3KP1E

Crystal structure of ornithine 4,5 aminomutase (resting state)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
109
structure length
109
Chain Sequence
b'DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 44
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp1E02
3KOXE 3KP1E 3KOWE 3KP0E 3KOZE 3KOYE
chains in the Genus database with same CATH superfamily
2YR0A 1KSFX 5ITUA 3TPZA 2XLJA 2LWXA 4DV1M 2L2DA 3UZUA 5IT9S 3B7NA 1IN5A 4KHPM 1GABA 1G8PA 1JQJC 2WSFF 3SC3A 2WSEF 3GRVA 3C3DA 2E5LM 5ITRA 3D8BA 4FCVA 5ITXA 3K1JA 2K6BA 2NQ8C 3DA1A 3PNVA 3J7AS 4I81A 2RGHA 3HU3A 1Z59A 3THGA 1CUKA 1PM5A 3A46A 1HNZM 3HHZA 1GVNA 3GLHB 3IG5A 4IBFA 2L7IA 1SXJA 3VDUA 1GJSA 4X64M 4P16A 2KW0A 3LQRA 1ZMUA 2L4EA 3NWLA 2QSFX 1Q3BA 4I4LA 4PCZA 3KS4A 4I8OA 2HAKA 3GLGE 3QWLA 3A42A 4OU7A 2UXDM 4JI5M 1D0KA 1IN8A 3L26A 1Z5AA 2XEPA 4M0DA 1NNJA 2F5SA 4G4NA 2D7HA 3EIEA 2EJSA 3GQ3A 2L4FA 2DAIA 4QHSA 3LVVA 3TQSA 2O5RA 5C18A 3CF6E 3KOWE 4M9SA 3FD9A 4DR5M 1TH2A 3ZQJA 1DGGA 1PJQA 5KQ8A 1IY0A 1XC8A 2R6FA 2FS1A 3R8FA 4LJ9A 3KSXA 3FTCA 4F1IA 3FUXA 3T15A 2ZANA 3LVWA 4IIWA 3W68A 2UUCM 1R6BX 1VEJA 3U6MA 3JR5A 3I01M 3MJ5A 3GLIE 1VG5A 3J27B 1L8QA 4L4UA 3W0FA 1L2CA 4NC6A 1IXZA 4B7GA 5FSWA 5EXPA 3U6LA 3W67A 1YUBA 3MHVC 4DR6M 4RKUF 3GLFA 1RU3A 1IY1A 2JY8A 4LCBA 1QVRA 3RGSA 2EKKA 1NVMA 4GKJM 4GMQA 2C9OA 3H4JA 5EXTA 4II7A 3TL4X 1YE9A 3BOSA 4EIWA 1AIPC 2MJ5B 3HWSA 3Q8XA 3I51A 5E6JA 5DNYA 1PRBA 3HKPA 2DHYA 2R65A 4JV5M 4DV2M 5EXSA 3SFZA 3I04M 2KRKA 3SASA 2O25A 3BXWA 4LRSA 4WW0A 2VF7A 4S12A 4ITQA 1NNUC 2J7NA 1HJPA 4LY6A 5FTJA 3C3EA 4FCWA 3U5ZB 2EA0A 4HL4A 1QZEA 1Z6TA 4OVZA 1ZV1A 3ILKA 4G4RA 3HHXA 1XXHA 3CTWB 2LBCA 1QUTA 4GEWA 3LQQA 2Y20A 2DWMA 2DWZB 2KNVA 2C96A 2G8LA 4DR1M 4IBEA 2BNKA 4LF8M 8CATA 2CE7A 4G6ZA 2Y0TA 2JZ1A 2DKLA 2G3QA 2Z7JA 2QNJA 4PD2A 3KVWA 4GC5A 4AKHA 3HX3A 3H4MA 4NRWA 4NRVA 4GIPA 2BJWA 3HJSA 3VKHA 4AI6A 1QAOA 3FTDA 2LH0A 1DGHB 1VEGA 1I4WA 4PDIA 3L2AA 1R4GA 3HGIA 3LCUA 1DO2A 4IBKA 4LZJA 4XBOA 2HKJA 3LW5F 3RFWA 4QOZC 3DZDA 5JI2E 2FH0A 1A5TA 3U60A 2V1UA 5EP2A 4LF6M 3VK7A 5ITYA 2DENA 1E94E 2CWBA 3T1YM 3U6QA 2L7HA 3FUVA 2QCUA 1JR3A 2XFTA 2J5YA 2VDBB 4OX9M 2Z3XA 1HNWM 2XSZA 4IBDA 2JZ0A 4AKGA 1HQCA 4AZFA 5DFLA 1N33M 2F5QA 4GHAA 3HU2A 3GQ5A 4REZA 5ITXE 1G71A 3SAVA 2F5OA 1ORYB 4P17A 2ERCA 1IN7A 1JB0F 2X4AA 2X8AA 1XHBA 1SXJE 5FLXS 4QNRA 2MH8A 2HCBA 3CF0A 1XNQM 1P3QQ 3J81S 1XMQM 4LG2A 1TR8A 2APLA 2QPAA 2W82A 4LJAA 4LFAM 3VFDA 3KDSE 1NJFA 1T43A 1E32A 3E21A 4G3OA 4DV3M 3KXEC 2QBYA 2MR9A 4B3RM 1S3SA 3KOXE 1D0MA 4AG6A 4AW4A 3PXGA 2VF8A 4NOOB 1EFUB 1WHCA 3E46A 1OAIA 4NXNM 2K9DA 1QYRA 2JA2A 4DBGB 2DXIA 4JI8M 1C1KA 3HJ8A 2ZAMA 1IY2A 1YLAA 3FYCA 4KODA 2V1CA 3U61A 2CEAA 2JY5A 4KO8A 1YSYA 2F5PA 4MGHA 4GHLA 1QAMA 3UJNA 3FTFA 2D7EA 3MMPA 1PJJA 4NL4H 2L09A 2OPFA 2CP8A 1LTMA 2F5NA 1VDLA 4ZPXA 3UMMA 3GRRA 4MGKE 1OAOC 3WHKA 1N36M 4DV4M 2UXCM 3B9PA 4D81A 3SARA 4LF5M 3SAUA 3PVSA 4IJEA 3SAWA 2UXBM 3DFZA 5JI3E 1XWIA 4RNAA 1E9SA 1G4AE 2CUZA 2C98A 4BBAA 3GLGB 4PT5A 2JY7A 4DV0M 3U6SA 2I7PA 3GLFE 3SBJA 1VEKA 2CHGA 2CV0A 3AOEC 4RF1A 3HHYA 3GPYA 2CHVA 1NHGC 3J2PB 4F2LA 3GLHA 5DYGA 2JY6B 1Q39A 1Y8GA 4YHHM 3U6EA 1QAQA 4JI4M 1R5LA 2RRUA 1D2NA 4IJFA 2OO9A 3KFUG 4B3MM 4L8RC 1AUAA 1IQPA 1XNRM 4ANRA 1V92A 4FWDA 1J09A 2XGNA 3SYLA 3W0LB 4FVMA 2C9CA 2JWSA 1WR1B 1OQYA 3B74A 1V34A 3FUTA 3QAUA 1H6UA 1XXHE 2V6ZM 4DV5M 1L2DA 2XFSA 3UK6A 2VQFM 1MJGM 2XF3A 2KNAA 3GLIB 4DUZM 3L29A 2FOIC 3SYKA 2ZM6M 4AKIA 2Y0QA 3F92A 5IWAM 2J7OA 3GPPA 1TDZA 4Z6YA 4GH9A 2KDLA 4LRTA 1JR3D 1MU5A 4B08A 2XSZD 