2L6OA

Nmr structure of the protein yp_926445.1 from shewanella amazonensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MGAGQTPHPQLIWPALLKQQGCNELLPLRTNDDWQRFCADSKHLLQYGDKLVDSNFHCFVLEEDAHWHPAAPLPPEGLNDLIRAHCATLGHCCTSKMHLHSVMDAIDFLNALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein YP_926445.1 from Shewanella Amazonensis
rcsb
source organism Shewanella amazonensis
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein YP_926445.1
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13642 DUF4144 protein structure with unknown function
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.650 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l6oA02
2.40.10.320 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2l6oA01
2L6OA
chains in the Genus database with same CATH superfamily
3A80A 1NU7B 1XUGA 2VH0A 1TFXA 2E5LM 1Z5CA 4X6PA 2EY4C 3GLGB 2JZ0A 1X37A 1A5GH 1O5CB 3RXRA 1VZQH 2YOLA 1PPZA 2GQFA 5C18A 4X1RU 1ELFA 1THSH 1QQWA 4UN2B 1Y8TA 2C4FH 1TGSZ 2UUAM 2ZFSA 1AVGH 1MZDA 1W2KH 3ZQJA 3RMNH 2PHBA 1HAYB 1GDUA 1PQ7A 1HUTH 1JQJC 1NHGC 2FH0A 1CBWB 1O2KA 4CRGA 3PV2A 3DFJA 3U5ZB 2EA0A 2QNJA 3KHVA 3SUEA 1IQJA 2A7CA 1SQOA 5C17A 2CHGA 3LCUA 2RCEA 3A7ZA 4FUCA 4IW4E 4ZROA 1GI4A 1EJAA 2BZ6H 3VGCC 3LT3A 3M3TA 2VGCC 3VFEA 3MNCA 1F5LA 3HHZA 2KZ4A 1ABIH 3W94A 1GVKB 3WHKA 1R2ZA 4YHHM 3UY9A 4O03A 2WYGA 1QRXA 2DHRA 1OWIA 2XWAA 1K1NA 1OWHA 2CF8H 3KN2A 4FUDA 3SAUA 1ESTA 1AKSA 4GCHF 1AIXH 1LHFH 1Z8JB 2OXSA 3NWLA 2CHVA 1OJLA 1HGTH 3QX5H 2BQ6B 3HATH 2R3UA 5E0GA 4BB9A 1GCTB 2P3TB 3U6DA 2THFB 1T4VH 2XZFA 1DPOA 2NU4E 4OS6A 3S7HB 2RFKC 1PJSA 1ZMJA 1E0FD 3L6PA 5EQTA 4QOSA 3C1KA 1K1IA 3DSGA 4X1NU 3FUTA 2ZFTA 2PSYA 3SJKA 1SGFG 1HAGE 5IZ7D 2W82A 1GI9B 2D2DA 4XFQA 2XFSA 1KYNA 3IHPA 1S0QA 3ZZ3A 3U61B 4I8JA 3VFDA 2F9NA 2BY5X 1O2ZA 3RXKA 2ZG0H 2UXBM 1IHSH 4Y6DA 2F9UA 3UQOA 4UDWH 2LVPC 1P3EA 2ZFQH 1ELTA 4QHSA 3EYDA 2F5QA 1IQKA 5JB9S 1YPHC 1O2IA 2V7QD 1O3IA 1QJ7B 3SYLA 1MKWK 4X6OA 3SGAE 1P01A 2AYWA 1IQEA 1UHBA 3BV9B 2ZDMA 1G3DA 1O34A 2AFQB 4LK4A 3P92A 1L1TA 1O39A 1TWXB 1QNJA 2FO9A 1RJXB 4ZAEA 4ZKNU 3OFND 2CE7A 3SN8A 2HLDD 1I4WA 1JMOH 3A83A 2R0IA 1WJ7A 2LVOC 4IJEA 1QBOA 1TPSA 1C9PA 3JZ2B 4L6V6 5ESBA 1SOZA 1AUJA 4DT4A 4DIIH 4FOUC 4ZHLU 1HAVA 5FTKA 1WDIA 2RDLA 3ZV8A 2ILNA 2B7DH 2J7NA 4NWKA 1TAWA 3W68A 4GEWA 1TIOA 4ZCNA 1V2QT 5EGMA 1W10U 1OFIA 1UK4A 1VITH 4ZXXH 3ZZ5A 3U6MA 2J92A 1SXJB 1MTUA 3VKHA 1UVPA 1TGNA 4B7HA 3SORA 2UUBM 1W0KD 3AW0A 3P8OA 1S6LA 2LVQD 2DWNA 3ZV9A 1W13U 3KCGH 2ZHWH 2JDID 4XBCA 1INCA 1UVTH 4FCTA 3GCNA 1GHXH 2BJWA 2X49A 1EZXC 1SXJD 3LC5A 1GBAA 3THGA 1LHEH 3GY4A 3E6PH 1SQRA 5DSFA 1FY3A 2P59A 4Z6YA 2C96A 1F7ZA 1FMGA 3DHKH 1ARBA 4NXMM 5GKNA 2BNKA 3I77A 1GGDC 1WHCA 2YNAA 3K6YA 5FBIA 3HJQA 1LQEA 1DICA 1IQLA 1BDAA 2CEAA 4M7GA 1ZPZA 3Q8XA 1H6UA 4D76A 2HKJA 4VGCC 2OQUA 1OWKA 2Z9GA 5B6OA 1EFUB 2FOGA 2JETB 5EQRA 1P9SA 1HIAB 3JR4A 1QDTA 4BTTB 2RGHA 1YC0A 4K5ZA 1G36A 3MNBA 3LW5F 5KPTA 2VIIA 2P3FH 1TA2A 2VIDA 3D49H 3SV8A 1TLDA 3NRLA 3L2AA 4L16A 1GO5A 2G5GX 1YCPM 4YZUA 1XVOA 5A8ZA 3EE0B 1AGJA 5HM2A 5FPTA 3MI4A 3GCHC 4F2LA 3AFHA 2XBXA 1TBZH 1Z1JA 5FTLA 2AIQA 5K7RA 5F8ZA 1YPLH 2FESH 2L7IA 1PPEE 2BVRH 1BBRH 5EXSA 3E8LA 2G5VA 2WPLS 1CSOE 5F8TA 1GMDF 1UTJA 1Z6JH 1NO1A 1GJ7B 3ELAH 1IM2A 1G4AE 3ODFA 4I4LA 5C1YA 2OC0A 1BT7A 3SAWA 4R7GA 1MJGM 1LKBA 1XX9A 2FOHA 1MKXK 1E38B 3GRUA 1MH0A 4AW4A 2OCVB 3UMMA 4B7FA 1YWUA 2QF4A 4X65M 4ACBA 1BRCE 4CH8B 1A5TA 1AO5A 4DT7B 3MO6A 2F5PA 2CWBA 4KGAA 1DO0A 3T1YM 3L28A 1RXPA 3QGNB 5GJ4B 1QL7A 2NU1E 2DE8A 4CJ6A 3RC6A 4Y8ZA 2OC8A 1Q3CA 4X1SU 7CATA 1YLNA 1PYTC 1GHBF 2ZU2A 1YPKH 3STJA 2C8XB 1DGGA 2VVVA 3RC4A 1UTLM 3RXVA 8KME2 4IMZA 1Y59T 1AI8H 1WGNA 3T28A 3CS0A 2O8MA 1YPMH 2A4OA 4G6ZA 3DSPA 4IMQA 1IBKM 2ZQ1A 2ZGBH 3BEIB 2X4AA 2G52A 1ZMUA 1BHXF 2DUCA 3T15A 1BA8B 1IHTH 2K0QA 1GDQA 2Z3DA 3AW1A 3MMGA 1BRBE 1LHGH 3H7TA 3OY6U 5FLXS 5EXXA 4DV5M 1GJ8B 4CRDA 2A0QB 3C9PA 2IJD1 3F0OA 2EKKA 4ABJA 4LY6A 1W0YH 4JZIA 3DSOA 4FU8A 2EEKA 4HLQA 1OWDA 2EKFA 1BMLA 1C5YB 4NFFA 1HJPA 1GHYH 3A8AA 3GLFA 1XUJA 3UJNA 4CISA 5L2YH 1HT1E 1NJGA 3UK6A 3R0FA 4TT3D 3CF0A 4Q63A 5EU8A 3ZZCA 4ABGA 3SZNA 4AB9A 1G2MA 1PPCE 3RXGA 1HAPH 2YNMD 3PM3A 4F49A 4FWHA 3QUMP 3SBKA 1ZQ9A 3MH7A 2FDAA 2QXJA 3WWBA 1O2RA 3RXPA 3GLFB 1C5PA 3FE3A 3FFGA 1K21H 1BTUA 5L2ZH 4FUGA 4B75A 4Y8XA 1E36B 3RXJA 1DWCH 3UOUA 2H5DA 2HVXA 3VLFB 2F3CE 5EODA 3TJVA 2V0BA 1GBKA 4MPXA 3TIUA 8GCHG 1AD8H 3N99A 3UNRA 1GBEA 3SUGA 4UFGH 4HI3A 3L3TA 5EJZA 1T8OA 5KO3A 2OO9A 2KR7A 3M3VA 2QHOB 4IBFA 1YBWA 5GCHF 2GP9B 2W7SA 3ZVDA 4F55A 1KXDA 3AOEA 4YT7H 1S84A 5C1BA 4IN1A 1VDDA 3Q8GA 1W14U 2BXTH 3A84A 2ZA5A 3MU8A 3AL0C 2SGFE 1N6XA 5IK2D 2GZ7A 5J4SA 2ZPRA 1C5OH 1O2VA 4MNWA 1UW7A 2L4EA 2PFEA 2VH6A 1HNZM 1ESAA 1SKYE 2ZWLH 2JZ1A 3E46A 1GHAG 4HG6A 1AE5A 1QB1A 3V13A 2MROB 3T38A 1GPZA 3GY5A 1O5FH 2B0FA 5T1VA 2UXCM 1D6RA 4Y28F 4L78A 4JN6A 3ITIA 4GLYA 1WGLA 2WSCF 5DN6D 4ABEA 2ANWA 1VJAU 2JKHA 2JH5D 1P2OA 3TK6A 1QZMA 1SGFA 1WUNH 1O3LA 1TRMA 3T5FH 4GKJM 4JYAM 2R65A 1EZSC 2FI5E 2HL7A 4K2YA 1ZMVA 4A7IB 4ABIA 2A45B 4B74A 2TIOA 1IQNA 1FUJA 2ZHFH 3Q76A 4GHQA 4RT0A 2Q6GA 2Z3CA 2O8WA 3QTOH 1E34B 1VEKA 4DR6M 3F2HA 3SHAH 5C0UA 4II7A 1F92A 4LFCM 1L0ZA 5DK1A 3HHWA 2RRUA 2QXIA 1C5NH 1C2JA 1ELVA 3C58A 2CN0H 4X2YA 2BB4A 1T8NA 5FX5A 2WZJA 2J98B 2LBCA 1CHGA 3KP0E 3FUXA 2FIRH 1TNKA 3A87A 2GZ8A 4L15A 4DR3M 3FRHA 1LVOA 4FU7A 2V6ZM 3ATMA 5AFYH 1WU1A 3LGYA 5K0HA 3BTEE 3RUOA 2ZHQH 2D26C 3VGCB 1OYQA 3MH4A 2F4VM 4DG4A 4XOJA 2MR9A 1WQSA 2A5KA 2UUKB 3SV6A 4JI0M 5LMNM 1EB1H 1S0RA 4AFUA 1TH2A 4BXWA 2H5CA 1C9TA 4OVZB 2R2WU 2VBCA 1LHCH 2GKVE 3TH4H 4NOOB 2G5NA 1QFKH 1CBWC 2ZU5A 4NSVA 2FOIC 1MABB 1SB1H 2LELA 3FZDA 2GD4B 3TJOA 1PJPA 2J7OA 2C8ZB 2PW8H 1SG8B 2FFJA 3DA9B 2WUBA 1GVNA 3ILKA 4D7FA 1J7KA 3WY8A 2G51A 1NSFA 4E7NA 1GGDB 4BTIB 1WOFA 1Z5AA 3KXEC 4NC6A 1AUTC 2WUCA 1CA0B 4ABDA 4AFSA 5FTMA 4FVDA 1GI5A 3D62A 3SATA 2P8OC 4A1XA 3UGJA 3QTVH 5ESTE 1KTSB 1H9IE 2XEPA 4IBGA 1C4V2 1H9HE 4NRVA 2VIPA 1SXJC 1HJAB 4IJFA 1D9IA 2TPIZ 1JR3D 3CF6E 2CUZA 1P2QA 2I7PA 1TPOA 2BDAA 2P93A 3F9HA 3RXTA 4RNAA 2FS9A 3RLYH 2OOAA 2UUCM 1ZGVA 2EI7A 4Q7YA 3T2NA 1XB2B 2SFAA 1TE0A 3KOWE 3LCVB 4LZZA 4OU7A 1C2KA 1XM1A 5EOKA 2KNAA 4AFZA 3S69A 1SFIA 3QDZB 3B7NA 1QHRB 3SHFA 1MTWA 1MQ6A 3ZVFA 2J4IA 1C5XB 1JXPA 3M3SA 1OKSA 2EO2A 9ESTA 1K82A 4NA8A 3QZQA 3GYLB 3RMMH 4ZKOU 2APLA 3TGJE 1V2NT 5F53A 3TH3H 1RTFB 2AMDA 3CF2A 4CGYB 4WXVA 2Y5FA 3A7YA 1QBVH 4D9RA 2JETC 5DP7A 4JYVH 5ITXE 4QNMA 3U61A 3MTYA 1MD8A 3M7QA 4FUIA 1Y8GA 3U1IB 1TX8A 3UR6A 5EXMA 2FS1A 5EPYA 1FAKH 4O3UA 1YSYA 2R46A 2Y0TA 3OSYA 1PPGE 3LC3A 5LPEA 3LQRA 1E1RD 1PM5A 2SNWA 2BLQA 1EAUA 3PMHB 4DJZB 2G81E 3M6AA 3RXHA 1IY2A 1SPJA 2GX4A 5EXTA 4FW9A 1DT2A 3LU9B 1ZAEA 3K65B 5CHBA 2J9NA 3GRYA 2OBOA 1J17T 1K28D 1DUEA 3EAJA 3LH3A 4G3OA 4PDIA 1FJSA 1GHZA 1OOKB 3TL4X 1GBLA 5T6FA 1V2UT 1TR8A 2GCTB 2SGAA 3OTJE 4FVMA 4G4OA 4TY7A 5CMXH 2Y21A 1D3QB 1VR1H 2HVYB 1Z8IB 1PFXC 3GCTF 4NWLA 2ULLA 3GY6A 1IN6A 2OC7A 3RM2H 2HCBA 3HJ8A 4AFQA 3S0NA 4CHAC 4YOJA 2FMJA 2O8UA 4GC9A 1T31A 2QENA 3K2LA 4B08A 4GCHG 1HLTH 1SC8U 1QQ4A 5IWAM 2KRUA 4BTUB 3TU7H 5JBTA 4OGXA 3UR9A 1C1MA 2ZQ2A 1QRWA 5L8RF 3TK5A 3FTDA 1DGBA 1TGCA 3KQEA 2CK3D 2OLGA 3TGKE 1IN4A 2Q6FA 2WV5A 4H6TA 3BIUH 1GI8B 1SFQB 5DGJA 3I29A 4Q4LA 2ZI2H 1O5AB 3UPEA 4B71A 1IY1A 7KMEH 1RIWC 2XBWA 1O38A 1KSNA 3TLOA 3E0PB 2BOKA 1J9CH 2CHAC 1HT2E 3KOXE 2AIPA 4MGKE 3U28C 2UU9M 2C8YB 2PSXA 2ZFRH 4B6EA 1GI7B 1NRNH 3DCLA 3PLPA 1ZPBA 3LH1A 2BLOA 1GHBG 4ZHMU 3UTUH 1C4Y2 1YM0A 1GBTA 2BQ7B 1E1QD 5HM9A 1HR0M 1QCPA 1PJIA 1O2MA 5LGOA 5JI3E 3LGVA 1D0LA 4M9ZA 5KPZA 1KFVA 3EA8A 1C5LH 2QCUA 1VEGA 4WW0A 2H9EH 1GBDA 1HJAC 1XUIA 3U69H 5A2MH 3UUZA 2DE9A 3HZJA 1IBLM 1O3MA 1GL1A 1C5UA 2XWBI 2DWMA 2PWXA 3DUXH 2ZDLA 1DM4B 5FTNA 1TPPA 3I78A 5A2QS 1C2MA 1GCTC 3PV5A 2SGQE 2CV0A 4L8RC 4ZHAA 4X8TH 5GIBA 3E9SA 1E32A 1TTEA 1UFZA 1O2XA 1SR5C 3EA7A 2F5OA 2WPDD 4JYTA 3NBIA 3SI3H 1M9UA 2D1JA 1LVMA 2ZGXH 4I81A 2GZ9A 2ZU1A 2FI4E 3PO1B 5HIZA 3RFWA 1O35A 1SGNE 3ZC7B 1BTXA 1KY9A 1QVRA 3QN7A 1KIGH 1H8ED 1XKBC 1P2IA 1H1BA 1P05A 1C1OA 1J8AA 1TPAE 5EXPA 2QZ4A 4AKGA 1ELDE 1ZMWA 1RGQA 4CR5A 7GCHG 5FCKA 2BWEA 1UJ1A 1BTYA 3AVZA 1TNLA 3QYBA 5E6JA 3LOXA 4DUYM 1EOJA 4UONA 3FZZA 3VB5A 4FWDA 4DR5M 2DAKA 1TA6A 3IECA 1Y3XA 3LJJA 1HXFH 1DWBH 4Z0KA 4AOQA 3CTWB 1N8OB 1G9IE 1QB9A 1FY1A 1N1LA 2JWSA 2EI6A 3B74A 2C5RA 1P2MA 3AAVA 2H2ZA 3T1HM 1GBJA 4UD9H 1GHVH 3KDSE 1MAYA 2R45A 4GSOA 1ZPCA 1O2SA 4REZA 1FPCH 3KOZE 3KW6A 3TGIE 1Z8RA 2XFTA 4YXWD 1GABA 5EJLA 4GIPA 4Y71A 3DOAA 3W0FA 4CIZA 1BJUA 5JI2E 4W5WA 2QY0B 3F68H 2F83A 5HKKD 2W26A 4JK5A 3IG5A 1F0RA 1GBBA 1YKTA 2PKSB 4ABBA 3RP2A 3E21A 1G32B 1O33A 3E0NB 4FUEA 4Y79A 3GQ5A 4LJ5A 3GPUA 1G59A 1XWIA 3GLGE 3SJ9A 2OK5A 1WSSH 3V12A 2VU8E 3V7TA 4MGZE 3KQBA 1TGBA 2JH6D 3SYKA 3ZZ6A 5JPMH 1NO9H 3QLPH 2ZANA 4O3TA 3S9BA 4GC5A 2HWLB 5DG6A 4LJ4A 3FTEA 1UVSH 3VB6A 1UTOA 3QYEA 1SL3A 4LFBM 4GHAA 1T43A 1HIAA 4Y7AA 1Z1IA 1EP6A 1QYRA 5C5OA 5C2ZA 3SQHE 3FYCA 1S83A 3GP1A 1FZZA 4AZFA 1BZXE 3KS4A 5ITXA 3Q77A 4DV2M 1L1JA 1NVMA 5JBCS 1TNHA 3KSJA 2PGQB 4WY3A 1SLWB 1JRTA 4A92A 1ZYOA 3ODDA 3E90B 1UMAH 1TNGA 4U30A 1V2TT 1KLTA 3NUMA 4TWWA 4B2AA 1T6OA 1EQ9A 1IQMA 2J5UA 4ISLA 3V3MA 1DXWA 3DFZA 5JYIA 2FX4A 2D7GA 1O2QA 2JJ1D 4IBIA 2VDBB 3R9XB 3GICB 3M37A 2WINI 4DUZM 4MPUA 1BB0B 5GNDA 2FNAA 