2JY7A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1). rdc refined
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-binding protein p62
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy7A00
2EKFA 1BVSA 1WGLA 5JI2E 3BBZA 2MJ5B 2JY8A 3FE3A 1WHCA 1EFUB 2DZLA 2LTUA 2EKKA 2JZ0A 2CWBA 1JR3E 1R4GA 2K0BX 1AIPC 2L4FA 1VDLA 2MROB 2CP8A 1WR1B 2ZTCA 1ZMUA 4UN2B 2O25A 2DHYA 2JNHA 3GLHE 1VEJA 2QHOB 3IECA 1C7YA 2L4EA 2KNZA 2ZTDA 2HWJA 2KHHA 2MR9A 1YLAA 1XB2B 2HAKA 1MN3A 1T43A 1Q02A 1P3QQ 1XXHE 3F92A 1ZMWA 1CUKA 3IHPA 1KYIA 2JZ1A 1HQYE 2JY6B 1IM2A 2DENA 1G3IA 2JY5A 2JY7A 3GLIE 2LVNC 1NV8A 2KNVA 1VG5A 2R0IA 1TTEA 1VEKA 1DV0A 2LVOC 2OOBA 2K9DA 1F4IA 1E94E 1VQ1A 2KNAA 3H4JA 4HEOA 2WZJA 3LCUA 3GLGE 4WP2A 2DKLA 4GEWA 1HT1E 3T6PA 4F1IA 1ZMVA 2JUJA 4DBGB 3E21A 2RRUA 1T6OA 3B89A 2DNAA 1ZV1A 2DI0A 3FRIA 1OAIA 1HJPA 1OQYA 1G4AE 1SG9A 1WGNA 2DAMA 4R71A 2QSFX 1WIVA 3LCVB 2BWBA 1VEGA 2MGWA 3MMPA 5DFLA 2QNJA 1OTRA 4F2LA 2G3QA 4Q7JA 2EJSA 2DAEA 2BWEA 2DAGA 1DO2A 2L2DA 3K9OA 1IFYA 2OOAA 2LVPC 2LVAA 2DAKA 1IXSA 2JP7A 2LVQD 2B3TA 1PGYA 1A5TA 2LBCA 2H5XA 1TR8A 3FRHA 1WJ7A 2OO9A 1NV9A 4G3OA 3K9PA 1HT2E 1G41A 1V92A 1OKSA 3GLFE 1UFZA 3E46A 1QZEA 1GO5A 1Y8GA 2DAIA 1DO0A
chains in the Genus database with same CATH superfamily
3PNYA 1I94M 4AW4A 3K2LA 3KOXE 1K3XA 5JI2E 3B7NA 3PNVA 2UXCM 2MJ5B 3DFZA 4IJEA 3SC3A 1WHCA 1IN8A 3VDPA 2DZLA 4RKUF 2J7OA 3FUTA 4D82A 2EKKA 2JZ0A 2CWBA 3AV0A 3EIEA 3HHYA 3GLIB 3M7GA 3HJ8A 2DZOB 4CIZA 3U61B 2MROB 2V6ZM 2CP8A 3D8LA 3L2AA 4AZFA 4D80A 4DV7M 4GHLA 5H37D 1HNXM 2GQFA 1MU5A 1XWIA 2DHYA 4JI0M 4GC9A 3SMSA 4MGIE 3NWLA 4REZA 5EXXA 3TWLA 1NO1A 2O5RA 1OAOC 4LF6M 1YE9A 4EIWA 4DV6M 1XNQM 4L78A 5EP2A 1QUSA 2NQ8C 1L2CA 4R3DA 2QPAA 2H1RA 2HAKA 2XF3A 4GIPA 3OTOM 3C58A 3AJIB 3TWMA 1T43A 1OJLA 4JI2M 3F92A 2E5LM 1CUKA 4FVMA 4LFCM 3SYKA 2UXDM 4DUZM 5EXSA 2JZ1A 3GP1A 2JA2A 1JQJC 3KP1E 1LTMA 2XEPA 1IM2A 2C9CA 1OIPA 2JY7A 2QP9X 4LJ5A 2LVNC 4P17A 1XC8A 4DV1M 3FYDA 4LJ8A 3U6LA 4RNAA 3LQQA 2LVOC 2OOBA 2KRUA 4LGYA 2KRKA 5KO3A 1E94E 3HX3A 2FH0A 3HZJA 4L6V6 5IREB 3VKGA 3RE8A 4HLQA 4FCTA 2WZJA 3GPXA 1QQWA 1SXJC 2DKLA 4GEWA 4A3VB 4F1IA 1E32A 3I4YA 1ZMVA 2BJWA 5KPTA 4DBGB 2ZAMA 4KT0F 3KSXA 2BJVA 3FKEA 2KEBA 1IN7A 1OAIA 2UUCM 1OQYA 2R4EA 1SG9A 4OVZB 1WXQA 4I81A 4R71A 4LG2A 3UGJA 4LF8M 4L16A 1VEGA 3HY5A 3HJSA 3LMMA 1EE8A 1QZMA 4QHSA 3E9SA 3GLIA 2D7EA 2CFOA 4Q7JA 1FJGM 3L29A 2CHQA 1DGHB 2VIIA 1J7KA 3U61A 2GNOA 2DAEA 2BWEA 1J09A 2RGOA 3SARA 3FTFA 1VDDA 2DWNA 1N78A 1PM5A 1Q3CA 1IN6A 3U6DA 4QOSA 2QCUA 3SAUA 4L15A 1W5SA 1L8QA 1HNWM 5EP1A 3K8ZA 5GKNA 1D2NA 1PJQA 4PDIA 1L2BA 2JP7A 4IBBA 4B3MM 2B3TA 1A5TA 1QAMA 