3K9OA

The crystal structure of e2-25k and ubb+1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of E2-25K/UBB+1 Interaction for Neurotoxicity of Alzheimer Disease by Proteasome Inhibition
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 K
total genus 68
structure length 198
sequence length 198
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3k9oA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 3k9oA01
4QPLB 2RRUA 3A4SA 4DS2A 1G4AE 2QSFX 1ZV1A 1J74A 4A49B 1Q02A 1NV9A 3RZ3A 1WGLA 2LXPA 1YLAA 2JY6B 3IECA 3K9OA 2BF8A 2EBKA 2YB6A 5F6UA 4R62A 3JW0A 5FERB 3PTFA 3CEGA 1IM2A 1AIPC 1BVSA 4UN2B 4YIIU 1J7DB 4NRIB 4FH1A 2ZTCA 1GO5A 3FN1B 2KNVA 1DV0A 4IP3B 4DHID 4NR3A 4AP4B 2H5XA 2Z6OA 2Y9MA 4A4CC 3UGBA 3FSHA 3UIPA 1C7YA 2GRNA 2Q0VA 4ONNA 1QZEA 4F2LA 1V92A 4Q5EC 5DFLA 3HCUB 2HAKA 4L83A 2LVQD 1DO0A 2PX9B 4LADA 2JY5A 1M4PA 2DKLA 2DNAA 2GROA 5F6DA 4G3OA 2Y4WA 2ONUA 1AYZA 4NRGB 2OO9A 2VRRA 1T6OA 1VDLA 5F6WA 4Q5HC 3A33A 2EKKA 2KNAA 1KYIA 5D0MA 4ONNB 2A7LA 1A5TA 2GMIB 4V3KA 3L1YA 2DI0A 1ZDNA 1HT2E 1ZMUA 4A4BC 1WR1B 2MROB 4GEWA 2C4PA 2PWQA 4DHJC 2EBMA 2PE6A 3GLIE 4ONMB 1WGNA 3UIOA 4WP2A 1A3SA 1U9BA 3EVXA 1X23A 2LVAA 4S3OA 1KPPA 3OJ4A 4V3LA 2R0IA 2DAIA 2A4DA 3OBQA 1YH2A 3MMPA 1ZUOA 2QHOB 3E21A 2ESPA 2YHOB 4WZ3A 1XXHE 3UINA 1T43A 2XWUA 3FRIA 2DZLA 1G3IA 1VEGA 5AITD 1UFZA 3L1ZA 4DHZF 1HT1E 4X57A 2DHYA 2KLYA 2F0RA 2K0BX 1VQ1A 4DDIA 2EKEA 1EFUB 3E95C 2O25A 1W4UA 1JATA 2OB4A 2MGWA 4GPRA 1Q34A 1ZGUA 1VEJA 3BZHA 2Z5DA 3W31B 2QGXA 1PGYA 3RCZB 2F4ZA 3GLHE 3FRHA 2ESKA 3O2UA 2O25C 2LTUA 5F6XA 4W5VA 4HEOA 2KJHA 2DAKA 5FQ2A 2JP7A 2CP8A 2AAKA 4LDTC 1JATB 2C2VB 3E46A 2BWBA 3GLFE 2K9DA 2QNJA 3P9HA 2DAYA 2ESQA 2BWEA 1ZMVA 3T6PA 1OAIA 2LBCA 2GRRA 2DAXA 1OTRA 1MN3A 3GLGE 2L4EA 1Z5SA 1QCQA 2C2VC 2JY8A 2HWJA 3HCTB 2CYXA 1SG9A 1VG5A 1IXSA 4CCGA 1M4QA 3B89A 4BVUB 3OBUA 2L2DA 2OXQA 2K07A 1KPQA 1FZYA 1HQYE 2EJSA 2AYVA 2DAEA 1S1QA 2JUJA 3LCUA 1CUKA 2CLWA 2CLWB 3ZNIC 2MT6A 1I7KA 2HLWA 1U9AA 1JBBA 3WE5A 1F4IA 4NR3B 3BBZA 2GJDA 1R4GA 3OBSA 2MR9A 3SY2C 1FBVC 1NV8A 1IFYA 4Q7JA 4II2C 1FXTA 2NVUC 5F6YA 2OOAA 4ONLA 4EJEA 1TTEA 1Z2UA 2GRPA 5KNLC 1P3QQ 2CWBA 1WJ7A 1Z3DA 5D1MA 2E2CA 4JQUA 3E95A 3OBXA 3H4JA 3KPAA 1WIVA 1C4ZD 4Y1LC 1UKXA 2L4FA 3IHPA 5EGGA 2EKFA 3VONB 3F92A 2YZ0A 2JZ0A 1ZMWA 3SQVC 4P5OG 4NRIA 5AIUB 3ZQSA 1JASA 5AITB 1E94E 2Y9PA 3ONGB 5IFRA 1PZVA 2WZJA 2KHHA 4BWFA 3VONC 4AUQA 3P9GA 2DAWA 2DENA 2JY7A 2DMFA 4F1IA 2EDIA 1YF9A 2AWFA 2LVPC 2LVNC 2H2YA 3EB6B 2B3TA 2GRQA 4ONLB 2Z6PA 2JNHA 1WHCA 2YBFA 4M1NA 2UYZA 5D0KA 3FE3A 5F6VA 5JNEB 2BEPA 1G41A 1VEKA 3RPGA 2FUHA 1Y8GA 2LVOC 2G3QA 1OKSA 2R0JA 1TR8A 3R3QA 4DBGB 4DDGA 1KPSA 4ONMA 5D1LA 2OOBA 4TKPA 2UCZA 3JVZA 5HPTC 3LCVB 2ZTDA 2KNZA 1OQYA 2GMIA 2ESOA 2FO3A 4JUEA 3H8KA 2MJ5B 4YC1A 2F4WA 4MDKA 1Y8XA 1J7DA 5AIEB 1XB2B 1Y6LA 4Y1LA 2DAGA 4NRGA 2JZ1A 1WZWA 5D1KA 1DO2A 2DAMA 4ZNYA 5F6EA 5JI2E 1UZXA 1HJPA 4R71A 3R42A 1YRVA 3K9PA 1WZVA 1JR3E 3TGDA 5D2MA
chains in the Genus database with same CATH superfamily
2ZBKB 3U61B 4QPLB 4XK8F 2RRUA 3A4SA 1NY6A 2Q2EB 3J7AS 4DS2A 4L8RC 1YE9A 1G4AE 2QSFX 3U60B 1ZV1A 2F5PA 1J74A 4A49B 2E5LM 1D0KA 3KS8A 4I4LA 1Q02A 5KQ8A 1G59A 2VQEM 1NV9A 1EIJA 3RZ3A 1WGLA 2XSZA 4FCWA 2O5RA 2LXPA 2FOIC 5A2QS 2KEBA 1YLAA 1L1ZA 1Q3BA 4B7HA 4EIWA 1K82A 2JY6B 3IECA 3K9OA 4IBJA 4GITA 1WXQA 1Z5CA 1IQPA 3FUWA 2BF8A 1D2NA 4LJ8A 2YQZA 1MU5A 3GRRA 1KFVA 2QBYB 3DFZA 2EBKA 4OU7A 4REZA 4ZPXA 4DV3M 4DR6M 2YB6A 2ERCA 2XFSA 1FNNA 5F6UA 5KO3A 2VF8A 1NHGC 4R62A 1HNZM 2H1RA 3JW0A 1IN4A 1UM8A 2F5OA 5KQDA 2BJWA 3I4YA 3VKGA 1OIPA 3SYKA 3PTFA 5FERB 5IREB 4QHSA 3CEGA 3FUVA 1IM2A 2XF3A 1PJJA 2RGOA 1DGGA 3WHKA 1AIPC 1NJGA 5IZ7D 2KW0A 1BVSA 4GKKM 1XMOM 4UN2B 4YIIU 5FSWA 3GLHB 1J7DB 1JB0F 2RGHA 4NRIB 1ZQ9A 3E4RA 4GIPA 4JI1M 4FH1A 2MH8A 2ZTCA 1GO5A 4LRSA 4JYAM 4IBFA 2VDBB 2KNVA 5JI3E 1R2ZA 1DV0A 1KSFX 3FN1B 1JASA 3KOWE 2KZSA 4L6V6 3ZH9B 2UXDM 4IP3B 3SMPA 3U5ZA 1X37A 3HY5A 4DHID 3I01M 2OQ4A 4WW0A 4NR3A 2C9OA 1IN7A 4AP4B 1N33M 3RFWA 3GPUA 2H5XA 4R3DA 4L78A 4LFCM 2Z6OA 3Q8XA 4D81A 2DWLA 2Y9MA 4A4CC 2DXIA 2CE7A 3FSHA 1SXJE 5EQTA 