1UTPA 1OYTH 2XZUA 1BTHH 3TE6A 3SU0A 3KFUG 1O2WA 2OTVA 1RS0A 1CA8B 5FPSA 3GDVA 5LPFA 2L2DA 1C5VA 1QBNA 1BCUH 1DFPA 4X1PU 1CVWH 3SHGB 5F3WA 1U6QA 1V3XA 1P09A 1CT0E 2BX3A 1QY6A 2DHYA 1B0EA 4FD2A 1V2KT 4MVNA 1UVOA 5CE1A 4G4QA 1NC6A 3LQQA 3V76A 2BTCE 1DANH 1TABE 3P8NA 1VQ1A 1HXEH 1Y5UT 2J98A 1FDPA 4I8LA 1TMUH 3GPXA 1P0SH 4D8NA 1C1SA 4KTCA 1QIXB 3HY5A 5C67A 4LJ9A 1GMCF 1F0UA 1P04A 1SMFE 1TGTA 1Y3VA 2VJ1A 5AVDA 1UHBB 1OAOC 5KEDA 3U6PA 3RXEA 3O8DA 2KA6B 4D82A 3FTFA 4KTSA 1C1UH 2J34A 4J2YB 2ESTE 2A1DB 1YY3A 4R3DA 1V92A 3M61U 4K1SA 2ZFPH 3FUWA 1C5RA 3RU4T 1HDTH 3MU5A 3M0EA 3PMJA 2Y81A 2G8LA 1O3NA 2GTBA 3F2GA 3U8TH 1G8PA 1OWEA 1PJTA 3SHCH 5DP6A 4ASUD 3RM0H 3SNAA 1PPHE 2P94A 3D65E 3Q3XA 2A5YB 3SUFA 3T62A 2QV1A 1ESBA 4INKA 4LJ8A 4NRWA 1CGJE 1ZOMA 4JXJA 4WMEA 1O5BB 1SOTA 3HX3A 4JYUH 3SQEE 1QDRA 1Y5AT 2GMTB 3F0PA 4H6SB 5EXNA 5FSWA 2W3IA 2WYJA 3U6QA 3U6EA 4BAQB 1GVZA 3D8BA 1F0TA 1Z6EA 2Z9JA 4D9QA 2R6FA 2STBE 2F9BH 1QL9A 4OS1A 4I33A 2KHHA 4MGYE 2BVXH 5GCHG 1SXJE 2LHCA 1C2GA 2M5TA 5TCCA 2ZPQA 2VWLA 4I8HA 2R62A 1J5EM 3ZVGA 1L1GA 1V2LT 1AU8A 2GJGA 3RXBA 1HFDA 4RKJB 1GJ9B 1HNWM 2GT7A 3GCHB 1AFEH 3Q3KA 5JBBS 4FCVA 3SARA 1YPGH 3F9FA 1OSSA 4KP0A 3SZEA 1N33M 2ZF0H 3BSQA 3SMSA 3GRVA 5H37D 1EUFA 1S5SA 1ZSJA 5GPIB 1KTTB 4LZJA 1K1MA 1QL8A 2JNHA 1GHAF 1GI3A 3U1JB 2DAMA 2JH0D 3BTHE 2HLCA 1V6DA 2CXVA 3O8BA 5C20A 1IXZA 4WVPE 2GCHF 4AN7A 5ITTA 2JJ2D 1O2NA 2BLWA 3NKKA 1NM6A 5C5NA 4BBAA 1WBGB 1EPTC 3RXFA 3B9PA 2A4GA 2CGAA 2FP7B 1T3TA 2WPHS 1MTNB 1O0DH 4QHTA 4IBLH 4Y0YE 2F9OA 2JA2A 2IPQX 2Z9KA 4DIHH 1XUFA 3OX7U 3OU0A 3U6CA 2P5TA 2ZPSA 2DAGA 2P3UB 3SFZA 2DXIA 2KCPA 1ZTJA 3SI4H 5FBEA 3K9OA 3JZ1B 1LVBA 5KQ8A 4NFEA 1Y3UA 1ZTLA 4IC6A 1AQ7A 4LG2A 1C2DA 2KEBA 1F2SE 1QA0A 1O31A 2RDEA 2LVAA 3KVWA 1AFQB 1GMCG 4HEOA 2VVCA 3F9GA 4CBNA 2XXLA 4AYVB 1BBRE 1KYIA 1NV9A 1ANBA 2AGIX 3GDSA 3VXEH 1WTGH 1C7YA 2O8LA 3UNQA 5ITUA 1C5TA 1NU9A 1FJGM 1F4IA 1ZHMA 1PGYA 3ENSB 3ZZ7A 1V2JT 3E16B 3BTGE 4PCZA 1O2HA 1GJBB 4A5TS 4LRSA 3BG4C 1ZSKA 3ATLA 1O2UA 3ZVAA 3UOPA 3TWLA 3ATIA 4X66M 1GBIA 2HHHM 1WXQA 1Q39A 3DA1A 1O2YA 2BZAA 2PR3A 5HMAA 1TRNA 2G3QA 3BTWE 1ELCA 4CR9A 1DDJA 2BD8A 4RT1A 1GHWH 4K3JA 3FYDA 2BHGA 1T8MA 1IN7A 3STIA 3B89A 5KECA 3GPPA 1FIZA 3UAIC 3UFAA 1Q3XA 1QGFA 2UUFB 8ESTE 3TPIZ 1JOUB 5FHTA 4ANRA 4MGHA 1DOJA 1ANCA 2ZDAH 5E8EH 1K9OE 3SJIA 2ZBKB 1GBHA 1OIZA 1W0ZU 2XCFA 1SBWA 3QGJA 4BAHB 4CRAA 1WAYB 1MZAA 1LHDH 3A7XA 4U01A 4PD2A 2FOCA 2B8OH 3Q00A 2V1CA 4FU9A 3UNSA 1A3BH 3PWBA 2QC2A 2ODYB 1ELAA 4LGYA 2QGRA 4X2WA 1N8OC 4X2XA 2Q6DA 1G3EA 2TGTA 2ZU3A 3H09A 1C2FA 5CHAC 1O32A 3NBXX 4IGDA 3TJNA 1S6HA 1ZTKA 1SGIB 3R8FA 2BD9A 1RFNA 3RXLA 2GVFA 4HZHA 3PTBA 4LGMA 2NU2E 1UVUH 1OAIA 1EZQA 2GT8A 1F0SA 3AJIB 3M5OA 3S9AA 8GCHF 1OP0A 3IG8A 3PLBA 2QXGA 3SNDA 2A7JA 1SQTA 2YMSC 1OXGA 4UFEH 4E06H 3AK5A 1J15A 2CV1A 4TPYA 1SHYA 3SU5A 1QR3E 2O5RA 1S81A 2VWMA 4M9XA 3I4YA 1OP2A 3DD2H 1GDNA 1NZQH 3W0LB 4DR1M 4Y7BA 3FD9A 1Q3BA 1GBMA 2Z8YM 3HU1A 4I31A 1V34A 2ANYA 2X8AA 3MOCA 4KT0F 5F6MA 2LWXA 1PYTD 4NZQA 2KXEA 2KZUA 4LFAM 5EP4A 2BDGA 2ZAMA 3ZYEA 2ZAOA 4I8OA 5T6GA 2QSFX 1ZGIA 1O3CA 2GV6A 4NIWA 3ESTA 1EZUC 3SU1A 4JI8M 3R3GB 2PV9B 4X6MA 2C9CA 4OW0A 3GPYA 2Z4RA 3SNEA 1TBQH 4NCYA 1HB0B 1V2WT 3BTFE 2K47A 2M5ZA 2YQZA 1VKYA 3S7KB 1P3QQ 1YLDA 1MTSA 4RF1A 3MFJA 1OTRA 2Z4SA 3TQSA 1CGHA 6CHAB 5DP5A 4BANB 4KO8A 3CGWA 1JIRA 1NFUA 3PTNA 3I4VA 1OWJA 1YYY1 3A7WA 3LIWA 4B6FA 3KP1E 4DOQA 2C93B 2I7NA 3J27B 1RIWB 4DGJA 2LPRA 4GUXA 1TALA 1YLAA 2HRVA 4JI4M 1AZ8A 4MQAA 1O36A 2JIZD 2R3YA 3HK3B 4JI7M 2QP9X 1SGYE 5FX6A 4JCNA 1C4U2 1R6BX 4LZ4B 3DT0H 1G71A 3KNXA 3QWLA 3PMBB 4GRIA 2KZSA 3VB3A 3BG8A 1DLEA 1MN3A 3IITA 4MPWA 4BAKB 1NN6A 3U6SA 2LHGA 3SU6A 1A61H 1KXAA 1NY6A 1WV7H 2BD3A 2BJVA 1LPKB 2QA9E 3OYPA 3TNTA 4TY6A 4WMDA 3M7GA 1Y5BT 3ZCBB 3QZRA 1GBFA 1FV9A 2KFWA 4DR4M 2ZZUH 3PYHA 4IC5A 1ZJKA 1CU1A 2TRMA 2GV7A 3IWMA 1TQ7B 3HKIB 1GL7A 3VDPA 1TYNA 1YCPH 1MCTA 3RMOH 3C27B 5KQDA 4F4OC 4WURA 5GWZA 5BR8M 2OOBA 3RXAA 1ANEA 2F4LA 4A1TA 3F3BA 1AFQC 4AG5A 2AS9A 2TGDA 3EDXB 1MQ5A 2QCYA 3UIRA 1OHHD 4B2CA 4IN2A 3FANA 3EE7A 1XUHA 3MH6A 1A0HB 5DYIA 1HJ9A 3SU2A 4NA9H 5DP9A 4K0KM 4SGAE 4LJ7A 5A09A 3T25A 4YLUA 3RXIA 1WCZA 2WPMS 2KCAA 4WWYA 2ODQA 1H4WA 4LF8M 2ALVA 3LDXH 3P8FA 2C99A 4GVUA 1WYKA 2Z7JA 1K1LA 1ZHPA 2TGPZ 3U8RH 1L8QA 4FCWA 2A5AA 4THNH 1J09A 2XLJA 4DR7M 1RTKA 1VITF 1XVMA 3AAUA 3KYFA 2J5YA 3HPTB 4NZLA 4XSKU 1G3CA 3HGPA 4BAMB 2FOBA 1F5RA 5I46H 3RXCA 2DZLA 1C1RA 3A8CA 1O3EA 1O2OA 3EIHA 3RXSA 3SNBA 2YMSD 3TH2H 4LXBH 2PGBB 3U5ZA 1VGCB 4IBBA 1IAUA 1P12E 4BOHA 4TYDA 2L4FA 4M0DA 3WW7A 4A3VB 1NFXA 2C3SA 1IQGA 4INLA 1C1PA 1OS8A 2A2XH 1H8DH 3E4RA 4IIWA 3SU4A 4LF7M 4B73A 4YOGA 3H7OA 1MAXA 2BYAX 3J2PB 1O3JA 3T26A 3MWIU 3QK1A 4ISNA 5AF9H 5EXLA 1HNEE 3GISB 3SUDA 1V2ST 3F9EA 2BDCA 2ZU4A 5LH8A 3LVVA 1ANDA 1FX0B 3JR5A 3KOYE 1LKAA 1SGPE 2J2UA 2J94A 2ZKSA 2CV3A 4KLNA 4M0WA 4CHTB 1AWHB 1ELBA 2QF0A 4ACAA 1W3CA 5ITYA 4CREA 5ITRA 1ZSLA 2ERCA 2DKLA 4MG3A 1O5GH 3ATKA 1DY8A 1FY8E 4FWGA 1FY4A 4K69A 2I6QA 1FIWA 1XHBA 4LF6M 2ZDNA 3GCOA 4G4RA 2M60A 3D23A 3MU1A 2IN2A 6CHAC 3SGBE 1QJ1B 2V35A 2CFOA 3B7ZA 4JZFH 2SGDE 1JRSA 1P2JA 2HNTF 5EQSA 4AI6A 3E1XB 3FP7E 4GHLA 5FCRA 4ABFA 2FLBH 3HGIA 3ZVBA 2R4JA 2KW0A 1VJ9U 4YLQH 1L1NA 1QJ6B 2NU3E 1C1QA 1V2MT 2XC5A 2KAIB 4WH8A 3LGIA 2ZTDA 5H4IB 4LCBA 1QZ8A 4JI2M 3KL6A 4XBDA 4NL4H 1JR3E 1IQFA 3GY3A 5J4QA 3LMMA 1EX3A 3LONA 4X2VA 1VEJA 3T6PA 2UWOA 1B5GH 1EXFA 1HAXB 3F6UH 5A0AE 2WV4A 1PQAA 5E2PA 3VK8A 3GQ3A 1W11U 2PKAB 2R18A 4MNXA 4P00A 1GWAA 4CH2B 3MO3A 1AMHA 1P02A 3OEHD 2XYAA 1P10A 1DGHA 1ZMLA 3I01M 1IOEA 5IT9S 1KLIH 4DVAU 1BMNH 2FXRA 2RKOA 3SGQE 3TWMA 2ZDKA 2Z6BD 2V3OH 4AGJA 1OFHA 5C1XA 4UFDH 2B9LA 1YE9A 1Q31A 3BEFB 1V2PT 1SHHB 1S3SA 1GJTA 2BLVA 4IBKA 2AHME 5F03A 3A42A 5EP2A 4GITA 2RA0A 1QANA 1A2CH 1N6YA 1L4ZA 1GCDA 2FE8A 5IYTA 4X8UH 4FUJA 4GPGA 3I51A 1AHTH 3FN8A 4R71A 1T32A 2A4QA 2UWPA 2F5SA 2FLRH 5HIYA 1K1PA 3VB7A 1C1KA 2KNZA 2AGGX 8LPRA 1KXCA 1Q02A 3H4MA 1Y3YA 2C98A 3HHYA 2XTTB 1CT4E 1HAOH 2ANKH 1NJFA 1R5LA 1EB2A 1TMTH 3FOAA 4K60A 1NESE 2XF3A 2DWZB 3N7DA 1O37A 1V2OT 2VQEM 1EAXA 2BDIA 1DE7H 1PRBA 1A0JA 2L7HA 3HHXA 2HPPH 2M2AA 4LF4M 4Q7JA 2A4RA 5FPYA 3ZYDA 1BTWA 5JB8S 3VK7A 5L30H 3OTOM 3A8BA 4X64M 3LGTA 3EIEA 1BMMH 2KNVA 1ELGA 5GXPA 5EP3A 3GO8A 1LCYA 4U32A 4E7RG 4U2WA 3DFLA 5PTPA 5TJXA 2BOHB 2ZCHP 1GG6C 5FAHA 1AIPC 1HBTH 2WSSD 4TSFD 4PT5A 4XBOA 1D3DB 4GHTA 2DWLA 3P17H 2Y5HA 3OE7D 4FVBA 5E2OA 4R0IA 3SV9A 3NZIA 3KQDA 4FUHA 1BQYA 1ZRKA 4YOIA 2FYRA 4AC9A 3D8LA 1IXRC 4AG6A 1ETSH 2VINA 4AZ2B 5EQQA 5HXFA 2C8WB 2K9DA 3O8RA 1FONA 2XH9A 1CUKA 1L2EA 1IXSA 1KXBA 1TDZA 5ITQA 3K9PA 1UTQA 1XUKA 4MNVA 2ANMH 2BY7X 3CNRA 3ZVCA 4DCDA 2G8TA 1QA7A 1OQYA 1W0JD 2G55A 2FI3E 4A1VA 1DWEH 1K3WA 2DZNB 1ARCA 1G37A 2VNTA 1DO2A 4BLCA 2XNDD 2B5TB 1QQUA 3FRIA 2G00A 2ZC9H 1BMFD 3BN9A 1GJ5H 3J80S 1P9UA 4OGYA 1T4UH 2O25A 1EAWA 2OBQA 1WR1B 1KSFX 4XGIA 3E91A 1LO6A 5A0CA 2JY5A 1TGUA 2KRKA 4IBEA 1HAZB 3M5NA 4ESTE 2VF7A 1P2NA 2AH4X 2EJSA 1FNIA 2R0LA 2WPJS 4X6NA 1HV7A 1VDLA 1O3KA 1S6FA 2H6MA 3PROA 4ISHH 1BTPA 1ZJDA 1GMHF 3L25A 1AVXA 1BMAA 2EA3A 2ZP0H 3PV4A 3FTCA 1W5TA 1EASA 3A7TA 3BF6H 4ZKSU 4CRFA 3N7EA 4AX9H 3M35A 1V33A 3KSXA 1ELEE 6LPRA 4FETA 3BTDE 1L2BA 3MU4A 2ZM6M 2BDYA 1C5SA 2R4EA 1HAHH 2FOAA 4MB7A 2GCHG 4X8VH 5A0BA 5T6DA 2H9HA 5EJ1A 1UCYK 3PXGA 3U60B 2ASUB 4B3RM 2A5IA 1EFRD 3U8OH 1QURH 1BBRK 2DNAA 3CENA 1GG6B 1NV8A 1UK3A 1EPTA 4DY7B 4P16A 1QZEA 4NSOB 1TBRH 2KCYA 2LP6A 2VWNA 2TGAA 1O5EH 4B3MM 3FUUA 3RMLH 2A31A 4FXGH 2H5XA 5FXLA 1KMHB 1NRRH 3GY7A 1THPB 2BY8X 3E3TA 1DS2E 3AV0A 2GMTC 2Z94A 1HCGA 4UEHH 1CT2E 4WP2A 3M7TA 3B23B 4LF5M 3MK6A 2K8IA 4LOYH 3SMPA 2WSFF 1C1VH 1AKSB 4KODA 1FAXA 1D2NA 2MGWA 1LPGB 1NROH 1O3OA 2BXUH 2RG3A 2XC4A 1L1ZA 4GKKM 1WXRA 1BVSA 1GI0A 4WMFA 3C3DA 4I5SA 1DGFA 3GLFE 3AOEC 4F48B 2Z9IA 2EQNA 1I94M 1NBME 1H8IH 1PPFE 1JWTA 2ZGCA 3BTTE 2BD7A 4LJAA 2FZZA 1LTMA 4YM9A 3A86A 1HAIH 4D7GA 5TCAA 5L6NH 1THRH 2HOBA 1QAQA 4VGCB 1O3BA 1MX0A 3M5MA 2ZTCA 1FNNA 4DV0M 1SGEE 4KELA 3SV7A 1L2DA 2O01F 1Q2WA 3K1JA 1FXYA 4YO9A 2OINA 3RDZA 3ZIAD 3PO1C 2ZCKP 4MTBA 4YY3M 4X1QU 4XK8F 2DZOB 2J95A 4CRBA 5ABWA 2KDLA 4JI5M 1W7GH 1SGRE 1E9SA 4AKHA 4DURA 1NRSH 1L2CA 3PNVA 5A8XA 2VIVA 4HGCA 4B3SM 4M9SA 1IFYA 1O3AA 4QT8C 5E0HA 1PPBH 2A7HA 3L26A 5DFLA 4JI1M 1P8VC 1SGQE 3A8DA 4O97A 3GLIB 1AWFH 1MKWH 1VITG 2O9QA 3VG8A 2AHMA 4QNRA 2ODPA 1TRYA 1VGCC 5EIYA 4ISIH 3UWJH 3A98B 5EP1A 2Y20A 1TH3A 3U6LA 1C5QA 3NPSA 2HGTH 2JY6B 1MBMA 2FTMA 4LZ1H 1MMJN 2CP8A 2NQ8C 1GJAB 4GAWA 5I25A 5ETXA 3BIVH 1AN1E 5CHAB 1X7AC 4MLFB 1O2PA 3M7UA 2P16A 2V6NA 2ZTXA 3GOVB 5KPRA 2D7HA 3MH5A 4CRCA 2OC1A 1NRPH 2W3KA 2L6OA 4MGIE 4DV7M 1DLKB 4GMQA 1BTZA 2MJ5B 2YNBA 2JXNA 4LRTA 3ZZ4A 2YFQA 3RXUA 2Y7ZA 2CHAB 2CRUA 1Z7KA 2ZTYA 4J1YA 1TX6A 4I7YH 2BY9X 3SNCA 1CQQA 4LJ6A 4I8KA 1DUAA 4KKDA 4X8SH 1UTKA 3GLGA 1QTFA 4TWYA 4H4FA 1MD7A 1Z6TA 1GJCB 3GQ4A 1QRZA 2SGPE 1EATA 2F5NA 5HGGA 4XDEA 1GKIA 1IQIA 3PVSA 1A0LA 1RD3B 3HGNA 1DY9A 1T8LA 4JZ1A 3HU2A 1UTNA 1QB6A 2D7EA 1J16A 3HKJB 4OS2A 2Q1JA 5DPAA 1WIVA 2UWLA 3LVWA 3NXPA 3KYGA 1V2VT 1O3FA 3LGUA 2G4TA 4PROA 2QF5A 2I6SA 3TNSA 1W12U 2ZGHA 3BBZA 2FWWA 2VB0A 1H8HD 1O30A 3UQVA 3PRBA 2FOEA 3DZDA 2FEQH 1EE8A 5HYOA 3A89A 2IOTA 1KLJH 5AFZH 2LXEA 3GYMA 2W6JD 3PB1E 2WHXA 1ZV1A 1IY0A 4RF0A 3G01A 2LTUA 4Y76A 3L27A 1UCYH 4AYYB 