1PRBA 4BB9A 4DV0M 3AL0C 1IBKM 1WJ7A 1PJSA 1N36M 3K9PA 1HT2E 4JI3M 3JR5A 1JB0F 2QBYB 2K47A 2UUAM 2ZBKB 2KDLA 2CV0A 1L1TA 1Y8GA 2XGNA 3B7ZA 1OFIA 1K82A 1GKIA 3NBIA 5C18A 5JI3E 2M5ZA 2EKFA 1R7RA 1Z5BA 1QVRA 2VQFM 3C9PA 1N34M 3KS8A 4OU7A 1XHBA 5A2QS 3BOSA 4B7HA 2I7NA 2LXEA 2VDBB 4XGIA 4IBJA 3RGPA 5EXPA 2KA6B 2LWXA 1IN5A 4LCBA 3IG5A 1WR1B 3L25A 3SATA 1ZMUA 3SMPA 2O25A 1R2YA 2KXEA 1NNJA 2CE7A 4M9XA 3ZQJA 4OVZA 1Z6TA 3HKPA 8CATA 1FNNA 4AI6A 4MH0E 4AKGA 2QHOB 3IECA 2Z4SA 2L4EA 1C7YA 5EQTA 2ZTDA 2HWJA 1JR3A 3UJNA 3A42A 1DGHA 1IY1A 1XB2B 2CV2A 3VLFB 4RF1A 3VFDA 4X65M 1OIZA 3T1YM 1Q02A 3J2PB 1ZMWA 4DUYM 3GQ4A 3DOAA 1KFVA 4LJ4A 4G4RA 3MJ5A 5LMNM 1G3IA 4FCWA 2JY5A 3GLIE 2KNVA 1VG5A 2R0IA 2N35A 4DV4M 1T3TA 4AG6A 2EO2A 3FTEA 5FSWA 1L1ZA 4KLNA 3VK8A 2R65A 2L7HA 2K9DA 3ZH9B 1F4IA 4I4LA 3H4JA 1NHWC 4L4UA 4G4OA 4HEOA 2F5QA 5E26A 5LMUM 2QBYA 1R6BX 4JXJA 1NY5A 3LCUA 4WP2A 4IBDA 3UZUA 3U6EA 3T6PA 3FTDA 1C1KA 1IXZA 4QOZC 3KOZE 1ZAEA 2CEAA 2JXNA 1MJGM 3B7QA 1IN4A 2WSEF 2DNAA 1ZV1A 3SHGB 1H6UA 3J81S 3W68A 3DZDA 1SXJB 1G4AE 1WGNA 2P5TA 1SXJE 2DAMA 4MGYE 5ITRA 2BWBA 1IBMM 5KQDA 2MH8A 5DFLA 3FD9A 4KHPM 4FD2A 2W82A 1QDRA 3T38A 3U5ZB 1TH3A 2EA0A 2XSZA 2V1CA 2Z8YM 3PVSA 2J7NA 3GRVA 5FLXS 4DV2M 5EP3A 7CATA 3AOGA 3K9OA 4X66M 1GJSA 1IFYA 2OOAA 3HGIA 2Z4RA 3KVWA 1W5TA 3WHLA 4Z6YA 3SAWA 2Y0TA 3QYBA 2DAKA 2LNHC 4IJFA 4LY6A 5FTNA 4XK8F 1NVMA 2LVQD 1HR0M 5F3WA 1QDTA 3K1JA 3GO8A 3GPPA 4I5SA 4IBKA 3QWLA 4X62M 4LZJA 2F5PA 3FUUA 3SFZA 2LBCA 3U6OA 1MX0A 3KOYE 3IG8A 2XLJA 3HJQA 1GL7A 2HHHM 4B3SM 1NV9A 3JR4A 3GLHB 1YSYA 3AOEA 1NHGC 1N77A 3I04M 4LF5M 2AHMA 2L7IA 2FFJA 1IY0A 2HKJA 2DAIA 1JR3E 4XBOA 2D7GA 1I4WA 2HCBA 4G6ZA 3B74A 3GPUA 1GABA 3U6QA 1BVSA 1WGLA 2EUCA 3L28A 3C3DA 5ITXA 3BBZA 4JI5M 3U60B 2CV1A 2JY8A 4PDGA 1GLNA 2WSFF 4NL4H 2LTUA 2O01F 2DHRA 2Y20A 5L8RF 2L4FA 1G8PA 1HQCA 1VDLA 4DV5M 3U6PA 2R4JA 3JAMS 1GL6A 4W5WA 4LJ7A 2ZTCA 3HHXA 3R8FA 2QZ4A 1Z5CA 3L27A 2JNHA 5EXTA 2G8LA 1SXJA 3LQRA 1VEJA 4GMQA 4LJ9A 4KO8A 2R46A 3UMMA 1IXRC 2CHGA 1EIJA 3CF6E 3J80S 3HHWA 1IXSB 2R6FA 3AFHA 2APLA 2FS1A 2KNZA 4NC6A 2KHHA 4LRTA 3U5ZA 1YLAA 3U6MA 1MN3A 5E6JA 2VF8A 1XXHB 2KZUA 2C96A 2FNAA 3FUXA 3HU1A 3E4RA 1XXHE 1J5EM 3IHPA 3THGA 1KYIA 4ANRA 4K0KM 4ITQA 3FYCA 4IBIA 1LV7A 4MM3B 1OFHA 4P16A 2LHGA 2JY6B 4GHAA 3H4MA 1TDZA 4QNMA 2D7HA 4PT5A 1D0MA 3Q8XA 4LFBM 1DGFA 1TTEA 3KSJA 1VEKA 1NJGA 1NSFA 4FWDA 2Z7JA 4D81A 1E9SA 2Y0QA 5FTLA 1HNZM 4JV5M 4PCZA 4JI8M 1VQ1A 1ZQ9A 2Y21A 3GLHA 1TF0B 5FTMA 1G59A 4CJ6A 3GLGB 2F5OA 2F5SA 1X37A 3GLGE 4PD2A 1HT1E 4FWGA 4LF4M 4NSOB 1GVNA 1D0LA 3E21A 2RRUA 4KODA 1T6OA 3VK7A 2LHCA 1GJTA 1Q3BA 1NJFA 2DI0A 2X8AA 3WHKA 2M60A 2YQZA 