1ZMVA

Catalytic and ubiqutin-associated domains of mark2/par-1: k82r mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
313
structure length
293
Chain Sequence
b'GNYRLLKTIGKGAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/Microtubule affinity regulating kinase 2
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
total genus 94
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmvA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmvA01
3OXZA 3PVWA 2DYLA 4FG7A 4CRSA 4WNKA 5JMSA 3EN5A 1GZNA 4M67A 4O7TA 2C6IA 3OT8A 2VV9A 2BKZA 5LQFA 2G01A 2VTTA 2JP7A 3KXXA 4BDKA 4F9YA 5M4UA 2QOQA 3OTUA 5LXMA 2QO9A 1WJ7A 2XKEA 3AC8A 3DFAA 4WO5A 3D5XA 3SRVA 4O81A 4TT7A 2XM8A 4TL0A 4RJ3A 3A61A 3CE3A 3VF9A 1BL6A 2BRMA 3AT2A 4PTCA 3DQWA 4QYFA 3RM6A 5E8WA 5LOHA 5FEEA 3ORXA 4TTHB 1H07A 5AUXA 4RQVA 4HCUA 3ZZEA 2C0TA 3EFJA 2B54A 3RAIA 2XBAA 4D1SA 4D2SA 3FI4A 4CSVA 1B6CB 1T45A 1TVOA 2HYYA 2R3FA 2Z7SA 3MSSA 4I41A 4YZNA 4IAFA 4DCEA 4MF1A 3HKOA 4CFNA 4JOAA 1PXLA 4MHAA 5HG9A 3VJOA 2VAGA 4IWQA 1FGIA 4CFMA 3FC2A 2X7GA 3W18A 4QMTA 1J91A 2BUJA 2WMAA 4QNAA 3B2WA 1Y8YA 4CMTA 4QP8A 5IH6A 4RQKA 3QTXA 2PK9A 3P7CA 5EYCA 4FGRA 3HV6A 2BROA 3LE6A 2R3PA 4TNDA 5T6KA 4FSYA 1J7UA 3FI8A 5EYMA 4ZLYA 1ZOGA 4O7ZA 2UW8A 1OL6A 3WYYA 4IZAA 2LVNC 1JSUA 3EOCA 2ZM4A 3G6HA 3QD4A 4D2RA 3I7BA 2E9VA 2VD5A 5KMIA 4RLKA 3QL8A 4MNEA 4D4SA 3TZ9A 4LI5A 3R9RA 4TYEA 3TDVA 3LJ1A 2IW9A 4ZZOA 5IMEA 3FUPA 4IXPA 2F2UA 3HMPA 5EG3A 3WILA 1Q8TA 2ZOQA 4I20A 5BVKA 2V62A 3K5VA 5D41A 1PMVA 5EM5A 5IA5A 4A9UA 1QCFA 3BYUA 4EBVA 4I23A 1G3NA 3T3UA 1K2PA 3EH9A 2OK1A 2YITA 1MN3A 2XRWA 2RG5A 3VUDA 2L4EA 4P7EA 3QFVA 3A4OX 5H2UA 4OTGA 1ZARA 2UZTA 2YDIA 3KKVA 4YLLA 5AAFA 4B8MA 4C35A 1DO0A 5L4QA 2JDRA 2EJSA 4OTWA 1NW1A 5IQCA 3AGMA 1SZMA 4XP3A 1P2AA 3RBWA 4AA4A 5JGBA 3FMJA 4BCHA 1BVSA 3OMVA 4KA3A 4F9WA 1OL5A 3EJ1A 5AFVA 4S32A 3TACA 3QC9A 3P4KA 1XBCA 2X1NA 4FODA 3F9NA 4C2WA 2BKKA 4AZFA 2GQSA 5HTIA 4FVPA 5HE0A 3LMIA 5FGKA 4AX8A 4JAJA 2C4GA 4AN3A 4I4EA 2Q83A 1CKPA 2EXCX 4UWYA 4MWHA 3C50A 2FSLX 4AGWA 3OWLA 4O91A 3RTPA 4XV1A 2YDKA 3P79A 4AT5A 4GIIA 4JBVA 4E20A 5L2TA 2WMBA 2PVLA 4XLVA 3H9FA 4M13A 1P3QQ 4QMMA 4ANOA 5DG5A 2WMXA 2ITQA 1YQJA 5I5ZA 3R1NA 2X6EA 4EH9A 3MPAA 4FKSA 4FOBA 2HIWA 1GNGA 3GENA 4ZTQA 3TNWA 1SMHA 4IC7A 1HJPA 3DK6A 1TTEA 3GLGE 3OCGA 3S95A 3UIUA 4AZSA 5BUIA 1ZXEA 5DRBA 5DT4A 4TWCA 5C01A 5K3YA 4XH6A 5JEBA 2RG6A 2A2AA 4Q9ZA 3IW4A 2B55A 3F7ZA 4RA5A 3W55A 4RBLA 3GC9A 1WZYA 2BIYA 3HZTA 1F4IA 3LJ2A 5J7HA 5KUPA 3DTWA 2QHOB 2R3GA 1UVRA 3TIZA 3UP7A 1WBOA 3RINA 1LR4A 1UU9A 2BRBA 4AOTA 5EDPA 2OF2A 3GOPA 4K77A 5DEYA 4BDAA 3EZVA 4IM3A 5D12A 4DT9A 3FBVA 4YBJA 3LMHA 2C0IA 3EQDA 3M2WA 2XK8A 4TW9A 5BVOA 4KNBA 5CF5A 3PA3A 3S1HA 4JT3A 1O6YA 3W2SA 2WMRA 5CALA 3FMHA 3DDQA 2UW0A 1SG9A 3GU7A 1IEPA 3R0TA 5KMJA 3RALA 2DI0A 3VIDA 3NYXA 2ITYA 4IB0A 4JRVA 3GI3A 4C61A 2HXQA 2BWBA 3EKKA 4O1PA 3ACJA 2FYSA 4R77A 2ZM1A 3FJQE 3PP1A 3GCPA 3QGWA 4YBKA 1GO5A 2C3LA 2BR1A 4EOJA 4BCQA 4PMMA 5M07A 4B0GA 3O51A 3Q9ZA 1UV5A 4MXOA 3ZSGA 1Z57A 2CGXA 3ALNA 4PUZA 3NMUF 3P7AA 3ZZWA 3ZM9A 4C33A 2B1PA 2OH4A 4G9CA 3DAEA 3GFWA 3W10A 4FSMA 3PY3A 5JSMA 5EM7A 2ZJWA 2NPQA 3P23A 3P5KA 3TV4A 4F0IA 3DK7A 2NNWB 3C4CA 2R3RA 2R3MA 4GSBA 4OUCA 1OI9A 2ONLA 4A4XA 2XK4A 3FLNC 3KMWA 2CLQA 2JDOA 4AUAA 5FBOA 1H28A 5AP4A 2OKRA 1YI4A 2R3HA 4CYJA 2OI4X 3OWJA 4BL1A 5AX9A 4G17A 5DR2A 5CSPA 3DJ6A 3PIXA 1CUKA 3RI1A 3L1SA 1I09A 2VTAA 3R8VA 2EB2A 2OU7A 3BQCA 1REJA 4BCGA 4WA9A 4X0MA 3VF8A 2W9ZB 4YJOA 2JIIA 2VNYA 4ACMA 4XLIA 4DG2E 2W1DA 3LPBA 5B2MA 2HAKA 1WVYA 3LCDA 4BI0A 5CAVA 5BVFA 3K5UA 3LXLA 4HGTA 4FTOA 3NIEA 3NWWA 1JOWB 4XEYA 4E4NA 3QC4A 2Z7QA 3ANRA 3EL8A 4IC8A 4YSMA 3R8MA 3RAHA 3UDBA 4BDEA 5A4EA 4U45A 2QNJA 3ZLYA 3O8TA 2PZPA 1FOTA 1J1BA 2QVSE 3DLZA 2JKMA 4GEWA 3GU5A 5CY3A 1OKSA 4KINA 3MH3A 3L8PA 3VS7A 2GCDA 4LUEA 1JKKA 3UQFA 3OWKA 5D1JA 1MUOA 2YM7A 4EUUA 5AAEA 2JY7A 4UZDA 4RVTA 4FKUA 3RNIA 4DH7A 4EH8A 3IONA 4WNMA 2BRNA 2UZWE 1IASA 5BYYA 5ACBC 3IECA 4BVUA 4KWPA 3TN8A 4M0YA 1Q97A 3PFQA 3DBFA 3HRFA 4CGAA 3PE2A 5KBRA 4KBKA 3FI2A 4FNYA 3V8SA 2X8DA 2J5FA 1T46A 4LQMA 2W99B 3LJ0A 2IVTA 5BPYA 5EI2A 3FQEA 4YTCA 3R8PA 3ZH8A 4CT1A 2XNEA 1KE6A 2QODA 1W7HA 4IMYA 2JZ0A 4JBPA 4L3LA 2C30A 5CF8A 3C4WA 2V5QA 3NNXA 1GZKA 4F0GA 2WEVA 3UG2A 4E5WA 2VX0A 4F6WA 5A6OA 1JQHA 2V55A 3ACKA 3F88A 2QLQA 4AZWA 3DA6A 2PVHA 5KMNA 5A54A 1ZZLA 3E3BX 1OM1A 4JQ7A 4EH6A 4LMUA 2WU7A 2CGUA 2ZDTA 4ZS0A 2O8YA 3O96A 4FIJA 3TV7A 5HG7A 2JAVA 4AN2A 4O7NA 3EZRA 4QQ5A 3PWYA 5M08A 3L8SA 4D2PA 3QQLA 4OLIA 4FE2A 5E8TA 2VGPA 1Q3WA 5HNBA 3N51A 4IEBA 5FUTA 3T3VA 4YSJA 4RC4A 3Q4TA 3WIKA 2WOUA 3GLIE 2Z7LA 3EMGA 2Q0NA 3EL7A 4LRJA 3HECA 4RA4A 3COKA 4ZY5A 3WE8A 1SYKA 1WGLA 1CMKE 1JKLA 4JDIA 1J3HA 4WT6A 5DT3A 5H8BA 4D4RA 4O7LA 1FINA 5GNKA 3ZRKA 2NP8A 1TR8A 2G2IA 4FK3A 4FSUA 4UV0A 4WG3A 4AE6A 3TUBA 4DITA 4A9TA 4X21A 2JZ1A 4O7YA 2UZBA 4UB7A 4EI4A 5GJFA 4AA5A 4IWDA 3WI6A 2LVPC 2YIXA 4ID7A 2ETMA 3LFAA 3NYNA 1P4OA 3SXSA 2IW8A 3UVRA 1OITA 1H1RA 4ARKA 1GZOA 4RIYA 4C0TA 2O5KA 4GKHA 3KMMA 4O6EA 2PMLX 3UPXA 2OXDA 2OJ9A 