2L4FA

Nmr structure of the uba domain of s. cerevisiae dcn1 bound to ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Defective in cullin neddylation protein 1
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4fA00
4F1IA 2JZ0A 2L2DA 1VQ1A 2OO9A 2RRUA 2KNZA 2EJSA 1IXSA 4F2LA 2K0BX 2MR9A 1WR1B 3MMPA 1EFUB 2QHOB 2H5XA 2LVOC 1QZEA 2DAKA 1XB2B 2LVQD 1G3IA 1MN3A 1PGYA 2L4FA 4Q7JA 1BVSA 2MGWA 3K9PA 1CUKA 1HJPA 1TR8A 3E21A 1OTRA 2KNVA 2QNJA 1HQYE 2DKLA 1XXHE 1AIPC 2CP8A 4DBGB 2JY8A 1VEJA 1UFZA 2MROB 2HAKA 1OKSA 2QSFX 3GLGE 1ZMWA 1Q02A 1TTEA 3LCUA 1T43A 2DAMA 3H4JA 1JR3E 1ZMVA 1IM2A 1E94E 1C7YA 2R0IA 2JUJA 2JY5A 1ZV1A 3B89A 2G3QA 2BWBA 1NV9A 1T6OA 2LTUA 2O25A 3BBZA 4G3OA 1DV0A 1HT1E 1A5TA 2JNHA 1NV8A 3FRIA 1G41A 1G4AE 3FE3A 2HWJA 2JY6B 1KYIA 1VEGA 2EKKA 2L4EA 1SG9A 2K9DA 1OQYA 2CWBA 1HT2E 2ZTDA 3T6PA 1IFYA 3IHPA 3E46A 4HEOA 2LVNC 3GLFE 1OAIA 1P3QQ 1ZMUA 2DHYA 1DO2A 1WIVA 1WHCA 2B3TA 1WGNA 2BWEA 2JZ1A 2DAIA 1GO5A 2LBCA 1R4GA 1VEKA 2DNAA 3FRHA 3LCVB 2MJ5B 1VDLA 2ZTCA 1YLAA 2WZJA 4UN2B 3GLHE 1DO0A 2JY7A 3F92A 2LVAA 2EKFA 3IECA 2KHHA 4GEWA 5DFLA 2OOAA 1V92A 1Y8GA 5JI2E 2DAGA 4WP2A 2LVPC 1VG5A 2DAEA 1WJ7A 4R71A 2DI0A 1WGLA 2JP7A 2OOBA 2DENA 3K9OA 3GLIE 2DZLA 2KNAA 1F4IA
chains in the Genus database with same CATH superfamily
1ZAEA 2MH8A 2R45A 2OPFA 2JA2A 2JZ0A 5KQDA 2L2DA 2OO9A 3IG8A 4Z6YA 1TF0B 4MB7A 4F2LA 4JI8M 4RKUF 2XGNA 1TH2A 1MJGM 3MMPA 4GHLA 3M7GA 3FTEA 2BNKA 4JI3M 5IREB 3GLGA 3U6EA 4B3TM 1XNRM 2LVQD 3HU3A 1R5LA 3LMMA 1G3IA 4LJ9A 5EP2A 3VK7A 4AKIA 4MGHA 2L4FA 4Q7JA 4BB9A 5FTNA 1K3WA 1TH4A 2BJVA 3V76A 3DFZA 3QWLA 2BJWA 4M9SA 4D81A 2HL7A 1V34A 1CUKA 2C98A 2QENA 4GC5A 3KOZE 3RE8A 1HJPA 1W5TA 2KDLA 2YQZA 5EP3A 2ZANA 1XXHE 3NBXX 4I5SA 1QYRA 2UUCM 2CP8A 5KPTA 4Z8XA 1ORYB 2YNMD 2Y21A 3BXWA 2MROB 2XFTA 1R2YA 4LF8M 2ZM6M 2CV2A 1ZMWA 2R65A 2DWNA 3U6MA 2L6OA 8CATA 4DV6M 2CHGA 3C3DA 4Y28F 2VDBB 1OIZA 3L28A 3HZJA 1NVMA 1C1KA 1JR3E 3SASA 4LJ4A 4L4UA 4RF0A 2R62A 4W5WA 1C7YA 2JUJA 3FTFA 3C58A 2APLA 3HJSA 3B89A 3BBZA 2KRUA 2XLJA 4DR7M 2JWSA 4OX9M 2V1UA 3HU1A 1L1ZA 1G59A 2JNHA 2R4EA 5IZ7D 2DXIA 2ERCA 1KYIA 1S3SA 1GJSA 3QYEA 2OQ4A 2Z3XA 5KQ8A 4WW0A 2EKKA 2L4EA 1RU3A 4FVMA 4GIPA 3L2AA 4IBFA 2F5SA 1SG9A 3U6DA 2D7GA 2DZOB 3U6OA 4L16A 1OAIA 4IBIA 4OVZA 5ITXA 4TUWA 3KSJA 3GLFB 1OIPA 1WIVA 2C99A 3SAVA 2I7NA 4R3DA 4BLCA 1JQJC 2O01F 2LBCA 2DWLA 4FWHA 1VEKA 2M60A 3GRYA 2F5PA 3NBIA 4NOOB 2MJ5B 1DGFA 1VDLA 2ZTCA 3SHGB 1YLAA 3WHLA 4L78A 5IT9S 1DGBA 1OJLA 1QZMA 2X49A 1DO0A 3L25A 3KOWE 2XZFA 3PNVA 2LVAA 3DZDA 3IECA 3ILKA 2LXEA 1I4WA 2NQ8C 2Z8YM 3VLFB 5BPVA 2FFJA 4JXJA 4IBEA 1VG5A 5F3WA 2C5RA 3TE6A 4R71A 1VDDA 3UGJA 