3K9OA

The crystal structure of e2-25k and ubb+1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 K
publication title Structural Basis of E2-25K/UBB+1 Interaction for Neurotoxicity of Alzheimer Disease by Proteasome Inhibition
rcsb
source organism Homo sapiens
total genus 68
structure length 198
sequence length 198
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3k9oA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 3k9oA01
3BZHA 5F6XA 1Z2UA 1QCQA 3PTFA 1A5TA 1NV8A 2DAXA 1XXHE 2Y4WA 2JY8A 4JQUA 3FSHA 1VEGA 3B89A 5D2MA 4GEWA 1IXSA 3GLHE 1TR8A 2DKLA 2LVQD 1J7DB 1E94E 1FXTA 2ESKA 2A4DA 4YC1A 1VEJA 2OO9A 2UYZA 2PWQA 4DBGB 1ZMWA 4WP2A 1VDLA 1ZV1A 4R71A 2O25A 1G4AE 5DFLA 1G41A 1VG5A 4A4BC 2JP7A 2GRRA 5JNEB 1ZDNA 5D1MA 1UKXA 2BEPA 1C4ZD 1UZXA 4HEOA 2MGWA 5JI2E 2NVUC 4R62A 1YLAA 2DZLA 2R0JA 2PX9B 4S3OA 5FERB 1NV9A 4NRIA 1DO2A 2ZTCA 1Y8GA 4TKPA 1VQ1A 3FRHA 2EKEA 2DAWA 5F6VA 2MJ5B 5AITD 2ZTDA 3L1ZA 2RRUA 1ZMUA 2GRPA 1UFZA 2Q0VA 2C2VB 4NR3B 3FE3A 2AWFA 2MR9A 1Z3DA 3FRIA 2YHOB 3ONGB 1PZVA 4Y1LA 3GLFE 4QPLB 2KNVA 3T6PA 1YH2A 1JATB 2L2DA 1Q34A 2CYXA 4ONMB 2QGXA 2JY6B 2HAKA 3P9HA 2JY7A 2LVOC 2K07A 4DHZF 2YZ0A 5D0KA 2OXQA 1ZGUA 4FH1A 4JUEA 3UGBA 2CLWB 4ONLA 3RPGA 2LXPA 2JNHA 5F6WA 1DO0A 3LCVB 2ESPA 2XWUA 3OBXA 4Q5EC 1R4GA 2HLWA 2C2VC 3SQVC 1EFUB 2DNAA 3EB6B 4F2LA 1HT2E 5F6DA 1IM2A 1J7DA 5D0MA 4DHJC 2JUJA 2LVAA 2YBFA 1GO5A 1IFYA 2GRQA 5F6EA 4V3KA 1W4UA 5AIUB 2VRRA 4X57A 2H5XA 2C4PA 5EGGA 4EJEA 2KNZA 1KPPA 2PE6A 2K9DA 2Z6PA 1WR1B 3E95A 3A4SA 3OBSA 2AYVA 2DAYA 1HQYE 2DAKA 3GLGE 3UINA 3KPAA 1QZEA 3K9OA 5F6UA 3OJ4A 1Z5SA 3E46A 2EJSA 1ZMVA 1WGLA 3UIPA 3E21A 2EKFA 2QSFX 3IECA 3BBZA 2FO3A 3O2UA 4ONNA 4NRGA 1KPQA 1T43A 1TTEA 3ZQSA 3JVZA 1WGNA 2MROB 4NRIB 4WZ3A 1OKSA 3W31B 2CWBA 2DAMA 5AITB 5AIEB 2DHYA 3CEGA 2LVNC 1M4PA 1KYIA 2BF8A 4ZNYA 1T6OA 3WE5A 1YF9A 2YB6A 1X23A 4CCGA 3H4JA 2O25C 2G3QA 4LDTC 1J74A 1MN3A 2GMIB 2GROA 3TGDA 3K9PA 1AYZA 2LVPC 2BWEA 2DI0A 4UN2B 3MMPA 3EVXA 5F6YA 4DDGA 2CLWA 1KPSA 4GPRA 3RCZB 2E2CA 3VONB 4F1IA 4Q7JA 1HJPA 1JASA 2F4ZA 1CUKA 2A7LA 2QNJA 1XB2B 4ONLB 1I7KA 1JBBA 2LBCA 1YRVA 4L83A 4W5VA 2OOAA 2ONUA 2EKKA 2JZ1A 1DV0A 1U9BA 2L4FA 2BWBA 2EBMA 4G3OA 2DAEA 4YIIU 3SY2C 4Q5HC 2B3TA 3A33A 1PGYA 1WZVA 3R3QA 4Y1LC 1WIVA 4DS2A 4M1NA 1G3IA 1OTRA 4DHID 3JW0A 1WJ7A 4LADA 2FUHA 1Y8XA 2K0BX 3VONC 2EDIA 3IHPA 2AAKA 2Z5DA 4V3LA 3HCUB 1Y6LA 1JR3E 1SG9A 1VEKA 3H8KA 3P9GA 2GRNA 5IFRA 1BVSA 1S1QA 2MT6A 1Q02A 3ZNIC 5KNLC 3UIOA 2F0RA 4AUQA 2Z6OA 2F4WA 5FQ2A 2ESQA 2KJHA 1FBVC 2DAIA 2KNAA 2KLYA 3RZ3A 2LTUA 3L1YA 3F92A 2R0IA 2WZJA 2CP8A 1V92A 5D1KA 1WZWA 1A3SA 3GLIE 4ONNB 1AIPC 4NRGB 2JZ0A 2UCZA 4NR3A 1M4QA 1ZUOA 4MDKA 1WHCA 1P3QQ 1HT1E 1F4IA 2OOBA 2QHOB 2OB4A 1U9AA 2DMFA 2JY5A 2DAGA 2H2YA 4IP3B 1FZYA 4BVUB 1JATA 2GJDA 2Y9MA 1C7YA 4AP4B 2EBKA 5D1LA 5HPTC 3LCUA 4ONMA 3FN1B 4P5OG 1OAIA 4A4CC 2HWJA 3HCTB 2GMIA 3OBQA 2L4EA 3OBUA 4A49B 4DDIA 3E95C 4II2C 4BWFA 2Y9PA 3R42A 1OQYA 2ESOA 2KHHA 2DENA
chains in the Genus database with same CATH superfamily
1Z2UA 3PTFA 3DA1A 5L8RF 4D80A 2V6ZM 4KHPM 7CATA 2Z8YM 1XXHE 1DGHA 3EIEA 3FSHA 2Z7JA 3SAVA 4GEWA 2DZNB 4P16A 1N36M 1YE9A 2O01F 3GP1A 2KZUA 4B7FA 1FXTA 4DV4M 2H1RA 2ESKA 1Q3BA 1VEJA 2XFSA 4DBGB 2BNKA 3T38A 1NJFA 3KOXE 1N32M 4MGYE 5ITQA 3L25A 3L29A 4L15A 1VG5A 2JP7A 2GRRA 3M7GA 3HKPA 3U6CA 3SATA 1OAOC 1C4ZD 2WSFF 2NVUC 1YUBA 2DZLA 4DUYM 3W68A 4LFCM 1HNZM 1NV9A 4NRIA 1Q3CA 2CFOA 3I4YA 1G59A 3FRHA 2EKEA 2CV1A 1JQJC 4I5SA 1R7RA 1I4WA 5F6VA 2MJ5B 2KZSA 3HGIA 4TUWA 3L2AA 1Z3DA 2YHOB 4LJ6A 1G71A 1PZVA 4Y1LA 2I7PA 4QPLB 1YH2A 2ERCA 4DR4M 4B3MM 2CV2A 2ZM6M 1H6UA 4B7HA 5DNYA 4B08A 2A5YB 3K92A 4GHAA 3J7BA 4NSRA 1NY6A 1N75A 3RPGA 5F6WA 3VKGA 1HR0M 3LCVB 3VK8A 1NJGA 1R4GA 1IXZA 3EB6B 1HT2E 5F6DA 4JV5M 1J7DA 1TDHA 1IFYA 4V3KA 1W4UA 2LWXA 3HU2A 1G8PA 1IBKM 5EGGA 4PDIA 4GC9A 1XNQM 2KNZA 3E4RA 2K9DA 5IWAM 2APLA 4LCBA 4LGYA 2DAYA 3KS4A 3GLGE 2V1UA 2LH0A 5IZ7D 8CATA 2Y21A 3RE8A 3E21A 5FLXS 2LHGA 3IECA 2XZUA 1KPQA 5DYIA 1IN8A 4PCZA 2MROB 4NRIB 3W31B 3J27B 1QUSA 1FJGM 3UK6A 5AIEB 1KYIA 2BF8A 1T6OA 2CEAA 4JI3M 4ZPXA 