2L4FA

Nmr structure of the uba domain of s. cerevisiae dcn1 bound to ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4fA00
2LVNC 2DAEA 1XB2B 1CUKA 2R0IA 2JUJA 3IECA 3K9OA 2BWEA 2L4FA 2KHHA 2LVPC 2LVQD 1DV0A 3E46A 3IHPA 1WGNA 2HAKA 4F1IA 1DO0A 2EJSA 1ZMVA 2JZ0A 2OOBA 3MMPA 2DAIA 1ZV1A 2LBCA 3GLGE 1DO2A 2RRUA 1G4AE 2ZTCA 3FE3A 1TR8A 1VEKA 2JY7A 1IFYA 3E21A 4WP2A 1EFUB 2QHOB 1TTEA 1HT2E 2DAMA 4F2LA 1VEGA 2MROB 2BWBA 2ZTDA 3GLFE 1ZMUA 3T6PA 1F4IA 1VG5A 2O25A 2DI0A 1XXHE 2JY8A 1WHCA 2EKFA 2LVAA 2MJ5B 1JR3E 2OOAA 1IXSA 2DAKA 1ZMWA 3F92A 4G3OA 2K9DA 3B89A 3FRIA 1R4GA 1T6OA 1T43A 2LVOC 2H5XA 2DAGA 3GLIE 1VQ1A 5JI2E 3FRHA 2DKLA 4Q7JA 1VDLA 2JY6B 3BBZA 1WJ7A 2JP7A 1OQYA 2MGWA 1G3IA 1VEJA 2L4EA 1E94E 1OTRA 1AIPC 2EKKA 4DBGB 1V92A 1Y8GA 1YLAA 1C7YA 2CP8A 4UN2B 3LCUA 1BVSA 2WZJA 1OKSA 2JNHA 1QZEA 1G41A 2QSFX 3GLHE 2KNZA 1OAIA 1PGYA 2G3QA 2QNJA 1WR1B 2DENA 1WIVA 3H4JA 1MN3A 2MR9A 3K9PA 2JY5A 1A5TA 1HJPA 1HT1E 4R71A 1KYIA 1P3QQ 1UFZA 2OO9A 1SG9A 2K0BX 2KNAA 2DHYA 2DNAA 4GEWA 1WGLA 1GO5A 2JZ1A 1IM2A 2KNVA 4HEOA 1NV9A 5DFLA 2L2DA 1Q02A 2HWJA 2B3TA 1NV8A 2LTUA 2CWBA 1HQYE 3LCVB 2DZLA
chains in the Genus database with same CATH superfamily
1XXHA 3HX3A 1NHWC 2DAEA 4G4RA 1PJJA 4LCBA 3L29A 1IBKM 1SXJE 3GLGA 1OFIA 1YSYA 3SARA 1N34M 1V34A 1DO0A 2OQ4A 2EJSA 3PNVA 2OOBA 1IN7A 2C99A 2RGHA 3M7GA 1L2BA 1ZV1A 3GLIA 3L25A 2QENA 4L6V6 3J7BA 3FTFA 3L2AA 3T1HM 2Z7JA 2ZTCA 4JI5M 4AKIA 2JXNA 1IXSB 1PJTA 1TR8A 4DR1M 1OIZA 3U6CA 1EIJA 1EFUB 2KRUA 3B7QA 2AHMA 4F2LA 2F5SA 4JI4M 2UXCM 4JI7M 1J7KA 2QBYA 1Z5AA 1MJGM 4X64M 4WURA 3CTWB 5EP4A 1ZMUA 5EQTA 3RE8A 2QBYB 1SXJC 1J09A 2CHGA 2O25A 4MGKE 4PT5A 5ITXE 2DI0A 3KS8A 3KW6A 3KFUG 1Q39A 3SC3A 1JB0F 3AJIB 4GMQA 4IBJA 1PJIA 3GLHA 1JR3E 1D0KA 2D7GA 2X4AA 4KLNA 1HNZM 3ZH9B 2OOAA 4S12A 3SMPA 1G8PA 3K2LA 1Z59A 4FWGA 2QCUA 3BOSA 4MGZE 3UK6A 3L26A 3FRIA 1T6OA 4LZJA 4GHAA 3THGA 2CHQA 4CHTB 3ZCBB 2HCBA 4GHLA 2J5YA 3CF0A 1L1ZA 4PD2A 3QYBA 5LMUM 4BLCA 3U61A 1XWIA 4Q7JA 2YFQA 4G6ZA 4KHPM 4I8OA 3BBZA 1WJ7A 2MGWA 1TDHA 4FD2A 3KOZE 3HWSA 1HR0M 2FOIC 1VEJA 3J2PB 1D0LA 4IBIA 1VDDA 1AIPC 2O5RA 4LJ6A 3RGSA 2DWLA 3HU1A 3MJ5A 3WHLA 2RKOA 4JN6A 4HL4A 2NQ8C 2WZJA 2C98A 4LY6A 5C1BA 2Y21A 3ZQJA 3VDUA 1QZEA 5KPZA 2Z4RA 4II7A 4LFAM 2CV2A 4LZZA 2X49A 3E9SA 3CF2A 4L4UA 1GVNA 1NNJA 1WIVA 4OVZB 1MN3A 4GC9A 4P16A 2Q2EB 1NNUC 4LJ5A 4QOSA 3A42A 3K1JA 3LQQA 1FJGM 1WXQA 2R65A 1UM8A 2M60A 1E32A 1GJTA 4FW9A 1YUBA 2KNAA 3AOEC 5DNYA 1L8QA 4GEWA 1DGBA 3VKGA 1V33A 2O01F 3DZDA 1QAMA 3W67A 4DV6M 3I4VA 4AKHA 4DR5M 3U6PA 4YY3M 3UJNA 2F5QA 3TWKA 1IN6A 4HEOA 3VKHA 3GLFA 3LVVA 2B3TA 1XNQM 3J7AS 1IY2A 1TH2A 4DR4M 