3K9OA

The crystal structure of e2-25k and ubb+1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of E2-25K/UBB+1 Interaction for Neurotoxicity of Alzheimer Disease by Proteasome Inhibition
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 K
total genus 68
structure length 198
sequence length 198
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3k9oA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 3k9oA01
1Y6LA 2JY5A 1W4UA 2KNVA 2EKKA 5JI2E 2KJHA 1OTRA 2UYZA 4P5OG 2R0IA 1A3SA 4HEOA 1VDLA 1ZGUA 2K0BX 4ONNA 4R62A 2F4WA 2DNAA 4F1IA 2DZLA 2QGXA 5FERB 1A5TA 1YLAA 3B89A 4ONLB 1Q34A 3PTFA 1HT2E 2EKFA 5D1LA 2DAYA 3UIOA 2OO9A 4GEWA 2L4EA 2BEPA 2JZ1A 4Q5EC 5D0KA 4MDKA 2GROA 1PGYA 4G3OA 4R71A 4ONNB 4A4BC 3P9HA 2GMIB 1NV9A 1AIPC 2CYXA 1SG9A 4UN2B 4DDIA 1Y8GA 2HAKA 1UKXA 4QPLB 3JW0A 1WHCA 3CEGA 2EDIA 4NRGA 1C7YA 1ZUOA 2UCZA 2AYVA 1Q02A 2EJSA 1EFUB 1JASA 3L1ZA 1IXSA 3GLIE 2CLWA 2DAGA 2DMFA 4W5VA 4AUQA 1HJPA 2XWUA 2H5XA 2LVQD 1KPSA 2DAEA 1WIVA 1JATA 5IFRA 2ESQA 4V3LA 4V3KA 4ONMB 3RZ3A 2CP8A 1J74A 4ONLA 4II2C 2Z5DA 2K07A 2F0RA 2RRUA 1DV0A 1FBVC 1YRVA 3UINA 2DHYA 2KLYA 2HLWA 1BVSA 2YZ0A 4X57A 1IM2A 3BZHA 3O2UA 3ZNIC 2AAKA 5AITD 3L1YA 2DENA 2Z6OA 1WJ7A 4DHJC 2NVUC 5D1MA 3RPGA 3R42A 2DAIA 2EBKA 4A49B 4NR3A 2Q0VA 3E21A 1M4PA 1IFYA 5HPTC 2DAXA 2A7LA 1WGLA 1VQ1A 4DHZF 1HT1E 3E95C 3FSHA 2LVPC 3EB6B 1ZDNA 2LVOC 2GRNA 4A4CC 4AP4B 4Y1LC 5EGGA 1PZVA 1Z2UA 5F6DA 2LTUA 1QCQA 2ZTDA 4LDTC 2PE6A 1WZVA 1Y8XA 4DHID 5F6EA 3IECA 3T6PA 2BWEA 1XXHE 2A4DA 4LADA 2O25C 4ZNYA 3LCVB 3KPAA 5AIUB 2ZTCA 2YB6A 1VEGA 2PWQA 1T6OA 1U9BA 3UIPA 2ESOA 2GRQA 2Y4WA 3OBXA 3OJ4A 4JUEA 3MMPA 1XB2B 3R3QA 4NRGB 1ZMVA 5F6XA 3OBUA 4FH1A 1KYIA 1ZV1A 3FE3A 2LXPA 2O25A 5KNLC 1OAIA 1G41A 1V92A 2CWBA 2HWJA 2OB4A 2Y9MA 2KNZA 3H4JA 2C4PA 1T43A 3GLHE 3A33A 1ZMWA 1G4AE 1GO5A 1J7DB 3P9GA 2JNHA 2MT6A 1VG5A 1TTEA 1G3IA 3GLFE 2GMIA 3SQVC 2JUJA 2G3QA 5F6VA 3VONB 2MROB 3SY2C 3EVXA 1OQYA 5D0MA 5FQ2A 2DI0A 2GRPA 1KPQA 2OOBA 2DKLA 3ONGB 4NRIA 2VRRA 4F2LA 1E94E 2JZ0A 3RCZB 2AWFA 2C2VB 2F4ZA 3HCTB 2YBFA 1AYZA 1UFZA 2FO3A 1U9AA 2DAMA 2OXQA 2PX9B 1VEKA 1FZYA 4DBGB 1S1QA 2QHOB 3FRHA 1CUKA 1X23A 2LVNC 2ESKA 2L2DA 2Z6PA 2EKEA 3WE5A 4WZ3A 2JP7A 4YC1A 1FXTA 1P3QQ 2FUHA 5AITB 3ZQSA 4TKPA 3K9OA 3K9PA 3OBQA 2GJDA 4BWFA 4IP3B 5F6UA 1TR8A 3IHPA 2JY7A 2QNJA 4S3OA 2EBMA 5DFLA 4ONMA 2KNAA 2JY6B 4L83A 2K9DA 1WZWA 4WP2A 3A4SA 3TGDA 4Q7JA 2BWBA 4DDGA 5D2MA 3UGBA 1DO2A 1ZMUA 5JNEB 4EJEA 4BVUB 3FN1B 2MJ5B 1WGNA 1JATB 2DAKA 2ONUA 3FRIA 4Q5HC 3W31B 2MGWA 3F92A 2QSFX 2JY8A 5F6YA 2KHHA 1M4QA 2H2YA 3OBSA 2ESPA 4DS2A 4NR3B 2E2CA 2WZJA 2DAWA 4NRIB 1QZEA 2LBCA 1Z3DA 3H8KA 2C2VC 5AIEB 3JVZA 2MR9A 4GPRA 1JBBA 2BF8A 1DO0A 1OKSA 5F6WA 2GRRA 3LCUA 4JQUA 2LVAA 2YHOB 1C4ZD 2L4FA 4YIIU 1MN3A 5D1KA 3VONC 1I7KA 1J7DA 3GLGE 2R0JA 3E95A 1KPPA 2B3TA 2Y9PA 4CCGA 1WR1B 4M1NA 2OOAA 1F4IA 1NV8A 1YF9A 3BBZA 1UZXA 3E46A 2CLWB 1Z5SA 1R4GA 1YH2A 1HQYE 1JR3E 1VEJA 4Y1LA 3HCUB
chains in the Genus database with same CATH superfamily
3U61A 4JI6M 4JI3M 4X62M 1Y6LA 3SHGB 3EIHA 2JY5A 4X64M 2XFSA 2KNVA 2Z4RA 1D0KA 4GC9A 7CATA 1GABA 1W4UA 2EKKA 2P5TA 3FUXA 1NY6A 4XGIA 4ITQA 5JI2E 2KJHA 2BNKA 4HL4A 2CUZA 4LJ7A 4LGYA 1OTRA 2UYZA 1LV7A 1TH3A 3O2UA 4G4RA 4JI2M 1DGBA 3SARA 2DZOB 3JAMS 4P5OG 3U61B 2R0IA 1PM5A 2F5NA 4HEOA 1PJTA 1IBMM 1VDLA 4G4QA 1A3SA 3VK7A 4RF1A 3HWSA 1JR3A 2K0BX 1R6BX 3FUWA 3LMMA 4FD2A 5KO3A 3JR4A 3K1JA 2HL7A 3SASA 4ONNA 2F4WA 2DNAA 4LJ4A 4R62A 1N36M 1IN7A 3KP0E 4F1IA 2DZLA 5DYIA 4DR6M 2QGXA 1MX0A 5FERB 5A2QS 1A5TA 1IXZA 1YLAA 3B89A 3NWLA 4ONLB 1K82A 1X37A 3HHWA 3GLGA 1Q34A 4PT5A 3PTFA 1HT2E 3CF2A 1KSFX 2C96A 2EKFA 1R5LA 3GLIA 5D1LA 1IN6A 4B7HA 1N78A 2RGOA 3ILKA 3E9SA 5EP3A 5FSWA 2E5LM 4MGKE 2DAYA 3UIOA 3EIEA 2OO9A 4GEWA 2L4EA 4IBFA 1ZGUA 2BEPA 4FWDA 4GMQA 2JZ1A 4Q5EC 2YR0A 5D0KA 4LZJA 4QOSA 1K3WA 1MJGM 1OFIA 4LF9M 3W67A 3PFIA 4MDKA 2QQ8A 2Z8YM 2K47A 2GROA 5KPZA 1PGYA 4G3OA 5FTJA 1AUAA 1GVNA 3ZNIC 3AV0A 4R71A 4ZNYA 4ONNB 2JXNA 3P9HA 4A4BC 3VK8A 2OPFA 3K8ZA 2Y21A 2GMIB 1NV9A 2F5SA 4R3DA 1AIPC 2R4EA 3FYDA 3UMMA 4L8RC 2CYXA 1SG9A 4UN2B 