1ZMVA

Catalytic and ubiqutin-associated domains of mark2/par-1: k82r mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
313
structure length
293
Chain Sequence
GNYRLLKTIGKGAKVKLARHILTGKEVAVRIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIAGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein,transferase
molecule keywords MAP/Microtubule affinity regulating kinase 2
total genus 94
structure length 293
sequence length 313
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1zmvA03
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zmvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zmvA01
4AT5A 2WTKB 3OBGA 4Y5QA 2W1CA 5AM6A 3RVGA 2ZV2A 4U81A 1PXNA 1CKPA 4AA4A 1XQZA 2ITTA 4HGTA 2OFVA 4ALUA 2JDRA 1SVHA 4I23A 4LL0A 4Y95A 2A2AA 2YHVA 4JR7A 3VS4A 4IAKA 1WIVA 2WTKC 5I0BA 4J98A 2Z7SA 1OGUA 2BZIB 3LFBA 3M2WA 5FM2A 4PDYA 3UOKA 5BYLA 4LOOA 4AN3A 4FSYA 1SMHA 3DBCA 3H10A 3EQBA 5DPVA 3WI6A 4DGOA 5LOHA 3FMKA 5DH3A 3TL8A 3OWPA 3W2CA 3FMEA 1Q99A 3U55A 3LCVB 4FT7A 4LV5A 2YLEA 2IW8A 5C26A 1W83A 2HXQA 4JBPA 2QHMA 4R1VA 4YJRA 4E5AX 3IQ7A 4BDFA 3NZ0A 2BIKB 4QMTA 4HGEA 2XKCA 1ZAOA 4E4MA 2UZUE 3F9NA 4IB0A 2G01A 2OJJA 4C38A 4CTCA 3EOCA 3EHAA 2EVAA 2PL0A 4UMTA 5HNGA 4BIDA 4YUQA 2DAEA 4K0YA 4NEUA 4UN0C 5JGAA 1QZEA 4QYYA 2JDTA 2ITOA 5IA3A 3GU6A 4I5HA 5CQUA 4RFZA 2ONLA 4MYGA 4YTHA 4O7SA 3UMWA 4QMWA 3S3IA 4RFMA 2BAQA 5EK7A 4ZJJA 4WOVA 4QPAA 3FEGA 4W9WA 3FRHA 3QA8A 2XYNA 4H36A 4S2ZA 3RALA 2C6KA 2X8EA 2BZJA 3R83A 4TL0A 2CHLA 5HG7A 5E90A 1WBTA 4FIIA 3LCOA 4S32A 4EHEA 4EOJA 2ITVA 2RSVA 3C5UA 1H08A 4C4FA 4DGLC 2WQOA 3QZIA 1WVYA 5AJQA 3JXWA 5JZJA 2W1HA 3LMIA 2O3PA 1P5EA 4U9AA 4D28A 4I1ZA 2JP7A 4JDKA 5CVFA 3K5VA 3T3VA 4R3RA 4BRXA 3PIYA 2RFEA 4MXOA 5H9BA 2C6TA 5DHJA 3BGPA 2VWVA 5C27A 4JIKA 4MXXA 3UNJA 3KF4A 4FSRA 5AR5A 5C8KA 2J51A 5CALA 3P7CA 4BTKA 3FJQE 2VTQA 4IADA 2JY7A 4JJRA 1O6KA 4PTGA 5HD7A 5GZ8A 5JGDA 1JSUA 3QZGA 4MWHA 3AC3A 1V0OA 3ZTXA 5J7BA 5HGIA 4ASDA 2R64A 4Y5HA 3R9HA 3T6PA 3IDCA 3HYHA 3Q5ZA 2BZKB 4IQ6A 4O91A 4V0GB 4RA4A 5HE3A 2UZTA 5M08A 4FTCA 3RBWA 5HESA 1WBOA 3TZ8A 4G31A 4F1MA 4RWIA 2PVMA 3HV3A 3ZMMA 2EKFA 4M12A 5HO6A 4DBXA 2J0LA 3LOKA 3DS6A 4CMUA 1M52A 1UV5A 2HY0A 4ZZNA 4ZIMA 5M55A 4FIHA 5AAEA 3U9NA 1W7HA 3ORNA 4CCUA 2JBOA 2R3JA 2CP8A 3NAXA 5L2WA 4KKHA 5FQDC 5IMEA 1Q8YA 2PUIA 3QCQA 4BDHA 4HPTE 4RJ8A 5TKDA 3ET7A 4FV4A 5DT0A 4A9TA 2CKPA 3KREA 2XNBA 3UP7A 4MQ2A 1YHVA 2VNWA 3LQ3A 3DXPA 3GU7A 4PY1A 2V0DA 4FSNA 4M14A 4ALVA 4IANA 3P79A 2XK4A 5HTIA 4C7TA 2ITWA 3E3BX 4O27B 3H0YA 4MKCA 4ZY4A 3PIXA 4EJ7A 3A60A 4ACCA 5A54A 2GHGA 3FLSA 5IA0A 3ATTA 2DUVA 5A4LA 2H8HA 2O2UA 3NNUA 4RPVA 4FNYA 4JDIA 4BHZA 2XH5A 1J1BA 1FVVA 3CTHA 5CEMA 2J5EA 5DLSA 1OL2A 4O7ZA 3KY2A 3MY5A 1Y8GA 5EYMA 4GMYA 4NFMA 5CLPA 4AAAA 2ITXA 4IXPA 5CU4A 3QTSA 5E1EA 4FG9A 1JNKA 4O2ZA 5C01A 3EQDA 4IX5A 5AADA 2YIWA 4PPAA 3LVPA 4HYSA 5IUHA 5M4CA 2Y4IB 3TUDA 4FODA 5LVMA 3OTVA 4BHNA 3DQWA 3UPZA 1MRYA 1W84A 3QZHA 3PA4A 3ORXA 4IX6A 3RM6A 5A6OA 5AEPA 3PG1A 3R8ZA 5LMBA 5GHVA 1XH9A 4HCTA 3AOXA 3DA6A 4XP0A 4YGAA 3R00A 4G6OA 1WBVA 3FAAA 1GNGA 4F1TA 1NVQA 4WNMA 3RNYA 4ITIA 3ZO3A 4RJ6A 3JYAA 5EOBA 5L8KA 2PMOX 3GCPA 2YITA 4LYNA 3UE4A 5KCVA 4BC6A 1ZOGA 4LGHA 2BAJA 2ZMCA 3PE1A 3UVQA 4V04A 5LMKC 1F3MC 3HDMA 5M51A 4RX8A 1EFUB 4RX7A 2BKKA 2C5YA 5JEBA 2C0OA 2PHKA 1DI9A 3PJCA 4GIIA 4CFXA 4OBPA 2ZTCA 4ZEGA 3BYVA 3VO3A 2YEXA 5LWNA 2VO6A 4BCPA 4DG2E 3TKHA 3PWDA 3PXFA 4XG6A 1VYWA 2QR8A 3FZRA 1GZNA 4FUYA 4KBKA 4XH6A 4X3FC 2VAGA 3FMMA 4J1RA 4DG0E 2JGZA 4BDAA 1IASA 3BV3A 3QCXA 5KE0A 3E87A 4FEXA 4IDTA 1JKKA 3CPBA 4U5JA 4AF3A 5KO1A 4X6QC 3QZFA 5JT2A 1U46A 5HTBA 3AG9A 4UMQA 3FHRA 4QMXA 5FRIA 3QAME 3AD5A 3R0TA 2MROB 3RMFA 3DOGA 3VW6A 4FKVA 4EI4A 1E94E 3MDYA 3OCBA 4PX6A 3WYYA 1SNUA 3BBZA 2H6DA 3SXFA 2WKMA 2CNVA 2R3QA 3QXOA 5M06A 3ZSIA 3PDTA 3GBZA 1GY3A 4DFZE 4ZSGA 1OL5A 4YP8A 2WTDA 1B6CB 4AZEA 2X81A 4YJSA 5DE2A 3TACA 3T9TA 5IQEA 4YZCA 2PTKA 1SVEA 2XUUA 4U8ZA 1YXVA 1OL7A 4WBOA 3R22A 3QBNA 2O0UA 2XS0A 3EZVA 5AP1A 3OW3A 2VZ6A 2ZAZA 4X2JA 5J8IA 1NV8A 4DBNA 1JLUE 1R4GA 5I4NA 2JY5A 1XO2B 1XBCA 1NY3A 4FTTA 2HELA 4R8QA 2WU6A 4UY9A 2QO7A 1QCFA 4RLKA 1A5TA 3FLQA 1WGLA 1QPEA 3ACKA 4JL9A 1JWHA 4G5PA 3MH3A 4I20A 5IA1A 4EOLA 4YLJA 3R7VA 4QQCA 2JZ0A 2GU8A 2GNGA 4QMVA 4FV7A 3HRBA 3R63A 4P90A 3O8UA 2PPQA 2C6EA 2WO6A 1M2QA 3RP9A 2LVNC 4FSMA 4M66A 4EK8A 3IW4A 3H30A 5GJGA 3VNTA 4V0GA 4YHFA 3LPBA 4L9IA 3VIDA 3TDWA 3LCUA 1JKSA 2IN6A 2QU5A 4I5CA 4MF0A 5DYJA 1JQHA 3O7LD 5ANKA 4E6QA 4BB4A 1BI8A 2PU8A 1V0BA 2VWWA 3W2PA 3BCEA 3UIMA 3JVRA 3C5IA 5CU6A 3VW8A 3HV4A 4WIHA 3V5TA 3RHKA 1CKJA 2FH9A 2BCJA 3EKKA 3H9OA 2JIIA 3PZEA 2P4IA 3JVSA 2F49A 2PZIA 3MIAA 2IVTA 4TNDA 4TYHA 3WF6A 3EQRA 2UV2A 5L4QA 4IWDA 4G3CA 5EI6A 2VGPA 3TCPA 3KFAA 2WMAA 5LARA 1TQPA 5E8TA 1ATPE 3O23A 3Q4CA 2XK6A 4FKWA 3WZJA 3UOJA 4Q7JA 2GMXA 1J1CA 2CKQA 3C9WA 2EU9A 2BRGA 2FVDA 2HENA 3KQ7A 4F7SA 2LVAA 1L8TA 5IQHA 2J0JA 3EQPA 5HU9A 1Q8UA 2F7ZE 3IGOA 4IFCA 3E3PA 3R7EA 4KBAA 1YI3A 4NU1A 4AN2A 4AW0A 4FVPA 3QRTA 4OTQA 5FDPA 5HNIX 3TM0A 2G15A 3ORTA 4DEGA 4F4PA 5GJFA 5GINE 5CSXA 3G5DA 