2L4FA

Nmr structure of the uba domain of s. cerevisiae dcn1 bound to ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Defective in cullin neddylation protein 1
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4fA00
3IHPA 2LVAA 1T43A 3GLFE 1JR3E 3LCUA 2JZ1A 2QSFX 2JY6B 2RRUA 3GLGE 1P3QQ 2HAKA 4F1IA 1VG5A 4GEWA 1HT2E 1WHCA 2JNHA 4Q7JA 1KYIA 2KNAA 4WP2A 2L4EA 2DAKA 1TTEA 1F4IA 2DAGA 2QNJA 2L2DA 1VEJA 1ZMUA 1DV0A 3K9PA 2BWEA 1HJPA 2DENA 3E21A 1Y8GA 1GO5A 2LVOC 2H5XA 1R4GA 3FE3A 1YLAA 2JY5A 3F92A 2DAMA 1G4AE 1C7YA 2LVNC 1IM2A 1WR1B 2G3QA 3IECA 5DFLA 2K0BX 1XXHE 1CUKA 4UN2B 2OOBA 1MN3A 1DO0A 1ZV1A 2CP8A 2LVQD 3K9OA 3BBZA 3T6PA 2KNVA 2ZTCA 2JZ0A 1Q02A 1E94E 1WIVA 1DO2A 1HQYE 4DBGB 1OQYA 2HWJA 2MROB 1WJ7A 1UFZA 1G3IA 2DHYA 1A5TA 1NV9A 2EKKA 2JY8A 1OTRA 2LVPC 2OOAA 1T6OA 4R71A 1AIPC 2JP7A 2K9DA 1G41A 1EFUB 2O25A 1OAIA 4F2LA 3FRIA 2BWBA 3H4JA 2LTUA 1XB2B 1IXSA 1WGLA 3GLIE 2JUJA 1VDLA 1VEKA 2EKFA 2OO9A 1V92A 2DI0A 1SG9A 2MGWA 1QZEA 1VQ1A 2DZLA 2KNZA 2WZJA 4G3OA 2DAIA 1BVSA 2LBCA 2JY7A 1NV8A 2L4FA 1HT1E 1WGNA 2MJ5B 2CWBA 1OKSA 1IFYA 2DNAA 3GLHE 3B89A 2EJSA 2MR9A 2DKLA 3LCVB 4HEOA 2ZTDA 1PGYA 1TR8A 2B3TA 1ZMVA 1ZMWA 2KHHA 3E46A 2QHOB 3FRHA 5JI2E 2R0IA 3MMPA 2DAEA 1VEGA
chains in the Genus database with same CATH superfamily
2LVAA 2KXEA 1D0KA 2LXEA 2JZ1A 1TGUA 2QSFX 4DV6M 2F5NA 1HQCA 4HLQA 2JY6B 3CGWA 3FD9A 3HWSA 5EP3A 5KQ8A 3TQSA 1GL6A 2M5ZA 3T1YM 1FJGM 2DVWB 4IBBA 1QUSA 2R45A 2QQ8A 1IN5A 3HJSA 3PXGA 4DUZM 3FKEA 3WHKA 3GQ5A 5FTNA 4GRIA 5LMNM 1EIJA 3ZH9B 2UXDM 2L4EA 2DAKA 2R4EA 8CATA 1TTEA 5E6JA 3I4VA 4L15A 2ZANA 4ZPXA 3D8LA 1DV0A 2BJWA 2LNHC 4B7GA 2DENA 4B7FA 5ITQA 3MK6A 1GO5A 2LVOC 3GRYA 5FTJA 4LJAA 1IN6A 3M7GA 3KS8A 4KHPM 1OJLA 4BBAA 1YLAA 2DAMA 3HKPA 1QAOA 3L28A 5C1BA 4GIPA 3AFHA 2G3QA 3GRUA 2J7OA 5DFLA 4IBGA 2CV0A 3R9XB 2R4JA 4RKUF 3J2PB 1L2CA 4GKJM 5ITTA 2CEAA 3ZQJA 2OQ4A 1PM5A 2P5TA 3KOYE 5LMUM 3E4RA 4B3TM 2LVQD 4LFBM 1D0LA 1QAQA 3SAUA 4LGMA 3NBXX 2JZ0A 5KPTA 1Q02A 4HL4A 5IWAM 3TWMA 4OVZB 4MM3B 3AOGA 2LH0A 2DHRA 2Z8YM 2QENA 3CF0A 4NXNM 1Z5CA 3FTCA 4L4UA 1WJ7A 4LJ9A 4R7GA 5EP4A 5ITRA 1NJGA 3VK8A 1GABA 1IY0A 1OTRA 1L1ZA 5IREB 2HCBA 4GITA 1IN8A 2H1RA 1IBLM 3SATA 1XNQM 1T6OA 1SXJA 3U6MA 4RF0A 5IT9S 2DZNB 3SASA 3LMMA 1EFUB 2O25A 4QHTA 5FTKA 3GLFA 3FRIA 2M60A 3SBJA 1E32A 1KSFX 3HHWA 4QHSA 3GLIE 4B7HA 1VEKA 1SG9A 1V92A 4MGHA 3OTOM 3FUXA 3GRVA 2BJVA 1VQ1A 2R62A 2KDLA 3K92A 2DAIA 1BVSA 3CTWB 2JY7A 4DR3M 4AQYM 3SMSA 1HT1E 2CRUA 3GPUA 5DYGA 1OKSA 3W68A 1IY2A 1IFYA 1ORYB 2LHCA 3HJ8A 2UUBM 3B89A 3LQRA 3HY5A 4AKGA 4M9ZA 4JN6A 4IBFA 3RFWA 3GP1A 4LF9M 4OW0A 1PRBA 1G8PA 3B7QA 4LF7M 2D7GA 1K3XA 1H6UA 