2L6OA

Nmr structure of the protein yp_926445.1 from shewanella amazonensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MGAGQTPHPQLIWPALLKQQGCNELLPLRTNDDWQRFCADSKHLLQYGDKLVDSNFHCFVLEEDAHWHPAAPLPPEGLNDLIRAHCATLGHCCTSKMHLHSVMDAIDFLNALEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein YP_926445.1
publication title NMR structure of the protein YP_926445.1 from Shewanella Amazonensis
rcsb
source organism Shewanella amazonensis
molecule tags Structure genomics, unknown function
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13642 DUF4144 protein structure with unknown function
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.650 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l6oA02
2.40.10.320 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2l6oA01
2L6OA
chains in the Genus database with same CATH superfamily
3BG4B 1QL9A 1QQWA 1OFIA 3CGWA 2F5PA 4X65M 1O5GH 1MD8A 2XW9A 2R0IA 3HU1A 1W12U 5GNDA 4LY6A 5LPEA 3KEEA 5FCRA 4KP0A 2BQWB 3FO8D 3SJ8A 1QAMA 1WGNA 1YC0A 1K28D 1ZSJA 3ZZCA 5H37D 2C4FH 1O3KA 1G37A 1VJ9U 3RGPA 3MQKC 4YO9A 1IQGA 1MJGM 3MTYA 4AW4A 1L1TA 1NRQH 3HHWA 3GY6A 2BWBA 5LH8A 5E2OA 4NA7A 3RXRA 1AKSB 3UK6A 3UIRA 1D0KA 4NWKA 1QRZA 3RGSA 1TPOA 2PP6A 2SNVA 1DX5M 5G4BA 2LPRA 3O8DA 1TDHA 4NRVA 5CHBA 2J5YA 4L16A 3O8CA 2Q6DA 2SGEE 1D0LA 4DIHH 3GDVA 4DVAU 1WIVA 5KEDA 1AIXH 3SJIA 1AB9B 1O34A 4OVZB 4UD9H 1E36B 1EZUC 1R7RA 4GC9A 3DSPA 1KXCA 2DI0A 2BVRH 3U98H 1GDNA 1T4UH 3ZVAA 3GLIA 3SHCH 3SV7A 1C9TA 3M5LA 3K9PA 4ZHMU 2GTBA 1MTNB 1EUFA 4LJ6A 1HAYB 1D3QB 2HLDD 1QZEA 3TPZA 1C5WB 1YY3A 2RA0A 2XRCA 3ZVDA 1B7XB 1AUTC 3LGYA 4E05H 1SSXA 1GJTA 2OUAA 2ANWA 3RXBA 1Y8GA 4QNRA 2IN2A 4X62M 2WYGA 2OD3B 4DV1M 1F92A 4NFFA 3RU4E 3GLFE 1THRH 1Z8JB 2J38A 3VDPA 3GCTF 4IC5A 4D7FA 4I32A 1GBJA 3QO6A 1TNGA 3EE0B 2DAEA 2FH0A 1BTYA 3IHPA 3LDXH 4I31A 2Y7ZA 3K9XB 1AY6H 3ZYEA 4M9XA 1P2IA 3FRIA 1FUJA 1P2JA 5T6FA 1EFUB 5FX6A 5EQRA 1HAHH 1S84A 1TQ7B 1AZZA 1FXYA 2AMDA 1YLAA 5JBTA 3IECA 4A1VA 2XSZA 4Z6YA 1SGYE 1BTXA 2CV0A 1AWFH 2A45B 5EXNA 2FOAA 4OS7A 2NU4E 1UVPA 3MNSA 1A7SA 3ZVFA 6ESTA 1THPB 2HNTE 2F9NA 2KFWA 1L2BA 1Q2WA 3DFJA 4AZ2B 1NU7B 1GJBB 1GI8B 3PYHA 1V2UT 1GI1A 1V6DA 3V12A 1WV7H 1SB1H 2H5XA 4CH8B 1OQYA 4TPIZ 1GI7B 5B6OA 1FNIA 1R5LA 3FTCA 2G5VA 3P8NA 1J15A 1EOLA 1O2JA 2I6QA 3BTDE 1AFQC 1C5XB 3A7XA 2JY8A 3AKZA 2ZC9H 4YOJA 3UJNA 2H1UA 1GO5A 3TGIE 4ANRA 1OYTH 1MBQA 1L2CA 3GY2A 4AX9H 1XMQM 2GV7A 1IBMM 3J7AS 2HWJA 1JBUH 4AKIA 1OPHB 1NO9H 3LIWA 2O8LA 2ZHEH 3DA1A 2GCTC 2AHME 1GHAG 3RXOA 3A80A 1BBRK 5A0AE 2WPKS 2A2QH 3GPYA 2A2XH 3FP6E 3BBZA 1SGQE 1VCPA 1F2SE 5BPVA 3KDSE 4HG6A 3SARA 5IT9S 2ZDMA 4FU8A 1KXDA 1JRSA 1CSOE 1CHOF 1HNEE 1IN7A 1DSTA 2DAGA 2C5RA 2ZKSA 3C3EA 3A7WA 5ITXA 1JR3A 4FW9A 4Q63A 1YUBA 1UO6A 2Z3XA 3HGPA 4UE7H 2VH6A 2UWPA 4OS1A 3MJ5A 3N99A 1RIWC 3RMNH 3M5MA 3QLPH 2LHCA 3KOWE 3MFJA 4Y11E 3LU9B 2LVQD 1NSFA 1GKIA 4JCNA 1KXBA 4Q7YA 1K1PA 3GPUA 4ZCNA 3L33A 1NN6A 4DR2M 1AN1E 1S6LA 4FD2A 4X6NA 4BAOB 4KTUA 3STJA 6GCHF 2G5GX 2ZU4A 3KN2A 2ZTZA 2VU8E 1UVUH 1BA8B 4NIXA 1O38A 3HX3A 2RA3A 2VJ1A 3U60B 4GVUA 5EQSA 4A1XA 2LBCA 1IBKM 1GMDF 1O5FH 2ZTYA 1O3HA 2RDLA 1UCYH 1DWDH 4JI4M 2EEKA 3MU4A 3GQ4A 3VPKA 1VEKA 3VG8A 1SOTA 3FUUA 3VKGA 2AIQA 1ZJKA 3GY5A 3HKIB 5E2PA 5C1BA 2C3SA 5K7RA 4NSOB 1AVXA 2DZOB 2XSZD 1O2IA 5EP1A 2VB0A 9LPRA 1DXWA 2CF9H 2W7SA 3GRVA 4FUGA 1X37A 3PXGA 3HHYA 1BZXE 4IGDA 2ZWLH 2Z4RA 1ZRKA 3FOAA 4JI6M 1BT7A 1GDQA 3EQ0H 2P5TA 2XFSA 1LPZB 2GJGA 1K1MA 4F1IA 3KQCA 3PV4A 3G01A 3N7OA 4OGYA 1VG5A 4G4NA 1EZSC 2YQZA 3D23A 1ZAEA 5TCAA 6CHAC 1TGNA 1K22H 3SC3A 4BXSA 2AMPA 5DJ7A 5A09A 1PPHE 1P04A 4JK6A 4K5ZA 1WJ7A 2R18A 4B08A 1ARCA 1MX0A 2VIWA 2GMTB 3OSYA 3SUGA 3F6UH 4U32A 4AORA 1DLKB 5ITUA 1PPGE 2BHGA 2ZGJA 1GBCA 5FX5A 2XNDD 1E37B 3UNRA 4KELA 2BD8A 3I78A 3F2HA 3TJNA 4DIIH 1G59A 1SXJE 4SGAE 3JAMS 4XRNA 3SASA 3NBXX 1NNUC 1GHBG 1NHWC 3K9OA 4LJAA 2GD4B 1LV7A 1T43A 1BRAA 2Y7XA 3ATLA 3H4MA 4A6LA 1O2RA 1SLUB 1TGTA 1S5SA 1PPCE 3AAUA 1GI3A 4JI7M 1XC8A 1O35A 4CH2B 3SBJA 1OWDA 1GJDB 1P3EA 1JQJC 2HAKA 1ABIH 1ANEA 1BMAA 2BB4A 4DR5M 1T6OA 1TMUH 1J09A 5JDUB 2DZNB 1O2ZA 1XKBC 2CV2A 1KDQA 2KCAA 2FOMB 1INCA 1JR3D 5EXSA 3MO6A 1GJAB 1PPBH 3CF6E 4IW4E 3UB0A 1YCPK 1FJSA 1T7CA 2EI7A 2O5RA 4DV0M 1LVMA 1GG6C 4Z0KA 3IG8A 2F43B 3ZVEA 3E16B 5DP3A 1NPMA 2AEIH 1F0UA 1TRNA 4MDSA 5C67A 1AU8A 1WOFA 1YPLH 1C2HA 4OU7A 1ZR0A 1F0RA 2QXIA 4X8TH 3IITA 1W0ZU 2BXTH 1B0EA 1HJ9A 4BTTB 2ZHFH 4O3UA 1EPTC 3U8RH 4LXBH 1C5UA 1UVOA 1O32A 3DCLA 5ITRA 1NRPH 1TRMA 2DE9A 1ETSH 2QCUA 1FIZA 2AS9A 3VLFB 2FNAA 2BLWA 4GKJM 3PV2A 3A8DA 1XWIA 1UTPA 3L6PA 4D81A 3FZDA 2BDYA 3PRBA 4G4OA 3GLGE 2N35A 1F5KU 4G4QA 2JIZD 4O97A 1QAOA 3NBIA 4B7FA 4JV5M 1EP5A 1TALA 1G4AE 3RUOA 2J2UA 1TGUA 3UWJH 5A0BA 1JB0F 2M5ZA 4FUBA 4Q7ZA 1O3OA 2K0BX 5C1XA 1OTRA 1LKAA 1HDTH 1UVTH 4M9SA 1L1ZA 3A87A 2BM2A 4AFUA 2QPAA 2PTCE 5KPRA 1Z6TA 4ZHLU 2JETC 1LVYA 1W13U 1IXRC 2F9PA 4MLFB 3B8JA 1TH2A 3LGUA 2ZDNA 5EXTA 1O3FA 1O5EH 4B2CA 7ESTE 2B3TA 4S12A 3Q3KA 5GXPA 2W7UA 2ZDLA 4Q7JA 2C9CA 2XC0A 5C3NA 2DAKA 3GPXA 1VKYA 1ZMNA 3ATMA 1BOQA 2JJ1D 4KTSA 1IQNA 1ZTKA 2J98B 4B3TM 1TBRH 2GGVB 1G71A 2JZ0A 3Q3XA 3HGNA 4ABFA 1YPKH 1C1MA 1D3DB 5A8XA 4AQYM 3CF2A 1DGHB 3FP8E 1A3BH 2FTLE 1H9IE 1HYLA 5EXXA 1RXPA 1ZV1A 3BTME 3SYKA 1G41A 4B71A 4JYTA 3KNXA 1GHAF 2CF8H 4HLQA 1DUAA 4LJ9A 2LWXA 2WINI 1KXAA 1HIAB 4B2AA 3FKEA 2OC7A 5AF9H 4X6MA 2D8WA 4X1NU 4AN7A 1TLDA 1GI2A 2MJ5B 4DW2U 3A82A 5JB8S 4CHAC 3U9AH 2GCHG 4JK5A 1JIMA 4MPWA 1D0MA 4WWYA 4M9ZA 4REZA 2ZFTA 1O2XA 4QOSA 1ELGA 1O2PA 4LJ8A 4MVNA 3TVJB 3E0NB 3RFWA 1IQKA 3RXHA 1GMHG 2C90B 4FCVA 1EJAA 3OY5U 1V2VT 1O3EA 5AFZH 1E0FD 2HNTC 1V2MT 4CBNA 2W6JD 2FWWA 1H8DH 4YM9A 1O2HA 4CRDA 1TR8A 2ZFSA 1XNRM 5HGGA 1TPPA 3MWIU 4B76A 5DG6A 3QZRA 1ZHPA 2FI5E 2DE8A 1FN8A 5GPIB 3B7NA 1ZPZA 1HUTH 1Z1JA 3WHKA 1LDTT 2VIIA 4NSYA 3RMOH 3Q3YA 1IY1A 4I8GA 2MR9A 3SGAE 3DSGA 3GISB 3FP7E 1O5AB 1THSH 5EODA 4XGIA 1I4WA 3NXPA 2UUCM 1P01A 2R2MB 3KHVA 4XBCA 1QDTA 4NFEA 1IQPA 1O36A 2WV5A 2VIQA 3B9PA 2D7HA 1J8AA 4K0KM 1QB6A 3T26A 1TQ0B 4FETA 5KGOA 1W14U 3UNQA 2AMQA 4JI3M 1H9HE 1C1KA 1ANDA 2A7CA 5FPSA 2KAIA 2PKSB 4NIWA 1HNZM 4YXWD 1BB0B 4M0WA 2P8OC 2NU0E 1FY5A 4LJ5A 4JZFH 1EJMA 3SAWA 2RCEA 3KF2A 2DWNA 2B9LA 1ZRBA 4K2YA 2AFQB 1EB1H 2QP9X 5LMUM 3M61U 3PO1B 5EJ1A 1W7XH 1EPTA 1CBWC 3LKWA 3NK8A 2BDBA 1BMLA 4LRTA 2WZQA 2KRKA 1KXFA 1IHSH 1IQFA 1P10A 4PT5A 3BTWE 2ZECA 5AVDA 1S82A 2C8ZB 3ZZ7A 4B6FA 1AQ7A 1PJJA 5EIYA 3NZIA 4K1EA 3HJSA 1C1RA 2JUJA 4RKOB 7GCHG 1SGIB 1MZAA 3A7VA 3HGIA 4MNWA 1CA0B 2M60A 2G3QA 1XUIA 2Y5HA 4LOYH 1I94M 1C1WH 3S7KB 4CR5A 3MH7A 3HZJA 2XBWA 3VKHA 1RTFB 1MN3A 1FV9A 2JH5D 4INLA 1CE5A 3S0NA 4CRCA 3N7DA 4CISA 3ZZ5A 1IXZA 2AYWA 2IJD1 3LGVA 3SV6A 1D4PB 2G8LA 3NUMA 4QNMA 2EI8A 1VGCC 8CATA 4B1TA 1QR3E 4E7NA 2WSCF 1NU9A 2LH0A 2BJWA 2Y6TA 3TL4X 4L78A 2OINA 4MGKE 5SGAE 1QCPA 4GKKM 2F4VM 1EIJA 4MTBA 1CVWH 1LTOA 3U6LA 1SFIA 1V2OT 2QCYA 4IBLH 4IBEA 2ZBKB 2EI6A 4ZXXH 1YLNA 1OKXA 4X1RU 3RXUA 3RM0H 1LTMA 2KR7A 4DUZM 3ZQJA 1EASA 4WY3A 3ILKA 2GT8A 1TNJA 1VR1H 4OGXA 2VIOA 4HI3A 2QZ4A 1HRTH 1RTKA 1PYTC 3GLFA 1OWEA 4XBBA 4AC9A 3L27A 5EP4A 1UMAH 3P8GA 4RSPA 5C1YA 1EKBB 2D26C 1G3DA 2R4EA 3RXAA 1RD3B 1SXJC 4Y0YE 1IAUA 1XNQM 4ZKOU 1K1LA 1O2NA 1SG8B 3D49H 3PNVA 5C0TA 1Y3WA 4GPGA 3OU0A 3TK5A 2KNVA 1RJXB 1IN6A 2ZGXH 3A84A 3J27B 1BTZA 2A7JA 1KLJH 1IY0A 2UWLA 2Y82A 4G4RA 1CGIE 1ETTH 1C1SA 3HPTB 1OHHD 2P94A 2VNTA 1DUEA 5E0JA 3RXPA 4X66M 2V1UA 1EQ9A 2BDCA 1MMJN 1P06A 4A7IB 3SAUA 2HRVA 2JY5A 1ELCA 1GCDA 2JY6B 2GDDA 2EJSA 3EIEA 1XXHB 1C2IA 1T8MA 4UFEH 1XUJA 2FPZA 2YOLA 2QYIA 2AH4X 4LFBM 3FTEA 4FCWA 1VQ1A 2DAIA 2IPHA 3LH1A 3M35A 4MPVA 2R0KA 3S9AA 4G3OA 3D65E 2X49A 3RU4T 4BTIB 4WXVA 4ABEA 3HU3A 1CUKA 2Y20A 3LGIA 2HL7A 1QDRA 1V2WT 1EAUA 3UR6A 1SHYA 3GY8A 1CA8B 1G2MA 2ALPA 4R71A 1TMTH 1KLIH 1G3BA 5DP5A 4H6TA 4IN1A 1PQ8A 2ZGCA 3FYDA 3KIDU 2AHMA 1AZ8A 4X6OA 1SHHB 2UUBM 3SBKA 2BNKA 2O01F 2BY6X 5IREB 1NBMD 1YPMH 2CXVA 1MAYA 3FFGA 4BAMB 2GCHF 2QA9E 1SLWB 2WV9A 3BTGE 2ILNA 3RXGA 1F7ZA 4HFPB 2GNOA 3KL6A 4TY6A 1QBNA 2F4LA 2RG3A 3KQEA 4FVBA 3QWLA 3MU1A 5GCHG 2W82A 1QRXA 1E9RA 1UTLM 3F3BA 3K2UA 2YNAA 1ZGVA 2XCFA 1LKBA 1O3MA 2FI3E 3A81A 1C1PA 3STIA 1BBRH 4JZIA 2VGCC 2PUQH 3ZZ8A 2EKKA 1S3SA 1A5GH 3A7TA 4X1QU 3GRYA 2WPDD 3PTBA 1A4WH 1YE9A 3RU4D 1PJTA 1LHCH 2P16A 4ASHA 3EE7A 1CT4E 4GC5A 1BRCE 1LMWB 2G55A 1V2QT 4I7YH 1RU3A 1GJ6A 3TPIZ 4IBKA 2F5QA 2FS8A 4RN6A 2BDIA 1KYNA 1BRUP 4GUXA 1QB9A 4KHPM 3TH3H 2XFTA 5KQ8A 2P3UB 4YOIA 1TX8A 3BOSA 1HAVA 1G9IE 1QQUA 2C8XB 1P2MA 1MD7A 1GI4A 5CHAB 3IG6B 3U6OA 4QHTA 8GCHG 1HT1E 4MGHA 2VQEM 4FUJA 1O3DA 1DGFA 4B3MM 2FXRA 2F3CE 2ZO3H 1C5LH 1ZYOA 3VGCC 2FM2A 5JBCS 1GHWH 3PVSA 1LVBA 1DM4B 1F0SA 4D9RA 2DAMA 3GLIB 1K1JA 4OS2A 2QXHA 4CGYB 2V6NA 2CV1A 2OBQA 3M5NA 4WJG2 4IBBA 4YT6H 2QXGA 1WXQA 3UMMA 3R9XB 1GMCG 5C5NA 3KCGH 1C1OA 3P17H 3OTJE 4P17A 1BCUH 1OAOC 3I51A 4X8SH 1NJFA 1W0YH 2G52A 3BTQE 4Z1MD 5CE1A 1FDPA 5GDSH 1KXEA 1GBTA 1SVPA 4AFSA 3MNCA 7GCHF 3P95A 1C5NH 4M9FA 2K6BA 4LFAM 2CN0H 5LGOA 2APLA 2CHAC 1NC6A 1HNWM 1TOMH 2B0FA 1DGBA 2WHXA 4GAWA 2B7DH 1C2GA 4IMQA 1N77A 1FY3A 1BHXB 2ZEBA 4FUDA 3LH3A 1O2QA 1TPAE 1Z71A 4KKDA 1FPCH 5L30H 1W2KH 1SR5C 1P2KA 1SBWA 3BTKE 1C5VA 1K3XA 1Y5BT 4AG6A 1MABB 1O2WA 2A5YB 2DNAA 3DFLA 3SMSA 2P59A 5TCCA 3PNYA 5A8ZA 4DR1M 2KDLA 2R45A 4MGYE 2FMJA 1GJCB 