5HU3A 1Y91A 5EQYA 3KRRA 4ZTHA 3RAKA 3DJ7A 2RF9A 5B0XA 3MJ1A 1OKWA 5J9ZA 4QTDA 2RL5A 4DH3A 3PVGA 4R7BA 3MH2A 3NUUA 4AG8A 4M69A 3DGKA 3FLZA 5H8EA 3RK7A 4E4MA 1PXIA 5IA2A 2HENA 4CFFA 5KCVA 2BVAA 2QOIA 3UNJA 3AOXA 4FTAA 3KXMA 3PPKA 3ALOA 3F3WA 3TNPC 3O8PA 4O2PA 4Q9SA 4NM3A 1YI3A 4J53A 4HVGA 5CXHA 4K0YA 2CJMA 1WVWA 5JFXA 1NY3A 1YXTA 4QMZA 3ZXZA 4LYNA 1DI9A 5GJDA 4E5AX 5CXZA 3IK3A 3FLQA 4GK4A 4AN9A 4D9UA 2ZM3A 2QLUA 5HE1A 2ITXA 4EL9A 3IQ7A 5EYKA 5AUUA 4XX9A 2IPXA 1WHCA 2BZIB 3CQEA 3ZFXA 4I1ZA 4ACDA 2WTVA 1H25A 4C4GA 5DA3A 2C6LA 2Z2WA 4MXZA 3R7IA 2EUFB 3FYKX 3U9CA 5ICPA 4WP2A 1TKIA 4FVQA 4GK2A 4NT4A 5CASA 2WXVA 2UZOA 2XF0A 4J98A 2B0QA 3CTQA 5BUJA 1KSWA 1QL6A 2W1HA 5J95A 1O6LA 3HMMA 2IZRA 5B2LA 5AJQA 2R3QA 4RWJA 1ZYDA 1BYGA 3NDMA 3TDWA 2WOTA 5B2KA 2W1IA 3VQHA 4G3GA 5HNIX 2UW7A 1WVXA 3GU4A 4C3RA 3CQWA 4X2GA 1T6OA 4JL9A 2WMUA 3PXYA 5DH3A 4ALUA 1A06A 4ANSA 1DO2A 3LMGA 3A8XA 3IDBA 4XP0A 3MI9A 4G9RA 2QURA 2SRCA 2VU3A 2IZSA 2O2UA 4GK3A 3ZC6A 1PMEA 3EFWA 4YHJA 2BZJA 5A4LA 4YZCA 2JBOA 4UXLA 3QCYA 3BWFA 1SM2A 4ZMEA 3BPRA 3VS4A 2C6TA 3NCZA 4IBMA 4M84A 3QALE 4FEQA 1T43A 4L01A 4RPVA 4UY9A 5HD7A 4ZJJA 2IO6A 2GHLA 3V5LA 1E1XA 3UTOA 2PUPA 4QTAA 1LUFA 4UMTA 1WR1B 5CQWA 4BDJA 4ASXA 5M4FA 1VEJA 2P4IA 3LCSA 2EU9A 2X81A 3V5WA 2A19B 3WYXA 4OTHA 2XNGA 4D5KA 3ZO2A 3KB7A 5LVPA 3GC0A 4N6YA 5A4CA 4YJSA 2AUHA 3E92A 3FC1X 3WOWA 4I0RA 4X3JA 2VWUA 4HGLA 2XKCA 2WEIA 5LVNA 3HAVA 1YXXA 1DM2A 1H4LA 1U4DA 1CKJA 5M09A 3MVJA 4EK8A 2I0HA 3Q4UA 4FT5A 5AR7A 4JVGA 4HYIA 4R1VA 3TTIA 5KX8A 2BDJA 3DPKA 2P3GX 4IB3A 2YAKA 4IZYA 5I9VA 4BDFA 3Q04A 1TQPA 3ET7A 3D9VA 3OWPA 2PVNA 5CX9A 5L3AA 5AA8A 1OL7A 2ZMDA 4R5YA 5AM7A 2PVMA 5ANIA 1H1WA 5HTBA 1QPDA 5KKRB 4BGGA 1B39A 3FKOA 3UOJA 4QMPA 5FP5A 1V0PA 1IM2A 3VAPA 4DTKA 2ZAZA 2R0IA 3CIKA 2VTRA 3LFNA 4TYGA 5L2QA 5B7VA 5EDQA 3BGQA 1GJOA 3CQUA 1M2RA 2YIWA 2X6DA 3FAAA 4IWPA 4F63A 4PNKA 4Z7HA 1ZMUA 4GL9A 4YJQA 4NIFB 3COHA 1Y6AA 2BRHA 3ZFMA 3KXHA 4B8LA 2Y4IB 2EXEA 4NM0A 5CNNA 3QF9A 3KA0A 4FX3A 5JFWA 1UWJA 5LMKA 4P2KA 3ZDIA 3DXPA 5HLNA 3IG7A 3OOGA 2XEZA 3VULA 4ZJVA 4WHZA 2JIUA 4H3PA 3NSZA 2EXMA 3SG8A 3F92A 5TR6A 3FZPA 2KTYA 4NKSA 4WOVA 4EK3A 4DFUA 4RMZA 3KXNA 3U54A 3R71A 4DFZE 2XS0A 5JT2A 2RSVA 4MKCA 4F9BA 5HLPA 3SG9A 5GINE 3NUXA 2G3QA 3MVMA 3PUPA 3RWQA 3LM0A 4ACGA 2J0JA 2IW6A 3BE9A 4GH2A 4G3FA 4EQMA 3OEFX 3DZQA 1CKIA 5EH0A 3C0HA 4ZTMA 3NPCA 1YW2A 4PTGA 5HIBA 4DGMA 1OAIA 4GU9A 2OGVA 2A4LA 3NS9A 1HT1E 1MP8A 4R5SA 4X3FA 1L3RE 3ZSHA 3QX2A 4ZTRA 4WG5A 5F20A 4ZK5A 4B7TA 4FZFB 4FV6A 2F9GA 4Q2AA 3KVWA 2QU6A 3WF6A 1E1VA 2OIQA 4JJRA 1RW8A 2JC6A 4C62A 4D9TA 4E1ZA 4OGRA 3R02A 2VTOA 3FXXA 2CCHA 3SXRA 5J5TA 1QMZA 5CI6A 2OZOA 3HA6A 5C8NA 3BLHA 1IRKA 2ZV7A 5AR5A 4QMYA 5HCXA 4CMOA 1U5QA 4MXYA 4CG9A 1XHAA 2A0CX 4QNYA 2F49A 3UOLA 4CT2A 3LQ3A 4JG8A 3SGCA 3THBA 3QQFA 3PA5A 3BLQA 4C3FA 2WTWA 4F9CA 2NRYA 3I81A 4QQTA 4MBIA 1OBGA 2FGIA 3OY1A 4IJ9A 4U43A 4Y8DA 3R7GA 4DH8A 3UO5A 2CKOA 2R3JA 1GZ8A 3BX5A 3VRYA 2OO9A 3R00A 3U87A 4YZ9A 3EKNA 2C47A 2X2LA 2QONA 4PDYA 3KC3A 4H58A 4U0IA 4FTKA 3UYSA 4L3JA 4QMLA 5M57A 2FSMX 2RIOA 4FKJA 4QPSA 4BZNA 1OPLA 3EQFA 2BPMA 2C3KA 4TYJA 5CSHA 3VN9A 4O0YA 1PKGA 3P1AA 2P2IA 4FSQA 5ETAA 3CTHA 3NZ0A 2JNHA 1XKKA 1VQ1A 5KBQA 2PZYA 3IW5A 4QYYA 3VUGA 4BTFA 5E9EA 1B38A 2WZJA 5EI6A 3SAYA 4D2VA 5IA3A 4F99A 1W84A 3LW0A 2BZKB 2W17A 3H9RA 2XIKA 4HYHA 4TXCA 1WMKA 2PMOX 4RFYA 2ZTDA 1Q99A 3BZ3A 2YJRA 1WCCA 4RIXB 2WQOA 4ZTNA 3HV3A 3FLYA 3GEQA 2VN9A 2F2CB 2GFCA 3PRIA 2LVQD 1H1QA 4XP2A 4EH7A 3M1SA 4LM5A 4IACA 3WF5A 4EHGA 3QRTA 5E92A 2OXYA 2ZVAA 3BKBA 3ZS5A 2L2DA 4EHVA 4F7NA 1NVRA 2WQEA 3ORPA 4BTJA 1W0XC 4YMJA 5M06A 3BV2A 3NUYA 4FUXA 4HZRA 2W0JA 2XNPA 5JRQA 1OUYA 3OT3A 2DAIA 4S30A 4DG0E 2C5XA 2UW5A 3UQGA 5AUTA 4ZS4A 2O63A 3AMYA 3GBZA 4KUJA 3G33A 2OFUA 2B53A 1DV0A 3EQGA 3QZHA 1KE8A 3RCJA 2PPQA 4R7IA 1ZWSA 4II5A 4L53A 4DH1A 3R2BA 4I6HA 4J8NA 4NCTA 4FV4A 2NRUA 3TKUA 2OIBA 4XYFA 4CTCA 2BMCA 4U41A 4PNIA 4CQEA 1KUTA 1MRYA 1E94E 5IEVA 1GIJA 2I6LA 3CCNA 2W9FB 5KKRC 4XG8A 4YPDA 1VDLA 3H3CA 3OCSA 2W1EA 4LOOA 4YO6A 3A62A 3ZEPA 1XH6A 3RZBA 4F08A 4TWOA 3OW4A 3FLWA 2R7BA 3QTZA 3RM7A 4E5BA 4I5HA 4BDHA 4J71A 4Z16A 4WRSA 5IF1A 3LQ5A 1OL2A 2Y7JA 3EYGA 2WNTA 2Y4PA 3FMMA 3MA3A 3PLSA 4H3BA 4RVLA 3DLSA 3VHEA 2V22A 4BCFA 4BWKA 5KNJA 3JXWA 2QG7A 3PG3A 2Y4IC 5D7VA 4KBAA 3UNZA 3FMLA 3PPZA 3V3VA 2VTLA 2UZEA 2XCHA 3DXNA 4ZXTA 3NUAA 5TOZA 3RMFA 4ZP5A 4WSQA 4MBLA 4N4SA 2C69A 4CD0A 2PE1A 4G1WA 2X9EA 4PY1A 2DHYA 5HX8A 4EORA 3NCGA 3RWPA 3QD3A 5A46A 2HZ4A 1M2QA 3DBEA 4NM7A 4DEDA 2QQ7A 5BVNA 3H9OA 5HU9A 1IFYA 3O71A 3R6XA 4ZEGA 3NNVA 4O6LA 1OB3A 4FTMA 4EOSA 4HPUE 2C68A 2K9DA 1LEZA 4D0WA 3LCTA 3R7EA 3W33A 3HDMA 2KULA 1R0PA 4UN2B 1PMNA 3AD5A 2XEYA 4M8TA 3VHKA 2B9FA 2J5EA 5I3OA 1Q62A 4L00A 4OTFA 1W83A 5DVRA 2VTSA 4BFMA 3EWHA 3P78A 3O7LD 1PXNA 1LEWA 5J9YA 4A06A 3DTCA 3UODA 3O17A 4OBOA 4FNZA 2R7IA 2YIQA 2BAQA 3KF4A 3AC5A 1KV2A 4AZTA 3QRIA 3TZ7A 5F1ZA 5CU4A 3Q9WA 4O22A 5IEYA 5E8VA 2XCKA 3U51A 5HO7A 2CN5A 3PJCA 4U6RA 5C03A 2Y0AA 4G3OA 4PX6A 5AR8A 5AIRA 5IQGA 1FVTA 5CF6A 4ALWA 1VR2A 1WBVA 