1Z6TA 2JP7A 2OOBA 4R7GA 3HJQA 4QOZC 5FTKA 1NNUC 2DZLA 4JI4M 1XWIA 1JB0F 4FWGA 1PJQA 4I4LA 4GKKM 2XSZA 2LNHC 1E32A 4AG5A 1VQ1A 3U6CA 1L2CA 7CATA 2CUZA 5ITUA 3T1HM 2ZBKB 3FUTA 1WR1B 1GVNA 3SYKA 3K8ZA 3SAUA 1R2ZA 4ITQA 1R7RA 1QZEA 2K47A 2DAKA 2JXNA 1NO1A 3M0EA 3FUXA 4B08A 4DV1M 2EUCA 4P16A 1FJGM 1GABA 4GHAA 4I8OA 1OFIA 4ZPXA 4X62M 4JN6A 3GLFA 5ITTA 1QQWA 3KW6A 1Z5AA 3FUVA 5EP4A 4G4OA 2UXCM 3CF2A 3J7AS 3B7ZA 1MU5A 1UM8A 2RGHA 4IBCA 3RGPA 3TWKA 1SXJC 3U60A 3K9PA 1WXQA 4QHSA 2WSCF 2DVWB 1TR8A 3THGA 4D80A 4LF6M 2KXEA 3E21A 3W0FA 3TWMA 3I4YA 3LQRA 2DKLA 3KXEC 4IBDA 1OFHA 1AIPC 1XC8A 2CRUA 4NRVA 2X8AA 1UFZA 3VDPA 1XHBA 2XSZD 4M9ZA 4DR2M 2VQEM 2AHMA 4FWDA 4PD2A 4QOSA 1IN6A 3BOSA 5EXTA 1QUSA 4KO8A 3K2LA 1IQPA 3LCUA 1T43A 4AZFA 3H4JA 3SHFA 2ZAMA 2UUAM 1MX0A 3T15A 1K82A 4WURA 4LY6A 4XBOA 1L2BA 1E94E 1NY6A 4NSRA 3AKZA 2FH0A 3HKPA 1ZV1A 3OTOM 3L26A 1NV9A 5EXPA 5LMNM 1KFVA 4CISA 4NSOB 3D8BA 2E5LM 1HT1E 1V33A 3B7QA 2F4VM 1A5TA 5FTMA 5C18A 3U6SA 1XXHB 1TGUA 2L09A 3KSXA 4G6ZA 1L1TA 3R9XB 2QZ4A 1N78A 1VEGA 3GRRA 2CHVA 2QP9X 4DV7M 3EIHA 2DWMA 2KZSA 4LJ7A 4JYAM 5C1BA 4LJ6A 1IFYA 3AL0C 4HEOA 4PDGA 1PJIA 1K3XA 2F5NA 1TH3A 2VQFM 4LF5M 4DR5M 3GQ3A 2WSFF 4DV2M 3FTDA 4HL4A 1NJGA 3LVWA 5EQTA 3HGIA 1OAOC 4X64M 3AFHA 3HX3A 5KO3A 3TWLA 4JI6M 1N77A 5FTJA 1HR0M 1GO5A 1R4GA 4DV0M 3FRHA 1J5EM 4M0WA 3SFZA 2O5RA 2N35A 2LHGA 2WZJA 3GLHE 4UN2B 5GKNA 4D82A 3B7NA 1IBKM 2C96A 2R44A 4LJAA 3ZQJA 2VIIA 1L8QA 1V92A 4FW9A 3L29A 5JI2E 4GITA 4LGMA 1PJTA 1Q3BA 3GPXA 3SMPA 5EJCA 5L8RF 2CV0A 3SATA 1WGLA 3KP1E 1NHGC 3R8FA 2W82A 4K0KM 1SXJE 1F4IA 1QDTA 2EA0A 4DV3M 2D7EA 3HHXA 3JR5A 3U61B 4GC9A 1IY1A 3K1JA 2A5YB 2KNZA 2EJSA 2WSEF 1FNNA 1IXSA 3KS4A 4MH0E 4LGYA 2K0BX 1H6UA 2XEPA 1YE9A 2FS1A 5E26A 3QYBA 1XMOM 3E4RA 2FNAA 2KA6B 1N34M 2QHOB 2H5XA 2LVOC 3Q8GA 4IBJA 1D0KA 2RGOA 1N75A 4LRSA 3UMMA 4AKHA 4NC6A 1TDHA 1XMQM 1Z59A 1PGYA 2J7NA 3VDUA 5KPZA 4LCBA 3W0LB 4OU7A 4LZJA 4KODA 3LQQA 4NXNM 1IY0A 2LWXA 3GP1A 1QAMA 4KT0F 3RGSA 1Q3CA 4XK8F 3SARA 4CJ6A 3A46A 3T1YM 2G5GX 4QHTA 1L2DA 2QBYA 1LV7A 2KNVA 1OTRA 1SXJA 1HQYE 4AI6A 4JI5M 3FD9A 3B74A 2JY8A 4YY3M 4GKJM 3VKGA 1VEJA 2DWZB 2HAKA 3U5ZB 1OKSA 3GLGE 4NRWA 3EIEA 1EIJA 4L15A 2F5OA 2DZNB 4GRIA 3DOAA 4LF7M 2DAMA 3SMSA 3GLGB 2Z4SA 5EP1A 1Z5BA 5DNYA 3FYCA 1TDZA 5EXSA 1GLNA 4DUZM 4X65M 3FTCA 4HLQA 4MGZE 2I7PA 2R0IA 2JY5A 3CF6E 5E6JA 3DA1A 1QVRA 3HU2A 5DYIA 1IXZA 4I81A 1HNZM 1QANA 2G3QA 2BWBA 2LTUA 1T6OA 1GJTA 2KW0A 3SYLA 3GQ4A 4G3OA 4FCTA 4B7GA 2HHHM 1IBLM 1KSFX 3CF0A 1XXHA 2XFSA 3VKHA 1NV8A 3J2PB 3FRIA 4BBAA 2R18A 1G41A 1G4AE 3FE3A 1PJJA 2JY6B 1SXJD 3VK8A 3PNYA 3KVWA 4B3SM 5BR8M 4PCZA 1IBMM 4FCWA 3PXGA 