2JY7A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1). rdc refined
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-binding protein p62
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy7A00
2HAKA 1NV8A 1VEKA 2LBCA 1VDLA 2MGWA 3BBZA 2KNZA 1Y8GA 2LVQD 4F1IA 2DKLA 4WP2A 4DBGB 4UN2B 2H5XA 2JUJA 2JY5A 4GEWA 2LVNC 3T6PA 1DV0A 3IHPA 1ZMWA 2JZ0A 5DFLA 2MROB 1V92A 2JP7A 2JY7A 2EKFA 1G41A 1VQ1A 1WIVA 1IXSA 1P3QQ 2JY8A 2JZ1A 3K9PA 1MN3A 1IFYA 1YLAA 1HJPA 2B3TA 3IECA 2DHYA 2OO9A 1WGLA 1HT2E 1UFZA 1OKSA 2DAGA 2QNJA 2JY6B 2ZTCA 2CP8A 5JI2E 2KNAA 2G3QA 2OOAA 1WJ7A 4Q7JA 1AIPC 1JR3E 3K9OA 1XXHE 1G4AE 2BWBA 2QHOB 2QSFX 1WR1B 1VEGA 1ZMUA 4R71A 1OTRA 1XB2B 1ZV1A 2LVPC 2CWBA 2KNVA 1F4IA 1QZEA 2K9DA 1WGNA 2DAKA 1CUKA 1OQYA 1Q02A 4F2LA 3GLHE 3GLGE 3E21A 3E46A 3FRHA 2OOBA 2KHHA 2WZJA 3F92A 2RRUA 2DAEA 1PGYA 1DO2A 2DNAA 2DAMA 1VG5A 1C7YA 2LVOC 3GLFE 2L4FA 3B89A 2DENA 1E94E 3FE3A 2K0BX 1OAIA 2EJSA 1KYIA 1T6OA 2L4EA 2R0IA 1TTEA 1T43A 1VEJA 3GLIE 2BWEA 1NV9A 2ZTDA 1HT1E 1SG9A 3FRIA 1R4GA 3LCVB 2DI0A 1IM2A 1WHCA 2O25A 1TR8A 2L2DA 2DZLA 3LCUA 1G3IA 2HWJA 3MMPA 1EFUB 2LTUA 2LVAA 1GO5A 1ZMVA 4HEOA 2MJ5B 1BVSA 4G3OA 1DO0A 2MR9A 2EKKA 2JNHA 3H4JA 1HQYE 1A5TA 2DAIA
chains in the Genus database with same CATH superfamily
2HAKA 1NV8A 1L2CA 3KSXA 3BOSA 4PDGA 1L1ZA 1VDLA 1IBLM 2Z7JA 3B9PA 2YQZA 2WSCF 3TPZA 4JI7M 3U6MA 4F1IA 4WP2A 4DBGB 3HHZA 4G4OA 2H5XA 3FYDA 1EIJA 4GEWA 3CGWA 3VDUA 2CFOA 4DUZM 1DV0A 4LGMA 1ZMWA 2I7PA 3SMPA 4D81A 3J81S 1V92A 4P16A 2JP7A 1XNRM 4IBKA 4JN6A 4DV7M 5ITQA 1G41A 3GQ5A 1QDRA 1VQ1A 2K47A 1X37A 3GO8A 3T1HM 4DR6M 1IY2A 1YLAA 2CHGA 3A98B 1OAOC 1J7KA 3IECA 1KSFX 4LY6A 1I94M 5BR8M 3U6CA 1WGLA 2QPAA 2D7EA 2QP9X 4LF5M 4LF6M 4LJ8A 2JY6B 2FOIC 3GLIA 2ZTCA 1K3XA 2BNKA 4LFBM 4DV3M 4LGYA 3J80S 1N32M 2J7OA 2CEAA 1XNQM 2V1UA 3TE6A 4L16A 2QHOB 2KDLA 3FTCA 4Z6YA 4DV2M 1WR1B 1VEGA 3LMMA 1ZMUA 1IXSB 2J7NA 4GITA 1D2NA 2JWSA 2L6OA 1D0KA 2CWBA 4MGKE 3A42A 3FUWA 2Z3XA 2DWZB 1W5TA 2DAKA 1L1TA 4P17A 2L7HA 2UXDM 4JI0M 4GKJM 3GLGE 2YNMD 3QWLA 3SFZA 1N36M 2OOBA 3UJNA 4NXMM 3K2LA 3F92A 1NNUC 2MH8A 3W0LB 1TH2A 1MJGM 1JQJC 1AUAA 2XH9A 3KOXE 2QQ8A 1QDTA 2W82A 4LJ9A 1VG5A 4REZA 2VQEM 1OJLA 4DR1M 4K0KM 4FVMA 4GH9A 1L8QA 1NHGC 3IG8A 3U60A 4JI2M 2DENA 3I4YA 4JXJA 5DYIA 1NSFA 4M9XA 1N77A 5KPZA 3NWLA 1PJJA 3K1JA 4LZJA 3KOYE 3HHXA 2EJSA 1N78A 1T6OA 2L4EA 3HU3A 4II7A 3W67A 3AJIB 1DGFA 3I04M 3C58A 3KS4A 3JR4A 4KO8A 3ZH9B 3GRUA 1TTEA 1WXQA 2UUAM 1W5SA 3GLIE 1NY6A 4AZFA 3GPPA 4OX9M 2UXBM 2BJWA 2GNOA 4GIPA 1Q3CA 3MK6A 1DGGA 1NV9A 1E9SA 2ZTDA 2P5TA 1TH3A 3CF6E 1SG9A 4GRIA 2F5OA 3AFHA 4TUWA 2A5YB 1FNNA 1MU5A 2DI0A 4OVZA 