2OO9A

Crystal structure of the uba domain from human c-cbl ubiquitin ligase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL
publication title Structural basis for UBA-mediated dimerization of c-Cbl ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 13
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2oo9A00
1VQ1A 3LCUA 2K9DA 2KNZA 2G3QA 1WGLA 2DAMA 3GLHE 5JI2E 2JY7A 4HEOA 1HJPA 1P3QQ 4G3OA 2DAIA 2JUJA 3T6PA 2QNJA 1VDLA 1DV0A 2JY5A 4GEWA 3K9PA 1R4GA 2DKLA 2LVQD 1VEKA 2QHOB 2ZTDA 3GLIE 1EFUB 1VEJA 1WJ7A 2H5XA 2MR9A 2DHYA 1T6OA 2CP8A 1JR3E 2K0BX 2JZ1A 1ZMVA 2KHHA 2DENA 2LBCA 1DO0A 2WZJA 1TR8A 2LTUA 4R71A 1G41A 2DI0A 1Q02A 1IFYA 3FRHA 1GO5A 2L4EA 2RRUA 1OAIA 4F1IA 3FRIA 1G4AE 1WHCA 1XB2B 4DBGB 1WR1B 1V92A 2KNAA 1ZMWA 1OKSA 1QZEA 5DFLA 1G3IA 4F2LA 1SG9A 2OO9A 2LVPC 2CWBA 1DO2A 1IXSA 3B89A 2DAGA 3BBZA 3F92A 1T43A 2HAKA 4Q7JA 1YLAA 2MJ5B 2JP7A 1KYIA 2MROB 2R0IA 1CUKA 2L4FA 2EKKA 3FE3A 2OOAA 1Y8GA 2JNHA 3LCVB 2ZTCA 2JY8A 2HWJA 2MGWA 1HT1E 4WP2A 2LVAA 1XXHE 2DAEA 2L2DA 1E94E 2B3TA 4UN2B 1NV8A 3IECA 1PGYA 2BWBA 3GLFE 2LVNC 1ZMUA 2DZLA 2O25A 2JZ0A 1WGNA 1AIPC 1VEGA 3E21A 3GLGE 1TTEA 2KNVA 3K9OA 1OTRA 3E46A 2JY6B 1WIVA 1OQYA 2DNAA 1A5TA 1IM2A 1HT2E 1NV9A 2DAKA 1F4IA 1HQYE 1MN3A 2EKFA 2EJSA 2LVOC 1C7YA 2OOBA 3IHPA 1BVSA 1UFZA 2BWEA 3H4JA 3MMPA 1VG5A 1ZV1A 2QSFX
chains in the Genus database with same CATH superfamily
3FTCA 3A98B 5EXSA 3FUTA 3GPYA 1VQ1A 1K82A 1SXJE 2K9DA 1ZAEA 3QWLA 4DR7M 1XC8A 3T1YM 4FWDA 4XBOA 2XSZA 1WGLA 3GLGB 3KFUG 3GRUA 7CATA 1NY6A 5JI2E 4BLCA 4D81A 2JA2A 2JUJA 2G8LA 3T6PA 2P5TA 1QVRA 3I04M 1ZQ9A 2RKOA 1N33M 5FTLA 5KO3A 2ERCA 3GP1A 3U61B 2I7PA 1NJGA 1PRBA 1VEJA 5E6JA 2DHYA 2R4JA 4LGMA 3CF2A 4MH0E 1TH4A 4AZFA 3GLFA 1XXHB 5DNYA 3QAUA 3GPXA 1J5EM 5E26A 2K0BX 1GVNA 4B3SM 3Q8XA 2Y0QA 2CV2A 2L6OA 1J09A 4Z8XA 4P17A 2O01F 3TQSA 3K2LA 4GH9A 4GITA 4MGKE 4OVZA 4S12A 5FSWA 2CRUA 2M60A 2N35A 4I5SA 1IN5A 1IBMM 1OIZA 4FCVA 2UU9M 2Z8YM 3PVSA 2LHGA 1LV7A 3HWSA 1HNWM 2R46A 3CF6E 1XWIA 3FRIA 3GPPA 1GL7A 1GKIA 2J5YA 2LWXA 1V92A 4L4UA 4A3VB 5DFLA 3L29A 3WHLA 3HHXA 4F2LA 3JAMS 4LF8M 1QAQA 1IXSA 3CTWB 2UXBM 3CF0A 5A2QS 2DAGA 5F3WA 4R3DA 3F92A 2R6FA 4PD2A 1NY5A 4LZJA 3ZCBB 4GKKM 2MJ5B 2XGNA 3U6LA 4L15A 2V1UA 1QANA 1KYIA 4B7GA 1CUKA 3LQRA 4I81A 3C3EA 2R4EA 3J27B 3QYBA 4KLNA 3B7QA 1J7KA 1G71A 4DV7M 1KSFX 2JNHA 3LCVB 4L16A 2JY8A 1KFVA 3AFHA 3T38A 4M9XA 1R7RA 4DR1M 2HWJA 1XMQM 4LF6M 1JR3A 3B7ZA 4AKHA 2LNHC 1E32A 2XLJA 1GJSA 3T15A 2LVAA 3HHWA 4DR4M 3ZC7B 1E94E 4KT0F 2ZM6M 4Y28F 3U6OA 4IBBA 5C18A 4D82A 1LTMA 2CV1A 1PJSA 2BWBA 4AW4A 1Q3CA 3GLFE 4TUWA 2O25A 1WGNA 3E21A 5KPTA 4X66M 1TTEA 3W67A 3U6MA 3K9OA 