1F5KU 1CHOG 2BDHA 2FM2A 1SLVB 2VIWA 2GGVB 2WV9A 3FKEA 2QN5T 2R2MB 3KEEA 2BVSH 1NNUC 3OEED 3RC5A 3AOGA 1NTPA 3EA9A 4UFFH 1C5WB 4O9VA 2G4UA 4AG2A 1GMDG 4P02A 2BM2A 5G4BA 1LDTT 2H1RA 2JP7A 1C1WH 2BDBA 3KQCA 3SC3A 1UO6A 2QBYA 1GLNA 4B2BA 3ZZ9A 5C3NA 1C2EA 3HWSA 2RA3A 3TITA 4Q7ZA 3RXMA 3F92A 3GCTG 1XXDA 3A81A 1JR3A 3VEQB 1YUBA 3T29A 2DVWB 2ZECA 2XSZA 2VIOA 1XXFA 3MO9A 4JV5M 4GH9A 2LNHC 3GLIE 5LMUM 1MCVA 2BWBA 2Y7XA 3RXDA 3VPKA 3PNYA 3K92A 2QPAA 3K6ZA 2XW9A 3UZUA 1HQCA 1XC8A 2PP6A 4JI3M 1EP5A 2HNTC 1BUIA 1DSUA 1H9LB 1JIMA 4JI6M 1AE8H 1UTMA 2IPHA 1NHWC 4OS4A 2AMPA 1OP8A 1GVLA 2R9PA 3KQ5A 1D6WA 1LTOA 1O3HA 2P95A 2FPZA 1E35B 3W95A 4KHPM 1NRQH 4AB8A 7GCHF 2PTNA 2RGOA 2IJOB 3I04M 3K2UA 3MMPA 2LH0A 2VIQA 2HALA 1XMQM 5DP8A 5LPRA 2VVUA 2ZTZA 1IN8A 1D4PB 2FOFA 3F2FA 3TVJB 3OAAD 2N35A 1K22H 1G2LA 1PQ8A 2ZCLP 3SO3A 2A2QH 2BQWB 3UREA 1Z71A 4K1TA 1OKXA 3A7VA 1D0KA 3HK6B 1ZHRA 4OX9M 2UUYA 2YMSB 2B3TA 1NY5A 2P8OB 1CO7E 1YPJH 2CHQA 2F91A 4I86A 5EPNA 3N7OA 3C3EA 3J7BA 3A85A 3KS8A 1TOCB 2FX6A 3RLWH 3GRRA 2YR0A 2Z3XA 1RU3A 1SXJA 2XGNA 1DSTA 1N77A 3GDUA 2TBSA 4AG1A 1DVAH 1HNXM 2QBYB 2XRCA 1XNRM 2DAEA 2QE7D 4ISOA 9LPRA 3U6OA 4A6LA 2VQFM 1HAVB 3PRDA 5DYGA 1DWDH 1N78A 2LVNC 4OS5A 3VXFH 2QF3A 1B7XB 4XBBA 5IDKA 2PLXA 2GDDA 2J97A 1P57B 3BOSA 3A88A 3IG6B 1E79D 3RU4D 1ZRBA 2Q2EB 4Y10E 1HRTH 1LVYA 2ZIQH 3P6ZB 4ZKRU 1DGHB 1K0HA 1TQ0B 2H1UA 1CHOF 3BTQE 3RGSA 3URDA 2OQ5A 5F8XA 2MH8A 8CATA 1FPHH 1O2GH 2FOMB 3W67A 4NG9H 4OVZA 2PKAA 2JY8A 4NIXA 2FTLE 4Y0ZE 4NGAH 2K0BX 2WPIS 3B9FH 4OS7A 3A45A 1SVPA 2XOKD 2W6ID 1P2KA 3J7AS 1ACBE 1AY6H 1XXHA 1TOMH 3MNSA 4Y11E 4L4UA 1AB9C 1SLUB 1G30B 1O2TA 5JBAS 3OY5U 1FLEE 2V3MA 4XD7D 1BITA 3SYJA 3BEUA 5EW1H 4CHAB 1R7RA 5C1UA 2L74A 4XE4A 3T27A 1ZLRA 7ESTE 3FUVA 1GMHG 1OPHB 3BTME 3MJ5A 3GLHA 6ESTA 4G4NA 1R2YA 1HJ8A 1NS3A 1YPHE 4RN6A 5A8YA 1IN5A 2EUCA 2GCTC 3PWCA 4P17A 1O3GA 2JUJA 1NFWA 1A3EH 1KXFA 4JZDH 3TPZA 3LKWA 1FN8A 3TJUA 1SGCA 4D81A 1BRAA 2VF8A 4DV3M 2XNIA 1JB0F 4NSYA 2ZFFH 2QXHA 5EW2H 4K1EA 1VG5A 1LMWB 2Y6TA 3LGWA 4R8TB 5EG4A 5E0JA 3U9AH 5DKMA 1P11E 1VCPA 3ZH9B 2W5EA 3AKZA 4DV4M 1N32M 1FY5A 1CE5A 3VDUA 2ZO3H 3FO8D 5DJ7A 5EJCA 4S12A 1A1RA 1MTVA 1YCPK 2OD3B 2ZGJA 7LPRA 1E37B 4YT6H 1T7CA 1IQPA 1LQDB 4Q80A 3MYWA 1SGDE 1E9RA 1TDHA 2HAKA 2LNCA 4FUFA 1NT1A 2FS8A 4NSRA 3MNXA 1RTLA 3FP8E 3GLIA 1XNQM 1RRKA 2WZQA 3PFIA 3SJ8A 1SI5H 4HFPB 4K8YA 4MPVA 1Z8GA 1DX5M 2OUAA 2BD2A 1MBQA 4QOZC 3V0XA 2BD4A 3KGPA 3LJOA 4AGKA 2Y80A 1SSXA 1ETRH 3EGKH 3ZZBA 6GCHG 5SGAE 2HNTE 1B0FA 1LV7A 1SG9A 4DR2M 3MHWU 1MU6B 5BPVA 2UXDM 1OIPA 1MU8B 2WPKS 3CS7A 2A32A 1C1NA 1AZZA 2GNOA 3TWKA 4WH6A 1S85A 2PKSC 3BG4B 5BRRE 3OTPA 4FUBA 4I8GA 5GDSH 4XRNA 5KGOA 2QQ8A 1Z59A 3P70B 2OQ4A 5DP3A 1G3IA 3HJSA 4DW2U 2ZDVH 4UE7H 1D3PB 3ZZ8A 1JBUH 1O2LA 2F43B 1TMBH 4JMYA 5T3HA 3SASA 4JK6A 3RXQA 1MKXH 2KM0A 3GY2A 2XC0A 1EJMA 1TH4A 3MQKC 5FTJA 1CA0C 6GCHF 1NY22 1VCWA 1YPEH 1XXHB 3J81S 4ZPXA 2QIQA 1NNJA 1EJNA 1K2I1 4ZH8A 4Z1MD 4DBGB 2PUQH 1GL6A 1WQVH 2ALPA 5C94A 1EIJA 4CBOA 2R0KA 2Z9LA 1AVWA 3UWIA 1L4DA 5B6LA 5IREB 3W1EA 1MTNC 4D80A 1C2HA 2W7UA 2ZNKH 4ITQA 3VB4A 3KIDU 1YLCA 1XKAC 2CMYA 3NK8A 3GLHB 1EPTB 1HPGA 1VCQA 4RKUF 1W5SA 4IBCA 3BTKE 3P95A 5FL7D 3SOSA 1D3TB 4B76A 4RKOB 1C5MD 5BPEA 4BXSA 3URCA 4OM9A 3ZZDA 3U60A 1G3BA 1O5DH 2XCNA 4NXNM 4JZEH 3EQ0H 1BJVA 1LPZB 2CV2A 3RE8A 2QAAA 1PQ5A 1HQYE 1PJJA 1O2JA 1N36M 1HYLA 1KDQA 3QO6A 5DP4A 3PLKA 1P06A 4Z6AH 4ZMAH 3S9CA 3SV2H 1S82A 3FP6E 4ASHA 3H4JA 2HWJA 1C2IA 1EKBB 2FODA 2ZHDA 2Y0QA 5JDUB 1IQHA 4Y8YA 1GJDB 1IXSB 1YGCH 2QYIA 2V3HH 2F9PA 2VWOA 4WXIA 2Z3EA 4B7GA 3LPRA 4BAOB 2CF9H 4DV1M 2XBYA 4LF9M 3GY8A 1GBCA 4NA7A 4YTAA 3L29A 4MDSA 1UCYE 1N34M 1ORYB 3UB0A 4RI0A 1DV0A 1O3PB 2K1QA 1J14A 1XMNB 3K8ZA 3WHLA 4AKIA 4Q2KA 3WWFA 1BRUP 1FN6A 2NU0E 3RXOA 1DITH 3NCLA 1TB6H 3GS9A 1ZR0A 4IBJA 3O8CA 4TPIZ 1QAOA 4BNRA 3SBJA 4B3TM 4YESB 3VKGA 4X0WU 1QAMA 2Z7FE 4F1IA 1A5HA 1TF0B 4EIWA 1TNJA 3FVFB 2PTCE 1GI1A 4Z8XA 1EAIA 1EOLA 4PDGA 1A5IA 4X62M 1V2RT 1GJ6A 2BX4A 2R44A 3MHVC 2C90B 2F9VA 1K3XA 1IBMM 1W8BH 1N75A 1XXHE 4RSPA 5CDFE 2ZHEH 3U98H 1NFYA 4HL4A 1QUSA 3RGPA 2XBVA 1FI8A 3BXWA 4AORA 4H42U 1KXEA 4TUWA 3MU0A 1ETTH 2DI0A 1A4WH 1SQAA 1OX1A 4MM3B 2KX4A 5DO4H 1C5ZB 3SAVA 1W7XH 1ZMNA 1P03A 2XSZD 3QAUA 4DV6M 1ID5H 1QUTA 2V1UA 3NWUA 2BMGB 2H9TH 1UK2A 1BIOA 2WSEF 1NPMA 3A82A 3HU3A 3H5CB 1CGIE 3L33A 1BOQA 1C2LA 1FQ3A 3SW2B 4HTCH 4NIVA 2C9OA 3B7QA 2D8WA 4AQYM 3GLHE 4WF8A 4MNYA 1SGTA 1AB9B 1COWD 3K9XB 1MUEB 2CJIA 1K1JA 2BY6X 2PUXB 2OPFA 2UUJB 3M36A 2STAE 3Q3YA 3M5LA 2Y82A 3FKSD 1KDQB 1G41A 3KF2A 2NWNA 3ZVEA 1YF4A 1TX7A 5C0TA 1NBMD 1XMOM 5E26A 5DNYA 2O8TA 4IBDA 3B8JA 2SGEE 2VGCB 4NIYA 1ORFA 1A46H 1C1TA 1MU5A 1GI6A 2DAIA 2DENA 1R4GA 1K1OA 3P8GA 1Z5BA 2KAIA 2Y5GA 2FYQA 3JAMS 2OP9A 1ABJH 2AMQA 2BD5A 3TK9A 3A46A 1UM8A 1Y3WA 4ZUHA 3QWCH 1GL0E 2K6BA 1GI2A 2EC9H 3F1SB 1PJQA 2AGEX 4MH0E 3HKPA 1A7SA 1GJ4H 2JY7A 2AERH 2ZEBA 4I32A 2EI8A 4K8BA 3SJOA 1GJSA 2AEIH 4Q7XA 1WTHD 2J38A 4WJG2 4KTUA 3ZZAA 3RU4E 2SNVA 4B1TA 4INHA 1ZZZA 1DXPA 3SU3A 3FAOA 1TONA 5AHGH 1D0MA 1SLXB 1E94E 3ATWA 4IS5A 4SGBE 3CP7A 4ZXYH 2KCOA 2GDEH 1BHXB 3PMAB 1AUAA 1P3CA 1O3DA 4ABAA 1TNIA 4E05H 4M9FA 1YP9A 4ABHA 2HPQH 3AASA 2L09A
chains in the Genus database with same CATH topology
3GLGA 2X8AA 5EPYA 1YSYA 2E5LM 1Z5CA 2R46A 2LWXA 2Y0TA 1Z6TA 3GLGB 2KXEA 2KZUA 1X37A 4LFAM 5EP4A 3LQRA 3GQ4A 1E1RD 2F5NA 1PM5A 2ZAMA 2YOLA 1GKIA 2ZAOA 3PVSA 4I8OA 5C18A 1DY9A 1QQWA 3M6AA 1IY2A 3HU2A 2UUAM 2D7EA 3LVWA 5EXTA 4FW9A 3SU1A 4JI8M 1ZAEA 5CHBA 2C9CA 4OW0A 1JQJC 3GRYA 1NHGC 3GPYA 2OBOA 2QF5A 3PV2A 2Z4RA 4PDIA 3U5ZB 3TL4X 2EA0A 3SUEA 1H8HD 3PRBA 2K47A 4FVMA 4G4OA 2M5ZA 2YQZA 2CHGA 5C17A 2Y21A 3DZDA 1EE8A 4NWLA 4RF1A 1IN6A 2Z4SA 3TQSA 2OC7A 2LXEA 2HCBA 3HJ8A 4KO8A 2W6JD 2WHXA 1IY0A 4RF0A 3I4VA 4GC9A 3L27A 3HHZA 2QENA 2KZ4A 3K2LA 4B08A 3WHKA 1R2ZA 4YHHM 4B6FA 3KP1E 2FM2A 2WV9A 2I7NA 3J27B 2GGVB 3FKEA 5IWAM 2DHRA 2KRUA 3KEEA 1NNUC 3OEED 3RC5A 3AOGA 3KN2A 3SAUA 4JI4M 2JIZD 3FTDA 1DGBA 4JI7M 2QP9X 2CK3D 1IN4A 1R6BX 3NWLA 2H1RA 2CHVA 3KNXA 3QWLA 3SC3A 4Q4LA 1OJLA 2KZSA 4GRIA 2QBYA 1GLNA 4B71A 1IY1A 3U6SA 3SU6A 1NY6A 3HWSA 2BJVA 4BB9A 3OYPA 3M7GA 3U6DA 3ZCBB 1JR3A 2XZFA 1YUBA 2KFWA 1HT2E 4DR4M 2DVWB 3KOXE 2XSZA 4MGKE 1CU1A 2UU9M 3L6PA 5EQTA 1GL7A 4QOSA 3VDPA 4JV5M 3FUTA 2LNHC 4GH9A 5LMUM 5KQDA 4B6EA 3PNYA 5IZ7D 2W82A 3K92A 4WURA 3DCLA 2XFSA 2QPAA 5BR8M 2F4LA 4A1TA 1E1QD 3UZUA 1HQCA 3VFDA 3U61B 1HR0M 1PJIA 1XC8A 3F3BA 4JI3M 5JI3E 4M9ZA 5KPZA 4AG5A 2UXBM 1KFVA 4JI6M 2QCUA 4WW0A 1NHWC 2F9UA 1DXWA 1OHHD 4QHSA 1IBLM 4KHPM 5DYIA 3EYDA 3SU2A 2F5QA 2RGOA 2IJOB 4K0KM 2LH0A 2DWMA 2V7QD 1XMQM 4LJ7A 3SYLA 1IN8A 5FTNA 3F2FA 5A2QS 3PV5A 3OAAD 2KCAA 2CV0A 4L8RC 1L1TA 3E9SA 4LF8M 1E32A 2C99A 3OFND 2CE7A 4OX9M 2HLDD 1I4WA 2F5OA 2WPDD 2YMSB 3NBIA 2Z7JA 1NY5A 1L8QA 4IJEA 4FCWA 1J09A 4I81A 2XLJA 4DR7M 2CHQA 3RFWA 5ESBA 5EPNA 3J7BA 3KS8A 4DT4A 3ZC7B 1QVRA 2YR0A 3GRRA 2Z3XA 1H8ED 1SXJA 5FTKA 3EIHA 2XGNA 2YMSD 1N77A 1HNXM 2J7NA 5EXPA 2QBYB 2QZ4A 4NWKA 3U5ZA 1XNRM 4AKGA 4ZCNA 4IBBA 1RGQA 2QE7D 1OFIA 4TYDA 3U6OA 4M0DA 2VQFM 3WW7A 5E6JA 4A3VB 3U6MA 1SXJB 3LOXA 4DUYM 3PRDA 5DYGA 1N78A 3VKHA 4FWDA 4DR5M 4B7HA 2UUBM 1W0KD 3E4RA 3P8OA 4IIWA 3CTWB 2DWNA 1S6LA 3SU4A 4LF7M 5IDKA 4B73A 2JDID 1N1LA 3BOSA 4FCTA 3J2PB 2C5RA 1E79D 3T1HM 2Q2EB 2BJWA 3KDSE 2X49A 2R45A 1SXJD 1DGHB 3THGA 4LJ6A 4REZA 3SUDA 3KOZE 3RGSA 5DSFA 3KW6A 2P59A 4Z6YA 2C96A 8CATA 2FOMB 4YXWD 2XFTA 4GIPA 3DOAA 3LVVA 4OVZA 3W0FA 5GKNA 2BNKA 4NXMM 3JR5A 3KOYE 1FX0B 5JI2E 4W5WA 3HJQA 5HKKD 3A45A 4KLNA 4M0WA 4CHTB 3IG5A 2CEAA 1W3CA 2XOKD 5ITYA 5ITRA 3Q8XA 1H6UA 2ERCA 2W6ID 3J7AS 2HKJA 1XXHA 4L4UA 1DY8A 4XD7D 3GQ5A 4FWGA 3SYJA 5EQRA 4LJ5A 3GPUA 3JR4A 1G59A 1XHBA 1XWIA 4LF6M 1R7RA 2RGHA 4G4RA 2OK5A 2M60A 5KPTA 2VIIA 3FUVA 3SV8A 3NRLA 3L2AA 4L16A 4MGZE 3MJ5A 2CFOA 3GLHA 3SYKA 4G4NA 1R2YA 1NS3A 1IN5A 2EUCA 5EQSA 4AI6A 2ZANA 4GHLA 3HGIA 4GC5A 2R4JA 2KW0A 4LJ4A 3FTEA 2G5GX 3TPZA 4LFBM 4GHAA 3LKWA 4D81A 4WH8A 5FPTA 1QYRA 4DV3M 3AFHA 4LCBA 4JI2M 2XNIA 3FYCA 5FTLA 5H4IB 4NL4H 3GP1A 4AZFA 3KS4A 2L7IA 5ITXA 4R8TB 3LMMA 5EXSA 3LONA 4DV2M 1NVMA 3ZH9B 3AKZA 4DV4M 3KSJA 1N32M 1IM2A 3VDUA 3FO8D 3VK8A 4A92A 5EJCA 4S12A 3GQ3A 1A1RA 1G4AE 2R18A 3E90B 4I4LA 2OC0A 1BT7A 3SAWA 4R7GA 1IQPA 3OEHD 3GRUA 1DGHA 4AW4A 1E9RA 1TDHA 3UMMA 4B7FA 5IT9S 2QF4A 4X65M 4NSRA 2RKOA 3TWMA 1RTLA 1OFHA 3GLIA 2J5UA 1XNQM 2F5PA 2WZQA 1YE9A 3PFIA 1DO0A 3L28A 3DFZA 3T1YM 5GJ4B 2D7GA 1S3SA 2JJ1D 4IBKA 4IBIA 3R9XB 2AHME 3RC6A 3A42A 1Q3CA 4GITA 5EP2A 7CATA 4DUZM 4QOZC 2OC8A 5GNDA 1QANA 2FNAA 2FE8A 2XZUA 3SU0A 3TE6A 1DGGA 3KFUG 1LV7A 4DR2M 3I51A 3RC4A 3FN8A 5FPSA 2A4QA 2F5SA 5BPVA 2UXDM 4WH6A 1C1KA 2O8MA 3TWKA 4G6ZA 3DSPA 1IBKM 3H4MA 3SHGB 5F3WA 3OTPA 2C98A 3HHYA 2X4AA 2K0QA 1Z59A 1NJFA 3T15A 4FD2A 2OQ4A 1G3IA 3HJSA 4G4QA 3FOAA 3LQQA 5EXXA 5FLXS 4DV5M 2XF3A 2DWZB 2IJD1 3F0OA 3N7DA 3P8NA 4LY6A 2VQEM 3GPXA 3DSOA 4KTCA 4HLQA 2F43B 4JMYA 2L7HA 3HHXA 3SASA 4LJ9A 2M2AA 4LF4M 2A4RA 3GLFA 5FPYA 3UJNA 3VK7A 3OTOM 3U6PA 1HT1E 1NJGA 4CISA 2KM0A 3O8DA 2KA6B 4D82A 1TH4A 3UK6A 4X64M 3EIEA 3FTFA 5FTJA 4TT3D 3CF0A 5EP3A 3GO8A 4Q63A 4R3DA 1XXHB 3J81S 4ZPXA 1NNJA 2YNMD 4Z1MD 4FWHA 1GL6A 1ZQ9A 2WSSD 4TSFD 4PT5A 3FUWA 4XBOA 5B6LA 2DWLA 3WWBA 3M0EA 5IREB 3F2GA 2G8LA 3OE7D 3GLFB 1G8PA 3W1EA 4D80A 3SV9A 