2L4FA

Nmr structure of the uba domain of s. cerevisiae dcn1 bound to ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
57
structure length
57
Chain Sequence
IKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defective in cullin neddylation protein 1
publication title Structural analysis of the ubiquitin-associated domain (UBA) of yeast Dcn1 in complex with ubiquitin
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 15
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14555 UBA_4 UBA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2l4fA00
1PGYA 2MGWA 2DZLA 4UN2B 2ZTDA 2K0BX 1MN3A 1WGLA 2LVOC 2QSFX 1QZEA 1Y8GA 1XXHE 3IHPA 1DV0A 2WZJA 1ZMUA 2DENA 2H5XA 2LVNC 3F92A 5JI2E 2LVPC 1AIPC 1WR1B 3H4JA 1TR8A 2OOAA 2DHYA 2JZ0A 1HT1E 1IFYA 2JY7A 3GLIE 1HJPA 2DAEA 2OOBA 1ZV1A 3K9OA 2RRUA 4DBGB 2OO9A 2KNAA 2QHOB 2QNJA 2LTUA 3LCVB 1YLAA 1F4IA 2EJSA 2B3TA 3T6PA 2DAIA 1VDLA 1UFZA 3K9PA 2DAMA 1XB2B 2JNHA 1DO2A 2JY8A 1KYIA 2L2DA 1ZMVA 2HWJA 2JY6B 1VG5A 1TTEA 2ZTCA 1EFUB 3B89A 1Q02A 1JR3E 2DKLA 1WHCA 2DAKA 3MMPA 4WP2A 1NV9A 1G4AE 3BBZA 1IM2A 1R4GA 1T6OA 1VQ1A 2K9DA 2O25A 1HT2E 1VEGA 1OAIA 2DAGA 1OKSA 1VEKA 2JZ1A 1OQYA 1BVSA 2L4FA 4Q7JA 2LVAA 1E94E 1WIVA 1GO5A 5DFLA 1P3QQ 2EKKA 4G3OA 2R0IA 1C7YA 2MROB 2L4EA 1NV8A 1WGNA 2DI0A 3FRIA 1ZMWA 2BWBA 4R71A 1OTRA 2BWEA 1IXSA 2LVQD 1SG9A 3GLFE 1T43A 1V92A 1CUKA 2HAKA 2LBCA 4F2LA 2MR9A 3FRHA 2JUJA 3GLHE 3E21A 2JP7A 2JY5A 1G3IA 2EKFA 1G41A 4GEWA 4F1IA 4HEOA 2DNAA 1VEJA 2KNVA 3E46A 1WJ7A 1A5TA 2CWBA 2G3QA 3FE3A 2MJ5B 2KNZA 1HQYE 3IECA 3LCUA 1DO0A 3GLGE 2KHHA 2CP8A
chains in the Genus database with same CATH superfamily
2KA6B 1PGYA 4AW4A 2DZLA 4UN2B 2OPFA 1E9RA 3FUWA 4TUWA 2X49A 4QNMA 4IBCA 2L7HA 2XLJA 4LF6M 3HHYA 3CGWA 4GKJM 2MH8A 5EJCA 3ZC7B 5KQ8A 2ERCA 3VK8A 2L09A 3VK7A 1XXHA 3R8FA 3MHVC 3KOWE 1KSFX 3J81S 1XC8A 3B7NA 1AIPC 1NVMA 1WR1B 4REZA 1N33M 1QQWA 3H4JA 4KO8A 2XZFA 4DV3M 1QUSA 2OOAA 2RGOA 3LQQA 2JA2A 4DV5M 4LJ6A 1OIPA 3HJ8A 4NSOB 2WSCF 1V34A 1IFYA 3Q8GA 3I01M 3AOGA 1XHBA 3FUVA 1QAOA 1XXHB 2QZ4A 3K9OA 3KOXE 3NWLA 3T38A 4LF9M 1G71A 4Z8XA 3EIEA 1YE9A 1ZAEA 4MGKE 3UZUA 3U61A 1FNNA 1OFHA 2C99A 3GLIA 4G4OA 3AKZA 1E32A 3GLHB 2LWXA 3J27B 3PNYA 4JI8M 1YLAA 1F4IA 1DGFA 2CUZA 3HU3A 3T6PA 3DZDA 3AL0C 4DV7M 1PRBA 2DHRA 2UU9M 2DAMA 3RFWA 5EP2A 4X66M 3LQRA 3GPUA 1J5EM 4OX9M 4GHAA 4FWHA 2L2DA 3TWLA 3HHZA 3GLIB 2HWJA 1Z59A 2JY6B 3RGPA 2W82A 2HL7A 4G4NA 1EFUB 3FD9A 1L2DA 3KXEC 3VDUA 4IBIA 3FTEA 5KO3A 3BBZA 2R45A 3ILKA 5E6JA 1NY5A 2XH9A 2Y21A 2JZ1A 1JR3A 1BVSA 5FTNA 2DWNA 3WHKA 1SXJA 2VQEM 1NHWC 4NL4H 2ZANA 2KZSA 4W5WA 1GO5A 1TH3A 2L7IA 3FYCA 3QYBA 2V1UA 1NSFA 5EP1A 3SMPA 4KT0F 4ITQA 4DV6M 3PNVA 7CATA 