4AQYM 3UGBA 1IY1A 2QCUA 3I51A 1C7YA 3UIPA 3K1JA 2R45A 2LNHC 2UUCM 2GRNA 2Q0VA 4LF9M 4ONNA 4IBIA 1QZEA 4A3VB 3VK8A 4LJ4A 1GKIA 2HKJA 1V92A 2WSCF 3AOEA 4MGYE 4F2LA 5ITTA 3J81S 3JAMS 3FTDA 4Q5EC 4AZFA 3FUXA 5DFLA 3HCUB 1GL7A 4X62M 2HAKA 4L83A 2LVQD 1DO0A 3L2AA 3HZJA 2PX9B 2XFTA 3LW5F 1OIZA 2UUBM 5EP4A 3EIHA 4LADA 2JY5A 2R4EA 4NRVA 1QZMA 3SAUA 3L28A 3M7GA 1M4PA 1J5EM 2DKLA 2DNAA 3IG5A 1W5SA 1TDHA 3B7NA 2GROA 2RKOA 5F6DA 4G3OA 3AKZA 4JN6A 4IBKA 4WURA 2Y4WA 1N75A 2VF7A 4NOOB 2ONUA 4IIWA 4JXJA 1AYZA 2L6OA 2CHQA 4M9ZA 4NRGB 2OO9A 4P17A 4RKUF 3A46A 2VRRA 3FUTA 4I81A 3U6LA 4IBDA 3UGJA 4QOZC 3PNVA 1T6OA 3HX3A 1VDLA 3A45A 4FD2A 3KOYE 2EO2A 3GO8A 4NRWA 3K92A 5F6WA 2UUAM 4Q5HC 1LTMA 1YSYA 3A33A 2K47A 3SC3A 2EKKA 2FFJA 2JA2A 1PRBA 2KNAA 1KYIA 1IN8A 4MGIE 3TWKA 3R9XB 2AYVA 5D0MA 4ONNB 2A7LA 2C5RA 1T3TA 1TF0B 2CHGA 1TGUA 2W82A 1A5TA 1MJGM 2GMIB 2C9CA 4BB9A 3L1YA 1J7KA 2DI0A 1IBKM 3TWMA 1ZDNA 4V3KA 3CF2A 1HT2E 4DR3M 4HL4A 1QAOA 1QYRA 4GHAA 1ZMUA 1IY0A 4A4BC 2CV1A 3TL4X 2R62A 3NBIA 4PDGA 1GABA 1WR1B 3U5ZB 3J27B 2MROB 3KXEC 4GEWA 2Z7JA 4BLCA 2LH0A 3SAVA 2DHRA 3QAUA 2C4PA 1XMQM 2PWQA 4DHJC 2EBMA 2PE6A 3GLIE 4ONMB 2C98A 1RU3A 1WGNA 3L29A 5IWAM 1XHBA 4WP2A 3SARA 3UIOA 1QAQA 3LVWA 4AG6A 3TPZA 1R5LA 3KP0E 4I5SA 4R7GA 3PXGA 1A3SA 1U9BA 1N78A 3EVXA 1QDRA 3LVVA 2F5SA 4DR5M 1L2DA 1X23A 5LMUM 2LVAA 1QAMA 4S3OA 5ITYA 1KPPA 3OJ4A 2A5YB 4V3LA 3GP1A 1QDTA 1XWIA 2R0IA 2DAIA 4B7GA 4LF6M 4LF4M 1OJLA 4JI7M 1SXJC 1NNUC 1IN5A 3C3DA 2A4DA 2XZUA 3OBQA 3FYDA 2DWNA 2R6FA 2CRUA 3HHWA 4IBCA 3MMPA 4JI5M 4GHLA 2QHOB 1GJSA 3E21A 1YH2A 1ZUOA 2ESPA 2YHOB 4WZ3A 1XXHE 2YNMD 4FWGA 3UINA 2ZM6M 1T43A 4MGKE 4JI2M 3BOSA 3FRIA 1V33A 4FWHA 4NSOB 3WHLA 2DZLA 1DGHB 4L16A 5EXXA 2JWSA 1ORYB 3CGWA 4DV5M 1G3IA 1VEGA 4AI6A 1EE8A 3AJIB 5KPTA 2OPFA 5AITD 2VIIA 4KT0F 1UFZA 1OAOC 5LMNM 3L1ZA 1W5TA 1HT1E 4W5WA 3KFUG 4DHZF 1XC8A 4X57A 2DHYA 1E9RA 1TH4A 3HU3A 3GLFB 2KLYA 2F0RA 2ZAMA 3QWLA 2K0BX 3FYCA 5EP2A 2G5GX 4Z6YA 2V1CA 4IJFA 4X66M 1PJSA 4DV6M 1VQ1A 3RE8A 3VK7A 4IBGA 3MJ5A 4DDIA 5EP1A 2F4VM 2EKEA 4LG2A 1EFUB 3T38A 3FKEA 3KSJA 2WSEF 2J7OA 1R2YA 2XSZD 4RF1A 2O25A 2WSFF 5EXPA 5FLXS 3E95C 2CV0A 2DWZB 1W4UA 5DNYA 1JATA 2ZAOA 2OB4A 2MGWA 3VLFB 4GPRA 1Q34A 3I4VA 3UMMA 1HQCA 1JR3A 2APLA 4GC9A 1L1TA 4CGYB 2R44A 3THGA 2L7HA 1VEJA 5IT9S 3AOEC 3AOGA 1ZGUA 4CHTB 1TH2A 4NSRA 3BZHA 3HU1A 1IXZA 4LJAA 2Z5DA 4S12A 1N34M 3GPYA 3W31B 4Z8XA 3KP1E 4FCVA 3J2PB 4PD2A 2QGXA 1MX0A 2BNKA 2AHMA 1NHWC 3U6PA 1Z59A 4MGHA 1QVRA 1PGYA 3RCZB 2EUCA 3SASA 1Q39A 2CUZA 3GRYA 3T1YM 2F4ZA 1FJGM 4X64M 3GLHE 3FRHA 2ESKA 3O2UA 4M9SA 2O25C 2LTUA 1XXHB 2XZFA 5F6XA 4DR1M 4W5VA 4HEOA 3M0EA 2D7EA 2KJHA 2DAKA 5BR8M 5FQ2A 4JI8M 1D0LA 2JP7A 2CP8A 3SFZA 3UZUA 5H37D 1NSFA 2AAKA 4LDTC 2XEPA 2J7NA 1XNQM 1JATB 1JR3D 2C99A 3E46A 2C2VB 2BWBA 3GLFE 2K9DA 4AKGA 2QNJA 3HHYA 4K0KM 2QENA 3P9HA 2DAYA 4G6ZA 3U61A 2ESQA 4CISA 5DYIA 2Z8YM 1Q3CA 2BWEA 4M0WA 3GRVA 2ZANA 1ZMVA 3T6PA 3U60A 4LF7M 3L27A 4NC6A 5EJCA 1QUSA 4OVZB 2BJVA 1OAIA 2L09A 2LBCA 4X65M 1DGFA 3GLGB 2GRRA 2DAXA 1OTRA 4D80A 1MN3A 3GLGE 2L4EA 1Z5SA 1PJQA 1Z5BA 4JV5M 1QCQA 2C2VC 1SXJB 1R6BX 2I7PA 1SXJA 1HNXM 2JY8A 2FE8A 1QANA 2HWJA 1DGBA 3HCTB 2CV2A 2CYXA 4IBEA 2CHVA 1SG9A 1VG5A 1S3SA 5C18A 1IXSA 3KVWA 1M4QA 4CCGA 3B89A 4DV4M 4BVUB 2LHGA 4DUZM 3OBUA 2LHCA 2L2DA 3B74A 1NO1A 2OXQA 2XWUA 2K07A 1OFIA 1L2CA 1KPQA 2NQ8C 1FZYA 1HQYE 2YFQA 2EJSA 4LJ7A 2X4AA 3K8ZA 1DGHA 2DAEA 3ILKA 2JUJA 4FW9A 3LCUA 1S1QA 1CUKA 3RGPA 3GLHA 2HHHM 2CLWA 2CLWB 3ZNIC 4GH9A 2XGNA 2MT6A 3PVSA 2FH0A 3U6MA 1IY2A 1GJTA 1I7KA 2HLWA 2JXNA 3KOXE 3ZC7B 2F5QA 1U9AA 4I8OA 3DOAA 3RGSA 2C96A 1JBBA 4LJ5A 3WE5A 2HCBA 5ITXE 3GLGA 1F4IA 4NR3B 3BBZA 8CATA 2GJDA 1R4GA 3PNYA 4L15A 3OBSA 4B3MM 4AKIA 3LQQA 4IJEA 2MR9A 4JI4M 3CF0A 3B7ZA 1IBMM 3SY2C 1SXJD 3FTFA 1L2BA 1FBVC 1NV8A 1NJFA 3GRUA 3MHVC 3A98B 4LGMA 1IFYA 4Q7JA 4AW4A 1R7RA 3UK6A 1J09A 4M9XA 4DUYM 1FXTA 1H6UA 4II2C 2NVUC 4NXNM 1LV7A 2OOAA 5F6YA 4ONLA 4XGIA 2V6ZM 4JI3M 5C1BA 3D8LA 2D7GA 3AV0A 2UU9M 4EJEA 1TTEA 2G8LA 2R46A 3FTCA 3IG8A 4FVMA 4MGZE 2CFOA 3C58A 1K3XA 4ITQA 2GRPA 5KNLC 1OFHA 2QQ8A 