2L4FA

Nmr structure of the uba domain of s. cerevisiae dcn1 bound to ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4fA00
2QNJA 2QSFX 2K0BX 1T43A 1C7YA 2JY8A 2MJ5B 2DAIA 2QHOB 3GLIE 1XXHE 2DAKA 2OOAA 2BWBA 1EFUB 2H5XA 1DO2A 3MMPA 2LVNC 2JUJA 3E46A 2EKFA 5JI2E 4UN2B 1NV9A 1OQYA 2K9DA 2ZTDA 3FRHA 2DI0A 1OTRA 2OOBA 2KNAA 1E94E 1G3IA 2KHHA 1G41A 2L4EA 3IECA 3GLGE 1MN3A 2LVPC 2LVOC 4R71A 1IFYA 3LCVB 2CWBA 2DENA 3K9OA 1WGNA 1CUKA 3B89A 2L4FA 1ZMUA 1HJPA 2WZJA 1PGYA 1OAIA 1VQ1A 4GEWA 3GLHE 1BVSA 1HT2E 2EJSA 2BWEA 1TTEA 2JZ1A 2KNVA 2LBCA 1OKSA 2RRUA 3LCUA 3FE3A 1Q02A 1YLAA 2JNHA 2MROB 2JY5A 2CP8A 2LVQD 3IHPA 2DZLA 1VEKA 1A5TA 1QZEA 1WHCA 2DAGA 1HT1E 2R0IA 3E21A 1ZMVA 1HQYE 3K9PA 3H4JA 5DFLA 2DAMA 4F1IA 2JY6B 1Y8GA 2HWJA 1ZMWA 1T6OA 1VDLA 1ZV1A 1F4IA 2JY7A 2MGWA 2MR9A 3T6PA 1WR1B 3F92A 2B3TA 1UFZA 2DAEA 2G3QA 1JR3E 1G4AE 1R4GA 2LTUA 2DKLA 2DHYA 2DNAA 2OO9A 1TR8A 4Q7JA 2O25A 1XB2B 2EKKA 1KYIA 4DBGB 3FRIA 1VEGA 1NV8A 1P3QQ 2ZTCA 1IXSA 1WJ7A 2HAKA 2JP7A 1IM2A 4HEOA 2LVAA 3BBZA 1DV0A 4F2LA 3GLFE 2KNZA 2JZ0A 1WGLA 1DO0A 4WP2A 1VEJA 1WIVA 4G3OA 1AIPC 1V92A 1SG9A 1VG5A 1GO5A 2L2DA
chains in the Genus database with same CATH superfamily
2V1CA 4NC6A 3GPYA 2QNJA 4L15A 3TQSA 1XHBA 1TDHA 3PVSA 1HNWM 1JQJC 1QAMA 3GLGA 3U60A 2QHOB 3V76A 1Q3BA 1DGGA 4FVMA 3GLIE 3U6MA 4BBAA 4D81A 2R6FA 2H5XA 3LVWA 2VDBB 4FWGA 1GL6A 5FTNA 2CUZA 3FUUA 4FCTA 4OVZA 1HNZM 4PT5A 1QVRA 4MGKE 5KPZA 3M7GA 3EIHA 4LF6M 3CGWA 4LFCM 1MN3A 2H1RA 2LVPC 3SHGB 5ITUA 3U6OA 2KEBA 2XEPA 2GNOA 2CWBA 3K9OA 3LVVA 3U61B 1WGNA 4DV5M 1D0KA 3FUTA 4DUZM 3SC3A 4HLQA 3CTWB 4LCBA 2P5TA 2UUCM 1XNQM 2JA2A 3ZCBB 4IBEA 4CJ6A 3OTOM 1RU3A 1HJPA 3KW6A 5IT9S 2LH0A 4JN6A 2KZSA 3D8LA 3GRYA 1QAQA 1OAIA 2EA0A 3MK6A 3GP1A 1VQ1A 2CHQA 3K1JA 4B7GA 2JZ1A 1TTEA 1HQCA 4AKIA 1L2BA 3FD9A 3T15A 3TE6A 5ITQA 3HWSA 3FE3A 2UXDM 2JNHA 2MROB 1D0LA 2G8LA 3C58A 2DWLA 2QBYA 4L8RC 1NJFA 3U6SA 3UJNA 3I01M 2Z8YM 4L4UA 3IHPA 4LF4M 4GMQA 4DV3M 2EUCA 1VEKA 4DR5M 2ZAOA 3AL0C 4AI6A 2QP9X 3KVWA 3L29A 1R6BX 4PDGA 5A2QS 4L16A 1Z6TA 2X8AA 4II7A 1HQYE 1IQPA 3HU1A 4DR2M 1Z5AA 5FTJA 3D8BA 4BLCA 4MGZE 5EP3A 1OIZA 2Z7JA 5EXSA 1Y8GA 4QNRA 1J5EM 3VFDA 2FE8A 1ZV1A 2ZANA 4LY6A 2MH8A 3BXWA 2JY7A 3RFWA 1WR1B 1KFVA 2B3TA 1UFZA 4JXJA 2QQ8A 1OFHA 4RNAA 1KSFX 4OX9M 1JR3E 1G4AE 1R4GA 3AV0A 3C3DA 3HJ8A 2DKLA 2C96A 4LJ9A 1E9SA 3R8FA 1EIJA 2DNAA 4MH0E 4QHSA 4YY3M 2F5PA 4LF7M 4NSRA 1DGHA 1XB2B 4DV7M 4LF8M 1G59A 1Q39A 4LJ8A 3IG5A 4DR1M 3U6DA 1P3QQ 4CIZA 2HAKA 4IBBA 3KOWE 1XMOM 2JP7A 4LZJA 2I7NA 1R2ZA 3B74A 3DA1A 4HEOA 1YSYA 5ITTA 2CFOA 3PNVA 4L6V6 2F4VM 2O01F 2DWNA 3ZH9B 1IY1A 3U61A 4G4QA 3RGPA 1WXQA 