2OO9A

Crystal structure of the uba domain from human c-cbl ubiquitin ligase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase CBL
publication title Structural basis for UBA-mediated dimerization of c-Cbl ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2oo9A00
1GO5A 2QHOB 2LTUA 2OOBA 2MJ5B 3GLHE 4GEWA 2JP7A 1HT2E 2LVPC 2MROB 3LCUA 1BVSA 3GLFE 1YLAA 1HQYE 1E94E 2JNHA 4Q7JA 2JUJA 3FRIA 2HAKA 1MN3A 3LCVB 5DFLA 2LVQD 2B3TA 1VEGA 3E21A 2CP8A 2DHYA 1DV0A 2O25A 2JY8A 1NV9A 1EFUB 2JZ0A 2JY7A 2LVOC 2EJSA 1WJ7A 2K9DA 1TR8A 3E46A 1KYIA 1T6OA 1WHCA 5JI2E 1G3IA 1NV8A 1HT1E 1JR3E 3K9OA 1UFZA 2LVAA 2JY6B 2HWJA 4R71A 4UN2B 1G41A 1IM2A 1WGLA 4HEOA 1ZMUA 3FE3A 2RRUA 1IFYA 3K9PA 1VG5A 1IXSA 2KNZA 1WIVA 2EKFA 1ZMVA 3T6PA 3BBZA 1HJPA 2JY5A 2KNAA 2ZTCA 3IHPA 1F4IA 1WGNA 1DO0A 3B89A 4F1IA 2DKLA 2JZ1A 2BWEA 1V92A 2QNJA 1R4GA 2R0IA 1Y8GA 2CWBA 3MMPA 2L4EA 1C7YA 1QZEA 2DAIA 1G4AE 2K0BX 1OTRA 2BWBA 1VEJA 1T43A 3IECA 1OKSA 1WR1B 2ZTDA 2DAEA 1CUKA 2DENA 2L4FA 1AIPC 2DAMA 4G3OA 3GLIE 2DZLA 1OAIA 2EKKA 1ZMWA 2MR9A 1OQYA 1P3QQ 1VDLA 2MGWA 2G3QA 3GLGE 2DAKA 2KNVA 2LBCA 1A5TA 2OOAA 1SG9A 2DI0A 1ZV1A 2QSFX 4F2LA 1Q02A 1XXHE 3FRHA 2DAGA 2DNAA 1TTEA 2WZJA 1PGYA 4WP2A 2KHHA 2L2DA 2OO9A 3F92A 2LVNC 1VQ1A 1XB2B 1DO2A 1VEKA 2H5XA 3H4JA 4DBGB
chains in the Genus database with same CATH superfamily
4FWGA 1L2DA 2LTUA 3I4YA 1K3WA 5EJCA 2CV2A 4X62M 1EE8A 4KT0F 2V1UA 3KS8A 3GRRA 3GPYA 3GLFE 3U6MA 2JNHA 1OIZA 1MN3A 4PDGA 5ITTA 2CRUA 4OU7A 3E21A 4LFAM 2D7EA 2XFSA 2R62A 4AG5A 2VQEM 3U6OA 1L2CA 4LF8M 4QNMA 1GJTA 2LH0A 2CV0A 1XXHA 3KS4A 4Z8XA 4GH9A 2JZ0A 2LVOC 2EJSA 5FTNA 2HL7A 1WJ7A 2K47A 4FVMA 1TR8A 1JB0F 1GKIA 1R5LA 1RU3A 1WHCA 3KOYE 1IBMM 4AW4A 2X8AA 3GLIB 3QYEA 5JI2E 3NBXX 2ZM6M 1NV8A 4L8RC 5FSWA 1UFZA 3GPXA 2I7NA 2CUZA 3I01M 1IM2A 1IY0A 4LJ7A 4NSOB 3PNYA 3LMMA 5A2QS 3U61A 3DA1A 1E9SA 4RF0A 4MB7A 4DV1M 3U6PA 2F5QA 3FYCA 2VF8A 4HEOA 4NOOB 4NSRA 4JI1M 4ITQA 1FNNA 3BXWA 1E9RA 3U6SA 2XGNA 1VDDA 4PD2A 2X4AA 1IXSA 4YY3M 4DV7M 4B3MM 4IBFA 2R4JA 4JI8M 3WHLA 1WIVA 4KO8A 3VKGA 4R3DA 4JV5M 3U5ZA 1ZMVA 2DWNA 3SMSA 4IJFA 2H1RA 2CHQA 2OPFA 1TH4A 1HJPA 2KNAA 2UUBM 3SARA 2ZTCA 4L16A 1D2NA 1HNWM 3FTEA 3CF6E 3I51A 4G4RA 4MH0E 1QUSA 4DV6M 4RF1A 3VLFB 1HNXM 3QAUA 2XZUA 4II7A 1ORYB 4JI0M 1YUBA 2R46A 3GLFA 4AKIA 1YSYA 2XEPA 1SXJE 2XSZD 4D81A 1V34A 3TWLA 2L4EA 4AG6A 1QZEA 2YQZA 2Y21A 3D8BA 5EXXA 1W5TA 3VK7A 1Z59A 5IZ7D 3J7BA 3SHGB 4B7GA 4R7GA 3K8ZA 2APLA 3NBIA 2L09A 2LWXA 4REZA 3GPUA 3M7GA 4DUYM 4QOZC 1OKSA 2ZTDA 3K1JA 5ITRA 2XSZA 1GABA 3SASA 1LTMA 2F5NA 4M9ZA 2L4FA 3LVWA 1KSFX 1Q39A 1SXJB 1NNUC 1XWIA 2ZAOA 1OAIA 2HCBA 4S12A 1G8PA 1ZMWA 2MR9A 3D8LA 