2L6OA

Nmr structure of the protein yp_926445.1 from shewanella amazonensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MGAGQTPHPQLIWPALLKQQGCNELLPLRTNDDWQRFCADSKHLLQYGDKLVDSNFHCFVLEEDAHWHPAAPLPPEGLNDLIRAHCATLGHCCTSKMHLHSVMDAIDFLNALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein YP_926445.1 from Shewanella Amazonensis
rcsb
source organism Shewanella amazonensis
molecule tags Structure genomics, unknown function
molecule keywords uncharacterized protein YP_926445.1
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13642 DUF4144 protein structure with unknown function
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.650 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l6oA02
2.40.10.320 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2l6oA01
2L6OA
chains in the Genus database with same CATH superfamily
1FONA 1DITH 3KHVA 5I46H 2V7QD 3GLHA 3K9OA 1O2TA 2QGRA 1HJAB 2BDGA 2ZGBH 4PROA 3WWFA 4DT4A 3RC6A 4WWYA 4HL4A 1ANBA 5E0HA 3E8LA 3LGUA 2ZAMA 1O32A 1GBBA 5ITXA 2DWMA 1PPFE 2VBCA 1W7GH 5KQ8A 3HHYA 2HHHM 4LF6M 2VJ1A 1P12E 2XCFA 4Q7JA 1ANDA 3GPUA 2H9EH 1K1NA 1YBWA 3BTWE 3U61A 2YR0A 1V2RT 2A5KA 5KGOA 2I6SA 3KYGA 2G52A 5F8XA 2C9CA 2ZANA 3PRBA 2KCAA 1EKBB 4RSPA 4ABFA 1OPHB 1SL3A 4AG2A 4WURA 2FOCA 2A1DB 1GBTA 3GRRA 2ZPQA 3GDSA 3B7NA 2BWBA 4MGKE 2F4LA 4FW9A 1J16A 3FUTA 1W11U 4NZLA 5JB8S 1JOUB 2C9OA 1TOMH 2YFQA 5EW2H 2BXTH 1Z8JB 3MU4A 5EP2A 1Z71A 1L1TA 4NC6A 2JIZD 4X66M 1TBRH 1LTMA 1TX7A 4ISOA 3TVJB 1SVPA 1K0HA 4UN2B 3KSJA 2CV2A 1ACBE 1O38A 2JP7A 4REZA 1LPGB 3HKJB 1XXDA 2KRKA 3ZYDA 1CHGA 1EB2A 3PYHA 3U5ZB 1TDZA 1BIOA 1O5FH 1ZGIA 1QFKH 1TQ7B 4UDWH 3RXSA 2QF3A 1KXEA 4D76A 1V2KT 2Y6TA 3TE6A 4OX9M 2HKJA 4R3DA 1BTZA 2GZ9A 2J34A 3SHAH 2M2AA 4GH9A 4CGYB 2MR9A 2A5AA 5JBCS 3RMNH 1MQ6A 1YCPH 4X1SU 3ZIAD 3SC3A 1K2I1 4DG4A 2OOBA 1FAXA 4FUCA 2VWMA 5ESBA 2XOKD 3EE7A 5EODA 3NPSA 3BTFE 3PMBB 3I29A 4FVDA 3EA7A 2ZGJA 2STAE 2C8WB 1BHXB 4CR5A 2ZNKH 4GIPA 2G5NA 4WVPE 2YNMD 1R2YA 1C2JA 1TMUH 2Y5GA 4MPWA 4LCBA 1WUNH 1C5RA 5ITXE 5EXLA 4FVBA 2R4EA 1Z6JH 1WR1B 2A7JA 2CGAA 2FOGA 2VIPA 4AGKA 2B5TB 4CRFA 2L2DA 5LMNM 4Y0ZE 3SZEA 1CHOG 1AFEH 3F2GA 1UK3A 3ZZCA 2Y7ZA 1NZQH 2K0BX 2P95A 4FWDA 2CFOA 1XHBA 4B3RM 1N32M 1T4VH 2D26C 3E91A 3LIWA 1CA0C 5AFYH 4DV0M 1D9IA 4AGJA 3FKSD 1EE8A 1P2NA 3VGCC 5FX5A 1DOJA 4WXIA 4IBJA 1YWUA 2QF4A 1HXFH 2VQEM 3H7OA 3C27B 2BVSH 3MU0A 5IZ7D 1N77A 1UTKA 4GCHG 4DUZM 1TNGA 3RXDA 5A2MH 5A8ZA 4MVNA 1ESAA 1EXFA 1TNHA 1X7AC 3ZVBA 1VDDA 2QP9X 3UWJH 1C1SA 5EIYA 1EASA 5J4SA 3RXIA 4E7NA 4LXBH 2DE8A 3RXUA 4G4NA 3V0XA 1P8VC 3S7KB 2XEPA 1HLTH 1RS0A 4JI7M 1S84A 1V2ST 4QNRA 3ATWA 3P70B 4I33A 4ZMAH 5EP4A 3D23A 4OU7A 2XZUA 1C1OA 2Z9IA 1OQYA 1T43A 1BBRE 4LF7M 1PPHE 1X37A 5FL7D 4A3VB 2UUJB 2AGEX 2UWOA 5HM2A 1OSSA 2FOBA 3SORA 4NRWA 2V0BA 3SV9A 5TCCA 4M0DA 1DWCH 1OWKA 3DA9B 2BNKA 1ELBA 4RN6A 1CU1A 3T29A 4MB7A 1AI8H 1C5ZB 4DR4M 2RG3A 3KQBA 2SGQE 2OCVB 1FNNA 3URCA 1HAPH 3SARA 4DR3M 1O5CB 2XYAA 1QY6A 1IN8A 3FP6E 1YPEH 3P17H 1SGFA 3B7QA 5F03A 4IBGA 5DP4A 1DXWA 2OC8A 2WV4A 3GQ4A 2VVUA 3VKGA 1JWTA 4ABEA 2ZU1A 4X65M 1K28D 4OVZB 1GMHF 2F43B 4D7FA 2JWSA 1XUIA 5EXPA 4F1IA 3QZQA 1KXCA 4DV3M 5HM9A 1L1NA 1V2NT 2LXEA 3PLKA 1XXHB 1GWAA 3T28A 1HAXB 1W12U 4WF8A 4X8UH 2PHBA 4A5TS 2CHVA 1H8HD 5AFZH 3SMSA 1P9UA 3EDXB 1BRUP 2QCYA 4AYYB 5F8ZA 1ZMUA 3LU9B 2BD9A 2R2MB 1XWIA 1P2KA 1QRXA 2BZAA 2QY0B 2VWOA 1GO5A 1CT2E 3A7ZA 4E7RG 4K60A 2G5GX 1BCUH 1QYRA 1KXBA 2IOTA 1AHTH 3E16B 4IW4E 3L6PA 2QPAA 1JBUH 4X0WU 2J7NA 3O8CA 1I94M 2KZUA 5EP1A 1MTNB 3FN8A 1NRNH 2GDEH 1DSUA 2FLBH 2XXLA 4GLYA 3HJSA 3A7WA 1TWXB 4KHPM 1GJSA 1PQ5A 1QQUA 2HNTF 1PGYA 4G4QA 1C5QA 1C1NA 3GCTG 5L2ZH 3U98H 4B3SM 1C2FA 1QTFA 4I31A 4G6ZA 1SQTA 2LP6A 1VR1H 1ZSJA 4IMZA 3M5OA 2D7HA 2FEQH 1IY0A 1O2QA 4SGAE 4B2AA 1QZEA 5JDUB 2NWNA 1XKAC 1SGQE 2BYAX 1QJ1B 2N35A 2ZM6M 1WV7H 1MKWK 1TNJA 3FTDA 3QAUA 3Q8GA 1UO6A 2GJGA 3SU3A 4NSYA 4IGDA 3RUOA 2QBYA 2O8TA 1MX0A 4QOZC 2BDHA 3GY2A 3PWCA 3OE7D 1AB9C 4RF0A 2LVAA 2QAAA 4I8LA 4LJ5A 1MU5A 1B7XB 3W67A 2VINA 4WH6A 1L4ZA 2GNOA 5ITYA 3GLFE 3I77A 1TLDA 2CF9H 4YHHM 3UJNA 2WPHS 3F0OA 1SXJA 3HZJA 5EPNA 3TWMA 2BX3A 4K0KM 5DP6A 3LGWA 1ELAA 1GHWH 2Z3XA 2Z9LA 4DIIH 1C9PA 4UE7H 2HVYB 4K8BA 1O37A 1AVWA 2LH0A 2ZFFH 1EIJA 1XVOA 3Q3XA 3GRYA 5KPZA 5KO3A 1LVOA 2HGTH 3GYLB 2R6FA 2OQUA 2AYWA 4Y71A 3T15A 4X2WA 4AZ2B 7ESTE 1C1WH 1PJPA 2ZHFH 5E26A 3VKHA 1O3DA 3L3TA 2CHAB 3FZDA 3DA1A 2F91A 2DENA 1E1QD 3MWIU 1ZMLA 4DT7B 1YPGH 5ITRA 1QBNA 1N1LA 3IG8A 3LCVB 4JZEH 1QZ8A 3STIA 2FS9A 3SGAE 5JI3E 1GI0A 4Y8XA 2OINA 3KSXA 4X6NA 1Z6TA 4P16A 2UXDM 1OXGA 3P8FA 4IS5A 1Y3XA 1SGRE 3M37A 1HJ8A 1A0JA 1KLTA 5JBAS 1WXRA 3EE0B 4NCYA 2HNTC 1JR3A 1KDQA 1RU3A 1S6FA 2HVXA 4MTBA 2G81E 4YLQH 5C20A 3LH3A 3SMPA 4IBCA 3OTJE 2FXRA 3RXJA 1XB2B 5DP7A 4I8JA 1CUKA 1SLXB 2CMYA 5DP3A 1SLUB 1ELEE 1FUJA 5CMXH 5A0AE 1G32B 1YPKH 4FUEA 1F0SA 2PLXA 3GRVA 2ZKSA 4X2XA 3F1SB 3KOXE 4AB8A 4MNWA 3SV2H 4AX9H 5EPYA 1EZUC 1S6LA 2AEIH 3NZIA 1RRKA 3A7XA 1HQYE 1Q02A 4XBOA 2D8WA 1BOQA 2H6MA 3E0PB 4KTUA 4H42U 3MO3A 3AOGA 3N7OA 2ASUB 3TJNA 1W7XH 2EI6A 4XBDA 2Q6DA 1Z7KA 4X1NU 3VB4A 4B6EA 3KOZE 2K1QA 1MBQA 1QNJA 1EJMA 4H6SB 5FLXS 3SI3H 1RTLA 2ZFSA 3ZV9A 1W8BH 3I51A 4DR1M 2BD5A 1DDJA 1GJ7B 1AVXA 2KA6B 2HLCA 1S0RA 1U6QA 1WU1A 1AN1E 3F6UH 3A83A 1CA0B 1LQDB 4ZKSU 3VK7A 2OC0A 1TGBA 1ZJDA 5ESTE 1K1PA 1IM2A 1S6HA 1MZAA 2AGGX 2HPPH 1EQ9A 3RE8A 2PKSB 4ABGA 2Z3CA 3WWBA 3ZZ6A 1IY1A 1HT2E 3WHKA 1IOEA 2P3TB 2XNIA 5FBIA 1T8NA 3LVVA 4IBIA 1A4WH 4LFCM 1AUJA 1VEJA 1AE5A 3LQQA 2TGPZ 2CV3A 1RJXB 4AOQA 1S3SA 3GYMA 5E6JA 4MG3A 3K9PA 2NU2E 4Y6DA 3EYDA 2CK3D 4Y8ZA 2VU8E 4B73A 4OS1A 1NFXA 1FN6A 2HWLB 4XFQA 1QZMA 2J98A 3FRHA 4Z1MD 1FIWA 4GCHF 1EJAA 5A0BA 1THPB 3L33A 4LJAA 1MTUA 1IXSB 2GMTB 4XDEA 4ZPXA 1C5NH 1H4WA 3U1JB 2K8IA 2EQNA 4R7GA 1WQVH 2RA3A 3MOCA 1ETRH 3IITA 1DWBH 1DY8A 4AI6A 2BDAA 2F4VM 3K9XB 4KO8A 3BEIB 3F9EA 2R9PA 2HLDD 1L1JA 4WY3A 1JR3E 2BD2A 4B2CA 3SJIA 1HIAB 4MLFB 1NNJA 4DV6M 1QRZA 1GMHG 1LKAA 2L6OA 1RXPA 5FPTA 1NRRH 3ATLA 2OK5A 1YLAA 1XUKA 2QSFX 1IBLM 2FZZA 2IPQX 4GITA 4IBKA 5KPRA 1YP9A 1Z1IA 1GPZA 5JPMH 1FQ3A 1QGFA 2C8ZB 1DPOA 1ZLRA 2BQWB 2BDCA 4NL4H 4BLCA 3BF6H 1ABIH 1ESTA 1E37B 3DSGA 2WYGA 3RXAA 5ITQA 2FYRA 4AG6A 5HYOA 2PKAA 3ATKA 4D82A 2FNAA 2V1UA 1BITA 4NXMM 1QRWA 2PR3A 1P2OA 2PKAB 1IN5A 2ZQ1A 1AU8A 1ZSLA 1C5MD 3A46A 2WSSD 3EQ0H 5C1XA 1W0JD 2B8OH 2F83A 3I04M 2LHCA 2WSCF 3A87A 3E46A 1XM1A 4MPUA 1UTJA 1UCYK 1INCA 1QAMA 1SGFG 1FJSA 1ZJKA 2MGWA 3IWMA 3HU1A 1ZMJA 1TONA 3KS8A 1E9SA 2ZFQH 3RXKA 1NO1A 2XWBI 3VB7A 1O3PB 5BRRE 3RLWH 1H9LB 2ZDLA 1TMTH 1IQEA 5HIZA 1B5GH 4AFUA 1OS8A 4GKJM 2LWXA 1MD8A 4UEHH 3RXFA 1UK2A 1VITF 2XNDD 3A80A 5GXPA 5B6OA 2CP8A 3K92A 1L2DA 1W0KD 4RKJB 5FTMA 2JY6B 1DO0A 4XGIA 1VCWA 1YC0A 2ZO3H 5F8TA 1MN3A 3RMLH 3KL6A 3SNCA 2ZDMA 3DHKH 4ITQA 3U8TH 3O8RA 3FUVA 4JZ1A 3MO6A 1OJLA 2XFSA 1K3XA 1L1GA 2ZGHA 2XSZD 3GY6A 1A0HB 1GJCB 3D49H 4YOGA 2UWPA 4IN2A 1DGBA 4CRGA 1GJ5H 3TK5A 3U6LA 3VFDA 1OTRA 5FTKA 3U6MA 4MGHA 2QQ8A 1C1MA 3MK6A 2TGTA 3VLFB 1W3CA 2DAIA 5T1VA 3FRIA 4DOQA 4LJ7A 1GBKA 4OGYA 5DP9A 1HAOH 1D4PB 3SBJA 4YT7H 4J2YB 3J7BA 5A8YA 2KNZA 2C96A 3FZZA 1LHCH 3TGKE 5IYTA 1ORYB 1C5PA 2Y82A 1QAQA 1LKBA 2A7CA 4IMQA 3M7GA 1EPTA 4XD7D 4JMYA 3ZZAA 1VITG 2V3OH 3M3TA 1NRSH 3RXLA 1VKYA 1K1MA 1PJTA 1V33A 3HK3B 2Q6GA 2ANKH 3RXEA 4ZAEA 4L78A 1GG6B 1ZRBA 4JK6A 1P03A 2P5TA 1MBMA 4PDIA 3HHXA 4H6TA 1C5LH 5KPTA 2BLVA 4INLA 2C8XB 3PV4A 4BTTB 1V2OT 2EUCA 2QXIA 2Z4SA 3BG4C 2C90B 2DWLA 2QXGA 2ZHQH 4Q80A 1VITH 1DGHA 3RMMH 4TWYA 3PV5A 1IN7A 1IHTH 5A8XA 3Q8XA 3N7DA 1AZZA 5ABWA 2G4TA 5LPEA 1NC6A 1NPMA 2FM2A 3TJOA 1MAXA 4I32A 7CATA 3GRUA 1O36A 3GY8A 2CV1A 4IN1A 5HKKD 2ZF0H 1HJ9A 3CF2A 1TNLA 4DIHH 1L0ZA 3RU4T 2ZTDA 1QB1A 1HNWM 1TH2A 4GC9A 2G5VA 3CENA 2LVPC 2XBVA 1OOKB 1EAXA 1LPKB 2AHME 2GP9B 1W5TA 3Q00A 1ZPBA 1H9HE 2F5NA 4U32A 2JZ0A 3PMHB 3T2NA 1VGCB 4PT5A 1GHAG 4Y7BA 1O5BB 1IAUA 1N8OB 2WINI 1G37A 1OWHA 2GCTB 1MKXK 4O9VA 2VH6A 2PSYA 2ZCLP 1O2ZA 4GHLA 2GX4A 2QF0A 3U6PA 2HWJA 2ODQA 1XNRM 1SGEE 1TH4A 2CN0H 4NSRA 1HQCA 1HUTH 4P17A 3GLHE 2KNAA 3A8BA 4MNYA 1CHOF 2A31A 1VCPA 1XMNB 3DFJA 4JYVH 1DE7H 1T7CA 4AB9A 1HCGA 2GD4B 3LW5F 2WSEF 5EJCA 1COWD 1EFRD 2CHGA 1EZXC 1P06A 2UUFB 4A1XA 1PPGE 5T6GA 2PWXA 1YPLH 5GCHG 2F9PA 2FWWA 3MMGA 1SFQB 2VIVA 1D3PB 5CHAC 1NHGC 4EIWA 3U6DA 3KQ5A 2IJOB 4BAQB 1P2QA 1O2JA 3KCGH 2FE8A 2RDEA 3QGNB 2NQ8C 1SXJB 1NJGA 3QDZB 3SYKA 4AW4A 2JH5D 1P04A 4BTIB 2F3CE 5L8RF 5KQDA 1AUAA 2BXUH 2BY9X 2XGNA 1OX1A 1ELFA 1TX8A 4DR5M 4LF5M 5LPRA 3MH5A 4JI6M 3FOAA 3SV6A 4DURA 3BTDE 4X6MA 2LVOC 3K1JA 2QBYB 2W3KA 1Y3WA 4I8KA 3NBXX 3LONA 3GDUA 1C4U2 4CRDA 3KQDA 3NRLA 5T6DA 4TY7A 3V12A 2BWEA 2JA2A 1JRTA 5CHAB 2QV1A 1HIAA 3P8NA 1HJPA 5J4QA 2QA9E 3U6QA 1WTHD 3U8RH 1Z6EA 1GVKB 4Y10E 5EQQA 4MPVA 2WPIS 1V2MT 1GHVH 4DV2M 3PTBA 3ODDA 4JYAM 3I01M 3VDUA 4YLUA 1MTNC 1Y3YA 1Q39A 1AE8H 1MD7A 4TT3D 4B2BA 3U6CA 2ZDNA 1QDRA 4K2YA 3P92A 2JXNA 4DR2M 4JI1M 4DV4M 4UFFH 3AOEA 3MO9A 1Q3BA 3GPYA 2R45A 2UXBM 1CSOE 2Q1JA 2X4AA 3AASA 7GCHG 1GMDG 2AHMA 3ZQJA 1C5SA 1EX3A 1IN4A 1IQLA 1O2RA 1TBQH 1C5XB 2ALPA 1B0EA 3BTKE 4B75A 4HLQA 1CT4E 5FTNA 2A4OA 1HYLA 3K2UA 3TL4X 3RP2A 1ZHRA 3PFIA 3SV8A 1C1KA 3AW1A 1GBCA 4Y11E 1CA8B 1IY2A 4GVUA 1HB0B 4X1RU 4AYVB 3KP0E 1LHDH 1RIWC 3SNDA 1JQJC 3MI4A 2FOIC 4LGMA 5T6FA 2J9NA 2JJ2D 3ENSB 1OYTH 3ZYEA 