3FTFA 4DR1M 1NNUC 3K9PA 3KW6A 1AYZA 3FD9A 1HNWM 2BWEA 3MMPA 4DV7M 2F4VM 3MHVC 4GRIA 3RCZB 4I81A 4B7GA 2X4AA 1JASA 1CUKA 4AW4A 4OU7A 1MX0A 2QNJA 2OOAA 1R6BX 4Z6YA 1U9BA 2N35A 3VFDA 3GPUA 4GKJM 1GL7A 2BWBA 3U60A 2DAEA 3SY2C 4Q5HC 1NVMA 3KOYE 3FTEA 4Y1LC 1LV7A 1WIVA 5FTLA 3BOSA 4M1NA 3I4VA 4KO8A 1G3IA 4ANRA 1L1TA 4M0DA 4AG6A 2BJWA 3Q8GA 2FUHA 3KSXA 2K0BX 2K47A 3K2LA 3IHPA 3WHKA 3SHGB 1Y6LA 1NO1A 3H8KA 3P9GA 2GRNA 1GVNA 1S1QA 1Q02A 3ZNIC 2F0RA 2KJHA 4FWGA 2XFTA 1FBVC 3HJSA 4RNAA 3KDSE 2LTUA 3D8LA 3T1YM 3F92A 5D1KA 1WZWA 2JA2A 1A3SA 2UCZA 4NR3A 1M4QA 1ZUOA 1TH3A 1WHCA 1HT1E 1F4IA 3M0EA 4FWDA 5KPRA 5BPVA 5LMUM 2UUAM 2H2YA 4IP3B 1JATA 4L78A 1C7YA 3SMSA 3FN1B 2R46A 4JI6M 4A4CC 2GMIA 3OBQA 4DDIA 2CHQA 2XF3A 3PFIA 2LHCA 4BWFA 3M6AA 4D82A 4MGIE 4LRTA 2K6BA 3BZHA 1PM5A 2UUCM 3U6OA 4DV6M 4MGZE 2FOIC 1NV8A 2DZOB 2AHMA 1N34M 2ZAOA 4S12A 5IT9S 2EA0A 4GH9A 1DGGA 4II7A 1IN6A 5E6JA 4FW9A 2KXEA 3RGPA 4BBAA 4L4UA 3TE6A 4M9ZA 4JI0M 3U60B 3FYCA 1J5EM 4WP2A 2O25A 4NC6A 4FWHA 5FTNA 2YR0A 2P5TA 4L16A 5DFLA 1G41A 1TDZA 5JNEB 1ZDNA 5D1MA 1GABA 4I8OA 1N78A 4IBIA 4HEOA 3UGJA 5A2QS 1L2CA 3LW5F 4R62A 1YLAA 3FUTA 3Q8XA 2PX9B 4BLCA 5FERB 5EXPA 2CUZA 2VDBB 2RKOA 2L6OA 1Y8GA 4TKPA 1VQ1A 3HJQA 1GKIA 3CF2A 4IBJA 1SXJE 2ZTDA 5EQTA 3L1ZA 1ZMUA 2RRUA 3HU3A 2C2VB 4NR3B 2HHHM 1WXQA 2DWLA 3FRIA 2DXIA 4YY3M 2F5PA 3U6LA 2KNVA 3T6PA 3TQSA 1Z59A 3U6SA 4G6ZA 1JATB 2L2DA 2CYXA 4KODA 5FTJA 1D2NA 3ZC7B 4DV2M 1D0KA 4B3TM 4JI7M 3LQRA 2ZAMA 2JY7A 4K0KM 4DHZF 1HQCA 1W5TA 4MGKE 1QAQA 2UXBM 4PDGA 4FH1A 1X37A 4DV5M 2JNHA 1V34A 1UM8A 1MJGM 3K8ZA 2HKJA 2ESPA 1FNNA 2C2VC 1EFUB 2DNAA 3MJ5A 3KP1E 1XXHB 4LF4M 1IM2A 2LVAA 3W67A 2DHRA 3HHXA 3GPXA 2QQ8A 2VRRA 2ZANA 3L28A 2H5XA 4XBOA 1Z5AA 2PE6A 3LMMA 2Z6PA 5FTKA 3CGWA 3GLGA 1QZEA 5F6UA 4QHSA 1E32A 4DR2M 2EKFA 2C96A 3AL0C 3O2UA 2RGOA 3AV0A 4NXNM 1T3TA 3HHZA 4CIZA 5BR8M 1Z6TA 2I7NA 1M4PA 3C58A 1KFVA 3U6MA 4GITA 2YB6A 3CF0A 2O25C 4LDTC 1J74A 1K3WA 3LVVA 5KPTA 2FH0A 4JI5M 2LVPC 4X66M 2DI0A 4UN2B 3EVXA 1QANA 4EIWA 5F6YA 5FSWA 4LJ5A 3J7AS 2CLWA 1KPSA 4GPRA 2X8AA 2Z4RA 3GPYA 2XH9A 3SMPA 2F4ZA 4AKHA 2C99A 2A7LA 1GJSA 1XB2B 4LZZA 1DGHB 1OFIA 2ONUA 2JZ1A 2CV0A 1DV0A 2L4FA 4FCVA 2C9CA 4YIIU 2QENA 4NOOB 2R45A 3GQ3A 3OTOM 1J09A 3KXEC 1IY1A 1OTRA 3K1JA 1L1ZA 2Y0QA 1WJ7A 3UZUA 1XWIA 1L2DA 4DR7M 1Q39A 1Y8XA 3BXWA 3R9XB 2Z5DA 3HCUB 4JN6A 1IXRC 1JR3E 1VEKA 4CGYB 1BVSA 2MT6A 4LRSA 3IG8A 4HL4A 3SYLA 2W82A 3A42A 4LGMA 3GLGB 3SFZA 4Z8XA 3I01M 1JB0F 1K82A 3VDUA 2CP8A 1V92A 4P17A 3GLIE 3CTWB 4NRVA 5E26A 1AIPC 3FTCA 3PXGA 2OOBA 3RFWA 2OB4A 4AG5A 4GKKM 5FTMA 2C98A 4DUZM 4AP4B 5D1LA 5HPTC 4ONMA 3AJIB 1OAIA 2L4EA 3B7ZA 3R8FA 1L2BA 4II2C 3TWMA 2LXEA 2L7IA 3B7NA 2JXNA 3DFZA 2DENA 2CHVA 5F6XA 1QCQA 4LJ4A 2KRKA 3J2PB 3GO8A 1ORYB 2DAXA 4DV3M 3NWLA 3A45A 3GLHE 1TR8A 2DKLA 5DYGA 2LVQD 1J7DB 1QYRA 4AKGA 4MB7A 4Y28F 2A4DA 4YC1A 5KO3A 2UYZA 2PWQA 4RF0A 2HCBA 1VDLA 1ZV1A 4R71A 3KVWA 4L6V6 1G4AE 2QZ4A 3NBIA 4WURA 1KSFX 5EP4A 3U6QA 2YQZA 3UJNA 4A4BC 2F5SA 4AZFA 2BEPA 3LVWA 1GJTA 4IJFA 2R0JA 3PVSA 1PJQA 2ZTCA 3HWSA 3U61A 1PJJA 3RGSA 5ITUA 4LF7M 3SHFA 3FUVA 2KDLA 5AITD 1NSFA 4LZJA 2XLJA 1SXJA 1EE8A 3VLFB 2Q0VA 3FE3A 2AWFA 2KW0A 2MR9A 4QNRA 4M0WA 3ONGB 4JI2M 1D0MA 4W5WA 2OPFA 1NNJA 1QAMA 3GLFE 5EXTA 1SXJD 3A98B 4X65M 1Q34A 4FVMA 4ONMB 2QGXA 3SAUA 1E9SA 3HY5A 2JY6B 2O5RA 2DVWB 4AKIA 2LVOC 1OJLA 4M9SA 5D0KA 3TWLA 2D7HA 1ZGUA 3UGBA 1DGBA 3W0LB 1QVRA 1S3SA 3OBXA 1QDTA 4Q5EC 1IY2A 2EUCA 4F2LA 5F3WA 5D0MA 4DHJC 2Q2EB 5ITRA 2JUJA 1NHGC 4IBCA 3WHLA 1GO5A 3NBXX 1AUAA 2GRQA 5F6EA 1N33M 2QBYA 3QYEA 1QUTA 3KOWE 1R5LA 5AIUB 4X57A 4JYAM 4EJEA 4LY6A 3JAMS 4AQYM 1KPPA 3AKZA 5EXXA 3E95A 3A4SA 1HQYE 2CE7A 2HL7A 3KPAA 4NSOB 3ZCBB 5GKNA 1Z5SA 3OJ4A 3E46A 3I51A 4DV0M 2UU9M 3HU1A 2FO3A 4ONNA 4NRGA 1T43A 1TTEA 3SARA 3JVZA 1WGNA 2VIIA 1OKSA 4OVZA 2CWBA 2DAMA 3U61B 5AITB 5KPZA 1C1KA 2LVNC 1RU3A 3U6PA 3GRYA 3AOEA 3UMMA 4X64M 2M5ZA 4XGIA 3V76A 4CCGA 1SXJB 4RF1A 1V33A 4QOSA 1MN3A 4IBFA 3QWLA 4LF8M 2GMIB 2GROA 4PD2A 4AI6A 1XMQM 4CJ6A 3B9PA 5ITTA 5KQDA 4DDGA 2DWZB 2CHGA 3C9PA 1TF0B 2E2CA 1HJPA 2Y0TA 1EIJA 2F5NA 2D7GA 