1Q3CA 2DKLA 3LQQA 1GLNA 2ZTDA 4HEOA 4BB9A 1MX0A 3AL0C 4DV4M 5FTLA 3HX3A 3E46A 3B7ZA 3FTDA 2QHOB 3GLHB 4GHAA 3QAUA 3T38A 3IHPA 3UMMA 2UXCM 1IXSB 1JR3E 3HU3A 4IBJA 1SXJD 3JAMS 3FTFA 1QUTA 2V6ZM 2X49A 4CIZA 1XHBA 3TE6A 1NY5A 3U6SA 2G5GX 4KLNA 1V34A 1P3QQ 5JI3E 1R5LA 4DV2M 2HAKA 2QP9X 2V1UA 4TUWA 4GEWA 4Z6YA 1GVNA 3U6LA 4DR2M 1X37A 2CE7A 2JNHA 4B08A 4YY3M 4JV5M 2Y21A 3TL4X 1KYIA 3GLGB 3GLHA 4WP2A 2LWXA 2OPFA 3PVSA 2C9CA 1TDZA 1ZMUA 4CISA 3VKHA 4FCWA 1L2BA 2BWEA 3SC3A 3SFZA 1HJPA 4OX9M 4AI6A 3HJQA 2H5XA 2R18A 1QZMA 2KW0A 3V76A 2D7EA 1MU5A 2ZAOA 4IBKA 4RNAA 2XFSA 3VFDA 2KRKA 1QDTA 1G4AE 2MH8A 3HU2A 2FE8A 3AKZA 1LV7A 3IECA 4QNRA 1QVRA 1N36M 1XXHE 3L26A 1PJQA 3FUWA 3AV0A 2EUCA 3KSXA 1N78A 1TDHA 1CUKA 3U6PA 2VDBB 1MN3A 1PJTA 2HHHM 3K9OA 3K8ZA 3BBZA 4DV1M 4CHTB 5E26A 3A98B 3KP0E 4NOOB 1GKIA 2XZFA 1WIVA 2XH9A 4G4NA 1HR0M 4DBGB 2F5QA 4KT0F 2HWJA 4FCTA 1D2NA 5EXPA 4AKIA 1RU3A 1J5EM 3HHYA 2VF7A 4I8OA 1DGHB 1J09A 1NV9A 3IG5A 3RGPA 2CHQA 1NHWC 2JY8A 4JI3M 2C5RA 4JYAM 4WURA 1FNNA 3U5ZB 3EIHA 3TWKA 1Z59A 2DXIA 3PFIA 4JI6M 3DZDA 3M0EA 1AIPC 3AJIB 5FSWA 4DUYM 2D7HA 2V1CA 4CGYB 3BOSA 1OAIA 4XGIA 2XLJA 3C3DA 3GPPA 2DWNA 1SXJE 4IBEA 1XXHA 4LF5M 2BWBA 3H4JA 3GLIB 2L09A 2LTUA 1XB2B 2CV2A 1DGBA 3W0FA 2CV1A 4W5WA 1OFIA 1XNRM 2KRUA 4NRVA 2EKFA 3UZUA 4M0WA 2DI0A 2O5RA 2R6FA 4ITQA 3DOAA 5ITYA 2L6OA 4K0KM 3H4MA 3HU1A 2DZLA 2KNZA 1R6BX 1Q3BA 3U5ZA 2Y0TA 5EXTA 3M6AA 4GH9A 4M9XA 5FTMA 4DV5M 1IQPA 2MJ5B 1MJGM 3L2AA 2DNAA 3VLFB 3J7AS 4DV7M 4LFAM 4L8RC 3DA1A 2C98A 2QCUA 1XXHB 5EJCA 1VDDA 4PDIA 1SXJB 2UXBM 2APLA 2L7IA 2MR9A 3CF6E 3LCVB 2XSZD 1PGYA 5FLXS 2B3TA 1E9RA 1TH4A 2JXNA 2XGNA 3ZCBB 2CFOA 3ILKA 3KVWA 2R0IA 3L29A 1JB0F 3MMPA 4IBDA 1VEGA 4LF8M 4NL4H 4QOZC 1T43A 3FYCA 2KEBA 5ITXE 3GQ3A 3L25A 5KPRA 1IXZA 2A5YB 2RRUA 2W82A 3DFZA 3GPYA 3Q8GA 3U6CA 1I94M 3B74A 3EIEA 1EE8A 4GKKM 3J80S 4G6ZA 4LZZA 1Z5BA 1G59A 3TWLA 2JWSA 2R44A 1VG5A 4F1IA 2ERCA 1IN7A 3RGSA 2Z4SA 3SMPA 2EA0A 2X4AA 4I81A 4NSRA 3TPZA 4NRWA 2AHMA 1NVMA 2QBYA 4G4QA 4Q7JA 1UM8A 1W5SA 4MGZE 4MH0E 2DAGA 2L2DA 1C1KA 1VEJA 1XMOM 2RGHA 3GRRA 3W0LB 5EXXA 3K9PA 1DGHA 1YSYA 3I51A 3E21A 4LJ4A 1Y8GA 4OU7A 1W5TA 1NNJA 2EO2A 2K47A 1R4GA 3FE3A 4G4RA 1DGGA 3F92A 4ANRA 2WSFF 2X8AA 5ITXA 1WR1B 3U61A 1L8QA 4FCVA 1QANA 4LZJA 2QBYB 4LFCM 4PDGA 1QYRA 4AG6A 2XEPA 4LJ5A 4R3DA 3GLIA 1J7KA 1JQJC 1ZV1A 2Z4RA 3SAWA 2RGOA 3IG8A 2JA2A 2KNVA 4L16A 4JI0M 3U60A 3SARA 4JI2M 2FH0A 2ZTCA 4B3RM 3UJNA 1G71A 2R65A 3NBIA 4MGKE 4X66M 4AG5A 1XC8A 1TH3A 2Q2EB 5BR8M 3GLFB 1L1TA 3E9SA 4EIWA 3KW6A 2UUCM 3AOEA 2QPAA 5C18A 5L8RF 1UFZA 3GQ4A 3RE8A 2DHYA 4LF4M 4KODA 4GC5A 4BLCA 2UUAM 4JI8M 3SYLA 4A3VB 2Z3XA 