4ASUD 4ITQA 4B75A 3D8LA 3GLHB 1IXRC 2A5YB 4AG6A 3SUFA 3VLFB 2QV1A 1W5SA 4IBCA 5EQQA 5FL7D 3O8RA 2XH9A 4LJ8A 4B76A 1TDZA 5ITQA 4NRWA 3N99A 4JXJA 3SUGA 4OM9A 3U60A 2XCNA 4NXNM 3F0PA 5KO3A 2KR7A 5FSWA 4IBFA 4F55A 3U6QA 1W0JD 3U6EA 3AOEA 3D8BA 2CV2A 3RE8A 5C1BA 4A1VA 1VDDA 1K3WA 2DZNB 4I33A 1HQYE 1PJJA 1DO2A 4BLCA 3AL0C 2XNDD 4MGYE 1N36M 5IK2D 1SXJE 1BMFD 3J80S 1HNZM 2R62A 2Y0QA 1J5EM 1SKYE 2OBQA 1KSFX 4XGIA 1HNWM 1IXSB 1TGUA 2KRKA 4FCVA 4IBEA 3SARA 3M5NA 3SZEA 1N33M 3T38A 3SMSA 3GRVA 5H37D 4B7GA 5GPIB 4LZJA 5T1VA 2UXCM 3U1JB 4DV1M 4L78A 4JN6A 4LF9M 5DN6D 3L25A 3L29A 3O8BA 1N34M 1ORYB 3UB0A 1IXZA 4RI0A 2K1QA 3FTCA 1W5TA 3K8ZA 3WHLA 4AKIA 1QZMA 5ITTA 2JJ2D 3WWFA 3N7EA 4GKJM 3KSXA 2R65A 4JYAM 2HL7A 4BBAA 4FETA 1L2BA 4B74A 3B9PA 2A4GA 2ZM6M 2FP7B 3GS9A 2R4EA 1T3TA 4MB7A 4IBJA 4DR6M 3F2HA 3O8CA 4QHTA 1QAOA 5C0UA 2JA2A 4II7A 3PXGA 3SBJA 3U60B 4B3TM 4LFCM 4B3RM 3VKGA 3HHWA 1EFRD 1QAMA 3U6CA 2P5TA 3C58A 4EIWA 3SFZA 2DXIA 2KCPA 4P16A 3KP0E 4Z8XA 3FUXA 4NSOB 5KQ8A 2KCYA 4PDGA 4X62M 4L15A 4DR3M 4LG2A 2KEBA 2F9VA 3MHVC 4B3MM 1K3XA 1IBMM 1N75A 2V6ZM 3FUUA 3KVWA 5CDFE 1KMHB 4HL4A 3RGPA 3AV0A 1KYIA 5ITUA 2F4VM 4TUWA 1FJGM 3SV6A 4MM3B 4LF5M 4JI0M 3MK6A 4PCZA 5LMNM 2K8IA 1TH2A 3SAVA 3SMPA 4OVZB 2XSZD 3QAUA 1D2NA 4KODA 4LRSA 4DV6M 2VBCA 2V1UA 4NOOB 1L1ZA 4GKKM 1WXRA 3TWLA 4X66M 2FOIC 4I5SA 1WXQA 1Q39A 3DA1A 2HHHM 3HU3A 1MABB 1DGFA 2LELA 3AOEC 2J7OA 1I94M 2FFJA 1NBME 1GVNA 3ILKA 1J7KA 4LJAA 2C9OA 4AQYM 1NSFA 4WF8A 1COWD 1QAQA 3FYDA 1MX0A 3M5MA 1IN7A 1FNNA 1Z5AA 3KXEC 3GPPA 2OPFA 4DV0M 3SV7A 1L2DA 3K1JA 3M5LA 5FTMA 3FKSD 1G41A 2OINA 3KF2A 3ZIAD 5C0TA 1NBMD 1XMOM 5E26A 5DNYA 4YY3M 3SATA 4IBDA 4MGHA 2DZOB 4A1XA 3UGJA 4JI5M 2ZBKB 1E9SA 4AKHA 2XCFA 1L2CA 2XEPA 1MU5A 3PNVA 4PD2A 4U01A 4IBGA 2V1CA 1Z5BA 4M9SA 4B3SM 4NRVA 1SXJC 4LGYA 4IJFA 3JAMS 3L26A 4JI1M 1JR3D 3CF6E 2CUZA 3GLIB 2I7PA 3A46A 3VG8A 2AHMA 1UM8A 4QNRA 3H09A 4RNAA 3A98B 2UUCM 5EP1A 2Y20A 3KOWE 1TH3A 4MH0E 3HKPA 3U6LA 4LZZA 4OU7A 3R8FA 4I32A 4K8BA 2GVFA 2NQ8C 5ETXA 4LGMA 3M5OA 3AJIB 3SHFA 3IG8A 5KPRA 2D7HA 1DXPA 2YMSC 2OC1A 3AK5A 3SU3A 2CV1A 1JXPA 3SU5A 2EO2A 1E94E 1K82A 2L6OA 4MGIE 2O5RA 4DV7M 4GMQA 2KCOA 4LRTA 4M9XA 3I4YA 2YFQA 5F53A 3CF2A 4CGYB 3W0LB 4DR1M 4M9FA 5ITXE 4QNMA 3FD9A 1Q3BA 3U61A 3U1IB 4I31A 3HU1A 2L09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6O A; 
#chains in the Genus database with same CATH topology
 3A80 A;  1NU7 B;  1XUG A;  2VH0 A;  1TFX A;  2E5L M;  1Z5C A;  4X6P A;  2EY4 C;  3GLG B;  2JZ0 A;  1X37 A;  1A5G H;  1O5C B;  3RXR A;  1VZQ H;  2YOL A;  1PPZ A;  2GQF A;  5C18 A;  4X1R U;  1ELF A;  1THS H;  1QQW A;  4UN2 B;  1Y8T A;  2C4F H;  1TGS Z;  2UUA M;  2ZFS A;  1AVG H;  1MZD A;  1W2K H;  3ZQJ A;  3RMN H;  2PHB A;  1HAY B;  1GDU A;  1PQ7 A;  1HUT H;  1JQJ C;  1NHG C;  2FH0 A;  1CBW B;  1O2K A;  4CRG A;  3PV2 A;  3DFJ A;  3U5Z B;  2EA0 A;  2QNJ A;  3KHV A;  3SUE A;  1IQJ A;  2A7C A;  1SQO A;  5C17 A;  2CHG A;  3LCU A;  2RCE A;  3A7Z A;  4FUC A;  4IW4 E;  4ZRO A;  1GI4 A;  1EJA A;  2BZ6 H;  3VGC C;  3LT3 A;  3M3T A;  2VGC C;  3VFE A;  3MNC A;  1F5L A;  3HHZ A;  2KZ4 A;  1ABI H;  3W94 A;  1GVK B;  3WHK A;  1R2Z A;  4YHH M;  3UY9 A;  4O03 A;  2WYG A;  1QRX A;  2DHR A;  1OWI A;  2XWA A;  1K1N A;  1OWH A;  2CF8 H;  3KN2 A;  4FUD A;  3SAU A;  1EST A;  1AKS A;  4GCH F;  1AIX H;  1LHF H;  1Z8J B;  2OXS A;  3NWL A;  2CHV A;  1OJL A;  1HGT H;  3QX5 H;  2BQ6 B;  3HAT H;  2R3U A;  5E0G A;  4BB9 A;  1GCT B;  2P3T B;  3U6D A;  2THF B;  1T4V H;  2XZF A;  1DPO A;  2NU4 E;  4OS6 A;  3S7H B;  2RFK C;  1PJS A;  1ZMJ A;  1E0F D;  3L6P A;  5EQT A;  4QOS A;  3C1K A;  1K1I A;  3DSG A;  4X1N U;  3FUT A;  2ZFT A;  2PSY A;  3SJK A;  1SGF G;  1HAG E;  5IZ7 D;  2W82 A;  1GI9 B;  2D2D A;  4XFQ A;  2XFS A;  1KYN A;  3IHP A;  1S0Q A;  3ZZ3 A;  3U61 B;  4I8J A;  3VFD A;  2F9N A;  2BY5 X;  1O2Z A;  3RXK A;  2ZG0 H;  2UXB M;  1IHS H;  4Y6D A;  2F9U A;  3UQO A;  4UDW H;  2LVP C;  1P3E A;  2ZFQ H;  1ELT A;  4QHS A;  3EYD A;  2F5Q A;  1IQK A;  5JB9 S;  1YPH C;  1O2I A;  2V7Q D;  1O3I A;  1QJ7 B;  3SYL A;  1MKW K;  4X6O A;  3SGA E;  1P01 A;  2AYW A;  1IQE A;  1UHB A;  3BV9 B;  2ZDM A;  1G3D A;  1O34 A;  2AFQ B;  4LK4 A;  3P92 A;  1L1T A;  1O39 A;  1TWX B;  1QNJ A;  2FO9 A;  1RJX B;  4ZAE A;  4ZKN U;  3OFN D;  2CE7 A;  3SN8 A;  2HLD D;  1I4W A;  1JMO H;  3A83 A;  2R0I A;  1WJ7 A;  2LVO C;  4IJE A;  1QBO A;  1TPS A;  1C9P A;  3JZ2 B;  4L6V 6;  5ESB A;  1SOZ A;  1AUJ A;  4DT4 A;  4DII H;  4FOU C;  4ZHL U;  1HAV A;  5FTK A;  1WDI A;  2RDL A;  3ZV8 A;  2ILN A;  2B7D H;  2J7N A;  4NWK A;  1TAW A;  3W68 A;  4GEW A;  1TIO A;  4ZCN A;  1V2Q T;  5EGM A;  1W10 U;  1OFI A;  1UK4 A;  1VIT H;  4ZXX H;  3ZZ5 A;  3U6M A;  2J92 A;  1SXJ B;  1MTU A;  3VKH A;  1UVP A;  1TGN A;  4B7H A;  3SOR A;  2UUB M;  1W0K D;  3AW0 A;  3P8O A;  1S6L A;  2LVQ D;  2DWN A;  3ZV9 A;  1W13 U;  3KCG H;  2ZHW H;  2JDI D;  4XBC A;  1INC A;  1UVT H;  4FCT A;  3GCN A;  1GHX H;  2BJW A;  2X49 A;  1EZX C;  1SXJ D;  3LC5 A;  1GBA A;  3THG A;  1LHE H;  3GY4 A;  3E6P H;  1SQR A;  5DSF A;  1FY3 A;  2P59 A;  4Z6Y A;  2C96 A;  1F7Z A;  1FMG A;  3DHK H;  1ARB A;  4NXM M;  5GKN A;  2BNK A;  3I77 A;  1GGD C;  1WHC A;  2YNA A;  3K6Y A;  5FBI A;  3HJQ A;  1LQE A;  1DIC A;  1IQL A;  1BDA A;  2CEA A;  4M7G A;  1ZPZ A;  3Q8X A;  1H6U A;  4D76 A;  2HKJ A;  4VGC C;  2OQU A;  1OWK A;  2Z9G A;  5B6O A;  1EFU B;  2FOG A;  2JET B;  5EQR A;  1P9S A;  1HIA B;  3JR4 A;  1QDT A;  4BTT B;  2RGH A;  1YC0 A;  4K5Z A;  1G36 A;  3MNB A;  3LW5 F;  5KPT A;  2VII A;  2P3F H;  1TA2 A;  2VID A;  3D49 H;  3SV8 A;  1TLD A;  3NRL A;  3L2A A;  4L16 A;  1GO5 A;  2G5G X;  1YCP M;  4YZU A;  1XVO A;  5A8Z A;  3EE0 B;  1AGJ A;  5HM2 A;  5FPT A;  3MI4 A;  3GCH C;  4F2L A;  3AFH A;  2XBX A;  1TBZ H;  1Z1J A;  5FTL A;  2AIQ A;  5K7R A;  5F8Z A;  1YPL H;  2FES H;  2L7I A;  1PPE E;  2BVR H;  1BBR H;  5EXS A;  3E8L A;  2G5V A;  2WPL S;  1CSO E;  5F8T A;  1GMD F;  1UTJ A;  1Z6J H;  1NO1 A;  1GJ7 B;  3ELA H;  1IM2 A;  1G4A E;  3ODF A;  4I4L A;  5C1Y A;  2OC0 A;  1BT7 A;  3SAW A;  4R7G A;  1MJG M;  1LKB A;  1XX9 A;  2FOH A;  1MKX K;  1E38 B;  3GRU A;  1MH0 A;  4AW4 A;  2OCV B;  3UMM A;  4B7F A;  1YWU A;  2QF4 A;  4X65 M;  4ACB A;  1BRC E;  4CH8 B;  1A5T A;  1AO5 A;  4DT7 B;  3MO6 A;  2F5P A;  2CWB A;  4KGA A;  1DO0 A;  3T1Y M;  3L28 A;  1RXP A;  3QGN B;  5GJ4 B;  1QL7 A;  2NU1 E;  2DE8 A;  4CJ6 A;  3RC6 A;  4Y8Z A;  2OC8 A;  1Q3C A;  4X1S U;  7CAT A;  1YLN A;  1PYT C;  1GHB F;  2ZU2 A;  1YPK H;  3STJ A;  2C8X B;  1DGG A;  2VVV A;  3RC4 A;  1UTL M;  3RXV A;  8KME 2;  4IMZ A;  1Y59 T;  1AI8 H;  1WGN A;  3T28 A;  3CS0 A;  2O8M A;  1YPM H;  2A4O A;  4G6Z A;  3DSP A;  4IMQ A;  1IBK M;  2ZQ1 A;  2ZGB H;  3BEI B;  2X4A A;  2G52 A;  1ZMU A;  1BHX F;  2DUC A;  3T15 A;  1BA8 B;  1IHT H;  2K0Q A;  1GDQ A;  2Z3D A;  3AW1 A;  3MMG A;  1BRB E;  1LHG H;  3H7T A;  3OY6 U;  5FLX S;  5EXX A;  4DV5 M;  1GJ8 B;  4CRD A;  2A0Q B;  3C9P A;  2IJD 1;  3F0O A;  2EKK A;  4ABJ A;  4LY6 A;  1W0Y H;  4JZI A;  3DSO A;  4FU8 A;  2EEK A;  4HLQ A;  1OWD A;  2EKF A;  1BML A;  1C5Y B;  4NFF A;  1HJP A;  1GHY H;  3A8A A;  3GLF A;  1XUJ A;  3UJN A;  4CIS A;  5L2Y H;  1HT1 E;  1NJG A;  3UK6 A;  3R0F A;  4TT3 D;  3CF0 A;  4Q63 A;  5EU8 A;  3ZZC A;  4ABG A;  3SZN A;  4AB9 A;  1G2M A;  1PPC E;  3RXG A;  1HAP H;  2YNM D;  3PM3 A;  4F49 A;  4FWH A;  3QUM P;  3SBK A;  1ZQ9 A;  3MH7 A;  2FDA A;  2QXJ A;  3WWB A;  1O2R A;  3RXP A;  3GLF B;  1C5P A;  3FE3 A;  3FFG A;  1K21 H;  1BTU A;  5L2Z H;  4FUG A;  4B75 A;  4Y8X A;  1E36 B;  3RXJ A;  1DWC H;  3UOU A;  2H5D A;  2HVX A;  3VLF B;  2F3C E;  5EOD A;  3TJV A;  2V0B A;  1GBK A;  4MPX A;  3TIU A;  8GCH G;  1AD8 H;  3N99 A;  3UNR A;  1GBE A;  3SUG A;  4UFG H;  4HI3 A;  3L3T A;  5EJZ A;  1T8O A;  5KO3 A;  2OO9 A;  2KR7 A;  3M3V A;  2QHO B;  4IBF A;  1YBW A;  5GCH F;  2GP9 B;  2W7S A;  3ZVD A;  4F55 A;  1KXD A;  3AOE A;  4YT7 H;  1S84 A;  5C1B A;  4IN1 A;  1VDD A;  3Q8G A;  1W14 U;  2BXT H;  3A84 A;  2ZA5 A;  3MU8 A;  3AL0 C;  2SGF E;  1N6X A;  5IK2 D;  2GZ7 A;  5J4S A;  2ZPR A;  1C5O H;  1O2V A;  4MNW A;  1UW7 A;  2L4E A;  2PFE A;  2VH6 A;  1HNZ M;  1ESA A;  1SKY E;  2ZWL H;  2JZ1 A;  3E46 A;  1GHA G;  4HG6 A;  1AE5 A;  1QB1 A;  3V13 A;  2MRO B;  3T38 A;  1GPZ A;  3GY5 A;  1O5F H;  2B0F A;  5T1V A;  2UXC M;  1D6R A;  4Y28 F;  4L78 A;  4JN6 A;  3ITI A;  4GLY A;  1WGL A;  2WSC F;  5DN6 D;  4ABE A;  2ANW A;  1VJA U;  2JKH A;  2JH5 D;  1P2O A;  3TK6 A;  1QZM A;  1SGF A;  1WUN H;  1O3L A;  1TRM A;  3T5F H;  4GKJ M;  4JYA M;  2R65 A;  1EZS C;  2FI5 E;  2HL7 A;  4K2Y A;  1ZMV A;  4A7I B;  4ABI A;  2A45 B;  4B74 A;  2TIO A;  1IQN A;  1FUJ A;  2ZHF H;  3Q76 A;  4GHQ A;  4RT0 A;  2Q6G A;  2Z3C A;  2O8W A;  3QTO H;  1E34 B;  1VEK A;  4DR6 M;  3F2H A;  3SHA H;  5C0U A;  4II7 A;  1F92 A;  4LFC M;  1L0Z A;  5DK1 A;  3HHW A;  2RRU A;  2QXI A;  1C5N H;  1C2J A;  1ELV A;  3C58 A;  2CN0 H;  4X2Y A;  2BB4 A;  1T8N A;  5FX5 A;  2WZJ A;  2J98 B;  2LBC A;  1CHG A;  3KP0 E;  3FUX A;  2FIR H;  1TNK A;  3A87 A;  2GZ8 A;  4L15 A;  4DR3 M;  3FRH A;  1LVO A;  4FU7 A;  2V6Z M;  3ATM A;  5AFY H;  1WU1 A;  3LGY A;  5K0H A;  3BTE E;  3RUO