2L6OA

Nmr structure of the protein yp_926445.1 from shewanella amazonensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MGAGQTPHPQLIWPALLKQQGCNELLPLRTNDDWQRFCADSKHLLQYGDKLVDSNFHCFVLEEDAHWHPAAPLPPEGLNDLIRAHCATLGHCCTSKMHLHSVMDAIDFLNALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein YP_926445.1
publication title NMR structure of the protein YP_926445.1 from Shewanella Amazonensis
rcsb
source organism Shewanella amazonensis
molecule tags Structure genomics, unknown function
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13642 DUF4144 protein structure with unknown function
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.650 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l6oA02
2.40.10.320 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2l6oA01
2L6OA
chains in the Genus database with same CATH superfamily
1A61H 3FUXA 2ANYA 4NIXA 3QTOH 1P02A 4GCHG 1UO6A 2PLXA 1PJIA 1FZZA 4OVZA 5DP5A 2EKFA 2ILNA 3KSJA 3R9XB 1KMHB 1ZRKA 1SSXA 1L8QA 1EOJA 4PROA 2PFEA 2FOEA 2BVSH 1XB2B 1LPKB 2P3UB 3KP1E 1UK3A 2VH6A 4FUHA 1YC0A 1Q3BA 1H8ED 1B5GH 1T8MA 3BG4C 4DURA 4O3UA 2WSFF 3U6PA 1GI3A 1IOEA 4NSYA 2QC2A 1TNHA 1R2YA 1SQRA 1GI8B 2XWBI 2WINI 2ZDLA 1ELGA 1EQ9A 3LIWA 1XVMA 3TQSA 3GQ5A 3JR4A 3PMHB 2OC1A 2Y7XA 1ANBA 1G3BA 1QR3E 2UUJB 3O8CA 4LZZA 3C58A 2HHHM 2H1RA 3RFWA 4AZFA 2NU1E 1LKAA 4FUCA 1HJ8A 2FI4E 4TY7A 2G4UA 4I81A 2QF3A 2XSZA 3PFIA 1OAIA 3QAUA 1JOUB 3AOEC 1Z8JB 2AHME 2XTTB 2Y5FA 5GPIB 1GI7B 5JB9S 2Y21A 1S5SA 3WW7A 1OAOC 3UJNA 3BG4B 1DWBH 4ACAA 4DBGB 4CBNA 2WPMS 2ZHWH 4IBGA 1Z6TA 3OFND 1K82A 5FXLA 3PXGA 1YLAA 1NO9H 4DG4A 2YNAA 2F5NA 2STBE 1GJ7B 1YCPM 1GMHF 3MH6A 1D3QB 2NU3E 1C2GA 3C27B 3U5ZA 2V6ZM 1C2HA 2WPIS 3MH7A 1ESAA 4INHA 1RTKA 2ODYB 2QE7D 2K6BA 3KFUG 4WWYA 4MVNA 2R2MB 1QGFA 1HAYB 2EC9H 1FUJA 4BNRA 5EW1H 3MQKC 5HYOA 5DP4A 2D8WA 1TRYA 4DY7B 2C98A 1SOZA 3RU4T 3STJA 1DICA 3BTHE 1F0UA 5F53A 4INLA 5ITTA 4NIWA 3SUEA 1MQ6A 2SGAA 2DHYA 4MPXA 2AHMA 1Z6JH 5FTNA 1K9OE 2J95A 4BAOB 3RU4E 2R0IA 5AHGH 2L2DA 5HKKD 2DZNB 5LPEA 3LOXA 3ZZAA 1YPKH 4FUJA 1TF0B 4FCTA 3LKWA 1UTPA 4GHQA 4X2YA 3SO3A 3GLHE 2ZF0H 4TUWA 4K60A 1ZMLA 3TJUA 1VR1H 1BTHH 4LXBH 5E26A 1FMGA 2HNTF 2IJOB 1O2LA 2LPRA 5BRRE 1GJDB 3VDUA 1O2YA 1ZTKA 1EPTA 2A7JA 2H5CA 4LF7M 1QVRA 3MJ5A 1HCGA 4TWYA 4DV7M 1GJBB 1SQTA 3PNYA 2GT7A 1YPHC 4ZXXH 2O8WA 3LJJA 1NSFA 3VB5A 1IQLA 1JXPA 1QRXA 4R3DA 1O2MA 1FY5A 1X7AC 3Q3YA 5HIYA 2Z7JA 3RGSA 4DR2M 4K1EA 4CH8B 2BNKA 2VDBB 3L6PA 1SC8U 2AMQA 3A89A 3NXPA 3ZVAA 4MNWA 1ZV1A 4HL4A 5T1VA 4GH9A 3EDXB 2RDLA 3E90B 4WMDA 2G52A 3TLOA 3BEFB 1LQDB 1R5LA 4EIWA 1MTWA 3H4JA 1L2DA 2BOKA 2NWNA 1IN8A 1C5RA 1K22H 4B7HA 1SFQB 3VG8A 3KOZE 1ZMJA 2C8WB 1TNLA 1TMTH 3FYDA 3IECA 1SKYE 2BD2A 5FTLA 3DA1A 4RKUF 2UXCM 1FONA 1P01A 1H6UA 5KO3A 3GLHA 1Y3YA 2OC7A 4AG2A 5A2MH 4BTUB 4O9VA 2L4EA 3A7ZA 4KTCA 1QIXB 2P5TA 1BJUA 3Q77A 5EP4A 2DWMA 1N36M 8LPRA 2ZECA 5JBBS 3MNCA 3U98H 3GCTG 3KIDU 3PLKA 2VIOA 1KFVA 4FWGA 1EJAA 2OXSA 3RXTA 3HK3B 3GLIE 2WPJS 3SNCA 4I5SA 3P6ZB 1TDZA 5IREB 2UUBM 3PYHA 2AEIH 3SZNA 1QA7A 4WVPE 1BMFD 2AYWA 4I8KA 5ITXE 3GO8A 2FYRA 1G3CA 1S6FA 4IBCA 3BTQE 1V34A 2A4RA 1TPOA 4OS2A 3RC5A 3SU4A 1Y3UA 3LCUA 1ZMNA 1Q31A 1OPHB 3SHAH 2ZA5A 1N75A 2HLDD 3LVVA 4M0DA 2HCBA 3E3TA 4L8RC 1OYTH 3UTUH 2C8YB 2V3OH 1GBHA 2XFTA 2JJ1D 2B8OH 4LK4A 1TWXB 1E1QD 3AJIB 1AZ8A 1O5GH 3C1KA 3NCLA 2DVWB 1VEKA 3SGBE 1D3TB 3OY5U 1XC8A 2G4TA 3GDSA 1EB1H 1WYKA 3ATIA 5KECA 4FUIA 4AX9H 2JIZD 4D9RA 2QN5T 1ELBA 1MTVA 1HJ9A 1NZQH 1DX5M 4FUFA 2EA3A 1DV0A 3GLIA 4NOOB 2RGOA 1DY9A 1TFXA 1ZZZA 2TRMA 2AERH 3RLYH 3U8RH 1C1SA 1UVPA 4PD2A 5T6DA 2DXIA 3AK5A 1O3EA 2ZHEH 3AW1A 1CT2E 3ELAH 1SGRE 3NK8A 2QHOB 3OU0A 4BTTB 1XKBC 2J94A 5ITXA 1OWHA 4DGJA 1WXRA 5IZ7D 2UUFB 3K92A 2C4FH 1GI1A 2P3FH 2RGHA 4AW4A 1S3SA 2XGNA 4GEWA 1TNGA 4QHSA 3SQHE 2J5YA 4KHPM 2D7EA 5DYGA 1HAGE 4ZAEA 4WY3A 3TJNA 2LVOC 4FW9A 2K8IA 2VIWA 3ZVFA 1EAWA 3F2HA 1KDQB 1TRNA 3BG8A 3SGQE 1Y3VA 2V7QD 3A8DA 3W94A 4FUDA 1FQ3A 4H4FA 1JR3E 1QBNA 1HXFH 4TWWA 4UFFH 2FPZA 2R3YA 4UFGH 1BT7A 1MUEB 3GCHC 3KQBA 3A45A 1N77A 5H37D 3BIVH 2PUQH 2DWNA 2ZQ2A 2Z8YM 2HNTE 3RC4A 1O39A 1AO5A 2ZFFH 4MDSA 3S0NA 2V6NA 1FNNA 2ZANA 4AKHA 5FX5A 3VB4A 3U6QA 4ACBA 5LPFA 2XNDD 4B3TM 4II7A 1FJSA 2R2WU 3CP7A 3QX5H 1MKWH 3LMMA 1S82A 2FS9A 1ZPCA 3P8NA 4X1SU 1G30B 4X6PA 2W5EA 3CGWA 4BBAA 3W0FA 6CHAC 1P2IA 2BDCA 3VB3A 3GCHB 2FI3E 3ZVGA 3UGJA 1R2ZA 1QJ7B 3SJ8A 3SJOA 1HIAB 3A7WA 4WMFA 1CA8B 5KPZA 4MLFB 4A7IB 4AG1A 1ANEA 1C2DA 2A5KA 3QLPH 1XUJA 2GNOA 1PYTD 3A7XA 3URDA 2LTUA 4A5TS 1YM0A 1W5SA 1A0LA 2EY4C 4LRSA 1ANDA 1JR3A 1MU6B 2FOFA 3IHPA 1KTTB 2GTBA 4NZLA 2ZTDA 1NVMA 2P3TB 2QGRA 4X1RU 1WHCA 4ASHA 1W0KD 4CRFA 6CHAB 2P59A 3HZJA 4NC6A 1HGTH 1A46H 1EKBB 1C1RA 3GPPA 1K1IA 3A85A 4I33A 1GMDF 2EUCA 1NFWA 3K65B 4PT5A 1AU8A 3MMPA 3SJ9A 1Y5AT 1WGNA 4S12A 1O5DH 3BTWE 2LHGA 2BWEA 5A0AE 1SGFG 2QNJA 1SGEE 4KTSA 3SU3A 1C2EA 1TA6A 1A5TA 3GRUA 1HAZB 1O2TA 1DITH 1SB1H 1SG8B 1SG9A 2I6QA 1Z6EA 2BJVA 2MH8A 4Z6YA 5ITUA 4HFPB 2Q6GA 3HKJB 3MNSA 3UOUA 1UTMA 6LPRA 1ZSLA 3KS4A 1DANH 3HX3A 2G5NA 3TK5A 4OVZB 3U69H 1WJ7A 4B6EA 2KNVA 4LJ4A 4B76A 2BD7A 4RN6A 3KW6A 3ZV9A 2BTCE 4IBJA 4ZKSU 4ABDA 3M7TA 5BR8M 3AKZA 2AH4X 1WTHD 4FWDA 3RXJA 3AAUA 3W95A 4AYVB 1K1MA 2OLGA 4OGXA 1HQYE 3B9PA 7CATA 5FTMA 2OQ5A 3K6YA 1AVXA 2CN0H 3CS0A 4D76A 4Y79A 1UTJA 3SUFA 1V2PT 3PB1E 1ZMUA 5EJZA 2MGWA 4X8SH 1VITF 3D23A 1NU9A 1G71A 4I8JA 2GKVE 4GMQA 3AOEA 1UVSH 2G8LA 2Z7FE 3SBJA 5H4IB 3SBKA 1O2GH 3RXLA 2ZGBH 3I4YA 1C4Y2 4JZDH 2EKKA 5L30H 1W12U 4CISA 1GHXH 2OO9A 2OBQA 4KTUA 4CH2B 2KNZA 3ZZ9A 2F91A 4GITA 1AE8H 1RU3A 1GHYH 1LKBA 1NRPH 4IMQA 2GZ9A 2GJGA 2O5RA 4GKJM 1P2KA 2R45A 2XH9A 1BMNH 2F3CE 4UDWH 4TSFD 3SGAE 1V2QT 2A32A 2R0KA 3ZVDA 3HHXA 2M5TA 5DJ7A 2UUKB 1TGCA 2DHRA 1TGUA 2XBWA 3FTFA 2KCOA 4O3TA 4AB9A 1OIPA 1OWEA 2ZGJA 1YPHE 2VH0A 2B3TA 2EQNA 3JZ1B 3SU6A 1ID5H 1GBKA 1NU7B 3UWIA 2NU0E 4K2YA 1KXCA 1S81A 2SFAA 2V0BA 4B08A 3UUZA 4AKIA 2CWBA 1GI0A 1OXGA 3RXOA 3FVFB 2XNIA 5E2PA 3KYGA 2PTNA 3V3MA 4Y8YA 2DENA 4DR1M 1DGFA 3DCLA 7LPRA 3U6DA 4OX9M 3L26A 1QRZA 2Q6FA 3RE8A 3MU4A 1MN3A 1TNIA 4NFFA 3SARA 2BDIA 2CEAA 2Y5GA 4D82A 1N1LA 5FCRA 2NU2E 3U60A 5GKNA 4CHTB 1C2MA 1THRH 3A7YA 9LPRA 1P9SA 3ODDA 4UFDH 4LZJA 5AF9H 2B7DH 3CF6E 3A8AA 4K0KM 3UNSA 4F48B 2ZIQH 3MNBA 1ZGIA 1S6HA 1TH4A 2VVUA 4X2WA 2I7NA 2AMDA 1ELFA 4ZUHA 1DSTA 1C5SA 1P2QA 2F9OA 4AFZA 4DIIH 5E0HA 4OS1A 1C5MD 3UR9A 2DAIA 2GP9B 2FZZA 3H7OA 1XUHA 1Z8IB 1F4IA 1K3XA 1FXYA 3F2GA 4NSOB 2PSXA 2FWWA 3KOWE 1E1RD 3E21A 2F9UA 3BXWA 2FTMA 3U6CA 3N7OA 1JQJC 3KQDA 5B6OA 1NO1A 3TH3H 2P93A 3ITIA 2X49A 4FU8A 2F9BH 4DJZB 4GUXA 4CR5A 1ORYB 2QP9X 4ABFA 5J4SA 2AFQB 1LHGH 1XNQM 1OHHD 3A87A 4Q7YA 1QL9A 4GHLA 3IWMA 4Q80A 3A84A 3LQRA 3MO6A 4WW0A 1XUKA 4JZEH 5EXLA 3SV9A 4MNXA 3AFHA 3TWMA 4JZIA 2J92A 1VQ1A 2H9HA 1V2NT 1DGHB 3M7GA 3M36A 1EP6A 4LJ8A 4K5ZA 4E7RG 8GCHG 1Z7KA 1BCUH 3OAAD 4Y76A 3LC5A 3ZZBA 6GCHG 4I32A 1DT2A 3U6EA 3QYBA 1D3DB 1O32A 1O3BA 3F9GA 3MU1A 4HLQA 3A82A 5JBAS 1K0HA 1SVPA 1Z5AA 4Q63A 3RM0H 4L6V6 1MKXK 2IN2A 3RXSA 3EA8A 1NJGA 1FDPA 1H1BA 2GCHF 1IN4A 3TPIZ 1S0QA 3A81A 3VGCC 1FN6A 4Z0KA 1MKWK 3URCA 3KSXA 3U8TH 3B7NA 3BEUA 2CFOA 1TNKA 1P03A 5EXSA 1A0HB 1MD8A 2ZI2H 3N7DA 5FTJA 1EZQA 5JI2E 1QY6A 2GV6A 4RKJB 4LY6A 3BIUH 5FTKA 1YWUA 3SN8A 3EIEA 3BEIB 2HAKA 1IBKM 1V2ST 2UUYA 1SLWB 1IAUA 1QCPA 2YNMD 5KPTA 2BDBA 1LMWB 3FP6E 4DV4M 2V1CA 4DUZM 1FAKH 2RDEA 1QBOA 4NWKA 1ZLRA 2QY0B 7GCHF 1TMUH 3BSQA 5EJLA 1UTKA 2PKAB 3MHWU 2F5SA 4FVDA 4ZCNA 3VGCB 3VFEA 1BBRE 4GCHF 1CHGA 1J7KA 4OGYA 4RI0A 1C9PA 1IBMM 4MNYA 2W7UA 2FIRH 1ELTA 2L6OA 1O36A 1ZGVA 3ATMA 1AGJA 1YE9A 1EZXC 3P8OA 4X0WU 3VEQB 1JIRA 3ZVCA 1UJ1A 3HHWA 2YR0A 4FVBA 2ZTZA 3DFZA 3JAMS 1O3DA 1DY8A 1IQKA 1EUFA 4JI6M 1O34A 1TABE 4BAQB 3Q76A 4DR7M 3BTFE 1LVMA 1GBAA 1NRNH 4PCZA 1TGSZ 1PPZA 1LVOA 1MQ5A 1A5IA 2FEQH 9ESTA 3DFLA 3GY3A 2VWMA 4LCBA 1WR1B 3GY8A 3LGIA 5FAHA 3MWIU 1YCPH 2VIDA 3ZZCA 2I7PA 4NRWA 2A7HA 4LF8M 4SGAE 1O5CB 1YLDA 4LRTA 5L2YH 2A2XH 3FTDA 4WF8A 4M9XA 3KS8A 3M0EA 1LHFH 1UVOA 3GY2A 1SGCA 4FWHA 4NWLA 4CREA 1SR5C 4DV0M 2DNAA 4AYYB 1AUTC 1DDJA 1V2VT 3OSYA 1HT2E 1KTSB 1HIAA 1BITA 1TIOA 4XSKU 4BXWA 5LGOA 2R3UA 1IY2A 4G4OA 3RMOH 2G3QA 2FOMB 1RJXB 2A4QA 1MBMA 4LJ9A 4G3OA 1IQIA 2P94A 5ETXA 3RLWH 3ZZ5A 3TGKE 1O38A 3VLFB 4FUEA 1N6XA 1ETRH 1P3EA 1BTZA 3KN2A 1AVWA 1O2OA 5ABWA 4TPYA 1PYTC 2GCTC 2W82A 2QF4A 1EATA 1HAPH 4ZKNU 5F03A 4I8GA 1N32M 3LH1A 1C1TA 5FPTA 2OC8A 4GSOA 1AI8H 3SAWA 3OE7D 3A42A 4XOJA 2ZDMA 4TPIZ 2DAKA 4TT3D 2YOLA 2OK5A 3W1EA 3K9OA 4WURA 1T32A 4XBOA 4AFSA 2YMSD 4ASUD 2VVVA 4JI7M 3RXIA 1MZAA 1NN6A 2Z4RA 3VK7A 2A45B 1G8PA 5DG6A 1ZTLA 5JBCS 4CRDA 5DYIA 1QJ6B 2GCTB 5JI3E 2ZDKA 4M9SA 2VNTA 3TNSA 1C2JA 3M3TA 4NRVA 5I25A 3SMSA 3QDZB 1P12E 1YGCH 2JA2A 1C5TA 1YKTA 3RXQA 4FU9A 5K0HA 1QZ8A 2G51A 3QK1A 1V2RT 2K0QA 1R7RA 2KRKA 4R8TB 4CJ6A 2ZU5A 4FUGA 4ISOA 1CO7E 2TBSA 5AVDA 1L4ZA 4DV3M 4JYVH 3L3TA 1C5YB 1HAVB 3KGPA 1QUTA 3GY6A 4BAMB 1A2CH 1EAIA 2JUJA 1K1PA 1PPFE 4ANRA 4MPVA 1O2RA 4GIPA 2LVQD 3LU9B 5ITQA 1QQ4A 1WCZA 1GVZA 5DP8A 2OD3B 2JETC 2Q2EB 3WY8A 4NSRA 3ENSB 3SV8A 4AFUA 1T8NA 1W7GH 3Q00A 2PSYA 1UCYK 1OP8A 3F9EA 3P92A 1R6BX 2HKJA 4B3MM 1DE7H 4RT0A 1XM1A 1NTPA 1O3LA 4DIHH 1O30A 2GX4A 2G8TA 2BVRH 1TR8A 7ESTE 4YHHM 5C1XA 2XBXA 4F2LA 2FI5E 2ZTCA 1ZRBA 1SXJD 1LVYA 4K3JA 5C0UA 4YO9A 3FRHA 1AUJA 