3B74A 4JI5M 1L8QA 2QBYA 2MGWA 2YFQA 2KA6B 5KQ8A 2DAKA 3GLGE 1IN6A 2KNVA 1W5SA 3LW5F 4YHHM 1IY1A 4G4QA 1G59A 1SG9A 2VDBB 4AKHA 3HJSA 2ZAMA 4OVZB 4NRVA 2V6ZM 1XXHE 4XGIA 1NNJA 1GJSA 2DNAA 4LZZA 1PJJA 2WZJA 3HGIA 3LQQA 1J7KA 3F92A 1MU5A 1OFIA 5EXTA 1QDRA 1DO2A 1SXJD 1OFHA 3FUWA 4LJ6A 5EP4A 4BLCA 1H6UA 1NJFA 3K92A 2MJ5B 2JP7A 2FE8A 4GHAA 2UUCM 4DR7M 3B7QA 2DVWB 1Z5CA 1YLAA 4MGYE 1E94E 5E6JA 2JUJA 3M0EA 1MJGM 4LJAA 4DUZM 3U6QA 1S3SA 1XXHB 2B3TA 4IBIA 3GQ3A 2CP8A 4FCWA 4G4OA 3BOSA 3SYLA 3R8FA 2F4VM 2O25A 3PFIA 4DV0M 1EFUB 1Z5BA 3C9PA 1IN5A 2ERCA 2JY7A 4LF6M 2K9DA 3GO8A 3KDSE 1IXZA 2ZBKB 4MGKE 3C58A 5FTMA 1QYRA 1HT1E 2L7IA 3U61B 1HR0M 2Z4SA 3K9OA 2UXBM 4LJ8A 2JA2A 2LVAA 3T1YM 2KEBA 2HHHM 2JWSA 4B3TM 1X37A 4UN2B 1G41A 3GQ4A 1TDHA 1GL6A 4LZJA 2R18A 1DGBA 2MH8A 2VIIA 1IXSB 3AOEC 4P16A 4B7FA 4IJEA 3B7NA 2WSCF 3MK6A 2RRUA 1KFVA 3J27B 4JI6M 3GLGA 3CTWB 5KPRA 1WXQA 4L15A 1YE9A 3JAMS 3HU1A 4RNAA 3VDPA 3BBZA 1IQPA 2O5RA 2F5PA 3AL0C 3WHKA 1XHBA 2BJVA 5BPVA 1F4IA 1IN4A 1G71A 5EP1A 4DV2M 5ITYA 3GRVA 3I04M 5DYIA 1JR3A 3GLFB 4LF4M 4KLNA 2JZ1A 4B08A 4WW0A 1TGUA 2F5OA 1V92A 4I4LA 4CJ6A 4IBGA 1K3XA 1NHWC 3VK8A 1R7RA 1N75A 1JQJC 3L26A 4RKUF 2C96A 3V76A 3FUUA 1OTRA 2BWBA 1PM5A 1T43A 4LRTA 3A42A 2KZUA 4AQYM 1XMQM 3IECA 3TWKA 2C9CA 1DGFA 2GQFA 3T15A 1DGGA 1ZAEA 4G3OA 4I5SA 3RFWA 3CF0A 4IBJA 3RGSA 3RGPA 3TPZA 4X64M 2QBYB 2DZLA 4DV5M 3AFHA 3DFZA 4FW9A 4QOSA 1XC8A 3FTFA 3VFDA 4I81A 2C5RA 3SATA 2BNKA 2Y20A 3A98B 1VDLA 2Z4RA 1NO1A 3KP1E 3MJ5A 2LHGA 5KPTA 4LGYA 1Q3BA 3CF2A 3GRUA 4I8OA 1IY2A 3FTCA 3HHYA 2KRUA 1A5TA 2OOAA 3B9PA 3HJQA 4MGIE 3A46A 3FRHA 5IREB 2DXIA 1TTEA 4WP2A 1PGYA 2KHHA 5FTKA 4Y28F 1R2YA 2KRKA 1QVRA 2KXEA 1QUTA 3UK6A 4DV3M 3TQSA 3UJNA 1PJIA 1J09A 2UXCM 1GO5A 3FD9A 2OOBA 3GQ5A 3GLHE 2G8LA 4GEWA 4M9XA 3PXGA 2MROB 2Q2EB 3KOWE 1PJQA 3KXEC 3MHVC 1HQYE 4Q7JA 5KQDA 4LG2A 4HL4A 5EXSA 2CFOA 3SAWA 1TH3A 4IBEA 3GPPA 3ZQJA 3JR5A 4AI6A 3HY5A 1D0MA 2DHYA 1DV0A 2JY8A 1NV9A 1N78A 2FNAA 2FH0A 4LF9M 5IT9S 2ZANA 2Z8YM 4WURA 5C18A 3U60B 4IBCA 4DR3M 3AJIB 3HU2A 3KOZE 1KYIA 1T6OA 3J81S 4QHTA 3DZDA 3UZUA 2VQFM 1I4WA 2W82A 1G3IA 4GC9A 1JR3E 4B7HA 3HKPA 4DR6M 1GVNA 3SYKA 1NY5A 2JY6B 4R71A 1WGLA 2M5ZA 2HKJA 4M0DA 3UMMA 4LJ9A 3GLGB 3T1HM 1N36M 5EP3A 4W5WA 2L6OA 1ZMUA 2NQ8C 1D0KA 3FE3A 5KPZA 4DV4M 3KSJA 5F3WA 4OX9M 2QPAA 1IFYA 4MGZE 1AUAA 2Y0QA 3KSXA 3HX3A 2KNZA 1R6BX 4NL4H 3T6PA 3L27A 1OAOC 2A5YB 1Q3CA 3PVSA 4PCZA 3W0LB 1IBLM 1SXJC 3Q8GA 5LMNM 3T38A 1XNQM 1DO0A 4JXJA 2P5TA 4F1IA 5FLXS 5IWAM 3LVVA 1IN8A 2DKLA 2J5YA 2KDLA 3GLHA 2O01F 5BR8M 2QNJA 1NJGA 1R4GA 3SBJA 3B7ZA 1Y8GA 1UM8A 2CWBA 3MMPA 4G6ZA 4M9SA 4OW0A 3ZCBB 3ZH9B 1N33M 4LJ4A 3VDUA 