2OO9A

Crystal structure of the uba domain from human c-cbl ubiquitin ligase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase CBL
publication title Structural basis for UBA-mediated dimerization of c-Cbl ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 13
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2oo9A00
1Y8GA 1VG5A 3IECA 3K9OA 1KYIA 2G3QA 1YLAA 2CWBA 1G4AE 4UN2B 4R71A 2BWEA 2MROB 1HQYE 1G41A 4Q7JA 3LCUA 2MGWA 1ZMUA 1NV8A 1IM2A 2JP7A 2L4FA 2KNAA 1DO0A 1MN3A 1OTRA 1WR1B 2LVAA 2LVPC 2KNVA 1VEJA 2MJ5B 3GLIE 1WHCA 4HEOA 3K9PA 2DAMA 3GLHE 2QNJA 3GLFE 1XB2B 2KNZA 1ZMVA 1SG9A 3B89A 2DNAA 4GEWA 1UFZA 1IFYA 2RRUA 1IXSA 4WP2A 2R0IA 3MMPA 1JR3E 1NV9A 4F1IA 1PGYA 1VEGA 1QZEA 2QSFX 1WIVA 2WZJA 2DAKA 2LVNC 1OKSA 3F92A 4G3OA 1AIPC 3IHPA 2LTUA 3FRHA 1OQYA 1HJPA 1VDLA 1T6OA 2B3TA 2ZTDA 1Q02A 2BWBA 2DAEA 2JZ1A 1VEKA 3GLGE 2LVOC 1V92A 2HAKA 2EKFA 2KHHA 2K9DA 2MR9A 4F2LA 2JY5A 2H5XA 1WGLA 2O25A 2DENA 2DZLA 2JNHA 1DO2A 1WGNA 1R4GA 3LCVB 2LBCA 1XXHE 1P3QQ 2JY8A 2JY6B 1OAIA 1DV0A 2JY7A 4DBGB 1CUKA 2OO9A 2L2DA 1F4IA 2OOAA 1EFUB 1BVSA 2DAIA 1ZV1A 1WJ7A 2LVQD 3T6PA 1TTEA 1G3IA 1TR8A 2L4EA 3E46A 1C7YA 2QHOB 3FRIA 1ZMWA 1A5TA 1VQ1A 5JI2E 1HT1E 2DAGA 2EJSA 5DFLA 1E94E 3BBZA 3FE3A 2ZTCA 1GO5A 2DHYA 2DI0A 2OOBA 2JUJA 2DKLA 3H4JA 2HWJA 1T43A 2K0BX 3E21A 2JZ0A 2CP8A 2EKKA 1HT2E
chains in the Genus database with same CATH superfamily
2G3QA 3ILKA 2R4EA 4X62M 4AG5A 2MROB 1N33M 3TQSA 4Q7JA 3T1YM 1DGHB 1IM2A 1GKIA 4QHTA 2RGOA 1PJIA 3K8ZA 2K6BA 2UXCM 4IBFA 2CFOA 1W5TA 1GL7A 2MH8A 2R44A 3A45A 1OTRA 4L6V6 1YUBA 2L09A 3SARA 3KDSE 1X37A 4PDGA 4NSOB 2MJ5B 3M6AA 3FKEA 2ZBKB 1TH3A 3T38A 4JI1M 3HJSA 1MJGM 1Z5CA 1K82A 3AFHA 3B89A 3ZQJA 2R62A 2YNMD 3C3DA 4GEWA 4G4RA 1UFZA 4I8OA 4JI2M 1Z59A 3TWMA 3MMPA 3R9XB 3VDPA 4F1IA 4QOZC 1GJSA 3CGWA 3ZCBB 2VIIA 4A3VB 3U61A 2H1RA 1OIZA 2DAKA 1J7KA 1TDZA 2UUAM 3FTEA 1JQJC 2KEBA 2P5TA 3F92A 5FTJA 3U60A 2V6ZM 3GPUA 3C3EA 1N78A 1PJJA 4GKKM 2X8AA 3H4MA 2G8LA 3AOGA 1HJPA 1AUAA 1TF0B 3UMMA 3GLGB 4LZZA 5ITQA 1IBMM 2ZTDA 1GJTA 2BWBA 2DAEA 3AV0A 4NSRA 3OTOM 4LF5M 4RF1A 3GLGE 1FJGM 4QNRA 3IG5A 4AI6A 4DUZM 5E26A 4AKHA 2K47A 1LTMA 4F2LA 4B7FA 2LNHC 3AOEC 2H5XA 3W67A 2O25A 1IBLM 3TE6A 2A5YB 3SBJA 2FFJA 1DGFA 4LF4M 3JAMS 3U6SA 1TH4A 3L26A 2C5RA 1XNQM 3RGPA 1XXHB 4YHHM 4CIZA 3UZUA 2R45A 1R4GA 3LCVB 1XXHE 3VFDA 2CUZA 5FTLA 2FOIC 2F4VM 1DV0A 3KOXE 3KSJA 2JY7A 4DBGB 3VK7A 1N32M 2UUBM 4IBEA 4MGHA 1T3TA 4X65M 4IBGA 3FYCA 5BPVA 3GRVA 1R2ZA 1W5SA 3LW5F 1J5EM 5DNYA 2Y21A 2L7IA 8CATA 2KXEA 4GMQA 2YFQA 1R2YA 3SMSA 2CV0A 4DR4M 1NJGA 1OAOC 4GHAA 2UXBM 1A5TA 5KPRA 1L1ZA 1QANA 1IQPA 3E4RA 4IBCA 4L4UA 2LWXA 1IN7A 2DAGA 