1ZMVA

Catalytic and ubiqutin-associated domains of mark2/par-1: k82r mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
313
structure length
293
Chain Sequence
GNYRLLKTIGKGAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 94
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmvA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmvA01
5HO8A 3F61A 3OUNB 2RFSA 3RPSA 3FE3A 3BX5A 3T6PA 2YCQA 4LG4A 4ZJIA 5E92A 5I9ZA 2QI8A 2VO7A 1JKSA 5AV3A 4AW5A 3WE4A 3HYHA 4ZOGA 3LCKA 3LHJA 1DAWA 4X3FB 3ZTXA 1GZNA 4F0FA 4DHFA 3I0OA 3NYOA 1WR1B 4FSTA 4XS2A 4ZY5A 4EK3A 3AGMA 1FQ1B 2VTQA 1Y91A 1U5RA 3HKOA 1J7UA 1A5TA 4RVMA 2IWIA 1YDTE 5DEWA 3R7UA 3KF4A 3ZLWA 5KMMA 5IQGA 1YOJA 2WMSA 3QTRA 4G6NA 4MF1A 4PL3A 3C4WA 3R1YA 4AOTA 3I5ZA 4FNYA 2P4IA 2QG5A 2PUPA 4PV0A 2G01A 3EZRA 3PFQA 3I7CA 1Y8GA 2C30A 1ZLTA 3LMGA 4ZTQA 4O27B 3V8SA 2JAMA 3ZS5A 2VGOA 2GQRA 1H1PA 3MPTA 1M2PA 3HA6A 3PSCA 4RFYA 3KULA 4GG7A 4XUFA 4XG2A 4CFVA 2BR1A 5AR8A 5BUEA 1IAJA 5H3QA 4XG7A 2WTWA 3LCUA 4GL9A 3PVGA 3MVLA 4PDSA 5FTGA 2BMCA 4OTDA 5J7HA 3NW7A 4BI1A 2UZBA 5A4LA 1C7YA 2XF0A 1OMWA 4TYEA 1WBOA 2OO8X 4YC3A 5E1EA 3W10A 2G2FA 1UNHA 4YHTA 4J71A 5HCYA 3P7AA 1UV5A 4M14A 4AQCA 5J8IA 4XP2A 2XKFA 4MD9E 3D2KA 2W1GA 3O7LB 3PLSA 2EB3A 4WKQA 4DINA 3RCJA 4EH6A 3I0QA 3LPBA 3D94A 4QTBA 4KUJA 2X6DA 2XH5A 4I5CA 4JBQA 4O1OA 1KE5A 5FDXA 4J52A 4OTPA 1J1CA 2YHVA 4FBXA 5IPJA 4KA3A 3H0YA 2K9DA 3KVXA 4R1VA 4JR3A 3FEGA 3LXLA 3NAXA 4BCKA 5KBQA 3L8VA 5DR6A 3R7IA 2YACA 3ZBXA 5HTIA 3MPMA 4MBIA 3BYSA 2QQ7A 5AP7A 3VC4A 2CNQA 3BQRA 1KE8A 2IVUA 1P5EA 2OH4A 3CR0A 5KHWA 4RJ8A 5FP5A 4F1OA 5CVGA 3C13A 2WIPA 1Q61A 4AS0A 1XKKA 4FKLA 4DFNA 3ZDUA 5M4CA 4RIXA 5EQEA 1APME 4AGDA 3KVWA 5L8JA 3UIBA 2GSFA 3WZJA 3COHA 4GK3A 5M07A 1H01A 4DE4A 4YLJA 1SVGA 3ZO2A 2VD5A 2W0JA 4F0GA 4D0XA 4IAFA 2J5EA 2JY8A 5KMNA 1Q99A 3OC1A 3KKVA 4WNOA 2XK7A 1ZY4A 4AE6A 4RLLA 3E7OA 3DV3A 2VTSA 2WMUA 5AUXA 4RZVA 5EOLA 3BHVA 2R64A 5CZIA 2V5QA 5KBRA 3MH1A 4ITHA 3IGOA 4FZFB 4YNEA 4EK4A 3D5WA 2YN8A 2PUIA 2GQSA 1BX6A 3QCSA 4NW5A 3A7GA 2E9UA 4FKQA 4IX4A 3UNZA 5DE2A 4EQMA 4F63A 2C6DA 2ONLC 1M7NA 2YJRA 3EFJA 4KD1A 3C5IA 1YOLA 3OHTA 3D4QA 2BWEA 3OEZA 4PDPA 3VBYA 3KC3A 3SW7A 2CCIA 3U9CA 3K2LA 4RWIA 4E6AA 4YMJA 4OAUC 3LXPA 2VTPA 5HI2A 1MQ4A 4A9TA 3K5VA 4X2NA 5DGZA 4ZY4A 5DIAA 3IW7A 2BZJA 1SM2A 4FKPA 3KU2A 3NPCA 3MY1A 3TN8A 4U5JA 5ITAA 5BUJA 1B6CB 5ANGA 2X7GA 4YP8A 5EHYA 4NM3A 3S0OA 2JDRA 2XVDA 4IHPA 2OZOA 1PXIA 3IW4A 1H0VA 3O7LD 3Q6WA 5BMSA 5BNJA 5L3AA 2YERA 3W1FA 3NR9A 2PWLA 4ZTLA 3E63A 1B39A 1ZARA 3LW0A 3C4ZA 3ORMA 4LUEA 2ZM4A 5JFXA 1PXJA 2GCDA 5C26A 5TKDA 3SLSA 5LXMA 2LVAA 1XO2B 4KB8A 4HVDA 3MFUA 4OBQA 3DKFA 2J0MB 2XEYA 2OLCA 4YJTA 4AU8A 1IM2A 5A4TA 2ETMA 5IMXA 2UZWE 4N6ZA 2W17A 4QPAA 5A4EA 3P7BA 3L9NA 4LQMA 5FP6A 4ZP5A 2RKUA 3QKLA 3ZFYA 5JK3A 2KULA 3DBFA 4JQ7A 4R78A 3SGCA 4XRLA 3EQRA 2WPAA 2CGWA 2OF4A 2R5TA 3Q4TA 4APPA 4X2GA 2XK4A 2I0HA 3OT3A 4FEQA 4FKWA 4EJ7A 2AYPA 4M84A 4A9RA 2B1PA 2R7IA 1T45A 1UVRA 4OT6A 4QQ5A 4YC8A 3U51A 1A06A 2OJGA 3KXHA 3JXWA 4JIKA 2VTIA 4F70A 1SNUA 2G2HA 2IVTA 3KRRA 1VEKA 3VS2A 5HLWA 1STCE 2ETRA 3CTHA 4LV8A 4WRSA 4YJNA 4QOXA 3WZEA 4BL1A 3W55A 2NRYA 4GJ2A 1UA2A 1YI4A 2MROB 2HCKA 2R3JA 3R28A 2W5AA 5KMJA 4L9IA 2VTRA 4FIHA 4Q2AA 3FL4A 3U55A 1UWJA 3FXWA 3FLWA 3Q3BA 4FIIA 4X21A 2IN6A 5HOAA 4NH1A 4AT5A 5M57A 4NU1A 5HE3A 3TZ7A 3HP2A 4APCA 2Z02A 3UJGA 2YIRA 4FV7A 4O7VA 4Y8DA 1PKDA 1MP8A 2BALA 1JSVA 4TWNA 5L6OA 3E64A 4K77A 4G9RA 2W1EA 1YI6A 3QU0A 4FX3A 3V8TA 3TNWA 1YHVA 1TQPA 2I40A 3IKAA 5EG3A 1IXSA 1DV0A 4G17A 5HTCA 4FG8A 4AT4A 1YRPA 5E8ZA 3RK5A 2OKRA 3RINA 4ONAA 4AGUA 2F49A 5AP5A 3TJDA 4QRCA 4GU9A 4IACA 2GPHA 5EM5A 4WG4A 4DG3E 1JVPP 1XH6A 1OKZA 4F7LA 3S95A 2A4LA 4KKGA 5I3RA 4EH7A 3MN3A 4MNEB 3P08A 3HDNA 2J51A 4FNZA 4XG3A 4YBJA 3JUHA 1BYGA 4J98A 2YWPA 3W32A 2PE2A 2J0LA 3WIGA 4BRXA 4E4LA 5F95A 2JY6B 3L8XA 3MIYA 4TKSA 4NW6A 3KK8A 5FEQA 2VTNA 3ZFXA 4AZEA 4BWKA 5IU2A 5JT2A 1OL6A 3FDNA 3E21A 3QUDA 3EHAA 3MJ2A 4F99A 4O1PA 4PP7A 2JDSA 3DGKA 1CM8A 4N6YA 5ANJA 1ZZLA 4DT9A 3OVVA 3RKBA 4WUAA 4MAOA 2HK5A 3UO6A 4J1RA 4E4XA 2JZ0A 2GS6A 4W9XA 5DLSA 5IQEA 4HZSA 1U4DA 2HWPA 3GCVA 5M06A 2JAVA 3EQGA 4ITJA 4FTIA 5CI7A 4KRDA 4FZ7A 5BPYA 5CNOA 4MKCA 3EQIA 4F6WA 2B54A 2H34A 4D2WA 4AFJA 2K0BX 4FTKA 2Q83A 4FK3A 4EOSA 2OZAB 5DT0A 5IA4A 4RX7A 2VTHA 3MH0A 4IB5A 2BAKA 4DN5A 1GO5A 4M8TA 4QP9A 2A19B 3UYTA 4DEEA 4D55A 4YURA 1ZOEA 4NFMA 5B0XA 2I1MA 4PP9A 4O0UA 3VBWA 4A9SA 3LJ1A 4I0SA 4ZZMA 3VVHA 4D28A 4EBVA 2X7FA 3C51A 2DS1A 3OCSA 4BDDA 3ZC6A 1E1VA 3QXPA 5HE2A 5TF9A 3UVRA 4ZJVA 5DT4A 4YTHA 1CSNA 1OUYA 2XEZA 1YOMA 3E3PA 5FDPA 3DBCA 5M4IA 2B0QA 5E4HA 4OUCA 2QU5A 4IAAA 5J1VA 3OEFX 5IH4A 5LMAA 5FXRA 4LOQA 3SRVB 4DTKA 5AR3A 4RIWA 3TG1A 4EOKA 3QRUA 1WBVA 4U81A 4UX9A 2JBPA 1OIUA 5DA3A 2XCHA 3ENMA 3G90X 3KMUA 4IX5A 4XG4A 2LAVA 4YLLA 4Z7GA 4CKRA 3QQFA 3V5PA 1MRVA 4U80A 4ZEGA 3NEWA 3FUPA 4I5HA 4C0TA 5EQPA 3U87A 4KS8A 5F9EA 3QWKA 4BDEA 4O7NA 2NRUA 4M13A 4RWKA 3F3UA 4YJOA 1J3HA 5I3OA 1A9UA 3RGFA 3KXGA 5LJJA 4GSBA 4CNHA 4MQ1A 5LMKC 1ZZ2A 2F7XE 1SG9A 