1DUEA 5C1UA 1MU5A 3SQEE 2JJ2D 3PRBA 5DP7A 4YXWD 1V2UT 4NXMM 3F0PA 2JETB 2O8MA 3GCTF 3FZZA 2G5VA 3CS7A 1EXFA 5DPAA 3RMNH 2EI6A 4D7GA 3N99A 1K1NA 2J9NA 4AKGA 4B2CA 2BZAA 3KQ5A 1U6QA 1PJJA 2PV9B 4AFQA 5C1YA 1AY6H 1K1OA 2J98A 4G6ZA 2ZTYA 5EP1A 4AGKA 2G5GX 2H9EH 1EZSC 1ELEE 3BOSA 4M9FA 1F5LA 1MCTA 1YPJH 3RXBA 2DAEA 3K9XB 3A7VA 3OEHD 4RF0A 3GPXA 1C5WB 1OWDA 2RRUA 2Q1JA 2EJSA 1XMQM 1G2LA 1T7CA 5KPRA 2QBYB 1O2IA 3PTBA 3T5FH 1DLEA 1GBIA 4ZKOU 4JK6A 1P8VC 2GV7A 3VK8A 5GXPA 4CRGA 1VZQH 2EO2A 4H42U 4F4OC 1GL0E 2FDAA 1SGTA 2PGBB 1GHAG 1W7XH 1DLKB 2Z94A 4XFQA 1HB0B 1UMAH 1UFZA 1O5FH 2D26C 3CNRA 3PLPA 1SHHB 2HVXA 2HWLB 1UVTH 1B7XB 1YPGH 3U6LA 1P06A 4OW0A 3U6MA 3OX7U 4JMYA 5EJCA 2BZ6H 2O8LA 2WV4A 3FKSD 4LGMA 3BTME 4R0IA 2HPPH 4X6OA 3U60B 3GRRA 2ZFSA 1SLUB 2FLBH 4U30A 4LZ4B 1ZSKA 4MG3A 2GZ7A 4Y0YE 4X62M 3GLGB 5LMNM 2R9PA 2XFSA 4ABHA 4KODA 1UVUH 8ESTE 1C2KA 5FPSA 3RMLH 1QDRA 4AI6A 2ZDNA 3FUWA 1C5VA 1DGHA 1QAQA 2XW9A 3J27B 1OS8A 1Z1IA 1IQGA 2AGGX 1IFYA 2F4LA 3B7ZA 3UZUA 1DPOA 2GDEH 2BXUH 3I4VA 3VB6A 2BD3A 3IITA 3A8CA 4JI4M 1C2IA 2JXNA 2KZ4A 3V7TA 1W5TA 1YCPK 2XCFA 1H4WA 3RXEA 4X1PU 5KQDA 2MROB 2VINA 3BTKE 1RRKA 4I31A 3RXKA 1AZZA 4AORA 4KKDA 4P16A 3PROA 3ZQJA 1DGBA 3ODFA 3GOVB 3RXMA 2Z9KA 4XBCA 2UWOA 4DCDA 2QXJA 3MOCA 1W0JD 3MMGA 2UXBM 1F2SE 1O3GA 2WPDD 2FNAA 3UNQA 1SPJA 4UN2B 3FTEA 2KCYA 2ZEBA 1SGIB 4BXSA 2VF8A 2F9NA 2KW0A 2PHBA 4I86A 1YSYA 2CV1A 2GT8A 2V3MA 4FCVA 2J38A 2PW8H 4Y8XA 2PKAA 5DK1A 4FU7A 4AOQA 2ANMH 1C5QA 3M35A 3QUMP 3T1HM 2W3IA 2LVPC 4H6TA 1VGCC 2J4IA 2GQFA 3R8FA 4F55A 1C1KA 1LTMA 1WXQA 3TL4X 2GMTC 1F0RA 3MO9A 3GPYA 1H8IH 1SQOA 1D9IA 1O5AB 2ZU2A 5A09A 1BMAA 1HR0M 1IXZA 3B74A 4X66M 2BWBA 2VQFM 1THPB 1NFYA 5JDUB 5C5NA 2CRUA 4I4LA 3HU2A 5E6JA 1TOMH 2VVCA 1LV7A 1OJLA 1LTOA 4JYAM 3SJIA 1CT0E 1O2XA 1DM4B 1IN5A 5GNDA 2JWSA 2OQ4A 3PMBB 1VGCB 1MTNC 1BHXF 2FS1A 4LJ5A 1V2MT 2FO9A 2EEKA 1EB2A 3FOAA 2GMTB 2H5XA 2R6FA 2V3HH 3MH5A 4MGKE 1E0FD 2G81E 4X8TH 4XE4A 2Z4SA 1E35B 2J97A 2GDDA 4LOYH 2M60A 1TONA 2HL7A 4ZHMU 2CHQA 1C4U2 4YOIA 1GJ8B 3FFGA 1BBRH 4HZHA 3PV2A 3UIRA 2WSEF 1Q3XA 1SFIA 2SGQE 1EAXA 5HMAA 5HM9A 3HWSA 1V92A 2FMJA 4D80A 3TNTA 3HJQA 1IY0A 1GABA 1MTNB 2APLA 3TH4H 4NG9H 3L29A 1O5BB 5JBTA 3FANA 4DVAU 1O2SA 1V2LT 3LGVA 1WV7H 1SOTA 3KEEA 3F0OA 1PPCE 2J2UA 4IBFA 4LGYA 1GBCA 3OY6U 4JZFH 1ZPZA 1BOQA 1XXHB 2P8OC 1K3WA 2F43B 2Y20A 3HGNA 3ATWA 1GMCG 5E8EH 4D7FA 1LPGB 1BMLA 4Q4LA 1NY6A 4RF1A 2XC0A 3B7QA 4D9QA 2H9TH 1MTUA 2R4EA 4BAHB 4E06H 2BX4A 5EPNA 5E2OA 2AGIX 1E38B 1ETTH 2PGQB 1GBEA 1PPHE 4B2BA 1TA2A 2JY6B 1GG6C 4Z8XA 4XDEA 1O3AA 2CF8H 2ZHFH 1WOFA 2YMSC 1Z1JA 1QQUA 3MU5A 2P8OB 1SGQE 1IQNA 2BY8X 4ITQA 3MYWA 2JZ0A 3ZZ8A 1Y8GA 1DGGA 2QAAA 5EIYA 2Z3XA 5DNYA 2QF5A 4HGCA 1GBMA 3EYDA 2R0LA 1ELCA 1LPZB 4AB8A 5CDFE 2KZSA 2QQ8A 2WPKS 1O5EH 1H8HD 3NWUA 3HU3A 4UD9H 1GG6B 5K7RA 1HAVA 1L0ZA 2WV9A 4MGIE 4ABBA 3SASA 4B2AA 2GD4B 4IJEA 1TTEA 1UM8A 3R0FA 1HUTH 1DWDH 2YMSB 2DAGA 2UUCM 2L4FA 4A1VA 4LF6M 2QPAA 1CU1A 1NV8A 2LNCA 1GI5A 2AMPA 3HKIB 5G4BA 1XUIA 1ARBA 2C90B 1DXWA 4QNRA 1C1QA 2QV1A 2ZCHP 3BTTE 5HM2A 2H2ZA 2GGVB 2LELA 2EI8A 1G2MA 4FETA 2Y7ZA 1HAHH 3JZ2B 3PWBA 5C17A 5LPRA 2IJD1 1AWHB 4I8LA 3L27A 3GISB 1QURH 3QWCH 1P09A 1UHBB 5A2QS 1IM2A 1W14U 5F3WA 1FLEE 1ZHMA 3OTJE 3RUOA 1SI5H 3RXRA 4YOGA 4JK5A 5FPYA 4MB7A 1XXDA 1DWEH 2ZKSA 3QZQA 2AGEX 2OTVA 1DOJA 1N8OC 1HNWM 3GQ3A 4GHAA 5TCAA 1DUAA 2O9QA 3DD2H 1O2KA 5EW2H 4CBOA 3RXHA 1EIJA 3W68A 2TGTA 3R3GB 4DR6M 2HLCA 1FV9A 2CXVA 1V6DA 3C3DA 4B3SM 2FX4A 4MQAA 2CK3D 1GL7A 5FHTA 1C5OH 2Y80A 4A3VB 3O8DA 3SHCH 3KVWA 2VWOA 1QZMA 4Y0ZE 4QOSA 1CVWH 2FODA 5FLXS 2OUAA 4ZH8A 8GCHF 1KSNA 4CR9A 6GCHF 1PRBA 2UWPA 1DVAH 4DV1M 1TPPA 5C2ZA 5CHBA 4MGHA 1P2MA 1DO2A 4IS5A 2QBYA 1QZEA 1N8OB 1O3HA 4IC5A 4Y71A 2L09A 4NFEA 3UNRA 2K1QA 1V33A 2FOGA 3GLGE 4U2WA 1QAOA 3SI4H 4NCYA 5F6MA 4YT6H 1Z5BA 2XF3A 3FKEA 2XBVA 4WH8A 5BPEA 2A7CA 2ZGCA 3E46A 1PPBH 3EAJA 5FBIA 2LHCA 1FX0B 3U61B 3EA7A 3F2FA 3QWLA 4X65M 1O2JA 3HHZA 3KDSE 2J98B 4JXJA 2KNAA 5EG4A 1ZTJA 5CMXH 4IBBA 1S6LA 5ESBA 3L33A 3AV0A 5A8ZA 3TIUA 1MMJN 1P57B 3GCNA 4NA7A 2JH0D 5A8YA 3TK9A 2WZJA 2SNVA 3PM3A 4Y28F 4CIZA 1NFXA 3MFJA 1XMOM 1DWCH 1EZUC 1F0SA 3VB7A 1A4WH 2L7HA 4YZUA 1SGFA 1W0ZU 3IG5A 1G9IE 1LCYA 1UW7A 4XD7D 2BQ7B 4NA9H 3SOSA 1W8BH 3LONA 3F9HA 3VKHA 3S7KB 3WWBA 3GLGA 3SMPA 3BBZA 1O35A 4JV5M 1OX1A 4Q7ZA 5C3NA 1HBTH 1NY5A 1WQSA 1FIWA 1KSFX 1QTFA 1WUNH 4H6SB 4JN6A 5BPVA 1GBDA 1P2NA 2QCYA 1BTXA 1GI4A 2C3SA 2CV0A 3VPKA 1HQCA 4INKA 3HGIA 4I8HA 2AIPA 1KLIH 4YT7H 3Q3XA 5KGOA 2WSCF 2BB4A 4L16A 3KXEC 2QYIA 1P9UA 1V2WT 3SV7A 2DKLA 1PJSA 2C8XB 1ZYOA 4DR4M 3UFAA 1EAUA 1VJAU 2F83A 2JP7A 4AQYM 3I77A 5JYIA 1G4AE 1HAOH 1YPEH 5FBEA 3LDXH 2ZU4A 1LO6A 1NHGC 2C9CA 4X8VH 1KXFA 2BY6X 3GRYA 3U8OH 1SHYA 3T26A 2LXEA 1SGNE 3E9SA 4FVMA 1G3IA 5C18A 3F3BA 1L1TA 3F9FA 3M6AA 3NPSA 2A0QB 1QNJA 2R46A 3HKPA 1CHOG 3PNVA 1KYNA 1LHCH 2A5AA 1AQ7A 4PDIA 3IG6B 1LVBA 2EA0A 2KR7A 3M5LA 2RA0A 1HXEH 2LP6A 4CGYB 3IG8A 4L4UA 1GDUA 1LDTT 3ZZ3A 1ZMWA 1A3BH 3OTOM 4MGYE 1TBRH 3HATH 1BUIA 3SI3H 1DO0A 1Y3XA 5J4QA 1QDTA 1OIZA 3Q8XA 1HDTH 2XBYA 3E4RA 2ZTXA 3K6ZA 2JNHA 5HXFA 3KOYE 2FS8A 3BTGE 2DZLA 1LHDH 3UR6A 3LGUA 1A7SA 3Q8GA 3MNXA 2CV2A 1O2WA 3DSOA 1TLDA 2ZFTA 2H5DA 2O8UA 1IHSH 4TYDA 5F8ZA 1Y3WA 3PMJA 2KFWA 4MGZE 1KYIA 4YY3M 3GRVA 4GVUA 4LJ6A 1RTLA 2N35A 3SU0A 1O33A 3SZEA 1BTPA 4E05H 4RKOB 1L1ZA 1O37A 2RCEA 2GZ8A 1FY3A 3ZZ4A 1OOKB 4WXVA 1TE0A 5C67A 2ANWA 2O25A 2KZUA 2FM2A 1IQMA 4KT0F 1D0KA 3GLFA 4B7GA 2ZU1A 2R18A 1FI8A 2D2DA 3SU1A 3UQVA 4LZ1H 3TWLA 1EFUB 1VEJA 4B1TA 1MTSA 3HY5A 5DFLA 1UTOA 2LH0A 2RG3A 1HFDA 4THNH 2F5OA 2XC5A 3CF2A 4X2VA 1QUSA 4AGJA 3PLBA 4KGAA 3FUVA 3S7HB 2CHVA 1E79D 2MJ5B 3DHKH 2KEBA 8CATA 4A1XA 3SUGA 1W11U 3PTNA 4BB9A 1GJAB 1C5UA 1E32A 1PQ7A 2BDAA 3LC3A 1O3CA 1XHBA 1XXHA 1T3TA 1COWD 3A86A 1TRMA 2KDLA 1J8AA 3LJOA 4FCWA 1NBMD 3EA9A 5DGJA 1Y5BT 2A31A 2QF0A 1INCA 3QZRA 3HU1A 1EJNA 3SNEA 4AG5A 1D2NA 1SGDE 1TYNA 3NKKA 1VDDA 3T2NA 1BZXE 4BANB 3M5NA 2F4VM 2KA6B 2A1DB 1XUGA 3K8ZA 4WMEA 3K9PA 3D8BA 4QOZC 1F92A 1Y8TA 1WGLA 2FOCA 3QN7A 2BD9A 1J14A 1C1MA 1UTNA 1C5XB 1GJ5H 4ZPXA 2TGDA 3UOPA 4ABAA 3Q3KA 1Q02A 4B3RM 2RKOA 1TPSA 4JYTA 2J5UA 3CENA 3NWLA 1RGQA 1Z8RA 2ZU3A 3KP0E 3A80A 5ESTE 3TVJB 1ZQ9A 1OWIA 2ZZUH 3RDZA 2F9VA 1NNUC 1NNJA 5GDSH 1TALA 1TH2A 2WZQA 1I4WA 2B0FA 3RXVA 4E7NA 1MCVA 3AW0A 3FE3A 3C3EA 4IBDA 1O31A 3E8LA 4YESB 1C2FA 4GPGA 4OM9A 2LVAA 3I29A 4K1TA 3M5OA 1ESBA 1C5NH 4IBEA 1O3OA 1A3EH 1T4UH 1CQQA 3ZZDA 1O3NA 1GHAF 1C1OA 2TGAA 2Z9JA 3F68H 4ISHH 5EJ1A 1N78A 2OQUA 4K8BA 5I46H 3K1JA 4G4RA 2ERCA 3TH2H 3K2LA 5L8RF 5JB8S 1JBUH 3OEED 1O3PB 5F8TA 2HWJA 3ZC7B 3SU5A 2F9PA 1PQ8A 1VDLA 1J9CH 1CGIE 1XMNB 2A2QH 2P95A 2VU8E 3LGWA 1PQAA 2DE9A 2JH5D 3AASA 4X8UH 1HT1E 2C5RA 3EIHA 3ZVBA 1MZDA 1UHBA 1IN6A 2BMGB 4AN7A 1TNJA 1OFIA 2BLWA 3B23B 1FPCH 2Y82A 4FOUC 4Y6DA 1TX7A 1N6YA 1T6OA 3GDVA 5KQ8A 4IBKA 2KX4A 1F7ZA 1ETSH 3NUMA 4Y11E 3KF2A 1Q3CA 2X4AA 3D49H 4KELA 1K1LA 3M3SA 4O03A 1YPLH 1TX8A 1P0SH 3SYKA 1A0JA 2TGPZ 5A0BA 2O8TA 3AVZA 1D3PB 7KMEH 1S84A 3E0NB 1XNRM 1MD7A 1ELAA 4Q2KA 1SXJA 5EPYA 2HOBA 1HAXB 3ZV8A 1PPGE 1IY1A 1NS3A 1RS0A 1VCPA 4BTIB 4DV2M 2OOBA 2R62A 1O2ZA 2LWXA 3MO3A 4LFAM 2WV5A 2YQZA 1S0RA 2XZUA 3CTWB 1GJ9B 2VWLA 3ZZ6A 3CF0A 4LG2A 2AS9A 4AC9A 2VQEM 3U61A 1GHBG 2Z3CA 5PTPA 4L15A 2XSZD 3DZDA 3ZCBB 1CGHA 3EE0B 2RA3A 3RXAA 3SU2A 3EE7A 1ZPBA 1AHTH 1C7YA 1R4GA 2CP8A 1YPMH 2TIOA 2BY7X 3FAOA 1FNIA 2Y81A 4ABJA 2PWXA 4GAWA 2BD5A 1C2LA 3WWFA 1KY9A 1WTGH 1TGBA 2P16A 3B89A 1GCTC 4ZROA 3V13A 4IN1A 5GCHG 5EXNA 3O8BA 4JI1M 2ZM6M 5LMUM 1T8OA 4B74A 1BRCE 1AN1E 3LVWA 3DSGA 1XX9A 3J80S 1V2TT 1QQWA 2QZ4A 1WIVA 1BRAA 1NY22 1VEGA 1N34M 3SORA 4G4NA 1B0EA 1OQYA 3DOAA 4GRIA 3BTEE 5C5OA 4HTCH 1EASA 1KXBA 1QA0A 2A5IA 2GVFA 2FOHA 2Z3DA 2FTLE 2ZFRH 1BQYA 1BMMH 1C1PA 1GCTB 2X8AA 1ABJH 1E34B 2WYJA 4JI8M 3HPTB 4DR5M 4LF9M 2YFQA 4P17A 3PRDA 1O3KA 4GC5A 4BOHA 2ZHDA 5EXPA 2KHHA 1TBZH 3NBIA 3RP2A 2Q6DA 4AG6A 3OTPA 1ABIH 1GKIA 2XRCA 3MTYA 3P8GA 2R65A 2B9LA 3T27A 1UCYE 2UXDM 4YM9A 1QB6A 2J7NA 1BJVA 1UTLM 4M0WA 2ZO3H 1KIGH 1P2JA 5EQQA 2A4OA 3RGPA 1BHXB 1V2OT 1GJ6A 4DT7B 2KCAA 1O3MA 3PV5A 2LVNC 2ZDVH 1GJTA 4HEOA 1JIMA 2ZPSA 3U9AH 2C8ZB 2ZGXH 1XXFA 1JRTA 1QB1A 2QENA 1A1RA 4CRAA 3L25A 1GDNA 4IMZA 3PMAB 1GGDC 3A98B 3E16B 3J81S 1VCWA 1SMFE 2IOTA 1GI6A 3ESTA 1WAYB 3WHKA 2ODQA 2W26A 2LBCA 5T3HA 3SNBA 2WPHS 2BXTH 2R44A 4PDGA 1KXAA 1GJ4H 2NU4E 5EU8A 1ZJKA 1D0MA 1YY3A 3KCGH 2XC4A 4QT8C 1XVOA 2BX3A 2DWLA 1QYRA 3RU4D 4AZ2B 1GMCF 5EGMA 1D4PB 5TJXA 1F0TA 1W2KH 4OS6A 1IXSB 1YP9A 3NZIA 1KLJH 3TWKA 4B7FA 1NT1A 1Q2WA 3GQ4A 2BYAX 2KCPA 4OS4A 1O2HA 3FP7E 2FFJA 1GGDB 4X64M 2BDYA 3M37A 1WSSH 3KQCA 4XBDA 3FP8E 1HNXM 3RM2H 3M61U 2CHGA 3F92A 2WUBA 3LGYA 1AKSB 2BHGA 1BRUP 4J1YA 3SNAA 1O2NA 2BOHB 3ZH9B 4ISNA 5EQTA 2PTCE 4Y7AA 3ZIAD 2E5LM 1JB0F 1AFQC 1GMHG 2J7OA 3KHVA 4K69A 3AOGA 1HAIH 4Y10E 2BVXH 3UAIC 5EQSA 2HVYB 1OP0A 2ZGHA 1PJPA 1J5EM 3O8RA 5DO4H 1GBTA 1NC6A 3D65E 3G01A 3UY9A 5EODA 3RXCA 4ZKRU 3QGNB 2C96A 4M9ZA 1P05A 2FE8A 1A5HA 1ELVA 1O3JA 1TOCB 1W13U 2VWNA 5HGGA 5LH8A 3T29A 1LHEH 1S83A 4Z1MD 4ISLA 2JZ1A 2ZAOA 1J17T 1AD8H 1AFQB 1NFUA 4XRNA 2VJ1A 1MU8B 4HI3A 4LFCM 2QA9E 3MI4A 5E0JA 2UUAM 2KM0A 3J7BA 2V1UA 2WYGA 5FX6A 5L6NH 2JY8A 2CV3A 4MH0E 1E36B 1G3DA 1MH0A 1O2VA 1L2CA 1AFEH 2V35A 3FZDA 3UK6A 2G00A 3GY7A 3I78A 