2EJSA 4RNAA 5DFLA 3WHLA 3FE3A 3SATA 2D7HA 1OIPA 2DKLA 1QZMA 3AL0C 4AW4A 2FH0A 1PJQA 4JN6A 3HU2A 1NHWC 4OVZA 4LJ4A 3FD9A 1E9SA 1N75A 4DV2M 1VG5A 3E9SA 3IECA 2KRUA 2CWBA 1G4AE 4UN2B 1GABA 3DFZA 4OU7A 1R7RA 1GVNA 1MX0A 2GNOA 2ZM6M 2BWEA 3HJ8A 1IN8A 3U61B 1G41A 1HQYE 1XC8A 3CTWB 3AKZA 1KFVA 3U60B 3J27B 4DR1M 1QUTA 1NV8A 2KNAA 1Q3CA 4FCWA 4DUYM 3KP1E 4D81A 1MN3A 2I7NA 1WR1B 1IN6A 1VDDA 1D0MA 2WSFF 4MGIE 4G4OA 4LFBM 1NNJA 2LVAA 4EIWA 2CHQA 4LGMA 3SAVA 2WSEF 2KZUA 2KDLA 4S12A 2ZANA 2QZ4A 3KS4A 5BR8M 2XLJA 2XGNA 3B7ZA 5KPZA 4LZJA 3U6MA 1HQCA 3SAWA 2QBYB 5LMNM 1IFYA 1IXSA 3B74A 5EXXA 1QAOA 3U6PA 4GIPA 1EIJA 4LJ5A 5EXPA 3VKHA 2I7PA 3AJIB 1IBKM 3KXEC 2QSFX 3T1HM 3FYDA 4ZPXA 1HNXM 3BXWA 1I4WA 3AOEA 4NC6A 2LVNC 4BB9A 1OKSA 1QVRA 4G6ZA 1NO1A 4I81A 4R7GA 5JI3E 2DWNA 2XFTA 3HHWA 2X4AA 2CV2A 3FRHA 1OQYA 4YY3M 4LG2A 2XEPA 3GQ3A 2WSCF 4FWGA 4W5WA 3GLIA 1PJTA 2KW0A 1ORYB 1Q02A 2XSZA 1WXQA 3FTFA 2LVOC 1E32A 1V92A 3GLHA 4I5SA 4LF6M 1NY6A 3GRUA 2DVWB 1N77A 3GLFA 2LXEA 3W0LB 2MR9A 1ZAEA 3CF2A 3HU3A 3UJNA 2F5PA 2QP9X 3LQRA 3HX3A 1IXZA 2XFSA 5ITXA 2DENA 2DZLA 3SMPA 2JNHA 1L8QA 4WW0A 3SYKA 4FWDA 1DO2A 2UXDM 1SXJC 1WGNA 5IREB 4XBOA 3UK6A 4DV1M 1IY0A 1S3SA 2XF3A 4OVZB 1P3QQ 2JY6B 3GPYA 4DV6M 2CE7A 1OFHA 4ITQA 4R3DA 1J09A 5FSWA 5E6JA 3A98B 4OX9M 1L2CA 2EO2A 4LJ8A 1F4IA 2FE8A 1BVSA 2DAIA 2R18A 3HZJA 2LH0A 1WJ7A 3T6PA 1QDTA 1TTEA 3B7NA 1G3IA 4FW9A 4XK8F 3B7QA 4LFAM 1NSFA 3K1JA 4IIWA 2YQZA 2KRKA 2F5SA 1ZMWA 3LVVA 2EUCA 3Q8XA 3QYBA 4NRVA 4LF8M 3QAUA 3KSXA 1HT1E 4MM3B 1Q39A 5H37D 3BBZA 4AG6A 1E9RA 1YSYA 3M7GA 2M60A 3U6LA 4LF9M 1GO5A 2OOBA 3VK8A 4FCVA 4GC5A 1K3XA 2XH9A 2KA6B 3KP0E 2Z8YM 3GO8A 3HJQA 3U6OA 3SC3A 4CGYB 1N36M 1EE8A 3E21A 3U6QA 2CEAA 4MGKE 3U6DA 2CP8A 1XHBA 3L29A 1IXSB 2UU9M 1Y8GA 3K9OA 1KYIA 1QAQA 2CHVA 4DV5M 2R4JA 1YLAA 5DYIA 4NXMM 2BJVA 1NHGC 3HWSA 2M5ZA 4REZA 4II7A 4LY6A 4R71A 4TUWA 3KW6A 2ERCA 3IG8A 3LCUA 4DV0M 1ZMUA 3RE8A 2LHCA 2OPFA 2FS1A 4NRWA 1D2NA 2JP7A 2L4FA 4HLQA 3RFWA 1IXRC 1D0KA 3EIHA 4FWHA 3FUUA 2F5QA 3GLIB 3B9PA 4D80A 4IBIA 5KQDA 3J7AS 1QDRA 3GLHB 4JXJA 2KNVA 1VEJA 2ZAMA 3GLIE 4KHPM 1WHCA 4HEOA 4DR5M 3GLFB 4JI8M 5FTNA 2DAMA 3GLHE 1H6UA 4PDIA 4DR3M 1MU5A 3WHKA 3R8FA 4P16A 3GLFE 4IJEA 1ZMVA 3U6EA 1SG9A 4QOSA 5KPTA 2DNAA 2RGHA 4BBAA 2O01F 3GQ4A 1XMQM 1OFIA 2JXNA 3L28A 4NOOB 2RRUA 5ITXE 2NQ8C 4WP2A 3SFZA 1V34A 1TDHA 2R0IA 4Z8XA 1NV9A 1R5LA 4LCBA 3RGSA 4LRTA 2YR0A 4JI0M 1VEGA 1HR0M 4M9XA 2KZSA 1PRBA 2VDBB 1NJFA 1WIVA 1TGUA 2C9OA 2WZJA 2Y0QA 3NBIA 4HL4A 4DV3M 4GKJM 2Y0TA 3TWKA 4RKUF 2FNAA 5FTKA 4P17A 4LRSA 2LTUA 5LMUM 3J7BA 4KODA 1SXJA 1IY2A 3VKGA 1VDLA 1QUSA 5KQ8A 3VDUA 2R6FA 2B3TA 3GPXA 1VEKA 1UM8A 3HHZA 