4BDJA 2CN8A 3QYWA 3BU5A 3R00A 4KS7A 3ZEPA 4KIOA 4YC6A 2YITA 4D1ZA 2YCSA 3EL8A 2WQNA 4WBOA 4XG6A 5I4NA 3CSVA 3BZ3A 3F5PA 3BBWA 3R01A 4L00A 3JY9A 4BCGA 5CEMA 3PVWA 2O0UA 3QTXA 4GK2A 4HCVA 4U9AA 2FYSA 3LJ0A 4KSQA 4QYFA 5DNRA 5F1ZA 2VTLA 4QP1A 4C4GA 1FBNA 1JQHA 3F3VA 4UMQA 3RWQA 3V8WA 3PXQA 4C34A 3TV6A 3L9LA 3UC3A 3GI3A 4H3PA 4GW8A 2JP7A 4BDGA 3IONA 3HAVA 3FMDA 1FVRA 3PG3A 3VRZA 5HU3A 3R73A 2YLEA 4FR4A 5HVYA 3MWUA 5M4UA 1WFCA 4FTJA 4ALWA 1OIYA 5E8XA 3M42A 1F5QA 1WVXA 2YAAA 3GB2A 4ID7A 3FZSA 5FM2A 4FZAB 3CIKA 5CU4A 4WO5A 3FI3A 4EQCA 5ACBC 4DEIA 4EUUA 4IJPA 1KE7A 2WO6A 3ACJA 2VX1A 4NCTC 2QOHA 4FL1A 1VEBA 5ICPA 4C57A 1H25A 3FLZA 3KY2A 3PIZA 4NIFA 1UU7A 4G34A 4RX5A 2XM8A 5KZ0A 1NA7A 4FUXA 2YM8A 3CCNA 4NZWB 4PPBA 2RG6A 4BCNA 3QFVA 5HBJA 3DFCB 2WB8A 4GFOA 4QQJA 1TQMA 2PVNA 5E91A 5AUWA 4XX9A 4O81A 1MQBA 2JIIA 3IHPA 3HMOA 4RSSA 2WMTA 4YTIA 4CV9A 3NW5A 5KO1A 1IA9A 4J8MA 3QTZA 3F69A 4FZ6A 3QTSA 3EFLA 4PTEA 4AW1A 5EYDA 5BYYA 5CYIA 4IAYA 1FGKA 2JIUA 3UPXA 3PTGA 4BWXA 2Y4IB 4QQTA 4YU2A 4V04A 4MK0A 1F4IA 3AQVA 1PXPA 4ANMA 3IW6A 3F2NA 3PG1A 3NS9A 5ANEA 4H1JA 2GHMA 4PMSA 5HNGA 3FKNA 4EQUA 3UZRA 3HMIA 3KEXA 3Q96A 3W16A 2G9XA 5ACKA 4JL9A 4AACA 2YA9A 4XRJA 1FMKA 5JZNA 3WOWA 3A2CA 3VS7A 5HG9A 2HZ0A 3F3ZA 3OWKA 3S00A 4J97A 4O7WA 3BEAA 3R7OA 3FRIA 1QPCA 4BDIA 3FY2A 3H10A 4EZ5A 2UZOA 4LGDA 4IAZA 4DEGA 1BI7A 2BKZA 2KNVA 3N4VA 1R1WA 4E20A 2Z60A 3P1AA 4UZDA 1AQ1A 2UW3A 4HPUE 4QTAA 3ZCLA 2FA2A 5DYJA 4FT3A 4XH6A 3DK3A 5C27A 5GJGA 3BLHA 4XG9A 3P86A 3ODZX 3TT0A 4D2TA 2IVSA 3EN7A 4UN2B 4YNOA 5AJQA 2QNJA 3QRKA 3TWJA 1T43A 4MVFA 4MCVA 5JRQA 4FGRA 4O22A 5HE1A 3CXWA 3OROA 1PXNA 2YABA 3S2PA 5K3YA 4BDBA 3LFNA 2NO3A 2BRBA 3LFQA 3V5LA 4C4FA 4XCUA 2VNWA 4AE9A 3A4OX 3KCKA 4GEOA 3OWJA 4GKIA 5I9XA 3IGGA 2RFDA 3QQGA 2FSLX 3POOA 3PY0A 5M4FA 1UNLA 3HMNA 3EQFA 3HUCA 4I94A 5EK7A 3I79A 4PY1A 4W4VA 5H9BA 3SW4A 3HDMA 3TZ8A 4A4XA 4B8LA 5I0BA 1OTRA 2C3IB 3DB8A 3FXXA 2WD1A 4RIYB 1H08A 3VS1A 5K9IA 2B7AA 3D7ZA 4M12A 2OJJA 4CFWA 4D2SA 3QD3A 3L8PA 2GNLA 1H1QA 4FTMA 5J9LA 3NUUA 2Z7SA 2EXCX 3T9TA 2UZVA 4W8EA 4S34A 4ZIMA 4F9BA 2C6IA 3FY0A 1J91A 1PY5A 5C4LA 4Y95A 4C35A 3AMAA 4WG5A 3RAIA 3PYYA 3GC8A 5HX8A 2EKFA 4W9WA 3QUPA 3OXIA 5AUZA 5HORA 3LLTA 2JEDA 3FRHA 3E62A 2CDZA 3Q32A 1ZXEA 1URWA 3C0HA 3FMLA 1VEGA 4I41A 4ZSEA 2JFMA 1IA8A 4QPMA 4V0GB 3LFDA 3N4UA 4FL2A 4ANLA 4G31A 5IUHA 1VG5A 4GFMA 4YTCA 1KOAA 4HNIA 2CN5A 2PE0A 4ASEA 2HXLA 4AAAA 4EHZA 5D1JA 4PNKA 1KV2A 1LEZA 3A7FA 3AD5A 5FXSA 3TV4A 2NPQA 3UZPA 5L6PA 1PMVA 4A9YA 3GU4A 5CU6A 3KN6A 4FODA 4U8ZA 5IDNA 4QMOA 4GEWA 5T6KA 2RSVA 4O84A 4L45A 3ET7A 1PGYA 1BL7A 1V0BA 3D83A 3LXKA 4FV8A 2GHGA 2YAKA 3RP9A 3SOAA 4AX8A 3EYGA 4DFBA 2PE1A 3Q4UA 3D5XA 4LM5A 4AN3A 3FZPA 5J5TA 1NY3A 2IVVA 2QSFX 3P5KA 1KWPA 2X39A 3ORPA 1DS5A 3ACKA 3IS5A 4FI1A 3ZHPC 2IZSA 3W2SA 4GIHA 4EL9A 4A7CA 3E8CA 4NM7A 1OM1A 2RF9A 4ZAUA 4G6OA 3W2QA 2FO0A 2IZRA 4BGQA 3RBWA 2QR8A 2YIQA 3LZBA 5AM6A 4YZDA 3BE2A 3OCGA 2DUVA 4AA5A 4F0IA 1KUTA 4DLIA 4EOIA 3ZZEA 3JVSA 2OXYA 5E9EA 3LAUA 4L68A 3DA6A 1PYXA 3R2YA 5JRSA 3EZVA 4D4RA 3DY7A 3Q9WA 2J0KA 2X8DA 4DGMA 1TTEA 4TN6A 3ELJA 3LFSA 2IW6A 2YIWA 5E8UA 4M97A 4EH2A 2CHLA 1Q97A 2BZIB 5BQ0A 4I1ZA 1TKIA 2IW8A 4BKZA 1GIIA 2EB2A 5CEKA 4S31A 2OF2A 5EI6A 3BLQA 3QCQA 2ZM1A 5LWMA 5L2QA 2W99B 3F5UA 4ZY6A 3F7ZA 2XRWA 4XMOA 2ITOA 2PPQA 4JDKA 4ZSGA 5AUYA 4MNFA 4D2PA 1YW2A 2MGWA 3LFBA 3KULB 1JPAA 4UXLA 2YEXA 5AUTA 3DOGA 4TYJA 2W96B 4FIFA 5HD4A 2R3OA 3TJCA 3JS2A 2OJFE 3NUNA 3U6IA 2ITZA 2DI0A 1YXVA 5IQIA 5AX3A 2VO0A 2OO9A 4U0IA 5AV0A 4FICA 3RNYA 4BC6A 4JDIA 2HOGA 2XIZA 2OGVA 3G0FA 4KBAA 4O0TA 3ENHA 4H39A 4WUNA 1UU8A 4H05A 4DTAA 5AP0A 4TYGA 4IEBA 3DLZA 4FIGA 4CCUA 5A6OA 3CJFA 4JIAA 4F64A 3IDBA 5HESA 4QMNA 3AT3A 4AA0A 3SG8A 2MJ5B 4M0ZA 1OL7A 1HT1E 4QNYA 1P4OA 4WSQA 2GNFA 4OAVB 3GQIA 2XKDA 1K3AA 5HCXA 3DS6A 4G3OA 3UG1A 3ZZWA 3MH3A 4MH7A 2YM4A 3ROYA 2WTKB 4M68A 5D7AA 2BRMA 3SHEA 4F1MA 3ZUVA 4O2ZA 5JEBA 4GUBA 4RWLA 1G5SA 3PVBA 2UW6A 1SMHA 1FVTA 2HENA 4DITA 2F2CB 2OJIA 3MW1A 5IH6A 1GZOA 2UVYA 3DQWA 3AT4A 3L9PA 4FIJA 1XH8A 3TDWA 2ACXA 3C4EA 4K18A 3Q9YA 1JSTA 1PF8A 1ZOHA 3QGYA 3QRTA 1R78A 4QTCA 5DHJA 4C4IA 5KMIA 5EQYA 2O25A 5T3QA 1G41A 3ZO3A 4BTMA 4F1TA 3CJGA 4EOMA 4RIXB 4C38A 5HLNA 4CFUA 2PY3A 5IISA 4FT7A 3E88A 2I0YA 1OITA 2VTJA 3Q60A 4YZNA 2PUNA 3HRCA 4JG7A 3GGFA 3Q53A 2W4KA 4RVLA 5EW3A 2C6MA 2X2LA 3AC4A 4FNWA 4MHAA 1EH4A 4M3QA 4NK9A 4RQVA 5E90A 4WSYA 1LEWA 4UMUA 3PXZA 3W2RA 3ITZA 5A4CA 4BDKA 2W9ZB 3AXWA 4RX9A 4LMUA 3PIYA 3V5WA 3AOXA 2UW5A 4QMLA 2ZM3A 2WTKC 2DAGA 2FVDA 4I6QA 3ZMMA 4C36A 4ACHA 5AR5A 1ZWSA 1U5QA 2V7OA 3IDCA 2RFEA 3R7GA 4FV4A 3FHRA 4XV2A 2XBAA 5J9ZA 4GV1A 4FYNA 1RJBA 3SVVA 5G1XA 3SOCA 5DPVA 2Z7QA 3FJQE 5TOZA 4LV5A 3DAEA 1W0XC 2PVLA 4WNMA 4ZSJA 3R71A 4ZTNA 1E94E 4MBLA 2Z8CA 2JDOA 3KRXA 4JDJA 4RPVA 3G15A 4PWNA 1BUHA 1YDSE 5K4IA 3DU8A 1S9IA 3MPAA 4JQEA 3O17A 2DYLA 3VULA 2UZEA 2R3QA 2PTKA 3FI2A 3I7BA 1IG1A 3UG2A 4YTFA 3M11A 2ZAZA 3FMMA 3PXRA 5LVLA 3RCDA 3WIKA 3DJ6A 4R71A 3E8NA 1YXXA 3QQLA 4FTUA 5KHXA 2L2DA 4B8MA 3NMUF 4HW7A 5KUPA 4UEUA 