1ZMVA

Catalytic and ubiqutin-associated domains of mark2/par-1: k82r mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
313
structure length
293
Chain Sequence
GNYRLLKTIGKGAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 94
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmvA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmvA01
4RJ8A 4UMRA 3DV3A 3S4QA 3AC4A 3ZFMA 2XIZA 3LQ5A 4X0MA 4EONA 3R9DA 4A9RA 1PXLA 5IPJA 2JY6B 4FT5A 2W7XA 4TZRA 4ORKA 5DHJA 2ERKA 4JAIA 4CKIA 4Z3VA 3AMBA 4C61A 3WF7A 3CE3A 4EK8A 5CEKA 1CSNA 2YACA 2UW4A 3UOJA 2WO6A 4IZ7A 4WRGA 4AXAA 4YZBA 4X3FC 3WBLA 5EHLA 4IVBA 3QHRA 3MPMA 4NIFB 3SQQA 3Q6UA 2JKKA 1ZWSA 3CLYA 3TV6A 2RL5A 2CP8A 3TACA 3ZXZA 2C6OA 5CNNA 2I1MA 3PDTA 4XG4A 3LFBA 3FQHA 4BYIA 3V6RA 4PL3A 4LUDA 5EI8A 3RTPA 4NFMA 4JNWA 5C01A 5ITAA 2V62A 2DZLA 2I40A 2ZM4A 1FVVA 4FTTA 4U79A 3D7TA 4I6BA 5K0XA 4RWIA 2YEXA 2QG5A 2VRXA 3TKHA 5AR3A 2VO3A 3BLHA 3FKLA 3ZCLA 3SRVB 1G41A 3R04A 2XKCA 4FKGA 1S9IA 3B2TA 4XG9A 3AT2A 4YHTA 2JIIA 1O6KA 2BILB 3P78A 3QUEA 3GQIA 5E8VA 2OF2A 4N6YA 2WMQA 2ZAZA 4FG9A 5HHWA 4EBWA 3OCTA 3QX2A 2CN5A 2LTUA 2V22A 3L8PA 3GLIE 2R7BA 3OEZA 3OY3A 4U81A 4QTDA 3DK3A 3DFAA 3HMNA 3IW6A 2YM5A 3ORMA 4WKQA 4WP2A 2YDJA 4TY1A 5CLPA 4LG4A 3P7CA 5D10A 5AX3A 4C34A 5M4IA 3COKA 3NW5A 2HK5A 3KB7A 4UN2B 1NVRA 3AD5A 3AD6A 3ALNA 3QD3A 4WG5A 3K2LA 5HBEA 4AW2A 4L67A 5KMKA 5LXMA 4PTGA 4WBOA 3DQWA 4EL9A 2WTWA 3MPAA 5I9YA 1Z5MA 4JX7A 4NCTA 5E1EA 2W1EA 4FYNA 3U6JA 5HX8A 2F2CB 2VWIA 1H8FA 4MBJA 4UMPA 4NZWB 1KE7A 5FEQA 4E3CA 4BR3A 4E93A 3QWJA 3ENMA 3O71A 4OTQA 4BWKA 4DF3A 5M06A 2WMVA 4DBNA 2GCDA 4P7EA 2BTRA 1H1RA 2B9HA 3QRJA 4A07A 3D5WA 5K3YA 3AG9A 3MB7A 3F7WA 4HGEA 3NS9A 2I0EA 4J99A 3EIDA 3V5TA 1KYIA 2ZJWA 4H39A 4C4IA 3ZYAA 4JBQA 2GS7A 3ZUUA 3OOMA 1CKJA 3SOAA 2X4ZA 1JR3E 1WHCA 3FMKA 4K11A 4A9TA 4BB4A 3P9JA 3FHRA 3FJQE 4BCOA 3EN9A 3NR9A 2JY5A 1VYZA 3CP9A 1IRKA 4FZ7A 3A4OX 3R01A 4NEUA 5B2KA 3QXOA 3HP5A 1YWVA 2AUHA 4E6QA 5LQFA 3LKMA 1UNLA 5IEYA 3CTHA 4AGWA 4F0GA 3O23A 3GC9A 3MS9A 1FGIA 4HVIA 5HBJA 4EH5A 3ZZWA 4KB8A 2Q83A 1GIJA 3E62A 4LGHA 5DYJA 3DB8A 3H9FA 2C0TA 2W17A 1OAIA 3D94A 3RM6A 2C3IB 1E94E 2UZOA 2XJ1A 5JRSA 4W4WA 3VBXA 2PUIA 1BUHA 1R78A 3AMYA 3PA5A 4MCVA 3TL8A 4OTGA 2BKKA 2ITWA 3ZRLA 3UQCA 4O7YA 3UJGA 3LXLA 2F4JA 4GG5A 4H3PA 4F2LA 3OWJA 1BX6A 4RMZA 3HV7A 3P0MA 1NT2A 2ETRA 3IDBA 2BFXA 4KRCA 4PPBA 2ITQA 4YU2A 4V05A 3MDYA 5C8MA 3TNQB 4FV3A 3RPVA 3R22A 3ZLSA 4U3YA 4RVTA 5A4LA 4P5ZA 4XBUA 4GKHA 4A4OA 1H01A 3IW8A 4L3LA 2LAVA 3R73A 3NUPA 5AADA 3NIZA 4OR5A 5ANGA 4CMTA 1VYWA 4HGTA 4QP7A 2OZAA 5L8KA 2XK3A 4QP9A 5DNRA 2DYLA 3IOPA 3RAHA 4QRCA 4QMNA 4BIBA 3HDMA 5ANJA 3I4BA 4H3BA 3VJOA 2HOGA 1W7HA 3OZ6A 3FUPA 4W4YA 5EM8A 2YM7A 2C5YA 5IQDA 2W9FB 4C57A 4QYEA 5HIBA 4IB1A 4E4MA 2EU9A 3DBEA 4BF2A 1MRVA 1OPLA 2UZLA 2P2IA 4CTCA 4QQTA 4EYJA 4H58A 1P3QQ 1QPDA 2PVYA 2HZ4A 3GU5A 1BYGA 3CQUA 3W2SA 5J5SA 3FE3A 4F1OA 3JYAA 4ZY6A 4P2KA 4FK6A 5HTCA 1ZYDA 5AEPA 2O8YA 5HX6A 3RJCA 4XUFA 4ASDA 2QOLA 4C4GA 2HW7A 3HAVA 4CG9A 3MH1A 3FZ1A 3MJ1A 4EOIA 2JKQA 2QONA 3BHUA 3R2YA 1T46A 4B9DA 2C6MA 2O25A 1DI8A 5IA3A 5K9IA 2FH9A 1J1CA 2NPQA 2WXVA 4PV0A 2YHVA 3VHKA 1H1QA 4UV0A 3FZOA 4Y5HA 2FO0A 4IAAA 4M0ZA 2W06A 3NNXA 3TV7A 3KY2A 4YLLA 3KXHA 4BDDA 4O7WA 2VUWA 2YIQA 5GZAA 4G17A 2NNWB 4HCVA 4QPSA 1BI7A 4GSBA 4Y83A 3R6XA 1RE8A 3UG1A 4EOSA 4EHGA 3NAYA 4U9AA 3U4UA 4KBCA 4LGDA 1OMWA 4KSQA 4M97A 4CD0A 4D0XA 3IHPA 4AS0A 4C59A 3R8PA 1FINA 5HG7A 4FG7A 2UZUE 3LCUA 5KE0A 2B53A 3ZHPC 3FV8A 1IA9A 2OW3A 4JBPA 2W4KA 4FIHA 5DG5A 1RQQA 1Y6BA 4O91A 3D9VA 2G9XA 3OTVA 4F99A 4EQUA 5HNIX 2QVSE 4M69A 1GZ8A 1R3CA 4DN5A 3UNKA 5IDNA 4M7IA 2YIWA 3RCDA 4X2NA 5B2MA 1UU3A 1ZYSA 5CNOA 5TF9A 5GJGA 4F64A 4I0RA 5DFLA 4DH7A 1PF8A 2VTPA 2JFLA 2QCSA 2W1GA 2ERZE 5K5XA 5E8UA 4AFEA 1Y6AA 4RLKA 5DEYA 1R4GA 3KXMA 2VTSA 3GGFA 3LE6A 2YCQA 5CSXA 5I3RA 3QFVA 3BIZA 4F1TA 1DV0A 1XBAA 3BZ3A 3QCYA 4II5A 2OIBA 5AP1A 2R0IA 5CVFA 3WZDA 3R30A 1Y8GA 4D2PA 3PLSA 4E4LA 5I9XA 2BDFA 2OJFE 3UC4A 4YO6A 1GZNA 2X7FA 3NYXA 4EH8A 3DLZA 3G9LX 4XRJA 3F3VA 2PULA 2XK9A 1ZV1A 3CR0A 2YLFA 4J53A 4C0TA 3LQ8A 3SX9A 5G6VA 5TKDA 3B89A 3PE2A 5GHVA 2DENA 3WZKA 4FEXA 4JXFA 2NP8A 4U80A 4GYGA 4EI4A 1HCKA 3H10A 4H1MA 1IAJA 3NX8A 3BGQA 3QYZA 3VUMA 1F5QA 5M53A 4ID7A 2XNGA 4U7ZA 3SG9A 1AQ1A 2RIOA 2QLUA 2Y4PA 1E9HA 3PSDA 5GINE 4YC3A 2F9GA 1WAKA 4RJ7A 3BRBA 3BQRA 4C02A 4X3FB 4H36A 4GV1A 3FMEA 2IVSA 2P3GX 3HL7A 4FF8A 4LMNA 4AACA 2CCIA 3VS0A 2EUFB 1OIYA 3W8QA 1FOTA 4BWXA 1TQIA 3RBWA 1C7YA 4ZY5A 3SAYA 4UB7A 3RVGA 3ORLA 3ORKA 3FI4A 4ASXA 4GKIA 4R3PA 5FLFA 2WMAA 3JS2A 4Y95A 1Q99A 3F61A 4C8BA 3ORZA 1HJPA 4K77A 4FTAA 5LMAA 4EOPA 2WMXA 5EOLA 2ITUA 3UMWA 2R3LA 5FXSA 4YC6A 4FKWA 4IDVA 5JFSA 3VUKA 4U45A 3RAKA 1GNGA 5DI1A 3WI6A 3LCSA 5K0KA 4GS6A 1YXVA 5CAUA 4EHEA 4F6SA 4CKJA 4FI1A 2WPAA 3DXNA 3UIXA 1JQHA 3CXWA 5KZ0A 4F0IA 2GFCA 3B8QA 5DGZA 2HYYA 2R3OA 3FPMA 1F3MC 3FC1X 3F2NA 3MFRA 5IA2A 3SDJA 3ZBXA 4BDEA 2PE0A 2UW7A 1OI9A 4CYIA 3BELA 1YHVA 3IO7A 2UVYA 3PG1A 3AXWA 4S32A 4BI2A 4D2WA 1VEKA 2P0CA 2ITZA 4C35A 3PPJA 