3HKPA 4B3MM 2GQFA 2CHVA 4B3SM 4NRWA 2YR0A 1J7KA 4X64M 1IN5A 2F5SA 3U6LA 2KZUA 1SXJB 2DZOB 3SAWA 1IQPA 1SXJC 2BWBA 4GC5A 5EP3A 3SC3A 1QZMA 3D8LA 4IBKA 1DGBA 3HHXA 2LVQD 2I7NA 4CIZA 1V92A 2HAKA 2G8LA 3IG8A 4LRSA 2WSEF 3GPPA 2R46A 1N77A 3GRUA 3KP1E 4II7A 4ZPXA 1D0MA 5KPRA 5FLXS 2R62A 4NRVA 1TDHA 2Y20A 4FVMA 1N32M 2ZAMA 3FUTA 3GQ4A 3J7BA 1KFVA 1EIJA 4GEWA 4RKUF 3I51A 3FTFA 4JI2M 1VEJA 2VQFM 1UM8A 1WJ7A 2Z4SA 2R44A 1A5TA 3FE3A 5LMUM 3L28A 2DZNB 3LMMA 2F5OA 3IECA 4G6ZA 3GLGE 3U6EA 3SYKA 4OVZA 1GJSA 1NNJA 1MX0A 2FNAA 1J09A 2FE8A 2K0BX 1WGLA 2QSFX 4B3TM 4P16A 1XXHE 3FTDA 4M0DA 1LV7A 2K47A 2XSZA 4LGMA 1W5TA 2WZJA 3T1YM 1G59A 2CHQA 1Q3CA 3I4YA 1ZMUA 2DWMA 2LVNC 3GRVA 1YUBA 2XFSA 3KSXA 4B7GA 3M7GA 4M9SA 3HU2A 4OVZB 3CF0A 1X37A 3LW5F 3M6AA 3HWSA 4CGYB 1RU3A 2FH0A 2KEBA 2XF3A 3MJ5A 2JZ0A 1QANA 2K6BA 2RKOA 3SHFA 4RF1A 3FUUA 3GLIE 3WHLA 1QDTA 3L2AA 3C9PA 2XEPA 4AKIA 4WW0A 2OOBA 1T3TA 1YSYA 3CF2A 4LJ9A 2KRUA 1IN7A 4R3DA 2QNJA 2QHOB 1D0KA 1TF0B 3GLGA 1D0LA 1L8QA 2LTUA 3LCVB 1S3SA 2QQ8A 4MGYE 2FOIC 2EJSA 1L1TA 3KOYE 3CTWB 4NC6A 2QPAA 2DAIA 1UFZA 3GRRA 2R4JA 1HNWM 2JNHA 1DO2A 4GC9A 3KS4A 2C96A 3KSJA 3B7QA 4JN6A 4L15A 2E5LM 4DUYM 2KW0A 2D7EA 2YNMD 4FCWA 2CV2A 4LFBM 3GLGB 4LJ8A 4Z6YA 4LJ4A 1JR3E 1NO1A 1Q02A 4LCBA 2DAKA 2C98A 2DKLA 3MMPA 3TL4X 3HHWA 1SXJE 2EUCA 4DV1M 1G4AE 2APLA 5EXXA 5EXTA 1HT2E 2X8AA 4AG6A 2I7PA 1VEKA 1ZQ9A 4IBFA 1QVRA 3BOSA 4Q7JA 2UUBM 2AHMA 1E94E 2LVAA 1XNRM 3W68A 3W67A 4JI7M 5EQTA 4PT5A 4LF7M 5DFLA 3U6QA 3B74A 2V1CA 4G3OA 1PJQA 2R0IA 3E9SA 3KDSE 5FTMA 4PDIA 1PJIA 4LF8M 4QNRA 2L4EA 1NV8A 4IBEA 3U61B 1DGGA 3H4MA 4PCZA 4LZZA 5DYGA 2Q2EB 4NXMM 5A2QS 1Z5AA 3DFZA 2UXBM 4NOOB 5EXPA 1ZMWA 4AI6A 2LH0A 2Z3XA 2LHGA 2VDBB 3M0EA 3U6OA 4F2LA 1CUKA 3KP0E 1LTMA 3V76A 2UUAM 4AKGA 4IBJA 2JUJA 1G8PA 3T1HM 4GHLA 1G3IA 4G4RA 3HJQA 3W0LB 4MH0E 1OIZA 3GLFA 3A46A 1G41A 1QAQA 4Y28F 1I4WA 1XWIA 2GNOA 5IREB 3GO8A 4LFCM 3BXWA 3Q8XA 2N35A 3AFHA 2NQ8C 2ZBKB 3E46A 2V6ZM 2CWBA 2MJ5B 2KNZA 4IIWA 5GKNA 4OU7A 1DO0A 2CE7A 3JAMS 3VKGA 2KHHA 1TDZA 3KOZE 4JI5M 4LJ5A 2ZTDA 2JXNA 4XGIA 4EIWA 3GLFB 2YQZA 5FTJA 2BJVA 1QZEA 1Y8GA 3IG5A 2C5RA 2R6FA 1VDDA 3IHPA 1DV0A 3A45A 4LJ7A 4I5SA 4GH9A 4LF4M 1GVNA 1IXRC 2DENA 2LHCA 4KHPM 5IWAM 3F92A 5JI2E 1N34M 2LVPC 2R18A 3QAUA 3W0FA 1JR3D 3TWKA 4CJ6A 3TWMA 1NJFA 3U6CA 3GRYA 1E9SA 3KW6A 2L6OA 4HL4A 1L2BA 4LG2A 3UJNA 2DHYA 2FS1A 4DV2M 2Z7JA 3NBXX 3GPYA 3K2LA 2JY7A 4DR6M 4A3VB 4MM3B 3SYLA 3A98B 5BPVA 1QAMA 2DAEA 1EE8A 4I4LA 3LVVA 2RRUA 3TE6A 3JR5A 3EIHA 3GQ5A 4JI0M 3TPZA 2C9OA 1GL7A 1W5SA 1R2YA 4JI4M 3HZJA 1N78A 3C58A 3E4RA 1VDLA 1Z5CA 4DUZM 1JB0F 4DV4M 3AV0A 1NY6A 4LGYA 1XB2B 3RE8A 2CFOA 3ZH9B 4NSRA 4DV0M 2J5YA 3GP1A 1QDRA 2HCBA 5KPTA 