2L4FA

Nmr structure of the uba domain of s. cerevisiae dcn1 bound to ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
b'IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4fA00
1HT1E 3LCVB 3GLFE 2JY7A 1IFYA 1WJ7A 4HEOA 1E94E 1HQYE 4GEWA 1DO2A 1VDLA 1G41A 1CUKA 2DZLA 2JP7A 3IHPA 2DAKA 2BWEA 2DHYA 2KNAA 4F1IA 2G3QA 1XB2B 3K9OA 2R0IA 1AIPC 2ZTCA 1TTEA 2DAMA 1OAIA 2LBCA 2JY6B 2H5XA 2RRUA 4G3OA 2JNHA 1VG5A 1HT2E 2OOBA 1R4GA 1IM2A 3F92A 2EJSA 1P3QQ 1ZMVA 2LVNC 2WZJA 1SG9A 1ZMUA 4R71A 1QZEA 5DFLA 3K9PA 4Q7JA 2LTUA 2MROB 1OTRA 3MMPA 4UN2B 2MR9A 3B89A 3E46A 1WIVA 1TR8A 2QHOB 2B3TA 1HJPA 1WR1B 1VQ1A 2L2DA 2O25A 2BWBA 3GLIE 1Y8GA 2JUJA 1WGNA 1VEKA 1ZV1A 1G3IA 2ZTDA 1KYIA 2OOAA 1NV8A 2QSFX 2LVAA 4DBGB 1VEGA 2JY5A 2LVOC 1EFUB 1OQYA 1XXHE 1OKSA 3E21A 4WP2A 2DI0A 1JR3E 2DAIA 2KNVA 2DAGA 1BVSA 1ZMWA 2QNJA 2OO9A 2KHHA 3FRHA 1VEJA 2EKFA 3BBZA 2HWJA 2MJ5B 3FE3A 1T43A 2DAEA 2CP8A 1T6OA 1UFZA 1C7YA 1IXSA 1MN3A 2K9DA 4F2LA 1G4AE 3H4JA 3GLGE 1DV0A 2L4EA 2DNAA 2CWBA 2JZ1A 2JZ0A 2LVPC 1DO0A 2HAKA 5JI2E 1WGLA 1YLAA 3FRIA 2KNZA 1PGYA 1GO5A 3IECA 2JY8A 2DENA 2MGWA 1F4IA 3LCUA 2K0BX 1WHCA 1Q02A 1NV9A 1V92A 2DKLA 2EKKA 2LVQD 2L4FA 1A5TA 3T6PA 3GLHE
chains in the Genus database with same CATH superfamily
2Z8YM 5LMNM 2JY7A 2X49A 2QZ4A 1JQJC 4HEOA 1HQYE 2L6OA 3DOAA 1DO2A 3ZC7B 3HY5A 3ILKA 1G41A 2JP7A 3JR5A 1D0MA 3QYEA 1XB2B 3KS4A 1NY6A 1AIPC 4B7GA 4CHTB 1VDDA 3V76A 2CUZA 2C96A 1I4WA 2UXCM 4KLNA 3RGSA 1OAIA 8CATA 2JY6B 3W0LB 4G3OA 1VG5A 3NWLA 4QOSA 3U6MA 1HT2E 1N77A 1N34M 1V33A 5KPZA 1IM2A 3I04M 4FWDA 2Q2EB 3VLFB 4M9XA 2WZJA 4OVZB 2Z3XA 3CF6E 2GNOA 4MGHA 1Z5CA 4DV3M 5DFLA 2KW0A 2XZUA 2DWZB 3KVWA 3MMPA 4S12A 3SASA 3FTFA 4DR4M 4BB9A 1EE8A 5ITXE 4IJEA 4I81A 2Y0QA 2YNMD 2D7EA 5FLXS 3B74A 3HU1A 5EXPA 5FTKA 2MH8A 2L2DA 2DZOB 4OVZA 2APLA 2BWBA 1JR3A 2O25A 4M9ZA 2DWMA 3FUXA 2BJWA 4LG2A 2L7HA 1DGFA 4K0KM 1ZV1A 2ZTDA 1KYIA 3EIEA 1NV8A 4FWHA 4JV5M 2M60A 2NQ8C 4B08A 3AKZA 2ERCA 1GABA 1OQYA 1SXJD 1NNUC 3LQQA 1OKSA 3Q8GA 1NSFA 4B3MM 3KP1E 5ITQA 2KNVA 2KDLA 1XXHB 2ZAOA 1ZMWA 4GHLA 1S3SA 2QNJA 5E6JA 5EXTA 1JB0F 5EP4A 4RF1A 3KOWE 5KO3A 2VF7A 5DYIA 1YUBA 1HNXM 2J7OA 2FE8A 1IXSB 3SYKA 3HJ8A 4IBEA 1UM8A 1C1KA 2HWJA 4I4LA 3ZH9B 1PJIA 3B7NA 3NBIA 4AW4A 4CGYB 3PFIA 1XXHA 1R2YA 3I01M 3PXGA 2DAEA 5KQDA 4LY6A 4EIWA 4L8RC 3HX3A 2UXBM 4JI4M 2CP8A 4QNMA 1XNRM 1IXSA 4LFAM 3WHKA 1MN3A 1QAQA 4GMQA 4F2LA 4GIPA 2J7NA 4Z6YA 3KOXE 2KZSA 2E5LM 3GLGE 3L27A 2L4EA 3U61B 2RGHA 1NHGC 2UUAM 1G59A 4G4RA 3KSXA 2P5TA 3GQ4A 3HJSA 3AOEA 5IWAM 2FFJA 5EP1A 3VFDA 3U6OA 4A3VB 4JI2M 1L1ZA 4AQYM 1IBKM 1DO0A 2HAKA 1K82A 1YLAA 3U61A 2QCUA 2F5NA 1DGHB 4QOZC 2DVWB 