4I5HA 3RPYA 4XG8A 1YKRA 2WFYA 2B9JA 4AA4A 4RVMA 4UX9A 4MXOA 2E9PA 4IMYA 3TXOA 1QZEA 4LL0A 4F08A 1LEWA 1GOLA 2J0LA 3BCEA 3OUKA 5LCKA 1PXPA 5AUZA 2PE1A 4E73A 4NL0A 4KIOA 1YI4A 5K4JA 2QURA 4FTNA 5CXHA 2IWIA 1JAMA 3GT8A 3C4FA 4C37A 5I4NA 4CLIA 1OBDA 4RA4A 4PTCA 3OVVA 4DYMA 1CKIA 3S3IA 3IQ7A 4BCIA 4XOZA 3E46A 4BDFA 5BVFA 5KMOA 2DAKA 3UO4A 4FEVA 2YN8A 3PXQA 1ND4A 3E3BX 3VBVA 2YITA 4NT4A 3DJ7A 4Q2AA 2XBAA 3W2RA 2XNMA 2C6DA 2WQMA 1PXJA 2XNOA 2Y4IC 3KK9A 4FV1A 2C5NA 3AGLA 3KGAA 4J8MA 5B2LA 2WIHA 1A5TA 5CSHA 1GJOA 2K9DA 2VNYA 3F7ZA 4DITA 5A14A 4UXQA 5KMJA 5EQEA 2JLDA 2SRCA 1KV2A 2REIA 4O38A 1KUTA 4G9CA 2V5QA 4FSMA 4HPTE 3DB6A 4NJ3A 4ENYA 4NCTC 4WHZA 3ZU7A 3QQUA 3QQLA 4NU1A 3SG8A 4GU6A 4UWCA 2GU8A 1OQYA 2J0IA 3G90X 4J8NA 4MQ1A 2I0YA 4CMOA 4E6DA 5HEZA 2BHHA 5KHWA 4ZSLA 4GFOA 1XB2B 3OT3A 1Q8UA 2G3QA 3A7GA 4YBJA 2CSNA 2BRNA 5AUUA 2IG7A 4JQ8A 4S30A 3DFCB 5JFXA 4O82A 1Q24A 1TQMA 2OGVA 3QQGA 4GL9A 4WNKA 3RGFA 4O86A 2OXXA 3GNIB 5HD7A 2UZWE 4RX9A 5DR2A 2ZVAA 1JPAA 3L8VA 4IX3A 4RC2A 3CY3A 4XOYA 4AGUA 4EZ5A 4TL0A 4Z16A 4DGGA 3UTOA 2QOOA 2BIYA 3HZTA 3WE8A 5JGAA 3MMPA 3QCXA 4WT6A 1ZOGA 3A8XA 4FIIA 4RJ4A 4K2RA 1IFYA 3GLFE 4BWPA 3HV6A 3KF4A 4C2VA 3WARA 3H9RA 3LOKA 1WCCA 4M0YA 3ZEPA 2OOBA 3ORTA 4EC9A 2JDSA 3T8OA 2X7OA 2HWOA 3HX4A 4C4JA 3A2CA 3LLAA 1URCA 2RGPA 3ZSIA 4CCBA 5EHYA 2A2AA 3BYUA 2XKDA 4YHFA 2IN6A 3IDPA 4M66A 3NRMA 4NTSA 4CEGA 3Q2MA 1V92A 1ERKA 4OAUC 3C4CA 4M14A 4FV0A 5HNBA 4YUQA 1VDLA 3KXXA 5KHXA 2GNJA 1Q8YA 4QNYA 3DJ6A 4D4YA 5J7HA 4KA3A 4YBKA 4IZYA 3BKBA 3TV4A 3Q60A 3DPKA 2FGIA 2J2IB 5DT4A 3V5LA 3E7VA 5CSWA 4A4LA 1HOWA 3PE1A 3QHWA 3ZDUA 5D41A 4Z7HA 3BHHA 2GQSA 3GCQA 3JXWA 4PDSA 2A1AB 4GEOA 5J9ZA 2PL0A 2VZ6A 5G1XA 4LRMA 3LM5A 5IQFA 4FA2A 3K5VA 1R39A 2EWAA 2PUNA 4O7VA 1LR4A 3CJFA 1DAWA 4FZ6A 5AV1A 3LLTA 4YZDA 3E8CA 4NM5A 1QCFA 2G2HA 4F4PA 2OJ9A 3PIYA 2WMSA 4O0XA 3HV3A 4KIKA 4F1IA 3ZH8A 4BDIA 5IQAA 4TTHB 5KKRC 4GT3A 4F9YA 3KXGA 1RDQE 2PVFA 4JDHA 5CQWA 4NFNA 3VRZA 4CMUA 2CNUA 3H4JA 4PMTA 3ZM9A 3C50A 1XH4A 4R71A 4S33A 2XJ2A 2J9MA 5TR6A 4N0SA 3U87A 3E8EA 3DNEA 1QMZA 1YXTA 3FPQA 4Q9ZA 3QX4A 1OTRA 1S9JA 3QTZA 2A19B 2R3HA 4RT7A 4WO5A 2XNNA 4IE9A 1OPJA 5AUWA 1BVSA 1WVXA 3QALE 2KNZA 4QO9A 3TKUA 4OBOA 3R8ZA 1KE6A 3COMA 3D2KA 4O1PA 3FY0A 1YXSA 4WUNA 4AX8A 4O84A 1L8TA 5AIKA 2G15A 5BUIA 4DTKA 1JKLA 3EN4A 4ZAUA 3P7BA 3QLFA 1CKPA 5FDPA 4YSMA 4FKPA 4JG8A 4EZ3A 2YIRA 4WNPA 5L8LA 2VTTA 4JAJA 3S00A 4O7SA 3NAXA 5IMXA 2UZEA 3AC8A 3BE2A 2UW8A 4FV6A 2GS2A 3KCFA 1K9AA 3PP1A 2VWBA 5CU2A 4GVJA 3EJ1A 4BCPA 3PPKA 4C36A 5M4CA 4ALUA 1SZMA 5IUHA 4AZSA 4IM2A 4LV8A 3KF7A 4PNIA 1OL2A 3LFCA 3BYSA 2I0HA 4UBAA 4BHNA 5CAVA 4DFYA 4LL5A 3Q4UA 2PU8A 4R78A 4G9RA 3P1AA 5HTBA 1OPKA 3SV0A 5CEIA 3Q4ZA 2IZSA 4LMUA 2J7TA 2R3NA 4ITIA 4Q9SA 4NYEA 4AW5A 5CU6A 4AGDA 5CAQA 1W83A 3V5QA 2QR7A 4GUBA 2PTKA 2CHLA 3MJ2A 3RCJA 4AAAA 4I92A 3JY0A 3HYHA 4FKSA 2HY0A 2RG6A 3BX5A 4IAIA 1Q3WA 4TW9A 1OZ1A 5C9CA 1ZY5A 2PZYA 3SOCA 4AOIA 2HELA 3O96A 5BVOA 4ANBA 2WQEA 3U51A 5IQEA 2VTLA 2PMOX 3QZIA 2VWWA 2QKRA 4FYOA 3HRFA 3TZMA 4CT2A 1W84A 4B7TA 3I6WA 4JR7A 4QQ5A 4OTDA 3QC4A 2X6DA 3QD0A 3C4XA 4TRLA 4AN2A 5JFWA 2HXLA 3R0TA 3V04A 4DHFA 3IS5A 3VJNA 4YMJA 4ANLA 3QWKA 4QP1A 3NMUF 1Q8ZA 4DFLA 1SVEA 4QTCA 3LFEA 5FM2A 4ASEA 3MN3A 3DXQA 4BGHA 2OK1A 3PSBA 4GH2A 2G2FA 4GVAA 1RJBA 4U40A 2ITVA 4X2FA 2IPXA 4HCTA 5BVKA 4GMYA 3GC7A 4RIWA 3BEAA 3D2IA 4E4NA 2LGCA 2XIXA 5E90A 2OO8X 2RKUA 3A8WA 4C3PA 3N4VA 2QOBA 1WBOA 5IMEA 2ZV7A 4XJ0A 4R3RA 4AZVA 4FEQA 5AFVA 4L46A 4I0SA 1PYXA 5FEEA 4MTAA 3ZTXA 4IVAA 5JFVA 4FNZA 3LQ3A 2W1HA 2IW8A 3GU7A 4YC8A 5DEWA 5ANIA 5AX9A 4EOOA 4K18A 4DCEA 2KNVA 4F9CA 2VD5A 3BPRA 3DDPA 3IW4A 4C58A 3FZPA 1XJDA 4I23A 3VUGA 5E1SA 5ACBC 4GEWA 2JDVA 4AFJA 2W1IA 4GK4A 4PL4A 3W2PA 1YXXA 2R5TA 5HU9A 5L6WL 2QOHA 4QTEA 5HKMA 4BI1A 1QPCA 4DBXA 4RPVA 4O7RA 2C4GA 4O0TA 1YW2A 3PJ8A 3LFSA 4GUEA 4JBVA 4ERKA 5I9ZA 3UVQA 3NUNA 4KD1A 2R3PA 2CMWA 2OWBA 5J8IA 2GHLA 4FSYA 5EG3A 4PRJA 1H08A 3ETAA 3SXFA 3EQGA 4D1SA 5CASA 2OZOA 1UVRA 3EYGA 3BLQA 2HW6A 4TN6A 3EMGA 5HCYA 3E92A 3FHIA 4GT4A 3V8WA 4BKJA 4EUTA 2CGXA 3G6HA 1M2QA 4QD6A 4EHVA 4CSVA 3R63A 3DK6A 2RG5A 5TOZA 4GYIA 1NVSA 3DQXA 3VBWA 3AOXA 5FDXA 3RAIA 4QMTA 4EBVA 2W99B 5LWMA 3ZSHA 3GBZA 2JITA 3HRCA 5T68A 3D7TB 1WZYA 3LM0A 4B99A 5HO7A 2C6TA 4FV7A 4RJ6A 4XMOA 3W2CA 3ZEWA 4RX7A 3K54A 3ZBFA 4DEDA 2WEIA 4DAWA 5AP7A 3A7IA 1GIIA 5FEDA 3AT4A 2R2PA 3DK7A 4R7BA 4ZMFA 2QODA 3HA6A 3QZHA 3HDNA 4G6LA 4NK9A 4R7IA 3VUTA 4BGQA 5CT0A 4CFFA 5AP5A 5ANEA 4R1VA 2ITNA 3OMVA 4R8QA 4DINA 2Y4IB 5DIAA 2EJSA 3TUCA 3C5UA 4E4XA 1WGNA 1BL6A 4FODA 4JIAA 3KK8A 4U42A 4PP9A 5KMIA 1SNUA 4HYSA 4JJRA 4XG7A 4KS8A 4FIJA 4G1WA 4X2GA 3F2AA 4YTCA 2WMBA 2Y9QA 1NV9A 5JI2E 1Z57A 3EQPA 3HP2A 4BCKA 2W5HA 3Q4TA 4IBMA 4PY1A 1Q97A 2C30A 3FQEA 5HGIA 3RALA 3ZS5A 1XH6A 4DFZE 4EK3A 2J6MA 4XYFA 4OGRA 4HVHA 4E1ZA 2JFMA 4GCJA 2W05A 3MTLA 2OOAA 3LXNA 3VUDA 3UP7A 4USEA 2W4JA 3LJ2A 5C27A 3UVPA 1ZLTA 1UWHA 2R64A 3NVMB 4Y73A 5EYKA 4YZNA 1U54A 4ZEGA 1MP8A 3A7HA 3A7FA 5KUPA 2XB7A 4PDOA 3UGCA 3CGOA 3DBDA 3KVXA 5EH0A 4ZK5A 