2DWMA 2JA2A 2HAKA 2E5LM 2EKFA 5L8RF 5ITUA 4BLCA 2J7NA 1C7YA 4PD2A 4PCZA 5EP4A 4Z6YA 2JY5A 3U5ZA 5FTMA 5IZ7D 5C18A 3BOSA 4KT0F 4PT5A 2J7OA 3GPPA 3ZH9B 4AQYM 1JR3A 3QWLA 4JI5M 3UGJA 4GC9A 4B3TM 2XZFA 1Z5BA 5EJCA 1Z5AA 1N34M 2JY8A 2L6OA 1OAIA 3QYEA 3HHXA 1QAMA 4M0WA 3HY5A 3DA1A 2W82A 2DHRA 3CF0A 4B3MM 2L2DA 1K3WA 3I4YA 3FUWA 2OQ4A 1EFUB 5EQTA 5A2QS 3FUVA 2DZOB 4G4NA 3SHGB 4JI7M 3I4VA 1C1KA 4KLNA 3I01M 4MH0E 2ZAOA 4CHTB 2CHGA 3W0FA 2BJWA 1PJSA 1TR8A 2L4EA 3E46A 4JI3M 2EA0A 2V1UA 3L25A 3KVWA 3EIEA 1G8PA 1DGBA 2QHOB 1HNWM 1XMOM 3FRIA 3A46A 2UUCM 3HU1A 3HHYA 4NL4H 1E94E 3FTDA 3MHVC 4XGIA 3NWLA 2V1CA 3NBXX 1Z6TA 3HKPA 4L78A 2DI0A 5EXTA 5KO3A 3H4JA 3VLFB 4X64M 1R6BX 2HWJA 1T43A 1G71A 1QQWA 2K0BX 1IY1A 2Z4RA 4FVMA 4GITA 4KO8A 2DXIA 1ZQ9A 1IN4A 3U6CA 3A42A 3LQQA 4IBDA 5EP3A 2JUJA 1HT2E 3KOWE 4FCTA 4DV4M 3J81S 4AKGA 3DOAA 2R65A 5IT9S 1D0LA 4M0DA 4MGYE 1JB0F 2QCUA 4GHLA 2MGWA 3TL4X 1Q3BA 4JI4M 2Z4SA 2JWSA 3I04M 1NNUC 3KOYE 1TH2A 3MK6A 2R46A 2XZUA 1DO0A 5GKNA 1SXJB 3DZDA 4M9ZA 3LVWA 4LJ6A 1V33A 1SXJE 4GRIA 2LVPC 2HL7A 3GRRA 2Z7JA 4B7GA 5FLXS 2L7HA 3PFIA 3FUTA 3K9PA 1QYRA 2QNJA 1I94M 4B7HA 2C9CA 2VF8A 3U5ZB 1XB2B 2BNKA 2KNZA 3PNVA 3SASA 4GH9A 4B3SM 2RKOA 2DZNB 4D82A 2CRUA 1L2BA 4NXNM 2CV1A 2VQFM 4JYAM 3I51A 1OJLA 3THGA 4QHSA 1PM5A 1JR3E 2APLA 1SXJD 1KSFX 3C9PA 4MGZE 1PGYA 1FNNA 3SAUA 2QBYA 2DWLA 1QZEA 4AZFA 5ITRA 3L2AA 3Q8GA 1GLNA 2HKJA 5ITTA 2DWZB 4CISA 3KS8A 1DGHA 2D7GA 2AHMA 4K0KM 4G3OA 3D8LA 1AIPC 3TPZA 3IHPA 3MJ5A 2QPAA 4IBKA 4L8RC 2Z3XA 4WURA 3KFUG 2LHGA 1T6OA 3PVSA 1L1TA 4ANRA 3K2LA 1JR3D 2J5YA 2JZ1A 2QQ8A 3SHFA 2KHHA 2Q2EB 2QENA 4X66M 2K9DA 5EP2A 4CJ6A 4LFCM 4Y28F 3JR5A 3T15A 4G4QA 1WGLA 1RU3A 1NVMA 4LJAA 3GQ5A 1L2DA 2F5NA 3J2PB 4OW0A 2XSZD 3C58A 5C1BA 4JV5M 5EP1A 4LJ7A 5EXSA 3K92A 1GL6A 1XWIA 4B3RM 2LBCA 4LF7M 5IWAM 4RF0A 1XNRM 4JI6M 4LJ9A 2C99A 3J80S 1CUKA 2OO9A 4LGYA 3L27A 2O5RA 2OOAA 3SYLA 2C98A 2C96A 3FUXA 4L16A 3KOZE 3PXGA 3GLGA 1ZV1A 2LVQD 4AKIA 1LV7A 5ITYA 1G59A 2VQEM 4IBBA 4IBJA 1DGGA 4M9SA 1NY5A 4QNMA 3TWLA 7CATA 2F5OA 5F3WA 5DYGA 2VF7A 3FTCA 4DR6M 3W68A 2X49A 1VQ1A 5JI2E 2GQFA 1IN5A 2G5GX 2HCBA 3M0EA 3V76A 4DR2M 2ZTCA 3LMMA 3GP1A 2Y20A 2DHYA 3GRYA 3PNYA 4FD2A 3CF6E 4B08A 4DV7M 1HNZM 1XXHA 4DR7M 1YE9A 3JR4A 2JZ0A 4IJFA 4L15A 2N35A 4MB7A 3ZC7B 2HHHM 3HGIA 2EKKA 3D8BA 4I4LA 2D7EA
chains in the Genus database with same CATH topology