5IDNA 2X9FA 2UVZA 5FM3A 5I9VA 4U45A 3R9DA 3Q96A 3K5UA 1OITA 2I0EA 3ORLA 3MVLA 3O96A 4MX9A 3R8LA 5HX8A 5DNRA 1JOWB 3ZO4A 2L4FA 1ERKA 4NM5A 3NRMA 3W16A 3W2RA 4IVAA 3UIXA 2VO7A 3SKCA 1J7UA 2LVPC 3DDPA 3TJCA 4FKOA 3TI1A 4FBXA 3ATSA 1YRPA 4TKSA 2VTOA 4JX7A 3CTJA 1PXMA 2ZOQA 3Q2JA 2FSLX 4X7QA 3IKAA 4L45A 3CLYA 3EZRA 4LMUA 5J5SA 2XB7A 5HCYA 1MRUA 5FLFA 1T46A 3R01A 4IM0A 4NWMA 4XLVA 2HZIA 3D9VA 3U6IA 2Z7LA 5AUYA 5ANIA 3DPKA 4GFOA 3V5JA 1PF8A 1FINA 2X4FA 3QHRA 3QTXA 4FZDB 5EKOA 1TR8A 2EXEA 2ZM1A 2WIPA 1ZLTA 4KD1A 4ZTLA 2LVQD 3KA0A 3NPCA 3VS1A 3QLFA 3LW0A 5L6OA 2BHHA 2RRUA 3DLSA 4TTHB 4U42A 2PZPA 3CKXA 3MH2A 3POOA 1PXIA 4JOAA 3RPRA 2ETMA 4H1JA 3RI1A 1R0EA 3WYXA 2UW4A 3DBDA 4TYHB 3BI6A 1JAMA 3PVUA 4X2FA 3SHEA 4IB3A 3EFLA 5AMNA 3N4VA 4K2RA 3BRBA 5CEPA 5HBJA 5CTPA 3OFMA 5KBQA 2ITUA 2W06A 3NUUA 4RA5A 1OPJA 4AE9A 4YJVA 4E6CA 5EM6A 2WHBA 5LVNA 4L3JA 5LXMA 5M09A 1B38A 1SVGA 4YBKA 5A4QA 4D5KA 2YM5A 3FSKA 4P2KA 3QFVA 4BCIA 4U44A 3MESA 2WIHA 4TXCA 2MGWA 2CGXA 5CF6A 3GQIA 1XH6A 2O65A 3KCFA 1VQ1A 5BVFA 3N4UA 2I0VA 4JQ8A 1YVJA 3HUCA 2VTSA 1P3QQ 4RIOA 3VBXA 2X6DA 3IO7A 4O0WA 4GK2A 3GQLA 5CQWA 3C50A 3CKWA 3R8VA 4BDIA 4CFMA 5IZFA 5F95A 2PUNA 4ZXTA 5KMOA 1IRKA 2OXXA 1M2PA 4AZFA 2KHHA 3CJFA 3CXWA 4C3FA 4A7CA 3EWHA 3LMHA 3MY0A 4RLLA 3VRYA 4EOPA 4Y72A 3ZBXA 4ERKA 1U5QA 3MN3A 1YDSE 2RF9A 3GI3A 5IEXA 4F64A 3KRLA 4RT7A 3F5GA 5LMAA 5AP2A 4GYGA 1NVSA 5FXQA 3ZFYA 4AP7A 3HLLA 1PYXA 1FGIA 4C4EA 4M15A 2PE2A 4DEHA 4YURA 3MA6A 3OVVA 5L2IA 2BR1A 1XXHE 3AC4A 4GKIA 4HCUA 2QLQA 3HP2A 3UC4A 2XIRA 4E6AA 2VTHA 3LE6A 5LVOA 3BELA 5EM5A 4ASXA 4FTKA 2UVXA 1AQ1A 3RAKA 4WT6A 3VC4A 1M17A 5AR3A 2CLXA 4D2TA 3TG1A 4XLIA 5IISA 3NGAA 2OF4A 4O0YA 5FEDA 3V8WA 2C6DA 4EH9A 2C1AA 3H9FA 3L9MA 2W1IA 3JUHA 2G9XA 2IVUA 2XIYA 3D7ZA 3HDNA 3BEAA 4FVRA 2IZRA 2VUWA 2JIUA 3W8LA 4AGUA 4R5YA 3PLAE 2VV9A 4CD0A 5IQIA 1PXOA 4RWJA 5E8UA 5A46A 1KUTA 4ZAUA 3KF7A 4LUEA 4FL3A 5BYZA 1EH4A 3D5WA 4H3QA 2Z8CA 5FEQA 5BPYA 4I41A 3EL7A 4LL5A 3R71A 4EH2A 5DFPA 4PL3A 3M42A 1DV0A 4P5QA 4MVFA 4JQEA 4U0IA 2YA9A 1ZY4A 4BGGA 4EJNA 4F6UA 1LR4A 3FZOA 3HP5A 2NRYA 5JI2E 3WOWA 4ZSAA 3C13A 3MWUA 4EHVA 4ACGA 4YC6A 1GZ8A 3I81A 3CEKA 4NSTA 4O0VA 4BFMA 2OOBA 3E92A 4FIGA 5HIBA 3DBFA 4LI5A 5KZ0A 2QR7A 3HAVA 1Z5MA 2CWBA 2ETRA 4AOIA 3V01A 1DO0A 3QALE 5GZAA 4J53A 3ZZEA 5HCZA 4CKJA 2GTNA 2HZ4A 2ZDUA 3LXKA 4TT7A 4EH6A 2R3GA 4MHAA 5KMNA 4RQVA 3KKVA 4J8NA 4D1XA 4IM3A 2LAVA 1W0XC 3VS2A 2GNHA 4L8MA 4Y85A 1S9IA 3EKNA 5J7HA 1F0QA 5BVKA 5AR8A 3VQHA 3PP0A 1YXXA 3L8PA 4AOTA 3DKFA 4F6SA 3Q6UA 2QOHA 2UW6A 2CSNA 2ZB0A 3OUNB 4BI0A 4B99A 2ACXA 3COKA 1UKHA 3OCTA 4UXLA 3S4QA 2HWOA 4DYMA 4O7WA 4KSPA 4OW8A 4K18A 1ZRZA 2L4EA 5ETIA 3VUDA 3CGFA 5A14A 4USFA 3MTFA 3NW5A 5CI6A 4DBGB 4EYMA 4GG7A 3R04A 4FZFB 3VN9A 4EWHA 2YFXA 4PL4A 3Q04A 1ZMVA 3QX4A 2HZNA 4K6ZA 3IS5A 3IOKA 3W2SA 3TNHA 2H96A 3CY3A 4OT5A 1V1KA 3DKGA 4Z16A 3G0FA 1PXLA 3DKOA 2BPMA 4NJ3A 5AUVA 1KOBA 3FKOA 2OJFE 4M13A 1HCLA 4DTAA 3K3JA 2FSTX 3CTQA 1FVTA 3PXYA 2AC5A 4O0RA 3KB7A 4WHZA 4WKQA 1YWVA 4QTBA 4UMUA 2UZWE 2YERA 1ZOHA 4BCGA 3UO6A 4QNAA 1G5SA 3L9LA 2BWBA 3DK3A 3RJCA 2VX0A 3W2OA 3ZFMA 4BL1A 3R2YA 5ETCA 2DZLA 3WBLA 4FKIA 3RZBA 4FTMA 4W4YA 2LGCA 4HPUE 4IB5A 2QODA 4KIQA 4XHKB 3C4ZA 3K3IA 4Y83A 5ANOA 4F99A 3B89A 2YM6A 4GH2A 4O7VA 2B9JA 1P14A 2Q83A 1I09A 1YDTE 2F9GA 3QXPA 4YSMA 4ANQA 2OOAA 5C4KA 4PWNA 2RKUA 2WPAA 3DCVA 2VWXA 4PL5A 1Q3WA 2GS7A 4HNIA 4XG8A 4EZ7A 3FWQA 3Q4UA 2DYLA 3B8QA 3BYUA 4FKQA 4O83A 4HVDA 4CG8A 3D5UA 5CEIA 1PJKA 2UW0A 2BIYA 1U54B 4DEEA 4A06A 4YMJA 4G3GA 2ZVAA 4QTAA 4RBLA 5CAOA 5FXRA 4BTMA 5A6NA 3D83A 5ANGA 2B53A 2VD5A 3U4UA 3PY0A 4UB7A 4Z55A 2HXLA 3F7ZA 2XVDA 3AGLA 4X3FB 4OAUC 3NVMB 2YCFA 4RX9A 3TJDA 2HIWA 5AA9A 5AP3A 1REJA 3LFEA 1Y6BA 2YM7A 4K1BA 3QKKA 3A7GA 4KIKA 3VBYA 2ETKA 1JSVA 2X2LA 3UMXA 2FO0A 4TY1A 2OZAA 3AXWA 2HWJA 3MJ1A 2O5KA 2VTIA 4A9UA 3N51A 2P2HA 4MBLA 3ANQA 2GHLA 2XK7A 2PVNA 4GK4A 3LFCA 2XYUA 3SDJA 5EYKA 4D0WA 4BYJA 4JRNA 5JZNA 3LAUA 3R6XA 4QMMA 4GT3A 4H3BA 3UBDA 3MW1A 3PPKA 4RJ5A 3RAWA 3SRVA 4CT1A 3HNGA 2QO2A 5J9LA 4TZRA 4LUDA 5CEOA 5DR9A 1OVEA 4YLKA 4I6HA 4QYFA 3V5LA 3LLTA 4I5PA 3NLBA 3CQEA 4TW9A 3GC0A 5FDXA 4F7LA 3QUDA 1FGKA 2MR9A 2R3HA 3F5UA 4X2GA 2IJMA 3B8RA 3I0QA 5DOSA 5GIOE 1NV9A 4JT3A 4GVAA 3FYJX 1V0PA 1OIYA 5IQGA 1L3RE 2W1EA 5JSMA 3OT3A 2WTVA 5C8MA 3KULA 3PXZA 3ERKA 1ZMWA 4I0SA 2A19B 1G41A 4G16A 3TT0A 1WHCA 4FIFA 3ZH8A 4QP9A 1KE7A 2VTAA 3FZ1A 5AFVA 2A0CX 4LRJA 4JDJA 4GKHA 2E9PA 2XEYA 2YAAA 3CCNA 4E26A 1VEBA 3FC2A 3QQUA 5A4EA 4C36A 2WFYA 4FVQA 5FTOA 1BL6A 3A4PA 1OKWA 3EQHA 2O63A 4PUZA 5T6KA 4AT3A 3AMAA 3WZUA 5BVNA 4DFYA 1GIIA 1FQ1B 4F6WA 4X6RA 4D9UA 5M56A 4NK9A 4DG3E 1T6OA 2BDWA 3WE4A 5DI1A 1WGNA 3RAIA 3A99A 3QRKA 3VBQA 2XRWA 3PVBA 2JKQA 4UWCA 3MMPA 2J0MB 2V7OA 3Q4ZA 5ETAA 3TZ7A 2WMXA 1IR3A 3MFTA 4O0SA 3GVUA 1X8BA 4P4CA 4IAIA 4RJ4A 3UG1A 3MY1A 1ZWSA 3VUKA 4BKJA 2YZLA 5CT0A 2GNLA 2ITQA 3DAKA 5AUXA 2YM8A 5JQ5A 5M57A 2YCSA 2QCSA 3R28A 4QMZA 3G90X 2CLQA 3HECA 5FWKK 4R7IA 3V6SA 5AUTA 5LJJA 3POZA 3LJ2A 3I7BA 2JNHA 4FICA 4XV9A 4YPSA 2R7BA 3CJGA 4AFJA 3BLQA 2ERZE 2BDJA 4IZ5A 