4D81A 1NSFA 3R8FA 3W67A 4G4OA 3KDSE 3D8BA 2OOAA 4R71A 2FFJA 3I04M 3KOXE 3U6DA 2L7HA 2ZM6M 3KS4A 1HNXM 4B3MM 3SHGB 4DV0M 4JI1M 3K1JA 4JI4M 4OVZA 1T3TA 2CHGA 4X65M 1YUBA 2J7NA 1WGLA 4LGYA 2FS1A 2JUJA 4M9SA 2YFQA 4DR1M 2XSZA 4B3SM 2MGWA 3FUTA 1D0MA 3KXEC 2WZJA 4G3OA 3VK7A 2ZBKB 3B7NA 3K2LA 1XWIA 4LY6A 2DWLA 1N33M 2Z7JA 2LBCA 3C3EA 4AKHA 1XMQM 3A45A 1HNZM 1NV8A 2L4FA 5DYIA 1WGNA 4PD2A 3J27B 3QWLA 2BNKA 2HL7A 3GLHE 1AUAA 1PJJA 4I4LA 2EJSA 1HNWM 4FVMA 4LJ7A 4Z8XA 5KPZA 2G8LA 2R46A 3MJ5A 1ZQ9A 4NSOB 5DNYA 1I4WA 1OFHA 3BXWA 2I7PA 1QAMA 2KHHA 1IBKM 2F5PA 4LCBA 5JI2E 4LF6M 2VQEM 1PJIA 4DR5M 2J5YA 4DR6M 3GLFE 3LCUA 2WSCF 4QNMA 3UGJA 2DZOB 1GJSA 4Y28F 5KQDA 4YHHM 4NXMM 3FYDA 3GLGE 3JR5A 1R2YA 3FUVA 4M0DA 3U6EA 2VQFM 1PJSA 4JXJA 3CF2A 1HT2E 2C9OA 1WHCA 1JR3D 1NJFA 4L6V6 3LVWA 4AW4A 1OAOC 3U60B 2YQZA 4XBOA 3ZC7B 2HKJA 2KNAA 4GHLA 2CUZA 4IJFA 1TH2A 3PNVA 3GO8A 1F4IA 4FWHA 2QNJA 4LG2A 3U6OA 2VF8A 1IY1A 1S3SA 5EQTA 1N32M 3T15A 4LJ6A 2VIIA 1V33A 4NC6A 2FOIC 4IBCA 4X62M 3KP1E 4P17A 4LRTA 4D82A 4IJEA 2JY5A 4X64M 1C7YA 2O01F 2LVNC 1QDRA 1JR3A 1N34M 1IM2A 1E9SA 1N75A 4P16A 2LHGA 5EP1A 3C9PA 3HGIA 3LW5F 4IIWA 4CJ6A 4DR4M 2E5LM 3JR4A 4PT5A 2K0BX 3QYBA 3GLGA 2K6BA 3SAVA 3B9PA 2Y20A 5GKNA 4D80A 4UN2B 3KFUG 2QZ4A 2KZUA 2OOBA 3GPXA 1DO0A 2CP8A 5EP2A 3SHFA 2XFTA 1LTMA 4II7A 3T6PA 2C99A 3SYKA 4MGYE 3LVVA 4PCZA 2YR0A 3Q8XA 1IBMM 1YE9A 1WXQA 2GNOA 1E94E 3NWLA 2Y0QA 3PNYA 1HQYE 1GL7A 1DO2A 3J7BA 2GQFA 4FWGA 3FTEA 1OQYA 2MROB 1GJTA 5KO3A 1G3IA 4MB7A 2F5SA 1A5TA 2EKKA 1DGFA 5F3WA 3HHXA 1TF0B 3FUUA 4JI5M 3QYEA 2XF3A 3J81S 3U6QA 2LVPC 2XZUA 4IBIA 2KZSA 1NO1A 1OIZA 2JP7A 3U61B 4DR7M 4LRSA 2K9DA 5EXSA 3T1HM 1G41A 4LJ8A 3WHLA 4AZFA 4REZA 3A46A 1K82A 3VDUA 4F2LA 1R2ZA 1Q39A 1R7RA 2WSEF 1IXSA 1VDLA 2C96A 2OO9A 3I4YA 3KSJA 1OIPA 4GC9A 4JI7M 2ZAMA 4XK8F 2N35A 1QZEA 5ITUA 3I01M 3KOZE 2RKOA 3AOEC 3VKGA 2I7NA 1N77A 1ZAEA 2FNAA 4RF1A 4FW9A 5BPVA 3THGA 1NY6A 1QQWA 4DV3M 2DWZB 2CWBA 2F4VM 1NNUC 4GMQA 4FWDA 4WW0A 5IZ7D 1SXJC 7CATA 3UK6A 5H37D 4KO8A 3C58A 1L2DA 3KOWE 1IXRC 4L78A 2NQ8C 3A42A 2F5OA 4FD2A 1K3WA 3VDPA 4MGIE 1IN4A 1Z6TA 1KFVA 4S12A 1TR8A 3HHZA 4QOSA 3HZJA 1Z5AA 1ZMVA 1ZMWA 2CHVA 3L27A 3FRHA 3MHVC 4I5SA 2DWMA 1NHGC 2UU9M 2KA6B 2DAEA 5A2QS 2YNMD
chains in the Genus database with same CATH topology
