1ZMVA

Catalytic and ubiqutin-associated domains of mark2/par-1: k82r mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
313
structure length
293
Chain Sequence
GNYRLLKTIGKGAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 94
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmvA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmvA01
4F6UA 2VWBA 5CQUA 4N6YA 2J51A 3B8RA 4MF1A 5BMMA 3E62A 1WBWA 4LMUA 2ONLC 2PVFA 4O1PA 4K77A 4AE9A 3SA0A 3WF9A 2W1DA 5M4FA 1G5SA 4L46A 3HVCA 4DBXA 3KCFA 2HENA 4R7BA 2H9VA 4AW5A 2XNMA 4I94A 4QMYA 4BVUA 4DH3A 2VTTA 1B6CB 3QTRA 2IVVA 2VGOA 4QQJA 4XH6A 4DEBA 3NNXA 4JBOA 3BRBA 3UVQA 2BFYA 4EC8A 1URWA 2ZVAA 5BVEA 1XH4A 1UU9A 3NNUA 4NJDA 4IAIA 4R77A 4BL1A 2Y6MA 1H00A 4IHPA 4NTSA 1YWVA 4L6QA 3W2QA 3LMIA 1ZOGA 3Q4CA 4M0YA 4UN2B 4KWPA 1FGIA 2VWYA 2ZB0A 3DJ6A 4AAAA 3UQCA 3UZTA 3HMMA 3PVUA 3VW8A 3SDJA 2SRCA 4TNDA 2A27A 5B2MA 2W96B 3EQRA 4RJ4A 4PDYA 2XKDA 1OL6A 5FDXA 4CTBA 5I9VA 2QVSE 1BUHA 3COKA 3GCVA 3QKMA 4YZBA 5M4IA 4R1YA 3SGCA 2OIBA 1K9AA 5DHJA 2QO9A 4FOCA 3M1SA 2JY5A 4G3OA 4I4FA 4XLIA 1OIQA 4V0GB 2OF2A 2G2HA 4BWPA 4D55A 1XR1A 4U43A 3QYZA 4BDDA 5AM7A 5JN2A 2IZSA 2BIYA 4LOQA 5D10A 3U9CA 3MFUA 3PPZA 4R71A 3R9RA 4JQ7A 3HMOA 1Q8UA 4LFIA 3UYSA 3MTFA 1S9JA 3PWDA 5HHWA 5HU3A 3RM6A 2IPXA 1M17A 1A5TA 4EC9A 5ETAA 5J1WA 5ANOA 5IA2A 2CLQA 2VNWA 3C4ZA 4D58A 1OL2A 4HEOA 5JK3A 3NZ0A 3U4WA 3BYUA 3TZ8A 4GSBA 5L2IA 4BTKA 4QMMA 3CS9A 4WUAA 3UIBA 4YU2A 3QD3A 2B7AA 2OICA 5GIOE 2GHGA 1YOJA 3FHRA 4FVQA 4GJ3A 3WF7A 5IA3A 4BY9E 2JP7A 5AR7A 3F69A 4JI9A 1ZMUA 3UOJA 4BGGA 3MB6A 2BRMA 3EL8A 5E8XA 3VC4A 4ZZNA 4NTTA 2K0BX 2XNOA 5A54A 1JKSA 3B89A 4WG5A 5LVNA 4FG7A 1UVRA 2IJMA 2C1BA 4NEUA 3ANRA 5HICA 2YDIA 4KSPA 3IDBA 4B7TA 1W82A 2W4OA 3QYWA 1XH7A 3OW3A 4RA4A 2HZ0A 4J1RA 2WB8A 1FGKA 1FVTA 3BYMA 2EKKA 3ZO3A 2DAIA 1JOWB 3R9DA 3TNWA 4NU1A 1LPUA 3BI6A 3LE6A 3OBGA 4WT6A 3ZEPA 4AGWA 5AA9A 3CSVA 1E9HA 3DOGA 4AF3A 5ICPA 5DEYA 5ANIA 3QZIA 3UODA 5LXMA 3QLFA 4FV6A 4I5HA 3UPZA 4O0WA 2HY81 4G6OA 4FEWA 1PGYA 3OP5A 1Q8WA 5DI1A 5I9YA 5IQHA 1YHSA 4G3FA 5TO8A 2R2PA 3GLIE 5CY3A 3QTIA 2UW8A 4WIHA 5HNIX 2F7ZE 4BR3A 3KL8A 1GJOA 5EHYA 2YJRA 2VNYA 1YXTA 3KRRA 5TR6A 4C57A 3A2CA 4H3QA 3AC2A 3G51A 4G9CA 4F9AA 4EKKA 3HYHA 1PXLA 3ZFXA 3HMPA 1OIRA 4RWKA 5CNNA 4EORA 3CGOA 3B2WA 4J52A 4AOTA 1OB3A 2YLEA 3OT8A 4KD1A 4ZTMA 3WILA 4F1OA 4YJNA 4YP8A 3WZKA 2CNQA 2OFVA 1U54A 3HKOA 2W17A 2IZTA 2VX1A 2FSTX 4WD5A 1XH8A 2VTLA 2ZV8A 5JFSA 3VQUA 1BI7A 4X2GA 5F20A 4F1TA 4YJSA 5F94A 1SVGA 3PXZA 3UYTA 4FUYA 5AUWA 2GNLA 4KBCA 3FKLA 2WMUA 2YIRA 4PQNA 4AA5A 3E63A 5BPYA 4RWIA 4ZTRA 3NEWA 4G5PA 2JC6A 3K3JA 2B54A 4ENYA 2Y9QA 3ZUTA 5IQBA 3Q53A 4DG2E 3IS5A 4NKSA 4MQ1A 3DT1A 3FLWA 4I6FA 3F6XA 4WBOA 3QGWA 1IM2A 3HP5A 2XNEA 3TZ9A 4ENXA 4G6NA 4GRBA 2GNHA 5HE3A 2VX0A 5E92A 4IVBA 2UVZA 4LUEA 5CEOA 2Z2WA 4RLKA 1PJKA 5DR2A 2WMTA 2X39A 4ACDA 4D2RA 1PF8A 4FMQA 4UWYA 4GIHA 4OAUC 1H0WA 3VULA 1DAWA 4AGUA 1O6YA 4FK6A 4KAOA 3KRJA 3OWKA 2IO6A 3KXNA 5EM5A 4FT7A 3THBA 3WZJA 4LUDA 3UIUA 4DN5A 4DFUA 2C3JA 2C30A 2QG7A 1WR1B 4ZOGA 4A4LA 4DTKA 4PPCA 5L3AA 2W1ZA 2CCHA 5DT0A 3S00A 5LCJA 1Z57A 3FPMA 3IOPA 3AMYA 4NH1A 2BCJA 4M12A 4QYYA 2RFDA 4CT2A 3I7CA 2HZ4A 3HAMA 1M2PA 3CPCA 4RX8A 2KNVA 1IR3A 3KC3A 4R7HA 4YNOA 3QQLA 3LCSA 3MDYA 1H1RA 3MGYA 4AN2A 4D5HA 4OGRA 2KHHA 2CGVA 3PA5A 4O1OA 2O2UA 3OG7A 2YJSA 5KMLA 3Q2JA 1H08A 1Y6AA 1Q8TA 2W05A 2XB7A 3MPMA 3PY3A 3E8CA 5D41A 4QQCA 3ZFMA 4FYOA 4D9UA 4D5KA 4UMUA 4J8NA 4C62A 4EH3A 5IA4A 3QZFA 3A7HA 4BCQA 1NV8A 4YJVA 1U5RA 3IGOA 5DT4A 5AP5A 3RWPA 3CP9A 3FQEA 4UMQA 2PU8A 4EJNA 4O81A 5EFQA 1ZMWA 2B1PA 4ZTSA 3VS1A 2XUUA 4XUFA 2W1IA 3ZBXA 5E9EA 4UN0C 1EFUB 3ZHPC 4CQGA 3FWQA 2XKEA 3F5UA 1F0QA 3CTQA 1UKHA 1OGUA 1SNUA 4FTTA 5CF6A 3LJ2A 2BZHB 4JS8A 4NZWB 1FMOE 2VGPA 2G15A 2YM4A 2XBJA 2PUUA 4Z7GA 2CNVA 5GINE 4KKGA 3GU5A 4CMUA 4F1IA 2OH4A 2BROA 4IX3A 3UTOA 5EM8A 3EZVA 1BLXA 3LIJA 5FEQA 1OZ1A 2AYPA 1OKWA 3FMHA 3QHRA 5IDPA 3LPBA 3PUPA 1QPJA 3KVWA 4OBQA 4AW0A 5JSMA 3DBEA 3E3BX 3RAWA 2C6DA 4L3JA 3A7FA 3NUPA 3ZXZA 3GU6A 1YHWA 4MX9A 4KS7A 3VUTA 3AMBA 4CZUA 3R1NA 1Y8GA 2BPMA 3KMUA 3MA3A 3O50A 4IB5A 3UP2A 3UP7A 5J9ZA 3EH9A 2FSMX 1ZYJA 2LTUA 3KMWA 4L43A 3VUHA 4ANNA 2ZMCA 2WMWA 3POOA 4CRSA 3AT4A 4N70A 4C02A 1C7YA 4JX3A 4YJQA 4DEIA 5AP6A 1I44A 4TYEA 4BCPA 5A4TA 3P7CA 2FYSA 4YTIA 5AV2A 4BB4A 2GNGA 4ASXA 4EONA 5BMSA 4YHTA 2QR7A 3DNEA 3HP2A 4K18A 3EQFA 3GB2A 4CLIA 5LWMA 4GEOA 4OTRA 5TOZA 3D15A 3E3PA 4RFZA 4JDKA 2H34A 3VS5A 1A9UA 3TTJA 5IMEA 5I3OA 1MN3A 2W1HA 5DRBA 3OOGA 3QX2A 4RVLA 3ZONA 2JDSA 4GU9A 4DT9A 4K2RA 5AR4A 3LLAA 2X9EA 2WZJA 3RK9A 3ZDIA 2HXLA 3REPA 4E6DA 5EKNA 1PYEA 4FT9A 3QTXA 5CEIA 3KY2A 3TZMA 3FLZA 4GK2A 3OUNB 1DS5A 1OL7A 2I1MA 3F2NA 5CLPA 4GT3A 3SXSA 5KMMA 4YZMA 1J3HA 2QD9A 3DBDA 4L7SA 5ETCA 4DGOA 3E7OA 2JIVA 2PZIA 3ET7A 4HVGA 2A0CX 3OS3A 4C4FA 3HRFA 2CKEA 1OTRA 4RT7A 3Q2MA 3Q9YA 3S95A 3V5LA 1NY3A 4JR3A 2HCKA 1IFYA 3U54A 2QLUA 3DPKA 4MWHA 3S4QA 1KWPA 3SW7A 2V7AA 3UO5A 1UWHA 3IOKA 3P79A 3FZOA 2WQOA 3NYVA 5CZIA 4GMYA 3P4KA 4Q9ZA 1Q3DA 3PRFA 5HE2A 3R7EA 