2L6OA

Nmr structure of the protein yp_926445.1 from shewanella amazonensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MGAGQTPHPQLIWPALLKQQGCNELLPLRTNDDWQRFCADSKHLLQYGDKLVDSNFHCFVLEEDAHWHPAAPLPPEGLNDLIRAHCATLGHCCTSKMHLHSVMDAIDFLNALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein YP_926445.1
publication title NMR structure of the protein YP_926445.1 from Shewanella Amazonensis
rcsb
source organism Shewanella amazonensis
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13642 DUF4144 protein structure with unknown function
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.650 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l6oA02
2.40.10.320 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2l6oA01
2L6OA
chains in the Genus database with same CATH superfamily
1AIXH 3P8FA 1FAKH 2WUCA 3QGNB 1R2YA 8KME2 3ELAH 1IY0A 1XUIA 5HM9A 3GLHB 3SYKA 1UVOA 2F9UA 3BTHE 3HATH 4NGAH 1XC8A 2FO9A 4QT8C 1W5SA 1QQWA 2M5TA 2V35A 3U6QA 1QZMA 1IBMM 3HZJA 2VDBB 1D3TB 4LF7M 1UCYH 2GCTB 1HAVB 2ZBKB 3U6PA 1SQTA 2BDBA 1DWEH 2JXNA 4LJ6A 3A8DA 5KPZA 5FHTA 1CHOF 2HWLB 1ZMWA 4GMQA 4WF8A 5GJ4B 4I8LA 1FXYA 2ZZUH 5L2ZH 3T6PA 3STJA 1IQMA 1IFYA 2IJD1 2O8MA 5FBEA 1JBUH 4NSRA 2ZHDA 1ZOMA 1V2MT 1Z5CA 1AWFH 3GLHE 1A5HA 1ZRKA 1GJAB 3SJ9A 1AGJA 1TBRH 1O2RA 2WYJA 2J98B 4ABBA 5JYIA 1Z59A 4K1SA 2V0BA 3KVWA 1HJ9A 1EOLA 1GCDA 5EP3A 2G51A 2DZNB 4ZHAA 2XOKD 3SGQE 1A4WH 1BJUA 1FI8A 1D0MA 1Z7KA 1E34B 2UUKB 2SGDE 4ZXYH 2R0IA 3D8BA 1IBKM 1K1PA 1OWDA 1COWD 2Y21A 2P3FH 2ZCHP 1GL6A 2F4VM 1GGDB 1HFDA 4MGKE 1X37A 3QYEA 1TPPA 2V7QD 3VKGA 3ATKA 3QTVH 3PLBA 1L2BA 1D3DB 2GNOA 4WXIA 1FLEE 1B0FA 2FYRA 2KCYA 3RC5A 1EAUA 4JYUH 3HHZA 4MQAA 2CHVA 3RDZA 3FAOA 2HCBA 3AK5A 1HIAA 2DWZB 1SGTA 3AKZA 4NWKA 1NRSH 2VWLA 3I4VA 5DP7A 3HGIA 1E1RD 5J4SA 4K3JA 4PCZA 3BBZA 4GAWA 4B2CA 4AFZA 3SNBA 2EO2A 1ZMJA 1F0UA 3J7BA 1HYLA 1N8OC 1W0ZU 4I32A 4JI0M 1Z1IA 2XBYA 1YPEH 1MD8A 2Y7XA 1GL0E 5E8EH 5EW1H 2ZU4A 1E9SA 5JBBS 1SGFA 1XMNB 3C1KA 4GC5A 3RXPA 3VEQB 4LJ4A 2ZAMA 4B3SM 3BG4C 2GQFA 5EP2A 3AW1A 1LVMA 1ZGVA 3KQBA 1WHCA 4K0KM 1FUJA 3H4JA 5FCKA 3C27B 3O8RA 4DY7B 4FUFA 1V2UT 2OK5A 2NQ8C 2XZUA 1LVBA 3TWLA 4DR7M 1ESTA 2FLRH 3QN7A 3VK7A 1NV8A 1IQIA 1FNNA 1TRMA 2W82A 1N34M 4NSOB 3L2AA 1WDIA 2QBYA 1GHBG 4IN2A 2J97A 1BRBE 1JWTA 4X8SH 1AVXA 1TABE 4CIZA 1V2VT 4L8RC 1P01A 3B74A 1SI5H 1QAOA 3SUGA 3A86A 4TSFD 2F9BH 3LPRA 3B9PA 3IG6B 2CE7A 4TPYA 5A0CA 3FUTA 2ZCLP 1THSH 3KDSE 3AOGA 1AKSB 2R6FA 8GCHG 2PFEA 1LMWB 1BBRE 1OAIA 1K1JA 3ZH9B 1GDNA 1SR5C 1O5FH 3C58A 3MHVC 2FOIC 1E94E 2WSCF 1L1GA 1CA8B 3M61U 5KPTA 3MU1A 4AYVB 5LPRA 1E37B 3NCLA 2BNKA 4LJ9A 4JK6A 5KEDA 8CATA 1EAIA 1PPCE 4WMEA 2OINA 2R9PA 1O5AB 2A2XH 2LNHC 1NU7B 4K5ZA 4G3OA 2DWNA 3GRRA 3TH2H 1IAUA 1QRWA 4LRSA 5EG4A 1BCUH 5FAHA 3R9XB 4K60A 1O3LA 3MK6A 1SGEE 1GJ4H 4LOYH 4JI3M 1G59A 4X2XA 1QJ6B 2VIOA 3T38A 2Z7JA 5BPVA 3KEEA 3KGPA 4RSPA 2Z6BD 3S69A 1QQUA 3TLOA 3VFDA 4KODA 1BMNH 4AG6A 4YLUA 1BTHH 1P2JA 3CENA 1O2XA 2XYAA 3RXTA 2A31A 5EU8A 2J95A 3UNSA 2XSZD 1N8OB 4IBGA 2XC0A 3DA1A 1WBGB 2D7HA 4AI6A 3U6CA 1G30B 5DJ7A 1C5TA 1O2YA 3TJVA 3CS0A 3T28A 4K69A 3SMSA 1FIZA 1MN3A 2QCYA 4DV3M 1EQ9A 4E7RG 3F9HA 2EKKA 1PPBH 1P9UA 4QNMA 1UM8A 1KXEA 4MGIE 4JYAM 2CV3A 1TBQH 4B08A 3CNRA 2FOGA 3LT3A 4BNRA 4Z6AH 3A80A 2P59A 1DUEA 4L4UA 3E9SA 4DV4M 4LF4M 1I4WA 4RT1A 1FDPA 5ITTA 2F5PA 4ABGA 8ESTE 4I7YH 3RXHA 3GY6A 3U6MA 5EW2H 2C99A 1NRPH 3BXWA 2I6QA 4FUCA 3THGA 2Z7FE 1BUIA 2BDAA 4PDIA 3F1SB 5CMXH 2DNAA 2FODA 2LVQD 1BTWA 5KPRA 1HXEH 1N77A 4DCDA 4KTUA 3FRIA 5EJLA 3RXQA 5JDUB 3SBJA 3T1HM 1XKBC 2H9HA 4HI3A 3LVWA 3TPIZ 3UY9A 2XF3A 4DT4A 3MU5A 4II7A 1C5NH 4AG1A 4J2YB 4K2YA 1UHBB 2UXBM 2R65A 1KLJH 4MNVA 1G4AE 4WMDA 2KFWA 1LTOA 2LPRA 1MJGM 4X1QU 3SU1A 1BTUA 2PHBA 3AASA 1C1OA 2CXVA 1Q3CA 1YPHC 3N99A 3W0LB 2FOCA 2QXGA 3FKEA 1O2NA 2ZNKH 1OQYA 3LONA 1QUSA 4JZDH 2J98A 5ESBA 3EE0B 5C5NA 3R0FA 4PT5A 4IBFA 2R18A 3JR5A 3PMHB 4ABFA 3KP0E 3GPXA 2PW8H 5CE1A 1MKWK 3GDSA 3FYCA 1QB9A 4G4RA 1U6QA 4SGAE 5DKMA 1BRUP 4X8TH 4Y76A 3MTYA 4I4LA 1KTTB 1NROH 1S0RA 2HOBA 5TCAA 5E2OA 2O5RA 1T32A 1QQ4A 3A82A 3GQ4A 4OGYA 2ZTYA 2OQUA 1XXHB 1BVSA 4INLA 4XBCA 2P8OB 4Q7ZA 3ZZBA 5JB8S 1O3NA 1SMFE 2P16A 4A92A 4ZH8A 2FM2A 1GBLA 1O3IA 1HAOH 1GBTA 3M7UA 1C5RA 1OWJA 2HLCA 4XSKU 5BPEA 5K0HA 2VBCA 2GJGA 2ZTDA 4B2BA 5C3NA 1WXRA 1AI8H 4M0DA 3RC4A 3ZZDA 1PGYA 1GHBF 1LHEH 2L4FA 2FESH 1D4PB 2SNWA 3OTPA 4EIWA 1KYIA 2JZ1A 3J81S 1M9UA 2AFQB 2BQWB 3F3BA 1XXHE 1HNZM 4I8KA 3A8AA 1WR1B 3GRUA 1JMOH 2ALPA 3TK6A 3U61B 3PYHA 1OS8A 2PGQB 1O3GA 3SHGB 1NC6A 1K1IA 4RKJB 1PM5A 4OGXA 2C9CA 1GBBA 2SGEE 1NY6A 1PRBA 3K8ZA 2BXTH 2A45B 1LQEA 1E36B 5CHBA 1EP6A 2B7DH 3SI4H 5J4QA 3RLYH 4BANB 1VITG 1O3BA 8GCHF 1YKTA 4IBDA 3EAJA 3K6YA 1QL8A 3U60B 3HJ8A 3I51A 1HNEE 1QGFA 3N7DA 2J9NA 1RRKA 2BD2A 3RXAA 3SNCA 1NM6A 2A7HA 2CJIA 3EQ0H 2KNZA 3LGIA 3PV5A 2ZDNA 3VPKA 4OU7A 5E6JA 1GJ8B 1TH2A 1L8QA 1BTYA 2SNVA 2VIWA 2KW0A 1TBZH 3MU4A 3SGAE 2ZFFH 4LFCM 1HPGA 2BVSH 1V2KT 1SXJE 2FX4A 3UWIA 4GIPA 3U5ZA 1TA2A 1YCPM 4AYYB 4LFBM 2AGIX 2FPZA 3ATLA 5A8ZA 3PFIA 3I29A 4M7GA 1LHGH 2WSFF 4AFQA 1TMUH 3PNVA 1DDJA 1BMLA 1NESE 1Q3XA 3OU0A 2QP9X 1WCZA 2ZECA 1KLTA 1AIPC 1EFRD 5FTLA 1AQ7A 1GBHA 1Q31A 1Z1JA 3AVZA 1CHGA 5FL7D 3SYJA 1GKIA 2SGAA 1L2EA 2PUXB 1VQ1A 1IQEA 1OP2A 2AIPA 1EXFA 1Y59T 2BDYA 3ZVDA 1MTNC 1HQCA 2AEIH 5C0UA 4UD9H 2Z3EA 1SLXB 2G4UA 3RXUA 1V2QT 2BOKA 3S7KB 1SGPE 2JETC 2EI6A 2B8OH 3IWMA 4IMZA 4B75A 4NIYA 1Y3UA 5L8RF 4BAKB 1LPGB 4G4QA 4JI7M 1F0RA 3FD9A 1FY3A 3SAWA 1HJPA 3F9GA 4B7GA 1SGIB 1YPHE 1O31A 2RRUA 2QF3A 2XFSA 2OBQA 2O9QA 1O5CB 2ZTZA 3OY6U 3W95A 4B74A 2BYAX 5BR8M 2QF5A 1TGUA 2V6ZM 4B3MM 1T4VH 3B9FH 1T31A 1YM0A 1XUGA 4M0WA 1EJMA 1YPGH 4JV5M 1EATA 1GBCA 5F53A 1TNLA 1FIWA 3LGUA 1DLKB 2TGDA 1P12E 1FMGA 2FMJA 2F5QA 4AKGA 2UUFB 4JXJA 3BTTE 4B2AA 4CRCA 3B8JA 4Y7AA 1YUBA 4O97A 3E91A 4YM9A 4F4OC 1SFQB 5A2MH 2FH0A 1DO0A 5ESTE 4HLQA 4THNH 4IC6A 4ZKNU 2A1DB 3K2LA 5EODA 1TNJA 1SGDE 1TOMH 4XOJA 5DP8A 2WSEF 4FWGA 1P2OA 2J94A 2F5NA 1L4ZA 1O36A 2ZFTA 4GVUA 3L27A 1QAMA 1MTSA 4GSOA 4OM9A 4X2YA 1LKAA 4AC9A 1A61H 1GHAG 1NRQH 3GDUA 3KHVA 3BEFB 1C2IA 4IC5A 4WWYA 4DW2U 1PJJA 3TU7H 1NY5A 4NIXA 1TALA 1OTRA 4NA9H 1O2TA 2WPDD 4MGYE 1O5GH 1P9SA 2TGPZ 4F55A 2UUYA 5I25A 1GPZA 2ZHEH 4B1TA 2BVRH 1IM2A 1KXCA 2HGTH 2ZGCA 4XRNA 2ZC9H 3EDXB 3U8RH 3ZCBB 4DJZB 1V2LT 1OFIA 3SUFA 1DWCH 1P2NA 2AHMA 1HB0B 4P00A 1PJTA 1AB9B 3T29A 4D9RA 1NV9A 1QIXB 1GBKA 1Q02A 4AW4A 2ZGHA 4MTBA 4Y11E 1WTHD 3FE3A 3SJIA 1JR3D 2EKFA 3E21A 4NSYA 2ODPA 4NZLA 1PPGE 2VIIA 2WPIS 2GV7A 4KLNA 2QXJA 1G3CA 5DNYA 1V6DA 5K7RA 3RXJA 1PQ7A 5DP6A 1OSSA 1OYQA 1F0SA 3M35A 5DP3A 7KMEH 2ZO3H 5AVDA 3IG8A 4HGCA 3FTCA 1GL1A 1O5EH 4TPIZ 1MMJN 1UHBA 3DSPA 3PMJA 3STIA 1C2DA 1LVYA 1OIZA 1TF0B 1SGFG 1YY3A 1O2JA 1MD7A 3GCOA 5TCCA 2K9DA 2R3UA 4R71A 1MKXH 4GCHG 1DGFA 3WW7A 5IDKA 2HNTC 1NS3A 1G2LA 4I8JA 2CFOA 1EOJA 3NZIA 5C0TA 2WUBA 3D8LA 1WIVA 4Z6YA 1ESBA 3LQQA 3WY8A 4AX9H 3MFJA 1PYTD 4GKJM 3GCHB 4DBGB 1Y5UT 1ZHPA 1TR8A 1HXFH 3MH5A 4SGBE 1ELBA 1W14U 1X7AC 2QBYB 5FPTA 1GI2A 3KOZE 2XRCA 2ZTXA 4LZJA 1GJBB 1VITF 3U6OA 3H7OA 3NXPA 3SU0A 1DSUA 3SV6A 3NK8A 3TK5A 4Y8YA 4AG2A 1K82A 1NTPA 4IIWA 2BD3A 2ZU5A 5EXPA 2QF4A 3LU9B 3ZVEA 2MJ5B 3L3TA 1R4GA 3GLFA 1ZMLA 5E0HA 5FTMA 3OEHD 4NIVA 4B71A 2W7SA 1MABB 4JYTA 3VB4A 3P17H 1A3BH 1C1SA 3ZZ7A 1RS0A 2J7OA 1MU8B 2WZQA 3OX7U 3PV2A 1UFZA 1O3EA 2WHXA 4NA8A 4Z1MD 3A46A 1OIPA 1C2HA 3PO1C 1INCA 3SAUA 1KXFA 3FKSD 1GHYH 4Q7JA 1C2JA 2JUJA 2ZHQH 1TMTH 6ESTA 5GKNA 3MJ5A 3A7WA 3F0OA 2WYGA 1RJXB 4JI8M 1XUJA 2FYQA 1RTLA 4YESB 2C96A 1BRCE 1SGCA 3FZDA 1VCWA 2AYWA 1SQAA 1ESAA 4I86A 3LMMA 1ZTLA 2BLOA 2WV9A 3QUMP 4MNYA 1T8MA 4FETA 1HAIH 1GG6C 3ZYEA 3U60A 3SATA 4OS1A 1ZPBA 1B5GH 2Y82A 1WYKA 3L28A 4UONA 3KXEC 5LGOA 2KRUA 3FZZA 1T8OA 1K22H 1UTQA 4A1XA 2JH6D 1OAOC 4BAMB 2YQZA 2VINA 3A7VA 5EQRA 2G5VA 2JH0D 2QN5T 3W68A 1SHYA 1NBME 1RFNA 1QRXA 1O3PB 1O2GH 4CBOA 4NRVA 3MO3A 1WOFA 4LFAM 1IXRC 3RMNH 3BOSA 2PKAB 2M60A 2TGAA 1TRYA 3TIUA 1ZSLA 2R46A 1S6FA 1QBOA 4XFQA 2K8IA 1TYNA 4BAHB 3FOAA 2CV0A 3SBKA 2OOAA 2BHGA 1C2KA 3MNBA 6CHAB 2KCPA 1B7XB 4LJ8A 2R45A 1DSTA 1O2ZA 2VIDA 2XW9A 2GT8A 2VVCA 3DUXH 2C3SA 3GY7A 2P95A 3UUZA 4A6LA 3RP2A 5KECA 4RNAA 2FI3E 2KCOA 1NO1A 2ALVA 1A5TA 2XWAA 3HU3A 1S85A 2ZM6M 2JDID 1MTUA 3K1JA 4J1YA 5HKKD 1C2GA 5EXNA 1YF4A 2B0FA 1GHAF 3A85A 2F9OA 5IYTA 3SV2H 1L2DA 4NZQA 1GI5A 3KW6A 1SBWA 1EX3A 2DWMA 3ATIA 4LZ4B 2B5TB 3A87A 5GIBA 1GABA 1C5LH 1W7XH 3FUUA 1C5VA 2YMSB 2HNTE 4A5TS 3M0EA 1K21H 2VWMA 3A7TA 4AZFA 5DSFA 3KP1E 3ZZ3A 1BMFD 3RLWH 2RA0A 1GJ7B 1L1TA 3SV7A 2STAE 1ZQ9A 2BDIA 4MPVA 4RI0A 3A42A 1NRNH 5EXTA 4LRTA 3AW0A 4NL4H 4ZMAH 4QHSA 4DOQA 3FP8E 3PO1B 7CATA 3SUDA 3U9AH 2GMTC 4A1VA 4IBIA 2ZKSA 2QQ8A 2KZUA 1W0KD 3TGIE 3EA7A 5ITXA 3ZZ5A 3LH1A 4DV0M 3VB5A 3H5CB 4DV2M 4D7FA 2CWBA 1UVSH 3MO6A 4AFSA 3LJJA 5IK2D 1PQ8A 5ITUA 2L4EA 4CH8B 4DIIH 4MB7A 2EQNA 3QX5H 1ZJDA 2YNBA 5CHAC 4UFDH 1GI6A 2OC0A 2HHHM 2A5AA 2PWXA 3U1IB 1TRNA 2ZPRA 3PB1E 4GCHF 2FZZA 4FU7A 2Y81A 4IBKA 4FWHA 1XNRM 1HCGA 1O2VA 3HK6B 3P8OA 1SG8B 2CHQA 1N78A 3T1YM 4AB8A 1GMDG 1GBMA 1DPOA 2V6NA 4JYVH 4MM3B 1C2LA 5EJCA 4JI4M 1ZSJA 1F2SE 2HALA 2QCUA 2G81E 1DT2A 5EP4A 3ESTA 2QA9E 1Z6TA 1HAZB 1YP9A 2C8YB 2FOBA 2KNAA 1NFXA 1O2UA 3IHPA 3RXIA 1IXSB 1V2ST 1VJ9U 2EA0A 2Y5HA 2Y0TA 1QJ7B 3RXRA 1VZQH 2KZSA 