3KP1E

Crystal structure of ornithine 4,5 aminomutase (resting state)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
109
structure length
109
Chain Sequence
DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEAKAIVDKTMDRGLMGKGAGHIVYKIAKEKNISVREAGLALSEGKYWDDAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ornithine aminomutase E component
publication title Large-scale domain dynamics and adenosylcobalamin reorientation orchestrate radical catalysis in ornithine 4,5-aminomutase.
pubmed doi rcsb
source organism Clostridium sticklandii
molecule tags Metal binding protein
total genus 44
structure length 109
sequence length 109
chains with identical sequence F, G, H
ec nomenclature ec 5.4.3.5: D-ornithine 4,5-aminomutase.
pdb deposition date 2009-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16552 OAM_alpha D-ornithine 4,5-aminomutase alpha-subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1000 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kp1E02
3KP0E 3KP1E 3KOWE 3KOYE 3KOZE 3KOXE
chains in the Genus database with same CATH superfamily
4DBGB 1TH3A 5EQTA 2R4EA 4WURA 1L1ZA 1IY2A 2H1RA 2C96A 4GHLA 1IN6A 4JXJA 2EJSA 3J80S 3TPZA 1GABA 1IY0A 3EIHA 2O25A 2ZBKB 4RF0A 2MR9A 4FWGA 2Q2EB 3LVVA 4LGMA 4NC6A 4YHHM 3JR4A 3U6MA 1XMQM 3MMPA 3CGWA 5EJCA 3GLFA 2EKFA 1QZMA 2DZLA 5ITXA 2ZM6M 1NVMA 4NOOB 3IECA 4LFCM 4LJ9A 4WW0A 3HU1A 2HHHM 2YFQA 2Z8YM 2LHGA 2FNAA 3FTEA 3T15A 4LGYA 3ZC7B 3GRYA 4DV7M 3C3DA 1KYIA 1VEJA 2XZFA 3LQQA 3FRIA 3FTDA 2FFJA 1QVRA 2CP8A 2LH0A 3HU3A 1TDHA 2DHRA 4GIPA 4IBCA 5ITQA 1R6BX 4DR5M 3SATA 4F2LA 1ZAEA 2R65A 2X4AA 3SAUA 2DNAA 1KSFX 2HKJA 3VFDA 2MH8A 3SYKA 3GLIE 3A46A 2L7HA 3T1HM 4X64M 2JY8A 1JR3A 4LFBM 4XK8F 3WHLA 3VKHA 1S3SA 2R45A 2VDBB 4IBFA 2CWBA 1IN7A 3CTWB 5GKNA 1ZQ9A 2BNKA 2EO2A 2CUZA 3U60B 2KXEA 2VIIA 2DWNA 5ITTA 1IN8A 4GMQA 1XWIA 2KEBA 3KW6A 1EFUB 3JR5A 4FW9A 1NHWC 4GC9A 4DR6M 1TGUA 3KS4A 3DZDA 5ITYA 1WR1B 4TUWA 1WGLA 5JI2E 5EP2A 3NBXX 4FD2A 4LF7M 3HJQA 1XB2B 4B3MM 3U6CA 2QQ8A 1IY1A 1ZMWA 2R6FA 2DAKA 3PVSA 2UUBM 4II7A 1D2NA 3B89A 1NY5A 2KRUA 3BBZA 2C99A 5IREB 8CATA 4B3SM 2DZOB 1W5TA 3A42A 1XHBA 1XXHB 3I51A 2BWEA 2F5OA 2KW0A 5F3WA 4LJ8A 4JI3M 5C1BA 3GPPA 2CEAA 4S12A 3UJNA 2XSZD 4PT5A 2CRUA 2CV1A 3Q8GA 1IXZA 2QCUA 3B74A 4NSRA 4PDIA 3RFWA 3QYEA 3TQSA 5KPRA 1A5TA 5DFLA 2FE8A 4IBGA 4X66M 4EIWA 4G4RA 3GRUA 4K0KM 4MB7A 3RE8A 4JV5M 1IXRC 1G4AE 3HHWA 4M9SA 2R62A 3B7ZA 5KPZA 1E9RA 2M60A 4AI6A 5DYGA 4LFAM 1H6UA 1N77A 3D8BA 2E5LM 4L8RC 3GQ5A 2XH9A 2QHOB 5E26A 2XFTA 3B7QA 1V92A 1VEGA 4B7HA 3ZH9B 2M5ZA 3U60A 2VF7A 2UUCM 1JQJC 2Y20A 1QDRA 1NJFA 2DENA 4L78A 1NNUC 5KQDA 1TTEA 3KP0E 2KZUA 2RGHA 2ZTDA 2LHCA 3E4RA 1WXQA 4L16A 3U6SA 3K9PA 2LNHC 2DAGA 4G4OA 1DGBA 3U5ZA 1DGFA 3TWLA 1C7YA 4HEOA 3KVWA 3AOEC 3FUXA 1G59A 3SHFA 1OIZA 2QPAA 1GKIA 2XFSA 1MN3A 1OQYA 2DI0A 2BJWA 2L6OA 1R2YA 1WHCA 4R7GA 3B7NA 1QAOA 4JI8M 3GPXA 3AL0C 4YY3M 5FTKA 1F4IA 4KLNA 2LVOC 2C9OA 4JI7M 3K8ZA 3W0LB 2F4VM 2VQFM 3GPYA 1XXHA 3L29A 4JI4M 5H37D 1SXJC 4JI5M 1J09A 2ZANA 3J27B 4AKHA 1GO5A 4RNAA 5IWAM 1V33A 3E21A 3L2AA 4LF8M 1PJJA 1Q39A 1IXSA 4GRIA 3HX3A 4ANRA 2ZAOA 3GLGA 1HNZM 2DVWB 1N75A 1OJLA 3LCVB 2QBYA 4OVZB 2QSFX 2F5QA 1QANA 3U61B 1YE9A 1WIVA 4I4LA 3H4MA 5IT9S 4GH9A 5EXSA 2LBCA 2OOAA 3L28A 3J81S 1TDZA 3SYLA 1IFYA 2K0BX 4NL4H 5L8RF 2O01F 3K2LA 2EUCA 1HQYE 1ZV1A 4Q7JA 4XGIA 2WSCF 4ITQA 2RKOA 3W0FA 4MH0E 2GNOA 1P3QQ 3QWLA 2XEPA 1LTMA 1OTRA 1PJSA 2QENA 1HT1E 1VG5A 4GEWA 4LF6M 4LY6A 1Z5BA 2D7GA 1R4GA 2YNMD 3C3EA 4B08A 4AKGA 3FRHA 3PNYA 3TWKA 1FJGM 5EXXA 1IQPA 3VK7A 4LJAA 2WZJA 1K3XA 3VDPA 1JB0F 1TF0B 