1ZYSA 3BV2A 2OH4A 2W1FA 4XNEA 3VUTA 4ZS4A 1Y6AA 5FBOA 3P5KA 4G6LA 3OZ6A 4EQUA 1DM2A 4D2WA 3FXWA 3HV7A 4J95A 3QRIA 4PQNA 4XEYA 4B8LA 1O6LA 5B2LA 5K9IA 4FV0A 5CSWA 2C5OA 2FUMA 5AR4A 5KMJA 3A7IA 3EN4A 1WJ7A 2AUHA 5HLNA 2FB8A 4CXAA 3R73A 4X0MA 2QG7A 1Y91A 3PJ3A 3Q9XA 2GQSA 2BDFA 3KXGA 4E20A 2XK9A 3OOGA 4MD9E 3O51A 1NA7A 4UEUA 4JBOA 4EKKA 4NL0A 1BKXA 2A1AB 2RIOA 2RGPA 3KXHA 4I92A 4IWPA 2R3KA 4QMLA 5K3YA 1QPJA 2UZOA 1UU9A 4A9SA 3UZTA 2CJMA 1F5QA 2I7QA 5DBXA 4DT8A 3VF8A 5IF1A 3MB6A 1P2AA 1LP4A 1WBNA 3AD6A 4J99A 4UN2B 4YHJA 1FVRA 3BE2A 4D58A 4CV8A 1QL6A 4EH3A 4M68A 4O84A 5ICPA 3DK6A 3LJ1A 3NUYA 4MBIA 5DT4A 3Q4TA 3DV3A 2X2MA 2QOKA 1V92A 1QPDA 2EB2A 3A7HA 4QP8A 3W33A 5DR6A 2R3OA 1KE8A 3UYTA 5AR2A 3FL5A 3OY3A 2QOQA 4MBJA 4XBRA 4Z9LA 5AP0A 1WBWA 3UODA 4XBUA 4NJDA 2DHYA 4FSWA 2G3QA 3FMLA 4FUXA 5CI7A 3KVXA 3NUXA 3QTUA 2X8DA 4FMQA 4TWCA 4QP1A 5CYIA 4BWKA 5A4TA 3SVVA 4DCAA 3G9LX 4GVJA 3ENHA 2WMWA 3G33A 4IZAA 4X21A 5HVJA 4PV0A 3RK7A 4NIFA 4UZDA 4DF3A 4W4XA 3FMJA 2GDOA 3GCVA 3NUSA 4HYIA 4D2RA 2E9VA 3BPRA 3KMUA 4NUSA 2CCIA 4DINA 4QTCA 3H0ZA 4O22A 5FXSA 1S9JA 2F2UA 3C0HA 5KKRB 4DCEA 2BUJA 4GU9A 4G5JA 4L7SA 4AX8A 4FL2A 4BCJA 4I4FA 5D7VA 3V5QA 3V5WA 1REKA 3MB7A 4AACA 5BNJA 1OKSA 1RDQE 3A2CA 2OICA 5HQ0A 3E8NA 2OZAB 4JX3A 2Z2WA 3HA8A 4ASZA 5JMSA 3W10A 4QMYA 3L1SA 2E9NA 3P4KA 4DTBA 1CKIA 5HO7A 2V7AA 2B1PA 2UVYA 4M84A 4CRLA 4L42A 4N6YA 2QC6A 4QYEA 4R3PA 4WG3A 3LCTA 5DIAA 5DA3A 1KE6A 5CNOA 2OXDA 3ZO1A 4CMOA 5EQYA 1XHAA 2JY6B 1W98A 2OLCA 3F5XA 3JY0A 2IWIA 4ZJVA 3PVGA 2W0JA 3U51A 3UDBA 2A27A 2P3GX 3ZXZA 3C0GA 1KE9A 3R7OA 3ZUVA 1Q8WA 4F65A 4E6DA 3KXZA 4U7ZA 4XG2A 2YZAA 3CGOA 2W9FB 3BQRA 5CEQA 4C2VA 2I1MA 1UU3A 2X9EA 3JS2A 1U59A 4EORA 4FEWA 3ZOSA 4J7BA 4ANOA 1R39A 2WMUA 2XK8A 4EHGA 2C0TA 3DFAA 3UNZA 5J9YA 1BVSA 3D5XA 2CPKE 2W9ZB 2YDJA 5EDRA 4E93A 4K11A 4WG5A 2J50A 3NYOA 4AFEA 3SG8A 1XH5A 4G3EA 2DNAA 4GK3A 5AAFA 1NW1A 3IOPA 4FTNA 4EWQA 5IDPA 2R9SA 1UNLA 1WBPA 2VO0A 3SC1A 4BCQA 3UO4A 4DAWA 1IFYA 2QOFA 2WQMA 3F2AA 1IAHA 4BIBA 4PP7A 5A3XA 4EONA 4HEOA 4YTFA 4QMUA 4ZSJA 3SV0A 3UP2A 3KXXA 3H4JA 4FKUA 5LVLA 4IAFA 3SOAA 4E8AA 5CSVA 4MNEB 5C9CA 4R3CA 4J97A 1O9UA 1YXTA 1OI9A 5C1QB 2QNJA 3RKBA 2F2CB 5EHYA 5ANDA 2CNQA 2OKRA 4CFNA 2WTWA 2CGVA 3I0OA 5ITAA 3ZO2A 5CNNA 2P2IA 4CZTA 4E5BA 2REIA 3EQIA 1XBBA 3F3ZA 3GC9A 3BU3A 2CKEA 3IDBA 3MVJA 3WARA 4IH8A 5M44A 4DA5A 4KKEA 4ARKA 5HTCA 4L52A 5CF5A 5E9EA 2BALA 4M0ZA 4U40A 3SAYA 3CD8A 3P7AA 1RJBA 1F4IA 3PA5A 5H8GA 1WR1B 2GQGA 3WF7A 5LWMA 4YZMA 4ZMFA 4RIXA 4U3YA 4DGGA 4D4YA 1ZYDA 2JFLA 5E8VA 4F0IA 4YNEA 3EMGA 1VYZA 3K2LA 4K9YA 5BVWA 4F9YA 5C03A 4D4SA 2ZV7A 4DEBA 3MSSA 4ZK5A 3ZSGA 3BGQA 1UKIA 5BMMA 3OXIA 3W1FA 4AGDA 2IG7A 3NUAA 4CYJA 3R7IA 3ROCA 4R77A 2YWVA 4AUAA 2R7IA 4AGCA 2BVAA 4PP9A 4MF1A 3QKLA 2CGWA 3FPQA 5TT7A 4LOQA 4RGJA 3ULZA 4D0XA 1BYGA 4U3ZA 4JQ7A 3B2TA 2JLDA 5F1ZA 4ACHA 1IG1A 2UZLA 4AZVA 3KULB 4M97A 2P0CA 4IZYA 3LQ5A 2GS6A 4M8TA 2Y4PA 2V22A 3WZEA 4FZ6A 4CFUA 4QQ5A 4ZJIA 2PVRA 4AU8A 4MNFA 2OF2A 3MFRA 3V04A 4EOKA 2QKRA 3DDQA 3GU8A 2UW9A 3QU0A 4GUEA 4IVBA 1OBGA 2JEDA 1UNHA 3DZOA 3FKLA 5AV2A 3G0EA 4MCVA 2QKWB 5K0XA 3PLSA 4QT1A 1OIQA 4FKPA 3EJ1A 3O2MA 3HUBA 5TE0A 3RPVA 4IAAA 2IW6A 3I6UA 4JBQA 2PVHA 5JK3A 4M7IA 4W8DA 4TWPA 4UALA 4L00A 3II5A 3PYYA 3FE3A 2C5NA 4OTGA 3ZFXA 4C2WA 5F4NA 1PGYA 5HORA 4CG9A 3IECA 1H1WA 4YZBA 4AZWA 3PY1A 1QPCA 4PRJA 3NIZA 4DE4A 4EHZA 2W17A 4O6LA 3KRWA 4ANLA 2BFYA 2HYYA 1H1QA 3F2NA 2OSCA 1E9HA 3ZUUA 5IQDA 4FV2A 3HMNA 1SG9A 5LCJA 1KSWA 2GPHA 3FMHA 2XA4A 4GUBA 2GNJA 3ELJA 4HZSA 5I9YA 2JY8A 2WNTA 3BQCA 5K5XA 3E21A 4Z7GA 5EM8A 5AP5A 2ERKA 3GCUA 4B8MA 4APCA 4FYOA 4IJPA 3LJ0A 3OP5A 4ZZOA 5CASA 3FI8A 5TOZA 4F2LA 4FV1A 2PVKA 1Q24A 3FPMA 5AAGA 2YISA 1XH4A 3EYGA 2QONA 3PJ8A 4F1OA 3FI4A 1Q3DA 3F2RA 4UV0A 2OO9A 2QOBA 2E9OA 2LBCA 2VX1A 4RFYA 2O8YA 1JVPP 3E8CA 5EHOA 3AQVA 4NKAA 2Y9QA 5IPJA 2F57A 5CS6A 3V6RA 1A48A 3NW6A 3WIGA 3DB8A 5IA4A 3E5AA 4FKJA 4I6FA 2BKZA 2OK1A 1DS5A 3O8TA 4U6RA 4MXCA 5BVOA 3D0EA 1DAWA 2QOLA 2WZJA 2R0UA 2JDVA 3AGMA 4JVGA 3KN6A 4CQEA 5EQEA 4GFMA 4FTIA 5I9WA 4DFUA 1MN3A 1JPAA 1M14A 2GHMA 5T68A 2C4GA 3Q6WA 3FSFA 4DLJA 3UPXA 4ZSEA 3VUMA 4DFXE 4DITA 1GO5A 3PJ2A 5CVGA 4FOCA 2ITYA 4C37A 4PMMA 3FLZA 1OUKA 2PE0A 4RX5A 3ZM4A 4IWOA 3DU8A 5D41A 4W8EA 4AW2A 3WF5A 4OTPA 1Q61A 3GENA 4TYJA 2C6IA 3FI3A 3FBVA 3OC1A 3UQFA 2XNNA 3DJ6A 2J90A 5KMLA 3LM5A 3ODYX 2OZOA 2XIZA 3BEGA 3FL4A 5AUZA 5FEEA 4AXAA 4E4LA 3F3UA 2ZB1A 3MI9A 1DAYA 3LCSA 4O7NA 1HOWA 3VHKA 4PF4A 2VRXA 2W5HA 2YIQA 5AUUA 4BDBA 5J1WA 4BVUA 3HX4A 3OWKA 3GU5A 5IQFA 4ZY6A 4W9XA 5HG5A 3FYKX 1CMKE 4F70A 1URWA 2QQ7A 4FTOA 2YM3A 5KMMA 4FNXA 5JQ8A 1OM1A 5E91A 3QWKA 5ETFA 4ZTNA 3ZEPA 2YACA 4BCHA 2XNMA 4GS6A 2Q0NA 1YOLA 5LVPA 2SRCA 2DI0A 3R1SA 4MD8E 2QSFX 5EW3A 5CSHA 5HU3A 3FY2A 4FSTA 5AP4A 3ETAA 3TNPC 5AP7A 3ZCLA 5CXHA 1OL1A 4EOMA 3GXLA 4F7NA 1G3NA 3S00A 4LV8A 4O7RA 4G3OA 1WMKA 4QTDA 4PMSA 5IA5A 4I4EA 2G2FA 4PDPA 2YDKA 2XJ2A 4FKTA 4RIWB 3UVRA 2XIKA 2VWYA 1Q5KA 4F63A 4GIHA 1NT2A 4CZUA 3P9JA 1TVOA 3BZ3A 4TYGA 1G8SA 2G2HA 3VRZA 2VTJA 4OTRA 3TNQB 2RFSA 5HIDA 2XRUA 5E8WA 