1I4WA

The crystal structure of the transcription factor sc-mttfb offers intriguing insights into mitochondrial transcription
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
322
Chain Sequence
PIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEWPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL REPLICATION PROTEIN MTF1
publication title Crystal structure of the transcription factor sc-mtTFB offers insights into mitochondrial transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 108
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i4wA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i4wA01
2ONYA 1KHHA 2Z6UA 2ADMA 2WA1A 2NXEA 3A4TA 3FUTA 2ZVJA 2UYCA 2AR0A 2GA9A 3ID6C 5T67A 2Q41A 4GC5A 4ER7A 3MTEA 1JR4A 1JSXA 1KP9A 1KYZA 3KQVA 5E1OA 1QAMA 2VDVE 3B5IA 3T0IA 4GUAA 1NW8A 4IWNA 5CVDA 3TM4A 4F86A 3FZGA 2F8LA 3K6RA 3GRZA 5EHIA 4Z2YA 4LWOA 2QRVB 4MIKA 2IDJA 2UYQA 4B17A 5BW5A 5HIKA 3LCUA 3HVKA 3JWGA 3OU2A 1O9HA 4MWZA 5EMKA 4PYNA 4DF3A 4E2XA 5JUWA 1KR5A 3LL7A 4NECA 3CJTA 2P3OA 3R3HA 5DM4A 2C7RA 4GF5A 1Q0TA 1NT2A 5CM2Z 3FTCA 1UFKA 5LQUA 1V39A 5FWDA 4OX9Y 3PS9A 4PYQA 3KR0A 3MQ2A 4X60A 1G55A 1MJFA 2YXEA 4QTTB 3NJRA 2IFTA 2OY0A 3OU6A 4KIFA 3T7TA 3G5TA 4YMGA 1I1NA 3GU3A 3A7DA 3JWJA 5FCDA 2P40A 4ISCA 2G70A 3KQQA 4ER5A 3LDGA 4R8RA 4YV1A 5ICEA 5K0GA 5CIYA 4OA8A 1YFJA 3CGGA 3GXOA 2ZIEA 1F38A 2IDKA 4KWCA 4L7VA 4P7FA 5LQKA 4EMSA 4E30A 4M7RA 2IH2A 2OKCA 2H1RA 3DLCA 2IH4A 2P7IA 3UJAA 3UJ8A 3UBTA 1WXXA 4KRGA 3UJDA 4DMGA 5CCXA 5E2AA 3DR5A 1RJFA 5ICCA 2NXJA 2OB1A 4FP9A 1R6AA 3R24A 1YUBA 3OFKA 1KPGA 2ZFUA 3NWBA 3SXJA 5EGSA 3ELWA 1R8YA 5FULA 2ZZMA 4C03A 3R6TA 3E23A 1U2ZA 2IGTA 4KDRA 3X0DA 1G38A 4CWAA 3Q87B 4QTUB 5E1BA 1H1DA 2P41A 4ER6A 1X19A 4PYOA 2JH8A 4RTMA 2CL5A 5FTWA 4RTOA 1FP2A 1YB2A 5GIPE 3HNRA 3DP7A 2PX8A 2AOXA 5F2KA 1XDZA 5CVVA 4OQDA 3UJCA 5E8JA 4HTFB 3K0BA 2C7PA 5B1SA 3OU7A 4KDCA 4U7TB 4E2YA 1ORHA 3NMUF 2NYUA 3EVEA 3DUWA 5EIWA 3BWMA 3MCTA 2C7OA 3UJ9A 3THRA 4GOMD 4A6DA 1M0EA 3JWIA 4P7GA 2EX4A 2ZLBA 3ELUA 2WK1A 4HRAA 1N7JA 1SG9A 5BP7A 4RTPA 4CKBA 1NW7A 4LECA 3PTAA 1VQ1A 1F3LA 4C4AA 2O05A 3DULA 3BUSA 4FGZA 2XVMA 2VDUE 4PGGA 3I5UA 2YVLA 4CKEA 4X61A 3ORHA 1BC5A 2G8NA 2QM3A 1ORIA 3G8AA 3TOSA 2HR1A 1EJ0A 3KQMA 3LCCA 3LDFA 5E9JA 1BKYA 4BLUA 3FPJA 1NW6A 1RJEA 2JJQA 3DLIA 4X63A 2Z6AA 2UYHA 3LX6A 4P7KA 5DTQA 5FA5A 2YXDA 3M70A 4P58A 5HIIA 4EK9A 1XDSA 2PY6A 3LBYA 3TMAA 4KIGA 1NW5A 3P2IA 2AS0A 1RJGA 3BWBA 5DM2A 1EAMA 4YUWA 3TFWA 5DPMA 4C06A 3TQSA 3KR9A 4P7JA 3THSA 5FWAA 3ER9A 3NVKI 4GOND 1I4WA 1JG3A 1FBNA 5G02A 2PT6A 1NV9A 4MQ4A 3UJBA 5C0OE 3CJQA 1DUSA 3BXOA 4UOEA 5K01A 2OO3A 3EVDA 9MHTA 2NNWB 3GRRA 1ZKDA 5EG5A 3LHDA 2I6GA 4IV0A 5EKUA 1P91A 3G89A 2OYRA 4FSDA 1SVUA 1AV6A 3EGIA 4GEKA 3G7UA 1D2GA 4PCLA 5DT2A 3KPVA 4R6XA 2AOTB 2A14A 2E5WA 2PX4A 2VDWA 2Z6QA 2PBFA 1G8SA 2GS9A 1D2CA 2YR0A 4X1OA 3C0KA 3FUUA 2JHCA 3A7EA 5LQCA 2OPBA 1FP1D 1SUIA 4GOOD 3E8SA 4PCAA 4RV9A 2JG3A 1IY9A 2IBSA 3NDJA 3PB3A 2ERCA 2B78A 2H11A 3FTFA 2ZBPA 3EVBA 3P9CA 5GOZA 5CD1A 1IM8A 5KQRA 1JQEA 4RVHA 5GINE 3EVAA 2ZULA 3EGEA 3KKZA 2AZTA 4RSRA 5FQNA 3T7SA 3C6KA 2I9KA 5DXAA 2Y1WA 5HEKA 1B42A 2AN5A 3M6UA 3DXXA 5EPEA 4E2ZA 5K0CA 2PKWA 3A26A 3B7PA 4PINA 3KQYA 1R74A 3LDUA 1P1CA 2HMYB 2ORED 1YZHA 1X1DA 3SSMA 4EVIA 1RI4A 3AWIA 4QQNA 4EQZA 1BOOA 3RIEA 3UZUA 1QZZA 1JTEA 3KR2A 4RTJA 1VE3A 5EMLA 3CCFA 4FR0A 1R8XA 3P2EA 4AZVA 3ER8A 2JH9A 3AXTA 5FHQA 5FQOA 3F4KA 5HIJA 4Y2HA 1DL5A 2R6ZA 3LSTA 4A6EA 2ZBQA 2QRVA 3P71T 3HCEA 3I64A 4RTNA 2HWKA 1NBIA 3KU1A 4PGHA 4QVKA 1JG4A 2O07A 5U4XA 5IH3A 1L3IA 3TKAA 2ZCJA 3PT9A 1O9GA 1JTFA 2ZSUA 5JR3A 4GC9A 4M38A 5DLYA 3IV6A 3BKXA 4ER3A 3OCJA 3VYWA 2AOVA 1KPIA 4RWZA 4WXHA 4QPPA 2LD4A 1NE2A 5DTRA 5IKMA 5EEGA 5MHTA 3A25A 2C7QA 2O57A 4PYIA 3OE4A 4GOLD 4LG1A 5CUQA 1BHJA 3BGIA 3FYDA 3SSOA 1T43A 2FRXA 4AZWA 1VP9A 3TM5A 3KQOA 3DMHA 4QVGA 1XCJA 1MHTA 4U7PB 1AQJA 3LPMA 4G56A 1XDUA 4QDKA 3UJ7A 3GDHA 5KVAA 3NW9A 3UA4A 4PYKA 3QOWA 3KHKA 4PONA 5DSXA 5E1DA 3REOA 1YZ3A 1P39A 2BR3A 5LQAA 3DOUA 3FUWA 1VL5A 2O06A 1NV8A 3HCFA 1X1BA 3PX2A 5EKXA 2ZW9A 5FUBA 1WZNA 4H0NA 2AN4A 5H02A 5LR6A 2XYVA 3HA7A 3O4FA 1JG2A 3LKDA 3AXSA 4PWYA 5F2NA 1TW2A 2AVNA 4OA5A 4C05A 3EEOA 1R18A 5K0BA 3FYCA 3C3YA 4RVFA 5EZSA 3SSNA 3UJ6A 5HIMA 3SM3A 5E2BA 4EKGA 2ZZNA 3KQTA 1EIZA 1KIAA 2EG5A 3OZRA 3FPHA 3E7PA 4HTFA 3C6MA 3H2BA 3OE5A 3M6XA 5HILA 4E33A 5LSAA 4ZTBA 2OB2A 3VSEA 3T7RA 3DMFA 1L1EA 2B3TA 1QANA 3EPPA 1EQAA 3P9KA 5GM1A 5E1MA 4PYMA 3ELYA 2IP2A 2DULA 5EHGA 1VPTA 3P9NA 4RVDA 4C04A 2FPOA 3OPNA 2FK7A 3MTIA 3P9IA 3FUVA 3TPZA 4JXJA 2G72A 2I62A 5FADA 3UA3A 4PYJA 1ZQ9A 4XUDA 1M6EX 3FUXA 1ZG3A 3M6WA 4IV8A 3R9XB 1WG8A 4RX1A 2EJTA 5EZQA 2XBMA 1P1BA 3JWHA 5LQRA 4F84A 2QY6A 1WXWA 2GLUA 3DH0A 3FRIA 5K0NA 5ERGB 2PSSA 3RW9A 2K4MA 5EC8A 2OBFA 4E32A 1N7IA 3HCAA 1D2HA 1HNNA 2PLWA 4HSGA 4RTLA 2ZIGA 1L9KA 5FA8A 2NXCA 3V97A 3BZBA 2I7CA 5HOQA 3KQWA 2KW5A 2P1DA 4MHTA 2P3LA 5K09A 1NKVA 4MTLA 3FRHA 5EEHA 4QQKA 2PV0A 2VS1A 3KPYA 3DXZA 2ZIFA 4DA4A 4RTKA 1Y8CA 2PXXA 3GRYA 3PX3A 4R8SA 3G2QA 3BGVA 3B3JA 3TLJA 1SUSA 5K0EA 5CCBA 3QV2A 