3OC1A 3RGFA 3ZU7A 2W9FB 3DKGA 3QU0A 4M7IA 4U45A 3NW6A 2DZLA 4E4LA 3OVVA 3PSDA 1MRYA 2VN9A 3LJ0A 2EJSA 2QHMA 4TXCA 4GU6A 5KZ0A 2FB8A 3K5UA 3WIGA 2BZJA 2FH9A 4ZZOA 1YHVA 3KA0A 3UZPA 4EBWA 2OBJA 3R2YA 4UXQA 4TN6A 4DT8A 4RG0A 2GQSA 2OO8X 4PPBA 5HBEA 3CJFA 3TN8A 4HYSA 1GZKA 3E8EA 2ITQA 4Z55A 2XIRA 3TJCA 3E92A 2KULA 4EQCA 4H39A 5KKRC 4R3RA 5M55A 3EYHA 3IECA 4DE4A 3HV5A 1CKPA 4ANMA 4FIFA 4PMSA 3VO3A 3C5UA 5LQFA 4O7NA 4UZDA 4FIHA 1HOWA 4JNWA 4YURA 2JKOA 4M13A 4IMYA 3Q3BA 1JKTA 2W1GA 4LL5A 4XV2A 4RMZA 4RC2A 3R71A 4G3EA 1VG5A 4OTDA 1L3RE 2XK4A 3MH3A 2C6KA 4UEUA 4WSQA 5LMKA 1E1XA 2EU9A 1LUFA 1OIUA 3BQCA 5FQDC 4DEAA 5AAGA 2ZTDA 3FL4A 1J7LA 2CLXA 3ORNA 3GNIB 3ZSIA 3PVWA 4PV0A 4TRLA 3P23A 1YI3A 2A2AA 3QX4A 5IKWA 3MFTA 4C35A 3TT0A 2Y0AA 3Q9WA 3KF7A 5HQ0A 1M7NA 4ZY4A 4O21A 2PZYA 4HW7A 4PDOA 3VUIA 5CAVA 3OCSA 5KBRA 2PMIA 2X2KA 5KE0A 4Q5HA 4A9TA 3IDPA 1DM2A 3VS4A 5EI2A 5KUPA 4ZSGA 3V5JA 1M2RA 3TV4A 3MH2A 4TWNA 4HGEA 4MCVA 3ANQA 1YOMA 3H9RA 3I5NA 3D9VA 3V8SA 4ZY6A 3KXZA 1H1QA 3MFRA 4EQMA 4QTEA 1YRPA 4R78A 4HOKA 3PZHA 3O8PA 5FLFA 4BI1A 3GLFE 2FVDA 2WMVA 5AX9A 4IB1A 4DLIA 1SG9A 2PPQA 5DLSA 4NL0A 2P2IA 3V6SA 2R3NA 2QODA 2PZPA 5AR3A 1MQ4A 4FSQA 2HW6A 3KU2A 2YAAA 4GYIA 4LOOA 3SOAA 4DLJA 4S2ZA 3V5WA 3FJQE 4XBUA 3TV7A 3E8NA 3OWPA 4RWJA 1JNKA 2QHNA 4W4WA 1OAIA 3OROA 1XHAA 4X0MA 3L9PA 2XNNA 2WQMA 3EOCA 3C4FA 3MMPA 4QPAA 4QMQA 2XYUA 3C13A 2IVSA 2CHLA 5EDPA 4PWNA 4RPVA 5CU6A 4CT1A 4PL5A 1AQ1A 4PMPA 4U6RA 4M67A 3UNJA 4BKJA 1R1WA 3MY1A 1WFCA 4AACA 3E5AA 3UDBA 3R22A 4XEYA 5CNOA 4XRJA 4I6HA 3RJCA 3AG9A 4FKRA 3NUYA 2OFUA 3QXOA 3TI1A 4I3ZA 3P86A 5TE0A 3QCYA 1NXKA 3KN6A 2CSNA 3LMGA 3OWLA 4YHFA 4CFVA 4YTFA 4GT5A 4OT6A 4QYFA 5E8UA 5FRIA 1H26A 4IM3A 4YNEA 3V8TA 4XG6A 3OXTA 1XJDA 5CWZA 4ID7A 4QMOA 3D5WA 4F9WA 5IDNA 4QP1A 5LMAA 4BDEA 4OLIA 5CEKA 2Y4IB 4LGGA 2W99B 4X6QC 3GLGE 2IW9A 2IZRA 4IWDA 3PSCA 1XWSA 2F2UA 2OXDA 5FXRA 3GFEA 3R02A 3KCKA 3KQ7A 2C5VA 4FV3A 3MI9A 4MXXA 4EOIA 2VTQA 5D11A 5F9EA 3FXWA 4IFCA 4CFWA 3GQIA 5KHWA 1KUTA 4CCBA 2P2HA 2XVDA 3G90X 5DOSA 5JQ8A 2R64A 3W16A 2GS7A 4ZJJA 5CEPA 5HLPA 5I9UA 4UMRA 5M4UA 2I7QA 4O7YA 4LL0A 2VTHA 4IZYA 3OXIA 4ZMEA 2YEXA 3WYXA 2YERA 4AU8A 2G2FA 4JRNA 4LM5A 3QRJA 4IAZA 2R4BA 1Q8YA 3L9LA 3VWAA 2JDTA 3QA8A 3SV0A 3N4TA 5ANDA 4RIWB 5IA5A 3O8TA 3Q4TA 2UW0A 4DYMA 4GUBA 3NYOA 3GEQA 4O7WA 2PE1A 4AFEA 2IW8A 1H1SA 4U7ZA 3LZBA 5L2QA 4KBAA 5L2TA 4MD8E 2VAGA 4YBJA 4RFYA 3QCXA 3RHKA 2YIQA 3FMEA 3DU8A 5AFVA 5DT3A 3W2CA 4FZ6A 5KMOA 4GG5A 5AV3A 4IX6A 2GQRA 1QMZA 1ZARA 4YO4A 3GCUA 3VHEA 3MJ1A 3KK9A 3QALE 5CSVA 2VTMA 2HK5A 1UNLA 4FE2A 5HGIA 2J90A 3I79A 2PSQA 4ZP5A 1Z5MA 4Y5HA 5C8NA 5AUYA 4CG8A 2JGZA 3R9HA 3KF4A 5IUIA 3QWJA 4IXPA 3DS6A 3R7VA 3KB7A 4EHZA 5I9XA 2C5NA 4O91A 3QKKA 5BQ0A 3W2PA 3H3CA 2HELA 2VO0A 1OMWA 2FGIA 2GDOA 3FMJA 4OR5A 3TDWA 3P78A 4FSNA 2G2IA 4BDAA 3FI4A 3MH1A 4BCNA 3COHA 4BCMA 1G4AE 4DGLC 5CASA 3PXKA 1H8FA 3HDNA 5I9WA 3ZDUA 4ALUA 4ARKA 1STCE 1R3CA 4GFOA 4WSYA 3V5PA 4DFBA 5IQFA 2OG8A 3HNGA 1P4OA 1RJBA 4KINA 4YC8A 2JIUA 3D7TA 4ALWA 3GT8A 3A8XA 4E20A 3C9WA 2HXQA 1IXSA 2Y8OA 2QONA 2VTNA 2P33A 3QAME 3CC6A 1S9IA 5HCYA 5JFWA 4NT4A 1O6LA 3CQWA 5AUVA 1PKDA 5CAOA 3DV3A 4XG9A 4NM3A 2RG6A 4FKUA 2OIDA 3DDPA 4ZTQA 2RFEA 4D4VA 2B9JA 5IPJA 2FUMA 2HW7A 3G9NA 4FKOA 4Y8DA 1JSVA 5C9CA 3CE3A 4YJPA 2XNBA 2X7FA 3KKVA 3O0GA 5IISA 2QOHA 3BHYA 2R3JA 4E5WA 3IW6A 5EQYA 4DA5A 4FOBA 5D12A 3WBLA 3KREA 2OW3A 2OK1A 3HMNA 2OO9A 4MNEA 5FWKK 3R8PA 3V04A 1GZ8A 1XQZA 4EK6A 2PVYA 5HO7A 4U5JA 2PVKA 2PUNA 4R3CA 3NLBA 4EOPA 3BGZA 2DQ7X 5CXHA 3C0GA 4AUAA 3VIDA 2C5XA 5BVWA 2J7TA 5C03A 4W4XA 4BCIA 1MRUA 4BZDA 5LVOA 2IZUA 5IMXA 3FDNA 3E21A 2LBCA 4IJ9A 4E26A 4E6QA 4FSWA 4MK0A 4BGQA 2J4ZA 4IZAA 4XOZA 4C4JA 4L8MA 3KVXA 4C58A 2QNJA 3ZH8A 4I4EA 3QGYA 4ZJIA 3LQ8A 3WZEA 4FKGA 3RNIA 4Q9SA 2J5FA 1ZY5A 3ZLXA 2V55A 3WIKA 4IFGA 3AQVA 3VBXA 2DNAA 4QPSA 5F4NA 4BCGA 3R8UA 4C34A 4ZAUA 5LARA 4PRJA 5AP3A 4QT1A 3PPJA 4QTCA 5AP0A 2VTPA 2VUWA 2RL5A 3OTVA 4X3JA 5IEVA 3VUDA 5L8KA 1VDLA 4LG4A 2R3RA 3HLLA 4X2JA 3E64A 4O2PA 4E6CA 2ETMA 5EW9A 4ONAA 2BIKB 3LVPA 4DAWA 5CZHA 4D2SA 4ZJVA 4CVAA 3OCBA 4OW8A 2I0YA 4IAAA 5AP7A 2DAGA 3KXXA 3QTZA 4G2FA 3D5UA 4W8DA 5TKDA 3ACJA 3GCPA 4FSYA 4JBQA 2HAKA 4FV4A 3FV8A 4JG6A 4WBBB 2F49A 2X7GA 3HV3A 5CF5A 4YJTA 4NCTC 5CU3A 3KRWA 3QFVA 4IX5A 4MHAA 4IM2A 4GFGA 5EHOA 1ZY4A 1BI8A 4G16A 5LVPA 4CV8A 3DFCB 4KRCA 5T68A 3UMXA 3ODZX 3TNPC 4L52A 4BF2A 4CTCA 3R7OA 1TTEA 3FY2A 2ZV9A 5I5ZA 2DENA 3K9PA 3TJDA 2JEDA 3U6HA 4GT4A 4KKEA 5K0KA 4FV7A 4ZZMA 1X8BA 2RKUA 4FTRA 2J2IB 3BU5A 4ITJA 4J96A 2X6EA 3CQEA 4O0VA 2ZMDA 3JY0A 2R3PA 2WTWA 1IASA 3C7QA 3WARA 2OGVA 5KMNA 3FI2A 4RRVA 3RHXA 2F7XE 4OTGA 5HE1A 4WNOA 4L45A 3ZLSA 1ZOEA 3BLRA 1T43A 3RTPA 3UC4A 3R01A 4FI1A 2XBAA 5HD7A 3TTIA 3U4UA 1KV1A 1PXJA 4MTAA 2I40A 3CY3A 3OD6X 4KIKA 3EN4A 3E7VA 4WKQA 2WXVA 2PY3A 3PRIA 4YLKA 5DYJA 1RE8A 3DFAA 2A4LA 3SVVA 3DAJA 5GJFA 2JFLA 4RA5A 1UV5A 4D1SA 3N4UA 4NJ3A 3PY0A 4BDBA 4BWKA 2K9DA 3ZC5A 4IACA 3GC0A 3S3IA 4APPA 3DBQA 3UO4A 4DEHA 3VQHA 4W8EA 4OTIA 2XRUA 4FSUA 5JGDA 1OPJA 2ZYBA 