2FOIC 2NQ8C 2UUBM 1JR3D 5IREB 1WIVA 3RGPA 3HJQA 2DNAA 4IBJA 1OJLA 1A5TA 3M7GA 4DUYM 3QYEA 1IM2A 4DR3M 2Y0TA 2XH9A 2DAKA 3HU2A 1HQYE 4NXNM 1L2CA 2F5QA 4IJFA 3W0FA 1QUTA 1NVMA 2VF8A 3H4MA 3KSJA 2UUAM 3UMMA 2CHQA 3IHPA 1BVSA 1PJTA 2BWEA 2XFTA 3E9SA 3MMPA 4HEOA 4BBAA 3GLGA 5EQTA 3TWMA 4B08A 3BOSA 5DYIA 2KNZA 3SAWA 3HHZA 4JI6M 1YE9A 1L2BA 3T1HM 3GLHE 1DGHB 3FUWA 3UK6A 4XK8F 1P3QQ 1IXZA 5EP2A 4G3OA 4JI2M 2DAIA 3LVWA 4EIWA 4DV3M 3J2PB 5KQ8A 2FH0A 3U6PA 2KRUA 1DV0A 3HU3A 4AKIA 1GL6A 3GQ5A 4HL4A 1R4GA 1R6BX 3D8LA 4MGYE 5ITTA 2R44A 2D7EA 2R18A 2R65A 1XXHA 4LJ4A 2Z3XA 4DV6M 1T3TA 2L7IA 4NOOB 3Q8GA 2H5XA 1WJ7A 4QOSA 1IXRC 1FJGM 1N32M 4LJ9A 3JR5A 1TDHA 1JR3E 1GABA 1SXJB 1IBLM 1ZMVA 1Z59A 2KHHA 2KZUA 4X65M 2LBCA 4P16A 3EIHA 5ITYA 4REZA 4AG6A 4R71A 3KOXE 1DGBA 5BPVA 1PJQA 2QPAA 4R7GA 1K3WA 3JR4A 1IY0A 1AUAA 4CIZA 4LJ8A 3I4VA 1D0KA 1XNQM 4MGIE 3SMSA 1OAIA 5H37D 3U60A 3FD9A 3GRVA 2R45A 1G4AE 2H1RA 1XB2B 4X62M 3ZH9B 2G5GX 3FTFA 1WR1B 3J7BA 1ZMWA 1QAOA 1QZEA 2QZ4A 3LVVA 1VDDA 3UGJA 4JI3M 4DV1M 4LFCM 3THGA 2OQ4A 1SG9A 1E9RA 1OIPA 2Z7JA 1QQWA 1G59A 1G8PA 2OO9A 3NBXX 4FWGA 4IJEA 1L8QA 4WURA 4KODA 3VK7A 4IBCA 2KRKA 5FTKA 1C1KA 2K47A 4LJ5A 3B89A 3UJNA 3BBZA 2XSZD 3WHKA 2XEPA 3SC3A 4G4OA 1T43A 1YLAA 2R0IA 3HY5A 2FFJA 2L4FA 2EKKA 4LRSA 3K1JA 3FE3A 2OOAA 2QP9X 1Y8GA 1IN4A 4G4RA 1Q39A 3GLIA 2Q2EB 1PM5A 4JI5M 2WSCF 2DZOB 3KSXA 3TWKA 4OX9M 5FTJA 5ITQA 4DV0M 5FTNA 4LRTA 1N75A 3FKEA 4LJAA 3PNVA 4WP2A 1QDTA 3K8ZA 3LMMA 2RGOA 4PT5A 1GJTA 4D80A 1EIJA 1XXHE 4M9ZA 2DAEA 1L1TA 2VF7A 4UN2B 1RU3A 4IBKA 1TDZA 1NV8A 1PGYA 3TE6A 3C3DA 5IWAM 2K6BA 3MJ5A 2C5RA 1HNZM 3HX3A 1MU5A 4LJ7A 3B9PA 4LF5M 3HU1A 3SHGB 2JY6B 3KP0E 2VQFM 3HGIA 3AKZA 4Z6YA 2XF3A 4MB7A 1D2NA 4IBIA 4M0DA 5ITUA 2GNOA 2DWNA 2HHHM 1MN3A 1EE8A 2LH0A 2EKFA 2E5LM 3U5ZA 3W0LB 2QQ8A 5JI3E 4LF9M 3AJIB 3B7NA 3AOEC 4LF4M 3KS8A 1UFZA 1W5SA 2OPFA 1Z5BA 1VG5A 1QUSA 3KP1E 4IIWA 4Q7JA 2L7HA 2QSFX 5FLXS 3HZJA 3GLFB 4JI7M 3LCUA 3IG8A 3ZQJA 4KHPM 4I8OA 2G3QA 5IZ7D 4G4QA 2JWSA 3J81S 1HJPA 2X4AA 1R2ZA 3FYDA 3GQ4A 1ORYB 2ZAMA 4OVZB 4JI1M 4RKUF 1W5TA 3I4YA 5ITRA 2QBYB 4L78A 4JI8M 1N77A 4FD2A 3SASA 2DKLA 2V6ZM 4BB9A 2LVQD 1TGUA 1VEKA 4OW0A 1MJGM 4FWHA 2ZTDA 3GLIE 1EFUB 1NNUC 2DWZB 4B3TM 3L28A 4LGYA 1Z5AA 3U6SA 2BNKA 5EP3A 2YQZA 1QDRA 4LJ6A 3VDPA 5GKNA 2UXCM 2CUZA 2DWLA 2UUCM 3AL0C 1NO1A 4RF1A 3A46A 1IXSB 1Q3BA 1TR8A 2LTUA 3GLHB 3V76A 4LG2A 2DI0A 5EJCA 5ITXA 3SMPA 5EP4A 1IFYA 2KXEA 4LFAM 3FRHA 3M6AA 3KXEC 1GO5A 4L6V6 1UM8A 5FTMA 1NHWC 3VK8A 3VDUA 3U61A 4B3RM 1NHGC 3U6EA 1IY1A 1HR0M 4DV2M 2HKJA 2KNAA 2RGHA 3NWLA 3EIEA 1IQPA 3KW6A 3SATA 1G3IA 2F5PA 2F4VM 4JYAM 2ZAOA 3SYLA 4QNMA 4GHLA 2CV0A 2LVPC 1DO2A 