2OXTA 3S68A 5DXJA 3MHTA 2AOTA 1FPQA 4HG2A 3EVFA 3L8DA 4RVGA 5DM1A 3UWPA 5CVEA 1QYRA 4OBXA 4EKIA 7MHTA 2HNKA 3E05A 3FTDA 1SQFA 3I58A 3MCZA 3UFBA 2FCAA 3I53A 2HV9A 2FYTA 3AJDA 3BWCA 3KPWA 3ME5A 3WSTA 3FTEA 4ATNA 4FZVA 4IKPA 4QPNA 3GRVA 3FPGA 2O0LA 5HZMA 2UZ4A 2N47A 3G2MA 4V0RA 2P35A 2AOWA 3FPFA 4AX8A 3AY0A 5KQSA 4DQ0A 4CTKA 1YFLA 3G5LA 4BP1A 3HCCA 1NBHA 3I9FA 1L3BA 4M37A 2JHPA 3EGVA 4FS8A 1INLA 3TKYA 5LQJA 3EVGA 4YUVA 4DKJA 5E8RA 3LECA 3IEIA 1ZGJA 5DSTA 4PIMA 3HVJA 1DCTA 5M5BA 4YUXA 3M4XA 1RI5A 3B3GA 1YF3A 2QYOA 1PRYA 2YX1A 3HCDA 4K6MA 4YV2A 3EVZA 2P8JA 3HM2A 2PWYA 3SMQA 2IBTA 3KPJA 1RI3A 3HP7A 3HA5A 4HH4A 5BXYA 1M6YA 1KYWA 3DTNA 4PIPA 3G8BA 3P8ZA 4CKCA 2R3SA 2HTEA 1NW3A 1KPHA 2P7HA 3PVCA 3KPUA 5D1HA 5EIFA 2PJDA 2Y1XA 2FHPA 2YUIA 2XVAA 4BLVA 2PX5A 3PFHA 5DX0A 1L3CA 1KXZA 3EMDA 2YTZA 4CTJA 3Q7EA 1EG2A 2PX2A 4LWPA 2PXCA 1RI1A 2PXAA 3P2KA 5P8WA 2BR4A 4BY9E 1OR8A 1R00A 3PFGA 1XJ5A 2NXNA 3HTXA 3DMGA 2CMHA 5T64A 5DWQA 3OZTA 3GWZA 2CKDA 3U81A 5DM0A 1WY7A 5GM2A 5E9QA 1XTPA 2CMGA 3ERCA 4OQEA 3GNLA 3NDIA 5K0FA 2EJUA 1G60A 5LQNA 2AN3A 5DTMA 3M33A 1UWVA 2PGXA 2BM9A 1EJ6A 4CXMA 1IXKA 2AOUB 1VIDA 3LCVB 5ICGA 2IH5A 1AQIA 3FPEA 3NWEA 3P97A 4YUYA 2EFJA 1AF7A 3MB5A 4OBWA 2BH2A 2ZWVA 3HCBA 2G71A 3VC2A 3CJRA 2B9EA 3HEMA 5K8VA 5FHRA 3O31A 1N2XA 1HMYA 3KR1A 4WVLA 2GB4A 1TW3A 4X41A 4KW7A 5EVJA 4FT2A 4R6WA 4HGYA 2H00A 2AOUA 3G2OA 1WS6A 5DX8A 4RYLA 3D2LA 3GCZA 4DM3A 1JQDA 5ICFA 3CBGA 1XXLA 5GP1A 2VZ9A 4AZSA 2IIPA 2ZZKA 5DRTA 2FK8A 1JSZA 1O54A 3CC8A 2GPYA 5DX1A 4AZTA 4RTQA 1Z3CA 1ZHFA 4RTRA 5F2OA 5HFJA 1RI2A 2PWPA 3HA3A 3OFJA 4XUCA 2ZBRA 5T6BA 3GRUA 2DPMA 3QOXA 3G2PA 1XVAA 3V8VA 5EMMA 1Q0SA 4XCXA 4DCGA 2XYRA 4BLWA 3KQPA 2VP3A 2YXLA 10MHA 5KS2A 4E2WA 5KYGA 4XUEA 4C07A 3TRKA 4DCMA 4HC4A 5EOVA 3A27A 3G88A 4RTSA 2QE6A 5K05A 3B3FA 2GH1A 2V74B 2ZTHA 2UYOA 8MHTA 5K0LA 1JQ3A 3C3PA 5DRYA 3GIWA 5GIOE 2ONZA 2NP7A 1X1AA 5K0JA 1SKMA 2B25A 2P3QA 2B2CA 3MERA 3O7WA 2GAFA 1VBFA 1VP3A 4GQBA 3LKZA 1TPYA 3CVOA 3GJYA 2WA2A 4M36A 5E9WA 2AVDA 5K03A 4AUKA 4FSXA 5GWXA 2PT9A 3HVHA 2BR5A 3NTVA 1PJZA 3SR4A 3R0QA 1QAOA 2BM8A 1XCLA 2OZVA 3M6VA 5C9ZA 5CVJA 4YMHA 4BP3A 3BT7A 3SX0A 1I9GA 4FT4A 3GO4A 3DXYA 3HVIA 3KQSA 3RODA 3BKWA 3SGLA 4DZRA 2G1PA 4V0QA 4KVZA 1G8AA 3IHTA 4E31A 3EVCA 3MAGA 3MGGA 2IPXA 3VC1A 4F85A 2CWWA 3BWYA 2NP6A 1G6Q1 3OZSA 3EMBA 3IYLW 3SVZA 4R05A 1UIRA 4PYLA 2JHAA 4YUZA 5EQJB 3PLAE 3EEYA 1X1CA 4ER0A 1SQGA 2PVCA 3LBFA 4QDJA 4PNEA 1ZGAA 2XYQA 3ELDA 5CVUA 3NVMB 3GGDA 5BW4A 3LGAA 4E70A 4C08A 4O29A 1VLMA 2ZWAA 3B89A 3CKKA 4YV0A 1FJXA 5C1IA 5EMJA 2V7EA 3ANXA 2BZGA 3BGDA 1QAQA 4HGZA 5D1NA 1RJDA 4GBED 1JG1A 2YQZA 3TR6A 2ESRA 4Y30A 4POOA
chains in the Genus database with same CATH superfamily
2I6QA 2GO7A 3ID6C 2WZCA 2BEKA 1LJUA 4CLRB 1O97C 2CSXA 4GAEA 4I8DA 3NHSA 1USVA 1SIWA 3QU5A 2IDJA 3CGWA 4PAMA 5I7EA 1LPNA 4EGQA 3D8HA 1EFLA 4ECAA 2W70A 3WHIA 1G21E 4B3CA 3IX7A 1WETA 1E3EA 2V6GA 4OTZA 1TTEA 3S1LA 2GOYA 2VHQA 3ZU6A 4IH4A 1N5LA 2CV2A 2B4KA 3JSAA 4BHTA 4FOTA 5FI5A 1WXXA 4KRGA 5LU9A 3TRHA 4H59A 2OMKA 1W73A 5FLXS 721PA 1JWLA 2IGTA 3EX7C 4CKXA 4R51A 2VQEB 1OZAA 1KSFX 5F2KA 4XDZA 2EYUA 8AT1A 1RWNA 4JVSB 3VLFB 1CVLA 1TQHA 3IUEA 4FLFA 3KSAC 5FIUA 1J8MF 2RGNC 1Y3DE 5LXTB 4JBHA 4JN6A 3PICA 2UZ0A 2P5TA 3THSA 4FKZA 3ER9A 2OA0A 4J8PA 1M72A 3EXG1 5EIXA 1C1XA 2E7ZA 3AL0C 4DR2M 1K3UB 3IESA 5DW3A 4DV6M 2Y4OA 3F9IA 2AJBA 3TIFA 2J31A 4GX1A 2P27A 3F46A 3QX8A 4DV3B 1ETUA 4EQZA 2E87A 4H6WA 3RVDA 3BF7A 4DMFA 2R6ZA 2ZRBA 1S2GA 3VHRA 3SHGB 4OI0A 1PQ4A 3AEZA 3L8ZA 1O1YA 3LOUA 5F33A 2AXNA 1NE2A 1MB4A 1GJRA 1VHLA 3ZDCA 4HNRA 2VHUA 1K3FA 4BE9A 1R0CA 3R3ZA 1YH3A 2BZ1A 2IXGA 4DL9A 5EKXA 2O2JA 4UDYX 4MOWA 5DYWA 1W4BA 1C3VA 3ZDRA 3INYA 3K8ZA 3CX4A 2IHYA 1ZI6A 1CV2A 5E1MA 1W7AA 1SEVA 4NH4A 2V7VA 4F7WA 1OLXA 1NDUA 4BKUA 5CLGA 2DBRA 5TDHA 2ZBFA 5AKEA 4RTLA 1DQPA 3Q8KA 2XMQA 1LWOA 3LWBA 3QQPA 3QE2A 1EX7A 1CIPA 4F3TA 2EFYA 2DQKA 3CF6R 1RWOA 4LDRA 4BO6A 4IBJA 5DXJA 3TGLA 3BWCA 2Z2ZA 3VVCA 2J0EA 2A9PA 1U0HC 2MSLA 2I1VB 2ZSIA 2I80A 3LD9A 4NABA 1NBHA 2DQSA 3GAMA 3ZHCA 1OE0A 5EESA 2ZWPA 1MA3A 3PFCA 2WTAA 2Y1OA 3IP1A 5CG1A 1LC0A 2P7HA 3KPUA 1I2MA 4Z0NA 3HDQA 1ZK1A 1X92A 1O95A 1ZBQA 2NM0A 2Q1UA 3VZCA 1KH1A 4IG9A 2GFHA 3DGFC 1SXJE 3VDPA 3GUVA 3NBXX 4N40A 2GFIA 3L28A 2FW9A 3NGLA 4IFBA 1GQ2A 4GIBA 3P97A 5JASA 3FRJA 3EPHA 2F5PA 4B3HA 3RU7A 3VR5H 4NE2A 4EARA 1X13A 3QUCA 4BRSA 4IJUA 2W90A 5GV8A 3IV9A 1WGNA 4ABYA 3WJ1A 5EJ6A 1FLNA 4DE5A 2Y2VA 2R0IA 1NPDA 3TH5A 4D9IA 3CVOA 2VPIA 4ZU6X 2NUTB 1CDEA 1ENPA 3DMTA 3V7FA 2ORWA 2QR3A 3SGLA 2DQ4A 5FL3A 2DFDA 4OOEA 2E3JA 4Q7QA 1MG5A 3LAWA 5J4KA 3NHBA 2A67A 2IOYA 1YS1X 5D1NA 2G9VA 1TAHA 1XHFA 4INPA 1WZUA 4YR9A 1U04A 3WYNA 4MS1B 3L29A 4G4OA 3EOZA 3IKMB 4GKVA 2A9VA 3ZGLA 3MSXA 3LSYA 5BQ3A 3BGSA 4ON9A 4J7XA 5AT1A 1J5EB 5E9AA 3PR3A 2W2OA 3K1TA 4C0WA 8CATA 1ST2A 3I01M 4E5VA 4NV1A 1B15A 2UZIR 2PRKA 1T1SA 1ODLA 1LEHA 4Z99A 1O8CA 1I13A 4HVTA 4G1FA 1YB1A 3O3NB 4ENQA 3CUVA 4C20A 3H5VA 4NJOA 3MOIA 4S04A 3BJZA 2C97A 3VAZA 1NMSA 1PFUA 3O4GA 3O4VA 4CEIA 3B1WA 2D13A 2YZMA 4MKRA 4FFSA 4EVQA 2REXB 2NVBA 2HD4A 3AETB 