5TE0A 4WOVA 2AC5A 4LL5A 3QZGA 3LFCA 4ERWA 1XH9A 2VN9A 2HY0A 2ZDUA 3GQLA 4PPAA 5HE0A 1G3NA 3LJ2A 4AZSA 5J9YA 1W83A 2WIHA 1TVOA 1UKIA 5AIRA 5L8KA 3OUKA 3E87A 3FLSA 3PIXA 4G9CA 3BQCA 2JUJA 4IC8A 2HZNA 4X3FC 2C1BA 4AN9A 4N4SA 3FWQA 5JGAA 3TDVA 4ZS0A 5CTPA 2OWBA 4O6EA 5A46A 3PXFA 2ZVAA 3F88A 1OUKA 3KXNA 4QMVA 5KMKA 4RVKA 4OLIA 4FKGA 2DKLA 3FC1X 2AC3A 3BHYA 4FUYA 5CVHA 5J95A 3O8TA 4FKIA 4GH2A 3QQUA 3WARA 4BICA 2W7XA 4UALA 3PA3A 2PMNX 5I9UA 3ZC5A 1PRYA 4NM5A 1GOLA 2BIKB 2ZTDA 3H0ZA 4ACDA 5FRIA 4UWCA 3VHEA 5AR7A 3S3IA 2VWYA 3KQ7A 5EW8A 4GVAA 1E1XA 4FMQA 4P4CA 4QMSA 1CMKE 2P33A 5IMEA 1AD5A 5E8TA 5CAVA 2PU8A 3GUBA 3ZM4A 2PYWA 3CQUA 4DGNA 4R7HA 4G2FA 3MY5A 3QXOA 5J87A 3R8MA 2AUHA 5LWNA 5IQDA 3MSSA 2QOIA 3MIAA 5CALA 1V1KA 1FINA 3AT2A 4G5JA 4KIKA 3R9HA 4Q9SA 5IUIA 2ZJWA 2UVZA 3OY1A 5AR4A 1OIRA 3TL8A 5AFVA 3VAPA 5AADA 1OL1A 4YO6A 2W1HA 4FTTA 5HQ0A 2H5XA 5L6WL 3TKIA 3VUKA 2B53A 2X0GA 4F7NA 4QMPA 3A60A 5F20A 2B55A 1VZOA 2VTMA 3CGOA 3DCVA 4R3CA 4DGOA 2WU6A 4FV2A 2SRCA 1XH5A 2ETKA 1H00A 2ZDTA 2CJMA 4FVRA 1YI3A 4BI2A 5BVKA 4HVHA 2I6LA 3GVUA 5JFVA 2EU9A 2XYNA 3U4WA 2VWVA 1ZY5A 2W5HA 3ZRKA 1WBNA 2B9FA 3HNGA 4DTBA 5ANIA 4FV5A 2PVKA 3R6XA 4TY1A 3A62A 1M14A 5HG5A 4W4YA 2R3GA 3R30A 4GG5A 4L3PA 4CYIA 2QD9A 4I23A 4X2KA 4YPDA 5HZNA 3G6GA 3E46A 1M52A 2UW4A 2GNJA 4FL3A 3EOCA 3GCSA 3MMPA 1UU9A 1Y6AA 3Q52A 3RZBA 2EXEA 3EB0A 4BZOA 5IQCA 3C4FA 4FK6A 4C3FA 4EK5A 5CEPA 4JG6A 2QOLA 4KBKA 4O0XA 4FTQA 1J7LA 3RZFA 2DZLA 2QO7A 3FMHA 4FSMA 3UODA 3P23A 4AOIA 5FBNC 2PMIA 5E1SA 4F9AA 2Y0AA 4JT3A 4DFUA 3QC9A 5HVKA 1Y8YA 2YZAA 4YBKA 4XV1A 3OWPA 5CVFA 3VUHA 5T68A 4EONA 4DH1A 1NW1A 3ZRLA 3R7EA 4PMMA 4MWHA 4QMTA 3F82A 4JI9A 1AIPC 4GYIA 4EC9A 4E73A 1QPDA 2F4JA 3VS4A 1PMUA 3K3IA 4BCOA 4K11A 4ZMFA 2JKOA 4O83A 2HZIA 5IA1A 4RA5A 4BTJA 3RPVA 4YJSA 3BV3A 3SXFA 4YR8A 4YZMA 1GJOA 4EH9A 5AV2A 4G3GA 4N70A 4OTGA 1OPKA 5HIDA 1H24A 4L53A 4BKJA 2UZLA 3UPZA 3HAMA 3F2AA 4QP4A 5EKNA 3FQHA 4DA5A 5DR9A 3NUYA 4NEUA 3ZSHA 3REPA 4E5AX 1H07A 3TCPA 1YWVA 4CMTA 2CKEA 4FSNA 4DC2A 5M44A 3C4XA 5HNBA 3OXZA 4IAIA 4LRJA 2RRUA 4OBOA 2BHHA 3TUCA 3U54A 5FTQA 5EYCA 4A4LA 5BVDA 3WZDA 1GZKA 3TUDA 3FYJX 5CEIA 1OVEA 5CU3A 3G33A 4TXCA 4XP3A 3BIZA 4EH3A 4F7JA 1W7HA 3HGKA 1H0WA 4BHNA 4CVAA 3Q04A 3A61A 3BYMA 1U54A 3BWJA 3QHRA 4CRSA 2PVJA 1GIJA 3ID6C 5IQBA 4BYIA 4IW0A 3LM0A 4F9WA 4HYUA 3BEGA 2YDIA 3OTUA 2ONLA 3MV5A 4U79A 3FZTA 3BI6A 4CRLA 5D11A 2WMVA 1Q8ZA 1V0PA 4RWJA 3VF9A 4Z16A 4FEUA 5AV4A 1SVHA 5DRDA 4HVSA 2UZTA 1JWHA 2CGXA 2JKKA 5AAGA 1QZEA 4H36A 2PMOX 2XP2A 3LCTA 2HYYA 1UNGA 3HVCA 1ATPE 5IKWA 3DJ7A 2VU3A 1JAMA 5ETFA 3PP0A 1H8FA 2OK1A 4C8BA 2A27A 3F5GA 2C5NA 5KKRB 1L8TA 3CTJA 4GS6A 5DR2A 1OKYA 3LMHA 3A8XA 4MX9A 2BFXA 3ANQA 3RAWA 4U40A 4DEAA 5C1QB 2J7TA 3MGYA 1JKTA 5I5ZA 3MFTA 4FYOA 4UWBA 4V05A 3FMJA 3BBZA 1UU3A 4C62A 2I7QA 5FBOA 1WCCA 3HX4A 4WBBB 4FEXA 1EFUB 1XHAA 2J6MA 1AGWA 1M7QA 3GXLA 1CDKA 3OW4A 3SV0A 4N57A 1NXKA 4LYNA 3Q5ZA 4USDA 4R7BA 1OBDA 1DO0A 4ACMA 3LE6A 3P79A 4AA4A 1WZYA 1IASA 4BCFA 5ETAA 3AC1A 5EI2A 4O0RA 3DXPA 3ZLYA 5JFWA 2F9GA 4WNPA 3EN9A 1MRUA 4D4YA 2A0CX 3FYKX 4DFXE 1JSUA 4FV3A 3CD8A 4OT5A 2DAMA 3NNUA 5DI1A 4AUAA 4ZTRA 4FV1A 3C4CA 5J5SA 4HZRA 5G6VA 5CAPA 3QHWA 2GQGA 2XNNA 5JSMA 4YJQA 4IBMA 3TKHA 4C37A 3G6HA 4C2WA 4S30A 2V55A 3HMMA 3ATTA 1NV9A 3F66A 4GYGA 4X6QC 1PMEA 2PZ5A 4X6RA 5AUVA 3UVPA 4AN2A 3FMEA 3O8PA 2C6EA 4EH5A 2WMBA 4J95A 4ZZOA 4PMPA 5IQAA 2A1AB 4UMTA 2DWBA 5A9UA 4U97A 2KNZA 1IEPA 3COMA 1Q4LA 3TI1A 5IUGA 4PF4A 4R77A 2C68A 2WELA 3EQCA 3UO4A 5D12A 5J7BA 4DCEA 1RQQA 5IQHA 4ZTMA 4HYSA 1H26A 3UOHA 3EJ1A 3BU3A 2BAJA 3PA5A 1Z9XA 4GMYA 4GUEA 4M7IA 4EKKA 2ZYBA 3OBJA 2REIA 1P3QQ 4PDYA 4R1YA 3GU8A 4M0YA 4NTSA 4UV0A 2UV2A 4IWQA 2I0VA 3K9OA 2ITQA 4QMQA 2XKCA 3W8LA 1MN3A 4JXFA 2ZV2A 4RX8A 4EK6A 5M08A 2I0EA 2IW9A 3EN6A 4QT1A 5CAOA 3HRFA 2X2KA 4E6DA 2C1AA 3LQ8A 4II5A 4WNKA 4PDOA 5BVWA 1YXTA 1Q8YA 5H2UA 1WGNA 2OXXA 4CFMA 2UZUE 2GTNA 1OB3A 2Z7LA 4OTHA 4DFZE 2R3FA 4JRNA 4AWIA 1WIVA 4R5SA 4P90A 3P0MA 1VDLA 3SQQA 4WRGA 5CS6A 5LVPA 2VZ6A 2BKKA 2E9OA 1NVSA 3LIJA 3I60A 3WI6A 5BVNA 1PXOA 3PXYA 4QTDA 1CKIA 2OG8A 2VO6A 3NIZA 4C3RA 3NUSA 3RTPA 2WKMA 2Y6MA 4FTNA 4DAWA 5ETCA 1M17A 4ENYA 4DBGB 5HG8A 3UQGA 2PUUA 3VW8A 4ZSLA 3GLGE 4TRLA 2B9IA 3NVMB 3C0IA 3ORTA 4GU6A 4L52A 2G15A 4UZHA 4YJVA 5CENA 3QYZA 2VX0A 2ITYA 4IVCA 4S32A 3U6HA 1IR3A 2WOUA 4QMZA 3G9NA 3QRJA 4TYHB 2BWBA 4RLKA 3DXNA 4YSMA 3PE1A 3R8UA 3BV2A 3DKGA 3FZRA 3UP7A 3JY0A 4F7SA 2GFSA 2QG7A 3DXQA 5CX9A 5AWMA 3TNPC 3UIXA 4E6CA 1W82A 2PK9A 4HJOA 2W06A 4JVGA 4BHZA 4RJ6A 2QVSE 2EUFB 3KB7A 3MA6A 1GY3A 2QHMA 4EZ7A 1H1WA 5KCVA 5LMKA 4KBCA 3RK7A 1ND4A 2YM6A 2HY81 3DNDA 3TIZA 2GS7A 2DNAA 5HO6A 5FM3A 5LVOA 3FLYA 4IZAA 4AZWA 4E93A 1QL6A 3MS9A 2BRGA 2CNVA 1H27A 3LXNA 2FB8A 3AC5A 3PJCA 3FZOA 3OT8A 4IM3A 4QNAA 4E4MA 5BVOA 4RVTA 2BUJA 2QOCA 4RJ4A 3JR1A 4N0SA 4F4PA 5GIPE 3BU6A 2J4ZA 3C5UA 2Y7JA 4E5WA 3LCSA 3UTOA 4E7WA 3DB6A 4MD8E 4AW0A 2XZSA 3FSKA 1VEJA 3V01A 4I5MA 3ORLA 2JZ1A 2R7BA 3FMNA 5TR6A 5DOSA 1M2RA 1PJKA 2EWAA 3OWLA 4CKJA 4RFMA 4IVBA 2YJSA 