A;  2ZHQ H;  2D26 C;  3VGC B;  1OYQ A;  3MH4 A;  2F4V M;  4DG4 A;  4XOJ A;  2MR9 A;  1WQS A;  2A5K A;  2UUK B;  3SV6 A;  4JI0 M;  5LMN M;  1EB1 H;  1S0R A;  4AFU A;  1TH2 A;  4BXW A;  2H5C A;  1C9T A;  4OVZ B;  2R2W U;  2VBC A;  1LHC H;  2GKV E;  3TH4 H;  4NOO B;  2G5N A;  1QFK H;  1CBW C;  2ZU5 A;  4NSV A;  2FOI C;  1MAB B;  1SB1 H;  2LEL A;  3FZD A;  2GD4 B;  3TJO A;  1PJP A;  2J7O A;  2C8Z B;  2PW8 H;  1SG8 B;  2FFJ A;  3DA9 B;  2WUB A;  1GVN A;  3ILK A;  4D7F A;  1J7K A;  3WY8 A;  2G51 A;  1NSF A;  4E7N A;  1GGD B;  4BTI B;  1WOF A;  1Z5A A;  3KXE C;  4NC6 A;  1AUT C;  2WUC A;  1CA0 B;  4ABD A;  4AFS A;  5FTM A;  4FVD A;  1GI5 A;  3D62 A;  3SAT A;  2P8O C;  4A1X A;  3UGJ A;  3QTV H;  5EST E;  1KTS B;  1H9I E;  2XEP A;  4IBG A;  1C4V 2;  1H9H E;  4NRV A;  2VIP A;  1SXJ C;  1HJA B;  4IJF A;  1D9I A;  2TPI Z;  1JR3 D;  3CF6 E;  2CUZ A;  1P2Q A;  2I7P A;  1TPO A;  2BDA A;  2P93 A;  3F9H A;  3RXT A;  4RNA A;  2FS9 A;  3RLY H;  2OOA A;  2UUC M;  1ZGV A;  2EI7 A;  4Q7Y A;  3T2N A;  1XB2 B;  2SFA A;  1TE0 A;  3KOW E;  3LCV B;  4LZZ A;  4OU7 A;  1C2K A;  1XM1 A;  5EOK A;  2KNA A;  4AFZ A;  3S69 A;  1SFI A;  3QDZ B;  3B7N A;  1QHR B;  3SHF A;  1MTW A;  1MQ6 A;  3ZVF A;  2J4I A;  1C5X B;  1JXP A;  3M3S A;  1OKS A;  2EO2 A;  9EST A;  1K82 A;  4NA8 A;  3QZQ A;  3GYL B;  3RMM H;  4ZKO U;  2APL A;  3TGJ E;  1V2N T;  5F53 A;  3TH3 H;  1RTF B;  2AMD A;  3CF2 A;  4CGY B;  4WXV A;  2Y5F A;  3A7Y A;  1QBV H;  4D9R A;  2JET C;  5DP7 A;  4JYV H;  5ITX E;  4QNM A;  3U61 A;  3MTY A;  1MD8 A;  3M7Q A;  4FUI A;  1Y8G A;  3U1I B;  1TX8 A;  3UR6 A;  5EXM A;  2FS1 A;  5EPY A;  1FAK H;  4O3U A;  1YSY A;  2R46 A;  2Y0T A;  3OSY A;  1PPG E;  3LC3 A;  5LPE A;  3LQR A;  1E1R D;  1PM5 A;  2SNW A;  2BLQ A;  1EAU A;  3PMH B;  4DJZ B;  2G81 E;  3M6A A;  3RXH A;  1IY2 A;  1SPJ A;  2GX4 A;  5EXT A;  4FW9 A;  1DT2 A;  3LU9 B;  1ZAE A;  3K65 B;  5CHB A;  2J9N A;  3GRY A;  2OBO A;  1J17 T;  1K28 D;  1DUE A;  3EAJ A;  3LH3 A;  4G3O A;  4PDI A;  1FJS A;  1GHZ A;  1OOK B;  3TL4 X;  1GBL A;  5T6F A;  1V2U T;  1TR8 A;  2GCT B;  2SGA A;  3OTJ E;  4FVM A;  4G4O A;  4TY7 A;  5CMX H;  2Y21 A;  1D3Q B;  1VR1 H;  2HVY B;  1Z8I B;  1PFX C;  3GCT F;  4NWL A;  2ULL A;  3GY6 A;  1IN6 A;  2OC7 A;  3RM2 H;  2HCB A;  3HJ8 A;  4AFQ A;  3S0N A;  4CHA C;  4YOJ A;  2FMJ A;  2O8U A;  4GC9 A;  1T31 A;  2QEN A;  3K2L A;  4B08 A;  4GCH G;  1HLT H;  1SC8 U;  1QQ4 A;  5IWA M;  2KRU A;  4BTU B;  3TU7 H;  5JBT A;  4OGX A;  3UR9 A;  1C1M A;  2ZQ2 A;  1QRW A;  5L8R F;  3TK5 A;  3FTD A;  1DGB A;  1TGC A;  3KQE A;  2CK3 D;  2OLG A;  3TGK E;  1IN4 A;  2Q6F A;  2WV5 A;  4H6T A;  3BIU H;  1GI8 B;  1SFQ B;  5DGJ A;  3I29 A;  4Q4L A;  2ZI2 H;  1O5A B;  3UPE A;  4B71 A;  1IY1 A;  7KME H;  1RIW C;  2XBW A;  1O38 A;  1KSN A;  3TLO A;  3E0P B;  2BOK A;  1J9C H;  2CHA C;  1HT2 E;  3KOX E;  2AIP A;  4MGK E;  3U28 C;  2UU9 M;  2C8Y B;  2PSX A;  2ZFR H;  4B6E A;  1GI7 B;  1NRN H;  3DCL A;  3PLP A;  1ZPB A;  3LH1 A;  2BLO A;  1GHB G;  4ZHM U;  3UTU H;  1C4Y 2;  1YM0 A;  1GBT A;  2BQ7 B;  1E1Q D;  5HM9 A;  1HR0 M;  1QCP A;  1PJI A;  1O2M A;  5LGO A;  5JI3 E;  3LGV A;  1D0L A;  4M9Z A;  5KPZ A;  1KFV A;  3EA8 A;  1C5L H;  2QCU A;  1VEG A;  4WW0 A;  2H9E H;  1GBD A;  1HJA C;  1XUI A;  3U69 H;  5A2M H;  3UUZ A;  2DE9 A;  3HZJ A;  1IBL M;  1O3M A;  1GL1 A;  1C5U A;  2XWB I;  2DWM A;  2PWX A;  3DUX H;  2ZDL A;  1DM4 B;  5FTN A;  1TPP A;  3I78 A;  5A2Q S;  1C2M A;  1GCT C;  3PV5 A;  2SGQ E;  2CV0 A;  4L8R C;  4ZHA A;  4X8T H;  5GIB A;  3E9S A;  1E32 A;  1TTE A;  1UFZ A;  1O2X A;  1SR5 C;  3EA7 A;  2F5O A;  2WPD D;  4JYT A;  3NBI A;  3SI3 H;  1M9U A;  2D1J A;  1LVM A;  2ZGX H;  4I81 A;  2GZ9 A;  2ZU1 A;  2FI4 E;  3PO1 B;  5HIZ A;  3RFW A;  1O35 A;  1SGN E;  3ZC7 B;  1BTX A;  1KY9 A;  1QVR A;  3QN7 A;  1KIG H;  1H8E D;  1XKB C;  1P2I A;  1H1B A;  1P05 A;  1C1O A;  1J8A A;  1TPA E;  5EXP A;  2QZ4 A;  4AKG A;  1ELD E;  1ZMW A;  1RGQ A;  4CR5 A;  7GCH G;  5FCK A;  2BWE A;  1UJ1 A;  1BTY A;  3AVZ A;  1TNL A;  3QYB A;  5E6J A;  3LOX A;  4DUY M;  1EOJ A;  4UON A;  3FZZ A;  3VB5 A;  4FWD A;  4DR5 M;  2DAK A;  1TA6 A;  3IEC A;  1Y3X A;  3LJJ A;  1HXF H;  1DWB H;  4Z0K A;  4AOQ A;  3CTW B;  1N8O B;  1G9I E;  1QB9 A;  1FY1 A;  1N1L A;  2JWS A;  2EI6 A;  3B74 A;  2C5R A;  1P2M A;  3AAV A;  2H2Z A;  3T1H M;  1GBJ A;  4UD9 H;  1GHV H;  3KDS E;  1MAY A;  2R45 A;  4GSO A;  1ZPC A;  1O2S A;  4REZ A;  1FPC H;  3KOZ E;  3KW6 A;  3TGI E;  1Z8R A;  2XFT A;  4YXW D;  1GAB A;  5EJL A;  4GIP A;  4Y71 A;  3DOA A;  3W0F A;  4CIZ A;  1BJU A;  5JI2 E;  4W5W A;  2QY0 B;  3F68 H;  2F83 A;  5HKK D;  2W26 A;  4JK5 A;  3IG5 A;  1F0R A;  1GBB A;  1YKT A;  2PKS B;  4ABB A;  3RP2 A;  3E21 A;  1G32 B;  1O33 A;  3E0N B;  4FUE A;  4Y79 A;  3GQ5 A;  4LJ5 A;  3GPU A;  1G59 A;  1XWI A;  3GLG E;  3SJ9 A;  2OK5 A;  1WSS H;  3V12 A;  2VU8 E;  3V7T A;  4MGZ E;  3KQB A;  1TGB A;  2JH6 D;  3SYK A;  3ZZ6 A;  5JPM H;  1NO9 H;  3QLP H;  2ZAN A;  4O3T A;  3S9B A;  4GC5 A;  2HWL B;  5DG6 A;  4LJ4 A;  3FTE A;  1UVS H;  3VB6 A;  1UTO A;  3QYE A;  1SL3 A;  4LFB M;  4GHA A;  1T43 A;  1HIA A;  4Y7A A;  1Z1I A;  1EP6 A;  1QYR A;  5C5O A;  5C2Z A;  3SQH E;  3FYC A;  1S83 A;  3GP1 A;  1FZZ A;  4AZF A;  1BZX E;  3KS4 A;  5ITX A;  3Q77 A;  4DV2 M;  1L1J A;  1NVM A;  5JBC S;  1TNH A;  3KSJ A;  2PGQ B;  4WY3 A;  1SLW B;  1JRT A;  4A92 A;  1ZYO A;  3ODD A;  3E90 B;  1UMA H;  1TNG A;  4U30 A;  1V2T T;  1KLT A;  3NUM A;  4TWW A;  4B2A A;  1T6O A;  1EQ9 A;  1IQM A;  2J5U A;  4ISL A;  3V3M A;  1DXW A;  3DFZ A;  5JYI A;  2FX4 A;  2D7G A;  1O2Q A;  2JJ1 D;  4IBI A;  2VDB B;  3R9X B;  3GIC B;  3M37 A;  2WIN I;  4DUZ M;  4MPU A;  1BB0 B;  5GND A;  2FNA A;  1UTP A;  1OYT H;  2XZU A;  1BTH H;  3TE6 A;  3SU0 A;  3KFU G;  1O2W A;  2OTV A;  1RS0 A;  1CA8 B;  5FPS A;  3GDV A;  5LPF A;  2L2D A;  1C5V A;  1QBN A;  1BCU H;  1DFP A;  4X1P U;  1CVW H;  3SHG B;  5F3W A;  1U6Q A;  1V3X A;  1P09 A;  1CT0 E;  2BX3 A;  1QY6 A;  2DHY A;  1B0E A;  4FD2 A;  1V2K T;  4MVN A;  1UVO A;  5CE1 A;  4G4Q A;  1NC6 A;  3LQQ A;  3V76 A;  2BTC E;  1DAN H;  1TAB E;  3P8N A;  1VQ1 A;  1HXE H;  1Y5U T;  2J98 A;  1FDP A;  4I8L A;  1TMU H;  3GPX A;  1P0S H;  4D8N A;  1C1S A;  4KTC A;  1QIX B;  3HY5 A;  5C67 A;  4LJ9 A;  1GMC F;  1F0U A;  1P04 A;  1SMF E;  1TGT A;  1Y3V A;  2VJ1 A;  5AVD A;  1UHB B;  1OAO C;  5KED A;  3U6P A;  3RXE A;  3O8D A;  2KA6 B;  4D82 A;  3FTF A;  4KTS A;  1C1U H;  2J34 A;  4J2Y B;  2EST E;  2A1D B;  1YY3 A;  4R3D A;  1V92 A;  3M61 U;  4K1S A;  2ZFP H;  3FUW A;  1C5R A;  3RU4 T;  1HDT H;  3MU5 A;  3M0E A;  3PMJ A;  2Y81 A;  2G8L A;  1O3N A;  2GTB A;  3F2G A;  3U8T H;  1G8P A;  1OWE A;  1PJT A;  3SHC H;  5DP6 A;  4ASU D;  3RM0 H;  3SNA A;  1PPH E;  2P94 A;  3D65 E;  3Q3X A;  2A5Y B;  3SUF A;  3T62 A;  2QV1 A;  1ESB A;  4INK A;  4LJ8 A;  4NRW A;  1CGJ E;  1ZOM A;  4JXJ A;  4WME A;  1O5B B;  1SOT A;  3HX3 A;  4JYU H;  3SQE E;  1QDR A;  1Y5A T;  2GMT B;  3F0P A;  4H6S B;  5EXN A;  5FSW A;  2W3I A;  2WYJ A;  3U6Q A;  3U6E A;  4BAQ B;  1GVZ A;  3D8B A;  1F0T A;  1Z6E A;  2Z9J A;  4D9Q A;  2R6F A;  2STB E;  2F9B H;  1QL9 A;  4OS1 A;  4I33 A;  2KHH A;  4MGY E;  2BVX H;  5GCH G;  1SXJ E;  2LHC A;  1C2G A;  2M5T A;  5TCC A;  2ZPQ A;  2VWL A;  4I8H A;  2R62 A;  1J5E M;  3ZVG A;  1L1G A;  1V2L T;  1AU8 A;  2GJG A;  3RXB A;  1HFD A;  4RKJ B;  1GJ9 B;  1HNW M;  2GT7 A;  3GCH B;  1AFE H;  3Q3K A;  5JBB S;  4FCV A;  3SAR A;  1YPG H;  3F9F A;  1OSS A;  4KP0 A;  3SZE A;  1N33 M;  2ZF0 H;  3BSQ A;  3SMS A;  3GRV A;  5H37 D;  1EUF A;  1S5S A;  1ZSJ A;  5GPI B;  1KTT B;  4LZJ A;  1K1M A;  1QL8 A;  2JNH A;  1GHA F;  1GI3 A;  3U1J B;  2DAM A;  2JH0 D;  3BTH E;  2HLC A;  1V6D A;  2CXV A;  3O8B A;  5C20 A;  1IXZ A;  4WVP E;  2GCH F;  4AN7 A;  5ITT A;  2JJ2 D;  1O2N A;  2BLW A;  3NKK A;  1NM6 A;  5C5N A;  4BBA A;  1WBG B;  1EPT C;  3RXF A;  3B9P A;  2A4G A;  2CGA A;  2FP7 B;  1T3T A;  2WPH S;  1MTN B;  1O0D H;  4QHT A;  4IBL H;  4Y0Y E;  2F9O A;  2JA2 A;  2IPQ X;  2Z9K A;  4DIH H;  1XUF A;  3OX7 U;  3OU0 A;  3U6C A;  2P5T A;  2ZPS A;  2DAG A;  2P3U B;  3SFZ A;  2DXI A;  2KCP A;  1ZTJ A;  3SI4 H;  5FBE A;  3K9O A;  3JZ1 B;  1LVB A;  5KQ8 A;  4NFE A;  1Y3U A;  1ZTL A;  4IC6 A;  1AQ7 A;  4LG2 A;  1C2D A;  2KEB A;  1F2S E;  1QA0 A;  1O31 A;  2RDE A;  2LVA A;  3KVW A;  1AFQ B;  1GMC G;  4HEO A;  2VVC A;  3F9G A;  4CBN A;  2XXL A;  4AYV B;  1BBR E;  1KYI A;  1NV9 A;  1ANB A;  2AGI X;  3GDS A;  3VXE H;  1WTG H;  1C7Y A;  2O8L A;  3UNQ A;  5ITU A;  1C5T A;  1NU9 A;  1FJG M;  1F4I A;  1ZHM A;  1PGY A;  3ENS B;  3ZZ7 A;  1V2J T;  3E16 B;  3BTG E;  4PCZ A;  1O2H A;  1GJB B;  4A5T S;  4LRS A;  3BG4 C;  1ZSK A;  3ATL A;  1O2U A;  3ZVA A;  3UOP A;  3TWL A;  3ATI A;  4X66 M;  1GBI A;  2HHH M;  1WXQ A;  1Q39 A;  3DA1 A;  1O2Y A;  2BZA A;  2PR3 A;  5HMA A;  1TRN A;  2G3Q A;  3BTW E;  1ELC A;  4CR9 A;  1DDJ A;  2BD8 A;  4RT1 A;  1GHW H;  4K3J A;  3FYD A;  2BHG A;  1T8M A;  1IN7 A;  3STI A;  3B89 A;  5KEC A;  3GPP A;  1FIZ A;  3UAI C;  3UFA A;  1Q3X A;  1QGF A;  2UUF B;  8EST E;  3TPI Z;  1JOU B;  5FHT A;  4ANR A;  4MGH A;  1DOJ A;  1ANC A;  2ZDA H;  5E8E