2LNHC 3KOXE 2Y0QA 3MJ5A 3QYEA 4GC9A 4DUYM 3T1HM 4DR6M 2XGNA 2D7GA 3L26A 2HCBA 4GHLA 1WGLA 5FTLA 3GLFB 4TUWA 2E5LM 4JI1M 5DYGA 5IZ7D 3AOEA 3W0LB 3LW5F 1VEJA 4DR3M 2VF7A 4WW0A 4OW0A 2CRUA 3FTEA 1GO5A 1K3WA 4NXMM 2C9CA 2WSFF 4DV0M 5KQ8A 4LJ5A 3SYKA 4G4RA 1HR0M 2QSFX 1T43A 4FWDA 3HX3A 4B3SM 2Q2EB 2JY8A 1NY5A 1YE9A 2DAIA 2MJ5B 3HZJA 3J27B 3ZC7B 4DV6M 1K82A 1EE8A 4FCVA 1N34M 1XXHE 2BJWA 2DAKA 2OOAA 3SYLA 4IIWA 1EFUB 2K47A 4EIWA 1L1ZA 1SXJE 2KA6B 4LJ4A 5JI2E 1NV9A 5ITYA 1IXRC 2BNKA 3I51A 4M0WA 3SAVA 1QQWA 2DI0A 2C5RA 2OOBA 1Z5CA 4M0DA 4DR4M 3U5ZA 2KNAA 2KHHA 3IG8A 3DFZA 3QWLA 3GLGE 5FTKA 1NY6A 2D7HA 3SAWA 3RGSA 2DZNB 4R71A 3FKEA 1IFYA 1IBLM 3VKGA 1MX0A 4ITQA 1FNNA 3B89A 3HY5A 4B3MM 5IWAM 1QUTA 2LHCA 2L4FA 1ZMUA 5BR8M 1V34A 1N77A 2ZBKB 3VK7A 5H37D 1G8PA 2GQFA 5KQDA 4IJFA 1I94M 1OIPA 1K3XA 4OU7A 3BOSA 3AKZA 3GRUA 4JI2M 4GEWA 4JI4M 3KOZE 2EJSA 1HT2E 1Q3CA 2C98A 2Z4RA 3NWLA 3VKHA 3GLHB 2LBCA 1OKSA 2R65A 2RRUA 4AZFA 4BB9A 3FYCA 3T38A 1DGBA 2QPAA 4GKJM 4M9ZA 1N75A 2L7IA 4CGYB 2JY5A 1L2CA 2R4EA 2CP8A 2DZOB 1YUBA 1IXZA 1TF0B 3B7QA 1GKIA 3QYBA 2YFQA 1A5TA 5F3WA 1QZEA 1FJGM 1QDTA 1HT1E 3FTCA 4X65M 3E21A 4DV4M 4KODA 2XZFA 3J7AS 3K9PA 1R2YA 2YQZA 2CE7A 4I5SA 3U5ZB 1SXJC 5DFLA 2KW0A 1L2DA 1IN6A 4AKHA 4QOSA 4F1IA 2JY6B 4NXNM 5ITXA 3JR4A 1ZMWA 5BPVA 3M6AA 1F4IA 2MGWA 1IBMM 2DAEA 1N36M 1Z59A 4S12A 4B7HA 1NHGC 4PD2A 3JAMS 4NSOB 4GHAA 3GLIA 4AG5A 3HHXA 4IBKA 4P16A 2DHYA 3LQRA 1V33A 4JI0M 1PJJA 3AOGA 4IJEA 4P17A 4GC5A 4Q7JA 1KYIA 2QENA 2UXBM 5FLXS 3GLFA 1IY2A 1X37A 3DOAA 3VK8A 1TDZA 5EJCA 3EIEA 1NV8A 5GKNA 5IREB 1WJ7A 4X62M 4GRIA 4LFBM 3SASA 1OFIA 1DV0A 3TWKA 3E4RA 4K0KM 3FYDA 4AW4A 3LQQA 4ZPXA 4XGIA 4Z8XA 3PXGA 2L6OA 2JZ0A 2LHGA 4YHHM 1MU5A 4Z6YA 2HKJA 1NSFA 4RF1A 2L09A 4NL4H 4JYAM 2BJVA 2CHVA 4REZA 3K2LA 2V1UA 1VG5A 3A45A 1R5LA 2KRUA 1GL7A 1NHWC 2UXCM 1D0MA 1MJGM 2K0BX 2L7HA 3KS8A 2FS1A 2R45A 3GQ4A 3FUWA 2FNAA 2BWBA 2QZ4A 3GLIB 2LVNC 3U6PA 3KFUG 2R44A 3HHWA 1AUAA 2FH0A 2EKFA 4UN2B 2K9DA 3MHVC 4WURA 3KOYE 1E94E 1G3IA 2L4EA 1G41A 1NJGA 3GPXA 2VIIA 3TWLA 2CV1A 3CF0A 1T3TA 1QANA 3NBXX 4NRVA 2LVOC 3GLHA 4MM3B 1IBKM 2A5YB 4B3TM 1GJSA 2M5ZA 1Z5BA 3B7ZA 1JR3D 4XBOA 3B9PA 2VF8A 3HGIA 2J5YA 1L1TA 2VQEM 1JR3A 3RE8A 3DZDA 3I4VA 2JWSA 3WHKA 3FUVA 1UM8A 1PGYA 1TH4A 2DHRA 2FOIC 2WZJA 1VDDA 2NQ8C 5EP2A 3L2AA 2J7NA 3QAUA 5KO3A 2BWEA 4W5WA 4DV1M 1NVMA 2OQ4A 1PJTA 7CATA 2VQFM 2JXNA 3J7BA 1Q02A 1I4WA 4L78A 4DV2M 4JI5M 3PFIA 2HHHM 2DWMA 2ZAMA 3PNYA 4PCZA 5LMNM 2Y21A 2DXIA 4JI8M 3SFZA 2LVQD 1QZMA 2DZLA 4IBCA 5FTMA 1H6UA 3TWMA 1NNJA 2F5NA 2LXEA 3SBJA 3U6EA 1WHCA 3HKPA 4R3DA 2R62A 2DAGA 3AOEC 4LJ7A 4AQYM 3KP1E 1ZMVA 