2UU9M 5H37D 3GLHA 2KRKA 3SC3A 2R4JA 2XZUA 3TL4X 2Y20A 3HHZA 2K9DA 1OQYA 2CWBA 3T6PA 4LF9M 3LW5F 4IBGA 1NY5A 2V6ZM 3E46A 3MJ5A 1EE8A 2LVNC 4M0DA 3ZC7B 3GLFE 4G4NA 4QNMA 2L7IA 4AQYM 2YFQA 2P5TA 1ZMUA 5KPRA 3KOXE 2DHYA 1SXJB 2KZUA 2VF8A 1WHCA 2CV1A 2X4AA 4KLNA 3J80S 1WGNA 3FKEA 3U6PA 1GL6A 4B7FA 5LMUM 2BWEA 1HNXM 2XF3A 1YUBA 2CE7A 2FOIC 2L7HA 3A98B 3HHWA 2V1CA 3HWSA 3LCVB 4CGYB 1GL7A 1IXRC 2Y0TA 2GNOA 3AOEA 4MGIE 5A2QS 2Q2EB 1J09A 4LJ8A 3KFUG 3TPZA 2JY7A 3F92A 2EKFA 5EXXA 1ZQ9A 4LFAM 2OOAA 4NL4H 3VFDA 2CFOA 4LG2A 2DAGA 2QCUA 1IN4A 1QDRA 1X37A 2LVPC 4REZA 3GPUA 2DAEA 2J7OA 1WJ7A 3W67A 1JR3A 2DI0A 4B3MM 2HKJA 2UUBM 2GQFA 2M5ZA 3SBJA 1N33M 1GKIA 4MM3B 4LF4M 3A45A 3UJNA 3D8LA 2KEBA 2Z7JA 1T3TA 3GRUA 3A42A 1LTMA 3I4VA 4F1IA 5FSWA 4DR1M 3ZCBB 2RRUA 2QBYB 4OW0A 4G4QA 3FYDA 2MR9A 3J81S 4JV5M 2D7HA 1PRBA 4GMQA 4IBKA 3GO8A 1PJSA 4L8RC 1JR3D 3RFWA 3MHVC 2Z4RA 4XGIA 1EFUB 3HJ8A 1XB2B 4DV4M 1MN3A 4II7A 4LFCM 1BVSA 2QPAA 3J7BA 3GLIA 1E9SA 4B7HA 2MGWA 2UXDM 4PDIA 3W68A 4CIZA 1D2NA 3QAUA 2XH9A 1QAOA 2QNJA 3U61A 4A3VB 3SAWA 4FD2A 1NSFA 4DBGB 2CHQA 4AKGA 3AOEC 4YHHM 1IXSB 3M6AA 1IN5A 1Q39A 2QSFX 3U5ZA 3FUWA 3WHKA 1W5SA 1Q02A 1TTEA 2YR0A 2C9OA 3UK6A 1DGGA 3AOGA 3NWLA 4MGYE 4G4RA 1Z5CA 4S12A 1ZMVA 4DR4M 3KOYE 4ANRA 1IM2A 1PM5A 2Y0QA 2C9CA 3KP0E 3IG5A 2EO2A 2HCBA 4EIWA 4DR6M 2O25A 3AJIB 3JR4A 4FCVA 1DV0A 5ITQA 1D0MA 3Q8XA 3GQ5A 2QQ8A 3CGWA 1IN8A 3GRVA 2J5YA 3K92A 4RNAA 4DV5M 2HWJA 3LVVA 5DYGA 1HQCA 3I51A 4LJ5A 1NHWC 1AUAA 4P17A 4IJEA 4B3RM 2ZAOA 1IY2A 1N32M 1DGHA 4L6V6 4LZZA 5ITRA 3C9PA 1HT2E 4PT5A 2ZTDA 1I94M 3MK6A 3IHPA 2CEAA 4GH9A 4DR3M 1D0LA 4OVZB 2DHRA 1G8PA 1P3QQ 1XNQM 2VF7A 4DUYM 4IJFA 2RKOA 1DO2A 4JI2M 4JI1M 4MGKE 3I04M 1E9RA 2UXBM 2B3TA 4JI0M 1NNJA 1YSYA 3H4MA 4LFBM 1N36M 2LH0A 4M9XA 3J27B 5IWAM 5FTLA 3U60B 2F5QA 1QUTA 2DAIA 1J7KA 2JZ1A 3E9SA 3C3EA 3HHYA 4RF1A 5ITYA 2DNAA 2FE8A 3TQSA 3I01M 3GPYA 5FLXS 3T38A 3PFIA 3PVSA 4NXMM 2R6FA 3AV0A 2LHCA 1NJFA 4X66M 1QAQA 2G8LA 4AG6A 2R46A 3HY5A 3U6QA 4JI7M 2KHHA 3GLHB 1DGHB 3KDSE 4GEWA 5DFLA 1HNWM 1Y8GA 3CTWB 3KS8A 4KHPM 3GPPA 4IIWA 4WP2A 4LRTA 3UZUA 3GLIB 5ITXE 1G71A 1R6BX 2H1RA 4AW4A 3U6LA 3B9PA 1IN7A 5JI3E 3JAMS 2DENA 3K9OA 3GLIE 2K6BA 2KNAA 4QNRA 3ZH9B 4CHTB 4IBBA 3FUUA 3L27A
chains in the Genus database with same CATH topology