3MK6A 4B7HA 3AV0A 1WXQA 1YSYA 2XZUA 2MH8A 3U6DA 2KA6B 2VDBB 3SYKA 4AQYM 1N36M 2WSEF 4PDGA 4DV5M 2HAKA 3AOGA 2DZNB 3VKGA 2JP7A 2MROB 3OTOM 1JQJC 4YHHM 3VKHA 3FUUA 1I94M 4QHTA 2ZBKB 3HJ8A 1PJIA 4DV4M 2ZTCA 1QZMA 2V1CA 2CE7A 2HL7A 4JXJA 4NRVA 2XFSA 2F5SA 1NSFA 2A5YB 3GRRA 4YY3M 1V33A 4QOZC 4KO8A 3GQ3A 1DGGA 1TF0B 1YUBA 2B3TA 2CFOA 2Y20A 4II7A 4RNAA 3CGWA 1OFIA 3FUVA 4G4NA 4GC5A 3A45A 3L2AA 2LVNC 1X37A 3HHYA 2DZLA 3LW5F 3RE8A 2BJVA 2C96A 2LXEA 3TWLA 3GLGE 3R9XB 2KNVA 1NNJA 1FNNA 3E46A 3SAVA 3VFDA 3GO8A 4L8RC 5ITXE 1TH3A 2HCBA 1HT2E 1NV9A 3DOAA 4XGIA 2XZFA 1H6UA 2APLA 1F4IA 4M0WA 1XNRM 4LFBM 2EJSA 4IBFA 3RGSA 4NC6A 2Z4SA 3C9PA 2X49A 8CATA 1L1ZA 3NBIA 3SHFA 4GKJM 2FNAA 2OOBA 2X8AA 4PCZA 1HNXM 1PJJA 5IT9S 3H4JA 1N78A 3L25A 1Z5CA 1ZV1A 1QAMA 2EUCA 3W68A 3FTDA 3PFIA 4MGZE 3GPUA 2O5RA 4CJ6A 2DAMA 3PXGA 2JY7A 4WW0A 4ZPXA 4CISA 3KVWA 4DR5M 1IBKM 2QBYA 4NRWA 1D0LA 3E4RA 1MX0A 1E9SA 1VDLA 2QNJA 2ZANA 4PDIA 2GQFA 2JY5A 2AHMA 2DVWB 1GLNA 1IN8A 2YNMD 3K9PA 4GEWA 4AKGA 4NL4H 2F5NA 3J7AS 3U60B 2QHOB 3MHVC 4W5WA 3M0EA 1TH2A 5LMUM 2MR9A 2KW0A 3KOZE 1QYRA 4DUZM 1T6OA 2L09A 4JN6A 2EA0A 1N34M 2CP8A 5EXTA 3GLHA 4NSOB 4DR2M 4RF0A 2VQEM 1I4WA 1IN7A 2JZ1A 2J7NA 2DENA 1XHBA 2M5ZA 3A42A 4FVMA 1DGHA 3PNYA 4DR6M 2WZJA 1DO0A 2CHVA 2WSFF 3B74A 2DXIA 2Z4RA 1G41A 3DA1A 3GRYA 3KOWE 4CHTB 4B7FA 1Q02A 1DGFA 3AOEA 3UZUA 4FCTA 2CHGA 4GMQA 2L4EA 1K3XA 3C58A 3IG5A 3SFZA 2RRUA 1SXJC 2Y21A 4CGYB 4JI4M 3TPZA 2QCUA 2YR0A 4ANRA 4F1IA 4OU7A 3I51A 1WHCA 2FS1A 3RFWA 3KDSE 3DZDA 3DFZA 1NJFA 4DBGB 3GLIB 5KPRA 1OKSA 3K92A 1SXJA 1IY2A 4HLQA 2D7HA 2FE8A 2J7OA 5KQDA 3KS4A 2C99A 2DWMA 4K0KM 2CWBA 4JV5M 2EO2A 5C1BA 4FW9A 5DYGA 1IN6A 2I7NA 3VLFB 4LF7M 3ILKA 3SARA 3U6QA 3U6CA 4X64M 2LHCA 3SAUA 4GC9A 1JB0F 1HQCA 3KOYE 2QENA 3J80S 3FTEA 4AI6A 5EP1A 1S3SA 2CEAA 4GIPA 3BXWA 2KDLA 4M9SA 4MM3B 4MGHA 5EXPA 1OFHA 4LCBA 1XMOM 1SXJD 1OAOC 2MGWA 1L2DA 5L8RF 1HT1E 1R2YA 2C98A 1R5LA 4G6ZA 4IBGA 4B3MM 4NSRA 1D0MA 2C9CA 3FUXA 1Z6TA 2L2DA 3U5ZB 1V34A 4IBDA 4LY6A 2VIIA 3IECA 5KPZA 4IBEA 3SBJA 2R62A 2KEBA 1ZMUA 2D7GA 3LQQA 2JZ0A 1AIPC 1VEGA 5EXXA 3FYCA 2C9OA 2DHRA 2F5OA 4GHAA 1OTRA 4FCWA 4I4LA 2UXDM 2KZSA 4LZZA 1OQYA 2BJWA 3TL4X 5LMNM 4NXMM 3L26A 2W82A 4QHSA 3HKPA 4JI0M 2YFQA 4ITQA 5BR8M 4AG5A 4GRIA 4QNRA 3I01M 3L27A 2LVOC 1C7YA 3R8FA 3D8BA 3HJSA 2JXNA
chains in the Genus database with same CATH topology