1NO9H 2OC7A 2ZI2H 4JI5M 1CGIE 3W94A 4NIWA 3A42A 8LPRA 2P16A 1PPZA 3TITA 1Z8IB 2G55A 4FU7A 4AFZA 3W0FA 4Z0KA 3FTCA 4OVZA 1MTVA 5FAHA 5E0JA 3SOSA 4RT0A 1TGTA 1XUHA 2GTBA 2ZU4A 1A7SA 3L28A 4GHQA 2HALA 1LPZB 1HNEE 3UREA 2KCOA 1Z8RA 1MMJN 2NU0E 3KVWA 2BZ6H 4GHTA 3HY5A 3KIDU 1O34A 1KY9A 3GISB 4AG5A 4BOHA 4THNH 1G36A 2KCPA 2PGQB 2Z7JA 2AMPA 4ZHMU 3P95A 2LNHC 3TPIZ 4YZUA 3PLBA 3A85A 2FI5E 2ZU2A 1DWEH 3LCUA 3BG4B 1GI8B 3A7VA 2H5DA 1FZZA 2Z94A 3U28C 3TPZA 1GDNA 1NN6A 4Q63A 4YM9A 5LGOA 1SGDE 4PD2A 2PGBB 3AV0A 4M0WA 5FPSA 5GIBA 1GG6C 1OP0A 2F5OA 1GJ9B 1BUIA 1CE5A 1NFYA 3GDVA 2R44A 1GI7B 1WAYB 2Z3DA 3SU1A 1ELDE 2B9LA 1O3JA 3T26A 3R8FA 4FCWA 4IC5A 3TGJE 1N34M 1Z5AA 2VIQA 2BX4A 1SLVB 4M9SA 3EAJA 5DP8A 4IIWA 4DCDA 4DVAU 1GBMA 2RRUA 4DR7M 3RM0H 2A32A 1FY3A 1F0RA 3UMMA 1C5WB 3C9PA 1P2MA 5GPIB 4JI0M 3RM2H 4Y0YE 3DT0H 1ZTKA 4ZUHA 3ZCBB 1C2EA 2R4JA 2A2QH 1SPJA 2QF5A 1C2LA 5FSWA 2ESTE 1QR3E 2FOMB 3SYLA 1IBMM 5FCKA 4MGIE 4DR6M 1IHSH 4IBLH 4ZHLU 2O8LA 8KME2 2SFAA 1WOFA 1OHHD 2GV7A 1WQSA 2PSXA 4BNRA 3HU2A 1IQHA 2XCNA 3M3VA 4L6V6 3QX5H 2ZBKB 4ANRA 3GPPA 2H1UA 3UAIC 1LVBA 1GJBB 3NK8A 3TWKA 2DNAA 1ANCA 1CT0E 2OBOA 1PQAA 1GMCG 1TGNA 2SNWA 6GCHG 1J17T 4ZCNA 2V3MA 3QO6A 5EJ1A 4PDGA 3ZZ9A 1Y8GA 2PTNA 3A8DA 1VZQH 2F9BH 2J94A 3W0LB 3PO1B 2ULLA 4JYUH 1BVSA 3Q76A 3ZVGA 3OEED 2Y0QA 1TPPA 2PTCE 4CRAA 3MMPA 2J2UA 1BTHH 4KP0A 4RKOB 2O8WA 1SB1H 2A5YB 4CRBA 1I4WA 3TK9A 3VB3A 2TGDA 1TOCB 2J5UA 5DFLA 1ZAEA 3MNCA 5C2ZA 5C5NA 3D62A 4NSOB 1ZHPA 3RGSA 1V2LT 2OXSA 1W2KH 1N33M 1HJAC 4O03A 2K9DA 4LJ4A 2ZFRH 3A82A 3K8ZA 1O2YA 2OTVA 5DPAA 5EXMA 4U30A 2BJVA 2FFJA 1O0DH 1JR3D 1F5KU 3SUDA 3F3BA 1V3XA 4NXNM 1AO5A 3UQVA 3DZDA 1HBTH 1QANA 3RXQA 3TH4H 3FE3A 3RXMA 2DWNA 3BEUA 2R0IA 4UFDH 1YPMH 2LTUA 1BDAA 2FOEA 4FCVA 3U5ZA 1TB6H 3IG6B 2ZU3A 1KXFA 3UOPA 7LPRA 2HCBA 1PPCE 1ZSKA 4WJG2 4GAWA 4KKDA 2A2XH 4MDSA 3ILKA 1Z1JA 5DGJA 1R6BX 1HPGA 2F9UA 3GOVB 3ZVAA 1YF4A 4FU8A 1QQWA 1DS2E 4MNVA 1MTSA 1PQ8A 4BAOB 4I81A 1D3TB 3HHWA 1L8QA 4F49A 3UK6A 4X8SH 3VPKA 1A5TA 2SGEE 1OP2A 1SQRA 3OSYA 3O8BA 5TCAA 1D2NA 1P3QQ 3HKPA 3KN2A 3SJKA 1QUSA 4X1QU 3T62A 2XBXA 4KLNA 1GBEA 2ZZUH 4XSKU 1GI9B 1TAWA 4OGXA 3STJA 1T6OA 3U6EA 2DZLA 1GVLA 1YLDA 2FP7B 3FUXA 5IDKA 1IFYA 1FMGA 2CRUA 3TGIE 1GVNA 3L2AA 1EPTC 1C5VA 4NFEA 3GY4A 4GKKM 1GL6A 1ZGVA 2K0QA 1UTLM 1O2KA 2ANMH 1SKYE 2BOHB 1H9IE 3GLHB 3SU6A 4K1EA 1TF0B 9ESTA 3S9BA 1NY6A 4FUIA 1Q2WA 1RGQA 1WTGH 2KX4A 4NIYA 2ZTYA 2NU4E 2P3FH 2CEAA 2GQFA 5DYGA 2GGVB 4JK5A 1FY1A 3KS4A 1A5GH 2CJIA 1SOTA 1HFDA 1OFHA 1HAZB 3GP1A 5C17A 3C1KA 5FTLA 1C1UH 3M6AA 1ELVA 3U60B 1YKTA 1G71A 2XRCA 2X8AA 3S0NA 2XH9A 1MKWH 3VG8A 4F48B 8GCHF 4L15A 8GCHG 3NBIA 1SGIB 3FFGA 3UPEA 4B3TM 1SC8U 2P3UB 1Z5CA 1P2IA 1PYTC 2F5QA 2VIWA 1DGFA 4PCZA 3GS9A 1SGCA 4U01A 4RT1A 1T8OA 2WPMS 2P94A 1SGTA 3B89A 3M7QA 3B7ZA 1OIPA 1MUEB 2J97A 1TNIA 5HIYA 3OU0A 2Y81A 2WUCA 4CREA 2DAMA 1CQQA 1DFPA 2PP6A 3B74A 1Y8TA 1SXJD 2DHRA 2VH0A 1AZ8A 3SQEE 1GJAB 1O3IA 2DUCA 3MHVC 3M3SA 4E05H 2GT7A 2EI7A 5FCRA 3E4RA 1N6XA 3MQKC 4AG1A 2J4IA 1TQ0B 1F0UA 5LPFA 3MYWA 1RIWB 5EQTA 2TPIZ 2VB0A 1E0FD 4AORA 1MU6B 1BT7A 3SUGA 2ZGCA 1D0KA 3U9AH 1NTPA 3UNRA 1MJGM 1A3BH 2XF3A 2WV9A 3RXHA 3LH1A 3UIRA 2OOAA 1FIZA 3AFHA 1VEKA 3ATMA 3SUFA 3SYJA 3PNYA 1YLCA 2EI8A 1DM4B 1MTWA 3F2HA 4JZFH 4F4OC 4X1PU 3SNBA 2ERCA 1L4DA 2ZTZA 3H4JA 1ZMWA 1PRBA 1SMFE 2QIQA 4O97A 5EJLA 5EG4A 5GDSH 3EA9A 3MH4A 2GCHG 5EU8A 3PV2A 2L7IA 3HHZA 3KOWE 2W26A 2THFB 1GABA 3ESTA 2OD3B 4L4UA 4CH8B 2FTLE 3OY5U 1GCTC 3U6SA 2Z7FE 1SLWB 1FY4A 1CBWB 4UD9H 2FLRH 1FY5A 1BHXF 3LQRA 2ZQ2A 1R2ZA 1C4Y2 2AS9A 2AH4X 1YPJH 2Z9JA 1PJSA 6GCHF 2IPHA 3LJOA 2FS1A 1GGDC 3PRDA 4JI4M 1LHEH 1UVPA 3ELAH 1WIVA 4FETA 1L2EA 4K3JA 1UVUH 4DUYM 1AWFH 2V35A 1ARCA 3PO1C 1C2DA 4YESB 1A0LA 3OAAD 5C1YA 4AQYM 5C0TA 4R8TB 1FAKH 2MJ5B 1GBAA 5DJ7A 2XSZA 4MGZE 3GCHC 5DYIA 1UCYE 3FO8D 4ESTE 5FX6A 4LF9M 2L74A 3HK6B 3Q3KA 3E1XB 2QYIA 4LRTA 1GI4A 1K1LA 2HAKA 3RXBA 1GBDA 5C18A 4LFBM 1N78A 2OC1A 1XMQM 3A88A 1K22H 3MNXA 3QYEA 2R46A 1E38B 4I8GA 4TSFD 2OBQA 1R5LA 1QL8A 3T1YM 2JETC 2CWBA 3MTYA 2QCUA 2RKOA 2L09A 1TH3A 2HOBA 2JJ1D 1Y5AT 1C9TA 4Y8YA 1G9IE 3EIEA 1NM6A 2DE9A 3L27A 1FPHH 3I4VA 2OO9A 4RKUF 3M61U 2G3QA 2OP9A 2VF8A 2R18A 1EAIA 1GCDA 1MCTA 1T31A 3KQEA 3QGJA 4TPYA 4XOJA 3LC5A 5C1UA 1C4V2 1ETTH 1O33A 1O2XA 2BY7X 4ISHH 5DKMA 4B08A 2FDAA 4KELA 2APLA 1XVMA 1LVMA 1DWDH 4A1VA 4ASUD 1EAUA 1TR8A 4M9FA 1QIXB 1YE9A 1GHBG 5EXXA 1GHBF 4QT8C 4OS4A 4XRNA 1NESE 1NRPH 4LK4A 3TQSA 4NIVA 4IBDA 2JDID 2EO2A 1BRAA 5DP5A 3URDA 3CNRA 1SGNE 4ZHAA 3SAVA 1THRH 1SSXA 2VF7A 1GGDB 1IQNA 4IJEA 2STBE 3VB5A 3VK8A 3CF0A 4VGCB 2QE7D 3J2PB 5GJ4B 2UXCM 1ZPZA 2GZ8A 1UHBA 4GC5A 2VWLA 1VJAU 4FU9A 3BV9B 3PMJA 1J9CH 1N6YA 2LELA 1FLEE 1O3AA 4BAKB 2D2DA 1YCPM 5FXLA 4B7FA 1DGHB 3IHPA 3BTGE 3M5NA 4YOJA 3NKKA 2HRVA 1YCPK 1LMWB 1G3EA 1M9UA 1J5EM 4LJ9A 1RTKA 4O3UA 1J8AA 1O39A 1AUTC 2AERH 4A92A 1GKIA 5EP3A 1P09A 3J80S 4NA8A 1SHHB 1GHXH 1ETSH 1BTUA 2BHGA 4OS6A 3IECA 1F4IA 1AIXH 4B6FA 2GVFA 2KR7A 2J7OA 1LQEA 7GCHF 4VGCC 1ANEA 1EAWA 1EPTB 1YSYA 1UW7A 3BN9A 3VB6A 2AIPA 4B76A 2JUJA 1Z8GA 3QTVH 4K8YA 2L4EA 2SGAA 2VWNA 3THGA 1GHAF 5EJZA 3PNVA 1F2SE 2FOHA 3K6ZA 4ZH8A 2IJD1 4JYTA 4DJZB 3FP8E 1G3DA 3Q77A 2XC0A 3GQ3A 1AKSA 1XC8A 1GBFA 1GI1A 3HWSA 1WSSH 4NFFA 1F92A 1NBME 3U69H 3UTUH 1T4UH 2Z9KA 1LTOA 2LHGA 1KDQB 3HPTB 3BBZA 1Z59A 3JR5A 2FX4A 2F5SA 4D9RA 1BTPA 1EP5A 1S5SA 2Z3EA 2EY4C 3JR4A 1LVYA 3R0FA 1UVSH 3GCNA 3UWIA 1O3BA 2ALVA 4A6LA 1TFXA 1ELGA 2BMGB 2ZP0H 3GICB 1XNQM 4XE4A 2C5RA 3BIUH 5JBTA 1GMDF 3U1IB 2RCEA 2ZDVH 4ISIH 1NU9A 3DCLA 3E3TA 1UTQA 3DD2H 4KT0F 1C1QA 2X49A 3SU4A 2R3YA 4UFEH 1THSH 2WSFF 4ASHA 1BMFD 4HI3A 2YOLA 3N7EA 2ZEBA 5H4IB 1Y5UT 4R0IA 1OKXA 3A98B 2EEKA 1SBWA 1S82A 1O2GH 3WY8A 2W6JD 2EKFA 1G4AE 3W68A 1F5RA 4I86A 1UCYH 4OS5A 1KLIH 1LCYA 3T5FH 1SXJE 1SG9A 1VQ1A 2LNCA 2PFEA 1E1RD 2Y21A 3LMMA 2H2ZA 3MFJA 3ZZ8A 2ZTCA 3GCOA 4L16A 4RI0A 1DX5M 1EUFA 1TGCA 5GWZA 3J27B 1LV7A 3HJQA 1K9OE 2QXHA 1ZRKA 3S69A 4CRCA 1A2CH 5K7RA 3ZV8A 2DAGA 1QAOA 1VCQA 2R65A 1ZTLA 1A1RA 3BTTE 4O3TA 1AB9B 2Y0TA 1V2UT 2E5LM 2VDBB 1NBMD 4AN7A 1OIZA 2ZFPH 5BR8M 1C1TA 1S85A 1HDTH 1OAOC 1O2HA 3J81S 4ACAA 1AVGH 3BTQE 1MU8B 1QA7A 2L4FA 3BG8A 2UUKB 2GZ7A 2OUAA 2FTMA 2XC5A 3UY9A 4CHAB 4DGJA 4JI3M 4BXSA 2BQ7B 2ZHDA 3ODFA 3VFEA 3OX7U 3OFND 1GBIA 4FUBA 1WGNA 1EZQA 1GJ8B 4FWHA 4I4LA 4ABBA 1TPAE 1DSTA 2ODYB 2R2WU 2TRMA 4GRIA 1IXSA 2Q2EB 2F9OA 1MABB 3LGYA 7KMEH 3RXRA 3A81A 1E34B 2RGOA 1Y5BT 2CXVA 3A84A 1TABE 4CBOA 4M9XA 4JV5M 2J98B 3M5MA 9LPRA 3S9AA 2DKLA 1V2PT 2KDLA 4NG9H 1E9RA 5EXTA 1UVOA 2O8MA 1DXPA 1O3NA 1BJVA 1BZXE 1GI5A 1SG8B 2XTTB 5C67A 3Q3YA 3A7TA 1NVMA 4NWLA 1C2GA 4OM9A 1SGPE 4K69A 4FUFA 4INHA 1MQ5A 2A4GA 3AJIB 3AKZA 1GBHA 4HFPB 2H5CA 2XBWA 3SHCH 1WDIA 3V3MA 1XXHA 4NA9H 3AW0A 3UGJA 1K1OA 1NS3A 4ABIA 4P02A 1ZMNA 4ZKOU 5L30H 3ZZ5A 5B6LA 5IT9S 2XW9A 1KXDA 2FI3E 1XUFA 5EQSA 4YTAA 1Y59T 3QTOH 1TYNA 1O2IA 2TGAA 2BB4A 2CHAC 2NU3E 4Q4LA 2SGPE 3I78A 5TJXA 2KHHA 1EOLA 5HXFA 3LOXA 4E06H 4DY7B 4B7HA 1SHYA 1XUJA 3VEQB 2VIIA 1JMOH 1TDHA 1Z5BA 2ZHWH 3H09A 1HV7A 3SNEA 2WPDD 2SGFE 3AAVA 1ZZZA 3DFZA 2JNHA 1QL7A 2BLQA 1QJ7B 1XXFA 4ISLA 1OAIA 3D8LA 1HAVB 2KZ4A 5DG6A 8ESTE 5E8EH 3A45A 1K82A 1HXEH 1G8PA 4DV7M 3TNSA 1E94E 1DT2A 3FTEA 1W0ZU 4LJ8A 1FI8A 4IC6A 1UTPA 3LJJA 1WJ7A 2G8TA 1BMLA 3ZVCA 2UUYA 2JY8A 3GCTF 5JI2E 1AMHA 4CH2B 3TU7H 1HAGE 2MH8A 3TH2H 1V34A 3HX3A 1NRQH 2PUQH 2G00A 3BTHE 5ITTA 4J1YA 4ABDA 3K2LA 5FTJA 3QK1A 4B3MM 1GL0E 1N8OC 2QXJA 3PMAB 3CTWB 5DNYA 2GCTC 3GY7A 2WV5A 3SHGB 1FV9A 1CGHA 1O5DH 1KFVA 1TBZH 1BTWA 2Z8YM 2ZPSA 2CE7A 4X8VH 1XUGA 1GJDB 1E36B 1GBLA 3S7HB 4BANB 1D0LA 2FH0A 5BPEA 1O35A 3JZ2B 2ZC9H 1HAYB 4WW0A 3FUUA 4IBEA 1EJNA 1BBRK 1ZQ9A 5E0GA 5AHGH 1N75A 2KAIA 1LO6A 2BD4A 1GJ4H 2AGIX 4Y79A 1OYQA 3SJ8A 4QHSA 5F53A 3TK6A 1PQ7A 3P8OA 2FYQA 2ZA5A 3B8JA 3K6YA 4LRSA 4MPXA 2ZHEH 2DZOB 4CIZA 2FPZA 4W5WA 2O25A 2C4FH 2FO9A 1AQ7A 3ZVFA 3VXFH 2ZTXA 3A86A 5A0CA 5G4BA 2Y5FA 1O3GA 4FUHA 3VXEH 1W10U 1HT1E 1VG5A 1OWEA 1S0QA 3SAUA 3M7UA 4FUDA 1ABJH 2C99A 3SQHE 3WW7A 3FYDA 2LBCA 2M5TA 1IQJA 3H4MA 2R62A 3H7TA 1KIGH 1QL9A 1C2MA 4LF4M 3E21A 1HRTH 4X6OA 2ANWA 3MJ5A 2JY5A 4BB9A 2BY6X 2KRUA 2Q6FA 2VVCA 2WPJS 2I7NA 3FYCA 2V6NA 2UU9M 1MZDA 2P8OB 3SAWA 1QVRA 4AZFA 3HJ8A 8CATA 1NU7B 3BXWA 1J09A 2KCYA 2Y7XA 3H5CB 2NU1E 3LDXH 5K0HA 4RNAA 1P11E 4YOIA 3ZZBA 3AAUA 3I4YA 1SQOA 4TY6A 1A3EH 2BD3A 2JY7A 2H5XA 4TPIZ 4BBAA 4WMFA 1UTMA 3CS7A 4FWGA 1TMBH 2G4UA 1GDQA 1YUBA 3SGBE 3ZVEA 5DK1A 1HNXM 3TLOA 2ZU5A 3FANA 1GJTA 1O2MA 1P9SA 2EA3A 2BD8A 2C3SA 1EP6A 3MU8A 1PPEE 3M35A 4Y7AA 1O2WA 3A8AA 1A5HA 2GCHF 1H8DH 3FVFB 3MU1A 5AF9H 1IQMA 5EGMA 1FX0B 1BMAA 3RU4D 4KTCA 2L7HA 2KM0A 4D8NA 1O3CA 2G8LA 2RDLA 1NJFA 1O2OA 5CHBA 1CVWH 2B7DH 3O8DA 1TGSZ 1LHGH 1BMNH 1FY8E 3GPXA 1OWIA 4H4FA 3SN8A 3HGIA 1TPSA 2CUZA 2A4RA 2ILNA 3SZNA 1KYIA 4Q7YA 2YQZA 4Y28F 1L2BA 2ZPRA 3OEHD 1ESBA 4NA7A 3ZZ4A 1GL7A 1NV9A 1T32A 1G3BA 2KXEA 2Z6BD 3QWCH 4XK8F 1W14U 2BLOA 1AIPC 1O2SA 1YYY1 1BTXA 3GLFB 3V7TA 4I8OA 3MHWU 4ABHA 1DUAA 3PB1E 1FN8A 1ELTA 3GO8A 1Q3CA 1GDUA 1AWHB 1P05A 3CS0A 3AK5A 1DUEA 2ZDAH 4LG2A 1UM8A 3IG5A 1KSFX 2I7PA 3GLGB 2C93B 2R3UA 3QWLA 2KNVA 1G3IA 1QDTA 1UJ1A 3E0NB 1RD3B 3CF6E 2WPLS 3BTME 3NWUA 3ZH9B 3UR9A 3V76A 4LZZA 1TRYA 3UB0A 1GLNA 1GI2A 4ZROA 4OS7A 3UNSA 3M36A 4GEWA 2W82A 1O5GH 1NSFA 4G3OA 