4IIWA 3CF6E 3ZC7B 2DZOB 4AQYM 1LV7A 2LVAA 2R4EA 2ZBKB 4CISA 2LVNC 1XMOM 4GC5A 4JXJA 1TF0B 1CUKA 1XB2B 2CEAA 2JUJA 3GRRA 1IN5A 3K9OA 3TL4X 3KDSE 4OU7A 1TH3A 1DV0A 1Q3CA 3FTEA 2HAKA 4F1IA 4FCVA 4IJFA 2JZ0A 4WW0A 3B9PA 3JAMS 4LF5M 3A46A 2DAIA 3UMMA 2W82A 4KODA 3GLGE 3FE3A 2JA2A 3MK6A 1IXZA 2N35A 2JY7A 3HJ8A 4D80A 3SATA 4LF7M 4WP2A 5DYIA 3SBJA 1TH4A 1RU3A 1VEGA 3GPPA 3SFZA 2BWBA 4NXMM 3C3DA 2ZTDA 4P17A 1R5LA 2UXDM 4Z8XA 4R3DA 4LFCM 3MHVC 3TWLA 8CATA 4LRTA 3A45A 1F4IA 3GRYA 5ITTA 2I7PA 1R2YA 4ITQA 5IWAM 1Z6TA 4L78A 4B3RM 4FWHA 4MM3B 4IBGA 3SHGB 5EJCA 2F4VM 3U6SA 2MJ5B 1GJSA 2XFSA 2R46A 4IBFA 4K0KM 2QQ8A 1IXSA 4G3OA 4L8RC 2K9DA 3B89A 1L2DA 2VDBB 1IY0A 3B74A 2G5GX 2KEBA 2J7OA 3U60B 3KXEC 2F5NA 5JI3E 2CE7A 2DAGA 2KRKA 5ITYA 3VDPA 4MGIE 2HKJA 5IT9S 2C9CA 4M0WA 3FTCA 1ZQ9A 2FH0A 2D7EA 2DKLA 1JQJC 1VDLA 2JY6B 4QNRA 1QUSA 4RNAA 3GRUA 1G3IA 3Q8GA 2C9OA 2D7HA 3FUWA 3U6LA 4NOOB 2DZNB 4DBGB 5EXPA 4LG2A 4LFBM 4DUYM 2WSCF 1Y8GA 2EO2A 2F5PA 2FNAA 2R62A 1NY6A 1D2NA 2UUCM 2CP8A 2L09A 4GRIA 4GKKM 4NSOB 4IBDA 2JNHA 4AG6A 4IBKA 4CIZA 4DR7M 4DV4M 1QQWA 2Z3XA 1R7RA 2QSFX 2LXEA 1PRBA 1TGUA 3UZUA 5KPTA 2CV0A 2ERCA 3W0FA 2XLJA 2Z8YM 2G3QA 3QYEA 2CV1A 5EXSA 4LGYA 1S3SA 2YQZA 3H4JA 2C5RA 3PVSA 3GPYA 4NRVA 3VK8A 2I7NA 1HJPA 2J7NA 3CGWA 3FUUA 1SXJB 4MGHA 3HHYA 3RFWA 3U6DA 4LF4M 5FSWA 3Q8XA 1UFZA 2KA6B 5C18A 4X62M 5H37D 2VIIA 3FYDA 3M0EA 1Z5CA 3SAVA 1N78A 2K0BX 4RF0A 2DHYA 2UU9M 1W5SA 3GPUA 1KSFX 3U6OA 3GQ5A 1E9SA 4DUZM 2R6FA 1MU5A 4IBEA 5DYGA 1GO5A 3TWMA 2KXEA 4NL4H 3GPXA 4G4NA 4AZFA 3U6EA 2K47A 2CFOA 4AI6A 1NV9A 1QAOA 2BNKA 1QVRA 5DFLA 1Q02A 2HWJA 4FVMA 3NWLA 4QNMA 5ITQA 1K3WA 2CWBA 4OVZA 2QPAA 2CRUA 3HY5A 1OIPA 3QAUA 2FS1A 2HL7A 5ITXA 3AFHA 5FTKA 1JR3A 5ITRA 5FLXS 2Y0QA 3AOGA 2LNHC 4I5SA 5FTLA 3IECA 4B3MM 2BWEA 1XNRM 5EP2A 4CJ6A 2DXIA 1MX0A 4L16A 1OJLA 3W68A 3E46A 3IHPA 3IG8A 2Z4SA 1GABA 3BXWA 3VFDA 2KDLA 1ZMVA 3FD9A 4B3SM 3MMPA 1FNNA 1G71A 2XGNA 4PDIA 4HLQA 1PM5A 3FYCA 5BR8M 1DO2A 1PJSA 1JR3D 4LJ9A 5EXTA 2XF3A 4FWDA 1VEKA 2LHCA 3I01M 3GQ4A 1XC8A 2DWMA 1IFYA 2WSFF 2QHOB 1W5TA 2Y0TA 1TTEA 1HT2E 3HKPA 2G8LA 4RF1A 4R7GA 4AKGA 7CATA 4DV7M 1NY5A 3H4MA 3T15A 3J81S 3AKZA 1N77A 2MH8A 1L2CA 2F5OA 1AUAA 3GRVA 3HJQA 3T6PA 1D0MA 1H6UA 1VG5A 4I4LA 4LF6M 1Q3BA 1I4WA 1XXHE 2JY8A 2XEPA 2EKFA 2V1CA 2K6BA 3I51A 3KOXE 3U5ZB 2XH9A 3PFIA 2R18A 2DAKA 3HJSA 1ZMWA 3F92A 2GNOA 1ORYB 4EIWA 3UGJA 1YE9A 2DHRA 5KQDA 3GP1A 5FTJA 1IQPA 1R4GA 2R45A 2LVOC 3GO8A 2VQEM 2C96A 2BJVA 1IN4A 1IBMM 2H5XA 3GLIE 3LVWA 4B3TM 2FFJA 2A5YB 4YHHM 3SAWA 1OFHA 4LJ7A 4LRSA 1C1KA 2QP9X 3OTOM 2EUCA 4ZPXA 3JR5A 2JP7A 1OQYA 1K82A 3V76A 4M9ZA 3K92A 3W0LB 