2NU2E 2ZDVH 5EXMA 4RT0A 5ESTE 3FN8A 1PQ5A 4JI8M 4XK8F 2Q6GA 1GBDA 2V35A 1EATA 3BN9A 4FVDA 5T1VA 3FAOA 2JP7A 2AGEX 3U28C 1NRRH 1S85A 2KEBA 5FPYA 1P11E 2WZJA 4LFCM 3KS4A 6LPRA 5KO3A 2Z9GA 4AFQA 5F53A 1HJ8A 1GGDC 5EGMA 3KOYE 4IS5A 5I25A 3GY4A 3SV2H 2YFQA 3MH6A 4KLNA 4Y7BA 1SOZA 1EOJA 3TWKA 1AUJA 1G36A 4P16A 1O3AA 2G00A 1L1NA 5ABWA 3GLGA 1A0JA 4VGCB 2P95A 3CTWB 2VF7A 1OJLA 1AE5A 1Z8RA 3BV9B 1BJVA 3E3TA 5LPRA 1O2KA 2LP6A 2ZGBH 4PROA 5F8ZA 1J14A 4X1PU 3RXCA 4L15A 5KQDA 1YLCA 4ZAEA 2OO9A 3RLYH 2FX6A 4ZKRU 3QUMP 1OWJA 4THNH 3OFND 2R6FA 1OOKB 5FPTA 3EGKH 2KZSA 1V3XA 2F9OA 4ISHH 4I8JA 3H5CB 1GBMA 2NU3E 3HWSA 4GHQA 2W3KA 2ZI2H 3MU8A 3E21A 4NXMM 3E46A 2BXUH 1NROH 3U6PA 4NIVA 1OFHA 1C5OH 1PYTD 3AJIB 1C1UH 2FTMA 2VWLA 3TNSA 3UNSA 3VFEA 1V2TT 2M5TA 2QF4A 1JMOH 1SQTA 2WUCA 3GY3A 2BY5X 2KXEA 3W94A 3WY8A 4X1SU 3U5ZA 4FUCA 3I4YA 3L26A 1OSSA 3GCNA 1NS3A 3BEFB 1QJ1B 5KPZA 2MROB 2CHGA 1QZMA 1QNJA 1V2LT 2R3YA 3ZZAA 1DE7H 4UFGH 3S69A 2XLJA 1PJPA 2ODQA 4WF8A 3GYMA 3P6ZB 2P93A 5E0HA 4AG2A 4DUYM 4HEOA 4Y71A 1K2I1 4BAKB 1GBHA 3WW7A 2A5AA 1HLTH 4MM3B 2VIPA 1TH3A 2J7OA 1C4Y2 2ZHDA 3AK5A 3E4RA 1WDIA 1G32B 3U8OH 5KPTA 1P9UA 1A3EH 4I8LA 1UFZA 1GVLA 5EQQA 1HJAC 3RMMH 2D2DA 4LZ4B 5GCHF 2J5UA 3IG5A 4BAHB 1T8NA 2ZANA 3ZVBA 3RXIA 1R6BX 3VXEH 4CBOA 1DO2A 3KW6A 1LQDB 1VCQA 2LELA 2BLQA 4I8HA 1K1IA 4R7GA 4CIZA 1C2LA 4KO8A 2CFOA 3I04M 4LG2A 1MKXH 4P02A 1D6RA 1T32A 5BPEA 2K47A 2LTUA 2WPHS 3SV9A 1L0ZA 2ZPSA 3E6PH 1UW7A 4BANB 2DENA 3S9CA 4WMDA 1PJQA 4JI1M 1H8HD 1DV0A 2C8YB 2QN5T 2ZQ2A 3F2FA 4B75A 4JXJA 2J7NA 5E0GA 3E1XB 2KA6B 4AKHA 4MG3A 1C4V2 1F5RA 3VB6A 2NQ8C 4Q80A 5EJLA 8GCHF 2BQ7B 3RXFA 2C96A 1N8OC 3SU2A 1EE8A 4FWDA 5L6NH 1KDQB 1W5TA 4UFFH 1GJ9B 4MQAA 1XXFA 1C1VH 3GPPA 3BIVH 2KCYA 2C9OA 1S0QA 1UK2A 1ESTA 2VDBB 4FWHA 2O8WA 1V92A 1N33M 1NY6A 5ITYA 5BR8M 1UTJA 1SFQB 2EC9H 2PFEA 2TPIZ 3SJKA 1O5DH 2HKJA 2YMSD 3FYCA 2EKFA 1EAWA 3SO3A 1GMCF 2R65A 2FI4E 1AFQB 2Y80A 1N75A 3F9HA 1TB6H 2R44A 1OP8A 9ESTA 2M2AA 2QBYA 1Y3UA 1QB1A 1ZLRA 2OTVA 4ISLA 7CATA 1ANBA 1D3TB 1M9UA 5A2QS 3RMLH 1MU5A 1NFYA 1HR0M 4BOHA 4UFDH 4F48B 1SGFA 1C5YB 2GCTB 3MNXA 1O3LA 1UTKA 5C94A 1A2CH 5GWZA 2IJOB 1K9OE 3PMBB 3UQOA 1ZMLA 4R0IA 1E79D 1GI9B 1OKSA 4FUEA 2R0LA 3HU2A 2OP9A 2L6OA 5T6GA 1K0HA 1TX6A 4XSKU 4B7GA 4DJZB 2AIPA 3A8CA 1XUHA 2XTTB 1BQYA 3E90B 1TABE 5C1UA 1L4ZA 1BRBE 1FY4A 3J81S 3QZQA 1HAGE 1ZZZA 4XDEA 1R2YA 1NTPA 2FFJA 2XGNA 4IJEA 1UTQA 1GI5A 1SGTA 3MHWU 3V13A 2PW8H 4GCHG 1QJ7B 2V3HH 4TPYA 1RIWB 5A2MH 4ZHAA 3A83A 2WYJA 3PROA 3K8ZA 2QNJA 3QYEA 1FNNA 3A98B 3SZEA 4FWGA 3SNAA 4FUHA 5EG4A 3QX5H 2TGPZ 1SG9A 2OQ4A 2JJ2D 3LQQA 1QUSA 4XBOA 2J9NA 3RLWH 1TNIA 4DV5M 1IOEA 2LNHC 4JI5M 3PMAB 5DP6A 2WPJS 1OIZA 2FO9A 2XWBI 1C2DA 1FN6A 1EXFA 1HXEH 1YP9A 4IMZA 4JYUH 2BDGA 1QYRA 3LQRA 3MHVC 3W0FA 4B7HA 8ESTE 1TF0B 1C2JA 3HJQA 3O8BA 3RC5A 3VFDA 3LPRA 1NM6A 3DFZA 2GZ9A 3UFAA 3PLPA 5HIYA 1WAYB 3M7TA 3FUTA 3W68A 3HK6B 4GHTA 1GCTC 2TGAA 1SGFG 4I5SA 3SJ9A 1HB0B 1TGSZ 3M3TA 1G3IA 4DCDA 2E5LM 1OAIA 1MBMA 4KODA 3E8LA 4TUWA 5HXFA 4D76A 1P05A 2GQFA 1XMOM 5DYGA 3ZZ6A 1O5BB 5C20A 6CHAB 2BWEA 1MZDA 2ODYB 2BOKA 3PM3A 4NC6A 4Y7AA 2FESH 1WSSH 2KW0A 1DWBH 1V2PT 5E26A 1N6XA 2KM0A 1DANH 3AW1A 1ELBA 3FZZA 1NFUA 3GLHE 2XH9A 2QQ8A 4DY7B 1FI8A 1AVGH 2UU9M 4D7GA 4DR7M 2YNMD 1BUIA 1L1JA 1QL7A 2ANKH 4MPXA 4NZLA 4INHA 4NA8A 3KQ5A 2BX3A 1J7KA 4M0DA 1HCGA 3M7GA 1X7AC 3Q00A 1BHXF 1YM0A 4TSFD 1GJ4H 4X2WA 5F8TA 4CJ6A 1BITA 1P3QQ 2ZFQH 1PFXC 1H8IH 1UCYK 3FKSD 2VH0A 1SL3A 1LVOA 1Q3CA 1O2MA 3TK9A 1XKAC 1XHBA 1GHXH 3MH5A 1O3PB 1UK4A 2ZU5A 2SGFE 1HAIH 2BZ6H 4M7GA 2FYQA 5EU8A 5EP3A 4X8VH 1C9PA 1IQHA 2LVNC 1NY22 2OCVB 4LF6M 1P9SA 2HPQH 1VZQH 1IQJA 1GBIA 4ISNA 2KAIB 1G8PA 2VQFM 2R9PA 3QWCH 2BD4A 1L1GA 5L8RF 3H7OA 1GG6B 5HKKD 2BD9A 4DV7M 1AI8H 1QA0A 1L2EA 2WV4A 2TGTA 2OOBA 1GJ7B 3QTOH 2C98A 3VB4A 1P2QA 2F9VA 2GV6A 4F49A 1C5TA 3O8RA 2BD7A 1ACBE 4ITQA 3KYGA 1QUTA 3A88A 5DGJA 1FLEE 1Z8IB 1ZMWA 1EPTB 1J9CH 2JKHA 2F9BH 1YLDA 3JR4A 2FLBH 4D9QA 3TIUA 2L4FA 3DZDA 3ATWA 1C2FA 2PTNA 4DGJA 1MTVA 3T38A 4HL4A 2V3MA 3M37A 4D82A 3U6DA 1K21H 1YYY1 2GP9B 3F0PA 1QY6A 2DZLA 4YHHM 3KVWA 1SGDE 3T1HM 2OC8A 1TFXA 1KIGH 2HALA 2UUAM 4O3TA 4O9VA 1XUGA 5FL7D 1GVNA 3SI4H 1TTEA 3SUFA 3GOVB 1ELVA 2A5KA 4FUIA 3RXMA 3FTDA 3J80S 3EDXB 5JBBS 3PV5A 3ATIA 2W5EA 3F1SB 1N78A 3M5OA 2R2WU 2JETB 4K69A 2VWOA 1QAQA 3RXKA 3UOPA 1O2LA 2DHYA 1YPEH 3Q76A 1TONA 3OY6U 4CHTB 3KOZE 3ZV9A 1GHBF 1QANA 3BTFE 3ELAH 2BD2A 2HWLB 3ZV8A 2A7HA 2PLXA 5I46H 3MU5A 2OC1A 1OIPA 1OWKA 4ZMAH 3SNBA 1T8LA 4AYVB 2PKAB 3K92A 2F5SA 3TGKE 2W26A 2OC0A 3SUEA 5JI3E 1O5CB 1Z1IA 1FIWA 1O0DH 2WPMS 2CMYA 2FODA 2BY9X 2ZU3A 2ZCKP 4JI0M 3BSQA 1HFDA 4NZQA 1QTFA 2LVPC 2UXBM 4MB7A 3GLFB 2FDAA 2SNWA 2VIDA 3SATA 1D3PB 3I4VA 1TAWA 4Y0ZE 3BEUA 4XD7D 1SGRE 5IYTA 3FUVA 1K1NA 2KX4A 4ABDA 2V7QD 1MCTA 2ESTE 3D62A 3A45A 2KCPA 4CHAB 4ABGA 4DT7B 3VK7A 2PKAA 4AG1A 5F3WA 3K6YA 2IPQX 2DVWB 2PWXA 1GHZA 3QTVH 4K8BA 3LGWA 2C8WB 1HAOH 4PDGA 1BVSA 3M3VA 4EIWA 4A1TA 1QHRB 4YLQH 3F2GA 1GL7A 2FOBA 4BAQB 4GSOA 3VB7A 1A0LA 1CT2E 2ZIQH 4GCHF 4ACAA 1P0SH 1NESE 3ZZDA 1FQ3A 4CRBA 3HJ8A 3GDSA 4LZZA 1SGEE 1O3NA 1EAIA 1BTHH 4X6PA 2XBVA 1UVSH 2CP8A 1H8ED 2A0QB 2XBYA 2QF5A 4IBGA 1DLEA 3C3DA 2GT7A 3BG4C 2EUCA 3SNDA 5K0HA 2JY7A 1NZQH 3DD2H 3M0EA 2A32A 3E9SA 1O30A 2RFKC 3CF0A 1QBOA 2UWOA 3GQ5A 3A42A 5C18A 1ETRH 3V0XA 4ESTE 1COWD 4II7A 2RRUA 2B8OH 2ZZUH 2LXEA 2FS1A 1XUFA 2OQUA 1IN8A 1MKWK 1O39A 1UK3A 1Y8TA 1L2DA 3GCHB 4NXNM 4XFQA 1TGBA 1S6HA 3BXWA 1JRTA 4ISOA 4CRFA 2GX4A 4LZ1H 1ZTLA 4OS6A 3RXVA 4GRIA 3MNBA 1NNJA 1Y3VA 2WUBA 3GRUA 2UXCM 5HYOA 3LW5F 1O2GH 1TDZA 3ZIAD 1LCYA 2P8OB 2GDEH 4JZDH 4Q7XA 3DT0H 5DN6D 1NFXA 1W0JD 4ABAA 1W8BH 2JDID 3AW0A 2XC4A 2D7EA 1AB9C 3FE3A 1DOJA 4KTCA 5HM2A 3OEED 4UN2B 3SQHE 1Q39A 3ODDA 4WXIA 1Q3BA 1C5SA 2XEPA 1CBWB 1E1RD 4W5WA 3QK1A 1Y59T 5JB9S 5H4IB 5BRRE 3LCVB 2Z4SA 4CREA 1MTNC 1QURH 2Q6FA 4DBGB 2ZFFH 1GBBA 3JZ2B 1HV7A 1NV8A 1XVOA 3CS0A 3SZNA 3W95A 4ABJA 2XWAA 2KCOA 3QGNB 2G51A 1Y5UT 3ZYDA 2FIRH 2L09A 3SU3A 3KSXA 2TBSA 4WVPE 2ZPQA 1EAXA 1UTMA 1GABA 4WW0A 4IN2A 1GMHF 3SU4A 1WTGH 1Z7KA 2FYRA 2HHHM 4DR6M 2HPPH 3NCLA 1FZZA 2K0QA 4LF9M 1HAVB 3V3MA 5IDKA 3EA7A 3LJOA 4UEHH 1BMMH 4LCBA 3RP2A 1VGCB 3SN8A 1Q31A 2V6ZM 1KYIA 1SGNE 3K2LA 3M36A 2KHHA 3MI4A 2LNCA 3U6MA 1O37A 2ANYA 4TYDA 2SGPE 1CHGA 1QA7A 3PLKA 1LPKB 4INKA 1C1QA 1SLXB 1A1RA 3SYLA 1EZQA 2ASUB 3EA9A 4Y10E 1F5LA 2L7IA 2OQ5A 1O3CA 2OBOA 3RXLA 3BEIB 3U69H 3UZUA 3KXEC 4ZKNU 3WWFA 3KYFA 1PJSA 4TWYA 3AOGA 1AVWA 3FRHA 1UHBA 1DY9A 1LQEA 2CJIA 2ZP0H 4FU7A 3TH4H 1PM5A 3UAIC 1PPZA 2TRMA 3VEQB 4IBCA 1FPHH 1O33A 1E35B 3AASA 5EPYA 1DICA 3TK6A 3BG8A 4YTAA 4WP2A 2ZTDA 2XNIA 4F4OC 1O3IA 5GKNA 7KMEH 1ESBA 1HPGA 4MNXA 2GKVE 3EAJA 5FHTA 1DXPA 2PGQB 5T3HA 4ABIA 4QT8C 3R8FA 3HHZA 1SXJB 3T29A 2ZG0H 2ZPRA 1WUNH 1PRBA 3H4JA 5FTKA 3LC3A 3ZZ9A 1HAXB 1NT1A 1GHYH 1G3CA 1AIPC 1JXPA 1UCYE 1VITH 4FOUC 4YOGA 4D80A 5EJCA 5B6LA 2Z8YM 5DNYA 1W11U 5FTLA 3OX7U 4FU9A 1YF4A 1CT0E 1SMFE 1IN4A 4WURA 2HVYB 2XZFA 2H9TH 4J2YB 1NVMA 1FAKH 2ZU2A 3V7TA 2H9EH 1VDLA 3I01M 1O2TA 3C1KA 3OYPA 3DOAA 2O8UA 3PMJA 1CO7E 1QIXB 3L2AA 1SXJA 5FBIA 3Q77A 3S7HB 1MQ6A 3BTEE 4AB9A 1YBWA 1EFRD 4Y28F 1QJ6B 2SGQE 3NWUA 4OS4A 2QSFX 1IFYA 2Z94A 4H4FA 4LGMA 5FTNA 1YPHE 2W3IA 2Z9JA 3E91A 1CU1A 4SGBE 2BY8X 5JPMH 1DT2A 3GCOA 5HM9A 2Q2EB 1ELDE 2UUKB 1NBME 2V0BA 3MH4A 3SOSA 1IN5A 1NJGA 5JBAS 4TY7A 3KGPA 2DWMA 2BY7X 5DFLA 3SAVA 2QXJA 1OYQA 3JR5A 3U61B 1W3CA 2EQNA 3CENA 4WH6A 4Y76A 5DKMA 3OTOM 1PJIA 2ZTCA 2BDHA 1ZMJA 3U6CA 1GL1A 2BOHB 1ORFA 1GDUA 4NOOB 1GVKB 1AKSA 2QAAA 4U01A 2H1RA 3LMMA 4AOQA 1N1LA 2HGTH 1C5ZB 3AFHA 1E1QD 5DP4A 3UUZA 5JYIA 2THFB 3THGA 3GLGB 4KGAA 1Y3XA 3RXSA 4DURA 4Y8YA 4CRGA 5DK1A 1D6WA 1ZMUA 3LT3A 4ZPXA 1DGGA 3B9FH 3U61A 1GI6A 4OX9M 3FUWA 1GJ5H 4OVZA 1O2SA 3HKJB 3TJOA 1ELAA 1ELTA 2ZNKH 4JN6A 4MNYA 1QGFA 1IY2A 3UPEA 2FOIC 8LPRA 1YCPH 2SGDE 1XX9A 1TMBH 3PWCA 1P3CA 2I6SA 2G4TA 2D7GA 1HQYE 2VGCB 2GZ8A 3PRDA 1AUAA 2Y0TA 1C5PA 4I8KA 2YMSB 3OEHD 5ETXA 4A3VB 4LF7M 1H1BA 1TH4A 3LGTA 2CWBA 2F83A 1KLTA 1ORYB 4BTUB 5AHGH 2KNZA 2XF3A 1IHTH 2GMTC 5FBEA 2JNHA 1GBKA 5EW2H 2ZCHP 2J34A 1L8QA 4X2YA 3GO8A 1LHDH 2J92A 4NIYA 3M7QA 3U5ZB 3HHXA 5LMNM 4RKUF 3SU1A 1ELFA 3HY5A 2AGGX 2LVOC 1PPEE 2R4JA 1C5MD 3OTPA 3KFUG 5J4SA 3A7YA 3MK6A 3A8BA 4OS5A 2F9UA 1HBTH 3RXEA 2ZAMA 1FAXA 1AGJA 4L4UA 1TNKA 5FLXS 1GBEA 2DWLA 3GLHB 1YKTA 2Y21A 1SQRA 1EZXC 4NG9H 1F4IA 2NU1E 5FTMA 1A5IA 2Y5GA 3R0FA 2Z3CA 3T5FH 3T27A 2J95A 3VGCB 2VVCA 1ZMVA 1GLNA 5DO4H 4E06H 1Z6JH 4I8OA 1SXJD 2EO2A 1ZTJA 4X8UH 3NWLA 3VDUA 4AG5A 1JIRA 2UUYA 1XXHE 1KFVA 1A61H 2PUXB 4X0WU 4Q4LA 4ABHA 2VF8A 1DITH 1KSNA 2BYAX 2WPLS 4ISIH 1S6FA 3BF6H 5C5OA 1JOUB 5C0UA 2CHVA 2FEQH 1GJ8B 4NCYA 1V2JT 5L2ZH 1UTNA 3GLHA 1Z5AA 3FD9A 2BVXH 4RF1A 2R3UA 4IC6A 2ZDKA 2SFAA 5EOKA 3UGJA 1DFPA 2JH0D 2BD5A 1YGCH 1V2RT 1WBGB 3SW2B 1GWAA 2ZFPH 4TT3D 4KT0F 2HLCA 4HZHA 1O2UA 5J4QA 3GP1A 2FOHA 4DOQA 4FCTA 1HGTH 2CHAB 1WGLA 4AI6A 1WQVH 4DV2M 3LCUA 3PB1E 1TA6A 4IBDA 3L25A 1MTWA 2STBE 2QENA 3GYLB 1IQIA 3LC5A 2KNAA 3AV0A 2ZFRH 2HNTF 1MH0A 2ZHWH 4UDWH 4ZH8A 1GHVH 3SORA 4K1SA 4CR9A 3W0LB 1LPGB 1YCPM 2CK3D 3HK3B 2F5OA 1ANCA 3URCA 4K1TA 4L8RC 2L7HA 1SLVB 3CP7A 1Q02A 1P57B 1N6YA 5CDFE 3LVWA 5F03A 3MO3A 1TA2A 1RRKA 5LPFA 5IWAM 3VXFH 1TX7A 3JZ1B 3SGBE 2CRUA 3P70B 3KP1E 1C2EA 4DR4M 5CMXH 