4FCTA 4D82A 1NY5A 3U6EA 3FTEA 3HHZA 4II7A 1P3QQ 2CWBA 2R4JA 1WJ7A 4LJ6A 4OVZA 1Z3DA 3HJSA 4IBBA 4LY6A 2E2CA 5D1MA 2Z4RA 3KSXA 4G4QA 4JQUA 3L25A 1YUBA 5ITQA 3E9SA 4LGYA 1QQWA 3HGIA 3E95A 4M0DA 5ITUA 2UXBM 3OBXA 4TUWA 3H4JA 1NVMA 2O01F 4BBAA 3SMSA 2UXCM 3KPAA 3JR4A 3SAWA 1WIVA 1C4ZD 2V1UA 3QYBA 4NL4H 4Y1LC 1UKXA 2GQFA 4QOSA 4DR7M 4KHPM 2KRUA 2L4FA 1IXRC 2KXEA 3IHPA 3GPXA 5EGGA 2EKFA 4HLQA 1G8PA 1I4WA 2HL7A 3SHGB 3VONB 3D8BA 3F92A 4CIZA 5GKNA 1TDZA 4QNRA 2JZ0A 2YZ0A 1JQJC 2QPAA 2Z4SA 4GRIA 4G4RA 3AL0C 1ZMWA 3SQVC 2KA6B 1V34A 4P5OG 7CATA 4NRIA 4LRTA 1C1KA 4GMQA 5ITXA 2Y0TA 5EP3A 3SBJA 4JI6M 5AIUB 3NBXX 2F5NA 3HKPA 3LMMA 3FUUA 3TQSA 1D0MA 1E94E 1I94M 5AITB 3H4MA 2Y9PA 2FS1A 3ONGB 4LFAM 5IFRA 4MM3B 1PZVA 2WZJA 2KHHA 4LZJA 3KDSE 4BWFA 3VONC 3GPPA 3Q8GA 2XH9A 3HWSA 5KPRA 2DAWA 3P9GA 4AUQA 4KODA 3HJ8A 2DENA 2JY7A 2DMFA 2X49A 2Y21A 3B7QA 4F1IA 1GVNA 2EDIA 3KOZE 1YF9A 1E9SA 3CF6E 3HJQA 2LVPC 4RNAA 5F3WA 4LZZA 2AWFA 4LFBM 3HHXA 2LVNC 3ZQJA 3T1HM 3U6QA 2LWXA 2H2YA 2QBYA 2B3TA 3EB6B 1PJIA 3W0LB 2GRQA 3B9PA 2XLJA 3FD9A 4YHHM 3CTWB 3K2LA 4OX9M 4AG5A 4ONLB 4GC5A 2Z6PA 4DV7M 1IN6A 2KRKA 3U6DA 1NNJA 5FTMA 1IXSB 4B3SM 1QUTA 2DZNB 2JNHA 4DR4M 1WHCA 2GNOA 4CJ6A 4ANRA 2YBFA 4G4NA 1TH3A 4M1NA 2UYZA 5D0KA 3FE3A 3EIEA 5F6VA 3SHFA 5JNEB 2KZUA 3LQRA 4KLNA 4DV1M 4L4UA 1G41A 1VEKA 4G4OA 1K3WA 2BEPA 4LF8M 3RPGA 2FUHA 4FWDA 2DWMA 2P5TA 1Y8GA 2LVOC 2Y20A 3TE6A 5ITRA 2G3QA 1HNWM 1OKSA 2R0JA 3PFIA 2X8AA 1TR8A 3R3QA 3M6AA 4DBGB 2L7IA 2Y0QA 4AKHA 3GLFA 4OW0A 4MH0E 4PT5A 1PM5A 2J5YA 2DZOB 3GLIA 2EA0A 4DDGA 5E6JA 3HU2A 2I7NA 4QHTA 1N77A 4JI0M 3UJNA 1KPSA 4ONMA 5D1LA 3ZQSA 2OOBA 2M5ZA 5FTLA 4TKPA 3ZCBB 1G71A 5KPZA 3VKHA 3C9PA 2UCZA 4LF5M 2QZ4A 1N32M 3JVZA 3R8FA 4LCBA 3U6OA 5HPTC 3LCVB 3J7BA 2ZTDA 2KNZA 1GLNA 4KO8A 1OQYA 2GMIA 5EXTA 4DR2M 4B3RM 2ESOA 2N35A 3KS4A 2FO3A 3BXWA 4LJ9A 4PDIA 3SYLA 5FTNA 3W0FA 2KDLA 2M60A 1XNRM 3H8KA 4JUEA 3VDUA 4XBOA 5L8RF 2MJ5B 3AFHA 3DA1A 2QP9X 3OTOM 3U6SA 4YC1A 3W68A 3GQ4A 3I04M 4NXMM 2DVWB 3L26A 2F4WA 4MDKA 1Y8XA 3A42A 1Z6TA 5DYGA 1J7DA 5E26A 4PCZA 1IBLM 3GQ3A 5AIEB 1VDDA 1Z2UA 1XB2B 3QYEA 4P16A 1Y6LA 2DAGA 4Y1LA 3MK6A 4B7FA 3VFDA 4MB7A 4NRGA 4B08A 2JZ1A 1WZWA 5D1KA 1DO2A 2DAMA 3GQ5A 2CEAA 2YR0A 3SATA 1Z5AA 4B3TM 1ZAEA 1AUAA 1L8QA 4ZNYA 3GLIB 1PJTA 1XXHA 5JI2E 3JR5A 2FNAA 2LXEA 4DV0M 1HR0M 5F6EA 1UZXA 1HJPA 5FTJA 3VDPA 3W67A 4YY3M 4R71A 1GL6A 3R42A 5BPVA 3U6CA 1YRVA 2R65A 3J80S 3V76A 1E32A 5EXSA 2R18A 2K6BA 3DZDA 4Y28F 2VQFM 3K9PA 4DV2M 3T15A 1JR3E 2D7HA 3C3EA 4QNMA 2Z3XA 1N36M 1WZVA 4RF0A 3TWLA 5FTKA 3TGDA 3KW6A 3NWLA 4GKJM 5D2MA
chains in the Genus database with same CATH topology
4QPLB 2RRUA 3A4SA 4DS2A 1G4AE 2QSFX 1ZV1A 1J74A 4A49B 1Q02A 1NV9A 3RZ3A 1WGLA 2LXPA 1YLAA 2JY6B 3IECA 3K9OA 2BF8A 2EBKA 2YB6A 5F6UA 4R62A 3JW0A 5FERB 3PTFA 3CEGA 1IM2A 1AIPC 1BVSA 4UN2B 4YIIU 1J7DB 4NRIB 4FH1A 2ZTCA 1GO5A 3FN1B 2KNVA 1DV0A 4IP3B 4DHID 4NR3A 4AP4B 2H5XA 2Z6OA 2Y9MA 4A4CC 3UGBA 3FSHA 3UIPA 1C7YA 2GRNA 2Q0VA 4ONNA 1QZEA 4F2LA 1V92A 4Q5EC 5DFLA 3HCUB 2HAKA 4L83A 2LVQD 1DO0A 2PX9B 4LADA 2JY5A 1M4PA 2DKLA 2DNAA 2GROA 5F6DA 4G3OA 2Y4WA 2ONUA 1AYZA 4NRGB 2OO9A 2VRRA 1T6OA 1VDLA 5F6WA 4Q5HC 3A33A 2EKKA 2KNAA 1KYIA 5D0MA 4ONNB 2A7LA 1A5TA 2GMIB 4V3KA 3L1YA 2DI0A 1ZDNA 1HT2E 1ZMUA 4A4BC 1WR1B 2MROB 4GEWA 2C4PA 2PWQA 4DHJC 2EBMA 2PE6A 3GLIE 4ONMB 1WGNA 3UIOA 4WP2A 1A3SA 1U9BA 3EVXA 1X23A 2LVAA 4S3OA 1KPPA 3OJ4A 4V3LA 2R0IA 2DAIA 2A4DA 3OBQA 1YH2A 3MMPA 1ZUOA 2QHOB 3E21A 2ESPA 2YHOB 4WZ3A 1XXHE 3UINA 1T43A 2XWUA 3FRIA 2DZLA 1G3IA 1VEGA 5AITD 1UFZA 3L1ZA 4DHZF 1HT1E 4X57A 2DHYA 2KLYA 2F0RA 2K0BX 1VQ1A 4DDIA 2EKEA 1EFUB 3E95C 2O25A 1W4UA 1JATA 2OB4A 2MGWA 4GPRA 1Q34A 1ZGUA 1VEJA 3BZHA 2Z5DA 3W31B 2QGXA 1PGYA 3RCZB 2F4ZA 3GLHE 3FRHA 2ESKA 3O2UA 2O25C 2LTUA 5F6XA 4W5VA 4HEOA 2KJHA 2DAKA 5FQ2A 2JP7A 2CP8A 2AAKA 4LDTC 1JATB 2C2VB 3E46A 2BWBA 3GLFE 2K9DA 2QNJA 3P9HA 2DAYA 2ESQA 2BWEA 1ZMVA 3T6PA 1OAIA 2LBCA 2GRRA 2DAXA 1OTRA 1MN3A 3GLGE 2L4EA 1Z5SA 1QCQA 2C2VC 2JY8A 2HWJA 3HCTB 2CYXA 1SG9A 1VG5A 1IXSA 4CCGA 1M4QA 3B89A 4BVUB 3OBUA 2L2DA 2OXQA 2K07A 1KPQA 