1VQ1A 3LCUA 2K9DA 2KNZA 2G3QA 1WGLA 2DAMA 3GLHE 5JI2E 2JY7A 4HEOA 1HJPA 1P3QQ 4G3OA 2DAIA 2JUJA 3T6PA 2QNJA 1VDLA 1DV0A 2JY5A 4GEWA 3K9PA 1R4GA 2DKLA 2LVQD 1VEKA 2QHOB 2ZTDA 3GLIE 1EFUB 1VEJA 1WJ7A 2H5XA 2MR9A 2DHYA 1T6OA 2CP8A 1JR3E 2K0BX 2JZ1A 1ZMVA 2KHHA 2DENA 2LBCA 1DO0A 2WZJA 1TR8A 2LTUA 4R71A 1G41A 2DI0A 1Q02A 1IFYA 3FRHA 1GO5A 2L4EA 2RRUA 1OAIA 4F1IA 3FRIA 1G4AE 1WHCA 1XB2B 4DBGB 1WR1B 1V92A 2KNAA 1ZMWA 1OKSA 1QZEA 5DFLA 1G3IA 4F2LA 1SG9A 2OO9A 2LVPC 2CWBA 1DO2A 1IXSA 3B89A 2DAGA 3BBZA 3F92A 1T43A 2HAKA 4Q7JA 1YLAA 2MJ5B 2JP7A 1KYIA 2MROB 2R0IA 1CUKA 2L4FA 2EKKA 3FE3A 2OOAA 1Y8GA 2JNHA 3LCVB 2ZTCA 2JY8A 2HWJA 2MGWA 1HT1E 4WP2A 2LVAA 1XXHE 2DAEA 2L2DA 1E94E 2B3TA 4UN2B 1NV8A 3IECA 1PGYA 2BWBA 3GLFE 2LVNC 1ZMUA 2DZLA 2O25A 2JZ0A 1WGNA 1AIPC 1VEGA 3E21A 3GLGE 1TTEA 2KNVA 3K9OA 1OTRA 3E46A 2JY6B 1WIVA 1OQYA 2DNAA 1A5TA 1IM2A 1HT2E 1NV9A 2DAKA 1F4IA 1HQYE 1MN3A 2EKFA 2EJSA 2LVOC 1C7YA 2OOBA 3IHPA 1BVSA 1UFZA 2BWEA 3H4JA 3MMPA 1VG5A 1ZV1A 2QSFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ1 A;  3LCU A;  2K9D A;  2KNZ A;  2G3Q A;  1WGL A;  2DAM A;  3GLH E;  5JI2 E;  2JY7 A;  4HEO A;  1HJP A;  1P3Q Q;  4G3O A;  2DAI A;  2JUJ A;  3T6P A;  2QNJ A;  1VDL A;  1DV0 A;  2JY5 A;  4GEW A;  3K9P A;  1R4G A;  2DKL A;  2LVQ D;  1VEK A;  2QHO B;  2ZTD A;  3GLI E;  1EFU B;  1VEJ A;  1WJ7 A;  2H5X A;  2MR9 A;  2DHY A;  1T6O A;  2CP8 A;  1JR3 E;  2K0B X;  2JZ1 A;  1ZMV A;  2KHH A;  2DEN A;  2LBC A;  1DO0 A;  2WZJ A;  1TR8 A;  2LTU A;  4R71 A;  1G41 A;  2DI0 A;  1Q02 A;  1IFY A;  3FRH A;  1GO5 A;  2L4E A;  2RRU A;  1OAI A;  4F1I A;  3FRI A;  1G4A E;  1WHC A;  1XB2 B;  4DBG B;  1WR1 B;  1V92 A;  2KNA A;  1ZMW A;  1OKS A;  1QZE A;  5DFL A;  1G3I A;  4F2L A;  1SG9 A;  2OO9 A;  2LVP C;  2CWB A;  1DO2 A;  1IXS A;  3B89 A;  2DAG A;  3BBZ A;  3F92 A;  1T43 A;  2HAK A;  4Q7J A;  1YLA A;  2MJ5 B;  2JP7 A;  1KYI A;  2MRO B;  2R0I A;  1CUK A;  2L4F A;  2EKK A;  3FE3 A;  2OOA A;  1Y8G A;  2JNH A;  3LCV B;  2ZTC A;  2JY8 A;  2HWJ A;  2MGW A;  1HT1 E;  4WP2 A;  2LVA A;  1XXH E;  2DAE A;  2L2D A;  1E94 E;  2B3T A;  4UN2 B;  1NV8 A;  3IEC A;  1PGY A;  2BWB A;  3GLF E;  2LVN C;  1ZMU A;  2DZL A;  2O25 A;  2JZ0 A;  1WGN A;  1AIP C;  1VEG A;  3E21 A;  3GLG E;  1TTE A;  2KNV A;  3K9O A;  1OTR A;  3E46 A;  2JY6 B;  1WIV A;  1OQY A;  2DNA A;  1A5T A;  1IM2 A;  1HT2 E;  1NV9 A;  2DAK A;  1F4I A;  1HQY E;  1MN3 A;  2EKF A;  2EJS A;  2LVO C;  1C7Y A;  2OOB A;  3IHP A;  1BVS A;  1UFZ A;  2BWE A;  3H4J A;  3MMP A;  1VG5 A;  1ZV1 A;  2QSF X; 
#chains in the Genus database with same CATH topology