1Y8GA 1VG5A 3IECA 3K9OA 1KYIA 2G3QA 1YLAA 2CWBA 1G4AE 4UN2B 4R71A 2BWEA 2MROB 1HQYE 1G41A 4Q7JA 3LCUA 2MGWA 1ZMUA 1NV8A 1IM2A 2JP7A 2L4FA 2KNAA 1DO0A 1MN3A 1OTRA 1WR1B 2LVAA 2LVPC 2KNVA 1VEJA 2MJ5B 3GLIE 1WHCA 4HEOA 3K9PA 2DAMA 3GLHE 2QNJA 3GLFE 1XB2B 2KNZA 1ZMVA 1SG9A 3B89A 2DNAA 4GEWA 1UFZA 1IFYA 2RRUA 1IXSA 4WP2A 2R0IA 3MMPA 1JR3E 1NV9A 4F1IA 1PGYA 1VEGA 1QZEA 2QSFX 1WIVA 2WZJA 2DAKA 2LVNC 1OKSA 3F92A 4G3OA 1AIPC 3IHPA 2LTUA 3FRHA 1OQYA 1HJPA 1VDLA 1T6OA 2B3TA 2ZTDA 1Q02A 2BWBA 2DAEA 2JZ1A 1VEKA 3GLGE 2LVOC 1V92A 2HAKA 2EKFA 2KHHA 2K9DA 2MR9A 4F2LA 2JY5A 2H5XA 1WGLA 2O25A 2DENA 2DZLA 2JNHA 1DO2A 1WGNA 1R4GA 3LCVB 2LBCA 1XXHE 1P3QQ 2JY8A 2JY6B 1OAIA 1DV0A 2JY7A 4DBGB 1CUKA 2OO9A 2L2DA 1F4IA 2OOAA 1EFUB 1BVSA 2DAIA 1ZV1A 1WJ7A 2LVQD 3T6PA 1TTEA 1G3IA 1TR8A 2L4EA 3E46A 1C7YA 2QHOB 3FRIA 1ZMWA 1A5TA 1VQ1A 5JI2E 1HT1E 2DAGA 2EJSA 5DFLA 1E94E 3BBZA 3FE3A 2ZTCA 1GO5A 2DHYA 2DI0A 2OOBA 2JUJA 2DKLA 3H4JA 2HWJA 1T43A 2K0BX 3E21A 2JZ0A 2CP8A 2EKKA 1HT2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8G A;  1VG5 A;  3IEC A;  3K9O A;  1KYI A;  2G3Q A;  1YLA A;  2CWB A;  1G4A E;  4UN2 B;  4R71 A;  2BWE A;  2MRO B;  1HQY E;  1G41 A;  4Q7J A;  3LCU A;  2MGW A;  1ZMU A;  1NV8 A;  1IM2 A;  2JP7 A;  2L4F A;  2KNA A;  1DO0 A;  1MN3 A;  1OTR A;  1WR1 B;  2LVA A;  2LVP C;  2KNV A;  1VEJ A;  2MJ5 B;  3GLI E;  1WHC A;  4HEO A;  3K9P A;  2DAM A;  3GLH E;  2QNJ A;  3GLF E;  1XB2 B;  2KNZ A;  1ZMV A;  1SG9 A;  3B89 A;  2DNA A;  4GEW A;  1UFZ A;  1IFY A;  2RRU A;  1IXS A;  4WP2 A;  2R0I A;  3MMP A;  1JR3 E;  1NV9 A;  4F1I A;  1PGY A;  1VEG A;  1QZE A;  2QSF X;  1WIV A;  2WZJ A;  2DAK A;  2LVN C;  1OKS A;  3F92 A;  4G3O A;  1AIP C;  3IHP A;  2LTU A;  3FRH A;  1OQY A;  1HJP A;  1VDL A;  1T6O A;  2B3T A;  2ZTD A;  1Q02 A;  2BWB A;  2DAE A;  2JZ1 A;  1VEK A;  3GLG E;  2LVO C;  1V92 A;  2HAK A;  2EKF A;  2KHH A;  2K9D A;  2MR9 A;  4F2L A;  2JY5 A;  2H5X A;  1WGL A;  2O25 A;  2DEN A;  2DZL A;  2JNH A;  1DO2 A;  1WGN A;  1R4G A;  3LCV B;  2LBC A;  1XXH E;  1P3Q Q;  2JY8 A;  2JY6 B;  1OAI A;  1DV0 A;  2JY7 A;  4DBG B;  1CUK A;  2OO9 A;  2L2D A;  1F4I A;  2OOA A;  1EFU B;  1BVS A;  2DAI A;  1ZV1 A;  1WJ7 A;  2LVQ D;  3T6P A;  1TTE A;  1G3I A;  1TR8 A;  2L4E A;  3E46 A;  1C7Y A;  2QHO B;  3FRI A;  1ZMW A;  1A5T A;  1VQ1 A;  5JI2 E;  1HT1 E;  2DAG A;  2EJS A;  5DFL A;  1E94 E;  3BBZ A;  3FE3 A;  2ZTC A;  1GO5 A;  2DHY A;  2DI0 A;  2OOB A;  2JUJ A;  2DKL A;  3H4J A;  2HWJ A;  1T43 A;  2K0B X;  3E21 A;  2JZ0 A;  2CP8 A;  2EKK A;  1HT2 E; 
#chains in the Genus database with same CATH topology