1S6HA 1C4V2 1G3IA 2P3UB 3MMPA 4IBJA 4R8TB 3TNTA 1GL7A 1IQLA 3BF6H 3UQOA 1IHSH 4MNXA 1GI1A 3N7OA 2KNVA 4Y8XA 3URDA 3MU0A 9ESTA 3BTKE 2BY8X 5FPSA 5HIYA 1E38B 5T6DA 4ABJA 1LQDB 2R2MB 3KS8A 2N35A 3HX3A 1QRZA 1T4UH 2TRMA 4YY3M 3BSQA 4ISIH 2APLA 2F9NA 1SLUB 2DKLA 1DFPA 2JJ1D 4ZKOU 3S9CA 3U1JB 3LGVA 1V2RT 2K6BA 1O38A 2G8LA 6LPRA 2UUBM 1UTMA 1CQQA 4AB9A 1YGCH 1IQKA 1RU3A 1V2TT 3LJOA 1ZHMA 3QO6A 5FLXS 3DA9B 4QHTA 4UFFH 5AFZH 2WV4A 2CGAA 3GCTG 1AVWA 1MZAA 1TLDA 1ZSKA 1QFKH 4U01A 3UZUA 4G4OA 1EJNA 5DK1A 3SUEA 2R4EA 4WP2A 4TWYA 5JBTA 3U5ZB 4ZKSU 4ACAA 1ZZZA 4ISOA 2FTLE 1PPZA 3AFHA 3DFZA 1W11U 5DG6A 7ESTE 3R3GB 2TIOA 2WV5A 5B6LA 2XTTB 4D81A 1WQSA 2UUAM 3O8BA 4DV1M 1EZXC 1DGGA 1GCTC 3A45A 1MU5A 1VCPA 5C17A 1SGQE 1SL3A 1O37A 1TA6A 2EY4C 4PROA 1D3PB 1TGTA 1H8HD 1ELFA 5KQDA 3E1XB 3SV8A 4K8BA 1TGCA 4ITQA 4OVZA 2KXEA 3GICB 3T25A 5KQ8A 1MBQA 1LHFH 1GJ6A 3PV4A 1EPTC 4H4FA 3UR6A 1S5SA 2CF8H 2LVPC 4CHTB 3PNYA 1S84A 2BXUH 3O8DA 4Y8ZA 5CHAB 2ZI2H 5EPYA 3JZ2B 2KX4A 2ZPSA 1BTPA 2ODQA 2FOFA 2W5EA 4DURA 1A3EH 2QHOB 3F9EA 3RU4E 1J9CH 2GT7A 3URCA 3QWCH 2ZFSA 3UQVA 3QWLA 3ZIAD 2EI8A 4TYDA 3TH3H 1QTFA 3GQ5A 4L6V6 3F0PA 2NU0E 1GVZA 3D49H 1N75A 1ETRH 3U8TH 2VGCC 1G8PA 5GWZA 4LF5M 4D8NA 5IWAM 1GJ9B 2GVFA 3P6ZB 4FOUC 4MDSA 2L2DA 3OTJE 3E90B 3TJUA 3PM3A 2XSZA 1GVKB 3K6ZA 1O2KA 3P92A 1CGJE 1E0FD 2AMQA 1OPHB 4I31A 2PKAA 2VVVA 1A0JA 1D6RA 3K65B 1LPKB 1Y3WA 1VEKA 3U28C 4LG2A 4NC6A 3KYGA 4Z8XA 2AMPA 3O8CA 3WWBA 1W0JD 1LCYA 4OX9M 2R0LA 1UK2A 3MYWA 1H1BA 1MU6B 1E32A 1HR0M 1OFHA 2GTBA 4FD2A 3BG4B 4YT6H 3SJOA 5EJ1A 2CP8A 1O2OA 2WPMS 2RGOA 3RXVA 2SGFE 2QV1A 5FX5A 4X65M 1PFXC 1SG9A 3RXKA 1C2FA 1YCPK 1EUFA 4TY7A 4Q7XA 1EKBB 2Q6FA 2R2WU 4AGKA 4GRIA 2C9OA 1EZUC 3QTOH 3PVSA 2Y20A 1CE5A 3HHWA 4ZKRU 4PD2A 5KGOA 1DLEA 1N6XA 1OWHA 1DANH 2TBSA 1Q3BA 4AFUA 3SU3A 5JPMH 2C90B 3Q76A 2PLXA 2D7EA 1UTKA 4FCTA 3SORA 3PRBA 5JI2E 1JB0F 5SGAE 2BY5X 1IN5A 1GBDA 4ZHMU 2YNMD 4UDWH 2DAEA 2KEBA 1GMDF 4Q2KA 4Y71A 1IHTH 2EEKA 1QA7A 3OYPA 2QXIA 1BRAA 1OXGA 4O3TA 3EA9A 2Z3DA 2LWXA 2AHME 5C1BA 1GJCB 2F83A 3VG8A 1GCTB 4R0IA 1TE0A 1GBEA 1JRSA 2FS1A 1KLIH 2VU8E 1NHWC 1OKXA 1KSFX 5EXSA 4WY3A 1UCYK 1V2PT 5AF9H 1C1RA 1UTLM 1DY9A 2Z94A 4Y0YE 2W6ID 4GKKM 3SARA 1EPTB 1S82A 1FY4A 3LDXH 3GY4A 3RMOH 4X2WA 2KRKA 5GPIB 4XE4A 2FX6A 4G6ZA 2V3HH 1SGNE 3MH6A 2QC2A 3W67A 3I77A 4B6FA 1QL7A 3BTFE 2EUCA 3TPZA 2C5RA 5FX6A 2Z9IA 3QGJA 1A5IA 3HY5A 2KCAA 2QAAA 1C1QA 1LVOA 1NO9H 1VR1H 2F9VA 4KT0F 2OC8A 1IQJA 1Y8GA 4DUYM 1O2SA 1NPMA 2ZFRH 2BVXH 3BIVH 2CHGA 5JB9S 1TDHA 4JZEH 2F9PA 2VJ1A 2L7HA 1A5GH 2QF0A 3A88A 3VXFH 3GLFB 1MZDA 2FTMA 4DR4M 5EIYA 1PQ5A 5B6OA 1ANCA 3GCTF 2VGCB 1GI3A 3A98B 1F92A 2ZU2A 4I81A 1CT0E 2R44A 2AS9A 1JXPA 4I5SA 1IXSA 1DGHA 3VB6A 1C4U2 2JY5A 2F43B 4REZA 2O8TA 3A7ZA 4FCWA 3KQDA 2XXLA 1PPHE 3F2GA 1T8NA 1SQRA 2XNIA 2BX3A 1G71A 3MH7A 2G55A 2OLGA 2OTVA 1FQ3A 3GLFE 1ACBE 4AKHA 1O2IA 3T26A 1TOCB 1G37A 3EYDA 4KTSA 4UFEH 2ZP0H 2W6JD 1G32B 1QA0A 2B3TA 5GNDA 4BXWA 2MGWA 5FBIA 1AE8H 1GDUA 2ZDMA 3ATMA 4K1TA 3F2HA 2XFTA 3ZC7B 4BTUB 3HHYA 1J14A 2G4TA 1V33A 3EIEA 3SU6A 2VH0A 3MOCA 1H9LB 5KO3A 2BZAA 4XBBA 1NU9A 1OP8A 1DUAA 1HJAC 4LJ5A 3HKPA 3LCVB 3TWMA 2IPHA 4R3DA 2JIZD 4OW0A 1AY6H 1C1KA 3GLGA 3U6DA 2JH5D 3E46A 1VJAU 2BLVA 5DP5A 1ARCA 3WHLA 4X62M 4CGYB 2A7CA 3A81A 2J4IA 3AOEC 3RMMH 3SHAH 2BDGA 5FCRA 2V1UA 3D62A 3AJIB 4FUIA 5DP9A 5E0GA 5C20A 3L29A 1QBNA 3M36A 1GI9B 4RT0A 1TNIA 3LC3A 2BY7X 3A89A 1MTVA 3IG5A 1O33A 2C8XB 2CEAA 1GDQA 4O9VA 1BHXB 3GRYA 1NY22 2CHAC 2QE7D 4Y0ZE 2RA3A 2BX4A 2Z9JA 1S0QA 1NVMA 4LGYA 3IECA 2PTCE 1DICA 1P06A 3E3TA 1CA0C 4M9FA 2AGEX 2HVXA 1ELEE 4WVPE 1C1NA 1ARBA 2YFQA 1P10A 3OE7D 1UTOA 2VNTA 3F92A 3U69H 4ABHA 4ABDA 1VEGA 1NNUC 4FXGH 2BZ6H 3Q00A 1F4IA 1Y3VA 1SLWB 1V2OT 1WU1A 3J27B 2A4QA 2XCFA 3CF0A 2DHRA 1IBLM 3ILKA 2AGGX 4MNWA 1HRTH 2PKSC 2ZGJA 1K3WA 2EA3A 3GY5A 2A4RA 1A46H 1KYNA 3NBXX 1YPLH 1TFXA 2FI5E 1DWBH 4NIWA 1LHDH 5ITRA 5BRRE 3KSJA 1TGSZ 1E9RA 3QAUA 1O3MA 3SQEE 4FW9A 3QDZB 1HDTH 2ANMH 2J38A 1CGIE 2C8WB 4ZXXH 1R2ZA 1WGLA 2QIQA 1MQ6A 1LKBA 1K1NA 2FI4E 1E1QD 1DV0A 3B7ZA 5F8ZA 4I33A 1G36A 4DUZM 1KFVA 3ZVGA 1IY2A 1CVWH 1DXPA 3M7QA 1BDAA 3ITIA 3U6LA 3QZQA 5GCHG 4GEWA 3TL4X 4Y7BA 4IGDA 1NJGA 2MH8A 3ZZ4A 1L1NA 2LHGA 2K0QA 3T5FH 4LGMA 1QZEA 3KS4A 1TX6A 2I7PA 1XX9A 2HPQH 4CRAA 3UJNA 3GS9A 2BMGB 4H6TA 1E35B 3Q77A 3DFLA 3GRVA 3MMGA 1JIMA 1H4WA 1C5ZB 1Z8RA 1FZZA 3KQCA 4W5WA 1QDRA 3RGSA 1XVOA 3GPPA 3E6PH 1C5WB 2LP6A 4B73A 2JNHA 1N36M 1CO7E 1C5MD 3SO3A 1OWKA 4A3VB 3LW5F 1WSSH 3DHKH 2R3YA 2VVUA 1KXDA 5ITXE 1G2MA 2Q2EB 1HJAB 3HKJB 3GY3A 1A7SA 3UNQA 5EP1A 3UFAA 1W12U 1EAXA 2C98A 3RXMA 1HLTH 1TH4A 3MHWU 1V2WT 4HTCH 3T2NA 4ABEA 4Q80A 2A5YB 1JOUB 5HGGA 3PRDA 1QURH 1JR3A 4XGIA 1MBMA 4AGJA 3NPSA 1HAYB 2OQ5A 3DFJA 1TNHA 1PJIA 3TQSA 4ISNA 2QNJA 3V13A 4O03A 2J5YA 4DV7M 5IZ7D 2CHAB 2OC1A 1P8VC 1OJLA 1XM1A 4UN2B 1O34A 1BT7A 1CA0B 3TWKA 3ZZCA 2A0QB 2MR9A 4X64M 2JP7A 3NWLA 3H4MA 1N6YA 1P0SH 3F9FA 3MO9A 1IQHA 1MTNB 4X1NU 1DM4B 2KAIA 1SB1H 3UB0A 2JETB 1BJVA 3MNSA 4BAQB 1DOJA 1EPTA 5F3WA 2DHYA 2KHHA 3CP7A 4FUHA 4LY6A 1AFEH 2PKSB 1W0YH 2H9TH 5EOKA 4LJAA 2Y80A 4I8GA 4M9XA 3I04M 3TGKE 4BTTB 3FP7E 4NCYA 3DD2H 5EXXA 1GJTA 3HHXA 1SOZA 4L15A 1XVMA 3SV9A 3UTUH 1ZMUA 4GLYA 5DPAA 2KM0A 1T8LA 2LELA 1P09A 1P11E 2I6SA 2H9EH 1QY6A 2XH9A 2VQFM 3NKKA 3GO8A 2H5XA 2LVNC 2Y7ZA 4CRGA 1KSNA 5IT9S 3V0XA 3KOXE 1F5LA 4HL4A 4NSVA 4Y6DA 4IBCA 5A8XA 3IITA 1LO6A 1PJPA 1GHVH 2L7IA 1TIOA 1Z6EA 1BZXE 4FVMA 1GBAA 2H1RA 1GMCG 1EE8A 1YSYA 3DCLA 1QB1A 1IN6A 2OPFA 5HIZA 1F0TA 1XUFA 3UWJH 4OVZB 3FUVA 2VB0A 1SFIA 2R0KA 2Z9KA 3P8GA 4ASUD 1UTJA 5L30H 4ISHH 2R4JA 1Y3YA 3L26A 1GHXH 5C1UA 3ZV9A 4XK8F 2BB4A 4GPGA 2J34A 2RGHA 3AAUA 2Z3CA 5EXMA 3FYDA 3TJOA 2BLQA 1EIJA 2QYIA 1ZLRA 1UK4A 3GCNA 3SZNA 2AIQA 2W3KA 1XB2B 1YLDA 3I01M 1FX0B 4LCBA 4I8OA 3E8LA 4GHAA 4B3RM 2CN0H 2F3CE 4D9QA 1Y8TA 2GZ8A 2Y5GA 4X2VA 2HWJA 3RXBA 3DSOA 1ZMVA 1MCVA 2JJ2D 4AOQA 3LGTA 3HJSA 4QNRA 3SNAA 3BN9A 4KELA 2A4OA 1GHZA 3KNXA 1WTGH 1R7RA 1S6LA 1SLVB 3QYBA 1EASA 3GLIA 1TGBA 3LVVA 1SKYE 2Z8YM 1G3BA 5DP4A 4XD7D 7GCHG 3RU4T 1W3CA 3M6AA 1KIGH 1H8DH 4IW4E 4UFGH 1BA8B 4RF0A 2FEQH 1D2NA 1IQFA 1SXJD 4U32A 2JWSA 4ZROA 4I8HA 4A7IB 1KTSB 4L16A 4Q63A 2CF9H 2BWEA 1C9TA 1S81A 3BTME 4CRDA 1C2EA 1W8BH 1QL9A 2M2AA 1A1RA 3OAAD 2QSFX 1K3XA 3M37A 3M5LA 3A8CA 1SGRE 1VKYA 1QVRA 3SYLA 1AVGH 5C5OA 1A0LA 1EB2A 3P95A 2JY6B 4INKA 4F48B 3KN2A 1P02A 5GCHF 1GBJA 2Y0QA 5LMNM 1KDQA 1HAGE 2SGQE 1T43A 2VIVA 3C3EA 5TJXA 1Y3XA 4ESTE 2C8ZB 2FS8A 3RXSA 1BBRK 3V12A 1ZV1A 3SU2A 4JK5A 2CV1A 4TT3D 4D7GA 2W26A 4JI5M 5A0AE 5JBAS 4FVDA 1ZHRA 3GOVB 2MROB 1TNGA 2Q1JA 1SVPA 4NXMM 2A5KA 1P2IA 4P02A 3ZYDA 5FTKA 2PGBB 3E4RA 1ZPZA 3SHCH 2W3IA 1OP0A 4H42U 3GQ3A 4NXNM 3RXOA 2BD5A 4VGCC 3OTOM 3UOPA 2BQ7B 3LOXA 1TQ7B 1GO5A 2DAGA 2XLJA 1GVNA 1THRH 2DAKA 3HGNA 5EXLA 1QBVH 5FPYA 4X8UH 3CTWB 1KXBA 3E0PB 3SQHE 1O2HA 2BM2A 2BD7A 3FP6E 1C1WH 4FU8A 3W94A 2Z9GA 1TPSA 3ZVCA 3K9OA 1V34A 2EJSA 2H2ZA 3FANA 2DXIA 1PJSA 4P17A 1HJ8A 4X1SU 4HFPB 3KOYE 1ID5H 1GLNA 4YLQH 4OS4A 4JI2M 1QB6A 3PWBA 1ZPCA 1UVTH 2OP9A 1BQYA 3DOAA 4E7NA 2L6OA 9LPRA 1ELDE 2ASUB 3ENSB 5HXFA 1G9IE 1N1LA 3SMPA 1LV7A 1MKWH 1LTMA 4D76A 4FUEA 4X66M 1WV7H 1ANDA 3H09A 4X6NA 1DY8A 2OCVB 1H8ED 3Q8GA 3UIRA 1O3HA 2DWLA 1AU8A 1CT4E 2DAIA 4D82A 3S9AA 1TX7A 1GG6B 5HM2A 1C5UA 4ZCNA 2GCHG 4NG9H 1W2KH 4ZAEA 1V2JT 1VG5A 1BTZA 1O3CA 1TX8A 1AZ8A 1FV9A 1H6UA 4ABAA 2QGRA 2JZ0A 2G00A 5EJZA 1IXZA 3JR4A 2OUAA 3ZZ8A 4GITA 1ANBA 3AOEA 2ZFQH 4MH0E 3Q3YA 3A83A 4K1EA 1L1JA 4WXVA 4Y79A 2BY6X 1DGHB 3KCGH 4OS5A 5ITYA 1NNJA 1GI0A 4MPWA 2C4FH 3AL0C 1P3CA 2XC5A 5HMAA 3SOSA 2ZQ2A 3KQ5A 1WGNA 1TH3A 4MGZE 1AMHA 2PR3A 1GMHG 2BJWA 2BJVA 1J16A 1CU1A 3SNDA 1P57B 3DSGA 4MG3A 2LBCA 3KIDU 1O32A 5ITQA 3K92A 1NFWA 1FPHH 2QENA 1GMCF 1DVAH 4DV6M 1O5BB 1UO6A 3AAVA 3UNRA 3UK6A 3A7XA 4HG6A 3OY5U 1GHWH 3RGPA 3FUWA 1IQGA 1QNJA 1RD3B 4E05H 3A84A 2ZCKP 2C93B 3TH4H 4MVNA 1GI4A 3HU1A 1YLCA 1EB1H 2J2UA 4Y10E 2GDDA 1RGQA 1Z6JH 3MNXA 1AUAA 3MQKC 1YYY1 1BB0B 2YNAA 2RKOA 2UWLA 4QOZC 1YPMH 5L2YH 1SSXA 1O2LA 1GVLA 3GLGB 4X6PA 1HT1E 3EIHA 1UK3A 5E0JA 4DIHH 3U98H 5PTPA 2JY8A 1JIRA 2D8WA 2V3MA 2FFJA 3GDVA 2FOEA 2ZG0H 3D65E 3J2PB 4ASHA 1Z71A 2SGPE 2WZJA 1MKXK 1C1MA 3KF2A 2FS9A 4VGCB 1C4Y2 1L0ZA 3K2UA 2A5IA 2M5ZA 3KSXA 1ZTKA 4R7GA 3NBIA 2VWNA 1UVUH 3M7TA 4FUBA 5DGJA 1FJGM 4MPXA 4LZ1H 1ZJKA 5G4BA 2AMDA 1ELAA 1C1TA 1RTFB 4JMYA 1J17T 4MPUA 7GCHF 4ZHLU 3GLGE 1C1VH 1A2CH 4DT7B 2GMTB 1HAHH 2F4LA 1Z5AA 3OEED 2DE8A 4P16A 2JKHA 4GHTA 1D9IA 2IN2A 5F6MA 3S0NA 1TTEA 5T6GA 3SZEA 4GH9A 3ZQJA 1GWAA 1QZ8A 5T6FA 4E06H 2XCNA 2DENA 1I94M 1C5PA 3UR9A 2VH6A 3VXEH 1PYTC 1YC0A 3RXDA 1ETTH 2VF7A 1KXAA 4CISA 3B7QA 4WH8A 1GJSA 2XNDD 3SFZA 1GBIA 3F2FA 2IPQX 4K8YA 2G3QA 2DUCA 2CUZA 4WW0A 3M5OA 1MUEB 4M9SA 4KHPM 1MTWA 4RKOB 2HNTF 1FN6A 2ZHFH 3U6SA 1C5SA 1QYRA 1R5LA 1BOQA 1K0HA 1J09A 1A0HB 2ZQ1A 2ZANA 3RXCA 1E79D 3LC5A 4CR5A 1F5RA 5F8XA 1XUKA 2H6MA 3A7YA 3KFUG 1AZZA 3FVFB 5E2PA 1J7KA 4NA7A 2ZEBA 3RC6A 4IJFA 2OD3B 4U30A 4WMFA 1L2CA 5C67A 2P94A 3NWUA 2QPAA 2RDLA 3S9BA 1AD8H 3I4YA 2ZU3A 2UU9M 1MH0A 3ODDA 1NBMD 1XHBA 3T15A 2STBE 4FU9A 2LH0A 2ZGBH 4IJEA 1TPAE 2P8OC 4YO9A 4OS2A 1H9IE 1ZAEA 5GXPA 5IREB 5DO4H 2VF8A 1G41A 4KTCA 2ZA5A 4CJ6A 3BTDE 5A2QS 4CRBA 4UE7H 1YBWA 1HNWM 1AWHB 3BTEE 4BAOB 4CH2B 4YOJA 2J5UA 3KL6A 3SNEA 