4O7YA 3NUPA 2QCSA 5HICA 2XNEA 1R4GA 2JY5A 2XIKA 3D7TB 2QONA 1YXSA 4XOZA 5A14A 4OTRA 3ZUTA 4I6FA 4S33A 1BLXA 5H8BA 5HTBA 5M56A 4ANQA 2XB7A 4I20A 4ZTSA 4F9CA 4OTWA 2CCHA 2WQOA 2O8YA 4L46A 4YLKA 2JFLA 1LR4A 2QO9A 3IW8A 3F92A 3O96A 1ZMUA 3EWHA 1OGUA 3OMVA 4I93A 4TZRA 2UVXA 3UOKA 5JGBA 4QMYA 3MH2A 5JMSA 3I81A 1DAYA 2QC6A 5CSVA 3HV7A 4OW8A 5BYLA 1HOWA 1Y6BA 3BYOA 5M55A 2WQBA 3R63A 3R04A 4ZXTA 1F0QA 1RE8A 5CU2A 4CZUA 3ALOA 1VYWA 5AA9A 1ZV1A 4WP2A 2YCRA 4HYIA 2OOAA 4X0MA 4XBRA 2WOTA 5LCJA 3GT8A 4D1SA 3P78A 1I44A 5C03A 2BDJA 1I09A 3GU7A 4KAOA 4BIBA 4EWHA 3SA0A 2PVMA 4GK4A 3WF8A 5BMMA 2ZMDA 3QA0A 4I4FA 2WXVA 1UKHA 1OI9A 1YXUA 3W2CA 4CTBA 5FUTA 4RBLA 2CLQA 3EN4A 3OCBA 4E5BA 2XMYA 3CBLA 5D7VA 2QOFA 4FC0A 4FZDB 4TWOA 3ROCA 4BWPA 5AUUA 4NTTA 4ITIA 1XWSA 2RG5A 3L8SA 1LP4A 2Y4IC 4HCTA 3ZH8A 3QC4A 2YDKA 2Y9QA 1WGLA 2F2UA 1K9AA 4K1BA 2XNMA 4NCTA 2BFYA 3FBVA 5AV1A 5I9YA 4BDCA 5IEXA 3DDQA 3NDMA 3IW5A 4WHZA 5KMOA 2HZ4A 4IM2A 3ORXA 4L3JA 2ZB0A 4HGTA 2JDVA 1U46A 2R3LA 4FE2A 1CUKA 3PJ3A 5ANDA 3ZLSA 4E4NA 1W98A 4OR5A 3LFAA 2WTCA 4NSTA 1YLAA 3AD4A 3MTLA 4QO9A 2OJ9A 3MY0A 2R3HA 4QYGA 3H4JA 2XIXA 5AM7A 4CMUA 5CU0A 1XBAA 1Y57A 3WF9A 2GNIA 2Z7RA 3WE8A 3GCUA 2CKPA 1PXLA 2W1DA 3QX4A 3QL8A 4O0WA 2QHOB 5GJFA 4AFEA 4FTRA 5D41A 5HKMA 3Q9ZA 3VS6A 4RGJA 3LFEA 1DI9A 4H58A 3VO3A 3F5XA 4X2FA 4ZTHA 1NVQA 2LVPC 3NGAA 4K9YA 4QP3A 3U9NA 5B2LA 5CAQA 4TTHB 2QODA 3MI9A 4XYFA 1GAGA 4HGEA 1G8SA 2C5YA 3ZLXA 2UW7A 3PUPA 2C0TA 4FTOA 4K8AA 5AAFA 3D9VA 3NW6A 2X4FA 2C5VA 4L67A 4QP2A 5FEEA 3ZUUA 5CXZA 3BLRA 4G3FA 3F2RA 2IJMA 5GZAA 1E9HA 3BGPA 4C7TA 4LMNA 3UQFA 4K6ZA 4C2VA 3E5AA 1CKPA 3QKMA 3TZ9A 2QKRA 3ZXZA 3IO7A 4IJ9A 3R22A 3K5UA 4FV0A 3VBXA 5M09A 3A7JA 5ANKA 1XJDA 2GHLA 2UZDA 3OCTA 3QLFA 3RAKA 4K33A 4DT8A 3CD3A 2XM9A 3LCVB 4BCIA 4AP7A 5FEDA 4P5ZA 4GCJA 4IWDA 4PMTA 3LQ3A 3CS9A 2C6TA 3B8QA 2QU6A 4PTCA 4FSRA 2JNHA 5FD2A 2DAEA 4HNFA 3QX2A 3VJNA 5AP2A 2C5OA 3VS0A 4KKHA 4B6LA 4BCHA 3OD6X 3A7IA 3B89A 2BRHA 3GLHE 4BTFA 5AX9A 3NNVA 4BZDA 3VJOA 3UYSA 1OZ1A 3CPBA 3TIYA 4O7RA 3QTWA 3V6SA 3PLAE 4AGCA 3PRIA 3TNQB 3CC6A 3HRBA 3EFWA 3DTCA 4YJRA 3KRWA 3QALE 3WZKA 4YGAA 3GEQA 4EOPA 3EQPA 3ALNA 3B2TA 4XLIA 2FSMX 3NNWA 3PPKA 3QZFA 4C4EA 3D5UA 4LGGA 5EW9A 1ZYCA 4MEDA 2R3PA 3PP1A 4FKUA 3W18A 2ITPA 2C0OA 4DBNA 4HYHA 4RZWA 4MWIA 5EHOA 1QPEA 5GIOE 4ALVA 3QLGA 5GJDA 3KRLA 4J8NA 4L01A 3F7WA 4CTCA 3HL7A 4JX3A 4O86A 3OF0A 4O7SA 4QMMA 4F08A 4FOCA 2YWVA 2PVRA 3E92A 5C8MA 4EWQA 3O0GA 1TR8A 1JKKA 4CCBA 2CGVA 4CGAA 3NSZA 2BCJA 4JBVA 3OW3A 4G3CA 1WBPA 5CQUA 3POZA 3O8UA 5AP3A 1VQ1A 2J9MA 5CLPA 4RG0A 2O2UA 1BKXA 1Q02A 5IQFA 1WBSA 2OW3A 2PVFA 3I5NA 2LGCA 3R1SA 3WYYA 4BBEA 4BF2A 3QWJA 3TTIA 4EBWA 1HT2E 4B0GA 2ZV7A 1ZYDA 4O91A 3FPQA 5L2IA 4EH8A 2Y6OA 4UYAA 1P4FA 4UYNA 4UY9A 4Y85A 2WHBA 1PW2A 4NUSA 2CGUA 4JLCA 4D0WA 2QOQA 2WTJA 3PA4A 2P2HA 3PPZA 3AMBA 4I24A 3BELA 4IVDA 2LBCA 2W05A 2X81A 4GIIA 4RIOA 3ZRMA 4HOKA 3LFFA 3QD2B 1H28A 3UC4A 4RQKA 1ZOGA 3UVQA 3MVJA 4EKLA 3R02A 2X2MA 2UZNA 4Y5HA 3OTVA 3RI1A 3GCQA 3FI8A 2XA4A 4JR7A 4WA9A 4HCUA 4P7EA 2XJ1A 4I21A 1FPUA 3KXZA 3MDYA 3QD4A 5DFPA 3P4KA 3R8ZA 2EJSA 4IZYA 4Q7JA 1H4LA 4MXCA 5CSWA 5DT3A 5EKOA 3JYAA 3WYXA 3EMGA 2WTDA 1ZMWA 4CFNA 5DG5A 3EYHA 3MVMA 4YHJA 3KMMA 3HEGA 2F7ZE 4FKOA 4FKVA 4NWMA 4TW9A 1FMOE 2KNAA 2X7OA 4XLVA 2ITWA 3OS3A 2JGZA 2P55A 3FLNC 2HW7A 2HWOA 4R8QA 2WEVA 2YFXA 4XV3A 3TNIA 4JNWA 3SX9A 3VUGA 4E6QA 4Z7HA 4EHGA 3QKKA 2XYUA 3UBDA 4ZLOA 3GP0A 1VYZA 3PJ1A 4CT1A 1GZ8A 3QRIA 4IMYA 3Q9XA 4NKAA 1OBGA 3ZU7A 2R3NA 4IAKA 5LARA 4WIHA 2LVOC 5CANA 3UNKA 3C0GA 1JBPE 1OKSA 1NT2A 2XBJA 4MF0A 2JD5A 5CSHA 4CFXA 4CT2A 1TQIA 1OL5A 3FSFA 4C3PA 2X1NA 3TNHA 4OTQA 4FT0A 4I6BA 1Q24A 5CNNA 2WGJA 5D9HA 4A06A 4BI0A 4NJ3A 5M51A 1OAIA 4R6VA 3MESA 3RMFA 4L3LA 2Q0NA 4ZSAA 5CXHA 4CZTA 5K4JA 3TM0A 2X6EA 4ASZA 3OY3A 2W1FA 2CMWA 4XNEA 3H9FA 4U3ZA 3KF7A 2BDWA 3PDTA 3OFMA 5TT7A 4EI4A 4Z9LA 3I1AA 1LPUA 2C0IA 4G16A 3K3JA 3MVHA 4DEHA 3MTFA 5IA0A 4XOYA 4K0YA 3MFSA 2ITNA 2L4EA 2VRXA 5H8EA 3ZSGA 4CMOA 2PHKA 3FQEA 3AG9A 3GC7A 2NP8A 2V62A 1PYEA 3QBNA 4QD6A 4U44A 3SAYA 3ZSIA 4EK8A 5HIEA 4FNXA 3DKOA 2CNUA 4FEWA 3H3CA 3UO5A 4EC8A 4NL0A 2XUUA 2DHYA 3VRYA 3TXOA 2EKKA 1J1BA 5CQWA 3B8RA 2GMXA 3FQSA 1OKWA 4JX7A 4M69A 4JBOA 3IPHA 3OP5A 4FIEA 4IIRA 3DFAA 4C4HA 5HU9A 4D5HA 3BKBA 4UXQA 4AG8A 4NKSA 2XJ0A 3C9WA 3BBTB 4XJ0A 5E8YA 4BB4A 2NNWB 5CT7A 4D4VA 4DG0E 4O7ZA 4Z3VA 4FG7A 3DBQA 5AP1A 5AAEA 4HGLA 5JFSA 2B3TA 4ASDA 1G8AA 3FLQA 5GINE 2VO3A 3FC2A 2B9HA 4EYJA 1JR3E 2X4ZA 2F57A 4D9TA 1WAKA 5BVEA 3R9NA 1U54B 2WMQA 4EYMA 2XNGA 1YVJA 3MJ1A 3UIMA 2E2BA 4H3BA 4EOLA 2P2IA 4G3DA 5KZIA 4UMPA 5CF4A 5EM8A 4D2RA 3GFEA 3GFWA 3NUXA 5AMNA 4D1XA 4CSVA 4JDHA 2CP8A 4F2LA 3A4PA 2XRUA 3ERKA 2PZRA 2Z2WA 4PQNA 3R9OA 3MBLA 3QUEA 1O6KA 4BGHA 3CPCA 2ZV8A 5FGKA 4Y46A 3UE4A 2JY7A 2QURA 2VTTA 4E8AA 2V0DA 1BL6A 3KGAA 3DLSA 2R9SA 3ULZA 3FHIA 3GNIB 4XP0A 4I3ZA 5I9VA 2ZV9A 3NYXA 1Q3DA 3H9RA 3BGZA 3FPMA 4RC4A 4FEVA 5IA3A 1UFZA 4IC7A 2VX3A 4FOBA 1KYIA 1T46A 4FKSA 3NYVA 5EM6A 4BFMA 2VWIA 5BVFA 1YWNA 4D9UA 1IFYA 3UGCA 5L8LA 2IG7A 