA 1LF5A 1DV0A 1I30A 1YSCA 2C0QA 1YZKA 2P77A 3QKIA 4I5EA 2P11A 3QPAA 3I8OA 4IBIA 4GECA 4L5YA 5ENDA 3TR0A 2JAWA 5IYZB 2AC7A 1VCHA 4RZ2A 3FNHA 4CU2A 1UDCA 2Q3MA 5EKDA 4COOA 4ZDKA 2ZBUA 3U4IA 3SS7X 5J2TB 1TR8A 1TAHA 4UULA 1O4WA 3RV3A 2UZ3A 4LVCA 2A1TS 2VDJA 1QOQB 2RB5A 3TCXB 2EERA 3P9PA 2UYQA 3GRAA 3PUZA 3PS9A 3F73A 1PFKA 4ESVA 5EHGA 2GJ9A 4P84A 1WCYA 1ZOLA 4MVJP 1UPXA 4P0TA 5DM2A 3ZXXA 3W1VA 2HA3A 3W68A 2Z1DA 3W79A 1PGYA 1XIVA 4QDUA 3TW0A 2HN9A 2ZJZA 4XPIB 3TD9A 1CUKA 8OHMA 5C1OA 5JAUA 1DXOA 1QKKA 5TY0A 4OYLA 1Z22A 4HL6A 3TQCA 4HXGA 4IMPA 4U2DA 4F3KA 4GXNA 3ISTA 1A4XA 2YVQA 3U2QA 1T0PA 3Q5EA 4HY3A 3BTUA 1QE3A 4NLLA 4M9XA 3LRXA 1K66A 1RCFA 1RM0A 2YW2A 2JDIA 1A9PA 1G20B 4GZMA 3O1JC 4K26A 3FI0A 1UKCA 2J5KA 5KYGA 3DE1X 2YNMC 1Z2OX 2BUCA 5BR8M 4EUEA 1ENYA 1PN3A 3E0QA 4RX1A 1WGNA 1KIFA 4YJ2F 5I9IA 4QYWA 1RABA 2Y0QA 1RC0A 2ZJOA 1B16A 3A36A 4E5NA 2UYYA 3LSYA 3SASA 1KNXA 1N25A 3GUVA 2IP2A 2ZEJA 2WAXA 3PI6A 1CJMA 3DTVA 1R0ZA 4W8HA 1GPWB 5LC1A 2HL6A 3LXUX 2ZCUA 3CS3A 3WGUA 4YV7A 2CZCA 2GBIA 1P0QA 1EKXA 1Q1BA 5J2TF 1HTBA 5EN4A 2MMGA 3RABA 2VTBB 1CUUA 4YDQA 2I78A 3P4UA 5IARA 4ER6A 4LG1A 2XBMA 1Z25A 1HLPA 2PWBA 1K7XB 4WZAE 1MAUA 3HA7A 3I9MA 1TTQB 3EE6A 1G5QA 1GG9A 4MUFA 2NVBA 3LGSA 1KH2A 1C41A 4D4MA 2YWJA 1FU8A 1U0GA 3BRCA 3C6QA 2QM0A 3EZ7A 3I6MA 2VHTA 1G7TA 4G56A 1DJPA 2ILVA 3AVPA 1MQ8B 2VT6A 5GIPE 1YDMA 3CEPB 3OE4A 5FL7A 2HFJA 4OGGA 1KHTA 3GJYA 4Q6BA 2L0XA 4TMXA 3ZIDA 4CNQA 5DEOA 1QF9A 4DL9A 4QD3A 2WD8A 3PFGA 5KTKA 1GV0A 4OHMA 3CE6A 4R2XA 3RR2A 1PLJA 1S2DA 1UDAA 1RHJA 3OE5A 4G97A 1NN0A 3SYTA 3W5JA 2BZGA 4YP1A 1M33A 4EHJA 1EVYA 3OD1A 3PTZA 1EUZA 1Y1SA 1YZYA 4UVEA 2WIFA 4JROA 2W0SA 3WK7A 3WMFA 4EH1A 3RYCA 3BHMA 