1TR8A 2L2DA 2QBYB 5KQDA 1Q3BA 3J7AS 2NQ8C 4I8OA 2R4EA 2F5NA 1Z5CA 3SBJA 2XF3A 1V34A 2L7IA 3MMPA 4GC9A 3KVWA 1EFUB 2LVAA 3CF2A 3SAVA 4DV1M 4PDIA 4G3OA 1ZAEA 1NJFA 2MR9A 1TDZA 1L2DA 3KS8A 1MX0A 3QYEA 2JNHA 3U6EA 1SXJE 2VF7A 4PT5A 3H4JA 2XGNA 4YHHM 4QNMA 3IG5A 2KRKA 1LV7A 1JR3A 4RNAA 1XXHA 2JA2A 3UGJA 2DXIA 4B3SM 4G4NA 2M60A 2X4AA 1SXJC 5LMNM 2F5QA 4CIZA 3BBZA 3B7ZA 4B7FA 5KPRA 2LHGA 4NSRA 4X64M 3GLGB 3U6DA 2F4VM 1QZMA 3AL0C 2DKLA 4IBCA 2QZ4A 3GLHA 1R2ZA 2VF8A 2JUJA 1R6BX 4FWHA 2FNAA 4LRTA 1XHBA 4IBFA 3U6SA 2XZFA 3VFDA 4LJ5A 4B7HA 2BJVA 1PJQA 1XMOM 3KOZE 1NVMA 4LG2A 3Q8XA 4JI8M 1NHWC 1WIVA 1P3QQ 2R6FA 3SAUA 1D0MA 4LZZA 4FCTA 2C96A 2K6BA 3PFIA 3SHGB 2B3TA 2KW0A 5ITTA 3U61A 4XGIA 4OW0A 1QAOA 4B08A 3EIHA 4ITQA 2Y21A 4IJFA 1HT2E 2RGHA 1SXJD 4W5WA 3D8LA 4NSOB 4MM3B 1UFZA 1OKSA 2C98A 2DAGA 3B7QA 3VK8A 2ZAOA 1QUSA 1TF0B 3RGPA 4AKGA 2CP8A 3OTOM 2KEBA 2QBYA 3TWKA 2G3QA 3W68A 4ZPXA 3FTFA 2OOAA 4Q7JA 3L26A 2R45A 1JR3E 4OU7A 1QAMA 1XXHE 2Y0QA 4B3MM 2XSZD 4MGZE 2QSFX 3GLFB 4M9SA 2XFTA 3L28A 2FFJA 3T15A 5EXSA 2LVPC 1GVNA 1XB2B 1ZV1A 2Z8YM 4FWGA 4DV5M 2KXEA 1QZEA 3Q8GA 3L25A 3HKPA 1Q39A 3U6LA 2X49A 4RKUF 3HGIA 3GLHE 3AOGA 1EE8A 1HNXM 3R8FA 5FTLA 1IQPA 3E21A 5FTKA 4JI5M 3EIEA 3FRHA 3GRRA 2ZM6M 5KO3A 2ERCA 4LJ7A 3C3DA 5H37D 2LNHC 4L15A 1IN7A 1Z59A 1KFVA 2DNAA 2C5RA 1OFIA 2DAMA 3MJ5A 2CRUA 2R46A 4KT0F 2LVOC 5FTJA 4KHPM 2L4FA 4DR2M 1TH4A 4S12A 4MB7A 2XFSA 5EXXA 4WW0A 2DVWB 2XZUA 3SATA 2Q2EB 3LQRA 3VLFB 3DFZA 2O01F 2DWNA 4L8RC 2RKOA 3LVWA 1VEJA 1N34M 3FTEA 3B74A 1YUBA 3U5ZB 1YE9A 3SAWA 2R65A 3FUVA 1PJSA 2QENA 3H4MA 3PVSA 3JR5A 1HT1E 1GL7A 2HCBA 4AG5A 2OQ4A 1IM2A 1WHCA 2O25A 4DR5M 5EP2A 2DZOB 1R2YA 4JI1M 4IBEA 1HNWM 4AKIA 4JV5M 4GMQA 1Z5AA 4BB9A 7CATA 3HY5A 5LMUM 1QANA 1RU3A 4NL4H 1GO5A 2FS1A 4HEOA 3T38A 2CUZA 2D7HA 1R5LA 2WSEF 2MJ5B 4M0DA 1J5EM 5ITUA 2EKKA 3AKZA 5EXPA 3SMSA 4BLCA 3KP0E 4NOOB 1HQYE 4RF1A 3HU1A 5GKNA 4Z8XA 2UXCM 3UZUA 4LFCM 4MGIE 3RFWA 3HWSA 1DGHB 2LBCA 2LXEA 2XEPA 5ITXA 5E26A 5EXTA 2KZSA 1NNJA 4JI4M 4FD2A 2C9OA 2DHRA 3VKGA 3PNYA 3GPXA 1QAQA 3SARA 2LWXA 3UK6A 1VDDA 3MHVC 4IBJA 5EP3A 4CHTB 2APLA 3J2PB 1IBKM 3AOEA 2AHMA 2LVNC 4YY3M 1T3TA 1UM8A 3WHKA 4DUYM 3IHPA 1GKIA 5DFLA 4A3VB 2X8AA 5JI3E 1GLNA 1V33A 2MROB 4KODA 2JY7A 4PCZA 3E4RA 4X66M 1IXSA 3FYCA 3V76A 2LHCA 3GP1A 1MN3A 1QQWA 4JYAM 1IFYA 3QYBA 1NO1A 3PNVA 3M6AA 1FJGM 1ZQ9A 4LCBA 5FTMA 4DV6M 2OO9A 1GABA 2F5SA 1IN8A 3DA1A 3FUXA 1DGBA 4L6V6 2QNJA 4FWDA 3R9XB 3TL4X 2CHVA 3M7GA 4HL4A 2HHHM 5JI2E 5FLXS 2KNAA 1IXZA 4DV4M 2CE7A 3I51A 1WJ7A 1IBMM 1S3SA 2F5PA 4B7GA 2ZAMA 3K9OA 5KQ8A 2C9CA 4AG6A 4GHLA 2BWBA 3HHWA 4HLQA 3E9SA 4KLNA 2WSFF 4IIWA 2VQFM 4R71A 