2CHVA 4GKKM 2UXCM 4X62M 4CISA 4MGIE 2APLA 4KODA 5BPVA 4QNMA 3BXWA 2G8LA 4IBIA 2D7EA 2KZSA 3AOGA 3LMMA 1CUKA 4B3RM 1N33M 1QYRA 4G3OA 3SMPA 1QUTA 4M9XA 2FH0A 4FWDA 1W5SA 4FVMA 1YUBA 2W82A 2XZUA 1TR8A 4B3TM 1E9SA 2EA0A 4AQYM 4OW0A 1NHGC 4BLCA 3GLIB 2I7PA 3HY5A 2LVAA 1VEKA 2DKLA 4FWHA 3U6QA 4I81A 1PM5A 4P16A 2P5TA 4DV3M 3GO8A 2JWSA 4IIWA 2V1UA 3BOSA 3AFHA 1N36M 1Z59A 1OFIA 2QNJA 4L4UA 4XBOA 1G71A 2CV0A 2VQEM 1MJGM 4LJ5A 4MM3B 1TH4A 1Z5AA 1R7RA 3A98B 2Y21A 1SG9A 4HL4A 2JUJA 3VLFB 1DV0A 4QOSA 2Z3XA 4GHAA 4GC5A 4OVZA 4Z6YA 2JA2A 3KOZE 2AHMA 1Z5CA 4RKUF 4G4QA 4DR3M 4MGYE 3GRVA 3U61A 3KFUG 2WSFF 3FYDA 2DAEA 4M9ZA 3SBJA 4LF5M 4AZFA 2RGOA 4JYAM 1SXJE 3KOXE 2FS1A 1NY6A 3GLHE 1DGHB 2RRUA 1NSFA 4F1IA 4GITA 4QHTA 2CHQA 2FOIC 3K9OA 3GPUA 2L4EA 3GQ3A 4LF4M 1YSYA 3HJ8A 1NO1A 1X37A 3M7GA 3H4JA 1YLAA 4R3DA 2CHGA 1VQ1A 2OO9A 4DV4M 4MGZE 4CIZA 1Z6TA 3KSJA 5EP1A 4BB9A 3GLHB 3GLFE 1OFHA 4PDGA 5FTMA 4D80A 2XSZA 5ITXE 1N34M 1Q3CA 1E32A 2R46A 4IJEA 3GP1A 1IN4A 2MROB 1G8PA 4LRTA 1NJGA 1KFVA 1VDDA 4G4NA 1IBKM 1AUAA 4I8OA 1ZMVA 2MGWA 1IN5A 4W5WA 2KNAA 2YR0A 5FTNA 2KNVA 3GLFB 1Q02A 2KNZA 4X65M 1G41A 1Q3BA 4M0DA 1RU3A 3FUVA 5EXTA 3FTFA 1GVNA 2DWZB 2J5YA 3CF2A 1K82A 3ILKA 1HT2E 3JAMS 3F92A 3GLIA 3PNVA 3NWLA 4OU7A 3VK8A 2LWXA 3HKPA 1JR3E 1ORYB 4G6ZA 5FTJA 3DA1A 4LZJA 1EE8A 1GL7A 1L1TA 1QQWA 1V34A 4JI0M 1HNXM 3THGA 2LTUA 5KPTA 2CE7A 2DWMA 1PGYA 2I7NA 1QAMA 2OQ4A 1SXJD 2Y0TA 1J5EM 2UU9M 4FCTA 4L6V6 2ZAMA 1D0LA 3U6LA 2K6BA 3HGIA 4D82A 4CJ6A 1OAIA 2Y0QA 4DV0M 4AG5A 5C18A 1N32M 3FE3A 2XF3A 3ZQJA 1N78A 3HZJA 4B7FA 2MJ5B 1QUSA 2JZ1A 5FLXS 3MK6A 1I94M 4NSOB 2KA6B 4DR4M 3GRRA 2LXEA 3L27A 4KO8A 3I04M 3M6AA 4NXMM 3FUUA 2F5SA 2X8AA 4JI1M 2H5XA 3IG5A 3T6PA 2O5RA 2KRKA 1FNNA 1NV9A 1Y8GA 3SMSA 4P17A 1L2DA 1T6OA 2HL7A 4M0WA 3RGPA 4NXNM 2V1CA 1XC8A 4DR7M 2DHYA 5KO3A 4DV5M 4IBEA 3C58A 3LQRA 4HLQA 1PJTA 2UXBM 2KDLA 3UZUA 3AV0A 2DAMA 2L2DA 3LVWA 2F5PA 4NRWA 1WJ7A 1D0MA 2R0IA 3EIEA 4DV1M 1VDLA 1UFZA 5EXPA 1WGNA 3I4VA 2OPFA 4REZA 2CFOA 3GQ4A 1JR3D 1ZMUA 3I01M 3MJ5A 3V76A 5ITRA 4PD2A 1L2CA 3SAWA 2QP9X 4JI6M 2BJVA 3SHGB 2K47A 3SC3A 4B7GA 2K9DA 2Z4RA 4D81A 2JP7A 1BVSA 4Y28F 2C98A 3PXGA 4UN2B 2JY7A 4LJ6A 1K3WA 3U6EA 4IJFA 5DYIA 3OTOM 3A45A 3KP1E 2LVQD 3HHZA 4JI2M 1QZEA 1DGGA 3U6PA 1QAQA 1T43A 3FD9A 3TWMA 2C5RA 2BWBA 4RF1A 1OKSA 3E46A 1G3IA 1T3TA 4DR2M 2KHHA 4DR1M 1XNRM 2L4FA 2WSEF 4WP2A 2DAIA 3IHPA 3RGSA 3AKZA 2ERCA 1XMOM 1UM8A 2XLJA 4GKJM 2HWJA 2L09A 4DV2M 2R4JA 5KQ8A 2DWLA 3L26A 4IBBA 4L15A 4CHTB 3U6DA 2X49A 2JY6B 3TL4X 5FSWA 5E6JA 2DZNB 1XXHE 1GL6A 2JZ0A 3MHVC 3Q8XA 4PCZA 3U5ZB 3B9PA 3UGJA 2LVNC 3UMMA 1NNJA 3AJIB 3QYBA 4LG2A 3GLGE 2Z4SA 2XGNA 4LCBA 3CF0A 4QNRA 3WHKA 3KDSE 2B3TA 2JNHA 3PFIA 3KOWE 1TH2A 2N35A 2V6ZM 4DUYM 3SAVA 3T38A 3U6OA 1I4WA 4DV6M 4IBKA 1SXJB 3UK6A 4BBAA 3K1JA 3J7AS 1R5LA 1C1KA 2D7HA 1OIPA 2OOBA 3NBIA 4AW4A 4KHPM 3SARA 4FCVA 2R44A 2F5NA 1IXSB 3GLGB 3T1YM 1HR0M 5IZ7D 1EIJA 1GLNA 2NQ8C 2QBYB 3C9PA 1HQCA 5BR8M 1MX0A 3KXEC 2VF8A 1PJIA 3W68A 2EKKA 3J2PB 3J7BA 3W67A 3VDUA 3M0EA 4FCWA 4KT0F 3K92A 1OAOC 1PRBA 2GQFA 2DXIA 4IBDA 2G3QA 4AG6A 4ZPXA 2C9CA 3CF6E 4LJ7A 3KS8A 4AKIA 4JN6A 2UUAM 5A2QS 4LZZA 4MGHA 1D0KA 7CATA 2LVPC 1L8QA 4QHSA 1QDTA 4OX9M 3D8LA 4MGKE 5LMUM 3QAUA 2J7OA 5EP4A 4LF9M 2J7NA 1DO0A 3LCUA 1IBLM 3FUTA 5DNYA 2HAKA 3KSXA 1J7KA 4NRVA 5JI3E 1IM2A 4CGYB 3IG8A 4Z8XA 2ZTCA 4DUZM 3LW5F 5ITUA 4LJ4A 4LRSA 4QOZC 3ZCBB 3HHYA 3HWSA 1R2ZA 2A5YB 3KOYE 3SASA 3VKGA 2YQZA 1GJSA 3FYCA 3HHXA 2G5GX 3DOAA 3HJSA 3FKEA 3L25A 2HCBA 4A3VB 3FUWA 2R18A 2L7IA 2Z7JA 2QZ4A 1GJTA 1HJPA 1NV8A 3TE6A 1L2BA 2JXNA 1XNQM 3R9XB 1IBMM 4IBJA 5FTLA 1LV7A 3R8FA 3I4YA 1DGHA 3AOEA 3E9SA 5EP3A 5LMNM 2UXDM 3DFZA 1AIPC 3SFZA 2JY5A 3FTCA 1E94E 3HU2A 4R71A 1HNWM 1SXJA 1PJQA 1MU5A 4I5SA 3GLHA 1DO2A 2CV2A