4WN3A 1QF7A 2QEQA 1IG3A 1RKXA 1XK6A 1QRTA 2CDRA 1JLRA 4V3BA 4HZGA 1LTMA 1FVXA 4DJTA 2OOKA 1U8EA 3H9QA 2BCEA 3QPBA 2SKEA 1QZEA 3VI3B 3NOOA 1MV5A 4YRSA 2VAVA 1GEGA 4NCNA 5EWJB 5G4LA 3NT5A 2LVNC 2FW8A 2HJ9A 3EEQA 2BFFA 1ZR2A 4IY1A 2K2QB 1R2QA 2FH5B 5J1TB 5F9HA 2DTDA 1OV4A 2IE8A 3I4CA 2H31A 4OHYA 4EQ6B 1QIKA 4PGHA 3UXYA 5K4HA 3JATB 5MHTA 3MRSA 4ZWNA 2MCFA 2QN9A 2ZIXA 3D7SA 1ZN9A 5A3QA 3LT4A 4DC1A 3P2YA 5E1DA 5LQAA 3QPUA 1EX9A 1G8FA 4WK4B 3IECA 1OXUA 3Q40A 1FF9A 3QKRB 2JZ0A 3OIWA 5I7SA 3G5MA 2NUBA 4X92A 1KSGA 4I66A 4OV6B 5IBQA 3BHJA 4ZPXA 3ETJA 4RF0A 4YX9A 3NM6B 2Z3WA 1WW8A 1SELA 4DM4A 4UOZA 3A1CA 2PLWA 2R18A 3P0EA 2JLYA 3RC1A 4CM7A 1N0VC 4QQKA 3PKIA 3PNKA 4TMTA 2GF2A 4ADSG 4V3CA 3ZQJA 5CYFA 3H4IA 2QN8A 3T3PB 2P0EA 3OT4A 2C5LA 2LP4Y 1INLA 1BMQA 1L5LA 1MLDA 4DSTA 4G24A 2C96A 2YZ7A 2SBTA 5HQJA 1R0SA 2EL9A 3T34A 3UT5B 4LY9A 4BTVA 2R4QA 3PGVA 5EIFA 2PJDA 2H5JA 3AR6A 2QRNA 2ZUEA 1JHRA 3AM3A 3NXKA 3GVIA 2J4DA 5E6UB 5DN6D 3U60B 3ZDAA 4A1OA 3R0ZA 4HYYA 2VQEM 1IQ0A 4HGNA 1SO8A 3HWWA 4EBBA 3IEMA 3C41J 3PXBA 3N7AA 4GOXA 4ZICA 1N2XA 2OENG 1CP2A 1JECA 1R4GA 5CFPA 4MYHA 3OCUA 1MH1A 3BSSA 4PG4A 4XYBA 2NTYC 2WYHA 3PHJA 2QJWA 3MQ4A 3ZHRA 3MWDA 1SXQA 2WUGA 1A69A 1I7PA 5EOVA 2F9LA 5CEEA 3E0XA 5K0JA 5LUAA 2O0KA 3CH7A 2OD7A 4R1PA 4V02A 4PDGA 4B6SA 4K6HA 5CYGA 5C9ZA 4QTYA 3IEXA 2FUNB 4O5OA 5SZKB 1G6Q1 3MT0A 2NTNA 2IZ5A 2RKWA 1E9FA 3W77A 1ECPA 2VJBA 1RPJA 5TV2A 4QDXA 2EBHX 4BBAA 1PDWA 4TYNA 5IAAA 3M7GA 2CXRA 1QCDA 3I30X 1Y7TA 1WTAA 4MWCA 3ROGA 1ECFA 2BFPA 1XZMA 4U2FA 3F6EX 1FNCA 5IS2A 4HPJB 1Z5NA 2IV2X 4XX0B 3D4IA 5AVVA 3L4BA 4IV5A 5C2JB 2J4FA 1WLYA 3AUAA 2OAGA 1NN0A 1N0HA 3L7LA 3MCWA 4XGQA 3RUIA 3GCGA 3H0EA 4TRNA 1TQ6A 3EBOA 2AA3A 3ZWYA 2R85A 2O7QA 2WWWA 5CTAA 3HRKA 2I1QA 2OHOA 3FVWA 3B7WA 5FJJA 2NAPA 1PVDA 4MUKA 5BYKA 1T4BA 2BTEA 3HUFA 2NYVA 1IXSB 3JRWA 4GFDA 1US8B 1W48A 2RCYA 3ELUA 3A4YA 4C4AA 8ATCA 2J0VA 3SSAA 3E7FA 3G6KA 2D1FA 521PA 4Z7OB 1Q0PA 3O8NA 3HJBA 3IAXA 4EIWA 3I12A 3ZE0B 1L7PA 3NTUA 3CTMA 1QYCA 3SHFA 1SXPA 1FUUA 4YH1A 5CNIA 1KI6B 1SKYE 1DJLA 4P35A 1Y82A 3ABRB 3G89A 2EW8A 2PX4A 1D2CA 4BTEA 3CEJA 4A8HA 3O8BA 3WLFA 4C0AC 1RKUA 5IZ7D 2IYXA 2GJ8A 1UMDB 2RC5A 3CG4A 1WUKS 1ZW6A 1Z38A 4QU9A 5JI3E 2UYYA 4JBNA 3O95A 4OLHA 1NATA 3OWOA 3QBEA 4RPGA 3L8YA 1FSGA 5TT0A 1CFJA 1OB5A 2VYND 3CLHA 1O9GA 5JR3A 1X7WB 3DQQA 3D3WA 1B2RA 3L1IA 1ZP6A 4H3HB 1VMIA 4RIFA 2PA0A 1Z4JA 1C3OA 3GJZA 3U3OA 4M54A 2J9ZB 1FUKA 3L26A 3TM5A 3EB9A 4V0KA 1JIJA 1OYWA 4F1WA 4JBIA 1G21B 4HS9A 2ZREA 2GFQA 2Q1WA 4URVR 2PS3A 5DNEA 3D7KA 3UJ6A 3WGOA 4LGVA 1Q74A 3SF8B 3INGA 1NRWA 3OJFA 4WRRA 2GI4A 3EPPA 3MOSA 2EU8A 1KTIA 2R00C 4KXYA 3P9NA 2ZUVA 1H85A 5G41A 2CLOB 1G3QA 4J4BA 4TSFA 3RW9A 3EOBI 2K4MA 3RHZA 3FCUB 1SULA 3QSYA 3V97A 3IAM1 4ARAA 5DNAA 1XDWA 5EEHA 1V1MA 1AUOA 3GRYA 4EJSC 4Z0TA 3MHTA 3SYRA 4ZKDA 1WZ2A 2V7QD 4AK9A 2H1LA 1UBNA 4P3KA 3HYSA 4R81A 2BE9A 1YRQA 1IBMM 3BN3A 3C4QA 1J5EM 4MWSA 1B41A 2C9OA 1MB2A 3K9QO 3G9QA 5JPDA 4K6MA 3RC8A 2WLSA 4RKWA 5FPTA 3Q7IA 4AZ3B 2FZ5A 3ZIUA 4X62B 3C1AA 4B8ZA 1AXGA 1QHHB 4JP1A 2MSEB 4LXYA 2H1VA 6GPBA 5GM2A 1DC7A 3LUDA 5K0FA 2JLRA 3ZDZB 2Q5OA 5FNZA 2OC9A 3HSKA 3PR2B 5JWHA 3HEMA 5AVJA 5DVZA 3WGKA 3VPDA 3V48A 1G8MA 3R7WB 2I1LA 1IB6A 3SQMA 1CC1S 4W8HA 1IU9A 4CM8A 3MTBA 2NZ8A 1YI0A 2ZXFA 3ZDQA 3IUPA 3KTFA 1XZGA 1UCFA 3CX3A 4U9UA 1GZSA 4ZYYA 1XAIA 3Q41A 1SKMA 5DJ5A 4Y9DA 2XUZA 5HKLA 4U02A 1PQWA 4BEBA 2C59A 1LBEA 4I55F 2QYSA 1EFDN 4FT4A 2ZM5A 2YBDA 1X7ZB 3AK4A 2IQIA 2R4EA 2W8ZA 1DV0A 3LMMA 2F3UA 3OZSA 3OTQA 4NFSA 4ZHSA 3O26A 4U7GA 2I2XB 4ER0A 1EQ2A 1YCFA 3AHGA 1IZ8A 1JHVA 1Q16A 2HO5A 1X1SA 3K7EA 2ADOA 4X8OA 3BXWA 4NCKA 3KLNA 2F7SA 2RE8A 3VMMA 1KDTA 2Y66A 3VHLB 2YIDA 4YRRA 2DWQA 2DHQA 4LNUA 4X1KA 5TQVA 4BQSA 4CI0B 3PZBA 1Z26A 1Z7BA 3E18A 2XT6A 4PZAA 3LUFA 1PNTA 1GPYA 3EZ7A 3X1WA 3PS9A 3PJRA 3UY4A 1FXWA 4QBFA 1TF0B 4DV7B 2Q5IA 3CR8A 2X0NA 1A9OA 2IH4A 1JHQA 3DOOA 5J23A 4XQ0A 2XUPA 2FG5A 3KOWE 5DEOA 3HV2A 1FFEA 2P41A 1X42A 4KIWA 4IEFB 2FW1A 2Y1GA 3EBLA 1KIMA 5KZMB 2HPZA 3CH6A 3EVEA 1AV7A 3U7IA 3UJ9A 3F5QA 4MVJH 3O90A 1Q11A 1VQ1A 3II6X 1E1KA 5JXHA 3U3RA 1KNXA 2GK6A 1X6VA 5K6TA 1UFZA 4KNVA 3ZNNA 5HGJA 3JXEA 2GZMA 3AI3A 2X1VA 3U31A 4ZK6A 2YWRA 3JZFA 3L07A 4Y2GA 4J0JA 5EG5A 3D3NA 1W581 2VPXA 2GS9A 2ZJ3A 4US2R 3AUFA 1ONSA 2R6R1 2H11A 4I4CA 3FE3A 3CG0A 2SKDA 2BMJA 3J81S 1RQXA 5LOVF 3BE8A 2GNAA 2UU9B 3L8CA 1A4IA 3BE5A 1CJCA 1ZNQO 2OFPA 3KZOA 2O20A 1Z4IA 5BOSB 4L4RA 1WXGA 1GRNA 4Y6LA 2R7LA 4ZYLA 1ZMVA 2XODA 1C0PA 5BWMA 1RM5A 2E1RA 1U0FA 4MZXA 1ESNA 4HATA 1H6DA 2DETA 3TOZA 3V4VB 2UUAB 1J0AA 4R84A 4QTXA 3HCFA 1XC8A 3IILA 2J85A 3VYTB 5LLTA 1MJGM 2JC3A 2ZUWA 3W6NA 3B82A 5MFPA 4PPNA 3S6JA 1KY2A 3PDWA 5AO9A 2CP8A 1E2HA 5IEJA 3GRKA 5AUPB 2QN1A 2BGKA 4UUOA 2CZQA 1UQTA 3G1TA 4UTPA 3P2OA 2KB0A 3WNCA 4N0QA 4FNGA 4XYLA 3UKOA 3WNVA 2WC1A 4WY5A 3WGYA 1DBRA 1GA4A 4D5EA 3KEOA 4HOYA 2FRVA 1QYRA 3TLGA 2FYTA 2TMKA 5J4LA 1S9DA 3QUQA 3GZ4A 4LDZA 5BSFA 1G4AE 4GHAA 4UXIA 2B4YA 4OGFA 5LQJA 1PQUA 3FNIA 3DDZX 5IJWA 3HVJA 1P0FA 3EVZA 4H1UA 1CRWG 4C7OA 1GNRA 1NXSA 3OIDA 2AI1A 4ZI3A 3WBBA 2B92A 1NQTA 5DI9A 1RLIA 