3RFWA 4BBAA 3UJNA 3GLFA 4FW9A 2C99A 2DENA 3KSJA 4JI3M 1D0LA 1D0KA 2A5YB 4MB7A 2K47A 1IXZA 1QAOA 3HKPA 4DR3M 2F5SA 1OAOC 4NSOB 1IN8A 1DGHA 3FUTA 3T6PA 1G71A 4MGIE 4GITA 4P17A 1MX0A 4DV6M 2KXEA 2CHGA 3GLHB 3HZJA 4ANRA 4JI8M 3KXEC 4LRTA 1OFIA 3GQ3A 2XFSA 4X62M 4M0DA 2DZLA 3IHPA 2ZM6M 4X66M 2DHYA 2QENA 2UUCM 3D8LA 4DR7M 4FCTA 2G3QA 2HCBA 4WW0A 5IZ7D 5H37D 3CTWB 2J5YA 3K9OA 2R0IA 2BJVA 2R4EA 3W0FA 5ITTA 1QVRA 3SATA 3U6SA 3GLHA 4LJAA 1TTEA 2DAMA 3GP1A 4LRSA 2VQEM 2CV0A 2R46A 4RKUF 2GQFA 3GRRA 2RRUA 4G4NA 5BR8M 4D81A 1GL6A 3GPUA 4OX9M 1R4GA 2R65A 1Z6TA 3F92A 2QBYA 1P3QQ 1IXRC 4I5SA 3HHYA 2LNHC 4IBDA 3K2LA 2VF8A 1SG9A 4ZPXA 2XLJA 3I51A 3AFHA 4IBJA 2Y20A 3J2PB 4L4UA 4DV7M 1KFVA 2MROB 1J09A 2MR9A 2ZAMA 2CV2A 4DV0M 1J7KA 2XEPA 1TR8A 4NOOB 2B3TA 4XBOA 2CEAA 2X8AA 1N75A 2Y21A 2ZBKB 1L2BA 4TUWA 2L7IA 5EP3A 1Y8GA 4Y28F 5FSWA 3U6QA 3W68A 5LMUM 1FJGM 4LF7M 3SYLA 1G3IA 2OOAA 2M5ZA 3GLIB 2UUBM 4MGZE 3HU2A 1MJGM 2JY5A 1N36M 1SXJC 2LVOC 4X64M 2UXDM 1XXHE 2F4VM 4WP2A 2LWXA 2KA6B 2OPFA 2XH9A 4CIZA 3HU3A 2DAGA 1BVSA 2L09A 1R2ZA 4R7GA 4B7HA 1Q3BA 4LZZA 2OO9A 4AG6A 3FRHA 1HR0M 3GLIA 3VK7A 2DWLA 1VEJA 2VQFM 4JI6M 3L26A 3B7ZA 1IN4A 4QHTA 1E9RA 4IIWA 1IBMM 2MJ5B 2LHCA 2KRKA 1IN6A 4M9SA 1R6BX 2JWSA 4QNRA 1HNWM 4B3TM 4WURA 5FTMA 5EJCA 3KFUG 2W82A 2XF3A 3FKEA 3MJ5A 4Z8XA 2D7HA 4L15A 3K92A 2KRUA 5EXXA 1QYRA 3FTEA 2C9CA 3RGPA 4DV1M 4B3RM 1DV0A 2R45A 3QWLA 4XK8F 2OQ4A 3GO8A 4LCBA 4NXMM 1X37A 1HNZM 2D7GA 3I4VA 3LVVA 2JZ1A 3TWLA 4LFCM 4MM3B 2V1CA 3DA1A 1XNQM 3L29A 1FNNA 4HL4A 1QANA 1ZQ9A 2YFQA 3OTOM 3GPYA 5F3WA 4JI5M 1NJFA 5C1BA 1GVNA 3U6PA 3B9PA 3IECA 3SHFA 2X4AA 1L2DA 2XSZD 1OIZA 2JY8A 2HKJA 4KO8A 3DFZA 3CF2A 1QUTA 3K8ZA 3LCUA 1NVMA 2QP9X 4W5WA 3HHZA 1HQCA 3A46A 4LJ6A 3R9XB 1Q02A 3KP0E 1V92A 3JR4A 3EIHA 2CHVA 1A5TA 1PJQA 1NO1A 1EIJA 2CE7A 4CISA 4II7A 3GLHE 4NL4H 3LCVB 3J27B 3UMMA 3R8FA 3J7AS 1WJ7A 2RGOA 2Y0TA 1E94E 4G6ZA 4HLQA 5FTJA 1Q3CA 4GEWA 3GLFB 1VDLA 3LMMA 3GPXA 4NRVA 4NRWA 1QDTA 1RU3A 3MK6A 2BWEA 2KNAA 4F1IA 5ITRA 3VK8A 3T1HM 1K3XA 1L1TA 2CHQA 1IBLM 3TWMA 3KOYE 1XMQM 2YQZA 4LJ8A 2EO2A 4REZA 1XHBA 5KPRA 4OU7A 2JNHA 2KEBA 1GJSA 3SAWA 2OOBA 4XGIA 3U5ZB 4IBKA 3W67A 3B7QA 3I4YA 2LVNC 2R44A 3SHGB 1OIPA 3TWKA 3HHXA 3FTCA 2XGNA 2ZANA 3PVSA 1ZAEA 3RE8A 1QZEA 3K9PA 4Q7JA 2WSCF 2LTUA 3FD9A 1OTRA 3HWSA 3WHLA 2C98A 4AG5A 2LH0A 3AJIB 1R7RA 3E46A 1TDHA 1DGGA 1WIVA 2QHOB 3U5ZA 2DXIA 4L78A 1T3TA 3SMPA 3TL4X 4X65M 4DUZM 1G8PA 1VQ1A 2VDBB 4R3DA 3GLIE 2QBYB 4LF9M 4P16A 1LV7A 2JUJA 1WGNA 3SC3A 1QAMA 4NC6A 5ITUA 3GPPA 4JI1M 2LVAA 4DBGB 2O5RA 2Z4RA 4GC5A 4ITQA 1EFUB 2HL7A 3A98B 5EP2A 5IT9S 1L2CA 3E21A 1NNJA 4MGYE 1MU5A 2DI0A 