2C5RA 3BXWA 1SXJD 2Z5DA 4DDIA 5EP4A 1IY1A 1Y8GA 2HAKA 2WSCF 4QNMA 5IREB 4NRVA 3KDSE 3ZQJA 1NNJA 1GKIA 4L78A 1UKXA 3SC3A 3UJNA 3JW0A 1WHCA 4AG5A 3CEGA 4QPLB 2QZ4A 3L28A 2EDIA 1J5EM 4NRGA 2XFTA 4IBDA 3SAWA 3GQ5A 4B3RM 4BB9A 1C7YA 1ZUOA 2UCZA 3D8BA 4LFAM 5F3WA 2CV0A 2AYVA 1Q02A 2DWLA 2EJSA 4CHTB 4JI1M 1EFUB 5KPTA 1DGHB 2QBYA 4LF4M 2L7HA 1JASA 2ERCA 3L1ZA 1IXSA 3ZCBB 2F5QA 3GLIE 2CLWA 2DAGA 3QAUA 4G6ZA 2DMFA 1PJQA 2K6BA 3FUTA 3M0EA 4WURA 4NRWA 1HJPA 1QZMA 4W5VA 3HJQA 4AUQA 3I01M 2XWUA 2H5XA 3C3EA 3GLIB 3L27A 2DWZB 2LVQD 2Q2EB 1KPSA 2DAEA 1WIVA 5LMUM 1JATA 4EIWA 4L15A 3DZDA 4KODA 2I7PA 3SFZA 1N75A 3A42A 1TF0B 3A98B 3HU1A 4KO8A 3VKGA 4LJ6A 5IFRA 2O5RA 1Z59A 4DV0M 4OW0A 2ESQA 5FTMA 2CHQA 3T15A 4JN6A 4AZFA 2F5OA 3TWLA 3MK6A 3GPXA 2UUAM 3HY5A 3KS8A 4ONMB 4V3KA 2Z7JA 2CP8A 2DZNB 2FE8A 4M9ZA 4CIZA 1L1TA 1J74A 3RZ3A 3GRUA 3RGSA 3FUVA 3CF0A 4ONLA 4II2C 1NHWC 2JWSA 4I5SA 4PCZA 4M0WA 1PJIA 3M6AA 3R8FA 2F0RA 3GO8A 5KPRA 1V34A 2K07A 3HJ8A 5ITRA 2RRUA 4MB7A 3THGA 1XMQM 1DV0A 4DR3M 1JR3D 4BBAA 4B7GA 1FBVC 2DHYA 4NOOB 1IXSB 3PNVA 3ZH9B 1BVSA 1YRVA 2HLWA 2KLYA 3IG8A 2YZ0A 4CISA 1TDHA 4X57A 4NL4H 2XGNA 4DR7M 3GRYA 1IM2A 1RU3A 4DV5M 3R9XB 3QWLA 3VFDA 3BZHA 1IN4A 2QCUA 1IBKM 3HU2A 2AAKA 3L1YA 2UU9M 5AITD 2DENA 2NQ8C 1WJ7A 2R6FA 3DFZA 3QYBA 3KFUG 2Z6OA 2NVUC 3KS4A 5D1MA 3RPGA 4MGYE 3I4YA 1TH4A 3R42A 5ITXA 2DAIA 2KA6B 2EO2A 3VDUA 2EBKA 4A49B 4NR3A 2Q0VA 3E21A 2CEAA 3L2AA 3U6OA 3J27B 1M4PA 1IN5A 1D0MA 2HKJA 4MM3B 1J09A 3TWKA 3J7AS 1IFYA 5HPTC 1QAOA 1T3TA 2FFJA 4L16A 2A7LA 3SHFA 2DAXA 2XLJA 1WGLA 1VQ1A 4IJEA 3Q8XA 4DV1M 1YE9A 4DHZF 2CRUA 1HT1E 3E95C 3FSHA 2LVPC 3AOGA 3C3DA 3EB6B 4IJFA 4ZPXA 4DV2M 3B7NA 2D7EA 1ZDNA 2RGHA 2LXEA 4REZA 4FCTA 1QUSA 2LVOC 3Q8GA 2GRNA 1XWIA 4A4CC 1HQCA 4AP4B 3GQ3A 4Y1LC 1YSYA 5EGGA 1PZVA 4YY3M 4DR2M 1Z2UA 4G4OA 5F6DA 2LTUA 4IIWA 2ZTDA 1QCQA 2BJWA 2QP9X 4DV3M 3LVWA 4LDTC 2PE6A 3K2LA 3I4VA 1WZVA 4II7A 1Y8XA 5F6EA 4DHID 2O01F 2KZSA 3IECA 3T6PA 2BWEA 4LF6M 1GJTA 2CE7A 1XXHE 1PRBA 3LQRA 4IBIA 1ZAEA 4P16A 2Z3XA 4AKGA 2A4DA 4LADA 4AQYM 3NBIA 3W0FA 1SXJA 1IN8A 3HJSA 5DYGA 5DNYA 2XSZA 3KVWA 3LCVB 1IBLM 2XEPA 3KPAA 1HR0M 5AIUB 4LF7M 2ZTCA 2JA2A 3RGPA 1TDZA 2YB6A 4LJ5A 1VEGA 2ZM6M 1GLNA 2VIIA 3J7BA 2PWQA 1Z5AA 1T6OA 3UZUA 4JV5M 2UUCM 2D7GA 4YHHM 1NVMA 2J7OA 1U9BA 2A5YB 4PDIA 4MGZE 4KLNA 3UIPA 3KOWE 2ESOA 2GRQA 2Y4WA 1Z5BA 2C9CA 4D82A 1N32M 3OBXA 3OJ4A 2W82A 2ZBKB 4JUEA 3U60A 3GRRA 1QDRA 4LRSA 1L8QA 3CTWB 1PJJA 2KDLA 3MMPA 4RF0A 1ZQ9A 3GLHB 2FOIC 4QHSA 1XB2B 4LJ8A 3PXGA 1IY2A 2OQ4A 2N35A 4GHAA 3R3QA 4FCVA 1E9SA 1ZMVA 3LVVA 4DV6M 4NRGB 2R44A 5F6XA 1UM8A 3OBUA 5E26A 4LGMA 3IG5A 3HHYA 4FH1A 2UXDM 2APLA 4PDGA 1NJGA 1KYIA 1ZV1A 3B74A 3FE3A 1KFVA 1L2CA 3JR5A 4A3VB 1NHGC 2O25A 2Y0QA 3U6DA 2LXPA 5KNLC 4HLQA 1Z5CA 5FTLA 4Y28F 4B3SM 3RE8A 1OAIA 5ITUA 4DUZM 4ANRA 1G41A 1V92A 2CWBA 4DR4M 4L6V6 4Z8XA 3A45A 2HWJA 5EQTA 4OVZB 3T1YM 4GKKM 4W5WA 2XZFA 2OB4A 5EXXA 2Y9MA 1Q39A 3V76A 3CGWA 2KNZA 3J2PB 1GJSA 3H4JA 2UXBM 3HGIA 2C4PA 2GNOA 1T43A 3GLHE 3DA1A 2MH8A 3A33A 1ZMWA 3FTDA 4QOZC 1G4AE 1WXQA 1NSFA 2CHVA 3TE6A 2UUBM 3FKEA 1OIZA 1HNZM 1GO5A 4IBKA 4KHPM 1JQJC 2VQFM 4D81A 2DHRA 4LF8M 1J7DB 1ORYB 1QAMA 1MU5A 2R45A 2ZANA 1D2NA 4DHJC 4RNAA 3P9GA 2JNHA 3J81S 4I4LA 1H6UA 2MT6A 1VG5A 1TTEA 4IBCA 1G3IA 4LJ9A 2EA0A 3GLFE 2GMIA 3SQVC 3I51A 3T1HM 3H4MA 1NNUC 3MHVC 1V33A 5EXTA 2JUJA 4DV7M 3U6QA 3U6MA 2G3QA 3GPPA 5F6VA 3VONB 4M9SA 4IBEA 2HCBA 3HHZA 4JI8M 2MROB 4OVZA 3SY2C 3EVXA 1OQYA 5IZ7D 4LG2A 1XXHB 3SAUA 4QHTA 2DI0A 4B08A 4DR1M 2GRPA 3U6SA 5D0MA 1NO1A 5FTNA 1E32A 3FTEA 2O25C 1KPQA 2OOBA 1E9RA 3L25A 2DKLA 3ONGB 3KSJA 4NRIA 2VRRA 4F2LA 4GKJM 2GQFA 1E94E 2JZ0A 1HNXM 2AHMA 3RCZB 2J7NA 3UINA 2AWFA 3SYKA 2C2VB 1Q3BA 2F4ZA 5EXPA 5E6JA 4IBJA 4M0DA 5ITTA 4AKIA 3HCTB 3W68A 2YBFA 4GH9A 1AYZA 3QYEA 2KEBA 2LWXA 1UFZA 2FO3A 1U9AA 2CV2A 2LHGA 2YNMD 3E4RA 2DAMA 1N33M 2M5ZA 4LY6A 5ITQA 3GLFA 2VQEM 2OXQA 2YFQA 2PX9B 1NJFA 1VEKA 4JI7M 2BJVA 4S12A 3WHKA 2EUCA 4MGIE 5IWAM 1SXJC 3AOEC 2HHHM 5H37D 2LHCA 2C99A 4FCWA 5EP1A 3AKZA 1FZYA 4JI0M 4V3LA 4DBGB 3FYCA 2VF8A 1S1QA 3U6LA 2QHOB 3I04M 