4FCWA 4KT0F 4I81A 1NO1A 4GITA 1TGUA 3UK6A 2K6BA 2CHGA 2XFTA 2DAMA 3GPUA 1XMQM 1E9RA 1T6OA 1VDLA 4M9XA 3HHYA 4RKUF 5EP1A 3U6LA 3F92A 2ERCA 2UUBM 3H4MA 2LTUA 3J2PB 3UGJA 1OJLA 1N33M 3HJSA 3TL4X 4MGHA 2F5QA 3W68A 4QOZC 1QDRA 2OO9A 3B7NA 1TR8A 1NNUC 3GO8A 1IN7A 2XSZD 4PDIA 1LV7A 2KXEA 4ANRA 5ITXE 3SAUA 3J80S 4DBGB 4FD2A 3FRIA 3SARA 2OPFA 2XSZA 1VEGA 2R4JA 1XWIA 2ZTCA 4LRTA 5DNYA 1TH3A 4X64M 2Z3XA 2X4AA 3K92A 2C99A 1GVNA 3L28A 4LFAM 2DWZB 2LVAA 4CISA 3BBZA 3KSXA 1W5SA 2KRKA 3VLFB 4G6ZA 4LJAA 2KZUA 4FW9A 2KNZA 3GLFE 2WSEF 4DR7M 1QAOA 4I8OA 3W0FA 4QNMA 5EXPA 2D7EA 1DO0A 1GLNA 4WP2A 1ZAEA 1IXSB 1WIVA 2Y0TA 4X66M 5EQTA 1AIPC 1V92A 4D82A 2J7OA 4NOOB 1R7RA 3W67A 2DVWB 5KPTA 4B08A 3E9SA 1XC8A 3GRRA 4HL4A 3ILKA 2V6ZM 3KS4A 5EXXA 1C7YA 4IBIA 1W5TA 1HNXM 3GQ5A 2RGHA 3HHZA 1XNRM 3Q8XA 3GQ3A 3MMPA 1DO2A 1IN8A 1XXHB 3KXEC 4I4LA 2XH9A 2JUJA 3SMSA 3E46A 4KO8A 2XLJA 1OQYA 3T1YM 1SXJB 2ZTDA 3FRHA 3M0EA 3FUXA 4KLNA 1OTRA 3K8ZA 5FSWA 2CEAA 3A98B 4CHTB 3SHFA 1IN4A 3IECA 5ITRA 2CV2A 2Z4SA 4LGMA 4LJ6A 3CF2A 4FWHA 3C3EA 3GLGB 3UZUA 3U60B 2CV0A 3LCVB 2DENA 5E26A 1CUKA 2QCUA 4LF9M 2LWXA 2R46A 4D80A 3CF6E 3HU2A 2APLA 2FFJA 4OVZB 3SATA 3L27A 4MB7A 3A46A 2XZUA 1DGFA 1PJSA 1E32A 2N35A 1OAOC 2KDLA 3FTFA 3GLHE 3NBIA 1BVSA 1IN5A 1G71A 2KNVA 5JI3E 1PM5A 1N32M 5KPRA 2M60A 2G5GX 2XFSA 3LCUA 3Q8GA 4R7GA 2Y20A 1YLAA 1ORYB 4AKGA 4JI3M 2O5RA 2ZM6M 3I4YA 3WHLA 4Y28F 2F5OA 3KDSE 2AHMA 2RKOA 3R9XB 4GIPA 4IBFA 1PJIA 2YR0A 4LZZA 2R0IA 3C9PA 2HL7A 4A3VB 1S3SA 2F5SA 3H4JA 1ZQ9A 1IY0A 3J81S 2RGOA 2W82A 2QBYB 3I04M 3TPZA 3VDPA 3UMMA 1C1KA 1L8QA 4IBDA 2HWJA 4LRSA 3U6QA 3FTDA 2MR9A 4MGIE 3T6PA 4JV5M 1JB0F 4MGYE 2C9OA 5DYIA 2G3QA 4QHTA 4XK8F 4JI6M 4KHPM 1D2NA 5E6JA 3A42A 3GRVA 3KSJA 4GKKM 1QYRA 1GABA 2O25A 4LF5M 2EKKA 4RF0A 5LMUM 8CATA 3GPPA 2YNMD 2WSCF 1QUSA 4M9SA 1IXSA 3SMPA 4GH9A 3ZQJA 4JI7M 5EP4A 1GJTA 1N78A 1PRBA 1TH2A 3HU3A 1IM2A 3JR5A 4G4NA 4LGYA 2UUAM 1J7KA 4AG6A 3THGA 5C18A 3U6CA 3AJIB 1LTMA 4F2LA 1DGHB 4LG2A 1J09A 1PJQA 4NRWA 3LMMA 3HJQA 3L25A 4B7FA 2UU9M 4B3RM 3KP0E 1SXJD 1XXHA 2R18A 2XF3A 4G3OA 4IBJA 3VDUA 5C1BA 5L8RF 2EO2A 2X49A 1SG9A 4IBGA 5EXTA 4G4OA 2L2DA 3AFHA 1SXJA 2I7PA
chains in the Genus database with same CATH topology
2QNJA 2QSFX 2K0BX 1T43A 1C7YA 2JY8A 2MJ5B 2DAIA 2QHOB 3GLIE 1XXHE 2DAKA 2OOAA 2BWBA 1EFUB 2H5XA 1DO2A 3MMPA 2LVNC 2JUJA 3E46A 2EKFA 5JI2E 4UN2B 1NV9A 1OQYA 2K9DA 2ZTDA 3FRHA 2DI0A 1OTRA 2OOBA 2KNAA 1E94E 1G3IA 2KHHA 1G41A 2L4EA 3IECA 3GLGE 1MN3A 2LVPC 2LVOC 4R71A 1IFYA 3LCVB 2CWBA 2DENA 3K9OA 1WGNA 1CUKA 3B89A 2L4FA 1ZMUA 1HJPA 2WZJA 1PGYA 1OAIA 1VQ1A 4GEWA 3GLHE 1BVSA 1HT2E 2EJSA 2BWEA 1TTEA 