4O27B 3PJ1A 2QOKA 3NCZA 3QAME 4PMSA 4TPTA 5FBOA 4BHZA 2QSFX 4RC3A 4HYHA 5AR7A 4JDJA 3VRYA 2WZJA 3VAPA 4DG3E 4DA5A 3AC3A 1MRYA 4YPSA 3LJ0A 2XM9A 2ESMA 3C9WA 4G5PA 5BPYA 5KCVA 2RRUA 1XH5A 3II5A 1K2PA 4FTJA 3OCSA 4QMYA 1E1VA 4W8DA 1WVYA 5A4QA 3TJCA 2X2MA 4K1BA 2PVLA 4QPMA 1OKSA 5A6NA 2P4IA 3S95A 4E8AA 4S34A 2IZUA 3CPCA 1DI9A 5E91A 4PQNA 5CVGA 4DEAA 3RHKA 2BMCA 3UIUA 2YM4A 5LWNA 4YPDA 4YJPA 4IIRA 2OJJA 1JKSA 3C4WA 1J3HA 3SW4A 4WA9A 4A4XA 1YVJA 3DAEA 5JN2A 2HXQA 3QZGA 2CWBA 3R9OA 4I20A 4FT7A 4L01A 5CYIA 3A7JA 2XF0A 4O0UA 5L8JA 3KXZA 1PHKA 5F9EA 5LARA 4MYGA 1B38A 3NYVA 4YJTA 2E9UA 4BCHA 2VAGA 3WF6A 3FXXA 4XBRA 3Q2JA 3UBDA 5M56A 1OVEA 2XYUA 4XHKB 5TE0A 1E1XA 3R7UA 2XA4A 3DAKA 1W98A 3OD6X 4IEBA 4RFMA 3E21A 3UC3A 3UQFA 5FD2A 2ACXA 4PPCA 4L42A 2WELA 4BCFA 4ERWA 3I79A 4O1OA 3TNWA 4NSTA 1OIUA 3K3IA 5EDPA 3PXRA 4W8EA 4EWHA 3GFWA 2OZAB 4TNBA 1M7NA 1WGLA 4GW8A 1YDTE 2CNVA 4ZSGA 5KKRB 3M42A 1YLAA 2XKFA 3GLHE 3FLQA 2ZB0A 4AT4A 3COIA 4RQKA 1H28A 4MXAA 4AGCA 4DC2A 1WR1B 2X9FA 2C3KA 3IOKA 4MXCA 2WB8A 2PSQA 2ZM1A 3KFAA 4S2ZA 3G9NA 5BX0A 2OLCA 5LVOA 3LZBA 4PUZA 3RINA 3PIXA 3ATSA 1XHAA 4USFA 1YI6A 2H96A 4J97A 5HQ0A 2B55A 4IWPA 4CFMA 3ZLWA 5FG8A 4PDYA 3DY7A 5CTPA 3MVLA 2GTMA 3C0GA 3VBTA 4BCNA 5KBQA 2FUMA 1A06A 2WMRA 4IB0A 3O51A 4UEUA 4AQCA 3FMLA 4E6AA 3R7OA 3PLAE 4XP3A 3NW6A 2UW9A 3BBTB 3NUSA 4KSPA 4X3JA 3ORNA 3NYNA 1WBVA 4U44A 4JDIA 5DRBA 3G33A 1U46A 2OIDA 3L1SA 4CV8A 3KRXA 4A9UA 4WSYA 1FMKA 5IG1A 2W1DA 3TIZA 4D1XA 2LVOC 3QUPA 5L2SA 1PXKA 4AA5A 3Q3BA 5ETCA 3W16A 4FSRA 5HO6A 4KKHA 4BCQA 4YZMA 1VJYA 3DKOA 4ALVA 3OROA 2XUUA 4ENXA 2WTIA 5HORA 5C4KA 5J9YA 5EI6A 3MIYA 5AA8A 5E92A 4GT5A 1HT1E 4FV4A 5IQBA 4RBLA 3ULZA 2MGWA 4ZLYA 3PWYA 3MSSA 5CZHA 4D9TA 2PVKA 4O2PA 2BFYA 3V5WA 4QMZA 3ZO3A 3GP0A 4YO4A 4G3GA 4S31A 1PXMA 4C3FA 1ZARA 1PXIA 4DTBA 3MFTA 2X81A 4JG7A 4G6OA 3S0OA 4IH8A 3MH2A 3GU8A 5FQDC 3KQ7A 2UV2A 2J50A 2F7XE 3OXIA 3ZUVA 4Z7GA 1Q8WA 3QBNA 2EB3A 1BKXA 3F5XA 3FMDA 3GUBA 4I4EA 5EYDA 4ZTRA 4FEWA 3U9CA 1DO0A 1OKZA 4BN1A 4NTTA 3G51A 4QMLA 3MESA 3B8RA 3PUPA 5AM7A 2RFEA 4IWOA 3ZO4A 2ITXA 4ACDA 3BBZA 2C0OA 5LMBA 2HZ0A 5D12A 4L68A 3V01A 4EKLA 3CKXA 3EQDA 3FXZA 4PNKA 1APME 3WILA 4HCUA 3NNWA 5KZIA 2WIPA 5A6OA 3TUBA 3TEIA 1L3RE 3WF9A 5DE2A 2X8IA 4FTUA 5HCXA 2X7GA 4M15A 3RK7A 4ASZA 4QMQA 1PMVA 3CQEA 4RQVA 3BBWA 3ZZEA 3ATTA 1IG1A 4IAYA 3BLRA 3GI3A 3PVUA 4JS8A 3ZRMA 4DBGB 1MQBA 5IUGA 5M09A 4M3QA 4MAOA 4TYGA 3KL8A 1JSUA 2VWYA 1FGKA 4K6ZA 3ZMMA 3IDCA 5E8ZA 3ORXA 3T3VA 2X4FA 4ZSEA 4AZEA 4TYHA 5J7BA 3FI8A 2CLQA 1ZMUA 5E7RA 4ZTMA 1REJA 1M2PA 2ZYBA 3VBYA 2F49A 4Y46A 4E7WA 4Q5HA 4MXXA 4EOLA 2C6KA 1AIPC 4JQEA 2B4SB 2WD1A 4N70A 5L6OA 1PGYA 2J5EA 3HMIA 5I5ZA 1H1SA 3GC8A 5CT7A 4AOTA 2BZIB 2IW6A 3R21A 5JZJA 2WGJA 3H9OA 4F7SA 1J7UA 4M84A 5CSPA 3HKOA 4O0SA 4XG3A 5AV4A 1WIVA 4FSUA 4HVGA 1VQ1A 5BYLA 5E4HA 4XEYA 5AR2A 5IH6A 2Y6MA 4EH7A 3TTIA 1M14A 5AJQA 4FZAB 5CSVA 4IC8A 1PYEA 4OTWA 3EL8A 4MKCA 2ETMA 4FKUA 5FP6A 2HZIA 2DAMA 4PL5A 2BAJA 3VQUA 2HWJA 3JUHA 3L9NA 5ETFA 2YERA 2C5XA 3AT3A 5J95A 4G3DA 5GZ9A 3NEWA 3EN7A 4IAKA 4UWYA 3I81A 3R7YA 3LFDA 3R7VA 3OEFX 1YHSA 2R3IA 3R8LA 3WOWA 4FG8A 3WIKA 2XJ0A 4IHPA 5EFQA 5TT7A 2UW3A 4L3PA 1U4DA 1DM2A 1GZKA 3CGFA 1WBNA 1I09A 2QI8A 3KULA 4AG8A 4O7NA 4FT3A 2BCJA 4YJNA 2WMTA 3UOLA 4BC6A 4Y72A 2C3JA 3E8DA 3GOKA 4H1JA 3QTIA 1FMOE 4JX3A 4EOQA 2BVAA 5EI2A 4F70A 3DU8A 3C13A 2HENA 3HGKA 4ZTQA 3G15A 2JD5A 4FOBA 3FL5A 3REPA 1YDRE 3KKVA 4DGLC 3TDWA 1KE8A 4U43A 5DR9A 4UN0C 5H8GA 5I3OA 1YWRA 1M52A 3IW5A 4FKLA 3ZC6A 4KBAA 2J0KA 4RVKA 2WMUA 2FSLX 4FNWA 3TNHA 5J1VA 3CS9A 5AWMA 3MFUA 5BYZA 1TVOA 5LOHA 3LCKA 1FBNA 3ACJA 1UU9A 5EDQA 4MF1A 1H25A 3FLZA 2GTNA 3PPZA 4RIXA 4FTRA 5C03A 3A99A 3Q5ZA 4A7CA 5EYMA 3OP5A 5CU4A 4F1MA 4O83A 3EQBA 4R6VA 4W9WA 3ZOSA 3GVUA 4BDCA 2JC6A 1XO2B 1NVQA 5JGDA 2WMWA 3RAWA 1UKHA 4FKJA 3AD4A 3SKCA 1FQ1B 4RLLA 3GU6A 3AGMA 4ANNA 3UODA 5JQ8A 2DNAA 4FVRA 2OBJA 4U3ZA 2OH4A 3W32A 5JSMA 3F92A 4KUJA 3T6PA 3EOCA 2ZDUA 2B52A 3VQHA 4CV9A 4ZIMA 3ROCA 5GJDA 3LMHA 1T6OA 3FL4A 3ERKA 3M11A 2CKOA 3KREA 2YJSA 1R1WA 3PXYA 4ZMEA 1IASA 4O0YA 4B6LA 3FQSA 2VO6A 3F3UA 3L8SA 3UP2A 3R71A 3ZONA 1P5EA 2UZDA 3PYYA 5C8NA 2Z02A 2WTJA 3PTGA 3CSVA 1H26A 3IW7A 3LMIA 3LJ1A 2LVNC 3NVKI 4CQEA 2VNWA 3ODZX 4A9YA 3I1AA 5DH3A 4B8LA 5DMZA 3R7IA 3BU3A 3R9NA 4ZZNA 5J5TA 1HT2E 4XNEA 4XX9A 2YM8A 4Q7JA 2PZIA 4ZSAA 3N51A 3M2WA 3GENA 1IXSA 2DQ7X 3EFKA 4ZS0A 4EQCA 2R0UA 3FZTA 4QMMA 1DAYA 5A46A 5HO8A 4MHAA 2YDIA 4FE2A 4X2KA 1KOAA 3PVWA 2GNLA 3GB2A 4FL2A 4I94A 1W82A 5T3QA 4BVUA 3K5UA 1VR2A 1UFZA 3R9HA 3U9NA 4L00A 5IKWA 4QMWA 3DZOA 3C0IA 4GK3A 3R02A 2PVRA 1H0WA 4PTEA 3I5ZA 2FSMX 3QD4A 4PDPA 3OCGA 2EXEA 1KE5A 4LRJA 3I5NA 3MA6A 1SVGA 3Q9WA 4IFGA 4DGMA 1TR8A 3QXPA 4KWPA 5EW9A 2UZVA 2W5BA 4FNYA 3LXKA 1Q61A 2C6IA 2YZAA 5L2TA 5L2IA 4K0YA 2W1ZA 2GNIA 3LFQA 4PMMA 5DR6A 4BCGA 4QNAA 5C4LA 4J98A 5D7VA 3IK3A 5JK3A 3W2OA 2DAIA 1YWNA 2R3JA 3FRIA 1I44A 2JKMA 4FC0A 4FKIA 3V8TA 4KIKB 2C5OA 4FR4A 3IECA 2KTYA 4IXPA 4RIYA 3FLYA 4K8AA 3MW1A 2UZNA 5I0BA 4DFUA 5CI7A 1OL7A 2QQ7A 4ZTHA 