2FJ0A 1UK6A 5KVCA 3KSRA 3C8MA 3RQSA 4DNOA 4FCWA 4KFRA 4OGLA 4WLEA 3V6LA 1EJ2A 5A2QS 1LSJA 1POXA 1G8PA 2OZKA 3HCBA 1NI4A 4AX4A 4RSGA 2H92A 1WBBA 3BMOA 4TKZA 3KUUA 4G4QA 4E6EA 2A4KA 2FK8A 2XH8A 3KSUA 4RD2A 3ZK8A 5DP2A 5AVZA 4WCDA 2OCDA 1DRWA 1NXTA 3THWA 2JCYA 2HJSA 4QU5A 4X97A 1N9KA 1TD9A 3QF4B 3CE6A 1QIMA 2ZYHA 3WYCA 3U0BA 4FCVA 1Y5NA 2X6TA 3GRAA 2IEZA 5KSYA 3GQVA 1Z29A 1OTYA 4D5GA 1DO0A 3BBLA 4IKEA 3IDSA 3W9SA 3RVPA 5GZ1A 1KYQA 3TQCA 5EWMA 1RCFA 4PYLA 4FI3C 4E70A 1AOXA 1KVSA 2ZJBA 3BGDA 2PTGA 5HZKA 4IDAA 2WA1A 3JZDA 5ECWA 3FPAA 1IBRA 2VDVE 4CKZA 4WD3A 1NX6A 4ESHA 3K6SA 3I37X 4IQ0A 1W30A 1RLJA 3D02A 2C9CA 3F9CA 2P3OA 2DQZA 5CX4A 5JXGA 2CVHA 3KYDB 1ZS9A 4HGQA 5J4HA 4L8FA 2VT7A 3GLFB 4ETNA 4M7RA 4WEQA 1NVGA 1R0ZA 1BEZA 4EG4A 2ZBEA 3M49A 1KPGA 3LFTA 1FQJA 4ER6A 1KSHA 4AO6A 4IFTA 2C4MA 4TUYB 2R60A 5CVVA 3L02A 3GUHA 2JCVA 4E7OA 3OFNA 4CR7A 3ABSB 4A6DA 1EM8B 4MAMA 3PFIA 4CV3A 2O4UX 3ORHA 4NDNE 3SAWA 1NBMD 4LRTA 3X2FA 2LKCA 2D0DA 4G8CA 2K5UA 3HXQA 3ZGYA 1U0JA 2PKYX 4D4HA 1NW5A 3B9QA 2ZANA 2APJA 3JZMA 5U1PA 4PRKA 4MTCA 1B8VA 3MRVA 3RFVA 4YCCA 9MHTA 4OMUA 3LBNA 4CEJA 3MIIA 1RDFA 4BNFA 4UE3S 1Z5BA 5EFZA 4I1OA 2DKNA 2XVZA 1Q3TA 3K2IA 2O3SA 2YCLA 5FQNA 2YQ5A 1GQOA 3D8TA 3VU3A 3OM0A 4BX0A 2R96A 4Y2XA 3ZDBA 1WKVA 1W1IA 4Y2HA 4HRXA 3WLRA 1WHTA 3B1XA 3ACBA 4IIDA 5FI0B 3JALA 1SCBA 5IC5A 1D04A 3D54D 1JEEA 4FCCA 3WLSA 2F3QA 2QHOB 4D0LB 2VF2A 3H84A 4W7HA 3TNFA 2G4LA 4D9HA 4CETA 1LPPA 4QPJC 2ZTLA 1T29A 1AZWA 1TQ2A 1QUFA 4H0NA 4HRVA 3HKDB 4U7JA 4DR3B 3NAMA 3BJMA 1GTMA 2SCUA 4IDGA 5FWXA 2ODPA 3N9IA 3TPZA 4PD2A 3PUXA 3SEQA 1GRRA 3UC5A 1OBOA 1XN1A 3EZXA 2ZIGA 3P9RA 4FGUA 1LA2A 2VSYA 5JFGA 5A9SB 1MORA 1J0CA 2XDAA 2DAPA 3W1VA 3C5WP 3TLEA 3ZBQA 4F9TA 3RS8A 4CL3A 2Y2UA 3EJ6A 2HNKA 1UFVA 1MX0A 1U28C 2O0LA 2D2XA 1SKYB 4B79A 4BP1A 2RGRA 4KQ1A 5CFOA 1YMQA 5M5BA 1PRYA 2F62A 4ZDKA 4Z54A 4PZPA 4DV7M 1T0HB 3UKJA 5KPZA 4YAGA 1Y6RA 4LSZA 3I8OA 3CX8A 2YWGA 1CUBA 1P4GA 3GK3A 3B6MA 2VQSA 3DDHA 5HJ5A 2AC2A 4D8WA 1CNFA 4TLDA 3T61A 1Y3CE 1RFLA 5EVCA 5IVKA 3AG5A 1JWBB 3S29A 1CW2B 3F6PA 1Q0QA 1DAGA 1RW4A 2OVBA 5ELLA 2RH5A 4DSUA 2PUTA 2YS7A 5KI6A 5SY4A 1VDDA 4C0JA 2BEWA 4TTIA 1YC2A 4M6WB 3VR6D 4R9UC 2RGBA 3FLBA 4HAIA 4FE3A 2I4OA 4MGEA 3VH4A 3L7NA 4LGYA 1PR6A 1Q0HA 1MAVA 2JIZD 4TRRA 3MAGA 4WY8A 3N2ZB 2QTCA 3MJRA 3QJ5A 3IHPA 5E95A 3ELDA 2UU9M 4O29A 4H6XA 3FUCA 2XEXA 1E3TA 3RT7A 3ZEIA 1Z13A 3M5DA 4F12A 2IVFA 1F14A 3GP8A 4DHWA 1M73E 3BEOA 3WGVA 1JBQA 5T3UA 4GUAA 4CW7A 1TRHA 1D9XA 2XLBA 4B6RA 4JENA 2AQKA 4E2XA 5AJYA 4D56A 3FHJA 5CM2Z 2ZTSA 5IANA 3DHVA 3WKDA 1PZXA 3T7TA 3NC4A 4HQRA 2KJQA 1VG8A 2DKOA 3JQAB 3P0FA 5IK2D 4H4EA 1SZCA 3RSHA 4RTMA 2DF8A 2IZ0A 4ZZ1A 2HBYA 5EIWA 3MCTA 3EIOA 2AN9A 1VKRA 4M7OA 3IBTA 1NDHA 4RMGA 3NIBA 4G8DA 2Q7OE 1BC5A 1AA9A 1RZRA 1EJ0A 5B37A 2K9DA 1TUIA 1R5LA 3FCSB 2UYHA 4GI1A 4EK9A 1UPFA 5DGXA 4U9IS 3NS7A 5CPFA 5JE8A 4UMFA 1ZRNA 4RACA 1QG6A 5A5EA 4FWDA 2QTLA 1DEXA 4FYIA 1LRJA 2L0XA 1Y5MA 4DM7A 4W1SA 2WI8A 2V7BA 4M60A 4C6RA 2XNJA 3M3DA 1M5UA 2OSVA 5IZCC 1TI7A 2HSZA 4QGHA 2ZRAA 3H0CA 2G8LA 1U6JA 3VNRA 3F49S 1Z75A 4N9QA 4B3BA 2QA5A 3GEIA 2VC2B 1JKJA 4IILA 5DNYA 1AM4D 3R5JA 2B61A 4OBBA 4EPWA 4HAZA 2GR9A 3MPOA 5FL7A 2NUPB 2JY7A 2O9JA 2QTVB 1O94A 5K6RA 3BRCA 3TIGA 1GGKA 5IVHA 2FQXA 2VK1A 2I6UA 4ETWA 3C48A 3LWNA 4JITA 2QRHA 1WVGA 1SVSA 5KVQA 1AK9A 4QOJA 3P26A 2KX7A 4TWBA 2OOBA 4FHFA 2AD5A 2RHOA 1SOAA 2XBMA 5EZYF 3IP6A 2JP7A 4Q1DA 2TRSB 1U63A 3RVJA 2JHFA 3T5BA 2C20A 5D3KA 5JARA 2QW0X 1G3RA 1VKNA 2P3LA 1NRJB 2BEVA 2ALJA 4BNHA 4M0LA 1FPQA 2VIIA 4KYTA 5EHXA 4OBXA 4RFLA 5FBWB 1GG5A 3JVVA 4ZO8A 5ARCA 1Q17A 3PNOA 1YF3A 4Q6BA 8ADHA 2D8AA 3PQ5A 3VR3D 1ZIDA 2RI6A 3R6DA 4BNJA 4K9RA 3TG2A 4RABA 1RM4A 3C6XA 1MEJA 1KXZA 2KRKA 5B7QA 4LMPA 2PNJA 1RAAA 3VSDA 3TPFA 2IKQA 5AYVA 3KQHA 3QVGA 4ZAYA 5I9NA 4CXMA 2QUAA 1RXUA 2I6FA 2H4WA 2A7QA 4DW8A 4OBEA 1G8JA 2IUEA 1QHEA 4I4TF 5T6BA 4ZC1A 2O54A 4F3NA 1RRVA 2FQ1A 4XUEA 4EY5A 3HU5A 4YCLA 4Z3DA 3GZNB 4YQFA 1T3GA 4LE1A 4MAAA 2WAOA 1L7NA 1VP3A 1N5DA 2GAOA 2WVJA 3DAYA 4BGIA 2F5OA 3HCOA 2G5TA 1LPBB 4RPHA 3FBTA 3PFFA 4RMHA 2I4LA 1ZMWA 1BD3A 3A1WA 4BQIA 3H1GA 3ZJ5A 4M8LA 3V1LA 1Y1KE 4QWMA 2FKAA 1FVHA 5DSZA 3NPMA 3HE3A 3PIDA 4ZZ0A 1PW5A 1KHHA 5JVDF 2WIFA 4XYMA 1O5OA 4TZ6A 2QQ0A 3FETA 1PJ2A 1OKSA 1F2DA 3B3QA 2IZOA 5DNCA 1M7HA 3RBZA 1TKBA 1AZTA 1UBOS 4B1FA 3TZCA 1GCUA 3C98A 4L4XA 1ZXBA 3RJZA 1ONBA 4YJHB 3WIBA 1ACLA 3A9RA 4DIMA 4FD2A 3KDPA 1CJBA 3FNQA 3OJOA 2ZYTX 3I8XA 4QT0A 4DR3M 2H1RA 3DE0X 3CNHA 1RJFA 1GL6A 4FP9A 3L1HA 3SXJA 1ZAEA 4LPKA 2O2EA 4R8MA 1QGYA 2Q4RA 5E8JA 2JFPA 1QBGA 2PZEA 4TZKA 4YRZA 4U2BA 3ITEA 4ZO7A 3RH0A 3HVUA 1K8XB 4X61A 5CDGA 2HV8A 4B4DA 1NP7A 1N3LA 3D6FA 3MOGA 4JGBA 1E9RA 4PF1A 5K3FA 2MINA 3AF0A 4UCFA 1YQTA 3NONA 1TTHA 1Q3BA 4P7JA 5A7HA 4WCFB 3IDZA 4YRLA 1ZKDA 4XJSA 1IULA 2DJIA 1BDHA 5I51A 3QUSA 1N2SA 4CMAA 4S05A 2X4LA 1SR8A 4OGWA 3BFPA 2CC2A 3HKEB 5ITWA 3PC6A 1DKOA 4EPTA 3B7PA 4EGJA 3LQFA 2C07A 1AQNA 1PJCA 3KBOA 7AT1A 5A71A 4TQ9A 3QHAA 1EFRD 3U9TA 3HCEA 3JAKB 2WU3A 1EVIA 1JJIA 1P8AA 4Z7QB 3HR8A 4GWGA 1E6MA 3TMYA 3BMCB 5FT9A 1T3TA 1OT3A 