 3FTC A;  3A98 B;  5EXS A;  3FUT A;  3GPY A;  1VQ1 A;  1K82 A;  1SXJ E;  2K9D A;  1ZAE A;  3QWL A;  4DR7 M;  1XC8 A;  3T1Y M;  4FWD A;  4XBO A;  2XSZ A;  1WGL A;  3GLG B;  3KFU G;  3GRU A;  7CAT A;  1NY6 A;  5JI2 E;  4BLC A;  4D81 A;  2JA2 A;  2JUJ A;  2G8L A;  3T6P A;  2P5T A;  1QVR A;  3I04 M;  1ZQ9 A;  2RKO A;  1N33 M;  5FTL A;  5KO3 A;  2ERC A;  3GP1 A;  3U61 B;  2I7P A;  1NJG A;  1PRB A;  1VEJ A;  5E6J A;  2DHY A;  2R4J A;  4LGM A;  3CF2 A;  4MH0 E;  1TH4 A;  4AZF A;  3GLF A;  1XXH B;  5DNY A;  3QAU A;  3GPX A;  1J5E M;  5E26 A;  2K0B X;  1GVN A;  4B3S M;  3Q8X A;  2Y0Q A;  2CV2 A;  2L6O A;  1J09 A;  4Z8X A;  4P17 A;  2O01 F;  3TQS A;  3K2L A;  4GH9 A;  4GIT A;  4MGK E;  4OVZ A;  4S12 A;  5FSW A;  2CRU A;  2M60 A;  2N35 A;  4I5S A;  1IN5 A;  1IBM M;  1OIZ A;  4FCV A;  2UU9 M;  2Z8Y M;  3PVS A;  2LHG A;  1LV7 A;  3HWS A;  1HNW M;  2R46 A;  3CF6 E;  1XWI A;  3FRI A;  3GPP A;  1GL7 A;  1GKI A;  2J5Y A;  2LWX A;  1V92 A;  4L4U A;  4A3V B;  5DFL A;  3L29 A;  3WHL A;  3HHX A;  4F2L A;  3JAM S;  4LF8 M;  1QAQ A;  1IXS A;  3CTW B;  2UXB M;  3CF0 A;  5A2Q S;  2DAG A;  5F3W A;  4R3D A;  3F92 A;  2R6F A;  4PD2 A;  1NY5 A;  4LZJ A;  3ZCB B;  4GKK M;  2MJ5 B;  2XGN A;  3U6L A;  4L15 A;  2V1U A;  1QAN A;  1KYI A;  4B7G A;  1CUK A;  3LQR A;  4I81 A;  3C3E A;  2R4E A;  3J27 B;  3QYB A;  4KLN A;  3B7Q A;  1J7K A;  1G71 A;  4DV7 M;  1KSF X;  2JNH A;  3LCV B;  4L16 A;  2JY8 A;  1KFV A;  3AFH A;  3T38 A;  4M9X A;  1R7R A;  4DR1 M;  2HWJ A;  1XMQ M;  4LF6 M;  1JR3 A;  3B7Z A;  4AKH A;  2LNH C;  1E32 A;  2XLJ A;  1GJS A;  3T15 A;  2LVA A;  3HHW A;  4DR4 M;  3ZC7 B;  1E94 E;  4KT0 F;  2ZM6 M;  4Y28 F;  3U6O A;  4IBB A;  5C18 A;  4D82 A;  1LTM A;  2CV1 A;  1PJS A;  2BWB A;  4AW4 A;  1Q3C A;  3GLF E;  4TUW A;  2O25 A;  1WGN A;  3E21 A;  5KPT A;  4X66 M;  1TTE A;  3W67 A;  3U6M A;  3K9O A;  2FOI C;  2NQ8 C;  2UUB M;  1JR3 D;  5IRE B;  1WIV A;  3RGP A;  3HJQ A;  2DNA A;  4IBJ A;  1OJL A;  1A5T A;  3M7G A;  4DUY M;  3QYE A;  1IM2 A;  4DR3 M;  2Y0T A;  2XH9 A;  2DAK A;  3HU2 A;  1HQY E;  4NXN M;  1L2C A;  2F5Q A;  4IJF A;  3W0F A;  1QUT A;  1NVM A;  2VF8 A;  3H4M A;  3KSJ A;  2UUA M;  3UMM A;  2CHQ A;  3IHP A;  1BVS A;  1PJT A;  2BWE A;  2XFT A;  3E9S A;  3MMP A;  4HEO A;  4BBA A;  3GLG A;  5EQT A;  3TWM A;  4B08 A;  3BOS A;  5DYI A;  2KNZ A;  3SAW A;  3HHZ A;  4JI6 M;  1YE9 A;  1L2B A;  3T1H M;  3GLH E;  1DGH B;  3FUW A;  3UK6 A;  4XK8 F;  1P3Q Q;  1IXZ A;  5EP2 A;  4G3O A;  4JI2 M;  2DAI A;  3LVW A;  4EIW A;  4DV3 M;  3J2P B;  5KQ8 A;  2FH0 A;  3U6P A;  2KRU A;  1DV0 A;  3HU3 A;  4AKI A;  1GL6 A;  3GQ5 A;  4HL4 A;  1R4G A;  1R6B X;  3D8L A;  4MGY E;  5ITT A;  2R44 A;  2D7E A;  2R18 A;  2R65 A;  1XXH A;  4LJ4 A;  2Z3X A;  4DV6 M;  1T3T A;  2L7I A;  4NOO B;  3Q8G A;  2H5X A;  1WJ7 A;  4QOS A;  1IXR C;  1FJG M;  1N32 M;  4LJ9 A;  3JR5 A;  1TDH A;  1JR3 E;  1GAB A;  1SXJ B;  1IBL M;  1ZMV A;  1Z59 A;  2KHH A;  2KZU A;  4X65 M;  2LBC