1Z8JB 1QAQA 2L74A 3SJKA 2UWPA 3I78A 1GJDB 3MWIU 3PTBA 3VLFB 3SASA 1DE7H 1K1MA 1T7CA 1CUKA 4AG5A 1H8IH 2GX4A 4NWLA 5C2ZA 1QUTA 1FPCH 4M9ZA 1LHCH 3ATWA 1P3QQ 2P3TB 3GY8A 2A7JA 3E16B 4Q7YA 1UW7A 1NHGC 1OX1A 1EZQA 1L1ZA 1ZTJA 2BOHB 2PTNA 2TGTA 1O3FA 3M3TA 5C1YA 1BTXA 3RXEA 1ANEA 2TPIZ 2P5TA 1P03A 1QHRB 1FAXA 2BDHA 2ZFPH 1HGTH 4X1PU 4LJ7A 4TWWA 1EZSC 1XNQM 3TJNA 1SXJC 2XGNA 1IOEA 2GCHF 5ETXA 4YZUA 3QZRA 5F8TA 5I46H 2FOMB 2UWOA 3FTEA 4ACBA 1XUHA 2NWNA 1MAYA 3HK3B 2WPLS 1UVPA 4WJG2 1PJQA 1DS2E 2OBOA 3PXGA 3DZDA 3QLPH 3BV9B 3M3SA 4FVBA 2GDEH 3GLHA 2XC4A 1O5DH 2BTCE 2EC9H 3F68H 4BOHA 4JN6A 1JR3E 2BD9A 4IBLH 2FE8A 2KAIB 4B7FA 1FN8A 5EGMA 3QK1A 1H9HE 1SOTA 1OOKB 3RM0H 3L6PA 2H5CA 1HAVA 1FY1A 1F5KU 2IJOB 2XWBI 3UGJA 1GMHF 2YMSD 3FFGA 3RUOA 4IBBA 1IN4A 3TNSA 2QY0B 2O8LA 1ZRBA 1K1LA 2Z4SA 3HKIB 3SJ8A 1O2QA 1EAWA 2G5NA 1S3SA 3MU8A 1DGBA 5ABWA 3VKHA 2A2QH 1YE9A 3VDUA 3NUMA 1OWEA 3TITA 4JZ1A 5FTJA 2THFB 3MNCA 2O8UA 2ZAOA 1N32M 2K0BX 4ANRA 2Z4RA 4YTAA 1HUTH 1W7GH 1TPOA 1YPJH 2BD8A 3MI4A 1DITH 4B3TM 2JY7A 1Y5BT 1C5OH 4FWDA 4INHA 5EQSA 1YLAA 4YXWD 3L33A 2FNAA 1MAXA 4DR6M 2LHCA 4LXBH 1T3TA 2X49A 2Y6TA 4WURA 2ANKH 3V3MA 1C2MA 1W10U 3K9XB 1HBTH 2G5GX 5L6NH 4X0WU 4F2LA 4XDEA 3FTDA 1YPKH 3GY2A 4MLFB 1DWDH 1EP5A 1XXFA 3LIWA 3RFWA 4ISLA 6GCHG 1CSOE 1XMQM 1BITA 2ZF0H 3HWSA 3J7AS 3SU4A 4BBAA 3MH4A 3V76A 3M7GA 2F5OA 3WHKA 1WAYB 2CMYA 3B23B 3HGPA 3HPTB 4FUJA 1HNXM 1O35A 1O3KA 4X6OA 3AV0A 1O39A 5CDFE 1C5YB 1FY8E 2PV9B 1FONA 2LVAA 2LVOC 3VDPA 1YLNA 2ANWA 1RTKA 3J80S 3WWFA 1TMBH 2HRVA 2CV2A 1OKSA 3VGCC 2HKJA 2DAMA 3VK8A 3Q8XA 2F91A 1TWXB 1OWIA 4AORA 1ZYOA 2YOLA 2K47A 5EPNA 3LKWA 4PDGA 3GLIB 1IQPA 1TONA 2GZ7A 2XBXA 3EE7A 1WXQA 1ELCA 1NFUA 3KOWE 3OFND 3K9PA 1AUTC 5AFYH 2I7NA 1WUNH 4LF9M 1W13U 4DG4A 1OYTH 2D2DA 4OS6A 1C9PA 1PPEE 2V3OH 4KGAA 1SXJB 3C3DA 4HEOA 2FOHA 1OHHD 2H5DA 3Q3XA 3SHFA 2ESTE 3DT0H 4FUGA 3LGWA 1S83A 4AN7A 3A8BA 2Q6DA 4NRWA 3T27A 2FDAA 2PP6A 2PUQH 1DXWA 4U2WA 3FO8D 2WPHS 3GLIE 2HLDD 5JI3E 3ZZ6A 3SAVA 3C9PA 4MGHA 4DR2M 1BMAA 1AB9C 3NRLA 4AZ2B 5LMUM 1P2MA 1KDQB 2A32A 1Z8GA 3BTWE 4FUDA 1Q39A 1QANA 3PLKA 4HZHA 1HT2E 3GPYA 3L25A 2RG3A 3UMMA 2NU2E 2ILNA 1LDTT 5FXLA 4CHAC 3FUXA 1TNKA 2KA6B 2WPKS 4GHLA 1O3AA 1GBFA 1QJ1B 2WSSD 2XEPA 1NRRH 2BLWA 3VFEA 3RMLH 2RDEA 1BBRH 3TVJB 1AN1E 4IMQA 4ZUHA 2QZ4A 7LPRA 2ZGXH 2E5LM 1P2KA 2FIRH 3M5MA 3GPUA 3LQRA 2BQ6B 3G01A 1P2QA 2GP9B 2DE9A 3N7EA 2ZHWH 1ELTA 2LNCA 1MQ5A 1AKSA 4GHQA 3P8NA 2O8WA 3RU4D 2DI0A 1BIOA 1AFQC 1K28D 4YOGA 1MX0A 2J7NA 1B0EA 3PLPA 4L78A 4YOIA 1AO5A 2ZWLH 2OOBA 3Q3KA 2OQ4A 3GCHC 5A0BA 2KZ4A 3LH3A 4S12A 1SQOA 1NT1A 2L09A 5E26A 2B9LA 4Z0KA 4LF8M 4CRFA 2NU4E 4JZIA 3W0FA 4JCNA 1O2MA 1CGHA 1TQ0B 3SN8A 3HU2A 2F5SA 3PMAB 5DFLA 2H1UA 3U8OH 2X8AA 3ODFA 2BY9X 2D1JA 4A1TA 4X8VH 4FCVA 2FLBH 2BDCA 4BLCA 4YHHM 2GKVE 3H7TA 3UAIC 3HJQA 2XZFA 3BEIB 2RCEA 4TUWA 2CK3D 1WJ7A 4KO8A 1UCYE 1Z5BA 4RKUF 3JAMS 2GGVB 2Q6GA 1PQAA 1MCTA 1DX5M 4RN6A 1ELGA 3R8FA 1TB6H 2O25A 2HAKA 4JI1M 1SHHB 3VGCB 2DZLA 1RIWC 3D23A 3SU5A 2O01F 4IBEA 3KQEA 1ELVA 1NJFA 2V1CA 4NOOB 4UEHH 2VQEM 1J5EM 2NU1E 1VDLA 2ANYA 2ULLA 2ODYB 5C1XA 2A4GA 1Y5AT 3EA8A 1P04A 1O0DH 2OC7A 1VEJA 1QCPA 2GV6A 2XBVA 3LGYA 3ZVBA 3U6EA 4ABIA 1VGCC 2J92A 5T3HA 2ZPQA 5FTNA 5GDSH 5LH8A 1C5QA 3VB7A 2ZDAH 5C94A 2JA2A 3BEUA 4LK4A 4XBOA 1D6WA 1XWIA 2GD4B 2Y5FA 1QDTA 4GC9A 1IY1A 3SGBE 2HPPH 1XXDA 1HIAB 2D7GA 1CHOG 4LF6M 4Q4LA 1N33M 2W7UA 3CGWA 5JBCS 1RXPA 3GYMA 1IN7A 3B7NA 1JQJC 4NFFA 1P3EA 1K1OA 1KMHB 4KP0A 3OSYA 3BG8A 3BTGE 5T1VA 4DGJA 8LPRA 2PSYA 3FTFA 1NZQH 2LTUA 4CHAB 2ZDLA 2WINI 4DR5M 2UUJB 2LXEA 6GCHF 1O3OA 2ZDKA 2EI7A 4F1IA 3PTNA 1ZGIA 4JI6M 4DVAU 1NFYA 1HAPH 2YR0A 4B7HA 5H37D 1C1PA 1G3DA 2P93A 1DO2A 1SGYE 3TE6A 3V7TA 1ETSH 3B89A 2UXDM 3RE8A 5DYGA 4OS7A 6CHAC 2G52A 3M3VA 1CBWC 2G8TA 1AE5A 1HV7A 3RXGA 4BTIB 1AFQB 3CS7A 3VB3A 5H4IB 1AUJA 2SFAA 1FJSA 1TAWA 1T6OA 3FRHA 2AH4X 1GI7B 4RF1A 3RM2H 3SW2B 2R62A 4LZZA 3ZVAA 4YT7H 2QXHA 1IN8A 3UREA 5LPFA 3PWCA 3GYLB 1IQNA 1W5TA 2VIQA 2ZU1A 1PPFE 1V3XA 1ABJH 5LPEA 1UTPA 1XXHA 1JRTA 2GCTC 5HYOA 2YMSC 1FNIA 4B76A 2HL7A 3GP1A 2ZIQH 3TK9A 2PSXA 4X6MA 1BHXF 4IN1A 1ZMNA 2NU3E 1TDZA 1D3QB 3CF2A 1ABIH 1O2WA 2XBWA 1NN6A 3LCUA 1RIWB 2KDLA 2UXCM 5DYIA 4WH6A 1O30A 2X4AA 1HAXB 1AHTH 1KY9A 2DZOB 1QR3E 3ZZAA 3TGJE 2ZDVH 1VCQA 5EQQA 1SPJA 1UMAH 2K1QA 1GI8B 4F49A 2FP7B 3RXFA 1GJ5H 4DR1M 2GZ9A 2VIPA 5AHGH 1EFUB 3UPEA 5DN6D 3CF6E 1V92A 3U61A 1C5XB 2D26C 3BTQE 2ERCA 1Q2WA 1WQVH 2HVYB 4D80A 2CRUA 2DVWB 2OXSA 2OO9A 1C7YA 1VGCB 1UTNA 2KR7A 4XBDA 3SC3A 4O3UA 2VWOA 3W1EA 2BWBA 1ORFA 1SXJA 1GGDC 4BXSA 1VDDA 2UUCM 4ZPXA 1F7ZA 1O2PA 2ZTCA 1P05A 3GISB 1UJ1A 4JZFH 1NSFA 1V2NT 4G4NA 5A8YA 3E0NB 4QOSA 1VITH 1TGNA 3P70B 4X1RU 4KKDA 4AKIA 3S7HB 1YWUA 2BD4A 2FXRA 4B6EA 2IOTA 2Z9LA 1R6BX 1EJAA 3BIUH 3T62A 4Y28F 3FN8A 1D0LA 4NFEA 4CREA 3KYFA 2FOAA 4CBNA 3ZZ9A 5F03A 3EGKH 4GUXA 1LPZB 2AERH 1XKAC 4H6SB 4IS5A 4BB9A 1L4DA 1O3JA 3PROA 5C18A 1Z8IB 1HQYE 2FWWA 1YCPH 3ZV8A 1ORYB 1K2I1 2WPJS 3SI3H 4CR9A 3UOUA 2RFKC 1THPB 3JZ1B 4AQYM 1CBWB 1C1UH 1O3DA 3RXLA 1FY5A 1ZR0A 1D0KA 5EQTA 3PMBB 3ZVFA 1CT2E 1J15A 4TY6A 1K9OE 1BMMH 1J8AA 5A09A 3M5NA 1XMOM 1SC8U 2Z3XA 4DV5M 1G3EA 3F6UH 5FSWA 4DR3M
chains in the Genus database with same CATH topology
1J09A 4KLNA 3EYDA 1R2YA 1IY0A 5DNYA 2W6JD 2ZANA 3GLHB 1E79D 3SYKA 2F9UA 5GNDA 3KFUG 1XC8A 1J7KA 1W5SA 1QQWA 4IJFA 3IG8A 3RC6A 3F2HA 3FTCA 3U6QA 1QZMA 1IBMM 2XFTA 3ZC7B 1L2CA 3HHYA 4LF7M 3DSPA 2ZBKB 3EIEA 3SU6A 2QPAA 3U6PA 3I4YA 5KO3A 4LJ6A 2UU9M 5KPZA 4LJ5A 1XHBA 3HKPA 4GMQA 1DGFA 3T15A 4R3DA 3TWMA 4OW0A 1NBMD 2JIZD 1C1KA 3GLGA 2LH0A 3U6DA 1NS3A 4IJEA 5GJ4B 2O8MA 3WHLA 2CFOA 4CGYB 4X62M 2IJD1 5C0TA 3AOEC 3D8LA 4Z6YA 3DCLA 3LQQA 1ZAEA 4NSRA 5IREB 1Z5CA 4GKJM 1G41A 2V1UA 3AJIB 4KTCA 3L29A 1Z59A 5A2QS 2QBYB 5FPTA 3KOZE 1HNWM 3IG5A 3KVWA 4LZJA 2J5UA 3U6OA 2CEAA 3SU0A 3SV6A 1QAQA 5EP3A 3GRYA 2QE7D 2DZNB 2XOKD 1K82A 4IIWA 3VLFB 3SASA 4NWLA 3D8BA 4AG5A 1NVMA 4LGYA 5EXPA 1IBKM 2QF4A 1COWD 4M9ZA 2Y21A 4M9FA 1GL6A 2F4VM 3GLFA 1NHGC 2YFQA 4MGKE 1X37A 3OE7D 1L1ZA 5FTMA 3VKGA 2V7QD 3OEHD 4B71A 1L2BA 1MABB 1NNUC 2KCYA 3RC5A 2P5TA 2J7OA 2WZQA 3PV2A 3HHZA 2CHVA 3J27B 4LJ7A 2A4QA 2XCFA 2WHXA 2HCBA 3CF0A 2DHRA 1IBLM 3AK5A 4Z1MD 3A46A 1XNQM 1SXJC 3ILKA 2DWZB 4NWKA 2XGNA 3AKZA 3SAUA 3FKSD 5ETXA 3I4VA 1K3WA 3HGIA 2FOMB 5GKNA 2A4RA 3FTEA 3MJ5A 1E1RD 3F0OA 4PCZA 4JI8M 1RTLA 2OBOA 3PXGA 5ITRA 2C96A 2EO2A 3DZDA 3KSJA 1E9RA 3QAUA 3J7BA 4FW9A 3GLHA 4I32A 1R2ZA 4JI0M 3LMMA 4JN6A 2WV9A 2FE8A 1E1QD 4B7FA 4FETA 4I33A 1E9SA 3U60A 3SATA 3L6PA 4DUZM 2IJOB 2YMSD 1KFVA 1IY2A 3L28A 3UGJA 1DXPA 3KXEC 4IBBA 4GC5A 2KRUA 1IN4A 3U6LA 3TL4X 4LJ4A 2ZAMA 2Z4SA 4B3SM 1NJGA 5EP2A 4A1XA 2K0QA 2YQZA 4K0KM 4LGMA 3KS4A 5EQRA 1S3SA 3O8RA 1DGBA 2I7PA 3VKHA 1YE9A 2OK5A 3VDUA 2NQ8C 2XZUA 3TWLA 4DR7M 3UJNA 1NBME 3GS9A 5FTJA 3VK7A 4NRVA 3GRVA 2ZAOA 1N32M 1FNNA 2W82A 4LFAM 1IXRC 2Z4RA 1N34M 4NSOB 3BOSA 3L2AA 4W5WA 3RGSA 2QBYA 2M60A 3GPPA 4B73A 1N36M 4B3TM 4YXWD 4FWDA 5EQSA 2R46A 2FNAA 4A3VB 4DR6M 2K8IA 1T3TA 2X49A 4WURA 3FOAA 4L8RC 2CV0A 5ITXE 2Q2EB 2KCPA 2G5GX 2R45A 4LJ8A 1QAOA 3SUGA 5EP1A 3FTDA 2C98A 4TSFD 4RNAA 3B9PA 2CE7A 1TH4A 3FUTA 3RFWA 3KDSE 2A5YB 1XMQM 2KCOA 3AOGA 3HU3A 3HWSA 3PRDA 3J7AS 3SU4A 2ZM6M 4BBAA 2JDID 1JR3A 4XGIA 2F5OA 3M7GA 3K1JA 3WHKA 5HKKD 1HNXM 3ZH9B 3AV0A 3TQSA 3MHVC 3C58A 1PJIA 5CDFE 2FOIC 1E94E 3VDPA 1L2DA 3KW6A 3J80S 5IZ7D 5KPTA 4DV7M 2DWMA 2OC1A 3WWFA 2CV2A 2BNKA 4LJ9A 1OJLA 3FUUA 8CATA 2HKJA 2YMSB 1BT7A 3M0EA 3VK8A 3TWKA 3Q8XA 2OINA 4AZFA 2YOLA 2K47A 2LNHC 3LKWA 5DSFA 3KP1E 4PDGA 5EPNA 3GLIB 1BMFD 4X64M 3NWLA 1IQPA 3H4MA 3SV7A 1L1TA 2DWNA 1WXQA 4WF8A 3KOWE 1ZQ9A 3OFND 3GRRA 4RI0A 3A42A 4LRSA 2I7NA 4LF9M 5EXTA 4LRTA 4NL4H 4QHSA 3R9XB 3UB0A 1SXJB 3MK6A 7CATA 5F3WA 3SUDA 4IBIA 4A1VA 4JI3M 1G59A 2KZUA 4LY6A 1OHHD 1W0KD 3SHFA 4LJAA 4M9XA 5ITXA 3T38A 2Z7JA 5BPVA 4DV0M 3KEEA 5EXXA 4DV2M 3HHXA 3VFDA 4L15A 3SV9A 4KODA 4NRWA 4AG6A 5IK2D 2KM0A 2LELA 5ITUA 1DXWA 3FO8D 4MB7A 2HLDD 2XH9A 5JI3E 2XSZD 2VQFM 3SAVA 4IBGA 3GO8A 3DA1A 4MGHA 4DR2M 2OC0A 2HHHM 2D7HA 4AI6A 3NRLA 3U6CA 5IT9S 3KOXE 4HL4A 5LMUM 3U1IB 4IBCA 3SMSA 1Q39A 1QANA 4DV3M 4IBKA 4FWHA 2L7IA 1HT2E 3GPYA 1XNRM 3L25A 3P8OA 3UMMA 4FVMA 2H1RA 1UM8A 3FUXA 1EE8A 1YSYA 2CHQA 2KA6B 4QNMA 4MGIE 3T1YM 4GHLA 4JYAM 1N78A 2WSSD 2XEPA 4B08A 4MM3B 2P59A 5EJCA 1IN6A 4JI4M 2OPFA 4L4UA 2QCUA 3E9SA 4OVZB 3FUVA 5EP4A 2QZ4A 4DV4M 1Z6TA 4LF4M 1I4WA 3M5MA 2E5LM 4ASUD 3GPUA 3LQRA 2R4JA 5ITTA 3L26A 2F5PA 3N7EA 1IXSB 2EA0A 3U6MA 2Y0TA 2C99A 2KZSA 2RGHA 3P8NA 3FYDA 1G3IA 3THGA 4IBJA 4R8TB 4PDIA 1GL7A 1MX0A 2J7NA 4L78A 1FX0B 4LCBA 4I8OA 5KPRA 1N77A 4GHAA 4B3RM 2OQ4A 3DSOA 2KZ4A 2JJ2D 3WW7A 5FPSA 3HJSA 4S12A 3SBJA 3T1HM 4QNRA 4DT4A 3LVWA 2XF3A 3KS8A 2L09A 5E26A 4YY3M 3KNXA 4LF8M 4II7A 1R7RA 1S6LA 3W0FA 2JJ1D 3U1JB 3GLIA 2UXBM 2R65A 2G8LA 1G4AE 3HU2A 3LVVA 2F5SA 2UUBM 1SKYE 2KFWA 4XD7D 2X8AA 3SU1A 1W3CA 3M6AA 4A1TA 1Q3CA 4FCVA 3N99A 3W0LB 4BLCA 4YHHM 4RF0A 5FLXS 3FKEA 3HJQA 2XZFA 1D2NA 3LONA 1SXJD 4QHTA 4TUWA 2CK3D 4L16A 4KO8A 5ESBA 1Z5BA 3JAMS 4Q63A 2GGVB 4PT5A 3UZUA 4IBFA 3R8FA 4U01A 2R18A 4JI1M 4G4OA 3SUEA 3JR5A 3U6SA 2R4EA 3KP0E 3GPXA 3SU5A 2M2AA 1A1RA 4IBEA 3OAAD 1NJFA 3FYCA 4G4RA 3U5ZB 1K3XA 3M5LA 2V1CA 4I4LA 4NOOB 3AFHA 3DFZA 1QVRA 3SYLA 2O5RA 2VQEM 1J5EM 3GQ4A 3KN2A 