4LJAA 4QNRA 3AKZA 3U60A 1PJIA 1N75A 2R45A 3B9PA 2QSFX 1WIVA 3LCVB 3MMPA 3GLFB 1TH2A 3EIHA 4FW9A 1OTRA 3HU3A 4JN6A 3V76A 2G3QA 3R9XB 3U6CA 4HL4A 2EJSA 4LRSA 2F5NA 4LF7M 2R18A 2DAGA 1R2ZA 4NRVA 1DO2A 3I4VA 4LFAM 3HWSA 4IBEA 4BBAA 2L2DA 5ITXE 2A5YB 3GQ5A 3SBJA 2XFSA 3SHFA 4JI7M 3VKHA 1S3SA 3FUWA 2XZUA 5DYIA 3RFWA 4G4NA 3QYEA 1TH4A 4QHTA 2L09A 3HHZA 4AQYM 2LVAA 2LH0A 3ZC7B 1IXSA 1KSFX 4GC5A 1PGYA 2XFTA 3GRUA 4NSRA 4LZZA 4OX9M 1XXHA 3W0LB 2H5XA 1IY2A 5KPRA 1TR8A 2OO9A 3KOWE 3GQ3A 1PJJA 2DXIA 4AKIA 2DVWB 3W0FA 3GRYA 3TWKA 2C98A 1G41A 2UXBM 2C9OA 5BPVA 3GPYA 1V33A 2R44A 1UFZA 2ERCA 3A46A 3E46A 1GO5A 1TDHA 3M6AA 1DO0A 2XH9A 2Z3XA 1Q39A 2CUZA 1R5LA 3AOEC 3PFIA 1NNUC 4M0WA 3KFUG 5EP4A 4CHTB 5BR8M 1IQPA 4B7FA 1XMQM 3FUVA 3DA1A 4GKKM 3CTWB 3L26A 2ZANA 4NRWA 3CF2A 4M9ZA 3FE3A 4OW0A 2ZAOA 3GLGA 3ZCBB 4G4QA 2OPFA 1QANA 1EFUB 4DR6M 2HL7A 3KP0E 2BNKA 4GITA 1SXJD 5ITUA 2YR0A 3LW5F 1L2DA 1R4GA 2K0BX 1AIPC 4DR5M 3SYLA 4JYAM 4M0DA 4B3RM 3LVWA 3ILKA 1D0KA 4UN2B 1Z5AA 4II7A 2QQ8A 3GLHE 5IWAM 1IBLM 3NBXX 2OQ4A 2UUBM 2CRUA 4DR7M 3Q8GA 4WW0A 3TE6A 4IBFA 5C1BA 3CGWA 3GLFA 5KQ8A 4AKHA 3T1HM 3PXGA 3C3EA 3TPZA 4R7GA 1YUBA 2MR9A 5ITTA 1TGUA 4LJ6A 2YNMD 4YY3M 4IIWA 4DV3M 1P3QQ 5IT9S 4M9SA 4Z8XA 3J7BA 4RF0A 4S12A 5ITYA 2RGHA 4JI1M 3W67A 2R62A 2WSCF 3FTCA 5FTJA 4JI4M 4ZPXA 3MHVC 4BLCA 5EJCA 1DGBA 1HQYE 2V1UA 3UK6A 2DENA 2F4VM 2J5YA 1NV8A 3CF0A 2G5GX 4MB7A 4MGKE 2DWMA 4B08A 2DZNB 1DV0A 1JR3D 3HU2A 1RU3A 4B7GA 1AUAA 2KNAA 4CISA 4DR4M 2K6BA 2ZM6M 4NXNM 2QENA 1QAQA 2DWLA 3D8BA 2XZFA 4TUWA 3GRRA 3QAUA 2JUJA 2RKOA 4FWHA 3KXEC 3BXWA 4YHHM 3B89A 2KW0A 2FOIC 3J27B 3KDSE 4GKJM 3FRIA 1HJPA 2C99A 4AG5A 4DR1M 4JI6M 2C5RA 2VF7A 2X4AA 4DR3M 4IBGA 4L8RC 2MGWA 4NXMM 2QNJA 4F2LA 1UM8A 5FTKA 1V34A 1N33M 2L6OA 4WURA 5ITQA 4LF9M 3A45A 4IBCA 4NOOB 3KW6A 2LVPC 4Y28F 4CGYB 2UU9M 5DYGA 4I8OA 1K3WA 5KPZA 1QAOA 3MK6A 2YFQA 2FE8A 3SAVA 3VDUA 4B3TM 1E9RA 5IZ7D 2Q2EB 3LVVA 3K92A 3T15A 2X49A 4FCVA 1XMOM 3A98B 1PJTA 1N32M 1ORYB 1QUTA 3U6SA 3FRHA 2DWZB 1DGGA 2JWSA 2XSZD 3TL4X 2VQEM 4G3OA 3I51A 3RGSA 4MGZE 2KZSA 1V92A 3M0EA 5DNYA 3J7AS 3KS4A 1OKSA 3TQSA 1QYRA 4DR2M 1XNRM 3GLFE 4MGHA 4GH9A 2I7PA 4LGMA 2CHVA 1NY6A 4GRIA 1Z59A 1QZEA 3I01M 1G71A 4X64M 3SASA
chains in the Genus database with same CATH topology