1VITH 1TGNA 1AWFH 4RT1A 3TJVA 3OYPA 4NXNM 3UMMA 3GLFB 1PQ5A 4X1QU 4LFBM 1O3FA 4ABEA 2L74A 5A8XA 3TU7H 4R71A 2ZCLP 1ZMVA 4QNMA 1XKAC 4L78A 3BF6H 3UPEA 2ZAMA 1CT4E 2K9DA 5EXMA 5FCKA 3SC3A 3DSPA 3GYLB 4WP2A 5EP3A 4IBLH 5JPMH 2JY5A 4YLQH 4CRBA 2L7IA 5IK2D 2TPIZ 1YYY1 1J16A 2FXRA 3E1XB 3ZZ7A 3GCOA 1FJGM 1RD3B 5DKMA 1YLCA 1HJPA 1P3CA 4UE7H 1Q39A 2A5YB 1ZHPA 5KEDA 2CUZA 3U1IB 3GYMA 4VGCC 1O2QA 2M2AA 1DS2E 5C0TA 1EOLA 7GCHG 3GDUA 3UREA 1BVSA 3H7TA 1AB9C 2STAE 2ZCKP 3STIA 1GDQA 2ZWLH 1C1WH 2OPFA 1PFXC 1OYQA 2JY7A 3GY5A 1FY1A 3DFJA 5ITRA 2VF7A 3MK6A 2D7GA 3J7AS 1OKXA 2KAIA 2ZPQA 1GBLA 2Z9LA 5C1BA 2XWAA 5FL7D 1SGYE 3AAVA 5DP3A 1BDAA 1O2PA 5T6FA 1D6RA 4ABIA 1MKXH 3T6PA 1NRRH 1IQEA 3P17H 1GHWH 1GCDA 3DA9B 2BDGA 4M7GA 3UB0A 1BRBE 1OWKA 1CUKA 4DUYM 2Z6BD 5EQRA 3RC6A 1HNZM 1RFNA 4VGCB 1C5ZB 1DFPA 3MHVC 1F5KU 4BAKB 2ZHQH 1EP5A 2JH6D 1OP2A 2FOAA 1IQFA 3RMMH 1LQEA 2ZG0H 4NIYA 4YTAA 4LF4M 2QXHA 2THFB 3S9AA 1AB9B 2HGTH 3SYLA 4B75A 1DXPA 3D8LA 3BTDE 5FSWA 1SQAA 1ESTA 5DP6A 3FD9A 2ZNKH 3MU8A 1AIPC 1AVGH 2W6ID 2W3KA 1GPZA 3T1YM 3I04M 4I7YH 3T15A 3SUDA 3HJ8A 3M7QA 2H6MA 4F1IA 3S9CA 6ESTA 3P70B 3RXFA 2SNWA 1GHVH 3QTVH 4ZHLU 1FIZA 1ZR0A 3D62A 5A0CA 3TPZA 4JI3M 3V0XA 5TCCA 1X37A 3V12A 1JR3D 1L1GA 3ATLA 2C9OA 1L2EA 1BA8B 1BTWA 4D81A 1NRQH 4Q7XA 1G59A 1Z8GA 3FO8D 2VIQA 2M5ZA 1MBQA 3GY4A 2R4JA 3PV4A 1DSUA 1YF4A 3N7EA 4NZQA 3EGKH 1W0YH 2Y0QA 2CF9H 4Y7BA 2CMYA 2FX6A 4P00A 1OSSA 1WBGB 4KP0A 1IN7A 3SJKA 5EOKA 3T38A 4JI5M 2JKHA 3A7TA 3M7UA 3B9FH 3GP1A 5HIZA 3TJOA 1BTYA 2K47A 2BLOA 4CHAC 3NRLA 2MR9A 3LGTA 1NHWC 3QO6A 1I94M 1M9UA 2W6JD 3KYFA 1SXJC 2OBOA 1IBLM 3HJSA 3U6SA 1QAMA 1J09A 1GI9B 1S85A 3S9BA 3ZVEA 1JRSA 1W3CA 3SAVA 3P8FA 1HV7A 1O0DH 5T6GA 3TK6A 2BM2A 4U32A 4QHTA 3A8BA 2XLJA 1HLTH 1EJMA 3DT0H 1C1UH 2B5TB 2ASUB 2QIQA 3A46A 1EFRD 3T25A 1GHZA 1TGTA 4CHAB 3C9PA 4GC9A 8KME2 1TDHA 1CHOF 1B0FA 2SGPE 4GHTA 4KLNA 2DE8A 3KNXA 1C1NA 2CGAA 1RTFB 1SXJB 3TGJE 3SAUA 2K0BX 4YOJA 3A88A 1ZAEA 1AUAA 2CE7A 3FUUA 3VFDA 2XEPA 4YLUA 3LH3A 1XUFA 4W5WA 2ESTE 5SGAE 2W7SA 2ZP0H 4RSPA 2QCUA 2RFKC 3RXUA 1ZOMA 2BY5X 3UQOA 3H4MA 1QL8A 2VIIA 2XOKD 1H9IE 1MABB 1JWTA 3MH4A 1QB9A 3QGJA 4UONA 5GJ4B 3FYCA 2BDHA 1O3IA 3LQQA 4RNAA 4R7GA 1GLNA 2HPQH 4P02A 2KRUA 1O2UA 1NRSH 4FD2A 1IXRC 3ZYDA 1H9HE 1UTQA 2VIVA 2ZPRA 4GLYA 2UU9M 3KOXE 1F5RA 1GVKB 3M5MA 1P3QQ 1SLVB 2BQWB 4JZ1A 2DWZB 5F8XA 3U5ZB 4DV6M 1CBWC 4IJFA 4XK8F 2AIQA 4ISIH 1C5LH 2HRVA 2OC0A 1EX3A 3SHGB 4LF5M 4F49A 4WJG2 3FUTA 2FESH 2DI0A 1IQPA 4OU7A 1WU1A 3SFZA 5IT9S 1G41A 2FP7B 2PUXB 3FN8A 3SV6A 1NV9A 1XWIA 1PPEE 3I01M 2VB0A 2XCNA 3KQEA 3NBXX 3GPUA 2QXIA 3RXPA 2PP6A 4U01A 3TGIE 1ANCA 2FOBA 1EPTC 1ORFA 5IDKA 1CGJE 3SW2B 3ATKA 1GMDG 4LJAA 3SHFA 1CBWB 3L28A 2SGFE 3F6UH 2KXEA 3KL6A 3LT3A 2C93B 1WQVH 1AE5A 4A1TA 4IGDA 2J34A 2BLVA 3SYJA 4IN2A 1IQJA 1T4VH 1GL6A 5EP2A 1TBQH 3DUXH 4X1NU 2FOIC 2ZFPH 3RXGA 1IHTH 3BN9A 1K28D 4IC6A 1GWAA 1FPHH 1GL1A 2CHAC 4BLCA 4REZA 1BBRK 1NM6A 2Z3EA 3U28C 1L2BA 4K1SA 3PO1C 1EPTB 3PWCA 5CE1A 1Z5CA 1E37B 1TPAE 1UCYH 2IPQX 1IXSA 1QL7A 2Z9IA 4JI0M 1V2JT 1T8LA 1VCQA 1L4DA 3RXDA 1QFKH 2C99A 2QXGA 4X2XA 2QSFX 1UK4A 2ULLA 2I6SA 1L1JA 2FYQA 1TQ7B 1CA0C 2PR3A 5GIBA 2HALA 3LPRA 1Z59A 3U6OA 1AKSA 1KXEA 1UK2A 2BY9X 1OFHA 3TE6A 3VXEH 3GICB 1BIOA 3GLFE 2CHAB 1NESE 5C20A 2BLQA 2DAMA 1TQ0B 1VITG 3SV2H 3PO1B 2DUCA 4UEHH 2A4GA 2ZBKB 2ZDAH 3M3VA 4X6NA 3WHLA 1QJ1B 4NIVA 3HHYA 1QBVH 4ZHAA 4B71A 3GLHB 3LW5F 1CA0B 1FN8A 2IPHA 1PJTA 1QRWA 1CE5A 1HNEE 2EI7A 2JDID 3PVSA 1P10A 4B6FA 5DN6D 4FXGH 3JR5A 1VKYA 4NL4H 3E0PB 4UFEH 2VGCC 2BD4A 1L1NA 1GI2A 1MAXA 2BQ6B 3VKGA 2VIPA 5CHAC 1VJ9U 1KLTA 1C5PA 5IWAM 3HK6B 1V2KT 4WH6A 1XXHE 2Y6TA 1YUBA 2LNHC 1K1JA 1NBME 4KO8A 3ZYEA 1E9RA 1THSH 2OOAA 2DZOB 1PGYA 3H09A 4Y8ZA 2OCVB 1MJGM 4J2YB 5EXTA 1AIXH 1BB0B 1TMBH 1NJFA 3ILKA 2F5QA 1MX0A 2F5PA 1QHRB 2WHXA 4MNVA 3GS9A 1SL3A 1Y5UT 4DOQA 4DT4A 3I51A 1KXDA 3U1JB 4DR3M 2VGCB 1Z71A 2ANKH 1PJQA 3T62A 5CHAB 1SBWA 4ZMAH 2WSSD 5B6LA 1FAXA 1JMOH 2YNBA 1Y59T 2ALVA 2PKSC 2ODPA 4XGIA 3B8JA 5IYTA 1G3EA 1H9LB 1GO5A 2CJIA 1J15A 2WUCA 3S69A 2O01F 1AMHA 3BV9B 1HYLA 2ZC9H 4JI2M 4NA8A 1N33M 1C9TA 1EE8A 2OINA 1ZHRA 2BJWA 2H1UA 1HPGA 2ALPA 3L2AA 4B73A 1P11E 1KDQA 1GJSA 2XZFA 3GLIB 1P04A 1OKSA 1C4V2 1YLNA 2PKSB 2VBCA 1E9SA 1VG5A 2FH0A 3V76A 1RXPA 3AL0C 1QANA 2SGDE 3QYEA 1PM5A 3VDPA 4WXIA 1A5GH 4JCNA 2XXLA 4Z6AH 3E6PH 1C1VH 1G36A 3FTCA 2OP9A 5GWZA 4IIWA 2BD8A 5E0GA 5L2ZH 4ESTE 4NGAH 4ABGA 1CSOE 2SGEE 4D8NA 3HGPA 4HG6A 2FLRH 1GHBF 1MAYA 3TITA 1ZJDA 3A83A 4O97A 1K2I1 4IBIA 4LJ7A 4Q7JA 3LCVB 1GBBA 1WDIA 4MPWA 3E91A 1GVNA 4IW4E 4TY6A 5C94A 1GBJA 2WPLS 1E94E 1GJCB 1ARCA 1K21H 2ZFQH 3H5CB 4GKKM 5GCHF 1OWJA 4OS7A 2ZQ1A 3UWJH 1G32B 4SGBE 1FY4A 1D0LA 2D1JA 1T43A 4XBBA 3K2UA 1T31A 4DV5M 4JYUH 4MTBA 5ITYA 4CRCA 1HJAC 2NQ8C 4MM3B 1ACBE 1TB6H 4DW2U 3P95A 4ZXYH 1TH3A 2KAIB 3F1SB 1D6WA 1HRTH 1NROH 1ZSJA 1GVLA 1RIWC 5EXXA 1G37A 4G4QA 3VXFH 3W0LB 3THGA 2GCHG 4OS5A 5DP9A 1SGPE 2XYAA 5AFYH 4A92A 1GBFA 1H8DH 3T28A 1NPMA 2D7HA 2Y5HA 1SXJE 4A6LA 1FY8E 3SATA 1ELDE 2G55A 1IQHA 2UWLA 3W67A 1TAWA 1OTRA 1TX6A 3EQ0H 4NSVA 3FRIA 3J2PB 2Z9GA 3MU0A 4K8YA 1W10U 4X6MA 5AFZH 1HJAB 1SLXB 2HNTC 4FUBA 3SNDA 2Y0TA 4I8OA 1P2OA 1BTUA 1RIWB 5DSFA 4MPUA 1V3XA 1YBWA
chains in the Genus database with same CATH topology
3SV9A 3AFHA 4A1VA 3FUXA 3TWMA 1IXSB 4LF6M 2QPAA 1CU1A 3TWKA 1DGHB 3M7GA 4B7FA 3GQ4A 2KCPA 1DXWA 4LJ8A 4QNRA 2FFJA 2QV1A 1PJIA 3OAAD 4OVZA 4X64M 4I32A 3U6EA 3KSJA 2GGVB 3R9XB 1HNXM 1KMHB 4HLQA 2LELA 1L8QA 2CHGA 1Z5AA 4FETA 4Q63A 3ZH9B 5EQTA 5C17A 3ZIAD 2E5LM 2IJD1 1NJGA 3KP1E 2J7OA 3L27A 1IN4A 3AOGA 1Q3BA 5A2QS 1IM2A 1H8ED 5F3WA 3KSXA 3U6PA 5EQSA 2CFOA 5EXSA 3N7DA 1J5EM 5FTJA 5FPYA 4MB7A 5JI2E 1R2YA 3O8RA 4LY6A 5FTKA 3TQSA 3GQ5A 3JR4A 1HNWM 3EIEA 1IBKM 3GQ3A 4GHAA 2OC1A 3O8CA 2C96A 4M9ZA 4LZZA 3C58A 2FE8A 2HHHM 2H1RA 3RFWA 4AZFA 4DR6M 2YNMD 5KPTA 4Z1MD 4DV4M 2V1CA 4DUZM 4B3SM 2ZAOA 4I81A 2CK3D 1GL7A 4NWKA 3NRLA 2XSZA 3PFIA 3QAUA 4A3VB 3AOEC 2AHME 3O8DA 5GPIB 4ZCNA 2F5SA 3KVWA 2Y21A 4LFCM 3WW7A 1QZMA 3UJNA 4QOSA 2UUAM 2KM0A 3J7BA 2V1UA 5FLXS 1J7KA 4RI0A 4MH0E 1IBMM 4DV1M 1L2CA 5CHBA 4IBGA 1Z6TA 4MGHA 3UK6A 1DO2A 2QBYA 3OFND 2L6OA 1K82A 3PXGA 2L09A 2K1QA 1QAOA 1YE9A 2F5NA 3P8OA 3OYPA 4NXNM 3UMMA 3HHWA 3GLFB 1Z5BA 2XF3A 2YR0A 3FKEA 4WH8A 3U5ZA 2V6ZM 3DFZA 3JAMS 4LFBM 1DY8A 4JI6M 1FX0B 3U61B 2QE7D 3F2FA 3QWLA 4X65M 3KFUG 4QNMA 4DR7M 3HHZA 3KDSE 4JXJA 4L78A 2ZAMA 4PCZA 4IBBA 3SC3A 3DSPA 1S6LA 5ESBA 3AV0A 2C98A 4LCBA 5EP3A 5F53A 2L7IA 3OTPA 5ITTA 3SUEA 5IK2D 2I7PA 4NRWA 4LF8M 2AHMA 1XMOM 4LRTA 5FTNA 1FJGM 3FTDA 4WF8A 1Q39A 2A5YB 2DZNB 2L7HA 3M0EA 4M9XA 2CUZA 3KS8A 3LOXA 3U1IB 4FWHA 3LKWA 3IG5A 4FCTA 2M2AA 4NWLA 5C0TA 4DV0M 4XD7D 4TUWA 3LONA 5DSFA 3VKHA 3WWBA 1HT2E 5E26A 3GLGA 2IJOB 3SMPA 2OPFA 4JV5M 3VDUA 5ITRA 3MK6A 3J7AS 2D7GA 1IY2A 4G4OA 5C1BA 1NY5A 4LF7M 2FOMB 5FL7D 1QVRA 2A4QA 1KSFX 3MJ5A 4LJ9A 4JN6A 5BPVA 5ETXA 3VLFB 2CV0A 4DV7M 1HQCA 3KN2A 3PNYA 3UB0A 3HGIA 4DUYM 1NSFA 5EQRA 3RC6A 1HNZM 2W82A 2QF4A 1JXPA 4R3DA 3MHVC 2Z7JA 3RGSA 4DR2M 4L16A 2BNKA 3KXEC 1N32M 3L6PA 5FPTA 3SV7A 4LF4M 2OC8A 4HL4A 4DR4M 5T1VA 3SYLA 4GH9A 4B75A 1DXPA 3E90B 3D8LA 4AQYM 3A42A 3SAWA 3OE7D 4EIWA 5FSWA 1G4AE 1L2DA 4TT3D 2YOLA 3FD9A 1NHGC 2C9CA 1IN8A 2W6ID 4WURA 2OK5A 4B7HA 4XBOA 3T1YM 3VG8A 3W1EA 3KOZE 3GRYA 3T15A 3SUDA 3HJ8A 2YMSD 3FYDA 4JI7M 4ASUD 5HKKD 1SKYE 2LXEA 5FTLA 2Z4RA 3VK7A 3DA1A 1G8PA 3E9SA 4FVMA 2UXCM 1G3IA 1H6UA 3GLHA 5DYIA 5KO3A 2OC7A 3TPZA 5C18A 5JI3E 1L1TA 4M9SA 3F3BA 4JI3M 3M6AA 1X37A 4KTCA 1JR3D 2R46A 3HKPA 2C9OA 4NRVA 3SMSA 4D81A 2P5TA 3PNVA 1G59A 2JA2A 5EP4A 3FO8D 2M5ZA 2DWMA 2R4JA 1N36M 3N7EA 4PDIA 2EA0A 2K0QA 4R8TB 1R7RA 2KRKA 2KR7A 3M5LA 2Y0QA 1KFVA 4FWGA 1IN7A 3IG8A 4CGYB 4DV3M 4L4UA 3T38A 4JI5M 3GP1A 2K47A 4I5SA 3OTOM 4MGYE 1TDZA 1NHWC 1DO0A 1I94M 3Q8XA 5IREB 3E4RA 4GIPA 2UUBM 2W6JD 1SXJC 5ITQA 1IBLM 2OBOA 3HJSA 3U6SA 1QAMA 1J09A 3KOYE 1BMFD 5ITXE 3GO8A 1W3CA 2Q2EB 3SAVA 4IBCA 4NSRA 2CV2A 2A4RA 3RC5A 3SU4A 3DSOA 3SV8A 4QHTA 4TYDA 2XLJA 1N75A 2HLDD 3LVVA 4M0DA 2HCBA 2KFWA 4MGZE 1R6BX 2HKJA 1KYIA 4B3MM 4YY3M 3GRVA 3A46A 4LJ6A 4L8RC 1EFRD 1RTLA 2XFTA 3SU0A 2JJ1D 4YHHM 3SZEA 4GC9A 1E1QD 3AJIB 1TDHA 1L1ZA 4KLNA 3KNXA 2DVWB 1SXJD 5C0UA 1SXJB 1XC8A 1MU5A 2JJ2D 3PRBA 4YXWD 2KZUA 2FM2A 3F0PA 4NXMM 3SAUA 2O8MA 3GLFA 2JIZD 4B7GA 1ZAEA 2R18A 3SU1A 3N99A 2CE7A 3TWLA 3FUUA 4AKGA 3VFDA 3GLIA 2XEPA 4NOOB 2RGOA 1PJJA 1DY9A 2LH0A 4W5WA 4PD2A 2DXIA 3AK5A 4G6ZA 2F5OA 3CF2A 2QCUA 5EP1A 2G5GX 3FUVA 3BOSA 2CHVA 1E79D 3H4MA 4M9FA 2VIIA 5ITXA 2XOKD 1MABB 2KEBA 3OEHD 5IZ7D 8CATA 4A1XA 1WXRA 3K92A 4RF0A 3GPXA 3SUGA 1XMQM 5GJ4B 3FYCA 2RGHA 4AW4A 5KPRA 2QBYB 3LQQA 4RNAA 1S3SA 1GLNA 2XGNA 4R7GA 4BB9A 1E32A 2KRUA 4QHSA 4FD2A 1IXRC 1XHBA 1XXHA 1T3TA 4KHPM 1COWD 2D7EA 5DYGA 2UU9M 3KOXE 3M5MA 3VK8A 4FCWA 1NBMD 2DWZB 4FW9A 2EO2A 2K8IA 3U5ZB 4DV6M 4IJFA 3F2HA 3HU1A 2OC0A 3SHGB 1D2NA 4AG5A 4LF5M 2V7QD 3FUTA 1VDDA 1IQPA 4OU7A 3M5NA 2F4VM 1BT7A 3SFZA 2KA6B 3A45A 1N77A 5IT9S 1G41A 3K8ZA 2FP7B 3FN8A 3D8BA 5H37D 4QOZC 1XWIA 3SV6A 2DWNA 2XCNA 3GPUA 4U01A 3RC4A 5IDKA 1FNNA 2ZANA 4AKHA 3U6LA 4ZPXA 4JMYA 3U6QA 4LJAA 4OW0A 3U6MA 3SHFA 4B3TM 2RKOA 5EJCA 4II7A 3L28A 4B3RM 2XNDD 2J5UA 2KXEA 3LMMA 3NWLA 1RGQA 4LGMA 3KP0E 3FKSD 3P8NA 4A1TA 3U60B 1ZQ9A 3SYJA 3GRRA 1GL6A 5EP2A 1NNUC 3W0FA 