4B7HA 1KYIA 3UMMA 1K3XA 4DR7M 3KS8A 4B3RM 2CHGA 2OQ4A 1GLNA 3VDPA 3QWLA 3DOAA 4M0WA 2ZTCA 4LZJA 2WSFF 3B89A 2XGNA 3K8ZA 2LNHC 1QYRA 1WHCA 3HX3A 4L78A 2DVWB 3L27A 3AJIB 4AQYM 4QOSA 1R4GA 1VQ1A 1T6OA 2K9DA 2M5ZA 2O25A 1MU5A 4QHTA 2CEAA 2DAGA 1IN4A 1OAIA 2X4AA 4FWGA 4LRTA 1Z6TA 1AUAA 2BNKA 2VF7A 3VKHA 1R5LA 4IJFA 3FTCA 3ZCBB 1PJSA 2XSZD 3PFIA 2YFQA 3OTOM 3SASA 4LF5M 1OFIA 2CV1A 1IBKM 3RGSA 4OW0A 4AZFA 3D8BA 3SAVA 1V33A 1C7YA 2H1RA 2F4VM 4D80A 3SATA 5C1BA 1Q3BA 3C3EA 4FW9A 1WGNA 1I94M 2F5PA 4JV5M 3SFZA 4JI6M 2ZAOA 3KVWA 3FRIA 4GRIA 1ORYB 2D7HA 4IBBA 1OTRA 2RGHA 3QYEA 3U6MA 5IT9S 2HHHM 5DNYA 3NBIA 4X62M 1HR0M 3GLFE 1T43A 2MR9A 3CF6E 1Q39A 3UK6A 5C18A 4DR3M 3U6PA 1GJTA 2JY5A 4I8OA 5IZ7D 5H37D 8CATA 5ITUA 4X65M 1IXZA 3K92A 1IN8A 1IBLM 1TH2A 3T15A 2EKFA 1GL6A 1XMQM 1DGHA 4MGIE 2JWSA 2ZM6M 3GLHA 3VLFB 4F1IA 1WXQA 2LXEA 4HLQA 4HEOA 1TGUA 2DNAA 2KNVA 3L26A 3KFUG 1IY2A 4AG5A 2CV0A 2UXDM 2G3QA 3I04M 2BJWA 1PJJA 3LCUA 5ITXA 3ZQJA 4KODA 4I81A 2CP8A 4K0KM 1R6BX 2MGWA 4AKHA 3UGJA 1MN3A 2LVOC 3PXGA 2HKJA 5L8RF 1DGHB 3AOEA 2R65A 4RNAA 5KPZA 4LFAM 4M9XA 5ITTA 2VIIA 4ANRA 5JI3E 1TH4A 2H5XA 2QCUA 3HJSA 4L16A 3SARA 1FJGM 1OJLA 5FTLA 1C1KA 5DYIA 3U60A 4DR2M 4BB9A 4WURA 3HY5A 4KLNA 2XZUA 1TR8A 4DR4M 4BLCA 1GABA 3SAUA 3AOEC 3HGIA 3TQSA 1HT1E 4GMQA 4CISA 4PDGA 2KXEA 4GIPA 1HJPA 5EXSA 4LJAA 2QP9X 1ZV1A 3VFDA 3JR4A 5LMNM 1XNQM 3GPXA 2O5RA 3U60B 4DBGB 2OO9A 3FYDA 2FFJA 4B08A 2UUCM 2KNAA 3U5ZA 3R9XB 2QENA 2Z4RA 1N75A 3A42A 4L8RC 2B3TA 4JYAM 2DXIA 1L2CA 3LVWA 3U6DA 1JQJC 3K9PA 3U6SA 1QUTA 2KDLA 2A5YB 3J80S 3THGA 5BR8M 1H6UA 4FWDA 3SHGB 1R7RA 1PJTA 2JY8A 1SXJD 2O01F 2R4EA 5FSWA 1ZMVA 5ITQA 2F5NA 4D82A 3HU1A 1NJGA 4L6V6 4MGZE 3U5ZB 1VG5A 4M9ZA 2Y0QA 1IBMM 1TTEA 3C3DA 2EO2A 4JI3M 3L25A 5F3WA 1K82A 3J7AS 4WP2A 4G4QA 1NV9A 2XFTA 3PVSA 4FD2A 4LY6A 5EP4A 1IM2A 1D2NA 1VEGA 2G5GX 1HQCA 1OKSA 2Z8YM 1OQYA 2UXCM 2DWZB 4L4UA 2L4FA 4PD2A 1HNZM 2QBYA 1WIVA 1NNUC 4BBAA 4FCTA 2P5TA 4CHTB 1P3QQ 1OAOC 2EKKA 2DWLA 2J7NA 4XK8F 3B7ZA 2MROB 4S12A 4GITA 1K3WA 4QHSA 1NHGC 4R7GA 4B7FA 3I4VA 1MJGM 3FKEA 5E26A 1L1ZA 4GKKM 3SBJA 2DI0A 4MGHA 2D7GA 4QOZC 3SMSA 1IN6A 2QBYB 3GQ3A 5KQDA 4R71A 2BWEA 2Y0TA 4IBDA 1IXSA 1SG9A 2C9CA 4NXNM 5ITYA 2LBCA 2CRUA 4FCVA 4JI1M 1GKIA 3K1JA 5FTKA 3FRHA 3GLHE 2VF8A 3E21A 3FUXA 2JP7A 4P17A 4MB7A 1PM5A 2M60A 4IJEA 4JXJA 1HNXM 5ITRA 4DR5M 3B9PA 5ITXE 1N36M 3L29A 1IY0A 1R2ZA 4YY3M 1IXSB 3J2PB 4DR1M 1XMOM 2F5QA 3MK6A 2KRKA 1HQYE 1Z5BA 4IBGA 4RF0A 1IY1A 3DA1A 4YHHM 4XBOA 4D81A 2EA0A 2J7OA
chains in the Genus database with same CATH topology