2ZBKB 2L7HA 2G8LA 4IIWA 2Z4SA 3T1HM 1JBBA 1YRVA 1PJTA 2M60A 1SXJC 5EJCA 3SAWA 4PT5A 4YHHM 4LJ8A 3A33A 1PGYA 3R3QA 3HHYA 5ITYA 4KLNA 1YSYA 4DS2A 2QPAA 2QBYB 4IBGA 5EXSA 2VF7A 5C1BA 4DHID 4OX9M 3W0FA 3U5ZA 1IN7A 5H37D 2EDIA 2EO2A 3HHWA 1OIZA 1SG9A 1JR3A 4GIPA 3B74A 2VQEM 4IBDA 4AUQA 2R18A 2Z6OA 2F4WA 5FQ2A 3T15A 2ESQA 4JI4M 4IBEA 4JXJA 2DAIA 2KNAA 2KLYA 1JR3D 4BB9A 4WW0A 2G5GX 2LNHC 3L1YA 2WZJA 2Z3XA 1E9RA 4CHTB 3GLIA 4ONNB 4NRGB 2JZ0A 4MDKA 1XMOM 1P3QQ 1TH2A 2YFQA 1QAOA 3J80S 2QHOB 4OVZB 1OFHA 1U9AA 2DMFA 2DAGA 2GJDA 1PJSA 2EBKA 3LCUA 1GLNA 3HCTB 3ILKA 1VDDA 3E95C 3KSJA 2KEBA 4R3DA 4HLQA 2ESOA 3FUWA 3CF6E 4LJAA 4DR3M 1IN5A 1A5TA 1IBMM 4G4OA 2QCUA 4IBKA 2UUBM 3FYDA 1IN4A 3DOAA 3D8BA 4LFBM 2Y4WA 2JY8A 3GRUA 4D81A 4JQUA 3MK6A 1J7KA 3U6EA 1VEGA 3B89A 5D2MA 4M9XA 5EP2A 3THGA 1IXSA 3LQQA 3AOEC 3GLHA 1E94E 2UXDM 2OO9A 1Z5CA 1ZMWA 2C9OA 3J81S 3VKHA 5EP1A 4GC5A 1QZMA 2XSZA 4JI8M 4FD2A 2J7OA 4NXMM 2BJVA 2DWMA 4X62M 5C18A 1UKXA 3U5ZB 1UZXA 2XSZD 2MGWA 5JI2E 3VK7A 3SBJA 4S3OA 3JR5A 1DO2A 1HNXM 3DZDA 4QOZC 1IY0A 2DAWA 2J7NA 4G4RA 1W5SA 4ITQA 3GLIB 2GRPA 1UFZA 2X49A 2KA6B 5KQ8A 4G4QA 2L09A 3QYBA 2J5YA 3FUXA 3C3EA 2F5QA 5JI3E 3GLFA 4NRWA 4A3VB 3B7QA 2FE8A 4LJ9A 2HAKA 2XEPA 3P9HA 3C3DA 3AFHA 4I4LA 4FCTA 2R44A 3VDPA 2K07A 1MU5A 2YZ0A 2OXQA 4JUEA 2CLWB 2MH8A 4ONLA 1IQPA 1OIPA 2LXPA 3U6DA 3EIHA 4IBBA 3QAUA 3IG5A 1DO0A 2FS1A 4B3SM 1N77A 2XWUA 1XC8A 2HLWA 4KT0F 3SQVC 2FNAA 1R2ZA 2YBFA 5IREB 3JR4A 2R62A 1IXSB 2XGNA 3GLHB 1ZAEA 4NL4H 1XNRM 1QDRA 4LF9M 2VQFM 4LJ7A 2C4PA 3HZJA 4MM3B 2OQ4A 3PNVA 4MGHA 3TWKA 2R65A 3A46A 1WR1B 2GNOA 2AYVA 3OBSA 2DAKA 3UINA 3I04M 2CRUA 3K9OA 2EJSA 3HJ8A 5ITXA 1ZMVA 1WGLA 3KFUG 3UIPA 1TH4A 5EP3A 2F5OA 2QSFX 2XZFA 3BBZA 4LF6M 4DV1M 3GQ4A 1PJIA 4GHLA 3ZQSA 4L8RC 2GQFA 4WZ3A 2RGHA 1DGFA 2DHYA 2DWNA 3CEGA 2V1CA 2WSEF 4ZNYA 1PRBA 3WE5A 3FTDA 1YF9A 1LTMA 4REZA 2QP9X 4RKUF 3GRVA 3KP0E 1X23A 3H4JA 2G3QA 2E5LM 1Z5BA 1I94M 3GPPA 1NHWC 3TGDA 3GLFB 2D7EA 1TGUA 3PNYA 1NY5A 1GL6A 3TL4X 1IBLM 3ZQJA 2KRUA 3VONB 4F1IA 4Q7JA 2C5RA 4LFAM 4ONLB 1I7KA 2LBCA 4L83A 3SC3A 4W5VA 1D0LA 1XXHA 2YNMD 3L26A 2EKKA 4FCWA 3KS8A 2EBMA 3FKEA 2R4JA 4G3OA 2B3TA 2NQ8C 1WZVA 3GQ5A 4CISA 5LMNM 4DR6M 3JW0A 1L8QA 4LADA 3KOZE 1ZQ9A 3E9SA 3VONC 4XK8F 2AAKA 5ITXE 4V3LA 3TPZA 2JWSA 5IFRA 4LG2A 2WSCF 5KNLC 4JI1M 3UIOA 3H4MA 3RZ3A 4B3RM 3AOGA 2R0IA 1XHBA 1R2YA 4IJEA 4QNMA 4OW0A 3ZH9B 3HX3A 2VF8A 4R7GA 4G4NA 4LF5M 1QQWA 2R6FA 2JY5A 1FZYA 2Y20A 4BVUB 2R4EA 2Y9MA 3FUUA 2FFJA 1K3XA 4DR5M 4MH0E 4P5OG 2HWJA 3L27A 3OBUA 4A49B 4QHTA 3GRRA 4GMQA 2UXCM 3SYKA 2Y9PA 3R42A 1OQYA 3SASA 2KHHA
chains in the Genus database with same CATH topology
3BZHA 5F6XA 1Z2UA 1QCQA 3PTFA 1A5TA 1NV8A 2DAXA 1XXHE 2Y4WA 2JY8A 4JQUA 3FSHA 1VEGA 3B89A 5D2MA 4GEWA 1IXSA 3GLHE 1TR8A 2DKLA 2LVQD 1J7DB 1E94E 1FXTA 2ESKA 2A4DA 4YC1A 1VEJA 2OO9A 2UYZA 2PWQA 4DBGB 1ZMWA 4WP2A 1VDLA 1ZV1A 4R71A 2O25A 1G4AE 5DFLA 1G41A 1VG5A 4A4BC 2JP7A 2GRRA 5JNEB 1ZDNA 5D1MA 1UKXA 2BEPA 1C4ZD 1UZXA 4HEOA 2MGWA 5JI2E 2NVUC 4R62A 1YLAA 2DZLA 2R0JA 2PX9B 4S3OA 5FERB 1NV9A 4NRIA 1DO2A 2ZTCA 1Y8GA 4TKPA 1VQ1A 3FRHA 2EKEA 2DAWA 5F6VA 2MJ5B 5AITD 2ZTDA 3L1ZA 2RRUA 1ZMUA 2GRPA 1UFZA 2Q0VA 2C2VB 4NR3B 3FE3A 2AWFA 2MR9A 1Z3DA 3FRIA 2YHOB 3ONGB 1PZVA 4Y1LA 3GLFE 4QPLB 2KNVA 3T6PA 1YH2A 1JATB 2L2DA 1Q34A 2CYXA 4ONMB 2QGXA 2JY6B 2HAKA 3P9HA 2JY7A 2LVOC 2K07A 4DHZF 2YZ0A 5D0KA 2OXQA 1ZGUA 4FH1A 4JUEA 3UGBA 2CLWB 4ONLA 3RPGA 2LXPA 2JNHA 5F6WA 1DO0A 3LCVB 2ESPA 2XWUA 3OBXA 4Q5EC 1R4GA 2HLWA 2C2VC 3SQVC 1EFUB 2DNAA 3EB6B 4F2LA 1HT2E 5F6DA 1IM2A 1J7DA 5D0MA 4DHJC 2JUJA 2LVAA 2YBFA 1GO5A 1IFYA 2GRQA 5F6EA 4V3KA 1W4UA 5AIUB 2VRRA 4X57A 2H5XA 2C4PA 5EGGA 4EJEA 2KNZA 1KPPA 2PE6A 2K9DA 2Z6PA 1WR1B 3E95A 3A4SA 3OBSA 2AYVA 2DAYA 1HQYE 2DAKA 3GLGE 3UINA 3KPAA 1QZEA 3K9OA 5F6UA 3OJ4A 1Z5SA 3E46A 2EJSA 1ZMVA 1WGLA 3UIPA 3E21A 2EKFA 2QSFX 3IECA 3BBZA 2FO3A 3O2UA 4ONNA 4NRGA 1KPQA 1T43A 1TTEA 3ZQSA 3JVZA 1WGNA 2MROB 4NRIB 4WZ3A 1OKSA 3W31B 2CWBA 2DAMA 5AITB 5AIEB 2DHYA 3CEGA 2LVNC 1M4PA 1KYIA 2BF8A 4ZNYA 1T6OA 3WE5A 1YF9A 2YB6A 1X23A 4CCGA 3H4JA 2O25C 