4F1IA 2JZ0A 2L2DA 1VQ1A 2OO9A 2RRUA 2KNZA 2EJSA 1IXSA 4F2LA 2K0BX 2MR9A 1WR1B 3MMPA 1EFUB 2QHOB 2H5XA 2LVOC 1QZEA 2DAKA 1XB2B 2LVQD 1G3IA 1MN3A 1PGYA 2L4FA 4Q7JA 1BVSA 2MGWA 3K9PA 1CUKA 1HJPA 1TR8A 3E21A 1OTRA 2KNVA 2QNJA 1HQYE 2DKLA 1XXHE 1AIPC 2CP8A 4DBGB 2JY8A 1VEJA 1UFZA 2MROB 2HAKA 1OKSA 2QSFX 3GLGE 1ZMWA 1Q02A 1TTEA 3LCUA 1T43A 2DAMA 3H4JA 1JR3E 1ZMVA 1IM2A 1E94E 1C7YA 2R0IA 2JUJA 2JY5A 1ZV1A 3B89A 2G3QA 2BWBA 1NV9A 1T6OA 2LTUA 2O25A 3BBZA 4G3OA 1DV0A 1HT1E 1A5TA 2JNHA 1NV8A 3FRIA 1G41A 1G4AE 3FE3A 2HWJA 2JY6B 1KYIA 1VEGA 2EKKA 2L4EA 1SG9A 2K9DA 1OQYA 2CWBA 1HT2E 2ZTDA 3T6PA 1IFYA 3IHPA 3E46A 4HEOA 2LVNC 3GLFE 1OAIA 1P3QQ 1ZMUA 2DHYA 1DO2A 1WIVA 1WHCA 2B3TA 1WGNA 2BWEA 2JZ1A 2DAIA 1GO5A 2LBCA 1R4GA 1VEKA 2DNAA 3FRHA 3LCVB 2MJ5B 1VDLA 2ZTCA 1YLAA 2WZJA 4UN2B 3GLHE 1DO0A 2JY7A 3F92A 2LVAA 2EKFA 3IECA 2KHHA 4GEWA 5DFLA 2OOAA 1V92A 1Y8GA 5JI2E 2DAGA 4WP2A 2LVPC 1VG5A 2DAEA 1WJ7A 4R71A 2DI0A 1WGLA 2JP7A 2OOBA 2DENA 3K9OA 3GLIE 2DZLA 2KNAA 1F4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1I A;  2JZ0 A;  2L2D A;  1VQ1 A;  2OO9 A;  2RRU A;  2KNZ A;  2EJS A;  1IXS A;  4F2L A;  2K0B X;  2MR9 A;  1WR1 B;  3MMP A;  1EFU B;  2QHO B;  2H5X A;  2LVO C;  1QZE A;  2DAK A;  1XB2 B;  2LVQ D;  1G3I A;  1MN3 A;  1PGY A;  2L4F A;  4Q7J A;  1BVS A;  2MGW A;  3K9P A;  1CUK A;  1HJP A;  1TR8 A;  3E21 A;  1OTR A;  2KNV A;  2QNJ A;  1HQY E;  2DKL A;  1XXH E;  1AIP C;  2CP8 A;  4DBG B;  2JY8 A;  1VEJ A;  1UFZ A;  2MRO B;  2HAK A;  1OKS A;  2QSF X;  3GLG E;  1ZMW A;  1Q02 A;  1TTE A;  3LCU A;  1T43 A;  2DAM A;  3H4J A;  1JR3 E;  1ZMV A;  1IM2 A;  1E94 E;  1C7Y A;  2R0I A;  2JUJ A;  2JY5 A;  1ZV1 A;  3B89 A;  2G3Q A;  2BWB A;  1NV9 A;  1T6O A;  2LTU A;  2O25 A;  3BBZ A;  4G3O A;  1DV0 A;  1HT1 E;  1A5T A;  2JNH A;  1NV8 A;  3FRI A;  1G41 A;  1G4A E;  3FE3 A;  2HWJ A;  2JY6 B;  1KYI A;  1VEG A;  2EKK A;  2L4E A;  1SG9 A;  2K9D A;  1OQY A;  2CWB A;  1HT2 E;  2ZTD A;  3T6P A;  1IFY A;  3IHP A;  3E46 A;  4HEO A;  2LVN C;  3GLF E;  1OAI A;  1P3Q Q;  1ZMU A;  2DHY A;  1DO2 A;  1WIV A;  1WHC A;  2B3T A;  1WGN A;  2BWE A;  2JZ1 A;  2DAI A;  1GO5 A;  2LBC A;  1R4G A;  1VEK A;  2DNA A;  3FRH A;  3LCV B;  2MJ5 B;  1VDL A;  2ZTC A;  1YLA A;  2WZJ A;  4UN2 B;  3GLH E;  1DO0 A;  2JY7 A;  3F92 A;  2LVA A;  2EKF A;  3IEC A;  2KHH A;  4GEW A;  5DFL A;  2OOA A;  1V92 A;  1Y8G A;  5JI2 E;  2DAG A;  4WP2 A;  2LVP C;  1VG5 A;  2DAE A;  1WJ7 A;  4R71 A;  2DI0 A;  1WGL A;  2JP7 A;  2OOB A;  2DEN A;  3K9O A;  3GLI E;  2DZL A;  2KNA A;  1F4I A; 
#chains in the Genus database with same CATH topology
