2L6OA

Nmr structure of the protein yp_926445.1 from shewanella amazonensis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
b'MGAGQTPHPQLIWPALLKQQGCNELLPLRTNDDWQRFCADSKHLLQYGDKLVDSNFHCFVLEEDAHWHPAAPLPPEGLNDLIRAHCATLGHCCTSKMHLHSVMDAIDFLNALEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein YP_926445.1
publication title NMR structure of the protein YP_926445.1 from Shewanella Amazonensis
rcsb
source organism Shewanella amazonensis
molecule tags Structure genomics, unknown function
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13642 DUF4144 protein structure with unknown function
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.650 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2l6oA02
2.40.10.320 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2l6oA01
2L6OA
chains in the Genus database with same CATH superfamily
2A45B 2STBE 4ANRA 2QP9X 4AZFA 2A7HA 2ZTCA 4LXBH 3MMGA 1NM6A 3A8BA 3PLKA 1BHXB 2HL7A 1UFZA 2XWAA 2X8AA 3VK8A 2A5YB 3UZUA 1J16A 1Z1JA 2BHGA 1N34M 1WAYB 3QZQA 3MYWA 3KVWA 1SXJB 2G51A 4QOZC 1Y59T 1IM2A 4TY7A 3H5CB 2JJ2D 2BQ6B 1ZGIA 3A7YA 1HDTH 2KNZA 3NWLA 1NSFA 1SMFE 1CUKA 2QV1A 4OS6A 7ESTE 3EYDA 2GQFA 3KYFA 1C1OA 5EJZA 4FUHA 1TPSA 4GC9A 1UVSH 3P6ZB 3A84A 2W7UA 2Z3EA 1P11E 1NRQH 3RXKA 3GCOA 1FLEE 1THRH 4IIWA 1BMMH 4JI4M 2P3TB 1WOFA 1H9IE 1C7YA 1QIXB 2FOBA 3S9BA 2ZFPH 1O37A 2O8MA 1VCPA 1O3HA 4UONA 4NA8A 3RXTA 3SHCH 4Y7AA 1PPEE 2TIOA 4ZMAH 5C20A 3FAOA 3MOCA 6CHAB 2BD3A 3U8TH 3ZZ6A 1EUFA 3MQKC 1EP5A 2ZTYA 1GJ9B 1UK2A 1ZTKA 2NU4E 4BAMB 1C1SA 2ZAOA 1PM5A 2OQ5A 1J17T 4NFFA 1GJSA 3BTGE 2I6SA 1IHSH 1H8ED 4KLNA 3AAVA 5EXPA 1EZQA 1LHDH 1MKXH 2XEPA 2KCOA 1WQSA 5GWZA 4II7A 3U61A 3L2AA 2Z9LA 2WPLS 3UK6A 3H09A 1QHRB 1Z6EA 4CR9A 3T1YM 3UREA 1CT0E 3M36A 2GDDA 1P03A 1FN6A 4JI0M 2P59A 2B0FA 4DCDA 2ZFFH 2KFWA 3PV5A 4DV0M 1LPGB 1L1JA 3A88A 4D7FA 1FMGA 1RIWB 4A5TS 3VFEA 4LJ6A 1L2CA 1NC6A 1LHFH 8LPRA 1OYTH 3IG5A 1LHGH 4MPVA 4M7GA 3TNTA 4FUFA 3F2GA 5IYTA 2C96A 1TIOA 4AGKA 1NT1A 1TMUH 3S7KB 5B6OA 1OHHD 1QANA 3GPXA 1GG6C 1P04A 4F55A 1K21H 3ZZ8A 2CXVA 2GD4B 3STJA 4AGJA 3HHYA 1O3EA 4GRIA 1IXZA 1S0RA 4BB9A 5HKKD 1E94E 3SHAH 4H6SB 1K1JA 1SL3A 2QA9E 3Q8XA 1ZOMA 4JK5A 2WSCF 2O8UA 2C99A 3GLGE 1IN8A 2L74A 1N6XA 2BY8X 4I8KA 1QURH 4FOUC 3Q8GA 1AMHA 2R45A 3ZC7B 3DSPA 3E6PH 1OTRA 3M5NA 2EI8A 4O3TA 4AB9A 4DV6M 2ZBKB 2QCYA 4MGHA 1IHTH 4Y0YE 3FOAA 4FU7A 2XTTB 1KIGH 2ZWLH 2BDBA 2J7NA 1JRTA 3JR5A 2QXIA 4B08A 1IFYA 1DGHA 2KRKA 3GCHC 5HMAA 1Y3XA 3C9PA 2Y82A 2RRUA 1Z8GA 1GHYH 3RUOA 1S85A 5JBAS 4HLQA 2KNAA 1E0FD 2BB4A 5FCRA 1C1VH 2J92A 4FVBA 1HLTH 1K0HA 3MI4A 3U6SA 4Q63A 8GCHF 6GCHF 1LQDB 1SXJD 4RKUF 2LVAA 1Y3WA 3I77A 5IT9S 4HTCH 1EOLA 2JP7A 3E46A 4GKKM 3FUTA 3A46A 2IPHA 2VWMA 1EFRD 3N7OA 1UTMA 3VB5A 4BNRA 5L30H 2P16A 1CHOG 1FONA 3A85A 3PWCA 3FUWA 1O3FA 3SZNA 1AY6H 3VLFB 3FYCA 1FPCH 3BIUH 2ZHWH 1WIVA 3RXLA 1ZPZA 2GTBA 4LCBA 1O2KA 2ZDAH 2DI0A 3HPTB 2OPFA 2LVQD 2R4EA 3KQBA 4L16A 1NV9A 1GL1A 1AVXA 1GHZA 3T29A 1XNQM 4RN6A 3RXMA 1K1PA 1S3SA 1GHBG 1KXAA 5LPEA 4AG5A 3LDXH 3MU8A 4A1VA 3BBZA 2PWXA 1G8PA 4SGBE 1SGYE 1NY6A 4Z6YA 4Y7BA 4LJ9A 2EQNA 3U6DA 1W12U 2PKAA 1PYTC 4JI3M 4L8RC 1XXHE 1OIZA 1ESAA 4FVDA 2TGTA 1NBMD 2FOAA 2Y6TA 1ZJDA 1LQEA 2ZGCA 3KCGH 4X6OA 3SUGA 1MN3A 4YLUA 2QQ8A 4K8YA 3W94A 4AZ2B 1IQJA 1C5UA 4LFAM 3K2LA 3SBJA 8KME2 4KKDA 3BEFB 1TGNA 3DOAA 4AKIA 2DHRA 1G71A 5KPZA 1A5HA 1NS3A 1QRZA 3LQRA 4K5ZA 2C9CA 1GMDG 1NRRH 2OO9A 2OTVA 1CE5A 5T6GA 2R4JA 1ZMWA 5BRRE 2FDAA 1TABE 4LZ4B 4G4QA 1EASA 4BAOB 4IMZA 3K6YA 1MKWK 1Q39A 3HZJA 2BXUH 2VIDA 4LJ4A 1P9SA 3SU4A 2F5NA 1CBWC 2BX3A 4JYTA 1EOJA 2D7HA 1MAXA 2QBYB 2BD8A 3V0XA 1Y8GA 5FX5A 2QN5T 3V76A 2O25A 1TBRH 4FUDA 