3K9OA

The crystal structure of e2-25k and ubb+1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
b'NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 K
publication title Structural Basis of E2-25K/UBB+1 Interaction for Neurotoxicity of Alzheimer Disease by Proteasome Inhibition
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 68
structure length 198
sequence length 198
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3k9oA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 3k9oA01
3K9OA 1YRVA 4R71A 4ONMA 2KNZA 1Z3DA 1Z5SA 2MGWA 3R42A 1Z2UA 2GRRA 2JY6B 1VG5A 1FZYA 4GEWA 3VONB 5F6WA 2JY5A 1OKSA 2EKKA 2DKLA 4DBGB 3P9HA 3RCZB 2CLWB 1TR8A 1JR3E 2KHHA 3ONGB 2KNVA 3OBSA 3UINA 1KPPA 3ZQSA 1GO5A 1EFUB 4G3OA 2CLWA 1WR1B 3GLHE 2EJSA 3HCUB 1HQYE 1XB2B 1DO2A 1OTRA 3ZNIC 1DV0A 1YF9A 1XXHE 2CYXA 2YB6A 2VRRA 2AWFA 2DAIA 5AIUB 4DHID 3PTFA 2OOBA 4BWFA 1Q02A 2QSFX 2G3QA 5JNEB 3FRHA 2DHYA 4V3LA 2Y9MA 3LCVB 2OOAA 1VEGA 4Y1LA 1W4UA 4AUQA 1WGLA 5F6EA 1NV8A 1WIVA 4DDIA 1J74A 5F6XA 3SY2C 2BWBA 2GMIB 1WHCA 2C2VB 2DENA 5EGGA 4JQUA 3UIPA 2GJDA 4IP3B 2ZTCA 4WZ3A 2HLWA 1HT2E 3FSHA 5KNLC 2JY7A 1MN3A 5D1MA 1JATA 3VONC 2QNJA 3FE3A 3UGBA 2KLYA 3IECA 2DAMA 1ZMWA 1Y8GA 3MMPA 4P5OG 2DNAA 1ZMUA 2ESKA 2DZLA 3RPGA 4EJEA 2MROB 2EKFA 4Q5HC 1ZDNA 2ZTDA 4NRIA 4ONNA 4A4CC 3L1YA 2Y4WA 3H8KA 3GLGE 3GLIE 1OAIA 1WZVA 4NRGB 5AITB 1OQYA 1DO0A 2R0IA 4BVUB 1IXSA 4Y1LC 1E94E 1A5TA 2K07A 2Z6OA 2JZ1A 1FXTA 1IM2A 5D1LA 5JI2E 1G4AE 5HPTC 2GRNA 1G41A 2OB4A 1AIPC 1UKXA 4ONLB 4WP2A 1ZUOA 2DAKA 5AIEB 5FQ2A 1FBVC 4S3OA 1VQ1A 1CUKA 4LDTC 2BEPA 3EB6B 1UFZA 2C2VC 2UYZA 1PGYA 3JVZA 4ONLA 3K9PA 4M1NA 2EBMA 2AYVA 2LXPA 1A3SA 4DHZF 1KYIA 2DAYA 2QHOB 1J7DB 3BZHA 2BF8A 3F92A 2JP7A 2DI0A 3CEGA 3B89A 1NV9A 2Z5DA 2XWUA 2A4DA 2JY8A 2Z6PA 1YLAA 4V3KA 2Q0VA 4TKPA 2LTUA 1JBBA 2DMFA 1V92A 2RRUA 5AITD 2K9DA 2Y9PA 1X23A 5D2MA 1TTEA 2E2CA 3L1ZA 1BVSA 2YHOB 4L83A 2LBCA 2O25A 5F6UA 2HWJA 1VEJA 1YH2A 4A49B 3A4SA 1F4IA 5FERB 4YC1A 3T6PA 3E95A 1ZGUA 2GMIA 1Q34A 4R62A 1ZMVA 2ESPA 2AAKA 2YBFA 2FUHA 2YZ0A 3GLFE 2F4ZA 4II2C 1S1QA 2DAXA 2ONUA 2H5XA 1Y6LA 4AP4B 2KJHA 4DS2A 2MR9A 2GRPA 5F6DA 4GPRA 1U9BA 2L2DA 2LVNC 2L4FA 3IHPA 3E21A 5D0MA 2OO9A 2C4PA 4CCGA 4F2LA 2F0RA 2H2YA 5D1KA 1VEKA 1IFYA 3A33A 3EVXA 2PWQA 4NRGA 1R4GA 2KNAA 2LVQD 2JNHA 2O25C 1C4ZD 3KPAA 1SG9A 1UZXA 4Q5EC 3OJ4A 1M4QA 3E95C 3W31B 2BWEA 2MJ5B 5DFLA 1KPQA 1U9AA 1WZWA 1M4PA 1P3QQ 3BBZA 1HJPA 2GROA 3HCTB 2JUJA 4UN2B 4LADA 1QCQA 3OBQA 2ESQA 2OXQA 4QPLB 4F1IA 2DAGA 1WJ7A 2EDIA 1J7DA 2CP8A 3H4JA 4FH1A 1G3IA 1JASA 2NVUC 3TGDA 1QZEA 3UIOA 3RZ3A 2DAWA 2LVOC 2MT6A 1ZV1A 4A4BC 2CWBA 2ESOA 1HT1E 2LVAA 4ZNYA 1C7YA 4X57A 4NR3B 3OBUA 4DHJC 2GRQA 1JATB 2PE6A 2JZ0A 3E46A 2L4EA 3LCUA 2WZJA 4MDKA 4NR3A 4YIIU 5IFRA 3OBXA 2FO3A 4HEOA 3R3QA 1VDLA 1AYZA 2F4WA 1WGNA 1I7KA 3O2UA 3P9GA 2A7LA 4DDGA 2B3TA 3JW0A 3WE5A 2QGXA 2LVPC 3FN1B 2K0BX 4NRIB 4ONNB 1Y8XA 3SQVC 5F6YA 1KPSA 4ONMB 5D0KA 2HAKA 2R0JA 2DAEA 3FRIA 4JUEA 1PZVA 2UCZA 4W5VA 5F6VA 1T43A 2PX9B 2EKEA 2EBKA 4Q7JA 1T6OA
chains in the Genus database with same CATH superfamily
2MGWA 4AW4A 4JI2M 1JQJC 5ITTA 2CHGA 4QNMA 3HJ8A 3T38A 1UM8A 1TR8A 2YQZA 2KA6B 2DWMA 5ITRA 2KNVA 2G5GX 4BB9A 3CF0A 2XFTA 1D2NA 1YUBA 1NNUC 2EJSA 4JXJA 2K47A 4IBGA 2X8AA 4JV5M 1DV0A 2CE7A 1YF9A 3ZQJA 2RGHA 4DHID 1YE9A 2WSCF 1NY6A 2X4AA 1D0LA 4V3LA 4KO8A 4PD2A 1VEGA 3THGA 2QZ4A 1NV8A 1WIVA 3L27A 2CFOA 1WHCA 4REZA 5EGGA 2P5TA 4JQUA 4GIPA 5EJCA 4LJAA 4A3VB 3FSHA 2JY7A 3LMMA 3U6DA 1OAOC 4K0KM 4LF6M 3IECA 2DAMA 3GLIA 3B9PA 2KXEA 3EIHA 2Z4RA 3M0EA 2ESKA 4MM3B 2KZUA 2MROB 2ZANA 3AOGA 1DGFA 5ITXA 1DO0A 5KPRA 4GITA 4PT5A 4X64M 1IXSA 1A5TA 1IM2A 3GPXA 3UMMA 1L1ZA 1ZUOA 2DAKA 5AIEB 4AI6A 2Z8YM 3KSXA 4DV2M 1HNXM 1QQWA 3KP1E 1UFZA 4IIWA 3ZH9B 3TWLA 2JXNA 2LXPA 1L8QA 4DHZF 1KYIA 2ERCA 2V1CA 1GL7A 3BZHA 3SASA 2NQ8C 3FUVA 3FUUA 3WHLA 2JP7A 2DI0A 3CEGA 4MGIE 3B89A 3U60B 1IQPA 2JY8A 3B7QA 1R2ZA 1QANA 5FTKA 4V3KA 2XLJA 3DOAA 4FWDA 2LTUA 3OTOM 4LRTA 2E2CA 2XEPA 5FTJA 2HWJA 1YH2A 2FOIC 2DWZB 1QDTA 3GQ4A 3T6PA 3BXWA 3TWMA 4LJ5A 1N75A 3SAWA 4CHTB 3J80S 2AAKA 5L8RF 