1RDQE 4G3EA 2OFVA 5L4QA 1ZYSA 4ALUA 3MB7A 3VBTA 4M15A 4JQ8A 3VN9A 3K9PA 3NNXA 4X7QA 4DH8A 2VUWA 4DGGA 3C1XA 1MRYA 2XS0A 3UIUA 5EM7A 3DAKA 3R7VA 2PVYA 3GOPA 2HXQA 1V92A 4UB7A 4XHKB 4Y83A 1PXMA 2PL0A 5AP6A 5A6NA 5LQFA 4KWPA 4EOJA 2WEIA 4QYYA 1JKLA 5DN3A 5EFQA 4X3FA 4JRVA 3VBQA 3HV5A 2PSQA 2BRNA 1H1SA 2RIOA 1VJYA 3PY3A 3TZMA 4IB0A 4PRJA 3OG7A 3D2IA 5GNKA 5IDPA 4P5QA 3VUMA 1OPJA 3HMPA 4MXXA 4QMXA 3AD6A 1OL2A 2XNPA 4MBJA 4HPTE 4NJDA 3RWPA 2C3LA 3VQHA 5A3XA 3LVPA 5CT0A 2BPMA 3W8QA 2X9FA 3DQXA 3R7YA 3R8PA 3T3UA 4GT4A 4BBFA 4C4JA 4E26A 4USFA 3Q2JA 1FVVA 3KRJA 3DTWA 4CQEA 2GU8A 4WG3A 3RHXA 3VS5A 2IPXA 4ZZNA 4PL5A 3RPRA 4K2RA 4TYIA 5TO8A 3I4BA 4I22A 1GIHA 3GOKA 4NM0A 4PUZA 3V04A 3VQUA 3O51A 4QYHA 5DFLA 4FT5A 4QMUA 2FGIA 2OXDA 4FSUA 5HEZA 1JOWB 3ORNA 2QR7A 3P7CA 4H3QA 4B4LA 4QTEA 3TKUA 4QQCA 4DH3A 3T8OA 3V3VA 3DPKA 2QHNA 3EQHA 4JAIA 4KABA 1WBWA 3WZUA 3RHKA 2BAQA 3PZHA 4OBPA 4I6HA 1ZYJA 4FG9A 1A48A 4O0SA 4BN1A 1BVSA 1Z5MA 1R0EA 4BIEA 5L2TA 5A54A 4FTCA 2IO6A 3QQKA 2YM5A 1Q3WA 3CEKA 4RIWB 4W4WA 5FG8A 5HBHA 1G3IA 2V22A 3PWDA 4DG2E 3KXMA 4L7FA 4TWCA 4F9YA 3BHHA 2YIYA 4F09A 1P14A 3ATSA 2BIYA 2R4BA 3FI4A 2H6DA 4UMRA 2OIBA 3PRFA 3LLAA 3OZ6A 1XB2B 1S9JA 1WHCA 3ORZA 4IDTA 3IG7A 3QGWA 3OOGA 3R1QA 5E8SA 3R21A 4X3JA 1XBCA 1KV1A 2FUMA 5IZFA 4EHEA 4MTAA 3N51A 4ANNA 4G5PA 5AP4A 2G1TA 2WMRA 5FXQA 3PE2A 5C01A 3BYUA 4AT3A 2YM3A 3F3TA 3IQ7A 2J50A 3D5VA 2UW0A 4LRKA 4FT9A 1PKGA 3SXSA 1NVRA 5HCZA 1HJPA 1RW8A 4LRMA 2DENA 3Q5IA 4ANBA 1YQJA 1JNKA 3VW6A 3KK9A 4DBXA 5JH6A 5IA5A 2JKQA 3TV7A 2UUEA 4PNIA 2VGPA 4X2JA 3VBVA 4BDHA 4U42A 4XV9A 4DGLC 2Q0BA 3ZM9A 2WTIA 4IFCA 4M66A 5BYZA 4CLIA 3RPYA 5KE0A 2E9VA 3FKLA 3O71A 3E93A 4F6SA 2O63A 4BCMA 3GU5A 2VTAA 4IM0A 4RA4A 1ZMVA 1PXKA 1WVWA 2GTMA 2L4FA 3CE3A 3FKOA 4L6QA 2WQMA 5K0KA 3PJ8A 3SXRA 4C58A 5EI8A 3CGFA 3V6RA 4E3CA 2E9NA 4YZ9A 4PL4A 4O82A 3LOKA 4RRVA 3U8WA 4TPTA 3EQDA 3NX8A 2XIYA 2DAKA 3PJ2A 1FGIA 3QZIA 4ENXA 2X8IA 2ZB1A 4ARKA 2JBOA 5JQ5A 3CY2A 3ZXTA 4CFFA 1Q41A 2OSCA 3DKCA 1YKRA 2GNHA 2BDFA 4LI5A 2O64A 2PZYA 3VNTA 3S1HA 2Y4PA 3DJ5A 4NIFB 4DEDA 2QOOA 5LMBA 3UMWA 3D15A 3QAME 3UOLA 3IOPA 4DCAA 3UNJA 2QLUA 4FGBA 4RJ7A 3RM7A 3BYVA 3H30A 3VS3A 1YWRA 2WTVA 4FA2A 5BUIA 5KKRC 4KSPA 3I6WA 5DWRA 1YDRE 1LUFA 3DK7A 3M1SA 4IWOA 1XH7A 4RT7A 4IWPA 3FZ1A 4YUQA 2PULA 3Q4CA 4IDVA 1XBBA 5KNJA 2R2PA 3LCOA 5FTOA 5FWKK 5CEQA 4C59A 3R0TA 4DH7A 3VHKA 2FH9A 2WU7A 2HELA 4YSJA 2XCKA 1BMKA 4JG8A 4L43A 2JLDA 3GC9A 2A2AA 2X9EA 4ZS4A 4GRBA 4EOQA 1VR2A 4CXAA 3ZO4A 3Q2MA 4JS8A 3IOKA 4ZK5A 2BTRA 2C4GA 4FSZA 1URCA 3EKKA 1GNGA 1YHWA 4EUTA 3ORIA 4Q5HA 3V5TA 1T6OA 2ITTA 4J7BA 2VNYA 4PX6A 2ERZE 1O6YA 2YLFA 3BE9A 4MXZA 2G2IA 1SZMA 2YISA 4U41A 4EORA 4HVIA 4F1IA 2DQ7X 4Z55A 3ODYX 2CKOA 3HP5A 2OBJA 4O38A 2FSOX 5DEYA 5CWZA 3BGQA 3MB6A 4GJ3A 5HVJA 3ZO1A 2EVAA 3EH9A 3JVRA 3BHUA 5JGDA 1P2AA 4BGGA 4FVPA 4UN0C 1H1RA 2QLQA 5KX8A 2J0IA 5CF8A 1QPJA 3GENA 2WMWA 3LMIA 2QOKA 3HECA 1OQYA 4ZLZA 2XK3A 3VUTA 2PZPA 4FKJA 3W2PA 4O21A 2PZIA 3G9LX 1XH4A 5C8NA 3KXXA 2UW9A 2CLXA 5AR2A 3S4QA 3ZDIA 4WD5A 4BBMA 4YJUA 5HX6A 4MXOA 4CV8A 4TWPA 2ZTCA 5M53A 4I5PA 2XJ2A 3A7HA 3UZTA 1O6LA 5E8WA 3RNIA 5HHWA 5EYKA 5JZJA 4ERKA 3PSDA 2B4SB 5CSPA 4FSYA 1PHKA 5HNIX 4JAJA 4BKYA 3U6JA 2ITVA 3R83A 3SD0A 2ERKA 1W84A 2W5BA 3D0EA 1KSWA 3C50A 2R3KA 3C7QA 2ITXA 3IDPA 5GZ8A 3WF7A 3MFRA 2J90A 2LVNC 2C47A 2V7AA 2XK9A 4G1WA 4R5YA 5DH3A 5F94A 3V51A 4DFLA 4O6LA 1OECA 1SNXA 3DDPA 3SG9A 5DMZA 4L8MA 4DLJA 5IG1A 4EOOA 4I0RA 3KCFA 1G4AE 3WF5A 2JC6A 3E8EA 1BI8A 2R0UA 3KMWA 2J2IB 2OU7A 5C8KA 3EN5A 2GS2A 3FL5A 3ULIA 1W8CA 4W4XA 5EOBA 5FQDC 4I92A 2GFCA 4O96A 2W4JA 5E8VA 3DAJA 4GT3A 4CYJA 2KTYA 1R39A 1UWHA 3HV6A 4BVUA 2E9PA 2VWWA 5LOHA 2IZTA 4NT4A 4XG8A 4ANSA 4BR3A 3EQBA 4MNEA 4JOAA 3CQWA 3PWYA 2GNGA 4HGSA 4Y73A 4QPSA 5HBEA 4IH8A 4U43A 5LVMA 4BDFA 3I6UA 2H8HA 3DZQA 5EDQA 2IZUA 2JKMA 4DF3A 4RC3A 3HA8A 4ORKA 4IXPA 3WILA 4EZ3A 2JITA 3DK6A 1YHSA 3VWAA 1NV8A 4L44A 3NYNA 3W33A 4EEVA 4JJRA 3QF9A 3R8VA 4BIDA 3N4TA 3EL7A 4IZ5A 2OIDA 5L2SA 2J0JA 4AW2A 3Q4ZA 2C6OA 3RPOA 4AOJA 5A4QA 3NUAA 5KMLA 3R2BA 4H1MA 2JDTA 2OICA 4OTIA 3EIDA 3RK9A 5EHLA 4YO4A 5C4KA 4HEOA 5FLFA 4CQGA 4Q9ZA 5HD7A 4J99A 4BTKA 5AIKA 4I0TA 4B9DA 1M2QA 4RC2A 3LCDA 2H9VA 3OOMA 3PXKA 5CZHA 5EDPA 5GHVA 3NZ0A 4GVJA 4RJ5A 5BX0A 3TUBA 1R3CA 5IF1A 5B2KA 2W9FB 2XK6A 3W2OA 5CY3A 1Q8WA 4KKEA 3H9OA 3THBA 3UDBA 2QO2A 2OZAA 1KE9A 4R7IA 4FSQA 3WBLA 1PMNA 4DFYA 2Y8OA 4CZYB 5CASA 3UMXA 3QCYA 4J96A 1WVYA 5B2MA 2ZOQA 4AZFA 3QQJA 3ZEWA 3GLIE 4CG8A 1FOTA 1REKA 4MD7E 4QP7A 3KA0A 3D14A 3VUDA 3EFKA 4U6RA 5CAUA 1J7IA 3NVKI 3DZOA 3QCXA 3FAAA 4RMZA 1HQYE 3ANRA 2PVHA 5K5NA 5LVNA 4RJ3A 2CWBA 4R3PA 3ZONA 3VUIA 2VWZA 5H8GA 1U59A 4LL0A 3EKNA 3G5DA 4CEGA 5AA8A 3IECA 3KFAA 3MA3A 3QQHA 3SRVA 4DH5A 1CKJA 5CSXA 4KNBA 3WF6A 4IADA 5L2WA 3GBZA 4EJNA 1IRKA 4KINA 2HIWA 2R3IA 3LM5A 2YZLA 3V5QA 1X8BA 3BRBA 1R0PA 4ZMEA 2X8EA 4D4SA 4PPCA 4Y72A 3GLFE 4CKIA 5K5XA 4C33A 4E1ZA 3G0EA 4NFNA 1IAHA 2LVQD 2R3RA 3CLYA 4MQ2A 2C6KA 2O5KA 2WFYA 4O2PA 4D2VA 5JI2E 3NWWA 3VIDA 2VTOA 2ESMA 4O0VA 