1QDRA 1JR3E 3A42A 1TGUA 1IN7A 3GLGB 5KPTA 1AUAA 2O01F 3U6EA 3U6LA 4L6V6 5FTLA 4RNAA 2JA2A 3C3EA 3SMSA 2F5PA 4CJ6A 3UGJA 2EKFA 2QPAA 1Q39A 2C9OA 3BBZA 1E9SA 1SXJB 3GRUA 4LF6M 7CATA 3FE3A 2CV1A 5KQ8A 3GLGA 3AOGA 3J80S 1Z5AA 4DR1M 3U60A 3L28A 1T6OA 2QQ8A 4PT5A 5C18A 1N78A 3QYBA 3K1JA 1SXJA 3SBJA 2K9DA 3AV0A 2F5QA 1G4AE 2LHGA 3LW5F 2WSFF 1H6UA 3T1YM 3C58A 4IBFA 1NY5A 2DNAA 3VDUA 2DHRA 5DYGA 1PJSA 3E9SA 3HGIA 3HJQA 4QHSA 1TH2A 3KW6A 3TE6A 3L25A 4FCWA 4B7FA 3FYDA 1TF0B 4JN6A 5JI2E 3KS8A 1L8QA 4FCVA 4FVMA 5FTNA 4AKIA 2V1UA 1PGYA 4GH9A 4PDGA 2CRUA 3T15A 2XSZA 3J7BA 1GO5A 2WSEF 4IBCA 4LGMA 4JYAM 5JI3E 2MGWA 1F4IA 2Z4SA 3HHWA 4LJ5A 2RKOA 4MH0E 3THGA 2V6ZM 2EA0A 1NV9A 1QUSA 3M0EA 1PJJA 2LVQD 2DKLA 3MHVC 1QQWA 3CF0A 4NXNM 4LGYA 1E32A 1HT1E 3PNVA 4IBBA 4NSRA 5EXSA 4PCZA 3GLFE 3KDSE 1IFYA 3GQ5A 4LJ7A 1QZMA 1XWIA 4M0WA 5EQTA 3T38A 1N33M 2FH0A 3FYCA 4GKJM 1V34A 1CUKA 3C9PA 3ZQJA 4G4QA 4JI7M 2DAKA 1GL7A 4BLCA 4AZFA 1LTMA 5GKNA 3A45A 4FD2A 3IG5A 3Q8XA 2XZFA 2ZTCA 1I94M 2LBCA 2VIIA 3GRYA 3UK6A 2H5XA 1GJTA 4DV5M 2HHHM 3ZCBB 3KOZE 2G5GX 4GC9A 1IY1A 1W5TA 3U6DA 1IY0A 1Z59A 2EJSA 1ZMVA 2FS1A 4I8OA 3NBXX 4DUYM 1ZMUA 4R71A 1N32M 2R18A 5IREB 2G8LA 1IY2A 2R6FA 3SAUA 3FUVA 4UN2B 1TDZA 4KHPM 4D82A 4DV4M 1K3WA 3B89A 4FWGA 1W5SA 2I7PA 4B3SM 3LQRA 1GKIA 1NJGA 4IBIA 2N35A 1HJPA 1WR1B 2XFTA 3SAVA 1IQPA 3BOSA 3BXWA 1J5EM 1JR3D 4IJFA 1VEKA 2DZNB 4MGKE 4AKGA 1NHWC 2K6BA 2QSFX 4PD2A 1VEGA 4KT0F 1XC8A 3FUWA 3E4RA 2R4JA 5ITXA 4YY3M 3J81S 1PM5A 2DAIA 3FUUA 4LF5M 2YR0A 4LJ4A 3AOEC 2KHHA 4JI0M 4AI6A 1SXJE 4D80A 2FNAA 2FOIC 3PNYA 3H4MA 3GRVA 4DR5M 2DWNA 1YSYA 3UZUA 3M7GA 3CGWA 3TPZA 4RF0A 3U6CA 3SARA 1PRBA 3IG8A 1T43A 3QAUA 1KSFX 4L16A 4PDIA 2CFOA 4KODA 4OW0A 1DGBA 5DNYA 3VKGA 3VDPA 1UFZA 1C7YA 2Z7JA 3FTDA 4GHAA 4G4OA 4LZJA 4JXJA 3H4JA 1ORYB 2R62A 2H1RA 3AL0C 1XMOM 3VKHA 3C3DA 1R5LA 4DR6M 2LXEA 2CWBA 3M6AA 3D8BA 4DR2M 2JZ0A 2LVPC 2BNKA 4YHHM 1TH3A 1IN5A 3U60B 2C5RA 4GRIA 3L2AA 2AHMA 4AKHA 1WGLA 3JAMS 1D2NA 3FRIA 4LF4M 2EUCA 4GKKM 1TH4A 2KNZA 3LVWA 4DV2M 4LF8M 1OFHA 4IBGA 5ITYA 2F5OA 1WXQA 2I7NA 4LJ9A 5E26A 2K0BX 5A2QS 1WHCA 3TQSA 1Z5BA 2UU9M 1OJLA 2EKKA 2JXNA 5BPVA 5L8RF 2L4FA 3SFZA 1GLNA 1PJTA 4LFBM 3DZDA 2KZUA 1YE9A
chains in the Genus database with same CATH topology