1XNRM 4LCBA 4LF4M 4D82A 4JI0M 4XBOA 3ZC7B 4LGMA 2DAXA 5C18A 2ONUA 2H5XA 4AP4B 3AKZA 2F4VM 3R9XB 2GRPA 2ZAOA 3HJQA 3RE8A 4GPRA 1U9BA 1NVMA 1IN7A 3IHPA 5IZ7D 2H2YA 3VKGA 2R4JA 5DYIA 1ORYB 3R8FA 4M0WA 2FFJA 3FTDA 3GRYA 2PWQA 3NBIA 3L2AA 2JNHA 2R45A 4DV0M 3PNVA 4Y28F 4IBFA 5KO3A 1IY2A 5EP1A 2UXBM 1XC8A 3GPYA 1XHBA 3J81S 1RU3A 2F5PA 1KPQA 1NJFA 1M4PA 1XXHA 4JI8M 2HCBA 1OIPA 3HCTB 2KDLA 2GNOA 4FVMA 1Z5AA 2I7NA 4UN2B 4L15A 4DR7M 2UU9M 4F1IA 4QHSA 2F5QA 3HX3A 3VDPA 2UXCM 2XZUA 2APLA 1JR3D 2C9CA 1IXZA 3TGDA 1IXRC 4IBKA 3RZ3A 2DAWA 3Q8XA 4OVZA 2CWBA 1JB0F 3B7NA 5EXXA 1HT1E 2R18A 3U6LA 2UUBM 2DHRA 2JZ0A 2L4EA 1QUSA 4NR3A 4YIIU 3OBXA 4MGZE 1VDLA 2F4WA 3CTWB 2DWNA 2A7LA 3FUXA 4QNRA 2LVPC 2VDBB 2K0BX 4NRIB 4ONNB 3ILKA 1IBKM 4AG6A 5F6YA 1N78A 3HKPA 2HKJA 2HAKA 2DAEA 2MH8A 5EXTA 5F6VA 4AKGA 4LF8M 3SC3A 2CV0A 4LJ4A 4R71A 3T1YM 3PFIA 1Z5SA 3KVWA 3R42A 1R6BX 1VG5A 2G8LA 5KQDA 1FZYA 1N32M 3J27B 3VONB 4NXNM 5FTLA 3RCZB 4DV3M 3KOXE 2ZM6M 1Q39A 2VIIA 1QAQA 3QWLA 3ONGB 3OBSA 1KPPA 1GO5A 1K3XA 2YFQA 3UK6A 3I04M 2L09A 1DO2A 2KEBA 1R5LA 1OTRA 3ZNIC 1EIJA 2CYXA 2YB6A 4X66M 3W0LB 2OOBA 4BWFA 1Q02A 2QSFX 2N35A 3U61B 2HL7A 2F5NA 2OOAA 1W4UA 4AUQA 5E26A 3HHZA 1G8PA 4DDIA 3SY2C 3U5ZB 2GMIB 3HU3A 5JI3E 2DENA 1TDZA 2GJDA 2HLWA 1C1KA 3SBJA 1N34M 4HL4A 3U6OA 4PDIA 5D1MA 2QQ8A 4AKIA 5FTNA 1N36M 3ZCBB 3UGBA 1GVNA 2KLYA 4LJ8A 3TE6A 2HHHM 3MMPA 2XGNA 1ZMUA 3C3DA 3SHFA 4W5WA 1X37A 4B7GA 1IXSB 2ZTDA 4NOOB 4NRIA 4ONNA 4RF0A 3L1YA 5FSWA 2I7PA 3GLGE 3GLIE 2LHGA 1WZVA 1L1TA 4BVUB 2O01F 4Y1LC 1FXTA 3GRRA 4G4RA 3PXGA 5HPTC 1KFVA 1FBVC 5ITXE 2R6FA 3MHVC 1CUKA 2LNHC 4WURA 1TDHA 2M5ZA 2Q2EB 2C2VC 1PGYA 4ONLA 3K1JA 3A98B 3CF6E 2AYVA 2LWXA 3HU2A 3J7BA 3JAMS 3AV0A 2Y20A 2J7NA 3V76A 2QHOB 4GC5A 3F92A 1XMOM 4LF5M 4DV1M 3LQRA 1NO1A 1MX0A 4RF1A 2Z6PA 1YLAA 3DZDA 3U61A 3SATA 3M6AA 1JBBA 3HHYA 2OQ4A 1IBMM 5D2MA 2Y0QA 2OPFA 1BVSA 4LJ9A 3NWLA 4FD2A 1DGHA 5KPZA 4NSOB 4AG5A 3U5ZA 2GMIA 5IT9S 4IBEA 4CIZA 2ESPA 1MJGM 2YZ0A 4DR5M 2VF7A 4XGIA 3GLFE 3NBXX 3BOSA 2F4ZA 1S1QA 3AL0C 2E5LM 1Z59A 2F5SA 4DS2A 4OW0A 4AKHA 5F6DA 2LVNC 3SARA 4LG2A 5GKNA 2BJVA 3DA1A 3W0FA 4F2LA 4DUZM 2F0RA 4R3DA 5D1KA 2C96A 1VEKA 3HGIA 3A33A 3EVXA 2V1UA 1R4GA 4ITQA 3GO8A 2O25C 1C4ZD 3B74A 1XXHB 1UZXA 2Y0TA 5BPVA 2QPAA 3HZJA 5DFLA 2D7EA 1P3QQ 2KRUA 4PDGA 4LADA 1QCQA 4DV4M 3L25A 4IJFA 5EXPA 1WJ7A 3H4JA 4IBBA 5ITUA 4OVZB 1WXQA 1SXJC 4JI1M 1HQCA 1JASA 3FTCA 1PJSA 4FCVA 3UIOA 2LVOC 1ZV1A 4NRVA 3CGWA 3HHWA 1GL6A 4GKKM 1GKIA 4X57A 5KPTA 3DFZA 1TGUA 2A5YB 4NR3B 5FTMA 1E32A 1NHWC 3UGJA 1JATB 3LCUA 3C3EA 2R4EA 3W67A 1PRBA 4HEOA 3R3QA 3P9GA 1W5SA 4DDGA 4GHLA 2QGXA 4B3SM 4DR6M 3GRUA 3C9PA 2WSEF 2JWSA 1N33M 3LW5F 3SQVC 1KPSA 3FYCA 3PVSA 5D0KA 1NNJA 2R0JA 4NXMM 1T43A 4L16A 3GPUA 1FNNA 2CHQA 2L6OA 4Q7JA 1T6OA 3U6PA 2L7HA 4ONMA 2KNZA 1Z3DA 3KSJA 1I4WA 3KFUG 2C5RA 1D0MA 1Z2UA 2GRRA 2JY6B 4FW9A 3K8ZA 2EKKA 3P9HA 3U6MA 2UUAM 4LGYA 1JR3E 3J2PB 1AUAA 3UINA 3ZQSA 1L2CA 1EFUB 2CLWA 3GLHE 3JR5A 1XB2B 3SFZA 3KOWE 2XF3A 2D7HA 3PTFA 2WSFF 1Z6TA 4JI4M 3QYBA 5EQTA 3D8BA 4YY3M 5EXSA 5JNEB 3E9SA 3KW6A 2DHYA 1Z5BA 4B7HA 1PJIA 3KOZE 1PJQA 4Y1LA 4GH9A 5F6EA 4Z8XA 3VKHA 3K2LA 5F6XA 3VFDA 4IP3B 2ZTCA 3FTEA 3FYDA 3FKEA 5KNLC 3QAUA 1QYRA 3SMPA 3I4YA 1JATA 2CRUA 3GQ3A 5EP2A 5IREB 1ZMWA 1Y8GA 3FUWA 1R2YA 4P5OG 2DNAA 1HNWM 2DZLA 3RPGA 2GQFA 3HU1A 2DZNB 4Q5HC 2C99A 1SXJB 1V33A 4WW0A 4TUWA 3H8KA 1OAIA 4NRGB 1OQYA 4PCZA 1IY0A 2QENA 1E94E 2K07A 2Z6OA 4XK8F 4QHTA 5JI2E 1G4AE 1IN4A 2LHCA 1UKXA 4ONLB 4WP2A 5FQ2A 1VQ1A 1IN5A 5BR8M 4JYAM 1XMQM 3EB6B 1G71A 4B3RM 4X65M 4FCWA 4M1NA 3GRVA 1XNQM 4LF9M 2DAYA 4I5SA 3SAVA 4B3MM 2DZOB 3AOEC 4L8RC 2YNMD 2Z5DA 2JA2A 3A42A 2XWUA 4DV7M 3RFWA 1PJJA 1SXJD 1T3TA 2F5OA 1DGHB 4M9XA 2Y9PA 3L1ZA 2YHOB 4L83A 2LBCA 2O25A 4YHHM 1VEJA 3E4RA 3LVVA 1F4IA 5FERB 4YC1A 4L78A 4I4LA 1Q34A 2YBFA 3TPZA 2XZFA 4B7FA 1OJLA 4NSRA 1KSFX 1OIZA 2V6ZM 3VK8A 4BLCA 3GLGB 3K92A 4DV5M 4II2C 5DNYA 5DYGA 4MGYE 1GLNA 3KDSE 1R7RA 2L2DA 5ITQA 2ZBKB 3E21A 2OO9A 4CCGA 1SXJA 3EIEA 3TQSA 3FD9A 1LV7A 1OFIA 4AQYM 1N77A 2Z3XA 4NRGA 4JN6A 5EP4A 2EO2A 2KNAA 2LVQD 4GC9A 4I81A 3KPAA 