A;  4P16 A;  3EIH A;  5ITY A;  4REZ A;  4AG6 A;  4R71 A;  3KOX E;  1DGB A;  5BPV A;  1PJQ A;  2QPA A;  4R7G A;  1K3W A;  3JR4 A;  1IY0 A;  1AUA A;  4CIZ A;  4LJ8 A;  3I4V A;  1D0K A;  1XNQ M;  4MGI E;  3SMS A;  1OAI A;  5H37 D;  3U60 A;  3FD9 A;  3GRV A;  2R45 A;  1G4A E;  2H1R A;  1XB2 B;  4X62 M;  3ZH9 B;  2G5G X;  3FTF A;  1WR1 B;  3J7B A;  1ZMW A;  1QAO A;  1QZE A;  2QZ4 A;  3LVV A;  1VDD A;  3UGJ A;  4JI3 M;  4DV1 M;  4LFC M;  3THG A;  2OQ4 A;  1SG9 A;  1E9R A;  1OIP A;  2Z7J A;  1QQW A;  1G59 A;  1G8P A;  2OO9 A;  3NBX X;  4FWG A;  4IJE A;  1L8Q A;  4WUR A;  4KOD A;  3VK7 A;  4IBC A;  2KRK A;  5FTK A;  1C1K A;  2K47 A;  4LJ5 A;  3B89 A;  3UJN A;  3BBZ A;  2XSZ D;  3WHK A;  2XEP A;  3SC3 A;  4G4O A;  1T43 A;  1YLA A;  2R0I A;  3HY5 A;  2FFJ A;  2L4F A;  2EKK A;  4LRS A;  3K1J A;  3FE3 A;  2OOA A;  2QP9 X;  1Y8G A;  1IN4 A;  4G4R A;  1Q39 A;  3GLI A;  2Q2E B;  1PM5 A;  4JI5 M;  2WSC F;  2DZO B;  3KSX A;  3TWK A;  4OX9 M;  5FTJ A;  5ITQ A;  4DV0 M;  5FTN A;  4LRT A;  1N75 A;  3FKE A;  4LJA A;  3PNV A;  4WP2 A;  1QDT A;  3K8Z A;  3LMM A;  2RGO A;  4PT5 A;  1GJT A;  4D80 A;  1EIJ A;  1XXH E;  4M9Z A;  2DAE A;  1L1T A;  2VF7 A;  4UN2 B;  1RU3 A;  4IBK A;  1TDZ A;  1NV8 A;  1PGY A;  3TE6 A;  3C3D A;  5IWA M;  2K6B A;  3MJ5 A;  2C5R A;  1HNZ M;  3HX3 A;  1MU5 A;  4LJ7 A;  3B9P A;  4LF5 M;  3HU1 A;  3SHG B;  2JY6 B;  3KP0 E;  2VQF M;  3HGI A;  3AKZ A;  4Z6Y A;  2XF3 A;  4MB7 A;  1D2N A;  4IBI A;  4M0D A;  5ITU A;  2GNO A;  2DWN A;  2HHH M;  1MN3 A;  1EE8 A;  2LH0 A;  2EKF A;  2E5L M;  3U5Z A;  3W0L B;  2QQ8 A;  5JI3 E;  4LF9 M;  3AJI B;  3B7N A;  3AOE C;  4LF4 M;  3KS8 A;  1UFZ A;  1W5S A;  2OPF A;  1Z5B A;  1VG5 A;  1QUS A;  3KP1 E;  4IIW A;  4Q7J A;  2L7H A;  2QSF X;  5FLX S;  3HZJ A;  3GLF B;  4JI7 M;  3LCU A;  3IG8 A;  3ZQJ A;  4KHP M;  4I8O A;  2G3Q A;  5IZ7 D;  4G4Q A;  2JWS A;  3J81 S;  1HJP A;  2X4A A;  1R2Z A;  3FYD A;  3GQ4 A;  1ORY B;  2ZAM A;  4OVZ B;  4JI1 M;  4RKU F;  1W5T A;  3I4Y A;  5ITR A;  2QBY B;  4L78 A;  4JI8 M;  1N77 A;  4FD2 A;  3SAS A;  2DKL A;  2V6Z M;  4BB9 A;  2LVQ D;  1TGU A;  1VEK A;  4OW0 A;  1MJG M;  4FWH A;  2ZTD A;  3GLI E;  1EFU B;  1NNU C;  2DWZ B;  4B3T M;  3L28 A;  4LGY A;  1Z5A A;  3U6S A;  2BNK A;  5EP3 A;  2YQZ A;  1QDR A;  4LJ6 A;  3VDP A;  5GKN A;  2UXC M;  2CUZ A;  2DWL A;  2UUC M;  3AL0 C;  1NO1 A;  4RF1 A;  3A46 A;  1IXS B;  1Q3B A;  1TR8 A;  2LTU A;  3GLH B;  3V76 A;  4LG2 A;  2DI0 A;  5EJC A;  5ITX A;  3SMP A;  5EP4 A;  1IFY A;  2KXE A;  4LFA M;  3FRH A;  3M6A A;  3KXE C;  1GO5 A;  4L6V 6;  1UM8 A;  5FTM A;  1NHW C;  3VK8 A;  3VDU A;  3U61 A;  4B3R M;  