1I4WA

The crystal structure of the transcription factor sc-mttfb offers intriguing insights into mitochondrial transcription
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
322
Chain Sequence
PIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEWPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL REPLICATION PROTEIN MTF1
publication title Crystal structure of the transcription factor sc-mtTFB offers insights into mitochondrial transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 108
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1i4wA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1i4wA01
3FTEA 2YUIA 3LKDA 3TM4A 4DM3A 1NV8A 5IKMA 3KQYA 5GINE 2XVMA 3EGVA 1JG1A 2Z6AA 3QOXA 3P9CA 2H1RA 5D1NA 1NW8A 3TM5A 1QANA 3HTXA 5DSXA 1D2GA 5BXYA 2H11A 3IV6A 3REOA 1EJ6A 2R6ZA 3SSNA 4EMSA 5KVAA 2P7HA 1QYRA 2UYOA 3KPYA 3IYLW 5LR6A 1M0EA 1SVUA 2AOUA 3HCDA 4BLUA 3C0KA 4E33A 1NW3A 3M6UA 4OBWA 5EVJA 3UJCA 1SQFA 1JG4A 8MHTA 4X60A 5C9ZA 3SSMA 5DT2A 3SX0A 3HEMA 2O07A 2UYHA 5E2AA 4V0RA 2OB1A 2QYOA 4ISCA 5JR3A 3EEYA 1Q0TA 1RI2A 3BKWA 3E23A 3TRKA 3RW9A 4DCGA 4MHTA 3M6WA 3JWHA 2NXEA 4PGHA 1YFLA 5DRTA 5T6BA 1TW3A 5EIFA 5BW5A 5DM4A 2OBFA 3DXXA 4P58A 3FTFA 1EIZA 2FYTA 4YUZA 2XYRA 5T64A 1R74A 3HA7A 3BZBA 3OFKA 3UJAA 4E2XA 5FA8A 3EGIA 1EAMA 4PCLA 1VQ1A 4E30A 4EKIA 4QPNA 4A6EA 3NW9A 2YR0A 4RVHA 3BT7A 5DX1A 3NTVA 5LQRA 5HFJA 4KDCA 3E05A 3JWJA 3UJ6A 4RVFA 3P2IA 4BLWA 4ER3A 2WA1A 3DUWA 3HM2A 4G56A 3KHKA 5DWQA 3FUTA 5T67A 4E31A 2BH2A 2PXXA 2PKWA 4YUXA 4QPPA 1U2ZA 1B42A 2Q41A 3FPHA 3LBFA 5FULA 4F86A 1JG3A 5EKUA 5HZMA 5K0NA 3U81A 3AY0A 4HRAA 4PYMA 4ER7A 3R0QA 2CKDA 3TKYA 1JR4A 4BLVA 2ZBPA 4A6DA 4GF5A 3TR6A 4FGZA 5FWAA 4HG2A 1X1AA 1FPQA 5U4XA 1P1BA 4CTJA 3TLJA 2B78A 4AZTA 3BGDA 4PWYA 2IBTA 1RJFA 2QY6A 3BWCA 3MGGA 2B2CA 5K0BA 3CBGA 5MHTA 2B25A 2ZULA 1MJFA 5FA5A 2LD4A 2ZFUA 3UJ8A 3FRHA 5LSAA 2PGXA 2AOTB 4FS8A 1YF3A 2K4MA 4CKCA 4C08A 3NMUF 4AZVA 3O31A 2JHPA 2BR5A 4PYJA 3EMDA 3TFWA 3MCZA 3H2BA 2QM3A 1RJGA 4X63A 2PXAA 4MQ4A 5FADA 5E9WA 2IFTA 3Q7EA 4E2YA 5EMKA 3BKXA 2F8LA 4GOOD 4ZTBA 5EC8A 1AV6A 3IHTA 3HA5A 1FP1D 3LPMA 3CJTA 4RX1A 5EZSA 1TPYA 1NV9A 5GOZA 2ZIEA 3B89A 4YMGA 3PFHA 2V7EA 3A25A 4YV2A 4QDJA 1D2CA 1SUIA 2XYVA 1ZG3A 3EPPA 3KPJA 3BWMA 5LQUA 3GWZA 3PX3A 4KIGA 1JTEA 5E2BA 1ZGJA 2VDUE 1EQAA 1VBFA 5E1BA 5EOVA 4LWPA 3AXSA 5M5BA 4R05A 3DMGA 4E2ZA 3JWGA 1YZ3A 4GQBA 3BWBA 4RTJA 1XDZA 2HV9A 3ORHA 4KWCA 5IH3A 1DUSA 1UWVA 4OBXA 2FK8A 1NBHA 1P91A 2CMGA 2HNKA 4ER0A 5K0GA 3PS9A 3K6RA 4IV8A 5D1HA 1RJEA 1ZQ9A 4RTRA 4GC5A 4RVGA 3LECA 5CVEA 3CC8A 2JHCA 4KRGA 5E1MA 3PVCA 3UJ9A 2QRVA 3LBYA 2WK1A 1YFJA 1RJDA 3EVGA 3M4XA 2ORED 5CIYA 1SG9A 5C1IA 3MERA 3HCCA 3ELYA 3GIWA 1IXKA 5P8WA 2PV0A 3UA3A 1ZKDA 2ZIFA 4XUDA 1V39A 1G8SA 1PRYA 3I64A 2ZTHA 4RV9A 4Z2YA 1WG8A 4HH4A 3LGAA 4C07A 2IH4A 5EG5A 2AN5A 3FUWA 2Z6UA 3SM3A 2OPBA 1KHHA 3HNRA 3I53A 2PX8A 3GRRA 1P39A 3UZUA 4RTQA 1XJ5A 2ADMA 3G89A 4PONA 4X61A 3KQWA 1KR5A 1RI5A 2KW5A 2BM8A 3EVCA 3EEOA 1L1EA 2JH8A 4MTLA 3AWIA 1Y8CA 4B17A 3BGVA 2PX5A 3KQTA 2EJUA 3ELUA 4LWOA 2NNWB 5LQNA 5DRYA 3BUSA 3CVOA 1DL5A 5ERGB 3FUVA 4XUCA 1KPHA 2AOVA 2BZGA 3THRA 2Z6QA 3FYCA 4RTLA 2PX4A 1RI3A 2GS9A 1YUBA 3G7UA 2NXNA 4AZSA 3CJQA 4CKEA 2NXJA 3L8DA 3MHTA 4FR0A 1ORHA 3FPEA 2JG3A 1PJZA 2UYCA 3DH0A 2PVCA 5ICCA 1VP9A 3KU1A 4XCXA 2NYUA 2OKCA 3LDUA 4HC4A 4DQ0A 2WA2A 3A7EA 5EMLA 2YQZA 4GOMD 3KQSA 5CVVA 4P7KA 5FTWA 5LQJA 3G2MA 4GOND 3KR9A 3C6MA 3KKZA 3HCAA 3OZSA 4OX9Y 3CJRA 2ZVJA 3DXYA 3IEIA 3RODA 2VDWA 1XDSA 3LL7A 3MQ2A 1NE2A 3X0DA 4KDRA 5K8VA 4F84A 3UBTA 1AF7A 4P7FA 2BR4A 2UZ4A 1I4WA 2N47A 3ELDA 3KPUA 3ER9A 1NKVA 5DM0A 3BGIA 4QVKA 2I9KA 1XTPA 3V8VA 4BP3A 3DULA 5KS2A 1SUSA 3ER8A 1H1DA 1UIRA 5FUBA 1O54A 4GBED 3UJ7A 3LCVB 1ORIA 1G38A 3UWPA 4Y30A 1KPGA 1XDUA 1Z3CA 5HIJA 2AN3A 2GAFA 2ZWAA 3P71T 5DX8A 3I58A 3QOWA 3EVFA 4KIFA 3P9NA 2G72A 3PB3A 4CKBA 2IDKA 1X19A 3P2KA 3MTIA 3LCCA 5K0FA 5DTMA 1XCLA 3KQOA 2CMHA 5EPEA 3THSA 4C4AA 4M37A 3P2EA 5KQRA 3A7DA 5BW4A 2P3LA 4KW7A 2ZZMA 2B9EA 1EG2A 3R3HA 3VC2A 2AOWA 3OU7A 3FPJA 4QQNA 4RYLA 5ICFA 2ONYA 3CKKA 3LKZA 3B7PA 2AOTA 3KQPA 2FK7A 1BKYA 2OY0A 3GGDA 3LHDA 4GUAA 2ZLBA 5GP1A 2ESRA 1WS6A 1ZHFA 3F4KA 4NECA 4RVDA 2P7IA 1WY7A 1R6AA 4AX8A 1RI4A 4CWAA 3KR1A 1YZHA 2OXTA 3EVBA 3EVEA 2YXDA 3GXOA 2P40A 3GRUA 3T7TA 1EJ0A 2OYRA 4R8SA 2YTZA 1YB2A 4QTUB 4HTFB 1N7JA 2PBFA 2O57A 3OPNA 5EQJB 4RTNA 3ELWA 5K05A 5K01A 1WZNA 3KR2A 4X1OA 1SKMA 1TW2A 4EQZA 1G8AA 1VL5A 3VSEA 2FCAA 3OFJA 3P9KA 4OQEA 4PYQA 5FQNA 4P7GA 2Y1WA 3JWIA 3LX6A 2ZZNA 2Y1XA 4DMGA 1JSZA 2C7PA 3UA4A 3DOUA 4GC9A 4H0NA 4R6WA 4V0QA 5EGSA 4OA8A 4GEKA 3I9FA 4FZVA 3T7SA 4DKJA 3OE5A 5FWDA 5DSTA 4DCMA 1JQEA 4FT2A 3I5UA 1QAMA 4XUEA 5E9QA 3SGLA 3V97A 1KYZA 4DZRA 1R18A 5EIWA 5DPMA 1OR8A 2I7CA 3DMHA 4LECA 3GRVA 3A27A 1DCTA 1KPIA 3EVZA 4P7JA 4QQKA 5E8JA 3NDJA 5CM2Z 1IM8A 1INLA 2AOXA 1KYWA 2ZBRA 3R6TA 2VZ9A 1I1NA 2B3TA 3ME5A 3TOSA 4C03A 4U7TB 3NWBA 3VYWA 4MWZA 4U7PB 2NXCA 2CL5A 2GLUA 5FCDA 4X41A 1VLMA 1XVAA 4BY9E 4FSXA 3ERCA 4RSRA 5EMMA 3GO4A 2VS1A 4YV0A 2PY6A 2ZIGA 3C3PA 3C6KA 3NDIA 2GA9A 5HEKA 