2DAEA 2PKAB 4TYDA 1JR3A 3SU1A 1E9SA 2OLGA 1G59A 1LVOA 5H4IB 2Q2EB 1HXEH 2QHOB 4WH6A 1NU9A 2APLA 1IXSB 1ZHMA 3KOYE 2OBOA 1SR5C 1BBRE 3BTKE 1DV0A 2BY6X 3B7QA 1YPHE 1WUNH 1YWUA 5EQTA 1UVTH 5E8EH 3LGIA 5AFYH 1U6QA 3N7DA 3KSXA 2DWLA 4NG9H 1YM0A 1BITA 3A86A 4P17A 1DWCH 1Y3UA 3F68H 4ZHLU 3RXRA 3GCTF 2PFEA 3MH7A 1G3EA 1NVMA 2HNTC 5HIZA 1TDZA 1R2YA 2THFB 4AYVB 2QY0B 1TPPA 3TE6A 5A0BA 1Y8TA 1O2GH 4IJEA 4NWKA 1NNUC 3E4RA 1AFEH 3FVFB 4ISNA 4WVPE 2XRCA 2G8TA 3ITIA 1QY6A 2P8OB 4NZQA 1FUJA 2F9NA 1TNGA 2FIRH 2V6NA 4ASHA 4D82A 4I32A 1C1WH 1O34A 1ZSJA 3GYMA 3NK8A 3UWJH 1GLNA 1LPZB 2XBYA 3U6LA 3L33A 3ZYDA 1UVUH 1IQGA 5GXPA 1P01A 2C8WB 1V2RT 1YGCH 3VK7A 2VIOA 4MPUA 5EQQA 4M9XA 1O33A 1TTEA 1SOTA 1NPMA 1Q3XA 4HGCA 1O2UA 2FX6A 1KXDA 3EAJA 2V1UA 4NSYA 2R62A 4B2BA 1NFYA 1SFIA 3AV0A 1OXGA 1AO5A 1DM4B 3A8AA 2FEQH 3UNQA 2A5KA 4DR6M 3FD9A 1DSUA 3RXCA 2CV3A 1MTUA 2LELA 1HAIH 1F5RA 1GL0E 1DITH 2F5QA 3LH1A 3RXIA 1GCTB 1MCTA 2TGDA 5F6MA 1MTNC 3F9GA 4XE4A 1UM8A 1N78A 5E0HA 4ZHMU 3PRDA 2ZECA 2CWBA 3CF2A 2ZTDA 2VIPA 4YZUA 3RDZA 2FS1A 1GJ5H 4OS7A 1D0MA 5EXSA 3SJIA 5IDKA 4QHSA 3NBIA 4JZFH 1O35A 2RDEA 2JY7A 4DV1M 1IQLA 3HHXA 1MTWA 3W95A 1PJJA 4Q7ZA 1C1TA 3LCVB 3QYEA 2JY6B 3W0FA 1O32A 2GDEH 5EOKA 1COWD 4BANB 2DWNA 4M9ZA 3UJNA 1BRBE 5HIYA 2PUQH 1NV8A 4DR5M 4AKHA 2HALA 2KCAA 2JY5A 1JBUH 1WJ7A 2OC0A 2R3UA 4R3DA 2GZ8A 3TIUA 4LGYA 3T6PA 1AIPC 1A0LA 1GHAF 1IBLM 7CATA 1ETRH 1MAYA 1KXEA 4S12A 1SGQE 4JI1M 1ELEE 1H8HD 3MU0A 1GJBB 1F92A 1GJTA 2BDAA 1V33A 1W0ZU 4AI6A 5DP3A 3U6MA 1QBVH 1AGJA 2FTMA 4IBEA 5C1BA 3SNAA 5DP5A 4AOQA 2UWOA 4LOYH 5G4BA 4CBOA 3GLGA 4X6NA 4DY7B 1OFIA 4AFZA 2F4LA 1NO9H 3B7ZA 5AVDA 3HK6B 2JWSA 1ZRBA 1L2BA 3RXOA 1CT4E 3VB4A 5F53A 3O8CA 1DXWA 3U8OH 1QTFA 1GI0A 1HXFH 2ERCA 4MGZE 3D23A 2BDCA 3OTJE 2KCPA 1OAIA 3EA7A 3SW2B 3P8NA 2CF8H 1HUTH 2XWBI 2VDBB 1ELBA 1S84A 2ZPRA 3UAIC 1A2CH 1C2MA 3J81S 2GMTC 8GCHG 2BLOA 6GCHG 1AFQC 4OVZA 4X1NU 1TQ7B 3RU4E 3SUEA 4BBAA 2FZZA 4NIWA 3SBKA 4TWWA 3V12A 4FUCA 2ZDKA 4UEHH 1B0FA 3SQHE 4JCNA 3E90B 1XUHA 1HB0B 3HJ8A 3PLPA 1VDLA 1BUIA 2Z3XA 1GCDA 1TX7A 4K1TA 5EJLA 1O5BB 1XWIA 1K1NA 3F0OA 2VF8A 3KXEC 4BTTB 1HBTH 2DAMA 2F9OA 1OWJA 4YLQH 2DAIA 4HI3A 1BTXA 2ZU2A 4JXJA 2AS9A 2K6BA 1HQCA 3A7VA 2ZO3H 2F5OA 2TPIZ 1VITH 3MHVC 3P8GA 2BD4A 3F6UH 2V35A 3PROA 4J1YA 2A31A 3VKHA 2EI6A 1HJAC 4UFGH 4ABBA 3ZZ7A 4X8UH 2FNAA 2DVWB 1S6HA 2FP7B 1C9TA 2BDGA 1IY0A 2NQ8C 1ZYOA 1S83A 3R3GB 2WINI 1O2LA 3UQOA 2Y0QA 2O01F 3B89A 1HAVA 1B7XB 2XNIA 1QQ4A 2SGFE 2B7DH 2UUJB 2JY8A 3TNSA 1P10A 3CS0A 2L2DA 5DP6A 4AX9H 2DE8A 4VGCB 2C90B 3ZQJA 1D3DB 4DR1M 3UTUH 1XXHA 2KAIA 1BMNH 7GCHG 1HNWM 2HWJA 1M9UA 2A4OA 4X64M 4D9QA 5F8XA 2EJSA 1NFXA 2ZFQH 2XFSA 3RXHA 1TMTH 3PLBA 1VG5A 4LF5M 2LNHC 1Z59A 1V6DA 4RI0A 1BTWA 1DY8A 1DLKB 1W14U 2J4IA 1LPKB 1TQ0B 2HVYB 2V0BA 1MJGM 4X1PU 1DGGA 2ZGJA 2ZNKH 3VGCC 2YMSC 3SUFA 1F5LA 2ZANA 4MGIE 1UO6A 4OS1A 2BY7X 3SV2H 2C8YB 1TRYA 1GL6A 2XFTA 3GLHA 4F1IA 1PPBH 1Z5BA 1HAVB 3NKKA 3NUMA 1QB9A 1L0ZA 3BTTE 2FOMB 2OCVB 3W1EA 1R7RA 2BVXH 3Q3KA 2DNAA 4X2WA 3MMPA 2OP9A 4IJFA 2GZ9A 1BQYA 2AMDA 2KAIB 1ZSKA 1C5MD 2CFOA 2W82A 3ZVAA 4YT7H 1Q2WA 2GCTC 1JWTA 1OWHA 2OC1A 3LGUA 3ZIAD 1D3PB 2JZ1A 3GDSA 2H9EH 1CGIE 3UFAA 1DE7H 2Z8YM 5FTKA 1N36M 2ZDMA 3UNRA 2WSFF 1AVWA 1ELTA 1GMHF 1HJ9A 4FCWA 1L4DA 5TCCA 3B23B 1YP9A 1DVAH 2A7JA 5EP4A 5CHAC 3LC5A 3B9FH 3LIWA 1IQMA 2I6QA 1GABA 3QGJA 2YQZA 3O8RA 5LPRA 3FTDA 3GCTG 4Y28F 5GIBA 3UIRA 1CSOE 3D62A 1MKWH 3RC4A 2BMGB 1G2MA 3M5LA 4K69A 4HG6A 3VKGA 2G8LA 4ABHA 4OGXA 3GLHB 3GPUA 1O2YA 3VXEH 3U5ZA 1R5LA 1P12E 1F0UA 2BZ6H 1RU3A 3DFZA 4EIWA 1VR1H 1E37B 4CRFA 1W0YH 3SJ8A 4X8TH 3GLFA 1D9IA 3OEED 1O2TA 3E0NB 4IBIA 1ORYB 5I25A 3QWCH 3SYJA 3KDSE 1MU8B 1BT7A 1IBKM 