4FSWA 5AV0A 2Y9QA 4DTBA 4FT9A 3QU0A 3HP5A 4Z9LA 4AFJA 5CLPA 1UU7A 2G1TA 3HL7A 3QQGA 4A4LA 4F1OA 4ZSAA 3ZLWA 3E21A 1OPJA 3NVKI 3G9LX 5K5NA 4JR3A 3D7TB 4V04A 2QG5A 2HZIA 4BCNA 2IZUA 3SOCA 5CU6A 2HXLA 3VS6A 5ETCA 3FI3A 4NW6A 4CRLA 3SW7A 3CTJA 1CSNA 3MFSA 4FTTA 4NEUA 4X7QA 5H3QA 4BBFA 4RZVA 1Q8UA 2FUMA 3HRBA 4YNOA 5EQEA 5LVLA 3UO6A 3K9OA 2OH0E 3MTFA 4FV8A 5FM3A 4D28A 1XXHE 4JAIA 1OZ1A 1Y8GA 4ASEA 4D55A 3FXWA 1GOLA 5F4NA 5E90A 5G6VA 3GC8A 1A48A 4KKHA 5J8IA 5I9YA 1KV1A 4E73A 3E88A 4UALA 2Z8CA 4ZLOA 3TXOA 4MD9E 4O21A 1HT2E 2ETRA 5IQHA 1LPUA 3FPMA 2FSOX 3MVHA 2OBJA 5JZJA 3EQRA 4FBXA 3VS2A 3GQIA 4DG3E 2EB3A 2KNAA 2RFSA 4TWPA 1ZYLA 4IVCA 2W5AA 4CCBA 4DEBA 2R3LA 3V5TA 5IISA 2UV2A 5LVOA 4JNWA 2XKFA 1V1KA 4IZ5A 1DAYA 4FTRA 4AOIA 5DLSA 1R78A 4BZDA 4AACA 4EC8A 2VWXA 4B99A 2UZLA 2VGOA 4RWKA 4AS0A 5CI7A 2XVDA 4V01A 1RDQE 5M56A 3GLFE 3KEXA 5F95A 3WARA 3TIYA 3F2RA 3UNKA 3MB6A 2JFLA 4RG0A 3ANQA 1YXVA 5JQ5A 4YJRA 1R0EA 1PXMA 3QBNA 3QA8A 3I0OA 5CS6A 2XM9A 3FKNA 3BV3A 1LP4A 2BAJA 2YM5A 3VW6A 1M52A 3G0FA 4J1RA 4F4PA 4EKLA 3ZXTA 5JI2E 3OW3A 5DFLA 2V7AA 1YOMA 4GIHA 4JBQA 4EH4A 1UA2A 1NV9A 3PSCA 1FQ1B 1BMKA 3PSDA 4QMUA 2J51A 2C5YA 2DQ7X 2ACXA 1W82A 4JR7A 5DI1A 4RWLA 3RPOA 3WF9A 4D58A 5BYLA 4G6NA 2CWBA 1ZAOA 4XOZA 4PPBA 4DGNA 3ATSA 2B52A 5HCYA 4BGHA 1UU8A 3E64A 3DOGA 4FK6A 4O83A 3QX4A 1AQ1A 3L8XA 5ANJA 2C3IB 5M4IA 4BWXA 4AE9A 3GC7A 1WBWA 3R21A 4ACHA 5K0XA 2QU5A 4QD6A 2E9PA 4FG9A 4JX7A 3RPRA 3ZOSA 5F9EA 3PVBA 2E9OA 4EZ5A 5AR4A 3OP5A 4IX5A 4XG6A 2ZDUA 4HW7A 3A7JA 5E91A 1WBNA 1ZMWA 2OO8X 4K6ZA 3VUMA 5CEMA 4RVMA 3FXZA 4BY9E 2I1MA 4IIRA 4NUSA 1YKRA 2QOBA 3BRBA 4PL5A 5CAPA 3ZM4A 2JGZA 4K2RA 4HCTA 4BDBA 3FKLA 4UZHA 3RPYA 3DBDA 2QOOA 3O2MA 4AGDA 3ULZA 4FSRA 3F7WA 4XMOA 2BDFA 5AP0A 4DINA 3SRVB 1P5EA 2XJ2A 4NTTA 1OKYA 4LL5A 2J7TA 3R7VA 5ETFA 5BNJA 3PY0A 3OBGA 1PYXA 1G41A 1TQIA 3VO3A 4V05A 4PP7A 1YWNA 2X8EA 4LRMA 2YWPA 4BKJA 3SC1A 3F66A 4C34A 2IWIA 4AXAA 4DYMA 4C8BA 4OT6A 5A9UA 3G0EA 5CU0A 4NZWB 3IO7A 3OROA 4L6QA 4S31A 4GS6A 1G3IA 4Q7JA 1O9UA 3C4XA 4I3ZA 4UWBA 4G6LA 5CVFA 4DFXE 4EUTA 3G5DA 3MPTA 5HOAA 3WBLA 2XKDA 4A9RA 4EQCA 5LCJA 4H39A 4MCVA 1U5RA 2YLEA 3GCSA 3OBJA 1WBSA 3DKFA 4FIFA 4ZTSA 4BRXA 5GIPE 1QPCA 2XK6A 3IOKA 5L6WL 1F0QA 1GY3A 3A60A 3DJ5A 2O0UA 3LVPA 4ITHA 4O0UA 3V01A 4EC9A 2EKKA 5DEWA 3VS3A 2R4BA 3ERKA 5HGIA 4BN1A 4EH3A 4KS7A 4M14A 2I7QA 4LGDA 5FQDC 4MVFA 3KU2A 4ANMA 4GG7A 2CLXA 4IH8A 4O0XA 3UOKA 4NL0A 5K0KA 3LFDA 3GLHE 2UZDA 3CP9A 4KRDA 2J2IB 4O86A 3DDPA 4I6QA 2VTJA 3MW1A 3CBLA 3KGAA 3NNWA 3B8QA 4DFNA 5CEIA 1CM8A 2E9UA 3CY3A 3Q4CA 4XV2A 1BI7A 1G5SA 2OJIA 4R1YA 4MNEB 3NX8A 4D0XA 4FG8A 4PRJA 5E8ZA 3ZRLA 5JGAA 4FF8A 2YCRA 5HORA 4IWOA 3AT4A 4D2WA 3LCVB 3B2TA 4DEHA 1ZYSA 4BZOA 5CTPA 5CSWA 4E7WA 3PZHA 4P5ZA 4EOMA 5LCKA 4F0FA 4B9DA 4H05A 4PPCA 4BWPA 2GFSA 4UMRA 1WIVA 4RFZA 4USEA 3TUDA 2VTHA 3KF7A 3D5VA 2R3OA 3Q5IA 4FT3A 5BUEA 3E93A 4DFBA 1JBPE 3QRKA 2ZB0A 4EZ3A 2WU6A 4JI9A 3OVVA 4NJDA 2XJ0A 2YWVA 4I21A 4TYHA 4UMQA 5KZ0A 3I4BA 3TEIA 4BKYA 3MY0A 3ODZX 5ETIA 4RX5A 4GT3A 1XH4A 4X6RA 4PWNA 3W8QA 2UVYA 4ERWA 3HV7A 3EYHA 3I5ZA 2DWBA 3UIBA 2HOGA 1GIIA 2ERKA 3IS5A 3DS6A 4A4OA 2XBJA 4EJNA 2BILB 2W4OA 4BF2A 3UPZA 3PIYA 4O0RA 4DE4A 4IAAA 4IDTA 4D1ZA 1M17A 3HRCA 2LVAA 5ANKA 5J5SA 5T3QA 3SVVA 3EQPA 1MQBA 5CAQA 2RGPA 3NUPA 4USDA 4NM5A 4N57A 2ETKA 5JRSA 3E46A 3QZFA 4GUEA 3TKHA 3R8ZA 3QTQA 4IHPA 4YR8A 2QHMA 1XWSA 4KD1A 4TYIA 4F70A 5E8XA 5L8KA 1FPUA 2BDWA 3RGFA 4QPMA 4U44A 4EZ7A 4DBGB 1ATPE 4FTCA 3OUNB 4L8MA 4W4VA 4E3CA 4NK9A 2UW4A 5HI2A 3VS5A 1IG1A 2PE2A 1WBTA 3SOAA 2GS7A 2X7FA 4G16A 3PY1A 2DUVA 3LFSA 2W06A 4IM0A 5BMSA 2GSFA 3PRFA 1UKIA 3FPQA 5FWKK 2OW3A 2O65A 2VNWA 3R22A 2Y6MA 4E6QA 3L9PA 4I5MA 2XNOA 1APME 4YZDA 4BHNA 4C4JA 5IG1A 3NAXA 3MVLA 3PJ3A 4QP9A 2OIDA 2JITA 2JEDA 2OZAA 3MIYA 4ITJA 3L9LA 1HCKA 2JKOA 4WD5A 5IDPA 1S9IA 1XB2B 4JG6A 3WIGA 4QMQA 4U8ZA 5AUWA 5LVMA 4IW0A 3EN4A 1BX6A 2XP2A 4RJ7A 5ANDA 3MH1A 5EW3A 5EHOA 3PJ8A 3QCXA 5L2SA 3QKMA 1SNXA 4FTQA 5AUYA 3DXQA 2E9NA 2YAAA 1OKZA 3P9JA 4IZ7A 3WF8A 5IQDA 3F3TA 4WUAA 4KIKA 2WAJA 3F3VA 3RVGA 4EH2A 4DN5A 2YCSA 4B6LA 4FTJA 2OJGA 4JXFA 4TNBA 4J97A 5G1XA 4OTIA 2XNNA 4C58A 3DAJA 2DAEA 5AP5A 4NH1A 4C36A 2AC5A 2LTUA 1IA8A 3BYOA 4L67A 3G51A 3TKIA 4YJUA 4AAAA 3KCFA 2GNLA 5EDRA 2C1AA 4PDSA 2BWEA 1FMKA 5CU3A 4YTHA 3Q32A 4C37A 4F9AA 4DA5A 4FOCA 4P90A 4YUQA 4MYGA 2JY8A 2XMYA 3F2AA 5LMAA 3MBLA 3RJCA 2QOKA 2GS2A 1U54A 3COIA 4BIBA 1IAHA 3VC4A 4HZSA 1H00A 2QO7A 3R28A 3ZSIA 4CFXA 4DFYA 4FSTA 3R04A 2H8HA 3R9DA 1Q3DA 3FZ1A 2X4FA 1TQMA 5EOBA 4LMNA 2YDJA 3I7CA 4FKPA 2GDOA 4S2ZA 3IW7A 3MY1A 5J87A 4O7SA 4FIGA 5HG5A 5HZNA 5EM6A 5LJJA 2K0BX 4O0VA 3ZUVA 3CGOA 1OIQA 5T68A 5GZ8A 2WMQA 4YJPA 4BC6A 1H1SA 2HW7A 4AW2A 2Z60A 3I1AA 1KYIA 1A9UA 4KBCA 5C8MA 2OJJA 3GT8A 5BVDA 2ITPA 1ZZ2A 4O7WA 2VTQA 1Z9XA 2IVVA 2C3JA 2PTKA 3FYJX 3SKCA 4FEVA 3UP2A 4G34A 4MX9A 4APCA 3LCOA 4FV7A 3TM0A 5M51A 2CKEA 1UU3A 4ZSGA 5EKOA 2UZVA 2KHHA 3R1QA 4U3ZA 5HVYA 4E8AA 1PGYA 3OXIA 2ZMCA 1H26A 4EOOA 4QTBA 4P5QA 4IFGA 5DWRA 3EQIA 3DCVA 4W4YA 4X2NA 3LXPA 2X4ZA 4JS8A 3HYHA 