4MM3B 1BTYA 3RXCA 3FD9A 1C1VH 1IBKM 3GLIE 3RC4A 1V2QT 1TNKA 2KAIB 2YNBA 2OLGA 3FUWA 3NWLA 5LMUM 3C3DA 4X6PA 3TJUA 4HTCH 1SR5C 4M9ZA 3PROA 3SV7A 3P8GA 2D7GA 1DICA 2DWZB 1HAHH 1WBGB 2M5ZA 1L2CA 2XC4A 3L26A 2LVQD 1WCZA 2BTCE 1FPCH 3NCLA 2ZAOA 4LJ6A 3UR6A 2CHQA 4AFSA 3S9CA 2LVNC 2PV9B 1IQFA 4GUXA 4MNXA 2B3TA 1AFQB 5SGAE 2GDDA 5L2YH 3RDZA 2D7EA 1BRCE 2TBSA 1MH0A 1TE0A 1TRMA 3UFAA 1C5OH 2UUAM 4TYDA 3PWBA 3EIHA 4GMQA 1O5AB 3OYPA 1R7RA 3PVSA 1HR0M 2DVWB 2P93A 2O9QA 3GLIA 1D3QB 1NT1A 1C2IA 2Z9GA 3BSQA 2B0FA 1OWJA 1SQAA 2EC9H 1H8ED 4X62M 1TIOA 3KYFA 1C1PA 2FI4E 4D7GA 1GHZA 1XKBC 5KEDA 5IREB 1BA8B 2SGDE 2XZFA 2XLJA 3VGCB 4CISA 1C2KA 2VIOA 2BD7A 2FX6A 4NRVA 2GV6A 3BEFB 2QENA 1O3EA 1TTEA 3KW6A 3F2FA 2EJSA 2BVXH 5BPVA 4YXWD 2H9HA 4G4RA 4X2YA 1ZYOA 3GLGA 5CDFE 1C1RA 1GVZA 2P59A 4LZ1H 1IQPA 1C5TA 4LZJA 5EOKA 1IQIA 3SI4H 4A1TA 1EFUB 1ID5H 2KEBA 2JH0D 2SNVA 1R4GA 3SGQE 4IBBA 1TRNA 1SOZA 2K6BA 1GBJA 3RGPA 1ZV1A 2BLWA 2ZCKP 4ISNA 3GLFA 1E35B 3TJVA 1P57B 3W95A 4Q7ZA 2GT8A 1LDTT 1P0SH 1K1IA 4P00A 4ACBA 1PJIA 3SU5A 5HGGA 2ZFTA 4BTUB 4F2LA 3NXPA 1ARBA 3SNAA 4Z8XA 1JXPA 2YNAA 3RXOA 2Y80A 2RGHA 5CE1A 3DFLA 3JZ1B 5PTPA 4II7A 5C94A 1T8MA 4JI8M 3QZRA 3LC3A 4FXGH 2AFQB 3U8OH 1K3WA 1UVTH 1G41A 3VDPA 2YMSD 1V6DA 4HEOA 5EW1H 3UOUA 1G30B 3ZZ3A 1AD8H 2WZJA 1GJ6A 2AMDA 1O3OA 3CP7A 3BIVH 4FD2A 1YLNA 1P01A 2BM2A 3SUEA 3F9GA 1S83A 3QN7A 3DSOA 4XBCA 2F9VA 4YO9A 4B1TA 1IN6A 2FIRH 2PUXB 1V92A 1VEGA 3SW2B 3KOYE 4Q7XA 5F6MA 1EB1H 5A2QS 3GY5A 5C0UA 5DO4H 2HNTE 3QUMP 4GHAA 4R71A 3FKEA 3G01A 5C5OA 6CHAB 1PJJA 1O2UA 5EXSA 2O8UA 3FP7E 5DSFA 4LFAM 1O30A 1DO2A 3GQ5A 4SGBE 3R9XB 3DUXH 2EA0A 3LGIA 4L8RC 2W7SA 2DHYA 2BOKA 2W7UA 3GCHB 1TA2A 4JN6A 3WHLA 4MGYE 4D9QA 1MCVA 2WUBA 1TALA 3U61B 3E90B 1CGJE 1KYNA 4KODA 3GLGE 2QC2A 1QJ6B 1IXRC 1QCPA 3EA8A 1O3LA 2ZDKA 2A0QB 4I7YH 2VVVA 3RXTA 1NHWC 3B9PA 4YY3M 3BTEE 5ITUA 1K21H 5GNDA 1O2PA 5L6NH 2DI0A 1P3EA 4ZKRU 1O2VA 4AFQA 4DV5M 2DZNB 1TPOA 2J95A 1O3FA 1TA6A 3UZUA 2BJWA 1WHCA 2V6ZM 3SHFA 1PM5A 2DXIA 1GMCF 1SGYE 5ETXA 3BOSA 1QQ4A 1A46H 2OPFA 1AY6H 1KLJH 4K1TA 3RC5A 3M7TA 1PPBH 3B23B 1B0FA 3UUZA 2V1CA 1YY3A 1A5IA 3RU4E 1V2JT 4ABAA 4QNMA 1O31A 1QB6A 3N99A 1O2NA 1S81A 4UFGH 1D3DB 1GL1A 2ZWLH 5IWAM 3MU5A 1RFNA 3B9FH 1ZHMA 3EGKH 1GI3A 1OP8A 2FODA 4TUWA 2LPRA 4GPGA 1IQKA 4GSOA 2V3HH 2G51A 4DW2U 4QHTA 1P2JA 3LGVA 1MAYA 3UNQA 1EOJA 3ZC7B 2WZQA 3HU3A 4U2WA 2W6ID 3PLPA 1NNUC 1J14A 3KF2A 4ZXXH 1BMMH 1XMOM 2BY5X 3T1HM 1O5EH 2FMJA 2VNTA 2VGCC 1UTNA 1OFIA 3AVZA 3SJOA 4WMEA 4NZQA 4UONA 5I25A 2O01F 3PTNA 2IN2A 1HNZM 1PJQA 2UUCM 3AL0C 4X8TH 1G3CA 1VDLA 5E2PA 1Y3VA 1EZSC 3MNBA 4LZ4B 1CO7E 1YM0A 1NV8A 2BVRH 1JIRA 5F3WA 2KZSA 4FUJA 4HG6A 3OTOM 2A7HA 3U6OA 2ANYA 3HATH 2OQ4A 4JZIA 3C58A 4WH8A 1YPHE 4XBBA 1F5LA 2PW8H 3F9HA 5C3NA 4KTSA 1SI5H 1QUTA 3L25A 1WGLA 4FVMA 3E9SA 1RTFB 3FAOA 3M5LA 3SASA 1HAIH 3A89A 4BAHB 5GCHF 4B74A 4LF8M 5A09A 2FOAA 1QHRB 4Z6AH 4S12A 3TIUA 4CHAC 3LT3A 1HAVA 2FOFA 3KQCA 5FPYA 1H6UA 1HGTH 4NWKA 4MH0E 4JCNA 2ZGXH 4OS2A 2TIOA 3TH3H 2J92A 4M7GA 1IQGA 3RXVA 3A7YA 1ELCA 3SATA 1QBVH 2WYJA 2R0KA 2BDYA 2BY8X 1AGJA 3QYBA 1KTSB 2XBYA 3D65E 1UK4A 1UHBB 3LKWA 5LH8A 3ZZDA 4D80A 3RFWA 3SU2A 2FS8A 4K1SA 1J15A 2R0LA 4WP2A 2A45B 4IJFA 2C8YB 4JZDH 2F9NA 4MQAA 2ODPA 5E2OA 1F7ZA 2ZG0H 2A5IA 2MROB 3W1EA 3T27A 1TGUA 2VQFM 3TWLA 3JAMS 2JZ1A 1NFWA 1C2HA 2VGCB 1ZOMA 1IXZA 1PFXC 2F5PA 2CF8H 3LPRA 4B71A 1NY5A 1BBRH 1FXYA 5FBEA 1FDPA 2W3IA 3ITIA 1T8LA 3ZVDA 3ZZ7A 4CR9A 5GKNA 1DY9A 1V2VT 1F0TA 1FNIA 1P3CA 1QBOA 3OY6U 1LHFH 2ZECA 4FCTA 1BJUA 4I5SA 2A4QA 2KFWA 3TNTA 2UUBM 1W13U 4DBGB 1KTTB 4JI2M 3GY3A 2ZCHP 3QLPH 1QB9A 4X64M 1GI6A 2OQ5A 1KXAA 3A8CA 1NY22 1D6WA 2HPQH 2JETB 4AC9A 4OW0A 1V2WT 1DGGA 4FUGA 4K5ZA 3V13A 3HGPA 4DV1M 1N36M 4Z6YA 4D81A 2C98A 3RMOH 3F0PA 2KW0A 3KP1E 3MH6A 1O2LA 2CV0A 1H8IH 1XX9A 2AIQA 3DSPA 1QA0A 3HKIB 4AKGA 1MKXH 2P8OC 2J5YA 3F92A 2XWAA 3KGPA 3KNXA 5T3HA 5JBBS 3F68H 4QOSA 3KDSE 3PM3A 4Y76A 1Y3UA 1DVAH 3E6PH 4NSVA 1C5UA 1Q3XA 1ZTJA 3RXPA 5C1BA 3F9FA 1XXHE 4HGCA 3T25A 1VGCC 3RLYH 5IK2D 4I8HA 3UQOA 1SXJC 1P02A 1BRBE 1H1BA 1OKSA 1NFUA 1DV0A 4AKHA 2W5EA 1NROH 3P6ZB 1BQYA 5H37D 2Y5HA 2UWLA 5HMAA 2J38A 1GCTB 1W0YH 3LGTA 4CHTB 3HGNA 2H1RA 1CBWC 1EATA 2JKHA 2PKSC 3KXEC 3LVWA 4ZXYH 1DLKB 5FHTA 1C5YB 5DN6D 3OTPA 5JB9S 1C7YA 1VJ9U 4Q2KA 3L29A 1DANH 4FOUC 4HZHA 1ZMVA 1WYKA 6LPRA 2QNJA 1Q31A 3M0EA 4KGAA 4ABJA 1P10A 4ZKNU 1YPHC 2WHXA 3KEEA 4LOYH 3SBKA 4RF1A 2VIDA 1D0MA 3ATIA 2QHOB 2QZ4A 3MH7A 5EXNA 3C3EA 4TWWA 2AMQA 3RXGA 3K65B 4BXWA 2Z4RA 3SJ9A 3AOEC 4A7IB 2ZIQH 3SO3A 1O3HA 4AKIA 2BQ6B 1ZPCA 1E79D 3GLIB 1W5SA 3T6PA 4CBNA 4IBFA 4WXVA 1J7KA 2WPKS 1WXQA 2GMTC 1JIMA 1GHYH 1L1ZA 1AKSB 2JH6D 2YMSC 2BDIA 2M60A 4LGYA 3NUMA 2XFTA 3FTFA 1K1JA 5EQRA 2H9TH 1D6RA 3D8BA 1V2TT 1T3TA 1AFQC 3R3GB 1UMAH 1UFZA 2I6QA 2EKKA 3PXGA 1KMHB 2DAEA 1YGCH 2D1JA 4LY6A 6CHAC 4X2VA 4B7GA 4F55A 5JYIA 2GKVE 2O5RA 2RA0A 4G4OA 6ESTA 2QN5T 1FJGM 1PYTD 2YMSB 1DLEA 4NIXA 3T38A 1KSNA 4NGAH 2FESH 1G2LA 3MNSA 1ZR0A 4INKA 1JB0F 1TX6A 4YT6H 3KFUG 4JXJA 2RFKC 1G59A 1A61H 1E32A 3SFZA 1JRSA 1ORFA 5KECA 3U60A 2DAKA 3SU0A 2HL7A 3CGWA 3DOAA 1BB0B 1O3MA 1QURH 1O3KA 4WMDA 4BAMB 3J7AS 1SFIA 4CJ6A 2BDBA 1OWDA 5AVDA 1UTOA 2K47A 2Y20A 1G2MA 4NOOB
chains in the Genus database with same CATH topology
5EQTA 1KYIA 2V7QD 2YQZA 1L2BA 3GLHA 1BT7A 3WWFA 3SUGA 3OEHD 4DT4A 3RC6A 4GKJM 2XF3A 2LWXA 4HL4A 2WV9A 1GL7A 2XNDD 2KXEA 2ZAMA 3KS8A 5ITXA 3K92A 3AFHA 1L2DA 2DWMA 1W0KD 5FTMA 2VBCA 3SUFA 1DO0A 4XGIA 3SYJA 3PNYA 5KQ8A 3HHYA 3GLFB 2HHHM 4LF6M 3F2HA 2XCFA 4I8OA 3O8RA 4ITQA 2ERCA 3FUVA 3GPUA 3GO8A 1Q3CA 1OJLA 2XFSA 1K3XA 3U61A 3AK5A 2XSZD 2YR0A 4LG2A 1UM8A 3IG5A 1DGBA 1KSFX 2C9CA 2I7PA 2ZANA 2KCAA 3U6LA 3PRBA 3PV2A 3GLGB 3VFDA 2L7IA 3QWLA 3KOWE 5FTKA 4MGHA 1G3IA 3HHZA 3U6MA 3MK6A 3CF6E 4WURA 4L4UA 3VLFB 1W3CA 3ZH9B 5T1VA 4LJ7A 3GRRA 3U6SA 4LZZA 3UB0A 1GLNA 3SBJA 3J7BA 2C96A 4MGKE 2F4LA 4FW9A 1ORYB 3FUTA 2W82A 3LQRA 1NSFA 1QAQA 2C9OA 2YFQA 3M7GA 4MM3B 1R2ZA 4XD7D 4JMYA 3FD9A 5EP2A 1L1TA 1IBKM 2JIZD 3RC4A 4X66M 3FUWA 3NWLA 4L78A 5LMUM 4JI4M 3PRDA 2P5TA 3KSJA 4PDIA 2CV2A 4FETA 3HHXA 4REZA 4M9ZA 4DUYM 5KPTA 2KRKA 3SV7A 3OAAD 2EUCA 4AQYM 5C0TA 2D7GA 2Z4SA 4R8TB 2DWZB 2DWLA 3U5ZB 1TDZA 2M5ZA 2XSZA 4MGZE 1DGHA 1L2CA 5DYIA 3FO8D 3L26A 3TE6A 4LF9M 4OX9M 2HKJA 1IN7A 2ZAOA 4LJ6A 4R3DA 3PV5A 2CHQA 3Q8XA 2M2AA 3N7DA 4GH9A 4LRTA 4CGYB 3ZIAD 2FM2A 2D7EA 3SC3A 5C18A 7CATA 3GRUA 4LFBM 1N78A 2CV1A 2OC1A 4I32A 5HKKD 1XMQM 2UUAM 2XOKD 4TYDA 5ESBA 3EIHA 4GMQA 3OYPA 3CF2A 1R7RA 2R46A 3PVSA 1HR0M 2DVWB 3GLIA 4TSFD 2OBQA 1HNWM 1TH2A 4GC9A 3T1YM 1H8ED 4X62M 4GIPA 2QCUA 2RKOA 2L09A 2YNMD 1R2YA 2AHME 1TH3A 2JJ1D 5IREB 3EIEA 4LCBA 1W5TA 5ITXE 3L27A 2XZFA 2XLJA 2R4EA 3I4VA 2F5NA 4CISA 4PT5A 2R18A 4NRVA 2QENA 5LMNM 3KW6A 3F2FA 5BPVA 3SZEA 4YXWD 4G4RA 3F2GA 4B08A 3GLGA 5CDFE 2P59A 4GHLA 1IQPA 4FWDA 2CFOA 1XHBA 4LZJA 4B3RM 3U6PA 1N32M 4A1VA 4A1TA 4ASUD 4DV0M 4M9FA 2KEBA 1XNRM 3FKSD 1TH4A 1EE8A 1YE9A 5EXXA 4IBBA 4NSRA 1HQCA 3TQSA 3RGPA 4IBDA 2JDID 2EO2A 4IBJA 3GLFA 2QF4A 2VQEM 3SAVA 1PJIA 5IZ7D 4IJEA 3SU5A 1N77A 3VK8A 4DUZM 3CF0A 2QE7D 3J2PB 5GJ4B 2UXCM 4Z8XA 1VDDA 2QP9X 1JXPA 5EJCA 2RGHA 1COWD 1EFRD 2CHGA 4II7A 4GC5A 4A1XA 4JI8M 2LELA 1K3WA 4G4NA 1G41A 3VDPA 2YMSD 4B7FA 1DGHB 3M5NA 1NHGC 4EIWA 3U6DA 2XEPA 4JI7M 4QNRA 2IJOB 4I33A 1J5EM 4LJ9A 4FD2A 5EP4A 3SUEA 4OU7A 2XZUA 4A92A 2FE8A 1GKIA 5EP3A 2NQ8C 3DSOA 3J80S 1SXJB 1NJGA 2F9VA 1IN6A 3SYKA 4AW4A 4LF7M 1X37A 5FL7D 4A3VB 5KQDA 3KOYE 4B6FA 2GVFA 2KR7A 2J7OA 2XGNA 5A2QS 5C0UA 1YSYA 4DR5M 4LF5M 4GHAA 4JI6M 3FOAA 4B76A 3FKEA 4NRWA 3SV6A 1PJJA 3SV9A 5EXSA 4M0DA 5DSFA 3K1JA 4LFAM 3THGA 2QBYB 1DO2A 3PNVA 3GQ5A 2BNKA 3R9XB 3LONA 2EA0A 2IJD1 4L8RC 1CU1A 3NRLA 4MB7A 2JA2A 4DR4M 3GQ3A 4JN6A 1XC8A 2QV1A 3P8NA 3WHLA 1FNNA 3HWSA 4MGYE 1NBME 3SARA 4DR3M 3U6QA 1IN8A 3U61B 5EQQA 1Z59A 3JR5A 4IBGA 3E90B 2F5SA 4KODA 4DV2M 1DXWA 4JYAM 1IXRC 3VDUA 2OC8A 3GQ4A 3VKGA 3JR4A 4TT3D 1Q39A 4X65M 3U6CA 4OVZB 2F43B 4JI1M 4DR2M 1NHWC 3B9PA 5EXPA 4YY3M 4DV3M 4DV4M 5ITUA 5GNDA 1XNQM 3AOEA 1Q3BA 3GPYA 2R45A 2LXEA 2UXBM 2X4AA 1XXHB 4DV5M 2AHMA 4WF8A 1IN4A 2DZNB 2C5RA 2CHVA 1H8HD 3UZUA 3U1IB 4B75A 2BJWA 2V6ZM 4HLQA 3SHFA 3SMSA 5FTNA 1PM5A 2DXIA 3DCLA 5ETXA 3BOSA 3TL4X 2OPFA 2X49A 3SU4A 3PFIA 3SV8A 3RC5A 1C1KA 1XWIA 1BMFD 2V1CA 1IY2A 2YOLA 3N7EA 5H4IB 3KP0E 2G5GX 2A4RA 1QYRA 1JQJC 4QNMA 3A98B 3L6PA 2FOIC 4LGMA 2QPAA 3N99A 2JJ2D 2J7NA 3O8CA 5IWAM 1I94M 2W6JD 2OC7A 1G4AE 2KZUA 5EP1A 3FN8A 4JI5M 3A42A 3HJSA 1SXJE 4TUWA 4KHPM 3W0FA 2Y21A 3FTCA 3LMMA 4OVZA 4G4QA 1E1RD 4QHTA 4L16A 4B3SM 3ZC7B 4I31A 4G6ZA 2WZQA 4RI0A 3HU3A 3J27B 1LV7A 3HJQA 2W6ID 1NNUC 1QAOA 3KF2A 2R65A 3L28A 3M5OA 1XMOM 3T1HM 2D7HA 1A1RA 1OFIA 1IY0A 2Y0TA 2KCOA 2E5LM 1NBMD 3KVWA 1HNZM 2UUCM 3AL0C 5BR8M 4AG5A 2KCPA 3J81S 2Z7JA 2ZM6M 3FTDA 2LNHC 5F3WA 3QAUA 2KZSA 3OTOM 3U6OA 3SU3A 2QBYA 2OQ4A 1MX0A 4JI3M 4QOZC 3C58A 4WH8A 3OE7D 3OFND 4RF0A 4LJ5A 1MU5A 4WH6A 3TPZA 4Q63A 4FWHA 3L25A 4I4LA 4FVMA 3E9SA 5ITYA 4PD2A 3AV0A 4M0WA 3M5LA 3SASA 5FPSA 4B74A 4YHHM 2F5OA 4LF8M 4GRIA 2Q2EB 1MABB 3UJNA 3F0OA 1SXJA 4S12A 2RGOA 3TWMA 5EPNA 3SU1A 4K0KM 5FPYA 4M9XA 4JV5M 3M5MA 1H6UA 4NWKA 4MH0E 2Z3XA 3R8FA 4FCWA 1N34M 1E9RA 1Z5AA 5EXTA 2O8MA 4K8BA 1DXPA 2LH0A 4M9SA 3SATA 4IIWA 3GRYA 1NVMA 5KPZA 5KO3A 4NWLA 4OM9A 4DR7M 