 1ZAE A;  2MH8 A;  2R45 A;  2OPF A;  2JA2 A;  2JZ0 A;  5KQD A;  2L2D A;  2OO9 A;  3IG8 A;  4Z6Y A;  1TF0 B;  4MB7 A;  4F2L A;  4JI8 M;  4RKU F;  2XGN A;  1TH2 A;  1MJG M;  3MMP A;  4GHL A;  3M7G A;  3FTE A;  2BNK A;  4JI3 M;  5IRE B;  3GLG A;  3U6E A;  4B3T M;  1XNR M;  2LVQ D;  3HU3 A;  1R5L A;  3LMM A;  1G3I A;  4LJ9 A;  5EP2 A;  3VK7 A;  4AKI A;  4MGH A;  2L4F A;  4Q7J A;  4BB9 A;  5FTN A;  1K3W A;  1TH4 A;  2BJV A;  3V76 A;  3DFZ A;  3QWL A;  2BJW A;  4M9S A;  4D81 A;  2HL7 A;  1V34 A;  1CUK A;  2C98 A;  2QEN A;  4GC5 A;  3KOZ E;  3RE8 A;  1HJP A;  1W5T A;  2KDL A;  2YQZ A;  5EP3 A;  2ZAN A;  1XXH E;  3NBX X;  4I5S A;  1QYR A;  2UUC M;  2CP8 A;  5KPT A;  4Z8X A;  1ORY B;  2YNM D;  2Y21 A;  3BXW A;  2MRO B;  2XFT A;  1R2Y A;  4LF8 M;  2ZM6 M;  2CV2 A;  1ZMW A;  2R65 A;  2DWN A;  3U6M A;  2L6O A;  8CAT A;  4DV6 M;  2CHG A;  3C3D A;  4Y28 F;  2VDB B;  1OIZ A;  3L28 A;  3HZJ A;  1NVM A;  1C1K A;  1JR3 E;  3SAS A;  4LJ4 A;  4L4U A;  4RF0 A;  2R62 A;  4W5W A;  1C7Y A;  2JUJ A;  3FTF A;  3C58 A;  2APL A;  3HJS A;  3B89 A;  3BBZ A;  2KRU A;  2XLJ A;  4DR7 M;  2JWS A;  4OX9 M;  2V1U A;  3HU1 A;  1L1Z A;  1G59 A;  2JNH A;  2R4E A;  5IZ7 D;  2DXI A;  2ERC A;  1KYI A;  1S3S A;  1GJS A;  3QYE A;  2OQ4 A;  2Z3X A;  5KQ8 A;  4WW0 A;  2EKK A;  2L4E A;  1RU3 A;  4FVM A;  4GIP A;  3L2A A;  4IBF A;  2F5S A;  1SG9 A;  3U6D A;  2D7G A;  2DZO B;  3U6O A;  4L16 A;  1OAI A;  4IBI A;  4OVZ A;  5ITX A;  4TUW A;  3KSJ A;  3GLF B;  1OIP A;  1WIV A;  2C99 A;  3SAV A;  2I7N A;  4R3D A;  4BLC A;  1JQJ C;  2O01 F;  2LBC A;  2DWL A;  4FWH A;  1VEK A;  2M60 A;  3GRY A;  2F5P A;  3NBI A;  4NOO B;  2MJ5 B;  1DGF A;  1VDL A;  2ZTC A;  3SHG B;  1YLA A;  3WHL A;  4L78 A;  5IT9 S;  1DGB A;  1OJL A;  1QZM A;  2X49 A;  1DO0 A;  3L25 A;  3KOW E;  2XZF A;  3PNV A;  2LVA A;  3DZD A;  3IEC A;  3ILK A;  2LXE A;  1I4W A;  2NQ8 C;  2Z8Y M;  3VLF B;  5BPV A;  2FFJ A;  4JXJ A;  4IBE A;  1VG5 A;  5F3W A;  2C5R A;  3TE6 A;  4R71 A;  1VDD A;  3UGJ A;  1Z6T A;  2JP7 A;  2OOB A;  4R7G A;  3HJQ A;  4QOZ C;  5FTK A;  1NNU C;  2DZL A;  4JI4 M;  1XWI A;  1JB0 F;  4FWG A;  1PJQ A;  4I4L A;  4GKK M;  2XSZ A;  2LNH C;  1E32 A;  4AG5 A;  1VQ1 A;  3U6C A;  1L2C A;  7CAT A;  2CUZ A;  5ITU A;  3T1H M;  2ZBK B;  3FUT A;  1WR1 B;  1GVN A;  3SYK A;  3K8Z A;  3SAU A;  1R2Z A;  4ITQ A;  1R7R A;  1QZE A;  2K47 A;  2DAK A;  2JXN A;  1NO1 A;  3M0E A;  3FUX A;  4B08 A;  4DV1 M;  2EUC A;  4P16 A;  1FJG M;  1GAB A;  4GHA A;  4I8O A;  1OFI A;  4ZPX A;  4X62 M;  4JN6 A;  3GLF A;  5ITT A;  1QQW A;  3KW6 A;  1Z5A A;  3FUV A;  5EP4 A;  4G4O A;  2UXC M;  3CF2 A;  3J7A S;  3B7Z A;  1MU5 A;  1UM8 A;  2RGH A;  4IBC A;  3RGP A;  3TWK A;  1SXJ C;  3U60 A;  3K9P A;  1WXQ A;  4QHS A;  2WSC F;  2DVW B;  1TR8 A;  3THG A;  4D80 A;  4LF6 M;  2KXE A;  3E21 A;  3W0F A;  3TWM A;  3I4Y A;  3LQR A;  2DKL A;  3KXE C;  4IBD A;  1OFH A;  1AIP C;  1XC8 A;  2CRU A;  4NRV A;  2X8A A;  1UFZ A;  3VDP A;  1XHB A;  2XSZ D;  4M9Z A;  4DR2 M;  2VQE