3PMHB 2BX4A 3ZZ3A 2Y81A 3TITA 4RF0A 1Z8GA 3NPSA 1AO5A 5ITTA 4FXGH 4BLCA 1VEGA 3ODFA 2QBYB 1C2KA 1KTTB 2ZF0H 1GGDB 3FANA 1T31A 4RKJB 2VWNA 1S81A 1MTUA 2LVAA 3U60A 4NA9H 1ZQ9A 3P8OA 3SHFA 2BLVA 3SI3H 1W5SA 4NGAH 5HMAA 2MGWA 5HIZA 5EXPA 2VWMA 1E38B 2VVUA 3VB5A 1SPJA 4DV6M 2DHRA 1Z6EA 1IQMA 1G2LA 5EXLA 2CGAA 3T62A 1WU1A 3N7EA 4B73A 1OX1A 3NRLA 3MOCA 1JWTA 3I29A 1Y3YA 2RDEA 1NHGC 3L3TA 3AOEC 2CHQA 1IBLM 1KTSB 5A8YA 3QYBA 4L6V6 2DXIA 2ZDAH 3KQBA 1W10U 5TJXA 3GLIE 2I7NA 4JZ1A 1DWEH 1W7GH 1Z5BA 2QHOB 1E34B 2RGHA 1MUEB 2X8AA 1PPFE 2V3OH 2K1QA 4XBDA 2R62A 1Z5CA 4LJ7A 2TGDA 4I33A 1TNHA 4E7RG 4WMEA 1NV9A 2NWNA 2J94A 4MNVA 1C1TA 1GBAA 4GITA 4LF4M 2A31A 5EW1H 2FLRH 1NO1A 1AWHB 3KSJA 1ZGIA 3MYWA 1PQ7A 4OM9A 1ZOMA 1HXFH 4X2XA 1C1NA 2Z7JA 1SQAA 5EP2A 2ZAOA 1KY9A 4CRAA 3SU6A 3TLOA 3EA8A 1TPSA 1PGYA 2I7PA 1NRNH 2G81E 2ZCLP 3SJOA 4Y8ZA 4AYYB 1V2ST 3K1JA 2XZUA 3SYJA 2QE7D 1ELEE 1J17T 5GJ4B 1AHTH 3EIHA 3Q8XA 1MTSA 2ODPA 5ITQA 2OLGA 3UR9A 1AD8H 4JI2M 1J16A 1QRWA 1WTHD 2PSYA 3HATH 3DA9B 1HJAB 4HTCH 3S9BA 4MPUA 2G8TA 2Z3EA 1RS0A 3WWBA 1HAZB 1G30B 2B5TB 2H5DA 2PKSC 4F55A 3B89A 4RNAA 3ITIA 3R3GB 5FXLA 5T6DA 2Z9KA 1D9IA 2ZQ1A 1VCWA 3PFIA 3B7QA 5DSFA 1EX3A 1YWUA 3A85A 1NY5A 2RKOA 1O2OA 1WXRA 2FE8A 1DPOA 2BJVA 1E9SA 2XYAA 2ZGHA 3PO1C 3SQEE 5DPAA 3ZC7B 1YPHC 2O9QA 2W6ID 4D8NA 4GHLA 1H4WA 5F8XA 1A0HB 3MU0A 2L4EA 2R46A 4HGCA 4NSRA 3SMPA 1SGCA 5EPNA 2HVXA 2QF0A 1VITG 1P2OA 1V33A 3IWMA 2EA0A 3U1JB 1IM2A 1QFKH 2K8IA 4IBJA 3A89A 1TBZH 1VJAU 3FTFA 1CA0C 3BIUH 2ERCA 1XB2B 1WYKA 1AMHA 5DP9A 1IXSB 2O8TA 2FZZA 3QGJA 3J7BA 1N8OB 4TWWA 1LO6A 2UUFB 3W67A 3QDZB 4JMYA 1FMGA 2VVVA 3U1IB 3LVVA 4B3SM 1DS2E 1TBQH 2IOTA 2JWSA 2ZHQH 1EJNA 1GI0A 3SNEA 1K82A 1SI5H 1O31A 4LF8M 4XE4A 1OWHA 1C5RA 1QZ8A 3BTHE 1BJUA 3CS7A 3MMPA 3PTNA 1ZJDA 4I81A 4PD2A 1JR3E 5ITXE 1N34M 2YNBA 1CGJE 2QGRA 1KSFX 1MKWH 3GS9A 4AB8A 1W0KD 2DKLA 1Y5AT 2A4GA 2K9DA 5IZ7D 3SHAH 2A4QA 1MKXK 1IXSA 1FX0B 2J98A 4PCZA 2PGBB 3BTTE 3DUXH 5F6MA 3C9PA 4GHAA 3GDUA 3SUDA 3D8LA 1EP6A 2UUJB 2A5IA 2DWZB 4RT1A 2A1DB 4K60A 1HJPA 3C27B 2D1JA 1GVZA 3A86A 4FUFA 1DGHA 3FUXA 3DSOA 3ESTA 4A92A 3B7ZA 2WSSD 1TWXB 2OPFA 4I86A 3TGJE 3SU5A 2XC5A 4ACBA 1EB2A 3GY7A 3U6EA 1T3TA 1P8VC 2P3FH 5E6JA 3VK8A 1BMNH 1V2NT 3W1EA 3OE7D 4ASUD 1CQQA 1HIAA 3AL0C 2VIVA 3VB3A 4DT4A 1BTWA 3A8AA 1DDJA 2FOCA 1CGHA 3ZH9B 1SGPE 1U6QA 5AFYH 3T6PA 2FP7B 1BIOA 3DHKH 3T25A 3AOEA 1V2KT 1HNXM 2QC2A 2BTCE 1DO0A 3LOXA 1VDDA 4B74A 4H42U 3SHGB 1VEJA 4OW0A 3HKPA 1G3EA 1ZHRA 1F0TA 1GBFA 3SU0A 3TU7H 3L28A 1O3BA 3UY9A 3UQVA 1XM1A 2H2ZA 1HAPH 3QN7A 1UJ1A 1O3GA 2H5CA 2JXNA 3TWMA 1FY8E 1ID5H 4Y6DA 5DP7A 2EY4C 1MCVA 4A5TS 3GCHC 3PWBA 4AKGA 3TQSA 1A5HA 1LHFH 4PDIA 2JZ1A 1BBRE 5FCKA 2WSFF 1QVRA 1C5QA 1MAXA 1NFWA 1K1OA 2FX4A 2QV1A 2VBCA 4YT7H 1TYNA 2Z3DA 3RE8A 4RI0A 1GJSA 3TNTA 4IBFA 2VINA 3U6SA 3F0OA 3ZZ4A 4Y8XA 2CEAA 4X2VA 3RXQA 2XCNA 4DR3M 1TOCB 1XUKA 2C99A 1GL6A 3B74A 2A4OA 1GCTB 1T8OA 4R3DA 3C58A 1ZSLA 4QOZC 3ATKA 1UM8A 4DV3M 4LRSA 3T1YM 1DVAH 2BMGB 2J97A 3F9GA 3SV8A 2OK5A 1R2ZA 5IK2D 4NL4H 3GRRA 1O3JA 3F9EA 4MH0E 4BXWA 3TWLA 4LK4A 1OS8A 4IIWA 1SC8U 1WCZA 1FONA 4GIPA 2PR3A 4AGKA 3RC6A 2RGOA 1P2NA 2XOKD 3AAVA 2F91A 2ULLA 4K3JA 2KZ4A 5KECA 2C93B 4F2LA 2BLOA 3ZVCA 2ZM6M 1FJGM 1OP0A 4FVMA 1QBVH 2O8MA 2G5NA 1N32M 3EYDA 3U8TH 3UWIA 3M3SA 1FY1A 2BZAA 4U30A 2CE7A 2DUCA 1LHGH 2QIQA 3TH2H 3ZZBA 3GICB 3P8FA 2XBXA 3P92A 3TJUA 2Q1JA 5E8EH 4NSVA 3RDZA 3RXDA 1QL8A 3B23B 4R8TB 5EJZA 5EQTA 4JZEH 1Z59A 3GCTG 4DG4A 1BMFD 2KRUA 4B6EA 1YSYA 3L29A 3K6ZA 3RM2H 2XXLA 2V1CA 5L2YH 2AGIX 2BD3A 3SFZA 1J5EM 1P02A 2ZA5A 3A7ZA 4WH8A 2FS9A 5FAHA 1A5TA 3RXTA 5CHAC 4BB9A 2H6MA 3MO9A 4AZFA 1P09A 2P3TB 1RFNA 5FSWA 1TIOA 2H9HA 2PSXA 1C7YA 2J4IA 8KME2 1SKYE 1GL0E 4NWLA 4IBIA 1B0FA 2X4AA 3LJJA 4BNRA 3H09A 3U6QA 5C17A 1AFEH 2QF3A 2QY0B 1GBLA 2EA3A 4P00A 1MU6B 3K65B 1ABJH 5A0CA 2Y5FA 2GVFA 1PQAA 3J2PB 1B5GH 3F92A 1IQEA 4X64M 3TJVA 1K3WA 2Y0QA 2HOBA 3OAAD 1C2MA 3SGQE 3KQDA 4YLUA 2Z6BD 1IQLA 4YZUA 3T15A 2UXDM 2BDAA 5FTJA 2STAE 4JYVH 1SQOA 4BBAA 1UTOA 3ZCBB 2SGAA 3A46A 1NRSH 3ZVGA 3UREA 1XXDA 4NRWA 1AE8H 2ZU1A 3QAUA 3AVZA 1VITF 2F5NA 1ZPCA 1ARBA 3M7UA 2JA2A 3T2NA 1YPGH 3F9FA 2YR0A 4Z6AH 2A4RA 4WMFA 2WSEF 3WHLA 7LPRA 1BTUA 1ESAA 3PLBA 1E94E 4H6SB 2OXSA 3GQ3A 3SNCA 5JI2E 2BQ6B 4AGJA 4MGIE 1HT2E 1TNLA 1YPJH 2TIOA 1ZHMA 1TE0A 1CHOG 4ZKSU 4DV4M 2FOGA 1ZPBA 1L4DA 4B2BA 3KOXE 3MMGA 4ZUHA 4ZROA 1D2NA 3KS8A 1XXHA 2MH8A 1H9LB 3E0PB 1XMNB 2BVSH 2PHBA 2Z9IA 3RC4A 4ZXYH 1BDAA 4K8YA 1QQ4A 4QHSA 5DP8A 2ANMH 2FOEA 1WHCA 4GMQA 2L74A 3H7TA 3UTUH 3M6AA 1P12E 1UHBB 3FVFB 1V34A 5C2ZA 4YY3M 4JYAM 3NKKA 2KZUA 4GH9A 2HCBA 1MQ5A 3LONA 2O25A 5DYIA 3TE6A 4LZJA 2Z9LA 3I77A 4AFZA 6GCHG 1KMHB 1RGQA 4MGZE 1ZSKA 2GZ7A 4LF5M 3RXJA 2CUZA 4I4LA 1GPZA 5ESBA 1R4GA 1DSUA 4Q2KA 1OWIA 2FOFA 5PTPA 1S0RA 1O2VA 1P03A 4YESB 4O03A 1E32A 4UONA 4LJ4A 4GEWA 1OP2A 2AERH 1T4VH 3V76A 1XVMA 3KP0E 2CV3A 1GMDG 2WPIS 2ZTXA 1O2YA 2PV9B 1S83A 1A46H 1N36M 1DWCH 3CNRA 4G6ZA 3F68H 1BTPA 4IJFA 1OXGA 1TGCA 2JH6D 1HQCA 1LHEH 3ENSB 4VGCC 1C4U2 1H6UA 2YMSC 2L2DA 2G4UA 3URDA 4LGYA 1WQSA 3UOUA 1RTLA 4ABBA 1TRYA 4XOJA 2LHGA 4B3RM 5GIBA 1WR1B 2Z7FE 4J1YA 1MU8B 1DY8A 4Y79A 3D8BA 2OOAA 1Q3XA 2ALVA 4U2WA 3T28A 4GLYA 4Z8XA 3Q8GA
chains in the Genus database with same CATH topology
4TT3D 8CATA 3DFZA 1QQWA 3FUTA 3GP1A 2LH0A 2BJWA 1OFIA 2F5PA 3TL4X 4X65M 4FCTA 4L78A 4I5SA 2OINA 4AI6A 3HU1A 4MGKE 5GNDA 4LY6A 4GKKM 2F4VM 3KEEA 4DV2M 1G3IA 3FO8D 2E5LM 4IBDA 3L25A 4KODA 4TUWA 1QAMA 3U6LA 2QENA 5H37D 1XMOM 4IBEA 2ZBKB 5DYGA 3RGPA 3AV0A 4AW4A 4DUZM 1L1TA 2KR7A 3W0LB 2CK3D 3HHWA 2KW0A 3ILKA 2F5OA 5E26A 3UK6A 2KM0A 4NWKA 2QZ4A 4L8RC 2L7HA 3RGSA 5CDFE 3GLFA 2XH9A 3L27A 5EP4A 3LVWA 2UU9M 3O8DA 1TDHA 2YNMD 4NRVA 4DR7M 5CHBA 5IWAM 2R4EA 4L16A 3O8CA 1SXJC 1J7KA 4M0DA 1XNQM 3KP1E 3M7GA 3PNVA 5C0TA 4OVZB 4DR4M 4TSFD 1IN6A 1R7RA 3J27B 4GC9A 3DSPA 1IY0A 4RF0A 4Z8XA 4G4RA 5ITTA 3GLIA 3FKSD 4BLCA 3SV7A 1OHHD 3M5LA 1Q3CA 2QBYB 4X66M 2V1UA 1XHBA 4LJ6A 2HLDD 3TPZA 3SAUA 5EP3A 3U60A 1ZQ9A 3P8OA 3SHFA 3EIEA 1W5SA 1XXHB 4LF6M 4QNRA 5EXPA 4X62M 4DV1M 4DV6M 1G8PA 2VQFM 2YOLA 2DHRA 4LFBM 3FTEA 3VDPA 5HKKD 4FCWA 4I32A 3N7EA 4B73A 3NRLA 4DV7M 2X49A 3HU3A 1NHGC 2Y20A 2C98A 4I31A 3AOEC 2CHQA 2F9VA 1IBLM 4M9XA 3RC5A 3O8RA 2HL7A 4ITQA 2DXIA 5EQRA 2I7NA 3JR4A 1Z5BA 3DZDA 4A1VA 2RGHA 2XSZA 4Z6YA 2X8AA 2CV0A 3FYDA 2AHMA 2K1QA 3T38A 2R62A 1Z5CA 4LJ7A 2UUBM 4HL4A 4I33A 2BNKA 4D82A 3U6DA 2KFWA 1L2BA 5IREB 3F0PA 1NBMD 4YHHM 3KVWA 3T1HM 2OC8A 4GITA 4LF4M 2UUAM 2WV9A 5FL7D 3KSJA 1GVNA 4OM9A 3SUFA 2F4LA 2Z7JA 5EP2A 2ZAOA 3FTDA 3FTCA 3J80S 3QWLA 3P8NA 3SU6A 3PV5A 2I7PA 2W82A 1N78A 1E9RA 3F3BA 3M5OA 3K1JA 3AKZA 2XCFA 3UJNA 2XZUA 1QAQA 3SYJA 2QE7D 1L2CA 5GJ4B 1XMQM 3EIHA 3Q8XA 1IBMM 4CHTB 1S3SA 3KOZE 5ITQA 3J7AS 4AKIA 1QANA 4JI2M 3GRYA 2WPDD 1YE9A 3DA1A 2AHME 4GC5A 2OC1A 3WWBA 3GPYA 3K92A 4F55A 4IBKA 4RNAA 2F5SA 2F5QA 3SUEA 2OC0A 5BPVA 5JI3E 3KDSE 3SARA 5IT9S 3PFIA 4JI0M 2XFTA 5KQ8A 4KHPM 5DSFA 3BOSA 1IN7A 2UXBM 1NY5A 2RKOA 4MB7A 3GLFB 2C5RA 3SATA 2FE8A 1WXRA 2BJVA 3U6OA 4QHTA 1E9SA 5ITXA 1JR3A 3I4VA 1HT1E 4FW9A 4MGHA 2VQEM 4Q63A 1YUBA 3ZC7B 2Z3XA 1DGFA 4XD7D 4B3MM 3FUVA 3MJ5A 3N99A 2W6ID 3M5MA 2V7QD 4GHLA 3KOWE 2FM2A 3A45A 2KCPA 3PVSA 3VK7A 2R46A 1NSFA 1GKIA 5F3WA 4NSRA 2DVWB 3SMPA 5EPNA 3GPUA 4ZCNA 4K8BA 3GLIB 4PDGA 2EA0A 4DR2M 3U1JB 1IM2A 4FD2A 1S6LA 2K8IA 4IBJA 4EIWA 2G5GX 4A1TA 3FTFA 4CGYB 3F2GA 1GL7A 2ERCA 2CV1A 2OBQA 3M5NA 3KN2A 1IXSB 4IBBA 1WXQA 3J7BA 3UMMA 3R9XB 3U1IB 3U60B 3HJ8A 4JMYA 5EQSA 4LZZA 4A1XA 1IBKM 3LVVA 4B3SM 3I51A 1K82A 1NJFA 4JI4M 3GQ4A 4LF8M 4Z1MD 1H8ED 2QF5A 3VG8A 4IBGA 3FUUA 3VKGA 4I81A 5C1BA 4PD2A 5ITXE 1N34M 2EUCA 4NSOB 2DZOB 2XSZD 4LFAM 5EP1A 4M9FA 1DXWA 1KSFX 3M0EA 3GS9A 3GRVA 1W0KD 1X37A 3E9SA 3HHYA 3PXGA 2A4GA 3CF0A 2Z4RA 1HNWM 3FOAA 1DGBA 4JI6M 3GQ5A 3A42A 2WHXA 1BT7A 2P5TA 2XFSA 5IZ7D 5C18A 2A4QA 1N77A 1FX0B 1COWD 4PCZA 4II7A 4GHAA 4G4NA 2LXEA 3SUDA 1IN8A 2YQZA 1ZAEA 3D8LA 2DWZB 1L2DA 4NXNM 1K3XA 3SC3A 1DGHA 3FUXA 3DSOA 4A92A 4AG6A 1MABB 2A5YB 2WSSD 2OPFA 3SU5A 4GRIA 2R18A 3SMSA 4B08A 1NNJA 1MX0A 2P59A 3SUGA 3PNYA 3GRUA 4DR1M 2UXCM 2R45A 4MGYE 5ITUA 1T3TA 3U6EA 1TDZA 5E6JA 3VK8A 3W1EA 3ZIAD 4ASUD 3OE7D 3FN8A 2XNDD 4JI8M 3AL0C 5DN6D 4DT4A 1W0JD 3F2HA 1G59A 2JDID 1SXJE 3ZH9B 3JAMS 3SASA 2D7EA 2FP7B 3AOEA 5T1VA 1NNUC 1HNXM 1NHWC 4LJAA 1DO0A 3LOXA 1LV7A 1VDDA 2KEBA 3OEED 4KTCA 3H4MA 1Q39A 5FPYA 4B74A 1Q3BA 4LFCM 3SHGB 4OW0A 3HKPA 2XEPA 1E1RD 3KS4A 4W5WA 4JI7M 1XC8A 5KO3A 5H4IB 3SU0A 5F53A 2Z4SA 3L28A 3SBJA 3KOYE 2YFQA 1JQJC 4KLNA 3TWMA 4DR5M 1J09A 2DZNB 3TWKA 2KCOA 4P16A 2CV2A 2KCAA 3GLGA 2FOMB 4AKGA 1JR3D 2L09A 5EXSA 3CTWB 3KSXA 1OJLA 3TQSA 3SU3A 3CF6E 4PDIA 3UB0A 4WW0A 3SU4A 2O5RA 1QVRA 4DV0M 2HHHM 4DR6M 2VBCA 2QV1A 3IG8A 4L15A 5KQDA 2F43B 3RE8A 2K0QA 4RI0A 4LF9M 5IDKA 4IBFA 3OFND 3U6SA 3F0OA 4LCBA 2CEAA 4OU7A 5FPTA 2XCNA 4DR3M 2KZSA 2V6ZM 1KYIA 3K2LA 2C99A 1GL6A 3HWSA 3U6MA 4R3DA 3DCLA 5ITRA 3C58A 4TYDA 4QOZC 4NXMM 1UM8A 2QCUA 4DV3M 3U6PA 4LRSA 3VLFB 2FNAA 3T1YM 1OFHA 4GKJM 3PV2A 1A1RA 1XWIA 2OK5A 3AJIB 3SYLA 1R2ZA 4D81A 3L6PA 3SV8A 5IK2D 2L7IA 4NL4H 3GRRA 3PRBA 2OBOA 4G4OA 4MH0E 3TWLA 3UZUA 3KXEC 4IIWA 4G4QA 2QF4A 2JIZD 4GIPA 3WWFA 3RC6A 2RGOA 2KXEA 1QAOA 3NBIA 3AOGA 4B7FA 4JV5M 1G4AE 3U5ZA 1DY9A 1TGUA 2XOKD 3I4YA 3L26A 