2GNOA 4PDIA 2L7HA 4DR1M 3U5ZB 3ILKA 5KO3A 4LFBM 2K0BX 1JR3D 5FTLA 3HHZA 2YR0A 4LF7M 3M6AA 1K82A 1T3TA 1N34M 4KODA 3IG8A 4BBAA 4JI2M 3AOEA 1WR1B 3Q8XA 1D0LA 4NXNM 4JI7M 3VKHA 3U6CA 1L2BA 1IN7A 2DENA 4IBBA 1AIPC 2DAMA 4LY6A 4PT5A 3OTOM 3LQRA 3GLIE 2XF3A 4CIZA 3AOGA 2CV1A 3EIHA 4DR2M 3SAVA 1N32M 2EKKA 1QANA 1DGHA 3HHWA 3TWMA 1OQYA 4ANRA 1P3QQ 2YNMD 8CATA 2WSFF 3KOXE 4Z6YA 4MM3B 3RE8A 3TL4X 2LBCA 3TE6A 2QSFX 2DI0A 4L4UA 2RGHA 3J80S 3FTDA 4F2LA 3FUXA 3ZC7B 4LRSA 1Q02A 5C1BA 5H37D 2KW0A 1Z5AA 1Z6TA 2DAGA 3HJ8A 2L2DA 2OQ4A 3KW6A 2CHVA 3H4MA 2XLJA 2F5SA 4GITA 2EUCA 2R6FA 3HHXA 3NWLA 4L78A 1NVMA 2H5XA 1FJGM 2KZSA 1MX0A 3W0FA 2RKOA 3H4JA 4DBGB 1ZQ9A 2QHOB 4LF5M 2EO2A 1EIJA 4IBKA 3E4RA 2X49A 3SMPA 1HT2E 2LVPC 3LCUA 4LJ5A 1BVSA 2K6BA 3L25A 2XH9A 2N35A 2AHMA 1R2ZA 4CISA 2FOIC 4GIPA 2G5GX 5DNYA 3FRIA 2HAKA 1GLNA 1I94M 3SC3A 3AV0A 3LCVB 5DFLA 2UXDM 2LVQD 1V33A 4D80A 4GC5A 1VEGA 3L29A 3A45A 4JYAM 3L2AA 1E32A 2JXNA 2XFTA 2QQ8A 4XBOA 3R9XB 1XMOM 2VF7A 3AKZA 2DWMA 4K0KM 1QQWA 4GKJM 3FUTA 4LCBA 5EQTA 3SAUA 4X66M 2UUAM 3SHFA 3SFZA 2CE7A 4GKKM 5FTJA 3HWSA 2R4EA 3E46A 1IXRC 1QAQA 2QZ4A 3HU3A 4FD2A 2R65A 2QENA 4IIWA 5L8RF 4ZPXA 3W68A 4BB9A 3QYBA 2QP9X 1J5EM 3J2PB 5ITQA 1OIPA 4NRWA 3J7AS 1NSFA 2R45A 2HWJA 3L28A 3PNVA 3GLIA 3HZJA 4EIWA 1L1ZA 3KP0E 3C3EA 5GKNA 2CHGA 1NHGC 3W67A 2C9OA 4IBDA 3CGWA 2FS1A 3K9PA 3K2LA 3DOAA 1VG5A 4QHSA 1QAMA 2FFJA 3U6DA 3U6LA 2Y0TA 7CATA 5LMUM 3I4VA 2EKFA 1IBKM 5ITXE 2C98A 2DHRA 2D7HA 2JY5A 3C3DA 2QCUA 1HNZM 1GL7A 2Z7JA 3GRYA 3IHPA 3GLHB 4M0WA 1N77A 1WGNA 3B89A 2E5LM 2LXEA 1XNRM 4NC6A 1QDTA 4A3VB 4GRIA 2EA0A 2BJWA 3E9SA 2BWEA 4XK8F 3FKEA 4B3SM 2R0IA 4JN6A 2DWZB 3IG5A 4DR5M 4LFCM 1C7YA 2DAIA 1G4AE 2DZOB 4X65M 1PRBA 3FUVA 3UGJA 2LNHC 1VEJA 3QWLA 1HQCA 3EIEA 4P17A 2WSEF 2DZNB 3KVWA 2C99A 2LHCA 1QAOA 4D82A 2DAEA 1TDZA 2I7PA 2R44A 2RGOA 4DR4M 2D7GA 1CUKA 1DGHB 4B3RM 4JI4M 4NXMM 4QNRA 4CHTB 1LV7A 3KFUG 2V1CA 1TF0B 4FCTA 2CEAA 4JI3M 2DWLA 1TH2A 1OJLA 4LGMA 5EXPA 3U6EA 2J7NA 4MGHA 2UU9M 1SXJA 3FYDA 2G3QA 2Z3XA 2M60A 5EP2A 1PJTA 1ZV1A 4FWDA 1L1TA 4FWHA 4GHLA 4L6V6 4AKGA 5JI3E 1QZMA 1NY6A 4FCVA 3THGA 1PJSA 4CGYB 4G4NA 5E26A 2OO9A 2J7OA 5ITXA 4OVZA 2LVNC 1C1KA 2XZFA 1VQ1A 1XB2B 4HLQA 5DYGA 4GMQA 5ITUA 3GP1A 4KHPM 1VEKA 4TUWA 3JR4A 3U60A 4AZFA
chains in the Genus database with same CATH topology