 2G3Q A;  3ILK A;  2R4E A;  4X62 M;  4AG5 A;  2MRO B;  1N33 M;  3TQS A;  4Q7J A;  3T1Y M;  1DGH B;  1IM2 A;  1GKI A;  4QHT A;  2RGO A;  1PJI A;  3K8Z A;  2K6B A;  2UXC M;  4IBF A;  2CFO A;  1W5T A;  1GL7 A;  2MH8 A;  2R44 A;  3A45 A;  1OTR A;  4L6V 6;  1YUB A;  2L09 A;  3SAR A;  3KDS E;  1X37 A;  4PDG A;  4NSO B;  2MJ5 B;  3M6A A;  3FKE A;  2ZBK B;  1TH3 A;  3T38 A;  4JI1 M;  3HJS A;  1MJG M;  1Z5C A;  1K82 A;  3AFH A;  3B89 A;  3ZQJ A;  2R62 A;  2YNM D;  3C3D A;  4GEW A;  4G4R A;  1UFZ A;  4I8O A;  4JI2 M;  1Z59 A;  3TWM A;  3MMP A;  3R9X B;  3VDP A;  4F1I A;  4QOZ C;  1GJS A;  3CGW A;  3ZCB B;  2VII A;  4A3V B;  3U61 A;  2H1R A;  1OIZ A;  2DAK A;  1J7K A;  1TDZ A;  2UUA M;  3FTE A;  1JQJ C;  2KEB A;  2P5T A;  3F92 A;  5FTJ A;  3U60 A;  2V6Z M;  3GPU A;  3C3E A;  1N78 A;  1PJJ A;  4GKK M;  2X8A A;  3H4M A;  2G8L A;  3AOG A;  1HJP A;  1AUA A;  1TF0 B;  3UMM A;  3GLG B;  4LZZ A;  5ITQ A;  1IBM M;  2ZTD A;  1GJT A;  2BWB A;  2DAE A;  3AV0 A;  4NSR A;  3OTO M;  4LF5 M;  4RF1 A;  3GLG E;  1FJG M;  4QNR A;  3IG5 A;  4AI6 A;  4DUZ M;  5E26 A;  4AKH A;  2K47 A;  1LTM A;  4F2L A;  4B7F A;  2LNH C;  3AOE C;  2H5X A;  3W67 A;  2O25 A;  1IBL M;  3TE6 A;  2A5Y B;  3SBJ A;  2FFJ A;  1DGF A;  4LF4 M;  3JAM S;  3U6S A;  1TH4 A;  3L26 A;  2C5R A;  1XNQ M;  3RGP A;  1XXH B;  4YHH M;  4CIZ A;  3UZU A;  2R45 A;  1R4G A;  3LCV B;  1XXH E;  3VFD A;  2CUZ A;  5FTL A;  2FOI C;  2F4V M;  1DV0 A;  3KOX E;  3KSJ A;  2JY7 A;  4DBG B;  3VK7 A;  1N32 M;  2UUB M;  4IBE A;  4MGH A;  1T3T A;  4X65 M;  4IBG A;  3FYC A;  5BPV A;  3GRV A;  1R2Z A;  1W5S A;  3LW5 F;  1J5E M;  5DNY A;  2Y21 A;  2L7I A;  8CAT A;  2KXE A;  4GMQ A;  2YFQ A;  1R2Y A;  3SMS A;  2CV0 A;  4DR4 M;  1NJG A;  1OAO C;  4GHA A;  2UXB M;  1A5T A;  5KPR A;  1L1Z A;  1QAN A;  1IQP A;  3E4R A;  4IBC A;  4L4U A;  2LWX A;  1IN7 A;  2DAG A;  2EJS A;  4RNA A;  5DFL A;  3WHL A;  3FE3 A;  3SAT A;  2D7H A;  1OIP A;  2DKL A;  1QZM A;  3AL0 C;  4AW4 A;  2FH0 A;  1PJQ A;  4JN6 A;  3HU2 A;  1NHW C;  4OVZ A;  4LJ4 A;  3FD9 A;  1E9S A;  1N75 A;  4DV2 M;  1VG5 A;  3E9S A;  3IEC A;  2KRU A;  2CWB A;  1G4A E;  4UN2 B;  1GAB A;  3DFZ A;  4OU7 A;  1R7R A;  1GVN A;  1MX0 A;  2GNO A;  2ZM6 M;  2BWE A;  3HJ8 A;  1IN8 A;  3U61 B;  1G41 A;  1HQY E;  1XC8 A;  3CTW B;  3AKZ A;  1KFV A;  3U60 B;  3J27 B;  4DR1 M;  1QUT A;  1NV8 A;  2KNA A;  1Q3C A;  4FCW A;  4DUY M;  3KP1 E;  4D81 A;  1MN3 A;  2I7N A;  1WR1 B;  1IN6 A;  1VDD A;  1D0M A;  2WSF F;  4MGI E;  4G4O A;  4LFB M;  1NNJ A;  2LVA A;  4EIW A;  2CHQ A;  4LGM A;  3SAV A;  2WSE F;  2KZU A;  2KDL A;  4S12 A;  2ZAN A;  2QZ4 A;  3KS4 A;  5BR8 M;  2XLJ A;  2XGN A;  3B7Z A;  5KPZ A;  4LZJ A;  3U6M A;  1HQC A;  3SAW A;  2QBY B;  5LMN M;  1IFY A;  1IXS A;  3B74 A;  5EXX A;  1QAO A;  3U6P A;  4GIP A;  1EIJ A;  4LJ5 A;  5EXP A;  3VKH A;  2I7P A;  3AJI B;  1IBK M;  3KXE C;  2QSF X;  3T1H M;  3FYD A;  4ZPX A;  1HNX M;  3BXW A;  1I4W A;  3AOE A;  4NC6 A;  