3IHPA 2LVAA 1T43A 3GLFE 1JR3E 3LCUA 2JZ1A 2QSFX 2JY6B 2RRUA 3GLGE 1P3QQ 2HAKA 4F1IA 1VG5A 4GEWA 1HT2E 1WHCA 2JNHA 4Q7JA 1KYIA 2KNAA 4WP2A 2L4EA 2DAKA 1TTEA 1F4IA 2DAGA 2QNJA 2L2DA 1VEJA 1ZMUA 1DV0A 3K9PA 2BWEA 1HJPA 2DENA 3E21A 1Y8GA 1GO5A 2LVOC 2H5XA 1R4GA 3FE3A 1YLAA 2JY5A 3F92A 2DAMA 1G4AE 1C7YA 2LVNC 1IM2A 1WR1B 2G3QA 3IECA 5DFLA 2K0BX 1XXHE 1CUKA 4UN2B 2OOBA 1MN3A 1DO0A 1ZV1A 2CP8A 2LVQD 3K9OA 3BBZA 3T6PA 2KNVA 2ZTCA 2JZ0A 1Q02A 1E94E 1WIVA 1DO2A 1HQYE 4DBGB 1OQYA 2HWJA 2MROB 1WJ7A 1UFZA 1G3IA 2DHYA 1A5TA 1NV9A 2EKKA 2JY8A 1OTRA 2LVPC 2OOAA 1T6OA 4R71A 1AIPC 2JP7A 2K9DA 1G41A 1EFUB 2O25A 1OAIA 4F2LA 3FRIA 2BWBA 3H4JA 2LTUA 1XB2B 1IXSA 1WGLA 3GLIE 2JUJA 1VDLA 1VEKA 2EKFA 2OO9A 1V92A 2DI0A 1SG9A 2MGWA 1QZEA 1VQ1A 2DZLA 2KNZA 2WZJA 4G3OA 2DAIA 1BVSA 2LBCA 2JY7A 1NV8A 2L4FA 1HT1E 1WGNA 2MJ5B 2CWBA 1OKSA 1IFYA 2DNAA 3GLHE 3B89A 2EJSA 2MR9A 2DKLA 3LCVB 4HEOA 2ZTDA 1PGYA 1TR8A 2B3TA 1ZMVA 1ZMWA 2KHHA 3E46A 2QHOB 3FRHA 5JI2E 2R0IA 3MMPA 2DAEA 1VEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP A;  2LVA A;  1T43 A;  3GLF E;  1JR3 E;  3LCU A;  2JZ1 A;  2QSF X;  2JY6 B;  2RRU A;  3GLG E;  1P3Q Q;  2HAK A;  4F1I A;  1VG5 A;  4GEW A;  1HT2 E;  1WHC A;  2JNH A;  4Q7J A;  1KYI A;  2KNA A;  4WP2 A;  2L4E A;  2DAK A;  1TTE A;  1F4I A;  2DAG A;  2QNJ A;  2L2D A;  1VEJ A;  1ZMU A;  1DV0 A;  3K9P A;  2BWE A;  1HJP A;  2DEN A;  3E21 A;  1Y8G A;  1GO5 A;  2LVO C;  2H5X A;  1R4G A;  3FE3 A;  1YLA A;  2JY5 A;  3F92 A;  2DAM A;  1G4A E;  1C7Y A;  2LVN C;  1IM2 A;  1WR1 B;  2G3Q A;  3IEC A;  5DFL A;  2K0B X;  1XXH E;  1CUK A;  4UN2 B;  2OOB A;  1MN3 A;  1DO0 A;  1ZV1 A;  2CP8 A;  2LVQ D;  3K9O A;  3BBZ A;  3T6P A;  2KNV A;  2ZTC A;  2JZ0 A;  1Q02 A;  1E94 E;  1WIV A;  1DO2 A;  1HQY E;  4DBG B;  1OQY A;  2HWJ A;  2MRO B;  1WJ7 A;  1UFZ A;  1G3I A;  2DHY A;  1A5T A;  1NV9 A;  2EKK A;  2JY8 A;  1OTR A;  2LVP C;  2OOA A;  1T6O A;  4R71 A;  1AIP C;  2JP7 A;  2K9D A;  1G41 A;  1EFU B;  2O25 A;  1OAI A;  4F2L A;  3FRI A;  2BWB A;  3H4J A;  2LTU A;  1XB2 B;  1IXS A;  1WGL A;  3GLI E;  2JUJ A;  1VDL A;  1VEK A;  2EKF A;  2OO9 A;  1V92 A;  2DI0 A;  1SG9 A;  2MGW A;  1QZE A;  1VQ1 A;  2DZL A;  2KNZ A;  2WZJ A;  4G3O A;  2DAI A;  1BVS A;  2LBC A;  2JY7 A;  1NV8 A;  2L4F A;  1HT1 E;  1WGN A;  2MJ5 B;  2CWB A;  1OKS A;  1IFY A;  2DNA A;  3GLH E;  3B89 A;  2EJS A;  2MR9 A;  2DKL A;  3LCV B;  4HEO A;  2ZTD A;  1PGY A;  1TR8 A;  2B3T A;  1ZMV A;  1ZMW A;  2KHH A;  3E46 A;  2QHO B;  3FRH A;  5JI2 E;  2R0I A;  3MMP A;  2DAE A;  1VEG A; 
#chains in the Genus database with same CATH topology