1GO5A 2QHOB 2LTUA 2OOBA 2MJ5B 3GLHE 4GEWA 2JP7A 1HT2E 2LVPC 2MROB 3LCUA 1BVSA 3GLFE 1YLAA 1HQYE 1E94E 2JNHA 4Q7JA 2JUJA 3FRIA 2HAKA 1MN3A 3LCVB 5DFLA 2LVQD 2B3TA 1VEGA 3E21A 2CP8A 2DHYA 1DV0A 2O25A 2JY8A 1NV9A 1EFUB 2JZ0A 2JY7A 2LVOC 2EJSA 1WJ7A 2K9DA 1TR8A 3E46A 1KYIA 1T6OA 1WHCA 5JI2E 1G3IA 1NV8A 1HT1E 1JR3E 3K9OA 1UFZA 2LVAA 2JY6B 2HWJA 4R71A 4UN2B 1G41A 1IM2A 1WGLA 4HEOA 1ZMUA 3FE3A 2RRUA 1IFYA 3K9PA 1VG5A 1IXSA 2KNZA 1WIVA 2EKFA 1ZMVA 3T6PA 3BBZA 1HJPA 2JY5A 2KNAA 2ZTCA 3IHPA 1F4IA 1WGNA 1DO0A 3B89A 4F1IA 2DKLA 2JZ1A 2BWEA 1V92A 2QNJA 1R4GA 2R0IA 1Y8GA 2CWBA 3MMPA 2L4EA 1C7YA 1QZEA 2DAIA 1G4AE 2K0BX 1OTRA 2BWBA 1VEJA 1T43A 3IECA 1OKSA 1WR1B 2ZTDA 2DAEA 1CUKA 2DENA 2L4FA 1AIPC 2DAMA 4G3OA 3GLIE 2DZLA 1OAIA 2EKKA 1ZMWA 2MR9A 1OQYA 1P3QQ 1VDLA 2MGWA 2G3QA 3GLGE 2DAKA 2KNVA 2LBCA 1A5TA 2OOAA 1SG9A 2DI0A 1ZV1A 2QSFX 4F2LA 1Q02A 1XXHE 3FRHA 2DAGA 2DNAA 1TTEA 2WZJA 1PGYA 4WP2A 2KHHA 2L2DA 2OO9A 3F92A 2LVNC 1VQ1A 1XB2B 1DO2A 1VEKA 2H5XA 3H4JA 4DBGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO5 A;  2QHO B;  2LTU A;  2OOB A;  2MJ5 B;  3GLH E;  4GEW A;  2JP7 A;  1HT2 E;  2LVP C;  2MRO B;  3LCU A;  1BVS A;  3GLF E;  1YLA A;  1HQY E;  1E94 E;  2JNH A;  4Q7J A;  2JUJ A;  3FRI A;  2HAK A;  1MN3 A;  3LCV B;  5DFL A;  2LVQ D;  2B3T A;  1VEG A;  3E21 A;  2CP8 A;  2DHY A;  1DV0 A;  2O25 A;  2JY8 A;  1NV9 A;  1EFU B;  2JZ0 A;  2JY7 A;  2LVO C;  2EJS A;  1WJ7 A;  2K9D A;  1TR8 A;  3E46 A;  1KYI A;  1T6O A;  1WHC A;  5JI2 E;  1G3I A;  1NV8 A;  1HT1 E;  1JR3 E;  3K9O A;  1UFZ A;  2LVA A;  2JY6 B;  2HWJ A;  4R71 A;  4UN2 B;  1G41 A;  1IM2 A;  1WGL A;  4HEO A;  1ZMU A;  3FE3 A;  2RRU A;  1IFY A;  3K9P A;  1VG5 A;  1IXS A;  2KNZ A;  1WIV A;  2EKF A;  1ZMV A;  3T6P A;  3BBZ A;  1HJP A;  2JY5 A;  2KNA A;  2ZTC A;  3IHP A;  1F4I A;  1WGN A;  1DO0 A;  3B89 A;  4F1I A;  2DKL A;  2JZ1 A;  2BWE A;  1V92 A;  2QNJ A;  1R4G A;  2R0I A;  1Y8G A;  2CWB A;  3MMP A;  2L4E A;  1C7Y A;  1QZE A;  2DAI A;  1G4A E;  2K0B X;  1OTR A;  2BWB A;  1VEJ A;  1T43 A;  3IEC A;  1OKS A;  1WR1 B;  2ZTD A;  2DAE A;  1CUK A;  2DEN A;  2L4F A;  1AIP C;  2DAM A;  4G3O A;  3GLI E;  2DZL A;  1OAI A;  2EKK A;  1ZMW A;  2MR9 A;  1OQY A;  1P3Q Q;  1VDL A;  2MGW A;  2G3Q A;  3GLG E;  2DAK A;  2KNV A;  2LBC A;  1A5T A;  2OOA A;  1SG9 A;  2DI0 A;  1ZV1 A;  2QSF X;  4F2L A;  1Q02 A;  1XXH E;  3FRH A;  2DAG A;  2DNA A;  1TTE A;  2WZJ A;  1PGY A;  4WP2 A;  2KHH A;  2L2D A;  2OO9 A;  3F92 A;  2LVN C;  1VQ1 A;  1XB2 B;  1DO2 A;  1VEK A;  2H5X A;  3H4J A;  4DBG B; 
#chains in the Genus database with same CATH topology