chains in the Genus database with same CATH topology
1TH3A 5EQTA 2R4EA 4WURA 1L1ZA 1IY2A 2H1RA 2C96A 4GHLA 1IN6A 4JXJA 3TPZA 3J80S 1IY0A 3EIHA 2ZBKB 4RF0A 4FWGA 3JR4A 2Q2EB 3LVVA 4LGMA 3U6MA 4YHHM 1XMQM 5EJCA 3GLFA 1QZMA 5ITXA 2ZM6M 1NVMA 4NOOB 4LFCM 4LJ9A 4WW0A 3HU1A 2HHHM 2YFQA 2FNAA 3FTEA 3T15A 4LGYA 3ZC7B 3GRYA 4DV7M 1KYIA 2XZFA 3LQQA 4GIPA 3FTDA 2FFJA 1QVRA 2LH0A 3HU3A 5ITQA 1TDHA 2DHRA 4IBCA 4DR5M 3SATA 1R6BX 1ZAEA 2R65A 2X4AA 3SAUA 1KSFX 2HKJA 3VFDA 3SYKA 3T1HM 3A46A 2L7HA 4X64M 1JR3A 4LFBM 3WHLA 3VKHA 1S3SA 2R45A 4IBFA 3CTWB 1IN7A 3U60B 5GKNA 1ZQ9A 2BNKA 2EO2A 2CUZA 1J5EM 2KXEA 2VIIA 2DWNA 5ITTA 1IN8A 4GMQA 1XWIA 2KEBA 3KW6A 3JR5A 4FW9A 1NHWC 4GC9A 4DR6M 1TGUA 3KS4A 3DZDA 5ITYA 4TUWA 5JI2E 5EP2A 4FD2A 4LF7M 3HJQA 4B3MM 3U6CA 1IY1A 3PVSA 2UUBM 4II7A 1D2NA 1NY5A 2KRUA 2C99A 5IREB 8CATA 4B3SM 2DZOB 1W5TA 3A42A 1XHBA 1XXHB 3I51A 2F5OA 2KW0A 5F3WA 4LJ8A 4JI3M 5C1BA 3GPPA 2CEAA 4S12A 3UJNA 2XSZD 4PT5A 2CV1A 1IXZA 2QCUA 4NSRA 4PDIA 3RFWA 3TQSA 5KPRA 2FE8A 4IBGA 4X66M 4EIWA 4G4RA 3GRUA 4K0KM 4MB7A 3RE8A 4JV5M 1IXRC 1G4AE 3HHWA 4M9SA 2R62A 5KPZA 1E9RA 2M60A 4AI6A 5DYGA 4LFAM 1H6UA 1N77A 3D8BA 2E5LM 4L8RC 3GQ5A 2XH9A 5E26A 2XFTA 4B7HA 3ZH9B 2M5ZA 3U60A 2UUCM 1JQJC 2Y20A 1NJFA 4L78A 1NNUC 5KQDA 3KP0E 2KZUA 2RGHA 3U6SA 3E4RA 1WXQA 4L16A 2LNHC 4G4OA 1DGBA 3U5ZA 1DGFA 3TWLA 3KVWA 3AOEC 3FUXA 1G59A 3SHFA 2QPAA 1GKIA 2XFSA 2BJWA 2L6OA 1R2YA 4R7GA 4JI8M 1QAOA 3GPXA 3AL0C 4YY3M 5FTKA 4KLNA 2C9OA 4JI7M 3K8ZA 3W0LB 2F4VM 2VQFM 3GPYA 1XXHA 3L29A 4JI4M 5H37D 1SXJC 4JI5M 1J09A 2ZANA 3J27B 4AKHA 4RNAA 5IWAM 3L2AA 4LF8M 1PJJA 1Q39A 3GLGA 4GRIA 2ZAOA 1HNZM 2DVWB 1N75A 1OJLA 2QBYA 4OVZB 2F5QA 1QANA 3U61B 1YE9A 4I4LA 3H4MA 5IT9S 4GH9A 5EXSA 3J81S 3L28A 1TDZA 3SYLA 4NL4H 3K2LA 2EUCA 1HQYE 4XGIA 4ITQA 2RKOA 3W0FA 4MH0E 3QWLA 2XEPA 2QENA 1HT1E 4LF6M 4LY6A 1Z5BA 2D7GA 2YNMD 4B08A 4AKGA 3PNYA 3TWKA 1FJGM 5EXXA 1IQPA 3VK7A 4LJAA 1K3XA 3VDPA 2CHVA 4GKKM 2UXCM 4X62M 4CISA 4MGIE 5BPVA 4KODA 4QNMA 2G8LA 4IBIA 2D7EA 2KZSA 3AOGA 3LMMA 4B3RM 1N33M 1QYRA 3SMPA 4M9XA 4FWDA 1W5SA 4FVMA 1YUBA 2W82A 2XZUA 4B3TM 1E9SA 2EA0A 4AQYM 4OW0A 1NHGC 4BLCA 3GLIB 2I7PA 3U6QA 4FWHA 4I81A 1PM5A 4P16A 2P5TA 4DV3M 3GO8A 4IIWA 2V1UA 3BOSA 3AFHA 1N36M 1Z59A 1OFIA 4L4UA 4XBOA 2CV0A 2VQEM 4LJ5A 4MM3B 1TH4A 1Z5AA 1R7RA 3A98B 2Y21A 4HL4A 3VLFB 4QOSA 2Z3XA 4GHAA 4GC5A 4OVZA 4Z6YA 2JA2A 3KOZE 2AHMA 1Z5CA 4G4QA 3U61A 4DR3M 4MGYE 3GRVA 3KFUG 3FYDA 4M9ZA 3SBJA 4LF5M 4AZFA 2RGOA 4JYAM 1SXJE 3KOXE 1NY6A 1DGHB 1NSFA 4GITA 4QHTA 2CHQA 2FOIC 3GPUA 3GQ3A 4LF4M 1YSYA 3HJ8A 1X37A 3M7GA 4R3DA 2CHGA 4DV4M 4MGZE 1Z6TA 3KSJA 5EP1A 4BB9A 3GLHB 1OFHA 4PDGA 5FTMA 4D80A 2XSZA 5ITXE 1N34M 1Q3CA 1E32A 2R46A 4IJEA 3GP1A 1IN4A 1G8PA 4LRTA 1NJGA 1KFVA 1VDDA 4G4NA 1IBKM 4I8OA 4W5WA 1IN5A 5FTNA 2YR0A 3GLFB 4X65M 1G41A 1Q3BA 4M0DA 3FUVA 5EXTA 3FTFA 1GVNA 2DWZB 3CF2A 1K82A 3ILKA 1HT2E 3JAMS 3GLIA 3PNVA 3NWLA 4OU7A 3VK8A 2LWXA 3HKPA 1ORYB 4G6ZA 5FTJA 3DA1A 4LZJA 1EE8A 1GL7A 1L1TA 1QQWA 4JI0M 1HNXM 3THGA 5KPTA 2CE7A 2DWMA 2I7NA 1QAMA 2OQ4A 1SXJD 2Y0TA 2UU9M 4FCTA 2ZAMA 3U6LA 3HGIA 4D82A 4DV0M 2Y0QA 4AG5A 5C18A 1N32M 2XF3A 1N78A 4B7FA 5FLXS 3MK6A 1I94M 4NSOB 2KA6B 4DR4M 3GRRA 2LXEA 3L27A 4KO8A 3M6AA 4NXMM 3FUUA 2F5SA 2X8AA 4JI1M 3IG5A 2O5RA 2KRKA 1FNNA 3SMSA 1L2DA 2HL7A 4M0WA 3RGPA 4NXNM 2V1CA 1XC8A 4DR7M 5KO3A 4DV5M 4IBEA 3C58A 3LQRA 4HLQA 2UXBM 3UZUA 3AV0A 3LVWA 2F5PA 4NRWA 3EIEA 4DV1M 5EXPA 3I4VA 2OPFA 4REZA 2CFOA 3GQ4A 1JR3D 3MJ5A 5ITRA 1L2CA 4PD2A 