H;  1K9O E;  3SJI A;  2ZBK B;  1GBH A;  1OIZ A;  1W0Z U;  2XCF A;  1SBW A;  3QGJ A;  4BAH B;  4CRA A;  1WAY B;  1MZA A;  1LHD H;  3A7X A;  4U01 A;  4PD2 A;  2FOC A;  2B8O H;  3Q00 A;  2V1C A;  4FU9 A;  3UNS A;  1A3B H;  3PWB A;  2QC2 A;  2ODY B;  1ELA A;  4LGY A;  2QGR A;  4X2W A;  1N8O C;  4X2X A;  2Q6D A;  1G3E A;  2TGT A;  2ZU3 A;  3H09 A;  1C2F A;  5CHA C;  1O32 A;  3NBX X;  4IGD A;  3TJN A;  1S6H A;  1ZTK A;  1SGI B;  3R8F A;  2BD9 A;  1RFN A;  3RXL A;  2GVF A;  4HZH A;  3PTB A;  4LGM A;  2NU2 E;  1UVU H;  1OAI A;  1EZQ A;  2GT8 A;  1F0S A;  3AJI B;  3M5O A;  3S9A A;  8GCH F;  1OP0 A;  3IG8 A;  3PLB A;  2QXG A;  3SND A;  2A7J A;  1SQT A;  2YMS C;  1OXG A;  4UFE H;  4E06 H;  3AK5 A;  1J15 A;  2CV1 A;  4TPY A;  1SHY A;  3SU5 A;  1QR3 E;  2O5R A;  1S81 A;  2VWM A;  4M9X A;  3I4Y A;  1OP2 A;  3DD2 H;  1GDN A;  1NZQ H;  3W0L B;  4DR1 M;  4Y7B A;  3FD9 A;  1Q3B A;  1GBM A;  2Z8Y M;  3HU1 A;  4I31 A;  1V34 A;  2ANY A;  2X8A A;  3MOC A;  4KT0 F;  5F6M A;  2LWX A;  1PYT D;  4NZQ A;  2KXE A;  2KZU A;  4LFA M;  5EP4 A;  2BDG A;  2ZAM A;  3ZYE A;  2ZAO A;  4I8O A;  5T6G A;  2QSF X;  1ZGI A;  1O3C A;  2GV6 A;  4NIW A;  3EST A;  1EZU C;  3SU1 A;  4JI8 M;  3R3G B;  2PV9 B;  4X6M A;  2C9C A;  4OW0 A;  3GPY A;  2Z4R A;  3SNE A;  1TBQ H;  4NCY A;  1HB0 B;  1V2W T;  3BTF E;  2K47 A;  2M5Z A;  2YQZ A;  1VKY A;  3S7K B;  1P3Q Q;  1YLD A;  1MTS A;  4RF1 A;  3MFJ A;  1OTR A;  2Z4S A;  3TQS A;  1CGH A;  6CHA B;  5DP5 A;  4BAN B;  4KO8 A;  3CGW A;  1JIR A;  1NFU A;  3PTN A;  3I4V A;  1OWJ A;  1YYY 1;  3A7W A;  3LIW A;  4B6F A;  3KP1 E;  4DOQ A;  2C93 B;  2I7N A;  3J27 B;  1RIW B;  4DGJ A;  2LPR A;  4GUX A;  1TAL A;  1YLA A;  2HRV A;  4JI4 M;  1AZ8 A;  4MQA A;  1O36 A;  2JIZ D;  2R3Y A;  3HK3 B;  4JI7 M;  2QP9 X;  1SGY E;  5FX6 A;  4JCN A;  1C4U 2;  1R6B X;  4LZ4 B;  3DT0 H;  1G71 A;  3KNX A;  3QWL A;  3PMB B;  4GRI A;  2KZS A;  3VB3 A;  3BG8 A;  1DLE A;  1MN3 A;  3IIT A;  4MPW A;  4BAK B;  1NN6 A;  3U6S A;  2LHG A;  3SU6 A;  1A61 H;  1KXA A;  1NY6 A;  1WV7 H;  2BD3 A;  2BJV A;  1LPK B;  2QA9 E;  3OYP A;  3TNT A;  4TY6 A;  4WMD A;  3M7G A;  1Y5B T;  3ZCB B;  3QZR A;  1GBF A;  1FV9 A;  2KFW A;  4DR4 M;  2ZZU H;  3PYH A;  4IC5 A;  1ZJK A;  1CU1 A;  2TRM A;  2GV7 A;  3IWM A;  1TQ7 B;  3HKI B;  1GL7 A;  3VDP A;  1TYN A;  1YCP H;  1MCT A;  3RMO H;  3C27 B;  5KQD A;  4F4O C;  4WUR A;  5GWZ A;  5BR8 M;  2OOB A;  3RXA A;  1ANE A;  2F4L A;  4A1T A;  3F3B A;  1AFQ C;  4AG5 A;  2AS9 A;  2TGD A;  3EDX B;  1MQ5 A;  2QCY A;  3UIR A;  1OHH D;  4B2C A;  4IN2 A;  3FAN A;  3EE7 A;  1XUH A;  3MH6 A;  1A0H B;  5DYI A;  1HJ9 A;  3SU2 A;  4NA9 H;  5DP9 A;  4K0K M;  4SGA E;  4LJ7 A;  5A09 A;  3T25 A;  4YLU A;  3RXI A;  1WCZ A;  2WPM S;  2KCA A;  4WWY A;  2ODQ A;  1H4W A;  4LF8 M;  2ALV A;  3LDX H;  3P8F A;  2C99 A;  4GVU A;  1WYK A;  2Z7J A;  1K1L A;  1ZHP A;  2TGP Z;  3U8R H;  1L8Q A;  4FCW A;  2A5A A;  4THN H;  1J09 A;  2XLJ A;  4DR7 M;  1RTK A;  1VIT F;  1XVM A;  3AAU A;  3KYF A;  2J5Y A;  3HPT B;  4NZL A;  4XSK U;  1G3C A;  3HGP A;  4BAM B;  2FOB A;  1F5R A;  5I46 H;  3RXC A;  2DZL A;  1C1R A;  3A8C A;  1O3E A;  1O2O A;  3EIH A;  3RXS A;  3SNB A;  2YMS D;  3TH2 H;  4LXB H;  2PGB B;  3U5Z A;  1VGC B;  4IBB A;  1IAU A;  1P12 E;  4BOH A;  4TYD A;  2L4F A;  4M0D A;  3WW7 A;  4A3V B;  1NFX A;  2C3S A;  1IQG A;  4INL A;  1C1P A;  1OS8 A;  2A2X H;  1H8D H;  3E4R A;  4IIW A;  3SU4 A;  4LF7 M;  4B73 A;  4YOG A;  3H7O A;  1MAX A;  2BYA X;  3J2P B;  1O3J A;  3T26 A;  3MWI U;  3QK1 A;  4ISN A;  5AF9 H;  5EXL A;  1HNE E;  3GIS B;  3SUD A;  1V2S T;  3F9E A;  2BDC A;  2ZU4 A;  5LH8 A;  3LVV A;  1AND A;  1FX0 B;  3JR5 A;  3KOY E;  1LKA A;  1SGP E;  2J2U A;  2J94 A;  2ZKS A;  2CV3 A;  4KLN A;  4M0W A;  4CHT B;  1AWH B;  1ELB A;  2QF0 A;  4ACA A;  1W3C A;  5ITY A;  4CRE A;  5ITR A;  1ZSL A;  2ERC A;  2DKL A;  4MG3 A;  1O5G H;  3ATK A;  1DY8 A;  1FY8 E;  4FWG A;  1FY4 A;  4K69 A;  2I6Q A;  1FIW A;  1XHB A;  4LF6 M;  2ZDN A;  3GCO A;  4G4R A;  2M60 A;  3D23 A;  3MU1 A;  2IN2 A;  6CHA C;  3SGB E;  1QJ1 B;  2V35 A;  2CFO A;  3B7Z A;  4JZF H;  2SGD E;  1JRS A;  1P2J A;  2HNT F;  5EQS A;  4AI6 A;  3E1X B;  3FP7 E;  4GHL A;  5FCR A;  4ABF A;  2FLB H;  3HGI A;  3ZVB A;  2R4J A;  2KW0 A;  1VJ9 U;  4YLQ H;  1L1N A;  1QJ6 B;  2NU3 E;  1C1Q A;  1V2M T;  2XC5 A;  2KAI B;  4WH8 A;  3LGI A;  2ZTD A;  5H4I B;  4LCB A;  1QZ8 A;  4JI2 M;  3KL6 A;  4XBD A;  4NL4 H;  1JR3 E;  1IQF A;  3GY3 A;  5J4Q A;  3LMM A;  1EX3 A;  3LON A;  4X2V A;  1VEJ A;  3T6P A;  2UWO A;  1B5G H;  1EXF A;  1HAX B;  3F6U H;  5A0A E;  2WV4 A;  1PQA A;  5E2P A;  3VK8 A;  3GQ3 A;  1W11 U;  2PKA B;  2R18 A;  4MNX A;  4P00 A;  1GWA A;  4CH2 B;  3MO3 A;  1AMH A;  1P02 A;  3OEH D;  2XYA A;  1P10 A;  1DGH A;  1ZML A;  3I01 M;  1IOE A;  5IT9 S;  1KLI H;  4DVA U;  1BMN H;  2FXR A;  2RKO A;  3SGQ E;  3TWM A;  2ZDK A;  2Z6B D;  2V3O H;  4AGJ A;  1OFH A;  5C1X A;  4UFD H;  2B9L A;  1YE9 A;  1Q31 A;  3BEF B;  1V2P T;  1SHH B;  1S3S A;  1GJT A;  2BLV A;  4IBK A;  2AHM E;  5F03 A;  3A42 A;  5EP2 A;  4GIT A;  2RA0 A;  1QAN A;  1A2C H;  1N6Y A;  1L4Z A;  1GCD A;  2FE8 A;  5IYT A;  4X8U H;  4FUJ A;  4GPG A;  3I51 A;  1AHT H;  3FN8 A;  4R71 A;  1T32 A;  2A4Q A;  2UWP A;  2F5S A;  2FLR H;  5HIY A;  1K1P A;  3VB7 A;  1C1K A;  2KNZ A;  2AGG X;  8LPR A;  1KXC A;  1Q02 A;  3H4M A;  1Y3Y A;  2C98 A;  3HHY A;  2XTT B;  1CT4 E;  1HAO H;  2ANK H;  1NJF A;  1R5L A;  1EB2 A;  1TMT H;  3FOA A;  4K60 A;  1NES E;  2XF3 A;  2DWZ B;  3N7D A;  1O37 A;  1V2O T;  2VQE M;  1EAX A;  2BDI A;  1DE7 H;  1PRB A;  1A0J A;  2L7H A;  3HHX A;  2HPP H;  2M2A A;  4LF4 M;  4Q7J A;  2A4R A;  5FPY A;  3ZYD A;  1BTW A;  5JB8 S;  3VK7 A;  5L30 H;  3OTO M;  3A8B A;  4X64 M;  3LGT A;  3EIE A;  1BMM H;  2KNV A;  1ELG A;  5GXP A;  5EP3 A;  3GO8 A;  1LCY A;  4U32 A;  4E7R G;  4U2W A;  3DFL A;  5PTP A;  5TJX A;  2BOH B;  2ZCH P;  1GG6 C;  5FAH A;  1AIP C;  1HBT H;  2WSS D;  4TSF D;  4PT5 A;  4XBO A;  1D3D B;  4GHT A;  2DWL A;  3P17 H;  2Y5H A;  3OE7 D;  4FVB A;  5E2O A;  4R0I A;  3SV9 A;  3NZI A;  3KQD A;  4FUH A;  1BQY A;  1ZRK A;  4YOI A;  2FYR A;  4AC9 A;  3D8L A;  1IXR C;  4AG6 A;  1ETS H;  2VIN A;  4AZ2 B;  5EQQ A;  5HXF A;  2C8W B;  2K9D A;  3O8R A;  1FON A;  2XH9 A;  1CUK A;  1L2E A;  1IXS A;  1KXB A;  1TDZ A;  5ITQ A;  3K9P A;  1UTQ A;  1XUK A;  4MNV A;  2ANM H;  2BY7 X;  3CNR A;  3ZVC A;  4DCD A;  2G8T A;  1QA7 A;  1OQY A;  1W0J D;  2G55 A;  2FI3 E;  4A1V A;  1DWE H;  1K3W A;  2DZN B;  1ARC A;  1G37 A;  2VNT A;  1DO2 A;  4BLC A;  2XND D;  2B5T B;  1QQU A;  3FRI A;  2G00 A;  2ZC9 H;  1BMF D;  3BN9 A;  1GJ5 H;  3J80 S;  1P9U A;  4OGY A;  1T4U H;  2O25 A;  1EAW A;  2OBQ A;  1WR1 B;  1KSF X;  4XGI A;  3E91 A;  1LO6 A;  5A0C A;  2JY5 A;  1TGU A;  2KRK A;  4IBE A;  1HAZ B;  3M5N A;  4EST E;  2VF7 A;  1P2N A;  2AH4 X;  2EJS A;  1FNI A;  2R0L A;  2WPJ S;  4X6N A;  1HV7 A;  1VDL A;  1O3K A;  1S6F A;  2H6M A;  3PRO A;  4ISH H;  1BTP A;  1ZJD A;  1GMH F;  3L25 A;  1AVX A;  1BMA A;  2EA3 A;  2ZP0 H;  3PV4 A;  3FTC A;  1W5T A;  1EAS A;  3A7T A;  3BF6 H;  4ZKS U;  4CRF A;  3N7E A;  4AX9 H;  3M35 A;  1V33 A;  3KSX A;  1ELE E;  6LPR A;  4FET A;  3BTD E;  1L2B A;  3MU4 A;  2ZM6 M;  2BDY A;  1C5S A;  2R4E A;  1HAH H;  2FOA A;  4MB7 A;  2GCH G;  4X8V H;  5A0B A;  5T6D A;  2H9H A;  5EJ1 A;  1UCY K;  3PXG A;  3U60 B;  2ASU B;  4B3R M;  2A5I A;  1EFR D;  3U8O H;  1QUR H;  1BBR K;  2DNA A;  3CEN A;  1GG6 B;  1NV8 A;  1UK3 A;  1EPT A;  4DY7 B;  4P16 A;  1QZE A;  4NSO B;  1TBR H;  2KCY A;  2LP6 A;  2VWN A;  2TGA A;  1O5E H;  4B3M M;  3FUU A;  3RML H;  2A31 A;  4FXG H;  2H5X A;  5FXL A;  1KMH B;  1NRR H;  3GY7 A;  1THP B;  2BY8 X;  3E3T A;  1DS2 E;  3AV0 A;  2GMT C;  2Z94 A;  1HCG A;  4UEH H;  1CT2 E;  4WP2 A;  3M7T A;  3B23 B;  4LF5 M;  3MK6 A;  2K8I A;  4LOY H;  3SMP A;  2WSF F;  1C1V H;  1AKS B;  4KOD A;  1FAX A;  1D2N A;  2MGW A;  1LPG B;  1NRO H;  1O3O A;  2BXU H;  2RG3 A;  2XC4 A;  1L1Z A;  4GKK M;  1WXR A;  1BVS A;  1GI0 A;  4WMF A;  3C3D A;  4I5S A;  1DGF A;  3GLF E;  3AOE C;  4F48 B;  2Z9I A;  2EQN A;  1I94 M;  1NBM E;  1H8I H;  1PPF E;  1JWT A;  2ZGC A;  3BTT E;  2BD7 A;  4LJA A;  2FZZ A;  1LTM A;  4YM9 A;  3A86 A;  1HAI H;  4D7G A;  5TCA A;  5L6N H;  1THR H;  2HOB A;  1QAQ A;  4VGC B;  1O3B A;  1MX0 A;  3M5M A;  2ZTC A;  1FNN A;  4DV0 M;  1SGE E;  4KEL A;  3SV7 A;  1L2D A;  2O01 F;  1Q2W A;  3K1J A;  1FXY A;  4YO9 A;  2OIN A;  3RDZ A;  3ZIA D;  3PO1 C;  2ZCK P;  4MTB A;  4YY3 M;  4X1Q U;  4XK8 F;  2DZO B;  2J95 A;  4CRB A;  5ABW A;  2KDL A;  4JI5 M;  1W7G H;  1SGR E;  1E9S A;  4AKH A;  4DUR A;  1NRS H;  1L2C A;  3PNV A;  5A8X A;  2VIV A;  4HGC A;  4B3S M;  4M9S A;  1IFY A;  1O3A A;  4QT8 C;  5E0H A;  1PPB H;  2A7H A;  3L26 A;  5DFL A;  4JI1 M;  1P8V C;  1SGQ E;  3A8D A;  4O97 A;  3GLI B;  1AWF H;  1MKW H;  1VIT G;  2O9Q A;  3VG8 A;  2AHM A;  4QNR A;  2ODP A;  1TRY A;  1VGC C;  5EIY A;  4ISI H;  3UWJ H;  3A98 B;  5EP1 A;  2Y20 A;  1TH3 A;  3U6L A;  1C5Q A;  3NPS A;  2HGT H;  2JY6 B;  1MBM A;  2FTM A;  4LZ1 H;  1MMJ N;  2CP8 A;  2NQ8 C;  1GJA B;  4GAW A;  5I25 A;  5ETX A;  3BIV H;  1AN1 E;  5CHA B;  1X7A C;  