2G3QA 4LDTC 1J74A 1MN3A 2GMIB 2GROA 3TGDA 3K9PA 1AYZA 2LVPC 2BWEA 2DI0A 4UN2B 3MMPA 3EVXA 5F6YA 4DDGA 2CLWA 1KPSA 4GPRA 3RCZB 2E2CA 3VONB 4F1IA 4Q7JA 1HJPA 1JASA 2F4ZA 1CUKA 2A7LA 2QNJA 1XB2B 4ONLB 1I7KA 1JBBA 2LBCA 1YRVA 4L83A 4W5VA 2OOAA 2ONUA 2EKKA 2JZ1A 1DV0A 1U9BA 2L4FA 2BWBA 2EBMA 4G3OA 2DAEA 4YIIU 3SY2C 4Q5HC 2B3TA 3A33A 1PGYA 1WZVA 3R3QA 4Y1LC 1WIVA 4DS2A 4M1NA 1G3IA 1OTRA 4DHID 3JW0A 1WJ7A 4LADA 2FUHA 1Y8XA 2K0BX 3VONC 2EDIA 3IHPA 2AAKA 2Z5DA 4V3LA 3HCUB 1Y6LA 1JR3E 1SG9A 1VEKA 3H8KA 3P9GA 2GRNA 5IFRA 1BVSA 1S1QA 2MT6A 1Q02A 3ZNIC 5KNLC 3UIOA 2F0RA 4AUQA 2Z6OA 2F4WA 5FQ2A 2ESQA 2KJHA 1FBVC 2DAIA 2KNAA 2KLYA 3RZ3A 2LTUA 3L1YA 3F92A 2R0IA 2WZJA 2CP8A 1V92A 5D1KA 1WZWA 1A3SA 3GLIE 4ONNB 1AIPC 4NRGB 2JZ0A 2UCZA 4NR3A 1M4QA 1ZUOA 4MDKA 1WHCA 1P3QQ 1HT1E 1F4IA 2OOBA 2QHOB 2OB4A 1U9AA 2DMFA 2JY5A 2DAGA 2H2YA 4IP3B 1FZYA 4BVUB 1JATA 2GJDA 2Y9MA 1C7YA 4AP4B 2EBKA 5D1LA 5HPTC 3LCUA 4ONMA 3FN1B 4P5OG 1OAIA 4A4CC 2HWJA 3HCTB 2GMIA 3OBQA 2L4EA 3OBUA 4A49B 4DDIA 3E95C 4II2C 4BWFA 2Y9PA 3R42A 1OQYA 2ESOA 2KHHA 2DENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZH A;  5F6X A;  1Z2U A;  1QCQ A;  3PTF A;  1A5T A;  1NV8 A;  2DAX A;  1XXH E;  2Y4W A;  2JY8 A;  4JQU A;  3FSH A;  1VEG A;  3B89 A;  5D2M A;  4GEW A;  1IXS A;  3GLH E;  1TR8 A;  2DKL A;  2LVQ D;  1J7D B;  1E94 E;  1FXT A;  2ESK A;  2A4D A;  4YC1 A;  1VEJ A;  2OO9 A;  2UYZ A;  2PWQ A;  4DBG B;  1ZMW A;  4WP2 A;  1VDL A;  1ZV1 A;  4R71 A;  2O25 A;  1G4A E;  5DFL A;  1G41 A;  1VG5 A;  4A4B C;  2JP7 A;  2GRR A;  5JNE B;  1ZDN A;  5D1M A;  1UKX A;  2BEP A;  1C4Z D;  1UZX A;  4HEO A;  2MGW A;  5JI2 E;  2NVU C;  4R62 A;  1YLA A;  2DZL A;  2R0J A;  2PX9 B;  4S3O A;  5FER B;  1NV9 A;  4NRI A;  1DO2 A;  2ZTC A;  1Y8G A;  4TKP A;  1VQ1 A;  3FRH A;  2EKE A;  2DAW A;  5F6V A;  2MJ5 B;  5AIT D;  2ZTD A;  3L1Z A;  2RRU A;  1ZMU A;  2GRP A;  1UFZ A;  2Q0V A;  2C2V B;  4NR3 B;  3FE3 A;  2AWF A;  2MR9 A;  1Z3D A;  3FRI A;  2YHO B;  3ONG B;  1PZV A;  4Y1L A;  3GLF E;  4QPL B;  2KNV A;  3T6P A;  1YH2 A;  1JAT B;  2L2D A;  1Q34 A;  2CYX A;  4ONM B;  2QGX A;  2JY6 B;  2HAK A;  3P9H A;  2JY7 A;  2LVO C;  2K07 A;  4DHZ F;  2YZ0 A;  5D0K A;  2OXQ A;  1ZGU A;  4FH1 A;  4JUE A;  3UGB A;  2CLW B;  4ONL A;  3RPG A;  2LXP A;  2JNH A;  5F6W A;  1DO0 A;  3LCV B;  2ESP A;  2XWU A;  3OBX A;  4Q5E C;  1R4G A;  2HLW A;  2C2V C;  3SQV C;  1EFU B;  2DNA A;  3EB6 B;  4F2L A;  1HT2 E;  5F6D A;  1IM2 A;  1J7D A;  5D0M A;  4DHJ C;  2JUJ A;  2LVA A;  2YBF A;  1GO5 A;  1IFY A;  2GRQ A;  5F6E A;  4V3K A;  1W4U A;  5AIU B;  2VRR A;  4X57 A;  2H5X A;  2C4P A;  5EGG A;  4EJE A;  2KNZ A;  1KPP A;  2PE6 A;  2K9D A;  2Z6P A;  1WR1 B;  3E95 A;  3A4S A;  3OBS A;  2AYV A;  2DAY A;  1HQY E;  2DAK A;  3GLG E;  3UIN A;  3KPA A;  1QZE A;  3K9O A;  5F6U A;  3OJ4 A;  1Z5S A;  3E46 A;  2EJS A;  1ZMV A;  1WGL A;  3UIP A;  3E21 A;  2EKF A;  2QSF X;  3IEC A;  3BBZ A;  2FO3 A;  3O2U A;  4ONN A;  4NRG A;  1KPQ A;  1T43 A;  1TTE A;  3ZQS A;  3JVZ A;  1WGN A;  2MRO B;  4NRI B;  4WZ3 A;  1OKS A;  3W31 B;  2CWB A;  2DAM A;  5AIT B;  5AIE B;  2DHY A;  3CEG A;  2LVN C;  1M4P A;  1KYI A;  2BF8 A;  4ZNY A;  1T6O A;  3WE5 A;  1YF9 A;  2YB6 A;  1X23 A;  4CCG A;  3H4J A;  2O25 C;  2G3Q A;  4LDT C;  1J74 A;  1MN3 A;  2GMI B;  2GRO A;  3TGD A;  3K9P A;  1AYZ A;  2LVP C;  2BWE A;  2DI0 A;  4UN2 B;  3MMP A;  3EVX A;  5F6Y A;  4DDG A;  2CLW A;  1KPS A;  4GPR A;  3RCZ B;  2E2C A;  3VON B;  4F1I A;  4Q7J A;  1HJP A;  1JAS A;  2F4Z A;  1CUK A;  2A7L A;  2QNJ A;  1XB2 B;  4ONL B;  1I7K A;  1JBB A;  2LBC A;  1YRV A;  4L83 A;  4W5V A;  2OOA A;  2ONU A;  2EKK A;  2JZ1 A;  1DV0 A;  1U9B A;  2L4F A;  2BWB A;  2EBM A;  4G3O A;  2DAE A;  4YII U;  3SY2 C;  4Q5H C;  2B3T A;  3A33 A;  1PGY A;  1WZV A;  3R3Q A;  4Y1L C;  1WIV A;  4DS2 A;  4M1N A;  1G3I A;  1OTR A;  4DHI D;  3JW0 A;  1WJ7 A;  4LAD A;  2FUH A;  1Y8X A;  2K0B X;  3VON C;  2EDI A;  3IHP A;  2AAK A;  2Z5D A;  4V3L A;  3HCU B;  1Y6L A;  1JR3 E;  1SG9 A;  1VEK A;  3H8K A;  3P9G A;  2GRN A;  5IFR A;  1BVS