1PGYA 2MGWA 2DZLA 4UN2B 2ZTDA 2K0BX 1MN3A 1WGLA 2LVOC 2QSFX 1QZEA 1Y8GA 1XXHE 3IHPA 1DV0A 2WZJA 1ZMUA 2DENA 2H5XA 2LVNC 3F92A 5JI2E 2LVPC 1AIPC 1WR1B 3H4JA 1TR8A 2OOAA 2DHYA 2JZ0A 1HT1E 1IFYA 2JY7A 3GLIE 1HJPA 2DAEA 2OOBA 1ZV1A 3K9OA 2RRUA 4DBGB 2OO9A 2KNAA 2QHOB 2QNJA 2LTUA 3LCVB 1YLAA 1F4IA 2EJSA 2B3TA 3T6PA 2DAIA 1VDLA 1UFZA 3K9PA 2DAMA 1XB2B 2JNHA 1DO2A 2JY8A 1KYIA 2L2DA 1ZMVA 2HWJA 2JY6B 1VG5A 1TTEA 2ZTCA 1EFUB 3B89A 1Q02A 1JR3E 2DKLA 1WHCA 2DAKA 3MMPA 4WP2A 1NV9A 1G4AE 3BBZA 1IM2A 1R4GA 1T6OA 1VQ1A 2K9DA 2O25A 1HT2E 1VEGA 1OAIA 2DAGA 1OKSA 1VEKA 2JZ1A 1OQYA 1BVSA 2L4FA 4Q7JA 2LVAA 1E94E 1WIVA 1GO5A 5DFLA 1P3QQ 2EKKA 4G3OA 2R0IA 1C7YA 2MROB 2L4EA 1NV8A 1WGNA 2DI0A 3FRIA 1ZMWA 2BWBA 4R71A 1OTRA 2BWEA 1IXSA 2LVQD 1SG9A 3GLFE 1T43A 1V92A 1CUKA 2HAKA 2LBCA 4F2LA 2MR9A 3FRHA 2JUJA 3GLHE 3E21A 2JP7A 2JY5A 1G3IA 2EKFA 1G41A 4GEWA 4F1IA 4HEOA 2DNAA 1VEJA 2KNVA 3E46A 1WJ7A 1A5TA 2CWBA 2G3QA 3FE3A 2MJ5B 2KNZA 1HQYE 3IECA 3LCUA 1DO0A 3GLGE 2KHHA 2CP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGY A;  2MGW A;  2DZL A;  4UN2 B;  2ZTD A;  2K0B X;  1MN3 A;  1WGL A;  2LVO C;  2QSF X;  1QZE A;  1Y8G A;  1XXH E;  3IHP A;  1DV0 A;  2WZJ A;  1ZMU A;  2DEN A;  2H5X A;  2LVN C;  3F92 A;  5JI2 E;  2LVP C;  1AIP C;  1WR1 B;  3H4J A;  1TR8 A;  2OOA A;  2DHY A;  2JZ0 A;  1HT1 E;  1IFY A;  2JY7 A;  3GLI E;  1HJP A;  2DAE A;  2OOB A;  1ZV1 A;  3K9O A;  2RRU A;  4DBG B;  2OO9 A;  2KNA A;  2QHO B;  2QNJ A;  2LTU A;  3LCV B;  1YLA A;  1F4I A;  2EJS A;  2B3T A;  3T6P A;  2DAI A;  1VDL A;  1UFZ A;  3K9P A;  2DAM A;  1XB2 B;  2JNH A;  1DO2 A;  2JY8 A;  1KYI A;  2L2D A;  1ZMV A;  2HWJ A;  2JY6 B;  1VG5 A;  1TTE A;  2ZTC A;  1EFU B;  3B89 A;  1Q02 A;  1JR3 E;  2DKL A;  1WHC A;  2DAK A;  3MMP A;  4WP2 A;  1NV9 A;  1G4A E;  3BBZ A;  1IM2 A;  1R4G A;  1T6O A;  1VQ1 A;  2K9D A;  2O25 A;  1HT2 E;  1VEG A;  1OAI A;  2DAG A;  1OKS A;  1VEK A;  2JZ1 A;  1OQY A;  1BVS A;  2L4F A;  4Q7J A;  2LVA A;  1E94 E;  1WIV A;  1GO5 A;  5DFL A;  1P3Q Q;  2EKK A;  4G3O A;  2R0I A;  1C7Y A;  2MRO B;  2L4E A;  1NV8 A;  1WGN A;  2DI0 A;  3FRI A;  1ZMW A;  2BWB A;  4R71 A;  1OTR A;  2BWE A;  1IXS A;  2LVQ D;  1SG9 A;  3GLF E;  1T43 A;  1V92 A;  1CUK A;  2HAK A;  2LBC A;  4F2L A;  2MR9 A;  3FRH A;  2JUJ A;  3GLH E;  3E21 A;  2JP7 A;  2JY5 A;  1G3I A;  2EKF A;  1G41 A;  4GEW A;  4F1I A;  4HEO A;  2DNA A;  1VEJ A;  2KNV A;  3E46 A;  1WJ7 A;  1A5T A;  2CWB A;  2G3Q A;  3FE3 A;  2MJ5 B;  2KNZ A;  1HQY E;  3IEC A;  3LCU A;  1DO0 A;  3GLG E;  2KHH A;  2CP8 A; 
#chains in the Genus database with same CATH topology