4AKHA 4OU7A 1G8PA 3FRHA 1CUKA 2QBYB 1X23A 2DVWB 2DXIA 2LVNC 4MH0E 4XBOA 2ESKA 2L2DA 2RKOA 4NSRA 1Z6TA 4B3TM 3FTFA 2Z6PA 4IBBA 2LNHC 2EKEA 3TPZA 1I4WA 2CHGA 4B7FA 3SATA 3WE5A 1J7KA 1OIPA 4WZ3A 4RKUF 1W5TA 2JP7A 4X65M 3KXEC 4I8OA 2WSFF 2WSEF 4YC1A 2J5YA 1N77A 1FXTA 3CF6E 2XZUA 1C1KA 3OTOM 2QPAA 1P3QQ 2XH9A 4DR5M 5FQ2A 2Z4SA 5GKNA 2FUHA 4PD2A 5ITYA 1EIJA 4AI6A 5AITB 3ZQSA 4TKPA 4LJAA 3GQ4A 3B7QA 1L2DA 4DV4M 4XK8F 1DGHA 4FWHA 3K9OA 2D7HA 3HZJA 3K9PA 4NC6A 5KQ8A 4GRIA 5BPVA 1JB0F 3OBQA 4K0KM 3VDPA 2R4JA 3FTCA 5IT9S 3ZC7B 2DWNA 2GJDA 3GPUA 4LRTA 2FNAA 1QVRA 4QNRA 2ZAMA 5C18A 1IY0A 4BWFA 1QDTA 4GIPA 4IP3B 2R65A 5F6UA 2X4AA 2Y20A 1TR8A 3GLHA 3HKPA 3IHPA 3PVSA 2JY7A 2QNJA 3TL4X 5C1BA 4BLCA 1L1ZA 2V1UA 2L6OA 3HU3A 4S3OA 2V6ZM 4OX9M 2EBMA 5DFLA 4ONMA 2KNAA 1QQWA 2JY6B 4X66M 4L83A 2K9DA 4GC5A 5KQDA 1PJSA 4WP2A 1WZWA 4R7GA 4G4NA 3A4SA 3GP1A 4JI5M 3GLGB 4LFBM 3KOZE 3TGDA 4KT0F 5FTKA 1IXRC 1DGGA 1QANA 1R7RA 3BOSA 2C98A 4Q7JA 3FD9A 5JI3E 2BWBA 5LMNM 4DDGA 3HX3A 1XNQM 5D2MA 3HHXA 2KW0A 2H1RA 4AG6A 2VDBB 3SAVA 4GITA 3U60B 3MJ5A 1G71A 3SMPA 1D0LA 2R18A 4CGYB 1DO2A 1ZMUA 4I81A 4P17A 2FS1A 5FLXS 3UGBA 1GL6A 5EJCA 4WW0A 3AFHA 5ITXE 5JNEB 4TUWA 2F5PA 4EJEA 1QAQA 3D8LA 1EE8A 3U5ZA 3FN1B 4BVUB 2MJ5B 4FW9A 1WGNA 1LTMA 3KOYE 4FVMA 4CJ6A 3GLFB 1XNRM 1JATB 2DAKA 1FJGM 2ONUA 3FRIA 4Q5HC 1R2YA 1DGFA 3W31B 2Y0TA 2MGWA 3F92A 3U6CA 2QSFX 4D80A 1YUBA 2JY8A 4LF5M 5F6YA 4LCBA 2KHHA 1M4QA 1IQPA 2H2YA 1SXJB 1VDDA 1TH2A 3KW6A 3TQSA 3B7ZA 3TWMA 3OBSA 4AW4A 4LZZA 5EXSA 2CV1A 2ESPA 1Q3CA 4DS2A 2G5GX 1GL7A 4B3MM 4MGHA 1XHBA 2KRUA 2WZJA 2E2CA 4NR3B 3VKHA 2DAWA 4NRIB 2XF3A 2R62A 1QZEA 3UGJA 4NXMM 1I94M 1OAOC 2V1CA 2KXEA 4JXJA 3FUUA 2CFOA 2X49A 3M7GA 2LH0A 2KRKA 1SXJE 1TGUA 2VF7A 1W5SA 3KP1E 2LBCA 4NXNM 5BR8M 1K3XA 1Z3DA 2DWMA 3A46A 2C2VC 3H8KA 1XXHA 3AJIB 3WHLA 3JVZA 5AIEB 3LW5F 2MR9A 3SBJA 1N34M 3W0LB 4JI4M 4GPRA 1JBBA 1OJLA 3RFWA 2BF8A 1XMOM 3GRVA 3VLFB 4FWGA 1DO0A 1OKSA 2M60A 5F6WA 1S3SA 2GRRA 1QYRA 3LCUA 4JQUA 2UXCM 1NY5A 3AL0C 2LVAA 1QUTA 3DOAA 5L8RF 1G59A 2QENA 2YHOB 3KOXE 3LQQA 3J80S 3U6EA 1C4ZD 2L4FA 4YIIU 1MN3A 2G8LA 4DUYM 2ZAOA 5D1KA 3C9PA 5EP2A 3U6PA 3VONC 3GPYA 1R2ZA 3L26A 3K92A 2X8AA 2YQZA 3GLGE 4LFCM 2F4VM 1J7DA 1I7KA 2R0JA 3L29A 4Z6YA 2L09A 8CATA 3U5ZB 3SMSA 1L2BA 3E95A 2C9OA 4JYAM 2B3TA 1KPPA 2FH0A 2R46A 2KZUA 2Y9PA 4CCGA 1WR1B 4M1NA 2OOAA 1F4IA 3UK6A 3KSXA 4IBGA 3B9PA 1NV8A 1YF9A 1HNWM 4GHLA 3BBZA 1UZXA 2I7NA 3E46A 3NBXX 4NSOB 1Z5SA 1FNNA 1R4GA 3AOEA 2CLWB 4M9XA 1HQYE 1JR3E 1VEJA 3SYLA 1YH2A 4Y1LA 3C58A 1XC8A 4L4UA 1OFHA 2XSZD 3T38A 2L7IA 3PNYA 3HCUB
chains in the Genus database with same CATH topology
1Y6LA 2JY5A 1W4UA 2KNVA 2EKKA 5JI2E 2KJHA 1OTRA 2UYZA 4P5OG 2R0IA 1A3SA 4HEOA 1VDLA 1ZGUA 2K0BX 4ONNA 4R62A 2F4WA 2DNAA 4F1IA 2DZLA 2QGXA 5FERB 1A5TA 1YLAA 3B89A 4ONLB 1Q34A 3PTFA 1HT2E 2EKFA 5D1LA 2DAYA 3UIOA 2OO9A 4GEWA 2L4EA 2BEPA 2JZ1A 4Q5EC 5D0KA 4MDKA 2GROA 1PGYA 4G3OA 4R71A 4ONNB 4A4BC 3P9HA 2GMIB 1NV9A 1AIPC 2CYXA 1SG9A 4UN2B 4DDIA 1Y8GA 2HAKA 1UKXA 4QPLB 3JW0A 1WHCA 3CEGA 2EDIA 4NRGA 1C7YA 1ZUOA 2UCZA 2AYVA 1Q02A 2EJSA 1EFUB 1JASA 3L1ZA 1IXSA 3GLIE 2CLWA 2DAGA 2DMFA 4W5VA 4AUQA 1HJPA 2XWUA 2H5XA 2LVQD 1KPSA 2DAEA 1WIVA 1JATA 5IFRA 2ESQA 4V3LA 4V3KA 4ONMB 3RZ3A 2CP8A 1J74A 4ONLA 4II2C 2Z5DA 2K07A 2F0RA 2RRUA 1DV0A 1FBVC 1YRVA 3UINA 2DHYA 2KLYA 2HLWA 1BVSA 2YZ0A 4X57A 1IM2A 3BZHA 3O2UA 3ZNIC 2AAKA 5AITD 3L1YA 2DENA 2Z6OA 1WJ7A 4DHJC 2NVUC 5D1MA 3RPGA 3R42A 2DAIA 2EBKA 4A49B 4NR3A 2Q0VA 3E21A 1M4PA 1IFYA 5HPTC 2DAXA 2A7LA 1WGLA 1VQ1A 4DHZF 1HT1E 3E95C 3FSHA 2LVPC 3EB6B 1ZDNA 2LVOC 2GRNA 4A4CC 4AP4B 4Y1LC 5EGGA 1PZVA 1Z2UA 5F6DA 2LTUA 1QCQA 2ZTDA 4LDTC 2PE6A 1WZVA 1Y8XA 4DHID 5F6EA 3IECA 3T6PA 2BWEA 1XXHE 2A4DA 4LADA 2O25C 4ZNYA 3LCVB 3KPAA 5AIUB 2ZTCA 2YB6A 1VEGA 2PWQA 1T6OA 1U9BA 3UIPA 2ESOA 2GRQA 2Y4WA 3OBXA 3OJ4A 4JUEA 3MMPA 1XB2B 3R3QA 4NRGB 1ZMVA 5F6XA 3OBUA 4FH1A 1KYIA 1ZV1A 3FE3A 2LXPA 2O25A 5KNLC 1OAIA 1G41A 1V92A 2CWBA 2HWJA 2OB4A 2Y9MA 2KNZA 3H4JA 2C4PA 1T43A 3GLHE 3A33A 1ZMWA 1G4AE 1GO5A 1J7DB 3P9GA 2JNHA 2MT6A 1VG5A 1TTEA 1G3IA 3GLFE 