1NY3A 1ZXEA 2VX1A 3GFEA 5FTGA 2IVVA 4XP2A 2K0BX 1NXKA 4FVPA 2BTSA 2C5VA 3WZUA 2L4FA 2XCKA 3OOGA 2J51A 5E8XA 3CBLA 4BTKA 4BDJA 4QP3A 1JOWB 4MWIA 1Z9XA 3NNVA 3C7QA 4FKOA 4LQMA 3NNUA 3QKMA 3ODYX 1JSTA 2IZRA 4XRLA 1T43A 5KMLA 3OG7A 2Q0NA 5CZIA 1K3AA 3T9TA 4YTIA 4WIHA 4L43A 5HLNA 2VV9A 2HZNA 2X8EA 1MRUA 2ZDTA 3C1XA 4MH7A 5AV0A 1Q62A 4LV5A 3DNDA 3ACKA 1Q8TA 3PJCA 4IX4A 3LPBA 3R8UA 2XEYA 5EQPA 3DCVA 1F4IA 5T6KA 2UW5A 3KC3A 4F7LA 2RSVA 3PA4A 3TCPA 3ZXTA 3RNIA 2GQRA 4KBKA 4IM3A 4EHZA 4CRLA 4FMQA 4E26A 3D5UA 2W9ZB 3PXFA 4LI5A 4D5KA 4EKKA 5IISA 4BBMA 5JQ5A 5CENA 2X8DA 1ZYJA 3LIJA 4B0GA 5LVPA 3PY1A 1UNGA 3P86A 3TT0A 2H34A 3PVGA 4I93A 3DS6A 3V5JA 4OBPA 5BMSA 3EZVA 2XZSA 4ALWA 2YAAA 4UZDA 4EJ7A 1PXNA 2QOIA 2Y7JA 4JLCA 5EK7A 1H27A 2O5KA 4NH1A 4EWQA 4XCUA 3PZHA 2KULA 1OGUA 2BUJA 4YNEA 4MD9E 1P4OA 2BRHA 3FC2A 3N4UA 3MGYA 4J96A 3CC6A 5A4TA 3RP9A 3LCDA 3E64A 4XG6A 3CTQA 1U59A 2X1NA 2YA9A 2IO6A 5H3QA 4HW7A 1YXUA 3LAUA 2O63A 3MYGA 1GAGA 1R0PA 2FSTX 2YLEA 4YLKA 3ELJA 3W10A 4KKEA 4QP6A 3PXZA 3JVRA 4X6RA 2Z8CA 4OT5A 4NKAA 3DTCA 5IA0A 4BCMA 2EXCX 3ANRA 3HV5A 3U8WA 3VN9A 4FT9A 1F0QA 4IC7A 2G2IA 3QC9A 4TYEA 5AP4A 4CCUA 3VS4A 1DO2A 3O50A 1T45A 4I4FA 5HZNA 3G0EA 1TKIA 3W33A 5KO1A 5L3AA 3VUIA 3QCSA 4GIIA 3VO3A 2YZLA 4DLJA 3MVHA 3ORPA 4RIWB 3FYJX 3CEKA 1VEBA 3OF0A 1V0PA 1WJ7A 3U6IA 5ICPA 5E8TA 2XK7A 3MH3A 1Q4LA 4AUAA 3EKNA 2JNHA 2VTMA 3DTWA 4XLIA 3I0OA 3G2FA 1CUKA 3FRHA 2O0UA 1DS5A 5CAPA 1OIRA 5AIRA 1BL7A 2X9EA 3PVBA 2A4LA 3DAJA 4MNEA 3RNYA 4D4SA 4OTRA 2RFSA 3BWJA 3KRWA 3QTSA 4O81A 4R1YA 4ZY4A 1AGWA 5CY3A 4MWHA 4FV9A 3SC1A 3EQHA 5IA5A 3RZBA 4EH3A 3QKKA 3QU0A 5EM5A 4EYMA 4AZWA 4F9BA 5K5NA 4OTHA 4PF4A 3F9NA 3O8TA 4AW0A 1OL5A 3UNZA 3SA0A 3D0EA 3TNPC 1W8CA 3OS3A 3QF9A 3ZRKA 2XS0A 4EC8A 4FKVA 5HE2A 4V0GA 4FEUA 2WTVA 1LUFA 3L8XA 4R3CA 1U5RA 3D5XA 3DKCA 2JIVA 2R4BA 3HMOA 4WNOA 2XNEA 2HAKA 3ZC5A 4U97A 4ANMA 5I9VA 2O64A 2C3LA 5D11A 3NGAA 4AE9A 2UVXA 4QMSA 4NUSA 2B9FA 4JVGA 4DEEA 4IADA 2F7EE 5ANOA 2R3KA 4F09A 5C26A 5JEBA 2G01A 2PHKA 3CIKA 2C47A 4NKSA 4WG4A 4KINA 4FKQA 4HPUE 2XIRA 5IH5A 5IQHA 4J7BA 4BIDA 3JPVA 4QTAA 3DXPA 4F9WA 2E9NA 5FP5A 4IZ5A 2F7ZE 4FSNA 4YJRA 4RX5A 3WF5A 3AQVA 5J87A 4IQ6A 1NA7A 4OTFA 3IONA 4AZFA 4MD8E 1Y91A 3COHA 4YURA 1YOMA 1XH8A 5KX8A 4L7FA 2WTDA 4ZLOA 4FIGA 4FNXA 2BAQA 1M17A 1CTPE 5LJJA 1BLXA 2B7AA 3QLGA 3OCBA 3I0QA 3FLWA 4XV9A 4MK0A 3R1NA 2MR9A 4Y5QA 1CMKE 3DT1A 4QYHA 5DOSA 4W4XA 4YJSA 2GFSA 1H00A 1IA8A 1QPJA 1EH4A 2R3FA 2R7IA 3CD3A 4RWJA 4IJPA 5AAEA 2JBPA 4FL3A 3VUHA 4HJOA 5IEXA 1YRPA 3O0GA 3B2WA 4HZSA 4IANA 4CFNA 5HLPA 1MN3A 2YWPA 3FAAA 2H5XA 4GU9A 1P2AA 5E9EA 5H8EA 2IVTA 1MUOA 1H07A 2P55A 3W8LA 5GIPE 3PP0A 4IWQA 4DE4A 4WSQA 4CT1A 2YWVA 5B0XA 2ETKA 1QL6A 1XWSA 3F5GA 4FTMA 4KS7A 3KVWA 4RFZA 3TWJA 3UIMA 5L2WA 1GIHA 3BHYA 2CN8A 1HQYE 1U54B 2PMIA 4P90A 2ZOQA 3HEGA 4YLJA 3H0YA 3KMMA 3FYKX 5GZ8A 1IAHA 4M67A 1SG9A 2AC5A 1EFUB 2AC3A 1OL1A 2FVDA 3IKAA 3CTJA 4MVFA 3VIDA 5HD4A 3OXZA 2PYWA 4P5QA 4DFBA 3ITZA 4L9IA 2J4ZA 4BTMA 1PJKA 4GG7A 3UQGA 1OKVA 5CAOA 4Q5EA 5JT2A 3HNGA 4YSJA 1H1WA 4CVAA 4C62A 4PMPA 1ZRZA 1FVTA 3LFNA 4ONAA 4P4CA 2JBOA 4L53A 3H0ZA 3MPTA 4AE6A 3VVHA 4E6CA 1G8AA 5IA1A 2XMYA 5D1JA 5CEMA 2XM8A 5BQ0A 4I6QA 2GDOA 4L3JA 4MX9A 5BUEA 2WHBA 3DZQA 3MB6A 4YZ9A 4FGRA 3V5PA 2EXMA 3A4PA 4USDA 1PXOA 2PPQA 4ACCA 4R77A 1J1BA 3FI2A 4BDBA 4RWLA 3VS7A 4K33A 1O6LA 3TZ7A 4D2RA 5FUTA 2NO3A 1M7QA 2W0JA 4J95A 5AR5A 4YP8A 5H8BA 5J79A 4FV2A 5EOBA 4WD5A 3SLSA 5JH6A 2BAKA 2QOQA 3GCUA 2QO7A 2JDRA 4IVCA 5A4CA 4L6QA 4G31A 4JDKA 4DLIA 3K3JA 4MD7E 5BMMA 2ITPA 4C38A 4F6WA 4H05A 2CKEA 5AM6A 4G5JA 3ZSGA 3ET7A 2OXYA 4ZP5A 3BYMA 2O3PA 2P2HA 3UOHA 3QL8A 4YR8A 1PMNA 1UU7A 3PIZA 4RX8A 1P4FA 4FSQA 3FSKA 3R1SA 4TT7A 4LFIA 3RPSA 4QMXA 3F6XA 5HE3A 3DDQA 4FBXA 4R7HA 4G3EA 1W0XC 3PA3A 2Y0AA 4ZZMA 2R3GA 3SD0A 3EKKA 2J0MB 3F3TA 4HNIA 4XV3A 2Z60A 4TNDA 3F3WA 2F2UA 3KA0A 4GFMA 2OSCA 3VHEA 3TTJA 2OICA 3TN8A 3QRIA 2WQBA 3QRUA 4IX5A 4XP0A 4V04A 3ZO2A 4C4HA 1NV8A 4KIQA 3G5DA 4WG3A 4Z9LA 5FTQA 3GQLA 3BGPA 2OU7A 3NPCA 2C1BA 4FICA 4HNFA 5B7VA 3A61A 4ZTLA 5HOAA 2OH0E 3AC5A 4BDAA 2A27A 3N9XA 3Q04A 2GNGA 4N4SA 4D4VA 5CU0A 1WBPA 2W96B 4U5JA 4EK4A 4HVDA 2JUJA 3OTUA 1OBGA 4DEIA 2YIXA 2QR8A 5HIEA 4I1ZA 3PRFA 4QYYA 2QNJA 2PE2A 3E3PA 4U8ZA 5BNJA 3E8NA 2VO7A 4APPA 1NW1A 4RWKA 1V0OA 2UZBA 3EHAA 4FL1A 3QQFA 4E5WA 4OT6A 5HCZA 3VULA 5HVYA 1V0BA 2JY8A 4IJ9A 1ZOHA 4CYJA 5CVHA 4HZRA 5F4NA 2JDOA 4NM7A 4GIHA 3UZPA 1OKWA 3OBGA 2I7QA 4IB5A 2XK8A 5HE1A 5I9UA 2VGPA 4BCJA 2HWPA 3DGKA 4MXZA 3FZSA 1XH7A 2GPHA 5LVNA 2XH5A 1JWHA 2PZRA 3DOGA 3E93A 3BYVA 3O8UA 4C33A 3MVMA 4GJ3A 2WOTA 3KMUA 4IAFA 4JG6A 3Q32A 3OWLA 4TYJA 4JIKA 2X39A 1GZOA 4ITHA 4KABA 1J91A 3KRJA 4MBIA 2LBCA 5L4QA 2X0GA 3UE4A 3POZA 3QTRA 5HE0A 2LVQD 1ZOEA 4FV8A 4J1RA 2Z7QA 4QYGA 3UPXA 5LMKC 1G5SA 4TXCA 4ZXTA 4EEVA 2ZMDA 4UWBA 4ACGA 3SW7A 1AD5A 4NIFA 4OTPA 4OBQA 2BRBA 3LFFA 2ZM3A 5AP0A 5EHOA 4QP4A 3A62A 3IGOA 2VTAA 2C0IA 3W18A 3Q4CA 4L52A 2PUPA 3Q96A 2DAEA 4LOQA 1SM2A 3BGZA 3UO6A 3MVJA 3UIBA 2PZ5A 5M51A 3TI1A 5ETAA 5AUYA 3FWQA 