3K9OA

The crystal structure of e2-25k and ubb+1 complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
NIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 K
publication title Structural Basis of E2-25K/UBB+1 Interaction for Neurotoxicity of Alzheimer Disease by Proteasome Inhibition
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 68
structure length 198
sequence length 198
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3k9oA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 3k9oA01
1V92A 1WJ7A 2R0IA 2K0BX 1YLAA 2OOBA 2JY8A 1FZYA 1AYZA 1GO5A 4NR3B 2CLWA 2K07A 2HAKA 2JZ1A 2L4FA 1KPPA 4ONNA 1IFYA 4W5VA 2EKFA 4A4BC 3SY2C 3FSHA 1ZUOA 5DFLA 2UYZA 1R4GA 2Y9PA 3EB6B 3PTFA 3BBZA 4JUEA 1QZEA 4BWFA 1HJPA 1VEKA 2DAWA 1PZVA 2MR9A 2H2YA 2DAMA 1A5TA 2DAYA 3RCZB 3L1YA 4R62A 3TGDA 2OO9A 1CUKA 4II2C 1WZVA 3R3QA 3IHPA 4MDKA 4QPLB 2Y9MA 1U9AA 2UCZA 1J74A 4NRIB 1JATB 2JY7A 4YC1A 4GPRA 5D0MA 2AYVA 1TTEA 4HEOA 2JZ0A 2Z6OA 1KPSA 2MROB 2C2VC 2DAGA 3JVZA 5D0KA 1WGNA 2AAKA 4S3OA 2CYXA 1IXSA 2GMIA 1Q02A 2Z5DA 3OJ4A 3OBSA 2QHOB 2LVNC 1J7DA 3RPGA 1C4ZD 1VEGA 1F4IA 1A3SA 2KNVA 2JNHA 1DO2A 1P3QQ 2QGXA 3UGBA 1UKXA 3GLIE 4X57A 4CCGA 2BWEA 1HT1E 2ZTDA 4BVUB 2JY5A 2B3TA 2DKLA 1YH2A 5FERB 3KPAA 1OTRA 2ZTCA 3GLHE 1JBBA 2KJHA 1Y8XA 2LVAA 1UFZA 2F0RA 5EGGA 1VEJA 1UZXA 5F6UA 3VONC 1DV0A 2GROA 1T43A 2YB6A 2CP8A 4AP4B 1HQYE 4GEWA 3W31B 2CWBA 1W4UA 2Y4WA 3RZ3A 2EKEA 1IM2A 3OBQA 4DHZF 2BWBA 5AITD 3ZQSA 3A33A 1SG9A 1KYIA 2DNAA 4L83A 3T6PA 4DDGA 2PWQA 1I7KA 2ESOA 2GRQA 3FN1B 2L4EA 1M4QA 2AWFA 1PGYA 3MMPA 1OQYA 4NRGA 4Q5HC 2EBMA 4AUQA 4M1NA 3A4SA 1XB2B 2GMIB 1ZMWA 1WGLA 3F92A 2G3QA 2O25C 4IP3B 4ZNYA 2EKKA 2YHOB 1X23A 3HCTB 1EFUB 3K9PA 1J7DB 2DENA 3GLFE 3HCUB 5FQ2A 2DAKA 3WE5A 2BEPA 5F6VA 1YRVA 2EBKA 1WZWA 1BVSA 4F1IA 1OKSA 2Q0VA 4A4CC 1WR1B 1Q34A 1Z5SA 3LCVB 3P9GA 1U9BA 5D2MA 3SQVC 2HLWA 5D1LA 2JP7A 2ESKA 4LADA 1HT2E 5F6YA 3BZHA 4ONLB 1VQ1A 3OBXA 3JW0A 3L1ZA 5F6DA 4FH1A 1VG5A 2KNAA 2KLYA 3ZNIC 2YZ0A 4WP2A 3E95C 2DI0A 1Z3DA 2OB4A 2LVOC 1NV9A 5AIEB 3UIPA 2OOAA 4LDTC 2BF8A 4WZ3A 1T6OA 5D1KA 5F6XA 1AIPC 2LVQD 1QCQA 5JI2E 2EJSA 4NRGB 3FRHA 4F2LA 2DAEA 4R71A 2LBCA 2ONUA 4ONLA 5F6WA 3OBUA 2PX9B 1G4AE 1NV8A 4Y1LC 2LXPA 4P5OG 1MN3A 1WIVA 3E46A 2DAXA 2L2DA 2C2VB 5KNLC 1XXHE 4ONMA 2H5XA 2OXQA 3K9OA 1S1QA 3FRIA 2A7LA 2JY6B 1G41A 2DMFA 5HPTC 1Y6LA 4JQUA 5F6EA 2K9DA 1ZGUA 1FXTA 1TR8A 2O25A 3B89A 3ONGB 2DHYA 2GRRA 3LCUA 2E2CA 4A49B 4NR3A 5D1MA 4DHID 2GRNA 2DAIA 1M4PA 4YIIU 2VRRA 4EJEA 1YF9A 4G3OA 2WZJA 2FO3A 5AITB 3FE3A 5AIUB 4DS2A 2QSFX 2MJ5B 4DBGB 3GLGE 4V3KA 3H8KA 2GJDA 2XWUA 1E94E 2LTUA 1WHCA 4V3LA 2PE6A 2F4ZA 3VONB 2RRUA 2MGWA 1C7YA 3EVXA 3O2UA 3CEGA 2NVUC 3UIOA 1ZV1A 2FUHA 4TKPA 2YBFA 4NRIA 1JATA 1VDLA 4UN2B 3R42A 2KHHA 2GRPA 1JASA 3E95A 2CLWB 3UINA 4Q5EC 2HWJA 1ZDNA 3H4JA 2F4WA 2Z6PA 4DHJC 2ESPA 1KPQA 2A4DA 2MT6A 2QNJA 5JNEB 4ONMB 1G3IA 2JUJA 5IFRA 1Z2UA 2LVPC 4ONNB 3IECA 1JR3E 1ZMVA 1DO0A 4Q7JA 2EDIA 2KNZA 2DZLA 2ESQA 4DDIA 1FBVC 2C4PA 1ZMUA 3E21A 3P9HA 1OAIA 2R0JA 1Y8GA 4Y1LA
chains in the Genus database with same CATH superfamily
2CEAA 2K0BX 4MGKE 3TL4X 4IBJA 2K07A 2UU9M 4L8RC 2APLA 4ZPXA 2Y21A 4W5VA 2KW0A 4DV7M 5DFLA 1NY6A 2DZOB 2O01F 4M9XA 2CRUA 3KP1E 2R65A 1QAQA 3UJNA 3KOYE 2MR9A 3HU3A 3GRRA 2H2YA 2DAMA 3HJSA 4NC6A 3L1YA 1OAOC 4PCZA 3R3QA 5ITXA 4MH0E 2Y0QA 4IIWA 3B7QA 4JI2M 3HGIA 4NL4H 2Z6OA 1KPSA 4DR5M 2QCUA 3JAMS 3AJIB 5KO3A 3QYBA 2CHGA 4KODA 3LVVA 3JVZA 2AAKA 4GITA 1S3SA 4P16A 4S3OA 3L2AA 1GLNA 5ITTA 4I4LA 3LQQA 1GL7A 1Q02A 3V76A 3OBSA 1J7DA 3RPGA 1C4ZD 1HNZM 1VEGA 1F4IA 3W0LB 2KNVA 4NRWA 3TWLA 3UGBA 1JR3A 3U6MA 3FUUA 1GABA 2C9OA 3CF6E 2BWEA 2ZTDA 2HHHM 2P5TA 5FERB 4GIPA 2DXIA 1R2ZA 4I5SA 3HKPA 4LRTA 1R7RA 3ZH9B 3VONC 3HU2A 1DV0A 4LF5M 3AV0A 4AP4B 1HQYE 3W31B 3SYLA 3J81S 4DR4M 2EKEA 3OBQA 3GLGB 2L7IA 4DV1M 3ZQSA 3A33A 1SG9A 2Q2EB 4GKKM 4L83A 4JI4M 2Y20A 3T6PA 4B3SM 2ESOA 1SXJB 5EXPA 3FN1B 1M4QA 2AWFA 2UXCM 4W5WA 1IXSB 1R6BX 4M1NA 4LZZA 1ZMWA 4B08A 3F92A 2G3QA 1X23A 3VKGA 3K9PA 4AG5A 2VDBB 1IN7A 1V34A 5FQ2A 3R8FA 5BPVA 1D0KA 1YRVA 2EBKA 2MH8A 2R4EA 3U5ZB 