3VJOA 1UNGA 5A4CA 3RTPA 3T8OA 5M4FA 1WCCA 2RFDA 4PNIA 1PRYA 2BWEA 3ULIA 2VX3A 4D2VA 4MXYA 5E4HA 3FQHA 1JKTA 3GU4A 3LFFA 3Q3BA 3E63A 4ZTHA 3TWJA 4WA9A 4AA0A 4L01A 3PXKA 4M0YA 1AGWA 4TNBA 4DN5A 4C4HA 2I0YA 5FBNC 5HNBA 4D5HA 2VTRA 4FTLA 4F9CA 4RMZA 2DAGA 3GLIE 5DN3A 4ORKA 3PWYA 4RC3A 5EH0A 1BL7A 4Q9ZA 4MEDA 3DQXA 3NAYA 3VWAA 4LFIA 3CBLA 3OCGA 2B9IA 3AT4A 4GJ2A 4LMNA 4XV1A 4AS0A 4JDHA 4RIYB 1HCKA 3BBWA 3PZHA 3D94A 3ZLSA 3RCJA 3DFCB 5I5ZA 3N4TA 3EQGA 4YSJA 3GGFA 4FYNA 5HVYA 4YO4A 5EYDA 4ID7A 5F20A 1LEWA 4Q5HA 4M3QA 2IO6A 4XOYA 5CT7A 4D4RA 3ANRA 4CLIA 4O81A 3IK3A 3I1AA 3MH0A 4OBOA 4RVTA 4XG4A 2VTTA 5J5TA 2GQRA 3FZTA 3VS6A 3O71A 5JN2A 2L2DA 2WMVA 4S34A 4X3JA 3P08A 4FTJA 1AIPC 4JS8A 2X8IA 4BI2A 4BI1A 5IH4A 5J1VA 3CIKA 3DLZA 4LQMA 2UUEA 3AT2A 4O0XA 1MQBA 3E46A 3TDVA 1JBPE 3ZSHA 5JFVA 4F0GA 2UW7A 2UW8A 2HY81 2UZBA 2YN8A 4GL9A 1OL6A 1OIRA 1H4LA 3HL7A 5C8NA 4FR4A 4YNOA 3QQLA 1IA9A 2QO9A 4S33A 2V55A 4FZAB 4KABA 3UNKA 3HV6A 3NR9A 3OW4A 3ZC5A 2J9MA 2XNPA 3TTJA 4EKLA 4EL9A 4CKRA 1H8FA 3I7CA 3PVWA 4L44A 4XJ0A 2P55A 5KKRC 4R7BA 1HT2E 3DT1A 2OG8A 4MQ1A 2R3RA 5EM7A 4YZNA 4MWIA 4EOSA 2DENA 2JAVA 4NTTA 4NFNA 1VJYA 5L3AA 2C3JA 3ORKA 3ZRKA 4FV9A 1CUKA 2Z7QA 3NCZA 4TRLA 4BBMA 2JKOA 4D1ZA 1G8AA 4EYJA 4JG7A 4QMQA 2NRUA 1H26A 5EG3A 2GFSA 3RPOA 4XRLA 2IPXA 3W55A 5CSPA 4OAVB 3D15A 3F6XA 4Z3VA 3TKUA 2YAKA 1UWJA 2OO8X 3DZQA 4EH7A 4DFBA 4FC0A 4IMYA 3M1SA 2XKEA 3BU6A 4HW7A 3HRCA 2BZHB 5K0KA 3THBA 3F92A 4APPA 3EQCA 2JITA 4AWIA 1CM8A 2HZ0A 4FKGA 3R1NA 4MTAA 4W4VA 5DT3A 2WEIA 4FEQA 4AOJA 4ZSLA 4C0TA 2XZSA 2BROA 4IHPA 4KIOA 1STCE 3DAEA 4O6EA 2X2KA 2XBJA 5GNKA 2WD1A 5H8BA 2WTJA 5HE2A 1SZMA 4UWBA 3WZKA 2RG6A 2WAJA 5IQBA 4XP3A 3FQEA 5BX0A 3KRXA 1G3IA 3C0IA 4GYIA 5I9XA 3CR0A 4RVLA 2OXYA 5IEVA 5HVKA 3ZRMA 3JPVA 1Z9XA 2X6EA 2Z02A 4WRGA 4ACMA 4O7LA 1P4OA 2W5AA 4ZTSA 4ERWA 1FMOE 3KGAA 1PW2A 5D12A 4OGRA 4X2NA 3T3UA 2B52A 4XV2A 4GT5A 1OUYA 4I22A 4TN6A 4ALWA 1YDRE 2BILB 2ZTDA 3HA6A 4BTJA 1ZZLA 5DVRA 4WP2A 3LFNA 3W32A 4G3DA 4JRVA 4WNOA 4BDEA 3BKBA 3DBQA 4R6VA 4F09A 3OT8A 3EYHA 4AZTA 4HYHA 4TWOA 2VN9A 4NIFB 4QNYA 4L7FA 4QPMA 1MUOA 3FXZA 3V51A 2IW9A 5L2TA 2ESMA 4IFGA 2R3IA 2FYSA 1UWHA 3OHTA 1KV2A 1XJDA 2BHEA 3TN8A 1RW8A 3FLYA 4WG4A 1SYKA 4MK0A 3EFJA 3F3TA 2C6MA 1KYIA 1LUFA 5E7RA 4RVKA 3PTGA 4ZOGA 4H05A 3QRJA 5LQFA 4O82A 4OTDA 4YJTA 1YOJA 3MH1A 3QTRA 4JXFA 5IUGA 2EXMA 3RZFA 4XRJA 4C02A 3HVCA 5JH6A 3FLNC 3BE9A 4N6ZA 3WF9A 3RM7A 3HMOA 3QQJA 4ITHA 3GT8A 4OT6A 4YJUA 3LIJA 4G17A 4B7TA 3Q5IA 4FSQA 5K5NA 5D1JA 3AC1A 3QC9A 5AV3A 3VUHA 3PUPA 3U4WA 2C69A 2QLUA 3GUBA 4RIXB 4I6QA 5E1SA 3I6WA 3W2QA 4FV5A 4ACDA 4WNKA 3ACJA 3BU5A 4WNPA 4PDSA 3P7BA 3ZS5A 4BDKA 3PJ1A 4BKYA 3QCSA 3VUGA 1ZXEA 3EN7A 3HMMA 4KKGA 3PSDA 1OBDA 3QQGA 1U5RA 4QYHA 5DMZA 2OU7A 3PP1A 2QOOA 4DFNA 2OIQA 3BX5A 2WMRA 2X7OA 2XKFA 2DAKA 4EUUA 4O21A 3K9OA 3QKMA 1PMNA 2PE1A 3OXTA 3R30A 4B0GA 3GLGE 2YJSA 3PG3A 1B39A 1IXSA 5TR6A 3OROA 1KV1A 1YWNA 2WMSA 2O64A 3BYOA 1YXSA 4JG6A 3ZYAA 3COIA 5HG8A 2H9VA 2XBAA 4BKZA 5EW8A 3VQUA 5KBRA 4TPTA 4GSBA 3V8SA 3GOPA 3SG9A 4EH8A 2Y4IC 3COHA 5B0XA 4WBBB 2EB3A 3R1YA 4KS7A 2C47A 2Y8OA 2XEZA 3RHXA 3SW7A 2EJSA 5A9UA 1J3HA 4FT0A 2HK5A 3RNIA 2PK9A 4K8AA 3S95A 3ZUTA 2J6MA 3BHUA 3O17A 3RPYA 2UW5A 5I9ZA 1WAKA 3OWJA 4FE2A 2QOCA 2XK3A 5CX9A 3VULA 5CAUA 3U9CA 2OI4X 4AGWA 1OECA 3EB0A 4R7HA 3NMUF 3R1QA 2X4ZA 4AG8A 3QWJA 3KRJA 1YWRA 3EL8A 2VO3A 1QMZA 2WMBA 3GC8A 4Q9SA 5GJDA 4GJ3A 3TNWA 4CSVA 4QQTA 3MPAA 4IVDA 4LGGA 3S0OA 2FA2A 4NM0A 3FZSA 3D7TA 4EBVA 4KUJA 2KTYA 1BLXA 5I9UA 1H0VA 3FZPA 3GP0A 4XCUA 4AE6A 1UFZA 4LRKA 3U8WA 4CMTA 3HGKA 4IC7A 3KCKA 3P86A 5T3QA 3CY2A 4ASEA 4Q2AA 4UZHA 3VBVA 4D4VA 2EKKA 2KNZA 4CNHA 4EZ3A 2BRHA 4MXAA 5CY3A 2IZSA 2WMQA 3DKCA 3QX2A 1U54A 1PXJA 3ZXTA 3IDPA 5B2KA 3P23A 4AA5A 4EQMA 4ZY5A 3IPHA 4FKRA 3HMPA 5FUTA 2YDIA 4IWQA 2YM4A 2AYPA 4C57A 5BYYA 1I44A 3I4BA 4G3FA 4IW0A 3BBTB 4YJQA 4BN1A 3LKMA 4RJ3A 4C3PA 4E73A 2W4JA 3G2FA 2Z60A 1JKLA 3BLRA 5H3QA 4BBEA 4ZMEA 3TZMA 4DH3A 2OFUA 2PVLA 4ANNA 2ONLC 4Y46A 3EIDA 3OUKA 3VBTA 2OJIA 1VG5A 2PSQA 2C3LA 4FTAA 4N0SA 4AW1A 2PVYA 4QP7A 3AMYA 3UIBA 3PFQA 4YTCA 3R7GA 5IQCA 5E92A 3WF8A 4EK5A 1Q8ZA 3CQWA 2QVSE 4KSQA 4LG4A 3LM0A 3RGFA 5HHWA 2B55A 4M69A 5JRQA 3LLAA 5K4IA 3FMDA 3RPSA 3ZONA 4DGNA 1FMKA 3Q53A 2JIVA 3ZM9A 3NW7A 4FV6A 4EK6A 4FKLA 5CF4A 3RAHA 4LOPA 3A4OX 5CVHA 4FA2A 1OZ1A 4QQJA 4CFFA 5FP5A 1U4DA 4LRMA 3C4FA 5KHWA 1PMUA 3FY0A 4TWNA 3ZBFA 2I0HA 1HQYE 1URCA 4UX9A 3QD4A 2C3KA 4J71A 1JSTA 5CENA 4BCNA 4J96A 2HAKA 5AM7A 4BBFA 5KHXA 5M07A 3UO5A 4L53A 2UZNA 2JKKA 3R7YA 4D2PA 3GLFE 4BR3A 3VVHA 4RQKA 4A4XA 2VTPA 3AC8A 5I3OA 4YJPA 3ID6C 3D7TB 3E8EA 4CFWA 1H1SA 5LCKA 4EOIA 4QMOA 2OIBA 5H2UA 4MXZA 4KIKB 3QQFA 4IVCA 4KS8A 2RL5A 4K77A 2YWPA 5AWMA 1ZARA 2IVVA 2C5XA 3FLWA 5J95A 3SOCA 4RZVA 2RFNA 3MPMA 2GCDA 2XCKA 3KMMA 2X7GA 2XKDA 5DWRA 2J7TA 2PZYA 2Y0AA 4JAIA 5M4IA 1FBNA 5KMIA 2ZDTA 3UOLA 2B7AA 5AUWA 2PYWA 3OMVA 1T43A 3MS9A 2VGOA 4WRSA 3WIKA 2QG5A 4DLIA 2BRMA 2BMCA 5AR7A 3LXPA 3MVHA 3QD0A 5IUIA 4QP6A 3HZTA 4H1MA 5BUIA 1UU8A 4DEDA 3O7LB 4JNWA 3VF9A 3CE3A 2J0IA 2GNFA 3L8XA 