2O8YA 3OWJA 2LVAA 1XBCA 3MS9A 3QCSA 4X21A 4E93A 1H25A 4L7FA 3SOCA 5GIPE 5ANKA 5CU4A 1RDQE 5HE0A 2WEIA 4M84A 2PZ5A 3GCQA 3TXOA 1JSUA 3VJNA 4E5BA 1WMKA 4RQVA 4F9YA 1TVOA 3AD4A 3BBTB 2I0VA 3I60A 3DK7A 3RWQA 5HKMA 5KZIA 2VD5A 2QSFX 4R1VA 4YTCA 1SVHA 3QD4A 2C6TA 4PTCA 4G5JA 4E73A 2G9XA 2CCIA 2PVRA 4RQKA 3ZM9A 4E6AA 2VTJA 2CWBA 3HRBA 3KRXA 4Y73A 4AW2A 3QRUA 3CD3A 1XH9A 5AAEA 2G01A 2WU7A 3HV4A 4GCJA 5H3QA 5FUTA 2W0JA 3LCKA 2B0QA 2CGUA 2OJ9A 2WTCA 3KMMA 4JXFA 3UIXA 4UALA 2E9UA 4H3BA 1JLUE 3C4EA 1CDKA 4O6EA 2O63A 4NW6A 5CSPA 4BIDA 2B9HA 3AT3A 2LVQD 3MVLA 1M52A 3CY2A 1NV9A 2B9IA 2J9MA 3CTHA 1YLAA 1OL1A 5EM7A 4H1JA 3QQUA 3VNTA 5M4CA 2J5EA 4DF3A 2RFNA 1OPLA 1YQJA 2C5YA 3W32A 4EHVA 3MESA 3BZ3A 1KE9A 5KNJA 1ZV1A 1ZLTA 2ONLA 3ENMA 2ITTA 4TYGA 4FTIA 4CFXA 2MGWA 1MP8A 1UU7A 4FL1A 3QLGA 3VAPA 3FLSA 2FSOX 2WOUA 4D28A 2UZLA 4FTJA 4HGSA 4B0GA 4D9TA 3ORXA 3PDTA 1J1BA 4D0XA 2OU7A 2BAQA 2LAVA 3IW8A 3BHUA 3GGFA 3O7LB 1Z9XA 3GCSA 1L8TA 3UBDA 4GKIA 4DFXE 3QUEA 3LCUA 4I6QA 2BWEA 4IZ5A 4QYEA 5CS6A 4DH8A 4C0TA 4JAIA 3PA4A 4JG7A 4J99A 5A4EA 2BALA 3SG9A 5FXQA 4FTOA 4PNIA 2AC3A 3LCTA 5M57A 3OF0A 4C38A 3KXGA 3DTWA 3UC3A 2OKRA 3DGKA 3RP9A 4M3QA 2ITVA 3FKNA 3LXPA 2RF9A 4R5YA 3MBLA 1OUYA 3BGQA 3DBFA 5DN3A 5CANA 2FSLX 4YBKA 4BCJA 4AZSA 5CT0A 1W8CA 4WO5A 4A9SA 5HLNA 5FP5A 4FKJA 3VS3A 4AN3A 3W2RA 5FTOA 1P2AA 1Q99A 3CQUA 4NM0A 3SLSA 4AGCA 4BGHA 4TYHA 4K8AA 4D2PA 4WG4A 2XJ0A 5D1JA 4EQUA 2C5OA 4ZSLA 4MNFA 4CZTA 1U46A 1BL7A 2GHMA 4LV8A 2QQ7A 4BDCA 3BKBA 2Y6OA 1J91A 3MTLA 3B8QA 4HGLA 3W18A 4M97A 4KA3A 5M44A 1OPKA 3FMNA 3Q32A 1UWJA 4QP8A 3CJGA 4DINA 4IWOA 2P4IA 4MWIA 3DXQA 3A7GA 3OFMA 1TR8A 3P1AA 2VTAA 3PVGA 4FV2A 4WNKA 5EW8A 5H8GA 4FA2A 4PP7A 5I4NA 2C4GA 5JFXA 3FLNC 3ATSA 1B38A 4KABA 2Y7JA 1W84A 4AP7A 5E1EA 2WO6A 2WTJA 3MYGA 2CNUA 3T6PA 2OJIA 2JZ0A 4HCVA 2L2DA 5E90A 3L9NA 2JDVA 4DTBA 1W0XC 4FTUA 5AV1A 2XK6A 1TQMA 3SHEA 3OT3A 4GVAA 2ITPA 4I6BA 3P7BA 4J7BA 5EQPA 4DH1A 1VJYA 5EDRA 3HMIA 3D2KA 3W33A 2B53A 3DCVA 3I1AA 5C8MA 4C33A 1KV2A 3QA0A 3GP0A 3R21A 4FTLA 3MVJA 4PTEA 3TKHA 5A9UA 5LWNA 4TTHB 4IVAA 2CDZA 3CR0A 1PRYA 3MH0A 3SX9A 1Q5KA 1NA7A 3DLSA 1H1WA 3ZXTA 4ZS0A 4WNMA 1PY5A 4IVDA 4YLLA 2C3KA 3PXQA 5AP4A 1CMKE 3PLSA 2UVXA 4NFMA 3VS2A 2V22A 4ASZA 2R3FA 4YJUA 3AC8A 4JRVA 3R2BA 3ACKA 3F92A 3BLQA 5AEPA 4CXAA 3RAIA 2YWVA 3UG1A 4USEA 4DBNA 3IG7A 1V1KA 3SXFA 3AC4A 5AADA 1Q02A 4NM5A 2BTRA 2QHOB 3OHTA 4XG7A 5FTQA 4S33A 1M2QA 4ACGA 3R1QA 1KE8A 3P9JA 4L3LA 4ZXTA 2R7BA 4H3PA 4GL9A 5HG8A 3TKIA 4JL9A 3ZFYA 4AZEA 3Q6UA 3HZTA 4FNWA 4JLCA 5HEZA 4I93A 5H9BA 4EH9A 4ZLOA 3PYYA 5DH3A 1PXIA 3S2PA 5EI8A 4D4RA 1U54B 4F08A 3MPAA 3DAKA 3FHIA 3FSKA 2PZRA 4EHEA 3Q4ZA 2JLDA 3ZLWA 5IH4A 1WJ7A 3KULA 1Q61A 3D5XA 3TKUA 2Z8CA 3ALOA 2I0HA 4QQTA 3IDCA 4AOJA 4I20A 4HZSA 1VQ1A 2BRBA 3F3ZA 3Q52A 2UZEA 4H36A 4MXCA 2BDFA 3CKWA 4HYHA 5E91A 3TL8A 4AXAA 5M51A 2W5BA 1H4LA 2HWJA 5IUGA 3RPSA 4GH2A 5FM3A 3R0TA 4ITHA 4IAFA 2WNTA 4PP9A 1WZYA 3DJ7A 4CEGA 4EZ3A 5IA1A 3I5ZA 4I22A 4JBVA 3ZBFA 4A7CA 4EOMA 4F0IA 4EHGA 3KEXA 3P5KA 4GV1A 4IDTA 4QTAA 3RPRA 3TDVA 5M08A 4IADA 5CEQA 1IRKA 1URCA 4AT3A 2ZDTA 2ITZA 5B0XA 2ERKA 2PMOX 4QYHA 5GZ9A 4HNIA 4JDJA 4D2VA 5T3QA 4EOOA 4YMJA 4ANQA 4XG2A 2ZJWA 3NW7A 5EI6A 5BYYA 1H0VA 3O96A 2HZIA 3U6IA 3HA8A 3WOWA 4FIEA 3OTUA 4JIKA 3DTCA 4ASEA 1BKXA 5AR5A 2BHEA 2QKRA 4XG4A 4DGNA 4FEVA 3BHTA 3FQSA 4RSSA 1XBAA 2XM9A 2IG7A 3ZUVA 3LFAA 3V5TA 3C0IA 4DFNA 4KBKA 3RK5A 2NO3A 4GJ2A 4X3FC 2X8DA 3S1HA 4FNZA 4CFUA 4J97A 1KOBA 3RI1A 3RAHA 2GNJA 2BR1A 4QPMA 2B52A 3FXZA 2UW7A 1G3NA 3PZEA 2R9SA 4XP0A 3FC2A 3Q5IA 3F7WA 5L2SA 3ORMA 3JY9A 3NS9A 3H9FA 3VS7A 2E9NA 4RWLA 3H0YA 1TKIA 4FSRA 3VW6A 3BEGA 3GBZA 4QYGA 4QTDA 3F61A 4RZWA 4C4HA 1OQYA 5HI2A 2I0EA 4L3PA 4CZYB 4TL0A 2Y4IC 3MWUA 4CSVA 3GU4A 4BI2A 2JUJA 1BX6A 3EMGA 3KGAA 4C3RA 2ZM4A 4MBLA 5L8LA 4ZTNA 4C3PA 1U4DA 4O7ZA 1FVVA 1ZRZA 3C50A 4WHZA 3UG2A 1U59A 4ASDA 4FL2A 3G6HA 3ZO2A 2E9VA 3W8QA 4BI0A 2FA2A 1WBOA 2OZOA 3CD8A 4JAJA 3N4VA 3JYAA 3QD0A 3EZRA 3L8XA 3PA3A 4FZFB 2KNAA 4GYGA 4KIPA 1F3MC 4RVMA 1XO2B 4OBPA 3MJ2A 3G0FA 3OEZA 5L6WL 5AA8A 5A6OA 4O0RA 2R3IA 2AUHA 3R1YA 3BELA 1OKVA 2XIZA 4BICA 3DXNA 4XHKB 4CFFA 3LQ3A 2WKMA 1Y57A 5IUHA 1YXVA 4U3YA 3A99A 5BVOA 3Q04A 4FV8A 3P08A 2GMXA 5IG1A 2P0CA 4WP2A 3EFLA 4FK3A 4FKVA 5EQEA 3PG1A 1ZZ2A 1PMNA 5C27A 3IKAA 3FEGA 5JMSA 4GW8A 4C4IA 3CLYA 4TWCA 4BZOA 2ESMA 3HX4A 4FL3A 5DR6A 4E4XA 3ZEWA 1P3QQ 2PMNX 3H0ZA 5C4KA 3GLHE 1PXMA 2C69A 3R1SA 2UW3A 3GQLA 3EN5A 4RC4A 4ITIA 3EB0A 3SG8A 3JPVA 2VWWA 4FT3A 3UOKA 4F64A 5DA3A 3LXKA 4O27B 4S30A 5KO1A 1SZMA 3ORLA 1Y6BA 3LLTA 3VUGA 3SD0A 3VF9A 2VWXA 3E93A 3VBVA 2JITA 4EK8A 3LCVB 4EZ7A 4MD9E 2QG5A 3CTJA 4OUCA 2V0DA 4FZDB 4XG8A 4C8BA 4FTNA 5HIDA 1XBBA 4D4YA 5L4QA 2OJFE 2VO3A 5D9HA 1OITA 2L4FA 2QLQA 1W7HA 5G1XA 4BC6A 3K5VA 1F4IA 4EWQA 5AP2A 4YZNA 3BYVA 2EKFA 4RJ6A 3U87A 3UVPA 4AZVA 3FC1X 3MPTA 3K9OA 3WI6A 1LR4A 2QR8A 3MW1A 3QRIA 4JIAA 5G6VA 4CV9A 4QNAA 4DH5A 1QPEA 3NNWA 2LVPC 2RG5A 2UZVA 5B2LA 4O7SA 3TCPA 4HJOA 3EFJA 1J7IA 1UU8A 5ETFA 3SAYA 3NVMB 5C26A 2ZV2A 1W83A 4GFMA 