1FZYA 1HQYE 2EJSA 2AYVA 2DAEA 1S1QA 2JUJA 3LCUA 1CUKA 2CLWA 2CLWB 3ZNIC 2MT6A 1I7KA 2HLWA 1U9AA 1JBBA 3WE5A 1F4IA 4NR3B 3BBZA 2GJDA 1R4GA 3OBSA 2MR9A 3SY2C 1FBVC 1NV8A 1IFYA 4Q7JA 4II2C 1FXTA 2NVUC 5F6YA 2OOAA 4ONLA 4EJEA 1TTEA 1Z2UA 2GRPA 5KNLC 1P3QQ 2CWBA 1WJ7A 1Z3DA 5D1MA 2E2CA 4JQUA 3E95A 3OBXA 3H4JA 3KPAA 1WIVA 1C4ZD 4Y1LC 1UKXA 2L4FA 3IHPA 5EGGA 2EKFA 3VONB 3F92A 2YZ0A 2JZ0A 1ZMWA 3SQVC 4P5OG 4NRIA 5AIUB 3ZQSA 1JASA 5AITB 1E94E 2Y9PA 3ONGB 5IFRA 1PZVA 2WZJA 2KHHA 4BWFA 3VONC 4AUQA 3P9GA 2DAWA 2DENA 2JY7A 2DMFA 4F1IA 2EDIA 1YF9A 2AWFA 2LVPC 2LVNC 2H2YA 3EB6B 2B3TA 2GRQA 4ONLB 2Z6PA 2JNHA 1WHCA 2YBFA 4M1NA 2UYZA 5D0KA 3FE3A 5F6VA 5JNEB 2BEPA 1G41A 1VEKA 3RPGA 2FUHA 1Y8GA 2LVOC 2G3QA 1OKSA 2R0JA 1TR8A 3R3QA 4DBGB 4DDGA 1KPSA 4ONMA 5D1LA 2OOBA 4TKPA 2UCZA 3JVZA 5HPTC 3LCVB 2ZTDA 2KNZA 1OQYA 2GMIA 2ESOA 2FO3A 4JUEA 3H8KA 2MJ5B 4YC1A 2F4WA 4MDKA 1Y8XA 1J7DA 5AIEB 1XB2B 1Y6LA 4Y1LA 2DAGA 4NRGA 2JZ1A 1WZWA 5D1KA 1DO2A 2DAMA 4ZNYA 5F6EA 5JI2E 1UZXA 1HJPA 4R71A 3R42A 1YRVA 3K9PA 1WZVA 1JR3E 3TGDA 5D2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QPL B;  2RRU A;  3A4S A;  4DS2 A;  1G4A E;  2QSF X;  1ZV1 A;  1J74 A;  4A49 B;  1Q02 A;  1NV9 A;  3RZ3 A;  1WGL A;  2LXP A;  1YLA A;  2JY6 B;  3IEC A;  3K9O A;  2BF8 A;  2EBK A;  2YB6 A;  5F6U A;  4R62 A;  3JW0 A;  5FER B;  3PTF A;  3CEG A;  1IM2 A;  1AIP C;  1BVS A;  4UN2 B;  4YII U;  1J7D B;  4NRI B;  4FH1 A;  2ZTC A;  1GO5 A;  3FN1 B;  2KNV A;  1DV0 A;  4IP3 B;  4DHI D;  4NR3 A;  4AP4 B;  2H5X A;  2Z6O A;  2Y9M A;  4A4C C;  3UGB A;  3FSH A;  3UIP A;  1C7Y A;  2GRN A;  2Q0V A;  4ONN A;  1QZE A;  4F2L A;  1V92 A;  4Q5E C;  5DFL A;  3HCU B;  2HAK A;  4L83 A;  2LVQ D;  1DO0 A;  2PX9 B;  4LAD A;  2JY5 A;  1M4P A;  2DKL A;  2DNA A;  2GRO A;  5F6D A;  4G3O A;  2Y4W A;  2ONU A;  1AYZ A;  4NRG B;  2OO9 A;  2VRR A;  1T6O A;  1VDL A;  5F6W A;  4Q5H C;  3A33 A;  2EKK A;  2KNA A;  1KYI A;  5D0M A;  4ONN B;  2A7L A;  1A5T A;  2GMI B;  4V3K A;  3L1Y A;  2DI0 A;  1ZDN A;  1HT2 E;  1ZMU A;  4A4B C;  1WR1 B;  2MRO B;  4GEW A;  2C4P A;  2PWQ A;  4DHJ C;  2EBM A;  2PE6 A;  3GLI E;  4ONM B;  1WGN A;  3UIO A;  4WP2 A;  1A3S A;  1U9B A;  3EVX A;  1X23 A;  2LVA A;  4S3O A;  1KPP A;  3OJ4 A;  4V3L A;  2R0I A;  2DAI A;  2A4D A;  3OBQ A;  1YH2 A;  3MMP A;  1ZUO A;  2QHO B;  3E21 A;  2ESP A;  2YHO B;  4WZ3 A;  1XXH E;  3UIN A;  1T43 A;  2XWU A;  3FRI A;  2DZL A;  1G3I A;  1VEG A;  5AIT D;  1UFZ A;  3L1Z A;  4DHZ F;  1HT1 E;  4X57 A;  2DHY A;  2KLY A;  2F0R A;  2K0B X;  1VQ1 A;  4DDI A;  2EKE A;  1EFU B;  3E95 C;  2O25 A;  1W4U A;  1JAT A;  2OB4 A;  2MGW A;  4GPR A;  1Q34 A;  1ZGU A;  1VEJ A;  3BZH A;  2Z5D A;  3W31 B;  2QGX A;  1PGY A;  3RCZ B;  2F4Z A;  3GLH E;  3FRH A;  2ESK A;  3O2U A;  2O25 C;  2LTU A;  5F6X A;  4W5V A;  4HEO A;  2KJH A;  2DAK A;  5FQ2 A;  2JP7 A;  2CP8 A;  2AAK A;  4LDT C;  1JAT B;  2C2V B;  3E46 A;  2BWB A;  3GLF E;  2K9D A;  2QNJ A;  3P9H A;  2DAY A;  2ESQ A;  2BWE A;  1ZMV A;  3T6P A;  1OAI A;  2LBC A;  2GRR A;  2DAX A;  1OTR A;  1MN3 A;  3GLG E;  2L4E A;  1Z5S A;  1QCQ A;  2C2V C;  2JY8 A;  2HWJ A;  3HCT B;  2CYX A;  1SG9 A;  1VG5 A;  1IXS A;  4CCG A;  1M4Q A;  3B89 A;  4BVU B;  3OBU A;  2L2D A;  2OXQ A;  2K07 A;  1KPQ A;  1FZY A;  1HQY E;  2EJS A;  2AYV A;  2DAE A;  1S1Q A;  2JUJ A;  3LCU A;  1CUK A;  2CLW A;  2CLW B;  3ZNI C;  2MT6 A;  1I7K A;  2HLW A;  1U9A A;  1JBB A;  3WE5 A;  1F4I A;  4NR3 B;  3BBZ A;  2GJD A;  1R4G A;  3OBS A;  2MR9 A;  3SY2 C;  1FBV C;  1NV8 A;  1IFY A;  4Q7J A;  4II2 C;  1FXT A;  2NVU C;  5F6Y A;  2OOA A;  4ONL A;  4EJE A;  1TTE A;  1Z2U A;  2GRP A;  5KNL C;  1P3Q Q;  2CWB A;  1WJ7 A;  1Z3D A;  5D1M A;  2E2C A;  4JQU A;  3E95 A;  3OBX A;  3H4J A;  3KPA A;  1WIV A;  1C4Z D;  4Y1L C;  1UKX A;  2L4F A;  3IHP A;  5EGG A;  2EKF A;  3VON B;  3F92 A;  2YZ0 A;  2JZ0 A;  1ZMW A;  3SQV C;  4P5O G;  4NRI A;  5AIU B;  3ZQS A;  1JAS A;  5AIT B;  1E94 E;  2Y9P A;  3ONG B;  5IFR A;  1PZV A;  2WZJ A;  2KHH A;  4BWF A;  3VON C;  4AUQ A;  3P9G A;  2DAW A;  2DEN A;  2JY7 