2JZ1A 2KNVA 2LBCA 1OKSA 2RRUA 3LCUA 3FE3A 1Q02A 1YLAA 2JNHA 2MROB 2JY5A 2CP8A 2LVQD 3IHPA 2DZLA 1VEKA 1A5TA 1QZEA 1WHCA 2DAGA 1HT1E 2R0IA 3E21A 1ZMVA 1HQYE 3K9PA 3H4JA 5DFLA 2DAMA 4F1IA 2JY6B 1Y8GA 2HWJA 1ZMWA 1T6OA 1VDLA 1ZV1A 1F4IA 2JY7A 2MGWA 2MR9A 3T6PA 1WR1B 3F92A 2B3TA 1UFZA 2DAEA 2G3QA 1JR3E 1G4AE 1R4GA 2LTUA 2DKLA 2DHYA 2DNAA 2OO9A 1TR8A 4Q7JA 2O25A 1XB2B 2EKKA 1KYIA 4DBGB 3FRIA 1VEGA 1NV8A 1P3QQ 2ZTCA 1IXSA 1WJ7A 2HAKA 2JP7A 1IM2A 4HEOA 2LVAA 3BBZA 1DV0A 4F2LA 3GLFE 2KNZA 2JZ0A 1WGLA 1DO0A 4WP2A 1VEJA 1WIVA 4G3OA 1AIPC 1V92A 1SG9A 1VG5A 1GO5A 2L2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNJ A;  2QSF X;  2K0B X;  1T43 A;  1C7Y A;  2JY8 A;  2MJ5 B;  2DAI A;  2QHO B;  3GLI E;  1XXH E;  2DAK A;  2OOA A;  2BWB A;  1EFU B;  2H5X A;  1DO2 A;  3MMP A;  2LVN C;  2JUJ A;  3E46 A;  2EKF A;  5JI2 E;  4UN2 B;  1NV9 A;  1OQY A;  2K9D A;  2ZTD A;  3FRH A;  2DI0 A;  1OTR A;  2OOB A;  2KNA A;  1E94 E;  1G3I A;  2KHH A;  1G41 A;  2L4E A;  3IEC A;  3GLG E;  1MN3 A;  2LVP C;  2LVO C;  4R71 A;  1IFY A;  3LCV B;  2CWB A;  2DEN A;  3K9O A;  1WGN A;  1CUK A;  3B89 A;  2L4F A;  1ZMU A;  1HJP A;  2WZJ A;  1PGY A;  1OAI A;  1VQ1 A;  4GEW A;  3GLH E;  1BVS A;  1HT2 E;  2EJS A;  2BWE A;  1TTE A;  2JZ1 A;  2KNV A;  2LBC A;  1OKS A;  2RRU A;  3LCU A;  3FE3 A;  1Q02 A;  1YLA A;  2JNH A;  2MRO B;  2JY5 A;  2CP8 A;  2LVQ D;  3IHP A;  2DZL A;  1VEK A;  1A5T A;  1QZE A;  1WHC A;  2DAG A;  1HT1 E;  2R0I A;  3E21 A;  1ZMV A;  1HQY E;  3K9P A;  3H4J A;  5DFL A;  2DAM A;  4F1I A;  2JY6 B;  1Y8G A;  2HWJ A;  1ZMW A;  1T6O A;  1VDL A;  1ZV1 A;  1F4I A;  2JY7 A;  2MGW A;  2MR9 A;  3T6P A;  1WR1 B;  3F92 A;  2B3T A;  1UFZ A;  2DAE A;  2G3Q A;  1JR3 E;  1G4A E;  1R4G A;  2LTU A;  2DKL A;  2DHY A;  2DNA A;  2OO9 A;  1TR8 A;  4Q7J A;  2O25 A;  1XB2 B;  2EKK A;  1KYI A;  4DBG B;  3FRI A;  1VEG A;  1NV8 A;  1P3Q Q;  2ZTC A;  1IXS A;  1WJ7 A;  2HAK A;  2JP7 A;  1IM2 A;  4HEO A;  2LVA A;  3BBZ A;  1DV0 A;  4F2L A;  3GLF E;  2KNZ A;  2JZ0 A;  1WGL A;  1DO0 A;  4WP2 A;  1VEJ A;  1WIV A;  4G3O A;  1AIP C;  1V92 A;  1SG9 A;  1VG5 A;  1GO5 A;  2L2D A; 
#chains in the Genus database with same CATH topology
 2V1C A;  4NC6 A;  3GPY A;  2QNJ A;  4L15 A;  3TQS A;  1XHB A;  1TDH A;  3PVS A;  1HNW M;  1JQJ C;  1QAM A;  3GLG A;  3U60 A;  2QHO B;  3V76 A;  1Q3B A;  1DGG A;  4FVM A;  3GLI E;  3U6M A;  4BBA A;  4D81 A;  2R6F A;  2H5X A;  3LVW A;  2VDB B;  4FWG A;  1GL6 A;  5FTN A;  2CUZ A;  3FUU A;  4FCT A;  4OVZ A;  1HNZ M;  4PT5 A;  1QVR A;  4MGK E;  5KPZ A;  3M7G A;  3EIH A;  4LF6 M;  3CGW A;  4LFC M;  1MN3 A;  2H1R