2XZUA 3LCVB 2F4VM 1T3TA 5KPRA 3A45A 2Z8YM 2I7NA 1IFYA 3MK6A 2FE8A 1WGNA 2JNHA 2DAGA 1PJTA 4QNMA 3ZCBB 4BLCA 5F3WA 2QZ4A 2KNZA 2N35A 3HJQA 4YY3M 3EIHA 2OOAA 1TH3A 1R7RA 2C99A 2R44A 4XK8F 2ZTCA 3UGJA 2XZFA 1PJIA 1JR3E 4FWGA 1IXSB 4NSRA 1NJGA 2WSCF 4W5WA 4X66M 3U6OA 2FFJA 3B7ZA 2QHOB 3E4RA 1K3WA 4GKKM 1QQWA 1QDRA 3AOGA 3NBIA 4L78A 2L6OA 2BWEA 1N75A 4LF4M 1NV8A 5KO3A 3U6CA 1IBLM 1TGUA 2D7GA 3FYDA 1W5TA 3U5ZA 3KSJA 3AFHA 3VDPA 2XH9A 3HY5A 3IG8A 2VQEM 7CATA 3HU1A 4LZZA 3NBXX 1NHWC 4AG5A 2Q2EB 3RGPA 1OIZA 2DHRA 4DV7M 1KFVA 2KRUA 2YQZA 2LVAA 2MROB 2K0BX 3JR4A 4LGYA 3TWMA 1EIJA 2DZNB 3KOZE 2CRUA 2CHQA 4LJ8A 3AKZA 4LFCM 4DR4M 1IN4A 4LF9M 2B3TA 4HEOA 4JYAM 5EP3A 4D80A 4AQYM 4GC9A 2QP9X 1L1TA 2LVNC 1C7YA 4JI7M 2KEBA 4BB9A 1I94M 1WGLA 2R45A 1HQYE 1DGHA 4L15A 5IZ7D 1UFZA 3IHPA 1K82A 4M9ZA 2AHMA 1VQ1A 1G3IA 2O01F 5KQDA 4R7GA 3SMSA 1DV0A 2H1RA 3FTEA 2LTUA 4FWHA 3SMPA 2BWBA 1ZAEA 2LHGA 5GKNA 1GKIA 1OFIA 1N77A 1Q3CA 4CIZA 4LFBM 4FW9A 4DUYM 1PGYA 4MGYE 1OJLA 1HNXM 1SXJB 5A2QS 1DGBA 2R4EA 2CFOA 3VK8A 1DO0A 1NY6A 1IBMM 2GNOA 4G4OA 4DR3M 1QDTA 2RKOA 2K47A 3L25A 3C58A 1MN3A 4DV6M 3SATA 5EP1A 1WIVA 2EKFA 2KZUA 3FRIA 3V76A 4D82A 4QOSA 1IN6A 5FTKA 3GPUA 1ZMVA 2KXEA 3GLHE 1HT1E 5FTNA 1SXJC 2LNHC 5H37D 5ITQA 1KYIA 3E9SA 4FD2A 5EXXA 1HR0M 1FJGM 2YFQA 2ZTDA 1G41A 1W5SA 2QQ8A 5L8RF 3QYBA 5C1BA 3K8ZA 2FNAA 1E9RA 3KOYE 2KA6B 3HHWA 1DGFA 4Y28F 4QHTA 1N78A 3WHLA 1SG9A 1F4IA 3Q8GA 4B3SM 4MGZE 3TWLA 4TUWA 2JXNA 3J80S 5LMNM 4MM3B 1GJTA 1MX0A 2R0IA 1QANA 2WZJA 5BPVA 2P5TA 1G59A 3QYEA 4L16A 3FUWA 4RF0A 3M6AA 2BJVA 3M0EA 4LGMA 1NY5A 2M60A 4FCTA 3GLFB 1IM2A 1OKSA 2EO2A 3AOEA 3VKGA 2DZLA 4NSOB 5E26A 1NO1A 5KPTA 3GRUA 3K92A 1TTEA 3FRHA 2DVWB 5KPZA 3T1HM 2LVPC 4GITA 4R71A 1OFHA 1L2BA 3KP0E 3KW6A 4B3TM 3GLGA 4CISA 1IXRC 2R62A 4JI1M 2G5GX 4B7FA 2CV2A 4JXJA 2UU9M 1R2YA 1J7KA 4OVZB 2DZOB 3B7QA 3BBZA 2ZBKB 3U6PA 1XXHB 2JUJA 1J5EM 3LMMA 2HWJA 4PDGA 3A98B 4IBJA 4X65M 2RGOA 3FE3A 4LJ6A 3SHGB 2Z4SA 2DI0A 3L27A 3DOAA 4MH0E 3CGWA 5EQTA 2VIIA 5EP4A 4M0WA 1Z5CA 3JAMS 1K3XA 2UUAM 2DWLA 2C5RA 4JI3M 1EE8A 1QUSA 3TWKA 1GO5A 1Z5BA 3TE6A 5IREB 2LVQD 3VLFB 5FTMA 5EJCA 1ZMWA 2CV1A 1X37A 3D8LA 3RE8A 2DWNA 5FTLA 4A3VB 1OIPA 1PJSA 3OTOM 3R9XB 1LV7A 4IBIA 1L1ZA 4MB7A 3GLIA 2QENA 5BR8M 3KS8A 4OW0A 2JP7A 4Z8XA 4M9XA 3C9PA 3U6DA 1GLNA 1QZMA 3AJIB 4UN2B 3U60B 4NXMM 3GQ4A 2M5ZA 4CJ6A 4LJ4A 3I4YA 2DAMA 2MGWA 2KHHA 1NV9A 4KT0F 1GL6A 2EUCA 1Q02A 4X62M 3GPXA 4JI6M 3HZJA 2H5XA 3GO8A 1IBKM 4XGIA 4I5SA 2UUBM 4IBBA 2LXEA 3CF2A 4LF7M 3ZH9B 1R2ZA 3FUUA 3GRYA 1TDHA 4MGIE 2LVOC 4KLNA 4CGYB 2LHCA 2OOBA 1HT2E 1V33A 4JI2M 2HHHM 4LJ5A 4B7HA 2KZSA 3PFIA 3I4VA 1IXSA 1WJ7A 3SHFA 4DR2M 2R18A 4Q7JA 2DAKA 4WP2A 1GL7A 2ZAOA 3K9OA 4G4QA 3M7GA 4WURA 1OTRA 2A5YB 2R4JA 1TH4A 2Y21A 1UM8A 4IBGA 1D0LA 2DNAA 2HL7A 2QBYB 1SXJD 4JI0M 1WXQA 1NSFA 3IECA 1BVSA 2X49A 4LJ7A 4K0KM 2R46A 1N32M 5LMUM 3T6PA 3FKEA 3T38A 3KP1E 4GRIA 1T6OA 1XB2B 3J7BA 3GP1A 4CHTB 4L6V6 3ZC7B 4R3DA 2YNMD 2DAEA 3K9PA 4JN6A 3U61B 1N34M 3PNYA 1TF0B 4DR7M 3AL0C 2Z4RA 4IBCA 3K2LA 3AV0A 5DYIA 2OQ4A 4HLQA 3B89A 1ZQ9A 1FNNA 1XMOM 2GQFA 1VDDA 3L28A 5ITTA
chains in the Genus database with same CATH topology