M;  2AHM A;  4FWD A;  4PD2 A;  4QOS A;  1IN6 A;  3BOS A;  5EXT A;  1QUS A;  4KO8 A;  3K2L A;  1IQP A;  3LCU A;  1T43 A;  4AZF A;  3H4J A;  3SHF A;  2ZAM A;  2UUA M;  1MX0 A;  3T15 A;  1K82 A;  4WUR A;  4LY6 A;  4XBO A;  1L2B A;  1E94 E;  1NY6 A;  4NSR A;  3AKZ A;  2FH0 A;  3HKP A;  1ZV1 A;  3OTO M;  3L26 A;  1NV9 A;  5EXP A;  5LMN M;  1KFV A;  4CIS A;  4NSO B;  3D8B A;  2E5L M;  1HT1 E;  1V33 A;  3B7Q A;  2F4V M;  1A5T A;  5FTM A;  5C18 A;  3U6S A;  1XXH B;  1TGU A;  2L09 A;  3KSX A;  4G6Z A;  1L1T A;  3R9X B;  2QZ4 A;  1N78 A;  1VEG A;  3GRR A;  2CHV A;  2QP9 X;  4DV7 M;  3EIH A;  2DWM A;  2KZS A;  4LJ7 A;  4JYA M;  5C1B A;  4LJ6 A;  1IFY A;  3AL0 C;  4HEO A;  4PDG A;  1PJI A;  1K3X A;  2F5N A;  1TH3 A;  2VQF M;  4LF5 M;  4DR5 M;  3GQ3 A;  2WSF F;  4DV2 M;  3FTD A;  4HL4 A;  1NJG A;  3LVW A;  5EQT A;  3HGI A;  1OAO C;  4X64 M;  3AFH A;  3HX3 A;  5KO3 A;  3TWL A;  4JI6 M;  1N77 A;  5FTJ A;  1HR0 M;  1GO5 A;  1R4G A;  4DV0 M;  3FRH A;  1J5E M;  4M0W A;  3SFZ A;  2O5R A;  2N35 A;  2LHG A;  2WZJ A;  3GLH E;  4UN2 B;  5GKN A;  4D82 A;  3B7N A;  1IBK M;  2C96 A;  2R44 A;  4LJA A;  3ZQJ A;  2VII A;  1L8Q A;  1V92 A;  4FW9 A;  3L29 A;  5JI2 E;  4GIT A;  4LGM A;  1PJT A;  1Q3B A;  3GPX A;  3SMP A;  5EJC A;  5L8R F;  2CV0 A;  3SAT A;  1WGL A;  3KP1 E;  1NHG C;  3R8F A;  2W82 A;  4K0K M;  1SXJ E;  1F4I A;  1QDT A;  2EA0 A;  4DV3 M;  2D7E A;  3HHX A;  3JR5 A;  3U61 B;  4GC9 A;  1IY1 A;  3K1J A;  2A5Y B;  2KNZ A;  2EJS A;  2WSE F;  1FNN A;  1IXS A;  3KS4 A;  4MH0 E;  4LGY A;  2K0B X;  1H6U A;  2XEP A;  1YE9 A;  2FS1 A;  5E26 A;  3QYB A;  1XMO M;  3E4R A;  2FNA A;  2KA6 B;  1N34 M;  2QHO B;  2H5X A;  2LVO C;  3Q8G A;  4IBJ A;  1D0K A;  2RGO A;  1N75 A;  4LRS A;  3UMM A;  4AKH A;  4NC6 A;  1TDH A;  1XMQ M;  1Z59 A;  1PGY A;  2J7N A;  3VDU A;  5KPZ A;  4LCB A;  3W0L B;  4OU7 A;  4LZJ A;  4KOD A;  3LQQ A;  4NXN M;  1IY0 A;  2LWX A;  3GP1 A;  1QAM A;  4KT0 F;  3RGS A;  1Q3C A;  4XK8 F;  3SAR A;  4CJ6 A;  3A46 A;  3T1Y M;  2G5G X;  4QHT A;  1L2D A;  2QBY A;  1LV7 A;  2KNV A;  1OTR A;  1SXJ A;  1HQY E;  4AI6 A;  4JI5 M;  3FD9 A;  3B74 A;  2JY8 A;  4YY3 M;  4GKJ M;  3VKG A;  1VEJ A;  2DWZ B;  2HAK A;  3U5Z B;  1OKS A;  3GLG E;  4NRW A;  3EIE A;  1EIJ A;  4L15 A;  2F5O A;  2DZN B;  4GRI A;  3DOA A;  4LF7 M;  2DAM A;  3SMS A;  3GLG B;  2Z4S A;  5EP1 A;  1Z5B A;  5DNY A;  3FYC A;  1TDZ A;  5EXS A;  1GLN A;  4DUZ M;  4X65 M;  3FTC A;  4HLQ A;  4MGZ E;  2I7P A;  2R0I A;  2JY5 A;  3CF6 E;  5E6J A;  3DA1 A;  1QVR A;  3HU2 A;  5DYI A;  1IXZ A;  4I81 A;  1HNZ M;  1QAN A;  2G3Q A;  2BWB A;  2LTU A;  1T6O A;  1GJT