1HT1E 3LCVB 3GLFE 2JY7A 1IFYA 1WJ7A 4HEOA 1E94E 1HQYE 4GEWA 1DO2A 1VDLA 1G41A 1CUKA 2DZLA 2JP7A 3IHPA 2DAKA 2BWEA 2DHYA 2KNAA 4F1IA 2G3QA 1XB2B 3K9OA 2R0IA 1AIPC 2ZTCA 1TTEA 2DAMA 1OAIA 2LBCA 2JY6B 2H5XA 2RRUA 4G3OA 2JNHA 1VG5A 1HT2E 2OOBA 1R4GA 1IM2A 3F92A 2EJSA 1P3QQ 1ZMVA 2LVNC 2WZJA 1SG9A 1ZMUA 4R71A 1QZEA 5DFLA 3K9PA 4Q7JA 2LTUA 2MROB 1OTRA 3MMPA 4UN2B 2MR9A 3B89A 3E46A 1WIVA 1TR8A 2QHOB 2B3TA 1HJPA 1WR1B 1VQ1A 2L2DA 2O25A 2BWBA 3GLIE 1Y8GA 2JUJA 1WGNA 1VEKA 1ZV1A 1G3IA 2ZTDA 1KYIA 2OOAA 1NV8A 2QSFX 2LVAA 4DBGB 1VEGA 2JY5A 2LVOC 1EFUB 1OQYA 1XXHE 1OKSA 3E21A 4WP2A 2DI0A 1JR3E 2DAIA 2KNVA 2DAGA 1BVSA 1ZMWA 2QNJA 2OO9A 2KHHA 3FRHA 1VEJA 2EKFA 3BBZA 2HWJA 2MJ5B 3FE3A 1T43A 2DAEA 2CP8A 1T6OA 1UFZA 1C7YA 1IXSA 1MN3A 2K9DA 4F2LA 1G4AE 3H4JA 3GLGE 1DV0A 2L4EA 2DNAA 2CWBA 2JZ1A 2JZ0A 2LVPC 1DO0A 2HAKA 5JI2E 1WGLA 1YLAA 3FRIA 2KNZA 1PGYA 1GO5A 3IECA 2JY8A 2DENA 2MGWA 1F4IA 3LCUA 2K0BX 1WHCA 1Q02A 1NV9A 1V92A 2DKLA 2EKKA 2LVQD 2L4FA 1A5TA 3T6PA 3GLHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HT1 E;  3LCV B;  3GLF E;  2JY7 A;  1IFY A;  1WJ7 A;  4HEO A;  1E94 E;  1HQY E;  4GEW A;  1DO2 A;  1VDL A;  1G41 A;  1CUK A;  2DZL A;  2JP7 A;  3IHP A;  2DAK A;  2BWE A;  2DHY A;  2KNA A;  4F1I A;  2G3Q A;  1XB2 B;  3K9O A;  2R0I A;  1AIP C;  2ZTC A;  1TTE A;  2DAM A;  1OAI A;  2LBC A;  2JY6 B;  2H5X A;  2RRU A;  4G3O A;  2JNH A;  1VG5 A;  1HT2 E;  2OOB A;  1R4G A;  1IM2 A;  3F92 A;  2EJS A;  1P3Q Q;  1ZMV A;  2LVN C;  2WZJ A;  1SG9 A;  1ZMU A;  4R71 A;  1QZE A;  5DFL A;  3K9P A;  4Q7J A;  2LTU A;  2MRO B;  1OTR A;  3MMP A;  4UN2 B;  2MR9 A;  3B89 A;  3E46 A;  1WIV A;  1TR8 A;  2QHO B;  2B3T A;  1HJP A;  1WR1 B;  1VQ1 A;  2L2D A;  2O25 A;  2BWB A;  3GLI E;  1Y8G A;  2JUJ A;  1WGN A;  1VEK A;  1ZV1 A;  1G3I A;  2ZTD A;  1KYI A;  2OOA A;  1NV8 A;  2QSF X;  2LVA A;  4DBG B;  1VEG A;  2JY5 A;  2LVO C;  1EFU B;  1OQY A;  1XXH E;  1OKS A;  3E21 A;  4WP2 A;  2DI0 A;  1JR3 E;  2DAI A;  2KNV A;  2DAG A;  1BVS A;  1ZMW A;  2QNJ A;  2OO9 A;  2KHH A;  3FRH A;  1VEJ A;  2EKF A;  3BBZ A;  2HWJ A;  2MJ5 B;  3FE3 A;  1T43 A;  2DAE A;  2CP8 A;  1T6O A;  1UFZ A;  1C7Y A;  1IXS A;  1MN3 A;  2K9D A;  4F2L A;  1G4A E;  3H4J A;  3GLG E;  1DV0 A;  2L4E A;  2DNA A;  2CWB A;  2JZ1 A;  2JZ0 A;  2LVP C;  1DO0 A;  2HAK A;  5JI2 E;  1WGL A;  1YLA A;  3FRI A;  2KNZ A;  1PGY A;  1GO5 A;  3IEC A;  2JY8 A;  2DEN A;  2MGW A;  1F4I A;  3LCU A;  2K0B X;  1WHC A;  1Q02 A;  1NV9 A;  1V92 A;  2DKL A;  2EKK A;  2LVQ D;  2L4F A;  1A5T A;  3T6P A;  3GLH E; 
#chains in the Genus database with same CATH topology
 2Z8Y M;  5LMN M;  2JY7 A;  2X49 A;  2QZ4 A;  1JQJ C;  4HEO A;  1HQY E;  2L6O A;  3DOA A;  1DO2 A;  3ZC7 B;  3HY5 A;  3ILK A;  1G41 A;  2JP7 A;  3JR5 A;  1D0M A;  3QYE A;  1XB2 B;  3KS4 A;  1NY6 A;  1AIP C;  4B7G A;  4CHT B;  1VDD A;  3V76 A;  2CUZ A;  2C96 A;  1I4W A;  2UXC M;  4KLN A;  3RGS A;  1OAI A;  8CAT A;  2JY6 B;  3W0L B;  4G3O A;  1VG5 A;  3NWL A;  4QOS A;  3U6M A;  1HT2 