1QAQA 2IP2A 3CCFA 3DTNA 3HVHA 1QZZA 4QDKA 5FHQA 2FRXA 3NWEA 4R8RA 1KP9A 1L3IA 5EEGA 1R00A 1Q0SA 2IH2A 3G2PA 5EZQA 1AQJA 3A4TA 3GCZA 4OA5A 3OU6A 2DPMA 2ZZKA 3EGEA 3KPVA 3PFGA 5DXJA 5GWXA 3OZRA 3ID6C 2A14A 4FP9A 3A26A 4WXHA 5DTQA 4EK9A 3SSOA 2AN4A 3AJDA 4EKGA 5KYGA 1F38A 2E5WA 1AQIA 4KVZA 2H00A 2P8JA 1JTFA 3T0IA 2PWPA 3KPWA 2PX2A 2JHAA 2YXLA 4PINA 3HVJA 4EVIA 5E1DA 4E32A 3C3YA 3KQMA 1JQ3A 5DM2A 5EKXA 1F3LA 1NW6A 5K09A 1KXZA 1MHTA 1HMYA 5CUQA 5EHIA 3NVKI 3CGGA 5GM1A 4PNEA 1NW7A 4PGGA 3P97A 1R8XA 3GNLA 3O4FA 2P35A 4F85A 1IY9A 4IV0A 4PYLA 2ZW9A 3GU3A 3P9IA 5HIIA 3UJBA 5LQKA 3FTDA 2AVNA 5E9JA 4C06A 2G70A 4DF3A 4RTOA 3B3FA 1RI1A 3GDHA 5K03A 3MCTA 3O7WA 4QTTB 4E2WA 2AOUB 5DXAA 4YV1A 3TQSA 4POOA 4PYNA 4UOEA 3NJRA 3DP7A 2C7RA 2IDJA 4C05A 1VE3A 5B1SA 3OCJA 3FYDA 5HOQA 5K0EA 2PT9A 5EHGA 1JG2A 4FT4A 3Q87B 3G8BA 4E70A 3E7PA 3FPFA 3M6XA 3PX2A 5CVJA 4C04A 2YXEA 2QE6A 3VC1A 4RTSA 4M38A 2GPYA 2XYQA 4PYKA 9MHTA 1D2HA 3BWYA 3KQQA 2HWKA 4M7RA 2EJTA 2C7OA 1VP3A 3LSTA 3FUXA 5H02A 3TPZA 4AUKA 3DMFA 4RTMA 2JH9A 5E8RA 3T7RA 1VPTA 4RTPA 3EMBA 3QV2A 3LDGA 4L7VA 1NW5A 2NP6A 1NT2A 1BC5A 4JXJA 3UJDA 1M6EX 5CD1A 4MIKA 2EX4A 1P1CA 2EFJA 3DR5A 3G5TA 2PWYA 3M33A 4PIPA 3DLCA 4R6XA 5GM2A 4AZWA 3K0BA 5K0CA 5HIKA 2P41A 2XVAA 4GOLD 2C7QA 3WSTA 3MB5A 5LQCA 3GJYA 1X1BA 1BHJA 5CVDA 3FZGA 5CVUA 3GRYA 2CWWA 4HSGA 1FBNA 3ANXA 3MTEA 4LG1A 3PT9A 2GH1A 3B5IA 1WXXA 3R24A 2O0LA 2P3QA 1G6Q1 5CCXA 2ZSUA 2OZVA 3B3GA 3B3JA 4ATNA 4CTKA 4HTFA 4YMHA 2O06A 2PLWA 4K6MA 3RIEA 4IKPA 2PJDA 3TMAA 5CCBA 2AZTA 1NBIA 1SQGA 3G8AA 2BR3A 7MHTA 1X1DA 3HCBA 4HGZA 3PLAE 3OZTA 1JQDA 4Y2HA 3NVMB 5K0LA 10MHA 1T43A 3HA3A 3PTAA 3OE4A 3HCFA 2IH5A 1L9KA 4PIMA 5E1OA 5HILA 4YUVA 3BXOA 3FPGA 2ERCA 3KQVA 4PCAA 4WVLA 5ICGA 2JJQA 1KIAA 4BP1A 4YUYA 2OB2A 2G8NA 3HCEA 4OQDA 3G5LA 2IIPA 2PT6A 2FPOA 5GIPE 2NP7A 2IGTA 2PXCA 5G02A 5HIMA 2IBSA 1M6YA 1O9GA 3DLIA 4QVGA 3G88A 5DTRA 1N2XA 2VP3A 3G2OA 4IWNA 3SMQA 5EMJA 1XXLA 3E8SA 4HGYA 2YVLA 4FSDA 2XBMA 3D2LA 3MAGA 3M6VA 2ZWVA 1FJXA 3FUUA 1X1CA 3KR0A 5F2KA 2HR1A 5ICEA 1WXWA 2EG5A 5DM1A 2P1DA 1G55A 2R3SA 3R9XB 4RTKA 2I6GA 2OO3A 3EVAA 4YUWA 5GIOE 5JUWA 4CXMA 1ZGAA 4O29A 2G1PA 2YX1A 1L3BA 1QAOA 5BP7A 2P3OA 1I9GA 3M70A 2HTEA 1R8YA 1BOOA 1N7IA 3P8ZA 4M36A 5DLYA 4ER6A 2V74B 5FHRA 1UFKA 1HNNA 2GB4A 2UYQA 3LCUA 3UFBA 3FRIA 5KQSA 3FTCA 2BM9A 3SVZA 3G2QA 2DULA 5F2NA 3HVIA 5DX0A 3TKAA 2O05A 2PSSA 4PYIA 2G71A 3LDFA 4RWZA 2ZCJA 5LQAA 1VIDA 2QRVB 5FQOA 5C0OE 2VDVE 3SR4A 2AR0A 5EEHA 5K0JA 3HVKA 2ONZA 2AVDA 1L3CA 2I62A 2FHPA 3AXTA 2ZBQA 1G60A 2HMYB 5F2OA 3HP7A 2AS0A 4ER5A 3OU2A 4DA4A 3GRZA 3SXJA 1O9HA 1FP2A 3S68A 3EVDA 4PYOA 3DXZA 1XCJA 1JSXA 2IPXA
chains in the Genus database with same CATH superfamily
1TK2A 1W36B 2DQSA 2WJZB 2X2EA 4ZYYA 4TL8A 4DR6B 1RKXA 2QW1A 3UMBA 3WGKA 1EJ6A 3R74A 1L5GB 1KVQA 4U6SA 5COBA 3GCXA 4YV7A 1RI2A 4OHOA 4ND6A 2E55A 3HJ8A 1O87A 4PCLA 2Y4NA 4R69A 3DOFA 3JATA 5E6RA 5KHOC 2XKJE 2BTQA 1EWRA 4MJ3A 4GX0A 5KSPA 3V48A 1ZXXA 3W2HA 2J46A 5KNCA 1JKJA 2IV3A 1UZUA 3G6KA 1TDHA 3GLFE 1ORYB 2NU7B 3PHBE 2ZFUA 3FJYA 3O4JA 4ZVOA 3AJRA 4U8GA 2I4NA 2WYIA 3DLPX 3V8QA 3Q98A 1U5BA 5THQA 4NEQA 3TCXB 4LOHA 4WAUA 2R4EA 3RS2A 2B7BA 4AULA 2JGRA 2POQX 3GFFA 1VKNA 5G0UA 4WD3A 4FYHA 4J43A 3QVGA 3AQ4A 1CY1A 3CLRC 1CJMA 4S0XA 1VBNA 4FHFA 3P96A 4OLFA 4PRKA 3SHWA 4GMGA 4NE2A 5CH3A 2EKLA 4WN9B 3W4IA 1XCGB 2FPPA 4YYZA 4ZYXA 1OWLA 4CF7A 3G7SA 1Z5VA 4ARIA 1OROA 1WUTA 2J67A 5JQGB 4RIGA 4BIIA 1HDZA 2PIAA 4PPYA 5KJ1A 1RFGE 3OQHA 2RGYA 1ORHA 1GLNA 1OYWA 2B20A 3VOAA 3D2CA 1I94M 4I5GA 1JIKA 1DX6A 3S1AA 3IIEA 2QGFA 1X1SA 2GD0A 5KNBA 3BCUA 3D6VA 4XW2A 3KFUG 1CUSA 5ESRA 4OYHA 5E3JA 2RGDA 3LCVB 1FCJA 4B0OA 5LOVA 1VFPA 3ULKA 2W5UA 2J0EA 4G4RA 3O8NA 4ZC1A 2C4NA 4G8BA 3PA8A 4G5RA 4MUFA 1YK0A 3T6KA 1LFDB 1WCIA 2BFDB 4MYHA 1W0JD 3NH6A 1Q44A 3CF0A 3R8FA 5F2EA 3HFSA 4J03A 3ZWPA 1Y1PA 1JF8A 4CWAA 3EVBA 3NHYA 2MDTA 2LGJA 4YI3A 3OPNA 3G0DA 4I19A 2GD2A 4UBLA 3OWOA 5KSYA 3COVA 4BX9A 3WYNA 1Q1ZA 3ITDA 3PG5A 2J3KA 2F9MA 3QKSB 5EXPA 4KIUA 4ARZB 4Y98A 3MS7A 3NBKA 3MUOA 3L79A 2IZ7A 3E48A 2FMFA 4DJJA 1XD2A 1Z5NA 1UJCA 3ZHUA 1KAMA 5EMMA 5TQJA 3HEBA 3H1AA 1E66A 1VLQA 1JP7A 6REQB 1C7IA 3G2PA 3U56A 1QIJA 5ARDA 5EYPA 1U02A 3SEFA 1P1JA 2PQ6A 2O5EA 1S6YA 2ZYWX 1A3CA 5IABA 3UICA 5AW4A 1JTFA 3M6AA 1BJRE 2YXLA 4IBBA 3MMPA 2BBTA 4MWCA 2BV3A 2C8VA 3GNLA 3MJTA 5IANA 3ZYZA 2AVNA 4EF5A 2PPLA 5EXSA 1GUFA 1F4VA 3MLEA 4NBWA 2R66A 4DOMA 2CFIA 4YQZA 1MU0A 5IPFA 1YCHA 4A5OA 4BMOB 4CEIA 4PD2A 1RNLA 2JCXA 5K0CA 3DO8A 2WILA 3N2GA 3PT9A 5KC8A 1QCCA 4RO0A 2CNBA 2GZHA 3MWLA 2J9FA 2PWAA 1W6RA 1L2DA 3ZCVA 4YPFA 3B9RA 4RW0A 3TE7A 2LTUA 5E6UB 4QELA 3I62A 3QLUA 2P69A 2I7DA 2HHAA 1K5GA 4PO9A 3AHCA 2V7VA 3CNEA 5DNVA 2HR1A 3UM9A 3ZX4A 4DUYM 3LY5A 2ZPUA 2BJHA 1NU8A 5AKEA 1WCWA 2JJ2A 4BUCA 4EHAA 3DYVA 5JQGA 1SGWA 3ZS8A 2O2GA 4MGZR 1J49A 1G2IA 2IPXA 3ZH2A 1YA6A 1M0TA 2OXIA 3VJMA 1MXHA 5KWVA 3HCRA 3U39A 4I8DA 4F4FA 1QF6A 4MWSA 4QWWA 2WY2D 4E33A 3NETA 3BRSA 1CVLA 1M0WA 1UBNA 3UV6A 2W2QA 5G4KA 5AH0A 5SYMA 1WHTA 3QNMA 1ZK0A 3E05A 2OO5A 2PLAA 3W7AA 5DV9A 4L72A 5IJAA 3U44B 3OP4A 