1UKIA 2BPMA 5HG9A 4XLVA 4CTBA 3HLLA 3QTUA 1KV1A 4M12A 5AA9A 4A06A 3NYOA 2I6LA 2XNBA 4UY9A 3EZRA 3HUCA 3Q6WA 2OG8A 3VS2A 2PVHA 2UVZA 5CI6A 5BVWA 4RIOA 4DEBA 3F5PA 1UV5A 4D28A 5KMNA 3QA0A 4JBOA 3SRVA 2QHNA 5IQCA 2QHMA 3WIGA 2GNFA 3R00A 2YCFA 4BBFA 4E20A 2C6EA 2VN9A 3RHXA 4O21A 2WOUA 4PP7A 5EKNA 3KMWA 4O0WA 1H4LA 3OXTA 4X2JA 4TWPA 4ZJVA 3UVRA 5KMMA 3R8VA 4TYHB 3GXLA 4X21A 3FKOA 2VU3A 4V01A 1VEJA 3EB0A 5DFPA 5E8WA 5L2QA 4CGAA 4IWDA 1ZYCA 2JDTA 5HG5A 5M4FA 3MV5A 1CDKA 4DFXE 2X2LA 1STCE 5IZFA 4UMTA 3L9LA 3QQKA 5DN3A 4FUYA 4XS2A 5DBXA 3RK9A 5CF8A 3NCGA 4Y8DA 3C5IA 2QO9A 2CCHA 4M69B 4ZOGA 3GOPA 5GNKA 5HICA 3FMHA 4FSWA 5ACKA 3HAMA 3MY0A 3Q52A 5A4EA 5GIOE 2JY7A 2GS6A 3ROYA 1YOLA 2WEVA 4GRBA 4CZUA 1TQPA 1XQZA 4FOCA 4I5PA 4OUCA 3MFSA 4FSTA 3OY1A 3R28A 4IM0A 3U55A 2OI4X 4KNBA 4CZYB 4QOXA 4ZLZA 3HMPA 2W1FA 3KRLA 2QO2A 3H30A 4RRVA 4RZVA 1O9UA 2PY3A 4YJVA 3M1SA 3U54A 1KOBA 4W9XA 1J7IA 2X2KA 5HLWA 2CPKE 4F7NA 3SXRA 4QP2A 3WYXA 5CEOA 3QTXA 2FB8A 3O7LB 2BRGA 2VWVA 4YJUA 2ZTCA 4D0WA 4F0FA 1PW2A 4RA5A 4NM3A 2UUEA 4TWNA 1G8SA 2WTCA 3MTFA 3AC1A 2JP7A 3RZFA 4EK6A 5C1QB 1JBPE 2Q0BA 3HVCA 3ULIA 3U6HA 5CALA 4L8MA 3LCVB 2GNHA 2C68A 3KULB 4CG8A 1H1PA 1BI8A 5CS6A 4UALA 1UA2A 3PJ2A 4W4VA 4MBLA 3TZ9A 2BRMA 5DT0A 2B0QA 4C3RA 2EKFA 3EQIA 5IH4A 2CDZA 3F2RA 2FYSA 3OBJA 2YCSA 5A3XA 4FTCA 4E5AX 2XVDA 3I6UA 3RK5A 5JKGA 4BBEA 2GQGA 4ANSA 4JL9A 2XIKA 3L9PA 1SMHA 2O2UA 3ANQA 3PSCA 2E9VA 2XKEA 2Y8OA 3E5AA 4IB3A 2IZTA 4FZDB 4LUEA 4RSSA 1WBSA 3WZJA 3QQHA 5L6PA 4HEOA 4RJ3A 1WBTA 2ZV9A 2XK6A 4N6ZA 4RIXB 4DT9A 3TKIA 2MJ5B 1P14A 2R3RA 3G6GA 4XV1A 3T9IA 1PMEA 1YDSE 1Q02A 4NW5A 3RM7A 3HECA 5DA3A 2RFDA 4G6NA 3BV2A 4BI0A 5HTIA 1URWA 3T3UA 3F69A 2OJIA 3I7BA 4LRKA 4QTBA 4CFUA 4AP7A 2CGVA 4CFXA 4CLJA 3D15A 3FZRA 3QTQA 4EH9A 2OF4A 4UXLA 3KCKA 2C6LA 4FX3A 3DA6A 2V7AA 3ZM4A 4FVQA 3SGCA 4D1ZA 3HA8A 3NUYA 2YISA 4CQGA 1JVPP 2C1AA 3P5KA 3UMXA 2BWBA 3Q9YA 5HI2A 2IJMA 3OT8A 3UDBA 4NWMA 2QKWB 5EM6A 3R1QA 4HOKA 5IU2A 4M68A 5AAGA 2I0VA 2CJMA 3CY2A 2R3QA 2BHEA 3AC2A 3EN5A 5EM7A 3UOKA 4EUUA 5M55A 2E2BA 3H3CA 2VTQA 4HYIA 5ETIA 5IA4A 1SNXA 2CGUA 1B39A 3BQCA 4QQJA 1H0VA 5F94A 2WTKC 2VTIA 5AV2A 3OWKA 3KRRA 3Q9ZA 3NUUA 1JLUE 3BEGA 3GCPA 4ZJJA 4ZZOA 2ITYA 2UZTA 3DLSA 4N57A 4BGGA 4CFVA 5EQYA 4JR3A 4D2TA 2G1TA 2ZB1A 4EH6A 3CQWA 2PUUA 4FTIA 1V1KA 2YM6A 4ARKA 5JZNA 2LVPC 4F6UA 4XH6A 2DKLA 2H9VA 1LPUA 5AP6A 3P4KA 5EKOA 5FRIA 2BALA 2EB2A 3SXSA 3MH0A 4IVDA 3NUAA 4BYJA 1O6YA 4YGAA 2VWXA 3KN5A 2GSFA 4APCA 2YFXA 2YCRA 3NIEA 4ANQA 3DKFA 4EK5A 4BIEA 1VEGA 3PWDA 1JKTA 2GHMA 4J71A 4QP8A 5CU3A 5H2UA 2CLXA 5HIDA 1H24A 5AUXA 3TNIA 4F9AA 2JEDA 3EYHA 5HG8A 4YTFA 4FTQA 4DT8A 2ZTDA 3MY1A 2KNAA 4HGSA 1IM2A 3W55A 3FMMA 2WQNA 1XBCA 4RC4A 4JOAA 5AUVA 3QCQA 4BZNA 5EYCA 3EN6A 2QOCA 1G3NA 1WFCA 4ITJA 3ORIA 3OWPA 4D58A 5M44A 3R7EA 4RZWA 3QGYA 5BYYA 2YM3A 3HUBA 3VS5A 4FTOA 2YAKA 2ONLC 4FIEA 3E88A 2B54A 2OJGA 4TYIA 4CKRA 5LVMA 1YQJA 3U4WA 3ENHA 4RIYB 4O7LA 5JGBA 4XG2A 5DRDA 3IGGA 3VF8A 3ZLYA 4FK3A 1OIQA 4X6QC 1JKKA 4I22A 2B9IA 2BZKB 1ZZ2A 2L4EA 2YIYA 2V7OA 2YJRA 4JQ7A 4O6LA 3R83A 4BZDA 4H3QA 4E5BA 3SVVA 3MIAA 2F57A 4UYAA 4AN3A 2HIWA 2B3TA 4YJOA 3KEXA 5J1WA 4FTLA 3C0HA 1J7LA 3QTWA 1GO5A 1PMUA 3S2PA 1CM8A 4EORA 2NRUA 3RPRA 1WVWA 3QD2B 5FWKK 3MA3A 4UMQA 5HU3A 3VC4A 4D55A 2WU6A 1A9UA 3FXWA 3E87A 5AR4A 4U0IA 4EH2A 2WAJA 5A54A 4OAVB 2L2DA 5DLSA 2PMNX 3HV4A 2A0CX 5M57A 4X3FA 4FV5A 4DH5A 3QZFA 2FA2A 3RWQA 4BZOA 5AUTA 4LYNA 3VW6A 3FMNA 5DVRA 3R8MA 2FSOX 2NRYA 3TIYA 1KE9A 3LXPA 3WE4A 4M13A 2ZV2A 3BU6A 5EDRA 3P23A 1GY3A 2QLQA 4EJNA 5CEPA 3F88A 2DAGA 1IR3A 1XKKA 4GK2A 2W5AA 2QU6A 4I41A 4KIPA 4WRSA 5IQGA 3NLBA 4X7QA 3NUXA 3BV3A 2VTNA 5DT3A 1KSWA 2OIQA 4KAOA 4YHJA 3KN6A 4ZS4A 2OXDA 3CD8A 3PY0A 5D9HA 3HRBA 2ITOA 2QU5A 2WQOA 3KXNA 4EOJA 4OLIA 1ZMVA 2BR1A 4BICA 5HBHA 1OECA 4D4RA 1PKDA 3WZEA 3PZEA 4I0TA 5CANA 4MF0A 3TG1A 2Z7RA 3VS1A 1OB3A 5AV3A 1JSVA 4ACHA 4DH8A 4JRVA 4BRXA 1OITA 3EQCA 3V51A 2CGWA 1OL6A 3DBCA 3LW0A 3BWFA 5CXZA 3D7ZA 3MBLA 4DH3A 1KWPA 3D14A 2XBJA 3QUDA 2XCHA 4O96A 3PXKA 2BDWA 5DWRA 2VTJA 5E8SA 3V8SA 1XH9A 5FTOA 3FBVA 3CPBA 5AR8A 4G34A 5EW8A 2EKKA 2YABA 4FT0A 4DEHA 3GCSA 4IACA 5IEVA 1REKA 5LMKA 4NW6A 1WBWA 3POOA 2BZHB 4QT1A 4R5SA 3F82A 4C2WA 2V55A 4EOMA 2P33A 3O17A 2PMLX 3RPOA 3AMAA 4FTKA 3TJDA 2YDKA 3Q9XA 2JIUA 3P08A 3EFWA 3NWWA 1G4AE 4R5YA 4O6EA 4U41A 4MNEB 1VG5A 3C4EA 4AWIA 1Q3DA 4C7TA 4QMVA 4AF3A 3EH9A 1ZYLA 5LCJA 4FSZA 4UYNA 3W2QA 4IAZA 3CJGA 3FI3A 1XBBA 5CF5A 2O65A 5F1ZA 3BHTA 4UZHA 4YZCA 4G3FA 4O0RA 4FIFA 4RJ5A 2PVJA 3S1HA 2XRUA 2XEZA 3MWUA 4O7TA 1VZOA 4TWOA 3LCOA 3R2BA 1Y8YA 3BU5A 4DFNA 3C51A 3QKLA 1YHWA 1IEPA 3QA8A 4IX6A 5EW3A 3TM0A 4CXAA 3DKGA 5F95A 4EOKA 4V0GB 2JZ1A 4I5MA 5CWZA 4LOOA 4JT3A 2H6DA 4L7SA 5JMSA 2CNQA 3OHTA 3RI1A 1XR1A 4NM0A 4K9YA 4MQ2A 4DGOA 2J5FA 4DCAA 4LM5A 2E9OA 4G2FA 3A60A 1PKGA 2H8HA 4D2SA 3UO5A 3NZ0A 3OFMA 4AT5A 2CKPA 1M2RA 1Q41A 5BVNA 2OFVA 4ACMA 4RFYA 3BI6A 3C4ZA 4ZSJA 3VWAA 4CNHA 5D7AA 4WNMA 4FGBA 3THBA 4I3ZA 3VS6A 4UMUA 4YNOA 4BDGA 3ID6C 5FXQA 4BDKA 1OKYA 4ANOA 4C4EA 3K9PA 