3RXGA 2LVOC 2K9DA 3VB6A 3TU7H 3BF6H 2SGPE 1ARBA 3F9FA 1R6BX 2B8OH 1D0LA 4JMYA 1YYY1 4Z0KA 1O3AA 1NRPH 3PYHA 4TPYA 3VDUA 2A32A 3MH6A 4ZUHA 2VBCA 4YOIA 4D8NA 1Q3BA 2WYJA 4DV3M 2QCUA 1KYNA 5EXNA 2LTUA 3U6OA 1MZAA 4NA7A 1EE8A 1PJSA 4XSKU 1TWXB 3MNSA 3LGYA 1OWDA 3SJOA 3ODFA 3SI3H 5CDFE 1DWDH 3KS8A 1GGDB 1SG8B 4ABIA 1G3BA 4A1XA 4JI5M 3GLFB 3ZVDA 1G9IE 1A1RA 3U6CA 4J2YB 4IBDA 1FI8A 4WMFA 1K28D 2PLXA 1AD8H 3TLOA 4A7IB 1TGBA 2WYGA 1FAKH 1HJPA 3U8RH 4BTIB 3SJKA 2ZI2H 2GV7A 3GQ5A 2QF4A 3NWUA 4ABFA 3VPKA 2WZJA 4KT0F 3BEUA 3PRBA 5A09A 1XMQM 1ZR0A 3E1XB 2BWBA 1SGFG 4UFDH 3KP0E 1SLXB 2A5IA 4GMQA 2BQ7B 1GBJA 1K2I1 1DGBA 3SGAE 3FZDA 1BMLA 5KPRA 4CJ6A 3GCNA 3KQCA 1GHAG 4B1TA 3TQSA 3PM3A 4ZPXA 5JI2E 4JZ1A 2H2ZA 3NZIA 3ZZ9A 4AFQA 1PJQA 1SFQB 3M0EA 3QDZB 3FP6E 3ATKA 5JPMH 3SU3A 2AGIX 1D3TB 3F1SB 1GHXH 1QCPA 4P16A 1BCUH 1GMDF 1SXJA 2O5RA 3LVVA 3SC3A 4DR4M 2CP8A 3E8LA 3UMMA 3A7XA 3OX7U 1LHCH 4KP0A 4NOOB 2JH6D 4QHTA 2ZCHP 2R6FA 2BOKA 4B2CA 5LH8A 2KEBA 4IMQA 3VXFH 4LRTA 3PTBA 3RLYH 3SYKA 3ZZCA 2W3KA 4NRVA 3RXSA 1BBRK 1BMAA 2FTLE 2ZPSA 1ZMVA 3ZZBA 1YY3A 3A45A 3AK5A 1BTYA 2STAE 2HRVA 1DPOA 5DN6D 3UPEA 1E38B 1ZTJA 2ZDLA 4NGAH 4FWGA 2K0QA 1DO0A 3I29A 3LJJA 3MH4A 1C2JA 1YC0A 1W2KH 1WXRA 4LFCM 2F9BH 1C1UH 2KM0A 1VQ1A 3L28A 2Z9GA 3N7EA 3KN2A 5DFLA 1BTUA 3DCLA 5EQSA 2QENA 2V1CA 3KNXA 4X1SU 1AHTH 1C1RA 3T28A 1K1IA 1P2NA 3GS9A 6LPRA 1QRWA 4RT1A 1LTMA 4X8VH 4X62M 2UUYA 3HKPA 3LT3A 2O9QA 2TGAA 5EXXA 2F3CE 1VJ9U 3MK6A 1HAPH 1SQAA 2FMJA 1LKBA 4MDSA 4HZHA 1C5PA 1G3IA 3RE8A 2Z94A 4Z8XA 5EW1H 4UD9H 1HAXB 1QDTA 3W67A 1L1NA 4BOHA 4Q7XA 3AVZA 5JI3E 3SMPA 2Z3DA 1NHWC 2QGRA 1VGCB 1GI1A 2D2DA 2YMSD 3LQQA 1ZZZA 1C4V2 4B6FA 3AOEA 5B6LA 4FU8A 1AB9B 1FNIA 4OGYA 1THPB 1PPHE 1ZGVA 1O3NA 2JZ0A 4GC5A 1GI3A 1L2EA 3DSOA 5EW2H 1DANH 1Y5BT 1WR1B 4DVAU 2FX4A 1PQAA 2R0KA 1HGTH 2C4FH 4K2YA 5C5NA 3H4MA 1MCVA 4AKGA 1GVKB 3SZEA 2WPKS 3E9SA 5C1YA 3BG4C 5DP7A 5EPYA 4B74A 4MNVA 3HU3A 4F2LA 1FX0B 1P02A 1TBQH 4INLA 5JBTA 3HJQA 3SNBA 1XNRM 2VVUA 1PRBA 2J98A 2VIIA 1TLDA 2AMQA 3DFJA 3OSYA 1WGNA 5K0HA 3LGWA 3SU0A 2YNBA 2ZU5A 4Q2KA 4WW0A 5DP8A 2WSEF 4R71A 2ZGHA 4CH8B 1T8NA 1WU1A 2J2UA 4K1SA 3T2NA 3THGA 1VJAU 5CMXH 2HPQH 4E7RG 1YPKH 4I8OA 3B9PA 1B0EA 2OOBA 1O2OA 2Y7ZA 2VIQA 3PMBB 3G01A 2C9OA 4TY6A 4DV7M 4G4RA 3WWBA 1OAOC 4Z6AH 1GMHG 4ABEA 5JYIA 2VIVA 1AI8H 2HCBA 1W3CA 2PV9B 5H37D 4Y8XA 2AERH 4ACBA 1IY1A 4IBJA 5ITRA 2JXNA 2DXIA 1TX6A 2J98B 1UHBB 1V2OT 4B3SM 2VU8E 2RDLA 3Q00A 4DOQA 4I33A 1FPHH 2ZIQH 3FTCA 4PDIA 2XGNA 4DR2M 1QB6A 3SGBE 1Q31A 3BTFE 4JK6A 1E1RD 1O2WA 3EA9A 1TH4A 5EP2A 1UCYH 2WV4A 3FP8E 5TJXA 9LPRA 5E6JA 2FOHA 2Y80A 3K9XB 2RA3A 3GY2A 2BD9A 5FTLA 4K0KM 2FXRA 2V3OH 3C1KA 3LGTA 1HFDA 5GCHF 2OK5A 3FKSD 4DT4A 2CV1A 2BJWA 3B8JA 3V7TA 3DD2H 4KHPM 4A92A 1FY3A 1QJ7B 4BAKB 1TH3A 2A1DB 1NFUA 5IK2D 1BMFD 2V3HH 3RMOH 5EXMA 4MTBA 1C2FA 1F0RA 3LJOA 2UUAM 3A42A 3HGIA 2X49A 1OP0A 1AWFH 3KSJA 1GJAB 3MH5A 1E36B 3SV6A 3TITA 1GJCB 3LCUA 1ID5H 1N6YA 1P3QQ 1KLTA 1Q02A 4IBCA 1V3XA 1QA0A 1YLNA 2A5AA 2GVFA 4GPGA 1XKBC 2XF3A 3H7TA 3BN9A 4DT7B 1O3JA 3M7TA 2UU9M 1O2VA 4DUZM 1V2JT 1WSSH 4MB7A 3DHKH 2M5ZA 1IQPA 5EPNA 4LZ1H 1N8OC 2LHGA 3DUXH 2VIWA 1GG6B 3CP7A 3LPRA 1GWAA 2KDLA 4WP2A 1SGFA 1GI8B 2W5EA 3FUVA 1TB6H 2GT8A 1MU5A 4MNYA 3U6PA 5E0JA 1GI2A 1GBBA 4XGIA 1VITF 2KR7A 3OEHD 2Q6GA 3BTDE 3SHGB 2Y81A 3LKWA 1OSSA 2QBYA 2B5TB 1P2OA 1O31A 3TPZA 2VGCC 4XBOA 2DAKA 4AG6A 2BDIA 2ZHFH 1HJ8A 1O2HA 2IOTA 3ENSB 5A8YA 2A4GA 3OFND 2AGGX 4Y0ZE 1GL7A 2J38A 7GCHF 2BZAA 1IXSA 2MROB 4KODA 2ZA5A 3GCHB 2QPAA 2AGEX 4WXIA 4B75A 3SJ9A 3JZ1B 5FAHA 2G81E 3L3TA 1ETSH 1RTFB 5C5OA 2FI5E 3ZVBA 5GJ4B 9ESTA 1YCPK 2XH9A 2VWLA 3Q77A 1ZSLA 1Z5AA 5C94A 4AORA 2RG3A 4YO9A 4YHHM 