1PM5A 2KZ4A 2M5ZA 1NS3A 4IBCA 2ZM6M 1FJGM 5KPZA 5EPYA 4FVMA 2O8MA 2CHGA 1QZMA 4M9SA 1L1ZA 1N32M 3EYDA 2XNIA 2QPAA 5GKNA 5KPRA 1Z6TA 2CE7A 2XLJA 4WF8A 1DXPA 1IXRC 3R8FA 4DUYM 1TH2A 3HHZA 1SXJB 3WW7A 5EXTA 4MM3B 1TH3A 5FTKA 2J7OA 4S12A 3AK5A 3E4RA 2C9CA 5ETXA 5KPTA 3GPXA 5B6LA 1JXPA 4D80A 5EJCA 2JJ1D 5EQQA 4R8TB 5DNYA 5EQTA 4B3TM 2GGVB 1Z59A 5FTLA 1BMFD 2J5UA 3IG5A 2KRUA 2ZANA 4B6EA 1IN4A 1YSYA 1R6BX 3L29A 4WURA 1DO2A 2V1CA 3KW6A 1NVMA 2XZFA 2LELA 4AQYM 3CF2A 1DGHB 3SFZA 4R7GA 1J5EM 3OYPA 3DOAA 5EXXA 4KO8A 2CFOA 3L2AA 4LG2A 4WH8A 3SYKA 1SXJA 1G41A 4BB9A 2K47A 4AZFA 4B71A 1EFRD 5FSWA 3KNXA 3SV9A 4HLQA 1SKYE 4NWLA 4IBIA 4LJ9A 2X4AA 2LWXA 4LGMA 3H09A 5FTNA 3FKEA 3U6QA 2OC7A 5C17A 1CU1A 2Q2EB 4JI1M 1H8HD 3F2FA 4B75A 1NBME 4JXJA 2J7NA 1IN5A 1NJGA 2GVFA 2KA6B 2DWMA 4AKHA 3J2PB 3SAVA 4X64M 3JR5A 3U61B 4M9ZA 1W3CA 4WH6A 4REZA 1K3WA 3OTOM 1PJIA 2Y0QA 2NQ8C 3OAAD 4QOSA 4LJ8A 3U6CA 4NOOB 3RFWA 2C96A 3T15A 2UXDM 5FTJA 4FCVA 4BBAA 3ZCBB 4U01A 2H1RA 3LMMA 3A46A 3SU2A 1EE8A 4FWDA 1N1LA 3AFHA 1E1QD 2W6JD 3THGA 3GLGB 1W5TA 4NRWA 3GPPA 2KCYA 2C9OA 3QAUA 1XNRM 4FWHA 2F5NA 1N33M 4B76A 1NY6A 5ITYA 5BR8M 2JA2A 4ZPXA 2YR0A 1DGGA 2HKJA 2YMSD 2A4RA 3FYCA 5GPIB 3U61A 4OX9M 3FUWA 3WHLA 3WHKA 4OVZA 2VIIA 4B6FA 1IY1A 2R65A 4JN6A 1IY2A 1N75A 1E94E 2FOIC 3GQ3A 5JI2E 4XGIA 1I4WA 1HT2E 4MGIE 2UUCM 2D7GA 1HQYE 2QBYA 2M2AA 3PRDA 2Y0TA 7CATA 5A2QS 1IQPA 1MU5A 4DV4M 1HR0M 4A3VB 4LF7M 3B9PA 2D7HA 3KOXE 4K0KM 2YMSB 3OEHD 1TH4A 1D2NA 4FETA 3KS8A 1XXHA 1ORYB 2IJOB 4JI3M 1C1KA 2XF3A 1E79D 3RC4A 5FPSA 3HU2A 1HNZM 4QHSA 2L6OA 4YXWD 1L8QA 4GMQA 4M0WA 3GO8A 3M6AA 4B7GA 3U5ZB 3HHXA 5LMNM 3SU1A 4LJ5A 3E90B 4YY3M 4JYAM 2KZUA 3OTPA 2R4JA 4GH9A 2HCBA 3SAWA 3KFUG 3KF2A 3LONA 5DYIA 3TE6A 3MK6A 4LZJA 2DWNA 2F9UA 3J81S 1R2YA 2ZAMA 1KMHB 4MGZE 1RGQA 4LF5M 2FFJA 2CUZA 2QP9X 2XGNA 4I4LA 4IJEA 4L4UA 5FLXS 5LMUM 2DWLA 3GLHB 5ESBA 2Y21A 3LKWA 1E32A 5FTMA 4LJ4A 4LRTA 2WZQA 2KRKA 3K8ZA 3KP0E 1FNNA 3A98B 3SZEA 1GLNA 4PT5A 4FWGA 4I8OA 1SXJD 2EO2A 1N36M 4G6ZA 3NWLA 2OQ4A 3VDUA 4AG5A 3LQQA 4IJFA 1PJJA 2JJ2D 1HQCA 1KFVA 4XBOA 3HJSA 1H6UA 4DV5M 2YMSC 4Q4LA 3HGIA 2LNHC 2M60A 4LGYA 4JI5M 1I94M 1RTLA 5C0UA 2CHVA 4B3RM 3VKHA 3GLHA 1Z5AA 3D8BA 3FD9A 4RF1A 1DY8A 1QYRA 3LQRA 3N7DA 4CISA 1IXZA 3MHVC 3W0FA 4B7HA 3UGJA 2IJD1 3HJQA 3SV6A 2G8LA 3O8BA 3VFDA 4QNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6O A; 
#chains in the Genus database with same CATH topology
 3BG4 B;  1QL9 A;  1QQW A;  1OFI A;  3CGW A;  2F5P A;  4X65 M;  1O5G H;  1MD8 A;  2XW9 A;  2R0I A;  3HU1 A;  1W12 U;  5GND A;  4LY6 A;  5LPE A;  3KEE A;  5FCR A;  4KP0 A;  2BQW B;  3FO8 D;  3SJ8 A;  1QAM A;  1WGN A;  1YC0 A;  1K28 D;  1ZSJ A;  3ZZC A;  5H37 D;  2C4F H;  1O3K A;  1G37 A;  1VJ9 U;  3RGP A;  3MQK C;  4YO9 A;  1IQG A;  1MJG M;  3MTY A;  4AW4 A;  1L1T A;  1NRQ H;  3HHW A;  3GY6 A;  2BWB A;  5LH8 A;  5E2O A;  4NA7 A;  3RXR A;  1AKS B;  3UK6 A;  3UIR A;  1D0K A;  4NWK A;  1QRZ A;  3RGS A;  1TPO A;  2PP6 A;  2SNV A;  1DX5 M;  5G4B A;  2LPR A;  3O8D A;  1TDH A;  4NRV A;  5CHB A;  2J5Y A;  4L16 A;  3O8C A;  2Q6D A;  2SGE E;  1D0L A;  4DIH H;  3GDV A;  4DVA U;  1WIV A;  5KED A;  1AIX H;  3SJI A;  1AB9 B;  1O34 A;  4OVZ B;  4UD9 H;  1E36 B;  1EZU C;  1R7R A;  4GC9 A;  3DSP A;  1KXC A;  2DI0 A;  2BVR H;  3U98 H;  1GDN A;  1T4U H;  3ZVA A;  3GLI A;  3SHC H;  3SV7 A;  1C9T A;  3M5L A;  3K9P A;  4ZHM U;  2GTB A;  1MTN B;  1EUF A;  4LJ6 A;  1HAY B;  1D3Q B;  2HLD D;  1QZE A;  3TPZ A;  1C5W B;  1YY3 A;  2RA0 A;  2XRC A;  3ZVD A;  1B7X B;  1AUT C;  3LGY A;  4E05 H;  1SSX A;  1GJT A;  2OUA A;  2ANW A;  3RXB A;  1Y8G A;  4QNR A;  2IN2 A;  4X62 M;  2WYG A;  2OD3 B;  4DV1 M;  1F92 A;  4NFF A;  3RU4 E;  3GLF E;  1THR H;  1Z8J B;  2J38 A;  3VDP A;  3GCT F;  4IC5 A;  4D7F A;  4I32 A;  1GBJ A;  3QO6 A;  1TNG A;  3EE0 B;  2DAE A;  2FH0 A;  1BTY A;  3IHP A;  3LDX H;  4I31 A;  2Y7Z A;  3K9X B;  1AY6 H;  3ZYE A;  4M9X A;  1P2I A;  3FRI A;  1FUJ A;  1P2J A;  5T6F A;  1EFU B;  5FX6 A;  5EQR A;  1HAH H;  1S84 A;  1TQ7 B;  1AZZ A;  1FXY A;  2AMD A;  1YLA A;  5JBT A;  3IEC A;  4A1V A;  2XSZ A;  4Z6Y A;  1SGY E;  1BTX A;  2CV0 A;  1AWF H;  2A45 B;  5EXN A;  2FOA A;  4OS7 A;  2NU4 E;  1UVP A;  3MNS A;  1A7S A;  3ZVF A;  6EST A;  1THP B;  2HNT E;  2F9N A;  2KFW A;  1L2B A;  1Q2W A;  3DFJ A;  4AZ2 B;  1NU7 B;  1GJB B;  1GI8 B;  3PYH A;  1V2U T;  1GI1 A;  1V6D A;  3V12 A;  1WV7 H;  1SB1 H;  2H5X A;  4CH8 B;  1OQY A;  4TPI Z;  1GI7 B;  5B6O A;  1FNI A;  1R5L A;  3FTC A;  2G5V A;  3P8N A;  1J15 A;  1EOL A;  1O2J A;  2I6Q A;  3BTD E;  1AFQ C;  1C5X B;  3A7X A;  2JY8 A;  3AKZ A;  2ZC9 H;  4YOJ A;  3UJN A;  2H1U A;  1GO5 A;  3TGI E;  4ANR A;  1OYT H;  1MBQ A;  1L2C A;  3GY2 A;  4AX9 H;  1XMQ M;  2GV7 A;  1IBM M;  3J7A S;  2HWJ A;  1JBU H;  4AKI A;  1OPH B;  1NO9 H;  3LIW A;  2O8L A;  2ZHE H;  3DA1 A;  2GCT C;  2AHM E;  1GHA G;  3RXO A;  3A80 A;  1BBR K;  5A0A E;  2WPK S;  2A2Q H;  3GPY A;  2A2X H;  3FP6 E;  3BBZ A;  1SGQ E;  1VCP A;  1F2S E;  5BPV A;  3KDS E;  4HG6 A;  3SAR A;  5IT9 S;  2ZDM A;  4FU8 A;  1KXD A;  1JRS A;  1CSO E;  1CHO F;  1HNE E;  1IN7 A;  1DST A;  2DAG A;  2C5R A;  2ZKS A;  3C3E A;  3A7W A;  5ITX A;  1JR3 A;  4FW9 A;  4Q63 A;  1YUB A;  1UO6 A;  2Z3X A;  3HGP A;  4UE7 H;  2VH6 A;  2UWP A;  4OS1 A;  3MJ5 A;  3N99 A;  1RIW C;  3RMN H;  3M5M A;  3QLP H;  2LHC A;  3KOW E;  3MFJ A;  4Y11 E;  3LU9 B;  2LVQ D;  1NSF A;  1GKI A;  4JCN A;  1KXB A;  4Q7Y A;  1K1P A;  3GPU A;  4ZCN A;  3L33 A;  1NN6 A;  4DR2 M;  1AN1 E;  1S6L A;  4FD2 A;  4X6N A;  4BAO B;  4KTU A;  3STJ A;  6GCH F;  2G5G X;  2ZU4 A;  3KN2 A;  2ZTZ A;  2VU8 E;  1UVU H;  1BA8 B;  4NIX A;  1O38 A;  3HX3 A;  2RA3 A;  2VJ1 A;  3U60 B;  4GVU A;  5EQS A;  4A1X A;  2LBC A;  1IBK M;  1GMD F;  1O5F H;  2ZTY A;  1O3H A;  2RDL A;  1UCY H;  1DWD H;  4JI4 M;  2EEK A;  3MU4 A;  3GQ4 A;  3VPK A;  1VEK A;  3VG8 A;  1SOT A;  3FUU A;  3VKG A;  2AIQ A;  1ZJK A;  3GY5 A;  3HKI B;  5E2P A;  5C1B A;  2C3S A;  5K7R A;  4NSO B;  1AVX A;  2DZO B;  2XSZ D;  1O2I A;  5EP1 A;  2VB0 A;  9LPR A;  1DXW A;  2CF9 H;  2W7S A;  3GRV A;  4FUG A;  1X37 A;  3PXG A;  3HHY A;  1BZX E;  4IGD A;  2ZWL H;  2Z4R A;  1ZRK A;  3FOA A;  4JI6 M;  1BT7 A;  1GDQ A;  3EQ0 H;  2P5T A;  2XFS A;  1LPZ B;  2GJG A;  1K1M A;  4F1I A;  3KQC A;  3PV4 A;  3G01 A;  3N7O A;  4OGY A;  1VG5 A;  4G4N A;  1EZS C;  2YQZ A;  3D23 A;  1ZAE A;  5TCA A;  6CHA C;  1TGN A;  1K22 H;  3SC3 A;  4BXS A;  2AMP A;  5DJ7 A;  5A09 A;  1PPH E;  1P04 A;  4JK6 A;  4K5Z A;  1WJ7 A;  2R18 A;  4B08 A;  1ARC A;  1MX0 A;  2VIW A;  2GMT B;  3OSY A;  3SUG A;  3F6U H;  4U32 A;  4AOR A;  1DLK B;  5ITU A;  1PPG E;  2BHG A;  2ZGJ A;  1GBC A;  5FX5 A;  2XND D;  1E37 B;  3UNR A;  4KEL A;  2BD8 A;  3I78 A;  3F2H A;  3TJN A;  4DII H;  1G59 A;  1SXJ E;  4SGA E;  3JAM S;  4XRN A;  3SAS A;  3NBX X;  1NNU C;  1GHB G;  1NHW C;  3K9O A;  4LJA A;  2GD4 B;  1LV7 A;  1T43 A;  1BRA A;  2Y7X A;  3ATL A;  3H4M A;  4A6L A;  1O2R A;  1SLU B;  1TGT A;  1S5S A;  1PPC E;  3AAU A;  1GI3 A;  4JI7 M;  1XC8 A;  1O35 A;  4CH2 B;  3SBJ A;  1OWD A;  1GJD B;  1P3E A;  1JQJ C;  2HAK A;  1ABI H;  1ANE A;  1BMA A;  2BB4 A;  4DR5 M;  1T6O A;  1TMU H;  1J09 A;  5JDU B;  2DZN B;  1O2Z A;  1XKB C;  2CV2 A;  1KDQ A;  2KCA A;  2FOM B;  1INC A;  1JR3 D;  5EXS A;  3MO6 A;  1GJA B;  1PPB H;  3CF6 E;  4IW4 E;  3UB0 A;  1YCP K;  1FJS A;  1T7C A;  2EI7 A;  2O5R A;  4DV0 M;  1LVM A;  1GG6 C;  4Z0K A;  3IG8 A;  2F43 B;  3ZVE A;  3E16 B;  5DP3 A;  1NPM A;  2AEI H;  1F0U A;  1TRN A;  4MDS A;  5C67 A;  1AU8 A;  1WOF A;  1YPL H;  1C2H A;  4OU7 A;  1ZR0 A;  1F0R A;  2QXI A;  4X8T H;  3IIT A;  1W0Z U;  2BXT H;  1B0E A;  1HJ9 A;  4BTT B;  2ZHF H;  4O3U A;  1EPT C;  3U8R H;  4LXB H;  1C5U A;  1UVO A;  1O32 A;  3DCL A;  5ITR A;  1NRP H;  1TRM A;  2DE9 A;  1ETS H;  2QCU A;  1FIZ A;  2AS9 A;  3VLF B;  2FNA A;  2BLW A;  4GKJ M;  3PV2 A;  3A8D A;  1XWI A;  1UTP A;  3L6P A;  4D81 A;  3FZD A;  2BDY A;  3PRB A;  4G4O A;  3GLG E;  2N35 A;  1F5K U;  4G4Q A;  2JIZ D;  4O97 A;  1QAO A;  3NBI A;  4B7F A;  4JV5 M;  1EP5 A;  1TAL A;  1G4A E;  3RUO A;  2J2U A;  1TGU A;  3UWJ H;  5A0B A;  1JB0 F;  2M5Z A;  4FUB A;  4Q7Z A;  1O3O A;  2K0B X;  5C1X A;  1OTR A;  1LKA A;  1HDT H;  1UVT H;  4M9S A;  1L1Z A;  3A87 A;  2BM2 A;  4AFU A;  2QPA A;  2PTC E;  5KPR A;  1Z6T A;  4ZHL U;  2JET C;  1LVY A;  1W13 U;  1IXR C;  2F9P A;  4MLF B;  3B8J A;  1TH2 A;  3LGU A;  2ZDN A;  5EXT A;  1O3F A;  1O5E H;  4B2C A;  7EST E;  2B3T A;  4S12 A;  3Q3K A;  5GXP A;  2W7U A;  2ZDL A;  4Q7J A;  2C9C A;  2XC0 A;  5C3N A;  2DAK A;  3GPX A;  1VKY A;  1ZMN A;  3ATM A;  1BOQ A;  2JJ1 D;  4KTS A;  1IQN A;  1ZTK A;  2J98 B;  4B3T M;  1TBR H;  2GGV B;  1G71 A;  2JZ0 A;  3Q3X A;  3HGN A;  4ABF A;  1YPK H;  1C1M A;  1D3D B;  5A8X A;  4AQY M;  3CF2 A;  1DGH B;  3FP8 E;  1A3B H;  2FTL E;  1H9I E;  1HYL A;  5EXX A;  1RXP A;  1ZV1 A;  3BTM E;  3SYK A;  1G41 A;  4B71 A;  4JYT A;  3KNX A;  1GHA F;  2CF8 H;  4HLQ A;  1DUA A;  4LJ9 A;  2LWX A;  2WIN I;  1KXA A;  1HIA B;  4B2A A;  3FKE A;  2OC7 A;  5AF9 H;  4X6M A;  2D8W A;  4X1N U;  4AN7 A;  1TLD A;  1GI2 A;  2MJ5 B;  4DW2 U;  3A82 A;  5JB8 S;  4CHA C;  3U9A H;  2GCH G;  