2GMIA 3SQVC 2JUJA 2G3QA 5F6VA 3VONB 2MROB 3SY2C 3EVXA 1OQYA 5D0MA 5FQ2A 2DI0A 2GRPA 1KPQA 2OOBA 2DKLA 3ONGB 4NRIA 2VRRA 4F2LA 1E94E 2JZ0A 3RCZB 2AWFA 2C2VB 2F4ZA 3HCTB 2YBFA 1AYZA 1UFZA 2FO3A 1U9AA 2DAMA 2OXQA 2PX9B 1VEKA 1FZYA 4DBGB 1S1QA 2QHOB 3FRHA 1CUKA 1X23A 2LVNC 2ESKA 2L2DA 2Z6PA 2EKEA 3WE5A 4WZ3A 2JP7A 4YC1A 1FXTA 1P3QQ 2FUHA 5AITB 3ZQSA 4TKPA 3K9OA 3K9PA 3OBQA 2GJDA 4BWFA 4IP3B 5F6UA 1TR8A 3IHPA 2JY7A 2QNJA 4S3OA 2EBMA 5DFLA 4ONMA 2KNAA 2JY6B 4L83A 2K9DA 1WZWA 4WP2A 3A4SA 3TGDA 4Q7JA 2BWBA 4DDGA 5D2MA 3UGBA 1DO2A 1ZMUA 5JNEB 4EJEA 4BVUB 3FN1B 2MJ5B 1WGNA 1JATB 2DAKA 2ONUA 3FRIA 4Q5HC 3W31B 2MGWA 3F92A 2QSFX 2JY8A 5F6YA 2KHHA 1M4QA 2H2YA 3OBSA 2ESPA 4DS2A 4NR3B 2E2CA 2WZJA 2DAWA 4NRIB 1QZEA 2LBCA 1Z3DA 3H8KA 2C2VC 5AIEB 3JVZA 2MR9A 4GPRA 1JBBA 2BF8A 1DO0A 1OKSA 5F6WA 2GRRA 3LCUA 4JQUA 2LVAA 2YHOB 1C4ZD 2L4FA 4YIIU 1MN3A 5D1KA 3VONC 1I7KA 1J7DA 3GLGE 2R0JA 3E95A 1KPPA 2B3TA 2Y9PA 4CCGA 1WR1B 4M1NA 2OOAA 1F4IA 1NV8A 1YF9A 3BBZA 1UZXA 3E46A 2CLWB 1Z5SA 1R4GA 1YH2A 1HQYE 1JR3E 1VEJA 4Y1LA 3HCUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6L A;  2JY5 A;  1W4U A;  2KNV A;  2EKK A;  5JI2 E;  2KJH A;  1OTR A;  2UYZ A;  4P5O G;  2R0I A;  1A3S A;  4HEO A;  1VDL A;  1ZGU A;  2K0B X;  4ONN A;  4R62 A;  2F4W A;  2DNA A;  4F1I A;  2DZL A;  2QGX A;  5FER B;  1A5T A;  1YLA A;  3B89 A;  4ONL B;  1Q34 A;  3PTF A;  1HT2 E;  2EKF A;  5D1L A;  2DAY A;  3UIO A;  2OO9 A;  4GEW A;  2L4E A;  2BEP A;  2JZ1 A;  4Q5E C;  5D0K A;  4MDK A;  2GRO A;  1PGY A;  4G3O A;  4R71 A;  4ONN B;  4A4B C;  3P9H A;  2GMI B;  1NV9 A;  1AIP C;  2CYX A;  1SG9 A;  4UN2 B;  4DDI A;  1Y8G A;  2HAK A;  1UKX A;  4QPL B;  3JW0 A;  1WHC A;  3CEG A;  2EDI A;  4NRG A;  1C7Y A;  1ZUO A;  2UCZ A;  2AYV A;  1Q02 A;  2EJS A;  1EFU B;  1JAS A;  3L1Z A;  1IXS A;  3GLI E;  2CLW A;  2DAG A;  2DMF A;  4W5V A;  4AUQ A;  1HJP A;  2XWU A;  2H5X A;  2LVQ D;  1KPS A;  2DAE A;  1WIV A;  1JAT A;  5IFR A;  2ESQ A;  4V3L A;  4V3K A;  4ONM B;  3RZ3 A;  2CP8 A;  1J74 A;  4ONL A;  4II2 C;  2Z5D A;  2K07 A;  2F0R A;  2RRU A;  1DV0 A;  1FBV C;  1YRV A;  3UIN A;  2DHY A;  2KLY A;  2HLW A;  1BVS A;  2YZ0 A;  4X57 A;  1IM2 A;  3BZH A;  3O2U A;  3ZNI C;  2AAK A;  5AIT D;  3L1Y A;  2DEN A;  2Z6O A;  1WJ7 A;  4DHJ C;  2NVU C;  5D1M A;  3RPG A;  3R42 A;  2DAI A;  2EBK A;  4A49 B;  4NR3 A;  2Q0V A;  3E21 A;  1M4P A;  1IFY A;  5HPT C;  2DAX A;  2A7L A;  1WGL A;  1VQ1 A;  4DHZ F;  1HT1 E;  3E95 C;  3FSH A;  2LVP C;  3EB6 B;  1ZDN A;  2LVO C;  2GRN A;  4A4C C;  4AP4 B;  4Y1L C;  5EGG A;  1PZV A;  1Z2U A;  5F6D A;  2LTU A;  1QCQ A;  2ZTD A;  4LDT C;  2PE6 A;  1WZV A;  1Y8X A;  4DHI D;  5F6E A;  3IEC A;  3T6P A;  2BWE A;  1XXH E;  2A4D A;  4LAD A;  2O25 C;  4ZNY A;  3LCV B;  3KPA A;  5AIU B;  2ZTC A;  2YB6 A;  1VEG A;  2PWQ A;  1T6O A;  1U9B A;  3UIP A;  2ESO A;  2GRQ A;  2Y4W A;  3OBX A;  3OJ4 A;  4JUE A;  3MMP A;  1XB2 B;  3R3Q A;  4NRG B;  1ZMV A;  5F6X A;  3OBU A;  4FH1 A;  1KYI A;  1ZV1 A;  3FE3 A;  2LXP A;  2O25 A;  5KNL C;  1OAI A;  1G41 A;  1V92 A;  2CWB A;  2HWJ A;  2OB4 A;  2Y9M A;  2KNZ A;  3H4J A;  2C4P A;  1T43 A;  3GLH E;  3A33 A;  1ZMW A;  1G4A E;  1GO5 A;  1J7D B;  3P9G A;  2JNH A;  2MT6 A;  1VG5 A;  1TTE A;  1G3I A;  3GLF E;  2GMI A;  3SQV C;  2JUJ A;  2G3Q A;  5F6V A;  3VON B;  2MRO B;  3SY2 C;  3EVX A;  1OQY A;  5D0M A;  5FQ2 A;  2DI0 A;  2GRP A;  1KPQ A;  2OOB A;  2DKL A;  3ONG B;  4NRI A;  2VRR A;  4F2L A;  1E94 E;  2JZ0 A;  3RCZ B;  2AWF A;  2C2V B;  2F4Z A;  3HCT B;  2YBF A;  1AYZ A;  1UFZ A;  2FO3 A;  1U9A A;  2DAM A;  2OXQ A;  2PX9 B;  1VEK A;  1FZY A;  4DBG B;  1S1Q A;  2QHO B;  3FRH A;  1CUK A;  1X23 A;  2LVN C;  2ESK A;  2L2D A;  2Z6P A;  2EKE A;  3WE5 A;  4WZ3 A;  2JP7 A;  4YC1 A;  1FXT A;  1P3Q Q;  2FUH A;  5AIT B;  3ZQS A;  4TKP A;  3K9O A;  3K9P A;  3OBQ A;  2GJD A;  4BWF A;  4IP3 B;  5F6U A;  1TR8 A;  3IHP A;  2JY7 A;  2QNJ A;  4S3O A;  2EBM A;  5DFL A;  4ONM A;  2KNA A;  2JY6 B;  4L83 A;  2K9D A;  1WZW A;  4WP2 A;  3A4S A;  3TGD A;  4Q7J A;  2BWB A;  4DDG A;  5D2M