5H9BA 3FKNA 3GCVA 2DS1A 5LVLA 2GMXA 3WF8A 3PJ3A 3BHVA 5HVKA 3N4TA 3UG2A 3IG7A 1R0EA 3JVSA 4Y85A 4EQMA 2PVNA 2XRWA 3D5VA 3UZTA 2HCKA 2CKQA 4DGNA 3O2MA 3TZ8A 5KNJA 4AN9A 4WOVA 4G16A 3DBFA 3LFAA 3RWPA 1YOJA 5CQUA 4F63A 3SHEA 2JKOA 3E63A 4G3OA 1MQ4A 1PY5A 2V0DA 3VNTA 2DHYA 4F65A 1QPEA 2HY81 2B1PA 2R3MA 4C4FA 2JZ0A 4O22A 2OKRA 2VX3A 3ZUTA 2WU7A 4QMUA 2QOFA 2GHGA 1UWJA 4I21A 3VW8A 3WYYA 2XIYA 4DEGA 2QHOB 3P79A 5K4IA 1B6CB 4AT3A 3KU2A 2VTHA 1U5QA 5BUJA 4QMOA 4GJ2A 5AMNA 3FLNC 4AA0A 2VWZA 3FY2A 4QPAA 3QRTA 4FKRA 4CFWA 4DG2E 1A48A 3LCTA 5IQIA 4HYUA 4DH1A 5M07A 3G0FA 1ZY4A 5FM3A 4A9SA 4KKGA 5IUIA 3TDVA 1OUYA 3D4QA 3D83A 3TUDA 3CCNA 3EFJA 4DG0E 4L45A 2VTRA 4MEDA 2VWUA 5ANDA 3V3VA 4D2VA 4IDTA 2WTKB 3V6SA 5CEQA 3K9OA 3PFQA 2XP2A 4I6FA 1FPUA 5C8KA 1WMKA 2EVAA 2MROB 2BKZA 2J90A 4L44A 4WUAA 4ZJIA 2DWBA 4RG0A 2WNTA 4M8TA 3RKBA 3ZLXA 2JAMA 4F7JA 3LMGA 5HESA 4HVSA 3EQFA 3IPHA 1X8BA 1XXHE 3Q5IA 1G3IA 3BYOA 5AP2A 5FXRA 3DJ5A 1YI3A 3UPZA 4QMPA 3F3ZA 3ZDIA 2WKMA 3LVPA 2IVUA 2VX0A 4OW8A 3OUNB 4FUXA 4I5CA 3R7GA 1JNKA 4AZTA 5M4UA 1HCLA 3I7CA 3PY3A 4QQCA 4RGJA 1LEZA 4YJQA 2LVAA 3FLSA 5BVEA 4QYFA 4AOJA 4BTFA 5A9UA 1FVRA 3NW7A 3QQJA 3GEQA 4LOPA 4U6RA 2Z7LA 5F20A 4GFGA 4ZTNA 4AW1A 3ALOA 4MXYA 4PWNA 5JRQA 5E8YA 4EH4A 3E7OA 5AP3A 3UNJA 2ITTA 5DPVA 3JR1A 2VO0A 4BDHA 4O0VA 2BROA 3PG3A 1BMKA 4D9UA 4TKSA 2QG7A 2QC6A 3ZO1A 3UYSA 4I24A 4CRSA 3EWHA 2VGOA 5HVJA 3EL7A 5M08A 3DBQA 3QRKA 4FKTA 4O2ZA 4PPAA 4BY9E 2PVMA 3O7LD 4D5HA 2OO9A 1SVHA 2JGZA 1TTEA 3FDNA 2QD9A 3I60A 4IW0A 3FEGA 5GJFA 3Q53A 5J9LA 1ZMWA 3NSZA 3PRIA 3MI9A 3F5UA 3EQRA 4YTHA 3RMFA 4I6HA 3QGWA 2BWEA 2XYNA 4HGLA 5TO8A 4NJDA 4BKYA 3W1FA 5CF6A 3UZRA 1PRYA 1OM1A 2UW6A 1Y57A 2BDJA 3HMMA 3O8PA 2OFUA 4TWCA 3VBQA 5IDPA 3VS3A 4EZ7A 2PZPA 2DI0A 1ZZLA 3GLGE 4ZTSA 2Z7SA 5CX9A 2C69A 5ANKA 3OW3A 3ZFYA 3L9MA 1UNHA 3QYWA 2J0JA 4BL1A 1RW8A 4OTIA 5FGKA 1ZAOA 3GC0A 3R1YA 2W4OA 3FMJA 5KBRA 4CZTA 4IZAA 5HNGA 2Y6OA 4LGGA 3VF9A 4FZFB 3F66A 2PK9A 4AU8A 2BZJA 2DUVA 3OW4A 4O7ZA 4MNFA 2KHHA 4G3CA 1Q5KA 4B4LA 5I9WA 3ZFXA 3P7AA 4JRNA 5BVDA 2UW0A 4BKZA 4Z55A 2VTOA 3EFLA 2RFNA 3CKWA 2RF9A 2R9SA 4J52A 5CF4A 2BIKB 1SYKA 2PWLA 2XK4A 3GU4A 2JAVA 4PX6A 3MY5A 3OC1A 4DTAA 1OUKA 1ATPE 3FSFA 3JY9A 4RVLA 3BE9A 3NDMA 4B8MA 4BFMA 4XV2A 5AAFA 2IW9A 4BTJA 4WBBB 3R9RA 2Z2WA 5IF1A 3LHJA 1LP4A 2ZMCA 2W1CA 2XNPA 4IFCA 4KRDA 5FBNC 2X6EA 2AYPA 4JI9A 1UU8A 2ONLA 2ZV8A 3UYTA
chains in the Genus database with same CATH superfamily
4RJ8A 3ZFMA 2XIZA 3LQ5A 3FTFA 1PXLA 2JY6B 4ORKA 2W7XA 5BV3A 5DHJA 4Z3VA 3AMBA 1CSNA 3UOJA 1GABA 5KPRA 5EHLA 3Q6UA 2JKKA 3CLYA 2F5QA 5EP3A 4XG4A 3V6RA 4PL3A 4LUDA 4JNWA 5C01A 5ITAA 2VRXA 5AR3A 3ZCLA 1G41A 4FKGA 1R6BX 1S9IA 3AT2A 4YHTA 2JIIA 1O6KA 2BILB 2CN5A 2LTUA 2QCUA 2R7BA 4QTDA 2YM5A 4GHAA 4WP2A 4C34A 2D7GA 2HK5A 3KB7A 4UN2B 4WG5A 3ALNA 5LXMA 4WBOA 5E1EA 4FYNA 3U6JA 4P7EA 3D5WA 5K3YA 4HGEA 3F7WA 3EIDA 3V5TA 1KYIA 2ZJWA 3U6PA 3ZYAA 2C5RA 3ZUUA 2X4ZA 1JR3E 4DHZA 3FHRA 3FJQE 3GLFA 2JY5A 1VYZA 3HP5A 3LKMA 3GC9A 1FGIA 4HVIA 4EH5A 3KXEC 3E62A 4LGHA 5DYJA 3DB8A 3RM6A 2XEPA 5JRSA 3VBXA 3AMYA 4MCVA 2BKKA 4O7YA 3LXLA 4GG5A 4RMZA 3HV7A 4PPBA 4V05A 3TNQB 4RVTA 4DR7M 4GKHA 4L3LA 2LAVA 3R73A 4OR5A 5L8KA 4QP9A 3IOPA 4QRCA 3VJOA 3FUPA 2YM7A 5HIBA 4IB1A 4M9ZA 4QQTA 2PVYA 1TF0B 3U61A 3FE3A 4XGIA 4FK6A 3RJCA 2QOLA 4CG9A 4EOIA 3BHUA 1DI8A 2FH9A 4QDEA 2HL7A 5C1BA 3NNXA 3KY2A 4G17A 4HCVA 1BI7A 4Y83A 2XH9A 4AXDA 4D0XA 3CF6E 3R8PA 5HG7A 4FG7A 2B53A 3FV8A 1IN4A 4JBPA 4FIHA 1RQQA 3OTVA 2QVSE 5IDNA 3RCDA 5TF9A 5DFLA 2W1GA 2YCQA 5I3RA 3BIZA 4II5A 2R0IA 2YFQA 4EH8A 1GZNA 4B7GA 2PULA 3SX9A 3WZKA 1HCKA 3QYZA 1E9HA 3BQRA 4C02A 4X3FB 4H36A 2P3GX 4AACA 1OIYA 1TQIA 4ZY5A 5EXSA 4GKIA 5FLFA 2WMAA 4FTAA 2Y21A 3VUKA 4U45A 3UIXA 1JQHA 2GFCA 1F3MC 3ZBXA 4BDEA 2UW7A 1OI9A 4DEAA 1VEKA 1YKRA 4UX9A 1QZEA 4OVZB 5LCKA 4NL0A 3C4FA 4CLIA 4PTCA 3OVVA 3PNVA 4BCIA 4O4EA 1Q3CA 3E46A 4XOZA 4BDFA 5KMOA 1ND4A 3VBVA 2YITA 3DJ7A 4Q2AA 2C6DA 2WQMA 1QDRA 5B2LA 2K9DA 4DITA 5KMJA 2SRCA 4KLNA 2V5QA 3DB6A 4ENYA 4NCTC 3ZU7A 3SG8A 2GU8A 4MQ1A 4L4UA 2BHHA 1XB2B 1Q8UA 2IG7A 5AUUA 3DFCB 3C58A 4O82A 4GL9A 3QQGA 4WNKA 5HD7A 4AKIA 4XOYA 4REZA 3KOYE 3WE8A 3GPXA 3WARA 3LOKA 2JDSA 2X7OA 2HWOA 3HX4A 1URCA 4KT0F 3J7AS 4CEGA 4M66A 3NRMA 1V92A 2XFTA 3C4CA 4M14A 2XF3A 2GNJA 5J7HA 4IZYA 3DPKA 4G4QA 2J2IB 5DT4A 3V5LA 5CSWA 1HOWA 3BHHA 3GCQA 2PL0A 4FA2A 2EWAA 1LR4A 4YZDA 2OJ9A 5IQAA 3ZH8A 3KXGA 4JDHA 4CISA 5TR6A 3U87A 3E8EA 1OTRA 2XNNA 1OPJA 4OBOA 3COMA 3FY0A 1L8TA 1CKPA 4YSMA 4JG8A 4WNPA 3W2OA 5CU2A 2UW8A 2DZNB 1SZMA 4AZSA 4LV8A 1OL2A 4RF0A 2PU8A 4R78A 4DFYA 4G9RA 5CEIA 2R3NA 5CU6A 2QR7A 4GUBA 4AAAA 3JY0A 3RMFA 1OZ1A 2HELA 2WQEA 2PMOX 3WHKA 1IY1A 4QQ5A 2HXLA 3V04A 3VJNA 4QP1A 3NMUF 3LFEA 5FM2A 1TH4A 3MN3A 5KQDA 3DXQA 4GH2A 4U40A 4X2FA 4HCTA 5BVKA 4GMYA 2XIXA 2RKUA 3N4VA 2ZV7A 4AZVA 5FEEA 4EOOA 3GU7A 4YC8A 5DEWA 5ANIA 4K18A 4DCEA 3VUGA 4QTEA 4RPVA 4O0TA 5I9ZA 4ERKA 3LFSA 4KD1A 2XZFA 3EQGA 4D1SA 3TMOA 1IN7A 5HCYA 3BLQA 3EMGA 4CSVA 2RG5A 2R4JA 3AOXA 5FDXA 5LWMA 2JITA 3HRCA 3UZUA 