E;  1N77 A;  1N34 M;  1V33 A;  5KPZ A;  1IM2 A;  3I04 M;  4FWD A;  2Q2E B;  3VLF B;  4M9X A;  2WZJ A;  4OVZ B;  2Z3X A;  3CF6 E;  2GNO A;  4MGH A;  1Z5C A;  4DV3 M;  5DFL A;  2KW0 A;  2XZU A;  2DWZ B;  3KVW A;  3MMP A;  4S12 A;  3SAS A;  3FTF A;  4DR4 M;  4BB9 A;  1EE8 A;  5ITX E;  4IJE A;  4I81 A;  2Y0Q A;  2YNM D;  2D7E A;  5FLX S;  3B74 A;  3HU1 A;  5EXP A;  5FTK A;  2MH8 A;  2L2D A;  2DZO B;  4OVZ A;  2APL A;  2BWB A;  1JR3 A;  2O25 A;  4M9Z A;  2DWM A;  3FUX A;  2BJW A;  4LG2 A;  2L7H A;  1DGF A;  4K0K M;  1ZV1 A;  2ZTD A;  1KYI A;  3EIE A;  1NV8 A;  4FWH A;  4JV5 M;  2M60 A;  2NQ8 C;  4B08 A;  3AKZ A;  2ERC A;  1GAB A;  1OQY A;  1SXJ D;  1NNU C;  3LQQ A;  1OKS A;  3Q8G A;  1NSF A;  4B3M M;  3KP1 E;  5ITQ A;  2KNV A;  2KDL A;  1XXH B;  2ZAO A;  1ZMW A;  4GHL A;  1S3S A;  2QNJ A;  5E6J A;  5EXT A;  1JB0 F;  5EP4 A;  4RF1 A;  3KOW E;  5KO3 A;  2VF7 A;  5DYI A;  1YUB A;  1HNX M;  2J7O A;  2FE8 A;  1IXS B;  3SYK A;  3HJ8 A;  4IBE A;  1UM8 A;  1C1K A;  2HWJ A;  4I4L A;  3ZH9 B;  1PJI A;  3B7N A;  3NBI A;  4AW4 A;  4CGY B;  3PFI A;  1XXH A;  1R2Y A;  3I01 M;  3PXG A;  2DAE A;  5KQD A;  4LY6 A;  4EIW A;  4L8R C;  3HX3 A;  2UXB M;  4JI4 M;  2CP8 A;  4QNM A;  1XNR M;  1IXS A;  4LFA M;  3WHK A;  1MN3 A;  1QAQ A;  4GMQ A;  4F2L A;  4GIP A;  2J7N A;  4Z6Y A;  3KOX E;  2KZS A;  2E5L M;  3GLG E;  3L27 A;  2L4E A;  3U61 B;  2RGH A;  1NHG C;  2UUA M;  1G59 A;  4G4R A;  3KSX A;  2P5T A;  3GQ4 A;  3HJS A;  3AOE A;  5IWA M;  2FFJ A;  5EP1 A;  3VFD A;  3U6O A;  4A3V B;  4JI2 M;  1L1Z A;  4AQY M;  1IBK M;  1DO0 A;  2HAK A;  1K82 A;  1YLA A;  3U61 A;  2QCU A;  2F5N A;  1DGH B;  4QOZ C;  2DVW B;  3RFW A;  4BBA A;  3UJN A;  3GLF A;  4FW9 A;  2C99 A;  2DEN A;  3KSJ A;  4JI3 M;  1D0L A;  1D0K A;  2A5Y B;  4MB7 A;  2K47 A;  1IXZ A;  1QAO A;  3HKP A;  4DR3 M;  2F5S A;  1OAO C;  4NSO B;  1IN8 A;  1DGH A;  3FUT A;  3T6P A;  1G71 A;  4MGI E;  4GIT A;  4P17 A;  1MX0 A;  4DV6 M;  2KXE A;  2CHG A;  3GLH B;  3HZJ A;  4ANR A;  4JI8 M;  3KXE C;  4LRT A;  1OFI A;  3GQ3 A;  2XFS A;  4X62 M;  4M0D A;  2DZL A;  3IHP A;  2ZM6 M;  4X66 M;  2DHY A;  2QEN A;  2UUC M;  3D8L A;  4DR7 M;  4FCT A;  2G3Q A;  2HCB A;  4WW0 A;  5IZ7 D;  5H37 D;  3CTW B;  2J5Y A;  3K9O A;  2R0I A;  2BJV A;  2R4E A;  3W0F A;  5ITT A;  1QVR A;  3SAT A;  3U6S A;  3GLH A;  4LJA A;  1TTE A;  2DAM A;  3GP1 A;  4LRS A;  2VQE M;  2CV0 A;  2R46 A;  4RKU F;  2GQF A;  3GRR A;  2RRU A;  4G4N A;  5BR8 M;  4D81 A;  1GL6 A;  3GPU A;  4OX9 M;  1R4G A;  2R65 A;  1Z6T A;  3F92 A;  2QBY A;  1P3Q Q;  1IXR C;  4I5S A;  3HHY A;  2LNH C;  4IBD A;  3K2L A;  2VF8 A;  