2XZSA 2YZLA 3BGPA 3VN9A 4ANOA 4FEQA 1VEGA 2YCSA 4KNBA 2WMQA 4WRGA 3R8VA 3MY5A 1UKIA 2X2MA 3EN6A 3PJ3A 3NX8A 2C6LA 2BVAA 3ERKA 4U42A 3VS6A 4EBVA 4O82A 2YIYA 2XKFA 4EYMA 3A8WA 3R28A 2R3LA 3D2IA 4PY1A 3KXHA 4I1ZA 3OY3A 4FNXA 2C68A 3MIYA 5DBXA 3ROCA 5J7BA 2C47A 3VBQA 3UZRA 5E8TA 5HORA 2R3MA 4WA9A 2VTSA 4IX4A 3W10A 2PYWA 2WMAA 4PF4A 4LRKA 4BRXA 3ORTA 4YPDA 3WF5A 4FG9A 1PW2A 4TYJA 4G6LA 3PE2A 2WTKC 4HYIA 4EEVA 5JRSA 3ATTA 4DCAA 3NSZA 1JKLA 2X6DA 2BKZA 2H8HA 2YHVA 4TW9A 4EH4A 2O0UA 4PDSA 2XF0A 1JQHA 3HUCA 4E1ZA 3Q4UA 2J0IA 2ZM1A 4OTFA 4I23A 4UMPA 3NUAA 2XCHA 4N6ZA 2F9GA 2OXXA 2PE2A 4FVRA 3QTWA 2PMLX 4GK4A 5C01A 1A48A 3GOPA 5EOLA 1AIPC 3HUBA 5HNGA 3ORZA 3FI3A 2WPAA 4AZWA 3PIYA 4AQCA 4F4PA 2XNPA 3WZUA 5KMKA 3MB7A 2OIQA 1WCCA 3BYSA 5DRDA 4IZ7A 5H8EA 2YM8A 5J9LA 2W5HA 3NUNA 2IWIA 5AR2A 3GFWA 2DAKA 3DQWA 2XS0A 4FX3A 4IDVA 5A4CA 3ULZA 2IVUA 4JJRA 4NYEA 1QCFA 3PXYA 1PMUA 4O7VA 3GC9A 5HTBA 2ZDUA 4WNPA 4BBEA 5CI6A 2UZBA 2UZWE 3RKBA 4APCA 4N4SA 2P3GX 5C4LA 1UFZA 3QQJA 2Z7QA 4FEUA 4EZ5A 3C4XA 4E8AA 5FBOA 3JR1A 2UVYA 3FMKA 3BPRA 4BFMA 3ZUUA 4EH2A 4EJ7A 4NIFA 1ZOHA 3FRHA 4RBLA 4IM0A 4FC0A 3HAVA 2ITYA 3PJ2A 4IANA 1IAJA 4CFNA 1CUKA 4MVFA 4QMNA 3UNKA 2C0TA 3O8UA 4BBMA 3SW4A 1HCKA 5FD2A 2REIA 4NKAA 4QP6A 3AC5A 1MUOA 2F7EE 5FP6A 2JY6B 5F95A 4R7IA 3QZGA 4YHJA 4YC3A 4Y46A 4DGGA 4UWCA 3ETAA 4FYNA 2UW6A 4TYIA 2F2CB 4R3PA 4FIGA 4EOJA 2XEZA 2UW9A 3TUBA 3HV6A 2F57A 4J8MA 4RGJA 5FEDA 1GO5A 5K0XA 3EIDA 3F7ZA 4F2LA 2VTIA 1YXSA 2GS2A 3MFSA 4JDHA 1WVYA 5AUXA 5CENA 3FPQA 4HVDA 1ZAOA 2JKQA 3MY0A 3TG1A 4G3DA 5CALA 1KE6A 2B9FA 2JD5A 4EOKA 4W9WA 4HYUA 2EWAA 1WBPA 3E87A 5ACKA 2O64A 2QOFA 4TY1A 3V3VA 5KKRB 2PUPA 2QC6A 4F99A 2X4ZA 4X6RA 4EK4A 1GIJA 1OUKA 4MXAA 2PVNA 3D94A 2C3LA 2VU3A 4AT4A 4FG8A 2OZAA 4II5A 4S32A 4BCFA 2I6LA 4FV5A 5C1QB 2PE0A 3AT2A 5DFPA 4C59A 4QMSA 4YLJA 4LV5A 5ANJA 4BDIA 1YWRA 4AT5A 1GNGA 4ZTLA 5A6NA 4GEWA 3SRVA 4X2KA 2PTKA 4KS8A 3FE3A 1OKYA 4I5MA 4F65A 4CKJA 4F0FA 4A9YA 2PHKA 3I0OA 4NFNA 3MVMA 3DK6A 4NUSA 3I81A 4N0SA 4UBAA 5GJGA 4EK3A 5HVYA 4OTWA 4Z9LA 4DFYA 3FLYA 3R8ZA 5CU0A 2GSFA 4PL4A 3R8MA 4KKHA 4F70A 2X8IA 2G1TA 3CKXA 3QC4A 3UOLA 4F1MA 1SNXA 4L44A 2WOTA 1LP4A 3II5A 3QUPA 4IEBA 3KXMA 3PY1A 3E46A 2Z60A 1DAYA 5BYZA 3ZRKA 1JPAA 3D4QA 3LJ1A 4K0YA 2VTOA 1YWNA 4C2VA 3TIYA 2VO6A 3QF9A 1SYKA 2HIWA 1Q24A 2JAMA 4IC8A 4F7JA 1JVPP 5LOHA 1JWHA 2BRHA 3QL8A 3QWKA 1NVSA 1P5EA 1Q4LA 4IW0A 2UZUE 2C6MA 4I21A 3VF8A 3K54A 5I3RA 3F5XA 3DA6A 3F82A 5HIEA 4HVHA 1ZXEA 2XRWA 5L6OA 4FZAB 3NYNA 2WQEA 5CI7A 4C4GA 2R3GA 2WMBA 3RMFA 3SC1A 4ACHA 5AUZA 2JZ1A 5AV4A 4G34A 4O96A 2MROB 5IH5A 4UMTA 3L8PA 1I09A 3GI3A 1Q41A 5HVKA 2YDKA 5EW3A 3S0OA 3R7IA 3FZ1A 4AFJA 4QTBA 4NK9A 2YITA 2GNIA 4LQMA 5AIRA 3PIXA 4O0UA 4PUZA 4FEXA 3FXXA 1Q97A 3PWYA 2JY7A 2XIKA 4U80A 2CN5A 2Q83A 3W2OA 4JOAA 2BAKA 5D7AA 5TT7A 1T46A 2UV2A 4OTQA 4MF0A 4UB7A 4MQ2A 5E4HA 2PK9A 2UZDA 3H30A 2EXCX 2IVTA 3EFKA 3KN5A 3RAKA 2VO7A 4RIYA 5JZJA 4EI4A 4RVTA 3MN3A 4X7QA 2QOCA 4FKSA 3AGLA 3ORKA 4IB0A 4O0XA 4TT7A 3CXWA 4YZCA 4LGHA 3OMVA 5HCZA 1WBSA 5M06A 1BYGA 2DI0A 1P4FA 3EQIA 4QO9A 4W9XA 5ANGA 3UMWA 4XG3A 2QO2A 2DAMA 2CMWA 3OBJA 2DAEA 4EOSA 4BTMA 2ETKA 3QQHA 3OW4A 3EQBA 4FT0A 3ROYA 3U51A 1RW8A 4RZVA 2QOBA 4USFA 3N51A 2XP2A 3FZRA 4TPTA 5B7VA 3D7TB 4UY9A 2V5QA 3BBZA 4AGDA 4G3CA 3DKCA 3UQGA 3OZ6A 4FSTA 5EYCA 4J98A 2ACXA 4YR8A 4WG3A 3RK7A 3ZMMA 4AS0A 3NYXA 2JY8A 2XH5A 4JX7A 4Q5EA 5HU9A 3UNZA 2JDRA 2PVMA 4ZY5A 5KCVA 3ZYAA 3UO6A 4AX8A 5KMIA 4A07A 4FTCA 2YA9A 3FBVA 2R3OA 2YDJA 4DEDA 2YIWA 1A06A 1Q8ZA 5FGKA 3UVRA 2QURA 4U9AA 1DO2A 2YLFA 3NUXA 4E5AX 4B9DA 4MNEB 4JG8A 3Q60A 3CPBA 3D5VA 2XNGA 4Y83A 5EYKA 1PXOA 3RBWA 4AW1A 3OUKA 4YC6A 5J1VA 2XIXA 5GZAA 1HT1E 2W9ZB 4YSJA 2JAVA 2C6EA 4LMNA 4Y85A 2BDJA 1CTPE 1P14A 4DEGA 2X9FA 4H05A 3F9NA 1H1PA 3PG3A 4D4SA 1JAMA 4I0SA 5HG7A 5GZ8A 2BHHA 3GXLA 2Q0NA 3OCGA 3EQDA 2KNZA 3H4JA 4IE9A 5M56A 5JGBA 3MA6A 1WBNA 3W2SA 4LRMA 4YZ9A 2R7IA 3VBYA 1OBGA 5GNKA 4L53A 3OCTA 4DFZE 2OJGA 4FSMA 1OKZA 3IK3A 2YABA 3R9OA 4HVIA 1IA8A 4DCEA 5LCKA 5A4LA 5CT7A 3W1FA 3VRYA 4EH6A 4Q7JA 3AMAA 5HOAA 1H28A 4F63A 4U44A 4LOPA 3RZBA 4FUXA 3U9NA 5CF8A 1OI9A 2PVLA 4BCOA 3MIAA 2BUJA 4F9BA 2W1FA 1YXUA 3ELJA 3JXWA 4RIYB 2C6OA 3A4PA 4ORKA 2VWZA 2BRGA 2BZIB 5HTIA 3EQGA 5AIKA 1OL5A 4O83A 4F6SA 2CP8A 3VUMA 2R5TA 1IG1A 3G2FA 2PUIA 4U8ZA 4ZIMA 2ZTCA 3EN9A 4YUQA 4NCTA 4YPSA 1R0EA 2P55A 1WAKA 1H24A 3BQRA 3GU8A 5CTPA 2AC5A 4C4EA 2OH0E 3POZA 1LEWA 3FLQA 4L00A 4B99A 3LFSA 4TKSA 4X2NA 3FZPA 4P5QA 4D1XA 2WTDA 3DKFA 4MEDA 4XOYA 2QOIA 2OOBA 1ERKA 5A46A 4WOVA 3TIZA 4A06A 3C5IA 2VX3A 2R0IA 1PXPA 3EWHA 2OI4X 4Y72A 2NP8A 5CEMA 5BVKA 5J5TA 3IW4A 3VBTA 5ITAA 4E4NA 3NUSA 2E9PA 3I0QA 3C0HA 4IQ6A 4LGDA 5CXZA 1LEZA 3BLHA 4OBOA 2W4KA 3ZRLA 3AOXA 4O7RA 4YTHA 4KB8A 2YISA 5CAQA 3ORIA 4QP7A 4FTKA 5AWMA 4IWPA 3W8LA 2JKKA 4OTHA 2WTIA 5K9IA 4AOIA 4PPAA 2H6DA 2X81A 3NRMA 1H01A 1NVRA 2J0KA 4FTQA 3WF6A 3WE4A 2L4EA 2E2BA 5DWRA 4XLVA 5HO8A 3RALA 5CVGA 3ZOSA 5I9ZA 1BVSA 3DAEA 4KIKB 3U8WA 2DWBA 3L9MA 1OECA 2GCDA 2LGCA 3LXNA 4P2KA 4J95A 1PMEA 