1GIIA 3AT4A 3HDNA 4R7IA 3VUTA 4DINA 3KK8A 4PP9A 4KS8A 3PXGA 4G1WA 4YTCA 1Z57A 4BCKA 2W5HA 2C30A 5HGIA 4GITA 3LXNA 3HY5A 3UP7A 3UVPA 2R64A 3HJQA 1X37A 1U54A 2ZAMA 5KUPA 3CGOA 3DBDA 2DXIA 4ZK5A 3PJ1A 4TPTA 2QSFX 5AR7A 1MRYA 5BPYA 2XM9A 3C9WA 1K2PA 1E1VA 4W8DA 2X2MA 2PVLA 3SAUA 2IZUA 5E91A 5CVGA 4YPDA 3AOEC 1J3HA 3QYBA 2CWBA 3R9OA 2XF0A 5L8JA 2QQ8A 4YJTA 4BCHA 3WF6A 3FXXA 2J5YA 3GRUA 3OD6X 4RFMA 3UQFA 4L42A 3I79A 1OIUA 4W8EA 1WGLA 4AT4A 1AUAA 4RQKA 4DC2A 4QEBA 2WB8A 5C18A 3G9NA 5BX0A 3ATSA 3U61B 2B55A 3PUFC 4PDYA 3VBTA 3C0GA 4AQCA 4E6AA 4XP3A 3ORNA 4JDIA 1SXJA 4LJ4A 2W1DA 4D1XA 2LVOC 3QUPA 4AA5A 4BCQA 4AXEA 2KA6B 3MIYA 4GT5A 4RBLA 3MSSA 4JI8M 4G3GA 4S31A 2F5OA 1ZARA 3S0OA 4LF9M 3GU8A 2J50A 3ZUVA 3GUBA 1OKZA 3MESA 4KHPM 2C0OA 2HZ0A 5D12A 1J5EM 3WILA 3TUBA 3TEIA 5HCXA 3EIEA 4ASZA 4RQVA 4DV5M 4IAYA 3GI3A 1L8QA 4MAOA 3KL8A 1FGKA 3ZMMA 3IDCA 3ORXA 4AZEA 5J7BA 3DZDA 4Y46A 4JQEA 3HMIA 1H1SA 5JZJA 3HKOA 4O0SA 4HVGA 5BYLA 2Y6MA 1M14A 5CSVA 1DGFA 2ETMA 2HZIA 2DAMA 2BAJA 3L9NA 3NEWA 3RGSA 3EN7A 1YHSA 4NSRA 3WIKA 5EFQA 4L3PA 1U4DA 1DM2A 1WBNA 4O7NA 2BCJA 3UOLA 4Y72A 3GOKA 4EOQA 4FOBA 3REPA 5DR9A 2X0OA 4RVKA 4FNWA 5J1VA 4X62M 5C03A 4A7CA 4O83A 4W9WA 3FUTA 1XO2B 5JGDA 4ANRA 3AGMA 3UODA 2DNAA 4FVRA 2C99A 4MGKE 2ZDUA 2B52A 4ZIMA 3ROCA 2CKOA 3ERKA 4B6LA 4O0YA 3ZONA 2VO6A 3HHXA 3L8SA 3SBJA 3W0MA 3RGPA 3LMIA 3NVKI 2LVNC 4CQEA 5DMZA 3BOSA 5J5TA 4XX9A 3GENA 2DQ7X 3EFKA 5A46A 5HO8A 2RGHA 2YDIA 4X2KA 1Z5BA 2GNLA 4FL2A 1UFZA 3U9NA 3C0IA 3QD4A 4PDPA 1KE5A 3AOEA 2UZVA 2W5BA 5L2IA 4K0YA 4PMMA 5DR6A 4BCGA 4Z6YA 5C4LA 4J98A 2R3JA 2CHQA 2C5OA 4RIYA 2KTYA 1OL7A 3GFEA 2K0BX 1NXKA 2C5VA 3WZUA 2XCKA 4BDJA 4QP3A 1JOWB 2FOIC 3NNVA 3C7QA 5KMLA 5CZIA 1K3AA 3T9TA 4YTIA 4L43A 4MH7A 3GLHA 1MRUA 1N33M 3R8UA 3KC3A 2RSVA 4IM3A 4CRLA 4E26A 2W9ZB 4LI5A 5JQ5A 4BBMA 5CENA 4I93A 3V5JA 4OBPA 5ITXA 2YAAA 2QOIA 5EK7A 4NH1A 3PNYA 4I81A 1OGUA 4B3MM 1YSYA 4MD9E 5A4TA 3RP9A 3PFIA 3HJ8A 2IO6A 3ML1A 1R0PA 4ZPXA 2Z8CA 4OT5A 5IA0A 3U8WA 2XFSA 3VN9A 4FT9A 1F0QA 2G2IA 3QC9A 4CCUA 1T45A 3W33A 2YZLA 5EQTA 1VEBA 3OF0A 3AKJA 1WJ7A 3U6IA 4AUAA 1FJGM 1DS5A 5CAPA 5AIRA 3THGA 4MNEA 2A4LA 3DAJA 4OTRA 2RFSA 3BWJA 3KRWA 4ZY4A 4MWHA 4R7GA 4EYMA 5EM5A 3QU0A 4AZWA 4OTHA 3F9NA 4FKVA 1N32M 4R3CA 3HMOA 4AQYM 2XNEA 3T15A 4U97A 4ANMA 3SAVA 4AE9A 4DEEA 4JI1M 5C26A 4F09A 4NKSA 3CIKA 2C47A 4KINA 2XIRA 5IH5A 5IQHA 4J7BA 4BIDA 3JPVA 3DXPA 4YJRA 3WF5A 1NA7A 3AJIB 5KX8A 2WTDA 5LJJA 4L16A 3I01M 3OCBA 3QLGA 3I0QA 2CHVA 4QYHA 4W4XA 4YJSA 1EH4A 3VUHA 4FL3A 3ZH9B 4HJOA 5IEXA 4CFNA 2H5XA 4GU9A 5E9EA 5H8EA 1H07A 3PP0A 4DE4A 2YWVA 5B0XA 4FTMA 5L2WA 4RFZA 3BHYA 3W0FA 1U54B 4YLJA 1SG9A 2AC5A 1EFUB 1OL1A 3IKAA 4DFBA 3OXZA 4L9IA 1PJKA 1OKVA 1H1WA 4C62A 3H0ZA 4AE6A 1G8AA 3VVHA 2XMYA 2XM8A 5BQ0A 5BUEA 2WHBA 4FGRA 2CE7A 2EXMA 4USDA 2PPQA 1J1BA 4K33A 1O6LA 4D2RA 4YP8A 2XAOA 5J79A 3GCUA 2QO7A 2OXYA 2O3PA 3QL8A 3PIZA 1UU7A 1P4FA 3R1SA 4QMXA 3F6XA 5HE3A 3DDQA 3CTWB 1W0XC 4ZZMA 2F2UA 3KA0A 4GFMA 3VHEA 3TTJA 2WQBA 4XP0A 3G5DA 4DUYM 4FICA 4HNFA 3A61A 5HOAA 3AC5A 3Q04A 4N4SA 4D4VA 2W96B 4U5JA 1OBGA 4DEIA 2QR8A 2PE2A 4APPA 4RWKA 1V0OA 4OT6A 5HCZA 5HVYA 4IJ9A 4CYJA 2G8LA 5F4NA 1W5TA 1OKWA 1N75A 2I7QA 2XK8A 2XH5A 3DOGA 3E93A 4B08A 3KMUA 2X39A 2X0GA 3POZA 5HE0A 2LVQD 2LHGA 4TXCA 1JB0F 4NIFA 4OTPA 2BRBA 3LFFA 5AP0A 4LDTA 3A62A 3IGOA 2VTAA 5FTMA 3Q4CA 1SM2A 2PZ5A 3FWQA 1KV1A 4M12A 1DGHA 2Y0QA 2XNBA 5CI6A 4DEBA 4JI4M 3J80S 4JBOA 3SRVA 2QHNA 2GNFA 2YCFA 4O0WA 3OXTA 4ZJVA 3UVRA 5KMMA 5KO3A 2VU3A 5E8WA 5DFPA 4CGAA 2EUCA 4LF7M 5IZFA 2CFOA 3QQKA 5DN3A 4XS2A 5DBXA 3NCGA 3C5IA 5HICA 4ZOGA 4M69B 5ACKA 3FMHA 3Q52A 5GIOE 2WEVA 4GRBA 4CZUA 1TQPA 4FOCA 4I5PA 4FSTA 4IM0A 4CZYB 3HMPA 2QO2A 3VKGA 1O9UA 4YJVA 3U54A 4F7NA 2WSEF 3WYXA 5CEOA 4D0WA 4RA5A 2UUEA 3RZFA 5C1QB 1JBPE 2ERCA 5CALA 4L8MA 3LCVB 3PJ2A 4DR4M 2B0QA 5IH4A 2FYSA 3OBJA 4FTCA 3U6QA 2E9VA 2XKEA 3E5AA 2IZTA 4RSSA 3QQHA 4RJ3A 1WBTA 2ZV9A 3TKIA 2R3RA 3G6GA 3T9IA 4XK8F 5DA3A 2RFDA 4G6NA 3F69A 3I7BA 4CFUA 4AP7A 4CFXA 4EH9A 2OF4A 3KCKA 3HA8A 4CQGA 2YISA 2C1AA 3Q9YA 3UDBA 3R1QA 3EN5A 4EUUA 3H3CA 2CGUA 3A42A 5AV2A 3OWKA 3Q9ZA 1JLUE 4II7A 2G1TA 5EP4A 1PM5A 5JZNA 3MH0A 5KPZA 1O6YA 2GSFA 3NIEA 2AEGA 1JKTA 2JXNA 3D8LA 3GLGA 3U6DA 5CU3A 1H24A 4JMQA 3QCQA 4BZNA 3EN6A 1WFCA 3QGYA 5BYYA 3VS5A 3HZJA 1YQJA 4RIYB 4O7LA 3IGGA 1OIQA 3GPUA 1JKKA 2V7OA 4JQ7A 3R83A 3LVWA 2F57A 2B3TA 1J7LA 3S2PA 2NRUA 3QD2B 5FWKK 3GLHB 4EH2A 5AR4A 4OAVB 4DR6M 2PMNX 1Z59A 3HV4A 5M57A 5AUTA 4LYNA 2A98A 3FMNA 1KE9A 1GY3A 4EJNA 2DAGA 1GLNA 4GK2A 2OXDA 5D9HA 4OLIA 1ST0A 3W0QA 3WZEA 4MF0A 3TG1A 3GLIA 5AV3A 3V51A 3DBCA 3LW0A 5CXZA 1KWPA 3B9PA 4O96A 2BDWA 2VTJA 1XH9A 5AR8A 5EW8A 4FT0A 4IACA 3F82A 2P33A 3RPOA 3AMAA 4C33A 3Q9XA 3NWWA 4MNEB 1VG5A 3C4EA 5FLXS 1Q3DA 5LCJA 4IAZA 5CF5A 5F1ZA 4YZCA 4O0RA 4RJ5A 2XEZA 4R3DA 4TWOA 1D0LA 1Y8YA 3QA8A 3TM0A 3DKGA 2CHGA 2J5FA 4DCAA 4G2FA 3A60A 4D2SA 2H8HA 3UO5A 2CKPA 4A3VB 5KPTA 4UMUA 2DS1A 3UG2A 4EQMA 2PVNA 3O2MA 4WOVA 1K3WA 5CQUA 4G3OA 3VNTA 4F65A 2R3MA 2B1PA 4C4FA 2OKRA 2UXBM 