3F5GA 5AV4A 3OHTA 4DCAA 4LFIA 4BDGA 4RLLA 2OLCA 3ORKA 3G15A 4LGGA 2QI8A 5D7AA 3T6PA 1QPEA 2KNVA 4U97A 2P55A 5HEZA 2W4KA 4GYGA 4ZJIA 1XBBA 4OAUC 2ITWA 3HP2A 3ORMA 3QQKA 4D4VA 4O0SA 5HVKA 2C6EA 2UW3A 2EKFA 3LHJA 4V0GA 2YLFA 3VBYA 3UC4A 4AGUA 3DNDA 3A2CA 4ZAUA 1R1WA 3IGOA 2HCKA 3LXNA 4BCOA 2MGWA 4BGQA 3EN9A 5KO1A 2YM3A 1J7LA 5ANGA 5IQIA 3U4UA 4BI1A 3F5XA 2O25A 4CEGA 5FD2A 4APPA 4BCJA 2YEXA 5BQ0A 1EH4A 2YN8A 3OD6X 3DB6A 4W8EA 3HNGA 1CDKA 4RIOA 2JY5A 4L7SA 3QRUA 3H30A 5A4TA 2WQMA 4D1XA 2EWAA 5K9IA 4F1TA 3ZUUA 4XCUA 3U9NA 3GCUA 3TTJA 3D0EA 3JY0A 4CZUA 4JX3A 4M15A 4R3CA 3HUBA 3KN6A 3PXFA 4F7SA 2W1FA 4OTQA 3FQHA 2YISA 1S9JA 2C6KA 1FMOE 2VTPA 3DKCA 3NW5A 4U7ZA 5E8UA 2QHNA 1XBAA 4E4LA 3I79A 3QYZA 1OUKA 3I6UA 5H9BA 5GZAA 2IVUA 3QLFA 4YGAA 5E7RA 4FIEA 4KIOA 2V0DA 4Z55A 2ITUA 4GJ3A 2YFXA 3V8WA 2AC3A 2QO2A 1JKTA 3C5IA 2WIPA 1WAKA 1PKDA 3FV8A 5FTQA 2FO0A 4EBWA 2OG8A 3OC1A 1KOBA 3C0IA 3AMBA 4QQJA 4X2FA 5CNOA 4Z3VA 4XG7A 3KY2A 2WQNA 3KRXA 2C6MA 4XG3A 1XH9A 2W1CA 2RRUA 3MYGA 3H4JA 3DB8A 4BIEA 5DR6A 4W8DA 4IB1A 3HVCA 4W4XA 4EYMA 2PL0A 3FHIA 2DS1A 4PDOA 4FEUA 2XNMA 3A7FA 4A9SA 4DEAA 4YO4A 4YC3A 2CKPA 5KMOA 2W05A 3CLYA 2OZAB 2DKLA 3CKXA 3Q4ZA 2L4FA 5CT0A 3ODYX 4RC3A 4ZZNA 1H01A 4RIYB 4WNPA 1NVSA 2VO3A 3RKBA 2IG7A 4IB5A 4M0ZA 1YI6A 2A1AB 4MH7A 3E5AA 3F2NA 4Y46A 1HCLA 5I9XA 1AGWA 3JR1A 1VYWA 1K9AA 4H1MA 4PDPA 4RZWA 2CGWA 4YPSA 3VWAA 4EOPA 1HOWA 4YLKA 3GNIB 3W8LA 4G3EA 4GVJA 4GJ2A 5C1QB 4M69B 2YM8A 1YVJA 3WZEA 2BHHA 3VNTA 3QKLA 3FL5A 1VJYA 3R1SA 4FGBA 4CCUA 3RHXA 3Q3BA 3PA4A 4KKEA 4ASDA 3ITZA 3GUBA 2B7AA 4FYNA 4J95A 3UOHA 5HHWA 1SVEA 1R39A 4E6CA 4QTEA 3OCTA 3GCQA 4KSPA 3BYMA 3NUNA 3JS2A 4KS8A 3SD0A 4GW8A 4YTIA 1ZY5A 4L44A 3ZRMA 4UMPA 3F5PA 2WMSA 2ONLC 3GVUA 4QP3A 4DC2A 5EOLA 5HKMA 2J9MA 4UN0C 1MQ4A 5CWZA 4ZY4A 3AXWA 2UVZA 5AP7A 1KWPA 4IX4A 4AT4A 3ELJA 5DIAA 3R7OA 4EEVA 2PWLA 5CYIA 4BKZA 4A9YA 2GU8A 2VRXA 4F65A 5J1VA 1ZRZA 3ATTA 3R9HA 3FEGA 2X2MA 3JVRA 4AQCA 4H1JA 1XH5A 1JNKA 3OY3A 4XBUA 3BBTB 5JQ8A 2PVKA 5CF4A 4ANNA 3GP0A 1CTPE 5EK7A 3ZHPC 4LL0A 1V0OA 4UYAA 4UEUA 4UX9A 4TKSA 3EN6A 2HY0A 1VYZA 3Q52A 5E1SA 5J1WA 2XIXA 4RVKA 5JH6A 1V92A 3G6GA 2IN6A 4YJNA 5ITAA 3GGFA 4IVDA 4QP2A 4C7TA 4TZRA 4CKRA 3B8RA 4K11A 4QQCA 4XV9A 1H24A 1U59A 3BELA 2X39A 2GHMA 4G5JA 2DAGA 2X9FA 5FLFA 3WE4A 3BU5A 4FUYA 4YHFA 2ITOA 4NFMA 5IU2A 3NW7A 4W4WA 3MMPA 3ORLA 2WGJA 2CSNA 4RGJA 4CNHA 2X0GA 4QO9A 5DRDA 1VZOA 2C0OA 3LFQA 3GU6A 4WUNA 5I9UA 4FKGA 5TE0A 3ZLSA 4DHFA 2J6MA 5IMXA 3P0MA 3R30A 2ZV8A 1ZOEA 2GQGA 2BAKA 1SVGA 2PUIA 1OIYA 2DENA 2OWBA 3QRJA 3TT0A 2VTMA 3RNYA 1ZLTA 4EHZA 5K5XA 3POZA 5L6OA 2PE0A 3NNUA 3QZGA 2FSTX 3A7IA 5CZHA 5TT7A 3R83A 2VZ6A 2QR7A 5FDXA 3D2IA 5KE0A 4Y73A 3TUCA 5KMLA 3RAWA 3OCBA 3SXFA 4L46A 3V8TA 2B3TA 2XIRA 4W9WA 3QAME 3REPA 1F5QA 2JDTA 3HGKA 3MA6A 3ORIA 4CLJA 4Y5HA 2YACA 3GB2A 5IH5A 3FDNA 4IFCA 5IQFA 1WGNA 1QPJA 3KULA 3UC3A 3WZDA 5DYJA 4D4YA 3BEAA 5BMMA 1FVVA 2C5VA 2OOAA 5D11A 5HNGA 3EFLA 4EQUA 1PXJA 5JFVA 3U4WA 3MFTA 5CVGA 3UVQA 4M66A 1HQYE 5C8KA 3ZYAA 5A14A 2R0UA 3IW8A 4U81A 1L8TA 3EB0A 1PY5A 2PVJA 3R8LA 5E4HA 2CDZA 4C57A 3E87A 3VS0A 4EHEA 3Q9XA 2G2HA 4HYSA 3TJDA 4MXCA 2PUNA 2YIYA 3V5QA 3W2QA 4EYJA 2YM4A 4M12A 3TZMA 3BE2A 1UFZA 2KNZA 5EKNA 4HPTE 5AP3A 5HCZA 2Z7RA 3OXTA 4U40A 4BDIA 3I6WA 4ONAA 3WZJA 4FV0A 5IQEA 3T9IA 3AD6A 4G2FA 2R64A 5HLWA 2H6DA 2LGCA 3ULIA 4ASZA 5E1EA 4EK5A 4EOQA 4MD7E 4WKQA 3NUSA 2WTCA 4XG4A 3COMA 4HNIA 2G9XA 4AP7A 3KQ7A 3IKAA 1P14A 2ITZA 4M7IA 3T9TA 3ZO1A 2UZUE 3QTSA 4FKOA 4Q5EA 1XR1A 1W98A 5JZNA 2LAVA 4O7RA 3MWUA 1NVQA 4X6QC 4FTIA 5AP6A 4YZBA 1Q8ZA 4RJ5A 4ZSLA 4AOJA 4M68A 3KXGA 5CAUA 4CKIA 4IAIA 2QCSA 4QMWA 2QOHA 4ZLZA 2RKUA 2LVOC 3OOMA 4YJTA 3T8OA 4J7BA 4AZEA 3K9PA 2Y6OA 3LAUA 4S33A 4BBMA 5HESA 2WMWA 5IH4A 3CPBA 5AX3A 1A5TA 3ETAA 3JUHA 3K2LA 4KIPA 3D5UA 3DK3A 3BHHA 3MFRA 2VWBA 3EIDA 3UIXA 2QOFA 1MRUA 3ZONA 5CEKA 2X7OA 4R71A 4HVDA 5CANA 3BBWA 4JIKA 3MN3A 3ORZA 4X3FB 1PJKA 3R9NA 2REIA 2UW9A 3BLRA 3K3IA 5IEXA 4Y85A 1ERKA 3C7QA 5AWMA 2IZTA 3ZTXA 2DAMA 5FXSA 4HOKA 3G90X 3PJ1A 3TZ8A 5AA9A 3N9XA 4OAVB 3FMKA 3V6SA 3CEKA 4OBPA 2H96A 1JWHA 5DGZA 2MR9A 5JFSA 3LQ8A 3Q6WA 2VWYA 4MNFA 4Y83A 2GNFA 3D94A 4LOQA 3TCPA 3EFKA 3I60A 4EOKA 1AD5A 4P4CA 3M11A 4FV1A 5DFPA 4BTMA 2PZIA 2WTDA 3R73A 3QKKA 5BVEA 2W1ZA 1OIRA 3AD4A 4XHKB 3DBCA 2PVYA 2QSFX 4QRCA 1IAJA 3DKGA 3CD3A 3E8DA 4DAWA 1H8FA 4U42A 1OBDA 1JPAA 4HGSA 4I94A 3KRLA 2ITNA 4GG5A 2WD1A 3DAKA 5KMMA 3R01A 4OR5A 5HX6A 3NEWA 4J52A 1J1CA 3LOKA 4M97A 1UWHA 4BI2A 4DEEA 3OS3A 1SNUA 4X2JA 1ND4A 3FY2A 3OEZA 2W5BA 4XBRA 1VEKA 1YLAA 4WG4A 3W2PA 3PP0A 3AC3A 2LBCA 5BVWA 5BYZA 4DFLA 4QMNA 2PULA 3LFBA 3VS1A 4FZDB 4FV5A 4WIHA 2ITTA 2JBPA 4GYIA 1YWRA 2VTIA 5EHYA 5C4LA 2ITVA 4MXAA 3CSVA 4DTAA 3RPVA 5FRIA 3G9NA 2VUWA 3NW6A 1BL7A 4BICA 3UQCA 2Y8OA 4UYNA 4GV1A 3LM5A 2JY6B 4QPAA 4Z7GA 4FSZA 4QP4A 5FXQA 1PRYA 4MK0A 3FMEA 4RJ4A 2BHEA 2UZNA 3HV5A 3R8UA 1Q02A 4R7HA 4G6OA 1PXOA 5DT0A 4ZZMA 1G8AA 3BYVA 5EM8A 1PHKA 1PMUA 3FZOA 3I0QA 4I5CA 5DE2A 3S2PA 4PL3A 5HBJA 3SV0A 2OF4A 3MS9A 2XK9A 3IPHA 4L42A 1X8BA 3EN7A 