3T15A 5E26A 3AJIB 3UMMA 3AKZA 3VKHA 2A4GA 5GPIB 4JI0M 3DA1A 3LKWA 1E1QD 1XXHA 4D80A 3ZCBB 3RFWA 2R4JA 3UGJA 2QF5A 3SU2A 5FSWA 5ITRA 2FOMB 1N1LA 3SYLA 1NS3A 3IG8A 1IBMM 5B6LA 4MGIE 4IJFA 4DR6M 5IT9S 5JI3E 2OINA 3KSXA 1Z6TA 5EQSA 3W1EA 1OHHD 4P16A 2UXDM 1TGUA 2VQFM 3TWLA 3JAMS 4Q4LA 3HU2A 2XCNA 1WXRA 2ZBKB 3GPPA 3LOXA 1IXZA 4B7HA 2F5PA 3TWKA 2OBOA 1JR3A 4B71A 1NY5A 2VIIA 1TDHA 1Z5BA 3H09A 3SMPA 4IBCA 5GKNA 4ZCNA 2WPDD 1DY9A 4PDGA 3DFZA 4FCTA 3D8LA 3W0LB 2KZ4A 4I5SA 3GRVA 2A4QA 2KFWA 3A45A 2UUBM 1K82A 4JI2M 1G8PA 2CUZA 4DV7M 3OEED 2Y0QA 3KOXE 4X64M 1E94E 3FTEA 4LJ8A 5EPYA 1S6LA 4OW0A 1DGGA 1HQYE 2A5YB 4XBOA 1I4WA 4DV1M 1N36M 2J5UA 4Z6YA 5JI2E 1ZAEA 4D81A 2C98A 3F0PA 3AOGA 3KP1E 2KW0A 4NSOB 3RGSA 5ITTA 2CV0A 3DSPA 3K2LA 5FTJA 1N33M 3KOZE 4AKGA 4B3MM 2K1QA 4LJ4A 4B6EA 3K8ZA 5FLXS 3KNXA 3CTWB 1RTLA 2BJVA 2FFJA 5DNYA 1JR3D 3I51A 4DR1M 3SHGB 3SUDA 2KA6B 3KDSE 4QOSA 1KFVA 4NXNM 3F3BA 3DZDA 1QANA 2CE7A 2DWNA 5C1BA 4FCVA 3U5ZA 3VK7A 2OC0A 2HCBA 5IK2D 1IM2A 3RE8A 4WW0A 1SXJC 3FUUA 4IBEA 3WWBA 3ILKA 1IY1A 1ZQ9A 1HT2E 1R6BX 3WHKA 2F9UA 4AKHA 1N75A 1QQWA 2XNIA 3LVVA 4IBIA 5H37D 4LFCM 4QHSA 5F53A 4I81A 3P8OA 3HHWA 3LQQA 1L8QA 4CHTB 3UK6A 2H1RA 4LRSA 1S3SA 3O8BA 1D2NA 2DZOB 5E6JA 3KXEC 3LVWA 4W5WA 3HKPA 3KN2A 3EYDA 2CK3D 4B73A 5DN6D 3OTPA 4KLNA 3L29A 1QZMA 1HT1E 4Z1MD 3M0EA 3U6EA 2FP7B 3SAUA 2WHXA 4LJAA 3FUXA 3KEEA 1IXSB 4RF1A 4ZPXA 2C99A 2QZ4A 5IDKA 3U1JB 3WW7A 3FYDA 2K8IA 4R7GA 2Z4RA 3AOEC 3H4MA 2R62A 1GVNA 3L2AA 4AKIA 4LF4M 1DY8A 4AI6A 1E79D 3GLIB 2F4VM 4GKKM 1W5SA 1GL6A 3MJ5A 4KO8A 4BB9A 2K0QA 2KRUA 4IBFA 2HLDD 2I7NA 3FYCA 1J7KA 2UU9M 1SKYE 1WXQA 3SAWA 3GLHB 3SU6A 1QVRA 4AZFA 3HJ8A 8CATA 1NNJA 4DV6M 1J09A 1L1ZA 2KCYA 2L6OA 2YMSC 1NY6A 2M60A 4RNAA 4LGYA 2XFTA 3FTFA 1RGQA 5EQRA 5FPTA 3D8BA 2OK5A 2CEAA 1T3TA 3I4YA 5DYGA 2GGVB 3KS4A 1IBLM 1OFHA 3PXGA 1KMHB 4GITA 4IBKA 5KPRA 3GP1A 5C17A 4BBAA 4LY6A 5FTLA 3M6AA 3U60B 2X8AA 2XH9A 4FWGA 4B7GA 4NL4H 4BLCA 4L15A 3VG8A 3NBIA 4F55A 2O5RA 1YUBA 4G4OA 4B3TM 1Z5CA 5ITQA 4AG6A 2F5QA 1FJGM 1HNXM 2YMSB 1DGFA 2FNAA 4D82A 4PCZA 3GS9A 2V1UA 4U01A 3T38A 4NXMM 1IN5A 3KFUG 4JXJA 3A46A 2WSSD 1G59A 1W0JD 1E32A 1SXJD 2DHRA 3SFZA 1FX0B 3U60A 4KTCA 2L7HA 2KM0A 2G8LA 3MHVC 1NJFA 2HL7A 3DOAA 5CHBA 3SU0A 3E4RA 3O8DA 3J7AS 1QAMA 3GPXA 3HGIA 3HU1A 2K47A 2Y20A 1E9SA 4NOOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6O A; 
#chains in the Genus database with same CATH topology
 1FON A;  1DIT H;  3KHV A;  5I46 H;  2V7Q D;  3GLH A;  3K9O A;  1O2T A;  2QGR A;  1HJA B;  2BDG A;  2ZGB H;  4PRO A;  3WWF A;  4DT4 A;  3RC6 A;  4WWY A;  4HL4 A;  1ANB A;  5E0H A;  3E8L A;  3LGU A;  2ZAM A;  1O32 A;  1GBB A;  5ITX A;  2DWM A;  1PPF E;  2VBC A;  1W7G H;  5KQ8 A;  3HHY A;  2HHH M;  4LF6 M;  2VJ1 A;  1P12 E;  2XCF A;  4Q7J A;  1AND A;  3GPU A;  2H9E H;  1K1N A;  1YBW A;  3BTW E;  3U61 A;  2YR0 A;  1V2R T;  2A5K A;  5KGO A;  2I6S A;  3KYG A;  2G52 A;  5F8X A;  2C9C A;  2ZAN A;  3PRB A;  2KCA A;  1EKB B;  4RSP A;  4ABF A;  1OPH B;  1SL3 A;  4AG2 A;  4WUR A;  2FOC A;  2A1D B;  1GBT A;  3GRR A;  2ZPQ A;  3GDS A;  3B7N A;  2BWB A;  4MGK E;  2F4L A;  4FW9 A;  1J16 A;  3FUT A;  1W11 U;  4NZL A;  5JB8 S;  1JOU B;  2C9O A;  1TOM H;  2YFQ A;  5EW2 H;  2BXT H;  1Z8J B;  3MU4 A;  5EP2 A;  1Z71 A;  1L1T A;  4NC6 A;  2JIZ D;  4X66 M;  1TBR H;  1LTM A;  1TX7 A;  4ISO A;  3TVJ B;  1SVP A;  1K0H A;  4UN2 B;  3KSJ A;  2CV2 A;  1ACB E;  1O38 A;  2JP7 A;  4REZ A;  1LPG B;  3HKJ B;  1XXD A;  2KRK A;  3ZYD A;  1CHG A;  1EB2 A;  3PYH A;  3U5Z B;  1TDZ A;  1BIO A;  1O5F H;  1ZGI A;  1QFK H;  1TQ7 B;  4UDW H;  3RXS A;  2QF3 A;  1KXE A;  4D76 A;  1V2K T;  2Y6T A;  3TE6 A;  4OX9 M;  2HKJ A;  4R3D A;  1BTZ A;  2GZ9 A;  2J34 A;  3SHA H;  2M2A A;  4GH9 A;  4CGY B;  2MR9 A;  2A5A A;  5JBC S;  3RMN H;  1MQ6 A;  1YCP H;  4X1S U;  3ZIA D;  3SC3 A;  1K2I 1;  4DG4 A;  2OOB A;  1FAX A;  4FUC A;  2VWM A;  5ESB A;  2XOK D;  3EE7 A;  5EOD A;  3NPS A;  3BTF E;  3PMB B;  3I29 A;  4FVD A;  3EA7 A;  2ZGJ A;  2STA E;  2C8W B;  1BHX B;  4CR5 A;  2ZNK H;  4GIP A;  2G5N A;  4WVP E;  2YNM D;  1R2Y A;  1C2J A;  1TMU H;  2Y5G A;  4MPW A;  4LCB A;  1WUN H;  1C5R A;  5ITX E;  5EXL A;  4FVB A;  2R4E A;  1Z6J H;  1WR1 B;  2A7J A;  2CGA A;  2FOG A;  2VIP A;  4AGK A;  2B5T B;  4CRF A;  2L2D A;  5LMN M;  4Y0Z E;  3SZE A;  1CHO G;  1AFE H;  3F2G A;  1UK3 A;  3ZZC A;  2Y7Z A;  1NZQ H;  2K0B X;  2P95 A;  4FWD A;  2CFO A;  1XHB A;  4B3R M;  1N32 M;  1T4V H;  2D26 C;  3E91 A;  3LIW A;  1CA0 C;  5AFY H;  4DV0 M;  1D9I A;  4AGJ A;  3FKS D;  1EE8 A;  1P2N A;  3VGC C;  5FX5 A;  1DOJ A;  4WXI A;  4IBJ A;  1YWU A;  2QF4 A;  1HXF H;  2VQE M;  3H7O A;  3C27 B;  2BVS H;  3MU0 A;  5IZ7 D;  1N77 A;  1UTK A;  4GCH G;  4DUZ M;  1TNG A;  3RXD A;  5A2M H;  5A8Z A;  4MVN A;  1ESA A;  1EXF A;  1TNH A;  1X7A C;  3ZVB A;  1VDD A;  2QP9 X;  3UWJ H;  1C1S A;  5EIY A;  1EAS A;  5J4S A;  3RXI A;  4E7N A;  4LXB H;  2DE8 A;  3RXU A;  4G4N A;  3V0X A;  1P8V C;  3S7K B;  2XEP A;  1HLT H;  1RS0 A;  4JI7 M;  1S84 A;  1V2S T;  4QNR A;  3ATW A;  3P70 B;  4I33 A;  4ZMA H;  5EP4 A;  3D23 A;  4OU7 A;  2XZU A;  1C1O A;  2Z9I A;  1OQY A;  1T43 A;  1BBR E;  4LF7 M;  1PPH E;  1X37 A;  5FL7 D;  4A3V B;  2UUJ B;  2AGE X;  2UWO A;  5HM2 A;  1OSS A;  2FOB A;  3SOR A;  4NRW A;  2V0B A;  3SV9 A;  5TCC A;  4M0D A;  1DWC H;  1OWK A;  3DA9 B;  2BNK A;  1ELB A;  4RN6 A;  1CU1 A;  3T29 A;  4MB7 A;  1AI8 H;  1C5Z B;  4DR4 M;  2RG3 A;  3KQB A;  2SGQ E;  2OCV B;  1FNN A;  3URC A;  1HAP H;  3SAR A;  4DR3 M;  1O5C B;  2XYA A;  1QY6 A;  1IN8 A;  3FP6 E;  1YPE H;  3P17 H;  1SGF A;  3B7Q A;  5F03 A;  4IBG A;  5DP4 A;  1DXW A;  2OC8 A;  2WV4 A;  3GQ4 A;  2VVU A;  3VKG A;  1JWT A;  4ABE A;  2ZU1 A;  4X65 M;  1K28 D;  4OVZ B;  1GMH F;  2F43 B;  4D7F A;  2JWS A;  1XUI A;  5EXP A;  4F1I A;  3QZQ A;  1KXC A;  4DV3 M;  5HM9 A;  1L1N A;  1V2N T;  2LXE A;  3PLK A;  1XXH B;  1GWA A;  3T28 A;  1HAX B;  1W12 U;  4WF8 A;  4X8U H;  2PHB A;  4A5T S;  2CHV A;  1H8H D;  5AFZ H;  3SMS A;  1P9U A;  3EDX B;  1BRU P;  2QCY A;  4AYY B;  5F8Z A;  1ZMU A;  3LU9 B;  2BD9 A;  2R2M B;  1XWI A;  1P2K A;  1QRX A;  2BZA A;  2QY0 B;  2VWO A;  1GO5 A;  1CT2 E;  3A7Z A;  4E7R G;  4K60 A;  2G5G X;  1BCU H;  1QYR A;  1KXB A;  2IOT A;  1AHT H;  3E16 B;  4IW4 E;  3L6P A;  2QPA A;  1JBU H;  4X0W U;  2J7N A;  3O8C A;  1I94 M;  2KZU A;  5EP1 A;  1MTN B;  3FN8 A;  1NRN H;  2GDE H;  1DSU A;  2FLB H;  2XXL A;  4GLY A;  3HJS A;  3A7W A;  1TWX B;  4KHP M;  1GJS A;  1PQ5 A;  1QQU A;  2HNT F;  1PGY A;  4G4Q A;  1C5Q A;  1C1N A;  3GCT G;  5L2Z H;  3U98 H;  4B3S M;  1C2F A;  1QTF A;  4I31 A;  4G6Z A;  1SQT A;  2LP6 A;  1VR1 H;  1ZSJ A;  4IMZ A;  3M5O A;  2D7H A;  2FEQ H;  1IY0 A;  1O2Q A;  4SGA E;  4B2A A;  1QZE A;  5JDU B;  2NWN A;  1XKA C;  1SGQ E;  2BYA X;  1QJ1 B;  2N35 A;  2ZM6 M;  1WV7 H;  1MKW K;  1TNJ A;  3FTD A;  3QAU A;  3Q8G A;  1UO6 A;  2GJG A;  3SU3 A;  4NSY A;  4IGD A;  3RUO A;  2QBY A;  2O8T A;  1MX0 A;  4QOZ C;  2BDH A;  3GY2 A;  3PWC A;  3OE7 D;  1AB9 C;  4RF0 A;  2LVA A;  2QAA A;  4I8L A;  4LJ5 A;  1MU5 A;  1B7X B;  3W67 A;  2VIN A;  4WH6 A;  1L4Z A;  2GNO A;  5ITY A;  3GLF E;  3I77 A;  1TLD A;  2CF9 H;  4YHH M;  3UJN A;  2WPH S;  3F0O A;  1SXJ A;  3HZJ A;  5EPN A;  3TWM A;  2BX3 A;  4K0K M;  5DP6 A;  3LGW A;  1ELA A;  1GHW H;  2Z3X A;  2Z9L A;  4DII H;  1C9P A;  4UE7 H;  2HVY B;  4K8B A;  1O37 A;  1AVW A;  2LH0 A;  2ZFF H;  1EIJ A;  1XVO A;  3Q3X A;  3GRY A;  5KPZ A;  5KO3 A;  1LVO A;  2HGT H;  3GYL B;  2R6F A;  2OQU A;  2AYW A;  4Y71 A;  3T15 A;  4X2W A;  4AZ2 B;  7EST E;  1C1W H;  1PJP A;  2ZHF H;  5E26 A;  3VKH A;  1O3D A;  3L3T A;  2CHA B;  3FZD A;  3DA1 A;  2F91 A;  2DEN A;  1E1Q D;  3MWI U;  1ZML A;  4DT7 B;  1YPG H;  5ITR A;  1QBN A;  1N1L A;  3IG8 A;  3LCV B;  4JZE H;  1QZ8 A;  3STI A;  2FS9 A;  3SGA E;  5JI3 E;  1GI0 A;  4Y8X A;  2OIN A;  3KSX A;  4X6N A;  1Z6T A;  4P16 A;  2UXD M;  1OXG A;  3P8F A;  4IS5 A;  1Y3X A;  1SGR E;  3M37 A;  1HJ8 A;  1A0J A;  1KLT A;  5JBA S;  1WXR A;  3EE0 B;  4NCY A;  2HNT C;  1JR3 A;  1KDQ A;  1RU3 A;  1S6F A;  2HVX A;  4MTB A;  2G81 E;  4YLQ H;  5C20 A;  3LH3 A;  3SMP A;  4IBC A;  3OTJ E;  2FXR A;  3RXJ A;  1XB2 B;  5DP7 A;  4I8J A;  1CUK A;  1SLX B;  2CMY A;  5DP3 A;  1SLU B;  1ELE E;  1FUJ A;  5CMX H;  5A0A E;  1G32 B;  1YPK H;  4FUE A;  1F0S A;  2PLX A;  3GRV A;  2ZKS A;  4X2X A;  3F1S B;  3KOX E;  4AB8 A;  4MNW A;  3SV2 H;  4AX9 H;  5EPY A;  1EZU C;  1S6L A;  2AEI H;  3NZI A;  1RRK A;  3A7X A;  1HQY E;  1Q02 A;  4XBO A;  2D8W A;  1BOQ A;  2H6M A;  3E0P B;  4KTU A;  4H42 U;  3MO3 A;  3AOG A;  3N7O A;  2ASU B;  3TJN A;  1W7X H;  2EI6 A;  4XBD A;  2Q6D A;  1Z7K A;  4X1N U;  3VB4 A;  4B6E A;  3KOZ E;  2K1Q A;  1MBQ A;  1QNJ A;  1EJM A;  4H6S B;  5FLX S;  3SI3 H;  1RTL A;  2ZFS A;  3ZV9 A;  1W8B H;  3I51 A;  4DR1 M;  2BD5 A;  1DDJ A;  1GJ7 B;  1AVX A;  2KA6 B;  2HLC A;  1S0R A;  1U6Q A;  1WU1 A;  1AN1 E;  3F6U H;  3A83 A;  1CA0 B;  1LQD B;  4ZKS U;  3VK7 A;  2OC0 A;  1TGB A;  1ZJD A;  5EST E;  1K1P A;  1IM2 A;  1S6H A;  1MZA A;  2AGG X;  2HPP H;  1EQ9 A;  3RE8 A;  2PKS B;  4ABG A;  2Z3C A;  3WWB A;  3ZZ6 A;  1IY1 A;  1HT2 E;  3WHK A;  1IOE A;  2P3T B;  2XNI