4JV5M 4X65M 1GL6A 2L4EA 1HNWM 3B7NA 4XK8F 1EE8A 1OAOC 3DFZA 3KSXA 3I04M 2UUBM 4PDGA 3EIHA 3KS4A 3QWLA 3U6QA 4UN2B 1BVSA 2P5TA 2VQFM 2LH0A 3KP0E 4LGMA 4MB7A 3U60A 3KOWE 3DA1A 1GKIA 4LJ4A 4OX9M 3E4RA 1G41A 1XHBA 4FCWA 3GLHE 4L15A 1GL7A 2OPFA 2QNJA 4GIPA 4B7FA 2FE8A 2MR9A 3K9PA 1GLNA 3NBIA 1R6BX 4NSRA 1A5TA 1HT1E 1XXHB 1J5EM 4JI1M 1QDTA 1KYIA 1P3QQ 4LF9M 2RGOA 5FTMA 3R9XB 1K3XA 1SG9A 4JI3M 4M0DA 1R2ZA 4M9XA 2DNAA 5BPVA 1G59A 4IBCA 3GLGB 1WGLA 4AW4A 1QANA 3JR4A 4DV0M 5KQ8A 2R44A 3DOAA 2H1RA 1IM2A 4M9SA 3GLIB 1N33M 2KNVA 1IY1A 4NC6A 2HHHM 2LTUA 1X37A 3RGPA 2X8AA 1HNXM 3TE6A 3HHWA 1HQYE 3ILKA 3LCVB 2DZLA 1SXJA 2QZ4A 3KSJA 4DR3M 3HU2A 2XSZA 4LF8M 4NRWA 2R0IA 4FCTA 2ZANA 2L4FA 2XFTA 2KHHA 2LVPC 2LVQD 5KO3A 1IBLM 1WGNA 2BJWA 2R4JA 2LBCA 1SXJD 3GQ3A 3GLHB 2XSZD 3K8ZA 2RRUA 1G4AE 5A2QS 2KZUA 5LMNM 2DWZB 3FUXA 3I4YA 2UXBM 5L8RF 3E21A 1N36M 1NSFA 2DAMA 3TPZA 4QHSA 3SASA 2WSEF 4DV2M 3LMMA 3VLFB 2MROB 1TDZA 2UUAM 3FUVA 3HZJA 3PXGA 3SYKA 4REZA 2M5ZA 1QAQA 1NJGA 2CUZA 4BBAA 3SHFA 4AG5A 4D81A 3GLFE 3LW5F 5EP1A 3U61B 3M6AA 4QHTA 4B7GA 1NHGC 2EA0A 4A3VB 1DGHA 3FUTA 1IXRC 1ZAEA 3SMSA 4RKUF 1WHCA 4W5WA 1Z5BA 2L7HA 4JI2M 5ITUA 1DGHB 2GQFA 3TQSA 3J27B 1T43A 4XBOA 4GH9A 4IBBA 2ZAOA 4CGYB 3D8LA 2V1UA 2VF8A 3LQRA 3SAUA 1VQ1A 5JI2E 4NXNM 1T3TA 3FRHA 3L28A 3J80S 3AL0C 2DVWB 1NJFA 4XGIA 4QOZC 3NBXX 3AOEA 2CHVA 3T1YM 3IG5A 1DGFA 3HHZA 3C58A 1E94E 1OTRA 2EKKA 3PNYA 3U6MA 1NVMA 3U5ZA 1V92A 2LWXA 3C3EA 4Z6YA 4DV3M 1YLAA 4GITA 1C7YA 3LCUA 3C9PA 4DR6M 1OKSA 2YR0A 4G4QA 4PCZA 3A98B 2JWSA 3KVWA 2Y20A 1HQCA 3SYLA 4DV1M 4G4OA 3T38A 4I81A 5GKNA 4KT0F 4JYAM 2LHGA 4MH0E 1DGGA 4MGYE 4B7HA 2KNZA 1OAIA 1PGYA 3AV0A 1E9RA 3KOYE 5EP3A 4DR2M 1XMQM 1QYRA 3GLFB 2L6OA 2XZFA 1WR1B 5E6JA 1I94M 3B7ZA 1LTMA 2DENA 2YNMD 5IREB 1L1TA 3HU3A 3L27A 2V6ZM 2JY5A 5KPRA 3VK7A 4R71A 4JI8M 2ZAMA 4TUWA 2OO9A 4B08A 3HGIA 4JI0M 4KO8A 4JI6M 4X66M 4LJ8A 1QUTA 2KW0A 1NO1A 2KZSA 3FKEA 1IN8A 4LJAA 1QDRA 4Y28F 5E26A 4D82A 1QZMA 3D8BA 1PJQA 5F3WA 2JZ1A 4GKJM 2E5LM 4OW0A 4DV5M 4ANRA 2APLA 3HHXA 3KP1E 5FTNA 2L2DA 2XZUA 4BB9A 1N32M 1NV8A 3FTDA 2L7IA 3R8FA 3EIEA 2VF7A 3WHKA 5IZ7D 2ZM6M 1KFVA 5EXXA 1N75A 4IJEA 2DWNA
chains in the Genus database with same CATH topology
2LVNC 2DAEA 1XB2B 1CUKA 2R0IA 2JUJA 3IECA 3K9OA 2BWEA 2L4FA 2KHHA 2LVPC 2LVQD 1DV0A 3E46A 3IHPA 1WGNA 2HAKA 4F1IA 1DO0A 2EJSA 1ZMVA 2JZ0A 2OOBA 3MMPA 2DAIA 1ZV1A 2LBCA 3GLGE 1DO2A 2RRUA 1G4AE 2ZTCA 3FE3A 1TR8A 1VEKA 2JY7A 1IFYA 3E21A 4WP2A 1EFUB 2QHOB 1TTEA 1HT2E 2DAMA 4F2LA 1VEGA 2MROB 2BWBA 2ZTDA 3GLFE 1ZMUA 3T6PA 1F4IA 1VG5A 2O25A 2DI0A 1XXHE 2JY8A 1WHCA 2EKFA 2LVAA 2MJ5B 1JR3E 2OOAA 1IXSA 