3NYVA 4ALVA 5L6PA 2AYPA 5I0BA 2F4JA 4FKRA 4GFOA 4JDJA 4YU2A 3NGAA 4FV2A 4C4EA 4OBQA 4DBXA 3UIMA 2DNAA 3PE1A 2PHKA 3BHYA 3UG1A 3E8CA 3HUCA 4BB4A 3D7ZA 3BWJA 3AGLA 4UMUA 2JDVA 4ZIMA 4NWMA 4QTCA 4BTKA 1YHVA 4EKKA 3HLLA 3EQCA 2PVRA 3C0GA 4I4FA 3F3UA 5L8LA 3LFEA 2WMVA 4FC0A 1VEBA 1U46A 3QWJA 4W9XA 3C4FA 3PXQA 5L2IA 4CFWA 4IAZA 5KMKA 3JYAA 3U6HA 2IJMA 4QMVA 4BCKA 5HIEA 3KULB 4AZVA 3L9MA 3MDYA 4PP9A 4O38A 3W2OA 4XG2A 5HO6A 3FSKA 3UJGA 5FTGA 2CCIA 3MJ2A 1YWVA 2G15A 4FV9A 3BQRA 3MV5A 5EHLA 4I0SA 4MQ1A 4AW5A 3QLGA 4FZ6A 5E8YA 2B9JA 3PXZA 3UZTA 2J0KA 2CKQA 2WB8A 1Y57A 3R7UA 3L8VA 4LOPA 4QP6A 2CNUA 5C9CA 5IZFA 5LMKC 1YHSA 4XNEA 3OTVA 3C51A 2R5TA 5CT7A 2XNBA 4FNXA 3IDPA 2F57A 4FTUA 1OIUA 1UKHA 2BFXA 2WMTA 3E8EA 4LGHA 4O0WA 3LFCA 4QYHA 2VX1A 4EJ7A 2NO3A 2JKQA 3ZBFA 1OMWA 4CG8A 4RC2A 4FKIA 2RFNA 2ZB1A 4G5PA 4BDCA 3V51A 2W1GA 2PSQA 4IJPA 1C7YA 5HE3A 5HTCA 3PLAE 4AFEA 2XK3A 3DY7A 4XRJA 3W32A 4C02A 2HWJA 4CFVA 3MB7A 4CZTA 5IKWA 4LRKA 4NYEA 3CJGA 3ZMMA 3OFMA 4J96A 3SW4A 2WKMA 1P4FA 2XA4A 4F09A 4NKAA 3TV6A 5LWMA 4LV5A 3VJNA 4GU6A 5IA1A 3GQLA 4F1MA 3POOA 3E8NA 3D15A 4XG9A 4ENYA 1I44A 3QYWA 2R3NA 4X3FC 4DT8A 2C6DA 5AP1A 3FE3A 2UVXA 4IQ6A 5HE2A 2YZAA 4NFNA 4ANQA 4BYJA 3KK9A 4IAKA 5DPVA 3VQUA 5J9LA 1JSVA 3HX4A 4I6BA 4OTPA 5HD4A 1YRPA 3N4VA 2XIZA 3H10A 3MIAA 4J99A 3GFEA 1OGUA 4KSQA 3Q9YA 2WTIA 2ZV2A 5TO8A 2F7ZE 3PWDA 3C1XA 1DI8A 3PXRA 4QT1A 4QMSA 1IXSA 1PF8A 4AWIA 3F69A 3BGPA 4DGLC 3KRJA 2CN8A 3P86A 4GEOA 3ZCLA 1JVPP 4I93A 4D2TA 1BUHA 4RJ6A 4H3QA 3F61A 3ZC5A 4BIDA 5KHXA 3II5A 4G31A 4TRLA 5DNRA 5EFQA 3UZPA 5JN2A 4JBOA 3MTLA 4CFUA 3HA8A 2Q0BA 3BIZA 5IUGA 3CJFA 5H8GA 4PMPA 4YC6A 4GFMA 4YTFA 5CENA 5TKDA 5HICA 5DN3A 4PV0A 4F7JA 2XUUA 2DAKA 2C5NA 2H34A 3QHRA 4JQ8A 5L2WA 5C4KA 5FM2A 3QCQA 3FMNA 2W7XA 2JUJA 1H0VA 4OTRA 5AADA 4XUFA 5AR3A 2XYUA 2B9IA 1ZYJA 4KAOA 3DKOA 4H36A 3BU3A 3CY2A 1OTRA 4G3CA 2JFMA 3KCKA 2YCQA 4C4IA 3Q96A 4Q5HA 1RJBA 1YHWA 4HVSA 3CPCA 2UUEA 2WFYA 5AR2A 3CD8A 4ZOGA 5FBNC 4ITIA 3VBVA 5EW9A 4USFA 4K18A 5IUIA 1Q8WA 4NJ3A 4JLCA 3BHTA 3ZDUA 3WZKA 4K9YA 2CHLA 4MQ2A 3LLTA 3E7VA 2BTRA 3ZBXA 1JAMA 3R9OA 4ANBA 4ERKA 4HVIA 5AUVA 3VBQA 3LKMA 2XB7A 5FXRA 1AIPC 2DZLA 3WF7A 1G8SA 4HEOA 1ZMVA 3SX9A 4YJVA 4FSNA 2R3KA 5E8SA 3VBWA 2J0MB 1W8CA 3DBQA 5TF9A 3HDNA 4WRGA 4C3PA 2I0YA 3OF0A 5FDPA 4ZTLA 1OKVA 4QP1A 4D5HA 5I9WA 3MESA 3K3JA 4XS2A 1PXPA 2R2PA 5M53A 5DR9A 1M7QA 3I5NA 4GCJA 4PMSA 4UWCA 3VRZA 4F6SA 3ENHA 4IDVA 2YJSA 2ZYBA 4JRNA 3KMUA 1BKXA 1JR3E 4FV3A 5EI8A 2F7EE 3LCUA 4FT7A 3ZLXA 4NIFA 4BHZA 2PUUA 3LZBA 4NCTC 3S4QA 1J7IA 4MF0A 4Y95A 5AP2A 4C4FA 5D9HA 5HQ0A 1G4AE 3SHEA 3BYSA 3QTRA 4MBJA 4MXXA 3A8WA 3RK9A 4FA2A 4ZMFA 4KABA 3TNIA 1OL1A 4BYIA 4UBAA 2YA9A 1SVHA 2X8IA 3JVSA 3NIZA 5FP6A 3V5JA 1URWA 2PMIA 3EQHA 3QTWA 1YXSA 1OQYA 3R2YA 4M3QA 4R6VA 3VBXA 2JAMA 3AT3A 3FL4A 3Q53A 3DU8A 3DV3A 3RK5A 1H27A 3UGCA 4DGGA 2VTNA 4YP8A 3QGYA 4ENXA 3KRWA 4ZSJA 1ZV1A 3BGZA 3SA0A 2CNQA 2BCJA 2MJ5B 2GTNA 4FNWA 3UMWA 1URCA 4PQNA 4NU1A 5FTOA 1NA7A 3ROCA 3SQQA 5M44A 3CC6A 3QWKA 2FH9A 2C1BA 3BBZA 1R3CA 3HAMA 2HZNA 3E62A 3FMDA 3QXOA 5IUHA 4PL4A 3C13A 3TL8A 4FKWA 4S34A 3VUIA 4IX3A 4O7VA 4R78A 4E6DA 4QP7A 2QR8A 5IA4A 4RFMA 2HWOA 2PZRA 4WBOA 5EYDA 1GIHA 2I40A 2EVAA 3PPJA 1ZY4A 2ZV9A 1WBPA 3C4EA 3EHAA 5AV1A 5CEQA 3W2RA 5LMBA 3QZIA 4EOLA 4JIAA 3MFUA 4FYOA 4AA0A 1H08A 2YIRA 5HBEA 2VWIA 4L9IA 5K4JA 5CAOA 5IQBA 3R7YA 3TJCA 4U9AA 3ENMA 5KZIA 3O23A 1MRVA 2UW6A 1NXKA 3N4UA 1JSTA 5CQUA 3RPSA 1FBNA 5LARA 5JGDA 3QUDA 3UMXA 2A27A 4KIQA 4ZY6A 3P7BA 4F7LA 5I4NA 2YZLA 3F5UA 2WHBA 5DHJA 3KN5A 3TNHA 2CMWA 4DLIA 3VUTA 4BDDA 3FRIA 2YHVA 3R63A 4QOXA 3VBTA 2VWZA 4J8MA 4JDHA 2HW6A 3GXLA 3D2KA 4IANA 5AIKA 5DBXA 2VX3A 3TNQB 1ZOHA 3UBDA 2CPKE 2W5HA 2XRUA 2HELA 3GCVA 4X2KA 1O6KA 3BI6A 2GPHA 2VWVA 1Q24A 2E2BA 4EK4A 1XQZA 4E93A 5HG8A 1PW2A 4GT4A 1REKA 3GOKA 1JKSA 3NR9A 4L7FA 5FG8A 3Q2JA 5IDNA 1UNGA 3FRHA 2PVFA 3A7GA 3A99A 4K33A 3ZO4A 1Q61A 1XO2B 2WO6A 3PVUA 4C4HA 3U6IA 3FY0A 2JKKA 2QC6A 2WTJA 2XYNA 3LIJA 3RCDA 2QOCA 2G2FA 2I0VA 3SDJA 3FZRA 4FI1A 4EWHA 3QQHA 3G2FA 3HMNA 2OXXA 3PXKA 1R4GA 5AV2A 5A3XA 4EH5A 4R3RA 5C27A 4RJ8A 5ANOA 4JQEA 2GNHA 5GHVA 4QMOA 4WSYA 3KVXA 3VVHA 2B4SB 2RFEA 3FLSA 4KB8A 5AV3A 2WQBA 3FHRA 2J90A 4XJ0A 4XRLA 3FZSA 4RIXA 2C5OA 3VUHA 4NTSA 5ANEA 4B4LA 4RIWA 5EW8A 2X2KA 3NRMA 3O7LB 4JDKA 4N70A 2JD5A 4FIIA 4K1BA 2QD9A 4FICA 4CMUA 3KXZA 4E26A 3MH0A 2WELA 5DOSA 2OOBA 1H1PA 3QQUA 2HK5A 2F7XE 2BALA 1STCE 4FTNA 4R8QA 3SLSA 3PJ2A 3RP9A 4GFGA 2OJFE 5FEDA 3V04A 3S00A 3HEGA 5EQPA 1VEGA 3GU8A 4CQGA 3ZFYA 4TY1A 3DQXA 4F1IA 3N4TA 5LWNA 2FA2A 2J0IA 3P08A 3QCSA 1VG5A 5AM6A 3LLAA 4FR4A 3BEGA 5J7BA 1BLXA 4BBEA 4I22A 3ID6C 4N0SA 5GIOE 4BCIA 4RX7A 3HMOA 3IDCA 4IAYA 3UYTA 4IM2A 4CV9A 3FSFA 2GNIA 4EWQA 2ZTCA 1YOJA 3B89A 2BRGA 2OFVA 1EFUB 1OPKA 2W96B 2WTKB 3IOPA 3NLBA 4TYHB 1H0WA 4YC8A 3TI1A 3U8WA 4ANLA 5HVJA 3HMIA 2XH5A 3MGYA 4TPTA 1PYEA 4N6ZA 5I3RA 4A7CA 3PIZA 3DT1A 4R3PA 3V5PA 4EOIA 5CU2A 4LV8A 2VO0A 4Y72A 3PTGA 4HNFA 2BIKB 3RZFA 5M55A 4RT7A 4FL3A 2O64A 4CTBA 4FKVA 2BTSA 4O27B 3HV4A 1KOAA 3DZOA 5CSVA 