4F1IA 1OJLA 4Y28F 4A4CC 4S12A 3SHFA 1WR1B 4II7A 3GPPA 3AL0C 3LCVB 2F5OA 1N32M 1U9BA 5KPTA 5H37D 2QQ8A 2K6BA 2QBYB 3JW0A 1MJGM 3FUVA 4G4RA 4FH1A 1VG5A 4G4OA 1JB0F 3DZDA 4RF1A 2XSZD 2LVOC 2QP9X 2BF8A 2HCBA 2ZAOA 3GPXA 3GRVA 4F2LA 2DAEA 1SXJD 2ONUA 4IBCA 1L2CA 1WIVA 5EXXA 2H5XA 2OXQA 4DV4M 3K9OA 2X8AA 3FRIA 2JY6B 1G41A 1Y6LA 4JQUA 5F6EA 1ZGUA 3U6DA 1XMQM 4AKHA 4CGYB 3A42A 3LCUA 5C18A 4A49B 4YHHM 5D1MA 2UXDM 2M5ZA 2DAIA 5FTKA 1M4PA 4YIIU 1TH3A 3GLIB 4G3OA 1E32A 4M0DA 2HKJA 3FE3A 2D7HA 1TDZA 2VF7A 4LJ4A 3GLGE 2D7GA 1OIZA 5IREB 3H8KA 2XWUA 4NXNM 4DV5M 1E94E 1Z6TA 3JR4A 3U61B 3EVXA 3CEGA 2FOIC 2FNAA 5EP1A 4AZFA 3GLIA 4TKPA 4NRIA 3C3EA 3VK8A 2CLWB 1XC8A 3UINA 2Z6PA 2ESPA 2V6ZM 2QNJA 5JNEB 1XNRM 3GLHA 1XMOM 1JQJC 2EDIA 1OIPA 1DO0A 3U60A 4QNMA 2XFSA 4D81A 3U6CA 3C3DA 2XZUA 3FTFA 1FBVC 2C98A 3E21A 2XH9A 3P9HA 3KW6A 3B7NA 4DR1M 1QQWA 1Y8GA 1V92A 2V1CA 2R0IA 4OU7A 1YLAA 2OOBA 3W0FA 1FZYA 1D2NA 1AYZA 4NR3B 3IG8A 2CLWA 2Z4RA 4LJ9A 3D8BA 1IFYA 4FWDA 5ITUA 1J7KA 2UYZA 2Y9PA 4FCTA 2KZSA 2DAWA 3DOAA 1EIJA 4LF4M 4TUWA 4QNRA 2W82A 4LF7M 4XGIA 2OO9A 3B7ZA 3KDSE 5FTJA 1HNWM 4R7GA 4MDKA 2Y9MA 3GLFA 3KS8A 1J74A 4CIZA 4NXMM 5GKNA 2LHCA 2F5NA 5D0MA 2AYVA 1TTEA 3M7GA 3U6OA 2FS1A 4LGMA 2C2VC 4L15A 2BJWA 3NBXX 1NJFA 4JI5M 4X62M 1OFHA 1K3WA 4IBGA 1D0MA 1Z5BA 1W5TA 3PXGA 2BJVA 3A98B 3OJ4A 2QHOB 4M0WA 2LVNC 5EP3A 3CTWB 2WSFF 4MB7A 1DO2A 2I7PA 2UXBM 1HR0M 3GLIE 4CCGA 2YFQA 1HT1E 3BOSA 1NHGC 1Z5CA 2B3TA 3HJ8A 1RU3A 2R6FA 3THGA 3KPAA 2ZM6M 2LHGA 1KFVA 3GLHE 1Y8XA 2F0RA 1LTMA 3FD9A 1VEJA 1R5LA 1IN5A 4LJ8A 4MGHA 1TH4A 4BB9A 2CWBA 3PNYA 4JI7M 2C9CA 4DV3M 5AITD 3I51A 3ZC7B 1KYIA 4IBFA 4JI1M 2PWQA 3MK6A 2L4EA 4LF9M 2K47A 1PGYA 3MMPA 4MGYE 2RGHA 3TPZA 4Q5HC 2EBMA 4LF6M 1XB2B 5DYGA 2O25C 3K1JA 2XGNA 4IP3B 3KS4A 2KRKA 2LH0A 1EFUB 1J7DB 4I8OA 1J5EM 2DENA 3L28A 2H1RA 2Y0TA 5EJCA 2LNHC 3VKHA 3GLFE 2EA0A 3VDUA 5F6VA 4DR3M 3J80S 4B3MM 4FD2A 2DVWB 4B7FA 1PJIA 4JV5M 3P9GA 5ITQA 1TGUA 2ESKA 4LADA 4BBAA 4LF8M 3DFZA 4ONLB 1VQ1A 3OBXA 5C1BA 5EQTA 2KLYA 3KOZE 3TWKA 3NWLA 2YZ0A 4B3RM 1PRBA 4WP2A 1NV9A 5AIEB 4DV6M 2M60A 4K0KM 2VIIA 1G71A 1QVRA 2FH0A 4LDTC 4MGIE 1AIPC 2C5RA 2L6OA 3WHLA 4PD2A 4IBIA 5IWAM 3FRHA 4R71A 2LXEA 2LBCA 4BLCA 1LV7A 4ONLA 1VDDA 1G4AE 3KVWA 2LXPA 3L26A 1NO1A 1Z59A 2J5YA 3L29A 2L2DA 3JR5A 5KNLC 3U6SA 4IBKA 4ONMA 2RKOA 4L4UA 4AW4A 1QAMA 3SATA 2A7LA 2ZANA 3CF0A 3J27B 5IZ7D 5HPTC 1JR3D 5ITYA 4KT0F 3W67A 2O25A 3ONGB 2D7EA 3SMSA 5EP2A 2GRRA 4AQYM 1QUSA 3FUTA 5E6JA 2XZFA 5ITXE 2GRNA 3VDPA 3HJQA 2VRRA 4EJEA 3Q8XA 5DNYA 1HQCA 2BNKA 1YF9A 4L78A 3HHYA 3M6AA 3D8LA 2HL7A 3KOWE 2UUBM 3AOEC 3U6QA 2QSFX 2CFOA 1IN4A 1YSYA 5FLXS 2GJDA 5FSWA 2QPAA 2LTUA 2AHMA 4V3LA 3VONB 2MGWA 2X49A 3GP1A 3UIOA 3W68A 1X37A 1ZV1A 1IY1A 3HY5A 4GHAA 2FUHA 3AFHA 1JATA 3FTEA 4M9ZA 1VDLA 4UN2B 3R42A 2KHHA 2GRPA 1GKIA 3HU1A 4LY6A 4NSOB 3RGSA 3H4JA 2F4WA 4NSRA 4DHJC 2MT6A 1G3IA 1Z2UA 4PT5A 3IECA 4LRSA 1JR3E 1G8PA 4Q7JA 4X65M 3UGJA 1XWIA 4L6V6 4GKJM 5KPZA 3QWLA 2CV1A 2R0JA 5ITRA 5A2QS 2EUCA 1GO5A 3J7BA 2ERCA 2Z7JA 1TDHA 2HAKA 2JZ1A 1XXHA 4LJ6A 2LWXA 3T15A 5IT9S 1KPPA 3SY2C 4LFBM 1KSFX 2XLJA 1ZUOA 4B7HA 3EB6B 1IBMM 3PTFA 3BBZA 4RNAA 4DR6M 2DWNA 4BWFA 1HJPA 1IN6A 2J7NA 2KZUA 3SYKA 2XEPA 4AG6A 1DGGA 3IG5A 3HZJA 1WZVA 1UM8A 3SASA 3FKEA 5L8RF 1U9AA 3KSXA 2KEBA 4NRIB 1QDTA 3AOEA 3AKZA 1L8QA 3M0EA 3A45A 4FCVA 2JZ0A 3GLHB 5D0KA 1WGNA 3U60B 4DV2M 2VQFM 4CJ6A 3SAWA 1GVNA 3RE8A 2GMIA 2R18A 4JI6M 4IJFA 1IBKM 2JXNA 4DUYM 4DV0M 1I94M 2NQ8C 4OVZA 2JNHA 1P3QQ 4DUZM 5FTNA 2QGXA 4LG2A 4YY3M 4BVUB 3KOXE 3QAUA 1GJSA 2CHVA 3GQ5A 2ZAMA 5E26A 2KJHA 2EO2A 2YR0A 3GQ4A 1UFZA 1Q39A 5EGGA 1IXRC 3GLFB 2DWMA 4Z8XA 2GQFA 4GEWA 2UUCM 1W4UA 2Y4WA 4PDIA 3RZ3A 2XFTA 4FCWA 1IM2A 4DHZF 2KRUA 2DZNB 2BWBA 3ZQJA 3MJ5A 4G4QA 1K3XA 1DGHB 1G59A 1PM5A 4DDGA 1I7KA 2GRQA 5DYIA 1Q3CA 2Z4SA 4NRGA 2R45A 2FFJA 4AUQA 1PJJA 4IJEA 2OQ4A 3FUXA 4DR7M 1DGBA 2EKKA 3A46A 3TWMA 4GMQA 1N33M 1D0LA 4P17A 2KA6B 5KQ8A 1DGHA 3K2LA 4GHLA 1IBLM 2DAKA 3WE5A 4D82A 1WZWA 1OKSA 3T1YM 3SMPA 1NVMA 2Q0VA 3HHXA 1Z5SA 3U6LA 2F5QA 5D2MA 2HLWA 1FNNA 1XNQM 4GC5A 1QYRA 3EIHA 4LGYA 1GL6A 1OFIA 