4FK6A 4BCFA 5M53A 4XS2A 1TQMA 5HE0A 5B2MA 2NPQA 5C4LA 4FTUA 3BWJA 5CU3A 2IZTA 4KWPA 4CEGA 1KWPA 1Y57A 5BUEA 3G6HA 4CRSA 5FGKA 1OAIA 2YJRA 3ALNA 3DNEA 5BVEA 4EK3A 3FC1X 3DNDA 3E7OA 4YTIA 2KULA 3LXNA 3COMA 4XP2A 5IU2A 2I40A 3EH9A 4O86A 2YCRA 3NWWA 4XG3A 2Y7JA 3QL8A 4PNKA 4DEIA 4N4SA 4BICA 4ENYA 3FQSA 4FIJA 4HOKA 3DTCA 1J7LA 2CMWA 2J2IB 2R2PA 4LM5A 3JR1A 3A8WA 5HI2A 4OLIA 1H25A 4F9BA 3C1XA 5J9ZA 3SXRA 2PMIA 3C51A 3IW6A 4XUFA 4HVGA 1H00A 1UVRA 3R9OA 3TIYA 3TEIA 3NNWA 1PKGA 4R71A 4HVSA 5JFXA 4V05A 2JZ1A 4FV3A 4G34A 2X7FA 2JUJA 2B4SB 2DQ7X 2UZDA 5EDQA 5HIEA 4YJOA 4HGSA 3FRIA 2PMLX 4F08A 2R3MA 1PKDA 3C4EA 4YZ9A 1IAJA 1R3CA 1H24A 1MP8A 3IHPA 3L8VA 3VJNA 3I60A 3GCSA 4DEAA 3ZEWA 1ZMUA 3SQQA 4BY9E 4NTSA 4BDCA 4YR8A 1YOMA 3MGYA 5DFLA 4UWYA 4IX3A 4C4IA 2ZMDA 1OKVA 1MRVA 1ZY5A 1O6YA 1W82A 4X3FA 1G4AE 3BIZA 3E88A 3QQKA 4C8BA 4ZLZA 2K9DA 3RWPA 4WSQA 4HGLA 4BCOA 3TUCA 2PULA 4JAJA 5G1XA 3ZHPC 1H1PA 4FSUA 1GAGA 3ORPA 4E1ZA 2XNGA 4MAOA 5KMKA 3Q9YA 3ORZA 3V8TA 4A4LA 3EN6A 2WXVA 4EK4A 1RE8A 1PYEA 2X0GA 3QTIA 3REPA 4RWLA 3VUIA 2PVJA 5L2SA 3R21A 2WOUA 3BGZA 4FV8A 4G9CA 1H01A 3LFQA 4U41A 4XX9A 2B9FA 2QD9A 4IBMA 5IH5A 3F61A 4YZDA 5DR2A 4A07A 1ZYLA 3CQUA 3Q32A 5IQAA 3E7VA 3K54A 2C3IB 1WFCA 4WSYA 2XF0A 3I5NA 5HOAA 5EFQA 1ZYCA 5DEWA 2R5TA 5DEYA 4E4XA 4CLJA 3DTWA 5JGBA 2WB8A 4IACA 5CZIA 3GFEA 2H34A 4BZNA 2JAMA 2NO3A 3IW5A 3UJGA 2OJGA 5CZHA 4BDJA 4TYIA 4I24A 1RQQA 5KZIA 4UYNA 1NXKA 3L9PA 3ORIA 3C4XA 4HJOA 4I5MA 4ZTRA 4C61A 4DH7A 2NNWB 4M67A 2IVSA 1R78A 1XBAA 4NW6A 2J4ZA 4OTHA 2NP8A 4P5ZA 5HD4A 2H5XA 1SM2A 2EXCX 1CTPE 5E8XA 4KINA 3MJ2A 3NS9A 1UU7A 2EWAA 3C7QA 3Q9WA 2B3TA 4MH7A 2WTIA 3PSBA 3TNIA 4IAYA 4BGHA 4DTKA 4QMPA 5D11A 3GFWA 4QMSA 2OIDA 2JKMA 3FUPA 5HG9A 4DC2A 4CZYB 2FSOX 2QHOB 5FTGA 5D9HA 3Q60A 3D2KA 5BVDA 3NNVA 2OGVA 3E62A 2CCHA 2PZRA 2JC6A 3PPJA 3QA0A 5HKMA 5FG8A 4E3CA 1BMKA 3QQHA 4A9YA 2LVOC 4DH5A 5DRDA 3PY3A 3UOHA 3P78A 2B0QA 4UMPA 5AA8A 2W4KA 1TTEA 3OF0A 2VNYA 3LHJA 4FKSA 4RVMA 5D10A 2J5FA 3IONA 3LFDA 3LFAA 3NYNA 3OG7A 4KA3A 3QLGA 4YPDA 5TF9A 1APME 4NKSA 3R8MA 4JBVA 4OTWA 3ZDIA 3JY9A 4YLLA 3R9RA 4YJNA 3CS9A 2YLFA 3VS3A 2P33A 5EI2A 4USDA 5IKWA 3TUBA 4JLCA 3NNXA 3KK9A 4QTEA 5BMSA 1P4FA 4G6NA 4PMPA 2DKLA 2ITZA 4XMOA 4RJ7A 4B6LA 2PUPA 1M7QA 4L67A 3Q9ZA 4E7WA 5DRBA 1WZYA 4IB1A 4IEBA 2C68A 4R5SA 2PY3A 4GCJA 2C5VA 3D2IA 2JDSA 1PMEA 4PTEA 4I0RA 5F94A 2I6LA 2WGJA 3H9RA 4AN9A 4EZ5A 3VS5A 2R3FA 4B9DA 3R8PA 5HBEA 4O1OA 3RINA 4JIAA 5CXZA 3CPCA 3A7JA 1YKRA 4C33A 5ANJA 2XM8A 1HT1E 1GIHA 3FXXA 3QHWA 4IE9A 4L6QA 4FT5A 4FNWA 4G1WA 4ZLYA 2XJ0A 1VEKA 4ZTMA 4RRVA 3SRVB 4QRCA 4NM3A 4OBQA 4X2KA 5EYCA 2VU3A 3LFSA 3V5PA 3WILA 4GEOA 2FGIA 4L43A 3ZRLA 3GNIB 3MIYA 3O8PA 2C30A 2R3PA 2VWZA 2K0BX 2WELA 3KU2A 1Q4LA 2GS2A 3G6GA 3PXRA 3M11A 5CWZA 3VAPA 5EHLA 1PHKA 1VEJA 4ZS0A 4RC2A 4FZ7A 4J8MA 2UZEA 2G2IA 2AC3A 4O0UA 3BHHA 4FF8A 3UZPA 3ZC6A 4AW5A 4DT9A 2GSFA 2R3NA 3MBLA 2W96B 3E93A 3QRUA 1AD5A 2YCQA 4A4OA 5EQPA 1XKKA 3MVMA 5E8ZA 4KBCA 4AT4A 4CKIA 2W4OA 3R7UA 3AC2A 4PTCA 3TKIA 2BFXA 2WQNA 2ZM3A 2B54A 4CT2A 3UQCA 3BLHA 5IA2A 4YC3A 3PRIA 2GNIA 2YIYA 4FSZA 2Y6OA 2HOGA 3AT3A 1MQ4A 4K33A 4KNBA 1A9UA 4JR3A 1PMVA 4RZWA 4BCKA 5FP6A 4U97A 4NW5A 3OXZA 4TYEA 4EH4A 1R0PA 5J79A 3P1AA 1YQJA 4C35A 2KNAA 3AMBA 1IEPA 3F66A 3LQ8A 4QP2A 3TTIA 4D55A 4QMNA 3OEFX 3S1HA 4C4JA 4EUTA 2F7EE 4E4NA 3GB2A 4O96A 4IJ9A 3MV5A 4GFGA 4MNEA 4Q5EA 4BZOA 4FGBA 3W18A 3U6HA 2DAMA 1A06A 4NZWB 4GG5A 4FX3A 3UTOA 2V62A 2WQBA 2OW3A 4C58A 5AIRA 3R02A 3UGCA 3VBWA 5HEZA 3DBEA 5DG5A 4I21A 3KXMA 3F69A 4CV9A 4IIRA 5DGZA 4BDGA 3R2BA 1K2PA 4XG7A 4KRDA 2WU7A 1Q62A 4N70A 3I79A 2HW6A 3KN5A 1E1XA 3KRRA 3OBJA 4YBJA 5IH6A 4FT9A 4YU2A 2C6LA 2CDZA 4BYIA 3D14A 3T9IA 2JDOA 2YIRA 2QU6A 3KEXA 4KB8A 4CVAA 3U6JA 1YXUA 3KC3A 1YI6A 4G9RA 4N57A 2R3LA 4OUCA 4YO6A 2F4JA 1W8CA 1H1RA 1KE5A 1JR3E 1VZOA 5L2QA 5FD2A 3SXSA 2ZJWA 4C59A 2XMYA 2A4LA 4S31A 4BWPA 5LMKA 4KAOA 4LGDA 4FNZA 4I3ZA 3TIZA 5GZ9A 3TV6A 4EQCA 4HZRA 1YHSA 2W1GA 4EEVA 5BQ0A 1PXKA 1BI7A 3DJ7A 4NCTA 2W1DA 4BZDA 5L6PA 3PA3A 1H0WA 4FTQA 5EKNA 1ND4A 3UQGA 3NUPA 1WVXA 1XH8A 1VR2A 3DK7A 3QD3A 2XNEA 4H39A 4ZLOA 5IEYA 1GJOA 1OB3A 1XH7A 1CSNA 4NT4A 4QP4A 2XNOA 3F3WA 2GTMA 5D7AA 3A62A 4U80A 3ODZX 3ZZWA 5HZNA 1KOAA 3F82A 4I93A 4CTBA 4DHFA 2DAIA 4D9TA 4GV1A 3ROYA 3MFSA 3TV4A 4CYIA 1VEGA 4XOZA 5CEKA 3UZRA 3C4WA 2BRNA 2W05A 1ZOEA 2ZV9A 4V01A 2KNVA 4O2PA 4EOOA 2HCKA 5I3RA 2WMTA 3D5VA 4FTRA 3PIZA 1GZOA 1K9AA 1OIUA 3OY1A 3CD3A 4FEVA 4DH1A 3CC6A 4Y8DA 5HICA 4E5WA 5TO8A 2ZV8A 4FOBA 4QD6A 3C4CA 1XR1A 1FOTA 4OR5A 5AIKA 2BRBA 3SLSA 1Q97A 3QUPA 5HE1A 3ZDUA 3GCQA 2CN5A 2QI8A 3F5PA 4IM2A 3DXNA 3TV7A 5EDPA 3QGYA 4GW8A 4L68A 3CP9A 4JG8A 2VWUA 4I94A 5CANA 1LPUA 4R1YA 3VS0A 3N9XA 4OTIA 5AX9A 4HNFA 1IM2A 3ALOA 3P0MA 5G6VA 4WUNA 3BHYA 5JKGA 5CU0A 2YIXA 5CAPA 1IA8A 3KXNA 1GIJA 4GRBA 5HBHA 3HRFA 3FMNA 3TXOA 2VTNA 5EW9A 2W5BA 2CKOA 4ANBA 1OTRA 1UA2A 3NSZA 4IC8A 4QPSA 2W99B 4UMRA 4C34A 3A8XA 4R78A 1H27A 3OWLA 3PPZA 2OWBA 3HV5A 3QYZA 1TQIA 2LTUA 2C0IA 3IW8A 4NCTC 3IGGA 3PE2A 2XJ1A 2PUUA 3EN5A 4ANSA 4NYEA 2VWBA 3R9NA 3HMIA 5AV0A 