A;  5FBI A;  1T8N A;  3LVV A;  4IBI A;  1A4W H;  4LFC M;  1AUJ A;  1VEJ A;  1AE5 A;  3LQQ A;  2TGP Z;  2CV3 A;  1RJX B;  4AOQ A;  1S3S A;  3GYM A;  5E6J A;  4MG3 A;  3K9P A;  2NU2 E;  4Y6D A;  3EYD A;  2CK3 D;  4Y8Z A;  2VU8 E;  4B73 A;  4OS1 A;  1NFX A;  1FN6 A;  2HWL B;  4XFQ A;  1QZM A;  2J98 A;  3FRH A;  4Z1M D;  1FIW A;  4GCH F;  1EJA A;  5A0B A;  1THP B;  3L33 A;  4LJA A;  1MTU A;  1IXS B;  2GMT B;  4XDE A;  4ZPX A;  1C5N H;  1H4W A;  3U1J B;  2K8I A;  2EQN A;  4R7G A;  1WQV H;  2RA3 A;  3MOC A;  1ETR H;  3IIT A;  1DWB H;  1DY8 A;  4AI6 A;  2BDA A;  2F4V M;  3K9X B;  4KO8 A;  3BEI B;  3F9E A;  2R9P A;  2HLD D;  1L1J A;  4WY3 A;  1JR3 E;  2BD2 A;  4B2C A;  3SJI A;  1HIA B;  4MLF B;  1NNJ A;  4DV6 M;  1QRZ A;  1GMH G;  1LKA A;  2L6O A;  1RXP A;  5FPT A;  1NRR H;  3ATL A;  2OK5 A;  1YLA A;  1XUK A;  2QSF X;  1IBL M;  2FZZ A;  2IPQ X;  4GIT A;  4IBK A;  5KPR A;  1YP9 A;  1Z1I A;  1GPZ A;  5JPM H;  1FQ3 A;  1QGF A;  2C8Z B;  1DPO A;  1ZLR A;  2BQW B;  2BDC A;  4NL4 H;  4BLC A;  3BF6 H;  1ABI H;  1EST A;  1E37 B;  3DSG A;  2WYG A;  3RXA A;  5ITQ A;  2FYR A;  4AG6 A;  5HYO A;  2PKA A;  3ATK A;  4D82 A;  2FNA A;  2V1U A;  1BIT A;  4NXM M;  1QRW A;  2PR3 A;  1P2O A;  2PKA B;  1IN5 A;  2ZQ1 A;  1AU8 A;  1ZSL A;  1C5M D;  3A46 A;  2WSS D;  3EQ0 H;  5C1X A;  1W0J D;  2B8O H;  2F83 A;  3I04 M;  2LHC A;  2WSC F;  3A87 A;  3E46 A;  1XM1 A;  4MPU A;  1UTJ A;  1UCY K;  1INC A;  1QAM A;  1SGF G;  1FJS A;  1ZJK A;  2MGW A;  3IWM A;  3HU1 A;  1ZMJ A;  1TON A;  3KS8 A;  1E9S A;  2ZFQ H;  3RXK A;  1NO1 A;  2XWB I;  3VB7 A;  1O3P B;  5BRR E;  3RLW H;  1H9L B;  2ZDL A;  1TMT H;  1IQE A;  5HIZ A;  1B5G H;  4AFU A;  1OS8 A;  4GKJ M;  2LWX A;  1MD8 A;  4UEH H;  3RXF A;  1UK2 A;  1VIT F;  2XND D;  3A80 A;  5GXP A;  5B6O A;  2CP8 A;  3K92 A;  1L2D A;  1W0K D;  4RKJ B;  5FTM A;  2JY6 B;  1DO0 A;  4XGI A;  1VCW A;  1YC0 A;  2ZO3 H;  5F8T A;  1MN3 A;  3RML H;  3KL6 A;  3SNC A;  2ZDM A;  3DHK H;  4ITQ A;  3U8T H;  3O8R A;  3FUV A;  4JZ1 A;  3MO6 A;  1OJL A;  2XFS A;  1K3X A;  1L1G A;  2ZGH A;  2XSZ D;  3GY6 A;  1A0H B;  1GJC B;  3D49 H;  4YOG A;  2UWP A;  4IN2 A;  1DGB A;  4CRG A;  1GJ5 H;  3TK5 A;  3U6L A;  3VFD A;  1OTR A;  5FTK A;  3U6M A;  4MGH A;  2QQ8 A;  1C1M A;  3MK6 A;  2TGT A;  3VLF B;  1W3C A;  2DAI A;  5T1V A;  3FRI A;  4DOQ A;  4LJ7 A;  1GBK A;  4OGY A;  5DP9 A;  1HAO H;  1D4P B;  3SBJ A;  4YT7 H;  4J2Y B;  3J7B A;  5A8Y A;  2KNZ A;  2C96 A;  3FZZ A;  1LHC H;  3TGK E;  5IYT A;  1ORY B;  1C5P A;  2Y82 A;  1QAQ A;  1LKB A;  2A7C A;  4IMQ A;  3M7G A;  1EPT A;  4XD7 D;  4JMY A;  3ZZA A;  1VIT G;  2V3O H;  3M3T A;  1NRS H;  3RXL A;  1VKY A;  1K1M A;  1PJT A;  1V33 A;  3HK3 B;  2Q6G A;  2ANK H;  3RXE A;  4ZAE A;  4L78 A;  1GG6 B;  1ZRB A;  4JK6 A;  1P03 A;  2P5T A;  1MBM A;  4PDI A;  3HHX A;  4H6T A;  1C5L H;  5KPT A;  2BLV A;  4INL A;  2C8X B;  3PV4 A;  4BTT B;  1V2O T;  2EUC A;  2QXI A;  2Z4S A;  3BG4 C;  2C90 B;  2DWL A;  2QXG A;  2ZHQ H;  4Q80 A;  1VIT H;  1DGH A;  3RMM H;  4TWY A;  3PV5 A;  1IN7 A;  1IHT H;  5A8X A;  3Q8X A;  3N7D A;  1AZZ A;  5ABW A;  2G4T A;  5LPE A;  1NC6 A;  1NPM A;  2FM2 A;  3TJO A;  1MAX A;  4I32 A;  7CAT A;  3GRU A;  1O36 A;  3GY8 A;  2CV1 A;  4IN1 A;  5HKK D;  2ZF0 H;  1HJ9 A;  3CF2 A;  1TNL A;  4DIH H;  1L0Z A;  3RU4 T;  2ZTD A;  1QB1 A;  1HNW M;  1TH2 A;  4GC9 A;  2G5V A;  3CEN A;  2LVP C;  2XBV A;  1OOK B;  1EAX A;  1LPK B;  2AHM E;  2GP9 B;  1W5T A;  3Q00 A;  1ZPB A;  1H9H E;  2F5N A;  4U32 A;  2JZ0 A;  3PMH B;  3T2N A;  1VGC B;  4PT5 A;  1GHA G;  4Y7B A;  1O5B B;  1IAU A;  1N8O B;  2WIN I;  1G37 A;  1OWH A;  2GCT B;  1MKX K;  4O9V A;  2VH6 A;  2PSY A;  2ZCL P;  1O2Z A;  4GHL A;  2GX4 A;  2QF0 A;  3U6P A;  2HWJ A;  2ODQ A;  1XNR M;  1SGE E;  1TH4 A;  2CN0 H;  4NSR A;  1HQC A;  1HUT H;  4P17 A;  3GLH E;  2KNA A;  3A8B A;  4MNY A;  1CHO F;  2A31 A;  1VCP A;  1XMN B;  3DFJ A;  4JYV H;  1DE7 H;  1T7C A;  4AB9 A;  1HCG A;  2GD4 B;  3LW5 F;  2WSE F;  5EJC A;  1COW D;  1EFR D;  2CHG A;  1EZX C;  1P06 A;  2UUF B;  4A1X A;  1PPG E;  5T6G A;  2PWX A;  1YPL H;  5GCH G;  2F9P A;  2FWW A;  3MMG A;  1SFQ B;  2VIV A;  1D3P B;  5CHA C;  1NHG C;  4EIW A;  3U6D A;  3KQ5 A;  2IJO B;  4BAQ B;  1P2Q A;  1O2J A;  3KCG H;  2FE8 A;  2RDE A;  3QGN B;  2NQ8 C;  1SXJ B;  1NJG A;  3QDZ B;  3SYK A;  4AW4 A;  2JH5 D;  1P04 A;  4BTI B;  2F3C E;  5L8R F;  5KQD A;  1AUA A;  2BXU H;  2BY9 X;  2XGN A;  1OX1 A;  1ELF A;  1TX8 A;  4DR5 M;  4LF5 M;  5LPR A;  3MH5 A;  4JI6 M;  3FOA A;  3SV6 A;  4DUR A;  3BTD E;  4X6M A;  2LVO C;  3K1J A;  2QBY B;  2W3K A;  1Y3W A;  4I8K A;  3NBX X;  3LON A;  3GDU A;  1C4U 2;  4CRD A;  3KQD A;  3NRL A;  5T6D A;  4TY7 A;  3V12 A;  2BWE A;  2JA2 A;  1JRT A;  5CHA B;  2QV1 A;  1HIA A;  3P8N A;  1HJP A;  5J4Q A;  2QA9 E;  3U6Q A;  1WTH D;  3U8R H;  1Z6E A;  1GVK B;  4Y10 E;  5EQQ A;  4MPV A;  2WPI S;  1V2M T;  1GHV H;  4DV2 M;  3PTB A;  3ODD A;  4JYA M;  3I01 M;  3VDU A;  4YLU A;  1MTN C;  1Y3Y A;  1Q39 A;  1AE8 H;  1MD7 A;  4TT3 D;  4B2B A;  3U6C A;  2ZDN A;  1QDR A;  4K2Y A;  3P92 A;  2JXN A;  4DR2 M;  4JI1 M;  4DV4 M;  4UFF H;  3AOE A;  3MO9 A;  1Q3B A;  3GPY A;  2R45 A;  2UXB M;  1CSO E;  2Q1J A;  2X4A A;  3AAS A;  7GCH G;  1GMD G;  2AHM A;  3ZQJ A;  1C5S A;  1EX3 A;  1IN4 A;  1IQL A;  1O2R A;  1TBQ H;  1C5X B;  2ALP A;  1B0E A;  3BTK E;  4B75 A;  4HLQ A;  1CT4 E;  5FTN A;  2A4O A;  1HYL A;  3K2U A;  3TL4 X;  3RP2 A;  1ZHR A;  3PFI A;  3SV8 A;  1C1K A;  3AW1 A;  1GBC A;  4Y11 E;  1CA8 B;  1IY2 A;  4GVU A;  1HB0 B;  4X1R U;  4AYV B;  3KP0 E;  1LHD H;  1RIW C;  3SND A;  1JQJ C;  3MI4 A;  2FOI C;  4LGM A;  5T6F A;  2J9N A;  2JJ2 D;  3ENS B;  1OYT H;  3ZYE A;  1NO9 H;  2OC7 A;  2ZI2 H;  4JI5 M;  1CGI E;  3W94 A;  4NIW A;  3A42 A;  8LPR A;  2P16 A;  1PPZ A;  3TIT A;  1Z8I B;  2G55 A;  4FU7 A;  4AFZ A;  3W0F A;  4Z0K A;  3FTC A;  4OVZ A;  1MTV A;  5FAH A;  5E0J A;  3SOS A;  4RT0 A;  1TGT A;  1XUH A;  2GTB A;  2ZU4 A;  1A7S A;  3L28 A;  4GHQ A;  2HAL A;  1LPZ B;  1HNE E;  3URE A;  2KCO A;  1Z8R A;  1MMJ N;  2NU0 E;  3KVW A;  2BZ6 H;  4GHT A;  3HY5 A;  3KID U;  1O34 A;  1KY9 A;  3GIS B;  4AG5 A;  4BOH A;  4THN H;  1G36 A;  2KCP A;  2PGQ B;  2Z7J A;  2AMP A;  4ZHM U;  3P95 A;  2LNH C;  3TPI Z;  4YZU A;  3PLB A;  3A85 A;  2FI5 E;  2ZU2 A;  1DWE H;  3LCU A;  3BG4 B;  1GI8 B;  3A7V A;  2H5D A;  1FZZ A;  2Z94 A;  3U28 C;  3TPZ A;  1GDN A;  1NN6 A;  4Q63 A;  4YM9 A;  5LGO A;  1SGD E;  4PD2 A;  2PGB B;  3AV0 A;  4M0W A;  5FPS A;  5GIB A;  1GG6 C;  1OP0 A;  2F5O A;  1GJ9 B;  1BUI A;  1CE5 A;  1NFY A;  3GDV A;  2R44 A;  1GI7 B;  1WAY B;  2Z3D A;  3SU1 A;  1ELD E;  2B9L A;  1O3J A;  3T26 A;  3R8F A;  4FCW A;  4IC5 A;  3TGJ E;  1N34 M;  1Z5A A;  2VIQ A;  2BX4 A;  1SLV B;  4M9S A;  3EAJ A;  5DP8 A;  4IIW A;  4DCD A;  4DVA U;  1GBM A;  2RRU A;  4DR7 M;  3RM0 H;  2A32 A;  1FY3 A;  1F0R A;  3UMM A;  1C5W B;  3C9P A;  1P2M A;  5GPI B;  4JI0 M;  3RM2 H;  4Y0Y E;  3DT0 H;  1ZTK A;  4ZUH A;  3ZCB B;  1C2E A;  2R4J A;  2A2Q H;  1SPJ A;  2QF5 A;  1C2L A;  5FSW A;  2EST E;  1QR3 E;  2FOM B;  3SYL A;  1IBM M;  5FCK A;  4MGI E;  4DR6 M;  1IHS H;  4IBL H;  4ZHL U;  2O8L A;  8KME 2;  2SFA A;  1WOF A;  1OHH D;  2GV7 A;  1WQS A;  2PSX A;  4BNR A;  3HU2 A;  1IQH A;  2XCN A;  3M3V A;  4L6V 6;  3QX5 H;  2ZBK B;  4ANR A;  3GPP A;  2H1U A;  3UAI C;  1LVB A;  1GJB B;  3NK8 A;  3TWK A;  2DNA A;  1ANC A;  1CT0 E;  2OBO A;  1PQA A;  1GMC G;  1TGN A;  2SNW A;  6GCH G;  1J17 T;  4ZCN A;  2V3M A;  3QO6 A;  5EJ1 A;  4PDG A;  3ZZ9 A;  1Y8G A;  2PTN A;  3A8D A;  1VZQ H;  2F9B H;  2J94 A;  3W0L B;  3PO1 B;  2ULL A;  4JYU H;  1BVS A;  3Q76 A;  3ZVG A;  3OEE D;  2Y0Q A;  1TPP A;  2PTC E;  4CRA A;  3MMP A;  2J2U A;  1BTH H;  4KP0 A;  4RKO B;  2O8W A;  1SB1 H;  2A5Y B;  4CRB A;  1I4W A;  3TK9 A;  3VB3 A;  2TGD A;  1TOC B;  2J5U A;  5DFL A;  1ZAE A;  3MNC A;  5C2Z A;  5C5N A;  3D62 A;  4NSO B;  1ZHP A;  3RGS A;  1V2L T;  2OXS A;  1W2K H;  1N33 M;  1HJA C;  4O03 A;  2K9D A;  4LJ4 A;  2ZFR H;  3A82 A;  3K8Z A;  1O2Y A;  2OTV A;  5DPA A;  5EXM A;  4U30 A;  2BJV A;  2FFJ A;  1O0D H;  1JR3 D;  1F5K U;  3SUD A;  3F3B A;  1V3X A;  4NXN M;  1AO5 A;  3UQV A;  3DZD A;  1HBT H;  1QAN A;  3RXQ A;  3TH4 H;  3FE3 A;  3RXM A;  2DWN A;  3BEU A;  2R0I A;  4UFD H;  1YPM H;  2LTU A;  1BDA A;  2FOE A;  4FCV A;  3U5Z A;  1TB6 H;  3IG6 B;  2ZU3 A;  1KXF A;  3UOP A;  7LPR A;  2HCB A;  1PPC E;  1ZSK A;  4WJG 2;  4GAW A;  4KKD A;  2A2X H;  4MDS A;  3ILK A;  1Z1J A;  5DGJ A;  1R6B X;  1HPG A;  2F9U A;  3GOV B;  3ZVA A;  1YF4 A;  4FU8 A;  1QQW A;  1DS2 E;  4MNV A;  1MTS A;  1PQ8 A;  4BAO B;  4I81 A;  1D3T B;  3HHW A;  1L8Q A;  4F49 A;  3UK6 A;  4X8S H;  3VPK A;  1A5T A;  2SGE E;  1OP2 A;  1SQR A;  3OSY A;  3O8B A;  5TCA A;  1D2N A;  1P3Q Q;  3HKP A;  3KN2 A;  3SJK A;  1QUS A;  4X1Q U;  3T62 A;  2XBX A;  4KLN A;  1GBE A;  2ZZU H;  4XSK U;  1GI9 B;  1TAW A;  4OGX A;  3STJ A;  1T6O A;  3U6E A;  2DZL A;  1GVL A;  1YLD A;  2FP7 B;  3FUX A;  5IDK A;  1IFY A;  1FMG A;  2CRU A;  3TGI E;  1GVN A;  3L2A A;  1EPT C;  1C5V A;  4NFE A;  3GY4 A;  4GKK M;  1GL6 A;  1ZGV A;  2K0Q A;  1UTL M;  1O2K A;  2ANM H;  1SKY E;  2BOH B;  