2LVN C;  4BB9 A;  1OKS A;  1QVR A;  4G6Z A;  1NO1 A;  4I81 A;  4R7G A;  5JI3 E;  2DWN A;  2XFT A;  3HHW A;  2X4A A;  2CV2 A;  3FRH A;  1OQY A;  4YY3 M;  4LG2 A;  2XEP A;  3GQ3 A;  2WSC F;  4FWG A;  4W5W A;  3GLI A;  1PJT A;  2KW0 A;  1ORY B;  1Q02 A;  2XSZ A;  1WXQ A;  3FTF A;  2LVO C;  1E32 A;  1V92 A;  3GLH A;  4I5S A;  4LF6 M;  1NY6 A;  3GRU A;  2DVW B;  1N77 A;  3GLF A;  2LXE A;  3W0L B;  2MR9 A;  1ZAE A;  3CF2 A;  3HU3 A;  3UJN A;  2F5P A;  2QP9 X;  3LQR A;  3HX3 A;  1IXZ A;  2XFS A;  5ITX A;  2DEN A;  2DZL A;  3SMP A;  2JNH A;  1L8Q A;  4WW0 A;  3SYK A;  4FWD A;  1DO2 A;  2UXD M;  1SXJ C;  1WGN A;  5IRE B;  4XBO A;  3UK6 A;  4DV1 M;  1IY0 A;  1S3S A;  2XF3 A;  4OVZ B;  1P3Q Q;  2JY6 B;  3GPY A;  4DV6 M;  2CE7 A;  1OFH A;  4ITQ A;  4R3D A;  1J09 A;  5FSW A;  5E6J A;  3A98 B;  4OX9 M;  1L2C A;  2EO2 A;  4LJ8 A;  1F4I A;  2FE8 A;  1BVS A;  2DAI A;  2R18 A;  3HZJ A;  2LH0 A;  1WJ7 A;  3T6P A;  1QDT A;  1TTE A;  3B7N A;  1G3I A;  4FW9 A;  4XK8 F;  3B7Q A;  4LFA M;  1NSF A;  3K1J A;  4IIW A;  2YQZ A;  2KRK A;  2F5S A;  1ZMW A;  3LVV A;  2EUC A;  3Q8X A;  3QYB A;  4NRV A;  4LF8 M;  3QAU A;  3KSX A;  1HT1 E;  4MM3 B;  1Q39 A;  5H37 D;  3BBZ A;  4AG6 A;  1E9R A;  1YSY A;  3M7G A;  2M60 A;  3U6L A;  4LF9 M;  1GO5 A;  2OOB A;  3VK8 A;  4FCV A;  4GC5 A;  1K3X A;  2XH9 A;  2KA6 B;  3KP0 E;  2Z8Y M;  3GO8 A;  3HJQ A;  3U6O A;  3SC3 A;  4CGY B;  1N36 M;  1EE8 A;  3E21 A;  3U6Q A;  2CEA A;  4MGK E;  3U6D A;  2CP8 A;  1XHB A;  3L29 A;  1IXS B;  2UU9 M;  1Y8G A;  3K9O A;  1KYI A;  1QAQ A;  2CHV A;  4DV5 M;  2R4J A;  1YLA A;  5DYI A;  4NXM M;  2BJV A;  1NHG C;  3HWS A;  2M5Z A;  4REZ A;  4II7 A;  4LY6 A;  4R71 A;  4TUW A;  3KW6 A;  2ERC A;  3IG8 A;  3LCU A;  4DV0 M;  1ZMU A;  3RE8 A;  2LHC A;  2OPF A;  2FS1 A;  4NRW A;  1D2N A;  2JP7 A;  2L4F A;  4HLQ A;  3RFW A;  1IXR C;  1D0K A;  3EIH A;  4FWH A;  3FUU A;  2F5Q A;  3GLI B;  3B9P A;  4D80 A;  4IBI A;  5KQD A;  3J7A S;  1QDR A;  3GLH B;  4JXJ A;  2KNV A;  1VEJ A;  2ZAM A;  3GLI E;  4KHP M;  1WHC A;  4HEO A;  4DR5 M;  3GLF B;  4JI8 M;  5FTN A;  2DAM A;  3GLH E;  1H6U A;  4PDI A;  4DR3 M;  1MU5 A;  3WHK A;  3R8F A;  4P16 A;  3GLF E;  4IJE A;  1ZMV A;  3U6E A;  1SG9 A;  4QOS A;  5KPT A;  2DNA A;  2RGH A;  4BBA A;  2O01 F;  3GQ4 A;  1XMQ M;  1OFI A;  2JXN A;  3L28 A;  4NOO B;  2RRU A;  5ITX E;  2NQ8 C;  4WP2 A;  3SFZ A;  1V34 A;  1TDH A;  2R0I A;  4Z8X A;  1NV9 A;  1R5L A;  4LCB A;  3RGS A;  4LRT A;  2YR0 A;  4JI0 M;  1VEG A;  1HR0 M;  4M9X A;  2KZS A;  1PRB A;  2VDB B;  1NJF A;  1WIV A;  1TGU A;  2C9O A;  2WZJ A;  2Y0Q A;  3NBI A;  4HL4 A;  4DV3 M;  4GKJ M;  2Y0T