2BGJA 1BGVA 1OAOA 1HJPA 1YR1A 4X6XA 1RJDA 2B78A 4OAQA 5K99A 1OKSA 1BJRE 4WGFA 4CF6A 3INTA 1WF3A 2PZKA 1R7RA 2P30A 1C1HA 1OA1A 3HVHA 5DYYA 3U1BA 4RZIA 2PUFA 4I9GA 2OOAA 1UDXA 2OBLA 4UMVA 1AQYA 3DFIA 2JAOA 3E8SA 3H4TA 5ALWA 1XYGA 1SMKA 2HGZA 4PW0A 2QSFX 2ZBDA 1QPBA 4RC9A 1KF0A 2MMCA 1FMLA 4L6IA 3R77A 3G1UA 2HPAA 4LZWA 4OGWA 4P58A 5KAMA 1P2GA 2X9QA 4W5HA 3EZGA 5SY6A 3LQRA 4ZQHA 2P9JA 4BP9A 1Z0ZA 2FN4A 2VHCA 3W8FA 1Z2CA 2FMKA 2FR1A 2WWYA 4FIDA 3ZOKA 1H8HD 3AEQA 3NPMA 3R44A 5BSKA 2RH8A 5L9AA 2VEDA 3ZNOA 2QP4A 2V7PA 2CK3A 3DZFA 1BEEA 3QKUA 1DNPA 2Q0XA 3VAYA 1EUCA 5T67A 1DKMA 3MF4A 4AF6A 1KOLA 1XTJA 4QECA 1Q0RA 1K7EB 1EI9A 3OJWA 4MVJE 4FUTA 1IFXA 4QFBA 1MO3A 1PJBA 3OP4A 2HA5A 4QT4A 3TX6A 1X8KA 2FN9A 4E30A 4YRJA 2NW6A 4V2UA 3ND8A 2QZ9A 4JI2B 3G0CA 4XIIA 4EA9A 5HM8A 3EPJA 3QLVC 3ROFA 1WXQA 4DSOA 3ANXA 5BYBA 1B6GA 1R5NA 3RVLA 2WIKA 4B83A 3QWFA 3VPFA 1NATA 3M7GA 4KQMA 4Y2UA 3ZPXA 3PHLA 2G7ZA 1WDWB 2HKIA 4TS3A 2WU4A 4UNSA 5IT5A 2OHGA 5B3AA 1T26A 4H0FA 1TRHA 3MINB 3TB6A 4RGVA 1DAEA 4O2BF 4L5IA 2JCSA 4FDTA 3PGMA 2P3LA 3R6DA 4TRMA 4FB4A 1KY2A 5A0TA 4Y2XA 3DEIA 3MTGA 3MUNA 1OVMA 4QAQA 3CEMA 4KZKA 2GERA 2JZ0A 2WSFF 3V8NA 3QWBA 2OCDA 1T13A 4I55B 3WI7A 4AU1A 4BAZA 3E8XA 1USIA 3FWPA 2L7HA 1ZM7A 4HNRA 1NYQA 1Y63A 2B3TA 4TT3D 1EX9A 3AC0A 5HIIA 2P9EA 1TVKB 1YZTA 3CGGA 4ERXA 1XHLA 2AMYA 1LPNA 4ZREA 5LL6P 2QXTA 4ZRDA 4P38A 3EARA 2NX2A 1QS0B 1AB5A 4TQAA 1Y1LA 5FOVA 1TC2A 2NSLA 3A05A 5CCDA 1Y3IA 1XXHB 4YDRA 3M81A 1VL0A 3LPLA 4ZI2A 5LIRA 1B3RA 5JLJA 2G3QA 5FLKA 1W4AA 3TZEA 4J0DA 1P72A 1JVNA 1LDBA 4I46A 4EG8A 2ZANA 1AQUA 2ZYGA 3C7CB 1HQCA 2RGOA 3EQ8A 4U7JA 1KE2A 3UK2A 4KUEA 1CJKC 3M49A 3NV9A 5ILOA 4F45A 3BWVA 1O97C 2XT9A 