4AW1A 3E63A 3NVMB 4E4XA 2XIYA 3DFCB 4A07A 2BZHB 4O1OA 4I5PA 2IVSA 4PPAA 3U6JA 2GMXA 1Z5MA 3VUKA 1YDRE 3VW8A 4O0TA 2QKWB 1Q5KA 4YZMA 1V0BA 2C6OA 2JIVA 5HO8A 3AMAA 2R3IA 3ZO3A 3C9WA 3QD2B 2H5XA 3PG1A 3CR0A 1BI8A 4OW8A 4WBBB 4QYGA 1YDTE 4BR3A 3H0ZA 4FT0A 2ESMA 5CVHA 3OUKA 2PMNX 4CLIA 4O2ZA 3AC4A 4AGCA 3UVPA 5A4QA 2CP8A 3AG9A 2PU8A 4IADA 5BX0A 4CZYB 1UNHA 3C5UA 4HYUA 3WZUA 2W4JA 3AC1A 3IGGA 5KHWA 1YXUA 5K4IA 3PYYA 3ORNA 4TWNA 4F6UA 4FIHA 4CKJA 2CNVA 1RQQA 1UNLA 3D14A 3QHWA 3QUEA 1KE5A 2YABA 3CKWA 4L45A 2YERA 4RX8A 5AEPA 3PDTA 3H0YA 4KKGA 4FKLA 3NYOA 4RWIA 5F94A 4F64A 3PZEA 4KIKB 2I0EA 3ZEWA 4IE9A 3AQVA 4FZAB 5CEPA 2B9HA 1YDSE 4QYEA 4XV3A 1XH8A 3Q60A 3BHVA 1FVRA 3A4PA 1FGKA 4AW0A 1PXKA 2XZSA 3R1YA 4RSSA 4HVHA 5DMZA 4DH5A 2J4ZA 4MWIA 4YURA 1Q8YA 3AC2A 2CGVA 3ZUTA 4L43A 2GTMA 2GNGA 3MPMA 4AF3A 3ROYA 4C2VA 5J79A 2H9VA 3U55A 2P2HA 1F3MC 3CXWA 3IW6A 2P0CA 4PTEA 4OTDA 2WIHA 4MAOA 2PZ5A 5A6NA 3JY9A 3BCEA 1U54B 3TWJA 4ACCA 1ZYCA 4L52A 4U79A 4XOYA 4CV8A 1KE7A 3D7TA 3V6RA 3FZTA 3L9NA 1NT2A 4GT5A 2Z02A 4Y5QA 3FQSA 2JLDA 3DNEA 2V7OA 2P33A 2MROB 4QMXA 4FKTA 2JDSA 3A7HA 4EONA 1Q41A 4I0TA 4HJOA 2O3PA 4O84A 4G3DA 4L3PA 3F82A 1OVEA 1WFCA 3D5WA 2VO6A 3O0GA 4RX9A 3S3IA 2GNJA 3CGFA 3MY5A 4IVAA 2QOLA 2YM6A 3BHUA 5IA0A 4YHTA 5AAGA 2BFYA 4CYIA 4AU8A 4GKIA 2R9SA 3F3ZA 3LCKA 4O82A 1RE8A 5AUZA 5FEQA 3D4QA 4AT3A 4IVBA 3D83A 1XH7A 4GRBA 4U80A 1QZEA 3QA0A 2J0LA 2VWWA 3EQBA 4O96A 4GUBA 1E9HA 2WPAA 1KE9A 5AMNA 2OSCA 4DEIA 1JLUE 5M4CA 3FWQA 4HCVA 4GMYA 4DLJA 5IQAA 5CZIA 3PSBA 1GAGA 4FZ7A 5I9ZA 5HIDA 2ERZE 3QXPA 2PYWA 3LXKA 3OZ6A 4I92A 3KREA 3QTIA 1Y6BA 5IPJA 2GS6A 3KK8A 3O50A 4BCMA 5ACKA 4ORKA 4PMTA 2QKRA 5GJGA 4LG4A 4FEXA 4FL2A 4HGEA 2XK7A 4ZSEA 3O8UA 4RIWB 2J50A 3TG1A 3ZU7A 2YCFA 3Q6UA 4CXAA 4TN6A 3IHPA 4V0GB 3Q2MA 3QUPA 4DBNA 3UO4A 1XJDA 4UXQA 3ORTA 4FKQA 3C4ZA 5GZ9A 3CS9A 1IA9A 3QTUA 4I6FA 4F2LA 1M14A 4DGOA 4PF4A 1DS5A 4CVAA 2FB8A 2XJ1A 5L8JA 2WTKC 4YNEA 3K54A 4FTLA 4LUDA 3Q5ZA 2HY81 4YLJA 4NSTA 4E6AA 4FMQA 4FEWA 4KRCA 4U3YA 3UZRA 3KFAA 4NW5A 4U5JA 3RHKA 4FL1A 4BCPA 2GHGA 4WNOA 3E7OA 3F6XA 3W16A 1M2PA 4MEDA 3W2CA 4DEGA 5CEOA 3S0OA 4L68A 5JKGA 3NAYA 4MD8E 3M42A 1NV8A 4DF3A 1YOLA 2HZ0A 4FVRA 1M7NA 1K3AA 4JG7A 3QD0A 5D10A 3BU6A 3JPVA 3KL8A 5CSXA 5HBHA 3UE4A 3W1FA 1OECA 2FVDA 4EK6A 5C26A 2PY3A 4GVAA 4C59A 4OT5A 2HWPA 3QQJA 4IX6A 1DAWA 4MTAA 4RRVA 3E3PA 3LFFA 2GQRA 3OG7A 4I24A 1Q4LA 4K8AA 2RFDA 5JK3A 2VO7A 2OICA 1IR3A 4C38A
chains in the Genus database with same CATH superfamily
2DYLA 4CRSA 2C6IA 5LQFA 4BDKA 1WJ7A 3SRVA 4TT7A 4LDTA 3CE3A 2BRMA 5LOHA 3EFJA 4CSVA 1T45A 4IAFA 1FGIA 4REZA 3W18A 2WMAA 4CMTA 4QP8A 2D7GA 4DV3M 5EYMA 3T15A 1JSUA 2E9VA 5KMIA 4LRTA 4RLKA 4MNEA 4D4SA 1EE8A 4MGZE 5D41A 1PMVA 2RG5A 3H4MA 3A4OX 4OTGA 1ZARA 2YDIA 5AAFA 4B8MA 2EJSA 1NW1A 1P2AA 4B3MM 3EJ1A 3TACA 1XBCA 4FODA 4X65M 5HTIA 3LMIA 4JI1M 2FSLX 4GIIA 1QQWA 4JBVA 4E20A 2PVLA 4M13A 5DG5A 1YQJA 3W0NA 2HIWA 1GNGA 4ZTQA 1SMHA 5FTKA 3UIUA 3S95A 2RG6A 4RA5A 1WZYA 3LJ2A 1F4IA 2QHOB 1UU9A 2OF2A 5DEYA 3EZVA 4IM3A 5D12A 2C0IA 3EQDA 4LJ8A 3DDQA 3SMSA 4C61A 4JRVA 3PP1A 5M07A 4MXOA 1Z57A 2CGXA 3P7AA 3DAEA 4F0IA 2R3RA 4A4XA 4AUAA 2R3HA 3OWJA 5DR2A 1I09A 2VF8A 2VTAA 3BQCA 4BCGA 2W9ZB 4ACMA 2VNYA 4DG2E 1TDZA 3K5UA 3NWWA 4IC8A 3ZLYA 1PJSA 4M9XA 4JI3M 1FOTA 1J1BA 4GEWA 3GU5A 5CY3A 3MH3A 1JKKA 1GABA 4EH8A 4MGHA 4WNMA 4KWPA 1E9RA 3PE2A 2IVTA 3ZH8A 4CT1A 1KE6A 5CF8A 2V5QA 2XALA 3U61A 2RGHA 1JQHA 5KMNA 4JQ7A 4LMUA 3TV7A 4KHPM 4QQ5A 3PWYA 5M08A 4D2PA 4OLIA 4FE2A 5E8TA 5HNBA 1Q3WA 2XEPA 3Q4TA 2WOUA 2Z7LA 3HECA 3COKA 3L26A 1R5LA 1WGLA 5H8BA 5GNKA 4WG3A 4UV0A 3TUBA 4DITA 4X21A 3LFAA 3UVRA 2R4EA 1GZOA 4RIYA 5HU3A 2X0OA 3RAKA 5B0XA 4QTDA 3PVGA 4R7BA 3RK7A 5KCVA 2QOIA 2L7HA 4NM3A 1YI3A 4J53A 5CXHA 5JFXA 4QMZA 1DI9A 4D9UA 2QLUA 5EYKA 4XX9A 3AOEA 2BZIB 4ACDA 2WTVA 1H25A 5DA3A 3UDZA 4MXZA 4LJ7A 4WP2A 1TKIA 4FVQA 4NT4A 2XF0A 2W1HA 5J95A 5AJQA 4RWJA 1ZYDA 5B2KA 1WVXA 1T6OA 4JL9A 3PXYA 4ALUA 3A8XA 3IDBA 2QURA 2SRCA 2AQXA 4YHJA 2BZJA 2JBOA 4ZMEA 2C6TA 3NCZA 4IBMA 4E4LA 4RPVA 5HD7A 3UTOA 4UMTA 4ASXA 3KB7A 4YJSA 2AUHA 3E92A 3WOWA 3J7BA 5LVNA 1YXXA 4I8OA 2ZAOA 3MVJA 4EK8A 3TTIA 4FT5A 4JVGA 4IB3A 3GO8A 4EIWA 3ET7A 5CX9A 5L3AA 5AA8A 5KKRB 1IM2A 4G4NA 1C1KA 3LFNA 5B7VA 4AAYA 3FAAA 4IWPA 3COHA 1Y6AA 4NM0A 3UDSA 5JFWA 5LMKA 1UWJA 4X64M 4IBCA 5HLNA 5EP1A 3IG7A 2XEZA 2QP9X 1GVNA 2EXMA 3F92A 4AKIA 3SG9A 2QQ8A 3RWQA 2J0JA 1NSFA 2IW6A 3BE9A 3DZQA 5EH0A 3NPCA 1YW2A 4PTGA 4DGMA 2A4LA 3KVWA 2JC6A 4AKGA 3R02A 2VTOA 5J5TA 5C8NA 3BLHA 1IRKA 2A0CX 3SGCA 3LQ3A 3QQFA 4C3FA 3LQQA 2KRUA 1OBGA 3OY1A 3UO5A 3AOGA 4IBFA 2R3JA 1R7RA 3BX5A 3EKNA 4FTKA 3K92A 3EQFA 2Z3XA 2P2IA 1H6UA 5ETAA 1TH3A 2JNHA 5KBQA 3VUGA 1NJFA 5EI6A 4F99A 2BZKB 2W17A 2XIKA 4HYHA 1WMKA 4RFYA 2YJRA 4RIXB 2F2CB 4EH7A 4IACA 5M06A 1NVRA 3ORPA 4BTJA 1W0XC 5JRQA 3UQGA 2O63A 4AW4A 2PPQA 2NRUA 2OIBA 4U41A 4CQEA 1KUTA 5KKRC 2W1EA 4LOOA 4YO6A 2R46A 3QAUA 4NSRA 3QTZA 4I5HA 4J71A 4Z16A 3LQ5A 4EH2A 4CGAA 3FMMA 3PLSA 3JXWA 5D7VA 3FMLA 2PE1A 3FUUA 2X9EA 1PJJA 1GL7A 2HZ4A 1WXQA 