2DAKA 1ZMWA 3F92A 4G3OA 2K9DA 3B89A 3FRIA 1R4GA 1T6OA 1T43A 2LVOC 2H5XA 2DAGA 3GLIE 1VQ1A 5JI2E 3FRHA 2DKLA 4Q7JA 1VDLA 2JY6B 3BBZA 1WJ7A 2JP7A 1OQYA 2MGWA 1G3IA 1VEJA 2L4EA 1E94E 1OTRA 1AIPC 2EKKA 4DBGB 1V92A 1Y8GA 1YLAA 1C7YA 2CP8A 4UN2B 3LCUA 1BVSA 2WZJA 1OKSA 2JNHA 1QZEA 1G41A 2QSFX 3GLHE 2KNZA 1OAIA 1PGYA 2G3QA 2QNJA 1WR1B 2DENA 1WIVA 3H4JA 1MN3A 2MR9A 3K9PA 2JY5A 1A5TA 1HJPA 1HT1E 4R71A 1KYIA 1P3QQ 1UFZA 2OO9A 1SG9A 2K0BX 2KNAA 2DHYA 2DNAA 4GEWA 1WGLA 1GO5A 2JZ1A 1IM2A 2KNVA 4HEOA 1NV9A 5DFLA 2L2DA 1Q02A 2HWJA 2B3TA 1NV8A 2LTUA 2CWBA 1HQYE 3LCVB 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVN C;  2DAE A;  1XB2 B;  1CUK A;  2R0I A;  2JUJ A;  3IEC A;  3K9O A;  2BWE A;  2L4F A;  2KHH A;  2LVP C;  2LVQ D;  1DV0 A;  3E46 A;  3IHP A;  1WGN A;  2HAK A;  4F1I A;  1DO0 A;  2EJS A;  1ZMV A;  2JZ0 A;  2OOB A;  3MMP A;  2DAI A;  1ZV1 A;  2LBC A;  3GLG E;  1DO2 A;  2RRU A;  1G4A E;  2ZTC A;  3FE3 A;  1TR8 A;  1VEK A;  2JY7 A;  1IFY A;  3E21 A;  4WP2 A;  1EFU B;  2QHO B;  1TTE A;  1HT2 E;  2DAM A;  4F2L A;  1VEG A;  2MRO B;  2BWB A;  2ZTD A;  3GLF E;  1ZMU A;  3T6P A;  1F4I A;  1VG5 A;  2O25 A;  2DI0 A;  1XXH E;  2JY8 A;  1WHC A;  2EKF A;  2LVA A;  2MJ5 B;  1JR3 E;  2OOA A;  1IXS A;  2DAK A;  1ZMW A;  3F92 A;  4G3O A;  2K9D A;  3B89 A;  3FRI A;  1R4G A;  1T6O A;  1T43 A;  2LVO C;  2H5X A;  2DAG A;  3GLI E;  1VQ1 A;  5JI2 E;  3FRH A;  2DKL A;  4Q7J A;  1VDL A;  2JY6 B;  3BBZ A;  1WJ7 A;  2JP7 A;  1OQY A;  2MGW A;  1G3I A;  1VEJ A;  2L4E A;  1E94 E;  1OTR A;  1AIP C;  2EKK A;  4DBG B;  1V92 A;  1Y8G A;  1YLA A;  1C7Y A;  2CP8 A;  4UN2 B;  3LCU A;  1BVS A;  2WZJ A;  1OKS A;  2JNH A;  1QZE A;  1G41 A;  2QSF X;  3GLH E;  2KNZ A;  1OAI A;  1PGY A;  2G3Q A;  2QNJ A;  1WR1 B;  2DEN A;  1WIV A;  3H4J A;  1MN3 A;  2MR9 A;  3K9P A;  2JY5 A;  1A5T A;  1HJP A;  1HT1 E;  4R71 A;  1KYI A;  1P3Q Q;  1UFZ A;  2OO9 A;  1SG9 A;  2K0B X;  2KNA A;  2DHY A;  2DNA A;  4GEW A;  1WGL A;  1GO5 A;  2JZ1 A;  1IM2 A;  2KNV A;  4HEO A;  1NV9 A;  5DFL A;  2L2D A;  1Q02 A;  2HWJ A;  2B3T A;  1NV8 A;  2LTU A;  2CWB A;  1HQY E;  3LCV B;  2DZL A; 
#chains in the Genus database with same CATH topology
 1XXH A;  3HX3 A;  1NHW C;  2DAE A;  4G4R A;  1PJJ A;  4LCB A;  3L29 A;  1IBK M;  1SXJ E;  3GLG A;  1OFI A;  1YSY A;  3SAR A;  1N34 M;  1V34 A;  1DO0 A;  2OQ4 A;  2EJS A;  3PNV A;  2OOB A;  1IN7 A;  2C99 A;  2RGH A;  3M7G A;  1L2B A;  1ZV1 A;  3GLI A;  3L25 A;  2QEN A;  4L6V 6;  3J7B A;  3FTF A;  3L2A A;  3T1H M;  2Z7J A;  2ZTC A;  4JI5 M;  4AKI A;  2JXN A;  1IXS B;  1PJT A;  1TR8 A;  4DR1 M;  1OIZ A;  3U6C