A;  2DMF A;  4F1I A;  2EDI A;  1YF9 A;  2AWF A;  2LVP C;  2LVN C;  2H2Y A;  3EB6 B;  2B3T A;  2GRQ A;  4ONL B;  2Z6P A;  2JNH A;  1WHC A;  2YBF A;  4M1N A;  2UYZ A;  5D0K A;  3FE3 A;  5F6V A;  5JNE B;  2BEP A;  1G41 A;  1VEK A;  3RPG A;  2FUH A;  1Y8G A;  2LVO C;  2G3Q A;  1OKS A;  2R0J A;  1TR8 A;  3R3Q A;  4DBG B;  4DDG A;  1KPS A;  4ONM A;  5D1L A;  2OOB A;  4TKP A;  2UCZ A;  3JVZ A;  5HPT C;  3LCV B;  2ZTD A;  2KNZ A;  1OQY A;  2GMI A;  2ESO A;  2FO3 A;  4JUE A;  3H8K A;  2MJ5 B;  4YC1 A;  2F4W A;  4MDK A;  1Y8X A;  1J7D A;  5AIE B;  1XB2 B;  1Y6L A;  4Y1L A;  2DAG A;  4NRG A;  2JZ1 A;  1WZW A;  5D1K A;  1DO2 A;  2DAM A;  4ZNY A;  5F6E A;  5JI2 E;  1UZX A;  1HJP A;  4R71 A;  3R42 A;  1YRV A;  3K9P A;  1WZV A;  1JR3 E;  3TGD A;  5D2M A; 
#chains in the Genus database with same CATH topology
 2ZBK B;  3U61 B;  4QPL B;  4XK8 F;  2RRU A;  3A4S A;  1NY6 A;  2Q2E B;  3J7A S;  4DS2 A;  4L8R C;  1YE9 A;  1G4A E;  2QSF X;  3U60 B;  1ZV1 A;  2F5P A;  1J74 A;  4A49 B;  2E5L M;  1D0K A;  3KS8 A;  4I4L A;  1Q02 A;  5KQ8 A;  1G59 A;  2VQE M;  1NV9 A;  1EIJ A;  3RZ3 A;  1WGL A;  2XSZ A;  4FCW A;  2O5R A;  2LXP A;  2FOI C;  5A2Q S;  2KEB A;  1YLA A;  1L1Z A;  1Q3B A;  4B7H A;  4EIW A;  1K82 A;  2JY6 B;  3IEC A;  3K9O A;  4IBJ A;  4GIT A;  1WXQ A;  1Z5C A;  1IQP A;  3FUW A;  2BF8 A;  1D2N A;  4LJ8 A;  2YQZ A;  1MU5 A;  3GRR A;  1KFV A;  2QBY B;  3DFZ A;  2EBK A;  4OU7 A;  4REZ A;  4ZPX A;  4DV3 M;  4DR6 M;  2YB6 A;  2ERC A;  2XFS A;  1FNN A;  5F6U A;  5KO3 A;  2VF8 A;  1NHG C;  4R62 A;  1HNZ M;  2H1R A;  3JW0 A;  1IN4 A;  1UM8 A;  2F5O A;  5KQD A;  2BJW A;  3I4Y A;  3VKG A;  1OIP A;  3SYK A;  3PTF A;  5FER B;  5IRE B;  4QHS A;  3CEG A;  3FUV A;  1IM2 A;  2XF3 A;  1PJJ A;  2RGO A;  1DGG A;  3WHK A;  1AIP C;  1NJG A;  5IZ7 D;  2KW0 A;  1BVS A;  4GKK M;  1XMO M;  4UN2 B;  4YII U;  5FSW A;  3GLH B;  1J7D B;  1JB0 F;  2RGH A;  4NRI B;  1ZQ9 A;  3E4R A;  4GIP A;  4JI1 M;  4FH1 A;  2MH8 A;  2ZTC A;  1GO5 A;  4LRS A;  4JYA M;  4IBF A;  2VDB B;  2KNV A;  5JI3 E;  1R2Z A;  1DV0 A;  1KSF X;  3FN1 B;  1JAS A;  3KOW E;  2KZS A;  4L6V 6;  3ZH9 B;  2UXD M;  4IP3 B;  3SMP A;  3U5Z A;  1X37 A;  3HY5 A;  4DHI D;  3I01 M;  2OQ4 A;  4WW0 A;  4NR3 A;  2C9O A;  1IN7 A;  4AP4 B;  1N33 M;  3RFW A;  3GPU A;  2H5X A;  4R3D A;  4L78 A;  4LFC M;  2Z6O A;  3Q8X A;  4D81 A;  2DWL A;  2Y9M A;  4A4C C;  2DXI A;  2CE7 A;  3FSH A;  1SXJ E;  5EQT A;  4AQY M;  3UGB A;  1IY1 A;  2QCU A;  3I51 A;  1C7Y A;  3UIP A;  3K1J A;  2R45 A;  2LNH C;  2UUC M;  2GRN A;  2Q0V A;  4LF9 M;  4ONN A;  4IBI A;  1QZE A;  4A3V B;  3VK8 A;  4LJ4 A;  1GKI A;  2HKJ A;  1V92 A;  2WSC F;  3AOE A;  4MGY E;  4F2L A;  5ITT A;  3J81 S;  3JAM S;  3FTD A;  4Q5E C;  4AZF A;  3FUX A;  5DFL A;  3HCU B;  1GL7 A;  4X62 M;  2HAK A;  4L83 A;  2LVQ D;  1DO0 A;  3L2A A;  3HZJ A;  2PX9 B;  2XFT A;  3LW5 F;  1OIZ A;  2UUB M;  5EP4 A;  3EIH A;  4LAD A;  2JY5 A;  2R4E A;  4NRV A;  1QZM A;  3SAU A;  3L28 A;  3M7G A;  1M4P A;  1J5E M;  2DKL A;  2DNA A;  3IG5 A;  1W5S A;  1TDH A;  3B7N A;  2GRO A;  2RKO A;  5F6D A;  4G3O A;  3AKZ A;  4JN6 A;  4IBK A;  4WUR A;  2Y4W A;  1N75 A;  2VF7 A;  4NOO B;  2ONU A;  4IIW A;  4JXJ A;  1AYZ A;  2L6O A;  2CHQ A;  4M9Z A;  4NRG B;  2OO9 A;  4P17 A;  4RKU F;  3A46 A;  2VRR A;  3FUT A;  4I81 A;  3U6L A;  4IBD A;  3UGJ A;  4QOZ C;  3PNV A;  1T6O A;  3HX3 A;  1VDL A;  3A45 A;  4FD2 A;  3KOY E;  2EO2 A;  3GO8 A;  4NRW A;  3K92 A;  5F6W A;  2UUA M;  4Q5H C;  1LTM A;  1YSY A;  3A33 A;  2K47 A;  3SC3 A;  2EKK A;  2FFJ A;  2JA2 A;  1PRB A;  2KNA A;  1KYI A;  1IN8 A;  4MGI E;  3TWK A;  3R9X B;  2AYV A;  5D0M A;  4ONN B;  2A7L A;  2C5R A;  1T3T A;  1TF0 B;  2CHG A;  1TGU A;  2W82 A;  1A5T A;  1MJG M;  2GMI B;  2C9C A;  4BB9 A;  3L1Y A;  1J7K A;  2DI0 A;  1IBK M;  3TWM A;  1ZDN A;  4V3K A;  3CF2 A;  1HT2 E;  4DR3 M;  4HL4 A;  1QAO A;  1QYR A;  4GHA A;  1ZMU A;  1IY0 A;  4A4B C;  2CV1 A;  3TL4 X;  2R62 A;  3NBI A;  4PDG A;  1GAB A;  1WR1 B;  3U5Z B;  3J27 B;  2MRO B;  3KXE C;  4GEW A;  2Z7J A;  