2YQZA 5F3WA 3L1ZA 3ILKA 3KP0E 4AKIA 4LJ5A 1MX0A 2KNAA 4B3TM 4I81A 3E95C 2DI0A 2OB4A 4FW9A 4KO8A 2OOAA 1TH2A 4QHSA 4WZ3A 5D1KA 5F6XA 4GRIA 2EJSA 4QOSA 1E9SA 1N77A 5FTMA 5F6WA 4FWHA 4OX9M 2PX9B 2C2VB 2R46A 1S1QA 4LFCM 1Z5AA 2K9DA 2L7HA 4MGZE 1FXTA 3B89A 2DHYA 4AKGA 1ZQ9A 2WSEF 3BXWA 3SFZA 4XK8F 3FYCA 3RFWA 5EXSA 2N35A 1QUTA 5EP4A 2WZJA 1DGFA 2R62A 2R44A 3KFUG 4DS2A 1T3TA 3FTDA 2MJ5B 4DBGB 2G8LA 1WHCA 2F4ZA 1J09A 3O2UA 2NVUC 4IBEA 1SXJC 1Q3BA 3HHWA 4ANRA 2YBFA 3SARA 2Z3XA 1JASA 1NNUC 4WW0A 3MHVC 3E95A 4Q5EC 2XF3A 2HWJA 5FTLA 2L09A 3T38A 1KPQA 1XHBA 4ONMB 1NHWC 2Z8YM 3I4VA 1ZAEA 3LQRA 4ONNB 3GQ3A 2CUZA 3PVSA 2GNOA 1ZMVA 2KNZA 3SAVA 2DZLA 3SBJA 4D80A 4DDIA 2C4PA 1ZMUA 1L1ZA 4AI6A 1OAIA 1L2DA 1WJ7A 2JY8A 4LJAA 5EXTA 2L4FA 3QYEA 3R9XB 2A5YB 3I01M 4ONNA 2EKFA 4A4BC 3FSHA 1V33A 1R4GA 3TE6A 7CATA 4JUEA 3SAUA 1QZEA 4OW0A 1VEKA 1PZVA 1WXQA 3C9PA 1A5TA 2DAYA 3GPYA 4Z6YA 3RCZB 4R3DA 4R62A 3FYDA 3TGDA 1CUKA 4II2C 4LJ7A 3I04M 3IHPA 4QPLB 5LMUM 2UCZA 3ZCBB 3GRYA 1QDRA 1JATB 2JY7A 2XSZA 3C58A 4YC1A 4GPRA 3LVWA 3GLGA 5LMNM 4HEOA 4JYAM 5KQDA 2MROB 3WHKA 2DAGA 3CGWA 4XBOA 1SXJA 2JA2A 1QZMA 2CYXA 1IXSA 5KPRA 2CE7A 2WSCF 2Z5DA 2F4VM 2F5PA 3UK6A 2V1UA 1XXHB 3UMMA 1A3SA 1QAOA 3U6PA 3GPUA 4JI0M 1UKXA 4X57A 1C1KA 3U5ZA 3SHGB 2JY5A 3TQSA 2DKLA 3HWSA 1YH2A 4KLNA 2G5GX 2KDLA 1OTRA 3FUWA 4M9SA 3VLFB 2ZTCA 1JBBA 4ITQA 2LVAA 4LFAM 1MU5A 3SC3A 1UZXA 1ORYB 5F6UA 4B7GA 2GROA 1T43A 3OTOM 4CHTB 2YB6A 4NRVA 2QBYA 2CP8A 2JWSA 1K82A 3K92A 1AUAA 3HHZA 2FE8A 4X64M 1PJQA 2CHQA 2QZ4A 2DNAA 1N34M 1E9RA 3H4MA 1EE8A 4REZA 1OQYA 3RGPA 2O5RA 3A4SA 2GMIB 1L1TA 4QOZC 4HLQA 1WGLA 1IXZA 1NY5A 4ZNYA 3HX3A 2CV2A 2YHOB 4GC9A 3HCTB 4QHTA 4RF0A 4OVZB 3HCUB 4MM3B 2BEPA 1YE9A 1BVSA 1NSFA 1HNXM 3E9SA 4WURA 4FWGA 3U6EA 1Q34A 3NBIA 3PFIA 4JI3M 1NNJA 1SXJE 3SQVC 3GO8A 4JI8M 5D1LA 2JP7A 4PDGA 4HL4A 1HT2E 5F6YA 3BZHA 4G4NA 2DWLA 4EIWA 5F6DA 3ZNIC 3Q8GA 1Z3DA 2C96A 5JI3E 1YUBA 3GRUA 2C99A 3UIPA 1W5SA 1T6OA 3U61A 4RKUF 2LVQD 4FVMA 1QCQA 2UUAM 5JI2E 4NRGB 3K8ZA 1QANA 2KXEA 4DR2M 1TF0B 2CV0A 3OBUA 1NV8A 3L27A 4Y1LC 4P5OG 1MN3A 2VQEM 3E46A 2DAXA 3AOGA 1XXHE 3T1HM 4CISA 3I4YA 1IY2A 4IBDA 3J2PB 1N75A 2VF8A 1L2BA 1I4WA 2DMFA 2DHRA 1IN8A 3KSJA 3PNVA 1TR8A 1IY0A 2J7OA 2E2CA 4NOOB 5BR8M 2RGOA 4G6ZA 4NR3A 3LW5F 4DHID 3B9PA 3VFDA 2X4AA 2I7NA 1PJSA 2FO3A 3LMMA 3J7AS 5AITB 4LCBA 3UZUA 3L25A 1NJGA 5AIUB 3DA1A 4V3KA 1R2YA 3B74A 3E4RA 3CF2A 3KXEC 2E5LM 2PE6A 2RRUA 1FJGM 1H6UA 1C7YA 1IQPA 4A3VB 3EIEA 1PJTA 2DWZB 2ZBKB 4JXJA 4LZJA 2QENA 2F5SA 2R4JA 1ZDNA 2A4DA 2OPFA 4JN6A 1N78A 2JUJA 5IFRA 4IBBA 4L16A 2LVPC 4GH9A 8CATA 4X66M 3VK7A 2YNMD 3FTCA 2ESQA 1GJTA 1N36M 4KHPM 4Y1LA
chains in the Genus database with same CATH topology
1V92A 1WJ7A 2R0IA 2K0BX 1YLAA 2OOBA 2JY8A 1FZYA 1AYZA 1GO5A 4NR3B 2CLWA 2K07A 2HAKA 2JZ1A 2L4FA 1KPPA 4ONNA 1IFYA 4W5VA 2EKFA 4A4BC 3SY2C 3FSHA 1ZUOA 5DFLA 2UYZA 1R4GA 2Y9PA 3EB6B 3PTFA 3BBZA 4JUEA 1QZEA 4BWFA 1HJPA 1VEKA 2DAWA 1PZVA 2MR9A 2H2YA 2DAMA 1A5TA 2DAYA 3RCZB 3L1YA 4R62A 3TGDA 2OO9A 1CUKA 4II2C 1WZVA 3R3QA 3IHPA 4MDKA 4QPLB 2Y9MA 1U9AA 2UCZA 1J74A 4NRIB 1JATB 2JY7A 4YC1A 4GPRA 5D0MA 2AYVA 1TTEA 4HEOA 2JZ0A 2Z6OA 1KPSA 2MROB 2C2VC 2DAGA 3JVZA 5D0KA 1WGNA 2AAKA 4S3OA 2CYXA 1IXSA 2GMIA 1Q02A 2Z5DA 3OJ4A 3OBSA 2QHOB 2LVNC 1J7DA 3RPGA 1C4ZD 1VEGA 1F4IA 1A3SA 2KNVA 2JNHA 1DO2A 1P3QQ 2QGXA 3UGBA 1UKXA 3GLIE 4X57A 4CCGA 2BWEA 1HT1E 2ZTDA 4BVUB 2JY5A 2B3TA 2DKLA 1YH2A 5FERB 3KPAA 1OTRA 2ZTCA 3GLHE 1JBBA 2KJHA 1Y8XA 2LVAA 1UFZA 2F0RA 5EGGA 1VEJA 1UZXA 5F6UA 3VONC 1DV0A 2GROA 1T43A 2YB6A 2CP8A 4AP4B 1HQYE 4GEWA 3W31B 2CWBA 1W4UA 2Y4WA 3RZ3A 2EKEA 1IM2A 3OBQA 4DHZF 2BWBA 5AITD 3ZQSA 3A33A 1SG9A 1KYIA 2DNAA 4L83A 3T6PA 4DDGA 2PWQA 1I7KA 2ESOA 2GRQA 3FN1B 2L4EA 1M4QA 2AWFA 1PGYA 3MMPA 1OQYA 4NRGA 4Q5HC 2EBMA 4AUQA 4M1NA 3A4SA 1XB2B 2GMIB 1ZMWA 1WGLA 3F92A 2G3QA 2O25C 4IP3B 4ZNYA 2EKKA 2YHOB 1X23A 3HCTB 1EFUB 3K9PA 1J7DB 2DENA 3GLFE 3HCUB 5FQ2A 2DAKA 3WE5A 2BEPA 5F6VA 1YRVA 2EBKA 1WZWA 1BVSA 4F1IA 1OKSA 2Q0VA 4A4CC 1WR1B 1Q34A 1Z5SA 3LCVB 3P9GA 1U9BA 5D2MA 3SQVC 2HLWA 5D1LA 2JP7A 2ESKA 4LADA 1HT2E 5F6YA 