3AC3A 3HA6A 3ZO4A 1KYIA 3C4CA 1YOLA 4I0RA 1XH5A 5IA0A 1DV0A 4XCUA 1EH4A 4PDPA 4ZSAA 3L1SA 4BKYA 4EYJA 1DI9A 1RQQA 3B2TA 3QC9A 3FZSA 4V05A 4FBXA 2R3KA 2O25A 3F3VA 2E9OA 2GNFA 3RVGA 2BAJA 2QU5A 3DBCA 4MD7E 4BYJA 5KMJA 1XH6A 3F88A 5CAPA 1JBPE 2CPKE 2PL0A 4I24A 3LW0A 1W98A 3EHAA 1QL6A 2GFSA 5IQEA 3AD5A 3EQHA 4HCUA 2WU6A 2ZM3A 1GY3A 2YACA 3FUPA 2WFYA 4BZNA 3QRKA 4QMTA 4Q2AA 2C3IB 3PP0A 2VWUA 2ZB1A 4M69A 4MAOA 3NPCA 4XX9A 5AM6A 1FOTA 3WE8A 5FTGA 3RCDA 1GIIA 1AD5A 3FMDA 3BHHA 2WD1A 5ACBC 4BYIA 3TNQB 2UW4A 4QMLA 4RIOA 4QP9A 5JGAA 5HX8A 1T45A 4GIIA 5EYDA 1HQYE 3VS0A 2GS6A 4DHFA 2BDWA 3WYYA 4CMTA 3PJCA 2XK8A 3V6RA 4A4OA 1WGNA 2O5KA 4MXOA 3Q96A 2YWPA 4XBRA 2A1AB 3JVRA 2H96A 5TF9A 2XIYA 2PULA 4OT5A 4DEEA 5B2KA 2IW6A 4F7SA 1KE7A 4D1ZA 2BZKB 5HO6A 2VRXA 4JR7A 4CD0A 4NSTA 4QNYA 4RC3A 5HESA 5DMZA 5L6PA 3ZTXA 3TNHA 3FKOA 3FYKX 3R73A 2Z7LA 5CSXA 3NUUA 1GZNA 3EKKA 5DNRA 3R8LA 3PIZA 4JT3A 5FXSA 5AUTA 3F2RA 1WIVA 3N9XA 4EOQA 2YM7A 1DO0A 4QP4A 4XYFA 2V7OA 1IEPA 1OM1A 5EOBA 3I6WA 3SXRA 3BV3A 5K5XA 1ZYDA 2QO7A 5HD4A 2BWBA 4I5CA 1CSNA 2YCQA 4FICA 1R78A 1KSWA 3IPHA 1WVWA 2QKWB 3HRCA 4K1BA 4TWOA 4F6WA 1T6OA 4IH8A 1OVEA 4IWQA 1WHCA 4ZSJA 3ENHA 2GTNA 5FM2A 2J0MB 2XK7A 4BDFA 5A4QA 2C0IA 4EH5A 4RJ5A 3T8OA 3NVKI 5J87A 4F7NA 2DKLA 3FSFA 4EUTA 1UNGA 5JT2A 1PKGA 1HCLA 2WMXA 1OBDA 3GC7A 2GFCA 4Z7HA 5K4IA 1SM2A 2CJMA 2GQGA 3LCDA 3QQKA 4G9RA 1AGWA 4NW5A 3C4WA 5DGZA 2DS1A 3QTSA 2WQNA 2XEYA 4W4VA 4D0WA 3DB6A 1JKKA 4TYHB 2YM3A 5IEXA 4RIXA 1TQIA 4H1MA 1M14A 4HPUE 1WBTA 5EK7A 5A3XA 2WQBA 3IW7A 2J0JA 3C51A 5CQWA 5EHLA 4EWHA 4BDKA 5KX8A 1O9UA 3H10A 3I7BA 4CCUA 4EH8A 3ORPA 5K5NA 5J7HA 4M69B 2DYLA 2HY0A 2DHYA 1GOLA 3G6GA 3PTGA 3R00A 5AMNA 3RPOA 4JQEA 4P5ZA 3LFNA 4QMZA 3G9LX 3QD2B 3R63A 3BV2A 3C1XA 4R5SA 2BILB 4U40A 3W55A 1V0BA 1MQBA 5AUUA 3U55A 4EKLA 3ITZA 1MRVA 2EVAA 5C8KA 3ULIA 2V62A 4AA4A 2HWOA 4FV1A 2Z02A 4QRCA 4ZLYA 5LJJA 1WBVA 3O7LD 4P90A 5H2UA 1YI4A 1KE5A 3SKCA 4MKCA 5J5SA 3TWJA 5HG9A 2X7OA 3P0MA 4B6LA 4G3GA 2QOLA 3DNDA 2R0UA 2LVNC 2JBPA 3DB8A 2OSCA 2W06A 4YO6A 1O6KA 5HBHA 3PJ8A 5EH0A 2YCFA 3VVHA 3F3TA 3T9TA 2YZAA 2GPHA 5JFVA 1REKA 4BHZA 2YAKA 1M7QA 3NW5A 2WTVA 4RLLA 5HCXA 3G15A 3PFQA 3MSSA 4UZHA 3DZQA 3EYGA 4R8QA 4M15A 3JVSA 4N57A 3WZDA 4FZ7A 1QZEA 3M11A 3PPKA 2ITNA 3OXZA 4EUUA 2NPQA 4MXZA 2R3QA 3SQQA 1NW1A 5CSHA 4UYNA 1H27A 3VBWA 3TM0A 4LRJA 1UU3A 2XYNA 4XRLA 2UUEA 3LFBA 5ANEA 3OOMA 3LKMA 4Z3VA 5IQCA 3IGGA 3LXLA 3E88A 2QOQA 4LI5A 4CKIA 3LAUA 5M07A 2BTSA 2WMSA 2EB2A 1E1VA 4C37A 1H07A 4CRLA 3BU6A 4CG9A 1QPCA 2X1NA 2OXYA 3QUDA 3Q9ZA 4TNBA 1ZZLA 2PWLA 2JNHA 4Y95A 5LMKC 3CCNA 1FQ1B 4O0TA 3EQPA 2LVOC 5HVJA 5J9YA 2CN8A 4HPTE 5DPVA 2EXEA 1WGLA 3I6UA 4AZFA 3FY0A 3LFEA 4CNHA 4RIXB 3CIKA 5KBQA 4FF8A 3ZC6A 3LHJA 3AGMA 3AXWA 4I5PA 2X2LA 3I4BA 4AA0A 3NWWA 3KULB 4J71A 3R83A 1OIYA 2QI8A 5FBNC 4HGTA 2VV9A 5E8ZA 4I92A 3V5QA 4I41A 4QQ5A 4ACCA 2YM5A 5L2WA 2WEVA 2RGPA 5EYMA 2WAJA 3GVUA 4HZRA 4GK3A 1K3AA 3LFDA 2UZTA 3O23A 1XXHE 1NT2A 2UW5A 4CFMA 4E3CA 3F3WA 4O38A 5LMBA 5BVFA 1XB2B 1U5QA 5DFLA 1VYWA 1CKIA 2WIPA 3F66A 3GENA 5IH6A 3KRLA 3BIZA 3ZM4A 4ALVA 1YVJA 4FKPA 2MJ5B 5BUJA 1IAHA 3ALNA 5HBJA 5AV0A 3ZZWA 2YIXA 5CYIA 4WUNA 4BCHA 5FDPA 5HTCA 3COIA 4BIBA 3H9OA 3TUCA 4DTAA 4ZS4A 2YFXA 4B8MA 3FI8A 1G41A 3NAYA 3BX5A 3TUDA 4K33A 2B4SB 4CYIA 4YZDA 3L8SA 4FV0A 4XV3A 1Q3WA 1FVRA 1ZYSA 3O2MA 4X3FA 4O86A 2CGXA 3EFWA 3QXPA 4FTMA 5JZNA 2RIOA 1FMKA 3DKOA 3EN7A 3NCZA 2XK3A 3FAAA 3P7AA 3PSBA 1ZWSA 3QQFA 4M14A 5JQ5A 4PNKA 3HECA 2XKCA 3R7YA 1SVEA 2Q0BA 3M42A 4IAYA 3IHPA 4U97A 4QD6A 5CF4A 5HZNA 2QU6A 2XJ2A 3PXRA 2ITOA 1E94E 4IIRA 1V0PA 4RJ8A 5AP1A 4D2WA 3EKNA 3UPXA 4FVPA 4QMWA 4WRSA 3DY7A 4GS6A 4X2FA 3UE4A 3AD6A 2XK9A 5DEWA 1G8AA 2HZNA 3NIZA 3ZCLA 2NNWB 4O22A 2PVHA 4FGBA 1B39A 3QRTA 4U81A 2W4JA 4UXLA 5BNJA 2WMRA 1PXKA 4MYGA 2HYYA 3IO7A 5HIBA 3ZSHA 3JUHA 3A7IA 3TEIA 3CEKA 2OWBA 5D7VA 4A4XA 2W5AA 4TZRA 4C2WA 4DG3E 2R3HA 4OAVB 3NMUF 2W1EA 3IW5A 3Q6WA 4FIJA 2G3QA 4K6ZA 4DFLA 5E8YA 2PVJA 4DGMA 2JBOA 4ZTHA 3BWJA 4G31A 4KIOA 2XCKA 4AZTA 2O3PA 3NR9A 1APME 4C36A 2A19B 4BIEA 4IAKA 1OKSA 1HJPA 5E7RA 2UZNA 4RIWA 4F0GA 3G0EA 1GAGA 2H5XA 5AR8A 5CAUA 5I0BA 2CKQA 4UX9A 3DXPA 1VR2A 4BWXA 3QTUA 3QTQA 4FR4A 4BDHA 3A4OX 1V0OA 3VJOA 4Y5QA 4Z16A 5BYLA 3CGFA 2CGWA 1UA2A 5JI2E 3ZS5A 3HV7A 3QHWA 4G1WA 2W7XA 4FKTA 4F7LA 1CM8A 3D7ZA 3KK8A 5LVMA 3DZOA 4UYAA 4OTPA 3A60A 2VWVA 4U3ZA 4W4YA 3G5DA 2F4JA 5DIAA 1VYZA 5AJQA 4BBFA 1V92A 3M2WA 5H8BA 4ACMA 5IU2A 5IQDA 4P4CA 3L8VA 1DI8A 5E8SA 1R4GA 3HGKA 5FG8A 4C3FA 4M68A 3F5GA 3KFAA 3D0EA 4XP3A 2ITUA 4A9RA 4BTJA 4EOLA 3ZSGA 2WIHA 4I0TA 3TV6A 5BVNA 4FKIA 3BWFA 2WELA 2XMYA 2BFXA 3LOKA 4JDIA 2OJJA 2X0GA 3PLAE 1XKKA 1Q62A 1PMVA 2OF4A 3QCQA 4X3FB 3RNYA 4EL9A 1ZYLA 4IJPA 4MH7A 3CBLA 1VEBA 3OY1A 4IC7A 1PHKA 4ZMFA 5BUEA 1VZOA 1GIHA 3DJ5A 4R6VA 3LM5A 1QPDA 1KOAA 3ZLYA 3ID6C 2C0OA 3LFQA 4FNYA 2Z7RA 3F2AA 3FL5A 5EG3A 5KHXA 2FO0A 3LFCA 3PP1A 5IQAA 4FT5A 1YI6A 2BMCA 2KTYA 3EL7A 4IBMA 4A9UA 1HT2E 5LVLA 4V04A 1YDRE 5JEBA 2QOKA 3EJ1A 5FEEA 5AX3A 4UWBA 3AC1A 5DVRA 3F3UA 1ATPE 4M0ZA 