5HKLA 3GOHA 4LHYA 1HNWM 2V4ZA 1PGQA 2Y0BA 2ZB3A 3ZU5A 4C6TB 4FDUA 4QPJC 2QS9A 3D8HA 4S3MA 2QRVA 1LXCA 1Y48E 1T2AA 2Q0QA 2OYCA 3ROGA 3P19A 1SQFA 1FXSA 1X8XA 3DONA 4W5OA 2O19A 1ZGHA 4YR9A 1TK3A 3NONA 1V1JA 4M7PA 4WASA 2C84A 1IZ0A 2GJ4A 2YDYA 4IEEA 4C29A 2AJLI 2NTYC 1E3IA 1HETA 4L3VA 4P83A 4CNBA 2QTCA 3A42A 4EGSA 1EXVA 2Z9CA 3GYGA 1F8YA 2GXQA 5E9AA 3V6MA 1RPAA 1LU9A 5KX5F 1WEKA 4DLZA 3VM6A 2K7ZA 3UNXA 4D4HA 3E9SA 2ODPA 2ZUEA 2JHFA 3F6SA 3F4KA 4G5HA 4A10A 4F5WA 3CVVA 2BNKA 2H92A 3R2JA 4ZCTA 5J4KA 1E9RA 4PO1A 2FG6C 1X37A 2QNJA 2WF9A 4CF7A 3U6PA 1NP6A 2JIDA 3OMLA 5BO5A 2BLNA 4EUSA 1UK7A 3SQMA 2FP3A 4AYXA 3FM9A 1DTSA 1M2OB 3FYSA 4O2BA 3I3SR 3Q5DA 4B35A 2ZJ2A 5AICA 5L4LA 1PJ3A 1PJIA 2D54A 2OZPA 1UMBB 3FCUB 1P39A 1FYXA 3WG9A 2FPLA 1Z4IA 4LQCA 3KWFA 2DWUA 1E8DA 1I14A 1PG5A 2XB9A 3AHDA 2LWIA 3C5VA 1Z5OA 2CUTA 3CEJA 2D1FA 1KS9A 3E53A 1S1MA 1U4SA 4HLNA 4E6PA 2AX3A 4RKRA 1XLWA 5AKKA 2RAUA 4PLYA 3HO1A 2WWWA 4Y7CA 4QOGA 3QUCA 5ITSA 4OHBA 3KEGA 2FPGB 3C1OA 4EDHA 2J41A 1G0NA 2MWMA 1TCUA 1XNQB 3KFVA 3FKEA 3IT1A 3KHTA 3P9CA 5DO9A 3TBKA 2O2EA 3VR1A 3ZUGA 2YS6A 4HB0A 3F8TA 1RXYA 5D51S 3U1TA 1YT5A 4U39A 4U9IS 4ANRA 2H9YA 2PS1A 4ZVVA 2IYUA 3PRHA 2FA9A 4JWKA 5HKOA 4M0WA 2W48A 3DT9A 1E6WA 1AN9A 1VG9B 2CLEB 2P6UA 2ZIVB 2QUZA 4JC5A 3LT2A 3QTLA 4HAUA 4U7DA 3ZDDA 3MOIA 5KMGB 3AHCA 2Q1UA 3B2NA 5LXTF 4BVEA 1JEYB 4RBNA 2QE7D 4JZKA 1NBAA 4QVIA 3EDYA 3M1YA 1O5IA 2FX5A 5FFMA 1FUEA 4RFSB 4O4JB 2VYVA 2EP5A 1CDZA 3HUFA 1EK5A 3IR5A 4FS3A 1IEWA 2P9CA 3P45A 4YT4A 3LHDA 3D02A 3IKVA 5NLLA 3KXLA 2Q7DA 2NUTA 2V9PA 4PFJA 4NIMA 4B79A 4BLWA 5HMMA 1QVZA 1NLZA 4E94A 1SKYB 1YDGA 5I4KA 3ZVNA 1BW9B 3KQPA 13PKA 2O0KA 2QUBA 1MF7A 1RWBA 2TECE 2WJIA 2ZRFA 