4BBAA 1NNJA 2FOIC 2F9VA 1TH2A 2WZQA 1I4WA 3UGJA 1R2ZA 4X62M 3GLGB 5LMNM 2XFSA 4REZA 4IBDA 4KODA 4BLCA 5KPZA 4OM9A 1L2BA 5FPSA 1Z5CA 3M5OA 4IBEA 4AI6A 3FUWA 4JI0M 1DGHA 1QAQA 3J27B 1W5SA 2C99A 4LRSA 1N78A 2F4LA 1JR3A 4K8BA 3UZUA 3K1JA 4G4RA 2ERCA 3K2LA 1NVMA 3I4VA 3OEED 1W0KD 3ZC7B 3SU5A 1Z59A 3U6OA 4JI4M 2P59A 2KZ4A 1OFHA 1W5TA 3TE6A 2XCFA 1HT1E 2C5RA 3EIHA 3GPPA 5KQDA 4I33A 1IN6A 2EUCA 4PT5A 4I31A 2A4GA 1OFIA 4S12A 2ZBKB 4P16A 1DGBA 3WHLA 3HHYA 3SU3A 5KQ8A 3GRUA 4IBKA 1W0JD 4B71A 3GLHB 2UXBM 2WPDD 2FNAA 2BJVA 4Z6YA 5ITUA 2JDID 4B6FA 3PVSA 3FTEA 2KCYA 5DN6D 3KF2A 3JR5A 3KS4A 4B6EA 2KW0A 1Q3CA 2X4AA 4NL4H 4OVZB 1YSYA 4LJ4A 2CV1A 4B76A 4FCVA 3VKGA 3KW6A 3SYKA 4IBJA 5IWAM 4WH6A 5BR8M 3AKZA 4FWDA 1YUBA 2LNHC 1NBME 4KO8A 1XNRM 1E9RA 3T1HM 1HQYE 3B9PA 2DZOB 7CATA 1SXJA 3H09A 5EPYA 5FTMA 3R8FA 5EXTA 4F55A 1C1KA 3TL4X 1WXQA 1IY1A 1NS3A 4DV2M 2R62A 1NJFA 2LWXA 3GPYA 3ILKA 2F5QA 1MX0A 2F5PA 2WHXA 3SUFA 4DT4A 4LFAM 3GS9A 2YQZA 1HR0M 3I51A 2XZUA 1IXZA 3CTWB 3U1JB 4X66M 2VQFM 4DR3M 3CF0A 4LG2A 4GMQA 3AOEA 2G8LA 2VQEM 3U61A 4I4LA 3HU2A 5E6JA 3SBJA 2WSSD 5H4IB 5B6LA 4L15A 1LV7A 1OJLA 2XSZD 3DZDA 3I4YA 4XGIA 3ZCBB 3SU2A 4CISA 4JYAM 2OBQA 1IN5A 5GNDA 2OQ4A 4GITA 3WWFA 4JI2M 4LJ5A 2O5RA 4GKJM 1N33M 3FOAA 2R45A 1EE8A 4MGKE 2OINA 4JI1M 3O8BA 2ZM6M 5LMUM 2XH9A 4B74A 4TSFD 2Z4SA 2M60A 3LVWA 2BJWA 2HL7A 3HHXA 2CHQA 3J80S 2DHRA 1QQWA 2QZ4A 1TGUA 3L2AA 3FTFA 2KCOA 3PV2A 4B73A 1N34M 4G4NA 2XZFA 3DOAA 3HWSA 3GLIB 2VBCA 4GRIA 1E9SA 4D80A 3AL0C 1QANA 3SU6A 2GVFA 3HJQA 3VDPA 1IY0A 1PM5A 4B08A 4AKIA 3L29A 3FTCA 2X8AA 4IIWA 4JI8M 2XNIA 4DR5M 4LF9M 2YFQA 3KEEA 3PRDA 4GC5A 4DR1M 3F0OA 1DGFA 3DCLA 3U6DA 4OX9M 3L26A 5EXPA 4IBFA 4LGYA 3RE8A 3NBIA 4IBIA 4LJ7A 3SARA 2CEAA 1XXHB 1GVNA 4AG6A 4D82A 1N1LA 1K3WA 2F43B 1GKIA 2Y20A 1E94E 5GKNA 3U60A 2R65A 4CHTB 4Q4LA 1NY6A 4RF1A 2UXDM 4GKKM 4LZJA 3CF6E 2J7NA 2R4EA 4K0KM 4M0WA 5EPNA 1TH4A 5EQQA 3RGPA 2I7NA 4DV5M 5ITYA 2NQ8C 4MM3B 4Z8XA 2KCAA 3PV5A 1TH3A 2YMSC 5EXXA 4G4QA 3W0LB 3THGA 1K3XA 3F2GA 4NSOB 4ITQA 3KOWE 2QENA 1A1RA 4A92A 1E1RD 1DGGA 2F9UA 3L25A 2D7HA 1SXJE 2Z3XA 3U6CA 5DNYA 3SATA 1JQJC 2QF5A 3A98B 3EYDA 3J81S 5CDFE 2KZSA 2X49A 3J2PB 3WHKA 1H8HD 3HU3A 1ORYB 2QP9X 4PDGA 2WV9A 2Y0TA 4MGIE 4I8OA 1XNQM 3SASA 1OHHD 4IJEA 4GHLA 1UM8A 1QYRA 2DWLA 3LQRA 2YMSB 4WW0A 2UUCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6O A; 
#chains in the Genus database with same CATH topology
 1A61 H;  3FUX A;  2ANY A;  4NIX A;  3QTO H;  1P02 A;  4GCH G;  1UO6 A;  2PLX A;  1PJI A;  1FZZ A;  4OVZ A;  5DP5 A;  2EKF A;  2ILN A;  3KSJ A;  3R9X B;  1KMH B;  1ZRK A;  1SSX A;  1L8Q A;  1EOJ A;  4PRO A;  2PFE A;  2FOE A;  2BVS H;  1XB2 B;  1LPK B;  2P3U B;  3KP1 E;  1UK3 A;  2VH6 A;  4FUH A;  1YC0 A;  1Q3B A;  1H8E D;  1B5G H;  1T8M A;  3BG4 C;  4DUR A;  4O3U A;  2WSF F;  3U6P A;  1GI3 A;  1IOE A;  4NSY A;  2QC2 A;  1TNH A;  1R2Y A;  1SQR A;  1GI8 B;  2XWB I;  2WIN I;  2ZDL A;  1ELG A;  1EQ9 A;  3LIW A;  1XVM A;  3TQS A;  3GQ5 A;  3JR4 A;  3PMH B;  2OC1 A;  2Y7X A;  1ANB A;  1G3B A;  1QR3 E;  2UUJ B;  3O8C A;  4LZZ A;  3C58 A;  2HHH M;  2H1R A;  3RFW A;  4AZF A;  2NU1 E;  1LKA A;  4FUC A;  1HJ8 A;  2FI4 E;  4TY7 A;  2G4U A;  4I81 A;  2QF3 A;  2XSZ A;  3PFI A;  1OAI A;  3QAU A;  1JOU B;  3AOE C;  1Z8J B;  2AHM E;  2XTT B;  2Y5F A;  5GPI B;  1GI7 B;  5JB9 S;  2Y21 A;  1S5S A;  3WW7 A;  1OAO C;  3UJN A;  3BG4 B;  1DWB H;  4ACA A;  4DBG B;  4CBN A;  2WPM S;  2ZHW H;  4IBG A;  1Z6T A;  3OFN D;  1K82 A;  5FXL A;  3PXG A;  1YLA A;  1NO9 H;  4DG4 A;  2YNA A;  2F5N A;  2STB E;  1GJ7 B;  1YCP M;  1GMH F;  3MH6 A;  1D3Q B;  2NU3 E;  1C2G A;  3C27 B;  3U5Z A;  2V6Z M;  1C2H A;  2WPI S;  3MH7 A;  1ESA A;  4INH A;  1RTK A;  2ODY B;  2QE7 D;  2K6B A;  3KFU G;  4WWY A;  4MVN A;  2R2M B;  1QGF A;  1HAY B;  2EC9 H;  1FUJ A;  4BNR A;  5EW1 H;  3MQK C;  5HYO A;  5DP4 A;  2D8W A;  1TRY A;  4DY7 B;  2C98 A;  1SOZ A;  3RU4 T;  3STJ A;  1DIC A;  3BTH E;  1F0U A;  5F53 A;  4INL A;  5ITT A;  4NIW A;  3SUE A;  1MQ6 A;  2SGA A;  2DHY A;  4MPX A;  2AHM A;  1Z6J H;  5FTN A;  1K9O E;  2J95 A;  4BAO B;  3RU4 E;  2R0I A;  5AHG H;  2L2D A;  5HKK D;  2DZN B;  5LPE A;  3LOX A;  3ZZA A;  1YPK H;  4FUJ A;  1TF0 B;  4FCT A;  3LKW A;  1UTP A;  4GHQ A;  4X2Y A;  3SO3 A;  3GLH E;  2ZF0 H;  4TUW A;  4K60 A;  1ZML A;  3TJU A;  1VR1 H;  1BTH H;  4LXB H;  5E26 A;  1FMG A;  2HNT F;  2IJO B;  1O2L A;  2LPR A;  5BRR E;  1GJD B;  3VDU A;  1O2Y A;  1ZTK A;  1EPT A;  2A7J A;  2H5C A;  4LF7 M;  1QVR A;  3MJ5 A;  1HCG A;  4TWY A;  4DV7 M;  1GJB B;  1SQT A;  3PNY A;  2GT7 A;  1YPH C;  4ZXX H;  2O8W A;  3LJJ A;  1NSF A;  3VB5 A;  1IQL A;  1JXP A;  1QRX A;  4R3D A;  1O2M A;  1FY5 A;  1X7A C;  3Q3Y A;  5HIY A;  2Z7J A;  3RGS A;  4DR2 M;  4K1E A;  4CH8 B;  2BNK A;  2VDB B;  3L6P A;  1SC8 U;  2AMQ A;  3A89 A;  3NXP A;  3ZVA A;  4MNW A;  1ZV1 A;  4HL4 A;  5T1V A;  4GH9 A;  3EDX B;  2RDL A;  3E90 B;  4WMD A;  2G52 A;  3TLO A;  3BEF B;  1LQD B;  1R5L A;  4EIW A;  1MTW A;  3H4J A;  1L2D A;  2BOK A;  2NWN A;  1IN8 A;  1C5R A;  1K22 H;  4B7H A;  1SFQ B;  3VG8 A;  3KOZ E;  1ZMJ A;  2C8W B;  1TNL A;  1TMT H;  3FYD A;  3IEC A;  1SKY E;  2BD2 A;  5FTL A;  3DA1 A;  4RKU F;  2UXC M;  1FON A;  1P01 A;  1H6U A;  5KO3 A;  3GLH A;  1Y3Y A;  2OC7 A;  4AG2 A;  5A2M H;  4BTU B;  4O9V A;  2L4E A;  3A7Z A;  4KTC A;  1QIX B;  2P5T A;  1BJU A;  3Q77 A;  5EP4 A;  2DWM A;  1N36 M;  8LPR A;  2ZEC A;  5JBB S;  3MNC A;  3U98 H;  3GCT G;  3KID U;  3PLK A;  2VIO A;  1KFV A;  4FWG A;  1EJA A;  2OXS A;  3RXT A;  3HK3 B;  3GLI E;  2WPJ S;  3SNC A;  4I5S A;  3P6Z B;  1TDZ A;  5IRE B;  2UUB M;  3PYH A;  2AEI H;  3SZN A;  1QA7 A;  4WVP E;  1BMF D;  2AYW A;  4I8K A;  5ITX E;  3GO8 A;  2FYR A;  1G3C A;  1S6F A;  4IBC A;  3BTQ E;  1V34 A;  2A4R A;  1TPO A;  4OS2 A;  3RC5 A;  3SU4 A;  1Y3U A;  3LCU A;  1ZMN A;  1Q31 A;  1OPH B;  3SHA H;  2ZA5 A;  1N75 A;  2HLD D;  3LVV A;  4M0D A;  2HCB A;  3E3T A;  4L8R C;  1OYT H;  3UTU H;  2C8Y B;  2V3O H;  1GBH A;  2XFT A;  2JJ1 D;  2B8O H;  4LK4 A;  1TWX B;  1E1Q D;  3AJI B;  1AZ8 A;  1O5G H;  3C1K A;  3NCL A;  2DVW B;  1VEK A;  3SGB E;  1D3T B;  3OY5 U;  1XC8 A;  2G4T A;  3GDS A;  1EB1 H;  1WYK A;  3ATI A;  5KEC A;  4FUI A;  4AX9 H;  2JIZ D;  4D9R A;  2QN5 T;  1ELB A;  1MTV A;  1HJ9 A;  1NZQ H;  1DX5 M;  4FUF A;  2EA3 A;  1DV0 A;  3GLI A;  4NOO B;  2RGO A;  1DY9 A;  1TFX A;  1ZZZ A;  2TRM A;  2AER H;  3RLY H;  3U8R H;  1C1S A;  1UVP A;  4PD2 A;  5T6D A;  2DXI A;  3AK5 A;  1O3E A;  2ZHE H;  3AW1 A;  1CT2 E;  3ELA H;  1SGR E;  3NK8 A;  2QHO B;  3OU0 A;  4BTT B;  1XKB C;  2J94 A;  5ITX A;  1OWH A;  4DGJ A;  1WXR A;  5IZ7 D;  2UUF B;  3K92 A;  2C4F H;  1GI1 A;  2P3F H;  2RGH A;  4AW4 A;  1S3S A;  2XGN A;  4GEW A;  1TNG A;  4QHS A;  3SQH E;  2J5Y A;  4KHP M;  2D7E A;  5DYG A;  1HAG E;  4ZAE A;  4WY3 A;  3TJN A;  2LVO C;  4FW9 A;  2K8I A;  2VIW A;  3ZVF A;  1EAW A;  3F2H A;  1KDQ B;  1TRN A;  3BG8 A;  3SGQ E;  1Y3V A;  2V7Q D;  3A8D A;  3W94 A;  4FUD A;  1FQ3 A;  4H4F A;  1JR3 E;  1QBN A;  1HXF H;  4TWW A;  4UFF H;  2FPZ A;  2R3Y A;  4UFG H;  1BT7 A;  1MUE B;  3GCH C;  3KQB A;  3A45 A;  1N77 A;  5H37 D;  3BIV H;  2PUQ H;  2DWN A;  2ZQ2 A;  2Z8Y M;  2HNT E;  3RC4 A;  1O39 A;  1AO5 A;  2ZFF H;  4MDS A;  3S0N A;  2V6N A;  1FNN A;  2ZAN A;  4AKH A;  5FX5 A;  3VB4 A;  3U6Q A;  4ACB A;  5LPF A;  2XND D;  4B3T M;  4II7 A;  1FJS A;  2R2W U;  3CP7 A;  3QX5 H;  1MKW H;  3LMM A;  1S82 A;  2FS9 A;  1ZPC A;  3P8N A;  4X1S U;  1G30 B;  4X6P A;  2W5E A;  3CGW A;  4BBA A;  3W0F A;  6CHA C;  1P2I A;  2BDC A;  3VB3 A;  3GCH B;  2FI3 E;  3ZVG A;  3UGJ A;  1R2Z A;  1QJ7 B;  3SJ8 A;  3SJO A;  1HIA B;  3A7W A;  4WMF A;  1CA8 B;  5KPZ A;  4MLF B;  4A7I B;  4AG1 A;  1ANE A;  1C2D A;  2A5K A;  3QLP H;  1XUJ A;  2GNO A;  1PYT D;  3A7X A;  3URD A;  2LTU A;  4A5T S;  1YM0 A;  1W5S A;  1A0L A;  2EY4 C;  4LRS A;  1AND A;  1JR3 A;  1MU6 B;  2FOF A;  3IHP A;  1KTT B;  2GTB A;  4NZL A;  2ZTD A;  1NVM A;  2P3T B;  2QGR A;  4X1R U;  1WHC A;  4ASH A;  1W0K D;  4CRF A;  6CHA B;  2P59 A;  3HZJ A;  4NC6 A;  1HGT H;  1A46 H;  1EKB B;  1C1R A;  3GPP A;  1K1I A;  3A85 A;  4I33 A;  1GMD F;  2EUC A;  1NFW A;  3K65 B;  4PT5 A;  1AU8 A;  3MMP A;  3SJ9 A;  1Y5A T;  1WGN A;  4S12 A;  1O5D H;  3BTW E;  2LHG A;  2BWE A;  5A0A E;  1SGF G;  2QNJ A;  1SGE E;  4KTS A;  3SU3 A;  1C2E A;  1TA6 A;  1A5T A;  3GRU A;  1HAZ B;  1O2T A;  1DIT H;  1SB1 H;  1SG8 B;  1SG9 A;  2I6Q A;  1Z6E A;  2BJV A;  2MH8 A;  4Z6Y A;  5ITU A;  4HFP B;  2Q6G A;  3HKJ B;  3MNS A;  3UOU A;  1UTM A;  6LPR A;  1ZSL A;  3KS4 A;  1DAN H;  3HX3 A;  2G5N A;  3TK5 A;  4OVZ B;  3U69 H;  1WJ7 A;  4B6E A;  2KNV A;  4LJ4 A;  4B76 A;  2BD7 A;  4RN6 A;  3KW6 A;  3ZV9 A;  2BTC E;  4IBJ A;  4ZKS U;  4ABD A;  3M7T A;  5BR8 M;  3AKZ A;  2AH4 X;  1WTH D;  4FWD A;  3RXJ A;  3AAU A;  3W95 A;  4AYV B;  1K1M A;  2OLG A;  4OGX A;  1HQY E;  3B9P A;  7CAT A;  5FTM A;  2OQ5 A;  3K6Y A;  1AVX A;  2CN0 H;  3CS0 A;  4D76 A;  4Y79 A;  1UTJ A;  3SUF A;  1V2P T;  3PB1 E;  1ZMU A;  5EJZ A;  2MGW A;  4X8S H;  1VIT F;  3D23 A;  1NU9 A;  1G71 A;  4I8J A;  2GKV E;  4GMQ A;  3AOE A;  1UVS H;  2G8L A;  2Z7F E;  3SBJ A;  5H4I B;  3SBK A;  