 2LVA A;  2KXE A;  1D0K A;  2LXE A;  2JZ1 A;  1TGU A;  2QSF X;  4DV6 M;  2F5N A;  1HQC A;  4HLQ A;  2JY6 B;  3CGW A;  3FD9 A;  3HWS A;  5EP3 A;  5KQ8 A;  3TQS A;  1GL6 A;  2M5Z A;  3T1Y M;  1FJG M;  2DVW B;  4IBB A;  1QUS A;  2R45 A;  2QQ8 A;  1IN5 A;  3HJS A;  3PXG A;  4DUZ M;  3FKE A;  3WHK A;  3GQ5 A;  5FTN A;  4GRI A;  5LMN M;  1EIJ A;  3ZH9 B;  2UXD M;  2L4E A;  2DAK A;  2R4E A;  8CAT A;  1TTE A;  5E6J A;  3I4V A;  4L15 A;  2ZAN A;  4ZPX A;  3D8L A;  1DV0 A;  2BJW A;  2LNH C;  4B7G A;  2DEN A;  4B7F A;  5ITQ A;  3MK6 A;  1GO5 A;  2LVO C;  3GRY A;  5FTJ A;  4LJA A;  1IN6 A;  3M7G A;  3KS8 A;  4KHP M;  1OJL A;  4BBA A;  1YLA A;  2DAM A;  3HKP A;  1QAO A;  3L28 A;  5C1B A;  4GIP A;  3AFH A;  2G3Q A;  3GRU A;  2J7O A;  5DFL A;  4IBG A;  2CV0 A;  3R9X B;  2R4J A;  4RKU F;  3J2P B;  1L2C A;  4GKJ M;  5ITT A;  2CEA A;  3ZQJ A;  2OQ4 A;  1PM5 A;  2P5T A;  3KOY E;  5LMU M;  3E4R A;  4B3T M;  2LVQ D;  4LFB M;  1D0L A;  1QAQ A;  3SAU A;  4LGM A;  3NBX X;  2JZ0 A;  5KPT A;  1Q02 A;  4HL4 A;  5IWA M;  3TWM A;  4OVZ B;  4MM3 B;  3AOG A;  2LH0 A;  2DHR A;  2Z8Y M;  2QEN A;  3CF0 A;  4NXN M;  1Z5C A;  3FTC A;  4L4U A;  1WJ7 A;  4LJ9 A;  4R7G A;  5EP4 A;  5ITR A;  1NJG A;  3VK8 A;  1GAB A;  1IY0 A;  1OTR A;  1L1Z A;  5IRE B;  2HCB A;  4GIT A;  1IN8 A;  2H1R A;  1IBL M;  3SAT A;  1XNQ M;  1T6O A;  1SXJ A;  3U6M A;  4RF0 A;  5IT9 S;  2DZN B;  3SAS A;  3LMM A;  1EFU B;  2O25 A;  4QHT A;  5FTK A;  3GLF A;  3FRI A;  2M60 A;  3SBJ A;  1E32 A;  1KSF X;  3HHW A;  4QHS A;  3GLI E;  4B7H A;  1VEK A;  1SG9 A;  1V92 A;  4MGH A;  3OTO M;  3FUX A;  3GRV A;  2BJV A;  1VQ1 A;  2R62 A;  2KDL A;  3K92 A;  2DAI A;  1BVS A;  3CTW B;  2JY7 A;  4DR3 M;  4AQY M;  3SMS A;  1HT1 E;  2CRU A;  3GPU A;  5DYG A;  1OKS A;  3W68 A;  1IY2 A;  1IFY A;  1ORY B;  2LHC A;  3HJ8 A;  2UUB M;  3B89 A;  3LQR A;  3HY5 A;  4AKG A;  4M9Z A;  4JN6 A;  4IBF A;  3RFW A;  3GP1 A;  4LF9 M;  4OW0 A;  1PRB A;  1G8P A;  3B7Q A;  4LF7 M;  2D7G A;  1K3X A;  1H6U A;  1Q3C A;  2DKL A;  3LQQ A;  1GLN A;  2ZTD A;  4HEO A;  4BB9 A;  1MX0 A;  3AL0 C;  4DV4 M;  5FTL A;  3HX3 A;  3E46 A;  3B7Z A;  3FTD A;  2QHO B;  3GLH B;  4GHA A;  3QAU A;  3T38 A;  3IHP A;  3UMM A;  2UXC M;  1IXS B;  1JR3 E;  3HU3 A;  4IBJ A;  1SXJ D;  3JAM S;  3FTF A;  1QUT A;  2V6Z M;  2X49 A;  4CIZ A;  1XHB A;  3TE6 A;  1NY5 A;  3U6S A;  2G5G X;  4KLN A;  1V34 A;  1P3Q Q;  5JI3 E;  1R5L A;  4DV2 M;  2HAK A;  2QP9 X;  2V1U A;  4TUW A;  4GEW A;  4Z6Y A;  1GVN A;  3U6L A;  4DR2 M;  1X37 A;  2CE7 A;  2JNH A;  4B08 A;  4YY3 M;  4JV5 M;  2Y21 A;  3TL4 X;  1KYI A;  3GLG B;  3GLH A;  4WP2 A;  2LWX A;  2OPF A;  3PVS A;  2C9C A;  1TDZ A;  1ZMU A;  4CIS A;  3VKH A;  4FCW A;  1L2B A;  2BWE A;  3SC3 A;  3SFZ A;  1HJP A;  4OX9 M;  4AI6 A;  3HJQ A;  2H5X A;  2R18 A;  1QZM A;  2KW0 A;  3V76 A;  2D7E A;  1MU5 A;  2ZAO A;  4IBK A;  4RNA A;  2XFS A;  3VFD A;  2KRK A;  1QDT A;  1G4A E;  2MH8 A;  3HU2 A;  2FE8 A;  3AKZ A;  1LV7 A;  3IEC A;  4QNR A;  1QVR A;  1N36 