A;  2LVP C;  3SHG B;  5ITU A;  3U6O A;  2KEB A;  2XEP A;  2GNO A;  2CWB A;  3K9O A;  3LVV A;  3U61 B;  1WGN A;  4DV5 M;  1D0K A;  3FUT A;  4DUZ M;  3SC3 A;  4HLQ A;  3CTW B;  4LCB A;  2P5T A;  2UUC M;  1XNQ M;  2JA2 A;  3ZCB B;  4IBE A;  4CJ6 A;  3OTO M;  1RU3 A;  1HJP A;  3KW6 A;  5IT9 S;  2LH0 A;  4JN6 A;  2KZS A;  3D8L A;  3GRY A;  1QAQ A;  1OAI A;  2EA0 A;  3MK6 A;  3GP1 A;  1VQ1 A;  2CHQ A;  3K1J A;  4B7G A;  2JZ1 A;  1TTE A;  1HQC A;  4AKI A;  1L2B A;  3FD9 A;  3T15 A;  3TE6 A;  5ITQ A;  3HWS A;  3FE3 A;  2UXD M;  2JNH A;  2MRO B;  1D0L A;  2G8L A;  3C58 A;  2DWL A;  2QBY A;  4L8R C;  1NJF A;  3U6S A;  3UJN A;  3I01 M;  2Z8Y M;  4L4U A;  3IHP A;  4LF4 M;  4GMQ A;  4DV3 M;  2EUC A;  1VEK A;  4DR5 M;  2ZAO A;  3AL0 C;  4AI6 A;  2QP9 X;  3KVW A;  3L29 A;  1R6B X;  4PDG A;  5A2Q S;  4L16 A;  1Z6T A;  2X8A A;  4II7 A;  1HQY E;  1IQP A;  3HU1 A;  4DR2 M;  1Z5A A;  5FTJ A;  3D8B A;  4BLC A;  4MGZ E;  5EP3 A;  1OIZ A;  2Z7J A;  5EXS A;  1Y8G A;  4QNR A;  1J5E M;  3VFD A;  2FE8 A;  1ZV1 A;  2ZAN A;  4LY6 A;  2MH8 A;  3BXW A;  2JY7 A;  3RFW A;  1WR1 B;  1KFV A;  2B3T A;  1UFZ A;  4JXJ A;  2QQ8 A;  1OFH A;  4RNA A;  1KSF X;  4OX9 M;  1JR3 E;  1G4A E;  1R4G A;  3AV0 A;  3C3D A;  3HJ8 A;  2DKL A;  2C96 A;  4LJ9 A;  1E9S A;  3R8F A;  1EIJ A;  2DNA A;  4MH0 E;  4QHS A;  4YY3 M;  2F5P A;  4LF7 M;  4NSR A;  1DGH A;  1XB2 B;  4DV7 M;  4LF8 M;  1G59 A;  1Q39 A;  4LJ8 A;  3IG5 A;  4DR1 M;  3U6D A;  1P3Q Q;  4CIZ A;  2HAK A;  4IBB A;  3KOW E;  1XMO M;  2JP7 A;  4LZJ A;  2I7N A;  1R2Z A;  3B74 A;  3DA1 A;  4HEO A;  1YSY A;  5ITT A;  2CFO A;  3PNV A;  4L6V 6;  2F4V M;  2O01 F;  2DWN A;  3ZH9 B;  1IY1 A;  3U61 A;  4G4Q A;  3RGP A;  1WXQ A;  2LNH C;  3KOX E;  2Y0Q A;  3MJ5 A;  3QYE A;  4GC9 A;  4DUY M;  3T1H M;  4DR6 M;  2XGN A;  2D7G A;  3L26 A;  2HCB A;  4GHL A;  1WGL A;  5FTL A;  3GLF B;  4TUW A;  2E5L M;  4JI1 M;  5DYG A;  5IZ7 D;  3AOE A;  3W0L B;  3LW5 F;  1VEJ A;  4DR3 M;  2VF7 A;  4WW0 A;  4OW0 A;  2CRU A;  3FTE A;  1GO5 A;  1K3W A;  4NXM M;  2C9C A;  2WSF F;  4DV0 M;  5KQ8 A;  4LJ5 A;  3SYK A;  4G4R A;  1HR0 M;  2QSF X;  1T43 A;  4FWD A;  3HX3 A;  4B3S M;  2Q2E B;  2JY8 A;  1NY5 A;  1YE9 A;  2DAI A;  2MJ5 B;  3HZJ A;  3J27 B;  3ZC7 B;  4DV6 M;  1K82 A;  1EE8 A;  4FCV A;  1N34 M;  1XXH E;  2BJW A;  2DAK A;  2OOA A;  3SYL A;  4IIW A;  1EFU B;  2K47 A;  4EIW A;  1L1Z A;  1SXJ E;  2KA6 B;  4LJ4 A;  5JI2 E;  1NV9 A;  5ITY A;  1IXR C;  2BNK A;  3I51 A;  4M0W A;  3SAV A;  1QQW A;  2DI0 A;  2C5R A;  2OOB A;  1Z5C A;  4M0D A;  4DR4 M;  3U5Z A;  2KNA A;  2KHH A;  3IG8 A;  3DFZ A;  3QWL A;  3GLG