4BLC A;  2LH0 A;  3SAV A;  2DHR A;  3QAU A;  2C4P A;  1XMQ M;  2PWQ A;  4DHJ C;  2EBM A;  2PE6 A;  3GLI E;  4ONM B;  2C98 A;  1RU3 A;  1WGN A;  3L29 A;  5IWA M;  1XHB A;  4WP2 A;  3SAR A;  3UIO A;  1QAQ A;  3LVW A;  4AG6 A;  3TPZ A;  1R5L A;  3KP0 E;  4I5S A;  4R7G A;  3PXG A;  1A3S A;  1U9B A;  1N78 A;  3EVX A;  1QDR A;  3LVV A;  2F5S A;  4DR5 M;  1L2D A;  1X23 A;  5LMU M;  2LVA A;  1QAM A;  4S3O A;  5ITY A;  1KPP A;  3OJ4 A;  2A5Y B;  4V3L A;  3GP1 A;  1QDT A;  1XWI A;  2R0I A;  2DAI A;  4B7G A;  4LF6 M;  4LF4 M;  1OJL A;  4JI7 M;  1SXJ C;  1NNU C;  1IN5 A;  3C3D A;  2A4D A;  2XZU A;  3OBQ A;  3FYD A;  2DWN A;  2R6F A;  2CRU A;  3HHW A;  4IBC A;  3MMP A;  4JI5 M;  4GHL A;  2QHO B;  1GJS A;  3E21 A;  1YH2 A;  1ZUO A;  2ESP A;  2YHO B;  4WZ3 A;  1XXH E;  2YNM D;  4FWG A;  3UIN A;  2ZM6 M;  1T43 A;  4MGK E;  4JI2 M;  3BOS A;  3FRI A;  1V33 A;  4FWH A;  4NSO B;  3WHL A;  2DZL A;  1DGH B;  4L16 A;  5EXX A;  2JWS A;  1ORY B;  3CGW A;  4DV5 M;  1G3I A;  1VEG A;  4AI6 A;  1EE8 A;  3AJI B;  5KPT A;  2OPF A;  5AIT D;  2VII A;  4KT0 F;  1UFZ A;  1OAO C;  5LMN M;  3L1Z A;  1W5T A;  1HT1 E;  4W5W A;  3KFU G;  4DHZ F;  1XC8 A;  4X57 A;  2DHY A;  1E9R A;  1TH4 A;  3HU3 A;  3GLF B;  2KLY A;  2F0R A;  2ZAM A;  3QWL A;  2K0B X;  3FYC A;  5EP2 A;  2G5G X;  4Z6Y A;  2V1C A;  4IJF A;  4X66 M;  1PJS A;  4DV6 M;  1VQ1 A;  3RE8 A;  3VK7 A;  4IBG A;  3MJ5 A;  4DDI A;  5EP1 A;  2F4V M;  2EKE A;  4LG2 A;  1EFU B;  3T38 A;  3FKE A;  3KSJ A;  2WSE F;  2J7O A;  1R2Y A;  2XSZ D;  4RF1 A;  2O25 A;  2WSF F;  5EXP A;  5FLX S;  3E95 C;  2CV0 A;  2DWZ B;  1W4U A;  5DNY A;  1JAT A;  2ZAO A;  2OB4 A;  2MGW A;  3VLF B;  4GPR A;  1Q34 A;  3I4V A;  3UMM A;  1HQC A;  1JR3 A;  2APL A;  4GC9 A;  1L1T A;  4CGY B;  2R44 A;  3THG A;  2L7H A;  1VEJ A;  5IT9 S;  3AOE C;  3AOG A;  1ZGU A;  4CHT B;  1TH2 A;  4NSR A;  3BZH A;  3HU1 A;  1IXZ A;  4LJA A;  2Z5D A;  4S12 A;  1N34 M;  3GPY A;  3W31 B;  4Z8X A;  3KP1 E;  4FCV A;  3J2P B;  4PD2 A;  2QGX A;  1MX0 A;  2BNK A;  2AHM A;  1NHW C;  3U6P A;  1Z59 A;  4MGH A;  1QVR A;  1PGY A;  3RCZ B;  2EUC A;  3SAS A;  1Q39 A;  2CUZ A;  3GRY A;  3T1Y M;  2F4Z A;  1FJG M;  4X64 M;  3GLH E;  3FRH A;  2ESK A;  3O2U A;  4M9S A;  2O25 C;  2LTU A;  1XXH B;  2XZF A;  5F6X A;  4DR1 M;  4W5V A;  4HEO A;  3M0E A;  2D7E A;  2KJH A;  2DAK A;  5BR8 M;  5FQ2 A;  4JI8 M;  1D0L A;  2JP7 A;  2CP8 A;  3SFZ A;  3UZU A;  5H37 D;  1NSF A;  2AAK A;  4LDT C;  2XEP A;  2J7N A;  1XNQ M;  1JAT B;  1JR3 D;  2C99 A;  3E46 A;  2C2V B;  2BWB A;  3GLF E;  2K9D A;  4AKG A;  2QNJ A;  3HHY A;  4K0K M;  2QEN A;  3P9H A;  2DAY A;  4G6Z A;  3U61 A;  2ESQ A;  4CIS A;  5DYI A;  2Z8Y M;  1Q3C A;  2BWE A;  4M0W A;  3GRV A;  2ZAN A;  1ZMV A;  3T6P A;  3U60 A;  4LF7 M;  3L27 A;  4NC6 A;  5EJC A;  1QUS A;  4OVZ B;  2BJV A;  1OAI A;  2L09 A;  2LBC A;  4X65 M;  1DGF A;  3GLG B;  2GRR A;  2DAX A;  1OTR A;  4D80 A;  1MN3 A;  3GLG E;  2L4E A;  1Z5S A;  1PJQ A;  1Z5B A;  4JV5 M;  1QCQ A;  2C2V C;  1SXJ B;  1R6B X;  2I7P A;  1SXJ A;  1HNX M;  2JY8 A;  2FE8 A;  1QAN A;  2HWJ A;  1DGB A;  3HCT B;  2CV2 A;  2CYX A;  4IBE A;  2CHV A;  1SG9 A;  1VG5 A;  1S3S A;  5C18 A;  1IXS A;  3KVW A;  1M4Q A;  4CCG A;  3B89 A;  4DV4 M;  4BVU B;  2LHG A;  4DUZ M;  3OBU A;  2LHC A;  2L2D A;  3B74 A;  1NO1 A;  2OXQ A;  2XWU A;  2K07 A;  1OFI A;  1L2C A;  1KPQ A;  2NQ8 C;  1FZY A;  1HQY E;  2YFQ A;  2EJS A;  4LJ7 A;  2X4A A;  3K8Z A;  1DGH A;  2DAE A;  3ILK A;  2JUJ A;  4FW9 A;  3LCU A;  1S1Q A;  1CUK A;  3RGP A;  3GLH A;  2HHH M;  2CLW A;  2CLW B;  3ZNI C;  4GH9 A;  2XGN A;  2MT6 A;  3PVS A;  2FH0 A;  3U6M A;  1IY2 A;  1GJT A;  1I7K A;  2HLW A;  2JXN A;  3KOX E;  3ZC7 B;  2F5Q A;  1U9A A;  4I8O A;  3DOA A;  3RGS A;  2C96 A;  1JBB A;  4LJ5 A;  3WE5 A;  2HCB A;  5ITX E;  3GLG A;  1F4I A;  4NR3 B;  3BBZ A;  8CAT A;  2GJD A;  1R4G A;  3PNY A;  4L15 A;  3OBS A;  4B3M M;  4AKI A;  3LQQ A;  4IJE A;  2MR9 A;  4JI4 M;  3CF0 A;  3B7Z A;  1IBM M;  3SY2 C;  1SXJ D;  3FTF A;  1L2B A;  1FBV C;  1NV8 A;  1NJF A;  3GRU