3BZHA 4ONLB 1VQ1A 3OBXA 3JW0A 3L1ZA 5F6DA 4FH1A 1VG5A 2KNAA 2KLYA 3ZNIC 2YZ0A 4WP2A 3E95C 2DI0A 1Z3DA 2OB4A 2LVOC 1NV9A 5AIEB 3UIPA 2OOAA 4LDTC 2BF8A 4WZ3A 1T6OA 5D1KA 5F6XA 1AIPC 2LVQD 1QCQA 5JI2E 2EJSA 4NRGB 3FRHA 4F2LA 2DAEA 4R71A 2LBCA 2ONUA 4ONLA 5F6WA 3OBUA 2PX9B 1G4AE 1NV8A 4Y1LC 2LXPA 4P5OG 1MN3A 1WIVA 3E46A 2DAXA 2L2DA 2C2VB 5KNLC 1XXHE 4ONMA 2H5XA 2OXQA 3K9OA 1S1QA 3FRIA 2A7LA 2JY6B 1G41A 2DMFA 5HPTC 1Y6LA 4JQUA 5F6EA 2K9DA 1ZGUA 1FXTA 1TR8A 2O25A 3B89A 3ONGB 2DHYA 2GRRA 3LCUA 2E2CA 4A49B 4NR3A 5D1MA 4DHID 2GRNA 2DAIA 1M4PA 4YIIU 2VRRA 4EJEA 1YF9A 4G3OA 2WZJA 2FO3A 5AITB 3FE3A 5AIUB 4DS2A 2QSFX 2MJ5B 4DBGB 3GLGE 4V3KA 3H8KA 2GJDA 2XWUA 1E94E 2LTUA 1WHCA 4V3LA 2PE6A 2F4ZA 3VONB 2RRUA 2MGWA 1C7YA 3EVXA 3O2UA 3CEGA 2NVUC 3UIOA 1ZV1A 2FUHA 4TKPA 2YBFA 4NRIA 1JATA 1VDLA 4UN2B 3R42A 2KHHA 2GRPA 1JASA 3E95A 2CLWB 3UINA 4Q5EC 2HWJA 1ZDNA 3H4JA 2F4WA 2Z6PA 4DHJC 2ESPA 1KPQA 2A4DA 2MT6A 2QNJA 5JNEB 4ONMB 1G3IA 2JUJA 5IFRA 1Z2UA 2LVPC 4ONNB 3IECA 1JR3E 1ZMVA 1DO0A 4Q7JA 2EDIA 2KNZA 2DZLA 2ESQA 4DDIA 1FBVC 2C4PA 1ZMUA 3E21A 3P9HA 1OAIA 2R0JA 1Y8GA 4Y1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V92 A;  1WJ7 A;  2R0I A;  2K0B X;  1YLA A;  2OOB A;  2JY8 A;  1FZY A;  1AYZ A;  1GO5 A;  4NR3 B;  2CLW A;  2K07 A;  2HAK A;  2JZ1 A;  2L4F A;  1KPP A;  4ONN A;  1IFY A;  4W5V A;  2EKF A;  4A4B C;  3SY2 C;  3FSH A;  1ZUO A;  5DFL A;  2UYZ A;  1R4G A;  2Y9P A;  3EB6 B;  3PTF A;  3BBZ A;  4JUE A;  1QZE A;  4BWF A;  1HJP A;  1VEK A;  2DAW A;  1PZV A;  2MR9 A;  2H2Y A;  2DAM A;  1A5T A;  2DAY A;  3RCZ B;  3L1Y A;  4R62 A;  3TGD A;  2OO9 A;  1CUK A;  4II2 C;  1WZV A;  3R3Q A;  3IHP A;  4MDK A;  4QPL B;  2Y9M A;  1U9A A;  2UCZ A;  1J74 A;  4NRI B;  1JAT B;  2JY7 A;  4YC1 A;  4GPR A;  5D0M A;  2AYV A;  1TTE A;  4HEO A;  2JZ0 A;  2Z6O A;  1KPS A;  2MRO B;  2C2V C;  2DAG A;  3JVZ A;  5D0K A;  1WGN A;  2AAK A;  4S3O A;  2CYX A;  1IXS A;  2GMI A;  1Q02 A;  2Z5D A;  3OJ4 A;  3OBS A;  2QHO B;  2LVN C;  1J7D A;  3RPG A;  1C4Z D;  1VEG A;  1F4I A;  1A3S A;  2KNV A;  2JNH A;  1DO2 A;  1P3Q Q;  2QGX A;  3UGB A;  1UKX A;  3GLI E;  4X57 A;  4CCG A;  2BWE A;  1HT1 E;  2ZTD A;  4BVU B;  2JY5 A;  2B3T A;  2DKL A;  1YH2 A;  5FER B;  3KPA A;  1OTR A;  2ZTC A;  3GLH E;  1JBB A;  2KJH A;  1Y8X A;  2LVA A;  1UFZ A;  2F0R A;  5EGG A;  1VEJ A;  1UZX A;  5F6U A;  3VON C;  1DV0 A;  2GRO A;  1T43 A;  2YB6 A;  2CP8 A;  4AP4 B;  1HQY E;  4GEW A;  3W31 B;  2CWB A;  1W4U A;  2Y4W A;  3RZ3 A;  2EKE A;  1IM2 A;  3OBQ A;  4DHZ F;  2BWB A;  5AIT D;  3ZQS A;  3A33 A;  1SG9 A;  1KYI A;  2DNA A;  4L83 A;  3T6P A;  4DDG A;  2PWQ A;  1I7K A;  2ESO A;  2GRQ A;  3FN1 B;  2L4E A;  1M4Q A;  2AWF A;  1PGY A;  3MMP A;  1OQY A;  4NRG A;  4Q5H C;  2EBM A;  4AUQ A;  4M1N A;  3A4S A;  1XB2 B;  2GMI B;  1ZMW A;  1WGL A;  3F92 A;  2G3Q A;  2O25 C;  4IP3 B;  4ZNY A;  2EKK A;  2YHO B;  1X23 A;  3HCT B;  1EFU B;  3K9P A;  1J7D B;  2DEN A;  3GLF E;  3HCU B;  5FQ2 A;  2DAK A;  3WE5 A;  2BEP A;  5F6V A;  1YRV A;  2EBK A;  1WZW A;  1BVS A;  4F1I A;  1OKS A;  2Q0V A;  4A4C C;  1WR1 B;  1Q34 A;  1Z5S A;  3LCV B;  3P9G A;  1U9B A;  5D2M A;  3SQV C;  2HLW A;  5D1L A;  2JP7 A;  2ESK A;  4LAD A;  1HT2 E;  5F6Y A;  3BZH A;  4ONL B;  1VQ1 A;  3OBX A;  3JW0 A;  3L1Z A;  5F6D A;  4FH1 A;  1VG5 A;  2KNA A;  2KLY A;  3ZNI C;  2YZ0 A;  4WP2 A;  3E95 C;  2DI0 A;  1Z3D A;  2OB4 A;  2LVO C;  1NV9 A;  5AIE B;  3UIP A;  2OOA A;  4LDT C;  2BF8 A;  4WZ3 A;  1T6O A;  5D1K A;  5F6X A;  1AIP C;  2LVQ D;  1QCQ A;  5JI2 E;  2EJS A;  4NRG B;  3FRH A;  4F2L A;  2DAE A;  4R71 A;  2LBC A;  2ONU A;  4ONL A;  5F6W A;  3OBU A;  2PX9 B;  1G4A E;  1NV8 A;  4Y1L C;  2LXP A;  4P5O G;  1MN3 A;  1WIV A;  3E46 A;  2DAX A;  2L2D A;  2C2V B;  5KNL C;  1XXH E;  4ONM A;  2H5X A;  2OXQ A;  3K9O A;  1S1Q A;  3FRI A;  2A7L A;  2JY6 B;  1G41 A;  2DMF A;  5HPT C;  1Y6L A;  4JQU A;  5F6E A;  2K9D A;  1ZGU A;  1FXT A;  1TR8 A;  2O25 A;  3B89 A;  3ONG B;  2DHY A;  2GRR A;  3LCU A;  2E2C A;  4A49 B;  4NR3 A;  5D1M A;  4DHI D;  2GRN A;  2DAI A;  1M4P