1O2G H;  3RXL A;  2ZGB H;  3I4Y A;  1C4Y 2;  4JZD H;  2EKK A;  5L30 H;  1W12 U;  4CIS A;  1GHX H;  2OO9 A;  2OBQ A;  4KTU A;  4CH2 B;  2KNZ A;  3ZZ9 A;  2F91 A;  4GIT A;  1AE8 H;  1RU3 A;  1GHY H;  1LKB A;  1NRP H;  4IMQ A;  2GZ9 A;  2GJG A;  2O5R A;  4GKJ M;  1P2K A;  2R45 A;  2XH9 A;  1BMN H;  2F3C E;  4UDW H;  4TSF D;  3SGA E;  1V2Q T;  2A32 A;  2R0K A;  3ZVD A;  3HHX A;  2M5T A;  5DJ7 A;  2UUK B;  1TGC A;  2DHR A;  1TGU A;  2XBW A;  3FTF A;  2KCO A;  4O3T A;  4AB9 A;  1OIP A;  1OWE A;  2ZGJ A;  1YPH E;  2VH0 A;  2B3T A;  2EQN A;  3JZ1 B;  3SU6 A;  1ID5 H;  1GBK A;  1NU7 B;  3UWI A;  2NU0 E;  4K2Y A;  1KXC A;  1S81 A;  2SFA A;  2V0B A;  4B08 A;  3UUZ A;  4AKI A;  2CWB A;  1GI0 A;  1OXG A;  3RXO A;  3FVF B;  2XNI A;  5E2P A;  3KYG A;  2PTN A;  3V3M A;  4Y8Y A;  2DEN A;  4DR1 M;  1DGF A;  3DCL A;  7LPR A;  3U6D A;  4OX9 M;  3L26 A;  1QRZ A;  2Q6F A;  3RE8 A;  3MU4 A;  1MN3 A;  1TNI A;  4NFF A;  3SAR A;  2BDI A;  2CEA A;  2Y5G A;  4D82 A;  1N1L A;  5FCR A;  2NU2 E;  3U60 A;  5GKN A;  4CHT B;  1C2M A;  1THR H;  3A7Y A;  9LPR A;  1P9S A;  3ODD A;  4UFD H;  4LZJ A;  5AF9 H;  2B7D H;  3CF6 E;  3A8A A;  4K0K M;  3UNS A;  4F48 B;  2ZIQ H;  3MNB A;  1ZGI A;  1S6H A;  1TH4 A;  2VVU A;  4X2W A;  2I7N A;  2AMD A;  1ELF A;  4ZUH A;  1DST A;  1C5S A;  1P2Q A;  2F9O A;  4AFZ A;  4DII H;  5E0H A;  4OS1 A;  1C5M D;  3UR9 A;  2DAI A;  2GP9 B;  2FZZ A;  3H7O A;  1XUH A;  1Z8I B;  1F4I A;  1K3X A;  1FXY A;  3F2G A;  4NSO B;  2PSX A;  2FWW A;  3KOW E;  1E1R D;  3E21 A;  2F9U A;  3BXW A;  2FTM A;  3U6C A;  3N7O A;  1JQJ C;  3KQD A;  5B6O A;  1NO1 A;  3TH3 H;  2P93 A;  3ITI A;  2X49 A;  4FU8 A;  2F9B H;  4DJZ B;  4GUX A;  4CR5 A;  1ORY B;  2QP9 X;  4ABF A;  5J4S A;  2AFQ B;  1LHG H;  1XNQ M;  1OHH D;  3A87 A;  4Q7Y A;  1QL9 A;  4GHL A;  3IWM A;  4Q80 A;  3A84 A;  3LQR A;  3MO6 A;  4WW0 A;  1XUK A;  4JZE H;  5EXL A;  3SV9 A;  4MNX A;  3AFH A;  3TWM A;  4JZI A;  2J92 A;  1VQ1 A;  2H9H A;  1V2N T;  1DGH B;  3M7G A;  3M36 A;  1EP6 A;  4LJ8 A;  4K5Z A;  4E7R G;  8GCH G;  1Z7K A;  1BCU H;  3OAA D;  4Y76 A;  3LC5 A;  3ZZB A;  6GCH G;  4I32 A;  1DT2 A;  3U6E A;  3QYB A;  1D3D B;  1O32 A;  1O3B A;  3F9G A;  3MU1 A;  4HLQ A;  3A82 A;  5JBA S;  1K0H A;  1SVP A;  1Z5A A;  4Q63 A;  3RM0 H;  4L6V 6;  1MKX K;  2IN2 A;  3RXS A;  3EA8 A;  1NJG A;  1FDP A;  1H1B A;  2GCH F;  1IN4 A;  3TPI Z;  1S0Q A;  3A81 A;  3VGC C;  1FN6 A;  4Z0K A;  1MKW K;  3URC A;  3KSX A;  3U8T H;  3B7N A;  3BEU A;  2CFO A;  1TNK A;  1P03 A;  5EXS A;  1A0H B;  1MD8 A;  2ZI2 H;  3N7D A;  5FTJ A;  1EZQ A;  5JI2 E;  1QY6 A;  2GV6 A;  4RKJ B;  4LY6 A;  3BIU H;  5FTK A;  1YWU A;  3SN8 A;  3EIE A;  3BEI B;  2HAK A;  1IBK M;  1V2S T;  2UUY A;  1SLW B;  1IAU A;  1QCP A;  2YNM D;  5KPT A;  2BDB A;  1LMW B;  3FP6 E;  4DV4 M;  2V1C A;  4DUZ M;  1FAK H;  2RDE A;  1QBO A;  4NWK A;  1ZLR A;  2QY0 B;  7GCH F;  1TMU H;  3BSQ A;  5EJL A;  1UTK A;  2PKA B;  3MHW U;  2F5S A;  4FVD A;  4ZCN A;  3VGC B;  3VFE A;  1BBR E;  4GCH F;  1CHG A;  1J7K A;  4OGY A;  4RI0 A;  1C9P A;  1IBM M;  4MNY A;  2W7U A;  2FIR H;  1ELT A;  2L6O A;  1O36 A;  1ZGV A;  3ATM A;  1AGJ A;  1YE9 A;  1EZX C;  3P8O A;  4X0W U;  3VEQ B;  1JIR A;  3ZVC A;  1UJ1 A;  3HHW A;  2YR0 A;  4FVB A;  2ZTZ A;  3DFZ A;  3JAM S;  1O3D A;  1DY8 A;  1IQK A;  1EUF A;  4JI6 M;  1O34 A;  1TAB E;  4BAQ B;  3Q76 A;  4DR7 M;  3BTF E;  1LVM A;  1GBA A;  1NRN H;  4PCZ A;  1TGS Z;  1PPZ A;  1LVO A;  1MQ5 A;  1A5I A;  2FEQ H;  9EST A;  3DFL A;  3GY3 A;  2VWM A;  4LCB A;  1WR1 B;  3GY8 A;  3LGI A;  5FAH A;  3MWI U;  1YCP H;  2VID A;  3ZZC A;  2I7P A;  4NRW A;  2A7H A;  4LF8 M;  4SGA E;  1O5C B;  1YLD A;  4LRT A;  5L2Y H;  2A2X H;  3FTD A;  4WF8 A;  4M9X A;  3KS8 A;  3M0E A;  1LHF H;  1UVO A;  3GY2 A;  1SGC A;  4FWH A;  4NWL A;  4CRE A;  1SR5 C;  4DV0 M;  2DNA A;  4AYY B;  1AUT C;  1DDJ A;  1V2V T;  3OSY A;  1HT2 E;  1KTS B;  1HIA A;  1BIT A;  1TIO A;  4XSK U;  4BXW A;  5LGO A;  2R3U A;  1IY2 A;  4G4O A;  3RMO H;  2G3Q A;  2FOM B;  1RJX B;  2A4Q A;  1MBM A;  4LJ9 A;  4G3O A;  1IQI A;  2P94 A;  5ETX A;  3RLW H;  3ZZ5 A;  3TGK E;  1O38 A;  3VLF B;  4FUE A;  1N6X A;  1ETR H;  1P3E A;  1BTZ A;  3KN2 A;  1AVW A;  1O2O A;  5ABW A;  4TPY A;  1PYT C;  2GCT C;  2W82 A;  2QF4 A;  1EAT A;  1HAP H;  4ZKN U;  5F03 A;  4I8G A;  1N32 M;  3LH1 A;  1C1T A;  5FPT A;  2OC8 A;  4GSO A;  1AI8 H;  3SAW A;  3OE7 D;  3A42 A;  4XOJ A;  2ZDM A;  4TPI Z;  2DAK A;  4TT3 D;  2YOL A;  2OK5 A;  3W1E A;  3K9O A;  4WUR A;  1T32 A;  4XBO A;  4AFS A;  2YMS D;  4ASU D;  2VVV A;  4JI7 M;  3RXI A;  1MZA A;  1NN6 A;  2Z4R A;  3VK7 A;  2A45 B;  1G8P A;  5DG6 A;  1ZTL A;  5JBC S;  4CRD A;  5DYI A;  1QJ6 B;  2GCT B;  5JI3 E;  2ZDK A;  4M9S A;  2VNT A;  3TNS A;  1C2J A;  3M3T A;  4NRV A;  5I25 A;  3SMS A;  3QDZ B;  1P12 E;  1YGC H;  2JA2 A;  1C5T A;  1YKT A;  3RXQ A;  4FU9 A;  5K0H A;  1QZ8 A;  2G51 A;  3QK1 A;  1V2R T;  2K0Q A;  1R7R A;  2KRK A;  4R8T B;  4CJ6 A;  2ZU5 A;  4FUG A;  4ISO A;  1CO7 E;  2TBS A;  5AVD A;  1L4Z A;  4DV3 M;  4JYV H;  3L3T A;  1C5Y B;  1HAV B;  3KGP A;  1QUT A;  3GY6 A;  4BAM B;  1A2C H;  1EAI A;  2JUJ A;  1K1P A;  1PPF E;  4ANR A;  4MPV A;  1O2R A;  4GIP A;  2LVQ D;  3LU9 B;  5ITQ A;  1QQ4 A;  1WCZ A;  1GVZ A;  5DP8 A;  2OD3 B;  2JET C;  2Q2E B;  3WY8 A;  4NSR A;  3ENS B;  3SV8 A;  4AFU A;  1T8N A;  1W7G H;  3Q00 A;  2PSY A;  1UCY K;  1OP8 A;  3F9E A;  3P92 A;  1R6B X;  2HKJ A;  4B3M M;  1DE7 H;  4RT0 A;  1XM1 A;  1NTP A;  1O3L A;  4DIH H;  1O30 A;  2GX4 A;  2G8T A;  2BVR H;  1TR8 A;  7EST E;  4YHH M;  5C1X A;  2XBX A;  4F2L A;  2FI5 E;  2ZTC A;  1ZRB A;  1SXJ D;  1LVY A;  4K3J A;  5C0U A;  4YO9 A;  3FRH A;  1AUJ A;  1DUE A;  5C1U A;  1MU5 A;  3SQE E;  2JJ2 D;  3PRB A;  5DP7 A;  4YXW D;  1V2U T;  4NXM M;  3F0P A;  2JET B;  2O8M A;  3GCT F;  3FZZ A;  2G5V A;  3CS7 A;  1EXF A;  5DPA A;  3RMN H;  2EI6 A;  4D7G A;  3N99 A;  1K1N A;  2J9N A;  4AKG A;  4B2C A;  2BZA A;  3KQ5 A;  1U6Q A;  1PJJ A;  2PV9 B;  4AFQ A;  5C1Y A;  1AY6 H;  1K1O A;  2J98 A;  4G6Z A;  2ZTY A;  5EP1 A;  4AGK A;  2G5G X;  2H9E H;  1EZS C;  1ELE E;  3BOS A;  4M9F A;  1F5L A;  1MCT A;  1YPJ H;  3RXB A;  2DAE A;  3K9X B;  3A7V A;  3OEH D;  4RF0 A;  3GPX A;  1C5W B;  1OWD A;  2RRU A;  2Q1J A;  2EJS A;  1XMQ M;  1G2L A;  1T7C A;  5KPR A;  2QBY B;  1O2I A;  3PTB A;  3T5F H;  1DLE A;  1GBI A;  4ZKO U;  4JK6 A;  1P8V C;  2GV7 A;  3VK8 A;  5GXP A;  4CRG A;  1VZQ H;  2EO2 A;  4H42 U;  4F4O C;  1GL0 E;  2FDA A;  1SGT A;  2PGB B;  1GHA G;  1W7X H;  1DLK B;  2Z94 A;  4XFQ A;  1HB0 B;  1UMA H;  1UFZ A;  1O5F H;  2D26 C;  3CNR A;  3PLP A;  1SHH B;  2HVX A;  2HWL B;  1UVT H;  1B7X B;  1YPG H;  3U6L A;  1P06 A;  4OW0 A;  3U6M A;  3OX7 U;  4JMY A;  5EJC A;  2BZ6 H;  2O8L A;  2WV4 A;  3FKS D;  4LGM A;  3BTM E;  4R0I A;  2HPP H;  4X6O A;  3U60 B;  3GRR A;  2ZFS A;  1SLU B;  2FLB H;  4U30 A;  4LZ4 B;  1ZSK A;  4MG3 A;  2GZ7 A;  4Y0Y E;  4X62 M;  3GLG B;  5LMN M;  2R9P A;  2XFS A;  4ABH A;  4KOD A;  1UVU H;  8EST E;  1C2K A;  5FPS A;  3RML H;  1QDR A;  4AI6 A;  2ZDN A;  3FUW A;  1C5V A;  1DGH A;  1QAQ A;  2XW9 A;  3J27 B;  1OS8 A;  1Z1I A;  1IQG A;  2AGG X;  1IFY A;  2F4L A;  3B7Z A;  3UZU A;  1DPO A;  2GDE H;  2BXU H;  3I4V A;  3VB6 A;  2BD3 A;  3IIT A;  3A8C A;  4JI4 M;  1C2I A;  2JXN A;  2KZ4 A;  3V7T A;  1W5T A;  1YCP K;  2XCF A;  1H4W A;  3RXE A;  4X1P U;  5KQD A;  2MRO B;  2VIN A;  3BTK E;  1RRK A;  4I31 A;  3RXK A;  1AZZ A;  4AOR A;  4KKD A;  4P16 A;  3PRO A;  3ZQJ A;  1DGB A;  3ODF A;  3GOV B;  3RXM A;  2Z9K A;  4XBC A;  2UWO A;  4DCD A;  2QXJ A;  3MOC A;  1W0J D;  3MMG A;  2UXB M;  1F2S E;  1O3G A;  2WPD D;  2FNA A;  3UNQ A;  1SPJ A;  4UN2 B;  3FTE A;  2KCY A;  2ZEB A;  1SGI B;  4BXS A;  2VF8 A;  2F9N A;  2KW0 A;  2PHB A;  4I86 A;  1YSY A;  2CV1 A;  2GT8 A;  2V3M A;  4FCV A;  2J38 A;  2PW8 H;  4Y8X A;  2PKA A;  5DK1 A;  4FU7 A;  4AOQ A;  2ANM H;  1C5Q A;  3M35 A;  3QUM P;  3T1H M;  2W3I A;  2LVP C;  4H6T A;  1VGC C;  2J4I A;  2GQF A;  3R8F A;  4F55 A;  1C1K A;  1LTM A;  1WXQ A;  3TL4 X;  2GMT C;  1F0R A;  3MO9 A;  3GPY A;  1H8I H;  1SQO A;  1D9I A;  1O5A B;  2ZU2 A;  5A09 A;  1BMA A;  1HR0 M;  1IXZ A;  3B74 A;  4X66 M;  2BWB A;  2VQF M;  1THP B;  1NFY A;  5JDU B;  5C5N A;  2CRU A;  4I4L A;  3HU2 A;  5E6J A;  1TOM H;  2VVC A;  1LV7 A;  1OJL A;  1LTO A;  4JYA M;  3SJI A;  1CT0 E;  1O2X A;  1DM4 B;  1IN5 A;  5GND A;  2JWS A;  2OQ4 A;  3PMB B;  1VGC B;  1MTN C;  1BHX F;  2FS1 A;  4LJ5 A;  1V2M T;  2FO9 A;  2EEK A;  1EB2 A;  3FOA A;  2GMT B;  2H5X A;  2R6F A;  2V3H H;  3MH5 A;  4MGK E;  1E0F D;  2G81 E;  4X8T H;  4XE4 A;  2Z4S A;  1E35 B;  2J97 A;  2GDD A;  4LOY H;  2M60 A;  1TON A;  2HL7 A;  4ZHM U;  2CHQ A;  1C4U 2;  4YOI A;  1GJ8 B;  3FFG A;  1BBR H;  4HZH A;  3PV2 A;  3UIR A;  2WSE F;  1Q3X A;  1SFI A;  2SGQ E;  1EAX A;  5HMA A;  5HM9 A;  3HWS A;  1V92 A;  2FMJ A;  4D80 A;  3TNT A;  3HJQ A;  1IY0 A;  1GAB A;  1MTN B;  2APL A;  3TH4 H;  4NG9 H;  3L29 A;  1O5B B;  5JBT A;  3FAN A;  4DVA U;  1O2S A;  1V2L T;  3LGV A;  1WV7 H;  1SOT A;  3KEE A;  3F0O A;  1PPC E;  2J2U A;  4IBF A;  4LGY A;  1GBC A;  3OY6 U;  4JZF H;  1ZPZ A;  1BOQ A;  1XXH B;  2P8O C;  