1XXHB 2A4GA 2Y0QA 5LMNM 5B6LA 4D81A 2OC7A 2UUAM 3O8BA 4DV1M 1DGGA 4A92A 3U6EA 3A45A 1MU5A 2FM2A 5C17A 3SU2A 5FTNA 2CV1A 4TT3D 4JI5M 1H8HD 5KQDA 2JA2A 3SV8A 2VBCA 4K8BA 4XBOA 4ITQA 1XWIA 4OVZA 2KXEA 1WXRA 5IDKA 4NXMM 4GC9A 4M0DA 3RC4A 1IY1A 5KQ8A 2D7GA 5FTKA 4LF6M 3E4RA 1N33M 4CHTB 3PNYA 4EIWA 3OTPA 3O8DA 4Q4LA 5EPYA 3GQ3A 1KYIA 4NXNM 1IN7A 3J81S 3OTOM 3F3BA 1JQJC 3LOXA 1HNZM 1KMHB 2XLJA 1GVNA 3GRUA 3U61B 5T1VA 5FPYA 3FTFA 3CTWB 3SHGB 1PM5A 2C9CA 1NY6A 4DR5M 2LXEA 3K8ZA 5CHBA 2DXIA 3QWLA 4JI6M 3KOYE 4TYDA 3ZIAD 4IBDA 1GLNA 3GQ5A 3U60B 2YR0A 3HJ8A 3I51A 4B7HA 5H37D 4JI2M 3F0PA 1DO2A 1N75A 3TE6A 3N7DA 1G8PA 3DOAA 2L6OA 4LF5M 3RE8A 5DYGA 5IWAM 2UXDM 2GVFA 1N1LA 3E90B 3SMPA 3PV5A 1LV7A 2XSZA 5H4IB 4OU7A 5E6JA 4X66M 3H09A 1TH2A 1L8QA 1DY8A 1H8ED 4I31A 2KW0A 2DWLA 4RF1A 4D82A 4LFCM 4ZCNA 1SXJE 2R62A 4LG2A 4Z8XA 4GIPA 4LZZA 3U5ZA 3O8CA 1IN8A 3WWBA 4LFBM 1W0JD 4OX9M 3PFIA 1W5TA 1E32A 1HR0M 1OFHA 4FD2A 1H6UA 3PNVA 2RGOA 2QP9X 1XXHA 1IXZA 3JR4A 2QV1A 4GITA 3AOEA 4MH0E 1EFRD 2YMSC 4X65M 2HL7A 5FTLA 4B76A 3GP1A 1DGHB 5ITYA 1NNJA 5FL7D 3SYJA 1GKIA 4GRIA 2C9OA 3AL0C 1TDZA 3PVSA 2Y20A 3CF2A 3HHWA 1HQCA 1TH3A 4MGZE 5C0UA 4PD2A 2BJWA 2BJVA 1Q3BA 1CU1A 3SU3A 2UXCM 5DYIA 4WH6A 2D7EA 4FCTA 3PRBA 2X4AA 5ITQA 5JI2E 3K92A 2DZOB 4B75A 1IN5A 2QENA 4DV6M 2YNMD 4G4QA 4JI7M 3UK6A 2KEBA 3FD9A 5EQQA 3SAWA 3RGPA 3FUWA 2K1QA 4B7GA 2FP7B 5DN6D 4DR1M 3OYPA 3CF6E 2XFSA 3U61A 2OBQA 2ERCA 2LWXA 2AHME 4B74A 3HU1A 5BR8M 5C1BA 4D80A 1RGQA 1TGUA 2V6ZM 4B3MM 2DVWB 2QF5A 3VG8A 2RKOA 4QOZC 2KR7A 4M0WA 3SC3A 4JV5M 5F53A 3W1EA 3GLGB 1NHWC 1KSFX 1SXJA 5EXSA 1HT1E 3EIHA 1VDDA 2F5QA 4AKGA 4JXJA 2UUCM 4ZPXA 1DY9A 2FFJA 2W6ID 4GKKM 3SARA 1YUBA 3J2PB 1NSFA 1DO0A 4G4NA 3KF2A 4HLQA 2KRKA 4QOSA 5GPIB 3K2LA 4G6ZA 4AKIA 4B6FA 2M5ZA 3KSXA 4B6EA 4R7GA 3NBIA 2EUCA 3TPZA 4FWGA 2C5RA 1R6BX 2F5NA 1FJGM 2KCAA 3L27A 1QAMA 3FN8A 4OM9A 2OC8A 2F9VA 4DUYM 4JMYA 2CHGA 1TDHA 2L7HA 4BB9A 1PJJA 3GLFB 5C18A 1NY5A 2F4LA 1HQYE 1Z5AA 3OEED 4P16A 4DR4M 2WPDD 1ORYB 4MGYE 3SZEA 4GH9A 4F55A 2XCNA 1IM2A 1I94M 3A98B 4AQYM 3ZCBB 4I81A 1OFIA 3SUFA 1JXPA 2AHMA 5EQTA 4I5SA 4CISA 1DGHA 4WH8A 2F43B 4REZA 3SFZA 2XNDD 3F2FA 4FCWA 2CUZA 4WW0A 3M5OA 4AW4A 4M9SA 3M5NA 4KHPM 3F2GA 1XMOM 4DR3M 2Z3XA 4DV5M 2XNIA 1JR3D 1QYRA 5FSWA 2VIIA 4AKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6O A; 
#chains in the Genus database with same CATH topology
 1AIX H;  3P8F A;  1FAK H;  2WUC A;  3QGN B;  1R2Y A;  8KME 2;  3ELA H;  1IY0 A;  1XUI A;  5HM9 A;  3GLH B;  3SYK A;  1UVO A;  2F9U A;  3BTH E;  3HAT H;  4NGA H;  1XC8 A;  2FO9 A;  4QT8 C;  1W5S A;  1QQW A;  2M5T A;  2V35 A;  3U6Q A;  1QZM A;  1IBM M;  3HZJ A;  2VDB B;  1D3T B;  4LF7 M;  1UCY H;  2GCT B;  1HAV B;  2ZBK B;  3U6P A;  1SQT A;  2BDB A;  1DWE H;  2JXN A;  4LJ6 A;  3A8D A;  5KPZ A;  5FHT A;  1CHO F;  2HWL B;  1ZMW A;  4GMQ A;  4WF8 A;  5GJ4 B;  4I8L A;  1FXY A;  2ZZU H;  5L2Z H;  3T6P A;  3STJ A;  1IQM A;  1IFY A;  2IJD 1;  2O8M A;  5FBE A;  1JBU H;  4NSR A;  2ZHD A;  1ZOM A;  1V2M T;  1Z5C A;  1AWF H;  3GLH E;  1A5H A;  1ZRK A;  1GJA B;  3SJ9 A;  1AGJ A;  1TBR H;  1O2R A;  2WYJ A;  2J98 B;  4ABB A;  5JYI A;  1Z59 A;  4K1S A;  2V0B A;  3KVW A;  1HJ9 A;  1EOL A;  1GCD A;  5EP3 A;  2G51 A;  2DZN B;  4ZHA A;  2XOK D;  3SGQ E;  1A4W H;  1BJU A;  1FI8 A;  1D0M A;  1Z7K A;  1E34 B;  2UUK B;  2SGD E;  4ZXY H;  2R0I A;  3D8B A;  1IBK M;  1K1P A;  1OWD A;  1COW D;  2Y21 A;  2P3F H;  2ZCH P;  1GL6 A;  2F4V M;  1GGD B;  1HFD A;  4MGK E;  1X37 A;  3QYE A;  1TPP A;  2V7Q D;  3VKG A;  3ATK A;  3QTV H;  3PLB A;  1L2B A;  1D3D B;  2GNO A;  4WXI A;  1FLE E;  1B0F A;  2FYR A;  2KCY A;  3RC5 A;  1EAU A;  4JYU H;  3HHZ A;  4MQA A;  2CHV A;  3RDZ A;  3FAO A;  2HCB A;  3AK5 A;  1HIA A;  2DWZ B;  1SGT A;  3AKZ A;  4NWK A;  1NRS H;  2VWL A;  3I4V A;  5DP7 A;  3HGI A;  1E1R D;  5J4S A;  4K3J A;  4PCZ A;  3BBZ A;  4GAW A;  4B2C A;  4AFZ A;  3SNB A;  2EO2 A;  1ZMJ A;  1F0U A;  3J7B A;  1HYL A;  1N8O C;  1W0Z U;  4I32 A;  4JI0 M;  1Z1I A;  2XBY A;  1YPE H;  1MD8 A;  2Y7X A;  1GL0 E;  5E8E H;  5EW1 H;  2ZU4 A;  1E9S A;  5JBB S;  1SGF A;  1XMN B;  3C1K A;  4GC5 A;  3RXP A;  3VEQ B;  4LJ4 A;  2ZAM A;  4B3S M;  3BG4 C;  2GQF A;  5EP2 A;  3AW1 A;  1LVM A;  1ZGV A;  3KQB A;  1WHC A;  4K0K M;  1FUJ A;  3H4J A;  5FCK A;  3C27 B;  3O8R A;  4DY7 B;  4FUF A;  1V2U T;  2OK5 A;  2NQ8 C;  2XZU A;  1LVB A;  3TWL A;  4DR7 M;  1EST A;  2FLR H;  3QN7 A;  3VK7 A;  1NV8 A;  1IQI A;  1FNN A;  1TRM A;  2W82 A;  1N34 M;  4NSO B;  3L2A A;  1WDI A;  2QBY A;  1GHB G;  4IN2 A;  2J97 A;  1BRB E;  1JWT A;  4X8S H;  1AVX A;  1TAB E;  4CIZ A;  1V2V T;  4L8R C;  1P01 A;  3B74 A;  1SI5 H;  1QAO A;  3SUG A;  3A86 A;  4TSF D;  2F9B H;  3LPR A;  3B9P A;  3IG6 B;  2CE7 A;  4TPY A;  5A0C A;  3FUT A;  2ZCL P;  1THS H;  3KDS E;  3AOG A;  1AKS B;  2R6F A;  8GCH G;  2PFE A;  1LMW B;  1BBR E;  1OAI A;  1K1J A;  3ZH9 B;  1GDN A;  1SR5 C;  1O5F H;  3C58 A;  3MHV C;  2FOI C;  1E94 E;  2WSC F;  1L1G A;  1CA8 B;  3M61 U;  5KPT A;  3MU1 A;  4AYV B;  5LPR A;  1E37 B;  3NCL A;  2BNK A;  4LJ9 A;  4JK6 A;  5KED A;  8CAT A;  1EAI A;  1PPC E;  4WME A;  2OIN A;  2R9P A;  1O5A B;  2A2X H;  2LNH C;  1NU7 B;  4K5Z A;  4G3O A;  2DWN A;  3GRR A;  3TH2 H;  1IAU A;  1QRW A;  4LRS A;  5EG4 A;  1BCU H;  5FAH A;  3R9X B;  4K60 A;  1O3L A;  3MK6 A;  1SGE E;  1GJ4 H;  4LOY H;  4JI3 M;  1G59 A;  4X2X A;  1QJ6 B;  2VIO A;  3T38 A;  2Z7J A;  5BPV A;  3KEE A;  3KGP A;  4RSP A;  2Z6B D;  3S69 A;  1QQU A;  3TLO A;  3VFD A;  4KOD A;  1BMN H;  4AG6 A;  4YLU A;  1BTH H;  1P2J A;  3CEN A;  1O2X A;  2XYA A;  3RXT A;  2A31 A;  5EU8 A;  2J95 A;  3UNS A;  2XSZ D;  1N8O B;  4IBG A;  2XC0 A;  3DA1 A;  1WBG B;  2D7H A;  4AI6 A;  3U6C A;  1G30 B;  5DJ7 A;  1C5T A;  1O2Y A;  3TJV A;  3CS0 A;  3T28 A;  4K69 A;  3SMS A;  1FIZ A;  1MN3 A;  2QCY A;  4DV3 M;  1EQ9 A;  4E7R G;  3F9H A;  2EKK A;  1PPB H;  1P9U A;  4QNM A;  1UM8 A;  1KXE A;  4MGI E;  4JYA M;  2CV3 A;  1TBQ H;  4B08 A;  3CNR A;  2FOG A;  3LT3 A;  4BNR A;  4Z6A H;  3A80 A;  2P59 A;  1DUE A;  4L4U A;  3E9S A;  4DV4 M;  4LF4 M;  1I4W A;  4RT1 A;  1FDP A;  5ITT A;  2F5P A;  4ABG A;  8EST E;  4I7Y H;  3RXH A;  3GY6 A;  3U6M A;  5EW2 H;  2C99 A;  1NRP H;  3BXW A;  2I6Q A;  4FUC A;  3THG A;  2Z7F E;  1BUI A;  2BDA A;  4PDI A;  3F1S B;  5CMX H;  2DNA A;  2FOD A;  2LVQ D;  1BTW A;  5KPR A;  1HXE H;  1N77 A;  4DCD A;  4KTU A;  3FRI A;  5EJL A;  3RXQ A;  5JDU B;  3SBJ A;  3T1H M;  1XKB C;  2H9H A;  4HI3 A;  3LVW A;  3TPI Z;  3UY9 A;  2XF3 A;  4DT4 A;  3MU5 A;  4II7 A;  1C5N H;  4AG1 A;  4J2Y B;  4K2Y A;  1UHB B;  2UXB M;  2R65 A;  1KLJ H;  4MNV A;  1G4A E;  4WMD A;  2KFW A;  1LTO A;  2LPR A;  1MJG M;  4X1Q U;  3SU1 A;  1BTU A;  2PHB A;  3AAS A;  1C1O A;  2CXV A;  1Q3C A;  1YPH C;  3N99 A;  3W0L B;  2FOC A;  2QXG A;  3FKE A;  1O2N A;  2ZNK H;  1OQY A;  3LON A;  1QUS A;  4JZD H;  2J98 A;  5ESB A;  3EE0 B;  5C5N A;  3R0F A;  4PT5 A;  4IBF A;  2R18 A;  3JR5 A;  3PMH B;  4ABF A;  3KP0 E;  3GPX A;  2PW8 H;  5CE1 A;  1MKW K;  3GDS A;  3FYC A;  1QB9 A;  4G4R A;  1U6Q A;  4SGA E;  5DKM A;  1BRU P;  4X8T H;  4Y76 A;  3MTY A;  4I4L A;  1KTT B;  1NRO H;  1S0R A;  2HOB A;  5TCA A;  5E2O A;  2O5R A;  1T32 A;  1QQ4 A;  3A82 A;  3GQ4 A;  4OGY A;  2ZTY A;  2OQU A;  1XXH B;  1BVS A;  4INL A;  4XBC A;  2P8O B;  4Q7Z A;  3ZZB A;  5JB8 S;  1O3N A;  1SMF E;  2P16 A;  4A92 A;  4ZH8 A;  2FM2 A;  1GBL A;  1O3I A;  1HAO H;  1GBT A;  3M7U A;  1C5R A;  1OWJ A;  2HLC A;  4XSK U;  5BPE A;  5K0H A;  2VBC A;  2GJG A;  2ZTD A;  4B2B A;  5C3N A;  1WXR A;  1AI8 H;  4M0D A;  3RC4 A;  3ZZD A;  1PGY A;  1GHB F;  1LHE H;  2L4F A;  2FES H;  1D4P B;  2SNW A;  3OTP A;  4EIW A;  1KYI A;  2JZ1 A;  3J81 S;  1M9U A;  2AFQ B;  2BQW B;  3F3B A;  1XXH E;  1HNZ M;  4I8K A;  3A8A A;  1WR1 B;  3GRU A;  1JMO H;  2ALP A;  3TK6 A;  3U61 B;  3PYH A;  1OS8 A;  2PGQ B;  1O3G A;  3SHG B;  1NC6 A;  1K1I A;  4RKJ B;  1PM5 A;  4OGX A;  2C9C A;  1GBB A;  2SGE E;  1NY6 A;  1PRB A;  3K8Z A;  2BXT H;  2A45 B;  1LQE A;  1E36 B;  5CHB A;  1EP6 A;  2B7D H;  3SI4 H;  5J4Q A;  3RLY H;  4BAN B;  1VIT G;  1O3B A;  8GCH F;  1YKT A;  4IBD A;  3EAJ A;  3K6Y A;  1QL8 A;  3U60 B;  3HJ8 A;  3I51 A;  1HNE E;  1QGF A;  3N7D A;  2J9N A;  1RRK A;  2BD2 A;  3RXA A;  3SNC A;  1NM6 A;  2A7H A;  2CJI A;  3EQ0 H;  2KNZ A;  3LGI A;  3PV5 A;  2ZDN A;  3VPK A;  4OU7 A;  5E6J A;  1GJ8 B;  1TH2 A;  1L8Q A;  1BTY A;  2SNV A;  2VIW A;  2KW0 A;  1TBZ H;  3MU4 A;  3SGA E;  2ZFF H;  4LFC M;  1HPG A;  2BVS H;  1V2K T;  1SXJ E;  2FX4 A;  3UWI A;  4GIP A;  3U5Z A;  1TA2 A;  1YCP M;  4AYY B;  4LFB M;  2AGI X;  2FPZ A;  3ATL A;  5A8Z A;  3PFI A;  3I29 A;  4M7G A;  1LHG H;  2WSF F;  4AFQ A;  1TMU H;  3PNV A;  1DDJ A;  1BML A;  1NES E;  1Q3X A;  3OU0 A;  2QP9 X;  1WCZ A;  2ZEC A;  1KLT A;  1AIP C;  1EFR D;  5FTL A;  1AQ7 A;  1GBH A;  1Q31 A;  1Z1J A;  3AVZ A;  1CHG A;  5FL7 D;  3SYJ A;  1GKI A;  2SGA A;  1L2E A;  2PUX B;  1VQ1 A;  1IQE A;  1OP2 A;  2AIP A;  1EXF A;  1Y59 T;  2BDY A;  3ZVD A;  1MTN C;  1HQC A;  2AEI H;  5C0U A;  4UD9 H;  2Z3E A;  1SLX B;  2G4U A;  3RXU A;  1V2Q T;  2BOK A;  3S7K B;  1SGP E;  2JET C;  2EI6 A;  2B8O H;  3IWM A;  