4HDCA 3E81A 3G3EA 3HZOA 4PG7A 5EJAA 2R5FA 3P0RA 4AMBA 2LHCA 2PS0A 2QZPA 3UXMA 1BRMA 3ZKAA 1G20E 5AM1A 3O3MB 2WAXA 2HJHA 2X7HA 5HIMA 3BHNA 3S0JA 3UT6A 3IJEB 3FPHA 3E7PA 1TMOA 2RH4A 4FDLA 3LY9A 3I9MA 2QI9C 1ZHOA 2PL1A 3BXEA 1S96A 2PSSA 2IY8A 2O50A 1V4VA 2H54A 2Z30A 5EL0A 4CQNA 2WSEF 3MJ5A 4YB8A 5HZGA 3VNQA 1CEXA 4QTZA 1BE6A 1QHFA 1ZUHA 4G41A 1P5FA 1WDWB 1MQ8B 5DBEX 3UW1A 3VRHA 1K9SA 2I3DA 3PYXA 3OMXA 4RQBA 5JCJA 3GIDA 2WDZA 2AJTA 2JHPA 4GH9A 2QNRA 5CFQA 5KX5B 3GQBA 4UD2A 3S2YA 3QPDA 4KP7A 1T2NA 3U4IA 1M2VA 2TSYB 1YQ9A 5ALGA 1A5ZA 3DMGA 3DC7A 2AEFA 5DM0A 4XARA 1O0BA 4PRLA 1Y8RB 3CLKA 1GZ3A 4PQEA 5H70A 3MW8A 2OBBA 4FXOA 5KYXB 1DWQA 2V7UA 3ZHUA 1DMRA 4ZYZA 1JDSA 1VKZA 3BDAA 4R6WA 1XIVA 4P93A 3GL9A 3R8FA 3QX9A 5DTJA 4QG7A 3TVDA 1H0KA 4WOCA 5DNWA 4JA2A 2EQBA 2GBCA 3HDVA 1I4EB 4MCIA 3T52A 3P20A 1YAHA 4CPDA 3J2PB 1VKHA 1NULA 2A5JA 1NJFA 3IHTA 3PV0A 1SD2A 1O9BA 3PKZA 1OX5A 4X54A 4JI2B 3A4VA 2XE6A 1QHIA 4V2UA 1DELA 4DA0A 3KWJA 2DUJA 3THGA 1USGA 3AB3A 3BB3A 1RE0A 2CXSA 2G08A 2G5CA 3FVVA 2AZXA 3VH1A 1S9HA 4I55A 1IOLA 1WB6A 4ID9A 4IAOA 2JASA 2P6RA 4BFWA 4OAOA 3F5FA 5CA0B 4XIYA 5DU2A 2CBXA 3J7TA 3VUEA 2OY0A 2B5VA 3AVWA 2HBRA 4PBSA 4IBIA 1OFHA 5K1ZA 1PR3A 4GRAA 1EFKA 4MS3A 1Z6TA 2NX2A 2O3JA 3D0OA 1XTZA 2G7MC 3H8SA 1TM3E 1UKCA 4ISBA 2DERA 1M5TA 1C29B 4CMCA 2JY8A 2O2IA 2FWJA 4C7MA 2GEDA 1I1HA 1X37A 1C2TA 2DAMA 5CB4B 4QM7A 5FUMA 3DXFA 3WMRA 1IY0A 1P9NA 1H2XA 4MCAA 1NSYA 1G42A 2AYZA 4RDXA 4NFYA 1GA1A 4OJYA 5BMVB 1JR3D 2GN6A 3WXMA 1P0IA 5AI6A 3LXMA 4HNQA 2O2ZA 4XKJA 1OLUB 4GP6A 3HG7A 2BIFA 3G6WA 4ED9A 4UATA 4GOOD 1KAMA 4I9FA 2LKDA 3S8YA 4CV2A 1DJPA 4IS3A 2W82A 1K5DA 4KRXA 1AS0A 4NAUA 4P0PB 4OQPA 1TQDA 4AZVA 4FFRA 3V8QA 1AKVA 1WPQA 1YQWA 1EFTA 3LYUA 1LDBA 3WYBA 2CE7A 3RNLA 1XZCA 4QQFA 3KCNA 2R7MA 2BBOA 2DBVO 4ZEMA 2X15A 1IVSA 1E0DA 4C0SA 1U0NA 3N53A 2HUNA 3OQ6A 5LOVA 2A1UA 3OQMA 3UMGA 3OZUA 2GYYA 5H1YA 2X0RA 1L4UA 4M1EA 5CLJA 1ORTA 4PW0A 4KH0A 5KSOA 1T8TA 3KXKA 5KEIA 1VMAA 1QKKA 4DR5B 1HFWA 2O3RA 5BSKA 1V1RB 1V6AA 3B1KA 5A2GA 3VO2A 4G5RA 2QM7A 4OSPA 3C7KA 3U6QA 4M9SA 3L7OA 3LMKA 3EA0A 3KSXA 3T7RA 1H2RS 4ZHQF 4TKUB 5FADA 3W68A 1KO4A 2FWBA 4LYYA 3QKTA 4QLOA 1JPNA 1OAOA 4NS4A 4RVOA 4PSUA 2Y76A 3G2IA 1NHGC 2I7CA 4OYRA 2KXEA 3I51A 4OVKA 1V35A 3DM9B 3PRYA 4EVRA 3K0CA 4PLFA 3AHDA 5JZOA 3LIPA 1YR8A 3GRVA 4DV2M 4FMBB 2JJ2A 1E5QA 2C3PA 1IZ9A 3E2PA 2QVLA 5DSTA 5EXEA 4CKCB 1RI5A 3L4SO 3TW4A 5ILOA 4O4LA 2BY4A 2DSNA 1EA7A 2OOSA 2PFSA 3IEPA 3GJ5A 2YUIA 4IMJB 2QX4A 1LBHA 4IJMA 2HMAA 4KOAA 4MUBA 1A5AB 1L7AA 3LUGA 1OBVA 1RZVA 4NZNA 1SIUA 4RF5A 2HYIC 3BVPA 2WWVD 4EY3A 3JQ8B 1A8SA 3H5AA 2UVPB 2ZI6A 4IYJA 3CJRA 1R4NA 2ZKLA 3UK2A 1W76A 1Q39A 2N35A 4I19A 1OPRA 5JBNA 1XXLA 5BWBA 3N2LA 3M2PA 1NN5A 3K9WA 2Q3BA 3EUWA 1PLKA 3WICA 5GJVC 1ZNWA 3RK1A 1XE3A 4YCMA 4GSKA 2AUMA 1QYWA 4CCSA 3KKMA 1HL3A 5BSRA 3BT7A 4IUDS 3ZV6A 4ITRC 1GZ5A 2RGWA 5U4QA 5ESRA 3JYPA 2WF8A 2ZE8A 2C8LA 1JIUA 2EQAA 5DW0A 1IIBA 4G63A 3ZWDA 4D9KA 1PJLA 1GIAA 2XKAA 3M9WA 1NQ5A 1PGYA 1Z36A 2WMOB 3W4KA 1ULTA 4FBMA 4CMEA 2YJ3A 4PO1A 4CV1A 4OH7A 4EG6A 4B85A 1DZIA 2OORC 3NIGB 2P90A 2EL7A 5LQUA 3EUAA 2QL9A 3B52X 1HE8B 4LC1A 2ZSAA 4HNVA 3PXDA 3H17A 3UJAA 5L3VA 3AI7A 1ORWA 1YUBA 3QPAA 4HLUA 2O3UA 1OFTA 3TZEA 2WYIA 4N8SA 3QEMA 4QUIA 2G0TA 2CL5A 1ENZA 4KODA 4B09A 3I72A 1M0EA 5IXSA 1Z47A 3DA1A 1WSDA 4AJ1A 3OLWA 2JBWA 1U7DA 1DEAA 4ERNA 3L40A 1E0AA 3B53X 2YNMD 3BRQA 5JSZB 3EAFA 3OLZA 3LX6A 1XNHA 4C7JA 4XM2A 1QO9A 2DHDA 2JJ1A 4ZVRA 4PBRA 1FLAA 3PHCA 3E5NA 5AI0A 2OO5A 4DC0A 3SKYA 4B3JA 1XTJA 1H2WA 1SBQA 1SEPA 3PHGA 4N03A 2HL7A 1O57A 4JP3A 2C9ZA 3MGAA 2QLBA 3UG7A 4B7XA 1T5DX 2OM2A 1UZAA 3U6MA 2GK4A 4GH5A 5HX7A 2ZDGA 2HU2A 4RSHA 3S5JA 4I9GA 2Y0DA 3CKLA 3ET4A 3RSZA 5U4XA 5FWYA 121PA 4F3RA 5HPYB 3O1HB 4BNKA 5EN4A 1DJNA 4Q9NA 2DKLA 3JYHA 3UICA 4TN5A 4OXYA 5TVKA 2VPQA 1A9PA 1EE8A 2V4ZA 3KQOA 3KVOA 2PGDA 1U8TA 1NP6A 2DKFA 4TLCA 1JFVA 4F4FA 1SVOA 4ZYTA 5LXTF 1R18A 2CHVA 4BC0A 5ESDA 2JZNA 3I39X 2OZPA 1MPTA 3OZRA 2V7WA 3MMPA 4B7AA 3TRDA 3W0FA 2P69A 2QQ5A 4DYDA 1KI7A 1AKRA 4JQZA 4W82A 1O89A 5MDHA 4JI5B 1RYZA 4JI2M 3EC7A 3GLKA 2DY1A 4FMPA 2DUNA 4R1QA 1DC5A 3FOBA 2ZBGA 3ZS9A 3OMWA 3OX4A 3HB4X 4DLRA 1L5SA 3QOFA 1MZPA 1DAPA 2OV8A 1JU9A 4LJ6A 2CYAA 3GNSA 4DV3M 5KNBA 1KMNA 2JGRA 3CLSD 4E1VA 1IBCA 1Z5PA 3BCRA 2MR5A 1CXZA 4FE4A 4ZAZA 1RYBA 1JE0A 1U3WA 3WKAA 2AEJA 5B6JA 1EXDA 3SQXA 4QIHA 5EHZA 4GNRA 3B6ZA 3OEHD 9ATCA 3W5VA 3WI7A 1OMOA 5K6AC 2O8VA 3L05A 2HWYA 4QICA 4RM2A 4L72A 3CTPA 2ZM6B 1K68A 5LQNA 2PMDA 1IHYA 3LCVB 1T4DA 4H7PA 2JCSA 2O7RA 1CEQA 5IMSA 2IPNA 2QHXA 3LGSA 1XYYA 3AB7A 2QVXX 4WZAA 2WWXA 4YYEA 3KKKA 4L4YA 2RHHA 5LMUB 1FJ2A 5JNRA 3O6VA 1I0LA 3R40A 1TA0A 3U61B 2VDRB 5KYUB 1J07A 4PSKA 3NFRA 4F4HA 4P54A 4DSOA 2GRAA 4C1NA 5DMXA 1NX9A 1F6DA 3LVVA 1HZZA 1X1CA 3G9XA 4HV4A 3IEKA 4IDDA 4S12A 1L7MA 3K31A 2O8NA 3WLTA 1F1JA 2J3LA 2D5LA 4UBIA 2HCRA 3QEBZ 3RWBA 2B5WA 5B3AA 4CG3A 3GRZA 1TUGA 3PXUA 1G5RA 3R5XA 5T4FA 1DC4A 1P1FA 4MW0A 2GZHA 4XJXA 2B0CA 3ROPA 3RGSA 3LQRA 2HA4A 4YJFA 4Z1MD 3WNZA 4F3KA 3I2HA 2D5BA 3D2AA 3OCZA 2AV6A 2HK7A 1SUFA 2QX6A 4X3OA 1XB2A 5GPBA 