2YR0A 1KSFX 5ITUA 3TPZA 2XLJA 2LWXA 4DV1M 3UZUA 5IT9S 1IN5A 4KHPM 1G8PA 1JQJC 3SC3A 3GRVA 2E5LM 5ITRA 3D8BA 4FCVA 5ITXA 3K1JA 3PNVA 2NQ8C 3DA1A 3J7AS 4I81A 2RGHA 3HU3A 1Z59A 3THGA 1PM5A 3A46A 1HNZM 3HHZA 1GVNA 3GLHB 3IG5A 4IBFA 2L7IA 1SXJA 3VDUA 4X64M 4P16A 2KW0A 3LQRA 3NWLA 1Q3BA 4I4LA 4PCZA 3KS4A 4I8OA 3QWLA 3A42A 4OU7A 2UXDM 1IN8A 3L26A 1Z5AA 2XEPA 4M0DA 1NNJA 2F5SA 4G4NA 2D7HA 3EIEA 3GQ3A 4QHSA 3TQSA 3LVVA 5C18A 2O5RA 3CF6E 3KOWE 4M9SA 3FD9A 4DR5M 1TH2A 1DGGA 5KQ8A 1IY0A 1XC8A 3R8FA 4LJ9A 3KSXA 3FTCA 3FUXA 3T15A 2ZANA 3LVWA 4IIWA 2UUCM 1R6BX 3U6MA 3JR5A 3MJ5A 3J27B 1L8QA 4L4UA 3W0FA 1L2CA 4B7GA 1IXZA 5FSWA 5EXPA 3U6LA 1YUBA 3MHVC 4DR6M 3GLFA 1IY1A 4LCBA 3RGSA 1QVRA 1NVMA 4GKJM 4GMQA 2C9OA 5EXTA 4II7A 3TL4X 1YE9A 3BOSA 4EIWA 3HWSA 3Q8XA 3I51A 5E6JA 5DNYA 3HKPA 2R65A 4JV5M 4DV2M 5EXSA 3SFZA 2KRKA 3SASA 4LRSA 4WW0A 4S12A 4ITQA 1NNUC 2J7NA 4LY6A 5FTJA 4FCWA 3U5ZB 2EA0A 4HL4A 1Z6TA 4OVZA 4G4RA 3ILKA 3HHXA 1XXHA 3CTWB 3LQQA 2Y20A 2DWMA 2DWZB 2C96A 2G8LA 4DR1M 4IBEA 2BNKA 4LF8M 8CATA 2CE7A 4G6ZA 2Y0TA 2Z7JA 4PD2A 3KVWA 4GC5A 4AKHA 3H4MA 4NRWA 4NRVA 4GIPA 2BJWA 3HJSA 3VKHA 4AI6A 1QAOA 3FTDA 2LH0A 1DGHB 1I4WA 4PDIA 3L2AA 3HGIA 4XBOA 1DO2A 4IBKA 4LZJA 3RFWA 2HKJA 4QOZC 3DZDA 5JI2E 3U60A 2V1UA 5EP2A 4LF6M 3VK7A 5ITYA 1E94E 3T1YM 3U6QA 2L7HA 3FUVA 2QCUA 1JR3A 2XFTA 4OX9M 1HNWM 2Z3XA 2XSZA 4IBDA 4AKGA 1HQCA 4AZFA 1N33M 2F5QA 4GHAA 3HU2A 3GQ5A 4REZA 5ITXE 3SAVA 2F5OA 1ORYB 2ERCA 1IN7A 2X4AA 2X8AA 1XHBA 1SXJE 5FLXS 4QNRA 2HCBA 3CF0A 1XNQM 3J81S 1XMQM 4LG2A 2QPAA 2W82A 4LJAA 4LFAM 3VFDA 3KDSE 1NJFA 4JI5M 1E32A 2QBYA 4DV3M 4B3RM 3KXEC 1S3SA 3KOXE 4AG6A 4AW4A 3PXGA 4NOOB 4NXNM 1QYRA 2JA2A 2DXIA 4JI8M 1C1KA 3HJ8A 2ZAMA 1IY2A 3FYCA 4KODA 2V1CA 3U61A 2CEAA 4KO8A 2F5PA 1YSYA 4GHLA 4MGHA 1QAMA 3UJNA 3FTFA 2D7EA 1PJJA 4NL4H 2L09A 2OPFA 2F5NA 4ZPXA 3UMMA 3GRRA 4MGKE 3WHKA 1N36M 2UXCM 4DV4M 3B9PA 4D81A 3SARA 4LF5M 3SAUA 3PVSA 4IJEA 3SAWA 2UXBM 3DFZA 5JI3E 1XWIA 4RNAA 1E9SA 1G4AE 2CUZA 2C98A 4BBAA 3GLGB 4PT5A 3U6SA 4DV0M 2I7PA 3SBJA 2CHGA 2CV0A 3AOEC 4RF1A 3HHYA 3GPYA 2CHVA 1NHGC 3J2PB 3GLHA 5DYGA 1Q39A 4YHHM 3U6EA 1QAQA 4JI4M 1D2NA 4IJFA 3KFUG 4B3MM 4L8RC 1IQPA 1XNRM 4FWDA 1J09A 2XGNA 3SYLA 3W0LB 4FVMA 2C9CA 3FUTA 3QAUA 1H6UA 2V6ZM 4DV5M 1L2DA 2XFSA 3UK6A 2VQFM 2XF3A 3GLIB 4DUZM 3L29A 2FOIC 3SYKA 2ZM6M 4AKIA 2Y0QA 5IWAM 3GPPA 2J7OA 1TDZA 4Z6YA 4GH9A 4LRTA 1JR3D 1MU5A 4B08A 2XSZD 2XZUA 2F4VM 1T3TA 5KPRA 3A45A 2I7NA 3MK6A 2FE8A 4QNMA 3ZCBB 4BLCA 5F3WA 2QZ4A 3HJQA 4YY3M 3EIHA 1TH3A 1R7RA 2C99A 2XZFA 3UGJA 1PJIA 4FWGA 1IXSB 4NSRA 1NJGA 4W5WA 4X66M 3U6OA 2FFJA 1K3WA 4GKKM 3E4RA 1QQWA 3AOGA 3NBIA 4L78A 2L6OA 1N75A 4LF4M 5KO3A 3U6CA 1IBLM 1TGUA 2D7GA 3FYDA 1W5TA 3U5ZA 3KSJA 3AFHA 3VDPA 2XH9A 3IG8A 2VQEM 7CATA 3HU1A 4LZZA 1NHWC 4AG5A 2Q2EB 3RGPA 4DV7M 2DHRA 1KFVA 2KRUA 2YQZA 3JR4A 3TWMA 4LGYA 2DZNB 3KOZE 2CHQA 4LJ8A 3AKZA 4LFCM 4DR4M 1IN4A 4LF9M 4JYAM 5EP3A 4D80A 4AQYM 4GC9A 2QP9X 1L1TA 4JI7M 2KEBA 4BB9A 1I94M 2R45A 1HQYE 1DGHA 4L15A 5IZ7D 1K82A 4M9ZA 2AHMA 5KQDA 1G3IA 4R7GA 3SMSA 2H1RA 3FTEA 4FWHA 3SMPA 1ZAEA 5GKNA 1GKIA 1OFIA 1N77A 1Q3CA 4LFBM 4FW9A 4DUYM 4MGYE 1OJLA 1HNXM 1SXJB 5A2QS 1DGBA 2R4EA 2CFOA 3VK8A 1DO0A 1NY6A 1IBMM 4G4OA 4DR3M 2RKOA 2K47A 3L25A 3C58A 4DV6M 3SATA 5EP1A 2KZUA 4D82A 4QOSA 1IN6A 5FTKA 3GPUA 2KXEA 5FTNA 1HT1E 1SXJC 2LNHC 5H37D 5ITQA 1KYIA 3E9SA 4FD2A 5EXXA 1HR0M 1FJGM 2YFQA 1G41A 1W5SA 5C1BA 3K8ZA 2FNAA 1E9RA 3KOYE 2KA6B 3HHWA 1DGFA 4QHTA 1N78A 3WHLA 4B3SM 4MGZE 3TWLA 4TUWA 3J80S 5LMNM 4MM3B 1MX0A 1QANA 5BPVA 2P5TA 1G59A 4L16A 3FUWA 4RF0A 3M6AA 2BJVA 3M0EA 4LGMA 1NY5A 2M60A 4FCTA 3GLFB 1IM2A 2EO2A 3AOEA 3VKGA 4NSOB 5E26A 5KPTA 3GRUA 3K92A 2DVWB 5KPZA 3T1HM 4GITA 1OFHA 1L2BA 3KP0E 3KW6A 4B3TM 3GLGA 4CISA 1IXRC 2R62A 4JI1M 2G5GX 4B7FA 2CV2A 4JXJA 2UU9M 1R2YA 1J7KA 4OVZB 2DZOB 1J5EM 2ZBKB 3U6PA 1XXHB 3LMMA 4PDGA 3A98B 4IBJA 4X65M 2RGOA 4LJ6A 3SHGB 2Z4SA 