4JK5 A;  1JIM A;  4MPW A;  1D0M A;  4WWY A;  4M9Z A;  4REZ A;  2ZFT A;  1O2X A;  4QOS A;  1ELG A;  1O2P A;  4LJ8 A;  4MVN A;  3TVJ B;  3E0N B;  3RFW A;  1IQK A;  3RXH A;  1GMH G;  2C90 B;  4FCV A;  1EJA A;  3OY5 U;  1V2V T;  1O3E A;  5AFZ H;  1E0F D;  2HNT C;  1V2M T;  4CBN A;  2W6J D;  2FWW A;  1H8D H;  4YM9 A;  1O2H A;  4CRD A;  1TR8 A;  2ZFS A;  1XNR M;  5HGG A;  1TPP A;  3MWI U;  4B76 A;  5DG6 A;  3QZR A;  1ZHP A;  2FI5 E;  2DE8 A;  1FN8 A;  5GPI B;  3B7N A;  1ZPZ A;  1HUT H;  1Z1J A;  3WHK A;  1LDT T;  2VII A;  4NSY A;  3RMO H;  3Q3Y A;  1IY1 A;  4I8G A;  2MR9 A;  3SGA E;  3DSG A;  3GIS B;  3FP7 E;  1O5A B;  1THS H;  5EOD A;  4XGI A;  1I4W A;  3NXP A;  2UUC M;  1P01 A;  2R2M B;  3KHV A;  4XBC A;  1QDT A;  4NFE A;  1IQP A;  1O36 A;  2WV5 A;  2VIQ A;  3B9P A;  2D7H A;  1J8A A;  4K0K M;  1QB6 A;  3T26 A;  1TQ0 B;  4FET A;  5KGO A;  1W14 U;  3UNQ A;  2AMQ A;  4JI3 M;  1H9H E;  1C1K A;  1AND A;  2A7C A;  5FPS A;  2KAI A;  2PKS B;  4NIW A;  1HNZ M;  4YXW D;  1BB0 B;  4M0W A;  2P8O C;  2NU0 E;  1FY5 A;  4LJ5 A;  4JZF H;  1EJM A;  3SAW A;  2RCE A;  3KF2 A;  2DWN A;  2B9L A;  1ZRB A;  4K2Y A;  2AFQ B;  1EB1 H;  2QP9 X;  5LMU M;  3M61 U;  3PO1 B;  5EJ1 A;  1W7X H;  1EPT A;  1CBW C;  3LKW A;  3NK8 A;  2BDB A;  1BML A;  4LRT A;  2WZQ A;  2KRK A;  1KXF A;  1IHS H;  1IQF A;  1P10 A;  4PT5 A;  3BTW E;  2ZEC A;  5AVD A;  1S82 A;  2C8Z B;  3ZZ7 A;  4B6F A;  1AQ7 A;  1PJJ A;  5EIY A;  3NZI A;  4K1E A;  3HJS A;  1C1R A;  2JUJ A;  4RKO B;  7GCH G;  1SGI B;  1MZA A;  3A7V A;  3HGI A;  4MNW A;  1CA0 B;  2M60 A;  2G3Q A;  1XUI A;  2Y5H A;  4LOY H;  1I94 M;  1C1W H;  3S7K B;  4CR5 A;  3MH7 A;  3HZJ A;  2XBW A;  3VKH A;  1RTF B;  1MN3 A;  1FV9 A;  2JH5 D;  4INL A;  1CE5 A;  3S0N A;  4CRC A;  3N7D A;  4CIS A;  3ZZ5 A;  1IXZ A;  2AYW A;  2IJD 1;  3LGV A;  3SV6 A;  1D4P B;  2G8L A;  3NUM A;  4QNM A;  2EI8 A;  1VGC C;  8CAT A;  4B1T A;  1QR3 E;  4E7N A;  2WSC F;  1NU9 A;  2LH0 A;  2BJW A;  2Y6T A;  3TL4 X;  4L78 A;  2OIN A;  4MGK E;  5SGA E;  1QCP A;  4GKK M;  2F4V M;  1EIJ A;  4MTB A;  1CVW H;  1LTO A;  3U6L A;  1SFI A;  1V2O T;  2QCY A;  4IBL H;  4IBE A;  2ZBK B;  2EI6 A;  4ZXX H;  1YLN A;  1OKX A;  4X1R U;  3RXU A;  3RM0 H;  1LTM A;  2KR7 A;  4DUZ M;  3ZQJ A;  1EAS A;  4WY3 A;  3ILK A;  2GT8 A;  1TNJ A;  1VR1 H;  4OGX A;  2VIO A;  4HI3 A;  2QZ4 A;  1HRT H;  1RTK A;  1PYT C;  3GLF A;  1OWE A;  4XBB A;  4AC9 A;  3L27 A;  5EP4 A;  1UMA H;  3P8G A;  4RSP A;  5C1Y A;  1EKB B;  2D26 C;  1G3D A;  2R4E A;  3RXA A;  1RD3 B;  1SXJ C;  4Y0Y E;  1IAU A;  1XNQ M;  4ZKO U;  1K1L A;  1O2N A;  1SG8 B;  3D49 H;  3PNV A;  5C0T A;  1Y3W A;  4GPG A;  3OU0 A;  3TK5 A;  2KNV A;  1RJX B;  1IN6 A;  2ZGX H;  3A84 A;  3J27 B;  1BTZ A;  2A7J A;  1KLJ H;  1IY0 A;  2UWL A;  2Y82 A;  4G4R A;  1CGI E;  1ETT H;  1C1S A;  3HPT B;  1OHH D;  2P94 A;  2VNT A;  1DUE A;  5E0J A;  3RXP A;  4X66 M;  2V1U A;  1EQ9 A;  2BDC A;  1MMJ N;  1P06 A;  4A7I B;  3SAU A;  2HRV A;  2JY5 A;  1ELC A;  1GCD A;  2JY6 B;  2GDD A;  2EJS A;  3EIE A;  1XXH B;  1C2I A;  1T8M A;  4UFE H;  1XUJ A;  2FPZ A;  2YOL A;  2QYI A;  2AH4 X;  4LFB M;  3FTE A;  4FCW A;  1VQ1 A;  2DAI A;  2IPH A;  3LH1 A;  3M35 A;  4MPV A;  2R0K A;  3S9A A;  4G3O A;  3D65 E;  2X49 A;  3RU4 T;  4BTI B;  4WXV A;  4ABE A;  3HU3 A;  1CUK A;  2Y20 A;  3LGI A;  2HL7 A;  1QDR A;  1V2W T;  1EAU A;  3UR6 A;  1SHY A;  3GY8 A;  1CA8 B;  1G2M A;  2ALP A;  4R71 A;  1TMT H;  1KLI H;  1G3B A;  5DP5 A;  4H6T A;  4IN1 A;  1PQ8 A;  2ZGC A;  3FYD A;  3KID U;  2AHM A;  1AZ8 A;  4X6O A;  1SHH B;  2UUB M;  3SBK A;  2BNK A;  2O01 F;  2BY6 X;  5IRE B;  1NBM D;  1YPM H;  2CXV A;  1MAY A;  3FFG A;  4BAM B;  2GCH F;  2QA9 E;  1SLW B;  2WV9 A;  3BTG E;  2ILN A;  3RXG A;  1F7Z A;  4HFP B;  2GNO A;  3KL6 A;  4TY6 A;  1QBN A;  2F4L A;  2RG3 A;  3KQE A;  4FVB A;  3QWL A;  3MU1 A;  5GCH G;  2W82 A;  1QRX A;  1E9R A;  1UTL M;  3F3B A;  3K2U A;  2YNA A;  1ZGV A;  2XCF A;  1LKB A;  1O3M A;  2FI3 E;  3A81 A;  1C1P A;  3STI A;  1BBR H;  4JZI A;  2VGC C;  2PUQ H;  3ZZ8 A;  2EKK A;  1S3S A;  1A5G H;  3A7T A;  4X1Q U;  3GRY A;  2WPD D;  3PTB A;  1A4W H;  1YE9 A;  3RU4 D;  1PJT A;  1LHC H;  2P16 A;  4ASH A;  3EE7 A;  1CT4 E;  4GC5 A;  1BRC E;  1LMW B;  2G55 A;  1V2Q T;  4I7Y H;  1RU3 A;  1GJ6 A;  3TPI Z;  4IBK A;  2F5Q A;  2FS8 A;  4RN6 A;  2BDI A;  1KYN A;  1BRU P;  4GUX A;  1QB9 A;  4KHP M;  3TH3 H;  2XFT A;  5KQ8 A;  2P3U B;  4YOI A;  1TX8 A;  3BOS A;  1HAV A;  1G9I E;  1QQU A;  2C8X B;  1P2M A;  1MD7 A;  1GI4 A;  5CHA B;  3IG6 B;  3U6O A;  4QHT A;  8GCH G;  1HT1 E;  4MGH A;  2VQE M;  4FUJ A;  1O3D A;  1DGF A;  4B3M M;  2FXR A;  2F3C E;  2ZO3 H;  1C5L H;  1ZYO A;  3VGC C;  2FM2 A;  5JBC S;  1GHW H;  3PVS A;  1LVB A;  1DM4 B;  1F0S A;  4D9R A;  2DAM A;  3GLI B;  1K1J A;  4OS2 A;  2QXH A;  4CGY B;  2V6N A;  2CV1 A;  2OBQ A;  3M5N A;  4WJG 2;  4IBB A;  4YT6 H;  2QXG A;  1WXQ A;  3UMM A;  3R9X B;  1GMC G;  5C5N A;  3KCG H;  1C1O A;  3P17 H;  3OTJ E;  4P17 A;  1BCU H;  1OAO C;  3I51 A;  4X8S H;  1NJF A;  1W0Y H;  2G52 A;  3BTQ E;  4Z1M D;  5CE1 A;  1FDP A;  5GDS H;  1KXE A;  1GBT A;  1SVP A;  4AFS A;  3MNC A;  7GCH F;  3P95 A;  1C5N H;  4M9F A;  2K6B A;  4LFA M;  2CN0 H;  5LGO A;  2APL A;  2CHA C;  1NC6 A;  1HNW M;  1TOM H;  2B0F A;  1DGB A;  2WHX A;  4GAW A;  2B7D H;  1C2G A;  4IMQ A;  1N77 A;  1FY3 A;  1BHX B;  2ZEB A;  4FUD A;  3LH3 A;  1O2Q A;  1TPA E;  1Z71 A;  4KKD A;  1FPC H;  5L30 H;  1W2K H;  1SR5 C;  1P2K A;  1SBW A;  3BTK E;  1C5V A;  1K3X A;  1Y5B T;  4AG6 A;  1MAB B;  1O2W A;  2A5Y B;  2DNA A;  3DFL A;  3SMS A;  2P59 A;  5TCC A;  3PNY A;  5A8Z A;  4DR1 M;  2KDL A;  2R45 A;  4MGY E;  2FMJ A;  1GJC B;  2NU2 E;  2ZDV H;  5EXM A;  4RT0 A;  5EST E;  3FN8 A;  1PQ5 A;  4JI8 M;  4XK8 F;  2Q6G A;  1GBD A;  2V35 A;  1EAT A;  3BN9 A;  4FVD A;  5T1V A;  3FAO A;  2JP7 A;  2AGE X;  3U28 C;  1NRR H;  1S85 A;  2KEB A;  5FPY A;  1P11 E;  2WZJ A;  4LFC M;  3KS4 A;  6LPR A;  5KO3 A;  2Z9G A;  4AFQ A;  5F53 A;  1HJ8 A;  1GGD C;  5EGM A;  3KOY E;  4IS5 A;  5I25 A;  3GY4 A;  3SV2 H;  2YFQ A;  3MH6 A;  4KLN A;  4Y7B A;  1SOZ A;  1EOJ A;  3TWK A;  1AUJ A;  1G36 A;  4P16 A;  1O3A A;  2G00 A;  1L1N A;  5ABW A;  3GLG A;  1A0J A;  4VGC B;  2P95 A;  3CTW B;  2VF7 A;  1OJL A;  1AE5 A;  1Z8R A;  3BV9 B;  1BJV A;  3E3T A;  5LPR A;  1O2K A;  2LP6 A;  2ZGB H;  4PRO A;  5F8Z A;  1J14 A;  4X1P U;  3RXC A;  4L15 A;  5KQD A;  1YLC A;  4ZAE A;  2OO9 A;  3RLY H;  2FX6 A;  4ZKR U;  3QUM P;  1OWJ A;  4THN H;  3OFN D;  2R6F A;  1OOK B;  5FPT A;  3EGK H;  2KZS A;  1V3X A;  2F9O A;  4ISH H;  4I8J A;  3H5C B;  1GBM A;  2NU3 E;  3HWS A;  4GHQ A;  2W3K A;  2ZI2 H;  3MU8 A;  3E21 A;  4NXM M;  3E46 A;  2BXU H;  1NRO H;  3U6P A;  4NIV A;  1OFH A;  1C5O H;  1PYT D;  3AJI B;  1C1U H;  2FTM A;  2VWL A;  3TNS A;  3UNS A;  3VFE A;  1V2T T;  2M5T A;  2QF4 A;  1JMO H;  1SQT A;  2WUC A;  3GY3 A;  2BY5 X;  2KXE A;  3W94 A;  3WY8 A;  4X1S U;  3U5Z A;  4FUC A;  3I4Y A;  3L26 A;  1OSS A;  3GCN A;  1NS3 A;  3BEF B;  1QJ1 B;  5KPZ A;  2MRO B;  2CHG A;  1QZM A;  1QNJ A;  1V2L T;  2R3Y A;  3ZZA A;  1DE7 H;  4UFG H;  3S69 A;  2XLJ A;  1PJP A;  2ODQ A;  4WF8 A;  3GYM A;  3P6Z B;  2P93 A;  5E0H A;  4AG2 A;  4DUY M;  4HEO A;  4Y71 A;  1K2I 1;  4BAK B;  1GBH A;  3WW7 A;  2A5A A;  1HLT H;  4MM3 B;  2VIP A;  1TH3 A;  2J7O A;  1C4Y 2;  2ZHD A;  3AK5 A;  3E4R A;  1WDI A;  1G32 B;  3U8O H;  5KPT A;  1P9U A;  1A3E H;  4I8L A;  1UFZ A;  1GVL A;  5EQQ A;  1HJA C;  3RMM H;  2D2D A;  4LZ4 B;  5GCH F;  2J5U A;  3IG5 A;  4BAH B;  1T8N A;  2ZAN A;  3ZVB A;  3RXI A;  1R6B X;  3VXE H;  4CBO A;  1DO2 A;  3KW6 A;  1LQD B;  1VCQ A;  2LEL A;  2BLQ A;  4I8H A;  1K1I A;  4R7G A;  4CIZ A;  1C2L A;  4KO8 A;  2CFO A;  3I04 M;  4LG2 A;  1MKX H;  4P02 A;  1D6R A;  1T32 A;  5BPE A;  2K47 A;  2LTU A;  2WPH S;  3SV9 A;  1L0Z A;  2ZPS A;  3E6P H;  1UW7 A;  4BAN B;  2DEN A;  3S9C A;  4WMD A;  1PJQ A;  4JI1 M;  1H8H D;  1DV0 A;  2C8Y B;  2QN5 T;  2ZQ2 A;  3F2F A;  4B75 A;  4JXJ A;  2J7N A;  5E0G A;  3E1X B;  2KA6 B;  4AKH A;  4MG3 A;  1C4V 2;  1F5R A;  3VB6 A;  2NQ8 C;  4Q80 A;  5EJL A;  8GCH F;  2BQ7 B;  3RXF A;  2C96 A;  1N8O C;  3SU2 A;  1EE8 A;  4FWD A;  5L6N H;  1KDQ B;  1W5T A;  4UFF H;  1GJ9 B;  4MQA A;  1XXF A;  1C1V H;  3GPP A;  3BIV H;  2KCY A;  2C9O A;  1S0Q A;  1UK2 A;  1EST A;  2VDB B;  4FWH A;  2O8W A;  1V92 A;  1N33 M;  1NY6 A;  5ITY A;  5BR8 M;  1UTJ A;  1SFQ B;  2EC9 H;  2PFE A;  2TPI Z;  3SJK A;  1O5D H;  2HKJ A;  2YMS D;  3FYC A;  2EKF A;  1EAW A;  3SO3 A;  1GMC F;  2R65 A;  2FI4 E;  1AFQ B;  2Y80 A;  1N75 A;  3F9H A;  1TB6 H;  2R44 A;  1OP8 A;  9EST A;  2M2A A;  2QBY A;  1Y3U A;  1QB1 A;  1ZLR A;  2OTV A;  4ISL A;  7CAT A;  1ANB A;  1D3T B;  1M9U A;  5A2Q S;  3RML H;  1MU5 A;  1NFY A;  1HR0 M;  4BOH A;  4UFD H;  4F48 B;  1SGF A;  1C5Y B;  2GCT B;  3MNX A;  1O3L A;  1UTK A;  5C94 A;  1A2C H;  5GWZ A;  2IJO B;  1K9O E;  3PMB B;  3UQO A;  1ZML A;  4R0I A;  1E79 D;  1GI9 B;  1OKS A;  4FUE A;  2R0L A;  3HU2 A;  2OP9 A;  2L6O A;  5T6G A;  1K0H A;  1TX6 A;  4XSK U;  4B7G A;  4DJZ B;  2AIP A;  3A8C A;  1XUH A;  2XTT B;  1BQY A;  3E90 B;  1TAB E;  5C1U A;  1L4Z A;  1BRB E;  