4CCBA 3Q2MA 3GEQA 4UBAA 5H8EA 4F9AA 2F7XE 3B2WA 1OQYA 5CAQA 2EUFB 2B9HA 3HAMA 1OMWA 5CU2A 1YHWA 4EBWA 2QHNA 3SA0A 1E1VA 2X1NA 3AC5A 3UVPA 5L6WL 1Q8TA 3MA3A 2WOTA 4GU6A 4UYAA 4WO5A 5HLPA 4BWXA 4G2FA 1Q02A 2OH0E 3ZLXA 3EQFA 3MPTA 3HKOA 3DXQA 5IG1A 4O38A 4O0TA 3F7WA 2DS1A 5FTQA 4C62A 2R4BA 3MYGA 4L3PA 4D2SA 2UW3A 5BUJA 2XIXA 3E8DA 3EFKA 4F9WA 2VTLA 4ENXA 1NVRA 1M2RA 5ANEA 5HO8A 1T45A 3OD6X 2Q0BA 3ENMA 3DY7A 3TZ9A 3ORMA 4BGQA 2C1BA 4KIPA 3F3VA 5F9EA 4FEUA 4YHTA 3GLHE 3E64A 1YI4A 3QGWA 5HCXA 4CGAA 4XV3A 3GC7A 4ZTQA 4NM7A 2R0IA 5EOLA 4UXQA 3RWQA 4HYUA 4CFVA 4QP3A 4M69B 1H07A 4QO9A 3O0GA 2JD5A 4II5A 4FT3A 4D1SA 3QTWA 4FIEA 1BUHA 2ITPA 2PMNX 1Q41A 3O50A 3LXLA 2VWIA 3D4QA 3IW7A 3L9NA 5JRSA 2YABA 3IG7A 3PXQA 2DWBA 3EN9A 3F88A 3QCYA 3AD4A 3OOMA 3FI2A 3A7FA 4XG9A 4Z7HA 3GOKA 2Z7RA 3OCSA 3K9PA 2ZM4A 5AP6A 3BYMA 5JFWA 2QOIA 2ZYBA 4I6BA 4BTFA 4YC8A 4C3RA 5ACBC 4RSSA 4F1IA 3LMGA 3BYSA 3QD2B 4GEWA 3UC3A 5M4UA 4QOXA 1R1WA 4J52A 4RWKA 4CQGA 2XP2A 2BAKA 3KVWA 4EC9A 3FHIA 3SD0A 4U43A 3SW4A 1OKZA 1Y8YA 2XCHA 3DB6A 4O1PA 4BCMA 5E8SA 3OEZA 3VS7A 3U87A 2UZVA 3DGKA 3MFUA 4FG7A 4W4WA 3VHEA 1VDLA 4FI1A 3EFWA 3PRFA 3BHTA 3ZLWA 3PSCA 2W7XA 4PPCA 3FKNA 3QYWA 5KNJA 1YLAA 5KX8A 3CSVA 5B7VA 4HCVA 4L46A 2WQEA 3DJ5A 1GZKA 2CGUA 2Y6MA 2E2BA 2WTCA 3NDMA 3SX9A 4O7TA 3NEWA 1LEZA 3G51A 4IZ7A 2CNUA 5L8JA 3FV8A 3LZBA 4H3PA 4Y73A 2OJ9A 5E8YA 2OBJA 3MTLA 4MD7E 4EOQA 2CN8A 2PVFA 1PXPA 2XM9A 3L8SA 5AV4A 2QURA 4EH5A 2X39A 3UIUA 3RCDA 4F0FA 3Q52A 4F7JA 1FPUA 3ITZA 4FGRA 3NVKI 1M7NA 1DI8A 3QF9A 4I0TA 4ANMA 4ONAA 2PWLA 5J87A 1XWSA 4RIYA 2BTSA 2IZUA 3RK5A 1CDKA 4NH1A 4IX4A 5CF8A 1ZZ2A 2ITNA 2C6OA 2PZ5A 5ACKA 3V3VA 4RIWA 4O7YA 3NX8A 3RK9A 5IMXA 3QTZA 3NIEA 1H28A 4BIEA 4JI9A 2VTMA 3FDNA 4XYFA 5EI8A 4DGMA 3WZDA 5CAVA 1ZYJA 4DH8A 1OPLA 4S30A 3ZLYA 1GOLA 4IDVA 4U79A 3NYVA 2MJ5B 3R8UA 2WEVA 3SGCA 4PMTA 2HWPA 3KL8A 5HX6A 4QYGA 1SNXA 1YW2A 2V5QA 3BHVA 4A9RA 3DAJA 1XB2B 5AV1A 3ZU7A 4L3LA 3OTUA 3UYSA 4RC4A 5L8LA 1PY5A 1K3AA 1TKIA 2RG5A 1DO2A 5K4JA 2HW7A 3S2PA 4GT4A 3U54A 4H58A 4EC8A 5KUPA 3LCDA 1HJPA 1OKYA 4HVIA 3QTQA 4PPBA 3W8QA 3QUEA 3G15A 4RG0A 4USEA 3I5ZA 3G9NA 4ITJA 2E9UA 3QC4A 4FK3A 1J91A 4DFLA 3KMWA 4AQCA 4WD5A 5JFSA 2O25A 2JBPA 3NCGA 4FG8A 4IAZA 4BDDA 5HLWA 2GFCA 2G1TA 3NYXA 3LCKA 3KK8A 1OPKA 3OS3A 4FL1A 4PDOA 3HEGA 5GIPE 1ZV1A 1WVWA 2JFMA 3WE8A 4B4LA 4AZSA 3UG2A 4HVHA 3A61A 3H3CA 3NUNA 2FSMX 4ZP5A 2W1ZA 4C4GA 1C7YA 2J0KA 5AX3A 1J7IA 4P7EA 4OTFA 1BX6A 3BWFA 4KRCA 4ZZMA 4WUAA 4BF2A 1Z57A 2BTRA 1WBSA
chains in the Genus database with same CATH superfamily
4AT5A 2WTKB 3OBGA 4Y5QA 2W1CA 5AM6A 3RVGA 2ZV2A 4U81A 1PXNA 1FJGM 1CKPA 4AA4A 1XQZA 2ITTA 4HGTA 2OFVA 4ALUA 1QYRA 1SVHA 2JDRA 3SATA 4I23A 4LL0A 2XH9A 2A2AA 2YHVA 4JR7A 4Y95A 4IAKA 3VS4A 1WIVA 2WTKC 5I0BA 4FCTA 4J98A 2Z7SA 1OGUA 2BZIB 3LFBA 2R4JA 3M2WA 5FM2A 4PDYA 3UOKA 5BYLA 4LOOA 4AN3A 4FSYA 1HNWM 1SMHA 3DBCA 3H10A 3EQBA 5DPVA 3WI6A 4DGOA 5LOHA 3FMKA 5DH3A 3TL8A 3OWPA 3W2CA 3FMEA 1Q99A 3U55A 3LCVB 4LF7M 4FT7A 2YLEA 4LV5A 2IW8A 5C26A 4JI6M 1W83A 2HXQA 4JBPA 2QHMA 4R1VA 4YJRA 4E5AX 5FTKA 3IQ7A 3NZ0A 2BIKB 4QMTA 4HGEA 4BDFA 2XKCA 1ZAOA 4E4MA 2UZUE 3F9NA 4IB0A 2G01A 2OJJA 4C38A 4CTCA 3EOCA 3EHAA 3MK6A 2EVAA 2Z8YM 2PL0A 4JI3M 4UMTA 5HNGA 2DAEA 4K0YA 4NEUA 4BIDA 4UN0C 4YUQA 5JGAA 1QZEA 4QYYA 2JDTA 2ITOA 5IA3A 2O01F 3GU6A 4I5HA 5CQUA 4RFZA 2ONLA 4MYGA 4YTHA 4O7SA 2IF8A 4QMWA 3S3IA 3UMWA 2AHMA 2BAQA 4RFMA 5EK7A 4ZJJA 4WOVA 3W0SA 4QPAA 3FEGA 3GP1A 4W9WA 3FRHA 3QA8A 2XYNA 4H36A 4S2ZA 3RALA 2C6KA 2X8EA 2DVWB 2BZJA 3R83A 4TL0A 2CHLA 5HG7A 5E90A 1WBTA 3GLIB 3LCOA 4FIIA 4S32A 4EHEA 4EOJA 2ITVA 2RSVA 3C5UA 1H08A 4C4FA 4DGLC 2WQOA 2CEAA 3EIHA 3QZIA 1WVYA 5AJQA 2DHRA 3H4MA 5KPZA 3JXWA 2W1HA 5JZJA 3LMIA 2O3PA 4BJJA 1P5EA 2L09A 4U9AA 3U5ZB 2JP7A 4I1ZA 4D28A 4JDKA 4GH9A 2O5RA 3SMSA 3K5VA 4R3RA 5CVFA 3T3VA 3PIYA 4BRXA 2RFEA 4MXOA 5H9BA 3OTOM 2C6TA 5DHJA 3BGPA 2VWVA 5C27A 4JIKA 4MXXA 3UNJA 3KF4A 4FSRA 5AR5A 5C8KA 2J51A 5CALA 1JR3D 4Z8XA 3P7CA 3U61B 4BTKA 3FJQE 2VTQA 2C9CA 4IADA 2JY7A 4JJRA 1O6KA 4PTGA 5HD7A 5GZ8A 5JGDA 1JSUA 1FNNA 1GJTA 3QZGA 3KFUG 3AC3A 1V0OA 4MWHA 3ZTXA 5HGIA 4ASDA 5J7BA 1OGYA 2R64A 4Y5HA 3R9HA 3T6PA 3IDCA 3HYHA 3Q5ZA 2BZKB 2LHCA 4LJ6A 4IQ6A 4O91A 4RA4A 2UZTA 5HE3A 5M08A 4FTCA 3RBWA 5HESA 1WBOA 3TZ8A 4G31A 4F1MA 4RWIA 2PVMA 3HV3A 3ZMMA 2EKFA 4M12A 5HO6A 4AXCA 2J0LA 4DBXA 3LOKA 3DS6A 4CMUA 1M52A 1UV5A 2HY0A 4ZZNA 4ZIMA 5M55A 4FIHA 5AAEA 3U9NA 1W7HA 3ORNA 4CCUA 3KP0E 4LCBA 2CP8A 2JBOA 2R3JA 3NAXA 4KKHA 5L2WA 5FQDC 5IMEA 1Q8YA 2PUIA 3QCQA 4BDHA 4DHJA 4HPTE 4RJ8A 5TKDA 3ET7A 4FV4A 5DT0A 4A9TA 2CKPA 3KREA 2XNBA 3UP7A 4MQ2A 1YHVA 3HX3A 2VNWA 3LQ3A 3DXPA 3GU7A 4PY1A 3TE6A 4RF1A 1R2YA 2V0DA 2XAMA 4FSNA 4M14A 4ALVA 4IANA 3P79A 1Z57A 4IBIA 2XK4A 5HTIA 4C7TA 2ITWA 3E3BX 4O27B 3H0YA 4MKCA 4ZY4A 3TQSA 4JI0M 3PIXA 3U6SA 4EJ7A 3A60A 4ACCA 5A54A 4YHHM 2GHGA 3FLSA 5IA0A 3ATTA 2DUVA 5J8IA 1VLRA 5A4LA 2H8HA 2O2UA 3NNUA 4RPVA 2J5YA 4FNYA 4JDIA 4BHZA 2XH5A 1J1BA 1FVVA 3CTHA 4B7HA 5CEMA 2J5EA 5DLSA 1OL2A 1QUSA 3LVWA 1W2FA 4O7ZA 3KY2A 3MY5A 1Y8GA 5EYMA 4GMYA 