1NHG C;  3U6E A;  1IY1 A;  1HR0 M;  4DV2 M;  2HKJ A;  2KNA A;  2RGH A;  3NWL A;  3EIE A;  1IQP A;  3KW6 A;  3SAT A;  1G3I A;  2F5P A;  2F4V M;  4JYA M;  2ZAO A;  3SYL A;  4QNM A;  4GHL A;  2CV0 A;  2LVP C;  1DO2 A;  3MK6 A;  4B7H A;  3AV0 A;  1WXQ A;  1YSY A;  2XZU A;  2MH8 A;  3U6D A;  2KA6 B;  2VDB B;  3SYK A;  4AQY M;  1N36 M;  2WSE F;  4PDG A;  4DV5 M;  2HAK A;  3AOG A;  2DZN B;  3VKG A;  2JP7 A;  2MRO B;  3OTO M;  1JQJ C;  4YHH M;  3VKH A;  3FUU A;  1I94 M;  4QHT A;  2ZBK B;  3HJ8 A;  1PJI A;  4DV4 M;  2ZTC A;  1QZM A;  2V1C A;  2CE7 A;  2HL7 A;  4JXJ A;  4NRV A;  2XFS A;  2F5S A;  1NSF A;  2A5Y B;  3GRR A;  4YY3 M;  1V33 A;  4QOZ C;  4KO8 A;  3GQ3 A;  1DGG A;  1TF0 B;  1YUB A;  2B3T A;  2CFO A;  2Y20 A;  4II7 A;  4RNA A;  3CGW A;  1OFI A;  3FUV A;  4G4N A;  4GC5 A;  3A45 A;  3L2A A;  2LVN C;  1X37 A;  3HHY A;  2DZL A;  3LW5 F;  3RE8 A;  2BJV A;  2C96 A;  2LXE A;  3TWL A;  3GLG E;  3R9X B;  2KNV A;  1NNJ A;  1FNN A;  3E46 A;  3SAV A;  3VFD A;  3GO8 A;  4L8R C;  5ITX E;  1TH3 A;  2HCB A;  1HT2 E;  1NV9 A;  3DOA A;  4XGI A;  2XZF A;  1H6U A;  2APL A;  1F4I A;  4M0W A;  1XNR M;  4LFB M;  2EJS A;  4IBF A;  3RGS A;  4NC6 A;  2Z4S A;  3C9P A;  2X49 A;  8CAT A;  1L1Z A;  3NBI A;  3SHF A;  4GKJ M;  2FNA A;  2OOB A;  2X8A A;  4PCZ A;  1HNX M;  1PJJ A;  5IT9 S;  3H4J A;  1N78 A;  3L25 A;  1Z5C A;  1ZV1 A;  1QAM A;  2EUC A;  3W68 A;  3FTD A;  3PFI A;  4MGZ E;  3GPU A;  2O5R A;  4CJ6 A;  2DAM A;  3PXG A;  2JY7 A;  4WW0 A;  4ZPX A;  4CIS A;  3KVW A;  4DR5 M;  1IBK M;  2QBY A;  4NRW A;  1D0L A;  3E4R A;  1MX0 A;  1E9S A;  1VDL A;  2QNJ A;  2ZAN A;  4PDI A;  2GQF A;  2JY5 A;  2AHM A;  2DVW B;  1GLN A;  1IN8 A;  2YNM D;  3K9P A;  4GEW A;  4AKG A;  4NL4 H;  2F5N A;  3J7A S;  3U60 B;  2QHO B;  3MHV C;  4W5W A;  3M0E A;  1TH2 A;  5LMU M;  2MR9 A;  2KW0 A;  3KOZ E;  1QYR A;  4DUZ M;  1T6O A;  2L09 A;  4JN6 A;  2EA0 A;  1N34 M;  2CP8 A;  5EXT A;  3GLH A;  4NSO B;  4DR2 M;  4RF0 A;  2VQE M;  1I4W A;  1IN7 A;  2JZ1 A;  2J7N A;  2DEN A;  1XHB A;  2M5Z A;  3A42 A;  4FVM A;  1DGH A;  3PNY A;  4DR6 M;  2WZJ A;  1DO0 A;  2CHV A;  2WSF F;  3B74 A;  2DXI A;  2Z4R A;  1G41 A;  3DA1 A;  3GRY A;  3KOW E;  4CHT B;  4B7F A;  1Q02 A;  1DGF A;  3AOE A;  3UZU A;  4FCT A;  2CHG A;  4GMQ A;  2L4E A;  1K3X A;  3C58 A;  3IG5 A;  3SFZ A;  2RRU A;  1SXJ C;  2Y21 A;  4CGY B;  4JI4 M;  3TPZ A;  2QCU A;  2YR0 A;  4ANR A;  4F1I A;  4OU7 A;  3I51 A;  1WHC A;  2FS1 A;  3RFW A;  3KDS E;  3DZD A;  3DFZ A;  1NJF A;  4DBG B;  3GLI B;  5KPR A;  1OKS A;  3K92 A;  1SXJ A;  1IY2 A;  4HLQ A;  2D7H A;  2FE8 A;  2J7O A;  5KQD A;  3KS4 A;  2C99 A;  2DWM