A;  4YII U;  2VRR A;  4EJE A;  1YF9 A;  4G3O A;  2WZJ A;  2FO3 A;  5AIT B;  3FE3 A;  5AIU B;  4DS2 A;  2QSF X;  2MJ5 B;  4DBG B;  3GLG E;  4V3K A;  3H8K A;  2GJD A;  2XWU A;  1E94 E;  2LTU A;  1WHC A;  4V3L A;  2PE6 A;  2F4Z A;  3VON B;  2RRU A;  2MGW A;  1C7Y A;  3EVX A;  3O2U A;  3CEG A;  2NVU C;  3UIO A;  1ZV1 A;  2FUH A;  4TKP A;  2YBF A;  4NRI A;  1JAT A;  1VDL A;  4UN2 B;  3R42 A;  2KHH A;  2GRP A;  1JAS A;  3E95 A;  2CLW B;  3UIN A;  4Q5E C;  2HWJ A;  1ZDN A;  3H4J A;  2F4W A;  2Z6P A;  4DHJ C;  2ESP A;  1KPQ A;  2A4D A;  2MT6 A;  2QNJ A;  5JNE B;  4ONM B;  1G3I A;  2JUJ A;  5IFR A;  1Z2U A;  2LVP C;  4ONN B;  3IEC A;  1JR3 E;  1ZMV A;  1DO0 A;  4Q7J A;  2EDI A;  2KNZ A;  2DZL A;  2ESQ A;  4DDI A;  1FBV C;  2C4P A;  1ZMU A;  3E21 A;  3P9H A;  1OAI A;  2R0J A;  1Y8G A;  4Y1L A; 
#chains in the Genus database with same CATH topology
 2CEA A;  2K0B X;  4MGK E;  3TL4 X;  4IBJ A;  2K07 A;  2UU9 M;  4L8R C;  2APL A;  4ZPX A;  2Y21 A;  4W5V A;  2KW0 A;  4DV7 M;  5DFL A;  1NY6 A;  2DZO B;  2O01 F;  4M9X A;  2CRU A;  3KP1 E;  2R65 A;  1QAQ A;  3UJN A;  3KOY E;  2MR9 A;  3HU3 A;  3GRR A;  2H2Y A;  2DAM A;  3HJS A;  4NC6 A;  3L1Y A;  1OAO C;  4PCZ A;  3R3Q A;  5ITX A;  4MH0 E;  2Y0Q A;  4IIW A;  3B7Q A;  4JI2 M;  3HGI A;  4NL4 H;  2Z6O A;  1KPS A;  4DR5 M;  2QCU A;  3JAM S;  3AJI B;  5KO3 A;  3QYB A;  2CHG A;  4KOD A;  3LVV A;  3JVZ A;  2AAK A;  4GIT A;  1S3S A;  4P16 A;  4S3O A;  3L2A A;  1GLN A;  5ITT A;  4I4L A;  3LQQ A;  1GL7 A;  1Q02 A;  3V76 A;  3OBS A;  1J7D A;  3RPG A;  1C4Z D;  1HNZ M;  1VEG A;  1F4I A;  3W0L B;  2KNV A;  4NRW A;  3TWL A;  3UGB A;  1JR3 A;  3U6M A;  3FUU A;  1GAB A;  2C9O A;  3CF6 E;  2BWE A;  2ZTD A;  2HHH M;  2P5T A;  5FER B;  4GIP A;  2DXI A;  1R2Z A;  4I5S A;  3HKP A;  4LRT A;  1R7R A;  3ZH9 B;  3VON C;  3HU2 A;  1DV0 A;  4LF5 M;  3AV0 A;  4AP4 B;  1HQY E;  3W31 B;  3SYL A;  3J81 S;  4DR4 M;  2EKE A;  3OBQ A;  3GLG B;  2L7I A;  4DV1 M;  3ZQS A;  3A33 A;  1SG9 A;  2Q2E B;  4GKK M;  4L83 A;  4JI4 M;  2Y20 A;  3T6P A;  4B3S M;  2ESO A;  1SXJ B;  5EXP A;  3FN1 B;  1M4Q A;  2AWF A;  2UXC M;  4W5W A;  1IXS B;  1R6B X;  4M1N A;  4LZZ A;  1ZMW A;  4B08 A;  3F92 A;  2G3Q A;  1X23 A;  3VKG A;  3K9P A;  4AG5 A;  2VDB B;  1IN7 A;  1V34 A;  5FQ2 A;  3R8F A;  5BPV A;  1D0K A;  1YRV A;  2EBK A;  2MH8 A;  2R4E A;  3U5Z B;  4F1I A;  1OJL A;  4Y28 F;  4A4C C;  4S12 A;  3SHF A;  1WR1 B;  4II7 A;  3GPP A;  3AL0 C;  3LCV B;  2F5O A;  1N32 M;  1U9B A;  5KPT A;  5H37 D;  2QQ8 A;  2K6B A;  2QBY B;  3JW0 A;  1MJG M;  3FUV A;  4G4R A;  4FH1 A;  1VG5 A;  4G4O A;  1JB0 F;  3DZD A;  4RF1 A;  2XSZ D;  2LVO C;  2QP9 X;  2BF8 A;  2HCB A;  2ZAO A;  3GPX A;  3GRV A;  4F2L A;  2DAE A;  1SXJ D;  2ONU A;  4IBC A;  1L2C A;  1WIV A;  5EXX A;  2H5X A;  2OXQ A;  4DV4 M;  3K9O A;  2X8A A;  3FRI A;  2JY6 B;  1G41 A;  1Y6L A;  4JQU A;  5F6E A;  1ZGU A;  3U6D A;  1XMQ M;  4AKH A;  4CGY B;  3A42 A;  3LCU A;  5C18 A;  4A49 B;  4YHH M;  5D1M A;  2UXD M;  2M5Z A;  2DAI A;  5FTK A;  1M4P A;  4YII U;  1TH3 A;  3GLI B;  4G3O A;  1E32 A;  4M0D A;  2HKJ A;  3FE3 A;  2D7H A;  1TDZ A;  2VF7 A;  4LJ4 A;  3GLG E;  2D7G A;  1OIZ A;  5IRE B;  3H8K A;  2XWU A;  4NXN M;  4DV5 M;  1E94 E;  1Z6T A;  3JR4 A;  3U61 B;  3EVX A;  3CEG A;  2FOI C;  2FNA A;  5EP1 A;  4AZF A;  3GLI A;  4TKP A;  4NRI A;  3C3E A;  3VK8 A;  2CLW B;  1XC8 A;  3UIN A;  2Z6P A;  2ESP A;  2V6Z M;  2QNJ A;  5JNE B;  1XNR M;  3GLH A;  1XMO M;  1JQJ C;  2EDI A;  1OIP A;  1DO0 A;  3U60 A;  4QNM A;  2XFS A;  4D81 A;  3U6C A;  3C3D A;  2XZU A;  3FTF A;  1FBV C;  2C98 A;  3E21 A;  2XH9 A;  3P9H A;  3KW6 A;  3B7N A;  4DR1 M;  1QQW A;  1Y8G A;  1V92 A;  2V1C A;  2R0I A;  4OU7 A;  1YLA A;  2OOB A;  3W0F A;  1FZY A;  1D2N A;  1AYZ A;  4NR3 B;  3IG8 A;  2CLW A;  2Z4R A;  4LJ9 A;  3D8B A;  1IFY A;  4FWD A;  5ITU A;  1J7K A;  2UYZ A;  2Y9P A;  4FCT A;  2KZS A;  2DAW A;  3DOA A;  1EIJ A;  4LF4 M;  4TUW A;  4QNR A;  2W82 A;  4LF7 M;  4XGI A;  2OO9 A;  3B7Z A;  3KDS E;  5FTJ A;  1HNW M;  4R7G A;  4MDK A;  2Y9M A;  