1H9I E;  3GLH B;  3SU6 A;  4K1E A;  1TF0 B;  9EST A;  3S9B A;  1NY6 A;  4FUI A;  1Q2W A;  1RGQ A;  1WTG H;  2KX4 A;  4NIY A;  2ZTY A;  2NU4 E;  2P3F H;  2CEA A;  2GQF A;  5DYG A;  2GGV B;  4JK5 A;  1FY1 A;  3KS4 A;  1A5G H;  2CJI A;  1SOT A;  1HFD A;  1OFH A;  1HAZ B;  3GP1 A;  5C17 A;  3C1K A;  5FTL A;  1C1U H;  3M6A A;  1ELV A;  3U60 B;  1YKT A;  1G71 A;  2XRC A;  2X8A A;  3S0N A;  2XH9 A;  1MKW H;  3VG8 A;  4F48 B;  8GCH F;  4L15 A;  8GCH G;  3NBI A;  1SGI B;  3FFG A;  3UPE A;  4B3T M;  1SC8 U;  2P3U B;  1Z5C A;  1P2I A;  1PYT C;  2F5Q A;  2VIW A;  1DGF A;  4PCZ A;  3GS9 A;  1SGC A;  4U01 A;  4RT1 A;  1T8O A;  2WPM S;  2P94 A;  1SGT A;  3B89 A;  3M7Q A;  3B7Z A;  1OIP A;  1MUE B;  2J97 A;  1TNI A;  5HIY A;  3OU0 A;  2Y81 A;  2WUC A;  4CRE A;  2DAM A;  1CQQ A;  1DFP A;  2PP6 A;  3B74 A;  1Y8T A;  1SXJ D;  2DHR A;  2VH0 A;  1AZ8 A;  3SQE E;  1GJA B;  1O3I A;  2DUC A;  3MHV C;  3M3S A;  4E05 H;  2GT7 A;  2EI7 A;  5FCR A;  3E4R A;  1N6X A;  3MQK C;  4AG1 A;  2J4I A;  1TQ0 B;  1F0U A;  5LPF A;  3MYW A;  1RIW B;  5EQT A;  2TPI Z;  2VB0 A;  1E0F D;  4AOR A;  1MU6 B;  1BT7 A;  3SUG A;  2ZGC A;  1D0K A;  3U9A H;  1NTP A;  3UNR A;  1MJG M;  1A3B H;  2XF3 A;  2WV9 A;  3RXH A;  3LH1 A;  3UIR A;  2OOA A;  1FIZ A;  3AFH A;  1VEK A;  3ATM A;  3SUF A;  3SYJ A;  3PNY A;  1YLC A;  2EI8 A;  1DM4 B;  1MTW A;  3F2H A;  4JZF H;  4F4O C;  4X1P U;  3SNB A;  2ERC A;  1L4D A;  2ZTZ A;  3H4J A;  1ZMW A;  1PRB A;  1SMF E;  2QIQ A;  4O97 A;  5EJL A;  5EG4 A;  5GDS H;  3EA9 A;  3MH4 A;  2GCH G;  5EU8 A;  3PV2 A;  2L7I A;  3HHZ A;  3KOW E;  2W26 A;  2THF B;  1GAB A;  3EST A;  2OD3 B;  4L4U A;  4CH8 B;  2FTL E;  3OY5 U;  1GCT C;  3U6S A;  2Z7F E;  1SLW B;  1FY4 A;  1CBW B;  4UD9 H;  2FLR H;  1FY5 A;  1BHX F;  3LQR A;  2ZQ2 A;  1R2Z A;  1C4Y 2;  2AS9 A;  2AH4 X;  1YPJ H;  2Z9J A;  1PJS A;  6GCH F;  2IPH A;  3LJO A;  2FS1 A;  1GGD C;  3PRD A;  4JI4 M;  1LHE H;  1UVP A;  3ELA H;  1WIV A;  4FET A;  1L2E A;  4K3J A;  1UVU H;  4DUY M;  1AWF H;  2V35 A;  1ARC A;  3PO1 C;  1C2D A;  4YES B;  1A0L A;  3OAA D;  5C1Y A;  4AQY M;  5C0T A;  4R8T B;  1FAK H;  2MJ5 B;  1GBA A;  5DJ7 A;  2XSZ A;  4MGZ E;  3GCH C;  5DYI A;  1UCY E;  3FO8 D;  4EST E;  5FX6 A;  4LF9 M;  2L74 A;  3HK6 B;  3Q3K A;  3E1X B;  2QYI A;  4LRT A;  1GI4 A;  1K1L A;  2HAK A;  3RXB A;  1GBD A;  5C18 A;  4LFB M;  1N78 A;  2OC1 A;  1XMQ M;  3A88 A;  1K22 H;  3MNX A;  3QYE A;  2R46 A;  1E38 B;  4I8G A;  4TSF D;  2OBQ A;  1R5L A;  1QL8 A;  3T1Y M;  2JET C;  2CWB A;  3MTY A;  2QCU A;  2RKO A;  2L09 A;  1TH3 A;  2HOB A;  2JJ1 D;  1Y5A T;  1C9T A;  4Y8Y A;  1G9I E;  3EIE A;  1NM6 A;  2DE9 A;  3L27 A;  1FPH H;  3I4V A;  2OO9 A;  4RKU F;  3M61 U;  2G3Q A;  2OP9 A;  2VF8 A;  2R18 A;  1EAI A;  1GCD A;  1MCT A;  1T31 A;  3KQE A;  3QGJ A;  4TPY A;  4XOJ A;  3LC5 A;  5C1U A;  1C4V 2;  1ETT H;  1O33 A;  1O2X A;  2BY7 X;  4ISH H;  5DKM A;  4B08 A;  2FDA A;  4KEL A;  2APL A;  1XVM A;  1LVM A;  1DWD H;  4A1V A;  4ASU D;  1EAU A;  1TR8 A;  4M9F A;  1QIX B;  1YE9 A;  1GHB G;  5EXX A;  1GHB F;  4QT8 C;  4OS4 A;  4XRN A;  1NES E;  1NRP H;  4LK4 A;  3TQS A;  4NIV A;  4IBD A;  2JDI D;  2EO2 A;  1BRA A;  5DP5 A;  3URD A;  3CNR A;  1SGN E;  4ZHA A;  3SAV A;  1THR H;  1SSX A;  2VF7 A;  1GGD B;  1IQN A;  4IJE A;  2STB E;  3VB5 A;  3VK8 A;  3CF0 A;  4VGC B;  2QE7 D;  3J2P B;  5GJ4 B;  2UXC M;  1ZPZ A;  2GZ8 A;  1UHB A;  4GC5 A;  2VWL A;  1VJA U;  4FU9 A;  3BV9 B;  3PMJ A;  1J9C H;  1N6Y A;  2LEL A;  1FLE E;  1O3A A;  4BAK B;  2D2D A;  1YCP M;  5FXL A;  4B7F A;  1DGH B;  3IHP A;  3BTG E;  3M5N A;  4YOJ A;  3NKK A;  2HRV A;  1YCP K;  1LMW B;  1G3E A;  1M9U A;  1J5E M;  4LJ9 A;  1RTK A;  4O3U A;  1J8A A;  1O39 A;  1AUT C;  2AER H;  4A92 A;  1GKI A;  5EP3 A;  1P09 A;  3J80 S;  4NA8 A;  1SHH B;  1GHX H;  1ETS H;  1BTU A;  2BHG A;  4OS6 A;  3IEC A;  1F4I A;  1AIX H;  4B6F A;  2GVF A;  2KR7 A;  2J7O A;  1LQE A;  7GCH F;  4VGC C;  1ANE A;  1EAW A;  1EPT B;  1YSY A;  1UW7 A;  3BN9 A;  3VB6 A;  2AIP A;  4B76 A;  2JUJ A;  1Z8G A;  3QTV H;  4K8Y A;  2L4E A;  2SGA A;  2VWN A;  3THG A;  1GHA F;  5EJZ A;  3PNV A;  1F2S E;  2FOH A;  3K6Z A;  4ZH8 A;  2IJD 1;  4JYT A;  4DJZ B;  3FP8 E;  1G3D A;  3Q77 A;  2XC0 A;  3GQ3 A;  1AKS A;  1XC8 A;  1GBF A;  1GI1 A;  3HWS A;  1WSS H;  4NFF A;  1F92 A;  1NBM E;  3U69 H;  3UTU H;  1T4U H;  2Z9K A;  1LTO A;  2LHG A;  1KDQ B;  3HPT B;  3BBZ A;  1Z59 A;  3JR5 A;  2FX4 A;  2F5S A;  4D9R A;  1BTP A;  1EP5 A;  1S5S A;  2Z3E A;  2EY4 C;  3JR4 A;  1LVY A;  3R0F A;  1UVS H;  3GCN A;  3UWI A;  1O3B A;  2ALV A;  4A6L A;  1TFX A;  1ELG A;  2BMG B;  2ZP0 H;  3GIC B;  1XNQ M;  4XE4 A;  2C5R A;  3BIU H;  5JBT A;  1GMD F;  3U1I B;  2RCE A;  2ZDV H;  4ISI H;  1NU9 A;  3DCL A;  3E3T A;  1UTQ A;  3DD2 H;  4KT0 F;  1C1Q A;  2X49 A;  3SU4 A;  2R3Y A;  4UFE H;  1THS H;  2WSF F;  4ASH A;  1BMF D;  4HI3 A;  2YOL A;  3N7E A;  2ZEB A;  5H4I B;  1Y5U T;  4R0I A;  1OKX A;  3A98 B;  2EEK A;  1SBW A;  1S82 A;  1O2G H;  3WY8 A;  2W6J D;  2EKF A;  1G4A E;  3W68 A;  1F5R A;  4I86 A;  1UCY H;  4OS5 A;  1KLI H;  1LCY A;  3T5F H;  1SXJ E;  1SG9 A;  1VQ1 A;  2LNC A;  2PFE A;  1E1R D;  2Y21 A;  3LMM A;  2H2Z A;  3MFJ A;  3ZZ8 A;  2ZTC A;  3GCO A;  4L16 A;  4RI0 A;  1DX5 M;  1EUF A;  1TGC A;  5GWZ A;  3J27 B;  1LV7 A;  3HJQ A;  1K9O E;  2QXH A;  1ZRK A;  3S69 A;  4CRC A;  1A2C H;  5K7R A;  3ZV8 A;  2DAG A;  1QAO A;  1VCQ A;  2R65 A;  1ZTL A;  1A1R A;  3BTT E;  4O3T A;  1AB9 B;  2Y0T A;  1V2U T;  2E5L M;  2VDB B;  1NBM D;  4AN7 A;  1OIZ A;  2ZFP H;  5BR8 M;  1C1T A;  1S85 A;  1HDT H;  1OAO C;  1O2H A;  3J81 S;  4ACA A;  1AVG H;  3BTQ E;  1MU8 B;  1QA7 A;  2L4F A;  3BG8 A;  2UUK B;  2GZ7 A;  2OUA A;  2FTM A;  2XC5 A;  3UY9 A;  4CHA B;  4DGJ A;  4JI3 M;  4BXS A;  2BQ7 B;  2ZHD A;  3ODF A;  3VFE A;  3OX7 U;  3OFN D;  1GBI A;  4FUB A;  1WGN A;  1EZQ A;  1GJ8 B;  4FWH A;  4I4L A;  4ABB A;  1TPA E;  1DST A;  2ODY B;  2R2W U;  2TRM A;  4GRI A;  1IXS A;  2Q2E B;  2F9O A;  1MAB B;  3LGY A;  7KME H;  3RXR A;  3A81 A;  1E34 B;  2RGO A;  1Y5B T;  2CXV A;  3A84 A;  1TAB E;  4CBO A;  4M9X A;  4JV5 M;  2J98 B;  3M5M A;  9LPR A;  3S9A A;  2DKL A;  1V2P T;  2KDL A;  4NG9 H;  1E9R A;  5EXT A;  1UVO A;  2O8M A;  1DXP A;  1O3N A;  1BJV A;  1BZX E;  1GI5 A;  1SG8 B;  2XTT B;  5C67 A;  3Q3Y A;  3A7T A;  1NVM A;  4NWL A;  1C2G A;  4OM9 A;  1SGP E;  4K69 A;  4FUF A;  4INH A;  1MQ5 A;  2A4G A;  3AJI B;  3AKZ A;  1GBH A;  4HFP B;  2H5C A;  2XBW A;  3SHC H;  1WDI A;  3V3M A;  1XXH A;  4NA9 H;  3AW0 A;  3UGJ A;  1K1O A;  1NS3 A;  4ABI A;  4P02 A;  1ZMN A;  4ZKO U;  5L30 H;  3ZZ5 A;  5B6L A;  5IT9 S;  2XW9 A;  1KXD A;  2FI3 E;  1XUF A;  5EQS A;  4YTA A;  1Y59 T;  3QTO H;  1TYN A;  1O2I A;  2TGA A;  2BB4 A;  2CHA C;  2NU3 E;  4Q4L A;  2SGP E;  3I78 A;  5TJX A;  2KHH A;  1EOL A;  5HXF A;  3LOX A;  4E06 H;  4DY7 B;  4B7H A;  1SHY A;  1XUJ A;  3VEQ B;  2VII A;  1JMO H;  1TDH A;  1Z5B A;  2ZHW H;  3H09 A;  1HV7 A;  3SNE A;  2WPD D;  2SGF E;  3AAV A;  1ZZZ A;  3DFZ A;  2JNH A;  1QL7 A;  2BLQ A;  1QJ7 B;  1XXF A;  4ISL A;  1OAI A;  3D8L A;  1HAV B;  2KZ4 A;  5DG6 A;  8EST E;  5E8E H;  3A45 A;  1K82 A;  1HXE H;  1G8P A;  4DV7 M;  3TNS A;  1E94 E;  1DT2 A;  3FTE A;  1W0Z U;  4LJ8 A;  1FI8 A;  4IC6 A;  1UTP A;  3LJJ A;  1WJ7 A;  2G8T A;  1BML A;  3ZVC A;  2UUY A;  2JY8 A;  3GCT F;  5JI2 E;  1AMH A;  4CH2 B;  3TU7 H;  1HAG E;  2MH8 A;  3TH2 H;  1V34 A;  3HX3 A;  1NRQ H;  2PUQ H;  2G00 A;  3BTH E;  5ITT A;  4J1Y A;  4ABD A;  3K2L A;  5FTJ A;  3QK1 A;  4B3M M;  1GL0 E;  1N8O C;  2QXJ A;  3PMA B;  3CTW B;  5DNY A;  2GCT C;  3GY7 A;  2WV5 A;  3SHG B;  1FV9 A;  1CGH A;  1O5D H;  1KFV A;  1TBZ H;  1BTW A;  2Z8Y M;  2ZPS A;  2CE7 A;  4X8V H;  1XUG A;  1GJD B;  1E36 B;  1GBL A;  3S7H B;  4BAN B;  1D0L A;  2FH0 A;  5BPE A;  1O35 A;  3JZ2 B;  2ZC9 H;  1HAY B;  4WW0 A;  3FUU A;  4IBE A;  1EJN A;  1BBR K;  1ZQ9 A;  5E0G A;  5AHG H;  1N75 A;  2KAI A;  1LO6 A;  2BD4 A;  1GJ4 H;  2AGI X;  4Y79 A;  1OYQ A;  3SJ8 A;  4QHS A;  5F53 A;  3TK6 A;  1PQ7 A;  3P8O A;  2FYQ A;  2ZA5 A;  3B8J A;  3K6Y A;  4LRS A;  4MPX A;  2ZHE H;  2DZO B;  4CIZ A;  2FPZ A;  4W5W A;  2O25 A;  2C4F H;  2FO9 A;  1AQ7 A;  3ZVF A;  3VXF H;  2ZTX A;  3A86 A;  5A0C A;  5G4B A;  2Y5F A;  1O3G A;  4FUH A;  3VXE H;  1W10 U;  1HT1 E;  1VG5 A;  1OWE A;  1S0Q A;  3SAU A;  3M7U A;  4FUD A;  1ABJ H;  2C99 A;  3SQH E;  3WW7 A;  3FYD A;  2LBC A;  2M5T A;  1IQJ A;  3H4M A;  2R62 A;  3H7T A;  1KIG H;  1QL9 A;  1C2M A;  4LF4 M;  3E21 A;  1HRT H;  4X6O A;  2ANW A;  3MJ5 A;  2JY5 A;  4BB9 A;  2BY6 X;  2KRU A;  2Q6F A;  2VVC A;  2WPJ S;  2I7N A;  3FYC A;  2V6N A;  2UU9 M;  1MZD A;  2P8O B;  3SAW A;  1QVR A;  4AZF A;  3HJ8 A;  8CAT A;  1NU7 B;  3BXW A;  1J09 A;  2KCY A;  2Y7X A;  3H5C B;  2NU1 E;  3LDX H;  5K0H A;  4RNA A;  1P11 E;  4YOI A;  3ZZB A;  3AAU A;  3I4Y A;  1SQO A;  4TY6 A;  1A3E H;  2BD3 A;  2JY7 A;  2H5X A;  4TPI Z;  4BBA A;  4WMF A;  1UTM A;  3CS7 A;  4FWG A;  1TMB H;  2G4U A;  1GDQ A;  1YUB A;  3SGB E;  3ZVE A;  5DK1 A;  1HNX M;  3TLO A;  2ZU5 A;  3FAN A;  1GJT A;  1O2M A;  1P9S A;  2EA3 A;  2BD8 A;  2C3S A;  1EP6 A;  3MU8 A;  1PPE E;  3M35 A;  4Y7A A;  