 2KA6 B;  1PGY A;  4AW4 A;  2DZL A;  4UN2 B;  2OPF A;  1E9R A;  3FUW A;  4TUW A;  2X49 A;  4QNM A;  4IBC A;  2L7H A;  2XLJ A;  4LF6 M;  3HHY A;  3CGW A;  4GKJ M;  2MH8 A;  5EJC A;  3ZC7 B;  5KQ8 A;  2ERC A;  3VK8 A;  2L09 A;  3VK7 A;  1XXH A;  3R8F A;  3MHV C;  3KOW E;  1KSF X;  3J81 S;  1XC8 A;  3B7N A;  1AIP C;  1NVM A;  1WR1 B;  4REZ A;  1N33 M;  1QQW A;  3H4J A;  4KO8 A;  2XZF A;  4DV3 M;  1QUS A;  2OOA A;  2RGO A;  3LQQ A;  2JA2 A;  4DV5 M;  4LJ6 A;  1OIP A;  3HJ8 A;  4NSO B;  2WSC F;  1V34 A;  1IFY A;  3Q8G A;  3I01 M;  3AOG A;  1XHB A;  3FUV A;  1QAO A;  1XXH B;  2QZ4 A;  3K9O A;  3KOX E;  3NWL A;  3T38 A;  4LF9 M;  1G71 A;  4Z8X A;  3EIE A;  1YE9 A;  1ZAE A;  4MGK E;  3UZU A;  3U61 A;  1FNN A;  1OFH A;  2C99 A;  3GLI A;  4G4O A;  3AKZ A;  1E32 A;  3GLH B;  2LWX A;  3J27 B;  3PNY A;  4JI8 M;  1YLA A;  1F4I A;  1DGF A;  2CUZ A;  3HU3 A;  3T6P A;  3DZD A;  3AL0 C;  4DV7 M;  1PRB A;  2DHR A;  2UU9 M;  2DAM A;  3RFW A;  5EP2 A;  4X66 M;  3LQR A;  3GPU A;  1J5E M;  4OX9 M;  4GHA A;  4FWH A;  2L2D A;  3TWL A;  3HHZ A;  3GLI B;  2HWJ A;  1Z59 A;  2JY6 B;  3RGP A;  2W82 A;  2HL7 A;  4G4N A;  1EFU B;  3FD9 A;  1L2D A;  3KXE C;  3VDU A;  4IBI A;  3FTE A;  5KO3 A;  3BBZ A;  2R45 A;  3ILK A;  5E6J A;  1NY5 A;  2XH9 A;  2Y21 A;  2JZ1 A;  1JR3 A;  1BVS A;  5FTN A;  2DWN A;  3WHK A;  1SXJ A;  2VQE M;  1NHW C;  4NL4 H;  2ZAN A;  2KZS A;  4W5W A;  1GO5 A;  1TH3 A;  2L7I A;  3FYC A;  3QYB A;  2V1U A;  1NSF A;  5EP1 A;  3SMP A;  4KT0 F;  4ITQ A;  4DV6 M;  3PNV A;  7CAT A;  3HKP A;  4B3M M;  2GQF A;  2CHV A;  4B3S M;  4NRW A;  2YR0 A;  1J7K A;  4X64 M;  1IN5 A;  2F5S A;  3U6L A;  2KZU A;  1SXJ B;  2DZO B;  3SAW A;  1IQP A;  1SXJ C;  2BWB A;  4GC5 A;  5EP3 A;  3SC3 A;  1QZM A;  3D8L A;  4IBK A;  1DGB A;  3HHX A;  2LVQ D;  2I7N A;  4CIZ A;  1V92 A;  2HAK A;  2G8L A;  3IG8 A;  4LRS A;  2WSE F;  3GPP A;  2R46 A;  1N77 A;  3GRU A;  3KP1 E;  4II7 A;  4ZPX A;  1D0M A;  5KPR A;  5FLX S;  2R62 A;  4NRV A;  1TDH A;  2Y20 A;  4FVM A;  1N32 M;  2ZAM A;  3FUT A;  3GQ4 A;  3J7B A;  1KFV A;  1EIJ A;  4GEW A;  4RKU F;  3I51 A;  3FTF A;  4JI2 M;  1VEJ A;  2VQF M;  1UM8 A;  1WJ7 A;  2Z4S A;  2R44 A;  1A5T A;  3FE3 A;  5LMU M;  3L28 A;  2DZN B;  3LMM A;  2F5O A;  3IEC A;  4G6Z A;  3GLG E;  3U6E A;  3SYK A;  4OVZ A;  1GJS A;  1NNJ A;  1MX0 A;  2FNA A;  1J09 A;  2FE8 A;  2K0B X;  1WGL A;  2QSF X;  4B3T M;  4P16 A;  1XXH E;  3FTD A;  4M0D A;  1LV7 A;  2K47 A;  2XSZ A;  4LGM A;  1W5T A;  2WZJ A;  3T1Y M;  1G59 A;  2CHQ A;  1Q3C A;  3I4Y A;  1ZMU A;  2DWM A;  2LVN C;  3GRV A;  1YUB A;  2XFS A;  3KSX A;  4B7G A;  3M7G A;  4M9S A;  3HU2 A;  4OVZ B;  3CF0 A;  1X37 A;  3LW5 F;  3M6A A;  3HWS A;  4CGY B;  1RU3 A;  2FH0 A;  2KEB A;  2XF3 A;  3MJ5 A;  2JZ0 A;  1QAN A;  2K6B A;  2RKO A;  3SHF A;  4RF1 A;  3FUU A;  3GLI E;  3WHL A;  1QDT A;  3L2A A;  3C9P A;  2XEP