3GLF A;  3KS8 A;  1J74 A;  4CIZ A;  4NXM M;  5GKN A;  2LHC A;  2F5N A;  5D0M A;  2AYV A;  1TTE A;  3M7G A;  3U6O A;  2FS1 A;  4LGM A;  2C2V C;  4L15 A;  2BJW A;  3NBX X;  1NJF A;  4JI5 M;  4X62 M;  1OFH A;  1K3W A;  4IBG A;  1D0M A;  1Z5B A;  1W5T A;  3PXG A;  2BJV A;  3A98 B;  3OJ4 A;  2QHO B;  4M0W A;  2LVN C;  5EP3 A;  3CTW B;  2WSF F;  4MB7 A;  1DO2 A;  2I7P A;  2UXB M;  1HR0 M;  3GLI E;  4CCG A;  2YFQ A;  1HT1 E;  3BOS A;  1NHG C;  1Z5C A;  2B3T A;  3HJ8 A;  1RU3 A;  2R6F A;  3THG A;  3KPA A;  2ZM6 M;  2LHG A;  1KFV A;  3GLH E;  1Y8X A;  2F0R A;  1LTM A;  3FD9 A;  1VEJ A;  1R5L A;  1IN5 A;  4LJ8 A;  4MGH A;  1TH4 A;  4BB9 A;  2CWB A;  3PNY A;  4JI7 M;  2C9C A;  4DV3 M;  5AIT D;  3I51 A;  3ZC7 B;  1KYI A;  4IBF A;  4JI1 M;  2PWQ A;  3MK6 A;  2L4E A;  4LF9 M;  2K47 A;  1PGY A;  3MMP A;  4MGY E;  2RGH A;  3TPZ A;  4Q5H C;  2EBM A;  4LF6 M;  1XB2 B;  5DYG A;  2O25 C;  3K1J A;  2XGN A;  4IP3 B;  3KS4 A;  2KRK A;  2LH0 A;  1EFU B;  1J7D B;  4I8O A;  1J5E M;  2DEN A;  3L28 A;  2H1R A;  2Y0T A;  5EJC A;  2LNH C;  3VKH A;  3GLF E;  2EA0 A;  3VDU A;  5F6V A;  4DR3 M;  3J80 S;  4B3M M;  4FD2 A;  2DVW B;  4B7F A;  1PJI A;  4JV5 M;  3P9G A;  5ITQ A;  1TGU A;  2ESK A;  4LAD A;  4BBA A;  4LF8 M;  3DFZ A;  4ONL B;  1VQ1 A;  3OBX A;  5C1B A;  5EQT A;  2KLY A;  3KOZ E;  3TWK A;  3NWL A;  2YZ0 A;  4B3R M;  1PRB A;  4WP2 A;  1NV9 A;  5AIE B;  4DV6 M;  2M60 A;  4K0K M;  2VII A;  1G71 A;  1QVR A;  2FH0 A;  4LDT C;  4MGI E;  1AIP C;  2C5R A;  2L6O A;  3WHL A;  4PD2 A;  4IBI A;  5IWA M;  3FRH A;  4R71 A;  2LXE A;  2LBC A;  4BLC A;  1LV7 A;  4ONL A;  1VDD A;  1G4A E;  3KVW A;  2LXP A;  3L26 A;  1NO1 A;  1Z59 A;  2J5Y A;  3L29 A;  2L2D A;  3JR5 A;  5KNL C;  3U6S A;  4IBK A;  4ONM A;  2RKO A;  4L4U A;  4AW4 A;  1QAM A;  3SAT A;  2A7L A;  2ZAN A;  3CF0 A;  3J27 B;  5IZ7 D;  5HPT C;  1JR3 D;  5ITY A;  4KT0 F;  3W67 A;  2O25 A;  3ONG B;  2D7E A;  3SMS A;  5EP2 A;  2GRR A;  4AQY M;  1QUS A;  3FUT A;  5E6J A;  2XZF A;  5ITX E;  2GRN A;  3VDP A;  3HJQ A;  2VRR A;  4EJE A;  3Q8X A;  5DNY A;  1HQC A;  2BNK A;  1YF9 A;  4L78 A;  3HHY A;  3M6A A;  3D8L A;  2HL7 A;  3KOW E;  2UUB M;  3AOE C;  3U6Q A;  2QSF X;  2CFO A;  1IN4 A;  1YSY A;  5FLX S;  2GJD A;  5FSW A;  2QPA A;  2LTU A;  2AHM A;  4V3L A;  3VON B;  2MGW A;  2X49 A;  3GP1 A;  3UIO A;  3W68 A;  1X37 A;  1ZV1 A;  1IY1 A;  3HY5 A;  4GHA A;  2FUH A;  3AFH A;  1JAT A;  3FTE A;  4M9Z A;  1VDL A;  4UN2 B;  3R42 A;  2KHH A;  2GRP A;  1GKI A;  3HU1 A;  4LY6 A;  4NSO B;  3RGS A;  3H4J A;  2F4W A;  4NSR A;  4DHJ C;  2MT6 A;  1G3I A;  1Z2U A;  4PT5 A;  3IEC A;  4LRS A;  1JR3 E;  1G8P A;  4Q7J A;  4X65 M;  3UGJ A;  1XWI A;  4L6V 6;  4GKJ M;  5KPZ A;  3QWL A;  2CV1 A;  2R0J A;  5ITR A;  5A2Q S;  2EUC A;  1GO5 A;  3J7B A;  2ERC A;  2Z7J A;  1TDH A;  2HAK A;  2JZ1 A;  1XXH A;  4LJ6 A;  2LWX A;  3T15 A;  5IT9 S;  1KPP A;  3SY2 C;  4LFB M;  1KSF X;  2XLJ A;  1ZUO A;  4B7H A;  3EB6 B;  1IBM M;  3PTF A;  3BBZ A;  4RNA A;  4DR6 M;  2DWN A;  4BWF A;  1HJP A;  1IN6 A;  2J7N A;  2KZU A;  3SYK A;  2XEP A;  4AG6 A;  1DGG A;  3IG5 A;  3HZJ A;  1WZV A;  1UM8 A;  3SAS A;  3FKE A;  5L8R F;  1U9A A;  3KSX A;  2KEB A;  4NRI B;  1QDT A;  3AOE A;  3AKZ A;  1L8Q A;  3M0E A;  3A45 A;  4FCV A;  2JZ0 A;  3GLH B;  5D0K A;  1WGN A;  3U60 B;  4DV2 M;  2VQF M;  4CJ6 A;  3SAW A;  1GVN A;  3RE8 A;  2GMI A;  2R18 A;  4JI6 M;  4IJF A;  1IBK M;  2JXN A;  4DUY M;  4DV0 M;  1I94 M;  2NQ8 C;  4OVZ A;  2JNH A;  1P3Q Q;  4DUZ M;  5FTN A;  2QGX A;  4LG2 A;  4YY3 M;  4BVU B;  3KOX E;  3QAU A;  1GJS A;  2CHV A;  3GQ5 A;  2ZAM A;  5E26 A;  2KJH A;  2EO2 A;  2YR0 A;  3GQ4 A;  1UFZ A;  1Q39 A;  5EGG A;  1IXR C;  3GLF B;  2DWM A;  4Z8X A;  2GQF A;  4GEW A;  2UUC M;  1W4U A;  2Y4W A;  4PDI A;  3RZ3 A;  2XFT A;  4FCW A;  1IM2 A;  4DHZ F;  2KRU A;  2DZN B;  2BWB A;  3ZQJ A;  3MJ5 A;  4G4Q A;  1K3X A;  1DGH B;  1G59 A;  1PM5 A;  4DDG A;  1I7K A;  2GRQ A;  5DYI A;  1Q3C A;  2Z4S A;  4NRG A;  2R45 A;  2FFJ A;  4AUQ A;  1PJJ A;  4IJE A;  2OQ4 A;  3FUX A;  4DR7 M;  1DGB A;  