4MLF B;  1O2P A;  3M7U A;  2P16 A;  2V6N A;  2ZTX A;  3GOV B;  5KPR A;  2D7H A;  3MH5 A;  4CRC A;  2OC1 A;  1NRP H;  2W3K A;  2L6O A;  4MGI E;  4DV7 M;  1DLK B;  4GMQ A;  1BTZ A;  2MJ5 B;  2YNB A;  2JXN A;  4LRT A;  3ZZ4 A;  2YFQ A;  3RXU A;  2Y7Z A;  2CHA B;  2CRU A;  1Z7K A;  2ZTY A;  4J1Y A;  1TX6 A;  4I7Y H;  2BY9 X;  3SNC A;  1CQQ A;  4LJ6 A;  4I8K A;  1DUA A;  4KKD A;  4X8S H;  1UTK A;  3GLG A;  1QTF A;  4TWY A;  4H4F A;  1MD7 A;  1Z6T A;  1GJC B;  3GQ4 A;  1QRZ A;  2SGP E;  1EAT A;  2F5N A;  5HGG A;  4XDE A;  1GKI A;  1IQI A;  3PVS A;  1A0L A;  1RD3 B;  3HGN A;  1DY9 A;  1T8L A;  4JZ1 A;  3HU2 A;  1UTN A;  1QB6 A;  2D7E A;  1J16 A;  3HKJ B;  4OS2 A;  2Q1J A;  5DPA A;  1WIV A;  2UWL A;  3LVW A;  3NXP A;  3KYG A;  1V2V T;  1O3F A;  3LGU A;  2G4T A;  4PRO A;  2QF5 A;  2I6S A;  3TNS A;  1W12 U;  2ZGH A;  3BBZ A;  2FWW A;  2VB0 A;  1H8H D;  1O30 A;  3UQV A;  3PRB A;  2FOE A;  3DZD A;  2FEQ H;  1EE8 A;  5HYO A;  3A89 A;  2IOT A;  1KLJ H;  5AFZ H;  2LXE A;  3GYM A;  2W6J D;  3PB1 E;  2WHX A;  1ZV1 A;  1IY0 A;  4RF0 A;  3G01 A;  2LTU A;  4Y76 A;  3L27 A;  1UCY H;  4AYY B;  1F5K U;  1CHO G;  2BDH A;  2FM2 A;  1SLV B;  2VIW A;  2GGV B;  2WV9 A;  3FKE A;  2QN5 T;  2R2M B;  3KEE A;  2BVS H;  1NNU C;  3OEE D;  3RC5 A;  3AOG A;  1NTP A;  3EA9 A;  4UFF H;  1C5W B;  4O9V A;  2G4U A;  4AG2 A;  1GMD G;  4P02 A;  2BM2 A;  5G4B A;  1LDT T;  2H1R A;  2JP7 A;  1C1W H;  2BDB A;  3KQC A;  3SC3 A;  1UO6 A;  2QBY A;  1GLN A;  4B2B A;  3ZZ9 A;  5C3N A;  1C2E A;  3HWS A;  2RA3 A;  3TIT A;  4Q7Z A;  3RXM A;  3F92 A;  3GCT G;  1XXD A;  3A81 A;  1JR3 A;  3VEQ B;  1YUB A;  3T29 A;  2DVW B;  2ZEC A;  2XSZ A;  2VIO A;  1XXF A;  3MO9 A;  4JV5 M;  4GH9 A;  2LNH C;  3GLI E;  5LMU M;  1MCV A;  2BWB A;  2Y7X A;  3RXD A;  3VPK A;  3PNY A;  3K92 A;  2QPA A;  3K6Z A;  2XW9 A;  3UZU A;  1HQC A;  1XC8 A;  2PP6 A;  4JI3 M;  1EP5 A;  2HNT C;  1BUI A;  1DSU A;  1H9L B;  1JIM A;  4JI6 M;  1AE8 H;  1UTM A;  2IPH A;  1NHW C;  4OS4 A;  2AMP A;  1OP8 A;  1GVL A;  2R9P A;  3KQ5 A;  1D6W A;  1LTO A;  1O3H A;  2P95 A;  2FPZ A;  1E35 B;  3W95 A;  4KHP M;  1NRQ H;  4AB8 A;  7GCH F;  2PTN A;  2RGO A;  2IJO B;  3I04 M;  3K2U A;  3MMP A;  2LH0 A;  2VIQ A;  2HAL A;  1XMQ M;  5DP8 A;  5LPR A;  2VVU A;  2ZTZ A;  1IN8 A;  1D4P B;  2FOF A;  3F2F A;  3TVJ B;  3OAA D;  2N35 A;  1K22 H;  1G2L A;  1PQ8 A;  2ZCL P;  3SO3 A;  2A2Q H;  2BQW B;  3URE A;  1Z71 A;  4K1T A;  1OKX A;  3A7V A;  1D0K A;  3HK6 B;  1ZHR A;  4OX9 M;  2UUY A;  2YMS B;  2B3T A;  1NY5 A;  2P8O B;  1CO7 E;  1YPJ H;  2CHQ A;  2F91 A;  4I86 A;  5EPN A;  3N7O A;  3C3E A;  3J7B A;  3A85 A;  3KS8 A;  1TOC B;  2FX6 A;  3RLW H;  3GRR A;  2YR0 A;  2Z3X A;  1RU3 A;  1SXJ A;  2XGN A;  1DST A;  1N77 A;  3GDU A;  2TBS A;  4AG1 A;  1DVA H;  1HNX M;  2QBY B;  2XRC A;  1XNR M;  2DAE A;  2QE7 D;  4ISO A;  9LPR A;  3U6O A;  4A6L A;  2VQF M;  1HAV B;  3PRD A;  5DYG A;  1DWD H;  1N78 A;  2LVN C;  4OS5 A;  3VXF H;  2QF3 A;  1B7X B;  4XBB A;  5IDK A;  2PLX A;  2GDD A;  2J97 A;  1P57 B;  3BOS A;  3A88 A;  3IG6 B;  1E79 D;  3RU4 D;  1ZRB A;  2Q2E B;  4Y10 E;  1HRT H;  1LVY A;  2ZIQ H;  3P6Z B;  4ZKR U;  1DGH B;  1K0H A;  1TQ0 B;  2H1U A;  1CHO F;  3BTQ E;  3RGS A;  3URD A;  2OQ5 A;  5F8X A;  2MH8 A;  8CAT A;  1FPH H;  1O2G H;  2FOM B;  3W67 A;  4NG9 H;  4OVZ A;  2PKA A;  2JY8 A;  4NIX A;  2FTL E;  4Y0Z E;  4NGA H;  2K0B X;  2WPI S;  3B9F H;  4OS7 A;  3A45 A;  1SVP A;  2XOK D;  2W6I D;  1P2K A;  3J7A S;  1ACB E;  1AY6 H;  1XXH A;  1TOM H;  3MNS A;  4Y11 E;  4L4U A;  1AB9 C;  1SLU B;  1G30 B;  1O2T A;  5JBA S;  3OY5 U;  1FLE E;  2V3M A;  4XD7 D;  1BIT A;  3SYJ A;  3BEU A;  5EW1 H;  4CHA B;  1R7R A;  5C1U A;  2L74 A;  4XE4 A;  3T27 A;  1ZLR A;  7EST E;  3FUV A;  1GMH G;  1OPH B;  3BTM E;  3MJ5 A;  3GLH A;  6EST A;  4G4N A;  1R2Y A;  1HJ8 A;  1NS3 A;  1YPH E;  4RN6 A;  5A8Y A;  1IN5 A;  2EUC A;  2GCT C;  3PWC A;  4P17 A;  1O3G A;  2JUJ A;  1NFW A;  1A3E H;  1KXF A;  4JZD H;  3TPZ A;  3LKW A;  1FN8 A;  3TJU A;  1SGC A;  4D81 A;  1BRA A;  2VF8 A;  4DV3 M;  2XNI A;  1JB0 F;  4NSY A;  2ZFF H;  2QXH A;  5EW2 H;  4K1E A;  1VG5 A;  1LMW B;  2Y6T A;  3LGW A;  4R8T B;  5EG4 A;  5E0J A;  3U9A H;  5DKM A;  1P11 E;  1VCP A;  3ZH9 B;  2W5E A;  3AKZ A;  4DV4 M;  1N32 M;  1FY5 A;  1CE5 A;  3VDU A;  2ZO3 H;  3FO8 D;  5DJ7 A;  5EJC A;  4S12 A;  1A1R A;  1MTV A;  1YCP K;  2OD3 B;  2ZGJ A;  7LPR A;  1E37 B;  4YT6 H;  1T7C A;  1IQP A;  1LQD B;  4Q80 A;  3MYW A;  1SGD E;  1E9R A;  1TDH A;  2HAK A;  2LNC A;  4FUF A;  1NT1 A;  2FS8 A;  4NSR A;  3MNX A;  1RTL A;  3FP8 E;  3GLI A;  1XNQ M;  1RRK A;  2WZQ A;  3PFI A;  3SJ8 A;  1SI5 H;  4HFP B;  4K8Y A;  4MPV A;  1Z8G A;  1DX5 M;  2OUA A;  2BD2 A;  1MBQ A;  4QOZ C;  3V0X A;  2BD4 A;  3KGP A;  3LJO A;  4AGK A;  2Y80 A;  1SSX A;  1ETR H;  3EGK H;  3ZZB A;  6GCH G;  5SGA E;  2HNT E;  1B0F A;  1LV7 A;  1SG9 A;  4DR2 M;  3MHW U;  1MU6 B;  5BPV A;  2UXD M;  1OIP A;  1MU8 B;  2WPK S;  3CS7 A;  2A32 A;  1C1N A;  1AZZ A;  2GNO A;  3TWK A;  4WH6 A;  1S85 A;  2PKS C;  3BG4 B;  5BRR E;  3OTP A;  4FUB A;  4I8G A;  5GDS H;  4XRN A;  5KGO A;  2QQ8 A;  1Z59 A;  3P70 B;  2OQ4 A;  5DP3 A;  1G3I A;  3HJS A;  4DW2 U;  2ZDV H;  4UE7 H;  1D3P B;  3ZZ8 A;  1JBU H;  1O2L A;  2F43 B;  1TMB H;  4JMY A;  5T3H A;  3SAS A;  4JK6 A;  3RXQ A;  1MKX H;  2KM0 A;  3GY2 A;  2XC0 A;  1EJM A;  1TH4 A;  3MQK C;  5FTJ A;  1CA0 C;  6GCH F;  1NY2 2;  1VCW A;  1YPE H;  1XXH B;  3J81 S;  4ZPX A;  2QIQ A;  1NNJ A;  1EJN A;  1K2I 1;  4ZH8 A;  4Z1M D;  4DBG B;  2PUQ H;  1GL6 A;  1WQV H;  2ALP A;  5C94 A;  1EIJ A;  4CBO A;  2R0K A;  2Z9L A;  1AVW A;  3UWI A;  1L4D A;  5B6L A;  5IRE B;  3W1E A;  1MTN C;  4D80 A;  1C2H A;  2W7U A;  2ZNK H;  4ITQ A;  3VB4 A;  3KID U;  1YLC A;  1XKA C;  2CMY A;  3NK8 A;  3GLH B;  1EPT B;  1HPG A;  1VCQ A;  4RKU F;  1W5S A;  4IBC A;  3BTK E;  3P95 A;  5FL7 D;  3SOS A;  1D3T B;  4B76 A;  4RKO B;  1C5M D;  5BPE A;  4BXS A;  3URC A;  4OM9 A;  3ZZD A;  3U60 A;  1G3B A;  1O5D H;  2XCN A;  4NXN M;  4JZE H;  3EQ0 H;  1BJV A;  1LPZ B;  2CV2 A;  3RE8 A;  2QAA A;  1PQ5 A;  1HQY E;  1PJJ A;  1O2J A;  1N36 M;  1HYL A;  1KDQ A;  3QO6 A;  5DP4 A;  3PLK A;  1P06 A;  4Z6A H;  4ZMA H;  3S9C A;  3SV2 H;  1S82 A;  3FP6 E;  4ASH A;  3H4J A;  2HWJ A;  1C2I A;  1EKB B;  2FOD A;  2ZHD A;  2Y0Q A;  5JDU B;  1IQH A;  4Y8Y A;  1GJD B;  1IXS B;  1YGC H;  2QYI A;  2V3H H;  2F9P A;  2VWO A;  4WXI A;  2Z3E A;  4B7G A;  3LPR A;  4BAO B;  2CF9 H;  4DV1 M;  2XBY A;  4LF9 M;  3GY8 A;  1GBC A;  4NA7 A;  4YTA A;  3L29 A;  4MDS A;  1UCY E;  1N34 M;  1ORY B;  3UB0 A;  4RI0 A;  1DV0 A;  1O3P B;  2K1Q A;  1J14 A;  1XMN B;  3K8Z A;  3WHL A;  4AKI A;  4Q2K A;  3WWF A;  1BRU P;  1FN6 A;  2NU0 E;  3RXO A;  1DIT H;  3NCL A;  1TB6 H;  3GS9 A;  1ZR0 A;  4IBJ A;  3O8C A;  4TPI Z;  1QAO A;  4BNR A;  3SBJ A;  4B3T M;  4YES B;  3VKG A;  4X0W U;  1QAM A;  2Z7F E;  4F1I A;  1A5H A;  1TF0 B;  4EIW A;  1TNJ A;  3FVF B;  2PTC E;  1GI1 A;  4Z8X A;  1EAI A;  1EOL A;  4PDG A;  1A5I A;  4X62 M;  1V2R T;  1GJ6 A;  2BX4 A;  2R44 A;  3MHV C;  2C90 B;  2F9V A;  1K3X A;  1IBM M;  1W8B H;  1N75 A;  1XXH E;  4RSP A;  5CDF E;  2ZHE H;  3U98 H;  1NFY A;  4HL4 A;  1QUS A;  3RGP A;  2XBV A;  1FI8 A;  3BXW A;  4AOR A;  4H42 U;  1KXE A;  4TUW A;  3MU0 A;  1ETT H;  2DI0 A;  1A4W H;  1SQA A;  1OX1 A;  4MM3 B;  2KX4 A;  5DO4 H;  1C5Z B;  3SAV A;  1W7X H;  1ZMN A;  1P03 A;  2XSZ D;  3QAU A;  4DV6 M;  1ID5 H;  1QUT A;  2V1U A;  3NWU A;  2BMG B;  2H9T H;  1UK2 A;  1BIO A;  2WSE F;  1NPM A;  3A82 A;  3HU3 A;  3H5C B;  1CGI E;  3L33 A;  1BOQ A;  1C2L A;  1FQ3 A;  3SW2 B;  4HTC H;  4NIV A;  2C9O A;  3B7Q A;  2D8W A;  4AQY M;  3GLH E;  4WF8 A;  4MNY A;  1SGT A;  1AB9 B;  1COW D;  3K9X B;  1MUE B;  2CJI A;  1K1J A;  2BY6 X;  2PUX B;  2OPF A;  2UUJ B;  3M36 A;  2STA E;  3Q3Y A;  3M5L A;  2Y82 A;  3FKS D;  1KDQ B;  1G41 A;  3KF2 A;  2NWN A;  3ZVE A;  1YF4 A;  1TX7 A;  5C0T A;  1NBM D;  1XMO M;  5E26 A;  5DNY A;  2O8T A;  4IBD A;  3B8J A;  2SGE E;  2VGC B;  4NIY A;  1ORF A;  1A46 H;  1C1T A;  1MU5 A;  1GI6 A;  2DAI A;  2DEN A;  1R4G A;  1K1O A;  3P8G A;  1Z5B A;  2KAI A;  2Y5G A;  2FYQ A;  3JAM S;  2OP9 A;  1ABJ H;  2AMQ A;  2BD5 A;  3TK9 A;  3A46 A;  1UM8 A;  1Y3W A;  4ZUH A;  3QWC H;  1GL0 E;  2K6B A;  1GI2 A;  2EC9 H;  3F1S B;  1PJQ A;  2AGE X;  4MH0 E;  3HKP A;  1A7S A;  1GJ4 H;  2JY7 A;  2AER H;  2ZEB A;  4I32 A;  2EI8 A;  4K8B A;  3SJO A;  1GJS A;  2AEI H;  4Q7X A;  1WTH D;  2J38 A;  4WJG 2;  4KTU A;  3ZZA A;  3RU4 E;  2SNV A;  4B1T A;  4INH A;  1ZZZ A;  1DXP A;  3SU3 A;  3FAO A;  1TON A;  5AHG H;  1D0M A;  1SLX B;  1E94 E;  3ATW A;  4IS5 A;  4SGB E;  3CP7 A;  4ZXY H;  2KCO A;  2GDE H;  1BHX B;  3PMA B;  1AUA A;  1P3C A;  1O3D A;  4ABA A;  1TNI A;  4E05 H;  4M9F A;  1YP9 A;  4ABH A;  2HPQ H;  3AAS A;  2L09 A; 
#chains in the Genus database with same CATH homology