4MXYA 4F9CA 5HLWA 3QZHA 5HNBA 4YJRA 4L9IA 4AN9A 5BX0A 3V01A 3UQFA 2ERZE 4FTAA 5CX9A 4JBPA 1GZOA 2RSVA 2GU8A 4RX5A 4QMUA 1YW2A 4O84A 4B4LA 1R0PA 2ZV7A 5CVFA 1Y91A 3BHVA 3RPVA 2UZOA 3DLZA 5BVDA 4O0YA 2EB3A 3F5PA 3TZ7A 3BCEA 3NGAA 4KUJA 2HOGA 2Z7SA 4UV0A 4EH7A 2OLCA 4C7TA 5K4JA 4USDA 3QBNA 4CMOA 5E8VA 5E1SA 4FKLA 4B8LA 3GOKA 3WF8A 4LYNA 1REJA 3QQGA 1K2PA 4P7EA 3R04A 3G33A 4ZSEA 3NNVA 5IEYA 1ZMVA 3D83A 3NAXA 2YCRA 3BU3A 3R7UA 4L01A 2QOOA 5JKGA 1VEKA 3RPYA 1IA9A 5M09A 1FINA 4KIQA 4XJ0A 4J53A 4G17A 3K3IA 1JSTA 3NIEA 5J8IA 4QMVA 5HG5A 4TWPA 2J50A 3RM7A 4HCTA 4ANBA 4BDGA 4KSQA 2VTRA 3LM0A 4ERKA 5DG5A 1G3IA 4RVKA 3LQ5A 3BE9A 3FMMA 4C61A 1PYXA 2GTMA 3PJ1A 4QMXA 3RCJA 3ODYX 3EQCA 4L67A 3Q9XA 3BEAA 4U41A 3R9NA 3VUKA 4BTFA 4L68A 4XV1A 3UIMA 3LFFA 1BL6A 4NM7A 4XNEA 2DUVA 1UNHA 3PXFA 3QKLA 4JQ8A 3K2LA 3R30A 2VWIA 4CGAA 5IQIA 1FPUA 1F5QA 3GC8A 4IVCA 3FRIA 3VRZA 2RFSA 3Q5ZA 4K11A 3BE2A 4HVSA 3NCGA 4PL3A 4U79A 1YDTE 1FBNA 4FGRA 5DR9A 2QCSA 2B3TA 5EKOA 4RFMA 5JH6A 3RZFA 5IF1A 3TACA 4RJ7A 5J79A 2VZ6A 2XJ1A 4GKHA 4ERWA 4DBGB 2JIIA 4QOXA 3UOHA 4XP2A 4BDJA 4NIFB 5T6KA 1J1CA 5BUIA 5IQGA 4O0SA 4YSMA 2IN6A 2XA4A 3A62A 4S31A 3HEGA 1ZYCA 4FSZA 2ZAZA 3GU7A 4XV9A 5K3YA 4ZEGA 3DQXA 4NWMA 4S34A 3R6XA 2XM8A 4KRDA 4PMMA 4D2TA 3O51A 4PTGA 4E7WA 3LMHA 4O7LA 4FV9A 3O17A 4EK5A 3DDQA 4U0IA 4AG8A 1JR3E 4ZK5A 4O7TA 4FIIA 3FMLA 3BYOA 5ETIA 1Y8YA 5EM6A 3IONA 4ANSA 5M53A 2CKPA 2W1CA 4ANLA 4QP2A 1VEJA 3FZTA 3OEFX 4DH7A 1ND4A 2EUFB 4MBIA 3A7JA 4QP3A 1R39A 4V01A 2X4FA 4PX6A 2NRUA 4BKZA 3DK3A 1YXXA 2HWPA 4H58A 4GG7A 3E8DA 4M66A 2JDOA 4CYJA 3D14A 4MBJA 5GHVA 3V51A 4XS2A 4JVGA 3O71A 3PVBA 5AAFA 1PXNA 2WHBA 4E4MA 2WTKB 5E8WA 5J95A 2OOAA 4RX9A 4DITA 2ITXA 4BCKA 4BHNA 4BN1A 3T3VA 4O6LA 2OZAB 3U6JA 3IQ7A 2J6MA 3LCOA 1NVQA 3BBWA 2ZOQA 1J7UA 3TNIA 3PE1A 2C1AA 4V0GA 5CVHA 2ITWA 3FQHA 2YM6A 3V8WA 4CQEA 4CKRA 2YN8A 3GUBA 2JFMA 2NRYA 2WGJA 2J0LA 4RJ3A 3SRVB 3RINA 5A14A 3HDMA 5F1ZA 3T9IA 4GUEA 4CLJA 1WVXA 4FODA 3HL7A 4GVJA 3ZZEA 2O65A 1SMHA 5GJDA 2BKKA 5L8JA 3R7GA 3A61A 3MV5A 3JS2A 4RX7A 1BMKA 3FYJX 4M8TA 2BRNA 4PMTA 3ZO1A 4HNFA 4YGAA 4AE6A 2CKOA 4L42A 4YJOA 3ZRMA 2B55A 1YDSE 5HX6A 2X8EA 4FKQA 4QMPA 1YKRA 5IZFA 5JRQA 2EXMA 4ZLZA 4F09A 2RRUA 1TQPA 1CKJA 2ETRA 4IB3A 3MVHA 5EDQA 3T3UA 3VHKA 5CU2A 3UGCA 4AWIA 4FKWA 4XMOA 2MR9A 5CSWA 4O2ZA 4K9YA 2Y4PA 3COMA 3NDMA 2JKMA 5DE2A 1G8SA 2C6IA 4DG0E 4DC2A 2GHLA 3UJGA
chains in the Genus database with same CATH superfamily
5CQUA 4N6YA 4MF1A 4O1PA 2ONLC 2PVFA 5M4FA 1G5SA 2XZUA 2VTTA 2IVVA 4DEBA 4X64M 2ZVAA 4IHPA 4NTSA 2FOIC 3LMIA 4UN2B 3UZTA 3HMMA 3VW8A 4RJ4A 5FDXA 5I9VA 3COKA 1K9AA 2JY5A 4G3OA 3QYBA 4V0GB 3QYZA 4BDDA 5JN2A 3R9RA 3AKLA 5HHWA 2ERCA 5ANOA 5ITRA 4D58A 5JK3A 3TZ8A 1N78A 4GJ3A 5IA3A 2JP7A 2EUCA 5A54A 2BRMA 5E8XA 2K0BX 4AI6A 3B7ZA 4NEUA 3ANRA 2YDIA 4B7TA 2G5GX 1XH7A 4D81A 2DAIA 3TNWA 3OBGA 5ICPA 3UODA 4FV6A 4O0WA 1Q8WA 5I9YA 5TO8A 2UW8A 3UK6A 3KL8A 2YJRA 2VNYA 1G8JA 4RWKA 4EORA 3CGOA 2YLEA 4ZTMA 4F1OA 3D8LA 3W68A 1U54A 2W17A 2IZTA 1QZMA 5JFSA 5F20A 5AUWA 2GNLA 2Y9QA 3Q53A 4DG2E 3IS5A 3U6QA 4I6FA 3QGWA 3TMOA 3HP5A 3TZ9A 5E92A 2UVZA 4ACDA 5BPVA 2D7EA 4UWYA 4KAOA 3BXWA 3UIUA 2C30A 3U6EA 4DTKA 3S00A 3AMYA 4IJEA 2BCJA 2RFDA 4CT2A 3HAMA 4YNOA 1H1RA 4D5HA 4O1OA 2KHHA 3PA5A 1QQWA 1Z5BA 2O2UA 4LJAA 1Y6AA 1Q8TA 3PY3A 4D9UA 4UMUA 4C62A 2C9CA 3IGOA 4LY6A 5DT4A 3CP9A 1ZMWA 3VS1A 2L09A 2W1IA 5E9EA 1EFUB 3F5UA 1OGUA 1SNUA 1H6UA 3SARA 1FMOE 2YM4A 2XBJA 2PUUA 4Z7GA 4CMUA 4IX3A 5EM8A 3I01M 2AYPA 3FMHA 4OBQA 3PUPA 3KVWA 1AUAA 3A7FA 3NUPA 3VUTA 1Y8GA 4IB5A 3O50A 2LTUA 2ZMCA 2WMWA 4JX3A 3KOXE 5AP6A 3P7CA 3KDSE 2A5YB 2FYSA 5AV2A 4BB4A 2GNGA 2QR7A 3DNEA 5LWMA 4GEOA 5TOZA 2W1HA 5DRBA 2W82A 3AKJA 3QX2A 3ZONA 2JDSA 4GU9A 4DT9A 4K2RA 2X9EA 2I1MA 3KSJA 4GT3A 5KMMA 1GVNA 1J3HA 2QD9A 4DGOA 3E7OA 2JIVA 2PZIA 2A0CX 2HCKA 3U54A 3IOKA 3A98B 3P4KA 4L16A 1Q3DA 3DKGA 2BZJA 4EBWA 2OBJA 4G4NA 2OO8X 3TN8A 1GZKA 2ITQA 5KKRC 5M55A 4DR1M 3EYHA 3HV5A 4ANMA 3GLGB 4YURA 2JKOA 4LL5A 4OTDA 1L3RE 2XK4A 2FS1A 4UEUA 4WSQA 4DEAA 5ITXA 2ZTDA 1J7LA 1YI3A 2A2AA 3MFTA 5HQ0A 4ZY4A 3SMPA 4O21A 4HW7A 4PDOA 5KBRA 2PMIA 2X2KA 4A9TA 5KUPA 4TWNA 1YOMA 3KXZA 4BI1A 5FLFA 2PPQA 4NL0A 2P2IA 3I4YA 5AR3A 4FSQA 3SOAA 4DLJA 2AQXA 4QEBA 3E8NA 1JNKA 4LFBM 4X0MA 3L9PA 4QPAA 5EDPA 4CT1A 4PL5A 5JI3E 4XEYA 4XRJA 2OFUA 3KN6A 3LMGA 4YHFA 4GT5A 4OT6A 5E8UA 3A45A 2UXBM 3D5WA 4QP1A 5FXRA 3R02A 4FV3A 2VTQA 3FXWA 4IFCA 3GQIA 5KHWA 3KP0E 4CCBA 1Z5AA 5JQ8A 5M4UA 3OXIA 1Q3CA 4AU8A 2G2FA 2JDTA 3HJ8A 5ANDA 2V1CA 3O8TA 3Q4TA 4O7WA 2IW8A 1H1SA 4U7ZA 4YBJA 3RHKA 2GQRA 3KK9A 3QALE 1K3XA 4GRIA 2J90A 4ZP5A 5AUYA 4CG8A 5I9XA 2VO0A 5KO3A 4BCNA 1G4AE 4DGLC 1KFVA 4WSYA 1P4OA 2OQ4A 2JIUA 4ALWA 3A8XA 2Y8OA 3CC6A 3CQWA 4NM3A 3DDPA 4ZTQA 2RFEA 2B9JA 2KRUA 2FUMA 4Y8DA 2RGHA 3CE3A 4NSRA 2X7FA 3KKVA 3BHYA 3KREA 2OW3A 3HMNA 5FWKK 5CALA 2PVYA 3U5ZB 4RF0A 2C5XA 4BCIA 4W4XA 2IZUA 5IMXA 4E6QA 2J4ZA 4C4JA 3KVXA 4I4EA 2J5FA 1ZY5A 3ZLXA 2V55A 4QPSA 3R8UA 4QTCA 1VDLA 4E6CA 5EW9A 4RF1A 4ZJVA 1Z5CA 3OCBA 5AP7A 3KXXA 4W8DA 