2EA0A 1G59A 3BXWA 3C9PA 3U6PA 4B3TM 1F4IA 2K9DA 2I7NA 5EP1A 5FSWA 3HHYA 3SASA 1CUKA 4BBAA 1G8PA 2R4JA 4PD2A 5FTNA 5IWAM 3GLIB 1J09A 4AW4A 5KPTA 2G8LA 2RRUA 2DAEA 1LTMA 1OFHA 1PGYA 2V1CA 1QUTA 1DO2A 3KFUG 5EP4A 5C1BA 1C7YA 4XBOA 1Z6TA 3AV0A 3AOEC 4FW9A 3ZCBB 1OIPA 2VDBB 1N75A 3I4VA 3KP1E 1E94E 4G4RA 3J7BA 2CV2A 3CF0A 2DZNB 1ORYB 3FE3A 4QHSA 2K0BX 2ZBKB 3TQSA 3K92A 1E32A 1KYIA 4LJ4A 2R18A 4JI6M 3L27A 4CJ6A 3JAMS 3GPYA 2R0IA 8CATA 1IY1A 2EO2A 2GQFA 1SXJB 1IN6A 4NC6A 2CHQA 3FUTA 2O5RA 2HL7A 5ITRA 1K82A 3RGSA 5BPVA 1R4GA 1OIZA 3HX3A 3KOWE 1R7RA 4R3DA 3K8ZA 4AQYM 3GLGA 4DV0M 3U60B 1TGUA 4QOZC 1G3IA 4G4QA 3C3EA 4NXNM 4L78A 4DR7M 3FD9A 2UU9M 3T1YM 5IT9S 4LF4M 1BVSA 4WURA 4LJ6A 1G71A 1C1KA 5L8RF 5E6JA 3CTWB 3HJQA 4L4UA 3UMMA 1PM5A 1VEKA 4X65M 5DNYA 1E9RA 1JR3D 2MGWA 3QAUA 3SYLA 4OVZB 2L09A 2KNZA 3GQ3A 4QHTA 5F3WA 4LF9M 4B3RM 1IN5A 1Y8GA 2EUCA 2LVQD 1NJGA 2V6ZM 2Y0TA 5C18A 4GC5A 1N33M 2M5ZA 5IZ7D 4UN2B 4D82A 3GQ4A 4FCWA 4DR4M 4R7GA 2CV0A 2Z4SA 2JY5A 3A45A 1L2BA 2R44A 3T6PA 4NRVA 4IBBA 2JZ0A 5EJCA 1XMQM 3A46A 3U6QA 1NY5A 4MGYE 1XXHB 1GJTA 2EKFA 3GLFA 2JY8A 3K9PA 4I81A 2JZ1A 3KXEC 4IBIA 3GPUA 3PXGA 1GJSA 1HJPA 3U6OA 2FH0A 1XC8A 1K3WA 2DHYA 1SXJA 2QCUA 4LFAM 3NBXX 3DOAA 3M0EA 1TDHA 3GLHB 2LH0A 2D7GA 3D8BA 5DYGA 3TWLA 1HNZM 2G5GX 2Y20A 3NBIA 2HKJA 1PJTA 3ZQJA 2XSZA 3GRYA 1AIPC 2J5YA 3VKHA 3FKEA 2OPFA 2KA6B 3FUUA 4MH0E 1QYRA 1G4AE 2JXNA 2RGOA 4JI3M 3SYKA 1OTRA 3LVVA 4IBGA 2KNVA 4NRWA 4IJEA 1WGNA 2UUCM 3U61B 1Z5BA 2DWMA 1OQYA 5ITYA 4LRSA 3KSJA 1Q02A 4F2LA 3GRVA 3SC3A 3LQQA 3ZC7B 4GHAA 4QOSA 4XK8F 1IXRC 3E46A 4M0WA 3U5ZA 4AI6A 1QVRA 1D0LA 2YR0A 2KHHA 2WZJA 4G6ZA 4MGHA 1H6UA 2KZUA 3L2AA 3DZDA 1HR0M 3THGA 2Z4RA 4LF7M 3TWMA 3GLFE 5EQTA 3B89A 4M9ZA 4DR3M 4FCVA 4I4LA 3FTDA 3ILKA 1YSYA 3VDPA 2N35A 1XWIA 4CGYB 1I4WA 4D80A 4I5SA 5ITXE 1OAIA 1HQCA 5A2QS 1PJIA 1IY0A 3VK7A 2YFQA 3J27B 1T43A 4X62M 3HJ8A 3W0FA 3WHLA 3HU2A 2R62A 3LW5F 5IREB 2CV1A 1JB0F 2BWEA 2VIIA 3HZJA 4EIWA 2XLJA 1DGHA 1PRBA 4ANRA 2DAIA 3FRIA 3L29A 3LCVB 2DWLA 1GL6A 3B7NA 3RE8A 3HJSA 2DZLA 3LCUA 4RF0A 2HWJA 2KRUA 1IN4A 2LTUA 4GKKM 1ZMVA 3SHFA 3KW6A 4AKHA 2FE8A 4LF8M 3I01M 1DO0A 4LJAA 2E5LM 4CISA 3KDSE 4QNRA 2UUBM 2C99A 4IBDA 2ZANA 4Y28F 1A5TA 2H1RA
chains in the Genus database with same CATH topology