A;  1S1Q A;  2MT6 A;  1Q02 A;  3ZNI C;  5KNL C;  3UIO A;  2F0R A;  4AUQ A;  2Z6O A;  2F4W A;  5FQ2 A;  2ESQ A;  2KJH A;  1FBV C;  2DAI A;  2KNA A;  2KLY A;  3RZ3 A;  2LTU A;  3L1Y A;  3F92 A;  2R0I A;  2WZJ A;  2CP8 A;  1V92 A;  5D1K A;  1WZW A;  1A3S A;  3GLI E;  4ONN B;  1AIP C;  4NRG B;  2JZ0 A;  2UCZ A;  4NR3 A;  1M4Q A;  1ZUO A;  4MDK A;  1WHC A;  1P3Q Q;  1HT1 E;  1F4I A;  2OOB A;  2QHO B;  2OB4 A;  1U9A A;  2DMF A;  2JY5 A;  2DAG A;  2H2Y A;  4IP3 B;  1FZY A;  4BVU B;  1JAT A;  2GJD A;  2Y9M A;  1C7Y A;  4AP4 B;  2EBK A;  5D1L A;  5HPT C;  3LCU A;  4ONM A;  3FN1 B;  4P5O G;  1OAI A;  4A4C C;  2HWJ A;  3HCT B;  2GMI A;  3OBQ A;  2L4E A;  3OBU A;  4A49 B;  4DDI A;  3E95 C;  4II2 C;  4BWF A;  2Y9P A;  3R42 A;  1OQY A;  2ESO A;  2KHH A;  2DEN A; 
#chains in the Genus database with same CATH topology
 1Z2U A;  3PTF A;  3DA1 A;  5L8R F;  4D80 A;  2V6Z M;  4KHP M;  7CAT A;  2Z8Y M;  1XXH E;  1DGH A;  3EIE A;  3FSH A;  2Z7J A;  3SAV A;  4GEW A;  2DZN B;  4P16 A;  1N36 M;  1YE9 A;  2O01 F;  3GP1 A;  2KZU A;  4B7F A;  1FXT A;  4DV4 M;  2H1R A;  2ESK A;  1Q3B A;  1VEJ A;  2XFS A;  4DBG B;  2BNK A;  3T38 A;  1NJF A;  3KOX E;  1N32 M;  4MGY E;  5ITQ A;  3L25 A;  3L29 A;  4L15 A;  1VG5 A;  2JP7 A;  2GRR A;  3M7G A;  3HKP A;  3U6C A;  3SAT A;  1OAO C;  1C4Z D;  2WSF F;  2NVU C;  1YUB A;  2DZL A;  4DUY M;  3W68 A;  4LFC M;  1HNZ M;  1NV9 A;  4NRI A;  1Q3C A;  2CFO A;  3I4Y A;  1G59 A;  3FRH A;  2EKE A;  2CV1 A;  1JQJ C;  4I5S A;  1R7R A;  1I4W A;  5F6V A;  2MJ5 B;  2KZS A;  3HGI A;  4TUW A;  3L2A A;  1Z3D A;  2YHO B;  4LJ6 A;  1G71 A;  1PZV A;  4Y1L A;  2I7P A;  4QPL B;  1YH2 A;  2ERC A;  4DR4 M;  4B3M M;  2CV2 A;  2ZM6 M;  1H6U A;  4B7H A;  5DNY A;  4B08 A;  2A5Y B;  3K92 A;  4GHA A;  3J7B A;  4NSR A;  1NY6 A;  1N75 A;  3RPG A;  5F6W A;  3VKG A;  1HR0 M;  3LCV B;  3VK8 A;  1NJG A;  1R4G A;  1IXZ A;  3EB6 B;  1HT2 E;  5F6D A;  4JV5 M;  1J7D A;  1TDH A;  1IFY A;  4V3K A;  1W4U A;  2LWX A;  3HU2 A;  1G8P A;  1IBK M;  5EGG A;  4PDI A;  4GC9 A;  1XNQ M;  2KNZ A;  3E4R A;  2K9D A;  5IWA M;  2APL A;  4LCB A;  4LGY A;  2DAY A;  3KS4 A;  3GLG E;  2V1U A;  2LH0 A;  5IZ7 D;  8CAT A;  2Y21 A;  3RE8 A;  3E21 A;  5FLX S;  2LHG A;  3IEC A;  2XZU A;  1KPQ A;  5DYI A;  1IN8 A;  4PCZ A;  2MRO B;  4NRI B;  3W31 B;  3J27 B;  1QUS A;  1FJG M;  3UK6 A;  5AIE B;  1KYI A;  2BF8 A;  1T6O A;  2CEA A;  4JI3 M;  4ZPX A;  3FTF A;  4DR1 M;  1NNU C;  3K9P A;  3KW6 A;  1AYZ A;  3FD9 A;  1HNW M;  2BWE A;  3MMP A;  4DV7 M;  2F4V M;  3MHV C;  4GRI A;  3RCZ B;  4I81 A;  4B7G A;  2X4A A;  1JAS A;  1CUK A;  4AW4 A;  4OU7 A;  1MX0 A;  2QNJ A;  2OOA A;  1R6B X;  4Z6Y A;  1U9B A;  2N35 A;  3VFD A;  3GPU A;  4GKJ M;  1GL7 A;  2BWB A;  3U60 A;  2DAE A;  3SY2 C;  4Q5H C;  1NVM A;  3KOY E;  3FTE A;  4Y1L C;  1LV7 A;  1WIV A;  5FTL A;  3BOS A;  4M1N A;  3I4V A;  4KO8 A;  1G3I A;  4ANR A;  1L1T A;  4M0D A;  4AG6 A;  2BJW A;  3Q8G A;  2FUH A;  3KSX A;  2K0B X;  2K47 A;  3K2L A;  3IHP A;  3WHK A;  3SHG B;  1Y6L A;  1NO1 A;  3H8K A;  3P9G A;  2GRN A;  1GVN A;  1S1Q A;  1Q02 A;  3ZNI C;  2F0R A;  2KJH A;  4FWG A;  2XFT A;  1FBV C;  3HJS A;  4RNA A;  3KDS E;  2LTU A;  3D8L A;  3T1Y M;  3F92 A;  5D1K A;  1WZW A;  2JA2 A;  1A3S A;  2UCZ A;  4NR3 A;  1M4Q A;  1ZUO A;  1TH3 A;  1WHC A;  1HT1 E;  1F4I A;  3M0E A;  4FWD A;  5KPR A;  5BPV A;  5LMU M;  2UUA M;  2H2Y A;  4IP3 B;  1JAT A;  4L78 A;  1C7Y A;  3SMS A;  3FN1 B;  2R46 A;  4JI6 M;  4A4C C;  2GMI A;  3OBQ A;  4DDI A;  2CHQ A;  2XF3 A;  3PFI A;  2LHC A;  4BWF A;  3M6A A;  4D82 A;  4MGI E;  4LRT A;  2K6B A;  3BZH A;  1PM5 A;  2UUC M;  3U6O A;  4DV6 M;  4MGZ E;  2FOI C;  1NV8 A;  2DZO B;  2AHM A;  1N34 M;  2ZAO A;  4S12 A;  5IT9 S;  2EA0 A;  4GH9 A;  1DGG A;  4II7 A;  1IN6 A;  5E6J A;  4FW9 A;  2KXE A;  3RGP A;  4BBA A;  4L4U A;  3TE6 A;  4M9Z A;  4JI0 M;  3U60 B;  3FYC A;  1J5E M;  4WP2 A;  2O25 A;  4NC6 A;  4FWH A;  5FTN A;  2YR0 A;  2P5T A;  4L16 A;  5DFL A;  1G41 A;  1TDZ A;  5JNE B;  1ZDN A;  5D1M A;  1GAB A;  4I8O A;  1N78 A;  