1SG9 A;  4ZPX A;  2XLJ A;  3I51 A;  3AFH A;  4IBJ A;  2Y20 A;  3J2P B;  4L4U A;  4DV7 M;  1KFV A;  2MRO B;  1J09 A;  2MR9 A;  2ZAM A;  2CV2 A;  4DV0 M;  1J7K A;  2XEP A;  1TR8 A;  4NOO B;  2B3T A;  4XBO A;  2CEA A;  2X8A A;  1N75 A;  2Y21 A;  2ZBK B;  1L2B A;  4TUW A;  2L7I A;  5EP3 A;  1Y8G A;  4Y28 F;  5FSW A;  3U6Q A;  3W68 A;  5LMU M;  1FJG M;  4LF7 M;  3SYL A;  1G3I A;  2OOA A;  2M5Z A;  3GLI B;  2UUB M;  4MGZ E;  3HU2 A;  1MJG M;  2JY5 A;  1N36 M;  1SXJ C;  2LVO C;  4X64 M;  2UXD M;  1XXH E;  2F4V M;  4WP2 A;  2LWX A;  2KA6 B;  2OPF A;  2XH9 A;  4CIZ A;  3HU3 A;  2DAG A;  1BVS A;  2L09 A;  1R2Z A;  4R7G A;  4B7H A;  1Q3B A;  4LZZ A;  2OO9 A;  4AG6 A;  3FRH A;  1HR0 M;  3GLI A;  3VK7 A;  2DWL A;  1VEJ A;  2VQF M;  4JI6 M;  3L26 A;  3B7Z A;  1IN4 A;  4QHT A;  1E9R A;  4IIW A;  1IBM M;  2MJ5 B;  2LHC A;  2KRK A;  1IN6 A;  4M9S A;  1R6B X;  2JWS A;  4QNR A;  1HNW M;  4B3T M;  4WUR A;  5FTM A;  5EJC A;  3KFU G;  2W82 A;  2XF3 A;  3FKE A;  3MJ5 A;  4Z8X A;  2D7H A;  4L15 A;  3K92 A;  2KRU A;  5EXX A;  1QYR A;  3FTE A;  2C9C A;  3RGP A;  4DV1 M;  4B3R M;  1DV0 A;  2R45 A;  3QWL A;  4XK8 F;  2OQ4 A;  3GO8 A;  4LCB A;  4NXM M;  1X37 A;  1HNZ M;  2D7G A;  3I4V A;  3LVV A;  2JZ1 A;  3TWL A;  4LFC M;  4MM3 B;  2V1C A;  3DA1 A;  1XNQ M;  3L29 A;  1FNN A;  4HL4 A;  1QAN A;  1ZQ9 A;  2YFQ A;  3OTO M;  3GPY A;  5F3W A;  4JI5 M;  1NJF A;  5C1B A;  1GVN A;  3U6P A;  3B9P A;  3IEC A;  3SHF A;  2X4A A;  1L2D A;  2XSZ D;  1OIZ A;  2JY8 A;  2HKJ A;  4KO8 A;  3DFZ A;  3CF2 A;  1QUT A;  3K8Z A;  3LCU A;  1NVM A;  2QP9 X;  4W5W A;  3HHZ A;  1HQC A;  3A46 A;  4LJ6 A;  3R9X B;  1Q02 A;  3KP0 E;  1V92 A;  3JR4 A;  3EIH A;  2CHV A;  1A5T A;  1PJQ A;  1NO1 A;  1EIJ A;  2CE7 A;  4CIS A;  4II7 A;  3GLH E;  4NL4 H;  3LCV B;  3J27 B;  3UMM A;  3R8F A;  3J7A S;  1WJ7 A;  2RGO A;  2Y0T A;  1E94 E;  4G6Z A;  4HLQ A;  5FTJ A;  1Q3C A;  4GEW A;  3GLF B;  1VDL A;  3LMM A;  3GPX A;  4NRV A;  4NRW A;  1QDT A;  1RU3 A;  3MK6 A;  2BWE A;  2KNA A;  4F1I A;  5ITR A;  3VK8 A;  3T1H M;  1K3X A;  1L1T A;  2CHQ A;  1IBL M;  3TWM A;  3KOY E;  1XMQ M;  2YQZ A;  4LJ8 A;  2EO2 A;  4REZ A;  1XHB A;  5KPR A;  4OU7 A;  2JNH A;  2KEB A;  1GJS A;  3SAW A;  2OOB A;  4XGI A;  3U5Z B;  4IBK A;  3W67 A;  3B7Q A;  3I4Y A;  2LVN C;  2R44 A;  3SHG B;  1OIP A;  3TWK A;  3HHX A;  3FTC A;  2XGN A;  2ZAN A;  3PVS A;  1ZAE A;  3RE8 A;  1QZE A;  3K9P A;  4Q7J A;  2WSC F;  2LTU A;  3FD9 A;  1OTR A;  3HWS A;  3WHL A;  2C98 A;  4AG5 A;  2LH0 A;  3AJI B;  1R7R A;  3E46 A;  1TDH A;  1DGG A;  1WIV A;  2QHO B;  3U5Z A;  2DXI A;  4L78 A;  1T3T A;  3SMP