3OBBA 1QP8A 1ZGBA 1JR6A 1V41E 1NIPA 2PQMA 4UHJA 2C57A 3DUWA 1J5XA 4JYBA 1A9SA 1KMQA 2WK1A 4R2HA 1XD8A 3DULA 2Z3VA 4TTPA 1FDWA 4MA0A 1EE2A 3VR6H 4X6XA 3ZCSA 5JPIA 5JS8A 2Z1DA 2AS0A 2OV3A 1GVHA 4DBVO 1LY1A 3I6ZA 3LH5A 4GKJB 3BH7A 2JBHA 4Y0VA 1KJZA 4DDUA 2YJNA 4EJMA 3AVPA 1CB0A 2GM4A 2A59A 4Y2PA 5B7NA 3CURA 3OOHA 4FOSA 4CM9A 1NU8A 3P27A 1H94A 4YRFA 2V9ZA 3HYNA 5DBIA 4IDQA 3NWLA 5HKAA 2R4UA 1DBPA 3H9CA 3H9UA 2R97A 2ILVA 4IBBA 1V37A 2JIDA 3GPCA 4FFNA 2OT3B 3GPUA 3HBLA 2LVOC 5CCEA 3D7RA 1EVLA 2ES4A 4QDOA 4Z2AA 3BWDD 3TTXA 2XWQA 1TJ4A 4PLGA 3OD5A 4RVFA 1WY5A 2CFSA 3F47A 3BCHA 1IM2A 3CS3A 2FPOA 3WHPA 1L5VA 4HDRB 4Y9TA 1YRWA 2O7NA 4RL4A 3BWEA 4PN7A 4YP1A 5TSDA 2IYEA 2FUCA 2QXUA 4Z86A 1JHMA 1HNNA 4ZDIA 1H9BA 3BH6A 2WMYA 2EFDB 1NN3A 4F6LA 1KBOA 2Y1FA 2CFTA 4E51A 3NO4A 3RWMB 3B3JA 2V5VA 3VR0A 1TIPA 1XEXA 2IBMA 1MC4A 3U56A 1QF9A 3FWKA 2VNJA 1P2VA 1MAWA 3DTTA 4GI7A 1PX2A 3K70D 3QXGA 2VYVD 4O08A 4Q3DA 2QW8A 3EPJA 3C4JA 5JCPA 1VPLA 2DUMA 3NWOA 1Y9AA 3WWZA 3CPSA 3X1ZA 4RK5A 2QGFA 3FD8A 1ZZEA 4QLAA 2XAUA 1Q7TA 2ZE5A 4LXUA 4M2LA 3NWPA 4PANA 4D8XA 4LA4A 1V9CA 4IXTA 4HXEB 1XRLA 2HYDA 2Q8NA 2IEAA 4AJLA 1YULA 3ACDA 1FVFA 1RYYA 4RLFA 4QOIA 2OGTA 1U2SA 3RTDA 4GXQA 1SIOA 4O33A 5JDCC 2VT2A 1N9GA 4AZSA 4CGYB 3JYQA 4XR4A 1SXJB 2BHRA 3JTMA 5EMMA 1Q2XA 2PKEA 1NUSA 3G88A 5K0TA 3FYUB 2FN8A 2KLBA 4BFXA 4L9RA 5LBIA 1E2LA 2EFGA 4I9HA 3H2ZA 1VOTA 3MCAA 4OFZA 4ZOLB 4I4TA 5J43A 1XRPA 3QOYA 1YE5A 1N2IA 2DPXA 4DHEA 1JNYA 1NQWA 4YAOA 1R50A 2UVDA 1CJKC 1H8ED 5JDIA 2WWGA 3IAM6 3NYRA 4XI9A 1VM6A 3LQ4A 3IUQA 5CX1A 4P36A 4X8HA 1LI4A 1JR2A 2QG4A 4BTLA 5IUKC 1ILWA 4XYEA 5FTLA 4R8VA 3L46A 4OY3A 4ZVPA 2ENWA 4FWGA 2RH8A 2PUHA 3KQQA 4YYZA 5JVDA 4CMGA 4E15A 3BE6A 3CLUC 4ZI7B 1JIIA 2W22A 4HFJA 1CUSA 1ZLXA 4TRJA 1DAOA 1KYXA 5CYPA 3T3OA 3RQIA 2QE7A 3Q15C 4JD5A 1UXGA 5I9SA 4JBLA 4RIHA 4C43A 3ZV7A 4IO0A 1X1QA 2NZUG 3SMPA 5SY9A 3EFHA 3SPXA 4FDVA 2ZLBA 1U0GA 1W25A 3I5UA 4UASA 5COBA 5LVAA 2BHNA 3DLPX 1NG9A 2YOGA 4QQ8A 2G7ZA 1N3YA 4QUGA 3P2IA 4M1WA 3ZJTA 1U3CA 4UOQA 4FSDA 1RAGA 3PPXA 2X6QA 2FMHA 3FKEA 2PFGA 1BCRB 4DXDA 5A5FA 3VOTA 2Z83A 3UWSA 2ERCA 3X1KA 3U5ZB 3UB2A 3MRTA 4UQPA 3GMSA 1T15A 2PKWA 1PE0A 2C42A 2C77A 3BJEA 3OCWA 2HRQA 1OU0A 4QREA 2ZM6M 5LJIA 3KS8A 2ZRKA 1Y5LA 5ECDA 3KKPA 3KK0A 1K6EA 4GS5A 4M0WA 4TXMA 4OU5A 2Y6VA 1P2UA 5THKA 2WUDA 4YY3B 2FWIA 2C99A 1T0JB 4AL4A 3ZXXA 1QP0A 5A1JA 3LLVA 1XZKA 3UJ7A 3Q2OA 1V11B 4IIJB 3QLVC 3K9BA 1Q7GA 2C7VA 2A57A 1VLZA 4PT5A 2X77A 1HG1A 4I46A 3H97A 2IOFA 3ITDA 2HA0A 1OAAA 1WU8A 4H2DA 1ZWLA 2KPOA 1IN8A 5T5QA 5EHGA 2H85A 4R9RA 4CN9A 4HAOA 3I5XA 3Q8XA 4L9AA 3KP1A 3DZCA 4GL2A 1QFYA 2GQ0A 1D7AA 4G07A 1DQYA 3C5CA 3GGOA 2A8YA 4KFUA 2G6BA 1X87A 3OCVA 2WG2A 3ZBTA 4MPJA 3PJFA 2QN3A 3ZK9A 4MGKE 3EH1A 1VDLA 4JDPA 2AOTA 2BZSA 2UUPA 4P34A 4C2TA 4DJ5X 3OUTA 1T8PA 1V7CA 3S2FA 4A7PA 2WNHA 3ZC3A 2DFNA 5IP5A 4M55A 5FFNA 1QH9A 3CTWB 2NQ8C 4O02B 4L9SA 4RORA 1KI9A 1XNRB 1J2RA 2ERXA 4BASA 2CK3D 4RZQA 2AF4C 3BB4A 5BR4A 2LIPA 2EX1A 4M1YA 3QLTA 2LV8A 3BRWA 4EKEA 3EXAA 3Q1LA 1V25A 1L3CA 4LWQA 4KPGA 4C7BA 1WP9A 3ANLA 3F98A 2ZETA 3IP3A 1W9HA 1QCYA 3OZTA 3BX1A 2CMGA 4Z4GA 2IHKA 1Z0ZA 1RR6A 3AF4A 3BXGA 5DTMA 4EPRA 1XOIA 2OFWA 2Q2OA 3M4YA 1J2YA 2QL5A 4PV7A 3WNBA 4HAYA 2GN1A 1FRQA 5AK5A 3EUEA 4CCYB 4IUCS 5D3MB 4QATA 3EFOB 4WKBA 3T7EA 4K9QA 1KBZA 3E9ZA 2J5RA 2V6IA 4DY4A 1FIUA 5HJ2A 1CERA 3OX1A 3VJKA 3LDHA 5TEWA 3KZVA 3PA8A 2I3BA 1OGJA 4P3YA 5ICMA 4AF6A 3DBOB 1C7QA 3K0FB 1J56A 4GKJM 4L0DA 4FSXA 5CT8A 2AJ8A 1DO8A 4HWGA 1OH5A 1DO2A 4UNQA 1LV8A 1XU4A 2BGMA 4Q4HA 3TLXA 2YL2A 3KJNA 4LY6A 2Z4SA 1CQXA 1Z7WA 4DWWA 3E3MA 1OPXA 5BNWA 1SMKA 5JS1A 4CMHA 3CKYA 5TMBA 4YK7A 3CEHA 1L6RA 4OJTA 2QSUA 4DB4A 5JEEA 3ISVA 4EI2A 2PLNA 1XUOA 3RHTA 2IPAB 4U5XA 4X62M 1I32A 5L95A 1OILA 5SICE 4Y7CA 1GZDA 1O9HA 1JJ7A 5KYYB 1QJCA 5JXJA 2JAWA 4D4MA 4KQGA 5EIAA 3ETEA 1MJFA 2Q9UA 4G89A 1EFVA 4KR6A 3P2MA 2P40A 1Z07A 4YV1A 5K0GA 4UARA 4LW8A 4X3PA 1VZ3A 3DWEX 2QT9A 1ZIPA 4IX1A 3OQHA 3CUYA 2Q3EA 1V48A 2CXTA 4ZVUA 2QTTA 2PJRA 4LS3A 3D4LA 1DQNA 5AUQA 3WL6A 1BZYA 3SD7A 2J33A 3EWAA 1PZHA 2RGUA 2PUVA 3HC7A 4PPQA 2R1VB 4P7KA 1PT6A 2XDYA 2IYRA 3LBYA 1MXFA 4KB5A 4YUWA 2BI4A 1FTYA 4UHHA 3KSMA 3LZDA 1QE3A 3ESDA 3V8PA 2W71A 1TDHA 3ADPA 1LVHA 3RE1A 3VVMA 2HDWA 5JNWA 4E5YA 1ADJA 3TIIA 2L4FA 3SDBA 2JLCA 3T9DA 5F5XA 4PTLA 4GD3Q 3E9DA 1GN9A 3UV6A 4RTJA 3DMRA 3TKLA 2FUEA 1BNCA 3T94A 2HMTA 5JS6A 4QVKA 3UN1A 4KC0A 1Z4QA 4AJOA 1GCOA 3R77A 1RWXA 2LD4A 5JRZA 1QRAA 4JP8A 4O1IA 3IUJA 4P3NA 2F1HA 4P6VF 3PUWA 3FNGA 1G17A 3WWEA 2JFWA 5T8KA 3F4BA 3I05A 2UDPA 5DB4A 3ULKA 3USZA 5KDDA 1PT9A 2JJ8A 3IQZA 2DZNB 5CTJA 2B3TA 5GM1A 4EO7A 3LY5A 4YJ3B 4PPGA 5JS7A 1WA5A 3TOVA 3RAFC 3BXXA 3T5GA 2E9SA 4MW1A 5KNCD 4UBJA 2HA2A 4M3NA 2MIIA 4M53A 2DEUA 1L9KA 1VE5A 1A72A 5F51A 3WO0A 4B32A 4NULA 4D3DA 1L7OA 5JD3A 2ZAIA 3H2KA 2O5VA 1IWPB 3MWLA 2YVQA 3FMFA 1TQ4A 1UBKS 4ZHQA 5B6IA 3EVFA 3KJIA 2QS9A 2PEZA 3LWDA 2FCAA 2GILA 3CYFA 4UVGA 2W2LD 4RK4A 3H8JA 2C3YA 4U1RA 3LECA 1RIFA 1BXGB 1KDPA 4EUFA 2RHJA 2PQ2A 4UM9B 3FGNA 4IIWA 3C58A 1RVV1 3PVCA 5FPQA 3OIYA 5BSMA 1M2OB 2UUAM 2H2IA 