2HAKA 1NV8A 1VEKA 2LBCA 1VDLA 2MGWA 3BBZA 2KNZA 1Y8GA 2LVQD 4F1IA 2DKLA 4WP2A 4DBGB 4UN2B 2H5XA 2JUJA 2JY5A 4GEWA 2LVNC 3T6PA 1DV0A 3IHPA 1ZMWA 2JZ0A 5DFLA 2MROB 1V92A 2JP7A 2JY7A 2EKFA 1G41A 1VQ1A 1WIVA 1IXSA 1P3QQ 2JY8A 2JZ1A 3K9PA 1MN3A 1IFYA 1YLAA 1HJPA 2B3TA 3IECA 2DHYA 2OO9A 1WGLA 1HT2E 1UFZA 1OKSA 2DAGA 2QNJA 2JY6B 2ZTCA 2CP8A 5JI2E 2KNAA 2G3QA 2OOAA 1WJ7A 4Q7JA 1AIPC 1JR3E 3K9OA 1XXHE 1G4AE 2BWBA 2QHOB 2QSFX 1WR1B 1VEGA 1ZMUA 4R71A 1OTRA 1XB2B 1ZV1A 2LVPC 2CWBA 2KNVA 1F4IA 1QZEA 2K9DA 1WGNA 2DAKA 1CUKA 1OQYA 1Q02A 4F2LA 3GLHE 3GLGE 3E21A 3E46A 3FRHA 2OOBA 2KHHA 2WZJA 3F92A 2RRUA 2DAEA 1PGYA 1DO2A 2DNAA 2DAMA 1VG5A 1C7YA 2LVOC 3GLFE 2L4FA 3B89A 2DENA 1E94E 3FE3A 2K0BX 1OAIA 2EJSA 1KYIA 1T6OA 2L4EA 2R0IA 1TTEA 1T43A 1VEJA 3GLIE 2BWEA 1NV9A 2ZTDA 1HT1E 1SG9A 3FRIA 1R4GA 3LCVB 2DI0A 1IM2A 1WHCA 2O25A 1TR8A 2L2DA 2DZLA 3LCUA 1G3IA 2HWJA 3MMPA 1EFUB 2LTUA 2LVAA 1GO5A 1ZMVA 4HEOA 2MJ5B 1BVSA 4G3OA 1DO0A 2MR9A 2EKKA 2JNHA 3H4JA 1HQYE 1A5TA 2DAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAK A;  1NV8 A;  1VEK A;  2LBC A;  1VDL A;  2MGW A;  3BBZ A;  2KNZ A;  1Y8G A;  2LVQ D;  4F1I A;  2DKL A;  4WP2 A;  4DBG B;  4UN2 B;  2H5X A;  2JUJ A;  2JY5 A;  4GEW A;  2LVN C;  3T6P A;  1DV0 A;  3IHP A;  1ZMW A;  2JZ0 A;  5DFL A;  2MRO B;  1V92 A;  2JP7 A;  2JY7 A;  2EKF A;  1G41 A;  1VQ1 A;  1WIV A;  1IXS A;  1P3Q Q;  2JY8 A;  2JZ1 A;  3K9P A;  1MN3 A;  1IFY A;  1YLA A;  1HJP A;  2B3T A;  3IEC A;  2DHY A;  2OO9 A;  1WGL A;  1HT2 E;  1UFZ A;  1OKS A;  2DAG A;  2QNJ A;  2JY6 B;  2ZTC A;  2CP8 A;  5JI2 E;  2KNA A;  2G3Q A;  2OOA A;  1WJ7 A;  4Q7J A;  1AIP C;  1JR3 E;  3K9O A;  1XXH E;  1G4A E;  2BWB A;  2QHO B;  2QSF X;  1WR1 B;  1VEG A;  1ZMU A;  4R71 A;  1OTR A;  1XB2 B;  1ZV1 A;  2LVP C;  2CWB A;  2KNV A;  1F4I A;  1QZE A;  2K9D A;  1WGN A;  2DAK A;  1CUK A;  1OQY A;  1Q02 A;  4F2L A;  3GLH E;  3GLG E;  3E21 A;  3E46 A;  3FRH A;  2OOB A;  2KHH A;  2WZJ A;  3F92 A;  2RRU A;  2DAE A;  1PGY A;  1DO2 A;  2DNA A;  2DAM A;  1VG5 A;  1C7Y A;  2LVO C;  3GLF E;  2L4F A;  3B89 A;  2DEN A;  1E94 E;  3FE3 A;  2K0B X;  1OAI A;  2EJS A;  1KYI A;  1T6O A;  2L4E A;  2R0I A;  1TTE A;  1T43 A;  1VEJ A;  3GLI E;  2BWE A;  1NV9 A;  2ZTD A;  1HT1 E;  1SG9 A;  3FRI A;  1R4G A;  3LCV B;  2DI0 A;  1IM2 A;  1WHC A;  2O25 A;  1TR8 A;  2L2D A;  2DZL A;  3LCU A;  1G3I A;  2HWJ A;  3MMP A;  1EFU B;  2LTU A;  2LVA A;  1GO5 A;  1ZMV A;  4HEO A;  2MJ5 B;  1BVS A;  4G3O A;  1DO0 A;  2MR9 A;  2EKK A;  2JNH A;  3H4J A;  1HQY E;  1A5T A;  2DAI A; 
#chains in the Genus database with same CATH topology