1NXSA 1VI2A 5KIAA 1MJGM 1JFLA 4IUDS 4G0NA 3GAAA 1JQKA 4CTJA 1EZZA 4M46A 3K1TA 4FW9A 5EHQA 2JFHA 4DIKA 3IA2A 2YS6A 2PX0A 3UPTA 2QJRA 5GY7A 3T7IA 2JHFA 3RG8A 3QKSA 3W3AD 4BFXA 4ARZA 4KFUA 3WG9A 4D9HA 1GG5A 1DFGA 3EGWA 3RANA 4OEHA 3TTSA 4UREA 4I2VA 1DUSA 3K5IA 4L50A 4TSRA 1BA3A 3FB1A 3NHZA 5E1MA 4ZCRA 3NOXA 4WASA 3GZTB 5K3FA 2WIBA 3QLTA 4JKOA 3I64A 1EFDN 1WG8A 3TZCA 1LDGA 4ALNA 3X3HA 5IVHA 3EEOA 4YONB 1KJ9A 1L5WA 2NVBA 3HYRA 2N3ZA 4XK8F 3R7WA 2W98A 2JGDB 2VJNA 3GA7A 3S40A 3UWOA 5JBNA 1J99A 2VDMB 3D1LA 5AW1A 3EUFA 4KXVA 1VLVA 3QKRB 4WSOA 2F90A 3ICPA 3QV1A 2XB6A 4RNDB 2NU9B 3DNFA 3NFYA 4S0ZA 3X1ZA 3IJ5A 3G5MA 3PB3A 2QTLA 3M6FA 4ETWA 1MMFB 1L5ZA 1TM2A 3MC1A 4DV5M 1NLUA 1N6KA 4MH0E 3JZFA 3GGSA 5EMHA 5DYTA 3DTYA 5FT9A 1FQOA 3TXAA 1GILA 2GJ4A 4WW0A 1UXJA 3L41A 5E4FA 3K2QA 3KJHA 3G82C 4TXJA 1A97A 2XYPA 2ORYA 5M29A 3V34A 1EGQA 1DQRA 2HA5A 4MW6A 4EX6A 2AX4A 5LC1A 3ZY3A 1IM8A 1P9RA 3QGMA 2IEZA 4KZPA 4MGIR 4DDKA 3DA8A 3OLYA 1A98A 4U7TB 3COJA 3KP0E 1A9ZA 2BM1A 1JKXA 1L3IA 2PBLA 1NF8A 3AHDA 3R6DA 5KYWB 1Q3TA 1YRAA 3DWIA 2JAXA 4M86A 4GHAA 2VAPA 4CUZA 1RYYA 4JI1M 2NLOA 1EHCA 1M6HA 4PFJA 3UJBA 4DR1M 5CNIA 2W2VA 4E6EA 1TMGE 2O23A 4LVOA 3TSOA 2NQ2C 3O3NB 3PGXA 2GCEA 4JYPA 4E1VA 3AHGA 3A45A 5J5CA 1D2HA 4FBGA 1ZI6A 2FP3A 1S96A 4S12A 2GPTA 4HN2A 4L7VA 4F21A 1N5IA 4EHNA 3NCHA 1E6UA 4F3TA 3QE0A 4UMEA 5IVPA 4O1IA 4OF4A 1B74A 1H85A 3DW1X 2NTJA 9LDBA 3CYFA 4YDHB 4JLUA 1VPDA 2PNJA 2Y93A 4B6JA 5FUQA 3PUKA 4NZOA 3BE5A 3NP7A 2VHVA 2FSVC 5IASA 3E9NA 2D1YA 4DA7A 1CDDA 3CW9A 5E3IA 1UP7A 3SS9X 4IBJA 4MKHA 2AT1A 3FA2A 2P1DA 3GLFA 3Q7IA 2JI6A 1IRXA 4HDAA 3OESA 5BW8A 1LX7A 1V5EA 3AF6A 2YRWA 4FNAA 1FNMA 1QQAA 1LA2A 4HOYA 1F8GA 1L5VA 521PA 2HMAA 4G0PA 3VKWA 4LRQA 1PL0A 4Y2TA 3LXUX 3S0JA 4I9GA 4ZOLA 1NJGA 3AF4A 3WHPA 3M4YA 4Y6OA 3TWOA 2EEZA 1BQ4A 3WGHA 3FVRA 3WBFA 2A57A 2CCKA 3Q6NA 2NYRA 4O1HA 5DT2A 1M8FA 1Q0TA 1J0BA 2NU9A 1I7PA 2LDXA 2XVYA 2P62A 4WERA 3G0IA 5TC4A 3T3MB 1HG0A 4RHTA 1CYEA 1FNCA 3ZWAA 5CDGA 2YVQA 1A7UA 2EL9A 4DCOA 1YR9A 4BMCA 4EJSC 3QVSA 4C01A 1PG0A 4P5DA 5C5EA 5B1EA 3U7GA 3I01M 3NMUF 1U2DC 1YULA 1QDTA 2H57A 5CCEA 3FGPA 2ONKA 5B1YA 4Y0NA 1EQ2A 2DBYA 1BXRB 2C9DA 2LWIA 1TU4A 2IPMA 3HLKA 3X1WA 4IHKA 4JVOA 4FUTA 1YACA 3TZQA 1D2NA 3PC8C 4PSDA 2TS1A 4YCJA 4GPZA 4YRSA 1ZQ9A 2BFNA 2FPUA 1G19A 2EKDA 3PUWA 4DL9A 1BDMA 2XDWA 2GYVA 3FDJA 4IKEA 4AI6A 2CB0A 1V43A 3L8FA 1EDOA 4P4UA 2PTHA 1J20A 1KYIA 3T7DA 4REOA 4QT4A 2VDPB 3CN9A 2J33A 4WGFA 2Z2XA 3C3CA 3IAS6 3VNBA 1KE1A 1CBUA 2PVCA 4CN9A 3ESDA 4EECA 1MPXA 1HG1A 1M54A 2J59A 2QN1A 3CJRA 3H7IA 3ORSA 4BCBA 4AJNA 4X1KB 1NE2A 1E2FA 3KC2A 3PZRA 2XNKA 1ZU4A 2QQFA 9ABPA 4XE5A 3GEHA 3NASA 1E3TA 4DSOA 1YBAA 1KPGA 2AN3A 2W9XA 4BJ1A 5JMPA 2G1AA 5AJXA 4RZIA 1MB2A 4YPVA 2VHYA 5TRTA 3P94A 3OG9A 4W5OA 4FHGA 4CL8A 4MW0A 2ESRA 2ZVDA 1S3FA 2WF5A 5EJAA 1T0JB 4YRNA 1NJSA 3U3JA 3UO8B 3KXIA 1E6WA 2J5BA 2G9VA 2NGRA 3TLKA 5BSWA 2X0EA 1UFVA 2ZB3A 2EFCB 3HJTA 3VC3A 2PGJA 4OP3A 4U63A 4DDWA 1JDJA 3NTLA 4HAUA 1V7CA 3HXMA 1CWUA 5CBPA 1SA0B 4GKAA 2AOXA 3K2LA 1G71A 1A76A 5KQMA 2VWPA 3THOA 1OKKD 2ZBFA 4OX9B 4BV3A 4CFYA 1J7JA 5LU9A 2F5PA 5A3JA 4CTMA 5DLDA 1H8HA 4W9NC 1NVBA 1QK5A 2CFRA 1AQIA 4V0OA 1ZMTA 2WSBA 4PVCA 4C3ZA 4TROA 5EKXA 2Z5GA 1H9BA 3RFFA 3U6KA 2P35A 3GOHA 1SEVA 4C06A 1RI1A 1KJQA 5L45A 1QIFA 4EX7A 3HC7A 1JHAA 4XJTA 1R0ZA 2XCRB 2YIJA 4FOTA 1O5OA 5JJLA 3OCUA 2YY5A 4TLMB 2X8WA 1DFHA 1TT7A 4R01A 2KDLA 3HLYA 4HSGA 5HKKD 4CUJA 2AFVA 4C4SA 2ZBUA 2ZSUA 2H8GA 4DFDA 1AQLA 1J6UA 4D3ZA 4OFXA 4NV3A 1UKAA 2WIGA 1JS1X 4JU8A 4Q5IA 3VPAA 3BXOA 3V4LA 4NK4A 3WOHA 1BEUB 4FD3A 5G02A 5AVKA 1KMNA 3VDQA 1NX6A 4DLKA 3STXA 2NTNA 4TYPA 3D8BA 1A4RA 4JN6B 3W77A 4J1TA 3PNSA 1IAQA 1E2LA 1Z4PX 2G82A 2QIOA 4ZJYA 1FBTA 3L7OA 1ISJA 4AJIA 1SVMA 2ZUUA 2I62A 2DUWA 3SP1A 1BG6A 3IP9A 4YN3A 3FHOA 4NTZA 1XCJA 4AJOA 1EK0A 5TS3A 2CJWA 1V35A 2XUQA 2VYCA 4F4CA 3TTVA 1C0EA 5FWNA 4B08A 1EDDA 2X14A 2LE0A 2HRBA 2WTUA 5JMWA 4TYYA 2WW8A 3JU3A 2C0CA 4PLPA 4KDCA 3V4SA 1AGRA 2CZGA 3KK0A 1EYZA 4BPRA 3V5NA 1VIAA 1QDLB 1P4AA 4KI0A 2X19A 4N49A 2ZQYA 1R27A 1X37A 2HHLA 4IEFB 1UDRA 2QYSA 1WV0A 1A5SB 1U1CA 1WDLA 4K2HA 5B6PA 2I66A 1NXQA 4PW0A 5JFGA 2HO5A 1DZ3A 3PITA 1SA0A 2QVYX 4ISBA 3TXYA 2MWMA 4D5GA 1R0XA 3CLRD 2VBIA 4Y6QA 2RGRA 5F3WB 1C80A 1P91A 1RCTE 2GCIA 4RLFA 1CUHA 3F8SA 1K3UB 5C1IA 3EAFA 3ZHSA 5JVDB 4XUDA 3NUZA 2QV0A 3QPVA 2AUMA 2PX5A 4DMLA 1NUPA 4X24A 4R2IA 3QVVA 3DEHA 4CCAA 5ABPA 2NO5A 2IV2X 1H6DA 3SKYA 3R4VA 2PS0A 1MO5A 1OWMA 3Q8WA 3GFGA 2VK4A 4PNZA 3F5DA 3FYHA 1HM5A 2GBGA 4E5YA 4YT2A 1L7XA 2GKGA 4IZ6A 1TIBA 4QARA 1OXMA 1Z33A 1RQPA 3W1VA 3ZNPA 1CVIA 1G3MA 3JRWA 5FDFA 3UBTA 1RM5A 3DBLA 3RRNA 3DDCA 3GI1A 2ZWAA 4Y7DA 1CQZA 3PKJA 4NV0A 1XTTA 3VR5D 3B70A 2QVCA 2V6JA 1NF2A 4PPNA 1XZKA 3LTEA 3JQ7B 4N5MA 1BRTA 4D44A 2PSFA 2DYKA 3O8OB 4BQNA 4QYSA 5C8ZA 3JASA 1QZEA 1Z6YA 1GDDA 2BE9A 5F3DA 2Y1XA 1M0SA 4RSHA 3M5CA 1JIUA 2ETXA 3ZD7A 5G2OA 2VYQA 4UNIA 4JAVC 3PVSA 3Q3EA 3R9IA 2GEFA 1Z0AA 3HUEA 4XTCS 4RY8A 2XMSA 4D9FA 4MGEA 1ZRHA 3ZWOA 2FSHA 1W9MA 5F1OA 2WJIA 2OSVA 3NOVA 3EUWA 1VHTA 3JQ9C 5AKGA 4K5QA 1CETA 1KRHA 2DFLA 1ECLA 