3D5UA 3ACJA 3GCPA 4KHPM 4WBBB 3FV8A 5CF5A 3HV3A 4YJTA 5CU3A 3QFVA 4IM2A 5EHOA 5LVPA 3UMXA 4L52A 4CTCA 1TTEA 5I5ZA 3TJDA 4ZPXA 3U6HA 4GT4A 5K0KA 3BU5A 4O0VA 2ZMDA 2R3PA 2WTWA 4S12A 3C7QA 2OGVA 5KMNA 3FI2A 2KA6B 3BLRA 3R01A 2XBAA 1KV1A 1V34A 4MTAA 3HHWA 1J09A 3E7VA 3EN4A 4YLKA 2DWMA 3DFAA 3DAJA 1UV5A 2VF8A 4BDBA 4APPA 4OTIA 2ZYBA 2LVAA 3MS9A 3QCSA 4X21A 4E93A 1H25A 4B7HA 1RDQE 4BJJB 4M84A 3GCQA 1JSUA 3VJNA 1WMKA 1TVOA 3AD4A 5KZIA 2QSFX 4R1VA 2C6TA 2G9XA 2CCIA 4RQKA 4E6AA 3KRXA 2CWBA 4AW2A 2W0JA 2OJ9A 3KMMA 4JXFA 2E9UA 1R7RA 1CDKA 2O63A 3AT3A 3MVLA 2J9MA 3QQUA 2J5EA 4DF3A 3HX3A 1KE9A 1ZLTA 2F5PA 2ITTA 1MP8A 1UU7A 3VAPA 4B0GA 2BAQA 3IW8A 3GGFA 3O7LB 4DFXE 1QDTA 4I6QA 4IZ5A 2NYAA 5FXQA 5M57A 3RP9A 4M3QA 2RF9A 3BGQA 2FSLX 4YBKA 5HLNA 3W2RA 5FTOA 1WXQA 1P2AA 5C1BA 4K8AA 2XJ0A 4ZSLA 1U46A 4MH0E 1BL7A 1J91A 4HGLA 3W18A 4KA3A 1OPKA 1UWJA 2P4IA 3A7GA 3OFMA 5EW8A 3P1AA 3PVGA 4PP7A 5JFXA 1OFIA 2WTJA 3T6PA 2JZ0A 2VDBB 4DTBA 4FTUA 1TQMA 4I6BA 3P7BA 5EQPA 3D2KA 3W33A 2B53A 3DCVA 3R21A 4IVAA 1MU5A 1NA7A 4ZS0A 4OX9M 3PXQA 3PLSA 3BLQA 5AEPA 4CXAA 1JB0F 5AADA 2X0QA 1Q02A 3OHTA 5FTQA 4S33A 3R1QA 3HGIA 4I4LA 2R7BA 1R5LA 3HZTA 4JLCA 4EH9A 5H9BA 4ZLOA 5DH3A 5EI8A 1U54B 3FHIA 2PZRA 1WJ7A 3TKUA 2Z8CA 2I0HA 4HZSA 3F3ZA 1TZDA 3AOEA 3CKWA 4HYHA 1NNUC 3RPSA 4ITHA 4PP9A 1WZYA 3I5ZA 4EOMA 4EHGA 4QTAA 3RPRA 4QYHA 5GZ9A 4D2VA 5T3QA 3DFZA 1JQJC 2ZJWA 2F4VM 3HA8A 4B08A 4DGNA 4RSSA 1XBAA 4KBKA 4J97A 3RAHA 2R9SA 4MUQA 3JY9A 3VS7A 4FSRA 4RZWA 1OQYA 2I0EA 4TL0A 3MWUA 3GU4A 3I04M 2ZM4A 1U4DA 3C50A 4FL2A 3G6HA 1L2CA 4FZFB 4KIPA 4LZJA 5L6WL 5A6OA 4O0RA 3BELA 2XIZA 4BICA 3DXNA 4XHKB 3LQ3A 5IUHA 4LV7A 1PMNA 5C27A 3IKAA 5JMSA 4GW8A 4FL3A 4R7GA 2PMNX 3H0ZA 4LJ7A 1PXMA 1N34M 4FT3A 3H4MA 3ORLA 3VUGA 2JITA 3CTJA 4C8BA 4FTNA 2VO3A 1OITA 2L4FA 3K5VA 3BYVA 4RJ6A 1PJSA 3FC1X 3MPTA 5G6VA 3TCPA 1UU8A 1MX0A 1W83A 2YZLA 3VN9A 1IBKM 2WMQA 3PJ3A 2QENA 2BVAA 3ERKA 3KOZE 4EYMA 3R28A 4PY1A 4I1ZA 3OY3A 2C68A 3ORTA 4YPDA 4TYJA 3PE2A 4HYIA 3NSZA 2BKZA 4TW9A 2J0IA 4G4RA 4OTFA 2XCHA 4N6ZA 2F9GA 1A48A 5C01A 1VLRA 1AIPC 1ST4A 2WPAA 4AZWA 2OIQA 5J9LA 2W5HA 3GFWA 3DQWA 5IREB 5A4CA 4O7VA 2ZDUA 2UZBA 1UFZA 4FEUA 3FMKA 3U60B 3HAVA 4IANA 4CFNA 4QMNA 3O8UA 3U6DA 4BBMA 3SW4A 4JYAM 2REIA 4QP6A 2F7EE 2JY6B 5F95A 3QZGA 4FWGA 3ETAA 4FIGA 2XEZA 2UW9A 3TUBA 2F57A 3F7ZA 3AJIB 2VTIA 4JDHA 1ZAOA 2JKQA 3TG1A 2B9FA 5ACKA 2O64A 2PUPA 2PVNA 2C3LA 4S32A 2I6LA 4FV5A 2PE0A 5DFPA 4QMSA 4BDIA 4B3TM 1GNGA 4X2KA 2PTKA 4F65A 1OKYA 4I5MA 4CKJA 2UUCM 3I0OA 3L27A 3DK6A 4NUSA 4N0SA 2KRKA 5HVYA 4OTWA 4Z9LA 3I4VA 4DR2M 4DFYA 5CU0A 4PL4A 4KKHA 4L44A 3II5A 3KXMA 3CTWB 3LJ1A 1SYKA 4AG6A 4IC8A 1JVPP 2BRHA 3F5XA 3DA6A 2WQEA 5AUZA 5AV4A 3GI3A 3S0OA 3R7IA 4QTBA 4NK9A 3PIXA 4O0UA 3LQRA 4U80A 2Q83A 4JOAA 2BAKA 4OTQA 4UB7A 3H30A 2EXCX 2IVTA 3KN5A 5JZJA 4YZCA 1E9RA 2DI0A 4QO9A 5ANGA 3U51A 4RZVA 2XP2A 4TPTA 2V5QA 4G3CA 3UQGA 4FSTA 1L2BA 3NYXA 2XH5A 5HU9A 4ZY5A 3PFYA 4U9AA 3NUXA 2R46A 4JG8A 3Q60A 3D5VA 4AW1A 4YC6A 2W9ZB 4YSJA 2VF7A 4I0SA 2BHHA 3H4JA 5JGBA 2F5SA 3MA6A 3VBYA 3OCTA 4DFZE 3R9OA 4HVIA 1IA8A 5LCKA 5A4LA 3W1FA 4EH6A 3AMAA 4FUXA 2PVLA 4BCOA 3MIAA 2W1FA 3HHXA 3A4PA 3EQGA 4F6SA 1IG1A 3G2FA 4U8ZA 2QCUA 1R0EA 1W2FA 2P55A 1WAKA 1H24A 2AC5A 2CUZA 1LEWA 4TKSA 4D1XA 2QOIA 2OOBA 2UXCM 3VKGA 4A06A 3TIZA 2NP8A 3IW4A 5ITAA 4LGDA 3C0HA 1LEZA 3AOXA 4O7RA 2YISA 4OTHA 4AOIA 2H6DA 2X81A 3NRMA 1BVSA 3U8WA 2LGCA 3LXNA 3ZO4A 4I0RA 1XH5A 1ZQ9A 3L1SA 1DI9A 3B2TA 3QC9A 2CHGA 2R3KA 3F3VA 2GNFA 3DBCA 4MD7E 5KMJA 1XH6A 2Z4RA 3EHAA 1QL6A 1HNWM 3W0OA 5IQEA 4HCUA 1XXHA 2ZM3A 2WFYA 4BZNA 4QMTA 4Q2AA 1FOTA 3FMDA 2WD1A 4QMLA 5JGAA 5HX8A 5EYDA 2BDWA 2XK8A 2H96A 2XIYA 2PULA 4F7SA 2XARA 2BZKB 5IZ7D 5L6PA 5HESA 4FVMA 4EOQA 1DO0A 5FLXS 3I6WA 3SXRA 4I5CA 4DV4M 1KSWA 1E32A 4IWQA 2GTNA 5FM2A 5A4QA 4EH5A 5J87A 4F7NA 5JT2A 1PKGA 2WMXA 3GC7A 4Z7HA 2GQGA 3LCDA 4NW5A 5DGZA 2KZSA 4GKKM 3QTSA 2XEYA 4W4VA 4RIXA 1TQIA 4H1MA 5KPRA 4BDKA 4EH8A 3HJQA 3RPOA 3R00A 4QMZA 3G9LX 4U40A 3W55A 3U55A 2EVAA 4AA4A 2Z02A 1WBVA 3O7LD 4AKGA 4MKCA 3TWJA 4G3GA 2LVNC 4BBAA 3DB8A 5HBHA 2BJVA 3F3TA 8CATA 4IBDA 1REKA 5HCXA 4RLLA 1TH4A 5GKNA 4DV6M 2QBYB 4IBBA 1QZEA 1NO1A 4UYNA 5CSHA 3VBWA 1E9SA 2UUEA 4Z3VA 4LI5A 2EB2A 4CG9A 2X1NA 3Q9ZA 3CCNA 1FQ1B 4KT0F 5HVJA 2CN8A 4HPTE 3EIHA 3I6UA 4AZFA 3W67A 3LFEA 4CNHA 4AKIA 3J81S 3ZC6A 3LHJA 4AA0A 2QI8A 5FBNC 5E8ZA 4I41A 2LH0A 3O23A 5IH6A 3ZM4A 1YVJA 2MJ5B 4MGHA 4BIBA 3H9OA 2YFXA 2ZAOA 2B4SB 1ZYSA 5ITTA 2CEAA 3P7AA 3PSBA 3NCZA 3FAAA 1ZWSA 4IAYA 1N75A 4D2WA 5AP1A 4QMWA 2HZNA 1B39A 4U81A 1PXKA 4MYGA 3JUHA 3A7IA 3TEIA 3CEKA 5D7VA 4TZRA 4DG3E 4OAVB 4ZTHA 3BWJA 4KIOA 2A19B 5CAUA 2UZNA 2H5XA 2CE7A 3DXPA 4Y5QA 1G59A 3QHWA 4G1WA 4FKTA 4F7LA 5LVMA 3G5DA 5IQDA 1DI8A 4C3FA 1GJSA 4M68A 4XP3A 4BTJA 3ZSGA 2WELA 2BFXA 1Q62A 2OF4A 3QCQA 2Y20A 1ZYLA 4LF4M 4DR4M 3DJ5A 4R6VA 4MB7A 5EG3A 5KHXA 4DHJA 1NHGC 2KTYA 4V04A 1YDRE 5JEBA 2QOKA 3EJ1A 3QZHA 4D82A 4JBPA 1GZOA 4RX5A 2UZOA 4B8LA 1K2PA 3KOYE 4ZSEA 3NNVA 2QOOA 3B9PA 4D2SA 4ANBA 3GPPA 4KSQA 4LF5M 3TL4X 