E;  5FTK A;  1NY6 A;  2D7H A;  3SAW A;  3RGS A;  2DZN B;  4R71 A;  3FKE A;  1IFY A;  1IBL M;  3VKG A;  1MX0 A;  4ITQ A;  1FNN A;  3B89 A;  3HY5 A;  4B3M M;  5IWA M;  1QUT A;  2LHC A;  2L4F A;  1ZMU A;  5BR8 M;  1V34 A;  1N77 A;  2ZBK B;  3VK7 A;  5H37 D;  1G8P A;  2GQF A;  5KQD A;  4IJF A;  1I94 M;  1OIP A;  1K3X A;  4OU7 A;  3BOS A;  3AKZ A;  3GRU A;  4JI2 M;  4GEW A;  4JI4 M;  3KOZ E;  2EJS A;  1HT2 E;  1Q3C A;  2C98 A;  2Z4R A;  3NWL A;  3VKH A;  3GLH B;  2LBC A;  1OKS A;  2R65 A;  2RRU A;  4AZF A;  4BB9 A;  3FYC A;  3T38 A;  1DGB A;  2QPA A;  4GKJ M;  4M9Z A;  1N75 A;  2L7I A;  4CGY B;  2JY5 A;  1L2C A;  2R4E A;  2CP8 A;  2DZO B;  1YUB A;  1IXZ A;  1TF0 B;  3B7Q A;  1GKI A;  3QYB A;  2YFQ A;  1A5T A;  5F3W A;  1QZE A;  1FJG M;  1QDT A;  1HT1 E;  3FTC A;  4X65 M;  3E21 A;  4DV4 M;  4KOD A;  2XZF A;  3J7A S;  3K9P A;  1R2Y A;  2YQZ A;  2CE7 A;  4I5S A;  3U5Z B;  1SXJ C;  5DFL A;  2KW0 A;  1L2D A;  1IN6 A;  4AKH A;  4QOS A;  4F1I A;  2JY6 B;  4NXN M;  5ITX A;  3JR4 A;  1ZMW A;  5BPV A;  3M6A A;  1F4I A;  2MGW A;  1IBM M;  2DAE A;  1N36 M;  1Z59 A;  4S12 A;  4B7H A;  1NHG C;  4PD2 A;  3JAM S;  4NSO B;  4GHA A;  3GLI A;  4AG5 A;  3HHX A;  4IBK A;  4P16 A;  2DHY A;  3LQR A;  1V33 A;  4JI0 M;  1PJJ A;  3AOG A;  4IJE A;  4P17 A;  4GC5 A;  4Q7J A;  1KYI A;  2QEN A;  2UXB M;  5FLX S;  3GLF A;  1IY2 A;  1X37 A;  3DOA A;  3VK8 A;  1TDZ A;  5EJC A;  3EIE A;  1NV8 A;  5GKN A;  5IRE B;  1WJ7 A;  4X62 M;  4GRI A;  4LFB M;  3SAS A;  1OFI A;  1DV0 A;  3TWK A;  3E4R A;  4K0K M;  3FYD A;  4AW4 A;  3LQQ A;  4ZPX A;  4XGI A;  4Z8X A;  3PXG A;  2L6O A;  2JZ0 A;  2LHG A;  4YHH M;  1MU5 A;  4Z6Y A;  2HKJ A;  1NSF A;  4RF1 A;  2L09 A;  4NL4 H;  4JYA M;  2BJV A;  2CHV A;  4REZ A;  3K2L A;  2V1U A;  1VG5 A;  3A45 A;  1R5L A;  2KRU A;  1GL7 A;  1NHW C;  2UXC M;  1D0M A;  1MJG M;  2K0B X;  2L7H A;  3KS8 A;  2FS1 A;  2R45 A;  3GQ4 A;  3FUW A;  2FNA A;  2BWB A;  2QZ4 A;  3GLI B;  2LVN C;  3U6P A;  3KFU G;  2R44 A;  3HHW A;  1AUA A;  2FH0 A;  2EKF A;  4UN2 B;  2K9D A;  3MHV C;  4WUR A;  3KOY E;  1E94 E;  1G3I A;  2L4E A;  1G41 A;  1NJG A;  3GPX A;  2VII A;  3TWL A;  2CV1 A;  3CF0 A;  1T3T A;  1QAN A;  3NBX X;  4NRV A;  2LVO C;  3GLH A;  4MM3 B;  1IBK M;  2A5Y B;  4B3T M;  1GJS A;  2M5Z A;  1Z5B A;  3B7Z A;  1JR3 D;  4XBO A;  3B9P A;  2VF8 A;  3HGI A;  2J5Y A;  1L1T A;  2VQE M;  1JR3 A;  3RE8 A;  3DZD A;  3I4V A;  2JWS A;  3WHK A;  3FUV A;  1UM8 A;  1PGY A;  1TH4 A;  2DHR A;  2FOI C;  2WZJ A;  1VDD A;  2NQ8 C;  5EP2 A;  3L2A A;  2J7N A;  3QAU A;  5KO3 A;  2BWE A;  4W5W A;  4DV1 M;  1NVM A;  2OQ4 A;  