2CP8A 1NA5A 3L1JA 4JSTA 2ASEA 3D5QA 4Q93A 2IU0A 4EYSA 4YMTA 5JPDA 2IYNA 3VKGA 3KPUA 5C8YF 1J2TA 1W93A 2ZB4A 2ZWOA 1IIBA 1FFXA 3QELA 5DHQA 1E1RD 3NZEA 5DHAA 3TLCA 3UOAB 5ADWA 1M6VB 3CZPA 4H1UA 4RF4A 5DWQA 3RVSA 4BFWA 1ECLA 4RD4A 3FXAA 1NWCA 4MYHA 3IPRA 2QL5A 3JYLA 1RRPA 2CXHA 2I3DA 4I2VA 3BIXA 4D92A 1W36D 4URVR 1FZQA 2QVCA 3SICE 1EB9A 1WM1A 4MKHA 2CE7A 2H2HA 1VHTA 3LHIA 2PNJA 1OGYA 2R6R1 5AI8A 2F3SA 2BM0A 4I50F 1NVTA 3EK2A 3G79A 3A2NA 3QYFA 2XMCA 2YVUA 4ARBA 1XYVA 4LJ5A 1CJCA 3C87A 3SZUA 1VDLA 1JTVA 4KOEC 3HB4X 3I6BA 4KWHA 2G67A 3SM9A 1XCOA 3U5ZA 1C2TA 1PNOA 4LRUA 4QICA 1ZN9A 1QDEA 4G26A 3AK4A 1XA0A 3PUIA 5CLGA 2H7CA 1NGSA 4LFCB 2CNOA 3IAS6 1KDVA 4Q7JA 1OI7A 3OECA 3P52A 2XADA 4BKUA 3FDXA 3B9QA 3OUTA 4PQFA 4EB6B 3L25A 1Z75A 2XOKD 3TIFA 2HI0A 1ZA1A 1LZLA 1CZUA 2RKWA 3ZHSA 1XCLA 3REOA 5LVAA 3OZDA 1W2HA 4C0LA 2O4CA 1YRLA 5ALKA 3DDHA 1OLSB 3DV0B 1A5BB 3H99A 3IAM6 5CCEA 4HDCA 3R0ZA 1HTWA 3PF9A 3TCKA 5BW5A 4M0KA 2Z2KA 4G5SA 4NHEA 4F3RA 3L5OA 5AW8A 4CR7A 2F55A 1FFDA 3M4XA 5GTDA 4IBKA 1VMAA 3CIOA 3E9MA 4DDMA 3UB4A 2QAJA 5JH7B 2YV5A 1AUOA 2KLBA 1C9YA 5DFAA 4KJZA 2CWWA 3IR7A 4NDNE 2DSNA 5EAIA 3SBDA 3WK8A 1JIXA 2QVZX 1NW9B 5DW3A 4Y1RA 4CODB 3CH7A 1GTRA 3I61A 4WJZA 4HAZA 1AXRA 1IEXA 4JB0A 3JARB 1NLUA 1KK0A 3HVIA 4FTWA 4AZWA 3U7HB 3O84A 1TTTA 3NB0A 4H08A 4RKEA 4XUEA 2VP5A 3N6XA 121PA 5FA6A 2IKQA 5ED4A 1XNRM 1G5RA 1L7NA 3W6NA 2PMFA 3QW2A 5KNBD 2NMVA 1X7XA 3GG2A 4DN6A 2D7EA 2NU6A 1G6KA 1YRYE 1G21B 2CVPA 3WGKA 1V39A 2V7VA 3O9ZA 4H3VA 4TS1A 1DWPA 2W93A 2X1MA 3AJAA 1XTZA 3ZYZA 2XQFA 1ES9A 1LI4A 5AHOA 1ZK1A 3GG9A 3D0RA 1DZIA 1RJWA 2J8ZA 3G2PA 4LYYA 4R3DA 2C29D 3PE3A 4PCLA 1IHPA 4K6GA 4RTOA 1LKZA 1ISMA 1IZZA 5MN5A 