A;  3UGB A;  1DO2 A;  1ZMU A;  5JNE B;  4EJE A;  4BVU B;  3FN1 B;  2MJ5 B;  1WGN A;  1JAT B;  2DAK A;  2ONU A;  3FRI A;  4Q5H C;  3W31 B;  2MGW A;  3F92 A;  2QSF X;  2JY8 A;  5F6Y A;  2KHH A;  1M4Q A;  2H2Y A;  3OBS A;  2ESP A;  4DS2 A;  4NR3 B;  2E2C A;  2WZJ A;  2DAW A;  4NRI B;  1QZE A;  2LBC A;  1Z3D A;  3H8K A;  2C2V C;  5AIE B;  3JVZ A;  2MR9 A;  4GPR A;  1JBB A;  2BF8 A;  1DO0 A;  1OKS A;  5F6W A;  2GRR A;  3LCU A;  4JQU A;  2LVA A;  2YHO B;  1C4Z D;  2L4F A;  4YII U;  1MN3 A;  5D1K A;  3VON C;  1I7K A;  1J7D A;  3GLG E;  2R0J A;  3E95 A;  1KPP A;  2B3T A;  2Y9P A;  4CCG A;  1WR1 B;  4M1N A;  2OOA A;  1F4I A;  1NV8 A;  1YF9 A;  3BBZ A;  1UZX A;  3E46 A;  2CLW B;  1Z5S A;  1R4G A;  1YH2 A;  1HQY E;  1JR3 E;  1VEJ A;  4Y1L A;  3HCU B; 
#chains in the Genus database with same CATH topology
 3U61 A;  4JI6 M;  4JI3 M;  4X62 M;  1Y6L A;  3SHG B;  3EIH A;  2JY5 A;  4X64 M;  2XFS A;  2KNV A;  2Z4R A;  1D0K A;  4GC9 A;  7CAT A;  1GAB A;  1W4U A;  2EKK A;  2P5T A;  3FUX A;  1NY6 A;  4XGI A;  4ITQ A;  5JI2 E;  2KJH A;  2BNK A;  4HL4 A;  2CUZ A;  4LJ7 A;  4LGY A;  1OTR A;  2UYZ A;  1LV7 A;  1TH3 A;  3O2U A;  4G4R A;  4JI2 M;  1DGB A;  3SAR A;  2DZO B;  3JAM S;  4P5O G;  3U61 B;  2R0I A;  1PM5 A;  2F5N A;  4HEO A;  1PJT A;  1IBM M;  1VDL A;  4G4Q A;  1A3S A;  3VK7 A;  4RF1 A;  3HWS A;  1JR3 A;  2K0B X;  1R6B X;  3FUW A;  3LMM A;  4FD2 A;  5KO3 A;  3JR4 A;  3K1J A;  2HL7 A;  3SAS A;  4ONN A;  2F4W A;  2DNA A;  4LJ4 A;  4R62 A;  1N36 M;  1IN7 A;  3KP0 E;  4F1I A;  2DZL A;  5DYI A;  4DR6 M;  2QGX A;  1MX0 A;  5FER B;  5A2Q S;  1A5T A;  1IXZ A;  1YLA A;  3B89 A;  3NWL A;  4ONL B;  1K82 A;  1X37 A;  3HHW A;  3GLG A;  1Q34 A;  4PT5 A;  3PTF A;  1HT2 E;  3CF2 A;  1KSF X;  2C96 A;  2EKF A;  1R5L A;  3GLI A;  5D1L A;  1IN6 A;  4B7H A;  1N78 A;  2RGO A;  3ILK A;  3E9S A;  5EP3 A;  5FSW A;  2E5L M;  4MGK E;  2DAY A;  3UIO A;  3EIE A;  2OO9 A;  4GEW A;  2L4E A;  4IBF A;  1ZGU A;  2BEP A;  4FWD A;  4GMQ A;  2JZ1 A;  4Q5E C;  2YR0 A;  5D0K A;  4LZJ A;  4QOS A;  1K3W A;  1MJG M;  1OFI A;  4LF9 M;  3W67 A;  3PFI A;  4MDK A;  2QQ8 A;  2Z8Y M;  2K47 A;  2GRO A;  5KPZ A;  1PGY A;  4G3O A;  5FTJ A;  1AUA A;  1GVN A;  3ZNI C;  3AV0 A;  4R71 A;  4ZNY A;  4ONN B;  2JXN A;  3P9H A;  4A4B C;  3VK8 A;  2OPF A;  3K8Z A;  2Y21 A;  2GMI B;  1NV9 A;  2F5S A;  4R3D A;  1AIP C;  2R4E A;  3FYD A;  3UMM A;  4L8R C;  2CYX A;  1SG9 A;  4UN2 B;  2C5R A;  3BXW A;  1SXJ D;  2Z5D A;  4DDI A;  5EP4 A;  1IY1 A;  1Y8G A;  2HAK A;  2WSC F;  4QNM A;  5IRE B;  4NRV A;  3KDS E;  3ZQJ A;  1NNJ A;  1GKI A;  4L78 A;  1UKX A;  3SC3 A;  3UJN A;  3JW0 A;  1WHC A;  4AG5 A;  3CEG A;  4QPL B;  2QZ4 A;  3L28 A;  2EDI A;  1J5E M;  4NRG A;  2XFT A;  4IBD A;  3SAW A;  3GQ5 A;  4B3R M;  4BB9 A;  1C7Y A;  1ZUO A;  2UCZ A;  3D8B A;  4LFA M;  5F3W A;  2CV0 A;  2AYV A;  1Q02 A;  2DWL A;  2EJS A;  4CHT B;  4JI1 M;  1EFU B;  5KPT A;  1DGH B;  2QBY A;  4LF4 M;  2L7H A;  1JAS A;  2ERC A;  3L1Z A;  1IXS A;  3ZCB B;  2F5Q A;  3GLI E;  2CLW A;  2DAG A;  3QAU A;  4G6Z A;  2DMF A;  1PJQ A;  2K6B A;  3FUT A;  3M0E A;  4WUR A;  4NRW A;  1HJP A;  1QZM A;  4W5V A;  3HJQ A;  4AUQ A;  3I01 M;  2XWU A;  2H5X A;  3C3E A;  3GLI B;  3L27 A;  2DWZ B;  2LVQ D;  2Q2E B;  1KPS A;  2DAE A;  1WIV A;  5LMU M;  1JAT A;  4EIW A;  4L15 A;  3DZD A;  4KOD A;  2I7P A;  3SFZ A;  1N75 A;  3A42 A;  1TF0 B;  3A98 B;  3HU1 A;  4KO8 A;  3VKG A;  4LJ6 A;  5IFR A;  2O5R A;  1Z59 A;  4DV0 M;  4OW0 A;  2ESQ A;  5FTM A;  2CHQ A;  3T15 A;  4JN6 A;  4AZF A;  2F5O A;  3TWL A;  3MK6 A;  3GPX A;  2UUA M;  3HY5 A;  3KS8 A;  4ONM B;  4V3K A;  2Z7J A;  2CP8 A;  2DZN B;  2FE8 A;  4M9Z A;  4CIZ A;  1L1T A;  1J74 A;  3RZ3 A;  3GRU A;  3RGS A;  3FUV A;  3CF0 A;  4ONL A;  4II2 C;  1NHW C;  2JWS A;  4I5S A;  4PCZ A;  4M0W A;  1PJI A;  3M6A A;  3R8F A;  2F0R A;  3GO8 A;  5KPR A;  1V34 A;  2K07 A;  3HJ8 A;  5ITR A;  2RRU A;  4MB7 A;  3THG A;  1XMQ M;  1DV0 A;  4DR3 M;  1JR3 D;  4BBA A;  4B7G A;  1FBV C;  2DHY A;  4NOO B;  1IXS B;  3PNV A;  3ZH9 B;  