 4FWG A;  1L2D A;  2LTU A;  3I4Y A;  1K3W A;  5EJC A;  2CV2 A;  4X62 M;  1EE8 A;  4KT0 F;  2V1U A;  3KS8 A;  3GRR A;  3GPY A;  3GLF E;  3U6M A;  2JNH A;  1OIZ A;  1MN3 A;  4PDG A;  5ITT A;  2CRU A;  4OU7 A;  3E21 A;  4LFA M;  2D7E A;  2XFS A;  2R62 A;  4AG5 A;  2VQE M;  3U6O A;  1L2C A;  4LF8 M;  4QNM A;  1GJT A;  2LH0 A;  2CV0 A;  1XXH A;  3KS4 A;  4Z8X A;  4GH9 A;  2JZ0 A;  2LVO C;  2EJS A;  5FTN A;  2HL7 A;  1WJ7 A;  2K47 A;  4FVM A;  1TR8 A;  1JB0 F;  1GKI A;  1R5L A;  1RU3 A;  1WHC A;  3KOY E;  1IBM M;  4AW4 A;  2X8A A;  3GLI B;  3QYE A;  5JI2 E;  3NBX X;  2ZM6 M;  1NV8 A;  4L8R C;  5FSW A;  1UFZ A;  3GPX A;  2I7N A;  2CUZ A;  3I01 M;  1IM2 A;  1IY0 A;  4LJ7 A;  4NSO B;  3PNY A;  3LMM A;  5A2Q S;  3U61 A;  3DA1 A;  1E9S A;  4RF0 A;  4MB7 A;  4DV1 M;  3U6P A;  2F5Q A;  3FYC A;  2VF8 A;  4HEO A;  4NOO B;  4NSR A;  4JI1 M;  4ITQ A;  1FNN A;  3BXW A;  1E9R A;  3U6S A;  2XGN A;  1VDD A;  4PD2 A;  2X4A A;  1IXS A;  4YY3 M;  4DV7 M;  4B3M M;  4IBF A;  2R4J A;  4JI8 M;  3WHL A;  1WIV A;  4KO8 A;  3VKG A;  4R3D A;  4JV5 M;  3U5Z A;  1ZMV A;  2DWN A;  3SMS A;  4IJF A;  2H1R A;  2CHQ A;  2OPF A;  1TH4 A;  1HJP A;  2KNA A;  2UUB M;  3SAR A;  2ZTC A;  4L16 A;  1D2N A;  1HNW M;  3FTE A;  3CF6 E;  3I51 A;  4G4R A;  4MH0 E;  1QUS A;  4DV6 M;  4RF1 A;  3VLF B;  1HNX M;  3QAU A;  2XZU A;  4II7 A;  1ORY B;  4JI0 M;  1YUB A;  2R46 A;  3GLF A;  4AKI A;  1YSY A;  2XEP A;  1SXJ E;  2XSZ D;  4D81 A;  1V34 A;  3TWL A;  2L4E A;  4AG6 A;  1QZE A;  2YQZ A;  2Y21 A;  3D8B A;  5EXX A;  1W5T A;  3VK7 A;  1Z59 A;  5IZ7 D;  3J7B A;  3SHG B;  4B7G A;  4R7G A;  3K8Z A;  2APL A;  3NBI A;  2L09 A;  2LWX A;  4REZ A;  3GPU A;  3M7G A;  4DUY M;  4QOZ C;  1OKS A;  2ZTD A;  3K1J A;  5ITR A;  2XSZ A;  1GAB A;  3SAS A;  1LTM A;  2F5N A;  4M9Z A;  2L4F A;  3LVW A;  1KSF X;  1Q39 A;  1SXJ B;  1NNU C;  1XWI A;  2ZAO A;  1OAI A;  2HCB A;  4S12 A;  1G8P A;  1ZMW A;  2MR9 A;  3D8L A;  3B74 A;  4JI5 M;  1L8Q A;  2QBY A;  2MGW A;  2YFQ A;  2KA6 B;  5KQ8 A;  2DAK A;  3GLG E;  1IN6 A;  2KNV A;  1W5S A;  3LW5 F;  4YHH M;  1IY1 A;  4G4Q A;  1G59 A;  1SG9 A;  2VDB B;  4AKH A;  3HJS A;  2ZAM A;  4OVZ B;  4NRV A;  2V6Z M;  1XXH E;  4XGI A;  1NNJ A;  1GJS A;  2DNA A;  4LZZ A;  1PJJ A;  2WZJ A;  3HGI A;  3LQQ A;  1J7K A;  3F92 A;  1MU5 A;  1OFI A;  5EXT A;  1QDR A;  1DO2 A;  1SXJ D;  1OFH A;  3FUW A;  4LJ6 A;  5EP4 A;  4BLC A;  1H6U A;  1NJF A;  3K92 A;  2MJ5 B;  2JP7 A;  2FE8 A;  4GHA A;  2UUC M;  4DR7 M;  3B7Q A;  2DVW B;  1Z5C A;  1YLA A;  4MGY E;  1E94 E;  5E6J A;  2JUJ A;  3M0E A;  1MJG M;  4LJA A;  4DUZ M;  3U6Q A;  1S3S A;  1XXH B;  2B3T A;  4IBI A;  3GQ3 A;  2CP8 A;  4FCW A;  4G4O A;  3BOS A;  3SYL A;  3R8F A;  2F4V M;  2O25 A;  3PFI A;  4DV0 M;  1EFU B;  1Z5B A;  3C9P A;  1IN5 A;  2ERC A;  2JY7 A;  4LF6 M;  2K9D A;  3GO8 A;  3KDS E;  1IXZ A;  2ZBK B;  4MGK E;  3C58 A;  5FTM A;  1QYR A;  1HT1 E;  2L7I A;  3U61 B;  1HR0 M;  2Z4S A;  3K9O A;  2UXB M;  4LJ8 A;  2JA2 A;  2LVA