4IBI A;  4HEO A;  3UGJ A;  5A2Q S;  1L2C A;  3LW5 F;  4R62 A;  1YLA A;  3FUT A;  3Q8X A;  2PX9 B;  4BLC A;  5FER B;  5EXP A;  2CUZ A;  2VDB B;  2RKO A;  2L6O A;  1Y8G A;  4TKP A;  1VQ1 A;  3HJQ A;  1GKI A;  3CF2 A;  4IBJ A;  1SXJ E;  2ZTD A;  5EQT A;  3L1Z A;  1ZMU A;  2RRU A;  3HU3 A;  2C2V B;  4NR3 B;  2HHH M;  1WXQ A;  2DWL A;  3FRI A;  2DXI A;  4YY3 M;  2F5P A;  3U6L A;  2KNV A;  3T6P A;  3TQS A;  1Z59 A;  3U6S A;  4G6Z A;  1JAT B;  2L2D A;  2CYX A;  4KOD A;  5FTJ A;  1D2N A;  3ZC7 B;  4DV2 M;  1D0K A;  4B3T M;  4JI7 M;  3LQR A;  2ZAM A;  2JY7 A;  4K0K M;  4DHZ F;  1HQC A;  1W5T A;  4MGK E;  1QAQ A;  2UXB M;  4PDG A;  4FH1 A;  1X37 A;  4DV5 M;  2JNH A;  1V34 A;  1UM8 A;  1MJG M;  3K8Z A;  2HKJ A;  2ESP A;  1FNN A;  2C2V C;  1EFU B;  2DNA A;  3MJ5 A;  3KP1 E;  1XXH B;  4LF4 M;  1IM2 A;  2LVA A;  3W67 A;  2DHR A;  3HHX A;  3GPX A;  2QQ8 A;  2VRR A;  2ZAN A;  3L28 A;  2H5X A;  4XBO A;  1Z5A A;  2PE6 A;  3LMM A;  2Z6P A;  5FTK A;  3CGW A;  3GLG A;  1QZE A;  5F6U A;  4QHS A;  1E32 A;  4DR2 M;  2EKF A;  2C96 A;  3AL0 C;  3O2U A;  2RGO A;  3AV0 A;  4NXN M;  1T3T A;  3HHZ A;  4CIZ A;  5BR8 M;  1Z6T A;  2I7N A;  1M4P A;  3C58 A;  1KFV A;  3U6M A;  4GIT A;  2YB6 A;  3CF0 A;  2O25 C;  4LDT C;  1J74 A;  1K3W A;  3LVV A;  5KPT A;  2FH0 A;  4JI5 M;  2LVP C;  4X66 M;  2DI0 A;  4UN2 B;  3EVX A;  1QAN A;  4EIW A;  5F6Y A;  5FSW A;  4LJ5 A;  3J7A S;  2CLW A;  1KPS A;  4GPR A;  2X8A A;  2Z4R A;  3GPY A;  2XH9 A;  3SMP A;  2F4Z A;  4AKH A;  2C99 A;  2A7L A;  1GJS A;  1XB2 B;  4LZZ A;  1DGH B;  1OFI A;  2ONU A;  2JZ1 A;  2CV0 A;  1DV0 A;  2L4F A;  4FCV A;  2C9C A;  4YII U;  2QEN A;  4NOO B;  2R45 A;  3GQ3 A;  3OTO M;  1J09 A;  3KXE C;  1IY1 A;  1OTR A;  3K1J A;  1L1Z A;  2Y0Q A;  1WJ7 A;  3UZU A;  1XWI A;  1L2D A;  4DR7 M;  1Q39 A;  1Y8X A;  3BXW A;  3R9X B;  2Z5D A;  3HCU B;  4JN6 A;  1IXR C;  1JR3 E;  1VEK A;  4CGY B;  1BVS A;  2MT6 A;  4LRS A;  3IG8 A;  4HL4 A;  3SYL A;  2W82 A;  3A42 A;  4LGM A;  3GLG B;  3SFZ A;  4Z8X A;  3I01 M;  1JB0 F;  1K82 A;  3VDU A;  2CP8 A;  1V92 A;  4P17 A;  3GLI E;  3CTW B;  4NRV A;  5E26 A;  1AIP C;  3FTC A;  3PXG A;  2OOB A;  3RFW A;  2OB4 A;  4AG5 A;  4GKK M;  5FTM A;  2C98 A;  4DUZ M;  4AP4 B;  5D1L A;  5HPT C;  4ONM A;  3AJI B;  1OAI A;  2L4E A;  3B7Z A;  3R8F A;  1L2B A;  4II2 C;  3TWM A;  2LXE A;  2L7I A;  3B7N A;  2JXN A;  3DFZ A;  2DEN A;  2CHV A;  5F6X A;  1QCQ A;  4LJ4 A;  2KRK A;  3J2P B;  3GO8 A;  1ORY B;  2DAX A;  4DV3 M;  3NWL A;  3A45 A;  3GLH E;  1TR8 A;  2DKL A;  5DYG A;  2LVQ D;  1J7D B;  1QYR A;  4AKG A;  4MB7 A;  4Y28 F;  2A4D A;  4YC1 A;  5KO3 A;  2UYZ A;  2PWQ A;  4RF0 A;  2HCB A;  1VDL A;  1ZV1 A;  4R71 A;  3KVW A;  4L6V 6;  1G4A E;  2QZ4 A;  3NBI A;  4WUR A;  1KSF X;  5EP4 A;  3U6Q A;  2YQZ A;  3UJN A;  4A4B C;  2F5S A;  4AZF A;  2BEP A;  3LVW A;  1GJT A;  4IJF A;  2R0J A;  3PVS A;  1PJQ A;  2ZTC A;  3HWS A;  3U61 A;  1PJJ A;  3RGS A;  5ITU A;  4LF7 M;  3SHF A;  3FUV A;  2KDL A;  5AIT D;  1NSF A;  4LZJ A;  2XLJ A;  1SXJ A;  1EE8 A;  3VLF B;  2Q0V A;  3FE3 A;  2AWF A;  2KW0 A;  2MR9 A;  4QNR A;  4M0W A;  3ONG B;  4JI2 M;  1D0M A;  4W5W A;  2OPF A;  1NNJ A;  1QAM A;  3GLF E;  5EXT A;  1SXJ D;  3A98 B;  4X65 M;  1Q34 A;  4FVM A;  4ONM B;  2QGX A;  3SAU A;  1E9S A;  3HY5 A;  2JY6 B;  2O5R A;  2DVW B;  4AKI A;  2LVO C;  1OJL A;  4M9S A;  5D0K A;  3TWL A;  2D7H A;  1ZGU A;  3UGB A;  1DGB A;  3W0L B;  1QVR A;  1S3S A;  3OBX A;  1QDT A;  4Q5E C;  1IY2 A;  2EUC A;  4F2L A;  5F3W A;  5D0M A;  4DHJ C;  2Q2E B;  5ITR A;  2JUJ A;  1NHG C;  4IBC A;  3WHL A;  1GO5 A;  3NBX X;  1AUA A;  2GRQ A;  5F6E A;  1N33 M;  2QBY A;  3QYE A;  1QUT A;  3KOW E;  1R5L A;  5AIU B;  4X57 A;  4JYA M;  4EJE A;  4LY6 A;  3JAM S;  4AQY M;  1KPP A;  3AKZ A;  5EXX A;  3E95 A;  3A4S A;  1HQY E;  2CE7 A;  2HL7 A;  3KPA A;  4NSO B;  3ZCB B;  5GKN A;  1Z5S A;  3OJ4 A;  3E46 A;  3I51 A;  4DV0 M;  2UU9 M;  3HU1 A;  2FO3 A;  4ONN A;  4NRG A;  1T43 A;  1TTE A;  3SAR A;  3JVZ A;  1WGN A;  2VII A;  1OKS A;  4OVZ A;  2CWB A;  2DAM A;  