M;  1XXH E;  3L26 A;  1PJQ A;  3FUW A;  3AV0 A;  2EUC A;  3KSX A;  1N78 A;  1TDH A;  1CUK A;  3U6P A;  2VDB B;  1MN3 A;  1PJT A;  2HHH M;  3K9O A;  3K8Z A;  3BBZ A;  4DV1 M;  4CHT B;  5E26 A;  3A98 B;  3KP0 E;  4NOO B;  1GKI A;  2XZF A;  1WIV A;  2XH9 A;  4G4N A;  1HR0 M;  4DBG B;  2F5Q A;  4KT0 F;  2HWJ A;  4FCT A;  1D2N A;  5EXP A;  4AKI A;  1RU3 A;  1J5E M;  3HHY A;  2VF7 A;  4I8O A;  1DGH B;  1J09 A;  1NV9 A;  3IG5 A;  3RGP A;  2CHQ A;  1NHW C;  2JY8 A;  4JI3 M;  2C5R A;  4JYA M;  4WUR A;  1FNN A;  3U5Z B;  3EIH A;  3TWK A;  1Z59 A;  2DXI A;  3PFI A;  4JI6 M;  3DZD A;  3M0E A;  1AIP C;  3AJI B;  5FSW A;  4DUY M;  2D7H A;  2V1C A;  4CGY B;  3BOS A;  1OAI A;  4XGI A;  2XLJ A;  3C3D A;  3GPP A;  2DWN A;  1SXJ E;  4IBE A;  1XXH A;  4LF5 M;  2BWB A;  3H4J A;  3GLI B;  2L09 A;  2LTU A;  1XB2 B;  2CV2 A;  1DGB A;  3W0F A;  2CV1 A;  4W5W A;  1OFI A;  1XNR M;  2KRU A;  4NRV A;  2EKF A;  3UZU A;  4M0W A;  2DI0 A;  2O5R A;  2R6F A;  4ITQ A;  3DOA A;  5ITY A;  2L6O A;  4K0K M;  3H4M A;  3HU1 A;  2DZL A;  2KNZ A;  1R6B X;  1Q3B A;  3U5Z A;  2Y0T A;  5EXT A;  3M6A A;  4GH9 A;  4M9X A;  5FTM A;  4DV5 M;  1IQP A;  2MJ5 B;  1MJG M;  3L2A A;  2DNA A;  3VLF B;  3J7A S;  4DV7 M;  4LFA M;  4L8R C;  3DA1 A;  2C98 A;  2QCU A;  1XXH B;  5EJC A;  1VDD A;  4PDI A;  1SXJ B;  2UXB M;  2APL A;  2L7I A;  2MR9 A;  3CF6 E;  3LCV B;  2XSZ D;  1PGY A;  5FLX S;  2B3T A;  1E9R A;  1TH4 A;  2JXN A;  2XGN A;  3ZCB B;  2CFO A;  3ILK A;  3KVW A;  2R0I A;  3L29 A;  1JB0 F;  3MMP A;  4IBD A;  1VEG A;  4LF8 M;  4NL4 H;  4QOZ C;  1T43 A;  3FYC A;  2KEB A;  5ITX E;  3GQ3 A;  3L25 A;  5KPR A;  1IXZ A;  2A5Y B;  2RRU A;  2W82 A;  3DFZ A;  3GPY A;  3Q8G A;  3U6C A;  1I94 M;  3B74 A;  3EIE A;  1EE8 A;  4GKK M;  3J80 S;  4G6Z A;  4LZZ A;  1Z5B A;  1G59 A;  3TWL A;  2JWS A;  2R44 A;  1VG5 A;  4F1I A;  2ERC A;  1IN7 A;  3RGS A;  2Z4S A;  3SMP A;  2EA0 A;  2X4A A;  4I81 A;  4NSR A;  3TPZ A;  4NRW A;  2AHM A;  1NVM A;  2QBY A;  4G4Q A;  4Q7J A;  1UM8 A;  1W5S A;  4MGZ E;  4MH0 E;  2DAG A;  2L2D A;  1C1K A;  1VEJ A;  1XMO M;  2RGH A;  3GRR A;  3W0L B;  5EXX A;  3K9P A;  1DGH A;  1YSY A;  3I51 A;  3E21 A;  4LJ4 A;  1Y8G A;  4OU7 A;  1W5T A;  1NNJ A;  2EO2 A;  2K47 A;  1R4G A;  3FE3 A;  4G4R A;  1DGG A;  3F92 A;  4ANR A;  2WSF F;  2X8A A;  5ITX A;  1WR1 B;  3U61 A;  1L8Q A;  4FCV A;  1QAN A;  4LZJ A;  2QBY B;  4LFC M;  4PDG A;  1QYR A;  4AG6 A;  2XEP A;  4LJ5 A;  4R3D A;  3GLI A;  1J7K A;  1JQJ C;  1ZV1 A;  2Z4R A;  3SAW A;  2RGO A;  3IG8 A;  2JA2 A;  2KNV A;  4L16 A;  4JI0 M;  3U60 A;  3SAR A;  4JI2 M;  2FH0 A;  2ZTC A;  4B3R M;  3UJN