A;  3T1Y M;  2KEB A;  2HHH M;  2JWS A;  4B3T M;  1X37 A;  4UN2 B;  1G41 A;  3GQ4 A;  1TDH A;  1GL6 A;  4LZJ A;  2R18 A;  1DGB A;  2MH8 A;  2VII A;  1IXS B;  3AOE C;  4P16 A;  4B7F A;  4IJE A;  3B7N A;  2WSC F;  3MK6 A;  2RRU A;  1KFV A;  3J27 B;  4JI6 M;  3GLG A;  3CTW B;  5KPR A;  1WXQ A;  4L15 A;  1YE9 A;  3JAM S;  3HU1 A;  4RNA A;  3VDP A;  3BBZ A;  1IQP A;  2O5R A;  2F5P A;  3AL0 C;  3WHK A;  1XHB A;  2BJV A;  5BPV A;  1F4I A;  1IN4 A;  1G71 A;  5EP1 A;  4DV2 M;  5ITY A;  3GRV A;  3I04 M;  5DYI A;  1JR3 A;  3GLF B;  4LF4 M;  4KLN A;  2JZ1 A;  4B08 A;  4WW0 A;  1TGU A;  2F5O A;  1V92 A;  4I4L A;  4CJ6 A;  4IBG A;  1K3X A;  1NHW C;  3VK8 A;  1R7R A;  1N75 A;  1JQJ C;  3L26 A;  4RKU F;  2C96 A;  3V76 A;  3FUU A;  1OTR A;  2BWB A;  1PM5 A;  1T43 A;  4LRT A;  3A42 A;  2KZU A;  4AQY M;  1XMQ M;  3IEC A;  3TWK A;  2C9C A;  1DGF A;  2GQF A;  3T15 A;  1DGG A;  1ZAE A;  4G3O A;  4I5S A;  3RFW A;  3CF0 A;  4IBJ A;  3RGS A;  3RGP A;  3TPZ A;  4X64 M;  2QBY B;  2DZL A;  4DV5 M;  3AFH A;  3DFZ A;  4FW9 A;  4QOS A;  1XC8 A;  3FTF A;  3VFD A;  4I81 A;  2C5R A;  3SAT A;  2BNK A;  2Y20 A;  3A98 B;  1VDL A;  2Z4R A;  1NO1 A;  3KP1 E;  3MJ5 A;  2LHG A;  5KPT A;  4LGY A;  1Q3B A;  3CF2 A;  3GRU A;  4I8O A;  1IY2 A;  3FTC A;  3HHY A;  2KRU A;  1A5T A;  2OOA A;  3B9P A;  3HJQ A;  4MGI E;  3A46 A;  3FRH A;  5IRE B;  2DXI A;  1TTE A;  4WP2 A;  1PGY A;  2KHH A;  5FTK A;  4Y28 F;  1R2Y A;  2KRK A;  1QVR A;  2KXE A;  1QUT A;  3UK6 A;  4DV3 M;  3TQS A;  3UJN A;  1PJI A;  1J09 A;  2UXC M;  1GO5 A;  3FD9 A;  2OOB A;  3GQ5 A;  3GLH E;  2G8L A;  4GEW A;  4M9X A;  3PXG A;  2MRO B;  2Q2E B;  3KOW E;  1PJQ A;  3KXE C;  3MHV C;  1HQY E;  4Q7J A;  5KQD A;  4LG2 A;  4HL4 A;  5EXS A;  2CFO A;  3SAW A;  1TH3 A;  4IBE A;  3GPP A;  3ZQJ A;  3JR5 A;  4AI6 A;  3HY5 A;  1D0M A;  2DHY A;  1DV0 A;  2JY8 A;  1NV9 A;  1N78 A;  2FNA A;  2FH0 A;  4LF9 M;  5IT9 S;  2ZAN A;  2Z8Y M;  4WUR A;  5C18 A;  3U60 B;  4IBC A;  4DR3 M;  3AJI B;  3HU2 A;  3KOZ E;  1KYI A;  1T6O A;  3J81 S;  4QHT A;  3DZD A;  3UZU A;  2VQF M;  1I4W A;  2W82 A;  1G3I A;  4GC9 A;  1JR3 E;  4B7H A;  3HKP A;  4DR6 M;  1GVN A;  3SYK A;  1NY5 A;  2JY6 B;  4R71 A;  1WGL A;  2M5Z A;  2HKJ A;  4M0D A;  3UMM A;  4LJ9 A;  3GLG B;  3T1H M;  1N36 M;  5EP3 A;  4W5W A;  2L6O A;  1ZMU A;  2NQ8 C;  1D0K A;  3FE3 A;  5KPZ A;  4DV4 M;  3KSJ A;  5F3W A;  4OX9 M;  2QPA A;  1IFY A;  4MGZ E;  1AUA A;  2Y0Q A;  3KSX A;  3HX3 A;  2KNZ A;  1R6B X;  4NL4 H;  3T6P A;  3L27 A;  1OAO C;  2A5Y B;  1Q3C A;  3PVS A;  4PCZ A;  3W0L B;  1IBL M;  1SXJ C;  3Q8G A;  5LMN M;  3T38 A;  1XNQ M;  1DO0 A;  