A;  3TL4 X;  4X65 M;  4DUZ M;  1G8P A;  1VQ1 A;  2VDB B;  4R3D A;  3GLI E;  2QBY B;  4LF9 M;  4P16 A;  1LV7 A;  2JUJ A;  1WGN A;  3SC3 A;  1QAM A;  4NC6 A;  5ITU A;  3GPP A;  4JI1 M;  2LVA A;  4DBG B;  2O5R A;  2Z4R A;  4GC5 A;  4ITQ A;  1EFU B;  2HL7 A;  3A98 B;  5EP2 A;  5IT9 S;  1L2C A;  3E21 A;  1NNJ A;  4MGY E;  1MU5 A;  2DI0 A;  1QDR A;  1JR3 E;  3A42 A;  1TGU A;  1IN7 A;  3GLG B;  5KPT A;  1AUA A;  2O01 F;  3U6E A;  3U6L A;  4L6V 6;  5FTL A;  4RNA A;  2JA2 A;  3C3E A;  3SMS A;  2F5P A;  4CJ6 A;  3UGJ A;  2EKF A;  2QPA A;  1Q39 A;  2C9O A;  3BBZ A;  1E9S A;  1SXJ B;  3GRU A;  4LF6 M;  7CAT A;  3FE3 A;  2CV1 A;  5KQ8 A;  3GLG A;  3AOG A;  3J80 S;  1Z5A A;  4DR1 M;  3U60 A;  3L28 A;  1T6O A;  2QQ8 A;  4PT5 A;  5C18 A;  1N78 A;  3QYB A;  3K1J A;  1SXJ A;  3SBJ A;  2K9D A;  3AV0 A;  2F5Q A;  1G4A E;  2LHG A;  3LW5 F;  2WSF F;  1H6U A;  3T1Y M;  3C58 A;  4IBF A;  1NY5 A;  2DNA A;  3VDU A;  2DHR A;  5DYG A;  1PJS A;  3E9S A;  3HGI A;  3HJQ A;  4QHS A;  1TH2 A;  3KW6 A;  3TE6 A;  3L25 A;  4FCW A;  4B7F A;  3FYD A;  1TF0 B;  4JN6 A;  5JI2 E;  3KS8 A;  1L8Q A;  4FCV A;  4FVM A;  5FTN A;  4AKI A;  2V1U A;  1PGY A;  4GH9 A;  4PDG A;  2CRU A;  3T15 A;  2XSZ A;  3J7B A;  1GO5 A;  2WSE F;  4IBC A;  4LGM A;  4JYA M;  5JI3 E;  2MGW A;  1F4I A;  2Z4S A;  3HHW A;  4LJ5 A;  2RKO A;  4MH0 E;  3THG A;  2V6Z M;  2EA0 A;  1NV9 A;  1QUS A;  3M0E A;  1PJJ A;  2LVQ D;  2DKL A;  3MHV C;  1QQW A;  3CF0 A;  4NXN M;  4LGY A;  1E32 A;  1HT1 E;  3PNV A;  4IBB A;  4NSR A;  5EXS A;  4PCZ A;  3GLF E;  3KDS E;  1IFY A;  3GQ5 A;  4LJ7 A;  1QZM A;  1XWI A;  4M0W A;  5EQT A;  3T38 A;  1N33 M;  2FH0 A;  3FYC A;  4GKJ M;  1V34 A;  1CUK A;  3C9P A;  3ZQJ A;  4G4Q A;  4JI7 M;  2DAK A;  1GL7 A;  4BLC A;  4AZF A;  1LTM A;  5GKN A;  3A45 A;  4FD2 A;  3IG5 A;  3Q8X A;  2XZF A;  2ZTC A;  1I94 M;  2LBC A;  2VII A;  3GRY A;  3UK6 A;  2H5X A;  1GJT A;  4DV5 M;  2HHH M;  3ZCB B;  3KOZ E;  2G5G X;  4GC9 A;  1IY1 A;  1W5T A;  3U6D A;  1IY0 A;  1Z59 A;  2EJS A;  1ZMV A;  2FS1 A;  4I8O A;  3NBX X;  4DUY M;  1ZMU A;  4R71 A;  1N32 M;  2R18 A;  5IRE B;  2G8L A;  1IY2 A;  2R6F A;  3SAU A;  3FUV A;  4UN2 B;  1TDZ A;  4KHP M;  4D82 A;  4DV4 M;  1K3W A;  3B89 A;  4FWG A;  1W5S A;  2I7P A;  4B3S M;  3LQR A;  1GKI A;  1NJG A;  4IBI A;  2N35 A;  1HJP A;  1WR1 B;  2XFT A;  3SAV A;  1IQP A;  3BOS A;  3BXW A;  1J5E M;  1JR3 D;  4IJF A;  1VEK A;  2DZN B;  4MGK E;  4AKG A;  1NHW C;  2K6B A;  2QSF X;  4PD2 A;  1VEG A;  4KT0 F;  1XC8 A;  3FUW A;  3E4R A;  2R4J A;  5ITX A;  4YY3 M;  3J81 S;  1PM5 A;  2DAI A;  3FUU A;  4LF5 M;  2YR0 A;  4LJ4 A;  