A;  1G71 A;  2R65 A;  3NBI A;  4MGK E;  4X66 M;  4AG5 A;  1XC8 A;  1TH3 A;  2Q2E B;  5BR8 M;  3GLF B;  1L1T A;  3E9S A;  4EIW A;  3KW6 A;  2UUC M;  3AOE A;  2QPA A;  5C18 A;  5L8R F;  1UFZ A;  3GQ4 A;  3RE8 A;  2DHY A;  4LF4 M;  4KOD A;  4GC5 A;  4BLC A;  2UUA M;  4JI8 M;  3SYL A;  4A3V B;  2Z3X A;  4D81 A;  1NSF A;  3R8F A;  3W67 A;  4G4O A;  3KDS E;  3D8B A;  2OOA A;  4R71 A;  2FFJ A;  3I04 M;  3KOX E;  3U6D A;  2L7H A;  2ZM6 M;  3KS4 A;  1HNX M;  4B3M M;  3SHG B;  4DV0 M;  4JI1 M;  3K1J A;  4JI4 M;  4OVZ A;  1T3T A;  2CHG A;  4X65 M;  1YUB A;  2J7N A;  1WGL A;  4LGY A;  2FS1 A;  2JUJ A;  4M9S A;  2YFQ A;  4DR1 M;  2XSZ A;  4B3S M;  2MGW A;  3FUT A;  1D0M A;  3KXE C;  2WZJ A;  4G3O A;  3VK7 A;  2ZBK B;  3B7N A;  3K2L A;  1XWI A;  4LY6 A;  2DWL A;  1N33 M;  2Z7J A;  2LBC A;  3C3E A;  4AKH A;  1XMQ M;  3A45 A;  1HNZ M;  1NV8 A;  2L4F A;  5DYI A;  1WGN A;  4PD2 A;  3J27 B;  3QWL A;  2BNK A;  2HL7 A;  3GLH E;  1AUA A;  1PJJ A;  4I4L A;  2EJS A;  1HNW M;  4FVM A;  4LJ7 A;  4Z8X A;  5KPZ A;  2G8L A;  2R46 A;  3MJ5 A;  1ZQ9 A;  4NSO B;  5DNY A;  1I4W A;  1OFH A;  3BXW A;  2I7P A;  1QAM A;  2KHH A;  1IBK M;  2F5P A;  4LCB A;  5JI2 E;  4LF6 M;  2VQE M;  1PJI A;  4DR5 M;  2J5Y A;  4DR6 M;  3GLF E;  3LCU A;  2WSC F;  4QNM A;  3UGJ A;  2DZO B;  1GJS A;  4Y28 F;  5KQD A;  4YHH M;  4NXM M;  3FYD A;  3GLG E;  3JR5 A;  1R2Y A;  3FUV A;  4M0D A;  3U6E A;  2VQF M;  1PJS A;  4JXJ A;  3CF2 A;  1HT2 E;  2C9O A;  1WHC A;  1JR3 D;  1NJF A;  4L6V 6;  3LVW A;  4AW4 A;  1OAO C;  3U60 B;  2YQZ A;  4XBO A;  3ZC7 B;  2HKJ A;  2KNA A;  4GHL A;  2CUZ A;  4IJF A;  1TH2 A;  3PNV A;  3GO8 A;  1F4I A;  4FWH A;  2QNJ A;  4LG2 A;  3U6O A;  2VF8 A;  1IY1 A;  1S3S A;  5EQT A;  1N32 M;  3T15 A;  4LJ6 A;  2VII A;  1V33 A;  4NC6 A;  2FOI C;  4IBC A;  4X62 M;  3KP1 E;  4P17 A;  4LRT A;  4D82 A;  4IJE A;  2JY5 A;  4X64 M;  1C7Y A;  2O01 F;  2LVN C;  1QDR A;  1JR3 A;  1N34 M;  1IM2 A;  1E9S A;  1N75 A;  4P16 A;  2LHG A;  5EP1 A;  3C9P A;  3HGI A;  3LW5 F;  4IIW A;  4CJ6 A;  4DR4 M;  2E5L M;  3JR4 A;  4PT5 A;  2K0B X;  3QYB A;  3GLG A;  2K6B A;  3SAV A;  3B9P A;  2Y20 A;  5GKN A;  4D80 A;  4UN2 B;  3KFU G;  2QZ4 A;  2KZU A;  2OOB A;  3GPX A;  1DO0 A;  2CP8 A;  5EP2 A;  3SHF A;  2XFT A;  1LTM A;  4II7 A;  3T6P A;  2C99 A;  3SYK A;  4MGY E;  3LVV A;  4PCZ A;  2YR0 A;  3Q8X A;  1IBM M;  1YE9 A;  1WXQ A;  2GNO A;  1E94 E;  3NWL A;  2Y0Q A;  3PNY A;  1HQY E;  1GL7 A;  1DO2 A;  3J7B A;  2GQF A;  4FWG A;  3FTE A;  1OQY A;  2MRO B;  1GJT A;  5KO3 A;  1G3I A;  4MB7 A;  2F5S A;  1A5T A;  2EKK A;  1DGF A;  5F3W A;  3HHX A;  1TF0 B;  3FUU