3SAWA 2QP9X 4JI6M 2BJVA 3SHGB 2K47A 3SC3A 4B7GA 4D81A 2Z4RA 2C98A 3PXGA 4LJ6A 1K3WA 3U6EA 4IJFA 5DYIA 3OTOM 3A45A 3KP1E 3HHZA 4JI2M 3U6PA 1DGGA 1QAQA 3FD9A 3TWMA 2C5RA 4RF1A 1G3IA 1T3TA 4DR2M 1XNRM 4DR1M 3RGSA 3AKZA 2ERCA 1XMOM 1UM8A 2XLJA 4GKJM 2L09A 4DV2M 2R4JA 5KQ8A 2DWLA 3L26A 4IBBA 4L15A 4CHTB 3U6DA 2X49A 3TL4X 5FSWA 5E6JA 2DZNB 1GL6A 3MHVC 3Q8XA 4PCZA 3U5ZB 3B9PA 3UGJA 3UMMA 1NNJA 3AJIB 4LG2A 2Z4SA 2XGNA 4LCBA 3CF0A 4QNRA 3WHKA 3KDSE 3PFIA 3KOWE 1TH2A 2V6ZM 3SAVA 4DUYM 3T38A 3U6OA 1I4WA 4DV6M 4IBKA 1SXJB 3UK6A 4BBAA 3K1JA 3J7AS 1C1KA 2D7HA 4AW4A 4KHPM 3NBIA 3SARA 4FCVA 2F5NA 1IXSB 3GLGB 3T1YM 1HR0M 5IZ7D 1GLNA 2NQ8C 2QBYB 1HQCA 5BR8M 1MX0A 3KXEC 1PJIA 3J2PB 3J7BA 3VDUA 3M0EA 4FCWA 3K92A 2DXIA 4IBDA 4AG6A 4ZPXA 2C9CA 3CF6E 4LJ7A 3KS8A 4AKIA 4JN6A 2UUAM 5A2QS 4LZZA 4MGHA 7CATA 1L8QA 4QHSA 4OX9M 3D8LA 4MGKE 5LMUM 3QAUA 2J7OA 5EP4A 4LF9M 2J7NA 1DO0A 1IBLM 3FUTA 5DNYA 3KSXA 1J7KA 4NRVA 5JI3E 1IM2A 4CGYB 3IG8A 4Z8XA 4DUZM 4QOZC 5ITUA 4LJ4A 4LRSA 3ZCBB 3HHYA 3HWSA 1R2ZA 2A5YB 3KOYE 3SASA 3VKGA 2YQZA 3FYCA 3HHXA 2G5GX 3DOAA 3HJSA 3FKEA 3L25A 2HCBA 4A3VB 3FUWA 2R18A 2L7IA 2Z7JA 2QZ4A 1XNQM 1L2BA 3R9XB 3TE6A 1IBMM 4IBJA 5FTLA 1LV7A 3R8FA 3I4YA 1DGHA 3AOEA 3E9SA 5EP3A 5LMNM 2UXDM 3DFZA 3SFZA 3FTCA 1E94E 3HU2A 1HNWM 1SXJA 1MU5A 4I5SA 3GLHA 1DO2A 2CV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP0 E;  3KP1 E;  3KOW E;  3KOY E;  3KOZ E;  3KOX E; 
#chains in the Genus database with same CATH topology
 4DBG B;  1TH3 A;  5EQT A;  2R4E A;  4WUR A;  1L1Z A;  1IY2 A;  2H1R A;  2C96 A;  4GHL A;  1IN6 A;  4JXJ A;  2EJS A;  3J80 S;  3TPZ A;  1GAB A;  1IY0 A;  3EIH A;  2O25 A;  2ZBK B;  4RF0 A;  2MR9 A;  4FWG A;  2Q2E B;  3LVV A;  4LGM A;  4NC6 A;  4YHH M;  3JR4 A;  3U6M A;  1XMQ M;  3MMP A;  3CGW A;  5EJC A;  3GLF A;  2EKF A;  1QZM A;  2DZL A;  5ITX A;  2ZM6 M;  1NVM A;  4NOO B;  3IEC A;  4LFC M;  4LJ9 A;  4WW0 A;  3HU1 A;  2HHH M;  2YFQ A;  2Z8Y M;  2LHG A;  2FNA A;  3FTE A;  3T15 A;  4LGY A;  3ZC7 B;  3GRY A;  4DV7 M;  3C3D A;  1KYI A;  1VEJ A;  2XZF A;  3LQQ A;  3FRI A;  3FTD A;  2FFJ A;  1QVR A;  2CP8 A;  2LH0 A;  3HU3 A;  1TDH A;  2DHR A;  4GIP A;  4IBC A;  5ITQ A;  1R6B X;  4DR5 M;  3SAT A;  4F2L A;  1ZAE A;  2R65 A;  2X4A A;  3SAU A;  2DNA A;  1KSF X;  2HKJ A;  3VFD A;  2MH8 A;  3SYK A;  3GLI E;  3A46 A;  2L7H A;  3T1H M;  4X64 M;  2JY8 A;  1JR3 A;  4LFB M;  4XK8 F;  3WHL A;  3VKH A;  1S3S A;  2R45 A;  2VDB B;  4IBF A;  2CWB A;  1IN7 A;  3CTW B;  5GKN A;  1ZQ9 A;  2BNK A;  2EO2 A;  2CUZ A;  3U60 B;  2KXE A;  2VII A;  2DWN A;  5ITT A;  1IN8 A;  4GMQ A;  1XWI A;  2KEB A;  3KW6 A;  1EFU B;  3JR5 A;  4FW9 A;  1NHW C;  4GC9 A;  4DR6 M;  1TGU A;  3KS4 A;  3DZD A;  5ITY A;  1WR1 B;  4TUW A;  1WGL A;  5JI2 E;  5EP2 A;  3NBX X;  4FD2 A;  4LF7 M;  3HJQ A;  1XB2 B;  4B3M M;  3U6C A;  2QQ8 A;  1IY1 A;  1ZMW A;  2R6F A;  2DAK A;  3PVS A;  2UUB M;  4II7 A;  1D2N A;  3B89 A;  1NY5 A;  2KRU A;  3BBZ A;  2C99 A;  5IRE B;  8CAT A;  4B3S M;  2DZO B;  1W5T A;  3A42 A;  1XHB A;  1XXH B;  3I51 A;  2BWE A;  2F5O A;  2KW0 A;  5F3W A;  4LJ8 A;  4JI3 M;  5C1B A;  3GPP A;  2CEA A;  4S12 A;  3UJN A;  2XSZ D;  4PT5 A;  2CRU A;  2CV1 A;  3Q8G A;  1IXZ A;  2QCU A;  3B74 A;  4NSR A;  4PDI A;  3RFW A;  3QYE A;  3TQS A;  5KPR A;  1A5T A;  5DFL A;  2FE8 A;  4IBG A;  4X66 M;  4EIW A;  4G4R A;  3GRU A;  4K0K M;  4MB7 A;  3RE8 A;  4JV5 M;  1IXR C;  1G4A E;  3HHW A;  4M9S A;  2R62 A;  3B7Z A;  5KPZ A;  1E9R A;  2M60 A;  4AI6 A;  5DYG A;  4LFA M;  1H6U A;  1N77 A;  3D8B A;  2E5L M;  4L8R C;  3GQ5 A;  2XH9 A;  2QHO B;  5E26 A;  2XFT