3FB4A 1U5CA 4MKXA 5BQFA 1GNTA 1XB2A 2GPJA 3CW9A 4KE7A 3I01M 3NTOA 4QPPA 2FHSA 2G17A 4BJ5A 3VNSA 4O4HF 1G21E 1Z06A 3PFIA 1ZXLA 4FVMA 4GBED 2RHCA 2BSAA 2FR0A 3GGOA 1H42A 4EKYA 4BTLA 1ZD9A 2OZVA 1G3MA 1AKUA 1GUFA 3MD9A 6REQA 2J0VA 5KOYA 3WFIA 2B0JA 1CW2B 3H1PA 1D2HA 3SIXA 4GOXA 1X3LA 2VDMB 2MDTA 2WT8A 3ZQ6A 3AZPA 5CVCA 4FP9A 3OY2A 1U2PA 3FVRA 2GAJA 2PD4A 4RQUA 2Q6TA 4NJOA 2X1HA 3HU2A 2WSMA 3H83A 2Q8PA 4N7MA 3GAFA 1SKMA 3P5SA 3MIIA 3L9WA 1TL7C 3OETA 3GA5A 1IYZA 2AF3C 4CR8A 4KSYA 1NVUQ 3KLMX 4Q3EA 5DULA 2VQFB 4MO9A 3N58A 3HGIA 2JAQA 1EFPB 2ZIWB 3EPPA 4AQYM 3RHTA 3TFQA 1QDRA 1CJBA 5AKIA 2JJ2D 5AFSA 1V8ZA 3RGWS 4EABA 1G42A 2L69A 2ZJ5A 4RXMA 1OWOA 3NKFA 1K68A 2XR1A 2WWFA 3CZ4A 5GGXA 3EPKA 2RJ3A 4GI5A 5CLIA 1P5FA 3ZE9A 4D44A 1KSHA 4Q1CA 4F85A 3LPCA 4HNVA 3FCOA 4O2AF 3L1UA 2WMYA 4AMBA 1D0VA 1RQ2A 1QLHA 4WXYB 5JW6A 4O33A 1MO5A 3CLSD 1IAQA 3AM3A 3DL0A 1RT9A 3CRQA 4GW3A 3IJEB 3BK7A 1KDPA 1X9IA 3GNTA 2V96A 4KZPA 3W6ZA 3M4NA 1SEPA 3K9QO 4IIJA 5AJWA 4M4SA 4UHJA 4PG7A 5J23A 1L5SA 5AKZA 5JY1A 4C3VA 1IBLM 2CV0A 1BCSA 2F48A 4GAEA 4MVJD 3JR3A 4K8OA 3WKBA 4O3FA 4RQTA 4NULA 1E1CA 4WXHA 2H8KA 1IOVA 1XP8A 2GN6A 2WW8A 4K0RA 3G2OA 1TECE 1ZWLA 3P32A 2WJ3A 3MILA 3ZWPA 1YQEA 3GLHA 2QQ8A 3GPXA 3AESB 3CUUA 2QMZA 3MGAA 4JASB 4MOWA 4KSBA 4ZZ2A 4RIEA 2XRMA 5JNUA 1EGMB 1TTPB 4N7RA 4IJVA 2AVNA 3W5VA 3ZNQA 3Q7RA 3DH0A 1KDZA 4F1KA 2G9UA 1L5WA 3KNZA 2JLYA 3D6NB 2JHAA 4YV0A 2AKYA 3R4CA 4NRVA 4UNQA 4BNHA 5I9LA 3OI7A 1IUOA 5J2UA 5A9SA 1RP1A 3QBVA 3QJGA 4YJFA 3TYXA 2PH5A 3LPMA 3D2AA 1XQ9A 5AMXA 5JSFA 4HI0E 1L2TA 3TRDA 1ULUA 1DAFA 2F7SA 3EVDA 5ALZA 5LMUB 4JLSA 1GFWA 1PE0A 2W58A 1YWGO 1CY8A 3D4IA 1SUEA 3JYHA 3MAGA 4EY6A 1U6JA 2CFRA 1JJ7A 