1H9HE 2XXLA 3NPSA 1XMNB 3QTOH 4B7HA 4NSRA 3LMMA 2UUBM 3T38A 3TK5A 1W11U 5FXLA 4LK4A 4E05H 4IBFA 4CBNA 4LF6M 3SNDA 1PFXC 3GLHE 3RMMH 2FYQA 1A5IA 3STIA 1FNNA 1EFUB 4LZJA 3GLIA 1ANDA 1O5AB 3I78A 3QO6A 4NCYA 1OJLA 2H1RA 2L4EA 3HU1A 4JI2M 3M3TA 2G00A 4IBBA 4NZLA 2W26A 1SGCA 3FN8A 3ZZAA 1C1KA 3DSGA 5JBCS 5GDSH 1HAHH 3PO1C 3C27B 3HHZA 3GRYA 1XM1A 5ABWA 1F5KU 4XBCA 3HY5A 3R9XB 4HFPB 1MABB 3KQ5A 1ZQ9A 2Z4RA 1GVZA 3PMAB 1DOJA 4B71A 1E1QD 1V2WT 3IG6B 3LOXA 1EZXC 4ESTE 3PTNA 1GBLA 1XC8A 1SQTA 1ESBA 1TNHA 1UVOA 2GNOA 3VFDA 3KHVA 1IQFA 4B76A 3TK9A 2C8XB 2H5DA 4I8GA 3VB7A 2I7PA 1UW7A 1QJ1B 1KLJH 3BTEE 4X66M 2B9LA 5EXLA 3F9EA 1SSXA 1UK4A 4Q80A 4CRDA 1NJFA 3U69H 1X37A 2M60A 1LO6A 3GLIB 3HU2A 1P06A 1TAWA 1FY8E 2KZ4A 1HT2E 2UXDM 3SU6A 4ISHH 2I7NA 1EAXA 3AFHA 1DICA 2ZTXA 3RXVA 4FD2A 4YT6H 1TRNA 4XFQA 1EJNA 2P5TA 1LVMA 1EX3A 3GLFE 1O5CB 2BNKA 1LCYA 2HWLB 4ASUD 1FZZA 2FE8A 2WHXA 4XBDA 5DK1A 1A4WH 2GKVE 4HL4A 5C0UA 1YPJH 1YCPM 2RGOA 1ELFA 3ATWA 4GAWA 1MTVA 1C5SA 2Y5FA 1E9RA 4MVNA 2XOKD 4ZKOU 4Q7JA 1CBWB 2KCYA 1C2HA 4CHAC 1C5TA 1KLIH 3AOGA 4M9SA 4W5WA 2BM2A 3J27B 3CENA 1GKIA 5FPSA 1QVRA 2Q6DA 1CGHA 1GVLA 2P95A 3WW7A 2UXCM 3OY6U 5A2QS 1EXFA 4IN1A 3W0LB 2XCNA 3CS7A 5KECA 1C2KA 2ASUB 1DO2A 2CEAA 3ZCBB 1Z8IB 4YOGA 1YE9A 2UUKB 1MMJN 2QZ4A 1R2ZA 2HOBA 2W6ID 2RCEA 3F3BA 4LZZA 1QQUA 1DFPA 5EU8A 1X7AC 4RF0A 1O39A 3TGKE 1WYKA 5JB8S 2KX4A 1ZTLA 3A7ZA 3BXWA 1EJAA 2VVCA 4ACAA 3J7BA 1P2MA 3RC6A 2DUCA 3AW0A 2VQFM 2KRUA 2EI7A 4D7GA 1T31A 1C1PA 5LMUM 4NRWA 1MQ5A 1S82A 2QF0A 1F0TA 1E34B 3IWMA 4I8HA 1T8MA 4LF4M 2R0LA 1QBNA 3GY7A 1AIXH 4IGDA 2GZ7A 1FAXA 3F0PA 5JDUB 2CN0H 5FX6A 5T6DA 4XK8F 1O3LA 1ETTH 4FWDA 5K7RA 5EJ1A 1QA7A 1TMBH 2JIZD 3T1HM 1O3CA 4ISOA 1LV7A 3M37A 2P93A 1RTLA 2GJGA 2PTCE 4GHQA 3T27A 3WHLA 3SUDA 1SI5H 1QYRA 2ANKH 1P8VC 2VB0A 4X2VA 3GY8A 1C4U2 4F4OC 1YSYA 1SXJE 4BLCA 1HV7A 2SNWA 1H9LB 1GBIA 2ZQ2A 2V7QD 1KFVA 2VWNA 1EIJA 1W5TA 3GY4A 3E21A 3P17H 2VF7A 4AB8A 5A0CA 1HNEE 1YPEH 5EXTA 5FTNA 4LF8M 3P8OA 1KSNA 1FJSA 1UTNA 2XBXA 3FANA 3NRLA 2HKJA 5GCHG 4A3VB 1FN8A 2V6ZM 1F0SA 3DZDA 2YNMD 5GNDA 4NIVA 3M5MA 1O2NA 3KEEA 3J7AS 4INKA 4INHA 4ZXYH 3TH3H 5HXFA 3SAUA 4XD7D 1PQ5A 2ZP0H 4AN7A 1MTNB 1IBMM 1FY5A 1QR3E 2OQ4A 3M3VA 3L6PA 4TT3D 3NXPA 2ZHEH 1HT1E 4OS5A 1J7KA 3U28C 1PYTD 4E7NA 2C5RA 1CGJE 5T6FA 1LHEH 3FRIA 1XXDA 1PPCE 3A7WA 1QBOA 1SQOA 4FUEA 3QK1A 3BV9B 1AVGH 2PR3A 3AW1A 5E2PA 1QZ8A 4RKJB 3I01M 3ZH9B 2DE9A 2UWLA 1HQYE 3L27A 2AH4X 5BR8M 3ATMA 2PKSC 1NBME 1VKYA 2ZEBA 1D6RA 1PQ8A 1N75A 4ITQA 1UK3A 4LRSA 2Y7XA 3TGJE 2ODYB 3KOZE 2L7HA 2R3YA 2D8WA 1CA0C 1OYQA 4THNH 2WPHS 2DZOB 3GPPA 1XXFA 1EZUC 2QIQA 3A82A 3FYDA 4Y8YA 2F4VM 3BTWE 5DJ7A 1CA8B 1VITG 3HATH 3U6EA 4LJ7A 2UXBM 1RFNA 5C18A 1V2LT 1V2TT 5EG4A 2H5XA 5L6NH 3K92A 3BIVH 4NA9H 3RGPA 3SV7A 1BJUA 1FXYA 1SC8U 4OW0A 1LTOA 1HAGE 1JR3D 5BPEA 3Q76A 3QUMP 1UVPA 1O2JA 4GSOA 2BD7A 3FTEA 3UWIA 3BG8A 2XC5A 5A2MH 1MQ6A 5F8TA 2NU1E 2D1JA 2R0IA 4B7GA 3GQ4A 2O8WA 2YNAA 3M3SA 2K0BX 1SB1H 4JI7M 1VEGA 2WPDD 3AAUA 2CHQA 5HGGA 5C67A 2RA0A 2IN2A 1ARCA 2LVPC 3GISB 4NSVA 1TNIA 2GMTB 3HX3A 1JMOH 4SGAE 3VDPA 3F92A 1AFQB 8CATA 1W7GH 1GI9B 1JRSA 2F83A 2HNTF 2XNDD 3UNSA 4AYYB 1RGQA 4OU7A 4BTUB 3MWIU 2EY4C 3SOSA 1DXPA 4GKJM 3MNXA 4Y71A 3UGJA 1QDRA 1T6OA 2DZLA 1KTSB 1KSFX 5KGOA 3S9CA 2BY5X 4REZA 1J9CH 4CR5A 1E35B 1VEKA 4R0IA 4YY3M 4K8BA 2TGPZ 3HGPA 3TWLA 1E32A 1Z7KA 3SV9A 3BSQA 2CUZA 5EGMA 3LONA 1DWBH 1XUGA 3FP7E 4MQAA 8ESTE 4CREA 5DGJA 1H4WA 1UMAH 2H6MA 4B7FA 2FLBH 4MG3A 2PKSB 1TA6A 3MO3A 1UTJA 1BRCE 1YPHC 1L1TA 1BTHH 3KOWE 1WTGH 2L6OA 1HJAB 1A5GH 1SBWA 5E0GA 3T5FH 1IQIA 4WF8A 2AFQB 2VJ1A 2ZCKP 3UOPA 3TJNA 1JIMA 2JETC 4OS2A 1UTOA 4IBGA 2FWWA 3T25A 2WPJS 1GDQA 3FFGA 