A;  1EIJ A;  1EFU B;  2KRU A;  3B7Q A;  2AHM A;  4F2L A;  2F5S A;  4JI4 M;  2UXC M;  4JI7 M;  1J7K A;  2QBY A;  1Z5A A;  1MJG M;  4X64 M;  4WUR A;  3CTW B;  5EP4 A;  1ZMU A;  5EQT A;  3RE8 A;  2QBY B;  1SXJ C;  1J09 A;  2CHG A;  2O25 A;  4MGK E;  4PT5 A;  5ITX E;  2DI0 A;  3KS8 A;  3KW6 A;  3KFU G;  1Q39 A;  3SC3 A;  1JB0 F;  3AJI B;  4GMQ A;  4IBJ A;  1PJI A;  3GLH A;  1JR3 E;  1D0K A;  2D7G A;  2X4A A;  4KLN A;  1HNZ M;  3ZH9 B;  2OOA A;  4S12 A;  3SMP A;  1G8P A;  3K2L A;  1Z59 A;  4FWG A;  2QCU A;  3BOS A;  4MGZ E;  3UK6 A;  3L26 A;  3FRI A;  1T6O A;  4LZJ A;  4GHA A;  3THG A;  2CHQ A;  4CHT B;  3ZCB B;  2HCB A;  4GHL A;  2J5Y A;  3CF0 A;  1L1Z A;  4PD2 A;  3QYB A;  5LMU M;  4BLC A;  3U61 A;  1XWI A;  4Q7J A;  2YFQ A;  4G6Z A;  4KHP M;  4I8O A;  3BBZ A;  1WJ7 A;  2MGW A;  1TDH A;  4FD2 A;  3KOZ E;  3HWS A;  1HR0 M;  2FOI C;  1VEJ A;  3J2P B;  1D0L A;  4IBI A;  1VDD A;  1AIP C;  2O5R A;  4LJ6 A;  3RGS A;  2DWL A;  3HU1 A;  3MJ5 A;  3WHL A;  2RKO A;  4JN6 A;  4HL4 A;  2NQ8 C;  2WZJ A;  2C98 A;  4LY6 A;  5C1B A;  2Y21 A;  3ZQJ A;  3VDU A;  1QZE A;  5KPZ A;  2Z4R A;  4II7 A;  4LFA M;  2CV2 A;  4LZZ A;  2X49 A;  3E9S A;  3CF2 A;  4L4U A;  1GVN A;  1NNJ A;  1WIV A;  4OVZ B;  1MN3 A;  4GC9 A;  4P16 A;  2Q2E B;  1NNU C;  4LJ5 A;  4QOS A;  3A42 A;  3K1J A;  3LQQ A;  1FJG M;  1WXQ A;  2R65 A;  1UM8 A;  2M60 A;  1E32 A;  1GJT A;  4FW9 A;  1YUB A;  2KNA A;  3AOE C;  5DNY A;  1L8Q A;  4GEW A;  1DGB A;  3VKG A;  1V33 A;  2O01 F;  3DZD A;  1QAM A;  3W67 A;  4DV6 M;  3I4V A;  4AKH A;  4DR5 M;  3U6P A;  4YY3 M;  3UJN A;  2F5Q A;  3TWK A;  1IN6 A;  4HEO A;  3VKH A;  3GLF A;  3LVV A;  2B3T A;  1XNQ M;  3J7A S;  1IY2 A;  1TH2 A;  4DR4 M;  4IIW A;  3CF6 E;  3ZC7 B;  2DZO B;  4AQY M;  1LV7 A;  2LVA A;  2R4E A;  2ZBK B;  4CIS A;  2LVN C;  1XMO M;  4GC5 A;  4JXJ A;  1TF0 B;  1CUK A;  1XB2 B;  2CEA A;  2JUJ A;  3GRR A;  1IN5 A;  3K9O A;  3TL4 X;  3KDS E;  4OU7 A;  1TH3 A;  1DV0 A;  1Q3C A;  3FTE A;  2HAK A;  4F1I A;  4FCV A;  4IJF A;  2JZ0 A;  4WW0 A;  3B9P A;  3JAM S;  4LF5 M;  3A46 A;  2DAI A;  3UMM A;  2W82 A;  4KOD A;  3GLG E;  3FE3 A;  2JA2 A;  3MK6 A;  1IXZ A;  2N35 A;  2JY7 A;  3HJ8 A;  4D80 A;  3SAT A;  4LF7 M;  4WP2 A;  5DYI A;  3SBJ A;  1TH4 A;  1RU3 A;  1VEG A;  3GPP A;  3SFZ A;  2BWB A;  4NXM M;  3C3D A;  2ZTD A;  4P17 A;  1R5L A;  2UXD M;  4Z8X A;  4R3D A;  4LFC M;  3MHV C;  3TWL A;  8CAT A;  4LRT A;  3A45 A;  1F4I A;  3GRY A;  5ITT A;  2I7P A;  1R2Y A;  4ITQ A;  5IWA M;  1Z6T A;  4L78 A;  4B3R M;  4FWH A;  4MM3 B;  4IBG A;  3SHG B;  5EJC A;  2F4V M;  3U6S A;  2MJ5 B;  1GJS A;  