4DEDA 3NBXX 3NNVA 4HPUE 2C68A 2K9DA 2B9FA 4D82A 2VTSA 4LF8M 3O7LD 1PXNA 3B7NA 3DTCA 3KF4A 1KV2A 2KXEA 5F1ZA 5CU4A 5E8VA 2XCKA 4IIWA 4PX6A 5AR8A 4MGKE 1VR2A 1WBVA 4FSWA 4DTBA 4FT9A 3QU0A 4Z9LA 4A4LA 3NVKI 3G9LX 4JR3A 2IZUA 4DUYM 3SW7A 1CSNA 3MFSA 4X7QA 5H3QA 2FUMA 3UO6A 5FM3A 4FV8A 2FH0A 4ASEA 1ZAEA 2Z8YM 3GLFA 3E88A 4MD9E 3FPMA 3MVHA 4DEBA 5IISA 5LVOA 2XKFA 4NL4H 2CHVA 5DLSA 1R78A 4EC8A 4LGYA 4V01A 5F95A 4RG0A 3I0OA 2XM9A 1LP4A 1M52A 5JI2E 4EH4A 1FQ1B 1BMKA 4QMUA 2ACXA 5DI1A 4RWLA 3GPPA 4G6NA 2CWBA 4PPBA 2B52A 1SXJB 3R21A 4ACHA 4DHJA 4IX5A 4XG6A 2XFTA 4K6ZA 4RVMA 4DHZA 2I1MA 4IIRA 1YKRA 2QOBA 4PL5A 4HCTA 4BDBA 4UZHA 3O2MA 3ULZA 3F7WA 4XMOA 3SRVB 4ANRA 2XJ2A 4LL5A 2J7TA 3OBGA 4PP7A 1YWNA 2X8EA 2YWPA 3F66A 2IWIA 4C8BA 1IBLM 4M9ZA 5A9UA 3T1HM 4NZWB 3OROA 4L6QA 4S31A 1G3IA 4Q7JA 3C4XA 4EUTA 5LCJA 4H39A 4FIFA 4ZTSA 5GIPE 4QOZC 1QPCA 3A60A 3HHZA 4JYAM 2O0UA 2N35A 2I7QA 4LGDA 4MVFA 3KU2A 4ANMA 2CLXA 4O0XA 3CP9A 2J2IB 2VTJA 3MW1A 4DFNA 1CM8A 3CY3A 4DR6M 4R1YA 4MNEB 4FG8A 4FF8A 2YCRA 2X0QA 4D2WA 3LCVB 5CTPA 5CSWA 4E7WA 4EOMA 1YSYA 3J27B 4UMRA 3D5VA 2R3OA 5BUEA 3E93A 2ZB0A 4EZ3A 4JI9A 2XJ0A 4UMQA 5KZ0A 3I4BA 3MY0A 4RX5A 2BNKA 5ETIA 4GT3A 4X6RA 3W8QA 2DWBA 1GIIA 4D1ZA 3SVVA 2G5GX 4DR2M 1MQBA 4USDA 4N57A 2QHMA 4AG5A 4E3CA 5HI2A 2GS7A 2X7FA 2W06A 5BMSA 4OVZA 2OW3A 2VNWA 3L9PA 2XNOA 5IG1A 4YZDA 3MVLA 5F3WA 2OIDA 2JEDA 4ITJA 4JG6A 1XB2B 4QMQA 4U8ZA 1SXJC 1BX6A 3PJ8A 4AXFA 3QKMA 1QDTA 3RVGA 4P17A 4B6LA 3DAJA 5AP5A 4NH1A 3G51A 4YJUA 3KCFA 4DA5A 4P90A 3F2AA 5LMAA 2LWXA 3VC4A 4HZSA 1H00A 2QO7A 2H8HA 2X4FA 4LMNA 2GDOA 5HZNA 5LJJA 4O0VA 5GZ8A 4BC6A 2Z60A 1KYIA 1A9UA 2OJJA 2ITPA 2C3JA 3I04M 2UUAM 3SKCA 4MX9A 3LCOA 2XAOA 5KPRA 5EKOA 2UZVA 5HVYA 2Y0QA 2ZMCA 4W4YA 4X2NA 2X4ZA 5C18A 3F5GA 3HYHA 2DWNA 3OHTA 2Z4RA 4BDGA 2OLCA 3DOAA 3FTFA 5D7AA 3HKPA 2KNVA 4U97A 4ZJIA 4OAUC 3ORMA 2C6EA 2UW3A 2YLFA 4K0KM 2UUCM 3UC4A 3DNDA 4ZAUA 3LXNA 4BGQA 5ANGA 3U4UA 3BL9A 5BQ0A 1EH4A 2YN8A 3OD6X 1CDKA 3QRUA 3ZUUA 4XCUA 3GCUA 1J7KA 3TTJA 3JY0A 4R3CA 4M15A 3HUBA 3U61B 3NW5A 3DKCA 1FMOE 2VTPA 1W2CA 4DV5M 1OUKA 2IVUA 3QLFA 5E7RA 2ITUA 4GJ3A 2YFXA 2AC3A 2QO2A 3FV8A 4EBWA 2OG8A 3OC1A 1KOBA 5CNOA 4XG7A 4BB9A 3MYGA 3DB8A 4BIEA 5DR6A 4EYMA 3HVCA 4PDOA 4FEUA 2XNMA 4A9SA 2CKPA 4JI7M 3Q4ZA 3ODYX 4RC3A 3HHXA 4RIYB 1NVSA 4WNPA 3RKBA 1YI6A 2A1AB 3E5AA 4Y46A 3B7QA 4H1MA 3W8LA 4YLKA 4GVJA 2BHHA 3FL5A 1YE9A 3SHFA 4ASDA 3ITZA 3K1JA 3GUBA 4J95A 5HHWA 3GCQA 2H1RA 4KS8A 4GW8A 1QYRA 1ZY5A 1N36M 4DC2A 5HKMA 2J9MA 5CWZA 2UVZA 4IX4A 3R7OA 3RGSA 1XH5A 1JNKA 3OY3A 1HNZM 5E1SA 1VYZA 3Q52A 2XIXA 2QPAA 4K11A 4XV9A 2M60A 3WE4A 2DAGA 4FUYA 5IU2A 3NW7A 4QO9A 1VZOA 3GU6A 4WUNA 2CFOA 3ZLSA 4DHFA 2J6MA 2GQFA 3P0MA 2J7NA 2BAKA 2PUIA 3TT0A 3RNYA 3O5AA 2FSTX 2XGNA 3TUCA 4D81A 2AEGA 3M0EA 2XIRA 3VDPA 3ORIA 3MA6A 3FDNA 4IFCA 1QPJA 3UC3A 3WZDA 5DYJA 3KFUG 2C5VA 1XMLA 4EQUA 3GRUA 3UVQA 1L8TA 3ZYAA 2R0UA 3EB0A 4IBJA 2DHRA 2C9CA 4MXCA 1QAOA 3W2QA 4EYJA 2YM4A 4M12A 3I6WA 5HLWA 4WKQA 4XG4A 4HNIA 4MB7A 3LVVA 4LF5M 4DV4M 3ZO1A 2LAVA 1W98A 4X6QC 4ZSLA 1Q8ZA 4IAIA 4ZLZA 2LVOC 5IT9S 3OOMA 4J7BA 2WMWA 3CPBA 3ETAA 3JUHA 3MFRA 3EIDA 2QOFA 1MRUA 4HVDA 1ERKA 3C7QA 5AA9A 3G90X 3PJ1A 3FMKA 3V6SA 5JFSA 3CF2A 3Q6WA 4Y83A 5DFPA 3AOEC 1IAJA 3UK6A 1OBDA 1JPAA 3KRLA 3DAKA 5HX6A 1UWHA 3OS3A 3W2PA 5BVWA 4QMNA 1NVMA 2Y8OA 4GV1A 5FXQA 4R7HA 1PXOA 5EM8A 3FZOA 1XMQM 3SV0A 2OF4A 1X8BA 5L6PA 4GFOA 2DZOB 4PD2A 3UIMA 2DNAA 3UG1A 3AGLA 3I4VA 3C0GA 4I4FA 1U46A 4W9XA 2V1UA 5DNYA 4BCKA 5HIEA 4PP9A 3UJGA 3MJ2A 2G15A 4FV9A 3BQRA 3MV5A 5E8YA 3PXZA 2CNUA 5IZFA 5LMKC 2R5TA 5CT7A 3K8ZA 1UKHA 2WMTA 3LFCA 2VX1A 2JKQA 4CG8A 2W1GA 2PSQA 4AFEA 3W32A 4C02A 4CZTA 5IKWA 2W82A 4LRKA 2WKMA 1D0KA 4F1MA 3AV0A 2V1CA 4NRVA 4XG9A 1I44A 2C6DA 4IQ6A 2YZAA 4IAKA 5DPVA 3HX4A 2D7HA 3N4VA 3GFEA 4BLCA 3F69A 3BGPA 4DGLC 4GEOA 1JVPP 4H3QA 3UZPA 4JBOA 3MTLA 3HA8A 3FYDA 5H8GA 4GFMA 5TKDA 5DN3A 2VQFM 3QCQA 4OTRA 8CATA 5AR3A 2B9IA 3DKOA 1OTRA 4G3CA 2YCQA 3Q96A 1R2ZA 1YHWA 3CPCA 2UUEA 3GLFB 4ITIA 5IUIA 1Z59A 4NJ3A 4JLCA 3BHTA 4TUWA 4MQ2A 1JAMA 3R9OA 3ZC7B 1AIPC 1G8SA 4YJVA 2R3KA 3DBQA 5TF9A 3HDNA 4QP1A 1PXPA 2R2PA 1M7QA 4UWCA 4QNRA 4IDVA 1BKXA 4FV3A 5EI8A 3ZLXA 3LCUA 3U6IA 1J7IA 4NIFA 2PUUA 3LZBA 4C4FA 5HQ0A 3SHEA 4MBJA 3QTRA 3A8WA 3TNIA 4NRWA 2PMIA 3VBXA 2JAMA 3FL4A 3Q53A 4ENXA 2BCJA 2GTNA 3ILKA 3BBZA 2HZNA 3E62A 3FMDA 3QXOA 3C13A 5IA4A 5EYDA 2I40A 3PPJA 3C4EA 5CEQA 4EOLA 4JIAA 3MFUA 4L9IA 3R7YA 4U9AA 5LARA 3UMXA 3P7BA 3F5UA 3KN5A 3L2AA 2YHVA 4QOXA 4J8MA 2HW6A 4IANA 2VX3A 1O6KA 3BI6A 2GPHA 4GKKM 4EK4A 1PW2A 5IDNA 3FRHA 4K33A 3ZO4A 4LFBM 3FY0A 3SDJA 2G2FA 2I0VA 3QQHA 5A3XA 4JQEA 5GHVA 4WSYA 3FLSA 4KB8A 3VUHA 4B4LA 3O7LB 4JDKA 4N70A 2JD5A 3U60A 3MH0A 5DOSA 2OOBA 2BALA 3U6CA 4AXDA 4TY1A 3DQXA 2J0IA 1VG5A 5GIOE 3BEGA 4BBEA 4N0SA 4IM2A 3FSFA 2ZTCA 1YOJA 3B89A 4ANLA 1H0WA 3KOXE 5HVJA 2XH5A 5CU2A 4LV8A 2VO0A 4Y72A 4HNFA 4RT7A 4FL3A 4FKVA 4O27B 3E63A 1XC8A 4E4XA 3DFCB 4A07A 1Z5MA 3VW8A 3CR0A 4OW8A 3I4YA 4QYGA 4OVZB 4FT0A 2ESMA 3OUKA 2PMNX 4O2ZA 2PU8A 4NXNM 3C5UA 3WZUA 2W4JA 