1FY4 A;  3J81 S;  3QZQ A;  1HAG E;  1ZZZ A;  4XDE A;  1R2Y A;  1NTP A;  2FFJ A;  2XGN A;  4IJE A;  1UTQ A;  1GI5 A;  1SGT A;  3MHW U;  3V13 A;  2PW8 H;  4GCH G;  1QJ7 B;  2V3H H;  4TPY A;  1RIW B;  5A2M H;  4ZHA A;  3A83 A;  2WYJ A;  3PRO A;  3K8Z A;  2QNJ A;  3QYE A;  1FNN A;  3A98 B;  3SZE A;  4FWG A;  3SNA A;  4FUH A;  5EG4 A;  3QX5 H;  2TGP Z;  1SG9 A;  2OQ4 A;  2JJ2 D;  3LQQ A;  1QUS A;  4XBO A;  2J9N A;  3RLW H;  1TNI A;  4DV5 M;  1IOE A;  2LNH C;  4JI5 M;  3PMA B;  5DP6 A;  2WPJ S;  1OIZ A;  2FO9 A;  2XWB I;  1C2D A;  1FN6 A;  1EXF A;  1HXE H;  1YP9 A;  4IMZ A;  4JYU H;  2BDG A;  1QYR A;  3LQR A;  3MHV C;  3W0F A;  4B7H A;  8EST E;  1TF0 B;  1C2J A;  3HJQ A;  3O8B A;  3RC5 A;  3VFD A;  3LPR A;  1NM6 A;  3DFZ A;  2GZ9 A;  3UFA A;  3PLP A;  5HIY A;  1WAY B;  3M7T A;  3FUT A;  3W68 A;  3HK6 B;  4GHT A;  1GCT C;  2TGA A;  1SGF G;  4I5S A;  3SJ9 A;  1HB0 B;  1TGS Z;  3M3T A;  1G3I A;  4DCD A;  2E5L M;  1OAI A;  1MBM A;  4KOD A;  3E8L A;  4TUW A;  5HXF A;  4D76 A;  1P05 A;  2GQF A;  1XMO M;  5DYG A;  3ZZ6 A;  1O5B B;  5C20 A;  6CHA B;  2BWE A;  1MZD A;  2ODY B;  2BOK A;  3PM3 A;  4NC6 A;  4Y7A A;  2FES H;  1WSS H;  2KW0 A;  1DWB H;  1V2P T;  5E26 A;  1N6X A;  2KM0 A;  1DAN H;  3AW1 A;  1ELB A;  3FZZ A;  1NFU A;  3GLH E;  2XH9 A;  2QQ8 A;  4DY7 B;  1FI8 A;  1AVG H;  2UU9 M;  4D7G A;  4DR7 M;  2YNM D;  1BUI A;  1L1J A;  1QL7 A;  2ANK H;  4MPX A;  4NZL A;  4INH A;  4NA8 A;  3KQ5 A;  2BX3 A;  1J7K A;  4M0D A;  1HCG A;  3M7G A;  1X7A C;  3Q00 A;  1BHX F;  1YM0 A;  4TSF D;  1GJ4 H;  4X2W A;  5F8T A;  4CJ6 A;  1BIT A;  1P3Q Q;  2ZFQ H;  1PFX C;  1H8I H;  1UCY K;  3FKS D;  2VH0 A;  1SL3 A;  1LVO A;  1Q3C A;  1O2M A;  3TK9 A;  1XKA C;  1XHB A;  1GHX H;  3MH5 A;  1O3P B;  1UK4 A;  2ZU5 A;  2SGF E;  1HAI H;  2BZ6 H;  4M7G A;  2FYQ A;  5EU8 A;  5EP3 A;  4X8V H;  1C9P A;  1IQH A;  2LVN C;  1NY2 2;  2OCV B;  4LF6 M;  1P9S A;  2HPQ H;  1VZQ H;  1IQJ A;  1GBI A;  4ISN A;  2KAI B;  1G8P A;  2VQF M;  2R9P A;  3QWC H;  2BD4 A;  1L1G A;  5L8R F;  3H7O A;  1GG6 B;  5HKK D;  2BD9 A;  4DV7 M;  1AI8 H;  1QA0 A;  1L2E A;  2WV4 A;  2TGT A;  2OOB A;  1GJ7 B;  3QTO H;  2C98 A;  3VB4 A;  1P2Q A;  2F9V A;  2GV6 A;  4F49 A;  1C5T A;  3O8R A;  2BD7 A;  1ACB E;  4ITQ A;  3KYG A;  1QUT A;  3A88 A;  5DGJ A;  1FLE E;  1Z8I B;  1ZMW A;  1EPT B;  1J9C H;  2JKH A;  2F9B H;  1YLD A;  3JR4 A;  2FLB H;  4D9Q A;  3TIU A;  2L4F A;  3DZD A;  3ATW A;  1C2F A;  2PTN A;  4DGJ A;  1MTV A;  3T38 A;  4HL4 A;  2V3M A;  3M37 A;  4D82 A;  3U6D A;  1K21 H;  1YYY 1;  2GP9 B;  3F0P A;  1QY6 A;  2DZL A;  4YHH M;  3KVW A;  1SGD E;  3T1H M;  2OC8 A;  1TFX A;  1KIG H;  2HAL A;  2UUA M;  4O3T A;  4O9V A;  1XUG A;  5FL7 D;  1GVN A;  3SI4 H;  1TTE A;  3SUF A;  3GOV B;  1ELV A;  2A5K A;  4FUI A;  3RXM A;  3FTD A;  3J80 S;  3EDX B;  5JBB S;  3PV5 A;  3ATI A;  2W5E A;  3F1S B;  1N78 A;  3M5O A;  2R2W U;  2JET B;  4K69 A;  2VWO A;  1QAQ A;  3RXK A;  3UOP A;  1O2L A;  2DHY A;  1YPE H;  3Q76 A;  1TON A;  3OY6 U;  4CHT B;  3KOZ E;  3ZV9 A;  1GHB F;  1QAN A;  3BTF E;  3ELA H;  2BD2 A;  2HWL B;  3ZV8 A;  2A7H A;  2PLX A;  5I46 H;  3MU5 A;  2OC1 A;  1OIP A;  1OWK A;  4ZMA H;  3SNB A;  1T8L A;  4AYV B;  2PKA B;  3K92 A;  2F5S A;  3TGK E;  2W26 A;  2OC0 A;  3SUE A;  5JI3 E;  1O5C B;  1Z1I A;  1FIW A;  1O0D H;  2WPM S;  2CMY A;  2FOD A;  2BY9 X;  2ZU3 A;  2ZCK P;  4JI0 M;  3BSQ A;  1HFD A;  4NZQ A;  1QTF A;  2LVP C;  2UXB M;  4MB7 A;  3GLF B;  2FDA A;  2SNW A;  2VID A;  3SAT A;  1D3P B;  3I4V A;  1TAW A;  4Y0Z E;  3BEU A;  4XD7 D;  1SGR E;  5IYT A;  3FUV A;  1K1N A;  2KX4 A;  4ABD A;  2V7Q D;  1MCT A;  2EST E;  3D62 A;  3A45 A;  2KCP A;  4CHA B;  4ABG A;  4DT7 B;  3VK7 A;  2PKA A;  4AG1 A;  5F3W A;  3K6Y A;  2IPQ X;  2DVW B;  2PWX A;  1GHZ A;  3QTV H;  4K8B A;  3LGW A;  2C8W B;  1HAO H;  4PDG A;  1BVS A;  3M3V A;  4EIW A;  4A1T A;  1QHR B;  4YLQ H;  3F2G A;  1GL7 A;  2FOB A;  4BAQ B;  4GSO A;  3VB7 A;  1A0L A;  1CT2 E;  2ZIQ H;  4GCH F;  4ACA A;  1P0S H;  1NES E;  3ZZD A;  1FQ3 A;  4CRB A;  3HJ8 A;  3GDS A;  4LZZ A;  1SGE E;  1O3N A;  1EAI A;  1BTH H;  4X6P A;  2XBV A;  1UVS H;  2CP8 A;  1H8E D;  2A0Q B;  2XBY A;  2QF5 A;  4IBG A;  1DLE A;  3C3D A;  2GT7 A;  3BG4 C;  2EUC A;  3SND A;  5K0H A;  2JY7 A;  1NZQ H;  3DD2 H;  3M0E A;  2A32 A;  3E9S A;  1O30 A;  2RFK C;  3CF0 A;  1QBO A;  2UWO A;  3GQ5 A;  3A42 A;  5C18 A;  1ETR H;  3V0X A;  4EST E;  1COW D;  4II7 A;  2RRU A;  2B8O H;  2ZZU H;  2LXE A;  2FS1 A;  1XUF A;  2OQU A;  1IN8 A;  1MKW K;  1O39 A;  1UK3 A;  1Y8T A;  1L2D A;  3GCH B;  4NXN M;  4XFQ A;  1TGB A;  1S6H A;  3BXW A;  1JRT A;  4ISO A;  4CRF A;  2GX4 A;  4LZ1 H;  1ZTL A;  4OS6 A;  3RXV A;  4GRI A;  3MNB A;  1NNJ A;  1Y3V A;  2WUB A;  3GRU A;  2UXC M;  5HYO A;  3LW5 F;  1O2G H;  1TDZ A;  3ZIA D;  1LCY A;  2P8O B;  2GDE H;  4JZD H;  4Q7X A;  3DT0 H;  5DN6 D;  1NFX A;  1W0J D;  4ABA A;  1W8B H;  2JDI D;  3AW0 A;  2XC4 A;  2D7E A;  1AB9 C;  3FE3 A;  1DOJ A;  4KTC A;  5HM2 A;  3OEE D;  4UN2 B;  3SQH E;  1Q39 A;  3ODD A;  4WXI A;  1Q3B A;  1C5S A;  2XEP A;  1CBW B;  1E1R D;  4W5W A;  3QK1 A;  1Y59 T;  5JB9 S;  5H4I B;  5BRR E;  3LCV B;  2Z4S A;  4CRE A;  1MTN C;  1QUR H;  2Q6F A;  4DBG B;  2ZFF H;  1GBB A;  3JZ2 B;  1HV7 A;  1NV8 A;  1XVO A;  3CS0 A;  3SZN A;  3W95 A;  4ABJ A;  2XWA A;  2KCO A;  3QGN B;  2G51 A;  1Y5U T;  3ZYD A;  2FIR H;  2L09 A;  3SU3 A;  3KSX A;  2TBS A;  4WVP E;  2ZPQ A;  1EAX A;  1UTM A;  1GAB A;  4WW0 A;  4IN2 A;  1GMH F;  3SU4 A;  1WTG H;  1Z7K A;  2FYR A;  2HHH M;  4DR6 M;  2HPP H;  3NCL A;  1FZZ A;  2K0Q A;  4LF9 M;  1HAV B;  3V3M A;  5IDK A;  3EA7 A;  3LJO A;  4UEH H;  1BMM H;  4LCB A;  3RP2 A;  1VGC B;  3SN8 A;  1Q31 A;  2V6Z M;  1KYI A;  1SGN E;  3K2L A;  3M36 A;  2KHH A;  3MI4 A;  2LNC A;  3U6M A;  1O37 A;  2ANY A;  4TYD A;  2SGP E;  1CHG A;  1QA7 A;  3PLK A;  1LPK B;  4INK A;  1C1Q A;  1SLX B;  1A1R A;  3SYL A;  1EZQ A;  2ASU B;  3EA9 A;  4Y10 E;  1F5L A;  2L7I A;  2OQ5 A;  1O3C A;  2OBO A;  3RXL A;  3BEI B;  3U69 H;  3UZU A;  3KXE C;  4ZKN U;  3WWF A;  3KYF A;  1PJS A;  4TWY A;  3AOG A;  1AVW A;  3FRH A;  1UHB A;  1DY9 A;  1LQE A;  2CJI A;  2ZP0 H;  4FU7 A;  3TH4 H;  1PM5 A;  3UAI C;  1PPZ A;  2TRM A;  3VEQ B;  4IBC A;  1FPH H;  1O33 A;  1E35 B;  3AAS A;  5EPY A;  1DIC A;  3TK6 A;  3BG8 A;  4YTA A;  4WP2 A;  2ZTD A;  2XNI A;  4F4O C;  1O3I A;  5GKN A;  7KME H;  1ESB A;  1HPG A;  4MNX A;  2GKV E;  3EAJ A;  5FHT A;  1DXP A;  2PGQ B;  5T3H A;  4ABI A;  4QT8 C;  3R8F A;  3HHZ A;  1SXJ B;  3T29 A;  2ZG0 H;  2ZPR A;  1WUN H;  1PRB A;  3H4J A;  5FTK A;  3LC3 A;  3ZZ9 A;  1HAX B;  1NT1 A;  1GHY H;  1G3C A;  1AIP C;  1JXP A;  1UCY E;  1VIT H;  4FOU C;  4YOG A;  4D80 A;  5EJC A;  5B6L A;  2Z8Y M;  5DNY A;  1W11 U;  5FTL A;  3OX7 U;  4FU9 A;  1YF4 A;  1CT0 E;  1SMF E;  1IN4 A;  4WUR A;  2HVY B;  2XZF A;  2H9T H;  4J2Y B;  1NVM A;  1FAK H;  2ZU2 A;  3V7T A;  2H9E H;  1VDL A;  3I01 M;  1O2T A;  3C1K A;  3OYP A;  3DOA A;  2O8U A;  3PMJ A;  1CO7 E;  1QIX B;  3L2A A;  1SXJ A;  5FBI A;  3Q77 A;  3S7H B;  1MQ6 A;  3BTE E;  4AB9 A;  1YBW A;  1EFR D;  4Y28 F;  1QJ6 B;  2SGQ E;  3NWU A;  4OS4 A;  2QSF X;  1IFY A;  2Z94 A;  4H4F A;  4LGM A;  5FTN A;  1YPH E;  2W3I A;  2Z9J A;  3E91 A;  1CU1 A;  4SGB E;  2BY8 X;  5JPM H;  1DT2 A;  3GCO A;  5HM9 A;  2Q2E B;  1ELD E;  2UUK B;  1NBM E;  2V0B A;  3MH4 A;  3SOS A;  1IN5 A;  1NJG A;  5JBA S;  4TY7 A;  3KGP A;  2DWM A;  2BY7 X;  5DFL A;  3SAV A;  2QXJ A;  1OYQ A;  3JR5 A;  3U61 B;  1W3C A;  2EQN A;  3CEN A;  4WH6 A;  4Y76 A;  5DKM A;  3OTO M;  1PJI A;  2ZTC A;  2BDH A;  1ZMJ A;  3U6C A;  1GL1 A;  2BOH B;  1ORF A;  1GDU A;  4NOO B;  1GVK B;  1AKS A;  2QAA A;  4U01 A;  2H1R A;  3LMM A;  4AOQ A;  1N1L A;  2HGT H;  1C5Z B;  3AFH A;  1E1Q D;  5DP4 A;  3UUZ A;  5JYI A;  2THF B;  3THG A;  3GLG B;  4KGA A;  1Y3X A;  3RXS A;  4DUR A;  4Y8Y A;  4CRG A;  5DK1 A;  1D6W A;  1ZMU A;  3LT3 A;  4ZPX A;  1DGG A;  3B9F H;  3U61 A;  1GI6 A;  4OX9 M;  3FUW A;  1GJ5 H;  4OVZ A;  1O2S A;  3HKJ B;  3TJO A;  1ELA A;  1ELT A;  2ZNK H;  4JN6 A;  4MNY A;  1QGF A;  1IY2 A;  3UPE A;  2FOI C;  8LPR A;  1YCP H;  2SGD E;  1XX9 A;  1TMB H;  3PWC A;  1P3C A;  2I6S A;  2G4T A;  2D7G A;  1HQY E;  2VGC B;  2GZ8 A;  3PRD A;  1AUA A;  2Y0T A;  1C5P A;  4I8K A;  2YMS B;  3OEH D;  5ETX A;  4A3V B;  4LF7 M;  1H1B A;  1TH4 A;  3LGT A;  2CWB A;  2F83 A;  1KLT A;  1ORY B;  4BTU B;  5AHG H;  2KNZ A;  2XF3 A;  1IHT H;  2GMT C;  5FBE A;  2JNH A;  1GBK A;  5EW2 H;  2ZCH P;  2J34 A;  1L8Q A;  4X2Y A;  3GO8 A;  1LHD H;  2J92 A;  4NIY A;  3M7Q A;  3U5Z B;  3HHX A;  5LMN M;  4RKU F;  3SU1 A;  1ELF A;  3HY5 A;  2AGG X;  2LVO C;  1PPE E;  2R4J A;  1C5M D;  3OTP A;  3KFU G;  5J4S A;  3A7Y A;  3MK6 A;  3A8B A;  4OS5 A;  2F9U A;  1HBT H;  3RXE A;  2ZAM A;  1FAX A;  1AGJ A;  4L4U A;  1TNK A;  5FLX S;  1GBE A;  2DWL A;  3GLH B;  1YKT A;  2Y21 A;  1SQR A;  1EZX C;  4NG9 H;  1F4I A;  2NU1 E;  5FTM A;  1A5I A;  2Y5G A;  3R0F A;  2Z3C A;  3T5F H;  3T27 A;  2J95 A;  3VGC B;  2VVC A;  1ZMV A;  1GLN A;  5DO4 H;  4E06 H;  1Z6J H;  4I8O A;  1SXJ D;  2EO2 A;  1ZTJ A;  4X8U H;  3NWL A;  3VDU A;  4AG5 A;  1JIR A;  2UUY A;  1XXH E;  