4NFMA 5CLPA 4GMQA 4AAAA 2ITXA 4IXPA 5CU4A 3QTSA 1IBKM 5E1EA 4FG9A 1JNKA 4O2ZA 5C01A 3EQDA 4IX5A 5AADA 2YIWA 4DR6M 4PPAA 3LVPA 4HYSA 5IUHA 3JR5A 2Y4IB 5M4CA 3TUDA 4FODA 5LVMA 3NFGB 3OTVA 4BHNA 2APLA 3DQWA 1MRYA 2QENA 1W84A 3QZHA 3PA4A 3UPZA 2X8AA 3ORXA 4IX6A 2E5LM 3RM6A 5A6OA 5AEPA 3PG1A 3R8ZA 5LMBA 5GHVA 1XH9A 5EP1A 4HCTA 3AOXA 3DA6A 4XP0A 4YGAA 3R00A 4G6OA 1WBVA 3FAAA 1GNGA 4F1TA 1NVQA 4WNMA 3RNYA 1NJFA 4ITIA 3ZO3A 4RJ6A 3JYAA 5EOBA 5L8KA 2PMOX 3GCPA 2YITA 4LYNA 3UE4A 5KCVA 4BC6A 2DWMA 1ZOGA 4LGHA 2BAJA 2ZMCA 3PE1A 4FCWA 3UVQA 4V04A 5LMKC 4RKUF 4RNAA 1F3MC 3HDMA 5M51A 4RX8A 1EFUB 4RX7A 4EK3A 2Z4RA 2BKKA 2C5YA 5JEBA 2C0OA 2PHKA 1DI9A 3PJCA 4GIIA 4CFXA 4OBPA 2ZTCA 5DYIA 4ZEGA 3BYVA 3VO3A 2YEXA 4A3VB 5LWNA 2VO6A 4BCPA 4DG2E 3TKHA 2Q2EB 3PWDA 3PXFA 4XG6A 1VYWA 4CJ6A 2QR8A 3FZRA 1GZNA 4MGHA 4FUYA 4KBKA 4XH6A 4X3FC 2VAGA 3LW5F 3FMMA 3BL7A 4J1RA 4DG0E 2VQEM 2JGZA 4BDAA 1IASA 3BV3A 3QCXA 1QQWA 5KE0A 3E87A 4FEXA 4IDTA 1JKKA 3CPBA 4U5JA 4DR5M 4AF3A 3CF2A 5KO1A 4X6QC 3QZFA 4CIZA 5JT2A 3L26A 1U46A 5HTBA 3AG9A 5KQ8A 4UMQA 3FHRA 4QMXA 5FRIA 3QAME 3AD5A 3R0TA 2MROB 3RMFA 3DOGA 1Z5AA 4MM3B 4FKVA 3VW6A 1E94E 3K92A 3MDYA 3OCBA 4PX6A 3WYYA 4EI4A 3NUAA 3QYBA 3BBZA 1SNUA 2H6DA 2WKMA 3SXFA 2R3QA 3QXOA 3J27B 3ZSIA 2CNVA 3PDTA 3GBZA 1GY3A 4DFZE 4ZSGA 1OL5A 4YP8A 4IJFA 1ZQ9A 2WTDA 1B6CB 5M06A 1I4WA 4AZEA 2X81A 4YJSA 5DE2A 4FWHA 3TACA 3DZDA 3T9TA 4YZCA 5IQEA 2PTKA 2OQ4A 1SVEA 2XUUA 4U8ZA 5IT9S 1YXVA 1OL7A 1GJSA 4WBOA 3C9PA 4AG6A 3R22A 3QBNA 3UDSA 3WHKA 2O0UA 2XS0A 3EZVA 5AP1A 3OW3A 3J7AS 2VZ6A 2ZAZA 4X2JA 1NV8A 1D0MA 2XFSA 4DBNA 1JLUE 1R4GA 5I4NA 2UU9M 2JY5A 1XO2B 1XBCA 1NY3A 4FTTA 2HELA 4R8QA 2WU6A 4UY9A 3WHLA 2QO7A 1QCFA 4RLKA 1A5TA 3FLQA 1WGLA 1QPEA 4NSRA 3ACKA 4JL9A 1JWHA 4G5PA 3MH3A 4I20A 5IA1A 4EOLA 4YLJA 3R7VA 4QQCA 2JZ0A 2GU8A 2GNGA 4QMVA 4FV7A 3HRBA 1ZAEA 2BJVA 2EA0A 3O8UA 3R63A 4P90A 2C6EA 2WO6A 2PPQA 2H1RA 1M2QA 4DV3M 3RP9A 2LVNC 4FSMA 4M66A 4EK8A 3IW4A 3H30A 5GJGA 3VNTA 4V0GA 4YHFA 3LPBA 4L9IA 3VIDA 1XC8A 3TDWA 3LCUA 1JKSA 2IN6A 2QU5A 4I5CA 4MF0A 5DYJA 1JQHA 3O7LD 4I81A 5ANKA 4BB4A 4E6QA 1BI8A 2PU8A 1V0BA 2VWWA 3W2PA 3BCEA 3UIMA 3JVRA 3C5IA 5CU6A 3VW8A 3HV4A 4WIHA 3A46A 1SXJC 3RHKA 1CKJA 2FH9A 2BCJA 3EKKA 3H9OA 2JIIA 3PZEA 2P4IA 3JVSA 2F49A 2PZIA 3MIAA 2IVTA 4TNDA 4TYHA 1G8JA 3WF6A 1R2ZA 3EQRA 4E3CA 2UV2A 5L4QA 3TPZA 4IWDA 4G3CA 5EI6A 2VGPA 3TCPA 3KFAA 2WMAA 5LARA 5FTMA 1TQPA 5E8TA 1ATPE 3O23A 3Q4CA 2XK6A 4FKWA 3WZJA 4EZ3A 3UOJA 4Q7JA 2GMXA 1J1CA 2CKQA 4PT5A 3C9WA 2EU9A 2BRGA 1TH4A 2FVDA 2HENA 3KQ7A 2LVAA 4F7SA 1L8TA 5IQHA 3DA1A 2J0JA 3EQPA 5HU9A 4HL4A 5KPTA 1IBLM 1Q8UA 3GQ4A 2F7ZE 2ZM6M 3E3PA 3IGOA 4IFCA 3R7EA 4KBAA 1YI3A 3IG8A 4NU1A 2ZANA 4FVPA 3QRTA 4OTQA 4AN2A 4AW0A 5FDPA 5HNIX 2G15A 3ORTA 4DEGA 1XMOM 4F4PA 4O4EA 5GJFA 5GINE 5CSXA 3G5DA 5IDNA 2X9FA 2UVZA 5FM3A 5I9VA 4U45A 3R9DA 3Q96A 3M0EA 3K5UA 1OITA 2I0EA 3ORLA 3MVLA 3O96A 4MX9A 3R8LA 5HX8A 5DNRA 1JOWB 3ZO4A 2L4FA 1ERKA 1TFFA 4NM5A 3NRMA 3ZQJA 3W16A 4IVAA 3W2RA 4L78A 3UIXA 2VO7A 3SKCA 1J7UA 2LVPC 3DDPA 3TJCA 4FKOA 2EO2A 3TI1A 4FBXA 3ATSA 1YRPA 4TKSA 2VTOA 4Z6YA 4JX7A 2DZNB 3CTJA 2LXEA 1GLNA 1PXMA 2ZOQA 3HGIA 3Q2JA 4IBGA 2FSLX 5EQTA 4X7QA 3IKAA 4L45A 3AL0C 4NXMM 5E26A 3CLYA 3EZRA 4LMUA 5J5SA 2R44A 2XB7A 5HCYA 1MRUA 5FLFA 1T46A 3R01A 2CHVA 4B3SM 2X0QA 4IM0A 1LV7A 4NWMA 3J2PB 2HZIA 3D9VA 2Z7LA 4XLVA 5AUYA 3U6IA 5ANIA 3DPKA 4GFOA 3V5JA 1PF8A 1FINA 2X4FA 3QHRA 3QTXA 4FZDB 1Q39A 1TR8A 2EXEA 2ZM1A 5EKOA 2WIPA 1ZLTA 3GQ5A 4KD1A 1S3SA 4ZTLA 2LVQD 3KA0A 3NPCA 3VS1A 3QLFA 3LW0A 5L6OA 2FE8A 2RRUA 2BHHA 3DLSA 4TTHB 3CF0A 3LMMA 1Z59A 4EIWA 2PZPA 5EP4A 3CKXA 3MH2A 4U42A 3POOA 1PXIA 4JOAA 3RPRA 2ETMA 4H1JA 3RI1A 2CV1A 1R0EA 3PFIA 4DR2M 2UW4A 3WYXA 3DBDA 4TYHB 3BI6A 3MHVC 1JAMA 3PVUA 4X2FA 3SHEA 4IB3A 3EFLA 5AMNA 3N4VA 1E9SA 4K2RA 3GLFB 5L2TA 3BRBA 5CEPA 5HBJA 4AXDA 4JMQA 5CTPA 3OFMA 5KBQA 2ITUA 2W06A 3NUUA 4RA5A 1OPJA 4AE9A 4YJVA 4E6CA 5EM6A 2WHBA 5LVNA 4L3JA 5LXMA 5M09A 1B38A 1SVGA 4YBKA 5A4QA 3TN8A 4D5KA 2YM5A 3FSKA 4P2KA 3QFVA 4BCIA 4U44A 3MESA 2WIHA 4TXCA 2MGWA 4LGYA 2CGXA 5CF6A 3GQIA 1XH6A 2O65A 3KCFA 1VQ1A 3P5JC 5BVFA 3N4UA 3W0OA 2I0VA 4JQ8A 1L2BA 1D0KA 1YVJA 3HUCA 5EXTA 4S12A 2VTSA 1P3QQ 1Q3CA 4RIOA 3VBXA 2X6DA 3IO7A 4O0WA 4GK2A 3GQLA 5CQWA 3C50A 3CKWA 5ITRA 4AKGA 3R8VA 4BDIA 5F95A 4CFMA 2PUNA 4ZXTA 5FTLA 5KMOA 1IRKA 2OXXA 3U60A 4AZFA 2KHHA 1M2PA 8CATA 3CJFA 3CXWA 4C3FA 4A7CA 3EWHA 3LMHA 4L16A 3MY0A 4RLLA 4LZJA 3VRYA 1XNRM 4Y72A 3ZBXA 4EOPA 4ERKA 1U5QA 5LMNM 3MN3A 1YDSE 2RF9A 3GI3A 5IEXA 4F64A 4BB9A 3KRLA 4FVMA 4D82A 4RT7A 3F5GA 5LMAA 5AP2A 4GYGA 1NVSA 5FXQA 5JI3E 3ZFYA 4AP7A 3HLLA 1PYXA 1FGIA 4C4EA 4M15A 2PE2A 4DEHA 4YURA 3MA6A 3OVVA 5L2IA 2BR1A 1XXHE 3AC4A 3B7QA 4GKIA 3HJSA 1L2CA 3GPPA 2QLQA 3HP2A 4HCUA 2XIRA 3UC4A 2VTHA 3LE6A 2VQFM 4E6AA 5LVOA 3BELA 5EM5A 4KLNA 4FTKA 4ASXA 2UVXA 1AQ1A 3RAKA 3FTCA 4WT6A 1M17A 2QBYB 2CLXA 3KXEC 2YQZA 5AR3A 3TG1A 4KODA 4XLIA 4D2TA 5IISA 3NGAA 2OF4A 4O0YA 5FEDA 3V8WA 2C6DA 4EH9A 2C1AA 3H9FA 3L9MA 2W1IA 3JUHA 2G9XA 2IVUA 2XIYA 3U6EA 3D7ZA 3HDNA 1HQCA 3BEAA 4FVRA 