A;  3B7Q A;  1V92 A;  1VEG A;  4B7H A;  3ZH9 B;  2M5Z A;  3U60 A;  2VF7 A;  2UUC M;  1JQJ C;  2Y20 A;  1QDR A;  1NJF A;  2DEN A;  4L78 A;  1NNU C;  5KQD A;  1TTE A;  3KP0 E;  2KZU A;  2RGH A;  2ZTD A;  2LHC A;  3E4R A;  1WXQ A;  4L16 A;  3U6S A;  3K9P A;  2LNH C;  2DAG A;  4G4O A;  1DGB A;  3U5Z A;  1DGF A;  3TWL A;  1C7Y A;  4HEO A;  3KVW A;  3AOE C;  3FUX A;  1G59 A;  3SHF A;  1OIZ A;  2QPA A;  1GKI A;  2XFS A;  1MN3 A;  1OQY A;  2DI0 A;  2BJW A;  2L6O A;  1R2Y A;  1WHC A;  4R7G A;  3B7N A;  1QAO A;  4JI8 M;  3GPX A;  3AL0 C;  4YY3 M;  5FTK A;  1F4I A;  4KLN A;  2LVO C;  2C9O A;  4JI7 M;  3K8Z A;  3W0L B;  2F4V M;  2VQF M;  3GPY A;  1XXH A;  3L29 A;  4JI4 M;  5H37 D;  1SXJ C;  4JI5 M;  1J09 A;  2ZAN A;  3J27 B;  4AKH A;  1GO5 A;  4RNA A;  5IWA M;  1V33 A;  3E21 A;  3L2A A;  4LF8 M;  1PJJ A;  1Q39 A;  1IXS A;  4GRI A;  3HX3 A;  4ANR A;  2ZAO A;  3GLG A;  1HNZ M;  2DVW B;  1N75 A;  1OJL A;  3LCV B;  2QBY A;  4OVZ B;  2QSF X;  2F5Q A;  1QAN A;  3U61 B;  1YE9 A;  1WIV A;  4I4L A;  3H4M A;  5IT9 S;  4GH9 A;  5EXS A;  2LBC A;  2OOA A;  3L28 A;  3J81 S;  1TDZ A;  3SYL A;  1IFY A;  2K0B X;  4NL4 H;  5L8R F;  2O01 F;  3K2L A;  2EUC A;  1HQY E;  1ZV1 A;  4Q7J A;  4XGI A;  2WSC F;  4ITQ A;  2RKO A;  3W0F A;  4MH0 E;  2GNO A;  1P3Q Q;  3QWL A;  2XEP A;  1LTM A;  1OTR A;  1PJS A;  2QEN A;  1HT1 E;  1VG5 A;  4GEW A;  4LF6 M;  4LY6 A;  1Z5B A;  2D7G A;  1R4G A;  2YNM D;  3C3E A;  4B08 A;  4AKG A;  3FRH A;  3PNY A;  3TWK A;  1FJG M;  5EXX A;  1IQP A;  3VK7 A;  4LJA A;  2WZJ A;  1K3X A;  3VDP A;  1JB0 F;  1TF0 B;  2CHV A;  4GKK M;  2UXC M;  4X62 M;  4CIS A;  4MGI E;  2APL A;  4KOD A;  5BPV A;  4QNM A;  3BXW A;  2G8L A;  4IBI A;  2D7E A;  2KZS A;  3AOG A;  3LMM A;  1CUK A;  4B3R M;  1N33 M;  1QYR A;  4G3O A;  3SMP A;  1QUT A;  4M9X A;  2FH0 A;  4FWD A;  1W5S A;  4FVM A;  1YUB A;  2W82 A;  2XZU A;  1TR8 A;  4B3T M;  1E9S A;  2EA0 A;  4AQY M;  4OW0 A;  1NHG C;  4BLC A;  3GLI B;  2I7P A;  3HY5 A;  2LVA A;  1VEK A;  2DKL A;  4FWH A;  3U6Q A;  4I81 A;  1PM5 A;  4P16 A;  2P5T A;  4DV3 M;  3GO8 A;  2JWS A;  4IIW A;  2V1U A;  3BOS A;  3AFH A;  1N36 M;  1Z59 A;  1OFI A;  2QNJ A;  4L4U A;  4XBO A;  1G71 A;  2CV0 A;  2VQE M;  1MJG M;  4LJ5 A;  4MM3 B;  1TH4 A;  1Z5A A;  1R7R A;  3A98 B;  2Y21 A;  1SG9 A;  4HL4 A;  2JUJ A;  3VLF B;  1DV0 A;  4QOS A;  2Z3X A;  4GHA A;  4GC5 A;  4OVZ A;  4Z6Y A;  2JA2 A;  3KOZ E;  2AHM A;  1Z5C A;  4RKU F;  4G4Q A;  4DR3 M;  4MGY E;  3GRV A;  3U61 A;  3KFU G;  2WSF F;  3FYD A;  2DAE A;  4M9Z A;  3SBJ A;  4LF5 M;  4AZF A;  2RGO A;  4JYA M;  1SXJ E;  3KOX E;  2FS1 A;  1NY6 A;  3GLH E;  1DGH B;  2RRU A;  1NSF A;  4F1I A;  4GIT A;  4QHT A;  2CHQ A;  2FOI C;  3K9O A;  3GPU A;  2L4E A;  3GQ3 A;  4LF4 M;  1YSY A;  3HJ8 A;  1NO1 A;  1X37 A;  3M7G A;  3H4J A;  1YLA A;  4R3D A;  2CHG A;  1VQ1 A;  2OO9 A;  4DV4 M;  4MGZ E;  4CIZ A;  1Z6T A;  3KSJ A;  5EP1 A;  4BB9 A;  3GLH B;  3GLF E;  1OFH A;  4PDG A;  5FTM A;  4D80 A;  2XSZ A;  5ITX E;  1N34 M;  1Q3C A;  1E32 A;  2R46 A;  4IJE A;  3GP1 A;  1IN4 A;  2MRO B;  1G8P A;  4LRT A;  1NJG A;  1KFV A;  1VDD A;  4G4N A;  1IBK M;  1AUA A;  4I8O A;  1ZMV A;  2MGW A;  1IN5 A;  4W5W A;  2KNA A;  2YR0 A;  5FTN A;  2KNV A;  3GLF B;  1Q02 A;  2KNZ A;  4X65 M;  1G41 A;  1Q3B A;  4M0D A;  1RU3 A;  3FUV A;  5EXT A;  3FTF A;  1GVN A;  2DWZ B;  2J5Y A;  3CF2 A;  1K82 A;  3ILK A;  1HT2 E;  3JAM S;  3F92 A;  3GLI A;  3PNV A;  3NWL A;  4OU7 A;  3VK8 A;  2LWX A;  3HKP A;  1JR3 E;  1ORY B;  4G6Z A;  5FTJ A;  3DA1 A;  4LZJ A;  1EE8 A;  1GL7 A;  1L1T A;  1QQW A;  1V34 A;  4JI0 