4IQGA 3PSAA 3EXG2 1I7DA 5GM1A 3TL3A 2RSLA 4BNTA 2J09A 3CVVA 1CJBA 2IW3A 1KEWA 1JAIA 2DHYA 2JFOA 4LYYA 5H81A 1FF9A 1I6KA 1Q1GA 1XO1A 3NJRA 1PK8A 3A4IA 2Y05A 3TCKA 2QE6A 3ETDA 3HN7A 4KR2A 1QH1B 1OA1A 1M1ZA 1T6XA 3BB1A 5IXSA 3RVMA 621PA 4WBSA 3OCXA 4ZWNA 1P1CA 1ZH8A 3JD4A 2JGFA 1KQPA 3UAVA 3JTEA 1MAVA 3LF2A 1MEEA 4R9SA 8AT1A 3WYGA 4HRVA 4KFCA 5AW6A 1P60A 4NCAA 1ZGCA 5FBVB 2B1GA 3OZTA 3DCYA 5INTA 3THSA 1PV4A 2ZWOA 1R88A 3HYCA 4IP0A 4YEDA 4FYVA 4Q6BA 1TK9A 2O2SA 1JMKC 4S3MA 5TE9A 2F00A 3KR0A 4HDNB 5TV2A 3ZS9A 1TYZA 1UQTA 2J08A 3F74A 1LDNA 2CDNA 2WVAA 5KPRA 4TWRA 2WV7A 4MGZE 2WM9B 4NESA 5FA6A 4GLBA 1YNSA 1QHIA 2HHHB 4KQJA 2HUNA 3BH6A 3N87A 1V1RB 4U3JB 4PYOA 2E89A 5F3RA 3EIXA 4YR7A 4HNHA 1H6AA 3OOEA 3KQYA 1ZH0A 3VK7A 1ZKMA 4DPLA 4D4KA 1I24A 4V02A 1HEYA 4DJDC 1W0KA 4BLUA 1BMQA 4M6WB 1SG0A 5AI8A 4EFNA 3OVMA 1EVEA 2NO1A 2YYZA 4OSOA 4PCZA 1YFLA 4UM5A 2Q28A 4WBNB 3I4LA 4P58A 2VYND 1H2AS 3QUQA 4E2XA 3VR1A 2VKQA 2D00A 4A6EA 1JMYA 3AFGA 4H3VA 4YY3M 5T67A 3IXMA 3DA1A 5ISMA 2X1MA 1JBEA 3EOAI 1ZOIA 1CDEA 1MJHA 5KB3A 4RKFA 3JQ7A 3RVBA 3DFUA 1NUHA 3B8EA 6ABPA 3MGGA 3FTQA 2CLLB 3V4ZA 4LMRA 4OQNA 1MCZA 3BD7A 1YF3A 4XLLA 1JHZA 5KO3A 3UUGA 3WWPA 5FBLB 3A28A 2JFNA 4BGEA 1ZM7A 1M2GA 3TZHA 5LQUA 1XPRA 3V55A 2FWRA 1E8MA 4OAPA 3JD3A 3AUKA 2VO1A 4BVFA 3OX4A 2WAXA 4FFSA 1SG9A 1NN3A 1GZDA 2H1CA 2JEOA 3FNGA 4B7GA 3PLNA 1MH9A 1WKVA 1K9SA 2JIDA 4R9UC 3R75A 3KNZA 4E03A 1I1QB 2YWDA 1EVKA 4PG4A 3WK7A 2Q6TA 1GPKA 3RYCA 3HL4A 5TQVA 4YLGA 1NVVQ 3LTNC 1H93A 5BSRA 3ZDEA 3L8DA 1N2HA 2PKEA 3ES9A 2HF8A 2QRJA 3C6YA 3OLXA 3UN1A 4HLUA 2H5IA 3ZHOA 1MG0A 1ESZA 1U3DA 2VDWA 1QPBA 5D84A 2HJWA 3SG0A 5IT0A 2BMFA 3E58A 4DMKA 4JJ6A 4MWTA 2XE8A 1WMEA 1VCIA 2NN3C 4UAJA 1S01A 1XDUA 2XLCA 3C7AA 1VJDA 2GJ9A 1RTKA 1FA9A 5H7XA 1JDZA 2GN1A 1QU3A 2FF7A 4MKGA 3GNSA 5TPWB 1FQJA 1JECA 3FJ1A 2Z4SA 2R6R1 2XT0A 4WNCA 4UXIA 3OBBA 4K0KB 1G5QA 4H7JA 2C95A 4RDXA 4LQDA 3KSAC 3QLEA 1A71A 4YAKA 4XIIA 4OA8A 3OLVA 1XRSB 4AJKA 5CB0A 3EWSA 1QHSA 3OJWA 1CC1S 3O1HB 3MOGA 2J5RA 3FG9A 4NBRA 3ZY6A 3ZOZA 3UWSA 2J5XA 4JYAB 2SNIE 4U3JA 4GXNA 4YV0A 4BB6A 1W96A 3N9IA 5FO1A 4BLOA 1P4SA 2A5JA 2KQUA 5JDCA 3E7DA 1NVFA 1RKVA 1A8PA 4RIIA 3KOYA 3ZTTA 4M6WA 1QVZA 3KB2A 3OPYA 4YWHA 3Q12A 4MKIA 1U1DA 1OLXB 3JQRA 1GGFA 3E1SA 3CEJA 3VOSA 1NVAA 1V37A 5KYTA 1XNRB 1GQFA 4I0WB 4G8JA 1W4RA 1PZFA 2CZCA 4TKVA 2ECFA 4ZOBA 3IDSA 4CCWA 2B8WA 2NWQA 3DV2A 4LOIA 1ZK3A 4RADA 1N3LA 1QGED 4D1YA 5BSHA 2WEKA 3KZ1E 4JI8M 3DGFC 5FI5A 3SC3A 3WSTA 3ZK8A 4TLLB 3LJKA 1HLGA 4G65A 2J3LA 5B4TA 3NNDA 1CY0A 1S9HA 3H05A 4IMRA 3O95A 4QJ4A 3PR1A 3O90A 1J97A 1X1DA 1XNJA 1QU2A 1ZI9A 1FNDA 1OI7A 3AGQA 5EWMA 4HKTA 5C4MA 1SBIA 2O50A 3CZMA 4HLDA 3O74A 3COWA 3MCVA 3TLBA 2J4CA 1FS6A 4RTKA 4X54A 2ODNA 1ZISA 2VZ0A 3K20A 4Q19A 1P3QQ 4IUYA 4IGKA 1DLIA 5AVXA 3EHEA 4TLCA 1KA9H 3IECA 4YT4A 1JIXA 3O8DA 4B7UA 3OO1A 1E1YA 2NTEA 1AS2A 2R2AA 3RVDA 2PJUA 5DYNA 3P4UA 4XBOA 3AEUB 3GP8A 2XVXA 1HZZC 2AK2A 4KO3S 2F6RA 4F3YA 3LUJA 2GI4A 5EL0A 4H1WA 1VRWA 1IZ8A 2C5LA 2D5BA 5B37A 5E4YA 2ZM6B 4KMSA 2D1TA 5DNYB 2EXXA 1X80A 1SCAA 1SXGA 5DX1A 3IBFA 1LBSA 2WA1A 3KJEA 3W05A 4GZ3A 3NGXA 3E84A 2QW8A 3OKFA 3CX4A 1FX1A 4LXXA 1TQ2A 3ZLTA 3QJYA 1TT5B 3GUCA 4BVGA 2VJYA 2EZ4A 3TIXB 3TTUA 3UCFA 2FSUA 2Y66A 4AY3A 4ANRA 2G6TA 2H1VA 4WT7A 1GZ4A 5AKYA 2ZYAA 2XTMA 4N3AA 4ZAWA 1ACMA 3T3IA 2X8JB 1NYLA 2JIPA 2CW5A 2Z58A 3IE1A 4CDGA 2ORED 1DKMA 2F1KA 3VNQA 3MAAC 1D2MA 3WYDA 1G9SA 3PUJA 3B7GA 2D2FA 3EXHA 2B8JA 3RK4A 4MV6A 1EX7A 4RIHA 1OLXA 3KEFA 3SN6A 2H4WA 3L0DA 1B14A 2NV6A 1ZUWA 1ODCA 3KBOA 3M1AA 3Q9NA 5EJ6A 1C1KA 2LHCA 1HE8B 3I4VA 1ISIA 1J5EB 2XB4A 2WJ4A 5AJHA 2W6NA 2XE4A 3M4NA 3GPBA 3JZIA 5CYOA 4IIGA 1SK9A 1ACLA 2G80A 4GBED 2R00A 2Q0SA 5C1DA 5JWOA 1TFUA 1TUGA 1JH8A 3VKHA 3L0BA 1OLOA 3C43A 2QTVB 1AZSC 4GE0A 2IPLA 5M3BA 1B1CA 3EVEA 3EW9A 3HGMA 1A7KA 4QODA 4N7BA 3IVAA 4CT0A 1ORTA 2POCA 4XPIB 2HXSA 3I2YX 1KI7A 4B3BA 2B69A 2WJJA 4H0NA 2LCQA 3HNPA 1KZ1A 1W4ZA 3DC2A 1RE1A 4FWHA 4LPSA 3GP1A 2OHFA 1XL1A 2NX2A 3L46A 4MI6A 1UBFA 1TEVA 1JFFB 3I2JA 5JZMA 3OIUA 2AG8A 4TT3D 2QD2A 1R4NA 1U9JA 1LNQA 3KB1A 1HETA 2QM8A 4YAUA 4PN7A 1HWYA 4OHFA 2I9PA 3UMVA 1MTZA 4EYGA 3CRRA 5IM5A 4D96A 3UFXA 4K9DA 4Y6LA 3WMGA 2GESA 1Q11A 2H2DA 4DV0M 2SBTA 2ORWA 3N8HA 1CEEA 1KU6A 2C7OA 4RTMA 4XIFA 1UJMA 3U4CA 1NW5A 4RDHA 2EKZA 5EE5B 1PJ4A 3ISTA 2QTRA 2OFWA 1X0VA 1SCBA 2Z3WA 2DPGA 2Y1LA 2B1IA 3VNVA 3ENQA 1IXYA 2X9VA 5BOSA 3EISA 1XNHA 1SQGA 3O26A 3NVMB 4FSHA 3N3AC 4KUEA 4YJ3B 2FPLA 4YECA 4Q12A 3AHIA 3NYQA 2X8JA 1QV6A 4U6QA 4JVNA 3R3JA 2X49A 4YFYA 4CG3A 2HMVA 1RMYA 1QAOA 3C3JA 1R0LA 4XPZA 2XQKA 1SXQA 1KFCB 1T24A 4XTRA 2BM9A 1OLUA 1IVYA 1UMBA 3U3OA 5BPVA 7AT1A 4FJ1A 2PFKA 5LNK1 1J8MF 3A06A 2J9YB 2H1LA 4JBIA 2R60A 5JPCA 3WGZA 1R37A 2H11A 2GN2A 4B6PA 1DRVA 3S8MA 3GLRA 3K35A 3EEYA 3OQIA 1AUAA 3URKA 2K47A 5JSYA 1DEHA 4U02A 2IZ5A 2YJTD 4HQNA 3KVVA 1LTHR 2EFHB 3I04A 4UU7A 2CF6A 2IYPA 1L5OA 1PFUA 2XDQB 4PGAA 2YY7A 1B23P 5AVJA 5AI9A 2H2AA 4RKYA 1Y5MA 4H4CA 2ZS7A 2QNIA 2TMYA 4LFBM 1TGVA 2D7CA 4B2LA 4DQLA 1UBJS 1YDHA 3EULA 3K8OE 1CQXA 5KMGA 2H1OA 3BD8A 2D59A 2YJ6A 3GUZA 