 2HAK A;  1NV8 A;  1L2C A;  3KSX A;  3BOS A;  4PDG A;  1L1Z A;  1VDL A;  1IBL M;  2Z7J A;  3B9P A;  2YQZ A;  2WSC F;  3TPZ A;  4JI7 M;  3U6M A;  4F1I A;  4WP2 A;  4DBG B;  3HHZ A;  4G4O A;  2H5X A;  3FYD A;  1EIJ A;  4GEW A;  3CGW A;  3VDU A;  2CFO A;  4DUZ M;  1DV0 A;  4LGM A;  1ZMW A;  2I7P A;  3SMP A;  4D81 A;  3J81 S;  1V92 A;  4P16 A;  2JP7 A;  1XNR M;  4IBK A;  4JN6 A;  4DV7 M;  5ITQ A;  1G41 A;  3GQ5 A;  1QDR A;  1VQ1 A;  2K47 A;  1X37 A;  3GO8 A;  3T1H M;  4DR6 M;  1IY2 A;  1YLA A;  2CHG A;  3A98 B;  1OAO C;  1J7K A;  3IEC A;  1KSF X;  4LY6 A;  1I94 M;  5BR8 M;  3U6C A;  1WGL A;  2QPA A;  2D7E A;  2QP9 X;  4LF5 M;  4LF6 M;  4LJ8 A;  2JY6 B;  2FOI C;  3GLI A;  2ZTC A;  1K3X A;  2BNK A;  4LFB M;  4DV3 M;  4LGY A;  3J80 S;  1N32 M;  2J7O A;  2CEA A;  1XNQ M;  2V1U A;  3TE6 A;  4L16 A;  2QHO B;  2KDL A;  3FTC A;  4Z6Y A;  4DV2 M;  1WR1 B;  1VEG A;  3LMM A;  1ZMU A;  1IXS B;  2J7N A;  4GIT A;  1D2N A;  2JWS A;  2L6O A;  1D0K A;  2CWB A;  4MGK E;  3A42 A;  3FUW A;  2Z3X A;  2DWZ B;  1W5T A;  2DAK A;  1L1T A;  4P17 A;  2L7H A;  2UXD M;  4JI0 M;  4GKJ M;  3GLG E;  2YNM D;  3QWL A;  3SFZ A;  1N36 M;  2OOB A;  3UJN A;  4NXM M;  3K2L A;  3F92 A;  1NNU C;  2MH8 A;  3W0L B;  1TH2 A;  1MJG M;  1JQJ C;  1AUA A;  2XH9 A;  3KOX E;  2QQ8 A;  1QDT A;  2W82 A;  4LJ9 A;  1VG5 A;  4REZ A;  2VQE M;  1OJL A;  4DR1 M;  4K0K M;  4FVM A;  4GH9 A;  1L8Q A;  1NHG C;  3IG8 A;  3U60 A;  4JI2 M;  2DEN A;  3I4Y A;  4JXJ A;  5DYI A;  1NSF A;  4M9X A;  1N77 A;  5KPZ A;  3NWL A;  1PJJ A;  3K1J A;  4LZJ A;  3KOY E;  3HHX A;  2EJS A;  1N78 A;  1T6O A;  2L4E A;  3HU3 A;  4II7 A;  3W67 A;  3AJI B;  1DGF A;  3I04 M;  3C58 A;  3KS4 A;  3JR4 A;  4KO8 A;  3ZH9 B;  3GRU A;  1TTE A;  1WXQ A;  2UUA M;  1W5S A;  3GLI E;  1NY6 A;  4AZF A;  3GPP A;  4OX9 M;  2UXB M;  2BJW A;  2GNO A;  4GIP A;  1Q3C A;  3MK6 A;  1DGG A;  1NV9 A;  1E9S A;  2ZTD A;  2P5T A;  1TH3 A;  3CF6 E;  1SG9 A;  4GRI A;  2F5O A;  3AFH A;  4TUW A;  2A5Y B;  1FNN A;  1MU5 A;  2DI0 A;  4OVZ A;  1TR8 A;  2L2D A;  2QBY B;  5KQD A;  1Q3B A;  3J7A S;  2NQ8 C;  4I8O A;  2R4E A;  2F5N A;  1Z5C A;  3SBJ A;  2XF3 A;  1V34 A;  2L7I A;  3MMP A;  4GC9 A;  3KVW A;  1EFU B;  2LVA A;  3CF2 A;  3SAV A;  4DV1 M;  4PDI A;  4G3O A;  1ZAE A;  1NJF A;  2MR9 A;  1TDZ A;  1L2D A;  3KS8 A;  1MX0 A;  3QYE A;  2JNH A;  3U6E A;  1SXJ E;  2VF7 A;  4PT5 A;  3H4J A;  2XGN A;  4YHH M;  4QNM A;  3IG5 A;  2KRK A;  1LV7 A;  1JR3 A;  4RNA A;  1XXH A;  2JA2 A;  3UGJ A;  2DXI A;  4B3S M;  4G4N A;  2M60 A;  2X4A A;  1SXJ C;  5LMN M;  2F5Q A;  4CIZ A;  3BBZ A;  3B7Z A;  4B7F A;  5KPR A;  2LHG A;  4NSR A;  4X64 M;  3GLG B;  3U6D A;  2F4V M;  1QZM A;  3AL0 C;  2DKL A;  4IBC A;  2QZ4 A;  3GLH A;  1R2Z A;  2VF8 A;  2JUJ A;  1R6B X;  4FWH A;  2FNA A;  4LRT A;  1XHB A;  4IBF A;  3U6S A;  2XZF A;  3VFD A;  4LJ5 A;  4B7H A;  2BJV A;  1PJQ A;  1XMO M;  3KOZ E;  1NVM A;  4LG2 A;  3Q8X A;  4JI8 M;  1NHW C;  1WIV A;  1P3Q Q;  2R6F A;  3SAU A;  1D0M A;  4LZZ A;  4FCT A;  