4ISLA 4RSPA 1KXBA 3SI4H 1TGCA 4ZKSU 3HKIB 4WURA 1ABIH 2MH8A 1VCWA 2CMYA 1CT2E 4PT5A 2VWOA 1C9PA 1WHCA 4IW4E 3VG8A 4FW9A 1G36A 1OP2A 1KTTB 2O8TA 1NY5A 1AQ7A 2PSYA 1TX8A 1DLEA 1QL9A 4XDEA 2OQUA 2G5VA 2ODQA 2KZUA 3B7NA 2EA3A 4CGYB 2JH5D 1S6LA 2L4FA 3QX5H 3GO8A 3FKEA 4JYUH 4QT8C 3K9PA 3FUUA 3VGCB 1OFHA 2YMSB 2FS8A 5KQ8A 4CRBA 2DWMA 3D49H 1YLAA 1D6WA 5C1XA 2BJVA 4FWHA 2FI3E 1SGEE 2LP6A 3BTME 4B73A 4O9VA 3TK6A 1T8LA 1O38A 5AF9H 1NHGC 1GBMA 5AHGH 4KTCA 4UE7H 4YTAA 1C2IA 6ESTA 3DA9B 2GGVB 2ZU3A 1K1MA 3A80A 1OIPA 2M2AA 1PJIA 4KTUA 2OXSA 1Y3YA 2GCTB 1TOMH 1C5XB 1SHYA 5T3HA 1YPMH 2WUCA 1GJ7B 1AZ8A 4RF1A 1H1BA 1ZMNA 1MH0A 2GP9B 2PGBB 3ATLA 3T62A 1RXPA 3HJSA 3OTPA 1IN7A 4I5SA 1I94M 1TA2A 4ZKNU 1SG9A 1G41A 5KEDA 2JETB 3GDUA 2BLWA 3OU0A 5KPTA 5F3WA 1GMCF 5CHAB 5EIYA 4MM3B 1BTZA 2MR9A 1GI5A 2WSSD 3SGQE 2QNJA 1EPTC 1FY1A 2SNVA 5A8ZA 3MO9A 2CHAC 3K1JA 1D0KA 2HHHM 3RLWH 1KY9A 3MU4A 4X0WU 1MD8A 2XBVA 2XBWA 4WMEA 3PFIA 4X2XA 1Z5CA 1BVSA 5FBEA 2C98A 1TPOA 3AL0C 2ZHDA 4F49A 1FDPA 1G3CA 1GJ8B 4QNRA 1TBZH 4DUYM 2WZQA 1TH2A 1DSTA 4O03A 2PP6A 1AWHB 4X1QU 4Q7YA 1IN6A 4MPWA 3A81A 3ZZDA 1UTLM 5ITXE 1DT2A 3LU9B 3OAAD 2DWZB 3OY5U 2VQEM 1MX0A 3U6QA 2PW8H 2ZQ1A 1XKAC 1PJTA 1L2DA 4CIZA 2A0QB 3GOVB 3LVWA 1MZDA 1HNZM 1Z6TA 2K1QA 2Z9KA 3R0FA 2A4RA 3K8ZA 4KO8A 1LMWB 2Q6FA 3E3TA 1FY4A 4GEWA 2FM2A 3GLIE 2J95A 3RXAA 1QAQA 1NESE 1FQ3A 2AHME 4NWLA 5ETXA 4GLYA 5DO4H 4NIYA 3O8BA 1OOKB 1FJGM 1O5EH 3K6ZA 2BVRH 1JIRA 5EP1A 1Y3VA 1D4PB 2WPMS 4P00A 1SLWB 1NFWA 5FBIA 2VH6A 4R8TB 1YBWA 1Z1IA 4H42U 1GI6A 5DYIA 3OYPA 3PB1E 6CHAC 4G4NA 3SAVA 3RU4T 3OE7D 2ANYA 3PNVA 1K82A 1CQQA 2DENA 1FIZA 3GPYA 2UUCM 3A8DA 3TL4X 2PGQB 4Y6DA 2AYWA 2E5LM 1VDDA 1ZPBA 3GYLB 1ELGA 2P3UB 3RXUA 4MH0E 3SHFA 1GJDB 4NFEA 3P95A 4ZH8A 1UTKA 1QUSA 5PTPA 1BJVA 4I4LA 2XLJA 2G3QA 1S5SA 1ZHRA 1Q3CA 2Z7FE 1R4GA 1GI4A 3AOEC 2D7EA 2Z9JA 1HAOH 1XUIA 1UJ1A 2A7CA 3TJVA 1RIWC 3R8FA 1QAOA 4R7GA 1SKYE 2XCFA 4JYVH 1FV9A 4PCZA 3FTFA 2ZGBH 1CHGA 1SLUB 1GDNA 3KOXE 3GICB 1ORFA 3BTQE 1EJMA 2BLQA 2HNTE 2IJD1 1W13U 3U60A 1W7XH 1G30B 1XX9A 5CE1A 1NO1A 4CHTB 3IITA 3NBXX 2F91A 2KNVA 1C2EA 3ZVGA 4DV4M 2Y5GA 1V2NT 2L7IA 2HLCA 3VB3A 1OS8A 3PXGA 1QNJA 3MNCA 4K1EA 1V2ST 1UTQA 1C5NH 1T7CA 1MD7A 2Y21A 2EKFA 1G37A 1A61H 1A7SA 3QGNB 2CE7A 4MGKE 2XC4A 2BOHB 2Y20A 1SOZA 1UHBA 3GY5A 3URDA 2FH0A 2OOAA 3I04M 4AQYM 2FOFA 2KHHA 3O8DA 2ZFSA 1P2IA 3QZRA 5DSFA 2CHVA 2PUXB 2Z6BD 3DT0H 3Q3XA 2OINA 3ELAH 3KP1E 2G55A 1VEJA 1ZAEA 5A8XA 2BWEA 3QAUA 3RXDA 1IQKA 4CISA 3BTHE 3U60B 1RRKA 1NN6A 3MU5A 3PV2A 4Y10E 3RXQA 2J97A 3HGNA 1EAWA 5FTMA 1PJPA 1CU1A 4FVMA 3SYLA 1L4ZA 3SNEA 3H4JA 1WDIA 4YXWD 1P3CA 3I51A 1BA8B 7KMEH 4TWYA 1JXPA 1O3OA 2OBQA 2B3TA 2BQWB 5DKMA 1J8AA 4FCTA 1C5RA 3URCA 4JN6A 2XSZD 1O30A 3CTWB 1SLVB 3EE0B 1UCYE 1O3PB 1TFXA 1GDUA 1HYLA 2ZG0H 4KTSA 2F5SA 1KYIA 4AG1A 3N99A 3BG4B 4PDGA 1Z8RA 2W3IA 3U61B 3FO8D 3SN8A 2ZAMA 3SORA 4FCVA 2EC9H 3CNRA 1RJXB 4LJ8A 4XBBA 1OWIA 1OKXA 4DG4A 5CHBA 2PSXA 3T15A 3EA8A 2VH0A 2QYIA 1L8QA 1Z6JH 1TOCB 4FUJA 1OPHB 1H8DH 1BRUP 2CGAA 3JAMS 4MGYE 2ZFTA 4ZHAA 3ODDA 1I4WA 3MO6A 3W68A 4LF7M 1C5VA 2QXGA 2FO9A 2VINA 3LGVA 4IC6A 3TPIZ 4DR7M 4HEOA 1BHXF 1A0HB 1Z71A 1NROH 4D9RA 3P92A 4I8LA 1ZMJA 4OX9M 1DUEA 2ZU1A 2KZSA 4GHAA 3AASA 2ZDNA 5TCAA 1ZRKA 4DW2U 5C1UA 4LJAA 1G2LA 2ZKSA 4QNMA 4U30A 2BYAX 4X65M 3P70B 2FFJA 5C0TA 5FTJA 3CF6E 1AUJA 1H6UA 1BB0B 1C1MA 3GP1A 1O2QA 2AEIH 1GMCG 1YUBA 2QXHA 2CK3D 2BD5A 1JB0F 1AE8H 1ELAA 1O5GH 1YKTA 2SFAA 2EA0A 1XUKA 1TR8A 3ZZ4A 1XB2B 2GCHG 3ZV9A 1ELCA 1AZZA 2AMPA 1P3EA 2AIPA 2FODA 2BLVA 2LNCA 3DFLA 4FXGH 4RKOB 5ESBA 4LGMA 1QZMA 1B5GH 1UTPA 3TWMA 3H7OA 1ZMUA 2R9PA 3QLPH 3L25A 1K1LA 4DV5M 1ZPCA 1F2SE 4GITA 1ZLRA 3EE7A 4B6EA 