3IGGA 4TWNA 4DHIB 4L45A 3D14A 5AEPA 3NYOA 4RWIA 4F64A 4FZAB 1YDSE 4QYEA 4AW0A 1PXKA 3HX3A 4HVHA 2GNGA 4AF3A 3ROYA 2H9VA 2R18A 3CXWA 5A6NA 3V6RA 3FZTA 1NT2A 4GT5A 3FQSA 3IG5A 2V6ZM 4JMQA 4FKTA 3A7HA 4O84A 4I0TA 2O3PA 4YHHM 3S3IA 1WFCA 3O0GA 4IVAA 4YHTA 5AAGA 4GKIA 5C1BA 4O82A 3D4QA 3EQBA 1E9HA 5M4CA 4GMYA 3LXKA 3KREA 3KK8A 4BCMA 5ACKA 4O4DA 2Y21A 4PMTA 2QKRA 5GJGA 4FL2A 2XK7A 2J50A 4OX9M 3ZU7A 3Q6UA 3Q2MA 5GZ9A 3C4ZA 3QTUA 4F2LA 1M14A 4CVAA 2HY81 3AKKA 4BCPA 4NW5A 4FL1A 2GHGA 2FE8A 1M2PA 3NAYA 3M42A 1NV8A 4FVRA 1M7NA 4CGYB 5CSXA 3UE4A 2O01F 1L1ZA 2FVDA 4GVAA 4OT5A 1ST4A 1DAWA 3C3DA 4K8AA 5JK3A 1IR3A 3PVWA 4WNKA 3EN5A 4M67A 3OT8A 4AI6A 2G01A 2VTTA 2JP7A 3OTUA 2QO9A 2XKEA 3D5XA 4O81A 2XM8A 1ZQ9A 5FEEA 3ORXA 2F5OA 1H07A 4HCUA 1OGYA 3FI4A 4I41A 4YZNA 4G4RA 4CFNA 3MJ5A 5HG9A 4MHAA 2X7GA 2BUJA 4QNAA 2PK9A 4FGRA 2XAMA 1J7UA 4ZLYA 4I5SA 3WYYA 2LVNC 3EOCA 2VDBB 4D2RA 3TZ9A 3TDVA 4DV1M 2IW9A 3FUPA 2F2UA 3WILA 2V62A 3K5VA 4B08A 4A9UA 1QCFA 4EBVA 1G3NA 3T3UA 3VUDA 4P7EA 3QFVA 5H2UA 4C35A 3FUWA 3AGMA 1SZMA 4XP3A 3RBWA 3JR4A 4AA4A 4BCHA 1BVSA 3OMVA 4KA3A 4F9WA 1OL5A 5AFVA 3P4KA 5HE0A 4AX8A 2C4GA 2Q83A 1L1TA 3OWLA 4XV1A 2YDKA 4XLVA 2WMXA 2ITQA 4EH9A 2X6EA 5EP2A 2J5YA 3HGIA 1AUAA 4IBEA 1HJPA 3PNYA 5BUIA 1ZXEA 5DRBA 5DT4A 4TWCA 5C01A 3C58A 4XH6A 5JEBA 1GJTA 3VK8A 2A2AA 4Q9ZA 4LJ4A 3GC9A 2BIYA 3UP7A 3TIZA 3SASA 3GOPA 4DT9A 3LMHA 4TW9A 2XK8A 4JI4M 4KNBA 5CALA 2UW0A 1SG9A 1IEPA 3VIDA 3NYXA 4DF3A 3GI3A 2HXQA 4R77A 3W0SA 3GCPA 1GO5A 2C3LA 4EOJA 4PMMA 4B0GA 3O51A 3NMUF 4G9CA 3GFWA 5EM7A 2ZJWA 3P23A 2NNWB 3DK7A 2UXDM 1OI9A 2XK4A 2CLQA 2JDOA 1H28A 5AP4A 2OKRA 1TZDA 4BL1A 5AX9A 1CUKA 3R8VA 2EB2A 1REJA 2JIIA 2ZM6M 4XLIA 2W1DA 2HAKA 5FSWA 3U6OA 5BVFA 4IBGA 3QC4A 2Z7QA 3ANRA 3RAHA 4BDEA 5A4EA 4U45A 2QNJA 3O8TA 2QVSE 3DLZA 1OKSA 3L8PA 4UZDA 3RNIA 4LFCM 2BRNA 5ACBC 4BVUA 3HRFA 3V8SA 2X8AA 2J5FA 4OW0A 5EI2A 4YTCA 2XNEA 4JXJA 4IMYA 4F0GA 5A6OA 3F88A 4AZWA 3DA6A 2PVHA 3E3BX 1OM1A 2ZDTA 4ZS0A 4FIJA 4AN2A 3L8SA 3QQLA 2VGPA 3N51A 4IEBA 5EJCA 3T3VA 4RC4A 4RNAA 4LRJA 3KSJA 2Q0NA 4ZY5A 1SYKA 1CMKE 4JDIA 1J3HA 5DT3A 1TR8A 4FK3A 4AE6A 4EI4A 3WI6A 2LVPC 4ID7A 2UXCM 2IW8A 4O6EA 2PMLX 3UPXA 2OJ9A 4ZTHA 3GQ3A 5J9ZA 2RL5A 3MH2A 2VF7A 4E4MA 3U5ZA 5IA2A 3KXMA 3PPKA 4O2PA 2CJMA 5ITXE 1NY3A 3ZXZA 4LYNA 3IK3A 4AN9A 4EL9A 2IPXA 1PJQA 1WHCA 4C4GA 4I1ZA 2Z2WA 3R7IA 4GK2A 5CASA 4J98A 2B0QA 5BUJA 1KSWA 1QL6A 3TDWA 3NDMA 1BYGA 2W1IA 4G3GA 5HNIX 4GC5A 3CQWA 2WMUA 3LW5F 1IBMM 2O2UA 1PMEA 4YZCA 3QCYA 3BPRA 3VS4A 3CGWA 4L01A 4UY9A 2PUPA 4QTAA 1VEJA 2P4IA 3LCSA 2EU9A 3WYXA 2XNGA 3ZO2A 5LVPA 3GC0A 5A4CA 2WEIA 2Z7JA 1H4LA 4HL4A 1HQCA 5KX8A 5AR7A 4R1VA 4LF7M 2BDJA 2YAKA 4BDFA 3Q04A 1Q3CA 3OWPA 3D9VA 4IBDA 4R5YA 3UOJA 4BGGA 1V0PA 3VAPA 4S12A 4I6LA 2ZAZA 2R0IA 4TYGA 5L2QA 5EDQA 3BGQA 4F63A 4QHSA 2X6DA 2YIWA 1ZMUA 4GL9A 4NIFB 3QF9A 4FX3A 3NFGB 1DGHA 5ITQA 4WHZA 2JIUA 3NSZA 2RGOA 3FZPA 4WOVA 4LG2A 2XS0A 2RSVA 4MKCA 5HLPA 5GINE 3NUXA 2G3QA 3PUPA 3LM0A 4ACGA 3D8LA 4D80A 4ZTMA 3NS9A 3ZSHA 3QX2A 4ZTRA 5F20A 4B7TA 2F9GA 4FJVA 2QU6A 3MHVC 1E1VA 2RKOA 1E32A 4JJRA 4C62A 4E1ZA 3FXXA 2CCHA 2OZOA 5AR5A 4QMYA 5HCXA 4MXYA 3BLAA 4QNYA 2F49A 1NO1A 3THBA 3GRVA 2AHMA 3I81A 2FGIA 4DH8A 2OO9A 2C47A 2QONA 4U0IA 3TMOA 5M57A 2FSMX 2RIOA 4BZNA 1OPLA 4TYJA 5CSHA 4FSQA 3CTHA 3NZ0A 1VQ1A 3IW5A 4QYYA 5ITYA 1IXRC 1B38A 2WZJA 3SAYA 2M5ZA 1IY2A 2PMOX 1Q99A 1WCCA 3HV3A 2VN9A 2GFCA 3PRIA 1H1QA 4LM5A 3U60B 4EHGA 4LCBA 4YMJA 3NUYA 2W0JA 2XNPA 3OT3A 4ZS4A 3AMYA 3LMMA 1DV0A 4R7IA 1ZWSA 3R2BA 3TKUA 2BMCA 4PNIA 1E94E 1GIJA 3CCNA 1UM8A 4XG8A 3OCSA 1I94M 3KSXA 1MX0A 3RZBA 4F08A 4TWOA 3FLWA 4WRSA 3FTDA 1OL2A 2Y7JA 3EYGA 4RVLA 3MA3A 2JXNA 3DLSA 2QG7A 3UNZA 2UZEA 3DXNA 4WSQA 2C69A 2DHYA 4CJ6A 4EORA 3NCGA 3QD3A 5A46A 4NM7A 5BVNA 3SC3A 1OB3A 4FTMA 3HDMA 1R0PA 3AD5A 5I3OA 1Q62A 4L00A 1W83A 3EWHA 3P78A 1Q3BA 4OBOA 4AZTA 5IEYA 5ITUA 3PJCA 2L7IA 5C03A 4X62M 4AXCA 3LQRA 3HP5A 4AFJA 5CLPA 2G1TA 1QANA 1OPJA 2QG5A 3SOCA 2HXLA 4FCTA 5ETCA 4NEUA 3MTFA 1XXHE 4M9SA 1Y8GA 3FXWA 1GOLA 1XNRM 5G6VA 1A48A 5IREB 1KV1A 4O21A 1HT2E 5IQHA 4DG3E 2KNAA 4TWPA 1ZYLA 2W5AA 1XMMA 2WSCF 1DAYA 4AACA 4B99A 4RWKA 5CI7A 3TIYA 2JFLA 3ANQA 5JQ5A 4YJRA 3QA8A 3BV3A 2BAJA 3VW6A 3B74A 3ZXTA 2V7AA 1UA2A 3PSCA 2J51A 5BYLA 4JR7A 4XOZA 2Z4SA 5HCYA 4O83A 1AQ1A 3L8XA 2C3IB 4BWXA 5K0XA 3VONA 4QD6A 4JX7A 3ZOSA 2E9OA 5AR4A 3OP5A 3A7JA 4FD2A 3KOYE 3ZM4A 2VIIA 3FKLA 4FSRA 2BDFA 2F5NA 5BNJA 1G41A 4Z8XA 3VO3A 3G0EA 5CU0A 3IO7A 4GS6A 1O9UA 4G6LA 5CVFA 4DFXE 3G5DA 1U5RA 4BRXA 3OBJA 2CE7A 2XK6A 3IOKA 1F0QA 5EQTA 3DJ5A 4ITHA 3V01A 2EKKA 2R4BA 4BN1A 4KS7A 5FQDC 5K0KA 3LFDA 2UZDA 4I6QA 3HJSA 3KGAA 5CEIA 4XV2A 2E9UA 4D0XA 3ZRLA 4IWOA 3KDSE 4H05A 5LCKA 2GFSA 4RFZA 5KPZA 4NSOB 4FT3A 1JBPE 2YWVA 1XH4A 3UIBA 5EXSA 3PIYA 4O0RA 3GPYA 1M17A 2LVAA 2RGPA 3NUPA 3RE8A 3TKHA 3QTQA 1XWSA 4KD1A 5L8KA 4U44A 4DBGB 2C96A 4L8MA 4NK9A 3T1YM 3SOAA 4G16A 3PY1A 3LFSA 2LHGA 5FWKK 2O65A 3R22A 4F09A 2Y6MA 4BHNA 3SMPA 3PJ3A 1IN8A 2JITA 2OZAA 4WD5A 5IDPA 1S9IA 3WIGA 5ITXA 5AUWA 5LVMA 4IW0A 4RJ7A 3MH1A 4GRIA