1PJT A;  7CAT A;  2VQF M;  2JXN A;  3J7B A;  1Q02 A;  1I4W A;  4L78 A;  4DV2 M;  4JI5 M;  3PFI A;  2HHH M;  2DWM A;  2ZAM A;  3PNY A;  4PCZ A;  5LMN M;  2Y21 A;  2DXI A;  4JI8 M;  3SFZ A;  2LVQ D;  1QZM A;  2DZL A;  4IBC A;  5FTM A;  1H6U A;  3TWM A;  1NNJ A;  2F5N A;  2LXE A;  3SBJ A;  3U6E A;  1WHC A;  3HKP A;  4R3D A;  2R62 A;  2DAG A;  3AOE C;  4LJ7 A;  4AQY M;  3KP1 E;  1ZMV A;  4FCW A;  4KT0 F;  4I81 A;  1NO1 A;  4GIT A;  1TGU A;  3UK6 A;  2K6B A;  2CHG A;  2XFT A;  2DAM A;  3GPU A;  1XMQ M;  1E9R A;  1T6O A;  1VDL A;  4M9X A;  3HHY A;  4RKU F;  5EP1 A;  3U6L A;  3F92 A;  2ERC A;  2UUB M;  3H4M A;  2LTU A;  3J2P B;  3UGJ A;  1OJL A;  1N33 M;  3HJS A;  3TL4 X;  4MGH A;  2F5Q A;  3W68 A;  4QOZ C;  1QDR A;  2OO9 A;  3B7N A;  1TR8 A;  1NNU C;  3GO8 A;  1IN7 A;  2XSZ D;  4PDI A;  1LV7 A;  2KXE A;  4ANR A;  5ITX E;  3SAU A;  3J80 S;  4DBG B;  4FD2 A;  3FRI A;  3SAR A;  2OPF A;  2XSZ A;  1VEG A;  2R4J A;  1XWI A;  2ZTC A;  4LRT A;  5DNY A;  1TH3 A;  4X64 M;  2Z3X A;  2X4A A;  3K92 A;  2C99 A;  1GVN A;  3L28 A;  4LFA M;  2DWZ B;  2LVA A;  4CIS A;  3BBZ A;  3KSX A;  1W5S A;  2KRK A;  3VLF B;  4G6Z A;  4LJA A;  2KZU A;  4FW9 A;  2KNZ A;  3GLF E;  2WSE F;  4DR7 M;  1QAO A;  4I8O A;  3W0F A;  4QNM A;  5EXP A;  2D7E A;  1DO0 A;  1GLN A;  4WP2 A;  1ZAE A;  1IXS B;  1WIV A;  2Y0T A;  4X66 M;  5EQT A;  1AIP C;  1V92 A;  4D82 A;  2J7O A;  4NOO B;  1R7R A;  3W67 A;  2DVW B;  5KPT A;  4B08 A;  3E9S A;  1XC8 A;  3GRR A;  4HL4 A;  3ILK A;  2V6Z M;  3KS4 A;  5EXX A;  1C7Y A;  4IBI A;  1W5T A;  1HNX M;  3GQ5 A;  2RGH A;  3HHZ A;  1XNR M;  3Q8X A;  3GQ3 A;  3MMP A;  1DO2 A;  1IN8 A;  1XXH B;  3KXE C;  4I4L A;  2XH9 A;  2JUJ A;  3SMS A;  3E46 A;  4KO8 A;  2XLJ A;  1OQY A;  3T1Y M;  1SXJ B;  2ZTD A;  3FRH A;  3M0E A;  3FUX A;  4KLN A;  1OTR A;  3K8Z A;  5FSW A;  2CEA A;  3A98 B;  4CHT B;  3SHF A;  1IN4 A;  3IEC A;  5ITR A;  2CV2 A;  2Z4S A;  4LGM A;  4LJ6 A;  3CF2 A;  4FWH A;  3C3E A;  3GLG B;  3UZU A;  3U60 B;  2CV0 A;  3LCV B;  2DEN A;  5E26 A;  1CUK A;  2QCU A;  4LF9 M;  2LWX A;  2R46 A;  4D80 A;  3CF6 E;  3HU2 A;  2APL A;  2FFJ A;  4OVZ B;  3SAT A;  3L27 A;  4MB7 A;  3A46 A;  2XZU A;  1DGF A;  1PJS A;  1E32 A;  2N35 A;  1OAO C;  2KDL A;  3FTF A;  3GLH E;  3NBI A;  1BVS A;  1IN5 A;  1G71 A;  2KNV A;  5JI3 E;  1PM5 A;  1N32 M;  5KPR A;  2M60 A;  2G5G X;  2XFS A;  3LCU A;  3Q8G A;  4R7G A;  2Y20 A;  1YLA A;  1ORY B;  4AKG A;  4JI3 M;  2O5R A;  2ZM6 M;  3I4Y A;  3WHL A;  4Y28 F;  2F5O A;  3KDS E;  2AHM A;  2RKO A;  3R9X B;  4GIP A;  4IBF A;  1PJI A;  2YR0 A;  4LZZ A;  2R0I A;  3C9P A;  2HL7 A;  