3GPPA 1S3IA 1E0KA 2ZYIA 1JEQA 1GJTA 2QP4A 3W6ZA 1XZIA 4W9RA 2BRUA 5AKLA 4HHEA 5A4IS 2VPZA 3E3LA 1AQIA 1DT3A 2TS1A 3I01A 4A6XA 1UJ5A 4LJKA 3OP4A 3MBOA 2IIPA 2E4VA 1VJCA 2CMFA 2YDXA 4U3JB 3BAFA 5FI1B 1IVNA 4P38A 4FIDA 4A4DA 1R9GA 1J9EA 3IQHX 2MSDB 3AW9A 4F9EA 4K03A 4M36A 3ORFA 1H23A 3GAAA 5THXA 2A9KA 3V6MA 4ZQBA 4NRWA 4BVEA 4MP6A 4NMHA 3SC2B 1BW9B 4MV5A 1YK0A 1QYIA 3WL4A 4Q3EA 4PAWA 1N8TA 5TQ0B 1OFUX 2FPPB 1CZKA 3X1MA 1O4VA 2E18A 3K6RA 2XB8A 2X8JA 4YY3M 3T9EA 2HWJA 3PE3A 1MABA 1CSEE 1J4AA 4L5JA 5LP6C 1B4DA 2WZDA 1V45E 2UZ3A 3H4MA 2R6JA 5FWNA 3ENNA 3L6DA 4OCZA 4Y18A 1EUZA 2XQGA 1ECGA 3M82A 4TM7A 3V2GA 2HAKA 2G70A 2P75A 5L4LA 2F3RA 4X7PA 3N8IA 4QDUA 4RCYA 4IGKA 3VNSA 1IY2A 4CN8A 3HVRA 4KTTE 3DMPA 1DKPA 2FPRA 4WZ6A 2RGDA 1HDXA 5IMBA 3ZH9B 1JDNA 3R6TA 4C5AA 3AEQB 4EB6B 3DE6X 4AYXA 3ADDA 3IHLA 1RADA 5LKAA 4I8IA 5K0ZA 1TB4A 1NHWC 1EI9A 2OXEA 2I0FA 1SVLA 1PP4A 3QVJA 4HJXA 3RVOA 3TOSA 4NVRA 1W85B 3R7BA 1PGJA 3USCS 5HIIA 1V2HE 3GEEA 1UK8A 3T7CA 2D1RA 1N2BA 4XQ9A 2FSIA 3SOZA 1DRJA 2B7LA 3RC7A 2BKAA 2B1RA 5L3SA 1QHGA 2Y68A 1MXHA 2GWHA 3OQVA 1YS4A 1XNRM 1FP1D 3QPCA 1MD9A 1BU5A 5EIBC 5FR1A 1GP2A 4K6CA 1JQEA 3NH9A 2OGWA 2FSFA 2NU7B 4AZFA 5KQ8A 1JIXA 1EZZA 4KQ9A 3KHTA 3C3MA 4CQLB 4GITA 3N8KA 5HXAA 2I2FA 3LSTA 1TYZA 3FW1A 3VO8A 2XJ9A 2HLDA 3JD4A 4TUYF 2EX0A 1GPUA 2JAOA 1CT9A 4LWZA 1TU4A 4G85A 4WZZA 5CT5A 3Q9UA 3AVQA 5FPPA 4N1AA 3R76A 1YMVA 2ZYWX 1NVWQ 1UF9A 3GCWA 4LPSA 3B60A 3TL2A 2PFKA 3KLPX 3G0BA 4MJ7A 4OL9A 3ZDFA 3NFYA 5CGQB 2HC9A 1WUJS 5IHXA 2CJYA 1U9CA 4REMA 4C1BA 1ZG3A 3GVHA 4Q7MB 1CHDA 2PU5A 4B7CA 3K5WA 5LXTA 1IOVA 4KUHA 2JGEA 5HOQA 3WRYA 4IVNA 4CM6A 4TTQA 1FUIA 3KPYA 5K0EA 3R5HA 3TDMA 4XXHA 3K1JA 4V0RA 3BE4A 4U7HA 1K86A 4QZVA 3MEQA 4OK5A 1N3BA 1OV6A 1QUSA 1TMGE 2GM3A 4Z6YA 3C3AA 2VH2A 3MA0A 2XCOA 1JQAA 3Q6NA 2GDJA 5EGNA 1U94A 1H0HA 5ISMA 4TLBA 5K4AA 4FWTA 5EP1A 4ENPA 2POCA 1JAIA 3ESZA 1CUGA 5D8DA 1UAGA 1HDGO 1V16A 5ICGA 3MQFA 2BH2A 2Z3ZA 3OJLA 2XHEA 3RSFA 2WAAA 4J7UA 1RI2A 1AF4A 4LDJA 2X4AA 1Z35A 3BG5A 2VQFB 2H17A 3FY4A 1K88A 5JD6A 2ZUBA 4C89A 4UDOA 2QOEA 4NZYA 4BLCA 3HJGA 1JXMA 1EK5A 1U8XX 5ITYA 3I6IA 4TQAA 1A88A 4A0RA 4BKPA 1ADGA 5C5CA 2CWWA 3BWYA 2FEMA 1GKLA 3DYVA 1YBVA 3O38A 2PJZA 3B9BA 1EHIA 4ZV4A 5H5JA 5KTTA 3SFTA 1FJXA 1ZM7A 1Q1AA 2B8JA 1QAQA 2FW0A 4EGSA 1S3FA 3PF9A 1E69A 3FGZA 3CCCA 3VYVA 3LF2A 2R7NA 3VR2D 4TLMB 3ZIDA 3OIUA 2PRJA 1FQWA 1JA0A 5CDFA 3K9OA 1GGHA 2I5PO 5H9VA 2M60A 5I9LA 1DINA 3CJTA 2QX7A 2YV4A 4DIKA 1GJSA 1PR0A 5CLIA 1GQSA 2C31A 1QOZA 3DEHA 1CKEA 3RKRA 1NU6A 4H6PA 2GPWA 5MFZA 3HB1A 3TECE 3E15A 1CZNA 3QSGA 4CKYA 1RWVA 1IC6A 3V4FA 3I6BA 3PNSA 1FRFS 4F4IA 5AH0A 5EGSA 2Y77A 4QTUB 4B48A 2NSDA 3LDAA 1XFDA 1LF0A 3TG8A 3ZUPA 3KZ1E 3COJA 3UW3A 1DCMA 3I9NA 4KRFA 3E7WA 3QENA 1EFUB 3SBDA 2PZBA 4POAA 1QWOA 2Q99A 2PU7A 4Q3LA 2OLJA 5ALZA 3PNMA 5JQWA 3DLAA 1JAXA 2PCJA 4WNCA 4QOSA 2UUOA 4B3GA 5TXGA 3ZNOA 2XECA 3M9LA 3LC0A 3IG5A 1D2GA 2P67A 4X24A 1WXDA 1EYZA 2QAGC 2AL7A 4PQYA 2ZJZA 3KL2A 1QSGA 3WWPA 3PEUA 1B42A 2Q4EA 1X15A 4CIAA 3HXTA 1J2TA 4AAYA 5E7QA 1BVSA 3N76A 2JEZA 4PS0A 4GPBA 3D59A 1QHSA 3E9RA 4TZTA 3TOXA 5ITSA 4RKFA 4QGSA 1H05A 3DF7A 1GDTA 4II7A 1LC3A 1LSUA 4H08A 4KU4A 3F4LA 2RBGA 3PWSA 1EFPB 1X77A 1SXIA 2VRCD 4ALJA 1E77A 1QDLB 3QELB 3EC2A 1Z8DA 3DMHA 3BK1A 4U7PB 4NCXA 1QO0D 4RPJA 3FHOA 5ILGA 4AKTA 3NPAA 3ZHSA 1I6LA 1R4MB 2JFQA 3NTXA 2C8KA 1XWFA 5HQ3B 4K8RB 2ZJFA 1FFXB 4A16A 4XCQA 3MTIA 1CY0A 1B26A 1O8BA 4C01A 2BUCA 1M10A 4FS3A 4G81A 3FHCB 3TQRA 2WJVA 4YT2A 1XZQA 4B0PA 3AUJB 1SFRA 3PNPA 3I9V6 4CT0A 1QV6A 3KQLA 2OL4A 3H1PA 2IXDA 1RT9A 2Q46A 2HA6A 4MITA 1N8NA 4GECA 4I1RA 4UU7A 1U0EA 5EWJA 3WWDA 4NSOB 1R10A 3Q0EA 4RK1A 3EBPA 3QW4B 4C4RA 2HMUA 2RHLA 3E46A 4UHKA 3O3CA 2IX3A 5CT4A 1WXFA 2QMZA 3B20A 2VTVA 3O74A 4UZEA 2PZ8A 2B2NA 2Y1XA 1G1AA 3HP1A 5EMNA 1HE5A 1R5BA 1WO8A 1WB9A 3JATA 3RVMA 4YXWD 4J9UE 1UMBB 3WR5A 3HEAA 3ZK7A 3DLHA 2ZT8A 1HEUA 1WD5A 2B8NA 3QI2A 1CF4A 1WUYA 4HDSB 1W36D 1G3IA 3DE3X 3AYXB 2UZAA 3ZYCA 3SYTA 3ZQKA 3JZIA 4BO2A 4KW7A 1OH7A 1PBNA 2P2GA 3GZTB 3QKRA 4BNZA 4ENVA 3EDQA 2XTAA 1LTHR 3E6AA 1XVAA 5DDIP 5C35A 4XCXA 4R68A 2VNAA 2QE6A 1D03A 3G17A 3MTJA 5DT9A 2FHSA 3HV0A 3ZCTA 2CL0X 4C4TA 3BL6A 5JZ9A 4S24A 1AUVA 4DLKA 1OASA 4UTNA 5K3AA 4DLSA 3URKA 1KVRA 4EKNB 3QWAA 2I3GA 4NBLA 4TYPA 3DAHA 1JG1A 3DAFA 4HNTA 3EA4A 2ZCVA 5ITTA 1JSXA 7ABPA 1I01A 4HFNA 1X86B 4YI5A 3TM4A 3SBJA 4YR7A 3QKWA 2P9GA 1JHPA 4JR2A 3IJPA 5AIAA 4GBMA 1UFKA 4WSOA 2HSEA 4UNNA 1SD1A 4FD3A 5BNFA 1JV2B 1DV1A 5E6UA 1Y33E 2VXOA 4URXR 4EJSB 1DAIA 3U60A 2UZ1A 2NU6B 3P9ZA 4KAXA 3WLIA 1MO6A 4HO1X 5E1BA 1MV8A 4R3UC 2QM8A 1UP7A 1O3YA 3LZ6A 2ZXUA 4JLVA 1ZNXA 2D62A 1CS0B 2GHIA 3OY2A 1MJGA 1OQAA 3IMEA 4GYWA 5BQFA 3QEJA 1L1FA 1LWNA 2R6CA 3FPJA 3YASA 1TMKA 4QYWA 4X44A 3OTOB 2EKFA 3GMTA 3NIWA 3D4BA 3T41A 4QBIA 4HY3A 1F60A 5AW7A 3ZVRA 2ZUUA 2L82A 2KHZA 9LDBA 4PZ9A 3W5SA 3GJSA 2OEPA 2PG3A 4YONB 2NO5A 3KJHA 4L07A 2WPNA 1NWHA 1IBLB 1O95D 3MUNA 5MN5A 4OJMX 2BL4A 3GA5A 4X7RA 4RZ2A 2AZ4A 1L5KA 3AEUB 4JIGA 5IUNC 5KHAA 4YT5A 4QUKA 3K1AA 2P2LA 1IQPA 5FBHA 3GMDA 5DTRA 4XX0A 7ADHA 2E48A 3TTUA 3L6EA 