3L27A 3DOAA 4MH0E 5EQTA 2VIIA 5EP4A 4M0WA 1Z5CA 3JAMS 1K3XA 2UUAM 2DWLA 2C5RA 4JI3M 1EE8A 3TWKA 1Z5BA 3TE6A 5IREB 3VLFB 5FTMA 5EJCA 2CV1A 1X37A 3D8LA 3RE8A 2DWNA 5FTLA 4A3VB 3R9XB 3OTOM 1LV7A 4IBIA 1L1ZA 4MB7A 3GLIA 2QENA 5BR8M 3KS8A 4OW0A 4Z8XA 4M9XA 3U6DA 1GLNA 1QZMA 3AJIB 4NXMM 3U60B 3GQ4A 2M5ZA 4LJ4A 3I4YA 1GL6A 2EUCA 4X62M 3GPXA 4JI6M 3GO8A 1IBKM 4XGIA 4I5SA 2UUBM 4IBBA 2LXEA 3CF2A 4LF7M 3ZH9B 1R2ZA 3FUUA 3GRYA 1TDHA 4MGIE 4KLNA 4CGYB 1HT2E 4JI2M 2HHHM 4LJ5A 4B7HA 2KZSA 3PFIA 3I4VA 3SHFA 4DR2M 2R18A 1GL7A 2ZAOA 4G4QA 3M7GA 4WURA 2A5YB 2R4JA 1TH4A 2Y21A 1UM8A 4IBGA 2HL7A 2QBYB 1SXJD 4JI0M 1WXQA 1NSFA 4LJ7A 4K0KM 2X49A 2R46A 1N32M 5LMUM 3FKEA 3T38A 3KP1E 4GRIA 3J7BA 3GP1A 4CHTB 3ZC7B 4R3DA 2YNMD 4JN6A 3U61B 1N34M 3PNYA 4DR7M 3AL0C 2Z4RA 4IBCA 3K2LA 3AV0A 5DYIA 2OQ4A 4HLQA 1ZQ9A 1FNNA 1XMOM 1VDDA 3L28A 5ITTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOX E;  3KP1 E;  3KOW E;  3KP0 E;  3KOZ E;  3KOY E; 
#chains in the Genus database with same CATH topology
 2YR0 A;  1KSF X;  5ITU A;  3TPZ A;  2XLJ A;  2LWX A;  4DV1 M;  2L2D A;  3UZU A;  5IT9 S;  3B7N A;  1IN5 A;  4KHP M;  1GAB A;  1G8P A;  1JQJ C;  2WSF F;  3SC3 A;  2WSE F;  3GRV A;  3C3D A;  2E5L M;  5ITR A;  3D8B A;  4FCV A;  5ITX A;  3K1J A;  2K6B A;  2NQ8 C;  3DA1 A;  3PNV A;  3J7A S;  4I81 A;  2RGH A;  3HU3 A;  1Z59 A;  3THG A;  1CUK A;  1PM5 A;  3A46 A;  1HNZ M;  3HHZ A;  1GVN A;  3GLH B;  3IG5 A;  4IBF A;  2L7I A;  1SXJ A;  3VDU A;  1GJS A;  4X64 M;  4P16 A;  2KW0 A;  3LQR A;  1ZMU A;  2L4E A;  3NWL A;  2QSF X;  1Q3B A;  4I4L A;  4PCZ A;  3KS4 A;  4I8O A;  2HAK A;  3GLG E;  3QWL A;  3A42 A;  4OU7 A;  2UXD M;  4JI5 M;  1D0K A;  1IN8 A;  3L26 A;  1Z5A A;  2XEP A;  4M0D A;  1NNJ A;  2F5S A;  4G4N A;  2D7H A;  3EIE A;  2EJS A;  3GQ3 A;  2L4F A;  2DAI A;  4QHS A;  3LVV A;  3TQS A;  2O5R A;  5C18 A;  3CF6 E;  3KOW E;  4M9S A;  3FD9 A;  4DR5 M;  1TH2 A;  3ZQJ A;  1DGG A;  1PJQ A;  5KQ8 A;  1IY0 A;  1XC8 A;  2R6F A;  2FS1 A;  3R8F A;  4LJ9 A;  3KSX A;  3FTC A;  4F1I A;  3FUX A;  3T15 A;  2ZAN A;  3LVW A;  4IIW A;  3W68 A;  2UUC M;  1R6B X;  1VEJ A;  3U6M A;  3JR5 A;  3I01 M;  3MJ5 A;  3GLI E;  1VG5 A;  3J27 B;  1L8Q A;  4L4U A;  3W0F A;  1L2C A;  4NC6 A;  1IXZ A;  4B7G A;  5FSW A;  5EXP A;  3U6L A;  3W67 A;  1YUB A;  3MHV C;  4DR6 M;  4RKU F;  3GLF A;  1RU3 A;  1IY1 A;  2JY8 A;  4LCB A;  1QVR A;  3RGS A;  2EKK A;  1NVM A;  4GKJ M;  4GMQ A;  2C9O A;  3H4J A;  5EXT A;  4II7 A;  3TL4 X;  1YE9 A;  3BOS A;  4EIW A;  1AIP C;  2MJ5 B;  3HWS A;  3Q8X A;  3I51 A;  5E6J A;  5DNY A;  1PRB A;  3HKP A;  2DHY A;  2R65 A;  4JV5 M;  4DV2 M;  5EXS A;  3SFZ A;  3I04 M;  2KRK A;  3SAS A;  2O25 A;  3BXW A;  4LRS A;  4WW0 A;  2VF7 A;  4S12 A;  4ITQ A;  1NNU C;  2J7N A;  1HJP A;  4LY6 A;  5FTJ A;  3C3E A;  4FCW A;  3U5Z B;  2EA0 A;  4HL4 A;  1QZE A;  1Z6T A;  4OVZ A;  1ZV1 A;  3ILK A;  4G4R A;  3HHX A;  1XXH A;  3CTW B;  2LBC A;  1QUT A;  4GEW A;  3LQQ A;  2Y20 A;  2DWM A;  2DWZ B;  2KNV A;  2C96 A;  2G8L A;  4DR1 M;  4IBE A;  2BNK A;  4LF8 M;  8CAT A;  2CE7 A;  4G6Z A;  2Y0T A;  2JZ1 A;  2DKL A;  2G3Q A;  2Z7J A;  2QNJ A;  4PD2 A;  3KVW A;  4GC5 A;  4AKH A;  3HX3 A;  3H4M A;  4NRW A;  4NRV A;  4GIP A;  2BJW A;  3HJS A;  3VKH A;  4AI6 A;  1QAO A;  3FTD A;  2LH0 A;  1DGH B;  1VEG A;  1I4W A;  4PDI A;  3L2A A;  1R4G A;  3HGI A;  3LCU A;  1DO2 A;  4IBK A;  4LZJ A;  4XBO A;  2HKJ A;  3LW5 F;  3RFW A;  4QOZ C;  3DZD A;  5JI2 E;  2FH0 A;  1A5T A;  3U60 A;  2V1U A;  5EP2 A;  