A;  4K0K M;  2CWB A;  4JV5 M;  2EO2 A;  5C1B A;  4FW9 A;  5DYG A;  1IN6 A;  2I7N A;  3VLF B;  4LF7 M;  3ILK A;  3SAR A;  3U6Q A;  3U6C A;  4X64 M;  2LHC A;  3SAU A;  4GC9 A;  1JB0 F;  1HQC A;  3KOY E;  2QEN A;  3J80 S;  3FTE A;  4AI6 A;  5EP1 A;  1S3S A;  2CEA A;  4GIP A;  3BXW A;  2KDL A;  4M9S A;  4MM3 B;  4MGH A;  5EXP A;  1OFH A;  4LCB A;  1XMO M;  1SXJ D;  1OAO C;  2MGW A;  1L2D A;  5L8R F;  1HT1 E;  1R2Y A;  2C98 A;  1R5L A;  4G6Z A;  4IBG A;  4B3M M;  4NSR A;  1D0M A;  2C9C A;  3FUX A;  1Z6T A;  2L2D A;  3U5Z B;  1V34 A;  4IBD A;  4LY6 A;  2VII A;  3IEC A;  5KPZ A;  4IBE A;  3SBJ A;  2R62 A;  2KEB A;  1ZMU A;  2D7G A;  3LQQ A;  2JZ0 A;  1AIP C;  1VEG A;  5EXX A;  3FYC A;  2C9O A;  2DHR A;  2F5O A;  4GHA A;  1OTR A;  4FCW A;  4I4L A;  2UXD M;  2KZS A;  4LZZ A;  1OQY A;  2BJW A;  3TL4 X;  5LMN M;  4NXM M;  3L26 A;  2W82 A;  4QHS A;  3HKP A;  4JI0 M;  2YFQ A;  4ITQ A;  5BR8 M;  4AG5 A;  4GRI A;  4QNR A;  3I01 M;  3L27 A;  2LVO C;  1C7Y A;  3R8F A;  3D8B A;  3HJS A;  2JXN A; 
#chains in the Genus database with same CATH homology
 1VQ1 A;  3LCU A;  2K9D A;  2KNZ A;  2G3Q A;  1WGL A;  2DAM A;  3GLH E;  5JI2 E;  2JY7 A;  4HEO A;  1HJP A;  1P3Q Q;  4G3O A;  2DAI A;  2JUJ A;  3T6P A;  2QNJ A;  1VDL A;  1DV0 A;  2JY5 A;  4GEW A;  3K9P A;  1R4G A;  2DKL A;  2LVQ D;  1VEK A;  2QHO B;  2ZTD A;  3GLI E;  1EFU B;  1VEJ A;  1WJ7 A;  2H5X A;  2MR9 A;  2DHY A;  1T6O A;  2CP8 A;  1JR3 E;  2K0B X;  2JZ1 A;  1ZMV A;  2KHH A;  2DEN A;  2LBC A;  1DO0 A;  2WZJ A;  1TR8 A;  2LTU A;  4R71 A;  1G41 A;  2DI0 A;  1Q02 A;  1IFY A;  3FRH A;  1GO5 A;  2L4E A;  2RRU A;  1OAI A;  4F1I A;  3FRI A;  1G4A E;  1WHC A;  1XB2 B;  4DBG B;  1WR1 B;  1V92 A;  2KNA A;  1ZMW A;  1OKS A;  1QZE A;  5DFL A;  1G3I A;  4F2L A;  1SG9 A;  2OO9 A;  2LVP C;  2CWB A;  1DO2 A;  1IXS A;  3B89 A;  2DAG A;  3BBZ A;  3F92 A;  1T43 A;  2HAK A;  4Q7J A;  1YLA A;  2MJ5 B;  2JP7 A;  1KYI A;  2MRO B;  2R0I A;  1CUK A;  2L4F A;  2EKK A;  3FE3 A;  2OOA A;  1Y8G A;  2JNH A;  3LCV B;  2ZTC A;  2JY8 A;  2HWJ A;  2MGW A;  1HT1 E;  4WP2 A;  2LVA A;  1XXH E;  2DAE A;  2L2D A;  1E94 E;  2B3T A;  4UN2 B;  1NV8 A;  3IEC A;  1PGY A;  2BWB A;  3GLF E;  2LVN C;  1ZMU A;  2DZL A;  2O25 A;  2JZ0 A;  1WGN A;  1AIP C;  1VEG A;  3E21 A;  3GLG E;  1TTE A;  2KNV A;  3K9O A;  1OTR A;  3E46 A;  2JY6 B;  1WIV A;  1OQY A;  2DNA A;  1A5T A;  1IM2 A;  1HT2 E;  1NV9 A;  2DAK A;  1F4I A;  1HQY E;  1MN3 A;  2EKF A;  2EJS A;  2LVO C;  1C7Y A;  2OOB A;  3IHP A;  1BVS A;  1UFZ A;  2BWE A;  3H4J A;  3MMP A;  1VG5 A;  1ZV1 A;  2QSF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...