2EKFA 1BVSA 1WGLA 5JI2E 3BBZA 2MJ5B 2JY8A 3FE3A 1WHCA 1EFUB 2DZLA 2LTUA 2EKKA 2JZ0A 2CWBA 1JR3E 1R4GA 2K0BX 1AIPC 2L4FA 1VDLA 2MROB 2CP8A 1WR1B 2ZTCA 1ZMUA 4UN2B 2O25A 2DHYA 2JNHA 3GLHE 1VEJA 2QHOB 3IECA 1C7YA 2L4EA 2KNZA 2ZTDA 2HWJA 2KHHA 2MR9A 1YLAA 1XB2B 2HAKA 1MN3A 1T43A 1Q02A 1P3QQ 1XXHE 3F92A 1ZMWA 1CUKA 3IHPA 1KYIA 2JZ1A 1HQYE 2JY6B 1IM2A 2DENA 1G3IA 2JY5A 2JY7A 3GLIE 2LVNC 1NV8A 2KNVA 1VG5A 2R0IA 1TTEA 1VEKA 1DV0A 2LVOC 2OOBA 2K9DA 1F4IA 1E94E 1VQ1A 2KNAA 3H4JA 4HEOA 2WZJA 3LCUA 3GLGE 4WP2A 2DKLA 4GEWA 1HT1E 3T6PA 4F1IA 1ZMVA 2JUJA 4DBGB 3E21A 2RRUA 1T6OA 3B89A 2DNAA 1ZV1A 2DI0A 3FRIA 1OAIA 1HJPA 1OQYA 1G4AE 1SG9A 1WGNA 2DAMA 4R71A 2QSFX 1WIVA 3LCVB 2BWBA 1VEGA 2MGWA 3MMPA 5DFLA 2QNJA 1OTRA 4F2LA 2G3QA 4Q7JA 2EJSA 2DAEA 2BWEA 2DAGA 1DO2A 2L2DA 3K9OA 1IFYA 2OOAA 2LVPC 2LVAA 2DAKA 1IXSA 2JP7A 2LVQD 2B3TA 1PGYA 1A5TA 2LBCA 2H5XA 1TR8A 3FRHA 1WJ7A 2OO9A 1NV9A 4G3OA 3K9PA 1HT2E 1G41A 1V92A 1OKSA 3GLFE 1UFZA 3E46A 1QZEA 1GO5A 1Y8GA 2DAIA 1DO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKF A;  1BVS A;  1WGL A;  5JI2 E;  3BBZ A;  2MJ5 B;  2JY8 A;  3FE3 A;  1WHC A;  1EFU B;  2DZL A;  2LTU A;  2EKK A;  2JZ0 A;  2CWB A;  1JR3 E;  1R4G A;  2K0B X;  1AIP C;  2L4F A;  1VDL A;  2MRO B;  2CP8 A;  1WR1 B;  2ZTC A;  1ZMU A;  4UN2 B;  2O25 A;  2DHY A;  2JNH A;  3GLH E;  1VEJ A;  2QHO B;  3IEC A;  1C7Y A;  2L4E A;  2KNZ A;  2ZTD A;  2HWJ A;  2KHH A;  2MR9 A;  1YLA A;  1XB2 B;  2HAK A;  1MN3 A;  1T43 A;  1Q02 A;  1P3Q Q;  1XXH E;  3F92 A;  1ZMW A;  1CUK A;  3IHP A;  1KYI A;  2JZ1 A;  1HQY E;  2JY6 B;  1IM2 A;  2DEN A;  1G3I A;  2JY5 A;  2JY7 A;  3GLI E;  2LVN C;  1NV8 A;  2KNV A;  1VG5 A;  2R0I A;  1TTE A;  1VEK A;  1DV0 A;  2LVO C;  2OOB A;  2K9D A;  1F4I A;  1E94 E;  1VQ1 A;  2KNA A;  3H4J A;  4HEO A;  2WZJ A;  3LCU A;  3GLG E;  4WP2 A;  2DKL A;  4GEW A;  1HT1 E;  3T6P A;  4F1I A;  1ZMV A;  2JUJ A;  4DBG B;  3E21 A;  2RRU A;  1T6O A;  3B89 A;  2DNA A;  1ZV1 A;  2DI0 A;  3FRI A;  1OAI A;  1HJP A;  1OQY A;  1G4A E;  1SG9 A;  1WGN A;  2DAM A;  4R71 A;  2QSF X;  1WIV A;  3LCV B;  2BWB A;  1VEG A;  2MGW A;  3MMP A;  5DFL A;  2QNJ A;  1OTR A;  4F2L A;  2G3Q A;  4Q7J A;  2EJS A;  2DAE A;  2BWE A;  2DAG A;  1DO2 A;  2L2D A;  3K9O A;  1IFY A;  2OOA A;  2LVP C;  2LVA A;  2DAK A;  1IXS A;  2JP7 A;  2LVQ D;  2B3T A;  1PGY A;  1A5T A;  2LBC A;  2H5X A;  1TR8 A;  3FRH A;  1WJ7 A;  2OO9 A;  1NV9 A;  4G3O A;  3K9P A;  1HT2 E;  1G41 A;  1V92 A;  1OKS A;  3GLF E;  1UFZ A;  3E46 A;  1QZE A;  1GO5 A;  1Y8G A;  2DAI A;  1DO0 A; 
#chains in the Genus database with same CATH topology