4LF6 M;  3VK7 A;  5ITY A;  2DEN A;  1E94 E;  2CWB A;  3T1Y M;  3U6Q A;  2L7H A;  3FUV A;  2QCU A;  1JR3 A;  2XFT A;  2J5Y A;  2VDB B;  4OX9 M;  2Z3X A;  1HNW M;  2XSZ A;  4IBD A;  2JZ0 A;  4AKG A;  1HQC A;  4AZF A;  5DFL A;  1N33 M;  2F5Q A;  4GHA A;  3HU2 A;  3GQ5 A;  4REZ A;  5ITX E;  1G71 A;  3SAV A;  2F5O A;  1ORY B;  4P17 A;  2ERC A;  1IN7 A;  1JB0 F;  2X4A A;  2X8A A;  1XHB A;  1SXJ E;  5FLX S;  4QNR A;  2MH8 A;  2HCB A;  3CF0 A;  1XNQ M;  1P3Q Q;  3J81 S;  1XMQ M;  4LG2 A;  1TR8 A;  2APL A;  2QPA A;  2W82 A;  4LJA A;  4LFA M;  3VFD A;  3KDS E;  1NJF A;  1T43 A;  1E32 A;  3E21 A;  4G3O A;  4DV3 M;  3KXE C;  2QBY A;  2MR9 A;  4B3R M;  1S3S A;  3KOX E;  1D0M A;  4AG6 A;  4AW4 A;  3PXG A;  2VF8 A;  4NOO B;  1EFU B;  1WHC A;  3E46 A;  1OAI A;  4NXN M;  2K9D A;  1QYR A;  2JA2 A;  4DBG B;  2DXI A;  4JI8 M;  1C1K A;  3HJ8 A;  2ZAM A;  1IY2 A;  1YLA A;  3FYC A;  4KOD A;  2V1C A;  3U61 A;  2CEA A;  2JY5 A;  4KO8 A;  1YSY A;  2F5P A;  4MGH A;  4GHL A;  1QAM A;  3UJN A;  3FTF A;  2D7E A;  3MMP A;  1PJJ A;  4NL4 H;  2L09 A;  2OPF A;  2CP8 A;  1LTM A;  2F5N A;  1VDL A;  4ZPX A;  3UMM A;  3GRR A;  4MGK E;  1OAO C;  3WHK A;  1N36 M;  4DV4 M;  2UXC M;  3B9P A;  4D81 A;  3SAR A;  4LF5 M;  3SAU A;  3PVS A;  4IJE A;  3SAW A;  2UXB M;  3DFZ A;  5JI3 E;  1XWI A;  4RNA A;  1E9S A;  1G4A E;  2CUZ A;  2C98 A;  4BBA A;  3GLG B;  4PT5 A;  2JY7 A;  4DV0 M;  3U6S A;  2I7P A;  3GLF E;  3SBJ A;  1VEK A;  2CHG A;  2CV0 A;  3AOE C;  4RF1 A;  3HHY A;  3GPY A;  2CHV A;  1NHG C;  3J2P B;  4F2L A;  3GLH A;  5DYG A;  2JY6 B;  1Q39 A;  1Y8G A;  4YHH M;  3U6E A;  1QAQ A;  4JI4 M;  1R5L A;  2RRU A;  1D2N A;  4IJF A;  2OO9 A;  3KFU G;  4B3M M;  4L8R C;  1AUA A;  1IQP A;  1XNR M;  4ANR A;  1V92 A;  4FWD A;  1J09 A;  2XGN A;  3SYL A;  3W0L B;  4FVM A;  2C9C A;  2JWS A;  1WR1 B;  1OQY A;  3B74 A;  1V34 A;  3FUT A;  3QAU A;  1H6U A;  1XXH E;  2V6Z M;  4DV5 M;  1L2D A;  2XFS A;  3UK6 A;  2VQF M;  1MJG M;  2XF3 A;  2KNA A;  3GLI B;  4DUZ M;  3L29 A;  2FOI C;  3SYK A;  2ZM6 M;  4AKI A;  2Y0Q A;  3F92 A;  5IWA M;  2J7O A;  3GPP A;  1TDZ A;  4Z6Y A;  4GH9 A;  2KDL A;  4LRT A;  1JR3 D;  1MU5 A;  4B08 A;  2XSZ D;  2XZU A;  3LCV B;  2F4V M;  1T3T A;  5KPR A;  3A45 A;  2Z8Y M;  2I7N A;  1IFY A;  3MK6 A;  2FE8 A;  1WGN A;  2JNH A;  2DAG A;  1PJT A;  4QNM A;  3ZCB B;  4BLC A;  5F3W A;  2QZ4 A;  2KNZ A;  2N35 A;  3HJQ A;  4YY3 M;  3EIH A;  2OOA A;  1TH3 A;  1R7R A;  2C99 A;  2R44 A;  4XK8 F;  2ZTC A;  3UGJ A;  2XZF A;  1PJI A;  1JR3 E;  4FWG A;  1IXS B;  4NSR A;  1NJG A;  2WSC F;  4W5W A;  4X66 M;  3U6O A;  2FFJ A;  3B7Z A;  2QHO B;  3E4R A;  1K3W A;  4GKK M;  1QQW A;  1QDR A;  3AOG A;  3NBI A;  4L78 A;  2L6O A;  2BWE A;  1N75 A;  4LF4 M;  1NV8 A;  5KO3 A;  3U6C A;  1IBL M;  1TGU A;  2D7G A;  3FYD A;  1W5T A;  3U5Z A;  3KSJ A;  3AFH A;  3VDP A;  2XH9 A;  3HY5 A;  3IG8 A;  2VQE M;  7CAT A;  3HU1 A;  4LZZ A;  3NBX X;  1NHW C;  4AG5 A;  2Q2E B;  3RGP A;  1OIZ A;  2DHR A;  4DV7 M;  1KFV A;  2KRU A;  2YQZ A;  2LVA A;  2MRO B;  2K0B X;  3JR4 A;  4LGY A;  3TWM A;  1EIJ A;  2DZN B;  3KOZ E;  2CRU A;  2CHQ A;  4LJ8 A;  3AKZ A;  4LFC M;  4DR4 M;  1IN4 A;  4LF9 M;  2B3T A;  4HEO A;  4JYA M;  5EP3 A;  4D80 A;  4AQY M;  4GC9 A;  2QP9 X;  1L1T A;  2LVN C;  1C7Y A;  4JI7 M;  2KEB A;  4BB9 A;  1I94 M;  1WGL A;  2R45 A;  1HQY E;  1DGH A;  4L15 A;  5IZ7 D;  1UFZ A;  3IHP A;  1K82 A;  4M9Z A;  2AHM A;  1VQ1 A;  1G3I A;  2O01 F;  5KQD A;  4R7G A;  3SMS A;  1DV0 A;  2H1R A;  