4JXJ A;  2P5T A;  4F1I A;  5FLX S;  5IWA M;  3LVV A;  1IN8 A;  2DKL A;  2J5Y A;  2KDL A;  3GLH A;  2O01 F;  5BR8 M;  2QNJ A;  1NJG A;  1R4G A;  3SBJ A;  3B7Z A;  1Y8G A;  1UM8 A;  2CWB A;  3MMP A;  4G6Z A;  4M9S A;  4OW0 A;  3ZCB B;  3ZH9 B;  1N33 M;  4LJ4 A;  3VDU A;  2GNO A;  4PDI A;  2L7H A;  4DR1 M;  3U5Z B;  3ILK A;  5KO3 A;  4LFB M;  2K0B X;  1JR3 D;  5FTL A;  3HHZ A;  2YR0 A;  4LF7 M;  3M6A A;  1K82 A;  1T3T A;  1N34 M;  4KOD A;  3IG8 A;  4BBA A;  4JI2 M;  3AOE A;  1WR1 B;  3Q8X A;  1D0L A;  4NXN M;  4JI7 M;  3VKH A;  3U6C A;  1L2B A;  1IN7 A;  2DEN A;  4IBB A;  1AIP C;  2DAM A;  4LY6 A;  4PT5 A;  3OTO M;  3LQR A;  3GLI E;  2XF3 A;  4CIZ A;  3AOG A;  2CV1 A;  3EIH A;  4DR2 M;  3SAV A;  1N32 M;  2EKK A;  1QAN A;  1DGH A;  3HHW A;  3TWM A;  1OQY A;  4ANR A;  1P3Q Q;  2YNM D;  8CAT A;  2WSF F;  3KOX E;  4Z6Y A;  4MM3 B;  3RE8 A;  3TL4 X;  2LBC A;  3TE6 A;  2QSF X;  2DI0 A;  4L4U A;  2RGH A;  3J80 S;  3FTD A;  4F2L A;  3FUX A;  3ZC7 B;  4LRS A;  1Q02 A;  5C1B A;  5H37 D;  2KW0 A;  1Z5A A;  1Z6T A;  2DAG A;  3HJ8 A;  2L2D A;  2OQ4 A;  3KW6 A;  2CHV A;  3H4M A;  2XLJ A;  2F5S A;  4GIT A;  2EUC A;  2R6F A;  3HHX A;  3NWL A;  4L78 A;  1NVM A;  2H5X A;  1FJG M;  2KZS A;  1MX0 A;  3W0F A;  2RKO A;  3H4J A;  4DBG B;  1ZQ9 A;  2QHO B;  4LF5 M;  2EO2 A;  1EIJ A;  4IBK A;  3E4R A;  2X49 A;  3SMP A;  1HT2 E;  2LVP C;  3LCU A;  4LJ5 A;  1BVS A;  2K6B A;  3L25 A;  2XH9 A;  2N35 A;  2AHM A;  1R2Z A;  4CIS A;  2FOI C;  4GIP A;  2G5G X;  5DNY A;  3FRI A;  2HAK A;  1GLN A;  1I94 M;  3SC3 A;  3AV0 A;  3LCV B;  5DFL A;  2UXD M;  2LVQ D;  1V33 A;  4D80 A;  4GC5 A;  1VEG A;  3L29 A;  3A45 A;  4JYA M;  3L2A A;  1E32 A;  2JXN A;  2XFT A;  2QQ8 A;  4XBO A;  3R9X B;  1XMO M;  2VF7 A;  3AKZ A;  2DWM A;  4K0K M;  1QQW A;  4GKJ M;  3FUT A;  4LCB A;  5EQT A;  3SAU A;  4X66 M;  2UUA M;  3SHF A;  3SFZ A;  2CE7 A;  4GKK M;  5FTJ A;  3HWS A;  2R4E A;  3E46 A;  1IXR C;  1QAQ A;  2QZ4 A;  3HU3 A;  4FD2 A;  2R65 A;  2QEN A;  4IIW A;  5L8R F;  4ZPX A;  3W68 A;  4BB9 A;  3QYB A;  2QP9 X;  1J5E M;  3J2P B;  5ITQ A;  1OIP A;  4NRW A;  3J7A S;  1NSF A;  2R45 A;  2HWJ A;  3L28 A;  3PNV A;  3GLI A;  3HZJ A;  4EIW A;  1L1Z A;  3KP0 E;  3C3E A;  5GKN A;  2CHG A;  1NHG C;  3W67 A;  2C9O A;  4IBD A;  3CGW A;  2FS1 A;  3K9P A;  3K2L A;  3DOA A;  1VG5 A;  4QHS A;  1QAM A;  2FFJ A;  3U6D A;  3U6L A;  2Y0T A;  7CAT A;  5LMU M;  3I4V A;  2EKF A;  1IBK M;  5ITX E;  2C98 A;  2DHR A;  2D7H A;  2JY5 A;  3C3D A;  2QCU A;  1HNZ M;  1GL7 A;  2Z7J A;  3GRY A;  3IHP A;  3GLH B;  4M0W A;  1N77 A;  1WGN A;  3B89 A;  2E5L M;  2LXE A;  1XNR M;  4NC6 A;  