1K3W A;  2F43 B;  2Y20 A;  3HGN A;  3ATW A;  1GMC G;  5E8E H;  4D7F A;  1LPG B;  1BML A;  4Q4L A;  1NY6 A;  4RF1 A;  2XC0 A;  3B7Q A;  4D9Q A;  2H9T H;  1MTU A;  2R4E A;  4BAH B;  4E06 H;  2BX4 A;  5EPN A;  5E2O A;  2AGI X;  1E38 B;  1ETT H;  2PGQ B;  1GBE A;  1PPH E;  4B2B A;  1TA2 A;  2JY6 B;  1GG6 C;  4Z8X A;  4XDE A;  1O3A A;  2CF8 H;  2ZHF H;  1WOF A;  2YMS C;  1Z1J A;  1QQU A;  3MU5 A;  2P8O B;  1SGQ E;  1IQN A;  2BY8 X;  4ITQ A;  3MYW A;  2JZ0 A;  3ZZ8 A;  1Y8G A;  1DGG A;  2QAA A;  5EIY A;  2Z3X A;  5DNY A;  2QF5 A;  4HGC A;  1GBM A;  3EYD A;  2R0L A;  1ELC A;  1LPZ B;  4AB8 A;  5CDF E;  2KZS A;  2QQ8 A;  2WPK S;  1O5E H;  1H8H D;  3NWU A;  3HU3 A;  4UD9 H;  1GG6 B;  5K7R A;  1HAV A;  1L0Z A;  2WV9 A;  4MGI E;  4ABB A;  3SAS A;  4B2A A;  2GD4 B;  4IJE A;  1TTE A;  1UM8 A;  3R0F A;  1HUT H;  1DWD H;  2YMS B;  2DAG A;  2UUC M;  2L4F A;  4A1V A;  4LF6 M;  2QPA A;  1CU1 A;  1NV8 A;  2LNC A;  1GI5 A;  2AMP A;  3HKI B;  5G4B A;  1XUI A;  1ARB A;  2C90 B;  1DXW A;  4QNR A;  1C1Q A;  2QV1 A;  2ZCH P;  3BTT E;  5HM2 A;  2H2Z A;  2GGV B;  2LEL A;  2EI8 A;  1G2M A;  4FET A;  2Y7Z A;  1HAH H;  3JZ2 B;  3PWB A;  5C17 A;  5LPR A;  2IJD 1;  1AWH B;  4I8L A;  3L27 A;  3GIS B;  1QUR H;  3QWC H;  1P09 A;  1UHB B;  5A2Q S;  1IM2 A;  1W14 U;  5F3W A;  1FLE E;  1ZHM A;  3OTJ E;  3RUO A;  1SI5 H;  3RXR A;  4YOG A;  4JK5 A;  5FPY A;  4MB7 A;  1XXD A;  1DWE H;  2ZKS A;  3QZQ A;  2AGE X;  2OTV A;  1DOJ A;  1N8O C;  1HNW M;  3GQ3 A;  4GHA A;  5TCA A;  1DUA A;  2O9Q A;  3DD2 H;  1O2K A;  5EW2 H;  4CBO A;  3RXH A;  1EIJ A;  3W68 A;  2TGT A;  3R3G B;  4DR6 M;  2HLC A;  1FV9 A;  2CXV A;  1V6D A;  3C3D A;  4B3S M;  2FX4 A;  4MQA A;  2CK3 D;  1GL7 A;  5FHT A;  1C5O H;  2Y80 A;  4A3V B;  3O8D A;  3SHC H;  3KVW A;  2VWO A;  1QZM A;  4Y0Z E;  4QOS A;  1CVW H;  2FOD A;  5FLX S;  2OUA A;  4ZH8 A;  8GCH F;  1KSN A;  4CR9 A;  6GCH F;  1PRB A;  2UWP A;  1DVA H;  4DV1 M;  1TPP A;  5C2Z A;  5CHB A;  4MGH A;  1P2M A;  1DO2 A;  4IS5 A;  2QBY A;  1QZE A;  1N8O B;  1O3H A;  4IC5 A;  4Y71 A;  2L09 A;  4NFE A;  3UNR A;  2K1Q A;  1V33 A;  2FOG A;  3GLG E;  4U2W A;  1QAO A;  3SI4 H;  4NCY A;  5F6M A;  4YT6 H;  1Z5B A;  2XF3 A;  3FKE A;  2XBV A;  4WH8 A;  5BPE A;  2A7C A;  2ZGC A;  3E46 A;  1PPB H;  3EAJ A;  5FBI A;  2LHC A;  1FX0 B;  3U61 B;  3EA7 A;  3F2F A;  3QWL A;  4X65 M;  1O2J A;  3HHZ A;  3KDS E;  2J98 B;  4JXJ A;  2KNA A;  5EG4 A;  1ZTJ A;  5CMX H;  4IBB A;  1S6L A;  5ESB A;  3L33 A;  3AV0 A;  5A8Z A;  3TIU A;  1MMJ N;  1P57 B;  3GCN A;  4NA7 A;  2JH0 D;  5A8Y A;  3TK9 A;  2WZJ A;  2SNV A;  3PM3 A;  4Y28 F;  4CIZ A;  1NFX A;  3MFJ A;  1XMO M;  1DWC H;  1EZU C;  1F0S A;  3VB7 A;  1A4W H;  2L7H A;  4YZU A;  1SGF A;  1W0Z U;  3IG5 A;  1G9I E;  1LCY A;  1UW7 A;  4XD7 D;  2BQ7 B;  4NA9 H;  3SOS A;  1W8B H;  3LON A;  3F9H A;  3VKH A;  3S7K B;  3WWB A;  3GLG A;  3SMP A;  3BBZ A;  1O35 A;  4JV5 M;  1OX1 A;  4Q7Z A;  5C3N A;  1HBT H;  1NY5 A;  1WQS A;  1FIW A;  1KSF X;  1QTF A;  1WUN H;  4H6S B;  4JN6 A;  5BPV A;  1GBD A;  1P2N A;  2QCY A;  1BTX A;  1GI4 A;  2C3S A;  2CV0 A;  3VPK A;  1HQC A;  4INK A;  3HGI A;  4I8H A;  2AIP A;  1KLI H;  4YT7 H;  3Q3X A;  5KGO A;  2WSC F;  2BB4 A;  4L16 A;  3KXE C;  2QYI A;  1P9U A;  1V2W T;  3SV7 A;  2DKL A;  1PJS A;  2C8X B;  1ZYO A;  4DR4 M;  3UFA A;  1EAU A;  1VJA U;  2F83 A;  2JP7 A;  4AQY M;  3I77 A;  5JYI A;  1G4A E;  1HAO H;  1YPE H;  5FBE A;  3LDX H;  2ZU4 A;  1LO6 A;  1NHG C;  2C9C A;  4X8V H;  1KXF A;  2BY6 X;  3GRY A;  3U8O H;  1SHY A;  3T26 A;  2LXE A;  1SGN E;  3E9S A;  4FVM A;  1G3I A;  5C18 A;  3F3B A;  1L1T A;  3F9F A;  3M6A A;  3NPS A;  2A0Q B;  1QNJ A;  2R46 A;  3HKP A;  1CHO G;  3PNV A;  1KYN A;  1LHC H;  2A5A A;  1AQ7 A;  4PDI A;  3IG6 B;  1LVB A;  2EA0 A;  2KR7 A;  3M5L A;  2RA0 A;  1HXE H;  2LP6 A;  4CGY B;  3IG8 A;  4L4U A;  1GDU A;  1LDT T;  3ZZ3 A;  1ZMW A;  1A3B H;  3OTO M;  4MGY E;  1TBR H;  3HAT H;  1BUI A;  3SI3 H;  1DO0 A;  1Y3X A;  5J4Q A;  1QDT A;  1OIZ A;  3Q8X A;  1HDT H;  2XBY A;  3E4R A;  2ZTX A;  3K6Z A;  2JNH A;  5HXF A;  3KOY E;  2FS8 A;  3BTG E;  2DZL A;  1LHD H;  3UR6 A;  3LGU A;  1A7S A;  3Q8G A;  3MNX A;  2CV2 A;  1O2W A;  3DSO A;  1TLD A;  2ZFT A;  2H5D A;  2O8U A;  1IHS H;  4TYD A;  5F8Z A;  1Y3W A;  3PMJ A;  2KFW A;  4MGZ E;  1KYI A;  4YY3 M;  3GRV A;  4GVU A;  4LJ6 A;  1RTL A;  2N35 A;  3SU0 A;  1O33 A;  3SZE A;  1BTP A;  4E05 H;  4RKO B;  1L1Z A;  1O37 A;  2RCE A;  2GZ8 A;  1FY3 A;  3ZZ4 A;  1OOK B;  4WXV A;  1TE0 A;  5C67 A;  2ANW A;  2O25 A;  2KZU A;  2FM2 A;  1IQM A;  4KT0 F;  1D0K A;  3GLF A;  4B7G A;  2ZU1 A;  2R18 A;  1FI8 A;  2D2D A;  3SU1 A;  3UQV A;  4LZ1 H;  3TWL A;  1EFU B;  1VEJ A;  4B1T A;  1MTS A;  3HY5 A;  5DFL A;  1UTO A;  2LH0 A;  2RG3 A;  1HFD A;  4THN H;  2F5O A;  2XC5 A;  3CF2 A;  4X2V A;  1QUS A;  4AGJ A;  3PLB A;  4KGA A;  3FUV A;  3S7H B;  2CHV A;  1E79 D;  2MJ5 B;  3DHK H;  2KEB A;  8CAT A;  4A1X A;  3SUG A;  1W11 U;  3PTN A;  4BB9 A;  1GJA B;  1C5U A;  1E32 A;  1PQ7 A;  2BDA A;  3LC3 A;  1O3C A;  1XHB A;  1XXH A;  1T3T A;  1COW D;  3A86 A;  1TRM A;  2KDL A;  1J8A A;  3LJO A;  4FCW A;  1NBM D;  3EA9 A;  5DGJ A;  1Y5B T;  2A31 A;  2QF0 A;  1INC A;  3QZR A;  3HU1 A;  1EJN A;  3SNE A;  4AG5 A;  1D2N A;  1SGD E;  1TYN A;  3NKK A;  1VDD A;  3T2N A;  1BZX E;  4BAN B;  3M5N A;  2F4V M;  2KA6 B;  2A1D B;  1XUG A;  3K8Z A;  4WME A;  3K9P A;  3D8B A;  4QOZ C;  1F92 A;  1Y8T A;  1WGL A;  2FOC A;  3QN7 A;  2BD9 A;  1J14 A;  1C1M A;  1UTN A;  1C5X B;  1GJ5 H;  4ZPX A;  2TGD A;  3UOP A;  4ABA A;  3Q3K A;  1Q02 A;  4B3R M;  2RKO A;  1TPS A;  4JYT A;  2J5U A;  3CEN A;  3NWL A;  1RGQ A;  1Z8R A;  2ZU3 A;  3KP0 E;  3A80 A;  5EST E;  3TVJ B;  1ZQ9 A;  1OWI A;  2ZZU H;  3RDZ A;  2F9V A;  1NNU C;  1NNJ A;  5GDS H;  1TAL A;  1TH2 A;  2WZQ A;  1I4W A;  2B0F A;  3RXV A;  4E7N A;  1MCV A;  3AW0 A;  3FE3 A;  3C3E A;  4IBD A;  1O31 A;  3E8L A;  4YES B;  1C2F A;  4GPG A;  4OM9 A;  2LVA A;  3I29 A;  4K1T A;  3M5O A;  1ESB A;  1C5N H;  4IBE A;  1O3O A;  1A3E H;  1T4U H;  1CQQ A;  3ZZD A;  1O3N A;  1GHA F;  1C1O A;  2TGA A;  2Z9J A;  3F68 H;  4ISH H;  5EJ1 A;  1N78 A;  2OQU A;  4K8B A;  5I46 H;  3K1J A;  4G4R A;  2ERC A;  3TH2 H;  3K2L A;  5L8R F;  5JB8 S;  1JBU H;  3OEE D;  1O3P B;  5F8T A;  2HWJ A;  3ZC7 B;  3SU5 A;  2F9P A;  1PQ8 A;  1VDL A;  1J9C H;  1CGI E;  1XMN B;  2A2Q H;  2P95 A;  2VU8 E;  3LGW A;  1PQA A;  2DE9 A;  2JH5 D;  3AAS A;  4X8U H;  1HT1 E;  2C5R A;  3EIH A;  3ZVB A;  1MZD A;  1UHB A;  1IN6 A;  2BMG B;  4AN7 A;  1TNJ A;  1OFI A;  2BLW A;  3B23 B;  1FPC H;  2Y82 A;  4FOU C;  4Y6D A;  1TX7 A;  1N6Y A;  1T6O A;  3GDV A;  5KQ8 A;  4IBK A;  2KX4 A;  1F7Z A;  1ETS H;  3NUM A;  4Y11 E;  3KF2 A;  1Q3C A;  2X4A A;  3D49 H;  4KEL A;  1K1L A;  3M3S A;  4O03 A;  1YPL H;  1TX8 A;  1P0S H;  3SYK A;  1A0J A;  2TGP Z;  5A0B A;  2O8T A;  3AVZ A;  1D3P B;  7KME H;  1S84 A;  3E0N B;  1XNR M;  1MD7 A;  1ELA A;  4Q2K A;  1SXJ A;  5EPY A;  2HOB A;  1HAX B;  3ZV8 A;  1PPG E;  1IY1 A;  1NS3 A;  1RS0 A;  1VCP A;  4BTI B;  4DV2 M;  2OOB A;  2R62 A;  1O2Z A;  2LWX A;  3MO3 A;  4LFA M;  2WV5 A;  2YQZ A;  1S0R A;  2XZU A;  3CTW B;  1GJ9 B;  2VWL A;  3ZZ6 A;  3CF0 A;  4LG2 A;  2AS9 A;  4AC9 A;  2VQE M;  3U61 A;  1GHB G;  2Z3C A;  5PTP A;  4L15 A;  2XSZ D;  3DZD A;  3ZCB B;  1CGH A;  3EE0 B;  2RA3 A;  3RXA A;  3SU2 A;  3EE7 A;  1ZPB A;  1AHT H;  1C7Y A;  1R4G A;  2CP8 A;  1YPM H;  2TIO A;  2BY7 X;  3FAO A;  1FNI A;  2Y81 A;  4ABJ A;  2PWX A;  4GAW A;  2BD5 A;  1C2L A;  3WWF A;  1KY9 A;  1WTG H;  1TGB A;  2P16 A;  3B89 A;  1GCT C;  4ZRO A;  3V13 A;  4IN1 A;  5GCH G;  5EXN A;  3O8B A;  4JI1 M;  2ZM6 M;  5LMU M;  1T8O A;  4B74 A;  1BRC E;  1AN1 E;  3LVW A;  3DSG A;  1XX9 A;  3J80 S;  1V2T T;  1QQW A;  2QZ4 A;  1WIV A;  1BRA A;  1NY2 2;  1VEG A;  1N34 M;  3SOR A;  4G4N A;  1B0E A;  1OQY A;  3DOA A;  4GRI A;  3BTE E;  5C5O A;  4HTC H;  1EAS A;  1KXB A;  1QA0 A;  2A5I A;  2GVF A;  2FOH A;  2Z3D A;  2FTL E;  2ZFR H;  1BQY A;  1BMM H;  1C1P A;  1GCT B;  2X8A A;  1ABJ H;  1E34 B;  2WYJ A;  4JI8 M;  3HPT B;  4DR5 M;  4LF9 M;  2YFQ A;  4P17 A;  3PRD A;  1O3K A;  4GC5 A;  4BOH A;  2ZHD A;  5EXP A;  2KHH A;  1TBZ H;  3NBI A;  3RP2 A;  2Q6D A;  4AG6 A;  3OTP A;  1ABI H;  1GKI A;  2XRC A;  3MTY A;  3P8G A;  2R65 A;  2B9L A;  3T27 A;  1UCY E;  2UXD M;  4YM9 A;  1QB6 A;  2J7N A;  1BJV A;  1UTL M;  4M0W A;  2ZO3 H;  1KIG H;  1P2J A;  5EQQ A;  2A4O A;  3RGP A;  1BHX B;  1V2O T;  1GJ6 A;  4DT7 B;  2KCA A;  1O3M A;  3PV5 A;  2LVN C;  2ZDV H;  1GJT A;  4HEO A;  1JIM A;  2ZPS A;  3U9A H;  2C8Z B;  2ZGX H;  1XXF A;  1JRT A;  1QB1 A;  2QEN A;  1A1R A;  4CRA A;  3L25 A;  1GDN A;  4IMZ A;  3PMA B;  1GGD C;  3A98 B;  3E16 B;  3J81 S;  1VCW A;  1SMF E;  2IOT A;  1GI6 A;  3EST A;  1WAY B;  3WHK A;  2ODQ A;  2W26 A;  2LBC A;  5T3H A;  3SNB A;  2WPH S;  2BXT H;  2R44 A;  4PDG A;  1KXA A;  1GJ4 H;  2NU4 E;  5EU8 A;  1ZJK A;  1D0M A;  1YY3 A;  3KCG H;  2XC4 A;  4QT8 C;  1XVO A;  2BX3 A;  2DWL A;  1QYR A;  3RU4 D;  4AZ2 B;  1GMC F;  5EGM A;  1D4P B;  5TJX A;  1F0T A;  1W2K H;  4OS6 A;  1IXS B;  1YP9 A;  3NZI A;  1KLJ H;  3TWK A;  4B7F A;  1NT1 A;  1Q2W A;  