3V8BA 1R0LA 2Z2IA 5IN5A 4IBGA 2XT0A 4ZOQI 2WWTA 3ECCA 3ENWA 2BGNA 3PEWA 1WHSA 2AR9A 2VQFM 2ZW9A 1W2GA 3A14A 3LUHA 2OHXA 1W52X 1IXSA 3P9SA 2GVZC 4AZ0B 1ZH0A 1CB7A 1MJ5A 2NZJA 4R1OA 3RT9A 4M8KA 5ERGB 2C4KA 4A8JC 5FYQA 4DA7A 4OLFA 1UKZA 1DARA 4DCSA 4EHAA 1DVRA 1KI6A 3F96A 2FNAA 4E09A 5T41A 3MJTA 4MUMA 4UC0A 1CUWA 3E53A 3I9OA 3L8DA 1C5KA 1X0VA 2FPSA 1ISJA 4S0ZA 1PEKE 2ZI4A 4FZVA 2ZAYA 5IF3A 3BFVA 3GFPA 1UMDA 1N9ZA 1LLCA 3TX6A 1J25A 3KV3O 3E22B 3FAKA 3RVNA 1DKMA 1GPAA 3KPJA 3OE1A 1K75A 1CX9B 3FMGA 4P53A 3VX4A 5D1HA 4BLVA 2VZ0A 4AT1A 5LL6P 1X7WA 4HWSA 3N0XA 1B1AA 3AM4A 3QPWA 3RBVA 2ZRLA 4HQ6A 3LUAA 5CJPA 4P4NA 2YVUA 1VDZA 3UATA 5GV7A 5JBIA 4DMCA 1OBCA 3AVXA 3FM9A 5A62A 1TFUA 5C5EA 3IE0A 3U7HB 1O54A 2J7KA 3HJRA 1LLUA 4DRXA 3G2PA 2GLXA 3KCQA 5KHOC 5KYGA 1P3Y1 1SOWA 1RP1A 3AUYA 3UYKA 1SXHA 1PV4A 1U1CA 2VHTA 1PM5A 3GBVA 5JATA 1W87A 4U00A 1W2HA 4I8XA 2ZT5A 2HZ7A 4KQ6A 2OHGA 4I5IA 2RKOA 1P72A 5C8XA 3U4MA 2OP1A 5KX5F 1G8AA 3GP3A 5HRCA 3UMMA 4G0VA 3DBHB 1CUAA 3BQ9A 4QDJA 1V8OA 4LOAA 4UHFA 3CKKA 2J9FB 1UC9A 3ANXA 2ODNA 4KR3A 2QLNA 2HRDA 1TTQB 4UJ5A 3V8MA 3VHXA 3MUOA 4H1VA 2X1HA 2X8WA 4Z2YA 3HXMA 4QBTA 2W6CX 3PPIA 4GLOA 5JANA 2GJAA 2V4MA 4FQ8A 1BN7A 1K06A 3MAAC 5DM4A 2DT8A 4AZ3A 1UKYA 1ZW1A 2JRCA 3IGFA 3FA2A 1TZBA 1QHHA 4L4SA 2ZIEA 1OZGA 1EK0A 2QUJA 2WHPA 4DMGA 5JWRA 3GEMA 3TW6A 1HORA 2FF7A 2ZZMA 3AT1A 3IERA 4QJ3A 1DNPA 3R7WA 4J1QA 5WRFA 1IBSA 3J7AS 4UMVA 1DGHA 3GLSA 1E2UA 1XJWA 2CSUA 2IP1A 3LJKA 4HRAA 5E6JA 2GUWA 4W5JA 1WR1B 3WV4A 4WURA 4KHPB 1BKYA 4D4LA 2CNKA 3ZJYA 3ON5A 5LZ7A 5ERYA 2P4HX 2FRDA 2FZLA 4YRMA 5K01A 1FTQA 3STWA 5KQMA 5D6NA 5TR9A 1YONA 4B40A 2J3QA 4EF5A 4S1PA 5CA0F 3S44A 1DZ3A 3G7SA 3C16C 5EE5B 3OZAA 3A2MA 3BZUA 3W6OA 1ZLYA 3O82A 4J16A 3TWLA 3AF6A 1TCBA 5SY6A 2W37A 4RY2A 4B9AA 3NHZA 3AWIA 5HFNA 2EFHB 1VE3A 2NG1A 1R12A 1XQVA 4AKSA 2P30A 2WZBA 4ND8B 4MQLA 4F3CA 2Z1NA 1SKQA 4PCZA 4NHEA 5CB4F 2DGDA 1OKKA 3L6BA 1PGPA 1IHPA 1S3GA 4GUDA 1N5MA 1NOIA 4G56A 4D41A 2VNSA 1NW4A 2FSVA 1MTZA 3L4EA 3IAS1 5F7ZA 4MUYA 1HETA 1NRIA 2JATA 3Q98A 5EZSA 4G4NA 3JQFA 2K6BA 5BMVF 1MFZA 4OW0A 4UAVA 2HK6A 1L2DA 1TIKA 1YHYA 4LXQA 3FDZB 4QNRA 2AKAB 1G20B 1P0PA 3L1VA 3BHIA 5HOEA 1TYDE 4MEBA 4E6PA 1XKQA 1KJIA 1UINA 2OAQ1 3INTA 2Q6OA 2IUUA 2NU9B 1OZFA 1N0IA 4DS3A 4F72A 1ZCZA 1N5KA 1X7XB 1O6BA 3G2MA 4JLPA 3U2QA 4QODA 4BB5A 4CQMB 4YAEA 1ZU4A 3HM2A 1KR2A 2WQ6A 2WQZA 1JE1A 5BOSA 3PGLA 4GSYA 3SIWA 4BMVA 3OX2A 2QQ8A 2JZCA 1SUAA 3PPYA 1T35A 4FSHA 3E9MA 3CEAA 3TZ6A 2VZ8A 5ALQA 3A9VA 4BIIA 1PTJA 4N3AA 4DR5M 3IPXA 2PRSA 3MTGA 3MJ4A 5K8CA 3K53A 4Y67A 1ZISA 3IAFA 2R1TB 3UMBA 5GP1A 1XC7A 2WB4A 3QOXA 3R23A 3V8VA 3OTOM 5LYJB 3KD2A 4NC6A 2C5HA 4C07A 4CM5A 2DWCA 5K05A 2IXBA 2ZTHA 5IKEA 1HTBA 1OREA 5KNCH 3CUUA 2GCIA 4X20B 3ZXUB 5JNVA 1QMGA 4KLZA 3S7TA 2R9VA 1BO6A 3SR4A 2BBSA 3ZLVA 3BHMA 3OCXA 3WSWA 4DCOA 1ZD9A 2EXXA 1IBLM 5GONB 4BAUA 2IEDA 5HF6A 1N5JA 3VC1A 5F52A 1FCJA 1J21A 3K1ZA 5CVUA 1ULZA 1VLMA 4MGHA 4K9MA 4AJKA 4UTOA 3C5EA 3QHQA 4LJLA 4GMQA 2IYWA 4CBVA 1RACA 5K3DA 3OJ0A 2Q2WA 1NVAA 3EGCA 3ORRA 2CCKA 3RS0A 2W7TA 4Q03A 2DPGA 4WLFA 2PPLA 1NNUA 2A88A 1SZJG 3RV3A 3UCXA 2C5GA 1Y3AA 3GLHE 2HLNA 1ZK2A 2AR7A 5IT4A 5G53C 5C1OA 1PS9A 4BUCA 2J7PA 2FQYA 3EZFA 1ZI8A 3DZJA 4TSFD 1QDRA 4LXHA 2NO4A 4U7TB 1HUQA 4RFVA 5JNLA 4B08A 3RDPA 1WQ4A 2QUIA 2R8YA 4KKVA 1CY1A 3C8DA 4MJ3A 2VHJA 3ONDA 1ORIA 3ZE2B 3ROMA 1XLWA 1L5GB 1JEAA 3ETHA 3QF4A 3A1TA 4IJVA 4LUCA 1DLIA 4DQVA 3FR8A 2VP5A 3CZPA 3RM3A 4A10A 1JBKA 1CQJA 4D9JA 2IEBA 5K3CA 2GMWA 2LW7A 1UZNA 3JPWA 1SKUA 4Z4CA 3W7AA 2O8EB 3JQGB 4QHYA 4WX2B 5EZYA 1XDGA 5C5DA 1A50B 3SMVA 1XZLA 5B6PA 2AG6A 1HDOA 4DNQA 5EJ4A 1FFGA 2EKQA 5ALRA 2QUHA 3P71T 1HY3A 2JAUA 1T2VA 3Q3EA 3TKAA 3W6UA 2DZDA 3B13B 3AFNA 3DOFA 5C8VA 1UJMA 4QJ4A 3ROKA 4FKMA 2ZOSA 3KYDA 2UXDB 3TR5A 3FCXA 4PYIA 4URYR 1NJGA 1Z2NX 4EJFA 4HEA1 4XDYA 3GLFA 3K4PA 4BVHA 5DCUA 5JMOA 4LQLA 3AKCA 1XTIA 3R41A 3CIFA 4QUBA 1K6IA 2A3RA 4UXHA 4EEKA 4TUYA 4LYEA 2ZRMA 3PXCX 3A04A 5CNJA 3EIWA 3EDRA 1FU4A 1P73A 4AICA 3QJYA 4UUBA 1EM8A 2NOAA 4L74A 2D1TA 3WZLA 2BBTA 4F4JA 3KETA 4ZVOA 1T9HA 1ZMTA 2NZVG 1ZCFA 2WUFA 4G1EB 2AMYA 4CM4B 1QQ5A 2NO1A 1AO0A 5IFLA 5TGDA 1H3NA 1DIGA 1VEGA 1PUXA 3ZW7A 7MHTA 1AMOA 2C61A 1HNZB 4Q4AB 2GEJA 2OCLA 3IP5A 1XZEA 1PWXA 5AVUA 2M2IA 3PHIA 4FGJA 4OHZA 2EWWA 1LLQA 4G0ZA 2QENA 4FYPA 4O0MA 4P17A 2BC9A 3PCRB 4C5BA 3WKCA 2O48X 4QNNA 2HMVA 2PGLA 2OG1A 4JU9A 2OZLB 4FONA 3ZD8A 1GAXA 2M9MA 3P2KA 4XQEA 3J7AC 1YR3A 5C18A 3KM0A 1CJTC 5HFAA 3MD0A 3AR9A 5AXAA 2HEGA 3DEZA 5HBRA 1EVYA 4ND3A 3LX4A 1RXYA 4N01A 2I7NA 3NM5A 4IRUB 1G6OA 2BFDA 3MS2A 5F7XA 1XT6A 1QLHA 4ZJUA 4LYHA 3HKDA 1E2IA 3FFXA 4KHPM 4RTQA 3EXHC 4XUCA 2JS7A 3QVKA 5FLKA 4JI5M 4PNPA 4Z9AA 2YRWA 2ORIA 1KERA 2P3QA 1QPGA 1KF0A 2WA2A 1RRGA 1XRRA 3T3NA 3ORSA 2P78A 3WHLA 2FN4A 4H1TA 4D7AA 2EUCA 5A9SA 3GO4A 2IZ6A 1XZDA 4YALA 4IZIA 3EDOA 2YYYA 2CCGA 2XHZA 1RIIA 3GPLA 4QXPA 3NVMB 2DM6A 3BL8A 4NZPA 2ZGVA 5C1IA 1SNYA 1ZN8A 4BWFB 1WKBA 5HILA 4LDQA 5A9TA 4MV7A 1HI9A 1A9ZA 3F2VA 4YCSA 1XJCA 4LQCA 3G0HA 4BU0A 2IDMA 1AQYA 4BMCA 4CHGA 3H9GA 4ZV9A 3P9XA 3T3DA 2QBYB 5F1PA <