A;  4AKI A;  4WW0 A;  2OOB A;  1T3T A;  1YSY A;  3CF2 A;  4LJ9 A;  2KRU A;  1IN7 A;  4R3D A;  2QNJ A;  2QHO B;  1D0K A;  1TF0 B;  3GLG A;  1D0L A;  1L8Q A;  2LTU A;  3LCV B;  1S3S A;  2QQ8 A;  4MGY E;  2FOI C;  2EJS A;  1L1T A;  3KOY E;  3CTW B;  4NC6 A;  2QPA A;  2DAI A;  1UFZ A;  3GRR A;  2R4J A;  1HNW M;  2JNH A;  1DO2 A;  4GC9 A;  3KS4 A;  2C96 A;  3KSJ A;  3B7Q A;  4JN6 A;  4L15 A;  2E5L M;  4DUY M;  2KW0 A;  2D7E A;  2YNM D;  4FCW A;  2CV2 A;  4LFB M;  3GLG B;  4LJ8 A;  4Z6Y A;  4LJ4 A;  1JR3 E;  1NO1 A;  1Q02 A;  4LCB A;  2DAK A;  2C98 A;  2DKL A;  3MMP A;  3TL4 X;  3HHW A;  1SXJ E;  2EUC A;  4DV1 M;  1G4A E;  2APL A;  5EXX A;  5EXT A;  1HT2 E;  2X8A A;  4AG6 A;  2I7P A;  1VEK A;  1ZQ9 A;  4IBF A;  1QVR A;  3BOS A;  4Q7J A;  2UUB M;  2AHM A;  1E94 E;  2LVA A;  1XNR M;  3W68 A;  3W67 A;  4JI7 M;  5EQT A;  4PT5 A;  4LF7 M;  5DFL A;  3U6Q A;  3B74 A;  2V1C A;  4G3O A;  1PJQ A;  2R0I A;  3E9S A;  3KDS E;  5FTM A;  4PDI A;  1PJI A;  4LF8 M;  4QNR A;  2L4E A;  1NV8 A;  4IBE A;  3U61 B;  1DGG A;  3H4M A;  4PCZ A;  4LZZ A;  5DYG A;  2Q2E B;  4NXM M;  5A2Q S;  1Z5A A;  3DFZ A;  2UXB M;  4NOO B;  5EXP A;  1ZMW A;  4AI6 A;  2LH0 A;  2Z3X A;  2LHG A;  2VDB B;  3M0E A;  3U6O A;  4F2L A;  1CUK A;  3KP0 E;  1LTM A;  3V76 A;  2UUA M;  4AKG A;  4IBJ A;  2JUJ A;  1G8P A;  3T1H M;  4GHL A;  1G3I A;  4G4R A;  3HJQ A;  3W0L B;  4MH0 E;  1OIZ A;  3GLF A;  3A46 A;  1G41 A;  1QAQ A;  4Y28 F;  1I4W A;  1XWI A;  2GNO A;  5IRE B;  3GO8 A;  4LFC M;  3BXW A;  3Q8X A;  2N35 A;  3AFH A;  2NQ8 C;  2ZBK B;  3E46 A;  2V6Z M;  2CWB A;  2MJ5 B;  2KNZ A;  4IIW A;  5GKN A;  4OU7 A;  1DO0 A;  2CE7 A;  3JAM S;  3VKG A;  2KHH A;  1TDZ A;  3KOZ E;  4JI5 M;  4LJ5 A;  2ZTD A;  2JXN A;  4XGI A;  4EIW A;  3GLF B;  2YQZ A;  5FTJ A;  2BJV A;  1QZE A;  1Y8G A;  3IG5 A;  2C5R A;  2R6F A;  1VDD A;  3IHP A;  1DV0 A;  3A45 A;  4LJ7 A;  4I5S A;  4GH9 A;  4LF4 M;  1GVN A;  1IXR C;  2DEN A;  2LHC A;  4KHP M;  5IWA M;  3F92 A;  5JI2 E;  1N34 M;  2LVP C;  2R18 A;  3QAU A;  3W0F A;  1JR3 D;  3TWK A;  4CJ6 A;  3TWM A;  1NJF A;  3U6C A;  3GRY A;  1E9S A;  3KW6 A;  2L6O A;  4HL4 A;  1L2B A;  4LG2 A;  3UJN A;  2DHY A;  2FS1 A;  4DV2 M;  2Z7J A;  3NBX X;  3GPY A;  3K2L A;  2JY7 A;  4DR6 M;  4A3V B;  4MM3 B;  3SYL A;  3A98 B;  5BPV A;  1QAM A;  2DAE A;  1EE8 A;  4I4L A;  3LVV A;  2RRU A;  3TE6 A;  3JR5 A;  3EIH A;  3GQ5 A;  4JI0 M;  3TPZ A;  2C9O A;  1GL7 A;  1W5S A;  1R2Y A;  4JI4 M;  3HZJ A;  1N78 A;  3C58 A;  3E4R A;  1VDL A;  1Z5C A;  4DUZ M;  1JB0 F;  4DV4 M;  3AV0 A;  1NY6 A;  4LGY A;  1XB2 B;  3RE8 A;  2CFO A;  3ZH9 B;  4NSR A;  4DV0 M;  2J5Y A;  3GP1 A;  1QDR A;  2HCB A;  