A;  3TWK A;  4RKU F;  2FNA A;  5FTK A;  4P17 A;  4LRS A;  2LTU A;  5LMU M;  3J7B A;  4KOD A;  1SXJ A;  1IY2 A;  3VKG A;  1VDL A;  1QUS A;  5KQ8 A;  3VDU A;  2R6F A;  2B3T A;  3GPX A;  1VEK A;  1UM8 A;  3HHZ A;  2DWM A;  2JA2 A;  2HAK A;  2E5L M;  2EKF A;  5L8R F;  5ITU A;  4BLC A;  2J7N A;  1C7Y A;  4PD2 A;  4PCZ A;  5EP4 A;  4Z6Y A;  2JY5 A;  3U5Z A;  5FTM A;  5IZ7 D;  5C18 A;  3BOS A;  4KT0 F;  4PT5 A;  2J7O A;  3GPP A;  3ZH9 B;  4AQY M;  1JR3 A;  3QWL A;  4JI5 M;  3UGJ A;  4GC9 A;  4B3T M;  2XZF A;  1Z5B A;  5EJC A;  1Z5A A;  1N34 M;  2JY8 A;  2L6O A;  1OAI A;  3QYE A;  3HHX A;  1QAM A;  4M0W A;  3HY5 A;  3DA1 A;  2W82 A;  2DHR A;  3CF0 A;  4B3M M;  2L2D A;  1K3W A;  3I4Y A;  3FUW A;  2OQ4 A;  1EFU B;  5EQT A;  5A2Q S;  3FUV A;  2DZO B;  4G4N A;  3SHG B;  4JI7 M;  3I4V A;  1C1K A;  4KLN A;  3I01 M;  4MH0 E;  2ZAO A;  4CHT B;  2CHG A;  3W0F A;  2BJW A;  1PJS A;  1TR8 A;  2L4E A;  3E46 A;  4JI3 M;  2EA0 A;  2V1U A;  3L25 A;  3KVW A;  3EIE A;  1G8P A;  1DGB A;  2QHO B;  1HNW M;  1XMO M;  3FRI A;  3A46 A;  2UUC M;  3HU1 A;  3HHY A;  4NL4 H;  1E94 E;  3FTD A;  3MHV C;  4XGI A;  3NWL A;  2V1C A;  3NBX X;  1Z6T A;  3HKP A;  4L78 A;  2DI0 A;  5EXT A;  5KO3 A;  3H4J A;  3VLF B;  4X64 M;  1R6B X;  2HWJ A;  1T43 A;  1G71 A;  1QQW A;  2K0B X;  1IY1 A;  2Z4R A;  4FVM A;  4GIT A;  4KO8 A;  2DXI A;  1ZQ9 A;  1IN4 A;  3U6C A;  3A42 A;  3LQQ A;  4IBD A;  5EP3 A;  2JUJ A;  1HT2 E;  3KOW E;  4FCT A;  4DV4 M;  3J81 S;  4AKG A;  3DOA A;  2R65 A;  5IT9 S;  1D0L A;  4M0D A;  4MGY E;  1JB0 F;  2QCU A;  4GHL A;  2MGW A;  3TL4 X;  1Q3B A;  4JI4 M;  2Z4S A;  2JWS A;  3I04 M;  1NNU C;  3KOY E;  1TH2 A;  3MK6 A;  2R46 A;  2XZU A;  1DO0 A;  5GKN A;  1SXJ B;  3DZD A;  4M9Z A;  3LVW A;  4LJ6 A;  1V33 A;  1SXJ E;  4GRI A;  2LVP C;  2HL7 A;  3GRR A;  2Z7J A;  4B7G A;  5FLX S;  2L7H A;  3PFI A;  3FUT A;  3K9P A;  1QYR A;  2QNJ A;  1I94 M;  4B7H A;  2C9C A;  2VF8 A;  3U5Z B;  1XB2 B;  2BNK A;  2KNZ A;  3PNV A;  3SAS A;  4GH9 A;  4B3S M;  2RKO A;  2DZN B;  4D82 A;  2CRU A;  1L2B A;  4NXN M;  2CV1 A;  2VQF M;  4JYA M;  3I51 A;  1OJL A;  3THG A;  4QHS A;  1PM5 A;  1JR3 E;  2APL A;  1SXJ D;  1KSF X;  3C9P A;  4MGZ E;  1PGY A;  1FNN A;  3SAU A;  2QBY A;  2DWL A;  1QZE A;  4AZF A;  5ITR A;  3L2A A;  3Q8G A;  1GLN A;  2HKJ A;  5ITT A;  2DWZ B;  4CIS A;  3KS8 A;  1DGH A;  2D7G A;  2AHM A;  4K0K M;  4G3O A;  3D8L A;  1AIP C;  3TPZ A;  3IHP A;  3MJ5 A;  2QPA A;  4IBK A;  4L8R C;  2Z3X A;  4WUR A;  3KFU G;  2LHG A;  1T6O A;  3PVS A;  1L1T A;  4ANR A;  3K2L A;  1JR3 D;  2J5Y A;  2JZ1 A;  2QQ8 A;  3SHF A;  2KHH A;  2Q2E B;  2QEN A;  4X66 M;  