 3GLG A;  2X8A A;  5EPY A;  1YSY A;  2E5L M;  1Z5C A;  2R46 A;  2LWX A;  2Y0T A;  1Z6T A;  3GLG B;  2KXE A;  2KZU A;  1X37 A;  4LFA M;  5EP4 A;  3LQR A;  3GQ4 A;  1E1R D;  2F5N A;  1PM5 A;  2ZAM A;  2YOL A;  1GKI A;  2ZAO A;  3PVS A;  4I8O A;  5C18 A;  1DY9 A;  1QQW A;  3M6A A;  1IY2 A;  3HU2 A;  2UUA M;  2D7E A;  3LVW A;  5EXT A;  4FW9 A;  3SU1 A;  4JI8 M;  1ZAE A;  5CHB A;  2C9C A;  4OW0 A;  1JQJ C;  3GRY A;  1NHG C;  3GPY A;  2OBO A;  2QF5 A;  3PV2 A;  2Z4R A;  4PDI A;  3U5Z B;  3TL4 X;  2EA0 A;  3SUE A;  1H8H D;  3PRB A;  2K47 A;  4FVM A;  4G4O A;  2M5Z A;  2YQZ A;  2CHG A;  5C17 A;  2Y21 A;  3DZD A;  1EE8 A;  4NWL A;  4RF1 A;  1IN6 A;  2Z4S A;  3TQS A;  2OC7 A;  2LXE A;  2HCB A;  3HJ8 A;  4KO8 A;  2W6J D;  2WHX A;  1IY0 A;  4RF0 A;  3I4V A;  4GC9 A;  3L27 A;  3HHZ A;  2QEN A;  2KZ4 A;  3K2L A;  4B08 A;  3WHK A;  1R2Z A;  4YHH M;  4B6F A;  3KP1 E;  2FM2 A;  2WV9 A;  2I7N A;  3J27 B;  2GGV B;  3FKE A;  5IWA M;  2DHR A;  2KRU A;  3KEE A;  1NNU C;  3OEE D;  3RC5 A;  3AOG A;  3KN2 A;  3SAU A;  4JI4 M;  2JIZ D;  3FTD A;  1DGB A;  4JI7 M;  2QP9 X;  2CK3 D;  1IN4 A;  1R6B X;  3NWL A;  2H1R A;  2CHV A;  3KNX A;  3QWL A;  3SC3 A;  4Q4L A;  1OJL A;  2KZS A;  4GRI A;  2QBY A;  1GLN A;  4B71 A;  1IY1 A;  3U6S A;  3SU6 A;  1NY6 A;  3HWS A;  2BJV A;  4BB9 A;  3OYP A;  3M7G A;  3U6D A;  3ZCB B;  1JR3 A;  2XZF A;  1YUB A;  2KFW A;  1HT2 E;  4DR4 M;  2DVW B;  3KOX E;  2XSZ A;  4MGK E;  1CU1 A;  2UU9 M;  3L6P A;  5EQT A;  1GL7 A;  4QOS A;  3VDP A;  4JV5 M;  3FUT A;  2LNH C;  4GH9 A;  5LMU M;  5KQD A;  4B6E A;  3PNY A;  5IZ7 D;  2W82 A;  3K92 A;  4WUR A;  3DCL A;  2XFS A;  2QPA A;  5BR8 M;  2F4L A;  4A1T A;  1E1Q D;  3UZU A;  1HQC A;  3VFD A;  3U61 B;  1HR0 M;  1PJI A;  1XC8 A;  3F3B A;  4JI3 M;  5JI3 E;  4M9Z A;  5KPZ A;  4AG5 A;  2UXB M;  1KFV A;  4JI6 M;  2QCU A;  4WW0 A;  1NHW C;  2F9U A;  1DXW A;  1OHH D;  4QHS A;  1IBL M;  4KHP M;  5DYI A;  3EYD A;  3SU2 A;  2F5Q A;  2RGO A;  2IJO B;  4K0K M;  2LH0 A;  2DWM A;  2V7Q D;  1XMQ M;  4LJ7 A;  3SYL A;  1IN8 A;  5FTN A;  3F2F A;  5A2Q S;  3PV5 A;  3OAA D;  2KCA A;  2CV0 A;  4L8R C;  1L1T A;  3E9S A;  4LF8 M;  1E32 A;  2C99 A;  3OFN D;  2CE7 A;  4OX9 M;  2HLD D;  1I4W A;  2F5O A;  2WPD D;  2YMS B;  3NBI A;  2Z7J A;  1NY5 A;  1L8Q A;  4IJE A;  4FCW A;  1J09 A;  4I81 A;  2XLJ A;  4DR7 M;  2CHQ A;  3RFW A;  5ESB A;  5EPN A;  3J7B A;  3KS8 A;  4DT4 A;  3ZC7 B;  1QVR A;  2YR0 A;  3GRR A;  2Z3X A;  1H8E D;  1SXJ A;  5FTK A;  3EIH A;  2XGN A;  2YMS D;  1N77 A;  1HNX M;  2J7N A;  5EXP A;  2QBY B;  2QZ4 A;  4NWK A;  3U5Z A;  1XNR M;  4AKG A;  4ZCN A;  4IBB A;  1RGQ A;  2QE7 D;  1OFI A;  4TYD A;  3U6O A;  4M0D A;  2VQF M;  3WW7 A;  5E6J A;  4A3V B;  3U6M A;  1SXJ B;  3LOX A;  4DUY M;  3PRD A;  5DYG A;  1N78 A;  3VKH A;  4FWD A;  4DR5 M;  4B7H A;  2UUB M;  1W0K D;  3E4R A;  3P8O A;  4IIW A;  3CTW B;  2DWN A;  1S6L A;  3SU4 A;  4LF7 M;  5IDK A;  4B73 A;  2JDI D;  1N1L A;  3BOS A;  4FCT A;  3J2P B;  2C5R A;  1E79 D;  3T1H M;  2Q2E B;  2BJW A;  3KDS E;  2X49 A;  2R45 A;  1SXJ D;  1DGH B;  3THG A;  4LJ6 A;  4REZ A;  3SUD A;  3KOZ E;  3RGS A;  5DSF A;  3KW6 A;  2P59 A;  4Z6Y A;  2C96 A;  8CAT A;  2FOM B;  4YXW D;  2XFT A;  4GIP A;  3DOA A;  3LVV A;  4OVZ A;  3W0F A;  5GKN A;  2BNK A;  4NXM M;  3JR5 A;  3KOY E;  1FX0 B;  5JI2 E;  4W5W A;  3HJQ A;  5HKK D;  3A45 A;  4KLN A;  4M0W A;  4CHT B;  3IG5 A;  2CEA A;  1W3C A;  2XOK D;  5ITY A;  5ITR A;  3Q8X A;  1H6U A;  2ERC A;  2W6I D;  3J7A S;  2HKJ A;  1XXH A;  4L4U A;  1DY8 A;  4XD7 D;  3GQ5 A;  4FWG A;  3SYJ A;  5EQR A;  4LJ5 A;  3GPU A;  3JR4 A;  1G59 A;  1XHB A;  1XWI A;  4LF6 M;  1R7R A;  2RGH A;  4G4R A;  2OK5 A;  2M60 A;  5KPT A;  2VII A;  3FUV A;  3SV8 A;  3NRL A;  3L2A A;  4L16 A;  4MGZ E;  3MJ5 A;  2CFO A;  3GLH A;  3SYK A;  4G4N A;  1R2Y A;  1NS3 A;  1IN5 A;  2EUC A;  5EQS A;  4AI6 A;  2ZAN A;  4GHL A;  3HGI A;  4GC5 A;  2R4J A;  2KW0 A;  4LJ4 A;  3FTE A;  2G5G X;  3TPZ A;  4LFB M;  4GHA A;  3LKW A;  4D81 A;  4WH8 A;  5FPT A;  1QYR A;  4DV3 M;  3AFH A;  4LCB A;  4JI2 M;  2XNI A;  3FYC A;  5FTL A;  5H4I B;  4NL4 H;  3GP1 A;  4AZF A;  3KS4 A;  2L7I A;  5ITX A;  4R8T B;  3LMM A;  5EXS A;  3LON A;  4DV2 M;  1NVM A;  3ZH9 B;  3AKZ A;  4DV4 M;  3KSJ A;  1N32 M;  1IM2 A;  3VDU A;  3FO8 D;  3VK8 A;  4A92 A;  5EJC A;  4S12 A;  3GQ3 A;  1A1R A;  1G4A E;  2R18 A;  3E90 B;  4I4L A;  2OC0 A;  1BT7 A;  3SAW A;  4R7G A;  1IQP A;  3OEH D;  3GRU A;  1DGH A;  4AW4 A;  1E9R A;  1TDH A;  3UMM A;  4B7F A;  5IT9 S;  2QF4 A;  4X65 M;  4NSR A;  2RKO A;  3TWM A;  1RTL A;  1OFH A;  3GLI A;  2J5U A;  1XNQ M;  2F5P A;  2WZQ A;  1YE9 A;  3PFI A;  1DO0 A;  3L28 A;  3DFZ A;  3T1Y M;  5GJ4 B;  2D7G A;  1S3S A;  2JJ1 D;  4IBK A;  4IBI A;  3R9X B;  2AHM E;  3RC6 A;  3A42 A;  1Q3C A;  4GIT A;  5EP2 A;  7CAT A;  4DUZ M;  4QOZ C;  2OC8 A;  5GND A;  1QAN A;  2FNA A;  2FE8 A;  2XZU A;  3SU0 A;  3TE6 A;  1DGG A;  3KFU G;  1LV7 A;  4DR2 M;  3I51 A;  3RC4 A;  3FN8 A;  5FPS A;  2A4Q A;  2F5S A;  5BPV A;  2UXD M;  4WH6 A;  1C1K A;  2O8M A;  3TWK A;  4G6Z A;  3DSP A;  1IBK M;  3H4M A;  3SHG B;  5F3W A;  3OTP A;  2C98 A;  3HHY A;  2X4A A;  2K0Q A;  1Z59 A;  1NJF A;  3T15 A;  4FD2 A;  2OQ4 A;  1G3I A;  3HJS A;  4G4Q A;  3FOA A;  3LQQ A;  5EXX A;  5FLX S;  4DV5 M;  2XF3 A;  2DWZ B;  2IJD 1;  3F0O A;  3N7D A;  3P8N A;  4LY6 A;  2VQE M;  3GPX A;  3DSO A;  4KTC A;  4HLQ A;  2F43 B;  4JMY A;  2L7H A;  3HHX A;  3SAS A;  4LJ9 A;  2M2A A;  4LF4 M;  2A4R A;  3GLF A;  5FPY A;  3UJN A;  3VK7 A;  3OTO M;  3U6P A;  1HT1 E;  1NJG A;  4CIS A;  2KM0 A;  3O8D A;  2KA6 B;  4D82 A;  1TH4 A;  3UK6 A;  4X64 M;  3EIE A;  3FTF A;  5FTJ A;  4TT3 D;  3CF0 A;  5EP3 A;  3GO8 A;  4Q63 A;  4R3D A;  1XXH B;  3J81 S;  4ZPX A;  1NNJ A;  2YNM D;  4Z1M D;  4FWH A;  1GL6 A;  1ZQ9 A;  2WSS D;  4TSF D;  4PT5 A;  3FUW A;  4XBO A;  5B6L A;  2DWL A;  3WWB A;  3M0E A;  5IRE B;  3F2G A;  2G8L A;  3OE7 D;  3GLF B;  1G8P A;  3W1E A;  4D80 A;  3SV9 A;  4ASU D;  4ITQ A;  4B75 A;  3D8L A;  3GLH B;  1IXR C;  2A5Y B;  4AG6 A;  3SUF A;  3VLF B;  2QV1 A;  1W5S A;  4IBC A;  5EQQ A;  5FL7 D;  3O8R A;  2XH9 A;  4LJ8 A;  4B76 A;  1TDZ A;  5ITQ A;  4NRW A;  3N99 A;  4JXJ A;  3SUG A;  4OM9 A;  3U60 A;  2XCN A;  4NXN M;  3F0P A;  5KO3 A;  2KR7 A;  5FSW A;  4IBF A;  4F55 A;  3U6Q A;  1W0J D;  3U6E A;  3AOE A;  3D8B A;  2CV2 A;  3RE8 A;  5C1B A;  4A1V A;  1VDD A;  1K3W A;  2DZN B;  4I33 A;  1HQY E;  1PJJ A;  1DO2 A;  4BLC A;  3AL0 C;  2XND D;  4MGY E;  1N36 M;  5IK2 D;  1SXJ E;  1BMF D;  3J80 S;  1HNZ M;  2R62 A;  2Y0Q A;  1J5E M;  1SKY E;  2OBQ A;  1KSF X;  4XGI A;  1HNW M;  1IXS B;  1TGU A;  2KRK A;  4FCV A;  4IBE A;  3SAR A;  3M5N A;  3SZE A;  1N33 M;  3T38 A;  3SMS A;  3GRV A;  5H37 D;  4B7G A;  5GPI B;  4LZJ A;  5T1V A;  2UXC M;  3U1J B;  4DV1 M;  4L78 A;  4JN6 A;  4LF9 M;  5DN6 D;  3L25 A;  3L29 A;  3O8B A;  1N34 M;  1ORY B;  3UB0 A;  1IXZ A;  4RI0 A;  2K1Q A;  3FTC A;  1W5T A;  3K8Z A;  3WHL A;  4AKI A;  1QZM A;  5ITT A;  2JJ2 D;  3WWF A;  3N7E A;  4GKJ M;  3KSX A;  2R65 A;  4JYA M;  2HL7 A;  4BBA A;  4FET A;  1L2B A;  4B74 A;  3B9P A;  2A4G A;  2ZM6 M;  2FP7 B;  3GS9 A;  2R4E A;  1T3T A;  4MB7 A;  4IBJ A;  4DR6 M;  3F2H A;  3O8C A;  4QHT A;  1QAO A;  5C0U A;  2JA2 A;  4II7 A;  3PXG A;  3SBJ A;  3U60 B;  4B3T M;  4LFC M;  4B3R M;  3VKG A;  3HHW A;  1EFR D;  1QAM A;  3U6C A;  2P5T A;  3C58 A;  4EIW A;  3SFZ A;  2DXI A;  2KCP A;  4P16 A;  3KP0 E;  4Z8X A;  3FUX A;  4NSO B;  5KQ8 A;  2KCY A;  4PDG A;  4X62 M;  4L15 A;  4DR3 M;  4LG2 A;  2KEB A;  2F9V A;  3MHV C;  4B3M M;  1K3X A;  1IBM M;  1N75 A;  2V6Z M;  3FUU A;  3KVW A;  5CDF E;  1KMH B;  4HL4 A;  3RGP A;  3AV0 A;  1KYI A;  5ITU A;  2F4V M;  4TUW A;  1FJG M;  3SV6 A;  4MM3 B;  4LF5 M;  4JI0 M;  3MK6 A;  4PCZ A;  5LMN M;  2K8I A;  1TH2 A;  3SAV A;  3SMP A;  4OVZ B;  2XSZ D;  3QAU A;  1D2N A;  4KOD A;  4LRS A;  4DV6 M;  2VBC A;  2V1U A;  4NOO B;  1L1Z A;  4GKK M;  1WXR A;  3TWL A;  4X66 M;  2FOI C;  4I5S A;  1WXQ A;  1Q39 A;  3DA1 A;  2HHH M;  3HU3 A;  1MAB B;  1DGF A;  2LEL A;  3AOE C;  2J7O A;  1I94 M;  2FFJ A;  1NBM E;  1GVN A;  3ILK A;  1J7K A;  4LJA A;  2C9O A;  4AQY M;  1NSF A;  4WF8 A;  1COW D;  1QAQ A;  3FYD A;  1MX0 A;  3M5M A;  1IN7 A;  1FNN A;  1Z5A A;  3KXE C;  3GPP A;  2OPF A;  4DV0 M;  3SV7 A;  1L2D A;  3K1J A;  3M5L A;  5FTM A;  3FKS D;  1G41 A;  2OIN A;  3KF2 A;  3ZIA D;  5C0T A;  1NBM D;  1XMO M;  5E26 A;  5DNY A;  4YY3 M;  3SAT A;  4IBD A;  4MGH A;  2DZO B;  4A1X A;  3UGJ A;  4JI5 M;  2ZBK B;  1E9S A;  4AKH A;  2XCF A;  1L2C A;  2XEP A;  1MU5 A;  3PNV A;  4PD2 A;  4U01 A;  4IBG A;  2V1C A;  1Z5B A;  4M9S A;  4B3S M;  4NRV A;  1SXJ C;  4LGY A;  4IJF A;  3JAM S;  3L26 A;  4JI1 M;  1JR3 D;  3CF6 E;  2CUZ A;  3GLI B;  2I7P A;  3A46 A;  3VG8 A;  2AHM A;  1UM8 A;  4QNR A;  3H09 A;  4RNA A;  3A98 B;  2UUC M;  5EP1 A;  2Y20 A;  3KOW E;  1TH3 A;  4MH0 E;  3HKP A;  3U6L A;  4LZZ A;  4OU7 A;  3R8F A;  4I32 A;  4K8B A;  2GVF A;  2NQ8 C;  5ETX A;  4LGM A;  3M5O A;  3AJI B;  3SHF A;  3IG8 A;  5KPR A;  2D7H A;  1DXP A;  2YMS C;  2OC1 A;  3AK5 A;  3SU3 A;  2CV1 A;  1JXP A;  3SU5 A;  2EO2 A;  1E94 E;  1K82 A;  2L6O A;  4MGI E;  2O5R A;  4DV7 M;  4GMQ A;  2KCO A;  4LRT A;  4M9X A;  3I4Y A;  2YFQ A;  5F53 A;  3CF2 A;  4CGY B;  3W0L B;  4DR1 M;  4M9F A;  5ITX E;  4QNM A;  3FD9 A;  1Q3B A;  3U61 A;  3U1I B;  4I31 A;  3HU1 A;  2L09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...