2C96 A;  2K6B A;  3PFI A;  3SHG B;  2B3T A;  2KW0 A;  5ITT A;  3U61 A;  4XGI A;  4OW0 A;  1QAO A;  4B08 A;  3EIH A;  4ITQ A;  2Y21 A;  4IJF A;  1HT2 E;  2RGH A;  1SXJ D;  4W5W A;  3D8L A;  4NSO B;  4MM3 B;  1UFZ A;  1OKS A;  2C98 A;  2DAG A;  3B7Q A;  3VK8 A;  2ZAO A;  1QUS A;  1TF0 B;  3RGP A;  4AKG A;  2CP8 A;  3OTO M;  2KEB A;  2QBY A;  3TWK A;  2G3Q A;  3W68 A;  4ZPX A;  3FTF A;  2OOA A;  4Q7J A;  3L26 A;  2R45 A;  1JR3 E;  4OU7 A;  1QAM A;  1XXH E;  2Y0Q A;  4B3M M;  2XSZ D;  4MGZ E;  2QSF X;  3GLF B;  4M9S A;  2XFT A;  3L28 A;  2FFJ A;  3T15 A;  5EXS A;  2LVP C;  1GVN A;  1XB2 B;  1ZV1 A;  2Z8Y M;  4FWG A;  4DV5 M;  2KXE A;  1QZE A;  3Q8G A;  3L25 A;  3HKP A;  1Q39 A;  3U6L A;  2X49 A;  4RKU F;  3HGI A;  3GLH E;  3AOG A;  1EE8 A;  1HNX M;  3R8F A;  5FTL A;  1IQP A;  3E21 A;  5FTK A;  4JI5 M;  3EIE A;  3FRH A;  3GRR A;  2ZM6 M;  5KO3 A;  2ERC A;  4LJ7 A;  3C3D A;  5H37 D;  2LNH C;  4L15 A;  1IN7 A;  1Z59 A;  1KFV A;  2DNA A;  2C5R A;  1OFI A;  2DAM A;  3MJ5 A;  2CRU A;  2R46 A;  4KT0 F;  2LVO C;  5FTJ A;  4KHP M;  2L4F A;  4DR2 M;  1TH4 A;  4S12 A;  4MB7 A;  2XFS A;  5EXX A;  4WW0 A;  2DVW B;  2XZU A;  3SAT A;  2Q2E B;  3LQR A;  3VLF B;  3DFZ A;  2O01 F;  2DWN A;  4L8R C;  2RKO A;  3LVW A;  1VEJ A;  1N34 M;  3FTE A;  3B74 A;  1YUB A;  3U5Z B;  1YE9 A;  3SAW A;  2R65 A;  3FUV A;  1PJS A;  2QEN A;  3H4M A;  3PVS A;  3JR5 A;  1HT1 E;  1GL7 A;  2HCB A;  4AG5 A;  2OQ4 A;  1IM2 A;  1WHC A;  2O25 A;  4DR5 M;  5EP2 A;  2DZO B;  1R2Y A;  4JI1 M;  4IBE A;  1HNW M;  4AKI A;  4JV5 M;  4GMQ A;  1Z5A A;  4BB9 A;  7CAT A;  3HY5 A;  5LMU M;  1QAN A;  1RU3 A;  4NL4 H;  1GO5 A;  2FS1 A;  4HEO A;  3T38 A;  2CUZ A;  2D7H A;  1R5L A;  2WSE F;  2MJ5 B;  4M0D A;  1J5E M;  5ITU A;  2EKK A;  3AKZ A;  5EXP A;  3SMS A;  4BLC A;  3KP0 E;  4NOO B;  1HQY E;  4RF1 A;  3HU1 A;  5GKN A;  4Z8X A;  2UXC M;  3UZU A;  4LFC M;  4MGI E;  3RFW A;  3HWS A;  1DGH B;  2LBC A;  2LXE A;  2XEP A;  5ITX A;  5E26 A;  5EXT A;  2KZS A;  1NNJ A;  4JI4 M;  4FD2 A;  2C9O A;  2DHR A;  3VKG A;  3PNY A;  3GPX A;  1QAQ A;  3SAR A;  2LWX A;  3UK6 A;  1VDD A;  3MHV C;  4IBJ A;  5EP3 A;  4CHT B;  2APL A;  3J2P B;  1IBK M;  3AOE A;  2AHM A;  2LVN C;  4YY3 M;  1T3T A;  1UM8 A;  3WHK A;  4DUY M;  3IHP A;  1GKI A;  5DFL A;  4A3V B;  2X8A A;  5JI3 E;  1GLN A;  1V33 A;  2MRO B;  4KOD A;  2JY7 A;  4PCZ A;  3E4R A;  4X66 M;  1IXS A;  3FYC A;  3V76 A;  2LHC A;  3GP1 A;  1MN3 A;  1QQW A;  4JYA M;  1IFY A;  3QYB A;  1NO1 A;  3PNV A;  3M6A A;  1FJG M;  1ZQ9 A;  4LCB A;  5FTM A;  4DV6 M;  2OO9 A;  1GAB A;  2F5S A;  1IN8 A;  3DA1 A;  3FUX A;  1DGB A;  