1ZAEA 1SG9A 3QYEA 1J7KA 2DVWB 2D7GA 3SYLA 4M0DA 1K82A 1M4QA 3E95C 2XH9A 2BWEA 4B3TM 2MJ5B 2XFSA 1VDDA 3BBZA 2GROA 2J7OA 3JR4A 3SYKA 4IBIA 4LZJA 1GJTA 4R7GA 3OBQA 2ESQA 4ANRA 2EDIA 2CP8A 3B7ZA 1S3SA 3KXEC 4MH0E 4FWGA 2VQEM 2NVUC 3SHGB 5E6JA 3FUTA 4KODA 3GLFB 4ZNYA 1C7YA 3U6QA 3VLFB 1HR0M 1I94M 3IG8A 4QOSA 2ZAMA 2QCUA 1Q3BA 2PE6A 4KLNA 1LTMA 3E46A 1DGGA 2WZJA 1E9SA 4MDKA 5IFRA 2Y21A 1AYZA 3O2UA 1WGNA 1I7KA 2FH0A 4BBAA 2KW0A 3I01M 2EUCA 3JW0A 3WE5A 2C98A 3GLGA 3MK6A 3FN1B 3A46A 3T15A 3SAUA 1Y8XA 4ONMB 3FRIA 4W5VA 3GP1A 2PX9B 3CF2A 2RKOA 2EKEA 3K9OA 1YRVA 3I4VA 4D81A 3W68A 3LVWA 2R44A 4GEWA 5F6WA 2JY5A 1OKSA 4II7A 2DKLA 4DBGB 4DR3M 2CLWB 3M7GA 2KHHA 4Z6YA 3AFHA 4GKJM 4G3OA 2CV2A 5H37D 1WR1B 3HCUB 5FLXS 3H4MA 1HQYE 4ZPXA 2R62A 2FNAA 1XXHE 2L7IA 2VRRA 2AWFA 2DAIA 5F3WA 5AIUB 1L2BA 1QZMA 4X62M 4NL4H 2EA0A 1J5EM 2G3QA 3FRHA 2BNKA 3RGSA 2Y9MA 3LCVB 1Z5CA 4L6V6 3VDUA 1QDRA 1WGLA 2XSZD 4LFBM 4M9SA 1J74A 4QOZC 4M9ZA 5ITYA 1TH2A 2BWBA 2C2VB 4GRIA 3UIPA 3GLFA 2CEAA 2R46A 4WZ3A 1E9RA 1HT2E 3VK7A 4RNAA 1MN3A 2CUZA 4DV6M 2YR0A 1QAMA 1HNZM 2RGOA 3VONC 1QVRA 2QNJA 3FE3A 4EIWA 3PNYA 3IG5A 4EJEA 5KQ8A 2EKFA 3AOEA 4CISA 1PM5A 1ZDNA 1W5TA 4A4CC 2Y4WA 5LMNM 1K3WA 2Z4SA 5AITB 3RGPA 2R0IA 2KRKA 4JI6M 2FE8A 2JZ1A 4MGKE 1TH4A 5D1LA 2XSZA 3GLHB 2GRNA 1G41A 2OB4A 1AIPC 2J5YA 2QBYB 3J7AS 4S3OA 4S12A 4LDTC 2BEPA 4GMQA 1IN8A 3JVZA 2UYZA 4P16A 3K9PA 2DWLA 2EBMA 3D8LA 2CHVA 4CJ6A 1XWIA 1A3SA 4LRSA 2LXEA 4DR1M 4JI3M 3HWSA 3HJSA 2AHMA 1J7DB 3KOYE 2X49A 2BF8A 4LFAM 1QUTA 3L26A 1NV9A 2LH0A 3HHXA 3L28A 4JI7M 3I51A 2A4DA 1NJGA 4LF7M 2Q0VA 4TKPA 2DMFA 2UUCM 4LJ6A 1V92A 2RRUA 5AITD 2K9DA 3Q8GA 1X23A 3U60A 1TTEA 1GABA 4KHPM 3U6SA 1IY1A 3WHKA 5F6UA 4P17A 4A49B 3A4SA 4CGYB 1NHGC 1G59A 4G4OA 3E95A 1ZGUA 1EE8A 4FWHA 4R62A 4IBCA 2FS1A 1ZMVA 2K6BA 2FUHA 3SMSA 4B08A 1L2DA 4IJEA 4G4QA 1Y6LA 4IBDA 2KJHA 2UXDM 2MR9A 2VF8A 4DUYM 1MU5A 4JI5M 4LY6A 2C9OA 2L4FA 1DGBA 5D0MA 2QP9X 1GJSA 2C4PA 2VQFM 1IFYA 1OFHA 1V34A 1JR3A 3KP0E 1NY5A 4Q5EC 1SXJE 3OJ4A 3GLHA 3W31B 2CV1A 8CATA 2QBYA 4HLQA 1U9AA 3UZUA 4IBJA 1WZWA 3LQQA 1HJPA 3GQ5A 1IBLM 3KS4A 2JUJA 3TWKA 2O5RA 1TH3A 2DXIA 5IWAM 4AZFA 4L4UA 2OXQA 4QPLB 3KS8A 2DAGA 1PJTA 5EP3A 1J7DA 1YSYA 4MB7A 4FH1A 2W82A 1QAOA 1G3IA 4KT0F 4FCTA 3T1HM 3AJIB 3MJ5A 4D80A 1QZEA 1NSFA 2MT6A 4RKUF 4A4BC 2ESOA 4OU7A 2LVAA 1IN6A 3C58A 4DR4M 2BJWA 1ZQ9A 4I8OA 4LZZA 3OBUA 2M60A 4DHJC 2GRQA 1TF0B 1H6UA 4NC6A 1D0KA 2H1RA 4G4NA 5LMUM 4NRWA 3FTFA 4MGHA 3GLIB 1Q3CA 2FO3A 4GHAA 3U6CA 2KZSA 5A2QS 1J09A 4LFCM 4OX9M 2B3TA 5C1BA 3A45A 3GPPA 1FJGM 2R65A 2Z7JA 7CATA 4G6ZA 3UJNA 3L29A 4JUEA 1PZVA 2UCZA 4DR2M 2EBKA 4LJ7A 3U6EA 3HY5A 3TL4X
chains in the Genus database with same CATH topology
3K9OA 1YRVA 4R71A 4ONMA 2KNZA 1Z3DA 1Z5SA 2MGWA 3R42A 1Z2UA 2GRRA 2JY6B 1VG5A 1FZYA 4GEWA 3VONB 5F6WA 2JY5A 1OKSA 2EKKA 2DKLA 4DBGB 3P9HA 3RCZB 2CLWB 1TR8A 1JR3E 2KHHA 3ONGB 2KNVA 3OBSA 3UINA 1KPPA 3ZQSA 1GO5A 1EFUB 4G3OA 2CLWA 1WR1B 3GLHE 2EJSA 3HCUB 1HQYE 1XB2B 1DO2A 1OTRA 3ZNIC 1DV0A 1YF9A 1XXHE 2CYXA 2YB6A 2VRRA 2AWFA 2DAIA 5AIUB 4DHID 3PTFA 2OOBA 4BWFA 1Q02A 2QSFX 2G3QA 5JNEB 3FRHA 2DHYA 4V3LA 2Y9MA 3LCVB 2OOAA 1VEGA 4Y1LA 1W4UA 4AUQA 1WGLA 5F6EA 1NV8A 1WIVA 4DDIA 1J74A 5F6XA 3SY2C 2BWBA 2GMIB 1WHCA 2C2VB 2DENA 5EGGA 4JQUA 3UIPA 2GJDA 4IP3B 2ZTCA 4WZ3A 2HLWA 1HT2E 3FSHA 5KNLC 2JY7A 1MN3A 5D1MA 1JATA 3VONC 2QNJA 3FE3A 3UGBA 2KLYA 3IECA 2DAMA 1ZMWA 1Y8GA 3MMPA 4P5OG 2DNAA 1ZMUA 2ESKA 2DZLA 3RPGA 4EJEA 2MROB 2EKFA 4Q5HC 1ZDNA 2ZTDA 4NRIA 4ONNA 4A4CC 3L1YA 2Y4WA 3H8KA 3GLGE 3GLIE 1OAIA 1WZVA 4NRGB 5AITB 1OQYA 1DO0A 2R0IA 4BVUB 1IXSA 4Y1LC 1E94E 1A5TA 2K07A 2Z6OA 2JZ1A 1FXTA 1IM2A 5D1LA 5JI2E 1G4AE 5HPTC 2GRNA 1G41A 2OB4A 1AIPC 1UKXA 4ONLB 4WP2A 1ZUOA 2DAKA 5AIEB 5FQ2A 1FBVC 4S3OA 1VQ1A 1CUKA 4LDTC 2BEPA 3EB6B 1UFZA 2C2VC 2UYZA 1PGYA 3JVZA 4ONLA 3K9PA 4M1NA 2EBMA 2AYVA 2LXPA 1A3SA 4DHZF 1KYIA 2DAYA 2QHOB 1J7DB 3BZHA 2BF8A 3F92A 2JP7A 2DI0A 3CEGA 3B89A 1NV9A 2Z5DA 2XWUA 2A4DA 2JY8A 2Z6PA 1YLAA 4V3KA 2Q0VA 4TKPA 2LTUA 1JBBA 2DMFA 1V92A 2RRUA 5AITD 2K9DA 2Y9PA 1X23A 5D2MA 1TTEA 2E2CA 3L1ZA 1BVSA 2YHOB 