A;  2KW0 A;  3SYL A;  3GQ4 A;  4G3O A;  4FCT A;  4B7G A;  2HHH M;  1IBL M;  1KSF X;  3CF0 A;  1XXH A;  2XFS A;  3VKH A;  1NV8 A;  3J2P B;  3FRI A;  4BBA A;  2R18 A;  1G41 A;  1G4A E;  3FE3 A;  1PJJ A;  2JY6 B;  1SXJ D;  3VK8 A;  3PNY A;  3KVW A;  4B3S M;  5BR8 M;  4PCZ A;  1IBM M;  4FCW A;  3PXG A;  2UU9 M;  5H37 D;  3GLH A;  2KRK A;  3SC3 A;  2R4J A;  2XZU A;  3TL4 X;  2Y20 A;  3HHZ A;  2K9D A;  1OQY A;  2CWB A;  3T6P A;  4LF9 M;  3LW5 F;  4IBG A;  1NY5 A;  2V6Z M;  3E46 A;  3MJ5 A;  1EE8 A;  2LVN C;  4M0D A;  3ZC7 B;  3GLF E;  4G4N A;  4QNM A;  2L7I A;  4AQY M;  2YFQ A;  2P5T A;  1ZMU A;  5KPR A;  3KOX E;  2DHY A;  1SXJ B;  2KZU A;  2VF8 A;  1WHC A;  2CV1 A;  2X4A A;  4KLN A;  3J80 S;  1WGN A;  3FKE A;  3U6P A;  1GL6 A;  4B7F A;  5LMU M;  2BWE A;  1HNX M;  2XF3 A;  1YUB A;  2CE7 A;  2FOI C;  2L7H A;  3A98 B;  3HHW A;  2V1C A;  3HWS A;  3LCV B;  4CGY B;  1GL7 A;  1IXR C;  2Y0T A;  2GNO A;  3AOE A;  4MGI E;  5A2Q S;  2Q2E B;  1J09 A;  4LJ8 A;  3KFU G;  3TPZ A;  2JY7 A;  3F92 A;  2EKF A;  5EXX A;  1ZQ9 A;  4LFA M;  2OOA A;  4NL4 H;  3VFD A;  2CFO A;  4LG2 A;  2DAG A;  2QCU A;  1IN4 A;  1QDR A;  1X37 A;  2LVP C;  4REZ A;  3GPU A;  2DAE A;  2J7O A;  1WJ7 A;  3W67 A;  1JR3 A;  2DI0 A;  4B3M M;  2HKJ A;  2UUB M;  2GQF A;  2M5Z A;  3SBJ A;  1N33 M;  1GKI A;  4MM3 B;  4LF4 M;  3A45 A;  3UJN A;  3D8L A;  2KEB A;  2Z7J A;  1T3T A;  3GRU A;  3A42 A;  1LTM A;  3I4V A;  4F1I A;  5FSW A;  4DR1 M;  3ZCB B;  2RRU A;  2QBY B;  4OW0 A;  4G4Q A;  3FYD A;  2MR9 A;  3J81 S;  4JV5 M;  2D7H A;  1PRB A;  4GMQ A;  4IBK A;  3GO8 A;  1PJS A;  4L8R C;  1JR3 D;  3RFW A;  3MHV C;  2Z4R A;  4XGI A;  1EFU B;  3HJ8 A;  1XB2 B;  4DV4 M;  1MN3 A;  4II7 A;  4LFC M;  1BVS A;  2QPA A;  3J7B A;  3GLI A;  1E9S A;  4B7H A;  2MGW A;  2UXD M;  4PDI A;  3W68 A;  4CIZ A;  1D2N A;  3QAU A;  2XH9 A;  1QAO A;  2QNJ A;  3U61 A;  4A3V B;  3SAW A;  4FD2 A;  1NSF A;  4DBG B;  2CHQ A;  4AKG A;  3AOE C;  4YHH M;  1IXS B;  3M6A A;  1IN5 A;  1Q39 A;  2QSF X;  3U5Z A;  3FUW A;  3WHK A;  1W5S A;  1Q02 A;  1TTE A;  2YR0 A;  2C9O A;  3UK6 A;  1DGG A;  3AOG A;  3NWL A;  4MGY E;  4G4R A;  1Z5C A;  4S12 A;  1ZMV A;  4DR4 M;  3KOY E;  4ANR A;  1IM2 A;  1PM5 A;  2Y0Q A;  2C9C A;  3KP0 E;  3IG5 A;  2EO2 A;  2HCB A;  4EIW A;  4DR6 M;  2O25 A;  3AJI B;  3JR4 A;  4FCV A;  1DV0 A;  5ITQ A;  1D0M A;  3Q8X A;  3GQ5 A;  2QQ8 A;  3CGW A;  1IN8 A;  3GRV A;  2J5Y A;  3K92 A;  4RNA A;  4DV5 M;  2HWJ A;  3LVV A;  5DYG A;  1HQC A;  3I51 A;  4LJ5 A;  1NHW C;  1AUA A;  4P17 A;  4IJE A;  4B3R M;  2ZAO A;  1IY2 A;  1N32 M;  1DGH A;  4L6V 6;  4LZZ A;  5ITR A;  3C9P