5KPT A;  4B7H A;  1KYI A;  3UMM A;  1K3X A;  4DR7 M;  3KS8 A;  4B3R M;  2CHG A;  2OQ4 A;  1GLN A;  3VDP A;  3QWL A;  3DOA A;  4M0W A;  2ZTC A;  4LZJ A;  2WSF F;  3B89 A;  2XGN A;  3K8Z A;  2LNH C;  1QYR A;  1WHC A;  3HX3 A;  4L78 A;  2DVW B;  3L27 A;  3AJI B;  4AQY M;  4QOS A;  1R4G A;  1VQ1 A;  1T6O A;  2K9D A;  2M5Z A;  2O25 A;  1MU5 A;  4QHT A;  2CEA A;  2DAG A;  1IN4 A;  1OAI A;  2X4A A;  4FWG A;  4LRT A;  1Z6T A;  1AUA A;  2BNK A;  2VF7 A;  3VKH A;  1R5L A;  4IJF A;  3FTC A;  3ZCB B;  1PJS A;  2XSZ D;  3PFI A;  2YFQ A;  3OTO M;  3SAS A;  4LF5 M;  1OFI A;  2CV1 A;  1IBK M;  3RGS A;  4OW0 A;  4AZF A;  3D8B A;  3SAV A;  1V33 A;  1C7Y A;  2H1R A;  2F4V M;  4D80 A;  3SAT A;  5C1B A;  1Q3B A;  3C3E A;  4FW9 A;  1WGN A;  1I94 M;  2F5P A;  4JV5 M;  3SFZ A;  4JI6 M;  2ZAO A;  3KVW A;  3FRI A;  4GRI A;  1ORY B;  2D7H A;  4IBB A;  1OTR A;  2RGH A;  3QYE A;  3U6M A;  5IT9 S;  2HHH M;  5DNY A;  3NBI A;  4X62 M;  1HR0 M;  3GLF E;  1T43 A;  2MR9 A;  3CF6 E;  1Q39 A;  3UK6 A;  5C18 A;  4DR3 M;  3U6P A;  1GJT A;  2JY5 A;  4I8O A;  5IZ7 D;  5H37 D;  8CAT A;  5ITU A;  4X65 M;  1IXZ A;  3K92 A;  1IN8 A;  1IBL M;  1TH2 A;  3T15 A;  2EKF A;  1GL6 A;  1XMQ M;  1DGH A;  4MGI E;  2JWS A;  2ZM6 M;  3GLH A;  3VLF B;  4F1I A;  1WXQ A;  2LXE A;  4HLQ A;  4HEO A;  1TGU A;  2DNA A;  2KNV A;  3L26 A;  3KFU G;  1IY2 A;  4AG5 A;  2CV0 A;  2UXD M;  2G3Q A;  3I04 M;  2BJW A;  1PJJ A;  3LCU A;  5ITX A;  3ZQJ A;  4KOD A;  4I81 A;  2CP8 A;  4K0K M;  1R6B X;  2MGW A;  4AKH A;  3UGJ A;  1MN3 A;  2LVO C;  3PXG A;  2HKJ A;  5L8R F;  1DGH B;  3AOE A;  2R65 A;  4RNA A;  5KPZ A;  4LFA M;  4M9X A;  5ITT A;  2VII A;  4ANR A;  5JI3 E;  1TH4 A;  2H5X A;  2QCU A;  3HJS A;  4L16 A;  3SAR A;  1FJG M;  1OJL A;  5FTL A;  1C1K A;  5DYI A;  3U60 A;  4DR2 M;  4BB9 A;  4WUR A;  3HY5 A;  4KLN A;  2XZU A;  1TR8 A;  4DR4 M;  4BLC A;  1GAB A;  3SAU A;  3AOE C;  3HGI A;  3TQS A;  1HT1 E;  4GMQ A;  4CIS A;  4PDG A;  2KXE A;  4GIP A;  1HJP A;  5EXS A;  4LJA A;  2QP9 X;  1ZV1 A;  3VFD A;  3JR4 A;  5LMN M;  1XNQ M;  3GPX A;  2O5R A;  3U60 B;  4DBG B;  2OO9 A;  3FYD A;  2FFJ A;  4B08 A;  2UUC M;  2KNA A;  3U5Z A;  3R9X B;  2QEN A;  2Z4R A;  1N75 A;  3A42 A;  4L8R C;  2B3T A;  4JYA M;  2DXI A;  1L2C A;  3LVW A;  3U6D A;  1JQJ C;  3K9P A;  3U6S A;  1QUT A;  2KDL A;  2A5Y B;  3J80 S;  3THG A;  5BR8 M;  1H6U A;  4FWD A;  3SHG B;  1R7R A;  1PJT A;  2JY8 A;  1SXJ D;  2O01 F;  2R4E A;  5FSW A;  1ZMV A;  5ITQ A;  2F5N A;  4D82 A;  3HU1 A;  1NJG A;  4L6V 6;  4MGZ E;  3U5Z B;  1VG5 A;  4M9Z A;  2Y0Q A;  1IBM M;  1TTE A;  3C3D A;  2EO2 A;  4JI3 M;  3L25 A;  5F3W A;  1K82 A;  3J7A S;  4WP2 A;  4G4Q A;  