4A3V B;  1S3S A;  2F5S A;  3H4J A;  1ZQ9 A;  1IY0 A;  3J81 S;  2RGO A;  2W82 A;  2QBY B;  3I04 M;  3TPZ A;  3VDP A;  3UMM A;  1C1K A;  1L8Q A;  4IBD A;  2HWJ A;  4LRS A;  3U6Q A;  3FTD A;  2MR9 A;  4MGI E;  3T6P A;  4JV5 M;  1JB0 F;  4MGY E;  2C9O A;  5DYI A;  2G3Q A;  4QHT A;  4XK8 F;  4JI6 M;  4KHP M;  1D2N A;  5E6J A;  3A42 A;  3GRV A;  3KSJ A;  4GKK M;  1QYR A;  1GAB A;  2O25 A;  4LF5 M;  2EKK A;  4RF0 A;  5LMU M;  8CAT A;  3GPP A;  2YNM D;  2WSC F;  1QUS A;  4M9S A;  1IXS A;  3SMP A;  4GH9 A;  3ZQJ A;  4JI7 M;  5EP4 A;  1GJT A;  1N78 A;  1PRB A;  1TH2 A;  3HU3 A;  1IM2 A;  3JR5 A;  4G4N A;  4LGY A;  2UUA M;  1J7K A;  4AG6 A;  3THG A;  5C18 A;  3U6C A;  3AJI B;  1LTM A;  4F2L A;  1DGH B;  4LG2 A;  1J09 A;  1PJQ A;  4NRW A;  3LMM A;  3HJQ A;  3L25 A;  4B7F A;  2UU9 M;  4B3R M;  3KP0 E;  1SXJ D;  1XXH A;  2R18 A;  2XF3 A;  4G3O A;  4IBJ A;  3VDU A;  5C1B A;  5L8R F;  2EO2 A;  2X49 A;  1SG9 A;  4IBG A;  5EXT A;  4G4O A;  2L2D A;  3AFH A;  1SXJ A;  2I7P A; 
#chains in the Genus database with same CATH homology
 2QNJ A;  2QSF X;  2K0B X;  1T43 A;  1C7Y A;  2JY8 A;  2MJ5 B;  2DAI A;  2QHO B;  3GLI E;  1XXH E;  2DAK A;  2OOA A;  2BWB A;  1EFU B;  2H5X A;  1DO2 A;  3MMP A;  2LVN C;  2JUJ A;  3E46 A;  2EKF A;  5JI2 E;  4UN2 B;  1NV9 A;  1OQY A;  2K9D A;  2ZTD A;  3FRH A;  2DI0 A;  1OTR A;  2OOB A;  2KNA A;  1E94 E;  1G3I A;  2KHH A;  1G41 A;  2L4E A;  3IEC A;  3GLG E;  1MN3 A;  2LVP C;  2LVO C;  4R71 A;  1IFY A;  3LCV B;  2CWB A;  2DEN A;  3K9O A;  1WGN A;  1CUK A;  3B89 A;  2L4F A;  1ZMU A;  1HJP A;  2WZJ A;  1PGY A;  1OAI A;  1VQ1 A;  4GEW A;  3GLH E;  1BVS A;  1HT2 E;  2EJS A;  2BWE A;  1TTE A;  2JZ1 A;  2KNV A;  2LBC A;  1OKS A;  2RRU A;  3LCU A;  3FE3 A;  1Q02 A;  1YLA A;  2JNH A;  2MRO B;  2JY5 A;  2CP8 A;  2LVQ D;  3IHP A;  2DZL A;  1VEK A;  1A5T A;  1QZE A;  1WHC A;  2DAG A;  1HT1 E;  2R0I A;  3E21 A;  1ZMV A;  1HQY E;  3K9P A;  3H4J A;  5DFL A;  2DAM A;  4F1I A;  2JY6 B;  1Y8G A;  2HWJ A;  1ZMW A;  1T6O A;  1VDL A;  1ZV1 A;  1F4I A;  2JY7 A;  2MGW A;  2MR9 A;  3T6P A;  1WR1 B;  3F92 A;  2B3T A;  1UFZ A;  2DAE A;  2G3Q A;  1JR3 E;  1G4A E;  1R4G A;  2LTU A;  2DKL A;  2DHY A;  2DNA A;  2OO9 A;  1TR8 A;  4Q7J A;  2O25 A;  1XB2 B;  2EKK A;  1KYI A;  4DBG B;  3FRI A;  1VEG A;  1NV8 A;  1P3Q Q;  2ZTC A;  1IXS A;  1WJ7 A;  2HAK A;  2JP7 A;  1IM2 A;  4HEO A;  2LVA A;  3BBZ A;  1DV0 A;  4F2L A;  3GLF E;  2KNZ A;  2JZ0 A;  1WGL A;  1DO0 A;  4WP2 A;  1VEJ A;  1WIV A;  4G3O A;  1AIP C;  1V92 A;  1SG9 A;  1VG5 A;  1GO5 A;  2L2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...