3S2YA 4D82A 5HGXA 1BMTA 1U2GC 4LF5B 4E4TA 4FZJA 1ZLXA 1QLHA 2FA9A 3F5MA 4P5EA 2BEVA 3IB3A 5LP6B 4DBVO 3EQZA 1Z47A 2C2OA 3T9BA 3OLWA 3KJNA 2ZVPX 1UC4B 3FUWA 1Q84A 2PEZA 2Z6UA 2CNDA 3GQ4A 3Q8KA 3RNLA 4GI3A 5COQA 1KFVA 4JLDA 2UXDB 2PX4A 3ILXA 1LLQA 5I3CA 4G4SO 2W2KA 3KEGA 3CH5A 2WSYB 3VZBA 5K3EA 2FEWB 1E2QA 3A8TA 3MWDB 3CNQS 4NCHA 4XOIA 3LWBA 1U94A 3ZIAA 4K8OA 1YBVA 2ZI6A 4C4ZA 3IX7A 4FCVA 2LPMA 2AMFA 3G0HA 3DC7A 1NX9A 4JQYA 3TIFA 2O0KA 2P5SA 3IP3A 4HWSA 5LMCA 3LHIA 1GUAA 4ALIA 2RGHA 3A7DA 3NEYA 4CLRA 5J58A 5JT1A 2VXYA 3VVCA 4OHXA 2R0QC 2GARA 4EYQA 4NQRA 1B0AA 1KVSA 3VXKA 4RTNA 1WMSA 2PO7A 4MVJI 3L01A 1ORRA 1KK1A 1OYYA 1J8DA 2J32A 3LDHA 2IU3A 1OF1A 5FNVB 3A9WA 3QKTA 1Z82A 3VYWA 4H4DA 2JLWA 2HU2A 4TTPA 5EEGA 3R09A 3PE3A 4LF6B 4RY9A 1W5SA 3ZV3A 2UVQA 3D4BA 3SICE 2FY8A 3KV3O 2A9PA 3BMOB 2PMFA 3QVOA 1KXZA 1GITA 1HQYE 2WJYA 1ZSVA 4IV0A 3GU3A 3PCTA 2MGWA 2IZOA 1DKRA 3HKBB 3GUUA 4JITA 3ZGOA 3B82A 1P4HA 1SRRA 4RM2A 4C0KA 5JTUA 2Y1DA 1RRPA 4MGHA 4P53A 2Q2EB 3U7JA 4C04A 3VA7A 3HNOA 4LWZA 1PZEA 2XDQA 3QWFA 1GU0A 3RTDA 2Y0PA 2M2IA 5LFAA 4ADSG 1Y5RA 1UZMA 1PJJA 3CTWB 1WXXA 3F2IA 1BYUA 2CWDA 3OCWA 1KY5A 2EYUA 5BRAA 2M32A 5LA6F 3I2HA 4HGZA 1YH3A 4YRIA 4C6RA 3LY9A 1YJCA 5EESA 1Y33E 2ZXUA 5FTLA 3VYUB 4B6EA 2WJWA 1L5SA 3FPAA 4X0EA 3DLIA 5LP6A 2VP3A 2FZCA 1NP6A 3BXEA 2C9CA 4IDNA 1W4LA 3KSJA 3GJ3A 1TCBA 1CERA 5TSDA 1Z34A 5C8YF 1I7LA 3TKAA 1YAHA 1HYEA 4D7AA 3IT1A 4P80A 1SPBS 2DPXA 4Q16A 2GCOA 1BCSA 4YACA 2VH2A 3HJUA 1K8YB 4DM3A 1BVRA 3KSUA 2QWXA 2PZLA 1CYDA 2Z6AA 4G3XA 2DTEA 4GNRA 4ASUA 4IPTA 1JXMA 4QXAA 1M0EA 4QYTA 1RACA 4UHJA 3W7BA 4UMFA 4JJFA 2BBSA 4CHGA 4CMCA 3LVVA 2A67A 4XLZA 5DSZA 3EH1A 1XRQA 4YJDA 3T61A 3PTLA 4BB9A 5EI5A 1GZVA 1YJAA 4G56A 2EUCA 4BE4A 4TVSA 1YQTA 1JDNA 2D1RA 4ZAVA 2X0NA 3TINA 2XGMA 3IB6A 2UZ1B 2ZULA 1VB3A 2F2TA 4D97A 1QYDA 4J91A 4W1RA 3ZE7A 3EA0A 1CZRA 1Z63A 2MT9A 4IYJA 4I4CA 4KQHA 1CRQA 1KE2A 2WHPB 2WG0A 4CM9A 2I1VB 3KSDO 2YMQA 4CV3A 3MYRA 1QORA 3OJCA 2RHRA 2HA4A 1VZ2A 1LK7A 1X2BA 2ZIFA 4EGFA 4AB1A 5KYUB 3WBKA 3BMOA 5JCOC 2DY0A 3I53A 1Q20A 3S44A 3VI3B 4C7MA 3G89A 5AVRA 4IZHA 1TUBB 3G0BA 1H5UA 3HKBA 2A2ZA 4HPJB 4UVGA 4O4JB 4JJKA 1ZNQO 3SR0A 2HOQA 3D54D 2W4IA 3O03A 2ZWMA 5ICCA 5LQJA 2CUKA 3RFXA 4NVRA 2P2NA 4CGYB 2VYVD 1EUYA 3EIOA 4RMJA 4M0EA 1HY3A 3EZNA 4HP8A 3A2NA 5DI9A 1JJVA 3AY3A 3VKUA 3ZNNA 2EGHA 4NOMA 1E0DA 2C78A 2NU7A 4KPEC 5J2UB 3VV2A 4MWDA 4ALJA 2XYHA 5L40A 2PH5A 1YOBA 1QM5A 1RLMA 2WZBA 4ZCSA 2X4AA 2RHDA 1WB5A 1XWFA 3PD1A 3MT0A 3NT2A 2F5NA 5EJMA 3DOUA 1YL5A 3GFTA 4GEKA 3RTCA 2PH1A 5F77A 4IFIA 4I3FA 4DWVA 1UXKA 3WRYA 4QBKA 1KI4A 3ROXA 4AWBA 1TLTA 3RJMA 1QB7A 4EY4A 4WN9A 1PAUA 1I13A 4GMXA 4MR8B 4X41A 4WADA 3JVEA 1PDVA 1IK4A 2YFQA 1E7QA 4D0RA 1YQ9A 1WJ7A 4Z3DA 1QE5A 3RTEA 3VBEA 2X7XA 2DWPA 4IIJF 3W67A 1U6JA 5HKAA 1AQYA 2X4LA 2Y0DA 2IYEA 3UK7A 1E7YA 3DKRA 3UAXA 4Q4AB 1GG2A 4CLOB 4YV1A 1EFHA 4IBEA 1XC8A 1AB6A 1P2GA 1WIVA 3AOEC 4ZJUA 1Z0DA 2RG1A 2FXIA 3G8BA 3GT3A 2L69A 2I8LA 5HE9A 1C4OA 1CLEA 4KOEC 2IZZA 1U9YA 4N3BA 2GLXA 4BNIA 4DV7B 1Z5GA 4CJXA 5F7JA 2JFWA 2BFDA 4OSEA 5KSZA 1XRLA 5C3MA 1TZCA 3V1TC 3HCBA 4JJZA 4KQFA 2PD6A 5K0LA 2WHPA 1XRRA 3D8HA 3DE2X 4KHPM 3RAJA 4TMWA 4D3XA 2Q9BA 1VG1A 4IINA 5IWCA 2Z95A 4QD3A 1SD1A 2P2DA 5BPHA 1G8FA 3IELA 2W58A 2V6GA 3JCZA 1ORVA 1C7JA 4BVJA 5CEJA 4NL4H 3MF4A 5JUWA 4FIZA 3WHKA 4NXMM 6REQA 1UDAA 1RAAA 2QENA 1YQGA 1XYYA 3DM5A 3GPYA 3KKMA 3EG5A 3THXB 2Y1FA 2VF4X 1YZUA 3C0KA 1NUQA 4CGYA 2OV4A 4WLNA 3RT9A 4C2BA 3T7EA 1KVUA 4RVHA 3QLVA 1Y6QA 4YCDA 4HWGA 1HNWM 4Q1BA 2BGNA 3HH8A 2C9BA 2NVOA 5JAIA 3IHPA 1YRQA 3OOYA 3SYKA 4FWGA 4EZEA 4KLAA 2ZJOA 5HQ3B 5E6UA 3U6OA 3ESZA 5DM60 3DNPA 4L9AA 4R0VA 3TFWA 4BQPA 2JJ2D 2NSLA 4OJKA 1T4GA 1PDOA 4M8LA 4LF9M 5CU7A 1WW8A 5I5EA 4MS3B 3NTXA 3I12A 4MV9A 1R9MA 1BA2A 4KI7A 4E2ZA 3JWGA 3GELA 5EIEA 2JDID 5K3SA 4NNJA 3K6RA 4YMVA 1Z6ZA 2EQ5A 3C16C 4QA9A 2J5QA 1NHWA 3HUTA 5JZ9A 3SYLA 4LRSB 2HT1A 4Q37A 1LWNA 1JDSA 1VDLA 2WJPA 2ZYDA 4PONA 5CLJA 4PAMA 1IONA 1ZCBA 4MITA 2Q49A 1D6MA 4B3TM 1PWEA 3KQTA 1QOPB 2AWOA 1W1WA 2LKCA 3FI9A 2MSNA 4JLAA 2R7AA 3UKOA 1GCOA 2NZ8A 1YWGO 5EQFA 1GWNA 1Y37A 1GA4A 2YIMA 2ZM5A 5C46F 3OTOB 1IB6A 3DDNA 4ND4A 4YRZA 1TNDA 3U44A 1H1DA 3USCS 3ZHRA 1N0WA 3W6ZA 2H5EA 1YGYA 2YN2A 3QOWA 1EG2A 3HHEA 1ATIA 1Z0JA 2FK7A 2RKWA 2B2NA 3WNVA 4PRZA 1EM6A 4LXQA 4MDFA 4LN1A 3JYQA 3U6BA 1XZNA 1NVKA 3A3YA 5A4IS 1XF1A 1UFOA 2EF0A 2VJDA 2CFCA 1FIUA 5JQWA 3RU9A 1PFVA 5CVTA 1Z39A 1GADO 3I52A 1LK0A 3A27A 3QFSA 5FUWA 1DV1A 1LF5A 1N8KA 2H08A 3KD2A 5AOAA 5CH5A 1SQ5A 2NXCA 3AW8A 4LJ8A 1G5IA 3B6EA 3LYUA 3WGIA 3I2IA 1LGYA 3EGOA 1EWQA 4IRUB 1UPUA 2AN4A 5JISA 3PLRA 2JGDA 3M3DA 2P8JA 4JUCA 4EVIA 3SS8A 3WLKX 3LQKA 4UHCA 2LBCA 2CHGA 1HTTA 2OUIA 4WFIA 1YS7A 4Q4DA 5TMEA 1WRBA 3A37A 2QSUA 3QKRA 4CR8A 1JEDA 4EGQA 2R4TA 1A9SA 3RREA 1Z56C 5KTTA 4UTPA 1K5DA 2WUWE 1Z4LA 1QYWA 2ZU0C 1SIOA 1CZUA 2FWPA 3MRXA 4IJMA 4BMPB 3L6BA 3GROA 2ZUCA 4O4LF 4P3YA 3RVPA 1LQUA 4O5OA 1NBEA 2RG7A 2PWZA 1Z3IX 1T35A 4PPGA 1U0JA 4AKIA 2HBYA 4MS3A 4IM7A 4AJ4A 1WLYA 3KT8A 4WZ6A 3PLAE 4G4JA 2ZR8A 4Y2HA 3OTGA 1QIGA 4HXFB 3ZUGA 4IHQA 2GK3A 