A;  4JI5 M;  3QYE A;  2XF3 A;  3J81 S;  3U6Q A;  2LVP C;  2XZU A;  4IBI A;  2KZS A;  1NO1 A;  1OIZ A;  2JP7 A;  3U61 B;  4DR7 M;  4LRS A;  2K9D A;  5EXS A;  3T1H M;  1G41 A;  4LJ8 A;  3WHL A;  4AZF A;  4REZ A;  3A46 A;  1K82 A;  3VDU A;  4F2L A;  1R2Z A;  1Q39 A;  1R7R A;  2WSE F;  1IXS A;  1VDL A;  2C96 A;  2OO9 A;  3I4Y A;  3KSJ A;  1OIP A;  4GC9 A;  4JI7 M;  2ZAM A;  4XK8 F;  2N35 A;  1QZE A;  5ITU A;  3I01 M;  3KOZ E;  2RKO A;  3AOE C;  3VKG A;  2I7N A;  1N77 A;  1ZAE A;  2FNA A;  4RF1 A;  4FW9 A;  5BPV A;  3THG A;  1NY6 A;  1QQW A;  4DV3 M;  2DWZ B;  2CWB A;  2F4V M;  1NNU C;  4GMQ A;  4FWD A;  4WW0 A;  5IZ7 D;  1SXJ C;  7CAT A;  3UK6 A;  5H37 D;  4KO8 A;  3C58 A;  1L2D A;  3KOW E;  1IXR C;  4L78 A;  2NQ8 C;  3A42 A;  2F5O A;  4FD2 A;  1K3W A;  3VDP A;  4MGI E;  1IN4 A;  1Z6T A;  1KFV A;  4S12 A;  1TR8 A;  3HHZ A;  4QOS A;  3HZJ A;  1Z5A A;  1ZMV A;  1ZMW A;  2CHV A;  3L27 A;  3FRH A;  3MHV C;  4I5S A;  2DWM A;  1NHG C;  2UU9 M;  2KA6 B;  2DAE A;  5A2Q S;  2YNM D; 
#chains in the Genus database with same CATH homology
 3IHP A;  2LVA A;  1T43 A;  3GLF E;  1JR3 E;  3LCU A;  2JZ1 A;  2QSF X;  2JY6 B;  2RRU A;  3GLG E;  1P3Q Q;  2HAK A;  4F1I A;  1VG5 A;  4GEW A;  1HT2 E;  1WHC A;  2JNH A;  4Q7J A;  1KYI A;  2KNA A;  4WP2 A;  2L4E A;  2DAK A;  1TTE A;  1F4I A;  2DAG A;  2QNJ A;  2L2D A;  1VEJ A;  1ZMU A;  1DV0 A;  3K9P A;  2BWE A;  1HJP A;  2DEN A;  3E21 A;  1Y8G A;  1GO5 A;  2LVO C;  2H5X A;  1R4G A;  3FE3 A;  1YLA A;  2JY5 A;  3F92 A;  2DAM A;  1G4A E;  1C7Y A;  2LVN C;  1IM2 A;  1WR1 B;  2G3Q A;  3IEC A;  5DFL A;  2K0B X;  1XXH E;  1CUK A;  4UN2 B;  2OOB A;  1MN3 A;  1DO0 A;  1ZV1 A;  2CP8 A;  2LVQ D;  3K9O A;  3BBZ A;  3T6P A;  2KNV A;  2ZTC A;  2JZ0 A;  1Q02 A;  1E94 E;  1WIV A;  1DO2 A;  1HQY E;  4DBG B;  1OQY A;  2HWJ A;  2MRO B;  1WJ7 A;  1UFZ A;  1G3I A;  2DHY A;  1A5T A;  1NV9 A;  2EKK A;  2JY8 A;  1OTR A;  2LVP C;  2OOA A;  1T6O A;  4R71 A;  1AIP C;  2JP7 A;  2K9D A;  1G41 A;  1EFU B;  2O25 A;  1OAI A;  4F2L A;  3FRI A;  2BWB A;  3H4J A;  2LTU A;  1XB2 B;  1IXS A;  1WGL A;  3GLI E;  2JUJ A;  1VDL A;  1VEK A;  2EKF A;  2OO9 A;  1V92 A;  2DI0 A;  1SG9 A;  2MGW A;  1QZE A;  1VQ1 A;  2DZL A;  2KNZ A;  2WZJ A;  4G3O A;  2DAI A;  1BVS A;  2LBC A;  2JY7 A;  1NV8 A;  2L4F A;  1HT1 E;  1WGN A;  2MJ5 B;  2CWB A;  1OKS A;  1IFY A;  2DNA A;  3GLH E;  3B89 A;  2EJS A;  2MR9 A;  2DKL A;  3LCV B;  4HEO A;  2ZTD A;  1PGY A;  1TR8 A;  2B3T A;  1ZMV A;  1ZMW A;  2KHH A;  3E46 A;  2QHO B;  3FRH A;  5JI2 E;  2R0I A;  3MMP A;  2DAE A;  1VEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...