 3PNY A;  1I94 M;  4AW4 A;  3K2L A;  3KOX E;  1K3X A;  5JI2 E;  3B7N A;  3PNV A;  2UXC M;  2MJ5 B;  3DFZ A;  4IJE A;  3SC3 A;  1WHC A;  1IN8 A;  3VDP A;  2DZL A;  4RKU F;  2J7O A;  3FUT A;  4D82 A;  2EKK A;  2JZ0 A;  2CWB A;  3AV0 A;  3EIE A;  3HHY A;  3GLI B;  3M7G A;  3HJ8 A;  2DZO B;  4CIZ A;  3U61 B;  2MRO B;  2V6Z M;  2CP8 A;  3D8L A;  3L2A A;  4AZF A;  4D80 A;  4DV7 M;  4GHL A;  5H37 D;  1HNX M;  2GQF A;  1MU5 A;  1XWI A;  2DHY A;  4JI0 M;  4GC9 A;  3SMS A;  4MGI E;  3NWL A;  4REZ A;  5EXX A;  3TWL A;  1NO1 A;  2O5R A;  1OAO C;  4LF6 M;  1YE9 A;  4EIW A;  4DV6 M;  1XNQ M;  4L78 A;  5EP2 A;  1QUS A;  2NQ8 C;  1L2C A;  4R3D A;  2QPA A;  2H1R A;  2HAK A;  2XF3 A;  4GIP A;  3OTO M;  3C58 A;  3AJI B;  3TWM A;  1T43 A;  1OJL A;  4JI2 M;  3F92 A;  2E5L M;  1CUK A;  4FVM A;  4LFC M;  3SYK A;  2UXD M;  4DUZ M;  5EXS A;  2JZ1 A;  3GP1 A;  2JA2 A;  1JQJ C;  3KP1 E;  1LTM A;  2XEP A;  1IM2 A;  2C9C A;  1OIP A;  2JY7 A;  2QP9 X;  4LJ5 A;  2LVN C;  4P17 A;  1XC8 A;  4DV1 M;  3FYD A;  4LJ8 A;  3U6L A;  4RNA A;  3LQQ A;  2LVO C;  2OOB A;  2KRU A;  4LGY A;  2KRK A;  5KO3 A;  1E94 E;  3HX3 A;  2FH0 A;  3HZJ A;  4L6V 6;  5IRE B;  3VKG A;  3RE8 A;  4HLQ A;  4FCT A;  2WZJ A;  3GPX A;  1QQW A;  1SXJ C;  2DKL A;  4GEW A;  4A3V B;  4F1I A;  1E32 A;  3I4Y A;  1ZMV A;  2BJW A;  5KPT A;  4DBG B;  2ZAM A;  4KT0 F;  3KSX A;  2BJV A;  3FKE A;  2KEB A;  1IN7 A;  1OAI A;  2UUC M;  1OQY A;  2R4E A;  1SG9 A;  4OVZ B;  1WXQ A;  4I81 A;  4R71 A;  4LG2 A;  3UGJ A;  4LF8 M;  4L16 A;  1VEG A;  3HY5 A;  3HJS A;  3LMM A;  1EE8 A;  1QZM A;  4QHS A;  3E9S A;  3GLI A;  2D7E A;  2CFO A;  4Q7J A;  1FJG M;  3L29 A;  2CHQ A;  1DGH B;  2VII A;  1J7K A;  3U61 A;  2GNO A;  2DAE A;  2BWE A;  1J09 A;  2RGO A;  3SAR A;  3FTF A;  1VDD A;  2DWN A;  1N78 A;  1PM5 A;  1Q3C A;  1IN6 A;  3U6D A;  4QOS A;  2QCU A;  3SAU A;  4L15 A;  1W5S A;  1L8Q A;  1HNW M;  5EP1 A;  3K8Z A;  5GKN A;  1D2N A;  1PJQ A;  4PDI A;  1L2B A;  2JP7 A;  4IBB A;  4B3M M;  2B3T A;  1A5T A;  1QAM A;  1PRB A;  4BB9 A;  4DV0 M;  3AL0 C;  1IBK M;  1WJ7 A;  1PJS A;  1N36 M;  3K9P A;  1HT2 E;  4JI3 M;  3JR5 A;  1JB0 F;  2QBY B;  2K47 A;  2UUA M;  2ZBK B;  2KDL A;  2CV0 A;  1L1T A;  1Y8G A;  2XGN A;  3B7Z A;  1OFI A;  1K82 A;  1GKI A;  3NBI A;  5C18 A;  5JI3 E;  2M5Z A;  2EKF A;  1R7R A;  1Z5B A;  1QVR A;  2VQF M;  3C9P A;  1N34 M;  3KS8 A;  4OU7 A;  1XHB A;  5A2Q S;  3BOS A;  4B7H A;  2I7N A;  2LXE A;  2VDB B;  4XGI A;  4IBJ A;  3RGP A;  5EXP A;  2KA6 B;  2LWX A;  1IN5 A;  4LCB A;  3IG5 A;  1WR1 B;  3L25 A;  3SAT A;  1ZMU A;  3SMP A;  2O25 A;  1R2Y A;  2KXE A;  1NNJ A;  2CE7 A;  4M9X A;  3ZQJ A;  4OVZ A;  1Z6T A;  3HKP A;  8CAT A;  1FNN A;  4AI6 A;  4MH0 E;  4AKG A;  2QHO B;  3IEC A;  2Z4S A;  2L4E A;  1C7Y A;  5EQT A;  2ZTD A;  2HWJ A;  1JR3 A;  3UJN A;  3A42 A;  1DGH A;  1IY1 A;  1XB2 B;  2CV2 A;  3VLF B;  4RF1 A;  3VFD A;  4X65 M;  1OIZ A;  3T1Y M;  1Q02 A;  3J2P B;  1ZMW A;  4DUY M;  3GQ4 A;  3DOA A;  1KFV A;  4LJ4 A;  4G4R A;  