1NV9 A;  2XFT A;  3PVS A;  4FD2 A;  4LY6 A;  5EP4 A;  1IM2 A;  1D2N A;  1VEG A;  2G5G X;  1HQC A;  1OKS A;  2Z8Y M;  1OQY A;  2UXC M;  2DWZ B;  4L4U A;  2L4F A;  4PD2 A;  1HNZ M;  2QBY A;  1WIV A;  1NNU C;  4BBA A;  4FCT A;  2P5T A;  4CHT B;  1P3Q Q;  1OAO C;  2EKK A;  2DWL A;  2J7N A;  4XK8 F;  3B7Z A;  2MRO B;  4S12 A;  4GIT A;  1K3W A;  4QHS A;  1NHG C;  4R7G A;  4B7F A;  3I4V A;  1MJG M;  3FKE A;  5E26 A;  1L1Z A;  4GKK M;  3SBJ A;  2DI0 A;  4MGH A;  2D7G A;  4QOZ C;  3SMS A;  1IN6 A;  2QBY B;  3GQ3 A;  5KQD A;  4R71 A;  2BWE A;  2Y0T A;  4IBD A;  1IXS A;  1SG9 A;  2C9C A;  4NXN M;  5ITY A;  2LBC A;  2CRU A;  4FCV A;  4JI1 M;  1GKI A;  3K1J A;  5FTK A;  3FRH A;  3GLH E;  2VF8 A;  3E21 A;  3FUX A;  2JP7 A;  4P17 A;  4MB7 A;  1PM5 A;  2M60 A;  4IJE A;  4JXJ A;  1HNX M;  5ITR A;  4DR5 M;  3B9P A;  5ITX E;  1N36 M;  3L29 A;  1IY0 A;  1R2Z A;  4YY3 M;  1IXS B;  3J2P B;  4DR1 M;  1XMO M;  2F5Q A;  3MK6 A;  2KRK A;  1HQY E;  1Z5B A;  4IBG A;  4RF0 A;  1IY1 A;  3DA1 A;  4YHH M;  4XBO A;  4D81 A;  2EA0 A;  2J7O A; 
#chains in the Genus database with same CATH homology
 1PGY A;  2MGW A;  2DZL A;  4UN2 B;  2ZTD A;  2K0B X;  1MN3 A;  1WGL A;  2LVO C;  2QSF X;  1QZE A;  1Y8G A;  1XXH E;  3IHP A;  1DV0 A;  2WZJ A;  1ZMU A;  2DEN A;  2H5X A;  2LVN C;  3F92 A;  5JI2 E;  2LVP C;  1AIP C;  1WR1 B;  3H4J A;  1TR8 A;  2OOA A;  2DHY A;  2JZ0 A;  1HT1 E;  1IFY A;  2JY7 A;  3GLI E;  1HJP A;  2DAE A;  2OOB A;  1ZV1 A;  3K9O A;  2RRU A;  4DBG B;  2OO9 A;  2KNA A;  2QHO B;  2QNJ A;  2LTU A;  3LCV B;  1YLA A;  1F4I A;  2EJS A;  2B3T A;  3T6P A;  2DAI A;  1VDL A;  1UFZ A;  3K9P A;  2DAM A;  1XB2 B;  2JNH A;  1DO2 A;  2JY8 A;  1KYI A;  2L2D A;  1ZMV A;  2HWJ A;  2JY6 B;  1VG5 A;  1TTE A;  2ZTC A;  1EFU B;  3B89 A;  1Q02 A;  1JR3 E;  2DKL A;  1WHC A;  2DAK A;  3MMP A;  4WP2 A;  1NV9 A;  1G4A E;  3BBZ A;  1IM2 A;  1R4G A;  1T6O A;  1VQ1 A;  2K9D A;  2O25 A;  1HT2 E;  1VEG A;  1OAI A;  2DAG A;  1OKS A;  1VEK A;  2JZ1 A;  1OQY A;  1BVS A;  2L4F A;  4Q7J A;  2LVA A;  1E94 E;  1WIV A;  1GO5 A;  5DFL A;  1P3Q Q;  2EKK A;  4G3O A;  2R0I A;  1C7Y A;  2MRO B;  2L4E A;  1NV8 A;  1WGN A;  2DI0 A;  3FRI A;  1ZMW A;  2BWB A;  4R71 A;  1OTR A;  2BWE A;  1IXS A;  2LVQ D;  1SG9 A;  3GLF E;  1T43 A;  1V92 A;  1CUK A;  2HAK A;  2LBC A;  4F2L A;  2MR9 A;  3FRH A;  2JUJ A;  3GLH E;  3E21 A;  2JP7 A;  2JY5 A;  1G3I A;  2EKF A;  1G41 A;  4GEW A;  4F1I A;  4HEO A;  2DNA A;  1VEJ A;  2KNV A;  3E46 A;  1WJ7 A;  1A5T A;  2CWB A;  2G3Q A;  3FE3 A;  2MJ5 B;  2KNZ A;  1HQY E;  3IEC A;  3LCU A;  1DO0 A;  3GLG E;  2KHH A;  2CP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...