3U61 B;  5AIT B;  5KPZ A;  1C1K A;  2LVN C;  1RU3 A;  3U6P A;  3GRY A;  3AOE A;  3UMM A;  4X64 M;  2M5Z A;  4XGI A;  3V76 A;  4CCG A;  1SXJ B;  4RF1 A;  1V33 A;  4QOS A;  1MN3 A;  4IBF A;  3QWL A;  4LF8 M;  2GMI B;  2GRO A;  4PD2 A;  4AI6 A;  1XMQ M;  4CJ6 A;  3B9P A;  5ITT A;  5KQD A;  4DDG A;  2DWZ B;  2CHG A;  3C9P A;  1TF0 B;  2E2C A;  1HJP A;  2Y0T A;  1EIJ A;  2F5N A;  2D7G A;  2ZBK B;  2L7H A;  2G8L A;  4IIW A;  2Z4S A;  3T1H M;  1JBB A;  1YRV A;  1PJT A;  2M60 A;  1SXJ C;  5EJC A;  3SAW A;  4PT5 A;  4YHH M;  4LJ8 A;  3A33 A;  1PGY A;  3R3Q A;  3HHY A;  5ITY A;  4KLN A;  1YSY A;  4DS2 A;  2QPA A;  2QBY B;  4IBG A;  5EXS A;  2VF7 A;  5C1B A;  4DHI D;  4OX9 M;  3W0F A;  3U5Z A;  1IN7 A;  5H37 D;  2EDI A;  2EO2 A;  3HHW A;  1OIZ A;  1SG9 A;  1JR3 A;  4GIP A;  3B74 A;  2VQE M;  4IBD A;  4AUQ A;  2R18 A;  2Z6O A;  2F4W A;  5FQ2 A;  3T15 A;  2ESQ A;  4JI4 M;  4IBE A;  4JXJ A;  2DAI A;  2KNA A;  2KLY A;  1JR3 D;  4BB9 A;  4WW0 A;  2G5G X;  2LNH C;  3L1Y A;  2WZJ A;  2Z3X A;  1E9R A;  4CHT B;  3GLI A;  4ONN B;  4NRG B;  2JZ0 A;  4MDK A;  1XMO M;  1P3Q Q;  1TH2 A;  2YFQ A;  1QAO A;  3J80 S;  2QHO B;  4OVZ B;  1OFH A;  1U9A A;  2DMF A;  2DAG A;  2GJD A;  1PJS A;  2EBK A;  3LCU A;  1GLN A;  3HCT B;  3ILK A;  1VDD A;  3E95 C;  3KSJ A;  2KEB A;  4R3D A;  4HLQ A;  2ESO A;  3FUW A;  3CF6 E;  4LJA A;  4DR3 M;  1IN5 A;  1A5T A;  1IBM M;  4G4O A;  2QCU A;  4IBK A;  2UUB M;  3FYD A;  1IN4 A;  3DOA A;  3D8B A;  4LFB M;  2Y4W A;  2JY8 A;  3GRU A;  4D81 A;  4JQU A;  3MK6 A;  1J7K A;  3U6E A;  1VEG A;  3B89 A;  5D2M A;  4M9X A;  5EP2 A;  3THG A;  1IXS A;  3LQQ A;  3AOE C;  3GLH A;  1E94 E;  2UXD M;  2OO9 A;  1Z5C A;  1ZMW A;  2C9O A;  3J81 S;  3VKH A;  5EP1 A;  4GC5 A;  1QZM A;  2XSZ A;  4JI8 M;  4FD2 A;  2J7O A;  4NXM M;  2BJV A;  2DWM A;  4X62 M;  5C18 A;  1UKX A;  3U5Z B;  1UZX A;  2XSZ D;  2MGW A;  5JI2 E;  3VK7 A;  3SBJ A;  4S3O A;  3JR5 A;  1DO2 A;  1HNX M;  3DZD A;  4QOZ C;  1IY0 A;  2DAW A;  2J7N A;  4G4R A;  1W5S A;  4ITQ A;  3GLI B;  2GRP A;  1UFZ A;  2X49 A;  2KA6 B;  5KQ8 A;  4G4Q A;  2L09 A;  3QYB A;  2J5Y A;  3FUX A;  3C3E A;  2F5Q A;  5JI3 E;  3GLF A;  4NRW A;  4A3V B;  3B7Q A;  2FE8 A;  4LJ9 A;  2HAK A;  2XEP A;  3P9H A;  3C3D A;  3AFH A;  4I4L A;  4FCT A;  2R44 A;  3VDP A;  2K07 A;  1MU5 A;  2YZ0 A;  2OXQ A;  4JUE A;  2CLW B;  2MH8 A;  4ONL A;  1IQP A;  1OIP A;  2LXP A;  3U6D A;  3EIH A;  4IBB A;  3QAU A;  3IG5 A;  1DO0 A;  2FS1 A;  4B3S M;  1N77 A;  2XWU A;  1XC8 A;  2HLW A;  4KT0 F;  3SQV C;  2FNA A;  1R2Z A;  2YBF A;  5IRE B;  3JR4 A;  2R62 A;  1IXS B;  2XGN A;  3GLH B;  1ZAE A;  4NL4 H;  1XNR M;  1QDR A;  4LF9 M;  2VQF M;  4LJ7 A;  2C4P A;  3HZJ A;  4MM3 B;  2OQ4 A;  3PNV A;  4MGH A;  3TWK A;  2R65 A;  3A46 A;  1WR1 B;  2GNO A;  2AYV A;  3OBS A;  2DAK A;  3UIN A;  3I04 M;  2CRU A;  3K9O A;  2EJS A;  3HJ8 A;  5ITX A;  1ZMV A;  1WGL A;  3KFU G;  3UIP A;  1TH4 A;  5EP3 A;  2F5O A;  2QSF X;  2XZF A;  3BBZ A;  4LF6 M;  4DV1 M;  3GQ4 A;  1PJI A;  4GHL A;  3ZQS A;  4L8R C;  2GQF A;  4WZ3 A;  2RGH A;  1DGF A;  2DHY A;  2DWN A;  3CEG A;  2V1C A;  2WSE F;  4ZNY A;  1PRB A;  3WE5 A;  3FTD A;  1YF9 A;  1LTM A;  4REZ A;  2QP9 X;  4RKU F;  3GRV A;  3KP0 E;  1X23 A;  3H4J A;  2G3Q A;  2E5L M;  1Z5B A;  1I94 M;  3GPP A;  1NHW C;  3TGD A;  3GLF B;  2D7E A;  1TGU A;  3PNY A;  1NY5 A;  1GL6 A;  3TL4 X;  1IBL M;  3ZQJ A;  2KRU A;  3VON B;  4F1I A;  4Q7J A;  2C5R A;  4LFA M;  4ONL B;  1I7K A;  2LBC A;  4L83 A;  3SC3 A;  4W5V A;  1D0L A;  1XXH A;  2YNM D;  3L26 A;  2EKK A;  4FCW A;  3KS8 A;  2EBM A;  3FKE A;  2R4J A;  4G3O A;  2B3T A;  2NQ8 C;  1WZV A;  3GQ5 A;  4CIS A;  5LMN M;  4DR6 M;  3JW0 A;  1L8Q A;  4LAD A;  3KOZ E;  1ZQ9 A;  3E9S A;  3VON C;  4XK8 F;  2AAK A;  5ITX E;  4V3L A;  3TPZ A;  2JWS A;  5IFR A;  4LG2 A;  2WSC F;  5KNL C;  4JI1 M;  3UIO A;  3H4M A;  3RZ3 A;  4B3R M;  3AOG A;  2R0I A;  1XHB A;  1R2Y A;  4IJE A;  4QNM A;  4OW0 A;  3ZH9 B;  3HX3 A;  2VF8 A;  4R7G A;  4G4N A;  4LF5 M;  1QQW A;  2R6F A;  2JY5 A;  1FZY A;  2Y20 A;  4BVU B;  2R4E A;  2Y9M A;  3FUU A;  2FFJ A;  1K3X A;  4DR5 M;  4MH0 E;  4P5O G;  2HWJ A;  3L27 A;  3OBU A;  4A49 B;  4QHT A;  3GRR A;  4GMQ A;  2UXC M;  3SYK A;  2Y9P A;  3R42 A;  1OQY A;  3SAS A;  2KHH A; 