3FTE A;  2LTU A;  4FWH A;  3SMP A;  2BWB A;  1ZAE A;  2LHG A;  5GKN A;  1GKI A;  1OFI A;  1N77 A;  1Q3C A;  4CIZ A;  4LFB M;  4FW9 A;  4DUY M;  1PGY A;  4MGY E;  1OJL A;  1HNX M;  1SXJ B;  5A2Q S;  1DGB A;  2R4E A;  2CFO A;  3VK8 A;  1DO0 A;  1NY6 A;  1IBM M;  2GNO A;  4G4O A;  4DR3 M;  1QDT A;  2RKO A;  2K47 A;  3L25 A;  3C58 A;  1MN3 A;  4DV6 M;  3SAT A;  5EP1 A;  1WIV A;  2EKF A;  2KZU A;  3FRI A;  3V76 A;  4D82 A;  4QOS A;  1IN6 A;  5FTK A;  3GPU A;  1ZMV A;  2KXE A;  3GLH E;  1HT1 E;  5FTN A;  1SXJ C;  2LNH C;  5H37 D;  5ITQ A;  1KYI A;  3E9S A;  4FD2 A;  5EXX A;  1HR0 M;  1FJG M;  2YFQ A;  2ZTD A;  1G41 A;  1W5S A;  2QQ8 A;  5L8R F;  3QYB A;  5C1B A;  3K8Z A;  2FNA A;  1E9R A;  3KOY E;  2KA6 B;  3HHW A;  1DGF A;  4Y28 F;  4QHT A;  1N78 A;  3WHL A;  1SG9 A;  1F4I A;  3Q8G A;  4B3S M;  4MGZ E;  3TWL A;  4TUW A;  2JXN A;  3J80 S;  5LMN M;  4MM3 B;  1GJT A;  1MX0 A;  2R0I A;  1QAN A;  2WZJ A;  5BPV A;  2P5T A;  1G59 A;  3QYE A;  4L16 A;  3FUW A;  4RF0 A;  3M6A A;  2BJV A;  3M0E A;  4LGM A;  1NY5 A;  2M60 A;  4FCT A;  3GLF B;  1IM2 A;  1OKS A;  2EO2 A;  3AOE A;  3VKG A;  2DZL A;  4NSO B;  5E26 A;  1NO1 A;  5KPT A;  3GRU A;  3K92 A;  1TTE A;  3FRH A;  2DVW B;  5KPZ A;  3T1H M;  2LVP C;  4GIT A;  4R71 A;  1OFH A;  1L2B A;  3KP0 E;  3KW6 A;  4B3T M;  3GLG A;  4CIS A;  1IXR C;  2R62 A;  4JI1 M;  2G5G X;  4B7F A;  2CV2 A;  4JXJ A;  2UU9 M;  1R2Y A;  1J7K A;  4OVZ B;  2DZO B;  3B7Q A;  3BBZ A;  2ZBK B;  3U6P A;  1XXH B;  2JUJ A;  1J5E M;  3LMM A;  2HWJ A;  4PDG A;  3A98 B;  4IBJ A;  4X65 M;  2RGO A;  3FE3 A;  4LJ6 A;  3SHG B;  2Z4S A;  2DI0 A;  3L27 A;  3DOA A;  4MH0 E;  3CGW A;  5EQT A;  2VII A;  5EP4 A;  4M0W A;  1Z5C A;  3JAM S;  1K3X A;  2UUA M;  2DWL A;  2C5R A;  4JI3 M;  1EE8 A;  1QUS A;  3TWK A;  1GO5 A;  1Z5B A;  3TE6 A;  5IRE B;  2LVQ D;  3VLF B;  5FTM A;  5EJC A;  1ZMW A;  2CV1 A;  1X37 A;  3D8L A;  3RE8 A;  2DWN A;  5FTL A;  4A3V B;  1OIP A;  1PJS A;  3OTO M;  3R9X B;  1LV7 A;  4IBI A;  1L1Z A;  4MB7 A;  3GLI A;  2QEN A;  5BR8 M;  3KS8 A;  4OW0 A;  2JP7 A;  4Z8X A;  4M9X A;  3C9P A;  3U6D A;  1GLN A;  1QZM A;  3AJI B;  4UN2 B;  3U60 B;  4NXM M;  3GQ4 A;  2M5Z A;  4CJ6 A;  4LJ4 A;  3I4Y A;  2DAM A;  2MGW A;  2KHH A;  1NV9 A;  4KT0 F;  1GL6 A;  2EUC A;  1Q02 A;  4X62 M;  3GPX A;  4JI6 M;  3HZJ A;  2H5X A;  3GO8 A;  1IBK M;  4XGI A;  4I5S A;  2UUB M;  4IBB A;  2LXE A;  3CF2 A;  4LF7 M;  3ZH9 B;  1R2Z A;  3FUU A;  3GRY A;  1TDH A;  4MGI E;  2LVO C;  4KLN A;  4CGY B;  2LHC A;  2OOB A;  1HT2 E;  1V33 A;  4JI2 M;  2HHH M;  4LJ5 A;  4B7H A;  2KZS A;  3PFI A;  3I4V A;  1IXS A;  1WJ7 A;  3SHF A;  4DR2 M;  2R18 A;  4Q7J A;  2DAK A;  4WP2 A;  1GL7 A;  2ZAO A;  3K9O A;  4G4Q A;  3M7G A;  4WUR A;  1OTR A;  2A5Y B;  2R4J A;  1TH4 A;  2Y21 A;  1UM8 A;  4IBG A;  1D0L A;  2DNA A;  2HL7 A;  2QBY B;  1SXJ D;  4JI0 M;  1WXQ A;  1NSF A;  3IEC A;  1BVS A;  2X49 A;  4LJ7 A;  4K0K M;  2R46 A;  1N32 M;  5LMU M;  3T6P A;  3FKE A;  3T38 A;  3KP1 E;  4GRI A;  1T6O A;  1XB2 B;  3J7B A;  3GP1 A;  4CHT B;  4L6V 6;  3ZC7 B;  4R3D A;  2YNM D;  2DAE A;  3K9P A;  4JN6 A;  3U61 B;  1N34 M;  3PNY A;  1TF0 B;  4DR7 M;  3AL0 C;  2Z4R A;  4IBC A;  3K2L A;  3AV0 A;  5DYI A;  2OQ4 A;  4HLQ A;  3B89 A;  1ZQ9 A;  1FNN A;  1XMO M;  2GQF A;  1VDD A;  3L28 A;  5ITT A; 
#chains in the Genus database with same CATH homology