4IMZ A;  4B75 A;  4NIY A;  1Y3U A;  5L8R F;  4BAK B;  1LPG B;  4G4Q A;  4JI7 M;  1F0R A;  3FD9 A;  1FY3 A;  3SAW A;  1HJP A;  3F9G A;  4B7G A;  1SGI B;  1YPH E;  1O31 A;  2RRU A;  2QF3 A;  2XFS A;  2OBQ A;  2O9Q A;  1O5C B;  2ZTZ A;  3OY6 U;  3W95 A;  4B74 A;  2BYA X;  5BR8 M;  2QF5 A;  1TGU A;  2V6Z M;  4B3M M;  1T4V H;  3B9F H;  1T31 A;  1YM0 A;  1XUG A;  4M0W A;  1EJM A;  1YPG H;  4JV5 M;  1EAT A;  1GBC A;  5F53 A;  1TNL A;  1FIW A;  3LGU A;  1DLK B;  2TGD A;  1P12 E;  1FMG A;  2FMJ A;  2F5Q A;  4AKG A;  2UUF B;  4JXJ A;  3BTT E;  4B2A A;  4CRC A;  3B8J A;  4Y7A A;  1YUB A;  4O97 A;  3E91 A;  4YM9 A;  4F4O C;  1SFQ B;  5A2M H;  2FH0 A;  1DO0 A;  5EST E;  4HLQ A;  4THN H;  4IC6 A;  4ZKN U;  2A1D B;  3K2L A;  5EOD A;  1TNJ A;  1SGD E;  1TOM H;  4XOJ A;  5DP8 A;  2WSE F;  4FWG A;  1P2O A;  2J94 A;  2F5N A;  1L4Z A;  1O36 A;  2ZFT A;  4GVU A;  3L27 A;  1QAM A;  1MTS A;  4GSO A;  4OM9 A;  4X2Y A;  1LKA A;  4AC9 A;  1A61 H;  1GHA G;  1NRQ H;  3GDU A;  3KHV A;  3BEF B;  1C2I A;  4IC5 A;  4WWY A;  4DW2 U;  1PJJ A;  3TU7 H;  1NY5 A;  4NIX A;  1TAL A;  1OTR A;  4NA9 H;  1O2T A;  2WPD D;  4MGY E;  1O5G H;  1P9S A;  2TGP Z;  4F55 A;  2UUY A;  5I25 A;  1GPZ A;  2ZHE H;  4B1T A;  2BVR H;  1IM2 A;  1KXC A;  2HGT H;  2ZGC A;  4XRN A;  2ZC9 H;  3EDX B;  3U8R H;  3ZCB B;  4DJZ B;  1V2L T;  1OFI A;  3SUF A;  1DWC H;  1P2N A;  2AHM A;  1HB0 B;  4P00 A;  1PJT A;  1AB9 B;  3T29 A;  4D9R A;  1NV9 A;  1QIX B;  1GBK A;  1Q02 A;  4AW4 A;  2ZGH A;  4MTB A;  4Y11 E;  1WTH D;  3FE3 A;  3SJI A;  1JR3 D;  2EKF A;  3E21 A;  4NSY A;  2ODP A;  4NZL A;  1PPG E;  2VII A;  2WPI S;  2GV7 A;  4KLN A;  2QXJ A;  1G3C A;  5DNY A;  1V6D A;  5K7R A;  3RXJ A;  1PQ7 A;  5DP6 A;  1OSS A;  1OYQ A;  1F0S A;  3M35 A;  5DP3 A;  7KME H;  2ZO3 H;  5AVD A;  3IG8 A;  4HGC A;  3FTC A;  1GL1 A;  1O5E H;  4TPI Z;  1MMJ N;  1UHB A;  3DSP A;  3PMJ A;  3STI A;  1C2D A;  1LVY A;  1OIZ A;  1TF0 B;  1SGF G;  1YY3 A;  1O2J A;  1MD7 A;  3GCO A;  5TCC A;  2K9D A;  2R3U A;  4R71 A;  1MKX H;  4GCH G;  1DGF A;  3WW7 A;  5IDK A;  2HNT C;  1NS3 A;  1G2L A;  4I8J A;  2CFO A;  1EOJ A;  3NZI A;  5C0T A;  2WUB A;  3D8L A;  1WIV A;  4Z6Y A;  1ESB A;  3LQQ A;  3WY8 A;  4AX9 H;  3MFJ A;  1PYT D;  4GKJ M;  3GCH B;  4DBG B;  1Y5U T;  1ZHP A;  1TR8 A;  1HXF H;  3MH5 A;  4SGB E;  1ELB A;  1W14 U;  1X7A C;  2QBY B;  5FPT A;  1GI2 A;  3KOZ E;  2XRC A;  2ZTX A;  4LZJ A;  1GJB B;  1VIT F;  3U6O A;  3H7O A;  3NXP A;  3SU0 A;  1DSU A;  3SV6 A;  3NK8 A;  3TK5 A;  4Y8Y A;  4AG2 A;  1K82 A;  1NTP A;  4IIW A;  2BD3 A;  2ZU5 A;  5EXP A;  2QF4 A;  3LU9 B;  3ZVE A;  2MJ5 B;  3L3T A;  1R4G A;  3GLF A;  1ZML A;  5E0H A;  5FTM A;  3OEH D;  4NIV A;  4B71 A;  2W7S A;  1MAB B;  4JYT A;  3VB4 A;  3P17 H;  1A3B H;  1C1S A;  3ZZ7 A;  1RS0 A;  2J7O A;  1MU8 B;  2WZQ A;  3OX7 U;  3PV2 A;  1UFZ A;  1O3E A;  2WHX A;  4NA8 A;  4Z1M D;  3A46 A;  1OIP A;  1C2H A;  3PO1 C;  1INC A;  3SAU A;  1KXF A;  3FKS D;  1GHY H;  4Q7J A;  1C2J A;  2JUJ A;  2ZHQ H;  1TMT H;  6EST A;  5GKN A;  3MJ5 A;  3A7W A;  3F0O A;  2WYG A;  1RJX B;  4JI8 M;  1XUJ A;  2FYQ A;  1RTL A;  4YES B;  2C96 A;  1BRC E;  1SGC A;  3FZD A;  1VCW A;  2AYW A;  1SQA A;  1ESA A;  4I86 A;  3LMM A;  1ZTL A;  2BLO A;  2WV9 A;  3QUM P;  4MNY A;  1T8M A;  4FET A;  1HAI H;  1GG6 C;  3ZYE A;  3U60 A;  3SAT A;  4OS1 A;  1ZPB A;  1B5G H;  2Y82 A;  1WYK A;  3L28 A;  4UON A;  3KXE C;  5LGO A;  2KRU A;  3FZZ A;  1T8O A;  1K22 H;  1UTQ A;  4A1X A;  2JH6 D;  1OAO C;  4BAM B;  2YQZ A;  2VIN A;  3A7V A;  5EQR A;  2G5V A;  2JH0 D;  2QN5 T;  3W68 A;  1SHY A;  1NBM E;  1RFN A;  1QRX A;  1O3P B;  1O2G H;  4CBO A;  4NRV A;  3MO3 A;  1WOF A;  4LFA M;  1IXR C;  3RMN H;  3BOS A;  2PKA B;  2M60 A;  2TGA A;  1TRY A;  3TIU A;  1ZSL A;  2R46 A;  1S6F A;  1QBO A;  4XFQ A;  2K8I A;  1TYN A;  4BAH B;  3FOA A;  2CV0 A;  3SBK A;  2OOA A;  2BHG A;  1C2K A;  3MNB A;  6CHA B;  2KCP A;  1B7X B;  4LJ8 A;  2R45 A;  1DST A;  1O2Z A;  2VID A;  2XW9 A;  2GT8 A;  2VVC A;  3DUX H;  2C3S A;  3GY7 A;  2P95 A;  3UUZ A;  4A6L A;  3RP2 A;  5KEC A;  4RNA A;  2FI3 E;  2KCO A;  1NO1 A;  2ALV A;  1A5T A;  2XWA A;  3HU3 A;  1S85 A;  2ZM6 M;  2JDI D;  1MTU A;  3K1J A;  4J1Y A;  5HKK D;  1C2G A;  5EXN A;  1YF4 A;  2B0F A;  1GHA F;  3A85 A;  2F9O A;  5IYT A;  3SV2 H;  1L2D A;  4NZQ A;  1GI5 A;  3KW6 A;  1SBW A;  1EX3 A;  2DWM A;  3ATI A;  4LZ4 B;  2B5T B;  3A87 A;  5GIB A;  1GAB A;  1C5L H;  1W7X H;  3FUU A;  1C5V A;  2YMS B;  2HNT E;  4A5T S;  3M0E A;  1K21 H;  2VWM A;  3A7T A;  4AZF A;  5DSF A;  3KP1 E;  3ZZ3 A;  1BMF D;  3RLW H;  2RA0 A;  1GJ7 B;  1L1T A;  3SV7 A;  2STA E;  1ZQ9 A;  2BDI A;  4MPV A;  4RI0 A;  3A42 A;  1NRN H;  5EXT A;  4LRT A;  3AW0 A;  4NL4 H;  4ZMA H;  4QHS A;  4DOQ A;  3FP8 E;  3PO1 B;  7CAT A;  3SUD A;  3U9A H;  2GMT C;  4A1V A;  4IBI A;  2ZKS A;  2QQ8 A;  2KZU A;  1W0K D;  3TGI E;  3EA7 A;  5ITX A;  3ZZ5 A;  3LH1 A;  4DV0 M;  3VB5 A;  3H5C B;  4DV2 M;  4D7F A;  2CWB A;  1UVS H;  3MO6 A;  4AFS A;  3LJJ A;  5IK2 D;  1PQ8 A;  5ITU A;  2L4E A;  4CH8 B;  4DII H;  4MB7 A;  2EQN A;  3QX5 H;  1ZJD A;  2YNB A;  5CHA C;  4UFD H;  1GI6 A;  2OC0 A;  2HHH M;  2A5A A;  2PWX A;  3U1I B;  1TRN A;  2ZPR A;  3PB1 E;  4GCH F;  2FZZ A;  4FU7 A;  2Y81 A;  4IBK A;  4FWH A;  1XNR M;  1HCG A;  1O2V A;  3HK6 B;  3P8O A;  1SG8 B;  2CHQ A;  1N78 A;  3T1Y M;  4AB8 A;  1GMD G;  1GBM A;  1DPO A;  2V6N A;  4JYV H;  4MM3 B;  1C2L A;  5EJC A;  4JI4 M;  1ZSJ A;  1F2S E;  2HAL A;  2QCU A;  2G81 E;  1DT2 A;  5EP4 A;  3EST A;  2QA9 E;  1Z6T A;  1HAZ B;  1YP9 A;  2C8Y B;  2FOB A;  2KNA A;  1NFX A;  1O2U A;  3IHP A;  3RXI A;  1IXS B;  1V2S T;  1VJ9 U;  2EA0 A;  2Y5H A;  2Y0T A;  1QJ7 B;  3RXR A;  1VZQ H;  2KZS A;  1S6H A;  1C4V 2;  1G3I A;  2P3U B;  3MMP A;  4IBJ A;  4R8T B;  3TNT A;  1GL7 A;  1IQL A;  3BF6 H;  3UQO A;  1IHS H;  4MNX A;  1GI1 A;  3N7O A;  2KNV A;  4Y8X A;  3URD A;  3MU0 A;  9EST A;  3BTK E;  2BY8 X;  5FPS A;  5HIY A;  1E38 B;  5T6D A;  4ABJ A;  1LQD B;  2R2M B;  3KS8 A;  2N35 A;  3HX3 A;  1QRZ A;  1T4U H;  2TRM A;  4YY3 M;  3BSQ A;  4ISI H;  2APL A;  2F9N A;  1SLU B;  2DKL A;  1DFP A;  2JJ1 D;  4ZKO U;  3S9C A;  3U1J B;  3LGV A;  1V2R T;  2K6B A;  1O38 A;  2G8L A;  6LPR A;  2UUB M;  1UTM A;  1CQQ A;  4AB9 A;  1YGC H;  1IQK A;  1RU3 A;  1V2T T;  3LJO A;  1ZHM A;  3QO6 A;  5FLX S;  3DA9 B;  4QHT A;  4UFF H;  5AFZ H;  2WV4 A;  2CGA A;  3GCT G;  1AVW A;  1MZA A;  1TLD A;  1ZSK A;  1QFK H;  4U01 A;  3UZU A;  4G4O A;  1EJN A;  5DK1 A;  3SUE A;  2R4E A;  4WP2 A;  4TWY A;  5JBT A;  3U5Z B;  4ZKS U;  4ACA A;  1ZZZ A;  4ISO A;  2FTL E;  1PPZ A;  3AFH A;  3DFZ A;  1W11 U;  5DG6 A;  7EST E;  3R3G B;  2TIO A;  2WV5 A;  5B6L A;  2XTT B;  4D81 A;  1WQS A;  2UUA M;  3O8B A;  4DV1 M;  1EZX C;  1DGG A;  1GCT C;  3A45 A;  1MU5 A;  1VCP A;  5C17 A;  1SGQ E;  1SL3 A;  1O37 A;  1TA6 A;  2EY4 C;  4PRO A;  1D3P B;  1TGT A;  1H8H D;  1ELF A;  5KQD A;  3E1X B;  3SV8 A;  4K8B A;  1TGC A;  4ITQ A;  4OVZ A;  2KXE A;  3GIC B;  3T25 A;  5KQ8 A;  1MBQ A;  1LHF H;  1GJ6 A;  3PV4 A;  1EPT C;  4H4F A;  3UR6 A;  1S5S A;  2CF8 H;  2LVP C;  4CHT B;  3PNY A;  1S84 A;  2BXU H;  3O8D A;  4Y8Z A;  5CHA B;  2ZI2 H;  5EPY A;  3JZ2 B;  2KX4 A;  2ZPS A;  1BTP A;  2ODQ A;  2FOF A;  2W5E A;  4DUR A;  1A3E H;  2QHO B;  3F9E A;  3RU4 E;  1J9C H;  2GT7 A;  3URC A;  3QWC H;  2ZFS A;  3UQV A;  3QWL A;  3ZIA D;  2EI8 A;  4TYD A;  3TH3 H;  1QTF A;  3GQ5 A;  4L6V 6;  3F0P A;  2NU0 E;  1GVZ A;  3D49 H;  1N75 A;  1ETR H;  3U8T H;  2VGC C;  1G8P A;  5GWZ A;  4LF5 M;  4D8N A;  5IWA M;  1GJ9 B;  2GVF A;  3P6Z B;  4FOU C;  4MDS A;  2L2D A;  3OTJ E;  3E90 B;  3TJU A;  3PM3 A;  2XSZ A;  1GVK B;  3K6Z A;  1O2K A;  3P92 A;  1CGJ E;  1E0F D;  2AMQ A;  1OPH B;  4I31 A;  2PKA A;  2VVV A;  1A0J A;  1D6R A;  3K65 B;  1LPK B;  1Y3W A;  1VEK A;  3U28 C;  4LG2 A;  4NC6 A;  3KYG A;  4Z8X A;  2AMP A;  3O8C A;  3WWB A;  1W0J D;  1LCY A;  4OX9 M;  2R0L A;  1UK2 A;  3MYW A;  1H1B A;  1MU6 B;  1E32 A;  1HR0 M;  1OFH A;  2GTB A;  4FD2 A;  3BG4 B;  4YT6 H;  3SJO A;  5EJ1 A;  2CP8 A;  1O2O A;  2WPM S;  2RGO A;  3RXV A;  2SGF E;  2QV1 A;  5FX5 A;  4X65 M;  1PFX C;  1SG9 A;  3RXK A;  1C2F A;  1YCP K;  1EUF A;  4TY7 A;  4Q7X A;  1EKB B;  2Q6F A;  2R2W U;  4AGK A;  4GRI A;  2C9O A;  1EZU C;  3QTO H;  3PVS A;  2Y20 A;  1CE5 A;  3HHW A;  4ZKR U;  4PD2 A;  5KGO A;  1DLE A;  1N6X A;  1OWH A;  1DAN H;  2TBS A;  1Q3B A;  4AFU A;  3SU3 A;  5JPM H;  2C90 B;  3Q76 A;  2PLX A;  2D7E A;  1UTK A;  4FCT A;  3SOR A;  3PRB A;  5JI2 E;  1JB0 F;  5SGA E;  2BY5 X;  1IN5 A;  1GBD A;  4ZHM U;  2YNM D;  4UDW H;  2DAE A;  2KEB A;  1GMD F;  4Q2K A;  4Y71 A;  1IHT H;  2EEK A;  1QA7 A;  3OYP A;  2QXI A;  1BRA A;  1OXG A;  4O3T A;  3EA9 A;  2Z3D A;  2LWX A;  2AHM E;  5C1B A;  1GJC B;  2F83 A;  3VG8 A;  1GCT B;  4R0I A;  1TE0 A;  1GBE A;  1JRS A;  2FS1 A;  1KLI H;  2VU8 E;  1NHW C;  1OKX A;  1KSF X;  5EXS A;  4WY3 A;  1UCY K;  1V2P T;  5AF9 H;  1C1R A;  1UTL M;  1DY9 A;  2Z94 A;  4Y0Y E;  2W6I D;  4GKK M;  3SAR A;  1EPT B;  1S82 A;  1FY4 A;  3LDX H;  3GY4 A;  3RMO H;  4X2W A;  2KRK A;  5GPI B;  4XE4 A;  2FX6 A;  4G6Z A;  2V3H H;  1SGN E;  3MH6 A;  