4IBBA 2IZRA 3Q8GA 2JIUA 4CGYB 1Z5BA 2VUWA 3W8LA 4AGUA 4R5YA 3PLAE 1NHGC 2VV9A 4CD0A 4RF0A 5IQIA 1PXOA 4RWJA 5E8UA 5A46A 1KUTA 4ZAUA 3B7NA 3KF7A 4LUEA 4FL3A 5BYZA 1EH4A 3D5WA 4H3QA 2Z8CA 5FEQA 5BPYA 4I41A 3EL7A 4LRTA 4LL5A 3R71A 4EH2A 5DFPA 4PL3A 3ILKA 1MU5A 3M42A 1DV0A 4P5QA 4MVFA 4JQEA 4GC5A 4U0IA 2YA9A 1ZY4A 4BGGA 4EJNA 4F6UA 3QAUA 1LR4A 3FZOA 3HP5A 2NRYA 1N75A 5JI2E 3WOWA 3I51A 4ZSAA 3C13A 3MWUA 4EHVA 3UDTA 4ACGA 3I04M 4YC6A 1GZ8A 4L4UA 3I81A 3CEKA 3UGJA 4NSTA 4O0VA 2CE7A 2OOBA 3HU3A 4LJ9A 3E92A 4FIGA 5HIBA 3DBFA 4QDEA 4LI5A 5KZ0A 2QR7A 3HAVA 2QQ8A 1Z5MA 2CWBA 2ETRA 1N34M 4AOIA 3TYKA 3V01A 1DO0A 3QALE 5GZAA 4J53A 3ZZEA 3W68A 4K0KM 5HCZA 4CKJA 2GTNA 2HZ4A 2ZDUA 3LXKA 4TT7A 4EH6A 2R3GA 4MHAA 5KMNA 4WURA 4RQVA 3KKVA 4J8NA 4D1XA 4IM3A 2LAVA 1W0XC 5A2QS 1R6BX 3VS2A 2GNHA 4L8MA 4Y85A 1S9IA 3EKNA 5J7HA 1F0QA 5BVKA 5AR8A 3SHGB 3VQHA 3PP0A 3O5AA 1YXXA 3L8PA 4AOTA 4JI1M 3DKFA 4F6SA 3Q6UA 2QOHA 2UW6A 2CSNA 2ZB0A 3OUNB 4BI0A 4B99A 2ACXA 2C9OA 1UKHA 3COKA 3OCTA 4UXLA 3S4QA 2HWOA 4DYMA 4O7WA 4KSPA 4OW8A 3BLAA 4K18A 1ZRZA 1QANA 2L4EA 5ETIA 3VUDA 3CGFA 5A14A 3K1JA 3T1YM 3MTFA 2XSZA 3NW5A 5CI6A 4DBGB 4LJ8A 1QDRA 4GG7A 3R04A 4FZFB 3VN9A 4EYMA 4EWHA 2YFXA 1G8PA 3V76A 4PL4A 3Q04A 1ZMVA 3QX4A 2HZNA 4K6ZA 3IS5A 3IOKA 3W2SA 3TNHA 2H96A 3CY3A 4OT5A 1V1KA 3DKGA 4Z16A 3G0FA 2I7PA 1PXLA 3DKOA 2BPMA 4NJ3A 5AUVA 5H37D 1KOBA 3FKOA 2OJFE 4M13A 1HCLA 4DTAA 4P16A 3K3JA 2FSTX 3CTQA 1FVTA 3PXYA 2AC5A 1TF0B 3FUXA 5ITYA 3KB7A 1YWVA 2FH0A 4O0RA 4QTBA 4UMUA 2UZWE 2YERA 1ZOHA 3KOWE 5FLXS 3UO6A 4QNAA 1G5SA 4BCGA 4LJAA 3L9LA 2BWBA 3DK3A 3RJCA 2VX0A 3W2OA 3ZFMA 4BL1A 3R2YA 5ETCA 2DZLA 4L6V6 3WBLA 2D7GA 4FKIA 4X62M 3RZBA 4FTMA 4W4YA 2LGCA 4HPUE 4IB5A 3AKZA 5LMUM 3PNYA 2QODA 4KIQA 4XHKB 3C4ZA 3K3IA 2KRUA 4Y83A 5ANOA 4F99A 3B89A 3RGSA 2YM6A 4GH2A 4O7VA 2B9JA 1P14A 2Q83A 1I09A 1YDTE 2F9GA 3QXPA 4YSMA 4ANQA 2OOAA 5C4KA 3M7GA 4PWNA 2RKUA 4FWDA 2CHGA 2WPAA 1QDTA 3DCVA 2VWXA 4PL5A 1Q3WA 2GS7A 4I8OA 4HNIA 4XG8A 3FWQA 1TDHA 2DYLA 3Q4UA 4EZ7A 3B8QA 3BYUA 4FKQA 4O83A 4HVDA 4CG8A 3D5UA 5CEIA 1PJKA 3KW6A 1AUAA 1U54B 2BIYA 2UW0A 4A06A 4G3GA 2DWLA 2L6OA 2ZVAA 4QTAA 4RBLA 4BTMA 5FXRA 5A6NA 3W0QA 2N35A 3D83A 5ANGA 2B53A 2QZ4A 4IJEA 2VD5A 3U4UA 3PY0A 4UB7A 4Z55A 2HXLA 3F7ZA 2XVDA 3AGLA 4X3FB 4OAUC 3NVMB 2YCFA 4R3DA 4RX9A 3TJDA 2HIWA 5AA9A 5AP3A 1REJA 3LFEA 4AXEA 1Y6BA 2YM7A 4K1BA 3QKKA 3A7GA 1VDDA 4KIKA 3VBYA 2ETKA 1JSVA 2X2LA 3UMXA 2FO0A 4TY1A 2OZAA 3AXWA 2HWJA 3MJ1A 4BLCA 2O5KA 2VTIA 4A9UA 3N51A 2P2HA 4MBLA 3ANQA 2GHLA 2XK7A 2PVNA 3SAUA 4GK4A 4FW9A 3LFCA 2XYUA 4NRWA 5EYKA 3SDJA 4BYJA 2JWSA 4D0WA 4JRNA 5JZNA 1C1KA 1J09A 3R8FA 3LAUA 3R6XA 4QMMA 1IY1A 3AKKA 4GT3A 4H3BA 3UBDA 1HNXM 1W2CA 3MW1A 3PPKA 4RJ5A 3RAWA 3SRVA 4CT1A 3HNGA 2QO2A 3SMPA 4TZRA 4LUDA 5CEOA 5J9LA 5DR9A 1OVEA 4YLKA 1RU3A 4I6HA 4QYFA 3V5LA 1MX0A 3LLTA 2OPFA 3NLBA 1YSYA 3CQEA 3GC0A 4I5PA 4TW9A 5FDXA 4F7LA 3HHYA 2HL7A 3QUDA 2MR9A 1FGKA 2R3HA 2UXBM 3F5UA 4X2GA 2XARA 2IJMA 3B8RA 3I0QA 5DOSA 5GIOE 1NV9A 4JT3A 1E9RA 3FYJX 4GVAA 2XEPA 1OIYA 1V0PA 5IQGA 1L3RE 2W1EA 5JSMA 3OT3A 3ZH9B 4KT0F 2WTVA 5C8MA 3KULA 3PXZA 3ERKA 1ZMWA 4I0SA 2A19B 1G41A 4G16A 3TT0A 1WHCA 4FIFA 3ZH8A 1N78A 1KE7A 2VTAA 3FZ1A 4QP9A 5AFVA 2A0CX 4LRJA 4JDJA 4GKHA 2E9PA 2XEYA 2YAAA 3CCNA 1R7RA 4X64M 1VEBA 3FC2A 3QQUA 4C36A 2WFYA 4FVQA 1TGUA 5FTOA 1BL6A 2Y0TA 3A4PA 1OKWA 3EQHA 2O63A 4PUZA 2Y21A 5T6KA 4AT3A 3AMAA 3WZUA 5BVNA 4DFYA 1GIIA 1FQ1B 4F6WA 4X6RA 4D9UA 5M56A 4NK9A 4DG3E 1T6OA 2BDWA 3WE4A 5DI1A 1WGNA 3RAIA 3A99A 3QRKA 3VBQA 3HHXA 2XRWA 3PVBA 2JKQA 4UWCA 3MMPA 2J0MB 2V7OA 3Q4ZA 5ETAA 3TZ7A 2WMXA 1IR3A 3MFTA 4O0SA 3GVUA 1X8BA 4P4CA 4IAIA 3B9PA 4RJ4A 2R62A 1ZWSA 4DV0M 3MY1A 3UG1A 5CT0A 1DGHB 2YZLA 2GNLA 2ITQA 3DAKA 3UJNA 2YM8A 5AUXA 5JQ5A 5M57A 2YCSA 2QCSA 3R28A 4QMZA 3G90X 2CLQA 3RFWA 3HECA 4R7IA 5FWKK 3V6SA 5AUTA 3POZA 3GRVA 5LJJA 3LJ2A 3I7BA 2JNHA 4FICA 4XV9A 1PJSA 4YPSA 2R7BA 3CJGA 4II7A 5EXSA 3BLQA 4AFJA 5BV3A 1PM5A 2BDJA 5IWAM 2ERZE 1ZYSA 4IZ5A 3BV2A 2OH4A 2W1FA 4XNEA 3VUTA 4ZS4A 1Y6AA 5FBOA 5BR8M 4L15A 3P5KA 4G6LA 3B7ZA 3OZ6A 1DM2A 4EQUA 4D2WA 3FXWA 2XF3A 3HV7A 4J95A 3QRIA 4PQNA 4XEYA 4B8LA 1O6LA 5B2LA 5K9IA 4FV0A 5CSWA 2C5OA 2FUMA 5AR4A 5KMJA 3A7IA 3EN4A 1WJ7A 3FYDA 2AUHA 3U6PA 5HLNA 2FB8A 4CXAA 3R73A 1N32M 4X0MA 2QG7A 1Y91A 2J7NA 5EJCA 2DXIA 3PJ3A 3Q9XA 2GQSA 2BDFA 3KXGA 4E20A 2XK9A 3OOGA 4MD9E 3O51A 1NA7A 4UEUA 4JBOA 4EKKA 4NL0A 1XMLA 1BKXA 2A1AB 2RIOA 2RGPA 3KXHA 4I92A 4IWPA 2R3KA 4QMLA 5K3YA 1QPJA 2UZOA 1UU9A 4A9SA 3UZTA 2CJMA 1F5QA 2I7QA 5DBXA 5EXPA 4DT8A 3VF8A 5IF1A 3MB6A 1P2AA 1LP4A 1WBNA 3AD6A 4J99A 2CFOA 4UN2B 4YHJA 1FVRA 3BE2A 4D58A 4CV8A 1QL6A 4EH3A 2A98A 1PJQA 3TM0A 4M68A 4O84A 5ICPA 3DK6A 3LJ1A 3NUYA 4MBIA 5DT4A 3Q4TA 3DV3A 4ITQA 3A45A 2X2MA 3RGPA 1WXQA 2QOKA 2ZBKB 1V92A 1QPDA 2EB2A 3A7HA 2Z4SA 2KDLA 4D81A 4QP8A 5DR6A 2R3OA 1KE8A 3UYTA 3W33A 5AR2A 3FL5A 3OY3A 2QOQA 1IN6A 1TDZA 4MBJA 4XBRA 4Z9LA 1WBWA 5AP0A 3UODA 2LH0A 4XBUA 4NJDA 2DHYA 4FSWA 2G3QA 3U6CA 3FMLA 4FUXA 3KVXA 3NUXA 3QTUA 2X8DA 4FMQA 4TWCA 4QP1A 5CYIA 4LFAM 4BWKA 5A4TA 3SVVA 3G9LX