1BVS A;  1YRV A;  2HLW A;  2KLY A;  3IG8 A;  2YZ0 A;  4CIS A;  1TDH A;  4X57 A;  4NL4 H;  2XGN A;  4DR7 M;  3GRY A;  1IM2 A;  1RU3 A;  4DV5 M;  3R9X B;  3QWL A;  3VFD A;  3BZH A;  1IN4 A;  2QCU A;  1IBK M;  3HU2 A;  2AAK A;  3L1Y A;  2UU9 M;  5AIT D;  2DEN A;  2NQ8 C;  1WJ7 A;  2R6F A;  3DFZ A;  3QYB A;  3KFU G;  2Z6O A;  2NVU C;  3KS4 A;  5D1M A;  3RPG A;  4MGY E;  3I4Y A;  1TH4 A;  3R42 A;  5ITX A;  2DAI A;  2KA6 B;  2EO2 A;  3VDU A;  2EBK A;  4A49 B;  4NR3 A;  2Q0V A;  3E21 A;  2CEA A;  3L2A A;  3U6O A;  3J27 B;  1M4P A;  1IN5 A;  1D0M A;  2HKJ A;  4MM3 B;  1J09 A;  3TWK A;  3J7A S;  1IFY A;  5HPT C;  1QAO A;  1T3T A;  2FFJ A;  4L16 A;  2A7L A;  3SHF A;  2DAX A;  2XLJ A;  1WGL A;  1VQ1 A;  4IJE A;  3Q8X A;  4DV1 M;  1YE9 A;  4DHZ F;  2CRU A;  1HT1 E;  3E95 C;  3FSH A;  2LVP C;  3AOG A;  3C3D A;  3EB6 B;  4IJF A;  4ZPX A;  4DV2 M;  3B7N A;  2D7E A;  1ZDN A;  2RGH A;  2LXE A;  4REZ A;  4FCT A;  1QUS A;  2LVO C;  3Q8G A;  2GRN A;  1XWI A;  4A4C C;  1HQC A;  4AP4 B;  3GQ3 A;  4Y1L C;  1YSY A;  5EGG A;  1PZV A;  4YY3 M;  4DR2 M;  1Z2U A;  4G4O A;  5F6D A;  2LTU A;  4IIW A;  2ZTD A;  1QCQ A;  2BJW A;  2QP9 X;  4DV3 M;  3LVW A;  4LDT C;  2PE6 A;  3K2L A;  3I4V A;  1WZV A;  4II7 A;  1Y8X A;  5F6E A;  4DHI D;  2O01 F;  2KZS A;  3IEC A;  3T6P A;  2BWE A;  4LF6 M;  1GJT A;  2CE7 A;  1XXH E;  1PRB A;  3LQR A;  4IBI A;  1ZAE A;  4P16 A;  2Z3X A;  4AKG A;  2A4D A;  4LAD A;  4AQY M;  3NBI A;  3W0F A;  1SXJ A;  1IN8 A;  3HJS A;  5DYG A;  5DNY A;  2XSZ A;  3KVW A;  3LCV B;  1IBL M;  2XEP A;  3KPA A;  1HR0 M;  5AIU B;  4LF7 M;  2ZTC A;  2JA2 A;  3RGP A;  1TDZ A;  2YB6 A;  4LJ5 A;  1VEG A;  2ZM6 M;  1GLN A;  2VII A;  3J7B A;  2PWQ A;  1Z5A A;  1T6O A;  3UZU A;  4JV5 M;  2UUC M;  2D7G A;  4YHH M;  1NVM A;  2J7O A;  1U9B A;  2A5Y B;  4PDI A;  4MGZ E;  4KLN A;  3UIP A;  3KOW E;  2ESO A;  2GRQ A;  2Y4W A;  1Z5B A;  2C9C A;  4D82 A;  1N32 M;  3OBX A;  3OJ4 A;  2W82 A;  2ZBK B;  4JUE A;  3U60 A;  3GRR A;  1QDR A;  4LRS A;  1L8Q A;  3CTW B;  1PJJ A;  2KDL A;  3MMP A;  4RF0 A;  1ZQ9 A;  3GLH B;  2FOI C;  4QHS A;  1XB2 B;  4LJ8 A;  3PXG A;  1IY2 A;  2OQ4 A;  2N35 A;  4GHA A;  3R3Q A;  4FCV A;  1E9S A;  1ZMV A;  3LVV A;  4DV6 M;  4NRG B;  2R44 A;  5F6X A;  1UM8 A;  3OBU A;  5E26 A;  4LGM A;  3IG5 A;  3HHY A;  4FH1 A;  2UXD M;  2APL A;  4PDG A;  1NJG A;  1KYI A;  1ZV1 A;  3B74 A;  3FE3 A;  1KFV A;  1L2C A;  3JR5 A;  4A3V B;  1NHG C;  2O25 A;  2Y0Q A;  3U6D A;  2LXP A;  5KNL C;  4HLQ A;  1Z5C A;  5FTL A;  4Y28 F;  4B3S M;  3RE8 A;  1OAI A;  5ITU A;  4DUZ M;  4ANR A;  1G41 A;  1V92 A;  2CWB A;  4DR4 M;  4L6V 6;  4Z8X A;  3A45 A;  2HWJ A;  5EQT A;  4OVZ B;  3T1Y M;  4GKK M;  4W5W A;  2XZF A;  2OB4 A;  5EXX A;  2Y9M A;  1Q39 A;  3V76 A;  3CGW A;  2KNZ A;  3J2P B;  1GJS A;  3H4J A;  2UXB M;  3HGI A;  2C4P A;  2GNO A;  1T43 A;  3GLH E;  3DA1 A;  2MH8 A;  3A33 A;  1ZMW A;  3FTD A;  4QOZ C;  1G4A E;  1WXQ A;  1NSF A;  2CHV A;  3TE6 A;  2UUB M;  3FKE A;  1OIZ A;  1HNZ M;  1GO5 A;  4IBK A;  4KHP M;  1JQJ C;  2VQF M;  4D81 A;  2DHR A;  4LF8 M;  1J7D B;  1ORY B;  1QAM A;  1MU5 A;  2R45 A;  2ZAN A;  1D2N A;  4DHJ C;  4RNA A;  3P9G A;  2JNH A;  3J81 S;  4I4L A;  1H6U A;  2MT6 A;  1VG5 A;  1TTE A;  4IBC A;  1G3I A;  4LJ9 A;  2EA0 A;  3GLF E;  2GMI A;  3SQV C;  3I51 A;  3T1H M;  3H4M A;  1NNU C;  3MHV C;  1V33 A;  5EXT A;  2JUJ A;  4DV7 M;  3U6Q A;  3U6M A;  2G3Q A;  3GPP A;  5F6V A;  3VON B;  4M9S A;  4IBE A;  2HCB A;  3HHZ A;  4JI8 M;  2MRO B;  4OVZ A;  3SY2 C;  3EVX A;  1OQY A;  5IZ7 D;  4LG2 A;  1XXH B;  3SAU A;  4QHT A;  2DI0 A;  4B08 A;  4DR1 M;  2GRP A;  3U6S A;  5D0M A;  1NO1 A;  5FTN A;  1E32 A;  3FTE A;  2O25 C;  1KPQ A;  2OOB A;  1E9R A;  3L25 A;  2DKL A;  3ONG B;  3KSJ A;  4NRI A;  2VRR A;  4F2L A;  4GKJ M;  2GQF A;  1E94 E;  2JZ0 A;  1HNX M;  2AHM A;  3RCZ B;  2J7N A;  3UIN A;  2AWF A;  3SYK A;  2C2V B;  1Q3B A;  2F4Z A;  5EXP A;  5E6J A;  4IBJ A;  4M0D A;  5ITT A;  4AKI A;  3HCT B;  3W68 A;  2YBF A;  4GH9 A;  1AYZ A;  3QYE A;  2KEB A;  2LWX A;  1UFZ A;  2FO3 A;  1U9A A;  2CV2 A;  2LHG A;  2YNM D;  3E4R A;  2DAM A;  1N33 M;  2M5Z A;  4LY6 A;  5ITQ A;  3GLF A;  2VQE M;  2OXQ A;  2YFQ A;  2PX9 B;  1NJF A;  1VEK A;  4JI7 M;  2BJV A;  4S12 A;  3WHK A;  2EUC A;  4MGI E;  5IWA M;  1SXJ C;  3AOE C;  2HHH M;  5H37 D;  2LHC A;  2C99 A;  4FCW A;  5EP1 A;  3AKZ A;  1FZY A;  4JI0 M;  4V3L A;  4DBG B;  3FYC A;  2VF8 A;  1S1Q A;  3U6L A;  2QHO B;  3I04 M;  4AKH A;  4OU7 A;  1G8P A;  3FRH A;  1CUK A;  2QBY B;  1X23 A;  2DVW B;  2DXI A;  2LVN C;  4MH0 E;  4XBO A;  2ESK A;  2L2D A;  2RKO A;  4NSR A;  1Z6T A;  4B3T M;  3FTF A;  2Z6P A;  4IBB A;  2LNH C;  2EKE A;  3TPZ A;  1I4W A;  2CHG A;  4B7F A;  3SAT A;  3WE5 A;  1J7K A;  1OIP A;  4WZ3 A;  4RKU F;  1W5T A;  2JP7 A;  4X65 M;  3KXE C;  4I8O A;  2WSF F;  2WSE F;  4YC1 A;  2J5Y A;  1N77 A;  1FXT A;  3CF6 E;  2XZU A;  1C1K A;  3OTO M;  2QPA A;  1P3Q Q;  2XH9 A;  4DR5 M;  5FQ2 A;  2Z4S A;  5GKN A;  2FUH A;  4PD2 A;  5ITY A;  1EIJ A;  4AI6 A;  5AIT B;  3ZQS A;  4TKP A;  4LJA A;  3GQ4 A;  3B7Q A;  1L2D A;  4DV4 M;  4XK8 F;  1DGH A;  4FWH A;  3K9O A;  2D7H A;  3HZJ A;  3K9P A;  4NC6 A;  5KQ8 A;  4GRI A;  5BPV A;  1JB0 F;  3OBQ A;  4K0K M;  3VDP A;  2R4J A;  3FTC A;  5IT9 S;  3ZC7 B;  2DWN A;  2GJD A;  3GPU A;  4LRT A;  2FNA A;  1QVR A;  4QNR A;  2ZAM A;  5C18 A;  1IY0 A;  4BWF A;  1QDT A;  4GIP A;  4IP3 B;  2R65 A;  5F6U A;  2X4A A;  2Y20 A;  1TR8 A;  3GLH A;  3HKP A;  3IHP A;  3PVS A;  2JY7 A;  2QNJ A;  3TL4 X;  5C1B A;  4BLC A;  1L1Z A;  2V1U A;  2L6O A;  3HU3 A;  4S3O A;  2V6Z M;  4OX9 M;  2EBM A;  5DFL A;  4ONM A;  2KNA A;  1QQW A;  2JY6 B;  4X66 M;  4L83 A;  2K9D A;  4GC5 A;  5KQD A;  1PJS A;  4WP2 A;  1WZW A;  4R7G A;  4G4N A;  3A4S A;  3GP1 A;  4JI5 M;  3GLG B;  4LFB M;  3KOZ E;  3TGD A;  4KT0 F;  5FTK A;  1IXR C;  1DGG A;  1QAN A;  1R7R A;  3BOS A;  2C98 A;  4Q7J A;  3FD9 A;  5JI3 E;  2BWB A;  5LMN M;  4DDG A;  3HX3 A;  1XNQ M;  5D2M A;  3HHX A;  2KW0 A;  2H1R A;  4AG6 A;  2VDB B;  3SAV A;  4GIT A;  3U60 B;  3MJ5 A;  1G71 A;  3SMP A;  1D0L A;  2R18 A;  4CGY B;  1DO2 A;  1ZMU A;  4I81 A;  4P17 A;  2FS1 A;  5FLX S;  3UGB A;  1GL6 A;  5EJC A;  4WW0 A;  3AFH A;  5ITX E;  5JNE B;  4TUW A;  2F5P A;  4EJE A;  1QAQ A;  3D8L A;  1EE8 A;  3U5Z A;  3FN1 B;  4BVU B;  2MJ5 B;  4FW9 A;  1WGN A;  1LTM A;  3KOY E;  4FVM A;  4CJ6 A;  3GLF B;  1XNR M;  1JAT B;  2DAK A;  1FJG M;  2ONU A;  3FRI A;  4Q5H C;  1R2Y A;  1DGF A;  3W31 B;  2Y0T A;  2MGW A;  3F92 A;  3U6C A;  2QSF X;  4D80 A;  1YUB A;  2JY8 A;  4LF5 M;  5F6Y A;  4LCB A;  2KHH A;  1M4Q A;  1IQP A;  2H2Y A;  1SXJ B;  1VDD A;  1TH2 A;  3KW6 A;  3TQS A;  3B7Z A;  3TWM A;  3OBS A;  4AW4 A;  4LZZ A;  5EXS A;  2CV1 A;  2ESP A;  1Q3C A;  4DS2 A;  2G5G X;  1GL7 A;  4B3M M;  4MGH A;  1XHB A;  2KRU A;  2WZJ A;  2E2C A;  4NR3 B;  3VKH A;  2DAW A;  4NRI B;  2XF3 A;  2R62 A;  1QZE A;  3UGJ A;  4NXM M;  1I94 M;  1OAO C;  2V1C A;  2KXE A;  4JXJ A;  3FUU A;  2CFO A;  2X49 A;  3M7G A;  2LH0 A;  2KRK A;  1SXJ E;  1TGU A;  2VF7 A;  1W5S A;  3KP1 E;  2LBC A;  4NXN M;  5BR8 M;  1K3X A;  1Z3D A;  2DWM A;  3A46 A;  2C2V C;  3H8K A;  1XXH A;  3AJI B;  3WHL A;  3JVZ A;  5AIE B;  3LW5 F;  2MR9 A;  3SBJ A;  1N34 M;  3W0L B;  4JI4 M;  4GPR A;  1JBB A;  1OJL A;  3RFW A;  2BF8 A;  1XMO M;  3GRV A;  3VLF B;  4FWG A;  1DO0 A;  1OKS A;  2M60 A;  5F6W A;  1S3S A;  2GRR A;  1QYR A;  3LCU A;  4JQU A;  2UXC M;  1NY5 A;  3AL0 C;  2LVA A;  1QUT A;  3DOA A;  5L8R F;  1G59 A;  2QEN A;  2YHO B;  3KOX E;  3LQQ A;  3J80 S;  3U6E A;  1C4Z D;  2L4F A;  4YII U;  1MN3 A;  2G8L A;  4DUY M;  2ZAO A;  5D1K A;  3C9P A;  5EP2 A;  3U6P A;  3VON C;  3GPY A;  1R2Z A;  3L26 A;  3K92 A;  2X8A A;  2YQZ A;  3GLG E;  4LFC M;  2F4V M;  1J7D A;  1I7K A;  2R0J A;  3L29 A;  4Z6Y A;  2L09 A;  8CAT A;  3U5Z B;  3SMS A;  1L2B A;  3E95 A;  2C9O A;  4JYA M;  2B3T A;  1KPP A;  2FH0 A;  2R46 A;  2KZU A;  2Y9P A;  4CCG A;  1WR1 B;  4M1N A;  2OOA A;  1F4I A;  3UK6 A;  3KSX A;  4IBG A;  3B9P A;  1NV8 A;  1YF9 A;  1HNW M;  4GHL A;  3BBZ A;  1UZX A;  2I7N A;  3E46 A;  3NBX X;  4NSO B;  1Z5S A;  1FNN A;  1R4G A;  3AOE A;  2CLW B;  4M9X A;  1HQY E;  1JR3 E;  1VEJ A;  3SYL A;  1YH2 A;  4Y1L A;  3C58 A;  1XC8 A;  4L4U A;  1OFH A;  2XSZ D;  3T38 A;  2L7I A;  3PNY A;  3HCU B; 