3MJ5 A;  5LMN M;  1G3I A;  4FCW A;  2JY5 A;  3GLI E;  2KNV A;  1VG5 A;  2R0I A;  2N35 A;  4DV4 M;  1T3T A;  4AG6 A;  2EO2 A;  3FTE A;  5FSW A;  1L1Z A;  4KLN A;  3VK8 A;  2R65 A;  2L7H A;  2K9D A;  3ZH9 B;  1F4I A;  4I4L A;  3H4J A;  1NHW C;  4L4U A;  4G4O A;  4HEO A;  2F5Q A;  5E26 A;  5LMU M;  2QBY A;  1R6B X;  4JXJ A;  1NY5 A;  3LCU A;  4WP2 A;  4IBD A;  3UZU A;  3U6E A;  3T6P A;  3FTD A;  1C1K A;  1IXZ A;  4QOZ C;  3KOZ E;  1ZAE A;  2CEA A;  2JXN A;  1MJG M;  3B7Q A;  1IN4 A;  2WSE F;  2DNA A;  1ZV1 A;  3SHG B;  1H6U A;  3J81 S;  3W68 A;  3DZD A;  1SXJ B;  1G4A E;  1WGN A;  2P5T A;  1SXJ E;  2DAM A;  4MGY E;  5ITR A;  2BWB A;  1IBM M;  5KQD A;  2MH8 A;  5DFL A;  3FD9 A;  4KHP M;  4FD2 A;  2W82 A;  1QDR A;  3T38 A;  3U5Z B;  1TH3 A;  2EA0 A;  2XSZ A;  2V1C A;  2Z8Y M;  3PVS A;  2J7N A;  3GRV A;  5FLX S;  4DV2 M;  5EP3 A;  7CAT A;  3AOG A;  3K9O A;  4X66 M;  1GJS A;  1IFY A;  2OOA A;  3HGI A;  2Z4R A;  3KVW A;  1W5T A;  3WHL A;  4Z6Y A;  3SAW A;  2Y0T A;  3QYB A;  2DAK A;  2LNH C;  4IJF A;  4LY6 A;  5FTN A;  4XK8 F;  1NVM A;  2LVQ D;  1HR0 M;  5F3W A;  1QDT A;  3K1J A;  3GO8 A;  3GPP A;  4I5S A;  4IBK A;  3QWL A;  4X62 M;  4LZJ A;  2F5P A;  3FUU A;  3SFZ A;  2LBC A;  3U6O A;  1MX0 A;  3KOY E;  3IG8 A;  2XLJ A;  3HJQ A;  1GL7 A;  2HHH M;  4B3S M;  1NV9 A;  3JR4 A;  3GLH B;  1YSY A;  3AOE A;  1NHG C;  1N77 A;  3I04 M;  4LF5 M;  2AHM A;  2L7I A;  2FFJ A;  1IY0 A;  2HKJ A;  2DAI A;  1JR3 E;  4XBO A;  2D7G A;  1I4W A;  2HCB A;  4G6Z A;  3B74 A;  3GPU A;  1GAB A;  3U6Q A;  1BVS A;  1WGL A;  2EUC A;  3L28 A;  3C3D A;  5ITX A;  3BBZ A;  4JI5 M;  3U60 B;  2CV1 A;  2JY8 A;  4PDG A;  1GLN A;  2WSF F;  4NL4 H;  2LTU A;  2O01 F;  2DHR A;  2Y20 A;  5L8R F;  2L4F A;  1G8P A;  1HQC A;  1VDL A;  4DV5 M;  3U6P A;  2R4J A;  3JAM S;  1GL6 A;  4W5W A;  4LJ7 A;  2ZTC A;  3HHX A;  3R8F A;  2QZ4 A;  1Z5C A;  3L27 A;  2JNH A;  5EXT A;  2G8L A;  1SXJ A;  3LQR A;  1VEJ A;  4GMQ A;  4LJ9 A;  4KO8 A;  2R46 A;  3UMM A;  1IXR C;  2CHG A;  1EIJ A;  3CF6 E;  3J80 S;  3HHW A;  1IXS B;  2R6F A;  3AFH A;  2APL A;  2FS1 A;  2KNZ A;  4NC6 A;  2KHH A;  4LRT A;  3U5Z A;  1YLA A;  3U6M A;  1MN3 A;  5E6J A;  2VF8 A;  1XXH B;  2KZU A;  2C96 A;  2FNA A;  3FUX A;  3HU1 A;  3E4R A;  1XXH E;  1J5E M;  3IHP A;  3THG A;  1KYI A;  4ANR A;  4K0K M;  4ITQ A;  3FYC A;  4IBI A;  1LV7 A;  4MM3 B;  1OFH A;  4P16 A;  2LHG A;  2JY6 B;  4GHA A;  3H4M A;  1TDZ A;  4QNM A;  2D7H A;  4PT5 A;  1D0M A;  3Q8X A;  4LFB M;  1DGF A;  1TTE A;  3KSJ A;  1VEK A;  1NJG A;  1NSF A;  4FWD A;  2Z7J A;  4D81 A;  1E9S A;  2Y0Q A;  5FTL A;  1HNZ M;  4JV5 M;  4PCZ A;  4JI8 M;  1VQ1 A;  1ZQ9 A;  2Y21 A;  3GLH A;  1TF0 B;  5FTM A;  1G59 A;  4CJ6 A;  3GLG B;  2F5O A;  2F5S A;  1X37 A;  3GLG E;  4PD2 A;  1HT1 E;  4FWG A;  4LF4 M;  4NSO B;  1GVN A;  1D0L A;  3E21 A;  2RRU A;  4KOD A;  1T6O A;  3VK7 A;  2LHC A;  1GJT A;  1Q3B A;  1NJF A;  2DI0 A;  2X8A A;  3WHK A;  2M60 A;  2YQZ A;  4LJA A;  4QNR A;  3AKZ A;  3U60 A;  1PJI A;  1N75 A;  2R45 A;  3B9P A;  2QSF X;  1WIV A;  3LCV B;  3MMP A;  3GLF B;  1TH2 A;  3EIH A;  4FW9 A;  1OTR A;  3HU3 A;  4JN6 A;  3V76 A;  2G3Q A;  3R9X B;  3U6C A;  4HL4 A;  2EJS A;  4LRS A;  2F5N A;  4LF7 M;  2R18 A;  2DAG A;  1R2Z A;  4NRV A;  1DO2 A;  3I4V A;  4LFA M;  3HWS A;  4IBE A;  4BBA A;  2L2D A;  5ITX E;  2A5Y B;  3GQ5 A;  3SBJ A;  2XFS A;  3SHF A;  4JI7 M;  3VKH A;  1S3S A;  3FUW A;  2XZU A;  5DYI A;  3RFW A;  4G4N A;  3QYE A;  1TH4 A;  4QHT A;  2L09 A;  3HHZ A;  4AQY M;  2LVA A;  2LH0 A;  3ZC7 B;  1IXS A;  1KSF X;  4GC5 A;  1PGY A;  2XFT A;  3GRU A;  4NSR A;  4LZZ A;  4OX9 M;  1XXH A;  3W0L B;  2H5X A;  1IY2 A;  5KPR A;  1TR8 A;  2OO9 A;  3KOW E;  3GQ3 A;  1PJJ A;  2DXI A;  4AKI A;  2DVW B;  3W0F A;  3GRY A;  3TWK A;  2C98 A;  1G41 A;  2UXB M;  2C9O A;  5BPV A;  3GPY A;  1V33 A;  2R44 A;  1UFZ A;  2ERC A;  3A46 A;  3E46 A;  1GO5 A;  1TDH A;  3M6A A;  1DO0 A;  2XH9 A;  2Z3X A;  1Q39 A;  2CUZ A;  1R5L A;  3AOE C;  3PFI A;  1NNU C;  4M0W A;  3KFU G;  5EP4 A;  4CHT B;  5BR8 M;  1IQP A;  4B7F A;  1XMQ M;  3FUV A;  3DA1 A;  4GKK M;  3CTW B;  3L26 A;  2ZAN A;  4NRW A;  3CF2 A;  4M9Z A;  3FE3 A;  4OW0 A;  2ZAO A;  3GLG A;  3ZCB B;  4G4Q A;  2OPF A;  1QAN A;  1EFU B;  4DR6 M;  2HL7 A;  3KP0 E;  2BNK A;  4GIT A;  1SXJ D;  5ITU A;  2YR0 A;  3LW5 F;  1L2D A;  1R4G A;  2K0B X;  1AIP C;  4DR5 M;  3SYL A;  4JYA M;  4M0D A;  4B3R M;  3LVW A;  3ILK A;  1D0K A;  4UN2 B;  1Z5A A;  4II7 A;  2QQ8 A;  3GLH E;  5IWA M;  1IBL M;  3NBX X;  2OQ4 A;  2UUB M;  2CRU A;  4DR7 M;  3Q8G A;  4WW0 A;  3TE6 A;  4IBF A;  5C1B A;  3CGW A;  3GLF A;  5KQ8 A;  4AKH A;  3T1H M;  3PXG A;  3C3E A;  3TPZ A;  4R7G A;  1YUB A;  2MR9 A;  5ITT A;  1TGU A;  4LJ6 A;  2YNM D;  4YY3 M;  4IIW A;  4DV3 M;  1P3Q Q;  5IT9 S;  4M9S A;  4Z8X A;  3J7B A;  4RF0 A;  4S12 A;  5ITY A;  2RGH A;  4JI1 M;  3W67 A;  2R62 A;  2WSC F;  3FTC A;  5FTJ A;  4JI4 M;  4ZPX A;  3MHV C;  4BLC A;  5EJC A;  1DGB A;  1HQY E;  2V1U A;  3UK6 A;  2DEN A;  2F4V M;  2J5Y A;  1NV8 A;  3CF0 A;  2G5G X;  4MB7 A;  4MGK E;  2DWM A;  4B08 A;  2DZN B;  1DV0 A;  1JR3 D;  3HU2 A;  1RU3 A;  4B7G A;  1AUA A;  2KNA A;  4CIS A;  4DR4 M;  2K6B A;  2ZM6 M;  4NXN M;  2QEN A;  1QAQ A;  2DWL A;  3D8B A;  2XZF A;  