4L83A 2LBCA 2O25A 5F6UA 2HWJA 1VEJA 1YH2A 4A49B 3A4SA 1F4IA 5FERB 4YC1A 3T6PA 3E95A 1ZGUA 2GMIA 1Q34A 4R62A 1ZMVA 2ESPA 2AAKA 2YBFA 2FUHA 2YZ0A 3GLFE 2F4ZA 4II2C 1S1QA 2DAXA 2ONUA 2H5XA 1Y6LA 4AP4B 2KJHA 4DS2A 2MR9A 2GRPA 5F6DA 4GPRA 1U9BA 2L2DA 2LVNC 2L4FA 3IHPA 3E21A 5D0MA 2OO9A 2C4PA 4CCGA 4F2LA 2F0RA 2H2YA 5D1KA 1VEKA 1IFYA 3A33A 3EVXA 2PWQA 4NRGA 1R4GA 2KNAA 2LVQD 2JNHA 2O25C 1C4ZD 3KPAA 1SG9A 1UZXA 4Q5EC 3OJ4A 1M4QA 3E95C 3W31B 2BWEA 2MJ5B 5DFLA 1KPQA 1U9AA 1WZWA 1M4PA 1P3QQ 3BBZA 1HJPA 2GROA 3HCTB 2JUJA 4UN2B 4LADA 1QCQA 3OBQA 2ESQA 2OXQA 4QPLB 4F1IA 2DAGA 1WJ7A 2EDIA 1J7DA 2CP8A 3H4JA 4FH1A 1G3IA 1JASA 2NVUC 3TGDA 1QZEA 3UIOA 3RZ3A 2DAWA 2LVOC 2MT6A 1ZV1A 4A4BC 2CWBA 2ESOA 1HT1E 2LVAA 4ZNYA 1C7YA 4X57A 4NR3B 3OBUA 4DHJC 2GRQA 1JATB 2PE6A 2JZ0A 3E46A 2L4EA 3LCUA 2WZJA 4MDKA 4NR3A 4YIIU 5IFRA 3OBXA 2FO3A 4HEOA 3R3QA 1VDLA 1AYZA 2F4WA 1WGNA 1I7KA 3O2UA 3P9GA 2A7LA 4DDGA 2B3TA 3JW0A 3WE5A 2QGXA 2LVPC 3FN1B 2K0BX 4NRIB 4ONNB 1Y8XA 3SQVC 5F6YA 1KPSA 4ONMB 5D0KA 2HAKA 2R0JA 2DAEA 3FRIA 4JUEA 1PZVA 2UCZA 4W5VA 5F6VA 1T43A 2PX9B 2EKEA 2EBKA 4Q7JA 1T6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O A;  1YRV A;  4R71 A;  4ONM A;  2KNZ A;  1Z3D A;  1Z5S A;  2MGW A;  3R42 A;  1Z2U A;  2GRR A;  2JY6 B;  1VG5 A;  1FZY A;  4GEW A;  3VON B;  5F6W A;  2JY5 A;  1OKS A;  2EKK A;  2DKL A;  4DBG B;  3P9H A;  3RCZ B;  2CLW B;  1TR8 A;  1JR3 E;  2KHH A;  3ONG B;  2KNV A;  3OBS A;  3UIN A;  1KPP A;  3ZQS A;  1GO5 A;  1EFU B;  4G3O A;  2CLW A;  1WR1 B;  3GLH E;  2EJS A;  3HCU B;  1HQY E;  1XB2 B;  1DO2 A;  1OTR A;  3ZNI C;  1DV0 A;  1YF9 A;  1XXH E;  2CYX A;  2YB6 A;  2VRR A;  2AWF A;  2DAI A;  5AIU B;  4DHI D;  3PTF A;  2OOB A;  4BWF A;  1Q02 A;  2QSF X;  2G3Q A;  5JNE B;  3FRH A;  2DHY A;  4V3L A;  2Y9M A;  3LCV B;  2OOA A;  1VEG A;  4Y1L A;  1W4U A;  4AUQ A;  1WGL A;  5F6E A;  1NV8 A;  1WIV A;  4DDI A;  1J74 A;  5F6X A;  3SY2 C;  2BWB A;  2GMI B;  1WHC A;  2C2V B;  2DEN A;  5EGG A;  4JQU A;  3UIP A;  2GJD A;  4IP3 B;  2ZTC A;  4WZ3 A;  2HLW A;  1HT2 E;  3FSH A;  5KNL C;  2JY7 A;  1MN3 A;  5D1M A;  1JAT A;  3VON C;  2QNJ A;  3FE3 A;  3UGB A;  2KLY A;  3IEC A;  2DAM A;  1ZMW A;  1Y8G A;  3MMP A;  4P5O G;  2DNA A;  1ZMU A;  2ESK A;  2DZL A;  3RPG A;  4EJE A;  2MRO B;  2EKF A;  4Q5H C;  1ZDN A;  2ZTD A;  4NRI A;  4ONN A;  4A4C C;  3L1Y A;  2Y4W A;  3H8K A;  3GLG E;  3GLI E;  1OAI A;  1WZV A;  4NRG B;  5AIT B;  1OQY A;  1DO0 A;  2R0I A;  4BVU B;  1IXS A;  4Y1L C;  1E94 E;  1A5T A;  2K07 A;  2Z6O A;  2JZ1 A;  1FXT A;  1IM2 A;  5D1L A;  5JI2 E;  1G4A E;  5HPT C;  2GRN A;  1G41 A;  2OB4 A;  1AIP C;  1UKX A;  4ONL B;  4WP2 A;  1ZUO A;  2DAK A;  5AIE B;  5FQ2 A;  1FBV C;  4S3O A;  1VQ1 A;  1CUK A;  4LDT C;  2BEP A;  3EB6 B;  1UFZ A;  2C2V C;  2UYZ A;  1PGY A;  3JVZ A;  4ONL A;  3K9P A;  4M1N A;  2EBM A;  2AYV A;  2LXP A;  1A3S A;  4DHZ F;  1KYI A;  2DAY A;  2QHO B;  1J7D B;  3BZH A;  2BF8 A;  3F92 A;  2JP7 A;  2DI0 A;  3CEG A;  3B89 A;  1NV9 A;  2Z5D A;  2XWU A;  2A4D A;  2JY8 A;  2Z6P A;  1YLA A;  4V3K A;  2Q0V A;  4TKP A;  2LTU A;  1JBB A;  2DMF A;  1V92 A;  2RRU A;  5AIT D;  2K9D A;  2Y9P A;  1X23 A;  5D2M A;  1TTE A;  2E2C A;  3L1Z A;  1BVS A;  2YHO B;  4L83 A;  2LBC A;  2O25 A;  5F6U A;  2HWJ A;  1VEJ A;  1YH2 A;  4A49 B;  3A4S A;  1F4I A;  5FER B;  4YC1 A;  3T6P A;  3E95 A;  1ZGU A;  2GMI A;  1Q34 A;  4R62 A;  1ZMV A;  2ESP A;  2AAK A;  2YBF A;  2FUH A;  2YZ0 A;  3GLF E;  2F4Z A;  4II2 C;  1S1Q A;  2DAX A;  2ONU A;  2H5X A;  1Y6L A;  4AP4 B;  2KJH A;  4DS2 A;  2MR9 A;  2GRP A;  5F6D A;  4GPR A;  1U9B A;  2L2D A;  2LVN C;  2L4F A;  3IHP A;  3E21 A;  5D0M A;  2OO9 A;  2C4P A;  4CCG A;  4F2L A;  2F0R A;  2H2Y A;  5D1K A;  1VEK A;  1IFY A;  3A33 A;  3EVX A;  2PWQ A;  4NRG A;  1R4G A;  2KNA A;  2LVQ D;  2JNH A;  2O25 C;  1C4Z D;  3KPA A;  1SG9 A;  1UZX A;  4Q5E C;  3OJ4 A;  1M4Q A;  3E95 C;  3W31 B;  2BWE A;  2MJ5 B;  5DFL A;  1KPQ A;  1U9A A;  1WZW A;  1M4P A;  1P3Q Q;  3BBZ A;  1HJP A;  2GRO A;  3HCT B;  2JUJ A;  4UN2 B;  4LAD A;  1QCQ A;  3OBQ A;  