M;  1HNX M;  3THG A;  2LTU A;  5KPT A;  2CE7 A;  2DWM A;  1PGY A;  2I7N A;  1QAM A;  2OQ4 A;  1SXJ D;  2Y0T A;  1J5E M;  2UU9 M;  4FCT A;  4L6V 6;  2ZAM A;  1D0L A;  3U6L A;  2K6B A;  3HGI A;  4D82 A;  4CJ6 A;  1OAI A;  2Y0Q A;  4DV0 M;  4AG5 A;  5C18 A;  1N32 M;  3FE3 A;  2XF3 A;  3ZQJ A;  1N78 A;  3HZJ A;  4B7F A;  2MJ5 B;  1QUS A;  2JZ1 A;  5FLX S;  3MK6 A;  1I94 M;  4NSO B;  2KA6 B;  4DR4 M;  3GRR A;  2LXE A;  3L27 A;  4KO8 A;  3I04 M;  3M6A A;  4NXM M;  3FUU A;  2F5S A;  2X8A A;  4JI1 M;  2H5X A;  3IG5 A;  3T6P A;  2O5R A;  2KRK A;  1FNN A;  1NV9 A;  1Y8G A;  3SMS A;  4P17 A;  1L2D A;  1T6O A;  2HL7 A;  4M0W A;  3RGP A;  4NXN M;  2V1C A;  1XC8 A;  4DR7 M;  2DHY A;  5KO3 A;  4DV5 M;  4IBE A;  3C58 A;  3LQR A;  4HLQ A;  1PJT A;  2UXB M;  2KDL A;  3UZU A;  3AV0 A;  2DAM A;  2L2D A;  3LVW A;  2F5P A;  4NRW A;  1WJ7 A;  1D0M A;  2R0I A;  3EIE A;  4DV1 M;  1VDL A;  1UFZ A;  5EXP A;  1WGN A;  3I4V A;  2OPF A;  4REZ A;  2CFO A;  3GQ4 A;  1JR3 D;  1ZMU A;  3I01 M;  3MJ5 A;  3V76 A;  5ITR A;  4PD2 A;  1L2C A;  3SAW A;  2QP9 X;  4JI6 M;  2BJV A;  3SHG B;  2K47 A;  3SC3 A;  4B7G A;  2K9D A;  2Z4R A;  4D81 A;  2JP7 A;  1BVS A;  4Y28 F;  2C98 A;  3PXG A;  4UN2 B;  2JY7 A;  4LJ6 A;  1K3W A;  3U6E A;  4IJF A;  5DYI A;  3OTO M;  3A45 A;  3KP1 E;  2LVQ D;  3HHZ A;  4JI2 M;  1QZE A;  1DGG A;  3U6P A;  1QAQ A;  1T43 A;  3FD9 A;  3TWM A;  2C5R A;  2BWB A;  4RF1 A;  1OKS A;  3E46 A;  1G3I A;  1T3T A;  4DR2 M;  2KHH A;  4DR1 M;  1XNR M;  2L4F A;  2WSE F;  4WP2 A;  2DAI A;  3IHP A;  3RGS A;  3AKZ A;  2ERC A;  1XMO M;  1UM8 A;  2XLJ A;  4GKJ M;  2HWJ A;  2L09 A;  4DV2 M;  2R4J A;  5KQ8 A;  2DWL A;  3L26 A;  4IBB A;  4L15 A;  4CHT B;  3U6D A;  2X49 A;  2JY6 B;  3TL4 X;  5FSW A;  5E6J A;  2DZN B;  1XXH E;  1GL6 A;  2JZ0 A;  3MHV C;  3Q8X A;  4PCZ A;  3U5Z B;  3B9P A;  3UGJ A;  2LVN C;  3UMM A;  1NNJ A;  3AJI B;  3QYB A;  4LG2 A;  3GLG E;  2Z4S A;  2XGN A;  4LCB A;  3CF0 A;  4QNR A;  3WHK A;  3KDS E;  2B3T A;  2JNH A;  3PFI A;  3KOW E;  1TH2 A;  2N35 A;  2V6Z M;  4DUY M;  3SAV A;  3T38 A;  3U6O A;  1I4W A;  4DV6 M;  4IBK A;  1SXJ B;  3UK6 A;  4BBA A;  3K1J A;  3J7A S;  1R5L A;  1C1K A;  2D7H A;  1OIP A;  2OOB A;  3NBI A;  4AW4 A;  4KHP M;  3SAR A;  4FCV A;  2R44 A;  2F5N A;  1IXS B;  3GLG B;  3T1Y M;  1HR0 M;  5IZ7 D;  1EIJ A;  1GLN A;  2NQ8 C;  2QBY B;  3C9P A;  1HQC A;  5BR8 M;  1MX0 A;  3KXE C;  2VF8 A;  1PJI A;  3W68 A;  2EKK A;  3J2P B;  3J7B A;  3W67 A;  3VDU A;  3M0E A;  4FCW A;  4KT0 F;  3K92 A;  1OAO C;  1PRB A;  2GQF A;  2DXI A;  4IBD A;  2G3Q A;  4AG6 A;  4ZPX A;  2C9C A;  3CF6 E;  4LJ7 A;  3KS8 A;  4AKI A;  4JN6 A;  2UUA M;  5A2Q S;  4LZZ A;  4MGH A;  1D0K A;  7CAT A;  2LVP C;  1L8Q A;  4QHS A;  1QDT A;  4OX9 M;  3D8L A;  4MGK E;  5LMU M;  3QAU A;  2J7O A;  5EP4 A;  4LF9 M;  2J7N A;  1DO0 A;  3LCU A;  1IBL M;  3FUT A;  5DNY A;  2HAK A;  3KSX A;  1J7K A;  4NRV A;  5JI3 E;  1IM2 A;  4CGY B;  3IG8 A;  4Z8X A;  2ZTC A;  4DUZ M;  3LW5 F;  5ITU A;  4LJ4 A;  4LRS A;  4QOZ C;  3ZCB B;  3HHY A;  3HWS A;  1R2Z A;  2A5Y B;  3KOY E;  3SAS A;  3VKG A;  2YQZ A;  1GJS A;  3FYC A;  3HHX A;  2G5G X;  3DOA A;  3HJS A;  3FKE A;  3L25 A;  2HCB A;  4A3V B;  3FUW A;  2R18 A;  2L7I A;  2Z7J A;  2QZ4 A;  1GJT A;  1HJP A;  1NV8 A;  3TE6 A;  1L2B A;  2JXN A;  1XNQ M;  3R9X B;  1IBM M;  4IBJ A;  5FTL A;  1LV7 A;  3R8F A;  3I4Y A;  1DGH A;  3AOE A;  3E9S A;  5EP3 A;  5LMN M;  2UXD M;  3DFZ A;  1AIP C;  3SFZ A;  2JY5 A;  3FTC A;  1E94 E;  3HU2 A;  4R71 A;  1HNW M;  1SXJ A;  1PJQ A;  1MU5 A;  4I5S A;  3GLH A;  1DO2 A;  2CV2 A; 