2YCFA 2O3PA 3TTJA 4ANOA 4EHVA 3K54A 2XK8A 3NLBA 3O2MA 4FTAA 4Y5QA 3PVUA 4YPSA 3VF8A 4AZTA 1XQZA 4F6UA 2WQEA 1REJA 4L42A 3LQ5A 1HCKA 2CKQA 4TT7A 3HV4A 3NRMA 4YZBA 2BZKB 3R8LA 3DBDA 4CD0A 4IANA 2RGPA 4L7SA 5DBXA 4TNDA 4A07A 4YJPA 5HO7A 3PY1A 1O9UA 1L3RE 4TYHA 3M2WA 4D5KA 2ITUA 2WZJA 1Z57A 4Q5EA 4J53A 4V01A 3UOJA 5K0XA 3N9XA 4DEBA 2YDJA 4UBAA 3RM6A 3ZOSA 3JPVA 3F9NA 5J79A 1ERKA 4AXAA 5JN2A 1DM2A 3ZYAA 2VWUA 3DBEA 4TNBA 4QMWA 5D10A 5I9WA 1ZRZA 4RFZA 3G2FA 2YM7A 4FSWA 3GC0A 3BWFA 3KREA 3R9RA 3AC8A 4IVAA 3T9IA 3ORKA 4LUDA 2XNOA 3RJCA 2VV9A 4FVQA 4IZ7A 3T3VA 5J1WA 5GZ9A 5LCKA 3GU6A 2WMXA 2CPKE 3CP9A 3B2WA 4BCJA 4FV9A 2OH0E 2W1CA 5HG7A 3NCZA 4IB3A 4IX3A 3QTIA 3OXTA 2XKEA 3E7VA 3RAHA 3DT1A 4JBPA 4BDAA 2XNBA 3F3WA 4C02A 5HGIA 1QCFA 1WMKA 4DYMA 2VWXA 4UWYA 3R9DA 4O7LA 3RVGA 1SYKA 2F7EE 2P0CA 4IQ6A 2C3KA 4U7ZA 4OGRA 3FXZA 1DO2A 2G3QA 4ACCA 3ZFMA 4AF3A 1OKVA 2WNTA 3D7TA 3SDJA 3AMYA 1KE6A 3O23A 3L9MA 4QYEA 4XBUA 5IA2A 2BTSA 2OOBA 4KIPA 3TACA 3ETAA 1K2PA 4TL0A 1Q62A 4CG9A 4LGHA 1QMZA 3QTQA 4U3YA 2BHEA 3NIEA 2BVAA 1XXHE 5ETIA 1F3MC 4I4EA 3BHTA 3ZBFA 4AZVA 4C61A 3E8DA 3HLLA 1Q8UA 3BCEA 3FV8A 1Q5KA 3COKA 3DNEA 4B7TA 5DRBA 1OPLA 2YIXA 4GKHA 3CY3A 3MYGA 5JQ8A 4MXAA 1WJ7A 2C69A 3AC3A 3QZHA 4GFGA 2FSTX 2W4OA 4A9UA 1ZAOA 2GDOA 3AC2A 4OTFA 4F65A 2BZHB 5EH0A 3HV3A 3UP2A 5C9CA 3E3BX 2O65A 4QP8A 5AEPA 4MXYA 2MR9A 4HVGA 3NAYA 2DAIA 4U45A 2RFNA 4O7TA 4FV6A 4IX6A 4BZNA 3A99A 4FKTA 4NYEA 5IEYA 5CF6A 1KOBA 3CKWA 3CQEA 2HAKA 2W1IA 4BCQA 1MUOA 3BPRA 2C5XA 3V5JA 4FF8A 3HUBA 4M69B 3NCGA 3PZEA 5DVRA 4A4OA 2R0IA 3PPJA 4ASXA 3F6XA 4MYGA 3II5A 5E7RA 4BYJA 4WT6A 1CTPE 4ACGA 3SC1A 3TEIA 4BCPA 5CEOA 3P9JA 4LOOA 4YHFA 2WAJA 2PMLX 4RIYA 3QA8A 2BILB 4KIQA 3SKCA 4R3RA 1DI8A 1HCLA 4LOPA 4W8DA 2C3JA 3CKXA 3AGLA 2BROA 4O0YA 1SVEA 2H96A 4LFIA 5IH5A 3FMKA 3OBGA 4M67A 4FKRA 3COIA 3L1SA 4FTLA 3Q6UA 4CLJA 1V0OA 3RALA 4ZLYA 2HW6A 2OI4X 3HZTA 2QOBA 1Q8TA 3QTUA 2QKWB 3PSBA 3U4UA 4KIKB 4IE9A 3R1NA 5ANOA 3GCPA 2KHHA 4V0GA 1B38A 2WMAA 5EDRA 3LKMA 2RL5A 2CSNA 3KN5A 5CF5A 2JIVA 5JKGA 2R3MA 3QD0A 4QP6A 1WBTA 2VWBA 2J5FA 4XEYA 3UQCA 4EH4A 3CTQA 2XIRA 4GT5A 5F4NA 4G6LA 5IEVA 2UW8A 1ZYLA 5EYMA 3A8WA 1XR1A 5B7VA 3IK3A 4ZJJA 2P3GX 2EXMA 2W1ZA 4P2KA 4B99A 2LTUA 4USEA 2B52A 2OIQA 3O50A 4BY9E 4D58A 2OFUA 2HWJA 4IB1A 1JLUE 2C6LA 4KRCA 4S2ZA 4YZCA 1OIQA 2VAGA 5HLPA 5HIBA 3G51A 4AGWA 2B9JA 4PTGA 2ZMCA 4IFGA 5CI6A 3KL8A
chains in the Genus database with same CATH superfamily
5HO8A 3RPSA 3AFHA 3BX5A 4JV5M 4LG4A 3PFYA 1QAQA 1JKSA 2LXEA 1DAWA 1G71A 3L26A 3AGMA 2VTQA 1A5TA 2IWIA 3C4WA 4IBJA 2QG5A 2G01A 2JAMA 3PSCA 4XUFA 5BUEA 3MVLA 4PDSA 2BMCA 4BI1A 5E1EA 2G2FA 4YHTA 2C98A 1UV5A 3JR5A 5KO3A 4G6ZA 4WKQA 3RCJA 3LPBA 2XH5A 4O1OA 4R1VA 2XARA 5DR6A 2YACA 2QQ7A 3VC4A 2CNQA 3BQRA 3CR0A 4F1OA 8CATA 2WIPA 4DFNA 4FKLA 5M4CA 1APME 3KVWA 4WURA 3COHA 4GK3A 3UDTA 3ZO2A 5KMNA 4RLLA 3E7OA 3DV3A 1I4WA 2UXBM 5KBRA 4YNEA 4FZFB 4NW5A 5DE2A 4EQMA 3EFJA 1YOLA 3OHTA 3OEZA 2BWEA 3VBYA 3SW7A 3U9CA 4RWIA 4YMJA 4OAUC 4A9TA 3IW7A 4P16A 5ITAA 4U5JA 4NM3A 2XVDA 2OZOA 1PXIA 3O7LD 1H0VA 1MU5A 3E63A 2ZM4A 5LXMA 5C26A 2J0MB 4CJ6A 4DR1M 3T1HM 2UZWE 4ZP5A 4IBGA 3QKLA 4R78A 1TFFA 3SGCA 4XRLA 5E6JA 4A9RA 1T45A 1UVRA 4YC8A 1A06A 2OJGA 1PJQA 2VTIA 1SNUA 2UUBM 4BL1A 4WRSA 4YJNA 4QOXA 1IN6A 3AKLA 4NXNM 2R3JA 3R28A 2W5AA 5KMJA 2L09A 4FIHA 4EH9A 3FXWA 3FLWA 4X21A 3HP2A 3UJGA 4O7VA 4Y8DA 2BALA 4TWNA 1N34M 1YI6A 1YHVA 2XANA 1TQPA 5EG3A 4FG8A 4AT4A 1YRPA 2OKRA 4ONAA 4AGUA 3TJDA 4QRCA 4DG3E 3S95A 5I3RA 3MN3A 4MNEB 3P08A 2J51A 3JUHA 4J98A 3WIGA 3L8XA 5IU2A 5JT2A 3KK8A 1OL6A 3E21A 3QUDA 1IY2A 3EHAA 3MJ2A 4F99A 1IY1A 2JDSA 1CM8A 4MGIE 4N6YA 1ZZLA 2J7NA 4DT9A 3OVVA 3B7NA 2KA6B 4W9XA 3RE8A 1U4DA 4ITJA 1I94M 5CI7A 5BPYA 3FTFA 4D2WA 4DN5A 4EWQA 3UYTA 4DEEA 4ZZMA 4LV7A 5TF9A 2C96A 5FDPA 5M4IA 1IN8A 5J1VA 5IH4A 5LMAA 3SRVB 2DWZB 3QRUA 1WBVA 3QQFA 4U80A 4KS8A 4M13A 4YJOA 4RWKA 3U6CA 3F3UA 3VLFB 5LJJA 4GSBA 4CNHA 2CN8A 2EO2A 1TH4A 3ZEPA 4KIOA 4YC6A 2YITA 2R46A 2YCSA 2WQNA 4WBOA 5I4NA 4G4NA 3BZ3A 3JY9A 2O0UA 3QTXA 3LJ0A 5F1ZA 2VTLA 1FBNA 4UMQA 1SXJE 4H3PA 2JP7A 1GLNA 3VRZA 5HVYA 3MWUA 4DV2M 4FZAB 3CIKA 5CU4A 4EQCA 4EUUA 2WO6A 3ACJA 5FTJA 4FL1A 3PIZA 1NA7A 2YM8A 2RG6A 4QQJA 3HMOA 1IA9A 4CV9A 3NW5A 4IAYA 3PTGA 1DGBA 1PXPA 4ANMA 3IW6A 3NS9A 5ANEA 4EQUA 3HMIA 2G9XA 5ACKA 4JL9A 4AACA 2YA9A 4XRJA 3OWKA 4O7WA 1QPCA 3FY2A 2KNVA 3N4VA 4UZDA 1AQ1A 4HPUE 3ZCLA 4DR3M 5DYJA 2KZSA 5C27A 3ODZX 3TT0A 2IVSA 2QNJA 3QRKA 3TWJA 3CXWA 3OROA 4BDBA 4XCUA 4GKIA 4B8LA 5I0BA 3HDMA 3DB8A 3FXXA 2B7AA 4CFWA 2OJJA 5DYIA 1H1QA 3T9TA 4L6V6 2UZVA 4W8EA 4ZIMA 1PY5A 5C4LA 4C35A 4WG5A 5HX8A 2EKFA 5AUZA 2JEDA 2CDZA 4B08A 4ITQA 3N4UA 2QBYB 2VDBB 4ANLA 4G31A 3Q8XA 4GFMA 4YTCA 3TV4A 1LEZA 3UZPA 4LZZA 3GU4A 4U8ZA 4GEWA 4O84A 3ET7A 3SOAA 2L7HA 2PE1A 2DXIA 4LM5A 4AN3A 3FZPA 5J5TA 1NY3A 3P5KA 3ACKA 1W5TA 4Z6YA 2IZRA 2QR8A 3DOAA 1KUTA 3LAUA 5JRSA 3UGJA 3EZVA 2X8DA 4DGMA 2IW6A 4M97A 4EH2A 1TKIA 2IW8A 4BKZA 2EB2A 3QCQA 5LWMA 3F7ZA 4D2PA 1JPAA 3U6IA 4JI1M 2ITZA 2DI0A 1YXVA 5IQIA 