1PYXA 3GPXA 3Q9XA 4U41A 3UIMA 4IBIA 3LFFA 3R30A 3E4RA 3GC8A 4IVCA 3NCGA 4IIWA 5JH6A 2VZ6A 2MH8A 5BUIA 2XA4A 4XV9A 4ZEGA 3NFFB 4D2TA 4FV9A 3O17A 3DDQA 4ZK5A 2C99A 3U6LA 1Y8YA 4ANSA 3LMMA 4AW4A 1XMQM 2CKPA 2W1CA 2EUFB 4V01A 2X4FA 1YXXA 4H58A 4GG7A 2JDOA 3V51A 4XS2A 5AAFA 2WHBA 5E8WA 4RX9A 3U6JA 3IQ7A 1J7UA 3PE1A 2ITWA 2YM6A 5A14A 2WGJA 4IBJA 5F1ZA 1WVXA 3ZZEA 2O65A 5GJDA 2BKKA 4NL4H 2DZOB 4M9SA 1BMKA 4M8TA 4PMTA 4HNFA 4L42A 2X8EA 1YKRA 2JWSA 2EXMA 4F09A 3T3UA 5CU2A 3UGCA 4AWIA 3COMA 3U6SA 3NDMA 5BMMA 4AE9A 3GLIB 3HVCA 2L6OA 2HENA 4R7BA 5DNYA 4I94A 3W0LB 1B6CB 3QTRA 2VGOA 4JBOA 3BRBA 4EC8A 5BVEA 4YHHM 1UU9A 3NNUA 4NJDA 4R77A 4BL1A 1H00A 4L6QA 3Q4CA 4M0YA 1FGIA 2ZB0A 3UQCA 4X62M 5DYIA 5B2MA 3EQRA 2QP9X 2XKDA 3PNYA 4CTBA 5M4IA 2JA2A 1BUHA 4YZBA 3SGCA 2OIBA 5DHJA 4XLIA 4D55A 2OF2A 4U43A 5D10A 3U9CA 3HMOA 1Q8UA 4LJ5A 1S9JA 3B7QA 5J1WA 2VNWA 1OL2A 4L78A 4HEOA 2HHHM 4BTKA 4QMMA 2R65A 4WUAA 3UIBA 4LJ6A 2B7AA 2OICA 5GIOE 1YOJA 3FHRA 2L7HA 3WF7A 3CF0A 1JKSA 4WG5A 4FG7A 5HICA 4KSPA 3IDBA 2W4OA 3SYLA 3OW3A 4J1RA 3ZO3A 2EKKA 5C18A 3R9DA 3LE6A 3ZEPA 4AGWA 4AF3A 5DEYA 3QLFA 3UPZA 2X49A 2HY81 5ITYA 2F7ZE 1GJOA 5EHYA 1YXTA 4MGZE 3A2CA 3G51A 2VQFM 1OB3A 4KD1A 3WILA 4YP8A 2CNQA 2OFVA 2VX1A 2FSTX 2UU9M 1XH8A 5F94A 1SVGA 3PXZA 4KBCA 2UUAM 2YIRA 4G5PA 2JC6A 3K3JA 2B54A 5IQBA 3SAVA 4NKSA 2H1RA 2XNEA 1NJFA 2VX0A 4L15A 4FMQA 3VULA 1DAWA 4FK6A 3OWKA 3KXNA 2X4AA 3WZJA 4LUDA 2C3JA 1WR1B 4ZOGA 2W1ZA 5LCJA 3FPMA 4M12A 4QYYA 3I7CA 1DGBA 2C9OA 4AXFA 3LCSA 3MGYA 3BLAA 4OGRA 3J7BA 3PUFC 3OG7A 3QZFA 1NV8A 1U5RA 5AP5A 3FKEA 4UMQA 4O81A 2B1PA 5IT9S 4ZTSA 4XUFA 3ZBXA 4UN0C 3LW5F 3FWQA 2XKEA 1SXJB 1UKHA 3LJ2A 2BZHB 4JI8M 2CNVA 5GINE 4KKGA 3GU5A 2BROA 3EZVA 3QHRA 3LPBA 4AW0A 5JSMA 3DBEA 2C6DA 2ZANA 3ZXZA 4KS7A 5J9ZA 3EH9A 1ZYJA 2DWNA 3AT4A 1J7KA 5A4TA 4YTIA 4EONA 5BMSA 3EQFA 1IN5A 1IY2A 3E3PA 2H34A 5EP4A 1A9UA 5I3OA 4RVLA 3REPA 3GLFB 4GK2A 3OUNB 2XH9A 3DBDA 3BL9A 2XANA 1NY3A 3UO5A 3FZOA 2WQOA 5HE2A 3R7EA 3QU0A 2EJSA 2FB8A 4TN6A 4RG0A 4Z55A 2XIRA 3TJCA 1XMLA 2R44A 4PMSA 3VO3A 2HCBA 3MH3A 2C6KA 5LMKA 1G8PA 2EU9A 1OIUA 3BQCA 5ITUA 5FQDC 4LJ9A 3KXEC 4TRLA 5IKWA 4C35A 3TT0A 3Q9WA 3KF7A 1M7NA 5CAVA 4Q5HA 3VS4A 1M2RA 1Z59A 3ANQA 3D9VA 4EQMA 1YRPA 4HOKA 3PZHA 3O8PA 2FVDA 1SG9A 2QODA 1MQ4A 4S2ZA 5BV3A 4O4EA 3OROA 1QUTA 2WQMA 3C13A 4PWNA 4RPVA 1AQ1A 4PMPA 4U6RA 4BKJA 1R1WA 3MY1A 4AACA 5CNOA 4FKRA 2R62A 3P86A 1TF0B 5TE0A 3QCYA 4YTFA 2CSNA 4QYFA 1H26A 3V8TA 1XJDA 4QMOA 5IDNA 4OLIA 4LGGA 3GLGE 2IZRA 1XWSA 2OXDA 3GFEA 3MI9A 2X0PA 5F9EA 4CFWA 1KUTA 5DOSA 3W16A 2GS7A 4ZJJA 4O7YA 5HLPA 2I7QA 4UMRA 3CF2A 2YERA 4JRNA 3QRJA 3SC3A 1IY0A 3QA8A 3SV0A 3GEQA 2PE1A 4FW9A 3LZBA 2VAGA 3QCXA 5AFVA 5DT3A 4GG5A 5AV3A 3W0RA 2VTMA 3T1YM 5HGIA 4Y5HA 5C8NA 4QDEA 3R9HA 3QWLA 1GLNA 1W2DA 1QVRA 2C5NA 4O91A 3H3CA 1OMWA 2GDOA 3FMJA 4OR5A 3HDNA 3ZDUA 3SASA 2IF8A 1STCE 4GFOA 4DFBA 2OG8A 4KINA 2AHMA 4YC8A 3JR4A 2QONA 2P33A 4OVZB 5HCYA 1S9IA 1PKDA 4FKUA 2OIDA 4FKOA 4DR5M 2XNBA 3O0GA 5IISA 2QOHA 4DA5A 3WBLA 5D12A 2OK1A 2OO9A 3V04A 5BVWA 5C03A 1MRUA 3FDNA 4IJ9A 4E26A 4L8MA 4ZJIA 3LQ8A 2BJWA 3WIKA 3AQVA 3VBXA 4PRJA 5AP3A 4QT1A 1JR3D 3PPJA 2VTPA 2VUWA 1OIPA 1QAQA 2RL5A 3OTVA 4X3JA 4LG4A 4X2JA 2BIKB 4DAWA 4OW8A 4IAAA 1NY5A 2DWZB 2FH0A 2HAKA 4FV4A 4PDYA 4JG6A 2F49A 1TH3A 4IX5A 1ZY4A 3SAWA 3ODZX 3TNPC 4BF2A 2DENA 3K9PA 4ITJA 2Z3XA 3CQEA 1I4WA 4OTGA 4L45A 1ZOEA 3UC4A 5HD7A 3TTIA 3U4UA 2I40A 4KIKA 4WKQA 2PY3A 1RE8A 2LNHC 5GJFA 3N4UA 4NJ3A 2K9DA 3S3IA 1W5TA 1OPJA 2O8YA 1XBCA 4IBEA 2Y0TA 5HE0A 2PZ5A 1YUBA 2I0VA 3DK7A 2VD5A 3QD4A 3ZM9A 2VTJA 1XH9A 3LCKA 2CGUA 2B9HA 2LVQD 5BR8M 1NV9A 2B9IA 5EM7A 5M4CA 1OPLA 1YQJA 2C5YA 5KNJA 2ONLA 3QLGA 3FLSA 2FSOX 2WOUA 2UZLA 4HGSA 1J1BA 4D0XA 3BHUA 1Z9XA 3UBDA 3QUEA 4JG7A 3PA4A 3SG9A 3HZJA 2AC3A 3OF0A 4C38A 3DTWA 3DGKA 1OUYA 4AZSA 5CT0A 1W8CA 5FP5A 4FKJA 3VS3A 4AN3A 4NM0A 4D2PA 4WG4A 5D1JA 4EQUA 2GHMA 4BDCA 3FMNA 1IN4A 3DZDA 4RKUF 3Q32A 4DINA 3DXQA 5H8GA 4WNKA 1EE8A 3THGA 2Y7JA 1W84A 5E1EA 2OPFA 2OJIA 1W0XC 3L2AA 1VJYA 3I1AA 1KV2A 3TKHA 4PTEA 5A9UA 1XNQM 4JI4M 1PRYA 3MH0A 3ZXTA 1H1WA 1PY5A 4YLLA 2C3KA 3VS2A 3UG1A 4USEA 4DBNA 3IG7A 3SXFA 4GC5A 3P9JA 4ZXTA 4GL9A 4JL9A 4AZEA 4XK8F 3Q6UA 4FNWA 3UGJA 4I93A 2QPAA 4XBOA 3S2PA 4D4RA 3MPAA 5IH4A 3ALOA 4AOJA 1VQ1A 3AOGA 4MXCA 5E91A 3TL8A 4AXAA 2W5BA 5IUGA 4IAFA 2WNTA 3ZBFA 4JBVA 4F0IA 3WHLA 3P5KA 2JXNA 3TDVA 5M08A 1N36M 4IADA 1IRKA 1URCA 2PMOX 4HNIA 4XG2A 5BYYA 1GJTA 3O96A 3L29A 3DTCA 1BKXA 5AR5A 4XG4A 3BHTA 3V5TA 4DFNA 3RK5A 3S1HA 2X8DA 4CFUA 1KOBA 2B52A 1G3NA 3PZEA 5L2SA 3KP1E 4CIZA 3BEGA 4QTDA 2Y4IC 4LDTA 1BX6A 4MBLA 4DR3M 4O7ZA 1ZRZA 4WHZA 2E9VA 4KO8A 4JAJA 4RVMA 2KNAA 1F3MC 2K6BA 3FD9A 1OKVA 2WKMA 3P08A 2GMXA 5IG1A 2P0CA 4FK3A 3PG1A 4TWCA 2ESMA 5DR6A 4E4XA 4ITIA 3JPVA 2VWWA 3UOKA 1SZMA 1SXJD 3SD0A 2VWXA 3VBVA 1XBBA 4D4YA 5L4QA 5D9HA 1W7HA 4EWQA 5AP2A 3UVPA 3K9OA 3WI6A 3VLFB 1LR4A 2UZVA 4HJOA 3EFJA 3SAYA 3BGPA 2DVWB 1UKIA 4O82A 3VDPA 2C6LA 2XKFA 3C9PA 4IJFA 3KXHA 4FNXA 5DBXA 3MIYA 3ROCA 5HORA 2R3MA 4DR6M 2VTSA 4IX4A