4L6V 6;  2QNJ A;  4FWD A;  3R9X B;  3TL4 X;  2CHV A;  3M7G A;  4HL4 A;  2HHH M;  5JI2 E;  5FLX S;  2KNA A;  1IXZ A;  4DV4 M;  2CE7 A;  3I51 A;  1WJ7 A;  1IBM M;  1S3S A;  2F5P A;  4B7G A;  2ZAM A;  3K9O A;  5KQ8 A;  2C9C A;  4AG6 A;  4GHL A;  2BWB A;  3HHW A;  4HLQ A;  3E9S A;  4KLN A;  2WSF F;  4IIW A;  2VQF M;  4R71 A;  2EA0 A;  1G59 A;  3BXW A;  3C9P A;  3U6P A;  4B3T M;  1F4I A;  2K9D A;  2I7N A;  5EP1 A;  5FSW A;  3HHY A;  3SAS A;  1CUK A;  4BBA A;  1G8P A;  2R4J A;  4PD2 A;  5FTN A;  5IWA M;  3GLI B;  1J09 A;  4AW4 A;  5KPT A;  2G8L A;  2RRU A;  2DAE A;  1LTM A;  1OFH A;  1PGY A;  2V1C A;  1QUT A;  1DO2 A;  3KFU G;  5EP4 A;  5C1B A;  1C7Y A;  4XBO A;  1Z6T A;  3AV0 A;  3AOE C;  4FW9 A;  3ZCB B;  1OIP A;  2VDB B;  1N75 A;  3I4V A;  3KP1 E;  1E94 E;  4G4R A;  3J7B A;  2CV2 A;  3CF0 A;  2DZN B;  1ORY B;  3FE3 A;  4QHS A;  2K0B X;  2ZBK B;  3TQS A;  3K92 A;  1E32 A;  1KYI A;  4LJ4 A;  2R18 A;  4JI6 M;  3L27 A;  4CJ6 A;  3JAM S;  3GPY A;  2R0I A;  8CAT A;  1IY1 A;  2EO2 A;  2GQF A;  1SXJ B;  1IN6 A;  4NC6 A;  2CHQ A;  3FUT A;  2O5R A;  2HL7 A;  5ITR A;  1K82 A;  3RGS A;  5BPV A;  1R4G A;  1OIZ A;  3HX3 A;  3KOW E;  1R7R A;  4R3D A;  3K8Z A;  4AQY M;  3GLG A;  4DV0 M;  3U60 B;  1TGU A;  4QOZ C;  1G3I A;  4G4Q A;  3C3E A;  4NXN M;  4L78 A;  4DR7 M;  3FD9 A;  2UU9 M;  3T1Y M;  5IT9 S;  4LF4 M;  1BVS A;  4WUR A;  4LJ6 A;  1G71 A;  1C1K A;  5L8R F;  5E6J A;  3CTW B;  3HJQ A;  4L4U A;  3UMM A;  1PM5 A;  1VEK A;  4X65 M;  5DNY A;  1E9R A;  1JR3 D;  2MGW A;  3QAU A;  3SYL A;  4OVZ B;  2L09 A;  2KNZ A;  3GQ3 A;  4QHT A;  5F3W A;  4LF9 M;  4B3R M;  1IN5 A;  1Y8G A;  2EUC A;  2LVQ D;  1NJG A;  2V6Z M;  2Y0T A;  5C18 A;  4GC5 A;  1N33 M;  2M5Z A;  5IZ7 D;  4UN2 B;  4D82 A;  3GQ4 A;  4FCW A;  4DR4 M;  4R7G A;  2CV0 A;  2Z4S A;  2JY5 A;  3A45 A;  1L2B A;  2R44 A;  3T6P A;  4NRV A;  4IBB A;  2JZ0 A;  5EJC A;  1XMQ M;  3A46 A;  3U6Q A;  1NY5 A;  4MGY E;  1XXH B;  1GJT A;  2EKF A;  3GLF A;  2JY8 A;  3K9P A;  4I81 A;  2JZ1 A;  3KXE C;  4IBI A;  3GPU A;  3PXG A;  1GJS A;  1HJP A;  3U6O A;  2FH0 A;  1XC8 A;  1K3W A;  2DHY A;  1SXJ A;  2QCU A;  4LFA M;  3NBX X;  3DOA A;  3M0E A;  1TDH A;  3GLH B;  2LH0 A;  2D7G A;  3D8B A;  5DYG A;  3TWL A;  1HNZ M;  2G5G X;  2Y20 A;  3NBI A;  2HKJ A;  1PJT A;  3ZQJ A;  2XSZ A;  3GRY A;  1AIP C;  2J5Y A;  3VKH A;  3FKE A;  2OPF A;  2KA6 B;  3FUU A;  4MH0 E;  1QYR A;  1G4A E;  2JXN A;  2RGO A;  4JI3 M;  3SYK A;  1OTR A;  3LVV A;  4IBG A;  2KNV A;  4NRW A;  4IJE A;  1WGN A;  2UUC M;  3U61 B;  1Z5B A;  2DWM A;  1OQY A;  5ITY A;  4LRS A;  3KSJ A;  1Q02 A;  4F2L A;  3GRV A;  