2XFS A;  2R46 A;  4IBF A;  4K0K M;  2QQ8 A;  1IXS A;  4G3O A;  4L8R C;  2K9D A;  3B89 A;  1L2D A;  2VDB B;  1IY0 A;  3B74 A;  2G5G X;  2KEB A;  2J7O A;  3U60 B;  3KXE C;  2F5N A;  5JI3 E;  2CE7 A;  2DAG A;  2KRK A;  5ITY A;  3VDP A;  4MGI E;  2HKJ A;  5IT9 S;  2C9C A;  4M0W A;  3FTC A;  1ZQ9 A;  2FH0 A;  2D7E A;  2DKL A;  1JQJ C;  1VDL A;  2JY6 B;  4QNR A;  1QUS A;  4RNA A;  3GRU A;  1G3I A;  3Q8G A;  2C9O A;  2D7H A;  3FUW A;  3U6L A;  4NOO B;  2DZN B;  4DBG B;  5EXP A;  4LG2 A;  4LFB M;  4DUY M;  2WSC F;  1Y8G A;  2EO2 A;  2F5P A;  2FNA A;  2R62 A;  1NY6 A;  1D2N A;  2UUC M;  2CP8 A;  2L09 A;  4GRI A;  4GKK M;  4NSO B;  4IBD A;  2JNH A;  4AG6 A;  4IBK A;  4CIZ A;  4DR7 M;  4DV4 M;  1QQW A;  2Z3X A;  1R7R A;  2QSF X;  2LXE A;  1PRB A;  1TGU A;  3UZU A;  5KPT A;  2CV0 A;  2ERC A;  3W0F A;  2XLJ A;  2Z8Y M;  2G3Q A;  3QYE A;  2CV1 A;  5EXS A;  4LGY A;  1S3S A;  2YQZ A;  3H4J A;  2C5R A;  3PVS A;  3GPY A;  4NRV A;  3VK8 A;  2I7N A;  1HJP A;  2J7N A;  3CGW A;  3FUU A;  1SXJ B;  4MGH A;  3HHY A;  3RFW A;  3U6D A;  4LF4 M;  5FSW A;  3Q8X A;  1UFZ A;  2KA6 B;  5C18 A;  4X62 M;  5H37 D;  2VII A;  3FYD A;  3M0E A;  1Z5C A;  3SAV A;  1N78 A;  2K0B X;  4RF0 A;  2DHY A;  2UU9 M;  1W5S A;  3GPU A;  1KSF X;  3U6O A;  3GQ5 A;  1E9S A;  4DUZ M;  2R6F A;  1MU5 A;  4IBE A;  5DYG A;  1GO5 A;  3TWM A;  2KXE A;  4NL4 H;  3GPX A;  4G4N A;  4AZF A;  3U6E A;  2K47 A;  2CFO A;  4AI6 A;  1NV9 A;  1QAO A;  2BNK A;  1QVR A;  5DFL A;  1Q02 A;  2HWJ A;  4FVM A;  3NWL A;  4QNM A;  5ITQ A;  1K3W A;  2CWB A;  4OVZ A;  2QPA A;  2CRU A;  3HY5 A;  1OIP A;  3QAU A;  2FS1 A;  2HL7 A;  5ITX A;  3AFH A;  5FTK A;  1JR3 A;  5ITR A;  5FLX S;  2Y0Q A;  3AOG A;  2LNH C;  4I5S A;  5FTL A;  3IEC A;  4B3M M;  2BWE A;  1XNR M;  5EP2 A;  4CJ6 A;  2DXI A;  1MX0 A;  4L16 A;  1OJL A;  3W68 A;  3E46 A;  3IHP A;  3IG8 A;  2Z4S A;  1GAB A;  3BXW A;  3VFD A;  2KDL A;  1ZMV A;  3FD9 A;  4B3S M;  3MMP A;  1FNN A;  1G71 A;  2XGN A;  4PDI A;  4HLQ A;  1PM5 A;  3FYC A;  5BR8 M;  1DO2 A;  1PJS A;  1JR3 D;  4LJ9 A;  5EXT A;  2XF3 A;  4FWD A;  1VEK A;  2LHC A;  3I01 M;  3GQ4 A;  1XC8 A;  2DWM A;  1IFY A;  2WSF F;  2QHO B;  1W5T A;  2Y0T A;  1TTE A;  1HT2 E;  3HKP A;  2G8L A;  4RF1 A;  4R7G A;  4AKG A;  7CAT A;  4DV7 M;  1NY5 A;  3H4M A;  3T15 A;  3J81 S;  3AKZ A;  1N77 A;  2MH8 A;  1L2C A;  2F5O A;  1AUA A;  3GRV A;  3HJQ A;  3T6P A;  1D0M A;  1H6U A;  1VG5 A;  4I4L A;  4LF6 M;  1Q3B A;  1I4W A;  1XXH E;  2JY8 A;  2XEP A;  2EKF A;  2V1C A;  2K6B A;  3I51 A;  3KOX E;  3U5Z B;  2XH9 A;  3PFI A;  2R18 A;  2DAK A;  3HJS A;  1ZMW A;  3F92 A;  