A;  1HT2 E;  4PT5 A;  2ZTD A;  1I94 M;  3MK6 A;  3IHP A;  2CEA A;  4GH9 A;  4DR3 M;  1D0L A;  4OVZ B;  2DHR A;  1G8P A;  1P3Q Q;  1XNQ M;  2VF7 A;  4DUY M;  4IJF A;  2RKO A;  1DO2 A;  4JI2 M;  4JI1 M;  4MGK E;  3I04 M;  1E9R A;  2UXB M;  2B3T A;  4JI0 M;  1NNJ A;  1YSY A;  3H4M A;  4LFB M;  1N36 M;  2LH0 A;  4M9X A;  3J27 B;  5IWA M;  5FTL A;  3U60 B;  2F5Q A;  1QUT A;  2DAI A;  1J7K A;  2JZ1 A;  3E9S A;  3C3E A;  3HHY A;  4RF1 A;  5ITY A;  2DNA A;  2FE8 A;  3TQS A;  3I01 M;  3GPY A;  5FLX S;  3T38 A;  3PFI A;  3PVS A;  4NXM M;  2R6F A;  3AV0 A;  2LHC A;  1NJF A;  4X66 M;  1QAQ A;  2G8L A;  4AG6 A;  2R46 A;  3HY5 A;  3U6Q A;  4JI7 M;  2KHH A;  3GLH B;  1DGH B;  3KDS E;  4GEW A;  5DFL A;  1HNW M;  1Y8G A;  3CTW B;  3KS8 A;  4KHP M;  3GPP A;  4IIW A;  4WP2 A;  4LRT A;  3UZU A;  3GLI B;  5ITX E;  1G71 A;  1R6B X;  2H1R A;  4AW4 A;  3U6L A;  3B9P A;  1IN7 A;  5JI3 E;  3JAM S;  2DEN A;  3K9O A;  3GLI E;  2K6B A;  2KNA A;  4QNR A;  3ZH9 B;  4CHT B;  4IBB A;  3FUU A;  3L27 A; 
#chains in the Genus database with same CATH homology
 4F1I A;  2JZ0 A;  2L2D A;  1VQ1 A;  2OO9 A;  2RRU A;  2KNZ A;  2EJS A;  1IXS A;  4F2L A;  2K0B X;  2MR9 A;  1WR1 B;  3MMP A;  1EFU B;  2QHO B;  2H5X A;  2LVO C;  1QZE A;  2DAK A;  1XB2 B;  2LVQ D;  1G3I A;  1MN3 A;  1PGY A;  2L4F A;  4Q7J A;  1BVS A;  2MGW A;  3K9P A;  1CUK A;  1HJP A;  1TR8 A;  3E21 A;  1OTR A;  2KNV A;  2QNJ A;  1HQY E;  2DKL A;  1XXH E;  1AIP C;  2CP8 A;  4DBG B;  2JY8 A;  1VEJ A;  1UFZ A;  2MRO B;  2HAK A;  1OKS A;  2QSF X;  3GLG E;  1ZMW A;  1Q02 A;  1TTE A;  3LCU A;  1T43 A;  2DAM A;  3H4J A;  1JR3 E;  1ZMV A;  1IM2 A;  1E94 E;  1C7Y A;  2R0I A;  2JUJ A;  2JY5 A;  1ZV1 A;  3B89 A;  2G3Q A;  2BWB A;  1NV9 A;  1T6O A;  2LTU A;  2O25 A;  3BBZ A;  4G3O A;  1DV0 A;  1HT1 E;  1A5T A;  2JNH A;  1NV8 A;  3FRI A;  1G41 A;  1G4A E;  3FE3 A;  2HWJ A;  2JY6 B;  1KYI A;  1VEG A;  2EKK A;  2L4E A;  1SG9 A;  2K9D A;  1OQY A;  2CWB A;  1HT2 E;  2ZTD A;  3T6P A;  1IFY A;  3IHP A;  3E46 A;  4HEO A;  2LVN C;  3GLF E;  1OAI A;  1P3Q Q;  1ZMU A;  2DHY A;  1DO2 A;  1WIV A;  1WHC A;  2B3T A;  1WGN A;  2BWE A;  2JZ1 A;  2DAI A;  1GO5 A;  2LBC A;  1R4G A;  1VEK A;  2DNA A;  3FRH A;  3LCV B;  2MJ5 B;  1VDL A;  2ZTC A;  1YLA A;  2WZJ A;  4UN2 B;  3GLH E;  1DO0 A;  2JY7 A;  3F92 A;  2LVA A;  2EKF A;  3IEC A;  2KHH A;  4GEW A;  5DFL A;  2OOA A;  1V92 A;  1Y8G A;  5JI2 E;  2DAG A;  4WP2 A;  2LVP C;  1VG5 A;  2DAE A;  1WJ7 A;  4R71 A;  2DI0 A;  1WGL A;  2JP7 A;  2OOB A;  2DEN A;  3K9O A;  3GLI E;  2DZL A;  2KNA A;  1F4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...