2QC2 A;  3W67 A;  3I77 A;  4B6F A;  1QL7 A;  3BTF E;  2EUC A;  3TPZ A;  2C5R A;  5FX6 A;  2Z9I A;  3QGJ A;  1A5I A;  3HY5 A;  2KCA A;  2QAA A;  1C1Q A;  1LVO A;  1NO9 H;  1VR1 H;  2F9V A;  4KT0 F;  2OC8 A;  1IQJ A;  1Y8G A;  4DUY M;  1O2S A;  1NPM A;  2ZFR H;  2BVX H;  3BIV H;  2CHG A;  5JB9 S;  1TDH A;  4JZE H;  2F9P A;  2VJ1 A;  2L7H A;  1A5G H;  2QF0 A;  3A88 A;  3VXF H;  3GLF B;  1MZD A;  2FTM A;  4DR4 M;  5EIY A;  1PQ5 A;  5B6O A;  1ANC A;  3GCT F;  2VGC B;  1GI3 A;  3A98 B;  1F92 A;  2ZU2 A;  4I81 A;  1CT0 E;  2R44 A;  2AS9 A;  1JXP A;  4I5S A;  1IXS A;  1DGH A;  3VB6 A;  1C4U 2;  2JY5 A;  2F43 B;  4REZ A;  2O8T A;  3A7Z A;  4FCW A;  3KQD A;  2XXL A;  1PPH E;  3F2G A;  1T8N A;  1SQR A;  2XNI A;  2BX3 A;  1G71 A;  3MH7 A;  2G55 A;  2OLG A;  2OTV A;  1FQ3 A;  3GLF E;  1ACB E;  4AKH A;  1O2I A;  3T26 A;  1TOC B;  1G37 A;  3EYD A;  4KTS A;  4UFE H;  2ZP0 H;  2W6J D;  1G32 B;  1QA0 A;  2B3T A;  5GND A;  4BXW A;  2MGW A;  5FBI A;  1AE8 H;  1GDU A;  2ZDM A;  3ATM A;  4K1T A;  3F2H A;  2XFT A;  3ZC7 B;  4BTU B;  3HHY A;  1J14 A;  2G4T A;  1V33 A;  3EIE A;  3SU6 A;  2VH0 A;  3MOC A;  1H9L B;  5KO3 A;  2BZA A;  4XBB A;  1NU9 A;  1OP8 A;  1DUA A;  1HJA C;  4LJ5 A;  3HKP A;  3LCV B;  3TWM A;  2IPH A;  4R3D A;  2JIZ D;  4OW0 A;  1AY6 H;  1C1K A;  3GLG A;  3U6D A;  2JH5 D;  3E46 A;  1VJA U;  2BLV A;  5DP5 A;  1ARC A;  3WHL A;  4X62 M;  4CGY B;  2A7C A;  3A81 A;  2J4I A;  3AOE C;  3RMM H;  3SHA H;  2BDG A;  5FCR A;  2V1U A;  3D62 A;  3AJI B;  4FUI A;  5DP9 A;  5E0G A;  5C20 A;  3L29 A;  1QBN A;  3M36 A;  1GI9 B;  4RT0 A;  1TNI A;  3LC3 A;  2BY7 X;  3A89 A;  1MTV A;  3IG5 A;  1O33 A;  2C8X B;  2CEA A;  1GDQ A;  4O9V A;  1BHX B;  3GRY A;  1NY2 2;  2CHA C;  2QE7 D;  4Y0Z E;  2RA3 A;  2BX4 A;  2Z9J A;  1S0Q A;  1NVM A;  4LGY A;  3IEC A;  2PTC E;  1DIC A;  1P06 A;  3E3T A;  1CA0 C;  4M9F A;  2AGE X;  2HVX A;  1ELE E;  4WVP E;  1C1N A;  1ARB A;  2YFQ A;  1P10 A;  3OE7 D;  1UTO A;  2VNT A;  3F92 A;  3U69 H;  4ABH A;  4ABD A;  1VEG A;  1NNU C;  4FXG H;  2BZ6 H;  3Q00 A;  1F4I A;  1Y3V A;  1SLW B;  1V2O T;  1WU1 A;  3J27 B;  2A4Q A;  2XCF A;  3CF0 A;  2DHR A;  1IBL M;  3ILK A;  2AGG X;  4MNW A;  1HRT H;  2PKS C;  2ZGJ A;  1K3W A;  2EA3 A;  3GY5 A;  2A4R A;  1A46 H;  1KYN A;  3NBX X;  1YPL H;  1TFX A;  2FI5 E;  1DWB H;  4NIW A;  1LHD H;  5ITR A;  5BRR E;  3KSJ A;  1TGS Z;  1E9R A;  3QAU A;  1O3M A;  3SQE E;  4FW9 A;  3QDZ B;  1HDT H;  2ANM H;  2J38 A;  1CGI E;  2C8W B;  4ZXX H;  1R2Z A;  1WGL A;  2QIQ A;  1MQ6 A;  1LKB A;  1K1N A;  2FI4 E;  1E1Q D;  1DV0 A;  3B7Z A;  5F8Z A;  4I33 A;  1G36 A;  4DUZ M;  1KFV A;  3ZVG A;  1IY2 A;  1CVW H;  1DXP A;  3M7Q A;  1BDA A;  3ITI A;  3U6L A;  3QZQ A;  5GCH G;  4GEW A;  3TL4 X;  4Y7B A;  4IGD A;  1NJG A;  2MH8 A;  3ZZ4 A;  1L1N A;  2LHG A;  2K0Q A;  3T5F H;  4LGM A;  1QZE A;  3KS4 A;  1TX6 A;  2I7P A;  1XX9 A;  2HPQ H;  4CRA A;  3UJN A;  3GS9 A;  2BMG B;  4H6T A;  1E35 B;  3Q77 A;  3DFL A;  3GRV A;  3MMG A;  1JIM A;  1H4W A;  1C5Z B;  1Z8R A;  1FZZ A;  3KQC A;  4W5W A;  1QDR A;  3RGS A;  1XVO A;  3GPP A;  3E6P H;  1C5W B;  2LP6 A;  4B73 A;  2JNH A;  1N36 M;  1CO7 E;  1C5M D;  3SO3 A;  1OWK A;  4A3V B;  3LW5 F;  1WSS H;  3DHK H;  2R3Y A;  2VVU A;  1KXD A;  5ITX E;  1G2M A;  2Q2E B;  1HJA B;  3HKJ B;  3GY3 A;  1A7S A;  3UNQ A;  5EP1 A;  3UFA A;  1W12 U;  1EAX A;  2C98 A;  3RXM A;  1HLT H;  1TH4 A;  3MHW U;  1V2W T;  4HTC H;  3T2N A;  4ABE A;  4Q80 A;  2A5Y B;  1JOU B;  5HGG A;  3PRD A;  1QUR H;  1JR3 A;  4XGI A;  1MBM A;  4AGJ A;  3NPS A;  1HAY B;  2OQ5 A;  3DFJ A;  1TNH A;  1PJI A;  3TQS A;  4ISN A;  2QNJ A;  3V13 A;  4O03 A;  2J5Y A;  4DV7 M;  5IZ7 D;  2CHA B;  2OC1 A;  1P8V C;  1OJL A;  1XM1 A;  4UN2 B;  1O34 A;  1BT7 A;  1CA0 B;  3TWK A;  3ZZC A;  2A0Q B;  2MR9 A;  4X64 M;  2JP7 A;  3NWL A;  3H4M A;  1N6Y A;  1P0S H;  3F9F A;  3MO9 A;  1IQH A;  1MTN B;  4X1N U;  1DM4 B;  2KAI A;  1SB1 H;  3UB0 A;  2JET B;  1BJV A;  3MNS A;  4BAQ B;  1DOJ A;  1EPT A;  5F3W A;  2DHY A;  2KHH A;  3CP7 A;  4FUH A;  4LY6 A;  1AFE H;  2PKS B;  1W0Y H;  2H9T H;  5EOK A;  4LJA A;  2Y80 A;  4I8G A;  4M9X A;  3I04 M;  3TGK E;  4BTT B;  3FP7 E;  4NCY A;  3DD2 H;  5EXX A;  1GJT A;  3HHX A;  1SOZ A;  4L15 A;  1XVM A;  3SV9 A;  3UTU H;  1ZMU A;  4GLY A;  5DPA A;  2KM0 A;  1T8L A;  2LEL A;  1P09 A;  1P11 E;  2I6S A;  2H9E H;  1QY6 A;  2XH9 A;  2VQF M;  3NKK A;  3GO8 A;  2H5X A;  2LVN C;  2Y7Z A;  4CRG A;  1KSN A;  5IT9 S;  3V0X A;  3KOX E;  1F5L A;  4HL4 A;  4NSV A;  4Y6D A;  4IBC A;  5A8X A;  3IIT A;  1LO6 A;  1PJP A;  1GHV H;  2L7I A;  1TIO A;  1Z6E A;  1BZX E;  4FVM A;  1GBA A;  2H1R A;  1GMC G;  1EE8 A;  1YSY A;  3DCL A;  1QB1 A;  1IN6 A;  2OPF A;  5HIZ A;  1F0T A;  1XUF A;  3UWJ H;  4OVZ B;  3FUV A;  2VB0 A;  1SFI A;  2R0K A;  2Z9K A;  3P8G A;  4ASU D;  1UTJ A;  5L30 H;  4ISH H;  2R4J A;  1Y3Y A;  3L26 A;  1GHX H;  5C1U A;  3ZV9 A;  4XK8 F;  2BB4 A;  4GPG A;  2J34 A;  2RGH A;  3AAU A;  2Z3C A;  5EXM A;  3FYD A;  3TJO A;  2BLQ A;  1EIJ A;  2QYI A;  1ZLR A;  1UK4 A;  3GCN A;  3SZN A;  2AIQ A;  2W3K A;  1XB2 B;  1YLD A;  3I01 M;  1FX0 B;  4LCB A;  4I8O A;  3E8L A;  4GHA A;  4B3R M;  2CN0 H;  2F3C E;  4D9Q A;  1Y8T A;  2GZ8 A;  2Y5G A;  4X2V A;  2HWJ A;  3RXB A;  3DSO A;  1ZMV A;  1MCV A;  2JJ2 D;  4AOQ A;  3LGT A;  3HJS A;  4QNR A;  3SNA A;  3BN9 A;  4KEL A;  2A4O A;  1GHZ A;  3KNX A;  1WTG H;  1R7R A;  1S6L A;  1SLV B;  3QYB A;  1EAS A;  3GLI A;  1TGB A;  3LVV A;  1SKY E;  2Z8Y M;  1G3B A;  5DP4 A;  4XD7 D;  7GCH G;  3RU4 T;  1W3C A;  3M6A A;  1KIG H;  1H8D H;  4IW4 E;  4UFG H;  1BA8 B;  4RF0 A;  2FEQ H;  1D2N A;  1IQF A;  1SXJ D;  4U32 A;  2JWS A;  4ZRO A;  4I8H A;  4A7I B;  1KTS B;  4L16 A;  4Q63 A;  2CF9 H;  2BWE A;  1C9T A;  1S81 A;  3BTM E;  4CRD A;  1C2E A;  1W8B H;  1QL9 A;  2M2A A;  1A1R A;  3OAA D;  2QSF X;  1K3X A;  3M37 A;  3M5L A;  3A8C A;  1SGR E;  1VKY A;  1QVR A;  3SYL A;  1AVG H;  5C5O A;  1A0L A;  1EB2 A;  3P95 A;  2JY6 B;  4INK A;  4F48 B;  3KN2 A;  1P02 A;  5GCH F;  1GBJ A;  2Y0Q A;  5LMN M;  1KDQ A;  1HAG E;  2SGQ E;  1T43 A;  2VIV A;  3C3E A;  5TJX A;  1Y3X A;  4EST E;  2C8Z B;  2FS8 A;  3RXS A;  1BBR K;  3V12 A;  1ZV1 A;  3SU2 A;  4JK5 A;  2CV1 A;  4TT3 D;  4D7G A;  2W26 A;  4JI5 M;  5A0A E;  5JBA S;  4FVD A;  1ZHR A;  3GOV B;  2MRO B;  1TNG A;  2Q1J A;  1SVP A;  4NXM M;  2A5K A;  1P2I A;  4P02 A;  3ZYD A;  5FTK A;  2PGB B;  3E4R A;  1ZPZ A;  3SHC H;  2W3I A;  1OP0 A;  4H42 U;  3GQ3 A;  4NXN M;  3RXO A;  2BD5 A;  4VGC C;  3OTO M;  3UOP A;  2BQ7 B;  3LOX A;  1TQ7 B;  1GO5 A;  2DAG A;  2XLJ A;  1GVN A;  1THR H;  2DAK A;  3HGN A;  5EXL A;  1QBV H;  5FPY A;  4X8U H;  3CTW B;  1KXB A;  3E0P B;  3SQH E;  1O2H A;  2BM2 A;  2BD7 A;  3FP6 E;  1C1W H;  4FU8 A;  3W94 A;  2Z9G A;  1TPS A;  3ZVC A;  3K9O A;  1V34 A;  2EJS A;  2H2Z A;  3FAN A;  2DXI A;  1PJS A;  4P17 A;  1HJ8 A;  4X1S U;  4HFP B;  3KOY E;  1ID5 H;  1GLN A;  4YLQ H;  4OS4 A;  4JI2 M;  1QB6 A;  3PWB A;  1ZPC A;  1UVT H;  2OP9 A;  1BQY A;  3DOA A;  4E7N A;  2L6O A;  9LPR A;  1ELD E;  2ASU B;  3ENS B;  5HXF A;  1G9I E;  1N1L A;  3SMP A;  1LV7 A;  1MKW H;  1LTM A;  4D76 A;  4FUE A;  4X66 M;  1WV7 H;  1AND A;  3H09 A;  4X6N A;  1DY8 A;  2OCV B;  1H8E D;  3Q8G A;  3UIR A;  1O3H A;  2DWL A;  1AU8 A;  1CT4 E;  2DAI A;  4D82 A;  3S9A A;  1TX7 A;  1GG6 B;  5HM2 A;  1C5U A;  4ZCN A;  2GCH G;  4NG9 H;  1W2K H;  4ZAE A;  1V2J T;  1VG5 A;  1BTZ A;  1O3C A;  1TX8 A;  1AZ8 A;  1FV9 A;  1H6U A;  4ABA A;  2QGR A;  2JZ0 A;  2G00 A;  5EJZ A;  1IXZ A;  3JR4 A;  2OUA A;  3ZZ8 A;  4GIT A;  1ANB A;  3AOE A;  2ZFQ H;  4MH0 E;  3Q3Y A;  3A83 A;  4K1E A;  1L1J A;  4WXV A;  4Y79 A;  2BY6 X;  1DGH B;  3KCG H;  4OS5 A;  5ITY A;  1NNJ A;  1GI0 A;  4MPW A;  2C4F H;  3AL0 C;  1P3C A;  2XC5 A;  5HMA A;  3SOS A;  2ZQ2 A;  3KQ5 A;  1WGN A;  1TH3 A;  4MGZ E;  1AMH A;  2PR3 A;  1GMH G;  2BJW A;  2BJV A;  1J16 A;  1CU1 A;  3SND A;  1P57 B;  3DSG A;  4MG3 A;  2LBC A;  3KID U;  1O32 A;  5ITQ A;  3K92 A;  1NFW A;  1FPH H;  2QEN A;  1GMC F;  1DVA H;  4DV6 M;  1O5B B;  1UO6 A;  3AAV A;  3UNR A;  3UK6 A;  3A7X A;  4HG6 A;  3OY5 U;  1GHW H;  3RGP A;  3FUW A;  1IQG A;  1QNJ A;  1RD3 B;  4E05 H;  3A84 A;  2ZCK P;  2C93 B;  3TH4 H;  4MVN A;  1GI4 A;  3HU1 A;  1YLC A;  1EB1 H;  2J2U A;  4Y10 E;  2GDD A;  1RGQ A;  1Z6J H;  3MNX A;  1AUA A;  3MQK C;  1YYY 1;  1BB0 B;  2YNA A;  2RKO A;  2UWL A;  4QOZ C;  1YPM H;  5L2Y H;  1SSX A;  1O2L A;  1GVL A;  3GLG B;  4X6P A;  1HT1 E;  3EIH A;  1UK3 A;  5E0J A;  4DIH H;  3U98 H;  5PTP A;  2JY8 A;  1JIR A;  2D8W A;  2V3M A;  2FFJ A;  3GDV A;  2FOE A;  2ZG0 H;  3D65 E;  3J2P B;  4ASH A;  1Z71 A;  2SGP E;  2WZJ A;  1MKX K;  1C1M A;  3KF2 A;  2FS9 A;  4VGC B;  1C4Y 2;  1L0Z A;  3K2U A;  2A5I A;  2M5Z A;  3KSX A;  1ZTK A;  4R7G A;  3NBI A;  2VWN A;  1UVU H;  3M7T A;  4FUB A;  5DGJ A;  1FJG M;  4MPX A;  4LZ1 H;  1ZJK A;  5G4B A;  2AMD A;  1ELA A;  1C1T A;  1RTF B;  4JMY A;  1J17 T;  4MPU A;  7GCH F;  4ZHL U;  3GLG E;  1C1V H;  1A2C H;  4DT7 B;  2GMT B;  1HAH H;  2F4L A;  1Z5A A;  3OEE D;  2DE8 A;  4P16 A;  2JKH A;  4GHT A;  1D9I A;  2IN2 A;  5F6M A;  3S0N A;  1TTE A;  5T6G A;  3SZE A;  4GH9 