2VO0A 2OO9A 4JDIA 4O0TA 3G0FA 3D8BA 4H39A 4FIGA 4CCUA 1OL7A 4QNYA 4WSQA 2R4JA 2GNFA 4OAVB 3GQIA 2XKDA 3DS6A 4M68A 2BRMA 3ZUVA 4RWLA 1G5SA 3PVBA 3MW1A 5IH6A 1GZOA 3AT4A 4FIJA 2ACXA 3C4EA 1JSTA 1R78A 2O25A 5T3QA 1G41A 1GJTA 4EOMA 2PY3A 1OITA 3GGFA 3FTEA 3Q53A 4RVLA 2X2LA 4MHAA 3OTOM 4UMUA 3W2RA 2W9ZB 3AXWA 4RX9A 3V5WA 4QMLA 2WTKC 4C36A 4ACHA 2V7OA 3IDCA 5GKNA 4LJ7A 4X64M 4WNMA 4ZSJA 1E94E 4MBLA 2Z8CA 3KRXA 1BUHA 3DU8A 2DYLA 3VULA 2UZEA 3WIKA 3DJ6A 3E8NA 1YXXA 5KHXA 4B8MA 5KUPA 4WOVA 4LL5A 1ZQ9A 3BLAA 1UKIA 3BQCA 4IC8A 2C1BA 4N4SA 1XMMA 4ZS0A 4DR7M 5A46A 3F88A 4OLIA 4FKGA 3FC1X 4FUYA 3M6AA 4ACDA 3VHEA 1E1XA 1XMLA 2PU8A 3ZM4A 3QXOA 5J87A 2AUHA 5LWNA 4FCWA 3MIAA 1V1KA 4G5JA 3R9HA 4Q9SA 2UVZA 3OY1A 4YO6A 2W1HA 4QMPA 2B55A 4DGOA 1H00A 2ZDTA 5BVKA 4KO8A 3GVUA 5JFVA 4F78A 3U4WA 2VWVA 2W5HA 3ZRKA 5ANIA 4FV5A 2EUCA 4TY1A 1M14A 4X2KA 1MJGM 3E46A 2GNJA 1Y6AA 3VK7A 1C1KA 1E32A 4KBKA 4PT5A 2QO7A 3UODA 4FSMA 3P23A 4AOIA 4F9AA 2Y0AA 3VUHA 1NJGA 4PMMA 1AIPC 4GYIA 3GLGA 5IREB 4O83A 5IA1A 4BTJA 5AV2A 4OTGA 4L53A 3HAMA 4QP4A 4NEUA 3ZSHA 1YWVA 4LRJA 2RRUA 4OBOA 4KLNA 4TXCA 3HGKA 3A61A 3BWJA 4CRSA 2PVJA 5EXPA 4FEUA 5AV4A 4HVSA 5AAGA 4H36A 2HYYA 1ATPE 5ETFA 3ZC7B 3PP0A 4DHIB 2C5NA 1L8TA 5DR2A 1OKYA 2AEGA 4U40A 5C1QB 4FYOA 4V05A 5FBOA 1AGWA 1M7QA 3OW4A 1NXKA 1DO0A 4ACMA 1WZYA 4BCFA 5ETAA 5EI2A 3DXPA 5FTLA 2A0CX 3FYKX 4DFXE 4GITA 1JSUA 4FV3A 3CD8A 2DAMA 4FV1A 5CAPA 2XNNA 4IBMA 3TKHA 2V55A 3HMMA 3F66A 1PMEA 5AUVA 2GNOA 2WMBA 4J95A 2DWBA 3W0LB 5A9UA 4U97A 2C68A 1RQQA 4HYSA 3UOHA 3EJ1A 2BAJA 1Z9XA 4GMYA 4GUEA 4EKKA 3OBJA 3GU8A 2R6FA 3K9OA 4QMQA 2IW9A 5CAOA 3HRFA 3LQ8A 4WNKA 4PDOA 1JQJC 1OB3A 2GTNA 4DFZE 4JRNA 1WIVA 1VDLA 3C3DA 2OG8A 5DNYA 3RTPA 1QDTA 4DBGB 4ZSLA 4TRLA 3ORTA 4KT0F 4UZHA 4S32A 2WOUA 4QMZA 3G9NA 3QRJA 3FZRA 4F7SA 3JY0A 2QG7A 5AWMA 3UIXA 4E6CA 1W82A 2PK9A 4HJOA 2EUFB 1H1WA 2HY81 4AKHA 2DNAA 5HO6A 3FLYA 4IZAA 4AZWA 1QL6A 3LXNA 3OT8A 1PJSA 2BUJA 1IBLM 2J4ZA 3KP1E 3C5UA 5BV3A 3ORLA 4CKJA 4IVBA 2QCSA 5HICA 2XNEA 2JY5A 5HTBA 4S33A 1BLXA 2CCHA 4L46A 4YLKA 4MEDA 4I93A 5JGBA 4OW8A 3TWKA 1HOWA 1Y6BA 2WQBA 1NVMA 1RE8A 3I04M 5AA9A 4WP2A 4XBRA 2ZANA 4EWHA 5BMMA 1OI9A 3W2CA 2CLQA 2XMYA 2Z4RA 4TWOA 3ROCA 3QC4A 2Y9QA 2F2UA 2XNMA 1G59A 3FBVA 4IM2A 2ZB0A 3VFDA 3PJ3A 1W98A 1Z59A 2WTCA 4NSTA 1YLAA 3AD4A 5KPTA 3H4JA 5CU0A 4FTRA 3NFGB 3VS6A 5B2LA 1NVQA 4QP3A 3NGAA 4TTHB 2C5YA 2UW7A 3PUPA 4K8AA 5CXZA 5GZAA 3UQFA 4C2VA 3E5AA 4JI3M 4IJ9A 3R22A 4DT8A 2UZDA 3OCTA 4K33A 3LCVB 4P5ZA 3CS9A 2UXDM 2QU6A 4PTCA 2JNHA 3QX2A 2C5OA 4BCHA 4B6LA 4XK8F 3B89A 2BRHA 4AXFA 4BTFA 4D80A 1OZ1A 4O7RA 1WXQA 3PRIA 3EFWA 4YGAA 4EOPA 3GRUA 4XLIA 2FSMX 4LGGA 2ITPA 2C0OA 3W0NA 4HYHA 1GL7A 5GIOE 3KRLA 4J8NA 3HL7A 3OF0A 4O7SA 2PVRA 3E92A 5C8MA 3AKJA 4B3RM 4G3CA 5ITTA 3O8UA 3FPQA 5L2IA 2V1UA 3U6SA 4NUSA 4JLCA 4D0WA 5KQ8A 2WTJA 2LBCA 2W05A 4RIOA 3ZRMA 2YFQA 3LFFA 3VDUA 1H28A 4OVZB 1R6BX 3GCQA 2XA4A 4WA9A 4P7EA 2XJ1A 5DFPA 3P4KA 4M0WA 4IZYA 1H4LA 5CSWA 4MXCA 3JYAA 1ZMWA 4CFNA 5DG5A 3EYHA 4YHJA 3HHWA 4FKOA 2HWOA 4XV3A 3TNIA 4E6QA 4JNWA 3GP0A 3PJ1A 4DV1M 2R3NA 4IAKA 3C0GA 1OKSA 1NT2A 2JD5A 1TQIA 4C3PA 4KHPM 2X1NA 4FT0A 2Y20A 2WGJA 4A06A 5M51A 1OAIA 4R6VA 4ZSAA 2X6EA 3H9FA 2BDWA 3PDTA 5TT7A 4Z9LA 3I1AA 1LPUA 2VRXA 5H8EA 2PHKA 1D0KA 3GLGB 5HIEA 1PYEA 3DKOA 4FEWA 4NL0A 3VRYA 3FQSA 4JX7A 5DYGA 2QPAA 4DV7M 4IIRA 5HU9A 3BKBA 4AG8A 3FLQA 3PVSA 2VO3A 2F57A 4D9TA 4EYMA 5BVEA 3UIMA 1YVJA 2P2IA 4G3DA 3KIOC 4CSVA 3R9OA 3MBLA 2ZV8A 1OGYA 2JY7A 3DLSA 3FHIA 5I9VA 3NYXA 3HHYA 5FTNA 1KYIA 1T46A 3GPXA 1YWNA 5L8LA 1RDQE 2OFVA 4EIWA 3VN9A 3K9PA 3NNXA 2VUWA 3MJ5A 2O01F 2WEIA 4QYYA 3HX3A 3VBQA 2PSQA 1VJYA 3OG7A 5GNKA 5IDPA 3HMPA 4QMXA 4MBJA 1YUBA 2X9FA 4GT4A 4C4JA 3Q2JA 4NRVA 3KRJA 2G8LA 2KZUA 2GU8A 2IPXA 2G5GX 4PL5A 3RPRA 3V04A 3O51A 4FT5A 2FGIA 4FWHA 1JOWB 7CATA 3ORNA 4QTEA 3WZUA 4OBPA 3PZHA 2V1CA 2YM5A 2J5YA 4F9YA 4F09A 1P14A 3ATSA 3OZ6A 1XB2B 1KV1A 4MTAA 4G5PA 3THGA 1IXRC 4AT3A 3D5VA 4LRKA 1NVRA 1YQJA 3KK9A 2JKQA 3TV7A 4BDHA 4XV9A 2WTIA 4IFCA 4M66A 4CLIA 4F6SA 4RA4A 2VTAA 1ZMVA 2GTMA 3CE3A 3SXRA 4O82A 4RRVA 3NX8A 3PJ2A 3M7GA 4CFFA 3ZXTA 3DKCA 1EIJA 3S1HA 3DJ5A 5LMBA 4DEDA 3UMWA 3D15A 2QLUA 3RM7A 4KSPA 5DWRA 3M1SA 2R2PA 5CEQA 1IBMM 1NY5A 1VR2A 4CXAA 3IOKA 4ZK5A 2BTRA 4FSZA 1YHWA 4J7BA 2YLFA 1O6YA 3BE9A 4Z55A 4F1IA 3HP5A 3GPUA 2EVAA 3EH9A 4UN0C 1AUAA 2QLQA 5KX8A 5CF8A 2OPFA 3GENA 2WMWA 2QOKA 2PZPA 2PZIA 1XH4A 3KXXA 2UW9A 3S4QA 4TWPA 4AXCA 5M53A 5HHWA 4YY3M 5HNIX 2ITVA 5GZ8A 4LF8M 2C47A 4DFLA 5DH3A 5F94A 1OECA 5DMZA 4DLJA 4EOOA 5E26A 3FL5A 3DAJA 1R39A 4ANSA 3EQBA 4JOAA 1XXHA 3PWYA 5EDQA 4RC3A 3WILA 2JITA 4LF9M 3W33A 3N4TA 2OIDA 4AW2A 5KMLA 3RK9A 3EIDA 3L29A 5EHLA 4HEOA 3LCDA 4GVJA 3W2OA 5CY3A 1QAOA 3THBA 3UDBA 2QO2A 2OZAA 2Y8OA 3QCYA 3QQJA 3ZEWA 3GLIE 1FOTA 4QP7A 4U6RA 3NVKI 5K5NA 2CWBA 3VUIA 2VWZA 5H8GA 4LL0A 3EKNA 5AA8A 3AKZA 3MA3A 3QQHA 5CSXA 4KNBA 4IADA 3GBZA 2HIWA 2YZLA 1X8BA 3GLFE 5K5XA 4QDVA 4NFNA 3CLYA 2O5KA 4D2VA 1QUTA 2XFSA 2YCFA 4ANOA 3TTJA 3NLBA 4Y5QA 3O2MA 3VF8A 4YPSA 3PVUA 4AZTA 