2GNO A;  1ORY B;  4EIW A;  3UGJ A;  1YE9 A;  2DHR A;  5KQD A;  3GP1 A;  5FTJ A;  1IQP A;  1R4G A;  2R45 A;  2LVO C;  3GO8 A;  2VQE M;  2C96 A;  2BJV A;  1IN4 A;  1IBM M;  2H5X A;  3GLI E;  3LVW A;  4B3T M;  2FFJ A;  2A5Y B;  4YHH M;  3SAW A;  1OFH A;  4LJ7 A;  4LRS A;  1C1K A;  2QP9 X;  3OTO M;  2EUC A;  4ZPX A;  3JR5 A;  2JP7 A;  1OQY A;  1K82 A;  3V76 A;  4M9Z A;  3K92 A;  3W0L B;  4JV5 M;  4X65 M;  1GL6 A;  2L4E A;  1HNW M;  3B7N A;  4XK8 F;  1EE8 A;  1OAO C;  3DFZ A;  3KSX A;  3I04 M;  2UUB M;  4PDG A;  3EIH A;  3KS4 A;  3QWL A;  3U6Q A;  4UN2 B;  1BVS A;  2P5T A;  2VQF M;  2LH0 A;  3KP0 E;  4LGM A;  4MB7 A;  3U60 A;  3KOW E;  3DA1 A;  1GKI A;  4LJ4 A;  4OX9 M;  3E4R A;  1G41 A;  1XHB A;  4FCW A;  3GLH E;  4L15 A;  1GL7 A;  2OPF A;  2QNJ A;  4GIP A;  4B7F A;  2FE8 A;  2MR9 A;  3K9P A;  1GLN A;  3NBI A;  1R6B X;  4NSR A;  1A5T A;  1HT1 E;  1XXH B;  1J5E M;  4JI1 M;  1QDT A;  1KYI A;  1P3Q Q;  4LF9 M;  2RGO A;  5FTM A;  3R9X B;  1K3X A;  1SG9 A;  4JI3 M;  4M0D A;  1R2Z A;  4M9X A;  2DNA A;  5BPV A;  1G59 A;  4IBC A;  3GLG B;  1WGL A;  4AW4 A;  1QAN A;  3JR4 A;  4DV0 M;  5KQ8 A;  2R44 A;  3DOA A;  2H1R A;  1IM2 A;  4M9S A;  3GLI B;  1N33 M;  2KNV A;  1IY1 A;  4NC6 A;  2HHH M;  2LTU A;  1X37 A;  3RGP A;  2X8A A;  1HNX M;  3TE6 A;  3HHW A;  1HQY E;  3ILK A;  3LCV B;  2DZL A;  1SXJ A;  2QZ4 A;  3KSJ A;  4DR3 M;  3HU2 A;  2XSZ A;  4LF8 M;  4NRW A;  2R0I A;  4FCT A;  2ZAN A;  2L4F A;  2XFT A;  2KHH A;  2LVP C;  2LVQ D;  5KO3 A;  1IBL M;  1WGN A;  2BJW A;  2R4J A;  2LBC A;  1SXJ D;  3GQ3 A;  3GLH B;  2XSZ D;  3K8Z A;  2RRU A;  1G4A E;  5A2Q S;  2KZU A;  5LMN M;  2DWZ B;  3FUX A;  3I4Y A;  2UXB M;  5L8R F;  3E21 A;  1N36 M;  1NSF A;  2DAM A;  3TPZ A;  4QHS A;  3SAS A;  2WSE F;  4DV2 M;  3LMM A;  3VLF B;  2MRO B;  1TDZ A;  2UUA M;  3FUV A;  3HZJ A;  3PXG A;  3SYK A;  4REZ A;  2M5Z A;  1QAQ A;  1NJG A;  2CUZ A;  4BBA A;  3SHF A;  4AG5 A;  4D81 A;  3GLF E;  3LW5 F;  5EP1 A;  3U61 B;  3M6A A;  4QHT A;  4B7G A;  1NHG C;  2EA0 A;  4A3V B;  1DGH A;  3FUT A;  1IXR C;  1ZAE A;  3SMS A;  4RKU F;  1WHC A;  4W5W A;  1Z5B A;  2L7H A;  4JI2 M;  5ITU A;  1DGH B;  2GQF A;  3TQS A;  3J27 B;  1T43 A;  4XBO A;  4GH9 A;  4IBB A;  2ZAO A;  4CGY B;  3D8L A;  2V1U A;  2VF8 A;  3LQR A;  3SAU A;  1VQ1 A;  5JI2 E;  4NXN M;  1T3T A;  3FRH A;  3L28 A;  3J80 S;  3AL0 C;  2DVW B;  1NJF A;  4XGI A;  4QOZ C;  3NBX X;  3AOE A;  2CHV A;  3T1Y M;  3IG5 A;  1DGF A;  3HHZ A;  3C58 A;  1E94 E;  1OTR A;  2EKK A;  3PNY A;  3U6M A;  1NVM A;  3U5Z A;  1V92 A;  2LWX A;  3C3E A;  4Z6Y A;  4DV3 M;  1YLA A;  4GIT A;  1C7Y