#chains in the Genus database with same CATH homology
 1TH3 A;  5EQT A;  2R4E A;  4WUR A;  1L1Z A;  1IY2 A;  2H1R A;  2C96 A;  4GHL A;  1IN6 A;  4JXJ A;  3TPZ A;  3J80 S;  1IY0 A;  3EIH A;  2ZBK B;  4RF0 A;  4FWG A;  3JR4 A;  2Q2E B;  3LVV A;  4LGM A;  3U6M A;  4YHH M;  1XMQ M;  5EJC A;  3GLF A;  1QZM A;  5ITX A;  2ZM6 M;  1NVM A;  4NOO B;  4LFC M;  4LJ9 A;  4WW0 A;  3HU1 A;  2HHH M;  2YFQ A;  2FNA A;  3FTE A;  3T15 A;  4LGY A;  3ZC7 B;  3GRY A;  4DV7 M;  1KYI A;  2XZF A;  3LQQ A;  4GIP A;  3FTD A;  2FFJ A;  1QVR A;  2LH0 A;  3HU3 A;  5ITQ A;  1TDH A;  2DHR A;  4IBC A;  4DR5 M;  3SAT A;  1R6B X;  1ZAE A;  2R65 A;  2X4A A;  3SAU A;  1KSF X;  2HKJ A;  3VFD A;  3SYK A;  3T1H M;  3A46 A;  2L7H A;  4X64 M;  1JR3 A;  4LFB M;  3WHL A;  3VKH A;  1S3S A;  2R45 A;  4IBF A;  3CTW B;  1IN7 A;  3U60 B;  5GKN A;  1ZQ9 A;  2BNK A;  2EO2 A;  2CUZ A;  1J5E M;  2KXE A;  2VII A;  2DWN A;  5ITT A;  1IN8 A;  4GMQ A;  1XWI A;  2KEB A;  3KW6 A;  3JR5 A;  4FW9 A;  1NHW C;  4GC9 A;  4DR6 M;  1TGU A;  3KS4 A;  3DZD A;  5ITY A;  4TUW A;  5JI2 E;  5EP2 A;  4FD2 A;  4LF7 M;  3HJQ A;  4B3M M;  3U6C A;  1IY1 A;  3PVS A;  2UUB M;  4II7 A;  1D2N A;  1NY5 A;  2KRU A;  2C99 A;  5IRE B;  8CAT A;  4B3S M;  2DZO B;  1W5T A;  3A42 A;  1XHB A;  1XXH B;  3I51 A;  2F5O A;  2KW0 A;  5F3W A;  4LJ8 A;  4JI3 M;  5C1B A;  3GPP A;  2CEA A;  4S12 A;  3UJN A;  2XSZ D;  4PT5 A;  2CV1 A;  1IXZ A;  2QCU A;  4NSR A;  4PDI A;  3RFW A;  3TQS A;  5KPR A;  2FE8 A;  4IBG A;  4X66 M;  4EIW A;  4G4R A;  3GRU A;  4K0K M;  4MB7 A;  3RE8 A;  4JV5 M;  1IXR C;  1G4A E;  3HHW A;  4M9S A;  2R62 A;  5KPZ A;  1E9R A;  2M60 A;  4AI6 A;  5DYG A;  4LFA M;  1H6U A;  1N77 A;  3D8B A;  2E5L M;  4L8R C;  3GQ5 A;  2XH9 A;  5E26 A;  2XFT A;  4B7H A;  3ZH9 B;  2M5Z A;  3U60 A;  2UUC M;  1JQJ C;  2Y20 A;  1NJF A;  4L78 A;  1NNU C;  5KQD A;  3KP0 E;  2KZU A;  2RGH A;  3U6S A;  3E4R A;  1WXQ A;  4L16 A;  2LNH C;  4G4O A;  1DGB A;  3U5Z A;  1DGF A;  3TWL A;  3KVW A;  3AOE C;  3FUX A;  1G59 A;  3SHF A;  2QPA A;  1GKI A;  2XFS A;  2BJW A;  2L6O A;  1R2Y A;  4R7G A;  4JI8 M;  1QAO A;  3GPX A;  3AL0 C;  4YY3 M;  5FTK A;  4KLN A;  2C9O A;  4JI7 M;  3K8Z A;  3W0L B;  2F4V M;  2VQF M;  3GPY A;  1XXH A;  3L29 A;  4JI4 M;  5H37 D;  1SXJ C;  4JI5 M;  1J09 A;  2ZAN A;  3J27 B;  4AKH A;  4RNA A;  5IWA M;  3L2A A;  4LF8 M;  1PJJ A;  1Q39 A;  3GLG A;  4GRI A;  2ZAO A;  1HNZ M;  2DVW B;  1N75 A;  1OJL A;  2QBY A;  4OVZ B;  2F5Q A;  1QAN A;  3U61 B;  1YE9 A;  4I4L A;  3H4M A;  5IT9 S;  4GH9 A;  5EXS A;  3J81 S;  3L28 A;  1TDZ A;  3SYL A;  4NL4 H;  3K2L A;  2EUC A;  1HQY E;  4XGI A;  4ITQ A;  2RKO A;  3W0F A;  4MH0 E;  3QWL A;  2XEP A;  2QEN A;  1HT1 E;  4LF6 M;  4LY6 A;  1Z5B A;  2D7G A;  2YNM D;  4B08 A;  4AKG A;  3PNY A;  3TWK A;  1FJG M;  5EXX A;  1IQP A;  3VK7 A;  4LJA A;  1K3X A;  3VDP A;  2CHV A;  4GKK M;  2UXC M;  4X62 M;  4CIS A;  4MGI E;  5BPV A;  4KOD A;  4QNM A;  2G8L A;  4IBI A;  2D7E A;  2KZS A;  3AOG A;  3LMM A;  4B3R M;  1N33 M;  1QYR A;  3SMP A;  4M9X A;  4FWD A;  1W5S A;  4FVM A;  1YUB A;  2W82 A;  2XZU A;  4B3T M;  1E9S A;  2EA0 A;  4AQY M;  4OW0 A;  1NHG C;  4BLC A;  3GLI B;  2I7P A;  3U6Q A;  4FWH A;  4I81 A;  1PM5 A;  4P16 A;  2P5T A;  4DV3 M;  3GO8 A;  4IIW A;  2V1U A;  3BOS A;  3AFH A;  1N36 M;  1Z59 A;  1OFI A;  4L4U A;  4XBO A;  2CV0 A;  2VQE M;  4LJ5 A;  4MM3 B;  1TH4 A;  1Z5A A;  1R7R A;  3A98 B;  2Y21 A;  4HL4 A;  3VLF B;  4QOS A;  2Z3X A;  4GHA A;  4GC5 A;  4OVZ A;  4Z6Y A;  2JA2 A;  3KOZ E;  2AHM A;  1Z5C A;  4G4Q A;  3U61 A;  4DR3 M;  4MGY E;  3GRV A;  3KFU G;  