2XV1A 2J3EA 3DAOA 4Z4FA 2B0CA 5E6JA 4M9SA 2ROQA 1FJXA 4XDGA 5B1HA 4BFVA 2WJGA 4MYRA 1MD9A 2XITA 1U0SY 4Q21A 4LRSA 2RE8A 3QYFA 4ND5A 1LVUA 3U4IA 1U4OA 2EDCA 3WA7A 3K96A 5KYWA 5BWNA 3R5SA 2C82A 2GZ1A 4LTMA 1V3VA 1YDGA 3F3MA 3UT6A 1HK7A 3RKRA 4A3SA 3B1ZA 1U7ZA 4Q7EA 4ECEA 5KREA 1QZTA 2RK6A 4MO9A 3F7TA 1ADYA 3F6BX 2F67A 1CY2A 3PE6A 3ROKA 1PYDA 1CF9A 5DCLA 3LOQA 4I1OA 2OSBA 4O8ZA 1YLAA 3V46A 3W2IA 3EGIA 5AXAA 1DGFA 3FYTA 2D3WA 5HQTA 4ROSA 2GTHA 2FTKE 3SMVA 3NKFA 1E1KA 3KLMX 4FFOA 1G64A 1CG6A 1J4AA 3R0QA 4Q3AA 1FDTA 3BTOA 5JDIA 2RGGA 2DZNB 1ES9A 3FLAA 2FGKA 4LCEA 2EARA 4IZIA 4KBGA 1M3SA 3I5MA 1BFUA 2PQ2A 3WL5A 1UIMA 2O3TA 5DCWA 2G9QA 3IUSA 1N34M 1JDBB 5ENZA 1IXSB 4BMSA 1W76A 2FR8C 4JB0A 2PN1A 3OOHA 2PV7A 5CLIA 3RFVA 5E7IA 3EE6A 1XG5A 2MOKA 2ZT5A 1CY6A 4NCXA 3O8CA 3NAZA 5LWQA 2OPFA 3FMIA 3C6XA 1LBHA 4KRGA 3LBYA 1XRJA 5J4YA 3B1JA 1PGOA 2FAXA 2C96A 3KS9A 5JNSA 1IU9A 4KE8A 3AL3A 4RDCA 3MWJA 2G3QA 1W5BA 4NCBA 1G6OA 4JCOA 3ZYCA 4TS3A 5DRYA 1XMIA 1GLVA 3PEYA 1TK3A 2X5KO 3KETA 1OI3A 5B36A 4A0GA 1FDRA 1UUFA 3BSFA 3PXCX 1MJNA 4WUVA 2E4AA 4J29A 3PF8A 5DGDA 3HSKA 2WZJA 2NTYC 4F84A 5AJUA 2XSZA 3M2TA 3ER8A 2Q1UA 2E87A 1VKRA 2WWGA 5KPDA 5FOXA 4JI4B 1DVRA 4QLAA 2PZAA 5EUMA 2WMOB 3LXXA 5J5VA 2OQIA 4RQTA 4KDEA 1W2GA 1GOTA 2GRAA 3L7AA 1L7OA 1RWOA 1RAGA 5CTAA 1IH8A 2Z2KA 3E15A 3TZBA 3GRUA 3QKIA 2F55A 1BXRA 4PEVA 3T1YB 2WTNA 1I3KA 3I5AA 3I04M 4OKNA 4UFNA 2J9XB 3ANMA 4CCSA 4EG1A 3CW2A 1GPNA 1F17A 4QC2A 3GEGA 1VJTA 3KOYE 1I4LD 1STOA 3RNOA 3W5IA 1DCFA 4JI7M 4A6PA 1NG1A 4JEUA 2P27A 5JY6A 1H2ZA 2Z8ZA 3G9ZA 5DTQA 1CJTC 3M89A 3JQFA 3ZC7B 4N0DA 4OXKA 3WTCA 2JIBA 1HMYA 4OIFA 4YAOA 2UUOA 2ZBEA 2KPOA 5IM4A 4RTOA 4PCUA 1EK1A 1U63A 9GPBA 1BMFA 4X1KA 2CE7A 4MWOA 4U5XA 2PMWB 3SLRA 4LYAA 5J59A 3MGAA 3IMCA 4G97A 1Z36A 3SQDA 2PCJA 1XRNA 2HWKA 3DE5X 4ZCTA 3VZRA 1MO6A 3TGWA 4L76A 1I6LA 2H1SA 2TYSB 2CXNA 1OIVA 4LMPA 3NHJA 4OBBA 1OBCA 3NBMA 3IESA 3ROMA 1HE5A 3GRYA 1LVGA 3GJSA 2OVFA 3Q7RA 3Q8MA 1OFVA 3IQZA 3QNWA 3OIDA 1OC4A 4PG6A 2PGOA 2DCMA 4TTSA 3TWKA 3FMGA 2GEJA 3DDSA 1H8HD 2X2PA 1UXGA 3NU1A 2CJPA 5HIMA 4YMTA 3Q9UA 4QYIB 3G0GA 5ULLA 2Z1NA 2EG5A 2IYAA 2AL7A 1A7AA 1ZGAA 4E5SA 2CLCX 2EP5A 4O33A 1CIVA 3T1VA 5HUJA 3EY4A 1QRDA 3U4AA 1RTTA 1XZHA 2PU5A 2W2LA 3BAZA 2XWBF 3A1UA 4Z0TA 2YJ3A 3IPXA 4C7XA 3DZDA 3MOSA 4GM1A 3TM5A 2I76A 1JKFA 2C2XA 4QUEA 3TZKA 3VRHA 2X0FA 4B7AA 4LKOA 1UPAA 4IBGA 3BKWA 4EZBA 5T7BA 3HHWA 3DMDA 1Z4IA 3GJQA 3GBPA 2VTDA 3IVRA 3UMRA 3SS7X 2KS6A 3U9LA 1Z18A 1XDWA 2EV9A 3UW1A 1A9PA 2RHGB 4UASA 3SEAA 1N1GA 4LZNA 1O8BA 4LFAM 4TTQA 3KVWA 1EFTA 3KB8A 4IO0A 4EI8A 3AR9A 2GBPA 3WGLA 4GF5A 1HEUA 2JI4A 2WM3A 3ICWA 2PKXA 3OCVA 1U0EA 2QMHA 5I9TA 3NV9A 3A3PA 1YBFA 3Q6IA 4QLBA 3RS8A 2Q4BA 2QVBA 3BKXA 3ZCRA 3CJTA 4JYZA 3NG1A 5EMNA 3RU2A 1IBMB 1MNAA 4JN6A 5E2BA 3N2KB 1X14A 3TDNA 2PQ0A 3GPIA 3TKLA 1JB1A 4DAOA 2QUHA 5AT1A 1MC1A 3L2OB 5DHFA 4CKXA 4XWOA 4IO1A 1YZVA 3GYGA 2PKQP 4LYDA 4P3OA 2FUG6 4IICA 2QIPA 2W6CX 4AG3A 1FVOA 1DV0A 1IZ9A 5LQNA 3SM9A 3GFPA 1KPHA 4P32A 3O4IA 1UBSB 4FMDF 1DXQA 4H0FA 2FX3A 1JU4A 5JATA 4AT1A 4C14A 2YJGA 2O0JA 2IF0A 5I8WA 3GPXA 1Z4JA 1UBHS 1F06A 3P9PA 4NZPA 4BO4A 5JJIA 2ZRMA 3TX2A 2HA3A 1PT5A 4EYOA 4EW3A 5F78A 5I4BA 2YNMA 3KTDA 3MMXA 2B61A 4RD1A 2GILA 4CIBA 2HK7A 4RVDA 3N05A 5CFNA 4QTXA 1YB2A 2WJHA 3AFNA 2O57A 3QI7A 1GGHA 4QYIA 2IU6A 2AC2A 4JA2A 3HDVA 2C7PA 3AINA 5TS2A 1WB6A 5F3WA 4E22A 2YYYA 4BFCA 1SHLA 2OV1A 3EF3A 5L3RA 3GP3A 2WD8A 2HSJA 2A86A 3F49S 5JVDA 1L6IA 3L7CA 3HS3A 4EUKA 2GF0A 4R1TA 3ZD9A 1Z06A 5EZQA 2DZDA 1QPZA 4DA8A 1QO7A 1V2GA 1JQBA 1T0IA 3ESAA 3BIWA 1KKLA 3KW6A 3JD1A 1VXRA 1S7GA 5FLYA 4ZEMA 1HLDA 5HQJA 1Y9ZA 3ILKA 4M9RA 3MRTA 4BDSA 3AV3A 1IZZA 2FDXA 4FDVA 2EU8A 2QHOB 3ISVA 2YW9A 4GMFA 2ZQ5A 3A0UA 2QMOA 2V97A 3HQ4O 3E3LA 4D42A 3SMPA 4U6NA 1F3OA 4DR6M 1E99A 1KMHB 2BMAA 2ASEA 3NVAA 4AUKA 2HQ1A 3MELA 2GPAA 1KR2A 1OU4A 4JSTA 3B9QA 5HMMA 4CJ6A 1ZH4A 2QSZA 1LWOA 3DEKA 3OY7A 2IPAB 4GXRA 1KEKA 221PA 2ZJ4A 3O8OA 3ZD8A 2HGZA 1XZIA 1BVUA 4EG7A 3N2KA 3FFBA 5I48A 1WO8A 2EBWA 2PT6A 4K2AA 1DAHA 1DWQA 2DBQA 1FEZA 1KTVA 4ZAYA 3G2OA 1RZRD 1IATA 4HGYA 4TWBA 5ALDA 3D2LA 5AM5A 4XQ9A 3DHYA 4D6YA 3ZDCA 1TYAE 1YHZA 4ZYZA 4XJXA 2YH2A 4WFKA 4CF3A 1HJPA 4FYWA 1MB0A 2C77A 3BXGA 4J0KA 3G2QA 2JLAA 5IDVA 4CQJA 1OTXA 4CTOA 3SJZA 3ZZ0A 1QP0A 2ZBQA 3OJ0A 3MXOA 1COZA 4D2IA 9LDTA 2B98A 1ZUIA 5IEJA 3FFTA 5BPFA 3V9AA 3QMMA 1RU3A 2XQJA 1G20B 4BE7B 5J47A 2DWUA 4FX5A 3UKDA 2UYOA 4XQCA 2HIAA 2OKGA 3UHAA 5DULA 1MEOA 3LHSA 5DM4A 4XGRA 4D46A 1QH1A 4AKHA 1DBWA 2EKBA 3OEYA 4IAOA 3O82A 4YUAA 1GTZA 1UFQA 3OOSA 1XA3A 2MJLA 2XNHA 2ODAA 2HYIC 4UOQA 4D02A 1YJ8A 1BXZA 3NNNA 1NVMB 2IHKA 3WLTA 4CMEA 3KLOA 5H68A 1JZQA 4D57A 4L5IA 3G1UA 1RRGA 1PT6A 1R4ZA 4HAXA 4MQ4A 4NEGA 4RQAA 1JVBA 4OV6B 4EVRA 4LF8B 5ALKA 1LZKA 4H6VA 1X7HA 4HDNA 3NC1C 2I3ZA 1E1DA 3PQ7A 3CHYA 2F62A 2IOQA 2LVAA 4CI9A 1QF9A 2ZP1A 3GVXA 1RKBA 4MK4A 4NPHA 1V1RA 4YMIA 5JCPA 3HNRA 2KHHA 3D64A 5C51B 1N77A 1ZX1A 3RSFA 1YE5A 1T6BY 1RI3A 5BMVB 1UANA 1K8RA 3S2FA 5LZ9A 4IJ5A 2BKXA 1MW9X 4WBNA 3SI7A 2H85A 3Q3HA 5KTYA 1C7YA 1D04A 1L4KA 1JXOA 3AVPA 2G6BA 