3AOE C;  2KHH A;  4JI0 M;  4AI6 A;  1SXJ E;  4D80 A;  2FNA A;  2FOI C;  3PNY A;  3H4M A;  3GRV A;  4DR5 M;  2DWN A;  1YSY A;  3UZU A;  3M7G A;  3CGW A;  3TPZ A;  4RF0 A;  3U6C A;  3SAR A;  1PRB A;  3IG8 A;  1T43 A;  3QAU A;  1KSF X;  4L16 A;  4PDI A;  2CFO A;  4KOD A;  4OW0 A;  1DGB A;  5DNY A;  3VKG A;  3VDP A;  1UFZ A;  1C7Y A;  2Z7J A;  3FTD A;  4GHA A;  4G4O A;  4LZJ A;  4JXJ A;  3H4J A;  1ORY B;  2R62 A;  2H1R A;  3AL0 C;  1XMO M;  3VKH A;  3C3D A;  1R5L A;  4DR6 M;  2LXE A;  2CWB A;  3M6A A;  3D8B A;  4DR2 M;  2JZ0 A;  2LVP C;  2BNK A;  4YHH M;  1TH3 A;  1IN5 A;  3U60 B;  2C5R A;  4GRI A;  3L2A A;  2AHM A;  4AKH A;  1WGL A;  3JAM S;  1D2N A;  3FRI A;  4LF4 M;  2EUC A;  4GKK M;  1TH4 A;  2KNZ A;  3LVW A;  4DV2 M;  4LF8 M;  1OFH A;  4IBG A;  5ITY A;  2F5O A;  1WXQ A;  2I7N A;  4LJ9 A;  5E26 A;  2K0B X;  5A2Q S;  1WHC A;  3TQS A;  1Z5B A;  2UU9 M;  1OJL A;  2EKK A;  2JXN A;  5BPV A;  5L8R F;  2L4F A;  3SFZ A;  1GLN A;  1PJT A;  4LFB M;  3DZD A;  2KZU A;  1YE9 A; 
#chains in the Genus database with same CATH homology
 1HT1 E;  3LCV B;  3GLF E;  2JY7 A;  1IFY A;  1WJ7 A;  4HEO A;  1E94 E;  1HQY E;  4GEW A;  1DO2 A;  1VDL A;  1G41 A;  1CUK A;  2DZL A;  2JP7 A;  3IHP A;  2DAK A;  2BWE A;  2DHY A;  2KNA A;  4F1I A;  2G3Q A;  1XB2 B;  3K9O A;  2R0I A;  1AIP C;  2ZTC A;  1TTE A;  2DAM A;  1OAI A;  2LBC A;  2JY6 B;  2H5X A;  2RRU A;  4G3O A;  2JNH A;  1VG5 A;  1HT2 E;  2OOB A;  1R4G A;  1IM2 A;  3F92 A;  2EJS A;  1P3Q Q;  1ZMV A;  2LVN C;  2WZJ A;  1SG9 A;  1ZMU A;  4R71 A;  1QZE A;  5DFL A;  3K9P A;  4Q7J A;  2LTU A;  2MRO B;  1OTR A;  3MMP A;  4UN2 B;  2MR9 A;  3B89 A;  3E46 A;  1WIV A;  1TR8 A;  2QHO B;  2B3T A;  1HJP A;  1WR1 B;  1VQ1 A;  2L2D A;  2O25 A;  2BWB A;  3GLI E;  1Y8G A;  2JUJ A;  1WGN A;  1VEK A;  1ZV1 A;  1G3I A;  2ZTD A;  1KYI A;  2OOA A;  1NV8 A;  2QSF X;  2LVA A;  4DBG B;  1VEG A;  2JY5 A;  2LVO C;  1EFU B;  1OQY A;  1XXH E;  1OKS A;  3E21 A;  4WP2 A;  2DI0 A;  1JR3 E;  2DAI A;  2KNV A;  2DAG A;  1BVS A;  1ZMW A;  2QNJ A;  2OO9 A;  2KHH A;  3FRH A;  1VEJ A;  2EKF A;  3BBZ A;  2HWJ A;  2MJ5 B;  3FE3 A;  1T43 A;  2DAE A;  2CP8 A;  1T6O A;  1UFZ A;  1C7Y A;  1IXS A;  1MN3 A;  2K9D A;  4F2L A;  1G4A E;  3H4J A;  3GLG E;  1DV0 A;  2L4E A;  2DNA A;  2CWB A;  2JZ1 A;  2JZ0 A;  2LVP C;  1DO0 A;  2HAK A;  5JI2 E;  1WGL A;  1YLA A;  3FRI A;  2KNZ A;  1PGY A;  1GO5 A;  3IEC A;  2JY8 A;  2DEN A;  2MGW A;  1F4I A;  3LCU A;  2K0B X;  1WHC A;  1Q02 A;  1NV9 A;  1V92 A;  2DKL A;  2EKK A;  2LVQ D;  2L4F A;  1A5T A;  3T6P A;  3GLH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...