2K9D A;  5EP2 A;  4CJ6 A;  4LFC M;  4Y28 F;  3JR5 A;  3T15 A;  4G4Q A;  1WGL A;  1RU3 A;  1NVM A;  4LJA A;  3GQ5 A;  1L2D A;  2F5N A;  3J2P B;  4OW0 A;  2XSZ D;  3C58 A;  5C1B A;  4JV5 M;  5EP1 A;  4LJ7 A;  5EXS A;  3K92 A;  1GL6 A;  1XWI A;  4B3R M;  2LBC A;  4LF7 M;  5IWA M;  4RF0 A;  1XNR M;  4JI6 M;  4LJ9 A;  2C99 A;  3J80 S;  1CUK A;  2OO9 A;  4LGY A;  3L27 A;  2O5R A;  2OOA A;  3SYL A;  2C98 A;  2C96 A;  3FUX A;  4L16 A;  3KOZ E;  3PXG A;  3GLG A;  1ZV1 A;  2LVQ D;  4AKI A;  1LV7 A;  5ITY A;  1G59 A;  2VQE M;  4IBB A;  4IBJ A;  1DGG A;  4M9S A;  1NY5 A;  4QNM A;  3TWL A;  7CAT A;  2F5O A;  5F3W A;  5DYG A;  2VF7 A;  3FTC A;  4DR6 M;  3W68 A;  2X49 A;  1VQ1 A;  5JI2 E;  2GQF A;  1IN5 A;  2G5G X;  2HCB A;  3M0E A;  3V76 A;  4DR2 M;  2ZTC A;  3LMM A;  3GP1 A;  2Y20 A;  2DHY A;  3GRY A;  3PNY A;  4FD2 A;  3CF6 E;  4B08 A;  4DV7 M;  1HNZ M;  1XXH A;  4DR7 M;  1YE9 A;  3JR4 A;  2JZ0 A;  4IJF A;  4L15 A;  2N35 A;  4MB7 A;  3ZC7 B;  2HHH M;  3HGI A;  2EKK A;  3D8B A;  4I4L A;  2D7E A; 
#chains in the Genus database with same CATH homology
 1Y8G A;  1VG5 A;  3IEC A;  3K9O A;  1KYI A;  2G3Q A;  1YLA A;  2CWB A;  1G4A E;  4UN2 B;  4R71 A;  2BWE A;  2MRO B;  1HQY E;  1G41 A;  4Q7J A;  3LCU A;  2MGW A;  1ZMU A;  1NV8 A;  1IM2 A;  2JP7 A;  2L4F A;  2KNA A;  1DO0 A;  1MN3 A;  1OTR A;  1WR1 B;  2LVA A;  2LVP C;  2KNV A;  1VEJ A;  2MJ5 B;  3GLI E;  1WHC A;  4HEO A;  3K9P A;  2DAM A;  3GLH E;  2QNJ A;  3GLF E;  1XB2 B;  2KNZ A;  1ZMV A;  1SG9 A;  3B89 A;  2DNA A;  4GEW A;  1UFZ A;  1IFY A;  2RRU A;  1IXS A;  4WP2 A;  2R0I A;  3MMP A;  1JR3 E;  1NV9 A;  4F1I A;  1PGY A;  1VEG A;  1QZE A;  2QSF X;  1WIV A;  2WZJ A;  2DAK A;  2LVN C;  1OKS A;  3F92 A;  4G3O A;  1AIP C;  3IHP A;  2LTU A;  3FRH A;  1OQY A;  1HJP A;  1VDL A;  1T6O A;  2B3T A;  2ZTD A;  1Q02 A;  2BWB A;  2DAE A;  2JZ1 A;  1VEK A;  3GLG E;  2LVO C;  1V92 A;  2HAK A;  2EKF A;  2KHH A;  2K9D A;  2MR9 A;  4F2L A;  2JY5 A;  2H5X A;  1WGL A;  2O25 A;  2DEN A;  2DZL A;  2JNH A;  1DO2 A;  1WGN A;  1R4G A;  3LCV B;  2LBC A;  1XXH E;  1P3Q Q;  2JY8 A;  2JY6 B;  1OAI A;  1DV0 A;  2JY7 A;  4DBG B;  1CUK A;  2OO9 A;  2L2D A;  1F4I A;  2OOA A;  1EFU B;  1BVS A;  2DAI A;  1ZV1 A;  1WJ7 A;  2LVQ D;  3T6P A;  1TTE A;  1G3I A;  1TR8 A;  2L4E A;  3E46 A;  1C7Y A;  2QHO B;  3FRI A;  1ZMW A;  1A5T A;  1VQ1 A;  5JI2 E;  1HT1 E;  2DAG A;  2EJS A;  5DFL A;  1E94 E;  3BBZ A;  3FE3 A;  2ZTC A;  1GO5 A;  2DHY A;  2DI0 A;  2OOB A;  2JUJ A;  2DKL A;  3H4J A;  2HWJ A;  1T43 A;  2K0B X;  3E21 A;  2JZ0 A;  2CP8 A;  2EKK A;  1HT2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...