A;  3ZQJ A;  1GWA A;  1QZ8 A;  5T6F A;  4E06 H;  2XCN A;  2DEN A;  1I94 M;  1C5P A;  3UR9 A;  2VH6 A;  3VXE H;  1PYT C;  1YC0 A;  3RXD A;  1ETT H;  2VF7 A;  1KXA A;  4CIS A;  3B7Q A;  4WH8 A;  1GJS A;  2XND D;  3SFZ A;  1GBI A;  3F2F A;  2IPQ X;  4K8Y A;  2G3Q A;  2DUC A;  2CUZ A;  4WW0 A;  3M5O A;  1MUE B;  4M9S A;  4KHP M;  1MTW A;  4RKO B;  2HNT F;  1FN6 A;  2ZHF H;  3U6S A;  1C5S A;  1QYR A;  1R5L A;  1BOQ A;  1K0H A;  1J09 A;  1A0H B;  2ZQ1 A;  2ZAN A;  3RXC A;  1E79 D;  3LC5 A;  4CR5 A;  1F5R A;  5F8X A;  1XUK A;  2H6M A;  3A7Y A;  3KFU G;  1AZZ A;  3FVF B;  5E2P A;  1J7K A;  4NA7 A;  2ZEB A;  3RC6 A;  4IJF A;  2OD3 B;  4U30 A;  4WMF A;  1L2C A;  5C67 A;  2P94 A;  3NWU A;  2QPA A;  2RDL A;  3S9B A;  1AD8 H;  3I4Y A;  2ZU3 A;  2UU9 M;  1MH0 A;  3ODD A;  1NBM D;  1XHB A;  3T15 A;  2STB E;  4FU9 A;  2LH0 A;  2ZGB H;  4IJE A;  1TPA E;  2P8O C;  4YO9 A;  4OS2 A;  1H9I E;  1ZAE A;  5GXP A;  5IRE B;  5DO4 H;  2VF8 A;  1G41 A;  4KTC A;  2ZA5 A;  4CJ6 A;  3BTD E;  5A2Q S;  4CRB A;  4UE7 H;  1YBW A;  1HNW M;  1AWH B;  3BTE E;  4BAO B;  4CH2 B;  4YOJ A;  2J5U A;  3KL6 A;  3SNE A;  1Z8J B;  1QAQ A;  2L74 A;  3SJK A;  2UWP A;  3I78 A;  1GJD B;  3MWI U;  3PTB A;  3VLF B;  3SAS A;  1DE7 H;  1K1M A;  1T7C A;  1CUK A;  4AG5 A;  1H8I H;  2GX4 A;  4NWL A;  5C2Z A;  1QUT A;  1FPC H;  4M9Z A;  1LHC H;  3ATW A;  1P3Q Q;  2P3T B;  3GY8 A;  2A7J A;  3E16 B;  4Q7Y A;  1UW7 A;  1NHG C;  1OX1 A;  1EZQ A;  1L1Z A;  1ZTJ A;  2BOH B;  2PTN A;  2TGT A;  1O3F A;  3M3T A;  5C1Y A;  1BTX A;  3RXE A;  1ANE A;  2TPI Z;  2P5T A;  1P03 A;  1QHR B;  1FAX A;  2BDH A;  2ZFP H;  1HGT H;  4X1P U;  4LJ7 A;  4TWW A;  1EZS C;  1XNQ M;  3TJN A;  1SXJ C;  2XGN A;  1IOE A;  2GCH F;  5ETX A;  4YZU A;  3QZR A;  5F8T A;  5I46 H;  2FOM B;  2UWO A;  3FTE A;  4ACB A;  1XUH A;  2NWN A;  1MAY A;  3HK3 B;  2WPL S;  1UVP A;  4WJG 2;  1PJQ A;  1DS2 E;  2OBO A;  3PXG A;  3DZD A;  3QLP H;  3BV9 B;  3M3S A;  4FVB A;  2GDE H;  3GLH A;  2XC4 A;  1O5D H;  2BTC E;  2EC9 H;  3F68 H;  4BOH A;  4JN6 A;  1JR3 E;  2BD9 A;  4IBL H;  2FE8 A;  2KAI B;  4B7F A;  1FN8 A;  5EGM A;  3QK1 A;  1H9H E;  1SOT A;  1OOK B;  3RM0 H;  3L6P A;  2H5C A;  1HAV A;  1FY1 A;  1F5K U;  2IJO B;  2XWB I;  3UGJ A;  1GMH F;  2YMS D;  3FFG A;  3RUO A;  4IBB A;  1IN4 A;  3TNS A;  2QY0 B;  2O8L A;  1ZRB A;  1K1L A;  2Z4S A;  3HKI B;  3SJ8 A;  1O2Q A;  1EAW A;  2G5N A;  1S3S A;  3MU8 A;  1DGB A;  5ABW A;  3VKH A;  2A2Q H;  1YE9 A;  3VDU A;  3NUM A;  1OWE A;  3TIT A;  4JZ1 A;  5FTJ A;  2THF B;  3MNC A;  2O8U A;  2ZAO A;  1N32 M;  2K0B X;  4ANR A;  2Z4R A;  4YTA A;  1HUT H;  1W7G H;  1TPO A;  1YPJ H;  2BD8 A;  3MI4 A;  1DIT H;  4B3T M;  2JY7 A;  1Y5B T;  1C5O H;  4FWD A;  4INH A;  5EQS A;  1YLA A;  4YXW D;  3L33 A;  2FNA A;  1MAX A;  4DR6 M;  2LHC A;  4LXB H;  1T3T A;  2X49 A;  2Y6T A;  4WUR A;  2ANK H;  3V3M A;  1C2M A;  1W10 U;  3K9X B;  1HBT H;  2G5G X;  5L6N H;  4X0W U;  4F2L A;  4XDE A;  3FTD A;  1YPK H;  3GY2 A;  4MLF B;  1DWD H;  1EP5 A;  1XXF A;  3LIW A;  3RFW A;  4ISL A;  6GCH G;  1CSO E;  1XMQ M;  1BIT A;  2ZF0 H;  3HWS A;  3J7A S;  3SU4 A;  4BBA A;  3MH4 A;  3V76 A;  3M7G A;  2F5O A;  3WHK A;  1WAY B;  2CMY A;  3B23 B;  3HGP A;  3HPT B;  4FUJ A;  1HNX M;  1O35 A;  1O3K A;  4X6O A;  3AV0 A;  1O39 A;  5CDF E;  1C5Y B;  1FY8 E;  2PV9 B;  1FON A;  2LVA A;  2LVO C;  3VDP A;  1YLN A;  2ANW A;  1RTK A;  3J80 S;  3WWF A;  1TMB H;  2HRV A;  2CV2 A;  1OKS A;  3VGC C;  2HKJ A;  2DAM A;  3VK8 A;  3Q8X A;  2F91 A;  1TWX B;  1OWI A;  4AOR A;  1ZYO A;  2YOL A;  2K47 A;  5EPN A;  3LKW A;  4PDG A;  3GLI B;  1IQP A;  1TON A;  2GZ7 A;  2XBX A;  3EE7 A;  1WXQ A;  1ELC A;  1NFU A;  3KOW E;  3OFN D;  3K9P A;  1AUT C;  5AFY H;  2I7N A;  1WUN H;  4LF9 M;  1W13 U;  4DG4 A;  1OYT H;  2D2D A;  4OS6 A;  1C9P A;  1PPE E;  2V3O H;  4KGA A;  1SXJ B;  3C3D A;  4HEO A;  2FOH A;  1OHH D;  2H5D A;  3Q3X A;  3SHF A;  2EST E;  3DT0 H;  4FUG A;  3LGW A;  1S83 A;  4AN7 A;  3A8B A;  2Q6D A;  4NRW A;  3T27 A;  2FDA A;  2PP6 A;  2PUQ H;  1DXW A;  4U2W A;  3FO8 D;  2WPH S;  3GLI E;  2HLD D;  5JI3 E;  3ZZ6 A;  3SAV A;  3C9P A;  4MGH A;  4DR2 M;  1BMA A;  1AB9 C;  3NRL A;  4AZ2 B;  5LMU M;  1P2M A;  1KDQ B;  2A32 A;  1Z8G A;  3BTW E;  4FUD A;  1Q39 A;  1QAN A;  3PLK A;  4HZH A;  1HT2 E;  3GPY A;  3L25 A;  2RG3 A;  3UMM A;  2NU2 E;  2ILN A;  1LDT T;  5FXL A;  4CHA C;  3FUX A;  1TNK A;  2KA6 B;  2WPK S;  4GHL A;  1O3A A;  1GBF A;  1QJ1 B;  2WSS D;  2XEP A;  1NRR H;  2BLW A;  3VFE A;  3RML H;  2RDE A;  1BBR H;  3TVJ B;  1AN1 E;  4IMQ A;  4ZUH A;  2QZ4 A;  7LPR A;  2ZGX H;  2E5L M;  1P2K A;  2FIR H;  3M5M A;  3GPU A;  3LQR A;  2BQ6 B;  3G01 A;  1P2Q A;  2GP9 B;  2DE9 A;  3N7E A;  2ZHW H;  1ELT A;  2LNC A;  1MQ5 A;  1AKS A;  4GHQ A;  3P8N A;  2O8W A;  3RU4 D;  2DI0 A;  1BIO A;  1AFQ C;  1K28 D;  4YOG A;  1MX0 A;  2J7N A;  1B0E A;  3PLP A;  4L78 A;  4YOI A;  1AO5 A;  2ZWL H;  2OOB A;  3Q3K A;  2OQ4 A;  3GCH C;  5A0B A;  2KZ4 A;  3LH3 A;  4S12 A;  1SQO A;  1NT1 A;  2L09 A;  5E26 A;  2B9L A;  4Z0K A;  4LF8 M;  4CRF A;  2NU4 E;  4JZI A;  3W0F A;  4JCN A;  1O2M A;  1CGH A;  1TQ0 B;  3SN8 A;  3HU2 A;  2F5S A;  3PMA B;  5DFL A;  2H1U A;  3U8O H;  2X8A A;  3ODF A;  2BY9 X;  2D1J A;  4A1T A;  4X8V H;  4FCV A;  2FLB H;  2BDC A;  4BLC A;  4YHH M;  2GKV E;  3H7T A;  3UAI C;  3HJQ A;  2XZF A;  3BEI B;  2RCE A;  4TUW A;  2CK3 D;  1WJ7 A;  4KO8 A;  1UCY E;  1Z5B A;  4RKU F;  3JAM S;  2GGV B;  2Q6G A;  1PQA A;  1MCT A;  1DX5 M;  4RN6 A;  1ELG A;  3R8F A;  1TB6 H;  2O25 A;  2HAK A;  4JI1 M;  1SHH B;  3VGC B;  2DZL A;  1RIW C;  3D23 A;  3SU5 A;  2O01 F;  4IBE A;  3KQE A;  1ELV A;  1NJF A;  2V1C A;  4NOO B;  4UEH H;  2VQE M;  1J5E M;  2NU1 E;  1VDL A;  2ANY A;  2ULL A;  2ODY B;  5C1X A;  2A4G A;  1Y5A T;  3EA8 A;  1P04 A;  1O0D H;  2OC7 A;  1VEJ A;  1QCP A;  2GV6 A;  2XBV A;  3LGY A;  3ZVB A;  3U6E A;  4ABI A;  1VGC C;  2J92 A;  5T3H A;  2ZPQ A;  5FTN A;  5GDS H;  5LH8 A;  1C5Q A;  3VB7 A;  2ZDA H;  5C94 A;  2JA2 A;  3BEU A;  4LK4 A;  4XBO A;  1D6W A;  1XWI A;  2GD4 B;  2Y5F A;  1QDT A;  4GC9 A;  1IY1 A;  3SGB E;  2HPP H;  1XXD A;  1HIA B;  2D7G A;  1CHO G;  4LF6 M;  4Q4L A;  1N33 M;  2W7U A;  3CGW A;  5JBC S;  1RXP A;  3GYM A;  1IN7 A;  3B7N A;  1JQJ C;  4NFF A;  1P3E A;  1K1O A;  1KMH B;  4KP0 A;  3OSY A;  3BG8 A;  3BTG E;  5T1V A;  4DGJ A;  8LPR A;  2PSY A;  3FTF A;  1NZQ H;  2LTU A;  4CHA B;  2ZDL A;  2WIN I;  4DR5 M;  2UUJ B;  2LXE A;  6GCH F;  1O3O A;  2ZDK A;  2EI7 A;  4F1I A;  3PTN A;  1ZGI A;  4JI6 M;  4DVA U;  1NFY A;  1HAP H;  2YR0 A;  4B7H A;  5H37 D;  1C1P A;  1G3D A;  2P93 A;  1DO2 A;  1SGY E;  3TE6 A;  3V7T A;  1ETS H;  3B89 A;  2UXD M;  3RE8 A;  5DYG A;  4OS7 A;  6CHA C;  2G52 A;  3M3V A;  1CBW C;  2G8T A;  1AE5 A;  1HV7 A;  3RXG A;  4BTI B;  1AFQ B;  3CS7 A;  3VB3 A;  5H4I B;  1AUJ A;  2SFA A;  1FJS A;  1TAW A;  1T6O A;  3FRH A;  2AH4 X;  1GI7 B;  4RF1 A;  3RM2 H;  3SW2 B;  2R62 A;  4LZZ A;  3ZVA A;  4YT7 H;  2QXH A;  1IN8 A;  3URE A;  5LPF A;  3PWC A;  3GYL B;  1IQN A;  1W5T A;  2VIQ A;  2ZU1 A;  1PPF E;  1V3X A;  1ABJ H;  5LPE A;  1UTP A;  1XXH A;  1JRT A;  2GCT C;  5HYO A;  2YMS C;  1FNI A;  4B76 A;  2HL7 A;  3GP1 A;  2ZIQ H;  3TK9 A;  2PSX A;  4X6M A;  1BHX F;  4IN1 A;  1ZMN A;  2NU3 E;  1TDZ A;  1D3Q B;  3CF2 A;  1ABI H;  1O2W A;  2XBW A;  1NN6 A;  3LCU A;  1RIW B;  2KDL A;  2UXC M;  5DYI A;  4WH6 A;  1O30 A;  2X4A A;  1HAX B;  1AHT H;  1KY9 A;  2DZO B;  1QR3 E;  3ZZA A;  3TGJ E;  2ZDV H;  1VCQ A;  5EQQ A;  1SPJ A;  1UMA H;  2K1Q A;  1GI8 B;  4F49 A;  2FP7 B;  3RXF A;  1GJ5 H;  4DR1 M;  2GZ9 A;  2VIP A;  5AHG H;  1EFU B;  3UPE A;  5DN6 D;  3CF6 E;  1V92 A;  3U61 A;  1C5X B;  2D26 C;  3BTQ E;  2ERC A;  1Q2W A;  1WQV H;  2HVY B;  4D80 A;  2CRU A;  2DVW B;  2OXS A;  2OO9 A;  1C7Y A;  1VGC B;  1UTN A;  2KR7 A;  4XBD A;  3SC3 A;  4O3U A;  2VWO A;  3W1E A;  2BWB A;  1ORF A;  1SXJ A;  1GGD C;  4BXS A;  1VDD A;  2UUC M;  4ZPX A;  1F7Z A;  1O2P A;  2ZTC A;  1P05 A;  3GIS B;  1UJ1 A;  4JZF H;  1NSF A;  1V2N T;  4G4N A;  5A8Y A;  3E0N B;  4QOS A;  1VIT H;  1TGN A;  3P70 B;  4X1R U;  4KKD A;  4AKI A;  3S7H B;  1YWU A;  2BD4 A;  2FXR A;  4B6E A;  2IOT A;  2Z9L A;  1R6B X;  1EJA A;  3BIU H;  3T62 A;  4Y28 F;  3FN8 A;  1D0L A;  4NFE A;  4CRE A;  3KYF A;  2FOA A;  4CBN A;  3ZZ9 A;  5F03 A;  3EGK H;  4GUX A;  1LPZ B;  2AER H;  1XKA C;  4H6S B;  4IS5 A;  4BB9 A;  1L4D A;  1O3J A;  3PRO A;  5C18 A;  1Z8I B;  1HQY E;  2FWW A;  1YCP H;  3ZV8 A;  1ORY B;  1K2I 1;  2WPJ S;  3SI3 H;  4CR9 A;  3UOU A;  2RFK C;  1THP B;  3JZ1 B;  4AQY M;  1CBW B;  1C1U H;  1O3D A;  3RXL A;  1FY5 A;  1ZR0 A;  1D0K A;  5EQT A;  3PMB B;  3ZVF A;  1CT2 E;  1J15 A;  4TY6 A;  1K9O E;  1BMM H;  1J8A A;  5A09 A;  3M5N A;  1XMO M;  1SC8 U;  2Z3X A;  4DV5 M;  1G3E A;  3F6U H;  5FSW A;  4DR3 M; 
#chains in the Genus database with same CATH homology