#chains in the Genus database with same CATH homology
 3BZH A;  5F6X A;  1Z2U A;  1QCQ A;  3PTF A;  1A5T A;  1NV8 A;  2DAX A;  1XXH E;  2Y4W A;  2JY8 A;  4JQU A;  3FSH A;  1VEG A;  3B89 A;  5D2M A;  4GEW A;  1IXS A;  3GLH E;  1TR8 A;  2DKL A;  2LVQ D;  1J7D B;  1E94 E;  1FXT A;  2ESK A;  2A4D A;  4YC1 A;  1VEJ A;  2OO9 A;  2UYZ A;  2PWQ A;  4DBG B;  1ZMW A;  4WP2 A;  1VDL A;  1ZV1 A;  4R71 A;  2O25 A;  1G4A E;  5DFL A;  1G41 A;  1VG5 A;  4A4B C;  2JP7 A;  2GRR A;  5JNE B;  1ZDN A;  5D1M A;  1UKX A;  2BEP A;  1C4Z D;  1UZX A;  4HEO A;  2MGW A;  5JI2 E;  2NVU C;  4R62 A;  1YLA A;  2DZL A;  2R0J A;  2PX9 B;  4S3O A;  5FER B;  1NV9 A;  4NRI A;  1DO2 A;  2ZTC A;  1Y8G A;  4TKP A;  1VQ1 A;  3FRH A;  2EKE A;  2DAW A;  5F6V A;  2MJ5 B;  5AIT D;  2ZTD A;  3L1Z A;  2RRU A;  1ZMU A;  2GRP A;  1UFZ A;  2Q0V A;  2C2V B;  4NR3 B;  3FE3 A;  2AWF A;  2MR9 A;  1Z3D A;  3FRI A;  2YHO B;  3ONG B;  1PZV A;  4Y1L A;  3GLF E;  4QPL B;  2KNV A;  3T6P A;  1YH2 A;  1JAT B;  2L2D A;  1Q34 A;  2CYX A;  4ONM B;  2QGX A;  2JY6 B;  2HAK A;  3P9H A;  2JY7 A;  2LVO C;  2K07 A;  4DHZ F;  2YZ0 A;  5D0K A;  2OXQ A;  1ZGU A;  4FH1 A;  4JUE A;  3UGB A;  2CLW B;  4ONL A;  3RPG A;  2LXP A;  2JNH A;  5F6W A;  1DO0 A;  3LCV B;  2ESP A;  2XWU A;  3OBX A;  4Q5E C;  1R4G A;  2HLW A;  2C2V C;  3SQV C;  1EFU B;  2DNA A;  3EB6 B;  4F2L A;  1HT2 E;  5F6D A;  1IM2 A;  1J7D A;  5D0M A;  4DHJ C;  2JUJ A;  2LVA A;  2YBF A;  1GO5 A;  1IFY A;  2GRQ A;  5F6E A;  4V3K A;  1W4U A;  5AIU B;  2VRR A;  4X57 A;  2H5X A;  2C4P A;  5EGG A;  4EJE A;  2KNZ A;  1KPP A;  2PE6 A;  2K9D A;  2Z6P A;  1WR1 B;  3E95 A;  3A4S A;  3OBS A;  2AYV A;  2DAY A;  1HQY E;  2DAK A;  3GLG E;  3UIN A;  3KPA A;  1QZE A;  3K9O A;  5F6U A;  3OJ4 A;  1Z5S A;  3E46 A;  2EJS A;  1ZMV A;  1WGL A;  3UIP A;  3E21 A;  2EKF A;  2QSF X;  3IEC A;  3BBZ A;  2FO3 A;  3O2U A;  4ONN A;  4NRG A;  1KPQ A;  1T43 A;  1TTE A;  3ZQS A;  3JVZ A;  1WGN A;  2MRO B;  4NRI B;  4WZ3 A;  1OKS A;  3W31 B;  2CWB A;  2DAM A;  5AIT B;  5AIE B;  2DHY A;  3CEG A;  2LVN C;  1M4P A;  1KYI A;  2BF8 A;  4ZNY A;  1T6O A;  3WE5 A;  1YF9 A;  2YB6 A;  1X23 A;  4CCG A;  3H4J A;  2O25 C;  2G3Q A;  4LDT C;  1J74 A;  1MN3 A;  2GMI B;  2GRO A;  3TGD A;  3K9P A;  1AYZ A;  2LVP C;  2BWE A;  2DI0 A;  4UN2 B;  3MMP A;  3EVX A;  5F6Y A;  4DDG A;  2CLW A;  1KPS A;  4GPR A;  3RCZ B;  2E2C A;  3VON B;  4F1I A;  4Q7J A;  1HJP A;  1JAS A;  2F4Z A;  1CUK A;  2A7L A;  2QNJ A;  1XB2 B;  4ONL B;  1I7K A;  1JBB A;  2LBC A;  1YRV A;  4L83 A;  4W5V A;  2OOA A;  2ONU A;  2EKK A;  2JZ1 A;  1DV0 A;  1U9B A;  2L4F A;  2BWB A;  2EBM A;  4G3O A;  2DAE A;  4YII U;  3SY2 C;  4Q5H C;  2B3T A;  3A33 A;  1PGY A;  1WZV A;  3R3Q A;  4Y1L C;  1WIV A;  4DS2 A;  4M1N A;  1G3I A;  1OTR A;  4DHI D;  3JW0 A;  1WJ7 A;  4LAD A;  2FUH A;  1Y8X A;  2K0B X;  3VON C;  2EDI A;  3IHP A;  2AAK A;  2Z5D A;  4V3L A;  3HCU B;  1Y6L A;  1JR3 E;  1SG9 A;  1VEK A;  3H8K A;  3P9G A;  2GRN A;  5IFR A;  1BVS A;  1S1Q A;  2MT6 A;  1Q02 A;  3ZNI C;  5KNL C;  3UIO A;  2F0R A;  4AUQ A;  2Z6O A;  2F4W A;  5FQ2 A;  2ESQ A;  2KJH A;  1FBV C;  2DAI A;  2KNA A;  2KLY A;  3RZ3 A;  2LTU A;  3L1Y A;  3F92 A;  2R0I A;  2WZJ A;  2CP8 A;  1V92 A;  5D1K A;  1WZW A;  1A3S A;  3GLI E;  4ONN B;  1AIP C;  4NRG B;  2JZ0 A;  2UCZ A;  4NR3 A;  1M4Q A;  1ZUO A;  4MDK A;  1WHC A;  1P3Q Q;  1HT1 E;  1F4I A;  2OOB A;  2QHO B;  2OB4 A;  1U9A A;  2DMF A;  2JY5 A;  2DAG A;  2H2Y A;  4IP3 B;  1FZY A;  4BVU B;  1JAT A;  2GJD A;  2Y9M A;  1C7Y A;  4AP4 B;  2EBK A;  5D1L A;  5HPT C;  3LCU A;  4ONM A;  3FN1 B;  4P5O G;  1OAI A;  4A4C C;  2HWJ A;  3HCT B;  2GMI A;  3OBQ A;  2L4E A;  3OBU A;  4A49 B;  4DDI A;  3E95 C;  4II2 C;  4BWF A;  2Y9P A;  3R42 A;  1OQY A;  2ESO A;  2KHH A;  2DEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...