3GQ4 A;  2BYA X;  2KCP A;  4OS4 A;  1O2H A;  3FP7 E;  2FFJ A;  1GGD B;  4X64 M;  2BDY A;  3M37 A;  1WSS H;  3KQC A;  4XBD A;  3FP8 E;  1HNX M;  3RM2 H;  3M61 U;  2CHG A;  3F92 A;  2WUB A;  3LGY A;  1AKS B;  2BHG A;  1BRU P;  4J1Y A;  3SNA A;  1O2N A;  2BOH B;  3ZH9 B;  4ISN A;  5EQT A;  2PTC E;  4Y7A A;  3ZIA D;  2E5L M;  1JB0 F;  1AFQ C;  1GMH G;  2J7O A;  3KHV A;  4K69 A;  3AOG A;  1HAI H;  4Y10 E;  2BVX H;  3UAI C;  5EQS A;  2HVY B;  1OP0 A;  2ZGH A;  1PJP A;  1J5E M;  3O8R A;  5DO4 H;  1GBT A;  1NC6 A;  3D65 E;  3G01 A;  3UY9 A;  5EOD A;  3RXC A;  4ZKR U;  3QGN B;  2C96 A;  4M9Z A;  1P05 A;  2FE8 A;  1A5H A;  1ELV A;  1O3J A;  1TOC B;  1W13 U;  2VWN A;  5HGG A;  5LH8 A;  3T29 A;  1LHE H;  1S83 A;  4Z1M D;  4ISL A;  2JZ1 A;  2ZAO A;  1J17 T;  1AD8 H;  1AFQ B;  1NFU A;  4XRN A;  2VJ1 A;  1MU8 B;  4HI3 A;  4LFC M;  2QA9 E;  3MI4 A;  5E0J A;  2UUA M;  2KM0 A;  3J7B A;  2V1U A;  2WYG A;  5FX6 A;  5L6N H;  2JY8 A;  2CV3 A;  4MH0 E;  1E36 B;  1G3D A;  1MH0 A;  1O2V A;  1L2C A;  1AFE H;  2V35 A;  3FZD A;  3UK6 A;  2G00 A;  3GY7 A;  3I78 A;  1VIT H;  1TGN A;  1AWF H;  4RT1 A;  3TJV A;  3OYP A;  4NXN M;  3UMM A;  3GLF B;  1PQ5 A;  4X1Q U;  4LFB M;  1O3F A;  4ABE A;  2L74 A;  5A8X A;  3TU7 H;  4R71 A;  2ZCL P;  1ZMV A;  4QNM A;  1XKA C;  4L78 A;  3BF6 H;  3UPE A;  2ZAM A;  1CT4 E;  2K9D A;  5EXM A;  5FCK A;  3SC3 A;  3DSP A;  3GYL B;  4WP2 A;  5EP3 A;  4IBL H;  5JPM H;  2JY5 A;  4YLQ H;  4CRB A;  2L7I A;  5IK2 D;  2TPI Z;  1YYY 1;  1J16 A;  2FXR A;  3E1X B;  3ZZ7 A;  3GCO A;  1FJG M;  1RD3 B;  5DKM A;  1YLC A;  1HJP A;  1P3C A;  4UE7 H;  1Q39 A;  2A5Y B;  1ZHP A;  5KED A;  2CUZ A;  3U1I B;  3GYM A;  4VGC C;  1O2Q A;  2M2A A;  1DS2 E;  5C0T A;  1EOL A;  7GCH G;  3GDU A;  3URE A;  1BVS A;  3H7T A;  1AB9 C;  2STA E;  2ZCK P;  3STI A;  1GDQ A;  2ZWL H;  1C1W H;  2OPF A;  1PFX C;  1OYQ A;  2JY7 A;  3GY5 A;  1FY1 A;  3DFJ A;  5ITR A;  2VF7 A;  3MK6 A;  2D7G A;  3J7A S;  1OKX A;  2KAI A;  2ZPQ A;  1GBL A;  2Z9L A;  5C1B A;  2XWA A;  5FL7 D;  1SGY E;  3AAV A;  5DP3 A;  1BDA A;  1O2P A;  5T6F A;  1D6R A;  4ABI A;  1MKX H;  3T6P A;  1NRR H;  1IQE A;  3P17 H;  1GHW H;  1GCD A;  3DA9 B;  2BDG A;  4M7G A;  3UB0 A;  1BRB E;  1OWK A;  1CUK A;  4DUY M;  2Z6B D;  5EQR A;  3RC6 A;  1HNZ M;  1RFN A;  4VGC B;  1C5Z B;  1DFP A;  3MHV C;  1F5K U;  4BAK B;  2ZHQ H;  1EP5 A;  2JH6 D;  1OP2 A;  2FOA A;  1IQF A;  3RMM H;  1LQE A;  2ZG0 H;  4NIY A;  4YTA A;  4LF4 M;  2QXH A;  2THF B;  3S9A A;  1AB9 B;  2HGT H;  3SYL A;  4B75 A;  1DXP A;  3D8L A;  3BTD E;  5FSW A;  1SQA A;  1EST A;  5DP6 A;  3FD9 A;  2ZNK H;  3MU8 A;  1AIP C;  1AVG H;  2W6I D;  2W3K A;  1GPZ A;  3T1Y M;  3I04 M;  4I7Y H;  3T15 A;  3SUD A;  3HJ8 A;  3M7Q A;  2H6M A;  4F1I A;  3S9C A;  6EST A;  3P70 B;  3RXF A;  2SNW A;  1GHV H;  3QTV H;  4ZHL U;  1FIZ A;  1ZR0 A;  3D62 A;  5A0C A;  3TPZ A;  4JI3 M;  3V0X A;  5TCC A;  1X37 A;  3V12 A;  1JR3 D;  1L1G A;  3ATL A;  2C9O A;  1L2E A;  1BA8 B;  1BTW A;  4D81 A;  1NRQ H;  4Q7X A;  1G59 A;  1Z8G A;  3FO8 D;  2VIQ A;  2M5Z A;  1MBQ A;  3GY4 A;  2R4J A;  3PV4 A;  1DSU A;  1YF4 A;  3N7E A;  4NZQ A;  3EGK H;  1W0Y H;  2Y0Q A;  2CF9 H;  4Y7B A;  2CMY A;  2FX6 A;  4P00 A;  1OSS A;  1WBG B;  4KP0 A;  1IN7 A;  3SJK A;  5EOK A;  3T38 A;  4JI5 M;  2JKH A;  3A7T A;  3M7U A;  3B9F H;  3GP1 A;  5HIZ A;  3TJO A;  1BTY A;  2K47 A;  2BLO A;  4CHA C;  3NRL A;  2MR9 A;  3LGT A;  1NHW C;  3QO6 A;  1I94 M;  1M9U A;  2W6J D;  3KYF A;  1SXJ C;  2OBO A;  1IBL M;  3HJS A;  3U6S A;  1QAM A;  1J09 A;  1GI9 B;  1S85 A;  3S9B A;  3ZVE A;  1JRS A;  1W3C A;  3SAV A;  3P8F A;  1HV7 A;  1O0D H;  5T6G A;  3TK6 A;  2BM2 A;  4U32 A;  4QHT A;  3A8B A;  2XLJ A;  1HLT H;  1EJM A;  3DT0 H;  1C1U H;  2B5T B;  2ASU B;  2QIQ A;  3A46 A;  1EFR D;  3T25 A;  1GHZ A;  1TGT A;  4CHA B;  3C9P A;  4GC9 A;  8KME 2;  1TDH A;  1CHO F;  1B0F A;  2SGP E;  4GHT A;  4KLN A;  2DE8 A;  3KNX A;  1C1N A;  2CGA A;  1RTF B;  1SXJ B;  3TGJ E;  3SAU A;  2K0B X;  4YOJ A;  3A88 A;  1ZAE A;  1AUA A;  2CE7 A;  3FUU A;  3VFD A;  2XEP A;  4YLU A;  3LH3 A;  1XUF A;  4W5W A;  2EST E;  5SGA E;  2W7S A;  2ZP0 H;  4RSP A;  2QCU A;  2RFK C;  3RXU A;  1ZOM A;  2BY5 X;  3UQO A;  3H4M A;  1QL8 A;  2VII A;  2XOK D;  1H9I E;  1MAB B;  1JWT A;  3MH4 A;  1QB9 A;  3QGJ A;  4UON A;  5GJ4 B;  3FYC A;  2BDH A;  1O3I A;  3LQQ A;  4RNA A;  4R7G A;  1GLN A;  2HPQ H;  4P02 A;  2KRU A;  1O2U A;  1NRS H;  4FD2 A;  1IXR C;  3ZYD A;  1H9H E;  1UTQ A;  2VIV A;  2ZPR A;  4GLY A;  2UU9 M;  3KOX E;  1F5R A;  1GVK B;  3M5M A;  1P3Q Q;  1SLV B;  2BQW B;  4JZ1 A;  2DWZ B;  5F8X A;  3U5Z B;  4DV6 M;  1CBW C;  4IJF A;  4XK8 F;  2AIQ A;  4ISI H;  1C5L H;  2HRV A;  2OC0 A;  1EX3 A;  3SHG B;  4LF5 M;  4F49 A;  4WJG 2;  3FUT A;  2FES H;  2DI0 A;  1IQP A;  4OU7 A;  1WU1 A;  3SFZ A;  5IT9 S;  1G41 A;  2FP7 B;  2PUX B;  3FN8 A;  3SV6 A;  1NV9 A;  1XWI A;  1PPE E;  3I01 M;  2VB0 A;  2XCN A;  3KQE A;  3NBX X;  3GPU A;  2QXI A;  3RXP A;  2PP6 A;  4U01 A;  3TGI E;  1ANC A;  2FOB A;  1EPT C;  1ORF A;  5IDK A;  1CGJ E;  3SW2 B;  3ATK A;  1GMD G;  4LJA A;  3SHF A;  1CBW B;  3L28 A;  2SGF E;  3F6U H;  2KXE A;  3KL6 A;  3LT3 A;  2C93 B;  1WQV H;  1AE5 A;  4A1T A;  4IGD A;  2J34 A;  2BLV A;  3SYJ A;  4IN2 A;  1IQJ A;  1T4V H;  1GL6 A;  5EP2 A;  1TBQ H;  3DUX H;  4X1N U;  2FOI C;  2ZFP H;  3RXG A;  1IHT H;  3BN9 A;  1K28 D;  4IC6 A;  1GWA A;  1FPH H;  1GL1 A;  2CHA C;  4BLC A;  4REZ A;  1BBR K;  1NM6 A;  2Z3E A;  3U28 C;  1L2B A;  4K1S A;  3PO1 C;  1EPT B;  3PWC A;  5CE1 A;  1Z5C A;  1E37 B;  1TPA E;  1UCY H;  2IPQ X;  1IXS A;  1QL7 A;  2Z9I A;  4JI0 M;  1V2J T;  1T8L A;  1VCQ A;  1L4D A;  3RXD A;  1QFK H;  2C99 A;  2QXG A;  4X2X A;  2QSF X;  1UK4 A;  2ULL A;  2I6S A;  1L1J A;  2FYQ A;  1TQ7 B;  1CA0 C;  2PR3 A;  5GIB A;  2HAL A;  3LPR A;  1Z59 A;  3U6O A;  1AKS A;  1KXE A;  1UK2 A;  2BY9 X;  1OFH A;  3TE6 A;  3VXE H;  3GIC B;  1BIO A;  3GLF E;  2CHA B;  1NES E;  5C20 A;  2BLQ A;  2DAM A;  1TQ0 B;  1VIT G;  3SV2 H;  3PO1 B;  2DUC A;  4UEH H;  2A4G A;  2ZBK B;  2ZDA H;  3M3V A;  4X6N A;  3WHL A;  1QJ1 B;  4NIV A;  3HHY A;  1QBV H;  4ZHA A;  4B71 A;  3GLH B;  3LW5 F;  1CA0 B;  1FN8 A;  2IPH A;  1PJT A;  1QRW A;  1CE5 A;  1HNE E;  2EI7 A;  2JDI D;  3PVS A;  1P10 A;  4B6F A;  5DN6 D;  4FXG H;  3JR5 A;  1VKY A;  4NL4 H;  3E0P B;  4UFE H;  2VGC C;  2BD4 A;  1L1N A;  1GI2 A;  1MAX A;  2BQ6 B;  3VKG A;  2VIP A;  5CHA C;  1VJ9 U;  1KLT A;  1C5P A;  5IWA M;  3HK6 B;  1V2K T;  4WH6 A;  1XXH E;  2Y6T A;  1YUB A;  2LNH C;  1K1J A;  1NBM E;  4KO8 A;  3ZYE A;  1E9R A;  1THS H;  2OOA A;  2DZO B;  1PGY A;  3H09 A;  4Y8Z A;  2OCV B;  1MJG M;  4J2Y B;  5EXT A;  1AIX H;  1BB0 B;  1TMB H;  1NJF A;  3ILK A;  2F5Q A;  1MX0 A;  2F5P A;  1QHR B;  2WHX A;  4MNV A;  3GS9 A;  1SL3 A;  1Y5U T;  4DOQ A;  4DT4 A;  3I51 A;  1KXD A;  3U1J B;  4DR3 M;  2VGC B;  1Z71 A;  2ANK H;  1PJQ A;  3T62 A;  5CHA B;  1SBW A;  4ZMA H;  2WSS D;  5B6L A;  1FAX A;  1JMO H;  2YNB A;  1Y59 T;  2ALV A;  2PKS C;  2ODP A;  4XGI A;  3B8J A;  5IYT A;  1G3E A;  1H9L B;  1GO5 A;  2CJI A;  1J15 A;  2WUC A;  3S69 A;  2O01 F;  1AMH A;  3BV9 B;  1HYL A;  2ZC9 H;  4JI2 M;  4NA8 A;  1N33 M;  1C9T A;  1EE8 A;  2OIN A;  1ZHR A;  2BJW A;  2H1U A;  1HPG A;  2ALP A;  3L2A A;  4B73 A;  1P11 E;  1KDQ A;  1GJS A;  2XZF A;  3GLI B;  1P04 A;  1OKS A;  1C4V 2;  1YLN A;  2PKS B;  2VBC A;  1E9S A;  1VG5 A;  2FH0 A;  3V76 A;  1RXP A;  3AL0 C;  1QAN A;  2SGD E;  3QYE A;  1PM5 A;  3VDP A;  4WXI A;  1A5G H;  4JCN A;  2XXL A;  4Z6A H;  3E6P H;  1C1V H;  1G36 A;  3FTC A;  2OP9 A;  5GWZ A;  4IIW A;  2BD8 A;  5E0G A;  5L2Z H;  4EST E;  4NGA H;  4ABG A;  1CSO E;  2SGE E;  4D8N A;  3HGP A;  4HG6 A;  2FLR H;  1GHB F;  1MAY A;  3TIT A;  1ZJD A;  3A83 A;  4O97 A;  1K2I 1;  4IBI A;  4LJ7 A;  4Q7J A;  3LCV B;  1GBB A;  1WDI A;  4MPW A;  3E91 A;  1GVN A;  4IW4 E;  4TY6 A;  5C94 A;  1GBJ A;  2WPL S;  1E94 E;  1GJC B;  1ARC A;  1K21 H;  2ZFQ H;  3H5C B;  4GKK M;  5GCH F;  1OWJ A;  4OS7 A;  2ZQ1 A;  3UWJ H;  1G32 B;  4SGB E;  1FY4 A;  1D0L A;  2D1J A;  1T43 A;  4XBB A;  3K2U A;  1T31 A;  4DV5 M;  4JYU H;  4MTB A;  5ITY A;  4CRC A;  1HJA C;  2NQ8 C;  4MM3 B;  1ACB E;  1TB6 H;  4DW2 U;  3P95 A;  4ZXY H;  1TH3 A;  2KAI B;  3F1S B;  1D6W A;  1HRT H;  1NRO H;  1ZSJ A;  1GVL A;  1RIW C;  5EXX A;  1G37 A;  4G4Q A;  3VXF H;  3W0L B;  3THG A;  2GCH G;  4OS5 A;  5DP9 A;  1SGP E;  2XYA A;  5AFY H;  4A92 A;  1GBF A;  1H8D H;  3T28 A;  1NPM A;  2D7H A;  2Y5H A;  1SXJ E;  4A6L A;  1FY8 E;  3SAT A;  1ELD E;  2G55 A;  1IQH A;  2UWL A;  3W67 A;  1TAW A;  1OTR A;  1TX6 A;  3EQ0 H;  4NSV A;  3FRI A;  3J2P B;  2Z9G A;  3MU0 A;  4K8Y A;  1W10 U;  4X6M A;  5AFZ H;  1HJA B;  1SLX B;  2HNT C;  4FUB A;  3SND A;  2Y0T A;  4I8O A;  1P2O A;  1BTU A;  1RIW B;  5DSF A;  4MPU A;  1V3X A;  1YBW A; 
#chains in the Genus database with same CATH homology