1KFV A;  1A61 H;  2PUX B;  4X0W U;  4Q4L A;  4ABH A;  2VF8 A;  1DIT H;  1KSN A;  2BYA X;  2WPL S;  4ISI H;  1S6F A;  3BF6 H;  5C5O A;  1JOU B;  5C0U A;  2CHV A;  2FEQ H;  1GJ8 B;  4NCY A;  1V2J T;  5L2Z H;  1UTN A;  3GLH A;  1Z5A A;  3FD9 A;  2BVX H;  4RF1 A;  2R3U A;  4IC6 A;  2ZDK A;  2SFA A;  5EOK A;  3UGJ A;  1DFP A;  2JH0 D;  2BD5 A;  1YGC H;  1V2R T;  1WBG B;  3SW2 B;  1GWA A;  2ZFP H;  4TT3 D;  4KT0 F;  2HLC A;  4HZH A;  1O2U A;  5J4Q A;  3GP1 A;  2FOH A;  4DOQ A;  4FCT A;  1HGT H;  2CHA B;  1WGL A;  4AI6 A;  1WQV H;  4DV2 M;  3LCU A;  3PB1 E;  1TA6 A;  4IBD A;  3L25 A;  1MTW A;  2STB E;  2QEN A;  3GYL B;  1IQI A;  3LC5 A;  2KNA A;  3AV0 A;  2ZFR H;  2HNT F;  1MH0 A;  2ZHW H;  4UDW H;  4ZH8 A;  1GHV H;  3SOR A;  4K1S A;  4CR9 A;  3W0L B;  1LPG B;  1YCP M;  2CK3 D;  3HK3 B;  2F5O A;  1ANC A;  3URC A;  4K1T A;  4L8R C;  2L7H A;  1SLV B;  3CP7 A;  1Q02 A;  1P57 B;  1N6Y A;  5CDF E;  3LVW A;  5F03 A;  3MO3 A;  1TA2 A;  1RRK A;  5LPF A;  5IWA M;  3VXF H;  1TX7 A;  3JZ1 B;  3SGB E;  2CRU A;  3P70 B;  3KP1 E;  1C2E A;  4DR4 M;  5CMX H;  3PMH B;  2BX4 A;  3ZZ3 A;  2Y81 A;  3TIT A;  4RF0 A;  1Z8G A;  3NPS A;  1AO5 A;  5ITT A;  4FXG H;  4BLC A;  1VEG A;  3ODF A;  2QBY B;  1C2K A;  1KTT B;  2ZF0 H;  1GGD B;  3FAN A;  1T31 A;  4RKJ B;  2VWN A;  1S81 A;  1MTU A;  2LVA A;  3U60 A;  4NA9 H;  1ZQ9 A;  3P8O A;  3SHF A;  2BLV A;  3SI3 H;  1W5S A;  4NGA H;  5HMA A;  2MGW A;  5HIZ A;  5EXP A;  2VWM A;  1E38 B;  2VVU A;  3VB5 A;  1SPJ A;  4DV6 M;  2DHR A;  1Z6E A;  1IQM A;  1G2L A;  5EXL A;  2CGA A;  3T62 A;  1WU1 A;  3N7E A;  4B73 A;  1OX1 A;  3NRL A;  3MOC A;  1JWT A;  3I29 A;  1Y3Y A;  2RDE A;  1NHG C;  3L3T A;  3AOE C;  2CHQ A;  1IBL M;  1KTS B;  5A8Y A;  3QYB A;  4L6V 6;  2DXI A;  2ZDA H;  3KQB A;  1W10 U;  5TJX A;  3GLI E;  2I7N A;  4JZ1 A;  1DWE H;  1W7G H;  1Z5B A;  2QHO B;  1E34 B;  2RGH A;  1MUE B;  2X8A A;  1PPF E;  2V3O H;  2K1Q A;  4XBD A;  2R62 A;  1Z5C A;  4LJ7 A;  2TGD A;  4I33 A;  1TNH A;  4E7R G;  4WME A;  1NV9 A;  2NWN A;  2J94 A;  4MNV A;  1C1T A;  1GBA A;  4GIT A;  4LF4 M;  2A31 A;  5EW1 H;  2FLR H;  1NO1 A;  1AWH B;  3KSJ A;  1ZGI A;  3MYW A;  1PQ7 A;  4OM9 A;  1ZOM A;  1HXF H;  4X2X A;  1C1N A;  2Z7J A;  1SQA A;  5EP2 A;  2ZAO A;  1KY9 A;  4CRA A;  3SU6 A;  3TLO A;  3EA8 A;  1TPS A;  1PGY A;  2I7P A;  1NRN H;  2G81 E;  2ZCL P;  3SJO A;  4Y8Z A;  4AYY B;  1V2S T;  3K1J A;  2XZU A;  3SYJ A;  2QE7 D;  1ELE E;  1J17 T;  5GJ4 B;  1AHT H;  3EIH A;  3Q8X A;  1MTS A;  2ODP A;  5ITQ A;  2OLG A;  3UR9 A;  1AD8 H;  4JI2 M;  1J16 A;  1QRW A;  1WTH D;  2PSY A;  3HAT H;  3DA9 B;  1HJA B;  4HTC H;  3S9B A;  4MPU A;  2G8T A;  2Z3E A;  1RS0 A;  3WWB A;  1HAZ B;  1G30 B;  2B5T B;  2H5D A;  2PKS C;  4F55 A;  3B89 A;  4RNA A;  3ITI A;  3R3G B;  5FXL A;  5T6D A;  2Z9K A;  1D9I A;  2ZQ1 A;  1VCW A;  3PFI A;  3B7Q A;  5DSF A;  1EX3 A;  1YWU A;  3A85 A;  1NY5 A;  2RKO A;  1O2O A;  1WXR A;  2FE8 A;  1DPO A;  2BJV A;  1E9S A;  2XYA A;  2ZGH A;  3PO1 C;  3SQE E;  5DPA A;  3ZC7 B;  1YPH C;  2O9Q A;  2W6I D;  4D8N A;  4GHL A;  1H4W A;  5F8X A;  1A0H B;  3MU0 A;  2L4E A;  2R46 A;  4HGC A;  4NSR A;  3SMP A;  1SGC A;  5EPN A;  2HVX A;  2QF0 A;  1VIT G;  1P2O A;  1V33 A;  3IWM A;  2EA0 A;  3U1J B;  1IM2 A;  1QFK H;  2K8I A;  4IBJ A;  3A89 A;  1TBZ H;  1VJA U;  3FTF A;  1CA0 C;  3BIU H;  2ERC A;  1XB2 B;  1WYK A;  1AMH A;  5DP9 A;  1IXS B;  2O8T A;  2FZZ A;  3QGJ A;  3J7B A;  1N8O B;  4TWW A;  1LO6 A;  2UUF B;  3W67 A;  3QDZ B;  4JMY A;  1FMG A;  2VVV A;  3U1I B;  3LVV A;  4B3S M;  1DS2 E;  1TBQ H;  2IOT A;  2JWS A;  2ZHQ H;  1EJN A;  1GI0 A;  3SNE A;  1K82 A;  1SI5 H;  1O31 A;  4LF8 M;  4XE4 A;  1OWH A;  1C5R A;  1QZ8 A;  3BTH E;  1BJU A;  3CS7 A;  3MMP A;  3PTN A;  1ZJD A;  4I81 A;  4PD2 A;  1JR3 E;  5ITX E;  1N34 M;  2YNB A;  1CGJ E;  2QGR A;  1KSF X;  1MKW H;  3GS9 A;  4AB8 A;  1W0K D;  2DKL A;  1Y5A T;  2A4G A;  2K9D A;  5IZ7 D;  3SHA H;  2A4Q A;  1MKX K;  1IXS A;  1FX0 B;  2J98 A;  4PCZ A;  2PGB B;  3BTT E;  3DUX H;  5F6M A;  3C9P A;  4GHA A;  3GDU A;  3SUD A;  3D8L A;  1EP6 A;  2UUJ B;  2A5I A;  2DWZ B;  4RT1 A;  2A1D B;  4K60 A;  1HJP A;  3C27 B;  2D1J A;  1GVZ A;  3A86 A;  4FUF A;  1DGH A;  3FUX A;  3DSO A;  3EST A;  4A92 A;  3B7Z A;  2WSS D;  1TWX B;  2OPF A;  4I86 A;  3TGJ E;  3SU5 A;  2XC5 A;  4ACB A;  1EB2 A;  3GY7 A;  3U6E A;  1T3T A;  1P8V C;  2P3F H;  5E6J A;  3VK8 A;  1BMN H;  1V2N T;  3W1E A;  3OE7 D;  4ASU D;  1CQQ A;  1HIA A;  3AL0 C;  2VIV A;  3VB3 A;  4DT4 A;  1BTW A;  3A8A A;  1DDJ A;  2FOC A;  1CGH A;  3ZH9 B;  1SGP E;  1U6Q A;  5AFY H;  3T6P A;  2FP7 B;  1BIO A;  3DHK H;  3T25 A;  3AOE A;  1V2K T;  1HNX M;  2QC2 A;  2BTC E;  1DO0 A;  3LOX A;  1VDD A;  4B74 A;  4H42 U;  3SHG B;  1VEJ A;  4OW0 A;  3HKP A;  1G3E A;  1ZHR A;  1F0T A;  1GBF A;  3SU0 A;  3TU7 H;  3L28 A;  1O3B A;  3UY9 A;  3UQV A;  1XM1 A;  2H2Z A;  1HAP H;  3QN7 A;  1UJ1 A;  1O3G A;  2H5C A;  2JXN A;  3TWM A;  1FY8 E;  1ID5 H;  4Y6D A;  5DP7 A;  2EY4 C;  1MCV A;  4A5T S;  3GCH C;  3PWB A;  4AKG A;  3TQS A;  1A5H A;  1LHF H;  4PDI A;  2JZ1 A;  1BBR E;  5FCK A;  2WSF F;  1QVR A;  1C5Q A;  1MAX A;  1NFW A;  1K1O A;  2FX4 A;  2QV1 A;  2VBC A;  4YT7 H;  1TYN A;  2Z3D A;  3RE8 A;  4RI0 A;  1GJS A;  3TNT A;  4IBF A;  2VIN A;  3U6S A;  3F0O A;  3ZZ4 A;  4Y8X A;  2CEA A;  4X2V A;  3RXQ A;  2XCN A;  4DR3 M;  1TOC B;  1XUK A;  2C99 A;  1GL6 A;  3B74 A;  2A4O A;  1GCT B;  1T8O A;  4R3D A;  3C58 A;  1ZSL A;  4QOZ C;  3ATK A;  1UM8 A;  4DV3 M;  4LRS A;  3T1Y M;  1DVA H;  2BMG B;  2J97 A;  3F9G A;  3SV8 A;  2OK5 A;  1R2Z A;  5IK2 D;  4NL4 H;  3GRR A;  1O3J A;  3F9E A;  4MH0 E;  4BXW A;  3TWL A;  4LK4 A;  1OS8 A;  4IIW A;  1SC8 U;  1WCZ A;  1FON A;  4GIP A;  2PR3 A;  4AGK A;  3RC6 A;  2RGO A;  1P2N A;  2XOK D;  3AAV A;  2F91 A;  2ULL A;  4K3J A;  2KZ4 A;  5KEC A;  2C93 B;  4F2L A;  2BLO A;  3ZVC A;  2ZM6 M;  1FJG M;  1OP0 A;  4FVM A;  1QBV H;  2O8M A;  2G5N A;  1N32 M;  3EYD A;  3U8T H;  3UWI A;  3M3S A;  1FY1 A;  2BZA A;  4U30 A;  2CE7 A;  2DUC A;  1LHG H;  2QIQ A;  3TH2 H;  3ZZB A;  3GIC B;  3P8F A;  2XBX A;  3P92 A;  3TJU A;  2Q1J A;  5E8E H;  4NSV A;  3RDZ A;  3RXD A;  1QL8 A;  3B23 B;  4R8T B;  5EJZ A;  5EQT A;  4JZE H;  1Z59 A;  3GCT G;  4DG4 A;  1BMF D;  2KRU A;  4B6E A;  1YSY A;  3L29 A;  3K6Z A;  3RM2 H;  2XXL A;  2V1C A;  5L2Y H;  2AGI X;  2BD3 A;  3SFZ A;  1J5E M;  1P02 A;  2ZA5 A;  3A7Z A;  4WH8 A;  2FS9 A;  5FAH A;  1A5T A;  3RXT A;  5CHA C;  4BB9 A;  2H6M A;  3MO9 A;  4AZF A;  1P09 A;  2P3T B;  1RFN A;  5FSW A;  1TIO A;  2H9H A;  2PSX A;  1C7Y A;  2J4I A;  8KME 2;  1SKY E;  1GL0 E;  4NWL A;  4IBI A;  1B0F A;  2X4A A;  3LJJ A;  4BNR A;  3H09 A;  3U6Q A;  5C17 A;  1AFE H;  2QF3 A;  2QY0 B;  1GBL A;  2EA3 A;  4P00 A;  1MU6 B;  3K65 B;  1ABJ H;  5A0C A;  2Y5F A;  2GVF A;  1PQA A;  3J2P B;  1B5G H;  3F92 A;  1IQE A;  4X64 M;  3TJV A;  1K3W A;  2Y0Q A;  2HOB A;  3OAA D;  1C2M A;  3SGQ E;  3KQD A;  4YLU A;  2Z6B D;  1IQL A;  4YZU A;  3T15 A;  2UXD M;  2BDA A;  5FTJ A;  2STA E;  4JYV H;  1SQO A;  4BBA A;  1UTO A;  3ZCB B;  2SGA A;  3A46 A;  1NRS H;  3ZVG A;  3URE A;  1XXD A;  4NRW A;  1AE8 H;  2ZU1 A;  3QAU A;  3AVZ A;  1VIT F;  2F5N A;  1ZPC A;  1ARB A;  3M7U A;  2JA2 A;  3T2N A;  1YPG H;  3F9F A;  2YR0 A;  4Z6A H;  2A4R A;  4WMF A;  2WSE F;  3WHL A;  7LPR A;  1BTU A;  1ESA A;  3PLB A;  1E94 E;  4H6S B;  2OXS A;  3GQ3 A;  3SNC A;  5JI2 E;  2BQ6 B;  4AGJ A;  4MGI E;  1HT2 E;  1TNL A;  1YPJ H;  2TIO A;  1ZHM A;  1TE0 A;  1CHO G;  4ZKS U;  4DV4 M;  2FOG A;  1ZPB A;  1L4D A;  4B2B A;  3KOX E;  3MMG A;  4ZUH A;  4ZRO A;  1D2N A;  3KS8 A;  1XXH A;  2MH8 A;  1H9L B;  3E0P B;  1XMN B;  2BVS H;  2PHB A;  2Z9I A;  3RC4 A;  4ZXY H;  1BDA A;  4K8Y A;  1QQ4 A;  4QHS A;  5DP8 A;  2ANM H;  2FOE A;  1WHC A;  4GMQ A;  2L74 A;  3H7T A;  3UTU H;  3M6A A;  1P12 E;  1UHB B;  3FVF B;  1V34 A;  5C2Z A;  4YY3 M;  4JYA M;  3NKK A;  2KZU A;  4GH9 A;  2HCB A;  1MQ5 A;  3LON A;  2O25 A;  5DYI A;  3TE6 A;  4LZJ A;  2Z9L A;  3I77 A;  4AFZ A;  6GCH G;  1KMH B;  1RGQ A;  4MGZ E;  1ZSK A;  2GZ7 A;  4LF5 M;  3RXJ A;  2CUZ A;  4I4L A;  1GPZ A;  5ESB A;  1R4G A;  1DSU A;  4Q2K A;  1OWI A;  2FOF A;  5PTP A;  1S0R A;  1O2V A;  1P03 A;  4YES B;  4O03 A;  1E32 A;  4UON A;  4LJ4 A;  4GEW A;  1OP2 A;  2AER H;  1T4V H;  3V76 A;  1XVM A;  3KP0 E;  2CV3 A;  1GMD G;  2WPI S;  2ZTX A;  1O2Y A;  2PV9 B;  1S83 A;  1A46 H;  1N36 M;  1DWC H;  3CNR A;  4G6Z A;  3F68 H;  1BTP A;  4IJF A;  1OXG A;  1TGC A;  2JH6 D;  1HQC A;  1LHE H;  3ENS B;  4VGC C;  1C4U 2;  1H6U A;  2YMS C;  2L2D A;  2G4U A;  3URD A;  4LGY A;  1WQS A;  3UOU A;  1RTL A;  4ABB A;  1TRY A;  4XOJ A;  2LHG A;  4B3R M;  5GIB A;  1WR1 B;  2Z7F E;  4J1Y A;  1MU8 B;  1DY8 A;  4Y79 A;  3D8B A;  2OOA A;  1Q3X A;  2ALV A;  4U2W A;  3T28 A;  4GLY A;  4Z8X A;  3Q8G A; 
#chains in the Genus database with same CATH homology