2ZF0H 3K9OA 2R2MB 5SGAE 1EP6A 5IREB 1T4UH 2ZU4A 1DGHB 3RU4D 2V3MA 3FE3A 1DWEH 3KW6A 2LBCA 1N1LA 1TNKA 2SGEE 3HKJB 1GBEA 1T43A 2NU3E 5ITXA 1O3BA 1ELDE 1KMHB 1DGFA 2H1UA 1O3MA 2ANWA 4CH2B 4U32A 1N32M 3ATIA 1O5DH 2WPIS 1O2PA 1LKAA 3QN7A 1V34A 4O97A 3TJOA 1THSH 1C1NA 4NC6A 2H5CA 1NRNH 3SV8A 2JNHA 3IECA 3KYGA 4WMDA 2NWNA 1ABJH 1EKBB 2RGHA 1QQWA 1K3WA 2SGQE 2P8OC 5HYOA 1C2GA 1LVBA 1T3TA 1TGSZ 2R18A 2AHMA 1OP8A 5A0AE 3D8LA 1S81A 1EATA 4CRAA 1O2IA 3C3DA 1A3BH 3S7HB 1RS0A 1GI7B 1N8OB 1O2SA 3SNCA 3U98H 2HLDD 1NZQH 2JDID 1J14A 1ZHPA 4IBLH 1OQYA 4AC9A 1HAZB 3B74A 3MTYA 1GBKA 1LDTT 1AUAA 1W10U 1F4IA 5HM9A 1CVWH 1H8IH 3ZVEA 4FUGA 1NTPA 1TGUA 2W6JD 3BEIB 3U1JB 1XUJA 3MNBA 7LPRA 5GKNA 2FYRA 3RXJA 2WV9A 1QJ6B 2F9PA 2ULLA 3M7QA 1A46H 2XYAA 5F8ZA 2VGCB 1QB1A 3F9HA 1J15A 4LF9M 3HK3B 4Z1MD 2RFKC 2FOCA 2SGDE 3A83A 5T1VA 4CRCA 5KO3A 1YF4A 1GHVH 1SHHB 4BAHB 4JI6M 1O2MA 1MTSA 2LPRA 4I7YH 3TJUA 1BBRH 1GCTC 1KXFA 4DIIH 3RXPA 5C17A 2NU2E 3SARA 1Z8JB 4Y8ZA 2DAGA 1AN1E 1ELVA 3UR9A 5L2YH 1QL7A 1DUAA 4ABJA 4D81A 1ANCA 2G4TA 3CF0A 1TYNA 4TUWA 1GBDA 1J5EM 1BTPA 2D26C 4GCHF 1QRXA 2ZCLP 4Y79A 2LHCA 1C5OH 3PMJA 1BZXE 3A87A 1PPGE 1GPZA 4IBKA 3FZZA 1K22H 4Y76A 2QSFX 1O3KA 2QC2A 3TH4H 3UOUA 1IN5A 4U01A 2RKOA 3RM2H 1J09A 2DZNB 1Y5AT 2HVXA 2ZDVH 3M7UA 3GY6A 3PO1B 1MBQA 2Y5HA 4UDWH 2OUAA 4WJG2 4ABGA 1AU8A 4GHLA 2Q1JA 2X4AA 2LWXA 4U2WA 3C58A 2D7GA 1IQNA 3DA1A 1HRTH 2L09A 1XUFA 5JBBS 3L29A 4AFSA 2BTCE 1K1OA 1D2NA 1C5YB 1C4Y2 1P2KA 3ZYEA 4JZEH 5J4SA 5FSWA 3SFZA 2BX4A 3FRHA 3E16B 3K2UA 1WV7H 3UY9A 2BDYA 3UUZA 3M7GA 1O3DA 4ISIH 3KGPA 3SU5A 4M0DA 1SPJA 1E79D 1ANEA 3A89A 1YLDA 2HPPH 2QE7D 1EZSC 1SGTA 1V2PT 2JKHA 1SGIB 3PVSA 2ZM6M 4JZDH 4X8SH 5E26A 5J4QA 3QYBA 5DNYA 2BXTH 5E2OA 3Q3YA 4IN2A 1QFKH 2N35A 2LXEA 2G52A 3QWLA 2C8ZB 3F2FA 1O3GA 4ZCNA 2FPZA 3E0PB 3J80S 2K8IA 4CHAB 4TSFD 2FOIC 2R2WU 1BOQA 3M61U 1DY9A 3M5OA 4X2YA 4KELA 5KQDA 2P3FH 1GBHA 1W5SA 2ALPA 4GVUA 4XOJA 2W7SA 4RT0A 4B3TM 4LG2A 1V2QT 2WUBA 4RNAA 2ZZUH 4GH9A 1PPZA 1TE0A 1C5WB 1AUTC 4DURA 1KXCA 2OC7A 3I4YA 2G4UA 4DGJA 1GBCA 4AW4A 1WBGB 3QTVH 5EQRA 4ZROA 4MPXA 5HM2A 3GRUA 1A3EH 3KF2A 1AE5A 4VGCC 4M9FA 2JJ1D 1N33M 2WV5A 4O3UA 2YOLA 1EQ9A 3V13A 5DG6A 3UB0A 4GHTA 3M6AA 1SGNE 5F03A 4A6LA 2XZUA 2H9HA 4L78A 2ODPA 1W0JD 4K60A 2P94A 1EAUA 1QUTA 2ZHQH 2ZPQA 2K47A 3KL6A 4KGAA 1BRAA 1TONA 4E06H 1SVPA 4P02A 3CGWA 2JA2A 4PD2A 1MBMA 5GPIB 4H6TA 3PNYA 4X1RU 3EIHA 2DHYA 4B3MM 3UQVA 1MUEB 2JH0D 1S6FA 3RXEA 1HAYB 2BDHA 1GO5A 1TPAE 2TRMA 4UFFH 5DP4A 1GBTA 3RM0H 3WWFA 1PPFE 2SGAA 2PHBA 5EJCA 2O8LA 3MFJA 1SGRE 4A1TA 4BAQB 1YLCA 4F48B 2HAKA 3GLGB 1QGFA 2CV2A 1P57B 3MU1A 4GUXA 5ESTE 4MNWA 1JQJC 4YESB 2J94A 2FOEA 1MKXK 1XMOM 3V3MA 3JZ2B 2CF9H 3PWBA 4JI8M 3D8BA 3KS4A 1T32A 4NL4H 5EODA 3JR4A 5ITUA 3EGKH 2Z7JA 3M35A 3U9AH 1P0SH 1YPLH 1HIAA 4FUIA 1TDHA 1O5FH 2MJ5B 4OVZB 2F9UA 3S9AA 1P9UA 2R46A 1OX1A 3SAWA 3RXFA 3EQ0H 1L1ZA 1WTHD 2CV0A 1GJ6A 4TPIZ 1A0JA 5FPTA 3P8FA 4D76A 4B3RM 4GIPA 1QL8A 1TNJA 2ZFRH 3TGIE 5DPAA 1FIWA 1NRSH 1T4VH 3SQEE 3ZV8A 4IC5A 2A2QH 2ESTE 3MJ5A 3KQEA 1RTKA 4YM9A 2J34A 4B2AA 1O2ZA 4H4FA 5FLXS 1EB1H 1IN4A 1SGDE 3J2PB 1V2UT 2PTNA 2M5TA 1ZJKA 3D65E 1DDJA 2VNTA 3F2HA 3LC3A 5JB9S 1G32B 1G3DA 1SQRA 2F9VA 2J5UA 2XZFA 2QF5A 3WHKA 5I46H 1A5TA 5L8RF 5FPYA 1RD3B 1CA0B 1IQHA 1GBFA 4FETA 1HIAB 1ANBA 1YCPH 3SASA 4K3JA 4ABAA 5C3NA 4LFBM 4BXSA 2FI4E 2ZGXH 1UCYK 2GV6A 3ZVFA 2QAAA 5LPFA 1ACBE 1IOEA 4G6ZA 1VZQH 4NIXA 3ZVCA 1JOUB 4FUBA 5IZ7D 1P2QA 1XXHB 1P05A 4M0WA 5LMNM 2H9TH 1TRMA 4AG2A 2CHGA 2Z9IA 2EUCA 3EIEA 4G3OA 5DYGA 3GY3A 3PMHB 3PV4A 2FS9A 4OM9A 3TH2H 5EP3A 3ESTA 1V92A 3TVJB 2C93B 4Q4LA 1IQEA 1GGDC 3A7TA 3RMLH 4D80A 4YOJA 1C2DA 1NNJA 1GHWH 1O36A 1PQ7A 1WCZA 