3FYD A;  4M9Z A;  3SBJ A;  4LF5 M;  4AZF A;  2RGO A;  4JYA M;  1SXJ E;  3KOX E;  1NY6 A;  1DGH B;  1NSF A;  4GIT A;  4QHT A;  2CHQ A;  2FOI C;  3GPU A;  3GQ3 A;  4LF4 M;  1YSY A;  3HJ8 A;  1X37 A;  3M7G A;  4R3D A;  2CHG A;  4DV4 M;  4MGZ E;  1Z6T A;  3KSJ A;  5EP1 A;  4BB9 A;  3GLH B;  1OFH A;  4PDG A;  5FTM A;  4D80 A;  2XSZ A;  5ITX E;  1N34 M;  1Q3C A;  1E32 A;  2R46 A;  4IJE A;  3GP1 A;  1IN4 A;  1G8P A;  4LRT A;  1NJG A;  1KFV A;  1VDD A;  4G4N A;  1IBK M;  4I8O A;  4W5W A;  1IN5 A;  5FTN A;  2YR0 A;  3GLF B;  4X65 M;  1G41 A;  1Q3B A;  4M0D A;  3FUV A;  5EXT A;  3FTF A;  1GVN A;  2DWZ B;  3CF2 A;  1K82 A;  3ILK A;  1HT2 E;  3JAM S;  3GLI A;  3PNV A;  3NWL A;  4OU7 A;  3VK8 A;  2LWX A;  3HKP A;  1ORY B;  4G6Z A;  5FTJ A;  3DA1 A;  4LZJ A;  1EE8 A;  1GL7 A;  1L1T A;  1QQW A;  4JI0 M;  1HNX M;  3THG A;  5KPT A;  2CE7 A;  2DWM A;  2I7N A;  1QAM A;  2OQ4 A;  1SXJ D;  2Y0T A;  2UU9 M;  4FCT A;  2ZAM A;  3U6L A;  3HGI A;  4D82 A;  4DV0 M;  2Y0Q A;  4AG5 A;  5C18 A;  1N32 M;  2XF3 A;  1N78 A;  4B7F A;  5FLX S;  3MK6 A;  1I94 M;  4NSO B;  2KA6 B;  4DR4 M;  3GRR A;  2LXE A;  3L27 A;  4KO8 A;  3M6A A;  4NXM M;  3FUU A;  2F5S A;  2X8A A;  4JI1 M;  3IG5 A;  2O5R A;  2KRK A;  1FNN A;  3SMS A;  1L2D A;  2HL7 A;  4M0W A;  3RGP A;  4NXN M;  2V1C A;  1XC8 A;  4DR7 M;  5KO3 A;  4DV5 M;  4IBE A;  3C58 A;  3LQR A;  4HLQ A;  2UXB M;  3UZU A;  3AV0 A;  3LVW A;  2F5P A;  4NRW A;  3EIE A;  4DV1 M;  5EXP A;  3I4V A;  2OPF A;  4REZ A;  2CFO A;  3GQ4 A;  1JR3 D;  3MJ5 A;  5ITR A;  1L2C A;  4PD2 A;  3SAW A;  2QP9 X;  4JI6 M;  2BJV A;  3SHG B;  2K47 A;  3SC3 A;  4B7G A;  4D81 A;  2Z4R A;  2C98 A;  3PXG A;  4LJ6 A;  1K3W A;  3U6E A;  4IJF A;  5DYI A;  3OTO M;  3A45 A;  3KP1 E;  3HHZ A;  4JI2 M;  3U6P A;  1DGG A;  1QAQ A;  3FD9 A;  3TWM A;  2C5R A;  4RF1 A;  1G3I A;  1T3T A;  4DR2 M;  1XNR M;  4DR1 M;  3RGS A;  3AKZ A;  2ERC A;  1XMO M;  1UM8 A;  2XLJ A;  4GKJ M;  2L09 A;  4DV2 M;  2R4J A;  5KQ8 A;  2DWL A;  3L26 A;  4IBB A;  4L15 A;  4CHT B;  3U6D A;  2X49 A;  3TL4 X;  5FSW A;  5E6J A;  2DZN B;  1GL6 A;  3MHV C;  3Q8X A;  4PCZ A;  3U5Z B;  3B9P A;  3UGJ A;  3UMM A;  1NNJ A;  3AJI B;  4LG2 A;  2Z4S A;  2XGN A;  4LCB A;  3CF0 A;  4QNR A;  3WHK A;  3KDS E;  3PFI A;  3KOW E;  1TH2 A;  2V6Z M;  3SAV A;  4DUY M;  3T38 A;  3U6O A;  1I4W A;  4DV6 M;  4IBK A;  1SXJ B;  3UK6 A;  4BBA A;  3K1J A;  3J7A S;  1C1K A;  2D7H A;  4AW4 A;  4KHP M;  3NBI A;  3SAR A;  4FCV A;  2F5N A;  1IXS B;  3GLG B;  3T1Y M;  1HR0 M;  5IZ7 D;  1GLN A;  2NQ8 C;  2QBY B;  1HQC A;  5BR8 M;  1MX0 A;  3KXE C;  1PJI A;  3J2P B;  3J7B A;  3VDU A;  3M0E A;  4FCW A;  3K92 A;  2DXI A;  4IBD A;  4AG6 A;  4ZPX A;  2C9C A;  3CF6 E;  4LJ7 A;  3KS8 A;  4AKI A;  4JN6 A;  2UUA M;  5A2Q S;  4LZZ A;  4MGH A;  7CAT A;  1L8Q A;  4QHS A;  4OX9 M;  3D8L A;  4MGK E;  5LMU M;  3QAU A;  2J7O A;  5EP4 A;  4LF9 M;  2J7N A;  1DO0 A;  1IBL M;  3FUT A;  5DNY A;  3KSX A;  1J7K A;  4NRV A;  5JI3 E;  1IM2 A;  4CGY B;  3IG8 A;  4Z8X A;  4DUZ M;  4QOZ C;  5ITU A;  4LJ4 A;  4LRS A;  3ZCB B;  3HHY A;  3HWS A;  1R2Z A;  2A5Y B;  3KOY E;  3SAS A;  3VKG A;  2YQZ A;  3FYC A;  3HHX A;  2G5G X;  3DOA A;  3HJS A;  3FKE A;  3L25 A;  2HCB A;  4A3V B;  3FUW A;  2R18 A;  2L7I A;  2Z7J A;  2QZ4 A;  1XNQ M;  1L2B A;  3R9X B;  3TE6 A;  1IBM M;  4IBJ A;  5FTL A;  1LV7 A;  3R8F A;  3I4Y A;  1DGH A;  3AOE A;  3E9S A;  5EP3 A;  5LMN M;  2UXD M;  3DFZ A;  3SFZ A;  3FTC A;  1E94 E;  3HU2 A;  1HNW M;  1SXJ A;  1MU5 A;  4I5S A;  3GLH A;  1DO2 A;  2CV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...