A;  3LCU A;  3C9P A;  4DR6 M;  1OKS A;  2YR0 A;  4G4Q A;  4PCZ A;  3A98 B;  2JWS A;  3KVW A;  2Y20 A;  1HQC A;  3SYL A;  4DV1 M;  4G4O A;  3T38 A;  4I81 A;  5GKN A;  4KT0 F;  4JYA M;  2LHG A;  4MH0 E;  1DGG A;  4MGY E;  4B7H A;  2KNZ A;  1OAI A;  1PGY A;  3AV0 A;  1E9R A;  3KOY E;  5EP3 A;  4DR2 M;  1XMQ M;  1QYR A;  3GLF B;  2L6O A;  2XZF A;  1WR1 B;  5E6J A;  1I94 M;  3B7Z A;  1LTM A;  2DEN A;  2YNM D;  5IRE B;  1L1T A;  3HU3 A;  3L27 A;  2V6Z M;  2JY5 A;  5KPR A;  3VK7 A;  4R71 A;  4JI8 M;  2ZAM A;  4TUW A;  2OO9 A;  4B08 A;  3HGI A;  4JI0 M;  4KO8 A;  4JI6 M;  4X66 M;  4LJ8 A;  1QUT A;  2KW0 A;  1NO1 A;  2KZS A;  3FKE A;  1IN8 A;  4LJA A;  1QDR A;  4Y28 F;  5E26 A;  4D82 A;  1QZM A;  3D8B A;  1PJQ A;  5F3W A;  2JZ1 A;  4GKJ M;  2E5L M;  4OW0 A;  4DV5 M;  4ANR A;  2APL A;  3HHX A;  3KP1 E;  5FTN A;  2L2D A;  2XZU A;  4BB9 A;  1N32 M;  1NV8 A;  3FTD A;  2L7I A;  3R8F A;  3EIE A;  2VF7 A;  3WHK A;  5IZ7 D;  2ZM6 M;  1KFV A;  5EXX A;  1N75 A;  4IJE A;  2DWN A; 
#chains in the Genus database with same CATH homology
 2LVN C;  2DAE A;  1XB2 B;  1CUK A;  2R0I A;  2JUJ A;  3IEC A;  3K9O A;  2BWE A;  2L4F A;  2KHH A;  2LVP C;  2LVQ D;  1DV0 A;  3E46 A;  3IHP A;  1WGN A;  2HAK A;  4F1I A;  1DO0 A;  2EJS A;  1ZMV A;  2JZ0 A;  2OOB A;  3MMP A;  2DAI A;  1ZV1 A;  2LBC A;  3GLG E;  1DO2 A;  2RRU A;  1G4A E;  2ZTC A;  3FE3 A;  1TR8 A;  1VEK A;  2JY7 A;  1IFY A;  3E21 A;  4WP2 A;  1EFU B;  2QHO B;  1TTE A;  1HT2 E;  2DAM A;  4F2L A;  1VEG A;  2MRO B;  2BWB A;  2ZTD A;  3GLF E;  1ZMU A;  3T6P A;  1F4I A;  1VG5 A;  2O25 A;  2DI0 A;  1XXH E;  2JY8 A;  1WHC A;  2EKF A;  2LVA A;  2MJ5 B;  1JR3 E;  2OOA A;  1IXS A;  2DAK A;  1ZMW A;  3F92 A;  4G3O A;  2K9D A;  3B89 A;  3FRI A;  1R4G A;  1T6O A;  1T43 A;  2LVO C;  2H5X A;  2DAG A;  3GLI E;  1VQ1 A;  5JI2 E;  3FRH A;  2DKL A;  4Q7J A;  1VDL A;  2JY6 B;  3BBZ A;  1WJ7 A;  2JP7 A;  1OQY A;  2MGW A;  1G3I A;  1VEJ A;  2L4E A;  1E94 E;  1OTR A;  1AIP C;  2EKK A;  4DBG B;  1V92 A;  1Y8G A;  1YLA A;  1C7Y A;  2CP8 A;  4UN2 B;  3LCU A;  1BVS A;  2WZJ A;  1OKS A;  2JNH A;  1QZE A;  1G41 A;  2QSF X;  3GLH E;  2KNZ A;  1OAI A;  1PGY A;  2G3Q A;  2QNJ A;  1WR1 B;  2DEN A;  1WIV A;  3H4J A;  1MN3 A;  2MR9 A;  3K9P A;  2JY5 A;  1A5T A;  1HJP A;  1HT1 E;  4R71 A;  1KYI A;  1P3Q Q;  1UFZ A;  2OO9 A;  1SG9 A;  2K0B X;  2KNA A;  2DHY A;  2DNA A;  4GEW A;  1WGL A;  1GO5 A;  2JZ1 A;  1IM2 A;  2KNV A;  4HEO A;  1NV9 A;  5DFL A;  2L2D A;  1Q02 A;  2HWJ A;  2B3T A;  1NV8 A;  2LTU A;  2CWB A;  1HQY E;  3LCV B;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...