 2YR0 A;  1KSF X;  5ITU A;  3TPZ A;  2XLJ A;  2LWX A;  4DV1 M;  3UZU A;  5IT9 S;  1IN5 A;  4KHP M;  1G8P A;  1JQJ C;  3SC3 A;  3GRV A;  2E5L M;  5ITR A;  3D8B A;  4FCV A;  5ITX A;  3K1J A;  3PNV A;  2NQ8 C;  3DA1 A;  3J7A S;  4I81 A;  2RGH A;  3HU3 A;  1Z59 A;  3THG A;  1PM5 A;  3A46 A;  1HNZ M;  3HHZ A;  1GVN A;  3GLH B;  3IG5 A;  4IBF A;  2L7I A;  1SXJ A;  3VDU A;  4X64 M;  4P16 A;  2KW0 A;  3LQR A;  3NWL A;  1Q3B A;  4I4L A;  4PCZ A;  3KS4 A;  4I8O A;  3QWL A;  3A42 A;  4OU7 A;  2UXD M;  1IN8 A;  3L26 A;  1Z5A A;  2XEP A;  4M0D A;  1NNJ A;  2F5S A;  4G4N A;  2D7H A;  3EIE A;  3GQ3 A;  4QHS A;  3TQS A;  3LVV A;  5C18 A;  2O5R A;  3CF6 E;  3KOW E;  4M9S A;  3FD9 A;  4DR5 M;  1TH2 A;  1DGG A;  5KQ8 A;  1IY0 A;  1XC8 A;  3R8F A;  4LJ9 A;  3KSX A;  3FTC A;  3FUX A;  3T15 A;  2ZAN A;  3LVW A;  4IIW A;  2UUC M;  1R6B X;  3U6M A;  3JR5 A;  3MJ5 A;  3J27 B;  1L8Q A;  4L4U A;  3W0F A;  1L2C A;  4B7G A;  1IXZ A;  5FSW A;  5EXP A;  3U6L A;  1YUB A;  3MHV C;  4DR6 M;  3GLF A;  1IY1 A;  4LCB A;  3RGS A;  1QVR A;  1NVM A;  4GKJ M;  4GMQ A;  2C9O A;  5EXT A;  4II7 A;  3TL4 X;  1YE9 A;  3BOS A;  4EIW A;  3HWS A;  3Q8X A;  3I51 A;  5E6J A;  5DNY A;  3HKP A;  2R65 A;  4JV5 M;  4DV2 M;  5EXS A;  3SFZ A;  2KRK A;  3SAS A;  4LRS A;  4WW0 A;  4S12 A;  4ITQ A;  1NNU C;  2J7N A;  4LY6 A;  5FTJ A;  4FCW A;  3U5Z B;  2EA0 A;  4HL4 A;  1Z6T A;  4OVZ A;  4G4R A;  3ILK A;  3HHX A;  1XXH A;  3CTW B;  3LQQ A;  2Y20 A;  2DWM A;  2DWZ B;  2C96 A;  2G8L A;  4DR1 M;  4IBE A;  2BNK A;  4LF8 M;  8CAT A;  2CE7 A;  4G6Z A;  2Y0T A;  2Z7J A;  4PD2 A;  3KVW A;  4GC5 A;  4AKH A;  3H4M A;  4NRW A;  4NRV A;  4GIP A;  2BJW A;  3HJS A;  3VKH A;  4AI6 A;  1QAO A;  3FTD A;  2LH0 A;  1DGH B;  1I4W A;  4PDI A;  3L2A A;  3HGI A;  4XBO A;  1DO2 A;  4IBK A;  4LZJ A;  3RFW A;  2HKJ A;  4QOZ C;  3DZD A;  5JI2 E;  3U60 A;  2V1U A;  5EP2 A;  4LF6 M;  3VK7 A;  5ITY A;  1E94 E;  3T1Y M;  3U6Q A;  2L7H A;  3FUV A;  2QCU A;  1JR3 A;  2XFT A;  4OX9 M;  1HNW M;  2Z3X A;  2XSZ A;  4IBD A;  4AKG A;  1HQC A;  4AZF A;  1N33 M;  2F5Q A;  4GHA A;  3HU2 A;  3GQ5 A;  4REZ A;  5ITX E;  3SAV A;  2F5O A;  1ORY B;  2ERC A;  1IN7 A;  2X4A A;  2X8A A;  1XHB A;  1SXJ E;  5FLX S;  4QNR A;  2HCB A;  3CF0 A;  1XNQ M;  3J81 S;  1XMQ M;  4LG2 A;  2QPA A;  2W82 A;  4LJA A;  4LFA M;  3VFD A;  3KDS E;  1NJF A;  4JI5 M;  1E32 A;  2QBY A;  4DV3 M;  4B3R M;  3KXE C;  1S3S A;  3KOX E;  4AG6 A;  4AW4 A;  3PXG A;  4NOO B;  4NXN M;  1QYR A;  2JA2 A;  2DXI A;  4JI8 M;  1C1K A;  3HJ8 A;  2ZAM A;  1IY2 A;  3FYC A;  4KOD A;  2V1C A;  3U61 A;  2CEA A;  4KO8 A;  2F5P A;  1YSY A;  4GHL A;  4MGH A;  1QAM A;  3UJN A;  3FTF A;  2D7E A;  1PJJ A;  4NL4 H;  2L09 A;  2OPF A;  2F5N A;  4ZPX A;  3UMM A;  3GRR A;  4MGK E;  3WHK A;  1N36 M;  2UXC M;  4DV4 M;  3B9P A;  4D81 A;  3SAR A;  4LF5 M;  3SAU A;  3PVS A;  4IJE A;  3SAW A;  2UXB M;  3DFZ A;  5JI3 E;  1XWI A;  4RNA A;  1E9S A;  1G4A E;  2CUZ A;  2C98 A;  4BBA A;  3GLG B;  4PT5 A;  3U6S A;  4DV0 M;  2I7P A;  3SBJ A;  2CHG A;  2CV0 A;  3AOE C;  4RF1 A;  3HHY A;  3GPY A;  2CHV A;  1NHG C;  3J2P B;  3GLH A;  5DYG A;  1Q39 A;  4YHH M;  3U6E A;  1QAQ A;  4JI4 M;  1D2N A;  4IJF A;  3KFU G;  4B3M M;  4L8R C;  1IQP A;  1XNR M;  4FWD A;  1J09 A;  2XGN A;  3SYL A;  3W0L B;  4FVM A;  2C9C A;  3FUT A;  3QAU A;  1H6U A;  2V6Z M;  4DV5 M;  1L2D A;  2XFS A;  3UK6 A;  2VQF M;  2XF3 A;  3GLI B;  4DUZ M;  3L29 A;  2FOI C;  3SYK A;  2ZM6 M;  4AKI A;  2Y0Q A;  5IWA M;  3GPP A;  2J7O A;  1TDZ A;  4Z6Y A;  4GH9 A;  4LRT A;  1JR3 D;  1MU5 A;  4B08 A;  2XSZ D;  2XZU A;  2F4V M;  1T3T A;  5KPR A;  3A45 