1O2W A;  3A8A A;  1A5H A;  2GCH F;  1H8D H;  3FVF B;  3MU1 A;  5AF9 H;  1IQM A;  5EGM A;  1FX0 B;  1BMA A;  3RU4 D;  4KTC A;  2L7H A;  2KM0 A;  4D8N A;  1O3C A;  2G8L A;  2RDL A;  1NJF A;  1O2O A;  5CHB A;  1CVW H;  2B7D H;  3O8D A;  1TGS Z;  1LHG H;  1BMN H;  1FY8 E;  3GPX A;  1OWI A;  4H4F A;  3SN8 A;  3HGI A;  1TPS A;  2CUZ A;  2A4R A;  2ILN A;  3SZN A;  1KYI A;  4Q7Y A;  2YQZ A;  4Y28 F;  1L2B A;  2ZPR A;  3OEH D;  1ESB A;  4NA7 A;  3ZZ4 A;  1GL7 A;  1NV9 A;  1T32 A;  1G3B A;  2KXE A;  2Z6B D;  3QWC H;  4XK8 F;  1W14 U;  2BLO A;  1AIP C;  1O2S A;  1YYY 1;  1BTX A;  3GLF B;  3V7T A;  4I8O A;  3MHW U;  4ABH A;  1DUA A;  3PB1 E;  1FN8 A;  1ELT A;  3GO8 A;  1Q3C A;  1GDU A;  1AWH B;  1P05 A;  3CS0 A;  3AK5 A;  1DUE A;  2ZDA H;  4LG2 A;  1UM8 A;  3IG5 A;  1KSF X;  2I7P A;  3GLG B;  2C93 B;  2R3U A;  3QWL A;  2KNV A;  1G3I A;  1QDT A;  1UJ1 A;  3E0N B;  1RD3 B;  3CF6 E;  2WPL S;  3BTM E;  3NWU A;  3ZH9 B;  3UR9 A;  3V76 A;  4LZZ A;  1TRY A;  3UB0 A;  1GLN A;  1GI2 A;  4ZRO A;  4OS7 A;  3UNS A;  3M36 A;  4GEW A;  2W82 A;  1O5G H;  1NSF A;  4G3O A;  4MM3 B;  1BTY A;  3RXC A;  3FD9 A;  1C1V H;  1IBK M;  3GLI E;  3RC4 A;  1V2Q T;  1TNK A;  2KAI B;  2YNB A;  2OLG A;  3FUW A;  3NWL A;  5LMU M;  3C3D A;  4X6P A;  3TJU A;  4HTC H;  1SR5 C;  4M9Z A;  3PRO A;  3SV7 A;  3P8G A;  2D7G A;  1DIC A;  2DWZ B;  1HAH H;  1WBG B;  2M5Z A;  1L2C A;  2XC4 A;  3L26 A;  2LVQ D;  1WCZ A;  2BTC E;  1FPC H;  3NCL A;  2ZAO A;  4LJ6 A;  3UR6 A;  2CHQ A;  4AFS A;  3S9C A;  2LVN C;  2PV9 B;  1IQF A;  4GUX A;  4MNX A;  2B3T A;  1AFQ B;  5SGA E;  2GDD A;  5L2Y H;  3RDZ A;  2D7E A;  1BRC E;  2TBS A;  1MH0 A;  1TE0 A;  1TRM A;  3UFA A;  1C5O H;  2UUA M;  4TYD A;  3PWB A;  3EIH A;  4GMQ A;  1O5A B;  3OYP A;  1R7R A;  3PVS A;  1HR0 M;  2DVW B;  2P93 A;  2O9Q A;  3GLI A;  1D3Q B;  1NT1 A;  1C2I A;  2Z9G A;  3BSQ A;  2B0F A;  1OWJ A;  1SQA A;  2EC9 H;  1H8E D;  4X62 M;  1TIO A;  3KYF A;  1C1P A;  2FI4 E;  4D7G A;  1GHZ A;  1XKB C;  5KED A;  5IRE B;  1BA8 B;  2SGD E;  2XZF A;  2XLJ A;  3VGC B;  4CIS A;  1C2K A;  2VIO A;  2BD7 A;  2FX6 A;  4NRV A;  2GV6 A;  3BEF B;  2QEN A;  1O3E A;  1TTE A;  3KW6 A;  3F2F A;  2EJS A;  2BVX H;  5BPV A;  4YXW D;  2H9H A;  4G4R A;  4X2Y A;  1ZYO A;  3GLG A;  5CDF E;  1C1R A;  1GVZ A;  2P59 A;  4LZ1 H;  1IQP A;  1C5T A;  4LZJ A;  5EOK A;  1IQI A;  3SI4 H;  4A1T A;  1EFU B;  1ID5 H;  2KEB A;  2JH0 D;  2SNV A;  1R4G A;  3SGQ E;  4IBB A;  1TRN A;  1SOZ A;  2K6B A;  1GBJ A;  3RGP A;  1ZV1 A;  2BLW A;  2ZCK P;  4ISN A;  3GLF A;  1E35 B;  3TJV A;  1P57 B;  3W95 A;  4Q7Z A;  2GT8 A;  1LDT T;  1P0S H;  1K1I A;  4P00 A;  4ACB A;  1PJI A;  3SU5 A;  5HGG A;  2ZFT A;  4BTU B;  4F2L A;  3NXP A;  1ARB A;  3SNA A;  4Z8X A;  1JXP A;  2YNA A;  3RXO A;  2Y80 A;  2RGH A;  5CE1 A;  3DFL A;  3JZ1 B;  5PTP A;  4II7 A;  5C94 A;  1T8M A;  4JI8 M;  3QZR A;  3LC3 A;  4FXG H;  2AFQ B;  3U8O H;  1K3W A;  1UVT H;  1G41 A;  3VDP A;  2YMS D;  1V6D A;  4HEO A;  5EW1 H;  3UOU A;  1G30 B;  3ZZ3 A;  1AD8 H;  2WZJ A;  1GJ6 A;  2AMD A;  1O3O A;  3CP7 A;  3BIV H;  4FD2 A;  1YLN A;  1P01 A;  2BM2 A;  3SUE A;  3F9G A;  1S83 A;  3QN7 A;  3DSO A;  4XBC A;  2F9V A;  4YO9 A;  4B1T A;  1IN6 A;  2FIR H;  2PUX B;  1V92 A;  1VEG A;  3SW2 B;  3KOY E;  4Q7X A;  5F6M A;  1EB1 H;  5A2Q S;  3GY5 A;  5C0U A;  5DO4 H;  2HNT E;  3QUM P;  4GHA A;  4R71 A;  3FKE A;  3G01 A;  5C5O A;  6CHA B;  1PJJ A;  1O2U A;  5EXS A;  2O8U A;  3FP7 E;  5DSF A;  4LFA M;  1O30 A;  1DO2 A;  3GQ5 A;  4SGB E;  3R9X B;  3DUX H;  2EA0 A;  3LGI A;  4L8R C;  2W7S A;  2DHY A;  2BOK A;  2W7U A;  3GCH B;  1TA2 A;  4JN6 A;  3WHL A;  4MGY E;  4D9Q A;  1MCV A;  2WUB A;  1TAL A;  3U61 B;  3E90 B;  1CGJ E;  1KYN A;  4KOD A;  3GLG E;  2QC2 A;  1QJ6 B;  1IXR C;  1QCP A;  3EA8 A;  1O3L A;  2ZDK A;  2A0Q B;  4I7Y H;  2VVV A;  3RXT A;  1NHW C;  3B9P A;  4YY3 M;  3BTE E;  5ITU A;  1K21 H;  5GND A;  1O2P A;  5L6N H;  2DI0 A;  1P3E A;  4ZKR U;  1O2V A;  4AFQ A;  4DV5 M;  2DZN B;  1TPO A;  2J95 A;  1O3F A;  1TA6 A;  3UZU A;  2BJW A;  1WHC A;  2V6Z M;  3SHF A;  1PM5 A;  2DXI A;  1GMC F;  1SGY E;  5ETX A;  3BOS A;  1QQ4 A;  1A46 H;  2OPF A;  1AY6 H;  1KLJ H;  4K1T A;  3RC5 A;  3M7T A;  1PPB H;  3B23 B;  1B0F A;  3UUZ A;  2V1C A;  1YY3 A;  1A5I A;  3RU4 E;  1V2J T;  4ABA A;  4QNM A;  1O31 A;  1QB6 A;  3N99 A;  1O2N A;  1S81 A;  4UFG H;  1D3D B;  1GL1 A;  2ZWL H;  5IWA M;  3MU5 A;  1RFN A;  3B9F H;  1ZHM A;  3EGK H;  1GI3 A;  1OP8 A;  2FOD A;  4TUW A;  2LPR A;  4GPG A;  1IQK A;  4GSO A;  2V3H H;  2G51 A;  4DW2 U;  4QHT A;  1P2J A;  3LGV A;  1MAY A;  3UNQ A;  1EOJ A;  3ZC7 B;  2WZQ A;  3HU3 A;  4U2W A;  2W6I D;  3PLP A;  1NNU C;  1J14 A;  3KF2 A;  4ZXX H;  1BMM H;  1XMO M;  2BY5 X;  3T1H M;  1O5E H;  2FMJ A;  2VNT A;  2VGC C;  1UTN A;  1OFI A;  3AVZ A;  3SJO A;  4WME A;  4NZQ A;  4UON A;  5I25 A;  2O01 F;  3PTN A;  2IN2 A;  1HNZ M;  1PJQ A;  2UUC M;  3AL0 C;  4X8T H;  1G3C A;  1VDL A;  5E2P A;  1Y3V A;  1EZS C;  3MNB A;  4LZ4 B;  1CO7 E;  1YM0 A;  1NV8 A;  2BVR H;  1JIR A;  5F3W A;  2KZS A;  4FUJ A;  4HG6 A;  3OTO M;  2A7H A;  3U6O A;  2ANY A;  3HAT H;  2OQ4 A;  4JZI A;  3C58 A;  4WH8 A;  1YPH E;  4XBB A;  1F5L A;  2PW8 H;  3F9H A;  5C3N A;  4KTS A;  1SI5 H;  1QUT A;  3L25 A;  1WGL A;  4FVM A;  3E9S A;  1RTF B;  3FAO A;  3M5L A;  3SAS A;  1HAI H;  3A89 A;  4BAH B;  5GCH F;  4B74 A;  4LF8 M;  5A09 A;  2FOA A;  1QHR B;  4Z6A H;  4S12 A;  3TIU A;  4CHA C;  3LT3 A;  1HAV A;  2FOF A;  3KQC A;  5FPY A;  1H6U A;  1HGT H;  4NWK A;  4MH0 E;  4JCN A;  2ZGX H;  4OS2 A;  2TIO A;  3TH3 H;  2J92 A;  4M7G A;  1IQG A;  3RXV A;  3A7Y A;  1ELC A;  3SAT A;  1QBV H;  2WYJ A;  2R0K A;  2BDY A;  2BY8 X;  1AGJ A;  3QYB A;  1KTS B;  2XBY A;  3D65 E;  1UK4 A;  1UHB B;  3LKW A;  5LH8 A;  3ZZD A;  4D80 A;  3RFW A;  3SU2 A;  2FS8 A;  4K1S A;  1J15 A;  2R0L A;  4WP2 A;  2A45 B;  4IJF A;  2C8Y B;  4JZD H;  2F9N A;  4MQA A;  2ODP A;  5E2O A;  1F7Z A;  2ZG0 H;  2A5I A;  2MRO B;  3W1E A;  3T27 A;  1TGU A;  2VQF M;  3TWL A;  3JAM S;  2JZ1 A;  1NFW A;  1C2H A;  2VGC B;  1ZOM A;  1IXZ A;  1PFX C;  2F5P A;  2CF8 H;  3LPR A;  4B71 A;  1NY5 A;  1BBR H;  1FXY A;  5FBE A;  1FDP A;  2W3I A;  3ITI A;  1T8L A;  3ZVD A;  3ZZ7 A;  4CR9 A;  5GKN A;  1DY9 A;  1V2V T;  1F0T A;  1FNI A;  1P3C A;  1QBO A;  3OY6 U;  1LHF H;  2ZEC A;  4FCT A;  1BJU A;  4I5S A;  2A4Q A;  2KFW A;  3TNT A;  2UUB M;  1W13 U;  4DBG B;  1KTT B;  4JI2 M;  3GY3 A;  2ZCH P;  3QLP H;  1QB9 A;  4X64 M;  1GI6 A;  2OQ5 A;  1KXA A;  3A8C A;  1NY2 2;  1D6W A;  2HPQ H;  2JET B;  4AC9 A;  4OW0 A;  1V2W T;  1DGG A;  4FUG A;  4K5Z A;  3V13 A;  3HGP A;  4DV1 M;  1N36 M;  4Z6Y A;  4D81 A;  2C98 A;  3RMO H;  3F0P A;  2KW0 A;  3KP1 E;  3MH6 A;  1O2L A;  2CV0 A;  1H8I H;  1XX9 A;  2AIQ A;  3DSP A;  1QA0 A;  3HKI B;  4AKG A;  1MKX H;  2P8O C;  2J5Y A;  3F92 A;  2XWA A;  3KGP A;  3KNX A;  5T3H A;  5JBB S;  3F68 H;  4QOS A;  3KDS E;  3PM3 A;  4Y76 A;  1Y3U A;  1DVA H;  3E6P H;  4NSV A;  1C5U A;  1Q3X A;  1ZTJ A;  3RXP A;  5C1B A;  3F9F A;  1XXH E;  4HGC A;  3T25 A;  1VGC C;  3RLY H;  5IK2 D;  4I8H A;  3UQO A;  1SXJ C;  1P02 A;  1BRB E;  1H1B A;  1OKS A;  1NFU A;  1DV0 A;  4AKH A;  2W5E A;  1NRO H;  3P6Z B;  1BQY A;  5H37 D;  2Y5H A;  2UWL A;  5HMA A;  2J38 A;  1GCT B;  1W0Y H;  3LGT A;  4CHT B;  3HGN A;  2H1R A;  1CBW C;  1EAT A;  2JKH A;  2PKS C;  3KXE C;  3LVW A;  4ZXY H;  1DLK B;  5FHT A;  1C5Y B;  5DN6 D;  3OTP A;  5JB9 S;  1C7Y A;  1VJ9 U;  4Q2K A;  3L29 A;  1DAN H;  4FOU C;  4HZH A;  1ZMV A;  1WYK A;  6LPR A;  2QNJ A;  1Q31 A;  3M0E A;  4KGA A;  4ABJ A;  1P10 A;  4ZKN U;  1YPH C;  2WHX A;  3KEE A;  4LOY H;  3SBK A;  4RF1 A;  2VID A;  1D0M A;  3ATI A;  2QHO B;  2QZ4 A;  3MH7 A;  5EXN A;  3C3E A;  4TWW A;  2AMQ A;  3RXG A;  3K65 B;  4BXW A;  2Z4R A;  3SJ9 A;  3AOE C;  4A7I B;  2ZIQ H;  3SO3 A;  1O3H A;  4AKI A;  2BQ6 B;  1ZPC A;  1E79 D;  3GLI B;  1W5S A;  3T6P A;  4CBN A;  4IBF A;  4WXV A;  1J7K A;  2WPK S;  1WXQ A;  2GMT C;  1JIM A;  1GHY H;  1L1Z A;  1AKS B;  2JH6 D;  2YMS C;  2BDI A;  2M60 A;  4LGY A;  3NUM A;  2XFT A;  3FTF A;  1K1J A;  5EQR A;  2H9T H;  1D6R A;  3D8B A;  1V2T T;  1T3T A;  1AFQ C;  3R3G B;  1UMA H;  1UFZ A;  2I6Q A;  2EKK A;  3PXG A;  1KMH B;  2DAE A;  1YGC H;  2D1J A;  4LY6 A;  6CHA C;  4X2V A;  4B7G A;  4F55 A;  5JYI A;  2GKV E;  2O5R A;  2RA0 A;  4G4O A;  6EST A;  2QN5 T;  1FJG M;  1PYT D;  2YMS B;  1DLE A;  4NIX A;  3T38 A;  1KSN A;  4NGA H;  2FES H;  1G2L A;  3MNS A;  1ZR0 A;  4INK A;  1JB0 F;  1TX6 A;  4YT6 H;  3KFU G;  4JXJ A;  2RFK C;  1G59 A;  1A61 H;  1E32 A;  3SFZ A;  1JRS A;  1ORF A;  5KEC A;  3U60 A;  2DAK A;  3SU0 A;  2HL7 A;  3CGW A;  3DOA A;  1BB0 B;  1O3M A;  1QUR H;  1O3K A;  4WMD A;  4BAM B;  3J7A S;  1SFI A;  4CJ6 A;  2BDB A;  1OWD A;  5AVD A;  1UTO A;  2K47 A;  2Y20 A;  1G2M A;  4NOO B; 
#chains in the Genus database with same CATH homology