 4TT3 D;  8CAT A;  3DFZ A;  1QQW A;  3FUT A;  3GP1 A;  2LH0 A;  2BJW A;  1OFI A;  2F5P A;  3TL4 X;  4X65 M;  4FCT A;  4L78 A;  4I5S A;  2OIN A;  4AI6 A;  3HU1 A;  4MGK E;  5GND A;  4LY6 A;  4GKK M;  2F4V M;  3KEE A;  4DV2 M;  1G3I A;  3FO8 D;  2E5L M;  4IBD A;  3L25 A;  4KOD A;  4TUW A;  1QAM A;  3U6L A;  2QEN A;  5H37 D;  1XMO M;  4IBE A;  2ZBK B;  5DYG A;  3RGP A;  3AV0 A;  4AW4 A;  4DUZ M;  1L1T A;  2KR7 A;  3W0L B;  2CK3 D;  3HHW A;  2KW0 A;  3ILK A;  2F5O A;  5E26 A;  3UK6 A;  2KM0 A;  4NWK A;  2QZ4 A;  4L8R C;  2L7H A;  3RGS A;  5CDF E;  3GLF A;  2XH9 A;  3L27 A;  5EP4 A;  3LVW A;  2UU9 M;  3O8D A;  1TDH A;  2YNM D;  4NRV A;  4DR7 M;  5CHB A;  5IWA M;  2R4E A;  4L16 A;  3O8C A;  1SXJ C;  1J7K A;  4M0D A;  1XNQ M;  3KP1 E;  3M7G A;  3PNV A;  5C0T A;  4OVZ B;  4DR4 M;  4TSF D;  1IN6 A;  1R7R A;  3J27 B;  4GC9 A;  3DSP A;  1IY0 A;  4RF0 A;  4Z8X A;  4G4R A;  5ITT A;  3GLI A;  3FKS D;  4BLC A;  3SV7 A;  1OHH D;  3M5L A;  1Q3C A;  2QBY B;  4X66 M;  2V1U A;  1XHB A;  4LJ6 A;  2HLD D;  3TPZ A;  3SAU A;  5EP3 A;  3U60 A;  1ZQ9 A;  3P8O A;  3SHF A;  3EIE A;  1W5S A;  1XXH B;  4LF6 M;  4QNR A;  5EXP A;  4X62 M;  4DV1 M;  4DV6 M;  1G8P A;  2VQF M;  2YOL A;  2DHR A;  4LFB M;  3FTE A;  3VDP A;  5HKK D;  4FCW A;  4I32 A;  3N7E A;  4B73 A;  3NRL A;  4DV7 M;  2X49 A;  3HU3 A;  1NHG C;  2Y20 A;  2C98 A;  4I31 A;  3AOE C;  2CHQ A;  2F9V A;  1IBL M;  4M9X A;  3RC5 A;  3O8R A;  2HL7 A;  4ITQ A;  2DXI A;  5EQR A;  2I7N A;  3JR4 A;  1Z5B A;  3DZD A;  4A1V A;  2RGH A;  2XSZ A;  4Z6Y A;  2X8A A;  2CV0 A;  3FYD A;  2AHM A;  2K1Q A;  3T38 A;  2R62 A;  1Z5C A;  4LJ7 A;  2UUB M;  4HL4 A;  4I33 A;  2BNK A;  4D82 A;  3U6D A;  2KFW A;  1L2B A;  5IRE B;  3F0P A;  1NBM D;  4YHH M;  3KVW A;  3T1H M;  2OC8 A;  4GIT A;  4LF4 M;  2UUA M;  2WV9 A;  5FL7 D;  3KSJ A;  1GVN A;  4OM9 A;  3SUF A;  2F4L A;  2Z7J A;  5EP2 A;  2ZAO A;  3FTD A;  3FTC A;  3J80 S;  3QWL A;  3P8N A;  3SU6 A;  3PV5 A;  2I7P A;  2W82 A;  1N78 A;  1E9R A;  3F3B A;  3M5O A;  3K1J A;  3AKZ A;  2XCF A;  3UJN A;  2XZU A;  1QAQ A;  3SYJ A;  2QE7 D;  1L2C A;  5GJ4 B;  1XMQ M;  3EIH A;  3Q8X A;  1IBM M;  4CHT B;  1S3S A;  3KOZ E;  5ITQ A;  3J7A S;  4AKI A;  1QAN A;  4JI2 M;  3GRY A;  2WPD D;  1YE9 A;  3DA1 A;  2AHM E;  4GC5 A;  2OC1 A;  3WWB A;  3GPY A;  3K92 A;  4F55 A;  4IBK A;  4RNA A;  2F5S A;  2F5Q A;  3SUE A;  2OC0 A;  5BPV A;  5JI3 E;  3KDS E;  3SAR A;  5IT9 S;  3PFI A;  4JI0 M;  2XFT A;  5KQ8 A;  4KHP M;  5DSF A;  3BOS A;  1IN7 A;  2UXB M;  1NY5 A;  2RKO A;  4MB7 A;  3GLF B;  2C5R A;  3SAT A;  2FE8 A;  1WXR A;  2BJV A;  3U6O A;  4QHT A;  1E9S A;  5ITX A;  1JR3 A;  3I4V A;  1HT1 E;  4FW9 A;  4MGH A;  2VQE M;  4Q63 A;  1YUB A;  3ZC7 B;  2Z3X A;  1DGF A;  4XD7 D;  4B3M M;  3FUV A;  3MJ5 A;  3N99 A;  2W6I D;  3M5M A;  2V7Q D;  4GHL A;  3KOW E;  2FM2 A;  3A45 A;  2KCP A;  3PVS A;  3VK7 A;  2R46 A;  1NSF A;  1GKI A;  5F3W A;  4NSR A;  2DVW B;  3SMP A;  5EPN A;  3GPU A;  4ZCN A;  4K8B A;  3GLI B;  4PDG A;  2EA0 A;  4DR2 M;  3U1J B;  1IM2 A;  4FD2 A;  1S6L A;  2K8I A;  4IBJ A;  4EIW A;  2G5G X;  4A1T A;  3FTF A;  4CGY B;  3F2G A;  1GL7 A;  2ERC A;  2CV1 A;  2OBQ A;  3M5N A;  3KN2 A;  1IXS B;  4IBB A;  1WXQ A;  3J7B A;  3UMM A;  3R9X B;  3U1I B;  3U60 B;  3HJ8 A;  4JMY A;  5EQS A;  4LZZ A;  4A1X A;  1IBK M;  3LVV A;  4B3S M;  3I51 A;  1K82 A;  1NJF A;  4JI4 M;  3GQ4 A;  4LF8 M;  4Z1M D;  1H8E D;  2QF5 A;  3VG8 A;  4IBG A;  3FUU A;  3VKG A;  4I81 A;  5C1B A;  4PD2 A;  5ITX E;  1N34 M;  2EUC A;  4NSO B;  2DZO B;  2XSZ D;  4LFA M;  5EP1 A;  4M9F A;  1DXW A;  1KSF X;  3M0E A;  3GS9 A;  3GRV A;  1W0K D;  1X37 A;  3E9S A;  3HHY A;  3PXG A;  2A4G A;  3CF0 A;  2Z4R A;  1HNW M;  3FOA A;  1DGB A;  4JI6 M;  3GQ5 A;  3A42 A;  2WHX A;  1BT7 A;  2P5T A;  2XFS A;  5IZ7 D;  5C18 A;  2A4Q A;  1N77 A;  1FX0 B;  1COW D;  4PCZ A;  4II7 A;  4GHA A;  4G4N A;  2LXE A;  3SUD A;  1IN8 A;  2YQZ A;  1ZAE A;  3D8L A;  2DWZ B;  1L2D A;  4NXN M;  1K3X A;  3SC3 A;  1DGH A;  3FUX A;  3DSO A;  4A92 A;  4AG6 A;  1MAB B;  2A5Y B;  2WSS D;  2OPF A;  3SU5 A;  4GRI A;  2R18 A;  3SMS A;  4B08 A;  1NNJ A;  1MX0 A;  2P59 A;  3SUG A;  3PNY A;  3GRU A;  4DR1 M;  2UXC M;  2R45 A;  4MGY E;  5ITU A;  1T3T A;  3U6E A;  1TDZ A;  5E6J A;  3VK8 A;  3W1E A;  3ZIA D;  4ASU D;  3OE7 D;  3FN8 A;  2XND D;  4JI8 M;  3AL0 C;  5DN6 D;  4DT4 A;  1W0J D;  3F2H A;  1G59 A;  2JDI D;  1SXJ E;  3ZH9 B;  3JAM S;  3SAS A;  2D7E A;  2FP7 B;  3AOE A;  5T1V A;  1NNU C;  1HNX M;  1NHW C;  4LJA A;  1DO0 A;  3LOX A;  1LV7 A;  1VDD A;  2KEB A;  3OEE D;  4KTC A;  3H4M A;  1Q39 A;  5FPY A;  4B74 A;  1Q3B A;  4LFC M;  3SHG B;  4OW0 A;  3HKP A;  2XEP A;  1E1R D;  3KS4 A;  4W5W A;  4JI7 M;  1XC8 A;  5KO3 A;  5H4I B;  3SU0 A;  5F53 A;  2Z4S A;  3L28 A;  3SBJ A;  3KOY E;  2YFQ A;  1JQJ C;  4KLN A;  3TWM A;  4DR5 M;  1J09 A;  2DZN B;  3TWK A;  2KCO A;  4P16 A;  2CV2 A;  2KCA A;  3GLG A;  2FOM B;  4AKG A;  1JR3 D;  2L09 A;  5EXS A;  3CTW B;  3KSX A;  1OJL A;  3TQS A;  3SU3 A;  3CF6 E;  4PDI A;  3UB0 A;  4WW0 A;  3SU4 A;  2O5R A;  1QVR A;  4DV0 M;  2HHH M;  4DR6 M;  2VBC A;  2QV1 A;  3IG8 A;  4L15 A;  5KQD A;  2F43 B;  3RE8 A;  2K0Q A;  4RI0 A;  4LF9 M;  5IDK A;  4IBF A;  3OFN D;  3U6S A;  3F0O A;  4LCB A;  2CEA A;  4OU7 A;  5FPT A;  2XCN A;  4DR3 M;  2KZS A;  2V6Z M;  1KYI A;  3K2L A;  2C99 A;  1GL6 A;  3HWS A;  3U6M A;  4R3D A;  3DCL A;  5ITR A;  3C58 A;  4TYD A;  4QOZ C;  4NXM M;  1UM8 A;  2QCU A;  4DV3 M;  3U6P A;  4LRS A;  3VLF B;  2FNA A;  3T1Y M;  1OFH A;  4GKJ M;  3PV2 A;  1A1R A;  1XWI A;  2OK5 A;  3AJI B;  3SYL A;  1R2Z A;  4D81 A;  3L6P A;  3SV8 A;  5IK2 D;  2L7I A;  4NL4 H;  3GRR A;  3PRB A;  2OBO A;  4G4O A;  4MH0 E;  3TWL A;  3UZU A;  3KXE C;  4IIW A;  4G4Q A;  2QF4 A;  2JIZ D;  4GIP A;  3WWF A;  3RC6 A;  2RGO A;  2KXE A;  1QAO A;  3NBI A;  3AOG A;  4B7F A;  4JV5 M;  1G4A E;  3U5Z A;  1DY9 A;  1TGU A;  2XOK D;  3I4Y A;  3L26 A;  1PM5 A;  2KZ4 A;  2M5Z A;  1NS3 A;  4IBC A;  2ZM6 M;  1FJG M;  5KPZ A;  5EPY A;  4FVM A;  2O8M A;  2CHG A;  1QZM A;  4M9S A;  1L1Z A;  1N32 M;  3EYD A;  2XNI A;  2QPA A;  5GKN A;  5KPR A;  1Z6T A;  2CE7 A;  2XLJ A;  4WF8 A;  1DXP A;  1IXR C;  3R8F A;  4DUY M;  1TH2 A;  3HHZ A;  1SXJ B;  3WW7 A;  5EXT A;  4MM3 B;  1TH3 A;  5FTK A;  2J7O A;  4S12 A;  3AK5 A;  3E4R A;  2C9C A;  5ETX A;  5KPT A;  3GPX A;  5B6L A;  1JXP A;  4D80 A;  5EJC A;  2JJ1 D;  5EQQ A;  4R8T B;  5DNY A;  5EQT A;  4B3T M;  2GGV B;  1Z59 A;  5FTL A;  1BMF D;  2J5U A;  3IG5 A;  2KRU A;  2ZAN A;  4B6E A;  1IN4 A;  1YSY A;  1R6B X;  3L29 A;  4WUR A;  1DO2 A;  2V1C A;  3KW6 A;  1NVM A;  2XZF A;  2LEL A;  4AQY M;  3CF2 A;  1DGH B;  3SFZ A;  4R7G A;  1J5E M;  3OYP A;  3DOA A;  5EXX A;  4KO8 A;  2CFO A;  3L2A A;  4LG2 A;  4WH8 A;  3SYK A;  1SXJ A;  1G41 A;  4BB9 A;  2K47 A;  4AZF A;  4B71 A;  1EFR D;  5FSW A;  3KNX A;  3SV9 A;  4HLQ A;  1SKY E;  4NWL A;  4IBI A;  4LJ9 A;  2X4A A;  2LWX A;  4LGM A;  3H09 A;  5FTN A;  3FKE A;  3U6Q A;  2OC7 A;  5C17 A;  1CU1 A;  2Q2E B;  4JI1 M;  1H8H D;  3F2F A;  4B75 A;  1NBM E;  4JXJ A;  2J7N A;  1IN5 A;  1NJG A;  2GVF A;  2KA6 B;  2DWM A;  4AKH A;  3J2P B;  3SAV A;  4X64 M;  3JR5 A;  3U61 B;  4M9Z A;  1W3C A;  4WH6 A;  4REZ A;  1K3W A;  3OTO M;  1PJI A;  2Y0Q A;  2NQ8 C;  3OAA D;  4QOS A;  4LJ8 A;  3U6C A;  4NOO B;  3RFW A;  2C96 A;  3T15 A;  2UXD M;  5FTJ A;  4FCV A;  4BBA A;  3ZCB B;  4U01 A;  2H1R A;  3LMM A;  3A46 A;  3SU2 A;  1EE8 A;  4FWD A;  1N1L A;  3AFH A;  1E1Q D;  2W6J D;  3THG A;  3GLG B;  1W5T A;  4NRW A;  3GPP A;  2KCY A;  2C9O A;  3QAU A;  1XNR M;  4FWH A;  2F5N A;  1N33 M;  4B76 A;  1NY6 A;  5ITY A;  5BR8 M;  2JA2 A;  4ZPX A;  2YR0 A;  1DGG A;  2HKJ A;  2YMS D;  2A4R A;  3FYC A;  5GPI B;  3U61 A;  4OX9 M;  3FUW A;  3WHL A;  3WHK A;  4OVZ A;  2VII A;  4B6F A;  1IY1 A;  2R65 A;  4JN6 A;  1IY2 A;  1N75 A;  1E94 E;  2FOI C;  3GQ3 A;  5JI2 E;  4XGI A;  1I4W A;  1HT2 E;  4MGI E;  2UUC M;  2D7G A;  1HQY E;  2QBY A;  2M2A A;  3PRD A;  2Y0T A;  7CAT A;  5A2Q S;  1IQP A;  1MU5 A;  4DV4 M;  1HR0 M;  4A3V B;  4LF7 M;  3B9P A;  2D7H A;  3KOX E;  4K0K M;  2YMS B;  3OEH D;  1TH4 A;  1D2N A;  4FET A;  3KS8 A;  1XXH A;  1ORY B;  2IJO B;  4JI3 M;  1C1K A;  2XF3 A;  1E79 D;  3RC4 A;  5FPS A;  3HU2 A;  1HNZ M;  4QHS A;  2L6O A;  4YXW D;  1L8Q A;  4GMQ A;  4M0W A;  3GO8 A;  3M6A A;  4B7G A;  3U5Z B;  3HHX A;  5LMN M;  3SU1 A;  4LJ5 A;  3E90 B;  4YY3 M;  4JYA M;  2KZU A;  3OTP A;  2R4J A;  4GH9 A;  2HCB A;  3SAW A;  3KFU G;  3KF2 A;  3LON A;  5DYI A;  3TE6 A;  3MK6 A;  4LZJ A;  2DWN A;  2F9U A;  3J81 S;  1R2Y A;  2ZAM A;  1KMH B;  4MGZ E;  1RGQ A;  4LF5 M;  2FFJ A;  2CUZ A;  2QP9 X;  2XGN A;  4I4L A;  4IJE A;  4L4U A;  5FLX S;  5LMU M;  2DWL A;  3GLH B;  5ESB A;  2Y21 A;  3LKW A;  1E32 A;  5FTM A;  4LJ4 A;  4LRT A;  2WZQ A;  2KRK A;  3K8Z A;  3KP0 E;  1FNN A;  3A98 B;  3SZE A;  1GLN A;  4PT5 A;  4FWG A;  4I8O A;  1SXJ D;  2EO2 A;  1N36 M;  4G6Z A;  3NWL A;  2OQ4 A;  3VDU A;  4AG5 A;  3LQQ A;  4IJF A;  1PJJ A;  2JJ2 D;  1HQC A;  1KFV A;  4XBO A;  3HJS A;  1H6U A;  4DV5 M;  2YMS C;  4Q4L A;  3HGI A;  2LNH C;  2M60 A;  4LGY A;  4JI5 M;  1I94 M;  1RTL A;  5C0U A;  2CHV A;  4B3R M;  3VKH A;  3GLH A;  1Z5A A;  3D8B A;  3FD9 A;  4RF1 A;  1DY8 A;  1QYR A;  3LQR A;  3N7D A;  4CIS A;  1IXZ A;  3MHV C;  3W0F A;  4B7H A;  3UGJ A;  2IJD 1;  3HJQ A;  3SV6 A;  2G8L A;  3O8B A;  3VFD A;  4QNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...