4TUW A;  3GRR A;  3QAU A;  2JUJ A;  2RKO A;  4FWH A;  3KXE C;  3BXW A;  4YHH M;  3B89 A;  2KW0 A;  2FOI C;  3J27 B;  3KDS E;  4GKJ M;  3FRI A;  1HJP A;  2C99 A;  4AG5 A;  4DR1 M;  4JI6 M;  2C5R A;  2VF7 A;  2X4A A;  4DR3 M;  4IBG A;  4L8R C;  2MGW A;  4NXM M;  2QNJ A;  4F2L A;  1UM8 A;  5FTK A;  1V34 A;  1N33 M;  2L6O A;  4WUR A;  5ITQ A;  4LF9 M;  3A45 A;  4IBC A;  4NOO B;  3KW6 A;  2LVP C;  4Y28 F;  4CGY B;  2UU9 M;  5DYG A;  4I8O A;  1K3W A;  5KPZ A;  1QAO A;  3MK6 A;  2YFQ A;  2FE8 A;  3SAV A;  3VDU A;  4B3T M;  1E9R A;  5IZ7 D;  2Q2E B;  3LVV A;  3K92 A;  3T15 A;  2X49 A;  4FCV A;  1XMO M;  3A98 B;  1PJT A;  1N32 M;  1ORY B;  1QUT A;  3U6S A;  3FRH A;  2DWZ B;  1DGG A;  2JWS A;  2XSZ D;  3TL4 X;  2VQE M;  4G3O A;  3I51 A;  3RGS A;  4MGZ E;  2KZS A;  1V92 A;  3M0E A;  5DNY A;  3J7A S;  3KS4 A;  1OKS A;  3TQS A;  1QYR A;  4DR2 M;  1XNR M;  3GLF E;  4MGH A;  4GH9 A;  2I7P A;  4LGM A;  2CHV A;  1NY6 A;  4GRI A;  1Z59 A;  1QZE A;  3I01 M;  1G71 A;  4X64 M;  3SAS A; 
#chains in the Genus database with same CATH homology
 2EKF A;  1BVS A;  1WGL A;  5JI2 E;  3BBZ A;  2MJ5 B;  2JY8 A;  3FE3 A;  1WHC A;  1EFU B;  2DZL A;  2LTU A;  2EKK A;  2JZ0 A;  2CWB A;  1JR3 E;  1R4G A;  2K0B X;  1AIP C;  2L4F A;  1VDL A;  2MRO B;  2CP8 A;  1WR1 B;  2ZTC A;  1ZMU A;  4UN2 B;  2O25 A;  2DHY A;  2JNH A;  3GLH E;  1VEJ A;  2QHO B;  3IEC A;  1C7Y A;  2L4E A;  2KNZ A;  2ZTD A;  2HWJ A;  2KHH A;  2MR9 A;  1YLA A;  1XB2 B;  2HAK A;  1MN3 A;  1T43 A;  1Q02 A;  1P3Q Q;  1XXH E;  3F92 A;  1ZMW A;  1CUK A;  3IHP A;  1KYI A;  2JZ1 A;  1HQY E;  2JY6 B;  1IM2 A;  2DEN A;  1G3I A;  2JY5 A;  2JY7 A;  3GLI E;  2LVN C;  1NV8 A;  2KNV A;  1VG5 A;  2R0I A;  1TTE A;  1VEK A;  1DV0 A;  2LVO C;  2OOB A;  2K9D A;  1F4I A;  1E94 E;  1VQ1 A;  2KNA A;  3H4J A;  4HEO A;  2WZJ A;  3LCU A;  3GLG E;  4WP2 A;  2DKL A;  4GEW A;  1HT1 E;  3T6P A;  4F1I A;  1ZMV A;  2JUJ A;  4DBG B;  3E21 A;  2RRU A;  1T6O A;  3B89 A;  2DNA A;  1ZV1 A;  2DI0 A;  3FRI A;  1OAI A;  1HJP A;  1OQY A;  1G4A E;  1SG9 A;  1WGN A;  2DAM A;  4R71 A;  2QSF X;  1WIV A;  3LCV B;  2BWB A;  1VEG A;  2MGW A;  3MMP A;  5DFL A;  2QNJ A;  1OTR A;  4F2L A;  2G3Q A;  4Q7J A;  2EJS A;  2DAE A;  2BWE A;  2DAG A;  1DO2 A;  2L2D A;  3K9O A;  1IFY A;  2OOA A;  2LVP C;  2LVA A;  2DAK A;  1IXS A;  2JP7 A;  2LVQ D;  2B3T A;  1PGY A;  1A5T A;  2LBC A;  2H5X A;  1TR8 A;  3FRH A;  1WJ7 A;  2OO9 A;  1NV9 A;  4G3O A;  3K9P A;  1HT2 E;  1G41 A;  1V92 A;  1OKS A;  3GLF E;  1UFZ A;  3E46 A;  1QZE A;  1GO5 A;  1Y8G A;  2DAI A;  1DO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...