2ESQ A;  2OXQ A;  4QPL B;  4F1I A;  2DAG A;  1WJ7 A;  2EDI A;  1J7D A;  2CP8 A;  3H4J A;  4FH1 A;  1G3I A;  1JAS A;  2NVU C;  3TGD A;  1QZE A;  3UIO A;  3RZ3 A;  2DAW A;  2LVO C;  2MT6 A;  1ZV1 A;  4A4B C;  2CWB A;  2ESO A;  1HT1 E;  2LVA A;  4ZNY A;  1C7Y A;  4X57 A;  4NR3 B;  3OBU A;  4DHJ C;  2GRQ A;  1JAT B;  2PE6 A;  2JZ0 A;  3E46 A;  2L4E A;  3LCU A;  2WZJ A;  4MDK A;  4NR3 A;  4YII U;  5IFR A;  3OBX A;  2FO3 A;  4HEO A;  3R3Q A;  1VDL A;  1AYZ A;  2F4W A;  1WGN A;  1I7K A;  3O2U A;  3P9G A;  2A7L A;  4DDG A;  2B3T A;  3JW0 A;  3WE5 A;  2QGX A;  2LVP C;  3FN1 B;  2K0B X;  4NRI B;  4ONN B;  1Y8X A;  3SQV C;  5F6Y A;  1KPS A;  4ONM B;  5D0K A;  2HAK A;  2R0J A;  2DAE A;  3FRI A;  4JUE A;  1PZV A;  2UCZ A;  4W5V A;  5F6V A;  1T43 A;  2PX9 B;  2EKE A;  2EBK A;  4Q7J A;  1T6O A; 
#chains in the Genus database with same CATH topology
 2MGW A;  4AW4 A;  4JI2 M;  1JQJ C;  5ITT A;  2CHG A;  4QNM A;  3HJ8 A;  3T38 A;  1UM8 A;  1TR8 A;  2YQZ A;  2KA6 B;  2DWM A;  5ITR A;  2KNV A;  2G5G X;  4BB9 A;  3CF0 A;  2XFT A;  1D2N A;  1YUB A;  1NNU C;  2EJS A;  4JXJ A;  2K47 A;  4IBG A;  2X8A A;  4JV5 M;  1DV0 A;  2CE7 A;  1YF9 A;  3ZQJ A;  2RGH A;  4DHI D;  1YE9 A;  2WSC F;  1NY6 A;  2X4A A;  1D0L A;  4V3L A;  4KO8 A;  4PD2 A;  1VEG A;  3THG A;  2QZ4 A;  1NV8 A;  1WIV A;  3L27 A;  2CFO A;  1WHC A;  4REZ A;  5EGG A;  2P5T A;  4JQU A;  4GIP A;  5EJC A;  4LJA A;  4A3V B;  3FSH A;  2JY7 A;  3LMM A;  3U6D A;  1OAO C;  4K0K M;  4LF6 M;  3IEC A;  2DAM A;  3GLI A;  3B9P A;  2KXE A;  3EIH A;  2Z4R A;  3M0E A;  2ESK A;  4MM3 B;  2KZU A;  2MRO B;  2ZAN A;  3AOG A;  1DGF A;  5ITX A;  1DO0 A;  5KPR A;  4GIT A;  4PT5 A;  4X64 M;  1IXS A;  1A5T A;  1IM2 A;  3GPX A;  3UMM A;  1L1Z A;  1ZUO A;  2DAK A;  5AIE B;  4AI6 A;  2Z8Y M;  3KSX A;  4DV2 M;  1HNX M;  1QQW A;  3KP1 E;  1UFZ A;  4IIW A;  3ZH9 B;  3TWL A;  2JXN A;  2LXP A;  1L8Q A;  4DHZ F;  1KYI A;  2ERC A;  2V1C A;  1GL7 A;  3BZH A;  3SAS A;  2NQ8 C;  3FUV A;  3FUU A;  3WHL A;  2JP7 A;  2DI0 A;  3CEG A;  4MGI E;  3B89 A;  3U60 B;  1IQP A;  2JY8 A;  3B7Q A;  1R2Z A;  1QAN A;  5FTK A;  4V3K A;  2XLJ A;  3DOA A;  4FWD A;  2LTU A;  3OTO M;  4LRT A;  2E2C A;  2XEP A;  5FTJ A;  2HWJ A;  1YH2 A;  2FOI C;  2DWZ B;  1QDT A;  3GQ4 A;  3T6P A;  3BXW A;  3TWM A;  4LJ5 A;  1N75 A;  3SAW A;  4CHT B;  3J80 S;  2AAK A;  5L8R F;  1XNR M;  4LCB A;  4LF4 M;  4D82 A;  4JI0 M;  4XBO A;  3ZC7 B;  4LGM A;  2DAX A;  5C18 A;  2ONU A;  2H5X A;  4AP4 B;  3AKZ A;  2F4V M;  3R9X B;  2GRP A;  2ZAO A;  3HJQ A;  3RE8 A;  4GPR A;  1U9B A;  1NVM A;  1IN7 A;  3IHP A;  5IZ7 D;  2H2Y A;  3VKG A;  2R4J A;  5DYI A;  1ORY B;  3R8F A;  4M0W A;  2FFJ A;  3FTD A;  3GRY A;  2PWQ A;  3NBI A;  3L2A A;  2JNH A;  2R45 A;  4DV0 M;  3PNV A;  4Y28 F;  4IBF A;  5KO3 A;  1IY2 A;  5EP1 A;  2UXB M;  1XC8 A;  3GPY A;  1XHB A;  3J81 S;  1RU3 A;  2F5P A;  1KPQ A;  1NJF A;  1M4P A;  1XXH A;  4JI8 M;  2HCB A;  1OIP A;  3HCT B;  2KDL A;  2GNO A;  4FVM A;  1Z5A A;  2I7N A;  4UN2 B;  4L15 A;  4DR7 M;  2UU9 M;  4F1I A;  4QHS A;  2F5Q A;  3HX3 A;  3VDP A;  2UXC M;  2XZU A;  2APL A;  1JR3 D;  2C9C A;  1IXZ A;  3TGD A;  1IXR C;  4IBK A;  3RZ3 A;  2DAW A;  3Q8X A;  4OVZ A;  2CWB A;  1JB0 F;  3B7N A;  5EXX A;  1HT1 E;  2R18 A;  3U6L A;  2UUB M;  2DHR A;  2JZ0 A;  2L4E A;  1QUS A;  4NR3 A;  4YII U;  3OBX A;  4MGZ E;  1VDL A;  2F4W A;  3CTW B;  2DWN A;  2A7L A;  3FUX A;  4QNR A;  2LVP C;  2VDB B;  2K0B X;  4NRI B;  4ONN B;  3ILK A;  1IBK M;  4AG6 A;  5F6Y A;  1N78 A;  3HKP A;  2HKJ A;  2HAK A;  2DAE A;  2MH8 A;  5EXT A;  5F6V A;  4AKG A;  4LF8 M;  3SC3 A;  2CV0 A;  4LJ4 A;  4R71 A;  3T1Y M;  3PFI A;  1Z5S A;  3KVW A;  3R42 A;  1R6B X;  1VG5 A;  2G8L A;  5KQD A;  1FZY A;  1N32 M;  3J27 B;  3VON B;  4NXN M;  5FTL A;  3RCZ B;  4DV3 M;  3KOX E;  2ZM6 M;  1Q39 A;  2VII A;  1QAQ A;  3QWL A;  3ONG B;  3OBS A;  1KPP A;  1GO5 A;  1K3X A;  2YFQ A;  3UK6 A;  3I04 M;  2L09 A;  1DO2 A;  2KEB A;  1R5L A;  1OTR A;  3ZNI C;  1EIJ A;  2CYX A;  2YB6 A;  4X66 M;  3W0L B;  2OOB A;  4BWF A;  1Q02 