 3SV9 A;  3AFH A;  4A1V A;  3FUX A;  3TWM A;  1IXS B;  4LF6 M;  2QPA A;  1CU1 A;  3TWK A;  1DGH B;  3M7G A;  4B7F A;  3GQ4 A;  2KCP A;  1DXW A;  4LJ8 A;  4QNR A;  2FFJ A;  2QV1 A;  1PJI A;  3OAA D;  4OVZ A;  4X64 M;  4I32 A;  3U6E A;  3KSJ A;  2GGV B;  3R9X B;  1HNX M;  1KMH B;  4HLQ A;  2LEL A;  1L8Q A;  2CHG A;  1Z5A A;  4FET A;  4Q63 A;  3ZH9 B;  5EQT A;  5C17 A;  3ZIA D;  2E5L M;  2IJD 1;  1NJG A;  3KP1 E;  2J7O A;  3L27 A;  1IN4 A;  3AOG A;  1Q3B A;  5A2Q S;  1IM2 A;  1H8E D;  5F3W A;  3KSX A;  3U6P A;  5EQS A;  2CFO A;  5EXS A;  3N7D A;  1J5E M;  5FTJ A;  5FPY A;  4MB7 A;  5JI2 E;  1R2Y A;  3O8R A;  4LY6 A;  5FTK A;  3TQS A;  3GQ5 A;  3JR4 A;  1HNW M;  3EIE A;  1IBK M;  3GQ3 A;  4GHA A;  2OC1 A;  3O8C A;  2C96 A;  4M9Z A;  4LZZ A;  3C58 A;  2FE8 A;  2HHH M;  2H1R A;  3RFW A;  4AZF A;  4DR6 M;  2YNM D;  5KPT A;  4Z1M D;  4DV4 M;  2V1C A;  4DUZ M;  4B3S M;  2ZAO A;  4I81 A;  2CK3 D;  1GL7 A;  4NWK A;  3NRL A;  2XSZ A;  3PFI A;  3QAU A;  4A3V B;  3AOE C;  2AHM E;  3O8D A;  5GPI B;  4ZCN A;  2F5S A;  3KVW A;  2Y21 A;  4LFC M;  3WW7 A;  1QZM A;  3UJN A;  4QOS A;  2UUA M;  2KM0 A;  3J7B A;  2V1U A;  5FLX S;  1J7K A;  4RI0 A;  4MH0 E;  1IBM M;  4DV1 M;  1L2C A;  5CHB A;  4IBG A;  1Z6T A;  4MGH A;  3UK6 A;  1DO2 A;  2QBY A;  3OFN D;  2L6O A;  1K82 A;  3PXG A;  2L09 A;  2K1Q A;  1QAO A;  1YE9 A;  2F5N A;  3P8O A;  3OYP A;  4NXN M;  3UMM A;  3HHW A;  3GLF B;  1Z5B A;  2XF3 A;  2YR0 A;  3FKE A;  4WH8 A;  3U5Z A;  2V6Z M;  3DFZ A;  3JAM S;  4LFB M;  1DY8 A;  4JI6 M;  1FX0 B;  3U61 B;  2QE7 D;  3F2F A;  3QWL A;  4X65 M;  3KFU G;  4QNM A;  4DR7 M;  3HHZ A;  3KDS E;  4JXJ A;  4L78 A;  2ZAM A;  4PCZ A;  4IBB A;  3SC3 A;  3DSP A;  1S6L A;  5ESB A;  3AV0 A;  2C98 A;  4LCB A;  5EP3 A;  5F53 A;  2L7I A;  3OTP A;  5ITT A;  3SUE A;  5IK2 D;  2I7P A;  4NRW A;  4LF8 M;  2AHM A;  1XMO M;  4LRT A;  5FTN A;  1FJG M;  3FTD A;  4WF8 A;  1Q39 A;  2A5Y B;  2DZN B;  2L7H A;  3M0E A;  4M9X A;  2CUZ A;  3KS8 A;  3LOX A;  3U1I B;  4FWH A;  3LKW A;  3IG5 A;  4FCT A;  2M2A A;  4NWL A;  5C0T A;  4DV0 M;  4XD7 D;  4TUW A;  3LON A;  5DSF A;  3VKH A;  3WWB A;  1HT2 E;  5E26 A;  3GLG A;  2IJO B;  3SMP A;  2OPF A;  4JV5 M;  3VDU A;  5ITR A;  3MK6 A;  3J7A S;  2D7G A;  1IY2 A;  4G4O A;  5C1B A;  1NY5 A;  4LF7 M;  2FOM B;  5FL7 D;  1QVR A;  2A4Q A;  1KSF X;  3MJ5 A;  4LJ9 A;  4JN6 A;  5BPV A;  5ETX A;  3VLF B;  2CV0 A;  4DV7 M;  1HQC A;  3KN2 A;  3PNY A;  3UB0 A;  3HGI A;  4DUY M;  1NSF A;  5EQR A;  3RC6 A;  1HNZ M;  2W82 A;  2QF4 A;  1JXP A;  4R3D A;  3MHV C;  2Z7J A;  3RGS A;  4DR2 M;  4L16 A;  2BNK A;  3KXE C;  1N32 M;  3L6P A;  5FPT A;  3SV7 A;  4LF4 M;  2OC8 A;  4HL4 A;  4DR4 M;  5T1V A;  3SYL A;  4GH9 A;  4B75 A;  1DXP A;  3E90 B;  3D8L A;  4AQY M;  3A42 A;  3SAW A;  3OE7 D;  4EIW A;  5FSW A;  1G4A E;  1L2D A;  4TT3 D;  2YOL A;  3FD9 A;  1NHG C;  2C9C A;  1IN8 A;  2W6I D;  4WUR A;  2OK5 A;  4B7H A;  4XBO A;  3T1Y M;  3VG8 A;  3W1E A;  3KOZ E;  3GRY A;  3T15 A;  3SUD A;  3HJ8 A;  2YMS D;  3FYD A;  4JI7 M;  4ASU D;  5HKK D;  1SKY E;  2LXE A;  5FTL A;  2Z4R A;  3VK7 A;  3DA1 A;  1G8P A;  3E9S A;  4FVM A;  2UXC M;  1G3I A;  1H6U A;  3GLH A;  5DYI A;  5KO3 A;  2OC7 A;  3TPZ A;  5C18 A;  5JI3 E;  1L1T A;  4M9S A;  3F3B A;  4JI3 M;  3M6A A;  1X37 A;  4KTC A;  1JR3 D;  2R46 A;  3HKP A;  2C9O A;  4NRV A;  3SMS A;  4D81 A;  2P5T A;  3PNV A;  1G59 A;  2JA2 A;  5EP4 A;  3FO8 D;  2M5Z A;  2DWM A;  2R4J A;  1N36 M;  3N7E A;  4PDI A;  2EA0 A;  2K0Q A;  4R8T B;  1R7R A;  2KRK A;  2KR7 A;  3M5L A;  2Y0Q A;  1KFV A;  4FWG A;  1IN7 A;  3IG8 A;  4CGY B;  4DV3 M;  4L4U A;  3T38 A;  4JI5 M;  3GP1 A;  2K47 A;  4I5S A;  3OTO M;  4MGY E;  1TDZ A;  1NHW C;  1DO0 A;  1I94 M;  3Q8X A;  5IRE B;  3E4R A;  4GIP A;  2UUB M;  2W6J D;  1SXJ C;  5ITQ A;  1IBL M;  2OBO A;  3HJS A;  3U6S A;  1QAM A;  1J09 A;  3KOY E;  1BMF D;  5ITX E;  3GO8 A;  1W3C A;  2Q2E B;  3SAV A;  4IBC A;  4NSR A;  2CV2 A;  2A4R A;  3RC5 A;  3SU4 A;  3DSO A;  3SV8 A;  4QHT A;  4TYD A;  2XLJ A;  1N75 A;  2HLD D;  3LVV A;  4M0D A;  2HCB A;  2KFW A;  4MGZ E;  1R6B X;  2HKJ A;  1KYI A;  4B3M M;  4YY3 M;  3GRV A;  3A46 A;  4LJ6 A;  4L8R C;  1EFR D;  1RTL A;  2XFT A;  3SU0 A;  2JJ1 D;  4YHH M;  3SZE A;  4GC9 A;  1E1Q D;  3AJI B;  1TDH A;  1L1Z A;  4KLN A;  3KNX A;  2DVW B;  1SXJ D;  5C0U A;  1SXJ B;  1XC8 A;  1MU5 A;  2JJ2 D;  3PRB A;  4YXW D;  2KZU A;  2FM2 A;  3F0P A;  4NXM M;  3SAU A;  2O8M A;  3GLF A;  2JIZ D;  4B7G A;  1ZAE A;  2R18 A;  3SU1 A;  3N99 A;  2CE7 A;  3TWL A;  3FUU A;  4AKG A;  3VFD A;  3GLI A;  2XEP A;  4NOO B;  2RGO A;  1PJJ A;  1DY9 A;  2LH0 A;  4W5W A;  4PD2 A;  2DXI A;  3AK5 A;  4G6Z A;  2F5O A;  3CF2 A;  2QCU A;  5EP1 A;  2G5G X;  3FUV A;  3BOS A;  2CHV A;  1E79 D;  3H4M A;  4M9F A;  2VII A;  5ITX A;  2XOK D;  1MAB B;  2KEB A;  3OEH D;  5IZ7 D;  8CAT A;  4A1X A;  1WXR A;  3K92 A;  4RF0 A;  3GPX A;  3SUG A;  1XMQ M;  5GJ4 B;  3FYC A;  2RGH A;  4AW4 A;  5KPR A;  2QBY B;  3LQQ A;  4RNA A;  1S3S A;  1GLN A;  2XGN A;  4R7G A;  4BB9 A;  1E32 A;  2KRU A;  4QHS A;  4FD2 A;  1IXR C;  1XHB A;  1XXH A;  1T3T A;  4KHP M;  1COW D;  2D7E A;  5DYG A;  2UU9 M;  3KOX E;  3M5M A;  3VK8 A;  4FCW A;  1NBM D;  2DWZ B;  4FW9 A;  2EO2 A;  2K8I A;  3U5Z B;  4DV6 M;  4IJF A;  3F2H A;  3HU1 A;  2OC0 A;  3SHG B;  1D2N A;  4AG5 A;  4LF5 M;  2V7Q D;  3FUT A;  1VDD A;  1IQP A;  4OU7 A;  3M5N A;  2F4V M;  1BT7 A;  3SFZ A;  2KA6 B;  3A45 A;  1N77 A;  5IT9 S;  1G41 A;  3K8Z A;  2FP7 B;  3FN8 A;  3D8B A;  5H37 D;  4QOZ C;  1XWI A;  3SV6 A;  2DWN A;  2XCN A;  3GPU A;  4U01 A;  3RC4 A;  5IDK A;  1FNN A;  2ZAN A;  4AKH A;  3U6L A;  4ZPX A;  4JMY A;  3U6Q A;  4LJA A;  4OW0 A;  3U6M A;  3SHF A;  4B3T M;  2RKO A;  5EJC A;  4II7 A;  3L28 A;  4B3R M;  2XND D;  2J5U A;  2KXE A;  3LMM A;  3NWL A;  1RGQ A;  4LGM A;  3KP0 E;  3FKS D;  3P8N A;  4A1T A;  3U60 B;  1ZQ9 A;  3SYJ A;  3GRR A;  1GL6 A;  5EP2 A;  1NNU C;  3W0F A;  4BBA A;  1NNJ A;  2FOI C;  2F9V A;  1TH2 A;  2WZQ A;  1I4W A;  3UGJ A;  1R2Z A;  4X62 M;  3GLG B;  5LMN M;  2XFS A;  4REZ A;  4IBD A;  4KOD A;  4BLC A;  5KPZ A;  4OM9 A;  1L2B A;  5FPS A;  1Z5C A;  3M5O A;  4IBE A;  4AI6 A;  3FUW A;  4JI0 M;  1DGH A;  1QAQ A;  3J27 B;  1W5S A;  2C99 A;  4LRS A;  1N78 A;  2F4L A;  1JR3 A;  4K8B A;  3UZU A;  3K1J A;  4G4R A;  2ERC A;  3K2L A;  1NVM A;  3I4V A;  3OEE D;  1W0K D;  3ZC7 B;  3SU5 A;  1Z59 A;  3U6O A;  4JI4 M;  2P59 A;  2KZ4 A;  1OFH A;  1W5T A;  3TE6 A;  2XCF A;  1HT1 E;  2C5R A;  3EIH A;  3GPP A;  5KQD A;  4I33 A;  1IN6 A;  2EUC A;  4PT5 A;  4I31 A;  2A4G A;  1OFI A;  4S12 A;  2ZBK B;  4P16 A;  1DGB A;  3WHL A;  3HHY A;  3SU3 A;  5KQ8 A;  3GRU A;  4IBK A;  1W0J D;  4B71 A;  3GLH B;  2UXB M;  2WPD D;  2FNA A;  2BJV A;  4Z6Y A;  5ITU A;  2JDI D;  4B6F A;  3PVS A;  3FTE A;  2KCY A;  5DN6 D;  3KF2 A;  3JR5 A;  3KS4 A;  4B6E A;  2KW0 A;  1Q3C A;  2X4A A;  4NL4 H;  4OVZ B;  1YSY A;  4LJ4 A;  2CV1 A;  4B76 A;  4FCV A;  3VKG A;  3KW6 A;  3SYK A;  4IBJ A;  5IWA M;  4WH6 A;  5BR8 M;  3AKZ A;  4FWD A;  1YUB A;  2LNH C;  1NBM E;  4KO8 A;  1XNR M;  1E9R A;  3T1H M;  1HQY E;  3B9P A;  2DZO B;  7CAT A;  1SXJ A;  3H09 A;  5EPY A;  5FTM A;  3R8F A;  5EXT A;  4F55 A;  1C1K A;  3TL4 X;  1WXQ A;  1IY1 A;  1NS3 A;  4DV2 M;  2R62 A;  1NJF A;  2LWX A;  3GPY A;  3ILK A;  2F5Q A;  1MX0 A;  2F5P A;  2WHX A;  3SUF A;  4DT4 A;  4LFA M;  3GS9 A;  2YQZ A;  1HR0 M;  3I51 A;  2XZU A;  1IXZ A;  3CTW B;  3U1J B;  4X66 M;  2VQF M;  4DR3 M;  3CF0 A;  4LG2 A;  4GMQ A;  3AOE A;  2G8L A;  2VQE M;  3U61 A;  4I4L A;  3HU2 A;  5E6J A;  3SBJ A;  2WSS D;  5H4I B;  5B6L A;  4L15 A;  1LV7 A;  1OJL A;  2XSZ D;  3DZD A;  3I4Y A;  4XGI A;  3ZCB B;  3SU2 A;  4CIS A;  4JYA M;  2OBQ A;  1IN5 A;  5GND A;  2OQ4 A;  4GIT A;  3WWF A;  4JI2 M;  4LJ5 A;  2O5R A;  4GKJ M;  1N33 M;  3FOA A;  2R45 A;  1EE8 A;  4MGK E;  2OIN A;  4JI1 M;  3O8B A;  2ZM6 M;  5LMU M;  2XH9 A;  4B74 A;  4TSF D;  2Z4S A;  2M60 A;  3LVW A;  2BJW A;  2HL7 A;  3HHX A;  2CHQ A;  3J80 S;  2DHR A;  1QQW A;  2QZ4 A;  1TGU A;  3L2A A;  3FTF A;  2KCO A;  3PV2 A;  4B73 A;  1N34 M;  4G4N A;  2XZF A;  3DOA A;  3HWS A;  3GLI B;  2VBC A;  4GRI A;  1E9S A;  4D80 A;  3AL0 C;  1QAN A;  3SU6 A;  2GVF A;  3HJQ A;  3VDP A;  1IY0 A;  1PM5 A;  4B08 A;  4AKI A;  3L29 A;  3FTC A;  2X8A A;  4IIW A;  4JI8 M;  2XNI A;  4DR5 M;  4LF9 M;  2YFQ A;  3KEE A;  3PRD A;  4GC5 A;  4DR1 M;  3F0O A;  1DGF A;  3DCL A;  3U6D A;  4OX9 M;  3L26 A;  5EXP A;  4IBF A;  4LGY A;  3RE8 A;  3NBI A;  4IBI A;  4LJ7 A;  3SAR A;  2CEA A;  1XXH B;  1GVN A;  4AG6 A;  4D82 A;  1N1L A;  1K3W A;  2F43 B;  1GKI A;  2Y20 A;  1E94 E;  5GKN A;  3U60 A;  2R65 A;  4CHT B;  4Q4L A;  1NY6 A;  4RF1 A;  2UXD M;  4GKK M;  4LZJ A;  3CF6 E;  2J7N A;  2R4E A;  4K0K M;  4M0W A;  5EPN A;  1TH4 A;  5EQQ A;  3RGP A;  2I7N A;  4DV5 M;  5ITY A;  2NQ8 C;  4MM3 B;  4Z8X A;  2KCA A;  3PV5 A;  1TH3 A;  2YMS C;  5EXX A;  4G4Q A;  3W0L B;  3THG A;  1K3X A;  3F2G A;  4NSO B;  4ITQ A;  3KOW E;  2QEN A;  1A1R A;  4A92 A;  1E1R D;  1DGG A;  2F9U A;  3L25 A;  2D7H A;  1SXJ E;  2Z3X A;  3U6C A;  5DNY A;  3SAT A;  1JQJ C;  2QF5 A;  3A98 B;  3EYD A;  3J81 S;  5CDF E;  2KZS A;  2X49 A;  3J2P B;  3WHK A;  1H8H D;  3HU3 A;  1ORY B;  2QP9 X;  4PDG A;  2WV9 A;  2Y0T A;  4MGI E;  4I8O A;  1XNQ M;  3SAS A;  1OHH D;  4IJE A;  4GHL A;  1UM8 A;  1QYR A;  2DWL A;  3LQR A;  2YMS B;  4WW0 A;  2UUC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...