A;  3MHV C;  3A98 B;  4LGM A;  1IFY A;  4Q7J A;  4AW4 A;  1R7R A;  3UK6 A;  1J09 A;  4M9X A;  4DUY M;  1FXT A;  1H6U A;  4II2 C;  2NVU C;  4NXN M;  1LV7 A;  2OOA A;  5F6Y A;  4ONL A;  4XGI A;  2V6Z M;  4JI3 M;  5C1B A;  3D8L A;  2D7G A;  3AV0 A;  2UU9 M;  4EJE A;  1TTE A;  2G8L A;  2R46 A;  3FTC A;  3IG8 A;  4FVM A;  4MGZ E;  2CFO A;  3C58 A;  1K3X A;  4ITQ A;  2GRP A;  5KNL C;  1OFH A;  2QQ8 A;  4FCT A;  4D82 A;  1NY5 A;  3U6E A;  3FTE A;  3HHZ A;  4II7 A;  1P3Q Q;  2CWB A;  2R4J A;  1WJ7 A;  4LJ6 A;  4OVZ A;  1Z3D A;  3HJS A;  4IBB A;  4LY6 A;  2E2C A;  5D1M A;  2Z4R A;  3KSX A;  4G4Q A;  4JQU A;  3L25 A;  1YUB A;  5ITQ A;  3E9S A;  4LGY A;  1QQW A;  3HGI A;  3E95 A;  4M0D A;  5ITU A;  2UXB M;  3OBX A;  4TUW A;  3H4J A;  1NVM A;  2O01 F;  4BBA A;  3SMS A;  2UXC M;  3KPA A;  3JR4 A;  3SAW A;  1WIV A;  1C4Z D;  2V1U A;  3QYB A;  4NL4 H;  4Y1L C;  1UKX A;  2GQF A;  4QOS A;  4DR7 M;  4KHP M;  2KRU A;  2L4F A;  1IXR C;  2KXE A;  3IHP A;  3GPX A;  5EGG A;  2EKF A;  4HLQ A;  1G8P A;  1I4W A;  2HL7 A;  3SHG B;  3VON B;  3D8B A;  3F92 A;  4CIZ A;  5GKN A;  1TDZ A;  4QNR A;  2JZ0 A;  2YZ0 A;  1JQJ C;  2QPA A;  2Z4S A;  4GRI A;  4G4R A;  3AL0 C;  1ZMW A;  3SQV C;  2KA6 B;  1V34 A;  4P5O G;  7CAT A;  4NRI A;  4LRT A;  1C1K A;  4GMQ A;  5ITX A;  2Y0T A;  5EP3 A;  3SBJ A;  4JI6 M;  5AIU B;  3NBX X;  2F5N A;  3HKP A;  3LMM A;  3FUU A;  3TQS A;  1D0M A;  1E94 E;  1I94 M;  5AIT B;  3H4M A;  2Y9P A;  2FS1 A;  3ONG B;  4LFA M;  5IFR A;  4MM3 B;  1PZV A;  2WZJ A;  2KHH A;  4LZJ A;  3KDS E;  4BWF A;  3VON C;  3GPP A;  3Q8G A;  2XH9 A;  3HWS A;  5KPR A;  2DAW A;  3P9G A;  4AUQ A;  4KOD A;  3HJ8 A;  2DEN A;  2JY7 A;  2DMF A;  2X49 A;  2Y21 A;  3B7Q A;  4F1I A;  1GVN A;  2EDI A;  3KOZ E;  1YF9 A;  1E9S A;  3CF6 E;  3HJQ A;  2LVP C;  4RNA A;  5F3W A;  4LZZ A;  2AWF A;  4LFB M;  3HHX A;  2LVN C;  3ZQJ A;  3T1H M;  3U6Q A;  2LWX A;  2H2Y A;  2QBY A;  2B3T A;  3EB6 B;  1PJI A;  3W0L B;  2GRQ A;  3B9P A;  2XLJ A;  3FD9 A;  4YHH M;  3CTW B;  3K2L A;  4OX9 M;  4AG5 A;  4ONL B;  4GC5 A;  2Z6P A;  4DV7 M;  1IN6 A;  2KRK A;  3U6D A;  1NNJ A;  5FTM A;  1IXS B;  4B3S M;  1QUT A;  2DZN B;  2JNH A;  4DR4 M;  1WHC A;  2GNO A;  4CJ6 A;  4ANR A;  2YBF A;  4G4N A;  1TH3 A;  4M1N A;  2UYZ A;  5D0K A;  3FE3 A;  3EIE A;  5F6V A;  3SHF A;  5JNE B;  2KZU A;  3LQR A;  4KLN A;  4DV1 M;  4L4U A;  1G41 A;  1VEK A;  4G4O A;  1K3W A;  2BEP A;  4LF8 M;  3RPG A;  2FUH A;  4FWD A;  2DWM A;  2P5T A;  1Y8G A;  2LVO C;  2Y20 A;  3TE6 A;  5ITR A;  2G3Q A;  1HNW M;  1OKS A;  2R0J A;  3PFI A;  2X8A A;  1TR8 A;  3R3Q A;  3M6A A;  4DBG B;  2L7I A;  2Y0Q A;  4AKH A;  3GLF A;  4OW0 A;  4MH0 E;  4PT5 A;  1PM5 A;  2J5Y A;  2DZO B;  3GLI A;  2EA0 A;  4DDG A;  5E6J A;  3HU2 A;  2I7N A;  4QHT A;  1N77 A;  4JI0 M;  3UJN A;  1KPS A;  4ONM A;  5D1L A;  3ZQS A;  2OOB A;  2M5Z A;  5FTL A;  4TKP A;  3ZCB B;  1G71 A;  5KPZ A;  3VKH A;  3C9P A;  2UCZ A;  4LF5 M;  2QZ4 A;  1N32 M;  3JVZ A;  3R8F A;  4LCB A;  3U6O A;  5HPT C;  3LCV B;  3J7B A;  2ZTD A;  2KNZ A;  1GLN A;  4KO8 A;  1OQY A;  2GMI A;  5EXT A;  4DR2 M;  4B3R M;  2ESO A;  2N35 A;  3KS4 A;  2FO3 A;  3BXW A;  4LJ9 A;  4PDI A;  3SYL A;  5FTN A;  3W0F A;  2KDL A;  2M60 A;  1XNR M;  3H8K A;  4JUE A;  3VDU A;  4XBO A;  5L8R F;  2MJ5 B;  3AFH A;  3DA1 A;  2QP9 X;  3OTO M;  3U6S A;  4YC1 A;  3W68 A;  3GQ4 A;  3I04 M;  4NXM M;  2DVW B;  3L26 A;  2F4W A;  4MDK A;  1Y8X A;  3A42 A;  1Z6T A;  5DYG A;  1J7D A;  5E26 A;  4PCZ A;  1IBL M;  3GQ3 A;  5AIE B;  1VDD A;  1Z2U A;  1XB2 B;  3QYE A;  4P16 A;  1Y6L A;  2DAG A;  4Y1L A;  3MK6 A;  4B7F A;  3VFD A;  4MB7 A;  4NRG A;  4B08 A;  2JZ1 A;  1WZW A;  5D1K A;  1DO2 A;  2DAM A;  3GQ5 A;  2CEA A;  2YR0 A;  3SAT A;  1Z5A A;  4B3T M;  1ZAE A;  1AUA A;  1L8Q A;  4ZNY A;  3GLI B;  1PJT A;  1XXH A;  5JI2 E;  3JR5 A;  2FNA A;  2LXE A;  4DV0 M;  1HR0 M;  5F6E A;  1UZX A;  1HJP A;  5FTJ A;  3VDP A;  3W67 A;  4YY3 M;  4R71 A;  1GL6 A;  3R42 A;  5BPV A;  3U6C A;  1YRV A;  2R65 A;  3J80 S;  3V76 A;  1E32 A;  5EXS A;  2R18 A;  2K6B A;  3DZD A;  4Y28 F;  2VQF M;  3K9P A;  4DV2 M;  3T15 A;  1JR3 E;  2D7H A;  3C3E A;  4QNM A;  2Z3X A;  1N36 M;  1WZV A;  4RF0 A;  3TWL A;  5FTK A;  3TGD A;  3KW6 A;  3NWL A;  4GKJ M;  5D2M A; 