3C97A 4LSZA 2N1MA 1KH3A 3ANYB 5T4FA 1XNJA 5KJCA 3A98B 1C5KA 1NX6A 4QGFA 1HDOA 3I6QA 4ZCPA 4CRWB 5BRAA 3NHAA 4M98A 4LF7M 2QD3A 3SU8A 3PVSA 4QHTA 4HT3B 1WSWA 3K70B 3A4IA 4LC9A 1K8ZB 1VYTA 1NVAA 4TV8A 4GPBA 5GOTA 3SPXA 5KYWA 3F98A 4PLGA 4RELA 3ZIAD 2FEAA 2A0FA 3G2IA 3GDGA 1SIUA 2JBAB 2VYVD 2A4MA 4BQFA 5EMNA 3RJ5A 2RCNA 3GFSA 3PUWA 1OUMA 1R4GA 4CGZA 4WUVA 1QGDA 3UCXA 4JQYA 1X39A 4FDMA 3GU3A 3K9PA 2DH5A 3FVQA 4D5EA 5U4XA 5CXUA 2W6PA 3PNKA 4JI3M 1UK6A 3R6TA 3OOJA 2HWYA 4YACA 1NUHA 2XCUA 2ZG6A 5CYFA 4YRDA 4BLVA 4BNZA 1PSZA 1U2DA 3FOFC 1L4LA 1WPXA 2C82A 3R3HA 3V34A 1UAYA 4YP9A 1MX5A 1P6QA 3AFGA 3GCXA 2XYGA 2V6JA 2QLMA 1BJTA 1VEGA 4FYIA 3KKPA 1T91A 4C30A 1BE0A 1PV4A 1PYDA 2BFMA 4PAMA 4YRNA 1BSVA 2A9FA 2RHRA 4RZHA 1A76A 3EJ6A 3BFKA 5L45A 4J7AA 4R1LA 1QNFA 1CUSA 2HLPA 4M21A 2JY7A 3KPYA 1QH1A 2DWOA 1PX0A 1V8PA 1J2EA 4OHRA 5K09A 3ICPA 2ZIXB 3CLHA 1GA6A 2MYPA 2Q7XA 3L5KA 4G23A 1VDMA 5F35A 4ZC8A 4E22A 3A9TA 4MH0R 4OYHA 3TUJC 4WSOA 3IDSA 2JBAA 3SQLA 4BYGA 1ORRA 1N5JA 1NYLA 4CG0A 1TOAA 4UHHA 3WL5A 2B6NA 2ZRDA 1UFKA 1E3WA 4F84A 3LQYA 4HOYA 3TZ6A 3ETDA 1PGJA 3SC6A 3HSYA 1E5QA 4DCMA 1E60A 2FFAA 1P7PA 2IZ0A 2GNAA 3R9WA 4R2IA 4FR2A 1N78A 4LKOA 2BFDB 4ZYUA 3UY4A 4HZUB 3ROPA 1ZD5A 2JJQA 3CNNA 1YR7A 4DRYA 1M2KA 1XJCA 1BEUB 3GMSA 4CLEA 4CT0A 4DV1B 4K03A 1NSFA 1W88B 4X3PA 1GYQA 1QOPB 1Z17A 2JRLA 3OF2A 2FFJA 3E9NA 3LL4A 3BJIC 1SU8A 4P3NA 1D6SA 2EZTA 4OXNA 4ONEA 4EKGA 3V7FA 3BBZA 5KS2A 1WETA 2JCGA 3GJTA 4IZOA 3V2HA 4F96A 1NUAA 3DTYA 4NU0A 5A9SB 1J0DA 2Q5JA 1JJFA 2WWHA 2EZUA 4GQIA 4WD3A 1U5BA 3FYTA 1J90A 2ZE6A 5E8JA 4POAA 3NWLA 1LY1A 5JH7F 2O2CA 1A2BA 2A0XA 4S1PA 4EG6A 1WOMA 5JZSA 1VE5A 4OW0A 1ZSYA 1VIMA 4N3GA 5DE3A 5KCMA 3W9YA 