A;  2I7N A;  3MK6 A;  2FE8 A;  4QNM A;  3ZCB B;  4BLC A;  5F3W A;  2QZ4 A;  3HJQ A;  4YY3 M;  3EIH A;  1TH3 A;  1R7R A;  2C99 A;  2XZF A;  3UGJ A;  1PJI A;  4FWG A;  1IXS B;  4NSR A;  1NJG A;  4W5W A;  4X66 M;  3U6O A;  2FFJ A;  1K3W A;  4GKK M;  3E4R A;  1QQW A;  3AOG A;  3NBI A;  4L78 A;  2L6O A;  1N75 A;  4LF4 M;  5KO3 A;  3U6C A;  1IBL M;  1TGU A;  2D7G A;  3FYD A;  1W5T A;  3U5Z A;  3KSJ A;  3AFH A;  3VDP A;  2XH9 A;  3IG8 A;  2VQE M;  7CAT A;  3HU1 A;  4LZZ A;  1NHW C;  4AG5 A;  2Q2E B;  3RGP A;  4DV7 M;  2DHR A;  1KFV A;  2KRU A;  2YQZ A;  3JR4 A;  3TWM A;  4LGY A;  2DZN B;  3KOZ E;  2CHQ A;  4LJ8 A;  3AKZ A;  4LFC M;  4DR4 M;  1IN4 A;  4LF9 M;  4JYA M;  5EP3 A;  4D80 A;  4AQY M;  4GC9 A;  2QP9 X;  1L1T A;  4JI7 M;  2KEB A;  4BB9 A;  1I94 M;  2R45 A;  1HQY E;  1DGH A;  4L15 A;  5IZ7 D;  1K82 A;  4M9Z A;  2AHM A;  5KQD A;  1G3I A;  4R7G A;  3SMS A;  2H1R A;  3FTE A;  4FWH A;  3SMP A;  1ZAE A;  5GKN A;  1GKI A;  1OFI A;  1N77 A;  1Q3C A;  4LFB M;  4FW9 A;  4DUY M;  4MGY E;  1OJL A;  1HNX M;  1SXJ B;  5A2Q S;  1DGB A;  2R4E A;  2CFO A;  3VK8 A;  1DO0 A;  1NY6 A;  1IBM M;  4G4O A;  4DR3 M;  2RKO A;  2K47 A;  3L25 A;  3C58 A;  4DV6 M;  3SAT A;  5EP1 A;  2KZU A;  4D82 A;  4QOS A;  1IN6 A;  5FTK A;  3GPU A;  2KXE A;  5FTN A;  1HT1 E;  1SXJ C;  2LNH C;  5H37 D;  5ITQ A;  1KYI A;  3E9S A;  4FD2 A;  5EXX A;  1HR0 M;  1FJG M;  2YFQ A;  1G41 A;  1W5S A;  5C1B A;  3K8Z A;  2FNA A;  1E9R A;  3KOY E;  2KA6 B;  3HHW A;  1DGF A;  4QHT A;  1N78 A;  3WHL A;  4B3S M;  4MGZ E;  3TWL A;  4TUW A;  3J80 S;  5LMN M;  4MM3 B;  1MX0 A;  1QAN A;  5BPV A;  2P5T A;  1G59 A;  4L16 A;  3FUW A;  4RF0 A;  3M6A A;  2BJV A;  3M0E A;  4LGM A;  1NY5 A;  2M60 A;  4FCT A;  3GLF B;  1IM2 A;  2EO2 A;  3AOE A;  3VKG A;  4NSO B;  5E26 A;  5KPT A;  3GRU A;  3K92 A;  2DVW B;  5KPZ A;  3T1H M;  4GIT A;  1OFH A;  1L2B A;  3KP0 E;  3KW6 A;  4B3T M;  3GLG A;  4CIS A;  1IXR C;  2R62 A;  4JI1 M;  2G5G X;  4B7F A;  2CV2 A;  4JXJ A;  2UU9 M;  1R2Y A;  1J7K A;  4OVZ B;  2DZO B;  1J5E M;  2ZBK B;  3U6P A;  1XXH B;  3LMM A;  4PDG A;  3A98 B;  4IBJ A;  4X65 M;  2RGO A;  4LJ6 A;  3SHG B;  2Z4S A;  3L27 A;  3DOA A;  4MH0 E;  5EQT A;  2VII A;  5EP4 A;  4M0W A;  1Z5C A;  3JAM S;  1K3X A;  2UUA M;  2DWL A;  2C5R A;  4JI3 M;  1EE8 A;  3TWK A;  1Z5B A;  3TE6 A;  5IRE B;  3VLF B;  5FTM A;  5EJC A;  2CV1 A;  1X37 A;  3D8L A;  3RE8 A;  2DWN A;  5FTL A;  4A3V B;  3R9X B;  3OTO M;  1LV7 A;  4IBI A;  1L1Z A;  4MB7 A;  3GLI A;  2QEN A;  5BR8 M;  3KS8 A;  4OW0 A;  4Z8X A;  4M9X A;  3U6D A;  1GLN A;  1QZM A;  3AJI B;  4NXM M;  3U60 B;  3GQ4 A;  2M5Z A;  4LJ4 A;  3I4Y A;  1GL6 A;  2EUC A;  4X62 M;  3GPX A;  4JI6 M;  3GO8 A;  1IBK M;  4XGI A;  4I5S A;  2UUB M;  4IBB A;  2LXE A;  3CF2 A;  4LF7 M;  3ZH9 B;  1R2Z A;  3FUU A;  3GRY A;  1TDH A;  4MGI E;  4KLN A;  4CGY B;  1HT2 E;  4JI2 M;  2HHH M;  4LJ5 A;  4B7H A;  2KZS A;  3PFI A;  3I4V A;  3SHF A;  4DR2 M;  2R18 A;  1GL7 A;  2ZAO A;  4G4Q A;  3M7G A;  4WUR A;  2A5Y B;  2R4J A;  1TH4 A;  2Y21 A;  1UM8 A;  4IBG A;  2HL7 A;  2QBY B;  1SXJ D;  4JI0 M;  1WXQ A;  1NSF A;  4LJ7 A;  4K0K M;  2X49 A;  2R46 A;  1N32 M;  5LMU M;  3FKE A;  3T38 A;  3KP1 E;  4GRI A;  3J7B A;  3GP1 A;  4CHT B;  3ZC7 B;  4R3D A;  2YNM D;  4JN6 A;  3U61 B;  1N34 M;  3PNY A;  4DR7 M;  3AL0 C;  2Z4R A;  4IBC A;  3K2L A;  3AV0 A;  5DYI A;  2OQ4 A;  4HLQ A;  1ZQ9 A;  1FNN A;  1XMO M;  1VDD A;  3L28 A;  5ITT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...