2EKK A;  3A46 A;  3TWM A;  4GMQ A;  1N33 M;  1D0L A;  4P17 A;  2KA6 B;  5KQ8 A;  1DGH A;  3K2L A;  4GHL A;  1IBL M;  2DAK A;  3WE5 A;  4D82 A;  1WZW A;  1OKS A;  3T1Y M;  3SMP A;  1NVM A;  2Q0V A;  3HHX A;  1Z5S A;  3U6L A;  2F5Q A;  5D2M A;  2HLW A;  1FNN A;  1XNQ M;  4GC5 A;  1QYR A;  3EIH A;  4LGY A;  1GL6 A;  1OFI A;  2YQZ A;  5F3W A;  3L1Z A;  3ILK A;  3KP0 E;  4AKI A;  4LJ5 A;  1MX0 A;  2KNA A;  4B3T M;  4I81 A;  3E95 C;  2DI0 A;  2OB4 A;  4FW9 A;  4KO8 A;  2OOA A;  1TH2 A;  4QHS A;  4WZ3 A;  5D1K A;  5F6X A;  4GRI A;  2EJS A;  4QOS A;  1E9S A;  1N77 A;  5FTM A;  5F6W A;  4FWH A;  4OX9 M;  2PX9 B;  2C2V B;  2R46 A;  1S1Q A;  4LFC M;  1Z5A A;  2K9D A;  2L7H A;  4MGZ E;  1FXT A;  3B89 A;  2DHY A;  4AKG A;  1ZQ9 A;  2WSE F;  3BXW A;  3SFZ A;  4XK8 F;  3FYC A;  3RFW A;  5EXS A;  2N35 A;  1QUT A;  5EP4 A;  2WZJ A;  1DGF A;  2R62 A;  2R44 A;  3KFU G;  4DS2 A;  1T3T A;  3FTD A;  2MJ5 B;  4DBG B;  2G8L A;  1WHC A;  2F4Z A;  1J09 A;  3O2U A;  2NVU C;  4IBE A;  1SXJ C;  1Q3B A;  3HHW A;  4ANR A;  2YBF A;  3SAR A;  2Z3X A;  1JAS A;  1NNU C;  4WW0 A;  3MHV C;  3E95 A;  4Q5E C;  2XF3 A;  2HWJ A;  5FTL A;  2L09 A;  3T38 A;  1KPQ A;  1XHB A;  4ONM B;  1NHW C;  2Z8Y M;  3I4V A;  1ZAE A;  3LQR A;  4ONN B;  3GQ3 A;  2CUZ A;  3PVS A;  2GNO A;  1ZMV A;  2KNZ A;  3SAV A;  2DZL A;  3SBJ A;  4D80 A;  4DDI A;  2C4P A;  1ZMU A;  1L1Z A;  4AI6 A;  1OAI A;  1L2D A;  1WJ7 A;  2JY8 A;  4LJA A;  5EXT A;  2L4F A;  3QYE A;  3R9X B;  2A5Y B;  3I01 M;  4ONN A;  2EKF A;  4A4B C;  3FSH A;  1V33 A;  1R4G A;  3TE6 A;  7CAT A;  4JUE A;  3SAU A;  1QZE A;  4OW0 A;  1VEK A;  1PZV A;  1WXQ A;  3C9P A;  1A5T A;  2DAY A;  3GPY A;  4Z6Y A;  3RCZ B;  4R3D A;  4R62 A;  3FYD A;  3TGD A;  1CUK A;  4II2 C;  4LJ7 A;  3I04 M;  3IHP A;  4QPL B;  5LMU M;  2UCZ A;  3ZCB B;  3GRY A;  1QDR A;  1JAT B;  2JY7 A;  2XSZ A;  3C58 A;  4YC1 A;  4GPR A;  3LVW A;  3GLG A;  5LMN M;  4HEO A;  4JYA M;  5KQD A;  2MRO B;  3WHK A;  2DAG A;  3CGW A;  4XBO A;  1SXJ A;  2JA2 A;  1QZM A;  2CYX A;  1IXS A;  5KPR A;  2CE7 A;  2WSC F;  2Z5D A;  2F4V M;  2F5P A;  3UK6 A;  2V1U A;  1XXH B;  3UMM A;  1A3S A;  1QAO A;  3U6P A;  3GPU A;  4JI0 M;  1UKX A;  4X57 A;  1C1K A;  3U5Z A;  3SHG B;  2JY5 A;  3TQS A;  2DKL A;  3HWS A;  1YH2 A;  4KLN A;  2G5G X;  2KDL A;  1OTR A;  3FUW A;  4M9S A;  3VLF B;  2ZTC A;  1JBB A;  4ITQ A;  2LVA A;  4LFA M;  1MU5 A;  3SC3 A;  1UZX A;  1ORY B;  5F6U A;  4B7G A;  2GRO A;  1T43 A;  3OTO M;  4CHT B;  2YB6 A;  4NRV A;  2QBY A;  2CP8 A;  2JWS A;  1K82 A;  3K92 A;  1AUA A;  3HHZ A;  2FE8 A;  4X64 M;  1PJQ A;  2CHQ A;  2QZ4 A;  2DNA A;  1N34 M;  1E9R A;  3H4M A;  1EE8 A;  4REZ A;  1OQY A;  3RGP A;  2O5R A;  3A4S A;  2GMI B;  1L1T A;  4QOZ C;  4HLQ A;  1WGL A;  1IXZ A;  1NY5 A;  4ZNY A;  3HX3 A;  2CV2 A;  2YHO B;  4GC9 A;  3HCT B;  4QHT A;  4RF0 A;  4OVZ B;  3HCU B;  4MM3 B;  2BEP A;  1YE9 A;  1BVS A;  1NSF A;  1HNX M;  3E9S A;  4WUR A;  4FWG A;  3U6E A;  1Q34 A;  3NBI A;  3PFI A;  4JI3 M;  1NNJ A;  1SXJ E;  3SQV C;  3GO8 A;  4JI8 M;  5D1L A;  2JP7 A;  4PDG A;  4HL4 A;  1HT2 E;  5F6Y A;  3BZH A;  4G4N A;  2DWL A;  4EIW A;  5F6D A;  3ZNI C;  3Q8G A;  1Z3D A;  2C96 A;  5JI3 E;  1YUB A;  3GRU A;  2C99 A;  3UIP A;  1W5S A;  1T6O A;  3U61 A;  4RKU F;  2LVQ D;  4FVM A;  1QCQ A;  2UUA M;  5JI2 E;  4NRG B;  3K8Z A;  1QAN A;  2KXE A;  4DR2 M;  1TF0 B;  2CV0 A;  3OBU A;  1NV8 A;  3L27 A;  4Y1L C;  4P5O G;  1MN3 A;  2VQE M;  3E46 A;  2DAX A;  3AOG A;  1XXH E;  3T1H M;  4CIS A;  3I4Y A;  1IY2 A;  4IBD A;  3J2P B;  1N75 A;  2VF8 A;  1L2B A;  1I4W A;  2DMF A;  2DHR A;  1IN8 A;  3KSJ A;  3PNV A;  1TR8 A;  1IY0 A;  2J7O A;  2E2C A;  4NOO B;  5BR8 M;  2RGO A;  4G6Z A;  4NR3 A;  3LW5 F;  4DHI D;  3B9P A;  3VFD A;  2X4A A;  2I7N A;  1PJS A;  2FO3 A;  3LMM A;  3J7A S;  5AIT B;  4LCB A;  3UZU A;  3L25 A;  1NJG A;  5AIU B;  3DA1 A;  4V3K A;  1R2Y A;  3B74 A;  3E4R A;  3CF2 A;  3KXE C;  2E5L M;  2PE6 A;  2RRU A;  1FJG M;  1H6U A;  1C7Y A;  1IQP A;  4A3V B;  3EIE A;  1PJT A;  2DWZ B;  2ZBK B;  4JXJ A;  4LZJ A;  2QEN A;  2F5S A;  2R4J A;  1ZDN A;  2A4D A;  2OPF A;  4JN6 A;  1N78 A;  2JUJ A;  5IFR A;  4IBB A;  4L16 A;  2LVP C;  4GH9 A;  8CAT A;  4X66 M;  3VK7 A;  2YNM D;  3FTC A;  2ESQ A;  1GJT A;  1N36 M;  4KHP M;  4Y1L A; 