1QDT A;  4A3V B;  4GRI A;  2EA0 A;  2BJW A;  3E9S A;  2BWE A;  4XK8 F;  3FKE A;  4B3S M;  2R0I A;  4JN6 A;  2DWZ B;  3IG5 A;  4DR5 M;  4LFC M;  1C7Y A;  2DAI A;  1G4A E;  2DZO B;  4X65 M;  1PRB A;  3FUV A;  3UGJ A;  2LNH C;  1VEJ A;  3QWL A;  1HQC A;  3EIE A;  4P17 A;  2WSE F;  2DZN B;  3KVW A;  2C99 A;  2LHC A;  1QAO A;  4D82 A;  2DAE A;  1TDZ A;  2I7P A;  2R44 A;  2RGO A;  4DR4 M;  2D7G A;  1CUK A;  1DGH B;  4B3R M;  4JI4 M;  4NXM M;  4QNR A;  4CHT B;  1LV7 A;  3KFU G;  2V1C A;  1TF0 B;  4FCT A;  2CEA A;  4JI3 M;  2DWL A;  1TH2 A;  1OJL A;  4LGM A;  5EXP A;  3U6E A;  2J7N A;  4MGH A;  2UU9 M;  1SXJ A;  3FYD A;  2G3Q A;  2Z3X A;  2M60 A;  5EP2 A;  1PJT A;  1ZV1 A;  4FWD A;  1L1T A;  4FWH A;  4GHL A;  4L6V 6;  4AKG A;  5JI3 E;  1QZM A;  1NY6 A;  4FCV A;  3THG A;  1PJS A;  4CGY B;  4G4N A;  5E26 A;  2OO9 A;  2J7O A;  5ITX A;  4OVZ A;  2LVN C;  1C1K A;  2XZF A;  1VQ1 A;  1XB2 B;  4HLQ A;  5DYG A;  4GMQ A;  5ITU A;  3GP1 A;  4KHP M;  1VEK A;  4TUW A;  3JR4 A;  3U60 A;  4AZF A; 
#chains in the Genus database with same CATH homology
 1GO5 A;  2QHO B;  2LTU A;  2OOB A;  2MJ5 B;  3GLH E;  4GEW A;  2JP7 A;  1HT2 E;  2LVP C;  2MRO B;  3LCU A;  1BVS A;  3GLF E;  1YLA A;  1HQY E;  1E94 E;  2JNH A;  4Q7J A;  2JUJ A;  3FRI A;  2HAK A;  1MN3 A;  3LCV B;  5DFL A;  2LVQ D;  2B3T A;  1VEG A;  3E21 A;  2CP8 A;  2DHY A;  1DV0 A;  2O25 A;  2JY8 A;  1NV9 A;  1EFU B;  2JZ0 A;  2JY7 A;  2LVO C;  2EJS A;  1WJ7 A;  2K9D A;  1TR8 A;  3E46 A;  1KYI A;  1T6O A;  1WHC A;  5JI2 E;  1G3I A;  1NV8 A;  1HT1 E;  1JR3 E;  3K9O A;  1UFZ A;  2LVA A;  2JY6 B;  2HWJ A;  4R71 A;  4UN2 B;  1G41 A;  1IM2 A;  1WGL A;  4HEO A;  1ZMU A;  3FE3 A;  2RRU A;  1IFY A;  3K9P A;  1VG5 A;  1IXS A;  2KNZ A;  1WIV A;  2EKF A;  1ZMV A;  3T6P A;  3BBZ A;  1HJP A;  2JY5 A;  2KNA A;  2ZTC A;  3IHP A;  1F4I A;  1WGN A;  1DO0 A;  3B89 A;  4F1I A;  2DKL A;  2JZ1 A;  2BWE A;  1V92 A;  2QNJ A;  1R4G A;  2R0I A;  1Y8G A;  2CWB A;  3MMP A;  2L4E A;  1C7Y A;  1QZE A;  2DAI A;  1G4A E;  2K0B X;  1OTR A;  2BWB A;  1VEJ A;  1T43 A;  3IEC A;  1OKS A;  1WR1 B;  2ZTD A;  2DAE A;  1CUK A;  2DEN A;  2L4F A;  1AIP C;  2DAM A;  4G3O A;  3GLI E;  2DZL A;  1OAI A;  2EKK A;  1ZMW A;  2MR9 A;  1OQY A;  1P3Q Q;  1VDL A;  2MGW A;  2G3Q A;  3GLG E;  2DAK A;  2KNV A;  2LBC A;  1A5T A;  2OOA A;  1SG9 A;  2DI0 A;  1ZV1 A;  2QSF X;  4F2L A;  1Q02 A;  1XXH E;  3FRH A;  2DAG A;  2DNA A;  1TTE A;  2WZJ A;  1PGY A;  4WP2 A;  2KHH A;  2L2D A;  2OO9 A;  3F92 A;  2LVN C;  1VQ1 A;  1XB2 B;  1DO2 A;  1VEK A;  2H5X A;  3H4J A;  4DBG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...