1QUTA 1G8HA 1E1NA 4LXGA 1SVNA 1E2DA 1HTBA 1L7DA 1DDGA 2O1WA 2FQWA 1BE8A 1JHXA 1ZEMA 1NI5A 3WDKA 4K6GA 5CDHA 3VO2A 1Z5UA 3BWXA 2EKQA 1LBQA 3E7FA 1CE8B 4I1RA 1WXGA 1GNRA 4MB6A 1ZMWA 1GZ5A 1W8DA 3NUQA 4GYWA 4QHSA 4HDCA 3WLLA 4EDHA 3SIRA 5EQJB 1XLUA 5C3UA 4QXOA 1GUZA 4ZD6A 5AM0A 3LSYA 2PSEA 3O2NA 4L22A 2RC6A 3MWGA 1OPRA 4QPJC 1V3QE 2FN7A 1CY7A 1EFAA 3NDJA 2LH0A 5CYPA 3KL2A 4N5DA 1W5AA 4WXRA 5I4KA 3ZWQA 3ERCA 2PY6A 3DTNA 1R00A 5JO9A 1G20A 4B85A 2AG0A 4XB2A 4JR0A 1JHPA 2ZB8A 4C0WA 1WB4A 2FFJA 1TZJA 3AR3A 4BV9A 4F5DA 4PO8A 2XKKA 1JMVA 2DWOA 3LUBA 4GNKA 1DC4A 3S55A 4JJIA 2HQSA 4P3XA 3QMWA 3EEIA 2II6A 3FPFA 4NC9A 5C7OO 1AT1A 1RC0A 3ZV4A 2C57A 1TVEA 4WH0A 3TPZA 1K68A 1TM4E 2QD3A 3ROTA 4AROA 2DEUA 1UADA 1NVMA 1TF7A 4JT2A 2FLKA 5JHHB 3U26A 1X1BA 5TPWA 1SKBA 3QLUC 1SOVA 2OZVA 5EXDA 1RW4A 5HFAA 1JN0A 3ICEA 3IP6A 3G8AA 4DV7M 4FWTA 2KI5A 2AJCA 1M83A 2QLTA 4GWGA 3PQ6A 3UUEA 2M1XA 4B71A 2X2OA 4ZQGA 1DTEA 1PP4A 4R7ZA 4YJFB 3R9XB 1DTSA 3QVUA 4DXHA 1ZYUA 2D0PB 3ASYA 5I7OA 2J8ZA 2PZJA 3FRIA 1BZYA 4MULA 2VHWA 4CIDA 2KHZA 3GL9A 5FJJA 2X23A 1DIAA 2KX7A 4B7HA 4Q3NA 4LJ7A 4YAJA 2ZATA 5JZOA 5A9TA 1QANA 2DSTA 2GZSA 5CFRA 3PDUA 4BO6A 3B7ZA 2OO5C 3TUIC 4V0KA 1U65A 1R74A 4QOEA 2YR0A 3ICVA 1FFYA 4F92B 4M8SA 1TC1A 3AB7A 2IS6A 4N6OA 3PF9A 1NQOA 3CPEA 6Q21A 2ZCVA 1GHTA 3H75A 3VZSA 3R8CA 4LXIA 3LD9A 2JLBA 1WKCA 4IDGA 2IHYA 4KKVA 2BZ0A 2PLRA 5MF6A 3UJ8A 2AE2A 1AGXA 3ZDRA 1GR0A 1E2GA 4LKRA 2MSEB 1T10A 3MCZA 5DN9A 1NJFA 3NM6B 3QUTA 4DV1B 5IT5A 4NZYA 3GQBB 5CA1F 4AWAA 3OE7D 5D86A 5ALHA 2F1HA 1C0KA 1V41E 3VDRA 1Y1LA 2Z6VA 2XRZA 5EOVA 2I6SA 2R8PA 4EY5A 4PC2A 3ORHA 4OW0A 1Y4UA 4RGYA 1RJEA 5DMHA 4TM8A 5KWEA 1Z13A 2R1TB 3RVSA 1IULA 3ZHTA 1KARA 4H9GA 2QGNA 2QN9A 1XMPA 4D9EA 3HXPA 2XMQA 4HEJA 1XJ5A 3AEUA 7ADHA 1E7WA 3ELUA 3G2KA 4C88A 4ZVVA 1XE3A 4C4PA 3CR3C 2XJ9A 1KSJA 2C4KA 1Y3DE 4TV9F 4U2DA 5DNYA 4JT9A 4QGHA 3KQSA 4KPFC 1VJ0A 1DAOA 4ZYWA 3LA6A 3UENA 1P1FA 5IT9A 4OFZA 1R0WA 1CUVA 2DFVA 2ZSBA 2OCXA 2WAAA 1NI3A 3KPUA 1ABFA 3F97A 1COWD 3AGPA 2H1HA 2A4MA 4CIXA 4TXLA 2AG6A 2GAFA 1TT5A 5HPYB 2RI6A 1P5JA 2RBGA 1FE8A 4B44A 5KUTA 3ZWDA 2ZDHA 3E9QA 3G85A 1SXHA 3LLCA 1IY8A 2Q9CA 3OTOM 1M34B 1AK2A 8ADHA 5ICMA 1H1LB 4YMSA 1XVUA 2FWMX 4I66A 1GRVA 3S2SA 3BJRA 4LOJA 4AJEA 2DGDA 3QTBA 3R9XA 3K9HA 5A6SB 4RDIA 4WCDA 4Y9SA 4IHAA 1OFGA 4KR0A 4DSNA 4MUGA 2QZZA 2IV7A 2XGSA 1FFXB 4ALMA 2ID7A 1JPJA 5IAKA 3CURA 1I3NA 1OZGA 2IH2A 3GD5A 3LT1A 2NUBA 4JI0B 4FWDA 2A14A 1ZGZA 1T5OA 4D3SA 3FHLA 3TAUA 1WTAA 4Q00A 3L1KA 3FNQA 3KJGA 3RBXA 2J7OA 5ELMA 5IMBA 4B4DA 1TZMA 4QZVA 1GQOA 1SXIA 1RBYA 3HBFA 1VLJA 5LD2B 4OKSA 2HFJA 1T0PA 1P0PA 3CPSA 2V3WA 3PNYA 4L4SA 4BECA 1A7JA 1X13A 3QV2A 1PQPA 4WY8A 2IITA 3O0DA 2BPOA 3KTFA 2IZ1A 16PKA 1XMOB 1GPMA 2QTVA 4XUGB 2BCJQ 2IHNA 2Q1YA 1NUTA 4OHRA 3R24A 4IMJB 1ODLA 1DTWB 2KW0A 5JAPA 3MT8A 1GFSA 4YMHA 3SJ7A 2CYCA 4XPIA 3GLHE 3LVQE 1N6PA 5E1OA 2QR2A 4XQ0A 4GLFA 1AHPA 1Z15A 3NXSA 1PHPA 3RHSA 3QSYA 3PDJA 1N2XA 5DJ5A 2R1TA 4BKPA 2E21A 4XSVA 1RLUA 1GL9B 4WESB 3LUKA 1JFFA 4DWOA 2JW5A 3IAFA 3IIIA 1F14A 4ZV4A 4MV0A 4BVEA 5BNTA 3BK7A 2PUAA 8ATCA 3CF4A 3M9XA 5LUBA 3GGPA 1Q7GA 1RZVA 2PMEA 1GABA 5ESWA 4K9MA 1GO5A 2ZTVA 1L8LA 3I2KA 2YDYA 4KR7A 5BXYA 4UTVA 1GZ7A 3L8MA 1FYXA 3T99A 2EIHA 4H77A 5ITXE 4PLTA 3HB0A 1YZLA 2RD2A 4ZI5A 5DXFA 3FOBA 1OOEA 2A78A 3KS8A 3WMFA 1FTNA 4HH3C 2NM0A 3GRFA 5BR7A 3RKSA 4EW2A 3C5EA 3E3MA 2XQGA 2MSCB 4MRSA 2WDPA 3ZWBA 1H1LA 4QO7A 3TR5A 2RK3A 3EXIB 3N6RA 4M99A 2KZUA 4PHGA 3DKVA 1UBKS 4IFEA 4YJ3A 1SC3A 4XOUA 3NONA 4BL5A 3NHKA 1IBSA 1G7SA 3F46A 1Z0ZA 1SB9A 3AO0B 1G98A 3OTHA 2OQ2A 1XC7A 1FFXA 1PGPA 3P32A 3SXPA 1MDFA 2AKYA 1G8GA 3AVXA 1CK4A 3CEMA 1MOSA 2OV6A 2O01F 1N6LA 1EVQA 1ESCA 3ELYA 5P8WA 2O8EB 3JYLA 3U4HA 3EF0A 3SR3A 3M3PA 3WAGA 1N6IA 4LOLA 1KH2A 3HKEB 4Y2VA 4OQPA 2KW5A 3GJ5A 2XLJA 3GG2A 4EMBA 3PPWA 5CBKA 3AFMA 3FX2A 2X1LA 3PPIA 4OX9M 3N5CA 3S5UA 1J33A 4F9GA 5HZGA 1NATA 4PLYA 4NE9A 1A69A 3GJ8A 1PSZA 3PKIA 4J16A 4I46A 4LX0A 3RIHA 1LVHA 1WEKA 3BSSA 1E1RA 3ZX5A 4KDFA 3B1KA 4WX2B 3IIMA 2G1JA 4BRWA 3L04A 2YKGA 2Q2OA 4G63A 3FCAA 1JALA 5AKLA 3F4KA 3IUPA 3D8LA 3WGNA 4L3WA 1XEXB 6YASA 2YV4A 3NRBA 3AP1A 3RTGA 3WQHA 3KVNA 1IVNA 4DBZA 1KFJB 3BJZA 4TLBA 4UBKA 3OQNA 3SLKA 4Y2RA 5HEKA 3FDIA 3R3SA 1YDEA 3ILYA 2OV3A 1RHQA 3NZEA 4X91A 2O20A 1QGZA 3ZIAD 3J7BA 5EJIA 3B5EA 1R2QA 3BAFA 5FP0A 1MTOA 1VCMA 2VUTA 4X97A 1UMDB 3MWDA 2TMKA 3IE2A 4ZIRB 3F3YA 5HBGA 4B6RA 4WIAA 3RFWA 3GQVA 2EAUA 3OWXA 3W5HA 4GX5A 1BHSA 4QG3A 3W6NA 2LXEA 1WMFA 5IBRA 2BYTA 3KAQA 1EFVB 2IUEA 3EXIA 1PG2A 4XM1A 4IOMA 4JI2B 2BBOA 3NIDB 2KBFA 3PGKA 2C7QA 1KQFA 5DP1A 1P2TA 3AP2A 2LUOA 3C24A 2RIRA 5TT1A 5HA5A 4M0LA 3AEQB 1DGBA 3QFHA 4WVLA 3FPLA 1GA1A 4LRUA 4R2WA 4J1TC 5H1YA 2PXCA 5FNVA 3N59A 4LV8B 1E3DA 3RRXA 2R8YA 2C2GA 4M8NE 1XWIA 2ZRKA 4BFUA 4KH1A 1IPFA 4DG5A 1AY0A 2NQTA 2DLNA 3SR4A 1ZOSA 3GLHB 2HMYB 3G9QA 3UJNA 2JLZA 4Z9XA 1NV8A 2HCFA 4NJEB 3N0VA 1VDMA 3BD9A 4CM4B 2IYSA 2VKTA 4AO6A 2FPGB 5C9ZA 3JWHA 4CDMA 3PT5A 3HY3A 4XYLA 1UKZA 3AESB 5KNCD 3SDZA 1J2TA 3F78A 1NJ6A 3ZY5A 3PXUA 2AQHA 1YSCA 5E4TA 2ACEA 2ZTLA 1U4NA 5D3KA 1P1BA 1KWKA 