#chains in the Genus database with same CATH homology
 1Y6L A;  2JY5 A;  1W4U A;  2KNV A;  2EKK A;  5JI2 E;  2KJH A;  1OTR A;  2UYZ A;  4P5O G;  2R0I A;  1A3S A;  4HEO A;  1VDL A;  1ZGU A;  2K0B X;  4ONN A;  4R62 A;  2F4W A;  2DNA A;  4F1I A;  2DZL A;  2QGX A;  5FER B;  1A5T A;  1YLA A;  3B89 A;  4ONL B;  1Q34 A;  3PTF A;  1HT2 E;  2EKF A;  5D1L A;  2DAY A;  3UIO A;  2OO9 A;  4GEW A;  2L4E A;  2BEP A;  2JZ1 A;  4Q5E C;  5D0K A;  4MDK A;  2GRO A;  1PGY A;  4G3O A;  4R71 A;  4ONN B;  4A4B C;  3P9H A;  2GMI B;  1NV9 A;  1AIP C;  2CYX A;  1SG9 A;  4UN2 B;  4DDI A;  1Y8G A;  2HAK A;  1UKX A;  4QPL B;  3JW0 A;  1WHC A;  3CEG A;  2EDI A;  4NRG A;  1C7Y A;  1ZUO A;  2UCZ A;  2AYV A;  1Q02 A;  2EJS A;  1EFU B;  1JAS A;  3L1Z A;  1IXS A;  3GLI E;  2CLW A;  2DAG A;  2DMF A;  4W5V A;  4AUQ A;  1HJP A;  2XWU A;  2H5X A;  2LVQ D;  1KPS A;  2DAE A;  1WIV A;  1JAT A;  5IFR A;  2ESQ A;  4V3L A;  4V3K A;  4ONM B;  3RZ3 A;  2CP8 A;  1J74 A;  4ONL A;  4II2 C;  2Z5D A;  2K07 A;  2F0R A;  2RRU A;  1DV0 A;  1FBV C;  1YRV A;  3UIN A;  2DHY A;  2KLY A;  2HLW A;  1BVS A;  2YZ0 A;  4X57 A;  1IM2 A;  3BZH A;  3O2U A;  3ZNI C;  2AAK A;  5AIT D;  3L1Y A;  2DEN A;  2Z6O A;  1WJ7 A;  4DHJ C;  2NVU C;  5D1M A;  3RPG A;  3R42 A;  2DAI A;  2EBK A;  4A49 B;  4NR3 A;  2Q0V A;  3E21 A;  1M4P A;  1IFY A;  5HPT C;  2DAX A;  2A7L A;  1WGL A;  1VQ1 A;  4DHZ F;  1HT1 E;  3E95 C;  3FSH A;  2LVP C;  3EB6 B;  1ZDN A;  2LVO C;  2GRN A;  4A4C C;  4AP4 B;  4Y1L C;  5EGG A;  1PZV A;  1Z2U A;  5F6D A;  2LTU A;  1QCQ A;  2ZTD A;  4LDT C;  2PE6 A;  1WZV A;  1Y8X A;  4DHI D;  5F6E A;  3IEC A;  3T6P A;  2BWE A;  1XXH E;  2A4D A;  4LAD A;  2O25 C;  4ZNY A;  3LCV B;  3KPA A;  5AIU B;  2ZTC A;  2YB6 A;  1VEG A;  2PWQ A;  1T6O A;  1U9B A;  3UIP A;  2ESO A;  2GRQ A;  2Y4W A;  3OBX A;  3OJ4 A;  4JUE A;  3MMP A;  1XB2 B;  3R3Q A;  4NRG B;  1ZMV A;  5F6X A;  3OBU A;  4FH1 A;  1KYI A;  1ZV1 A;  3FE3 A;  2LXP A;  2O25 A;  5KNL C;  1OAI A;  1G41 A;  1V92 A;  2CWB A;  2HWJ A;  2OB4 A;  2Y9M A;  2KNZ A;  3H4J A;  2C4P A;  1T43 A;  3GLH E;  3A33 A;  1ZMW A;  1G4A E;  1GO5 A;  1J7D B;  3P9G A;  2JNH A;  2MT6 A;  1VG5 A;  1TTE A;  1G3I A;  3GLF E;  2GMI A;  3SQV C;  2JUJ A;  2G3Q A;  5F6V A;  3VON B;  2MRO B;  3SY2 C;  3EVX A;  1OQY A;  5D0M A;  5FQ2 A;  2DI0 A;  2GRP A;  1KPQ A;  2OOB A;  2DKL A;  3ONG B;  4NRI A;  2VRR A;  4F2L A;  1E94 E;  2JZ0 A;  3RCZ B;  2AWF A;  2C2V B;  2F4Z A;  3HCT B;  2YBF A;  1AYZ A;  1UFZ A;  2FO3 A;  1U9A A;  2DAM A;  2OXQ A;  2PX9 B;  1VEK A;  1FZY A;  4DBG B;  1S1Q A;  2QHO B;  3FRH A;  1CUK A;  1X23 A;  2LVN C;  2ESK A;  2L2D A;  2Z6P A;  2EKE A;  3WE5 A;  4WZ3 A;  2JP7 A;  4YC1 A;  1FXT A;  1P3Q Q;  2FUH A;  5AIT B;  3ZQS A;  4TKP A;  3K9O A;  3K9P A;  3OBQ A;  2GJD A;  4BWF A;  4IP3 B;  5F6U A;  1TR8 A;  3IHP A;  2JY7 A;  2QNJ A;  4S3O A;  2EBM A;  5DFL A;  4ONM A;  2KNA A;  2JY6 B;  4L83 A;  2K9D A;  1WZW A;  4WP2 A;  3A4S A;  3TGD A;  4Q7J A;  2BWB A;  4DDG A;  5D2M A;  3UGB A;  1DO2 A;  1ZMU A;  5JNE B;  4EJE A;  4BVU B;  3FN1 B;  2MJ5 B;  1WGN A;  1JAT B;  2DAK A;  2ONU A;  3FRI A;  4Q5H C;  3W31 B;  2MGW A;  3F92 A;  2QSF X;  2JY8 A;  5F6Y A;  2KHH A;  1M4Q A;  2H2Y A;  3OBS A;  2ESP A;  4DS2 A;  4NR3 B;  2E2C A;  2WZJ A;  2DAW A;  4NRI B;  1QZE A;  2LBC A;  1Z3D A;  3H8K A;  2C2V C;  5AIE B;  3JVZ A;  2MR9 A;  4GPR A;  1JBB A;  2BF8 A;  1DO0 A;  1OKS A;  5F6W A;  2GRR A;  3LCU A;  4JQU A;  2LVA A;  2YHO B;  1C4Z D;  2L4F A;  4YII U;  1MN3 A;  5D1K A;  3VON C;  1I7K A;  1J7D A;  3GLG E;  2R0J A;  3E95 A;  1KPP A;  2B3T A;  2Y9P A;  4CCG A;  1WR1 B;  4M1N A;  2OOA A;  1F4I A;  1NV8 A;  1YF9 A;  3BBZ A;  1UZX A;  3E46 A;  2CLW B;  1Z5S A;  1R4G A;  1YH2 A;  1HQY E;  1JR3 E;  1VEJ A;  4Y1L A;  3HCU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...