1HCKA 2CKQA 4GHLA 2RGPA 4TNDA 3B9PA 3PY1A 2RKOA 3A98B 4Q5EA 3UOJA 5K0XA 3N9XA 2YDJA 3ZOSA 3F9NA 5J79A 1ERKA 4AXAA 1DM2A 2XSZA 3G2FA 2YM7A 3FD9A 2XNOA 2NQ8C 1JR3D 5J1WA 3GU6A 4REZA 4FV9A 2W1CA 4IB3A 3QTIA 3OXTA 2XKEA 3RAHA 4JBPA 2XNBA 5HGIA 4DYMA 4UWYA 4IQ6A 3FXZA 3ZFMA 1OKVA 3AMYA 3O23A 4XBUA 4KIPA 3ETAA 1K2PA 4LGHA 4U3YA 4C61A 1F3MC 1ST0A 3ZBFA 1OPLA 4MXAA 3AC3A 5C9CA 2MR9A 2RFNA 4O7TA 4IX6A 3A99A 4FKTA 5CF6A 5ITQA 4MB7A 1MUOA 3HUBA 2X0OA 2RGHA 2R0IA 4MYGA 5E7RA 4WT6A 1CTPE 4ACGA 3P9JA 2WAJA 2PMLX 4RIYA 3QA8A 2H96A 5IH5A 1QANA 4FTLA 3HZTA 3QTUA 3PSBA 5EP1A 1OJLA 4KIKB 5ANOA 3L2AA 3LKMA 2CSNA 5CF5A 5JKGA 4QP6A 2YR0A 5F4NA 5B7VA 2EXMA 2LTUA 2OIQA 2OFUA 1JLUE 3G51A 4AGWA 4IFGA 5CI6A 3KL8A 3FE3A 4ZJIA 3LCKA 3LHJA 3NYOA 4GH9A 1WR1B 4ZY5A 2XAMA 3ZLWA 5KMMA 3KW6A 4QOZC 2P4IA 4PV0A 3EZRA 3I7CA 2C30A 4ZTQA 3V8SA 3ZS5A 3MPTA 1M2PA 3HA6A 3KULA 1GABA 2BR1A 1IAJA 4GL9A 3PVGA 2E5LM 3NW7A 2IF8A 1C7YA 3BL9A 2XF0A 1OMWA 2OO8X 4AQCA 2XKFA 4DINA 3D94A 4I5CA 4J52A 5IPJA 1J1CA 4KA3A 3NAXA 5KBQA 2H1RA 3R7IA 5HTIA 4MBIA 3KS8A 1SXJC 1KE8A 2IVUA 1P5EA 4AS0A 2GSFA 1SVGA 4F0GA 2XK7A 5AUXA 4RZVA 5CZIA 3MH1A 4EK4A 1J7KA 2YN8A 3A7GA 2C6DA 2ONLC 3C5IA 3KC3A 2CCIA 3K2LA 2VTPA 3SAVA 3B74A 3A42A 2BZJA 1SM2A 3MY1A 1B6CB 4YP8A 5EHYA 5BNJA 3IW4A 2YERA 3W1FA 3NR9A 1ZARA 3C4ZA 2LVAA 4KB8A 4HVDA 3MFUA 4OBQA 3BXWA 4YJTA 4AU8A 2ETMA 3P7BA 4LQMA 5FP6A 2RKUA 3ZFYA 2WPAA 2CGWA 2OF4A 2R5TA 3Q4TA 4APPA 2XK4A 2I0HA 4M84A 4CFVA 3JXWA 4F70A 3VS2A 1STCE 2ETRA 3CTHA 3JR4A 1YI4A 2HCKA 3U55A 3FL4A 3Q3BA 5M57A 4NH1A 4APCA 2XFTA 1MP8A 1JSVA 5L6OA 2N35A 3QU0A 4FX3A 3CGWA 4G17A 3C9PA 2W82A 4IACA 1JVPP 4F7LA 2A4LA 4G4QA 4FNZA 4XG3A 1TGUA 1BYGA 3W32A 2J0LA 1W2FA 4NW6A 5FSWA 3FDNA 3GRRA 3RKBA 4J1RA 4E4XA 5KPRA 4FZ7A 4MKCA 2NYAA 4AFJA 4FTKA 2Q83A 4FK3A 2OZAB 2VTHA 4YURA 1GO5A 4QP9A 2A19B 2P5TA 4EBVA 4D28A 2X7FA 3C51A 2DS1A 1E1VA 1PJIA 4YTHA 2XEZA 3E3PA 5E4HA 2QU5A 4IAAA 5FXRA 4EOKA 5DA3A 3ENMA 2LAVA 4CKRA 2JWSA 3FUPA 4C0TA 3U87A 4BDEA 2NRUA 3RGFA 3KXGA 4MQ1A 5LMKC 1ZZ2A 1SG9A 4BDJA 3AJIB 4AQKA 1KFVA 2FE8A 4XG6A 3R01A 3PVWA 4U9AA 5DNRA 4QP1A 4C4GA 3PXQA 3TV6A 3UC3A 1E9RA 4GW8A 3J81S 3R73A 1WFCA 3M42A 4WO5A 1QZMA 1KE7A 5L8RF 3CF0A 5EQTA 1VEBA 5ICPA 1H25A 4G34A 5KZ0A 4PPBA 4BCNA 3QFVA 4GFOA 4O81A 4RSSA 2WMTA 4J8MA 3F69A 4OU7A 5BYYA 3UPXA 4BWXA 4YU2A 3W0PA 2GHMA 5HNGA 3UZRA 3KEXA 3W16A 3VKGA 5JZNA 3F3ZA 3S00A 3BEAA 3R7OA 3FRIA 3H10A 4EZ5A 4IAZA 2BKZA 3DK3A 4YNOA 2F4VM 1T43A 5JRQA 2R4EA 4FGRA 2KEBA 4O22A 4ZPXA 3LFQA 3B7ZA 4AE9A 3IGGA 2RFDA 5H9BA 3HUCA 3EQFA 3I79A 4PY1A 1OTRA 4RIYB 1H08A 3QD3A 4FTMA 3NUUA 2Z7SA 2EXCX 4S34A 1J91A 3RAIA 3PYYA 3U5ZA 3QUPA 5HORA 3FRHA 3IG5A 3FMLA 1IA8A 4HNIA 2PE0A 4AAAA 4EHZA 4ZZOA 1QVRA 5FXSA 1XC8A 4A9YA 4RF1A 4FODA 2RSVA 3RP9A 4AX8A 4DFBA 2IVVA 3DFZA 1LTMA 2IZSA 4EL9A 4A7CA 3E8CA 4NM7A 4DR4M 3BE2A 2DUVA 3ZZEA 3JVSA 2OXYA 3R2YA 4X66M 3BOSA 4D4RA 1TTEA 3ELJA 4DV6M 5E8UA 1Q97A 2ZM1A 5L2QA 2W99B 3F5UA 2XRWA 4XMOA 2PPQA 4JDKA 5ITRA 3LFBA 3KULB 2YEXA 4TYJA 2W96B 4FIFA 5HD4A 4U0IA 5AV0A 4BC6A 5AP0A 4PD2A 4JIAA 3AT3A 1P4OA 5HCXA 3SBJA 3UG1A 4G3OA 2YM4A 4F1MA 2UW6A 2HENA 2F2CB 1XH8A 3TDWA 4K18A 1PF8A 3HHZA 3QGYA 5HLNA 4CFUA 5IISA 4FT7A 2I0YA 2PUNA 5EW3A 3FUWA 1EH4A 5E90A 1LEWA 4BDKA 2UW5A 2ZM3A 2FVDA 4FV4A 1U5QA 3R7GA 2XBAA 4GV1A 3SOCA 5TOZA 4LV5A 3DAEA 2PVLA 4RPVA 2JDOA 2UU9M 4JDJA 3G15A 5K4IA 3O17A 3QWLA 3I7BA 1IG1A 3RCDA 2ZAZA 4FTUA 2L2DA 2CRUA 4AG6A 4HW7A 3QZGA 4QNMA 4LJ5A 2VN9A 5HE0A 1PJTA 1G3NA 3LJ2A 4AZSA 5J9YA 5L8KA 3OUKA 4X3FC 3FWQA 1DGHA 3TDVA 4O6EA 3E9SA 3PXFA 4QMVA 2DKLA 5J95A 3BHYA 4GH2A 3WARA 4BICA 4UALA 2PMNX 2BIKB 2Y21A 2ZTDA 3H0ZA 5FRIA 4GVAA 4QMSA 1CMKE 4CIZA 5E8TA 1FINA 3SAUA 1OIRA 3VAPA 4FTTA 5L6WL 3VUKA 3A60A 3DCVA 2VTMA 3CGOA 4R3CA 2ETKA 4NSOB 1WBNA 4P17A 3A62A 5HG5A 2R3GA 2VF8A 3QAUA 3EOCA 2EXEA 2AHMA 4EK5A 5CEPA 4O0XA 1J7LA 3RZFA 5KQDA 2PMIA 4DFUA 3QC9A 1Y8YA 2YZAA 4AG5A 3I4YA 4DH1A 1NW1A 3R7EA 3F82A 4JI9A 4E73A 2M60A 1QPDA 3VS4A 4DV4M 3K3IA 4K11A 4RA5A 1SXJA 5HIDA 3ZCBB 4BKJA 4DA5A 3FQHA 4CMTA 4FSNA 4LF4M 4B3MM 5EYCA 4A4LA 3WZDA 4L78A 1OVEA 4XP3A 4EH3A 1W7HA 1H0WA 4CVAA 3Q04A 3ID6C 4BYIA 4BLCA 4F9WA 4HYUA 2YDIA 2ONLA 1Q8ZA 1V0PA 2JKKA 5FLXS 3W0OA 2PMOX 1UNGA 1JAMA 2OK1A 2A27A 3CTJA 3LMHA 4DEAA 2J7TA 1JKTA 5I5ZA 3MFTA 4UWBA 1EFUB 1XHAA 1CDKA 3SV0A 2X0PA 3SC3A 5JFWA 2F9GA 4NC6A 1MRUA 3C4CA 5J5SA 2YNMD 4YJQA 4C37A 4S30A 1NV9A 3UVPA 3FMEA 4PMPA 3TWMA 1Q4LA 4R77A 2WELA 5J7BA 3H4MA 1H26A 4M7IA 4PDYA 4R1YA 4M0YA 2I0VA 2XKCA 3W8LA 4JXFA 3EN6A 4QT1A 1WGNA 4CFMA 3SQQA 4WRGA 5CS6A 2E9OA 3PXYA 1CKIA 4C3RA 3NUSA 5EP3A 1M17A 3VW8A 3GLGE 2B9IA 4GU6A 4L52A 4YJVA 2G15A 5CENA 1IR3A 4TYHB 2BWBA 3ZQJA 3TPZA 3R8UA 3W0FA 3KOXE 2R65A 3GLHA 3TNPC 2F5PA 1K82A 3KB7A 1GY3A 1NNUC 3W0SA 5FM3A 5LVOA 3RFWA 3PJCA 4IM3A 5BVOA 4RVTA 4RJ4A 3BU6A 4E5WA 3LCSA 4E7WA 1VEJA 3FMNA 3HWSA 5DOSA 1M2RA 2EWAA 3OWLA 3T1YM 4K0KM 4XOZA 1R4GA 1YXSA 5A14A 2VIIA 4ANQA 4F9CA 4OTWA 5LMKA 3VIDA 1LR4A 2QO9A 4TZRA 4JR7A 1ZMUA 3EWHA 1OGUA 3UOKA 2UVXA 4QMYA 5JMSA 3HV7A</