#chains in the Genus database with same CATH homology
 4QPL B;  2RRU A;  3A4S A;  4DS2 A;  1G4A E;  2QSF X;  1ZV1 A;  1J74 A;  4A49 B;  1Q02 A;  1NV9 A;  3RZ3 A;  1WGL A;  2LXP A;  1YLA A;  2JY6 B;  3IEC A;  3K9O A;  2BF8 A;  2EBK A;  2YB6 A;  5F6U A;  4R62 A;  3JW0 A;  5FER B;  3PTF A;  3CEG A;  1IM2 A;  1AIP C;  1BVS A;  4UN2 B;  4YII U;  1J7D B;  4NRI B;  4FH1 A;  2ZTC A;  1GO5 A;  3FN1 B;  2KNV A;  1DV0 A;  4IP3 B;  4DHI D;  4NR3 A;  4AP4 B;  2H5X A;  2Z6O A;  2Y9M A;  4A4C C;  3UGB A;  3FSH A;  3UIP A;  1C7Y A;  2GRN A;  2Q0V A;  4ONN A;  1QZE A;  4F2L A;  1V92 A;  4Q5E C;  5DFL A;  3HCU B;  2HAK A;  4L83 A;  2LVQ D;  1DO0 A;  2PX9 B;  4LAD A;  2JY5 A;  1M4P A;  2DKL A;  2DNA A;  2GRO A;  5F6D A;  4G3O A;  2Y4W A;  2ONU A;  1AYZ A;  4NRG B;  2OO9 A;  2VRR A;  1T6O A;  1VDL A;  5F6W A;  4Q5H C;  3A33 A;  2EKK A;  2KNA A;  1KYI A;  5D0M A;  4ONN B;  2A7L A;  1A5T A;  2GMI B;  4V3K A;  3L1Y A;  2DI0 A;  1ZDN A;  1HT2 E;  1ZMU A;  4A4B C;  1WR1 B;  2MRO B;  4GEW A;  2C4P A;  2PWQ A;  4DHJ C;  2EBM A;  2PE6 A;  3GLI E;  4ONM B;  1WGN A;  3UIO A;  4WP2 A;  1A3S A;  1U9B A;  3EVX A;  1X23 A;  2LVA A;  4S3O A;  1KPP A;  3OJ4 A;  4V3L A;  2R0I A;  2DAI A;  2A4D A;  3OBQ A;  1YH2 A;  3MMP A;  1ZUO A;  2QHO B;  3E21 A;  2ESP A;  2YHO B;  4WZ3 A;  1XXH E;  3UIN A;  1T43 A;  2XWU A;  3FRI A;  2DZL A;  1G3I A;  1VEG A;  5AIT D;  1UFZ A;  3L1Z A;  4DHZ F;  1HT1 E;  4X57 A;  2DHY A;  2KLY A;  2F0R A;  2K0B X;  1VQ1 A;  4DDI A;  2EKE A;  1EFU B;  3E95 C;  2O25 A;  1W4U A;  1JAT A;  2OB4 A;  2MGW A;  4GPR A;  1Q34 A;  1ZGU A;  1VEJ A;  3BZH A;  2Z5D A;  3W31 B;  2QGX A;  1PGY A;  3RCZ B;  2F4Z A;  3GLH E;  3FRH A;  2ESK A;  3O2U A;  2O25 C;  2LTU A;  5F6X A;  4W5V A;  4HEO A;  2KJH A;  2DAK A;  5FQ2 A;  2JP7 A;  2CP8 A;  2AAK A;  4LDT C;  1JAT B;  2C2V B;  3E46 A;  2BWB A;  3GLF E;  2K9D A;  2QNJ A;  3P9H A;  2DAY A;  2ESQ A;  2BWE A;  1ZMV A;  3T6P A;  1OAI A;  2LBC A;  2GRR A;  2DAX A;  1OTR A;  1MN3 A;  3GLG E;  2L4E A;  1Z5S A;  1QCQ A;  2C2V C;  2JY8 A;  2HWJ A;  3HCT B;  2CYX A;  1SG9 A;  1VG5 A;  1IXS A;  4CCG A;  1M4Q A;  3B89 A;  4BVU B;  3OBU A;  2L2D A;  2OXQ A;  2K07 A;  1KPQ A;  1FZY A;  1HQY E;  2EJS A;  2AYV A;  2DAE A;  1S1Q A;  2JUJ A;  3LCU A;  1CUK A;  2CLW A;  2CLW B;  3ZNI C;  2MT6 A;  1I7K A;  2HLW A;  1U9A A;  1JBB A;  3WE5 A;  1F4I A;  4NR3 B;  3BBZ A;  2GJD A;  1R4G A;  3OBS A;  2MR9 A;  3SY2 C;  1FBV C;  1NV8 A;  1IFY A;  4Q7J A;  4II2 C;  1FXT A;  2NVU C;  5F6Y A;  2OOA A;  4ONL A;  4EJE A;  1TTE A;  1Z2U A;  2GRP A;  5KNL C;  1P3Q Q;  2CWB A;  1WJ7 A;  1Z3D A;  5D1M A;  2E2C A;  4JQU A;  3E95 A;  3OBX A;  3H4J A;  3KPA A;  1WIV A;  1C4Z D;  4Y1L C;  1UKX A;  2L4F A;  3IHP A;  5EGG A;  2EKF A;  3VON B;  3F92 A;  2YZ0 A;  2JZ0 A;  1ZMW A;  3SQV C;  4P5O G;  4NRI A;  5AIU B;  3ZQS A;  1JAS A;  5AIT B;  1E94 E;  2Y9P A;  3ONG B;  5IFR A;  1PZV A;  2WZJ A;  2KHH A;  4BWF A;  3VON C;  4AUQ A;  3P9G A;  2DAW A;  2DEN A;  2JY7 A;  2DMF A;  4F1I A;  2EDI A;  1YF9 A;  2AWF A;  2LVP C;  2LVN C;  2H2Y A;  3EB6 B;  2B3T A;  2GRQ A;  4ONL B;  2Z6P A;  2JNH A;  1WHC A;  2YBF A;  4M1N A;  2UYZ A;  5D0K A;  3FE3 A;  5F6V A;  5JNE B;  2BEP A;  1G41 A;  1VEK A;  3RPG A;  2FUH A;  1Y8G A;  2LVO C;  2G3Q A;  1OKS A;  2R0J A;  1TR8 A;  3R3Q A;  4DBG B;  4DDG A;  1KPS A;  4ONM A;  5D1L A;  2OOB A;  4TKP A;  2UCZ A;  3JVZ A;  5HPT C;  3LCV B;  2ZTD A;  2KNZ A;  1OQY A;  2GMI A;  2ESO A;  2FO3 A;  4JUE A;  3H8K A;  2MJ5 B;  4YC1 A;  2F4W A;  4MDK A;  1Y8X A;  1J7D A;  5AIE B;  1XB2 B;  1Y6L A;  4Y1L A;  2DAG A;  4NRG A;  2JZ1 A;  1WZW A;  5D1K A;  1DO2 A;  2DAM A;  4ZNY A;  5F6E A;  5JI2 E;  1UZX A;  1HJP A;  4R71 A;  3R42 A;  1YRV A;  3K9P A;  1WZV A;  1JR3 E;  3TGD A;  5D2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...