 5EQT A;  1KYI A;  2V7Q D;  2YQZ A;  1L2B A;  3GLH A;  1BT7 A;  3WWF A;  3SUG A;  3OEH D;  4DT4 A;  3RC6 A;  4GKJ M;  2XF3 A;  2LWX A;  4HL4 A;  2WV9 A;  1GL7 A;  2XND D;  2KXE A;  2ZAM A;  3KS8 A;  5ITX A;  3K92 A;  3AFH A;  1L2D A;  2DWM A;  1W0K D;  5FTM A;  2VBC A;  3SUF A;  1DO0 A;  4XGI A;  3SYJ A;  3PNY A;  5KQ8 A;  3HHY A;  3GLF B;  2HHH M;  4LF6 M;  3F2H A;  2XCF A;  4I8O A;  3O8R A;  4ITQ A;  2ERC A;  3FUV A;  3GPU A;  3GO8 A;  1Q3C A;  1OJL A;  2XFS A;  1K3X A;  3U61 A;  3AK5 A;  2XSZ D;  2YR0 A;  4LG2 A;  1UM8 A;  3IG5 A;  1DGB A;  1KSF X;  2C9C A;  2I7P A;  2ZAN A;  2KCA A;  3U6L A;  3PRB A;  3PV2 A;  3GLG B;  3VFD A;  2L7I A;  3QWL A;  3KOW E;  5FTK A;  4MGH A;  1G3I A;  3HHZ A;  3U6M A;  3MK6 A;  3CF6 E;  4WUR A;  4L4U A;  3VLF B;  1W3C A;  3ZH9 B;  5T1V A;  4LJ7 A;  3GRR A;  3U6S A;  4LZZ A;  3UB0 A;  1GLN A;  3SBJ A;  3J7B A;  2C96 A;  4MGK E;  2F4L A;  4FW9 A;  1ORY B;  3FUT A;  2W82 A;  3LQR A;  1NSF A;  1QAQ A;  2C9O A;  2YFQ A;  3M7G A;  4MM3 B;  1R2Z A;  4XD7 D;  4JMY A;  3FD9 A;  5EP2 A;  1L1T A;  1IBK M;  2JIZ D;  3RC4 A;  4X66 M;  3FUW A;  3NWL A;  4L78 A;  5LMU M;  4JI4 M;  3PRD A;  2P5T A;  3KSJ A;  4PDI A;  2CV2 A;  4FET A;  3HHX A;  4REZ A;  4M9Z A;  4DUY M;  5KPT A;  2KRK A;  3SV7 A;  3OAA D;  2EUC A;  4AQY M;  5C0T A;  2D7G A;  2Z4S A;  4R8T B;  2DWZ B;  2DWL A;  3U5Z B;  1TDZ A;  2M5Z A;  2XSZ A;  4MGZ E;  1DGH A;  1L2C A;  5DYI A;  3FO8 D;  3L26 A;  3TE6 A;  4LF9 M;  4OX9 M;  2HKJ A;  1IN7 A;  2ZAO A;  4LJ6 A;  4R3D A;  3PV5 A;  2CHQ A;  3Q8X A;  2M2A A;  3N7D A;  4GH9 A;  4LRT A;  4CGY B;  3ZIA D;  2FM2 A;  2D7E A;  3SC3 A;  5C18 A;  7CAT A;  3GRU A;  4LFB M;  1N78 A;  2CV1 A;  2OC1 A;  4I32 A;  5HKK D;  1XMQ M;  2UUA M;  2XOK D;  4TYD A;  5ESB A;  3EIH A;  4GMQ A;  3OYP A;  3CF2 A;  1R7R A;  2R46 A;  3PVS A;  1HR0 M;  2DVW B;  3GLI A;  4TSF D;  2OBQ A;  1HNW M;  1TH2 A;  4GC9 A;  3T1Y M;  1H8E D;  4X62 M;  4GIP A;  2QCU A;  2RKO A;  2L09 A;  2YNM D;  1R2Y A;  2AHM E;  1TH3 A;  2JJ1 D;  5IRE B;  3EIE A;  4LCB A;  1W5T A;  5ITX E;  3L27 A;  2XZF A;  2XLJ A;  2R4E A;  3I4V A;  2F5N A;  4CIS A;  4PT5 A;  2R18 A;  4NRV A;  2QEN A;  5LMN M;  3KW6 A;  3F2F A;  5BPV A;  3SZE A;  4YXW D;  4G4R A;  3F2G A;  4B08 A;  3GLG A;  5CDF E;  2P59 A;  4GHL A;  1IQP A;  4FWD A;  2CFO A;  1XHB A;  4LZJ A;  4B3R M;  3U6P A;  1N32 M;  4A1V A;  4A1T A;  4ASU D;  4DV0 M;  4M9F A;  2KEB A;  1XNR M;  3FKS D;  1TH4 A;  1EE8 A;  1YE9 A;  5EXX A;  4IBB A;  4NSR A;  1HQC A;  3TQS A;  3RGP A;  4IBD A;  2JDI D;  2EO2 A;  4IBJ A;  3GLF A;  2QF4 A;  2VQE M;  3SAV A;  1PJI A;  5IZ7 D;  4IJE A;  3SU5 A;  1N77 A;  3VK8 A;  4DUZ M;  3CF0 A;  2QE7 D;  3J2P B;  5GJ4 B;  2UXC M;  4Z8X A;  1VDD A;  2QP9 X;  1JXP A;  5EJC A;  2RGH A;  1COW D;  1EFR D;  2CHG A;  4II7 A;  4GC5 A;  4A1X A;  4JI8 M;  2LEL A;  1K3W A;  4G4N A;  1G41 A;  3VDP A;  2YMS D;  4B7F A;  1DGH B;  3M5N A;  1NHG C;  4EIW A;  3U6D A;  2XEP A;  4JI7 M;  4QNR A;  2IJO B;  4I33 A;  1J5E M;  4LJ9 A;  4FD2 A;  5EP4 A;  3SUE A;  4OU7 A;  2XZU A;  4A92 A;  2FE8 A;  1GKI A;  5EP3 A;  2NQ8 C;  3DSO A;  3J80 S;  1SXJ B;  1NJG A;  2F9V A;  1IN6 A;  3SYK A;  4AW4 A;  4LF7 M;  1X37 A;  5FL7 D;  4A3V B;  5KQD A;  3KOY E;  4B6F A;  2GVF A;  2KR7 A;  2J7O A;  2XGN A;  5A2Q S;  5C0U A;  1YSY A;  4DR5 M;  4LF5 M;  4GHA A;  4JI6 M;  3FOA A;  4B76 A;  3FKE A;  4NRW A;  3SV6 A;  1PJJ A;  3SV9 A;  5EXS A;  4M0D A;  5DSF A;  3K1J A;  4LFA M;  3THG A;  2QBY B;  1DO2 A;  3PNV A;  3GQ5 A;  2BNK A;  3R9X B;  3LON A;  2EA0 A;  2IJD 1;  4L8R C;  1CU1 A;  3NRL A;  4MB7 A;  2JA2 A;  4DR4 M;  3GQ3 A;  4JN6 A;  1XC8 A;  2QV1 A;  3P8N A;  3WHL A;  1FNN A;  3HWS A;  4MGY E;  1NBM E;  3SAR A;  4DR3 M;  3U6Q A;  1IN8 A;  3U61 B;  5EQQ A;  1Z59 A;  3JR5 A;  4IBG A;  3E90 B;  2F5S A;  4KOD A;  4DV2 M;  1DXW A;  4JYA M;  1IXR C;  3VDU A;  2OC8 A;  3GQ4 A;  3VKG A;  3JR4 A;  4TT3 D;  1Q39 A;  4X65 M;  3U6C A;  4OVZ B;  2F43 B;  4JI1 M;  4DR2 M;  1NHW C;  3B9P A;  5EXP A;  4YY3 M;  4DV3 M;  4DV4 M;  5ITU A;  5GND A;  1XNQ M;  3AOE A;  1Q3B A;  3GPY A;  2R45 A;  2LXE A;  2UXB M;  2X4A A;  1XXH B;  4DV5 M;  2AHM A;  4WF8 A;  1IN4 A;  2DZN B;  2C5R A;  2CHV A;  1H8H D;  3UZU A;  3U1I B;  4B75 A;  2BJW A;  2V6Z M;  4HLQ A;  3SHF A;  3SMS A;  5FTN A;  1PM5 A;  2DXI A;  3DCL A;  5ETX A;  3BOS A;  3TL4 X;  2OPF A;  2X49 A;  3SU4 A;  3PFI A;  3SV8 A;  3RC5 A;  1C1K A;  1XWI A;  1BMF D;  2V1C A;  1IY2 A;  2YOL A;  3N7E A;  5H4I B;  3KP0 E;  2G5G X;  2A4R A;  1QYR A;  1JQJ C;  4QNM A;  3A98 B;  3L6P A;  2FOI C;  4LGM A;  2QPA A;  3N99 A;  2JJ2 D;  2J7N A;  3O8C A;  5IWA M;  1I94 M;  2W6J D;  2OC7 A;  1G4A E;  2KZU A;  5EP1 A;  3FN8 A;  4JI5 M;  3A42 A;  3HJS A;  1SXJ E;  4TUW A;  4KHP M;  3W0F A;  2Y21 A;  3FTC A;  3LMM A;  4OVZ A;  4G4Q A;  1E1R D;  4QHT A;  4L16 A;  4B3S M;  3ZC7 B;  4I31 A;  4G6Z A;  2WZQ A;  4RI0 A;  3HU3 A;  3J27 B;  1LV7 A;  3HJQ A;  2W6I D;  1NNU C;  1QAO A;  3KF2 A;  2R65 A;  3L28 A;  3M5O A;  1XMO M;  3T1H M;  2D7H A;  1A1R A;  1OFI A;  1IY0 A;  2Y0T A;  2KCO A;  2E5L M;  1NBM D;  3KVW A;  1HNZ M;  2UUC M;  3AL0 C;  5BR8 M;  4AG5 A;  2KCP A;  3J81 S;  2Z7J A;  2ZM6 M;  3FTD A;  2LNH C;  5F3W A;  3QAU A;  2KZS A;  3OTO M;  3U6O A;  3SU3 A;  2QBY A;  2OQ4 A;  1MX0 A;  4JI3 M;  4QOZ C;  3C58 A;  4WH8 A;  3OE7 D;  3OFN D;  4RF0 A;  4LJ5 A;  1MU5 A;  4WH6 A;  3TPZ A;  4Q63 A;  4FWH A;  3L25 A;  4I4L A;  4FVM A;  3E9S A;  5ITY A;  4PD2 A;  3AV0 A;  4M0W A;  3M5L A;  3SAS A;  5FPS A;  4B74 A;  4YHH M;  2F5O A;  4LF8 M;  4GRI A;  2Q2E B;  1MAB B;  3UJN A;  3F0O A;  1SXJ A;  4S12 A;  2RGO A;  3TWM A;  5EPN A;  3SU1 A;  4K0K M;  5FPY A;  4M9X A;  4JV5 M;  3M5M A;  1H6U A;  4NWK A;  4MH0 E;  2Z3X A;  3R8F A;  4FCW A;  1N34 M;  1E9R A;  1Z5A A;  5EXT A;  2O8M A;  4K8B A;  1DXP A;  2LH0 A;  4M9S A;  3SAT A;  4IIW A;  3GRY A;  1NVM A;  5KPZ A;  5KO3 A;  4NWL A;  4OM9 A;  4DR7 M;  3T15 A;  5E26 A;  3AJI B;  3UMM A;  3AKZ A;  3VKH A;  2A4G A;  5GPI B;  4JI0 M;  3DA1 A;  3LKW A;  1E1Q D;  1XXH A;  4D80 A;  3ZCB B;  3RFW A;  2R4J A;  3UGJ A;  2QF5 A;  3SU2 A;  5FSW A;  5ITR A;  2FOM B;  1N1L A;  3SYL A;  1NS3 A;  3IG8 A;  1IBM M;  5B6L A;  4MGI E;  4IJF A;  4DR6 M;  5IT9 S;  5JI3 E;  2OIN A;  3KSX A;  1Z6T A;  5EQS A;  3W1E A;  1OHH D;  4P16 A;  2UXD M;  1TGU A;  2VQF M;  3TWL A;  3JAM S;  4Q4L A;  3HU2 A;  2XCN A;  1WXR A;  2ZBK B;  3GPP A;  3LOX A;  1IXZ A;  4B7H A;  2F5P A;  3TWK A;  2OBO A;  1JR3 A;  4B71 A;  1NY5 A;  2VII A;  1TDH A;  1Z5B A;  3H09 A;  3SMP A;  4IBC A;  5GKN A;  4ZCN A;  2WPD D;  1DY9 A;  4PDG A;  3DFZ A;  4FCT A;  3D8L A;  3W0L B;  2KZ4 A;  4I5S A;  3GRV A;  2A4Q A;  2KFW A;  3A45 A;  2UUB M;  1K82 A;  4JI2 M;  1G8P A;  2CUZ A;  4DV7 M;  3OEE D;  2Y0Q A;  3KOX E;  4X64 M;  1E94 E;  3FTE A;  4LJ8 A;  5EPY A;  1S6L A;  4OW0 A;  1DGG A;  1HQY E;  2A5Y B;  4XBO A;  1I4W A;  4DV1 M;  1N36 M;  2J5U A;  4Z6Y A;  5JI2 E;  1ZAE A;  4D81 A;  2C98 A;  3F0P A;  3AOG A;  3KP1 E;  2KW0 A;  4NSO B;  3RGS A;  5ITT A;  2CV0 A;  3DSP A;  3K2L A;  5FTJ A;  1N33 M;  3KOZ E;  4AKG A;  4B3M M;  2K1Q A;  4LJ4 A;  4B6E A;  3K8Z A;  5FLX S;  3KNX A;  3CTW B;  1RTL A;  2BJV A;  2FFJ A;  5DNY A;  1JR3 D;  3I51 A;  4DR1 M;  3SHG B;  3SUD A;  2KA6 B;  3KDS E;  4QOS A;  1KFV A;  4NXN M;  3F3B A;  3DZD A;  1QAN A;  2CE7 A;  2DWN A;  5C1B A;  4FCV A;  3U5Z A;  3VK7 A;  2OC0 A;  2HCB A;  5IK2 D;  1IM2 A;  3RE8 A;  4WW0 A;  1SXJ C;  3FUU A;  4IBE A;  3WWB A;  3ILK A;  1IY1 A;  1ZQ9 A;  1HT2 E;  1R6B X;  3WHK A;  2F9U A;  4AKH A;  1N75 A;  1QQW A;  2XNI A;  3LVV A;  4IBI A;  5H37 D;  4LFC M;  4QHS A;  5F53 A;  4I81 A;  3P8O A;  3HHW A;  3LQQ A;  1L8Q A;  4CHT B;  3UK6 A;  2H1R A;  4LRS A;  1S3S A;  3O8B A;  1D2N A;  2DZO B;  5E6J A;  3KXE C;  3LVW A;  4W5W A;  3HKP A;  3KN2 A;  3EYD A;  2CK3 D;  4B73 A;  5DN6 D;  3OTP A;  4KLN A;  3L29 A;  1QZM A;  1HT1 E;  4Z1M D;  3M0E A;  3U6E A;  2FP7 B;  3SAU A;  2WHX A;  4LJA A;  3FUX A;  3KEE A;  1IXS B;  4RF1 A;  4ZPX A;  2C99 A;  2QZ4 A;  5IDK A;  3U1J B;  3WW7 A;  3FYD A;  2K8I A;  4R7G A;  2Z4R A;  3AOE C;  3H4M A;  2R62 A;  1GVN A;  3L2A A;  4AKI A;  4LF4 M;  1DY8 A;  4AI6 A;  1E79 D;  3GLI B;  2F4V M;  4GKK M;  1W5S A;  1GL6 A;  3MJ5 A;  4KO8 A;  4BB9 A;  2K0Q A;  2KRU A;  4IBF A;  2HLD D;  2I7N A;  3FYC A;  1J7K A;  2UU9 M;  1SKY E;  1WXQ A;  3SAW A;  3GLH B;  3SU6 A;  1QVR A;  4AZF A;  3HJ8 A;  8CAT A;  1NNJ A;  4DV6 M;  1J09 A;  1L1Z A;  2KCY A;  2L6O A;  2YMS C;  1NY6 A;  2M60 A;  4RNA A;  4LGY A;  2XFT A;  3FTF A;  1RGQ A;  5EQR A;  5FPT A;  3D8B A;  2OK5 A;  2CEA A;  1T3T A;  3I4Y A;  5DYG A;  2GGV B;  3KS4 A;  1IBL M;  1OFH A;  3PXG A;  1KMH B;  4GIT A;  4IBK A;  5KPR A;  3GP1 A;  5C17 A;  4BBA A;  4LY6 A;  5FTL A;  3M6A A;  3U60 B;  2X8A A;  2XH9 A;  4FWG A;  4B7G A;  4NL4 H;  4BLC A;  4L15 A;  3VG8 A;  3NBI A;  4F55 A;  2O5R A;  1YUB A;  4G4O A;  4B3T M;  1Z5C A;  5ITQ A;  4AG6 A;  2F5Q A;  1FJG M;  1HNX M;  2YMS B;  1DGF A;  2FNA A;  4D82 A;  4PCZ A;  3GS9 A;  2V1U A;  4U01 A;  3T38 A;  4NXM M;  1IN5 A;  3KFU G;  4JXJ A;  3A46 A;  2WSS D;  1G59 A;  1W0J D;  1E32 A;  1SXJ D;  2DHR A;  3SFZ A;  1FX0 B;  3U60 A;  4KTC A;  2L7H A;  2KM0 A;  2G8L A;  3MHV C;  1NJF A;  2HL7 A;  3DOA A;  5CHB A;  3SU0 A;  3E4R A;  3O8D A;  3J7A S;  1QAM A;  3GPX A;  3HGI A;  3HU1 A;  2K47 A;  2Y20 A;  1E9S A;  4NOO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...