#chains in the Genus database with same CATH homology
 1V92 A;  1WJ7 A;  2R0I A;  2K0B X;  1YLA A;  2OOB A;  2JY8 A;  1FZY A;  1AYZ A;  1GO5 A;  4NR3 B;  2CLW A;  2K07 A;  2HAK A;  2JZ1 A;  2L4F A;  1KPP A;  4ONN A;  1IFY A;  4W5V A;  2EKF A;  4A4B C;  3SY2 C;  3FSH A;  1ZUO A;  5DFL A;  2UYZ A;  1R4G A;  2Y9P A;  3EB6 B;  3PTF A;  3BBZ A;  4JUE A;  1QZE A;  4BWF A;  1HJP A;  1VEK A;  2DAW A;  1PZV A;  2MR9 A;  2H2Y A;  2DAM A;  1A5T A;  2DAY A;  3RCZ B;  3L1Y A;  4R62 A;  3TGD A;  2OO9 A;  1CUK A;  4II2 C;  1WZV A;  3R3Q A;  3IHP A;  4MDK A;  4QPL B;  2Y9M A;  1U9A A;  2UCZ A;  1J74 A;  4NRI B;  1JAT B;  2JY7 A;  4YC1 A;  4GPR A;  5D0M A;  2AYV A;  1TTE A;  4HEO A;  2JZ0 A;  2Z6O A;  1KPS A;  2MRO B;  2C2V C;  2DAG A;  3JVZ A;  5D0K A;  1WGN A;  2AAK A;  4S3O A;  2CYX A;  1IXS A;  2GMI A;  1Q02 A;  2Z5D A;  3OJ4 A;  3OBS A;  2QHO B;  2LVN C;  1J7D A;  3RPG A;  1C4Z D;  1VEG A;  1F4I A;  1A3S A;  2KNV A;  2JNH A;  1DO2 A;  1P3Q Q;  2QGX A;  3UGB A;  1UKX A;  3GLI E;  4X57 A;  4CCG A;  2BWE A;  1HT1 E;  2ZTD A;  4BVU B;  2JY5 A;  2B3T A;  2DKL A;  1YH2 A;  5FER B;  3KPA A;  1OTR A;  2ZTC A;  3GLH E;  1JBB A;  2KJH A;  1Y8X A;  2LVA A;  1UFZ A;  2F0R A;  5EGG A;  1VEJ A;  1UZX A;  5F6U A;  3VON C;  1DV0 A;  2GRO A;  1T43 A;  2YB6 A;  2CP8 A;  4AP4 B;  1HQY E;  4GEW A;  3W31 B;  2CWB A;  1W4U A;  2Y4W A;  3RZ3 A;  2EKE A;  1IM2 A;  3OBQ A;  4DHZ F;  2BWB A;  5AIT D;  3ZQS A;  3A33 A;  1SG9 A;  1KYI A;  2DNA A;  4L83 A;  3T6P A;  4DDG A;  2PWQ A;  1I7K A;  2ESO A;  2GRQ A;  3FN1 B;  2L4E A;  1M4Q A;  2AWF A;  1PGY A;  3MMP A;  1OQY A;  4NRG A;  4Q5H C;  2EBM A;  4AUQ A;  4M1N A;  3A4S A;  1XB2 B;  2GMI B;  1ZMW A;  1WGL A;  3F92 A;  2G3Q A;  2O25 C;  4IP3 B;  4ZNY A;  2EKK A;  2YHO B;  1X23 A;  3HCT B;  1EFU B;  3K9P A;  1J7D B;  2DEN A;  3GLF E;  3HCU B;  5FQ2 A;  2DAK A;  3WE5 A;  2BEP A;  5F6V A;  1YRV A;  2EBK A;  1WZW A;  1BVS A;  4F1I A;  1OKS A;  2Q0V A;  4A4C C;  1WR1 B;  1Q34 A;  1Z5S A;  3LCV B;  3P9G A;  1U9B A;  5D2M A;  3SQV C;  2HLW A;  5D1L A;  2JP7 A;  2ESK A;  4LAD A;  1HT2 E;  5F6Y A;  3BZH A;  4ONL B;  1VQ1 A;  3OBX A;  3JW0 A;  3L1Z A;  5F6D A;  4FH1 A;  1VG5 A;  2KNA A;  2KLY A;  3ZNI C;  2YZ0 A;  4WP2 A;  3E95 C;  2DI0 A;  1Z3D A;  2OB4 A;  2LVO C;  1NV9 A;  5AIE B;  3UIP A;  2OOA A;  4LDT C;  2BF8 A;  4WZ3 A;  1T6O A;  5D1K A;  5F6X A;  1AIP C;  2LVQ D;  1QCQ A;  5JI2 E;  2EJS A;  4NRG B;  3FRH A;  4F2L A;  2DAE A;  4R71 A;  2LBC A;  2ONU A;  4ONL A;  5F6W A;  3OBU A;  2PX9 B;  1G4A E;  1NV8 A;  4Y1L C;  2LXP A;  4P5O G;  1MN3 A;  1WIV A;  3E46 A;  2DAX A;  2L2D A;  2C2V B;  5KNL C;  1XXH E;  4ONM A;  2H5X A;  2OXQ A;  3K9O A;  1S1Q A;  3FRI A;  2A7L A;  2JY6 B;  1G41 A;  2DMF A;  5HPT C;  1Y6L A;  4JQU A;  5F6E A;  2K9D A;  1ZGU A;  1FXT A;  1TR8 A;  2O25 A;  3B89 A;  3ONG B;  2DHY A;  2GRR A;  3LCU A;  2E2C A;  4A49 B;  4NR3 A;  5D1M A;  4DHI D;  2GRN A;  2DAI A;  1M4P A;  4YII U;  2VRR A;  4EJE A;  1YF9 A;  4G3O A;  2WZJ A;  2FO3 A;  5AIT B;  3FE3 A;  5AIU B;  4DS2 A;  2QSF X;  2MJ5 B;  4DBG B;  3GLG E;  4V3K A;  3H8K A;  2GJD A;  2XWU A;  1E94 E;  2LTU A;  1WHC A;  4V3L A;  2PE6 A;  2F4Z A;  3VON B;  2RRU A;  2MGW A;  1C7Y A;  3EVX A;  3O2U A;  3CEG A;  2NVU C;  3UIO A;  1ZV1 A;  2FUH A;  4TKP A;  2YBF A;  4NRI A;  1JAT A;  1VDL A;  4UN2 B;  3R42 A;  2KHH A;  2GRP A;  1JAS A;  3E95 A;  2CLW B;  3UIN A;  4Q5E C;  2HWJ A;  1ZDN A;  3H4J A;  2F4W A;  2Z6P A;  4DHJ C;  2ESP A;  1KPQ A;  2A4D A;  2MT6 A;  2QNJ A;  5JNE B;  4ONM B;  1G3I A;  2JUJ A;  5IFR A;  1Z2U A;  2LVP C;  4ONN B;  3IEC A;  1JR3 E;  1ZMV A;  1DO0 A;  4Q7J A;  2EDI A;  2KNZ A;  2DZL A;  2ESQ A;  4DDI A;  1FBV C;  2C4P A;  1ZMU A;  3E21 A;  3P9H A;  1OAI A;  2R0J A;  1Y8G A;  4Y1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...