3SC3 A;  3LQQ A;  3ZC7 B;  4GHA A;  4QOS A;  4XK8 F;  1IXR C;  3E46 A;  4M0W A;  3U5Z A;  4AI6 A;  1QVR A;  1D0L A;  2YR0 A;  2KHH A;  2WZJ A;  4G6Z A;  4MGH A;  1H6U A;  2KZU A;  3L2A A;  3DZD A;  1HR0 M;  3THG A;  2Z4R A;  4LF7 M;  3TWM A;  3GLF E;  5EQT A;  3B89 A;  4M9Z A;  4DR3 M;  4FCV A;  4I4L A;  3FTD A;  3ILK A;  1YSY A;  3VDP A;  2N35 A;  1XWI A;  4CGY B;  1I4W A;  4D80 A;  4I5S A;  5ITX E;  1OAI A;  1HQC A;  5A2Q S;  1PJI A;  1IY0 A;  3VK7 A;  2YFQ A;  3J27 B;  1T43 A;  4X62 M;  3HJ8 A;  3W0F A;  3WHL A;  3HU2 A;  2R62 A;  3LW5 F;  5IRE B;  2CV1 A;  1JB0 F;  2BWE A;  2VII A;  3HZJ A;  4EIW A;  2XLJ A;  1DGH A;  1PRB A;  4ANR A;  2DAI A;  3FRI A;  3L29 A;  3LCV B;  2DWL A;  1GL6 A;  3B7N A;  3RE8 A;  3HJS A;  2DZL A;  3LCU A;  4RF0 A;  2HWJ A;  2KRU A;  1IN4 A;  2LTU A;  4GKK M;  1ZMV A;  3SHF A;  3KW6 A;  4AKH A;  2FE8 A;  4LF8 M;  3I01 M;  1DO0 A;  4LJA A;  2E5L M;  4CIS A;  3KDS E;  4QNR A;  2UUB M;  2C99 A;  4IBD A;  2ZAN A;  4Y28 F;  1A5T A;  2H1R A; 
#chains in the Genus database with same CATH homology
 2HAK A;  1NV8 A;  1VEK A;  2LBC A;  1VDL A;  2MGW A;  3BBZ A;  2KNZ A;  1Y8G A;  2LVQ D;  4F1I A;  2DKL A;  4WP2 A;  4DBG B;  4UN2 B;  2H5X A;  2JUJ A;  2JY5 A;  4GEW A;  2LVN C;  3T6P A;  1DV0 A;  3IHP A;  1ZMW A;  2JZ0 A;  5DFL A;  2MRO B;  1V92 A;  2JP7 A;  2JY7 A;  2EKF A;  1G41 A;  1VQ1 A;  1WIV A;  1IXS A;  1P3Q Q;  2JY8 A;  2JZ1 A;  3K9P A;  1MN3 A;  1IFY A;  1YLA A;  1HJP A;  2B3T A;  3IEC A;  2DHY A;  2OO9 A;  1WGL A;  1HT2 E;  1UFZ A;  1OKS A;  2DAG A;  2QNJ A;  2JY6 B;  2ZTC A;  2CP8 A;  5JI2 E;  2KNA A;  2G3Q A;  2OOA A;  1WJ7 A;  4Q7J A;  1AIP C;  1JR3 E;  3K9O A;  1XXH E;  1G4A E;  2BWB A;  2QHO B;  2QSF X;  1WR1 B;  1VEG A;  1ZMU A;  4R71 A;  1OTR A;  1XB2 B;  1ZV1 A;  2LVP C;  2CWB A;  2KNV A;  1F4I A;  1QZE A;  2K9D A;  1WGN A;  2DAK A;  1CUK A;  1OQY A;  1Q02 A;  4F2L A;  3GLH E;  3GLG E;  3E21 A;  3E46 A;  3FRH A;  2OOB A;  2KHH A;  2WZJ A;  3F92 A;  2RRU A;  2DAE A;  1PGY A;  1DO2 A;  2DNA A;  2DAM A;  1VG5 A;  1C7Y A;  2LVO C;  3GLF E;  2L4F A;  3B89 A;  2DEN A;  1E94 E;  3FE3 A;  2K0B X;  1OAI A;  2EJS A;  1KYI A;  1T6O A;  2L4E A;  2R0I A;  1TTE A;  1T43 A;  1VEJ A;  3GLI E;  2BWE A;  1NV9 A;  2ZTD A;  1HT1 E;  1SG9 A;  3FRI A;  1R4G A;  3LCV B;  2DI0 A;  1IM2 A;  1WHC A;  2O25 A;  1TR8 A;  2L2D A;  2DZL A;  3LCU A;  1G3I A;  2HWJ A;  3MMP A;  1EFU B;  2LTU A;  2LVA A;  1GO5 A;  1ZMV A;  4HEO A;  2MJ5 B;  1BVS A;  4G3O A;  1DO0 A;  2MR9 A;  2EKK A;  2JNH A;  3H4J A;  1HQY E;  1A5T A;  2DAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...