3H9QA 2I7CA 3L7MA 5DYTA 1PUIA 4MB2A 4EZIA 2RI1A 2I7NA 5KNBH 1H05A 3PR2B 4ZVOA 3GLHE 1DJLA 2E5FA 2R00A 3A7EA 3F5SA 4TLBA 2JLCA 4DB4A 3WGMA 4QO8A 3BXFA 4EUKA 2JD1A 2AOXA 4HEJA 4BECA 1E99A 4H16A 1OAAA 1KFKB 3AVTA 4YRAA 5AIBA 4IIJB 2BMDA 4LA4A 3OKFA 2VZ9A 5E6RA 1UDRA 1GHTA 1VKHA 3OLQA 3IT3A 3B38A 4GVPA 2Q8QA 1JEAA 4MQLA 2PMKA 3WIVA 3GUHA 4YHBA 5BW6B 1BMDA 4GEGA 4CM5A 5KTPA 3C3AA 4QXAA 1F0YA 3L7YA 2L4FA 4RHYA 3ZD9A 5GIOE 2CNWA 2EGHA 3PXCX 4TV9B 1E1MA 4KFCA 2AHRA 1BNCA 1AKTA 2SECE 5K6AC 3CZAA 4B17A 1ZK3A 4E31A 2ZRHA 3ABOB 4XD7A 4J4TA 1ZUHA 3OA0A 1G2IA 4XGQA 4JV5M 4E33A 1R5OA 2DQ4A 3AUFA 4IXNA 4JCOA 4OK3A 4JFAA 3AM4A 1E2EA 1EFPA 1YZHA 2P67A 3OX3A 3CXUA 3PT5A 3AZOA 1SUCA 2HCJB 3FWYA 3IC5A 2FWMX 3IQFA 3KEOA 3MD0A 4X60A 1Z5CA 4B76A 3ZJVA 3VNUA 3V4FA 4CLHA 3I9KA 3KVNA 1U9JA 2EW1A 1NW5A 2PZJA 4W5QA 3GEBA 2JFPA 5FL7D 4H35A 4BGVA 3LRPA 2X0JA 2EC5A 5M2QA 1D4OA 1L7BA 4DUGA 2K0BX 2V97A 3OZTA 1C1XA 2PFKA 1GA4A 3LBAA 1ECBA 4R8SA 4RVNA 4MA0A 4C20A 3PNOA 4A73A 2G70A 2E7ZA 4UEWA 2EQBA 3BHNA 1PUJA 2AKAB 1BCRB 1FX0A 4LY6A 4JYAM 3RWOA 4Z1MA 5CLQA 6REQB 4PX5A 2OLKA 3GQ4A 4YRBA 4LMRA 4LE2A 1UOOA 3UKJA 2ASVA 1YS1X 3PCXA 4PQRA 5ALFA 6GPBA 4JI1M 2DCUA 5MN4A 3O3MB 2H2AA 4Q0MA 5FBKA 3WXBA 3WAJA 4O1HA 4RJ2A 4BGIA 5FFNA 1EWVA 2XUDA 4RKFA 4LSWA 2VH5R 5DN9A 3OKAA 1TJNA 2PUEA 4BV8A 5TS2A 3HDYA 5K3OA 5IREB 3CINA 3UHAA 3NV7A 5KQ8A 1REQB 3D1JA 1ZCFA 3X1XA 1UAGA 4NSOB 3BWCA 5FYDA 2ZJ1A 4HNUA 3RAPR 3UMVA 2WF7A 3NCHA 3BMNB 2G9NA 4X9XA 1SVWA 3EVCA 4BO0A 4FI3C 4CTJA 3V8VA 4MR9A 2YIMA 4X64M 1FFEA 4HQ0A 1G21A 1UJ4A 4N8EA 4RA9B 5CH8A 2Q3JA 2AZTA 3NWOA 3CVOA 4Z8XA 3N6RA 3U40A 2K9DA 4TTQA 4BQSA 4PC1A 4CMBA 2DKLA 2W6ZA 2Y2VA 3P9SA 1XMQB 3GB9A