A;  2QSF X;  2N35 A;  3U61 B;  2HL7 A;  2F5N A;  2OOA A;  1W4U A;  4AUQ A;  5E26 A;  3HHZ A;  1G8P A;  4DDI A;  3SY2 C;  3U5Z B;  2GMI B;  3HU3 A;  5JI3 E;  2DEN A;  1TDZ A;  2GJD A;  2HLW A;  1C1K A;  3SBJ A;  1N34 M;  4HL4 A;  3U6O A;  4PDI A;  5D1M A;  2QQ8 A;  4AKI A;  5FTN A;  1N36 M;  3ZCB B;  3UGB A;  1GVN A;  2KLY A;  4LJ8 A;  3TE6 A;  2HHH M;  3MMP A;  2XGN A;  1ZMU A;  3C3D A;  3SHF A;  4W5W A;  1X37 A;  4B7G A;  1IXS B;  2ZTD A;  4NOO B;  4NRI A;  4ONN A;  4RF0 A;  3L1Y A;  5FSW A;  2I7P A;  3GLG E;  3GLI E;  2LHG A;  1WZV A;  1L1T A;  4BVU B;  2O01 F;  4Y1L C;  1FXT A;  3GRR A;  4G4R A;  3PXG A;  5HPT C;  1KFV A;  1FBV C;  5ITX E;  2R6F A;  3MHV C;  1CUK A;  2LNH C;  4WUR A;  1TDH A;  2M5Z A;  2Q2E B;  2C2V C;  1PGY A;  4ONL A;  3K1J A;  3A98 B;  3CF6 E;  2AYV A;  2LWX A;  3HU2 A;  3J7B A;  3JAM S;  3AV0 A;  2Y20 A;  2J7N A;  3V76 A;  2QHO B;  4GC5 A;  3F92 A;  1XMO M;  4LF5 M;  4DV1 M;  3LQR A;  1NO1 A;  1MX0 A;  4RF1 A;  2Z6P A;  1YLA A;  3DZD A;  3U61 A;  3SAT A;  3M6A A;  1JBB A;  3HHY A;  2OQ4 A;  1IBM M;  5D2M A;  2Y0Q A;  2OPF A;  1BVS A;  4LJ9 A;  3NWL A;  4FD2 A;  1DGH A;  5KPZ A;  4NSO B;  4AG5 A;  3U5Z A;  2GMI A;  5IT9 S;  4IBE A;  4CIZ A;  2ESP A;  1MJG M;  2YZ0 A;  4DR5 M;  2VF7 A;  4XGI A;  3GLF E;  3NBX X;  3BOS A;  2F4Z A;  1S1Q A;  3AL0 C;  2E5L M;  1Z59 A;  2F5S A;  4DS2 A;  4OW0 A;  4AKH A;  5F6D A;  2LVN C;  3SAR A;  4LG2 A;  5GKN A;  2BJV A;  3DA1 A;  3W0F A;  4F2L A;  4DUZ M;  2F0R A;  4R3D A;  5D1K A;  2C96 A;  1VEK A;  3HGI A;  3A33 A;  3EVX A;  2V1U A;  1R4G A;  4ITQ A;  3GO8 A;  2O25 C;  1C4Z D;  3B74 A;  1XXH B;  1UZX A;  2Y0T A;  5BPV A;  2QPA A;  3HZJ A;  5DFL A;  2D7E A;  1P3Q Q;  2KRU A;  4PDG A;  4LAD A;  1QCQ A;  4DV4 M;  3L25 A;  4IJF A;  5EXP A;  1WJ7 A;  3H4J A;  4IBB A;  5ITU A;  4OVZ B;  1WXQ A;  1SXJ C;  4JI1 M;  1HQC A;  1JAS A;  3FTC A;  1PJS A;  4FCV A;  3UIO A;  2LVO C;  1ZV1 A;  4NRV A;  3CGW A;  3HHW A;  1GL6 A;  4GKK M;  1GKI A;  4X57 A;  5KPT A;  3DFZ A;  1TGU A;  2A5Y B;  4NR3 B;  5FTM A;  1E32 A;  1NHW C;  3UGJ A;  1JAT B;  3LCU A;  3C3E A;  2R4E A;  3W67 A;  1PRB A;  4HEO A;  3R3Q A;  3P9G A;  1W5S A;  4DDG A;  4GHL A;  2QGX A;  4B3S M;  4DR6 M;  3GRU A;  3C9P A;  2WSE F;  2JWS A;  1N33 M;  3LW5 F;  3SQV C;  1KPS A;  3FYC A;  3PVS A;  5D0K A;  1NNJ A;  2R0J A;  4NXM M;  1T43 A;  4L16 A;  3GPU A;  1FNN A;  2CHQ A;  2L6O A;  4Q7J A;  1T6O A;  3U6P A;  2L7H A;  4ONM A;  2KNZ A;  1Z3D A;  3KSJ A;  1I4W A;  3KFU G;  2C5R A;  1D0M A;  1Z2U A;  2GRR A;  2JY6 B;  4FW9 A;  3K8Z A;  2EKK A;  3P9H A;  3U6M A;  2UUA M;  4LGY A;  1JR3 E;  3J2P B;  1AUA A;  3UIN A;  3ZQS A;  1L2C A;  1EFU B;  2CLW A;  3GLH E;  3JR5 A;  1XB2 B;  3SFZ A;  3KOW E;  2XF3 A;  2D7H A;  3PTF A;  2WSF F;  1Z6T A;  4JI4 M;  3QYB A;  5EQT A;  3D8B A;  4YY3 M;  5EXS A;  5JNE B;  3E9S A;  3KW6 A;  2DHY A;  1Z5B A;  4B7H A;  1PJI A;  3KOZ E;  1PJQ A;  4Y1L A;  4GH9 A;  5F6E A;  4Z8X A;  3VKH A;  3K2L A;  5F6X A;  3VFD A;  4IP3 B;  2ZTC A;  3FTE A;  3FYD A;  3FKE A;  5KNL C;  3QAU A;  1QYR A;  3SMP A;  3I4Y A;  1JAT A;  2CRU A;  3GQ3 A;  5EP2 A;  5IRE B;  1ZMW A;  1Y8G A;  3FUW A;  1R2Y A;  4P5O G;  2DNA A;  1HNW M;  2DZL A;  3RPG A;  2GQF A;  3HU1 A;  2DZN B;  4Q5H C;  2C99 A;  1SXJ B;  1V33 A;  4WW0 A;  4TUW A;  3H8K A;  1OAI A;  4NRG B;  1OQY A;  4PCZ A;  1IY0 A;  2QEN A;  1E94 E;  2K07 A;  2Z6O A;  4XK8 F;  4QHT A;  5JI2 E;  1G4A E;  1IN4 A;  2LHC A;  1UKX A;  4ONL B;  4WP2 A;  5FQ2 A;  1VQ1 A;  1IN5 A;  5BR8 M;  4JYA M;  1XMQ M;  3EB6 B;  1G71 A;  4B3R M;  4X65 M;  4FCW A;  4M1N A;  3GRV A;  1XNQ M;  4LF9 M;  2DAY A;  4I5S A;  3SAV A;  4B3M M;  2DZO B;  3AOE C;  4L8R C;  2YNM D;  2Z5D A;  2JA2 A;  3A42 A;  2XWU A;  4DV7 M;  3RFW A;  1PJJ A;  1SXJ D;  1T3T A;  2F5O A;  1DGH B;  4M9X A;  2Y9P A;  3L1Z A;  2YHO B;  4L83 A;  2LBC A;  2O25 A;  4YHH M;  1VEJ A;  3E4R A;  3LVV A;  1F4I A;  5FER B;  4YC1 A;  4L78 A;  4I4L A;  1Q34 A;  2YBF A;  3TPZ A;  2XZF A;  4B7F A;  1OJL A;  4NSR A;  1KSF X;  1OIZ A;  2V6Z M;  