 1J09 A;  4KLN A;  3EYD A;  1R2Y A;  1IY0 A;  5DNY A;  2W6J D;  2ZAN A;  3GLH B;  1E79 D;  3SYK A;  2F9U A;  5GND A;  3KFU G;  1XC8 A;  1J7K A;  1W5S A;  1QQW A;  4IJF A;  3IG8 A;  3RC6 A;  3F2H A;  3FTC A;  3U6Q A;  1QZM A;  1IBM M;  2XFT A;  3ZC7 B;  1L2C A;  3HHY A;  4LF7 M;  3DSP A;  2ZBK B;  3EIE A;  3SU6 A;  2QPA A;  3U6P A;  3I4Y A;  5KO3 A;  4LJ6 A;  2UU9 M;  5KPZ A;  4LJ5 A;  1XHB A;  3HKP A;  4GMQ A;  1DGF A;  3T15 A;  4R3D A;  3TWM A;  4OW0 A;  1NBM D;  2JIZ D;  1C1K A;  3GLG A;  2LH0 A;  3U6D A;  1NS3 A;  4IJE A;  5GJ4 B;  2O8M A;  3WHL A;  2CFO A;  4CGY B;  4X62 M;  2IJD 1;  5C0T A;  3AOE C;  3D8L A;  4Z6Y A;  3DCL A;  3LQQ A;  1ZAE A;  4NSR A;  5IRE B;  1Z5C A;  4GKJ M;  1G41 A;  2V1U A;  3AJI B;  4KTC A;  3L29 A;  1Z59 A;  5A2Q S;  2QBY B;  5FPT A;  3KOZ E;  1HNW M;  3IG5 A;  3KVW A;  4LZJ A;  2J5U A;  3U6O A;  2CEA A;  3SU0 A;  3SV6 A;  1QAQ A;  5EP3 A;  3GRY A;  2QE7 D;  2DZN B;  2XOK D;  1K82 A;  4IIW A;  3VLF B;  3SAS A;  4NWL A;  3D8B A;  4AG5 A;  1NVM A;  4LGY A;  5EXP A;  1IBK M;  2QF4 A;  1COW D;  4M9Z A;  2Y21 A;  4M9F A;  1GL6 A;  2F4V M;  3GLF A;  1NHG C;  2YFQ A;  4MGK E;  1X37 A;  3OE7 D;  1L1Z A;  5FTM A;  3VKG A;  2V7Q D;  3OEH D;  4B71 A;  1L2B A;  1MAB B;  1NNU C;  2KCY A;  3RC5 A;  2P5T A;  2J7O A;  2WZQ A;  3PV2 A;  3HHZ A;  2CHV A;  3J27 B;  4LJ7 A;  2A4Q A;  2XCF A;  2WHX A;  2HCB A;  3CF0 A;  2DHR A;  1IBL M;  3AK5 A;  4Z1M D;  3A46 A;  1XNQ M;  1SXJ C;  3ILK A;  2DWZ B;  4NWK A;  2XGN A;  3AKZ A;  3SAU A;  3FKS D;  5ETX A;  3I4V A;  1K3W A;  3HGI A;  2FOM B;  5GKN A;  2A4R A;  3FTE A;  3MJ5 A;  1E1R D;  3F0O A;  4PCZ A;  4JI8 M;  1RTL A;  2OBO A;  3PXG A;  5ITR A;  2C96 A;  2EO2 A;  3DZD A;  3KSJ A;  1E9R A;  3QAU A;  3J7B A;  4FW9 A;  3GLH A;  4I32 A;  1R2Z A;  4JI0 M;  3LMM A;  4JN6 A;  2WV9 A;  2FE8 A;  1E1Q D;  4B7F A;  4FET A;  4I33 A;  1E9S A;  3U60 A;  3SAT A;  3L6P A;  4DUZ M;  2IJO B;  2YMS D;  1KFV A;  1IY2 A;  3L28 A;  3UGJ A;  1DXP A;  3KXE C;  4IBB A;  4GC5 A;  2KRU A;  1IN4 A;  3U6L A;  3TL4 X;  4LJ4 A;  2ZAM A;  2Z4S A;  4B3S M;  1NJG A;  5EP2 A;  4A1X A;  2K0Q A;  2YQZ A;  4K0K M;  4LGM A;  3KS4 A;  5EQR A;  1S3S A;  3O8R A;  1DGB A;  2I7P A;  3VKH A;  1YE9 A;  2OK5 A;  3VDU A;  2NQ8 C;  2XZU A;  3TWL A;  4DR7 M;  3UJN A;  1NBM E;  3GS9 A;  5FTJ A;  3VK7 A;  4NRV A;  3GRV A;  2ZAO A;  1N32 M;  1FNN A;  2W82 A;  4LFA M;  1IXR C;  2Z4R A;  1N34 M;  4NSO B;  3BOS A;  3L2A A;  4W5W A;  3RGS A;  2QBY A;  2M60 A;  3GPP A;  4B73 A;  1N36 M;  4B3T M;  4YXW D;  4FWD A;  5EQS A;  2R46 A;  2FNA A;  4A3V B;  4DR6 M;  2K8I A;  1T3T A;  2X49 A;  4WUR A;  3FOA A;  4L8R C;  2CV0 A;  5ITX E;  2Q2E B;  2KCP A;  2G5G X;  2R45 A;  4LJ8 A;  1QAO A;  3SUG A;  5EP1 A;  3FTD A;  2C98 A;  4TSF D;  4RNA A;  3B9P A;  2CE7 A;  1TH4 A;  3FUT A;  3RFW A;  3KDS E;  2A5Y B;  1XMQ M;  2KCO A;  3AOG A;  3HU3 A;  3HWS A;  3PRD A;  3J7A S;  3SU4 A;  2ZM6 M;  4BBA A;  2JDI D;  1JR3 A;  4XGI A;  2F5O A;  3M7G A;  3K1J A;  3WHK A;  5HKK D;  1HNX M;  3ZH9 B;  3AV0 A;  3TQS A;  3MHV C;  3C58 A;  1PJI A;  5CDF E;  2FOI C;  1E94 E;  3VDP A;  1L2D A;  3KW6 A;  3J80 S;  5IZ7 D;  5KPT A;  4DV7 M;  2DWM A;  2OC1 A;  3WWF A;  2CV2 A;  2BNK A;  4LJ9 A;  1OJL A;  3FUU A;  8CAT A;  2HKJ A;  2YMS B;  1BT7 A;  3M0E A;  3VK8 A;  3TWK A;  3Q8X A;  2OIN A;  4AZF A;  2YOL A;  2K47 A;  2LNH C;  3LKW A;  5DSF A;  3KP1 E;  4PDG A;  5EPN A;  3GLI B;  1BMF D;  4X64 M;  3NWL A;  1IQP A;  3H4M A;  3SV7 A;  1L1T A;  2DWN A;  1WXQ A;  4WF8 A;  3KOW E;  1ZQ9 A;  3OFN D;  3GRR A;  4RI0 A;  3A42 A;  4LRS A;  2I7N A;  4LF9 M;  5EXT A;  4LRT A;  4NL4 H;  4QHS A;  3R9X B;  3UB0 A;  1SXJ B;  3MK6 A;  7CAT A;  5F3W A;  3SUD A;  4IBI A;  4A1V A;  4JI3 M;  1G59 A;  2KZU A;  4LY6 A;  1OHH D;  1W0K D;  3SHF A;  4LJA A;  4M9X A;  5ITX A;  3T38 A;  2Z7J A;  5BPV A;  4DV0 M;  3KEE A;  5EXX A;  4DV2 M;  3HHX A;  3VFD A;  4L15 A;  3SV9 A;  4KOD A;  4NRW A;  4AG6 A;  5IK2 D;  2KM0 A;  2LEL A;  5ITU A;  1DXW A;  3FO8 D;  4MB7 A;  2HLD D;  2XH9 A;  5JI3 E;  2XSZ D;  2VQF M;  3SAV A;  4IBG A;  3GO8 A;  3DA1 A;  4MGH A;  4DR2 M;  2OC0 A;  2HHH M;  2D7H A;  4AI6 A;  3NRL A;  3U6C A;  5IT9 S;  3KOX E;  4HL4 A;  5LMU M;  3U1I B;  4IBC A;  3SMS A;  1Q39 A;  1QAN A;  4DV3 M;  4IBK A;  4FWH A;  2L7I A;  1HT2 E;  3GPY A;  1XNR M;  3L25 A;  3P8O A;  3UMM A;  4FVM A;  2H1R A;  1UM8 A;  3FUX A;  1EE8 A;  1YSY A;  2CHQ A;  2KA6 B;  4QNM A;  4MGI E;  3T1Y M;  4GHL A;  4JYA M;  1N78 A;  2WSS D;  2XEP A;  4B08 A;  4MM3 B;  2P59 A;  5EJC A;  1IN6 A;  4JI4 M;  2OPF A;  4L4U A;  2QCU A;  3E9S A;  4OVZ B;  3FUV A;  5EP4 A;  2QZ4 A;  4DV4 M;  1Z6T A;  4LF4 M;  1I4W A;  3M5M A;  2E5L M;  4ASU D;  3GPU A;  3LQR A;  2R4J A;  5ITT A;  3L26 A;  2F5P A;  3N7E A;  1IXS B;  2EA0 A;  3U6M A;  2Y0T A;  2C99 A;  2KZS A;  2RGH A;  3P8N A;  3FYD A;  1G3I A;  3THG A;  4IBJ A;  4R8T B;  4PDI A;  1GL7 A;  1MX0 A;  2J7N A;  4L78 A;  1FX0 B;  4LCB A;  4I8O A;  5KPR A;  1N77 A;  4GHA A;  4B3R M;  2OQ4 A;  3DSO A;  2KZ4 A;  2JJ2 D;  3WW7 A;  5FPS A;  3HJS A;  4S12 A;  3SBJ A;  3T1H M;  4QNR A;  4DT4 A;  3LVW A;  2XF3 A;  3KS8 A;  2L09 A;  5E26 A;  4YY3 M;  3KNX A;  4LF8 M;  4II7 A;  1R7R A;  1S6L A;  3W0F A;  2JJ1 D;  3U1J B;  3GLI A;  2UXB M;  2R65 A;  2G8L A;  1G4A E;  3HU2 A;  3LVV A;  2F5S A;  2UUB M;  1SKY E;  2KFW A;  4XD7 D;  2X8A A;  3SU1 A;  1W3C A;  3M6A A;  4A1T A;  1Q3C A;  4FCV A;  3N99 A;  3W0L B;  4BLC A;  4YHH M;  4RF0 A;  5FLX S;  3FKE A;  3HJQ A;  2XZF A;  1D2N A;  3LON A;  1SXJ D;  4QHT A;  4TUW A;  2CK3 D;  4L16 A;  4KO8 A;  5ESB A;  1Z5B A;  3JAM S;  4Q63 A;  2GGV B;  4PT5 A;  3UZU A;  4IBF A;  3R8F A;  4U01 A;  2R18 A;  4JI1 M;  4G4O A;  3SUE A;  3JR5 A;  3U6S A;  2R4E A;  3KP0 E;  3GPX A;  3SU5 A;  2M2A A;  1A1R A;  4IBE A;  3OAA D;  1NJF A;  3FYC A;  4G4R A;  3U5Z B;  1K3X A;  3M5L A;  2V1C A;  4I4L A;  4NOO B;  3AFH A;  3DFZ A;  1QVR A;  3SYL A;  2O5R A;  2VQE M;  1J5E M;  3GQ4 A;  3KN2 A;  1XXH B;  2A4G A;  2Y0Q A;  5LMN M;  5B6L A;  4D81 A;  2OC7 A;  2UUA M;  3O8B A;  4DV1 M;  1DGG A;  4A92 A;  3U6E A;  3A45 A;  1MU5 A;  2FM2 A;  5C17 A;  3SU2 A;  5FTN A;  2CV1 A;  4TT3 D;  4JI5 M;  1H8H D;  5KQD A;  2JA2 A;  3SV8 A;  2VBC A;  4K8B A;  4XBO A;  4ITQ A;  1XWI A;  4OVZ A;  2KXE A;  1WXR A;  5IDK A;  4NXM M;  4GC9 A;  4M0D A;  3RC4 A;  1IY1 A;  5KQ8 A;  2D7G A;  5FTK A;  4LF6 M;  3E4R A;  1N33 M;  4CHT B;  3PNY A;  4EIW A;  3OTP A;  3O8D A;  4Q4L A;  5EPY A;  3GQ3 A;  1KYI A;  4NXN M;  1IN7 A;  3J81 S;  3OTO M;  3F3B A;  1JQJ C;  3LOX A;  1HNZ M;  1KMH B;  2XLJ A;  1GVN A;  3GRU A;  3U61 B;  5T1V A;  5FPY A;  3FTF A;  3CTW B;  3SHG B;  1PM5 A;  2C9C A;  1NY6 A;  4DR5 M;  2LXE A;  3K8Z A;  5CHB A;  2DXI A;  3QWL A;  4JI6 M;  3KOY E;  4TYD A;  3ZIA D;  4IBD A;  1GLN A;  3GQ5 A;  3U60 B;  2YR0 A;  3HJ8 A;  3I51 A;  4B7H A;  5H37 D;  4JI2 M;  3F0P A;  1DO2 A;  1N75 A;  3TE6 A;  3N7D A;  1G8P A;  3DOA A;  2L6O A;  4LF5 M;  3RE8 A;  5DYG A;  5IWA M;  2UXD M;  2GVF A;  1N1L A;  3E90 B;  3SMP A;  3PV5 A;  1LV7 A;  2XSZ A;  5H4I B;  4OU7 A;  5E6J A;  4X66 M;  3H09 A;  1TH2 A;  1L8Q A;  1DY8 A;  1H8E D;  4I31 A;  2KW0 A;  2DWL A;  4RF1 A;  4D82 A;  4LFC M;  4ZCN A;  1SXJ E;  2R62 A;  4LG2 A;  4Z8X A;  4GIP A;  4LZZ A;  3U5Z A;  3O8C A;  1IN8 A;  3WWB A;  4LFB M;  1W0J D;  4OX9 M;  3PFI A;  1W5T A;  1E32 A;  1HR0 M;  1OFH A;  4FD2 A;  1H6U A;  3PNV A;  2RGO A;  2QP9 X;  1XXH A;  1IXZ A;  3JR4 A;  2QV1 A;  4GIT A;  3AOE A;  4MH0 E;  1EFR D;  2YMS C;  4X65 M;  2HL7 A;  5FTL A;  4B76 A;  3GP1 A;  1DGH B;  5ITY A;  1NNJ A;  5FL7 D;  3SYJ A;  1GKI A;  4GRI A;  2C9O A;  3AL0 C;  1TDZ A;  3PVS A;  2Y20 A;  3CF2 A;  3HHW A;  1HQC A;  1TH3 A;  4MGZ E;  5C0U A;  4PD2 A;  2BJW A;  2BJV A;  1Q3B A;  1CU1 A;  3SU3 A;  2UXC M;  5DYI A;  4WH6 A;  2D7E A;  4FCT A;  3PRB A;  2X4A A;  5ITQ A;  5JI2 E;  3K92 A;  2DZO B;  4B75 A;  1IN5 A;  2QEN A;  4DV6 M;  2YNM D;  4G4Q A;  4JI7 M;  3UK6 A;  2KEB A;  3FD9 A;  5EQQ A;  3SAW A;  3RGP A;  3FUW A;  2K1Q A;  4B7G A;  2FP7 B;  5DN6 D;  4DR1 M;  3OYP A;  3CF6 E;  2XFS A;  3U61 A;  2OBQ A;  2ERC A;  2LWX A;  2AHM E;  4B74 A;  3HU1 A;  5BR8 M;  5C1B A;  4D80 A;  1RGQ A;  1TGU A;  2V6Z M;  4B3M M;  2DVW B;  2QF5 A;  3VG8 A;  2RKO A;  4QOZ C;  2KR7 A;  4M0W A;  3SC3 A;  4JV5 M;  5F53 A;  3W1E A;  3GLG B;  1NHW C;  1KSF X;  1SXJ A;  5EXS A;  1HT1 E;  3EIH A;  1VDD A;  2F5Q A;  4AKG A;  4JXJ A;  2UUC M;  4ZPX A;  1DY9 A;  2FFJ A;  2W6I D;  4GKK M;  3SAR A;  1YUB A;  3J2P B;  1NSF A;  1DO0 A;  4G4N A;  3KF2 A;  4HLQ A;  2KRK A;  4QOS A;  5GPI B;  3K2L A;  4G6Z A;  4AKI A;  4B6F A;  2M5Z A;  3KSX A;  4B6E A;  4R7G A;  3NBI A;  2EUC A;  3TPZ A;  4FWG A;  2C5R A;  1R6B X;  2F5N A;  1FJG M;  2KCA A;  3L27 A;  1QAM A;  3FN8 A;  4OM9 A;  2OC8 A;  2F9V A;  4DUY M;  4JMY A;  2CHG A;  1TDH A;  2L7H A;  4BB9 A;  1PJJ A;  3GLF B;  5C18 A;  1NY5 A;  2F4L A;  1HQY E;  1Z5A A;  3OEE D;  4P16 A;  4DR4 M;  2WPD D;  1ORY B;  4MGY E;  3SZE A;  4GH9 A;  4F55 A;  2XCN A;  1IM2 A;  1I94 M;  3A98 B;  4AQY M;  3ZCB B;  4I81 A;  1OFI A;  3SUF A;  1JXP A;  2AHM A;  5EQT A;  4I5S A;  4CIS A;  1DGH A;  4WH8 A;  2F43 B;  4REZ A;  3SFZ A;  2XND D;  3F2F A;  4FCW A;  2CUZ A;  4WW0 A;  3M5O A;  4AW4 A;  4M9S A;  3M5N A;  4KHP M;  3F2G A;  1XMO M;  4DR3 M;  2Z3X A;  4DV5 M;  2XNI A;  1JR3 D;  1QYR A;  5FSW A;  2VII A;  4AKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...