3KE8A 4CF4A 3DT8A 4OFWA 4XRRA 2EOAA 5F1YA 2IYFA 1U1FA 3F3KA 1Z2NX 2QUAA 1JG7A 1T0UA 3OZCA 3RH0A 5BNWA 2R84A 1XP8A 3LI2A 2WWVD 3ZCPA 2PU7A 4CM8B 3F8TA 2CV0A 2WK1A 3ZDDA 5D3ZA 1ZS9A 3VPDA 1MLDA 4A27A 4Q3BA 3CEPB 4LHXA 3BRCA 3GA0A 1RWKA 4X95A 2BBWA 1S1CA 1YRWA 5AFSA 4LSGA 2D1SA 4GBMA 3BF8A 3OHSX 4XUCA 5KNBD 1YI1A 4JLMA 5FPTA 2IXEA 4JROA 5E7QA 3HGTA 1G17A 1EFVA 2B83A 2Z5LA 1B15A 5K8JB 4C0SA 4FMCF 2P30A 1UC5B 3BE6A 1Q39A 3ESXA 1E9CA 3AVTA 5KQGA 1L4UA 2V55B 5DX8A 1WMDA 4RA9B 2XD4A 3DVLA 4HK4A 3PD0A 2UZ1A 2A0FA 4L0MA 4DJ5X 2C5HA 4P36A 4NECA 5KVCA 4Z51A 3HDTA 2OCGA 1N9ZA 4PZUA 1C3XA 2BWEA 1KI9A 4UNQA 1GSHA 3I3OA 3JYHA 3VVBA 3KYBA 1W36D 2JY8A 3EARA 1QO9A 4ZXPA 3Q5EA 5AKZA 2JFZA 3BMQB 1HFKA 2Y68A 2I71A 2G3YA 2I7TA 1FDSA 3HJNA 4EY6A 1KPIA 2OLJA 1A95A 1J7KA 3TOXA 5KTMA 2ZBRA 4DAEA 3GLHA 4UU8A 4I50F 5ADHA 5KYUA 3C3PA 1O5IA 2C2WA 3V8PA 1TUBA 5DYWA 3EB9A 3KWLA 5AHRA 5DW0A 4IH1A 4TTAA 4CM4A 4O4JA 2FPGA 4R5HA 4NAUA 4N6GA 5K09A 2XBUA 1R8XA 5TMBA 3HJFA 2I0FA 1YMVA 1ZO8A 2HHHM 1Y4SA 4RZQA 1L4LA 5AJZA 1AS0A 2CSXA 3U6SA 3VNUA 2O1XA 5ELLA 4L3OA 1LKZA 3WLHA 5KI6A 5ALFA 2QQ8A 4LE0A 2PMDA 3RYIB 5L3SB 5EE1A 1IUPA 1ICEA 5G1OA 5A06A 2C2KA 4A8PA 3FZQA 2HT6A 5J2UA 5ITXA 5EJ7A 1YQEA 2CDRA 3D9QX 2BEUB 2D7JA 1HFJA 3VYTB 2FWJA 4K6MA 5JZVA 4LYGA 2MR5A 5GAJA 2IYWA 6PFKA 3N6VA 3DLAA 4R83A 5ALPA 1QCZA 4M0KA 3NHBA 5K8LA 4DQUA 4I8OA 2PSDA 1HUQA 1TR8A 1FU8A 1XL0A 1FSPA 4CXMA 3DR3A 2MR6A 3P20A 3E7XA 4MR8A 1IOWA 5BN1A 3M70A 5FWYB 3IKMB 3GWGA 1NQUA 4EHLA 2RGBA 5CFQA 2Z4TA 1JIJA 2VHQA 3N2EA 3HG7A 4CMJA 1AHIA 4H18A 4DEVA 3LKDA 2O14A 4A91A 5D2CA 2MTBA 4F2HA 4Y6GB 4YQFA 2VJBA 5CT6A 4Q4AA 3IAXA 2YHUA 1ZEJA 1QYRA 4CLOA 2H51A 5J40A 5FOTA 1J0EA 4FN4A 3JWPA 5FPHA 4BMDA 1QNLA 1DQZA 1CZLA 2R7MA 4FLFA 3FHJA 2RARA 1B42A 1D6JA 4EAQA 2DB3A 4XDYA 3ITEA 5L53A 2DFPA 4MUJA 1VZ3A 4FGZA 4MV1A 3TTTA 5EZYB 3BHMA 5JYDA 4JLOA 4KQXA 5K0BA 3NBXX 1XKTA 1GXSB 1Z38A 4DCUA 4MWBA 1JTVA 4G36A 2CUZA 1FFGA 1EE9A 1X6VA 1XHFA 4IEEA 2XD9A 3N2LA 4ZT7A 5B6IA 1U5AA 1L5NA 2SCUB 1VKZA 4O2LA 3S28A 3CC8A 4OI2A 3KS4A 4F04A 3HB4X 3WYAA 4K0KM 2IP4A 1M9NA 5SICE 4BPBA 1UBTS 4OXIA 4ENQA 5IWAB 1WXIA 2FH0A 3IEVA 3ACDA 1DC3A 3IS3A 1ZMVA 5BQPA 3SIPA 4L4UA 1CRLA 2V7PA 5F9HA 1LSOA 4UCQA 2A6PA 3THXA 3W8EA 3CVOA 4HLUC 3I5XA 3M9WA 5LB2A 4NE7A 4DRYA 4JYAM 5JYCA 3DAHA 2AI2A 2XAAA 1XI2A 3DKIA 1H5QA 5L3SA 2XE6A 2DKLA 5H37D 3E35A 1HQCA 3W6OA 3A9UA 1H5NA 1PN3A 3SQNA 4MRRA 3QVTA 2J6CA 4AG5A 3UWPA 1QLJA 4DJEC 1F2DA 3VDPA 3DBOB 1XNRM 2IXAA 3KHTA 5TR9A 5KTOA 1LDEA 5HQ3A 2YHSA 4FCWA 2QT1A 5JH7B 4LHVA 3HVRA 1W1UA 4LHZA 1XUOA 5AM3A 2F8SA 4ZGBA 1P7CA 3ZJUA 1Y9EA 5AHWA 5FWYA 4NWIA 2R4QA 3CVXA 2ZYIA 3GRVA 2VXCA 4B4KA 2QMZA 1CVRA 5JDCC 4IFBA 1I10A 1IJKA 1FRVA 2H54A 4ZTZB 1GGMA 2L6OA 4V24A 4Y6PA 3LXRA 2YHAA 2Z43A 2GFIA 4HAWA 3VFDA 3WBJA 2PH7A 2DAIA 2YWBA 3JVVA 3K8QA 3KVOA 4C2AA 3L1UA 4O4IB 1FPMA 3QFRA 4TZTA 2O3QA 3IBSA 5DBEX 4F9TA 1KDZA 5CW2A 2EJWA 3TQIA 4EHHA 5JFTA 1ENYA 3UXMA 4B3XA 3DP7A 2IWRA 1VE3A 2KWIA 2PYZA 3C6BA 3E03A 2IYNA 1NM5A 3W5BA 4PZZA 4F46A 2NP6A 3ECAA 5KNDA 2WU8A 4PQYA 3GEDA 2RMKA 1KZGB 2JJ1A 3Q88A 2ZM6M 4OK5A 3EZGA 1LK5A 2Q62A 5LKRA 3N7TA 1P17A 1N3YA 4MLPA 3H6GA 3SQLA 3CQ9A 3GF4A 1T1EA 2REXB 3RABA 4NMXB 2YZGA 4GZMA 4BUJA 3C1TA 3D6HA 1Q1EA 4FJ2A 2H4JA 5F2KA 1CR0A 2G9RA 4DDHA 2YRFA 4TTRA 1WUHS 3VC7A 4TPKA 3C48A 4P33A 4OGLA 3H7AA 4D9CA 1Z6GA 1WUKS 5F2NA 2OBMA 1SQSA 5K0JA 3D5TA 1ZJZA 2IYQA 4HDQB 4QOZC 4RAQA 2F3TA 1G2PA 4DZZA 5IT9S 2NPFA 3GNTA 1Y63A 1OMOA 3R0VA 1YC5A 3K9NA 3R5XA 2B5OA 3G7NA 3BBZA 1ODIA 4KLZA 3TRKA 1OX4B 4DC9A 2UXCB 2YICA 5A4AA 5LM3A 2XYRA 3AY6A 2OBNA 3RKUA 2PA3A 4YASA 1LZLA 1RMQA 3O3OB 1NOKA 3IMFA 2CDAA 1H2BA 4WBXC 2JI7A 4DEXA 1ZHHA 4R2XA 4DPKA 1J5EM 5KSOA 1QV9A 3K72B 4E08A 5DFLA 2O0HA 4F3CA 4KP7A 1JQJC 3H5IA 2JIQA 3GT4A 1HC7A 1DOHA 4BATA 1T3LA 1U99A 1YDWA 2GOYA 3BXWA 1WPQA 3TCNA 3SAUA 4MEJA 1D2CA 3EAQA 3VSCA 1M2JA 1RWNA 1Q77A 1ZC3A 4EYKA 4R05A 3SJBA 1LRJA 1J0XO 3EXHC 2KBEA 2ZAMA 4TSFA 2FE8A 4KE6A 4F96A 4GM4A 4OCZA 3ANSA 5JWRA 1L7EA 3WLFA 5J2TF 1C8BA 4UEWA 5KPZA 2Q07A 1PJIA 2ZKIA 1YIAA 4O4IA 4R98A 4E5DA 1SPXA 5K51A 1Y8QB 3HXTA 4NJMB 4YCBA 2BGJA 2Z6QA 3LT5A 4RTLA 2PM8A 1SXPA 2G1KA 1G1MA 1WHSB 2DPYA 4EHDA 4IVPA 1T34A 4PHCA 2CVQA 2R00C 4W5NA 4BJ5A 4J9VA 1YQUA 2CFOA 4BLCA 4TKUB 5T4FA 1L7NA 1KEEB 1R64A 3P9NA 4Q7QA 4IW3B 4WY2A 5KHLB 2AOWA 3IT0A 1P74A 3EBPA 2OTCA 2XX3A 4M60A 4ZT2A 2CLHB 2Y0TA 1IXSA 2DFTA 1TTHA 1C2YA 1VBKA 4F2DA 3KOZE 5ESXA 4GLOA 3QVKA 3HBAA 4MXDA 2HLNA 2IYYA 3V4RA 4UMVA 4I3HA 5FD8A 1NWHA 3QUAA 5JXJA 3KZCA 4TGLA 1GYQA 1NYQA 1G20E 4XCVA 4QPCA 2H7XA 3V2UA 4EELA 2WPDA 2B6HA 5JZSA 3Q2KA 1QDUA 1R9NA 1A1SA 5EHXA 2PG3A 3NDIA 2CLEB 4Q48A 2GEKA 1NXTA 3IULA 4LK3A 1VGVA 4HDKB 1F8YA 4MMXB 1IY1A 2WTEA 1ABEA 1I33A 3LCJA 1ZVKA 4KQ9A 4U7JA 3FPKA 4DADA 4R41A 3FWHA 5A7FA 1ECFA 5LQKA 1IZ7A 2JZNA 1YTUA 2FR0A 3AKDA 3TD2A 1KFEB 4QGBA 2Z5FA 1ETHA 3QYEA 5FTMA 4EPWA 4ABYA 1NXWA 4GICA 3BWYA 4EDFA 4ZT6A 3IQEA 2FMKA 4MW1A 4PLCA 3SAWA 3EIHA 3QI2A 3CVUA 4GP7A 3IAHA 4G4QA 4GMKA 3B5IA 4NARA 5EUCA 1QHNA 1YE9A 2GBFA 4NCJA 1UJ5A 4GWKA 1Z6AA 4E88A 5ICGA <