3VK8 A;  4BLC A;  3GLG B;  3K92 A;  4DV5 M;  4II2 C;  5DNY A;  5DYG A;  4MGY E;  1GLN A;  3KDS E;  1R7R A;  2L2D A;  5ITQ A;  2ZBK B;  3E21 A;  2OO9 A;  4CCG A;  1SXJ A;  3EIE A;  3TQS A;  3FD9 A;  1LV7 A;  1OFI A;  4AQY M;  1N77 A;  2Z3X A;  4NRG A;  4JN6 A;  5EP4 A;  2EO2 A;  2KNA A;  2LVQ D;  4GC9 A;  4I81 A;  3KPA A;  1ZAE A;  1SG9 A;  3QYE A;  1J7K A;  2DVW B;  2D7G A;  3SYL A;  4M0D A;  1K82 A;  1M4Q A;  3E95 C;  2XH9 A;  2BWE A;  4B3T M;  2MJ5 B;  2XFS A;  1VDD A;  3BBZ A;  2GRO A;  2J7O A;  3JR4 A;  3SYK A;  4IBI A;  4LZJ A;  1GJT A;  4R7G A;  3OBQ A;  2ESQ A;  4ANR A;  2EDI A;  2CP8 A;  3B7Z A;  1S3S A;  3KXE C;  4MH0 E;  4FWG A;  2VQE M;  2NVU C;  3SHG B;  5E6J A;  3FUT A;  4KOD A;  3GLF B;  4ZNY A;  1C7Y A;  3U6Q A;  3VLF B;  1HR0 M;  1I94 M;  3IG8 A;  4QOS A;  2ZAM A;  2QCU A;  1Q3B A;  2PE6 A;  4KLN A;  1LTM A;  3E46 A;  1DGG A;  2WZJ A;  1E9S A;  4MDK A;  5IFR A;  2Y21 A;  1AYZ A;  3O2U A;  1WGN A;  1I7K A;  2FH0 A;  4BBA A;  2KW0 A;  3I01 M;  2EUC A;  3JW0 A;  3WE5 A;  2C98 A;  3GLG A;  3MK6 A;  3FN1 B;  3A46 A;  3T15 A;  3SAU A;  1Y8X A;  4ONM B;  3FRI A;  4W5V A;  3GP1 A;  2PX9 B;  3CF2 A;  2RKO A;  2EKE A;  3K9O A;  1YRV A;  3I4V A;  4D81 A;  3W68 A;  3LVW A;  2R44 A;  4GEW A;  5F6W A;  2JY5 A;  1OKS A;  4II7 A;  2DKL A;  4DBG B;  4DR3 M;  2CLW B;  3M7G A;  2KHH A;  4Z6Y A;  3AFH A;  4GKJ M;  4G3O A;  2CV2 A;  5H37 D;  1WR1 B;  3HCU B;  5FLX S;  3H4M A;  1HQY E;  4ZPX A;  2R62 A;  2FNA A;  1XXH E;  2L7I A;  2VRR A;  2AWF A;  2DAI A;  5F3W A;  5AIU B;  1L2B A;  1QZM A;  4X62 M;  4NL4 H;  2EA0 A;  1J5E M;  2G3Q A;  3FRH A;  2BNK A;  3RGS A;  2Y9M A;  3LCV B;  1Z5C A;  4L6V 6;  3VDU A;  1QDR A;  1WGL A;  2XSZ D;  4LFB M;  4M9S A;  1J74 A;  4QOZ C;  4M9Z A;  5ITY A;  1TH2 A;  2BWB A;  2C2V B;  4GRI A;  3UIP A;  3GLF A;  2CEA A;  2R46 A;  4WZ3 A;  1E9R A;  1HT2 E;  3VK7 A;  4RNA A;  1MN3 A;  2CUZ A;  4DV6 M;  2YR0 A;  1QAM A;  1HNZ M;  2RGO A;  3VON C;  1QVR A;  2QNJ A;  3FE3 A;  4EIW A;  3PNY A;  3IG5 A;  4EJE A;  5KQ8 A;  2EKF A;  3AOE A;  4CIS A;  1PM5 A;  1ZDN A;  1W5T A;  4A4C C;  2Y4W A;  5LMN M;  1K3W A;  2Z4S A;  5AIT B;  3RGP A;  2R0I A;  2KRK A;  4JI6 M;  2FE8 A;  2JZ1 A;  4MGK E;  1TH4 A;  5D1L A;  2XSZ A;  3GLH B;  2GRN A;  1G41 A;  2OB4 A;  1AIP C;  2J5Y A;  2QBY B;  3J7A S;  4S3O A;  4S12 A;  4LDT C;  2BEP A;  4GMQ A;  1IN8 A;  3JVZ A;  2UYZ A;  4P16 A;  3K9P A;  2DWL A;  2EBM A;  3D8L A;  2CHV A;  4CJ6 A;  1XWI A;  1A3S A;  4LRS A;  2LXE A;  4DR1 M;  4JI3 M;  3HWS A;  3HJS A;  2AHM A;  1J7D B;  3KOY E;  2X49 A;  2BF8 A;  4LFA M;  1QUT A;  3L26 A;  1NV9 A;  2LH0 A;  3HHX A;  3L28 A;  4JI7 M;  3I51 A;  2A4D A;  1NJG A;  4LF7 M;  2Q0V A;  4TKP A;  2DMF A;  2UUC M;  4LJ6 A;  1V92 A;  2RRU A;  5AIT D;  2K9D A;  3Q8G A;  1X23 A;  3U60 A;  1TTE A;  1GAB A;  4KHP M;  3U6S A;  1IY1 A;  3WHK A;  5F6U A;  4P17 A;  4A49 B;  3A4S A;  4CGY B;  1NHG C;  1G59 A;  4G4O A;  3E95 A;  1ZGU A;  1EE8 A;  4FWH A;  4R62 A;  4IBC A;  2FS1 A;  1ZMV A;  2K6B A;  2FUH A;  3SMS A;  4B08 A;  1L2D A;  4IJE A;  4G4Q A;  1Y6L A;  4IBD A;  2KJH A;  2UXD M;  2MR9 A;  2VF8 A;  4DUY M;  1MU5 A;  4JI5 M;  4LY6 A;  2C9O A;  2L4F A;  1DGB A;  5D0M A;  2QP9 X;  1GJS A;  2C4P A;  2VQF M;  1IFY A;  1OFH A;  1V34 A;  1JR3 A;  3KP0 E;  1NY5 A;  4Q5E C;  1SXJ E;  3OJ4 A;  3GLH A;  3W31 B;  2CV1 A;  8CAT A;  2QBY A;  4HLQ A;  1U9A A;  3UZU A;  4IBJ A;  1WZW A;  3LQQ A;  1HJP A;  3GQ5 A;  1IBL M;  3KS4 A;  2JUJ A;  3TWK A;  2O5R A;  1TH3 A;  2DXI A;  5IWA M;  4AZF A;  4L4U A;  2OXQ A;  4QPL B;  3KS8 A;  2DAG A;  1PJT A;  5EP3 A;  1J7D A;  1YSY A;  4MB7 A;  4FH1 A;  2W82 A;  1QAO A;  1G3I A;  4KT0 F;  4FCT A;  3T1H M;  3AJI B;  3MJ5 A;  4D80 A;  1QZE A;  1NSF A;  2MT6 A;  4RKU F;  4A4B C;  2ESO A;  4OU7 A;  2LVA A;  1IN6 A;  3C58 A;  4DR4 M;  2BJW A;  1ZQ9 A;  4I8O A;  4LZZ A;  3OBU A;  2M60 A;  4DHJ C;  2GRQ A;  1TF0 B;  1H6U A;  4NC6 A;  1D0K A;  2H1R A;  4G4N A;  5LMU M;  4NRW A;  3FTF A;  4MGH A;  3GLI B;  1Q3C A;  2FO3 A;  4GHA A;  3U6C A;  2KZS A;  5A2Q S;  1J09 A;  4LFC M;  4OX9 M;  2B3T A;  5C1B A;  3A45 A;  3GPP A;  1FJG M;  2R65 A;  2Z7J A;  7CAT A;  4G6Z A;  3UJN A;  3L29 A;  4JUE A;  1PZV A;  2UCZ A;  4DR2 M;  2EBK A;  4LJ7 A;  3U6E A;  3HY5 A;  3TL4 X; 