4PROA 1IAUA 2QXJA 2LVNC 3E91A 2Z3CA 1W8BH 1YPGH 4DR3M 3AKZA 2HGTH 4WY3A 3RGSA 5L2ZH 3SATA 2FESH 1NU7B 1C5LH 1XHBA 4LJ5A 4QOSA 2R44A 1SGPE 2UUFB 4GCHG 2BVSH 1IXRC 4X6MA 3SU2A 1WGLA 3VEQB 2CJIA 4G4OA 2ILNA 3BOSA 1BIOA 2FOGA 2OD3B 1TNLA 3NCLA 1P2JA 4OS4A 1V2VT 2TBSA 1HR0M 4UFEH 3KFUG 1P09A 4CRGA 2J7OA 4ZKRU 2NU0E 3A8CA 1EAIA 1C2LA 2CRUA 1OWEA 1TALA 1C1QA 1TGTA 2BY9X 2EO2A 1G4AE 3S0NA 1XVOA 4BXWA 2MGWA 1HCGA 4WXVA 1ZMLA 4ZAEA 3IHPA 3HWSA 4AFUA 4DV2M 1D3QB 2EKKA 1O3IA 4FU9A 3SMSA 2GT7A 3TWKA 4MLFB 1OWKA 3ZZ3A 2IPQX 4XRNA 2QF3A 2J5YA 5ITQA 3UR6A 2UWPA 3C3EA 1C5ZB 2F43B 5ITYA 2XSZA 1DS2E 3I4VA 1QAMA 2GCHF 3ZZ5A 1CHOF 2ZTZA 1HPGA 1NJGA 4I86A 2G5GX 5FL7D 4WWYA 3U5ZB 5DP9A 1BDAA 5BPVA 1IY2A 5FCKA 1QZEA 3HHWA 2XW9A 4MNXA 1S0QA 1AKSA 2AIQA 2J9NA 1WXQA 2EEKA 3FUXA 1NY22 1LVYA 1GJ4H 1KDQA 2FLRH 2YFQA 2BD2A 4NSOB 2XC0A 1MU6B 2KXEA 2ALVA 3GQ3A 1O2RA 5IWAM 1GBAA 3LW5F 3L26A 1PGYA 1GHBF 2KW0A 1T8OA 3OTOM 3IG8A 1SXJC 2KA6B 3RXBA 1WQVH 1HNXM 4X6PA 3KIDU 3AJIB 1F7ZA 1EPTA 3K65B 1K3XA 4I81A 5LGOA 3RC5A 3GRRA 4ABDA 4L6V6 4WH8A 1W0KD 3GDVA 1Y5UT 2LH0A 1EB2A 1V2KT 1ZV1A 1GVNA 2R65A 4UN2B 2F5PA 1OKSA 1N77A 1VCQA 3MHWU 3U1IB 5AFZH 2A2XH 2ZC9H 4JYAM 4NXMM 1O0DH 3S69A 4Y11E 1XVMA 2GX4A 1AKSB 2YR0A 1O2XA 3EDXB 1VGCC 4I8JA 3ILKA 1KDQB 1ESTA 1DX5M 2C3SA 1INCA 2G5NA 3LH3A 1AB9C 2Y0TA 3WY8A 4DJZB 4DIHH 5C2ZA 4L15A 5FHTA 4DBGB 1CO7E 3RFWA 1K9OE 4NXNM 2VVVA 3T26A 4IS5A 2ANMH 3KQDA 2Z4SA 1C5QA 2IJOB 4JV5M 2DKLA 4LY6A 5ITTA 1L1GA 1EPTB 3A98B 4JZIA 4I31A 3RMNH 1TF0B 3GRVA 2A4QA 2CHAB 3SO3A 3RP2A 1JR3E 1V2MT 4ZXXH 4L4UA 2OC8A 2JUJA
chains in the Genus database with same CATH topology
3J7BA 3CF6E 4AZFA 2QP9X 3RC6A 1H6UA 2KRUA 2VQFM 4IJFA 3GP1A 5LMUM 4NRWA 1YUBA 2CK3D 2CFOA 2HL7A 2W82A 4LF4M 2EA0A 2X8AA 2OC1A 3ZIAD 3VK8A 2A5YB 3UZUA 3F0PA 1N34M 5FTKA 1N36M 3KVWA 1SXJB 5ESBA 4FCWA 4LGMA 1QZMA 4QOZC 1IM2A 3TWMA 4FWDA 5EP4A 2JJ2D 3L25A 4DV5M 3NWLA 1NSFA 4GITA 2QV1A 4B6EA 2JIZD 2YQZA 3EYDA 3T1HM 3O8RA 3FTDA 5IREB 1LV7A 1DGHB 1RTLA 3RC4A 3WHLA 3M5LA 4GC9A 3SUDA 1QYRA 3KW6A 2G8LA 3VKGA 1N1LA 3GLHB 3GPUA 1YSYA 1SXJE 4BLCA 5ITXA 3U5ZA 4IIWA 1KMHB 1DGFA 4JI4M 3DFZA 4EIWA 2V7QD 1KFVA 1N32M 1W5TA 2O8MA 3GLFA 5EXTA 5FTNA 4LF8M 3OEED 3P8OA 4IBIA 1ORYB 3SV8A 3NRLA 2HKJA 4A3VB 3SYJA 2V6ZM 2RGHA 1QQWA 2YNMD 3DZDA 3KDSE 5GNDA 3M5MA 1BT7A 1K3WA 1IBKM 3KEEA 3J7AS 1T3TA 2ZAOA 2R18A 2AHMA 1PM5A 3SAUA 4XD7D 1R6BX 3D8LA 4JMYA 1H8ED 4KLNA 1IBMM 5EXPA 2OQ4A 3VDUA 3L6PA 2XEPA 2HLDD 2KCOA 2VBCA 4II7A 3U61A 1Q3BA 3L2AA 2JDID 4TT3D 1HT1E 3UK6A 4DV3M 3H09A 1J7KA 2QCUA 3U6OA 3T1YM 2C5RA 1EE8A 4JI0M 2P59A 1TGUA 2W6JD 3U1JB 5GKNA 5CDFE 2KFWA 2WV9A 3ZH9B 4DV0M 3KS8A 3PV5A 4A1XA 1HQYE 3L27A 5BR8M 3GLFB 4JI5M 1NBME 1A1RA 3U6CA 4LF9M 4IBDA 4LJ6A 1L2CA 1N75A 4ITQA 4Z1MD 4LRSA 3KOZE 2L7HA 5T1VA 2FFJA 5KO3A 2DZOB 3IG5A 3GPPA 5C0TA 3F2GA 3FYDA 4JI6M 2C96A 2F4VM 3GQ5A 2QF4A 3U6EA 4LJ7A 2UXBM 3PRBA 5C18A 1XMQM 5C17A 3K92A 3SARA 3RGPA 1QANA 3GPXA 3KP0E 1OHHD 3SV7A 4GMQA 4F55A 1DGBA 4OW0A 1JR3D 3HHYA 4GRIA 1IXZA 5KPRA 4BB9A 4D81A 3TQSA 4ZPXA 3CF0A 5JI2E 4TUWA 3FTEA 1J5EM 5HKKD 1E94E 3M0EA 3Q8XA 3SU3A 4B7GA 3GQ4A 2C99A 1IN8A 4JI7M 2WPDD 4P16A 2CHQA 1SXJA 2O5RA 3LVVA 3SC3A 4DR4M 4IBKA 2R45A 3ZC7B 3UMMA 3DSPA 3M5NA 1IN5A 4U01A 2RKOA 4DV6M 2ZBKB 4NOOB 4MGHA 1J09A 2DZNB 4QHTA 3VDPA 3FOAA 8CATA 2XNDD 2J7NA 1RGQA 4OU7A 3JR5A 4B08A 2KEBA 1DGHA 2KRKA 2LWXA 2X4AA 4GHLA 3UGJA 4GKJM 1DXPA 4LRTA 3C58A 2D7GA 1KSFX 3DA1A 4REZA 3SYKA 2L09A 4HLQA 4NRVA 3L29A 4YY3M 4K8BA 3TWLA 1E32A 3SV9A 2CUZA 3A45A 3U6SA 4Q63A 3AK5A 3LONA 1SXJD 5DN6D 1D2NA 5IT9S 4FWGA 4GKKM 1DO0A 3SFZA 5FSWA 2K0QA 4B7FA 3FUTA 1WXRA 3A46A 4LFCM 2KM0A 3L28A 1EFRD 1L1TA 3KOWE 3N7EA 2L6OA 