2VX3A 2WU7A 4QMUA 2OPFA 2QHOB 3RFWA 2VWZA 3FY2A 4QPAA 4DG2E 3LCTA 1ZY4A 5FM3A 4A9SA 5IUIA 3TDVA 3D4QA 3CCNA 3EFJA 3CF0A 1HNWM 3V3VA 4D2VA 4IDTA 3V6SA 2XP2A 4I6FA 2EVAA 2DWBA 4RG0A 2JAMA 4F7JA 3EQFA 5AP2A 5FXRA 3KIOC 4GMQA 4AZTA 1LEZA 4BLCA 2LVAA 5BVEA 4BTFA 2UXCM 3NW7A 4U6RA 3GEQA 5F20A 4PWNA 5E8YA 5AP3A 2ITTA 1NHWC 4BDHA 3PG3A 1BMKA 4TKSA 3ZO1A 3UYSA 4CRSA 5HVJA 4PPAA 4IW0A 3FEGA 5GJFA 5J9LA 1ZMWA 5E6JA 4NJDA 3UZRA 1OM1A 1IN5A 1Y57A 2BDJA 3VBQA 2OFUA 3VS3A 2PZPA 2DI0A 4ZTSA 5CX9A 1GVNA 1UNHA 4OTIA 5FGKA 3R1YA 5KBRA 4IZAA 3VF9A 2Y6OA 2BZJA 1Q5KA 4JRNA 1IY2A 1SYKA 2XK4A 3OC1A 3BE9A 4BFMA 4XV2A 5AAFA 2IW9A 3LHJA 3W0SA 4JI9A 3ILKA 4UMRA 3NBIA 3S4QA 3U6OA 4X0MA 5IPJA 4TZRA 2ERKA 4JAIA 4CKIA 4C61A 3CE3A 5CEKA 2WO6A 3WBLA 3QHRA 4NIFB 3SQQA 3PDTA 4AW4A 3RTPA 4BJJA 1DGHB 3GRRA 3NFGB 4OU7A 4RWIA 2YEXA 2QG5A 5EXXA 2VO3A 3BLHA 3SRVB 4XG9A 3B2TA 3P78A 3UJNA 3QUEA 3GQIA 2OF2A 2WMQA 4FG9A 3OCTA 3OEZA 3OY3A 2YDJA 4LG4A 3P7CA 3COKA 3ZCBB 5HBEA 4Z8XA 4JX7A 2HKJA 2W1EA 2F2CB 2VWIA 1H8FA 4NZWB 2O01F 4BR3A 3ENMA 4BWKA 3QRJA 4A07A 3MB7A 2CV1A 4C4IA 4JBQA 4K11A 3FMKA 3P9JA 3EN9A 1J7KA 1IRKA 4E6QA 3CTHA 4AGWA 3ZZWA 4KB8A 2C0TA 1OAIA 4JI6M 1E94E 2UU9M 2C3IB 4W4WA 3PA5A 4OTGA 1BX6A 4PD2A 3SHGB 5C8MA 4FV3A 4G4RA 3ZLSA 4P5ZA 1YUBA 4FCWA 5ANGA 1VYWA 4QP7A 5DNRA 4QMNA 3HDMA 3I4BA 4H3BA 2HOGA 3OZ6A 5EM8A 2C5YA 5IQDA 1MRVA 1OPLA 4H58A 4P17A 1P3QQ 2HZ4A 3GU5A 1BYGA 3JYAA 5AEPA 2O8YA 4ASDA 2KRUA 3FZ1A 3MJ1A 3W0LB 4B9DA 1T46A 2C6MA 2O25A 2WXVA 3VHKA 2KZSA 1H1QA 3FZOA 4Y5HA 4YLLA 4BDDA 4DV2M 4O7WA 5GZAA 3B7NA 1RE8A 1XMQM 1OMWA 4KSQA 4AS0A 1FINA 2UZUE 5KE0A 1IA9A 3GLGB 2W4KA 5DG5A 1Y6BA 4O91A 4F99A 5HNIX 1R3CA 5CNOA 5GJGA 2JFLA 2QCSA 3KP1E 5DEYA 3LE6A 2F5NA 1Z6TA 3WZDA 4YO6A 3NYXA 3F3VA 2XK9A 1ZV1A 3CR0A 2YLFA 3PE2A 4FEXA 2NP8A 4U80A 4EI4A 3H10A 3SG9A 1AQ1A 2Y4PA 2QLUA 3PSDA 5GINE 2F9GA 1WAKA 4RJ7A 2DVWB 3BRBA 4GV1A 4FF8A 3L27A 2X4AA 2EUFB 4MM3B 4QHSA 1C7YA 4UB7A 2R45A 3FI4A 4R3PA 4K77A 3VONA 5FXSA 4FKWA 4IDVA 5DI1A 4GS6A 5CAUA 4CKJA 1HNZM 4DV1M 3GLIB 5KZ0A 5IA2A 4CYIA 3IO7A 4S32A 4I5HA 4XG8A 1OGYA 1NSFA 4F08A 3BCEA 3OUKA 5AUZA 4KIOA 2DHRA 4FTNA 5I4NA 2IWIA 4LF6M 4DYMA 2DAKA 3UO4A 2YN8A 3E3BX 3KS8A 2XBAA 3FTDA 4FV1A 3AGLA 4J8MA 2WIHA 2VNYA 3F7ZA 5A14A 4UXQA 1KV2A 4O38A 4G9CA 4NJ3A 1XMOM 4WHZA 4CJ6A 4GU6A 1OQYA 4CMOA 5HEZA 5KHWA 4GFOA 1L2DA 1Q24A 2OGVA 2UZWE 2ZVAA 3L8VA 4RC2A 3CY3A 2QOOA 2BIYA 3MMPA 3QCXA 4WT6A 4HLQA 3TWLA 3GLFE 4BWPA 3KF4A 4M0YA 2OOBA 4C4JA 3LLAA 3A2CA 3ZSIA 2A2AA 4YHFA 4OAUC 1ERKA 4FV0A 1VDLA 4D4YA 1GJTA 3SHFA 4WURA 4FW9A 3ZDUA 4PDSA 5J9ZA 2JWSA 2VZ6A 5G1XA 4LRMA 3K5VA 2PUNA 4FZ6A 3CJFA 5AV1A 2G2HA 5EXTA 4O0XA 3HV3A 4KIKA 3GPYA 4F9YA 2PVFA 5CQWA 4NFNA 4PMTA 4S33A 2J9MA 3J2PB 4Q9ZA 3QX4A 2A19B 2R3HA 2KNZA 4QO9A 3TKUA 1KE6A 4O1PA 4WUNA 1JKLA 3EN4A 5L8LA 2YIRA 4JAJA 3S00A 2UZEA 4FV6A 3PP1A 4BCPA 3EJ1A 3PPKA 4ALUA 5IUHA 4IM2A 3KF7A 5CAVA 3LFCA 3P1AA 1OPKA 4LMUA 2J7TA 4ITIA 1W83A 3V5QA 2L7IA 3MJ2A 4FKSA 3PVSA 3BX5A 4AOIA 2PZYA 5BVOA 4ANBA 2VTLA 3TZMA 2VWWA 1EIJA 4NXNM 4JR7A 4OTDA 3IS5A 1Q8ZA 1SVEA 4QTCA 4ASEA 4BGHA 3PSBA 1RJBA 2ITVA 3BEAA 2OO8X 3A8WA 2QOBA 5AFVA 4L46A 3ZTXA 4IVAA 4FNZA 2W1HA 5AX9A 4F9CA 2VD5A 3DDPA 4C58A 1XJDA 4GEWA 2W1IA 4GK4A 3W2PA 5HU9A 1YXXA 2QOHA 4BI1A 2C4GA 1YW2A 3PJ8A 4JBVA 3UVQA 2CMWA 2GHLA 4PRJA 1H08A 3SXFA 5EXPA 2HW6A 4TN6A 3FHIA 4GT4A 4EUTA 2CGXA 3G6HA 3NWLA 3R63A 1NVSA 2W99B 4BJJB 3GBZA 2VDBB 1KFVA 5T68A 1WXQA 1WZYA 5HO7A 4XMOA 3W2CA 4DEDA 4DAWA 3WHLA 5FEDA 3DK7A 2R2PA 4R7BA 4ZMFA 3HA6A 4G6LA 4NK9A 4CFFA 5AP5A 2ITNA 4R8QA 2Y4IB 3FUXA 3C5UA 4E4XA 1WGNA 4JIAA 5KMIA 4HYSA 3I51A 2WMBA 2Y9QA 5JI2E 3HP2A 1W2DA 4EYJA 4DFZE 1Q97A 3FQEA 3ZS5A 4EK3A 4OGRA 4GRIA 4E1ZA 4LRSA 3VUDA 3LJ2A 1UWHA 3HHWA 4ZEGA 1NHGC 3KVXA 4O27B 2QOKA 3NCZA 4BHZA 4NRVA 4JDJA 3VRYA 3LJ0A 2ESMA 2RRUA 4QMYA 5A4QA 1WVYA 4QPMA 3S95A 4E8AA 4S34A 3CPCA 4PQNA 2BMCA 2OJJA 1JKSA 3SW4A 5JN2A 1YVJA 4I20A 5CYIA 3A7JA 4JXJA 3KXZA 4XBRA 1OVEA 1E1XA 2J7OA 1W98A 3E21A 4ERWA 3TNWA 5EDPA 4EWHA 3GFWA 1M7NA 4ZSGA 5KKRB 3M42A 4I5SA 1YLAA 3FLQA 2ZB0A 1L1TA 4AGCA 2X9FA 2LHCA 3IOKA 4MXCA 2OLCA 5LVOA 3LZBA 3PIXA 5IT9S 4IWPA 4CFMA 5KBQA 1A06A 2WMRA 4UEUA 3FMLA 3R7OA 4KSPA 4X3JA 1U46A 2LXEA 4WSYA 5IG1A 3TIZA 5L2SA 3Q3BA 5ETCA 3C3DA 4YZMA 3DKOA 5EI6A 4FV4A 3ULZA 4ZLYA 3PWYA 5CZHA 4QMZA 3SYLA 1PXIA 4YY3M 4JG7A 4MUQA 4G6OA 5FQDC 1Q8WA 2EB3A 3F5XA 5EYDA 1NNUC 3G51A 4QMLA 3PUPA 1XHBA 3ZO4A 5LMBA 3V01A 4EKLA 3FXZA 2QBYA 5KZIA 4CIZA 5A6OA 3WF9A 5DE2A 2X7GA 4M15A 4QMQA 1PMVA 3CQEA 3DA1A 4G4OA 3ZZEA 3ATTA 3PVUA 4K6ZA 3T3VA 2X4FA 4ZSEA 4TYHA 2CLQA 1ZMUA 4JN6A 2ZYBA 3VBYA 2F49A 4E7WA 3UK6A 4EOLA 2WD1A 5L6OA 1PGYA 2J5EA 3GC8A 2E5LM 3LMMA 4DV4M 5AV4A 1VQ1A 4XEYA 4EH7A 5AJQA 4FZAB 1PYEA 4PL5A 3VQUA 2HWJA 3JUHA 5J95A 4LZJA 3LFDA 2R3IA 4FG8A 4G4NA 4IHPA 2UW3A 2X0QA 1I09A 4AG8A 3QTIA 2BVAA 3DU8A 3C13A 3G15A 2JD5A 1NJGA 5H8GA 3L28A 1M52A 3IW5A 3ZC6A 4KBAA 2J0KA 3TE6A 3FTEA 4JV5M 5AWMA 5BYZA 3LCKA 3BL7A 1UU9A 3FLZA 3A99A 4F1MA 3OP5A 1NVQA 2WMWA 1UKHA 4FKJA 3SKCA 1FQ1B 2OH4A