#chains in the Genus database with same CATH homology
 3K9O A;  1YRV A;  4R71 A;  4ONM A;  2KNZ A;  1Z3D A;  1Z5S A;  2MGW A;  3R42 A;  1Z2U A;  2GRR A;  2JY6 B;  1VG5 A;  1FZY A;  4GEW A;  3VON B;  5F6W A;  2JY5 A;  1OKS A;  2EKK A;  2DKL A;  4DBG B;  3P9H A;  3RCZ B;  2CLW B;  1TR8 A;  1JR3 E;  2KHH A;  3ONG B;  2KNV A;  3OBS A;  3UIN A;  1KPP A;  3ZQS A;  1GO5 A;  1EFU B;  4G3O A;  2CLW A;  1WR1 B;  3GLH E;  2EJS A;  3HCU B;  1HQY E;  1XB2 B;  1DO2 A;  1OTR A;  3ZNI C;  1DV0 A;  1YF9 A;  1XXH E;  2CYX A;  2YB6 A;  2VRR A;  2AWF A;  2DAI A;  5AIU B;  4DHI D;  3PTF A;  2OOB A;  4BWF A;  1Q02 A;  2QSF X;  2G3Q A;  5JNE B;  3FRH A;  2DHY A;  4V3L A;  2Y9M A;  3LCV B;  2OOA A;  1VEG A;  4Y1L A;  1W4U A;  4AUQ A;  1WGL A;  5F6E A;  1NV8 A;  1WIV A;  4DDI A;  1J74 A;  5F6X A;  3SY2 C;  2BWB A;  2GMI B;  1WHC A;  2C2V B;  2DEN A;  5EGG A;  4JQU A;  3UIP A;  2GJD A;  4IP3 B;  2ZTC A;  4WZ3 A;  2HLW A;  1HT2 E;  3FSH A;  5KNL C;  2JY7 A;  1MN3 A;  5D1M A;  1JAT A;  3VON C;  2QNJ A;  3FE3 A;  3UGB A;  2KLY A;  3IEC A;  2DAM A;  1ZMW A;  1Y8G A;  3MMP A;  4P5O G;  2DNA A;  1ZMU A;  2ESK A;  2DZL A;  3RPG A;  4EJE A;  2MRO B;  2EKF A;  4Q5H C;  1ZDN A;  2ZTD A;  4NRI A;  4ONN A;  4A4C C;  3L1Y A;  2Y4W A;  3H8K A;  3GLG E;  3GLI E;  1OAI A;  1WZV A;  4NRG B;  5AIT B;  1OQY A;  1DO0 A;  2R0I A;  4BVU B;  1IXS A;  4Y1L C;  1E94 E;  1A5T A;  2K07 A;  2Z6O A;  2JZ1 A;  1FXT A;  1IM2 A;  5D1L A;  5JI2 E;  1G4A E;  5HPT C;  2GRN A;  1G41 A;  2OB4 A;  1AIP C;  1UKX A;  4ONL B;  4WP2 A;  1ZUO A;  2DAK A;  5AIE B;  5FQ2 A;  1FBV C;  4S3O A;  1VQ1 A;  1CUK A;  4LDT C;  2BEP A;  3EB6 B;  1UFZ A;  2C2V C;  2UYZ A;  1PGY A;  3JVZ A;  4ONL A;  3K9P A;  4M1N A;  2EBM A;  2AYV A;  2LXP A;  1A3S A;  4DHZ F;  1KYI A;  2DAY A;  2QHO B;  1J7D B;  3BZH A;  2BF8 A;  3F92 A;  2JP7 A;  2DI0 A;  3CEG A;  3B89 A;  1NV9 A;  2Z5D A;  2XWU A;  2A4D A;  2JY8 A;  2Z6P A;  1YLA A;  4V3K A;  2Q0V A;  4TKP A;  2LTU A;  1JBB A;  2DMF A;  1V92 A;  2RRU A;  5AIT D;  2K9D A;  2Y9P A;  1X23 A;  5D2M A;  1TTE A;  2E2C A;  3L1Z A;  1BVS A;  2YHO B;  4L83 A;  2LBC A;  2O25 A;  5F6U A;  2HWJ A;  1VEJ A;  1YH2 A;  4A49 B;  3A4S A;  1F4I A;  5FER B;  4YC1 A;  3T6P A;  3E95 A;  1ZGU A;  2GMI A;  1Q34 A;  4R62 A;  1ZMV A;  2ESP A;  2AAK A;  2YBF A;  2FUH A;  2YZ0 A;  3GLF E;  2F4Z A;  4II2 C;  1S1Q A;  2DAX A;  2ONU A;  2H5X A;  1Y6L A;  4AP4 B;  2KJH A;  4DS2 A;  2MR9 A;  2GRP A;  5F6D A;  4GPR A;  1U9B A;  2L2D A;  2LVN C;  2L4F A;  3IHP A;  3E21 A;  5D0M A;  2OO9 A;  2C4P A;  4CCG A;  4F2L A;  2F0R A;  2H2Y A;  5D1K A;  1VEK A;  1IFY A;  3A33 A;  3EVX A;  2PWQ A;  4NRG A;  1R4G A;  2KNA A;  2LVQ D;  2JNH A;  2O25 C;  1C4Z D;  3KPA A;  1SG9 A;  1UZX A;  4Q5E C;  3OJ4 A;  1M4Q A;  3E95 C;  3W31 B;  2BWE A;  2MJ5 B;  5DFL A;  1KPQ A;  1U9A A;  1WZW A;  1M4P A;  1P3Q Q;  3BBZ A;  1HJP A;  2GRO A;  3HCT B;  2JUJ A;  4UN2 B;  4LAD A;  1QCQ A;  3OBQ A;  2ESQ A;  2OXQ A;  4QPL B;  4F1I A;  2DAG A;  1WJ7 A;  2EDI A;  1J7D A;  2CP8 A;  3H4J A;  4FH1 A;  1G3I A;  1JAS A;  2NVU C;  3TGD A;  1QZE A;  3UIO A;  3RZ3 A;  2DAW A;  2LVO C;  2MT6 A;  1ZV1 A;  4A4B C;  2CWB A;  2ESO A;  1HT1 E;  2LVA A;  4ZNY A;  1C7Y A;  4X57 A;  4NR3 B;  3OBU A;  4DHJ C;  2GRQ A;  1JAT B;  2PE6 A;  2JZ0 A;  3E46 A;  2L4E A;  3LCU A;  2WZJ A;  4MDK A;  4NR3 A;  4YII U;  5IFR A;  3OBX A;  2FO3 A;  4HEO A;  3R3Q A;  1VDL A;  1AYZ A;  2F4W A;  1WGN A;  1I7K A;  3O2U A;  3P9G A;  2A7L A;  4DDG A;  2B3T A;  3JW0 A;  3WE5 A;  2QGX A;  2LVP C;  3FN1 B;  2K0B X;  4NRI B;  4ONN B;  1Y8X A;  3SQV C;  5F6Y A;  1KPS A;  4ONM B;  5D0K A;  2HAK A;  2R0J A;  2DAE A;  3FRI A;  4JUE A;  1PZV A;  2UCZ A;  4W5V A;  5F6V A;  1T43 A;  2PX9 B;  2EKE A;  2EBK A;  4Q7J A;  1T6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...