3KN2A 3FUWA 3DCLA 5EQSA 2QENA 2V1CA 3FYCA 3M7GA 3VLFB 3KNXA 4WF8A 3SU5A 4M0DA 4IBGA 4L4UA 1E79D 3GS9A 4LCBA 2OPFA 2QE7D 2R4EA 4X62M 3HKPA 4L16A 3PVSA 2ZM6M 5EXXA 5E26A 3MK6A 4WURA 1XNQM 5DNYA 1S3SA 4AG5A 4PT5A 4A1VA 2LXEA 1G3IA 3QWLA 3RE8A 4Z8XA 3F2FA 4ZCNA 1G8PA 3VG8A 1NY6A 4FW9A 5JI3E 3J80S 3SMPA 1NHWC 2K8IA 4Z6YA 1NY5A 2YMSD 4TSFD 3LQQA 2FOIC 4LJ9A 4B6FA 3AOEA 5B6LA 1DY9A 3M5OA 3U6DA 5KQDA 4JI3M 4GC5A 3DSOA 4L8RC 1W5SA 2KZUA 4CGYB 4B3TM 1NBMD 4LG2A 3SUGA 4RNAA 1S6LA 4GH9A 3GO8A 3FKEA 3FUUA 3H4MA 1OFHA 2YMSB 4LFAM 3K2LA 5KQ8A 3SBJA 3I4YA 2DWMA 2OC7A 4AKGA 4AW4A 2BJVA 3SZEA 3DOAA 4FWHA 2DHRA 5KPZA 4AKIA 3E9SA 1NS3A 5EQRA 3LQRA 2C9CA 4B73A 5EPYA 3GRUA 4B74A 3HU3A 1FX0B 3KF2A 2R4JA 1NHGC 4M9FA 3HJQA 1XNRM 2JJ1D 4G4QA 1N33M 4KTCA 2VIIA 2YOLA 1Q39A 3UB0A 2GGVB 3M6AA 4LJ4A 3SU4A 2XZUA 2M2AA 1PJIA 4L78A 2F5NA 1W0JD 3SU0A 2D7HA 2K47A 2QBYB 4WW0A 4RF1A 3HJSA 3OTPA 2JA2A 1IN7A 4I5SA 3THGA 4PD2A 1I94M 4TYDA 1JR3A 1G41A 3PNYA 5GPIB 1E9SA 3SU1A 5KPTA 3EIHA 5F3WA 2Q2EB 1G59A 4B3MM 4WH6A 5H4IB 4I8OA 3B9PA 4MM3B 2WSSD 1IXSB 2OBOA 3KOYE 2C9OA 3WWFA 3K1JA 5EQTA 4DV7M 5EJCA 2HHHM 4G4RA 4A1TA 3WWBA 3GLGB 3N7DA 2CV2A 3PFIA 3KSXA 1Z5CA 2DWLA 2C98A 3AL0C 2HCBA 1W3CA 5H37D 1JQJC 1IY1A 4IBJA 5ITRA 2DXIA 4QNRA 1XMOM 4DUYM 2WZQA 1TH2A 4B3SM 1NVMA 1TDZA 1R2YA 4I33A 1IN6A 3D8BA 4JI8M 3TE6A 3KS4A 5ITXE 3OAAD 3FTCA 4NL4H 2DWZB 2XGNA 4IJEA 4PDIA 4DR2M 1NNUC 3E4RA 5ITUA 3JR4A 4NWKA 2Z7JA 2VQEM 1MX0A 3U6QA 1E1RD 1TH4A 1TDHA 5EP2A 4OVZB 2F9UA 1L2DA 5E6JA 2R46A 3LVWA 3SAWA 1HNZM 4D82A 1Z6TA 5FTLA 1L1ZA 4K0KM 2K1QA 4I32A 2A4RA 3K8ZA 2CV0A 5FPTA 1GLNA 4KO8A 4B3RM 4GIPA 2FM2A 2OK5A 3U6LA 1QAQA 3FKSD 4DT4A 2CV1A 2BJWA 4KHPM 4A92A 2AHME 4NWLA 5ETXA 1TH3A 3MJ5A 3O8BA 3VK7A 5IK2D 1BMFD 1FJGM 5EQQA 4M9XA 5FLXS 1IN4A 3J2PB 5EP1A 2UUAM 3A42A 3HGIA 2V1UA 2R62A 2X49A 3F2HA 4R8TB 3AV0A 2F9VA 2J5UA 3KSJA 3OYPA 5DYIA 2XZFA 2QF5A 3SV6A 4G4NA 3WHKA 3SAVA 3OE7D 4DR6M 3FD9A 5FPYA 3PNVA 1K82A 4IBCA 2LELA 2GVFA 4FETA 2XF3A 3GPYA 2UUCM 3TL4X 3SASA 2F5QA 2E5LM 4LFBM 2UU9M 4DUZM 1VDDA 1UM8A 1N78A 4MB7A 5EPNA 2M5ZA 1IQPA 3PRDA 4G6ZA 4MH0E 3SHFA 3CF2A 5IZ7D 5IDKA 5EXSA 1XXHB 4QHSA 3NBIA 4M0WA 5LMNM 3FUVA 4DV1M 1MU5A 2CHGA 3HHXA 4I4LA 2XLJA 3U6PA 1PJJA 2EUCA 1Q3CA 3EIEA 4XGIA 5DYGA 2KR7A 3W0FA 3OEHD 4OM9A 1COWD 5EP3A 3SHGB 3LKWA 3AOEC 4Q4LA 2DWNA 2D7EA 4M9ZA 3UJNA 4D80A 2QBYA 3TPZA 4DR5M 1NNJA 4XBOA 4AKHA 2KCAA 2OC0A 4AG6A 3R8FA 4R3DA 1QAOA 4R7GA 1SKYE 2XCFA 4LGYA 4PCZA 3FTFA 2A4GA 4DR3M 3AKZA 7CATA 1IBLM 3OFND 3KOXE 3RGSA 1GL7A 3SATA 4S12A 4JI1M 1H8HD 1XHBA 4LJ5A 4QOSA 2IJD1 4KODA 3U60A 2QPAA 4B75A 1IXRC 4AI6A 3U6MA 3SU2A 4CHTB 4IBEA 5C1BA 5GJ4B 4DV4M 4G4OA 2XH9A 3BOSA 2L7IA 1Z5AA 3GLGA 1OFIA 3PXGA 4YHHM 1HR0M 2F4LA 4B7HA 4NSRA 3LMMA 2UUBM 3T38A 2Y21A 3KFUG 1L2BA 2CE7A 2J7OA 4MGKE 5F53A 2Y20A 3O8CA 1DXWA 4IBFA 4LF6M 2ERCA 4MGZE 4AQYM 2EO2A 2KCPA 1G4AE 3O8DA 1FNNA 4LZJA 3GLIA 3P8NA 5DSFA 2CHVA 1OJLA 2H1RA 3HU1A 4JI2M 3HWSA 4IBBA 4DV2M 2OINA 3FN8A 3J81S 1C1KA 3KP1E 3SMSA 3TWKA 1ZAEA 4OVZA 3SUEA 4BBAA 3HHZA 3GRYA 3QAUA 5ITQA 3R9XB 1MABB 4CISA 2F43B 1ZQ9A 2Z4RA 5ITYA 3E90B 3U60B 2XSZA 3HJ8A 3I4VA 1QAMA 2Z3XA 3PV2A 4B71A 1E1QD 1NJGA 2G5GX 3LOXA 5FL7D 1XWIA 3U5ZB 5FTMA 3KXEC 3F0OA 1XC8A 5BPVA 1IY2A 4FVMA 3SYLA 3VFDA 1CU1A 3HHWA 4B76A 4YXWD 1WXQA 4JXJA 3FUXA 1HQCA 3I51A 2I7PA 2YFQA 4NSOB 2F5OA 4X66M 2KXEA 3MHVC 3GQ3A 1JXPA 2OBQA 4FCTA 5IWAM 1NJFA 3VKHA 3L26A 1X37A 4JN6A 2M60A 2KW0A 3GLIB 3HU2A 2FNAA 2DVWB 2XSZD 3CTWB 3IG8A 1SXJC 1HT2E 3OTOM 2UXDM 2KA6B 2FP7B 2KZ4A 3SU6A 2I7NA 1HNXM 1IY0A 2NQ8C 3AJIB 3AFHA 4FD2A 4I81A 1K3XA 2Y0QA 3RC5A 2P5TA 3GRRA 2F5SA 1KYIA 2XNIA 3N99A 2BNKA 4WH8A 1W0KD 4PDGA 4ASUD 2LH0A 3U61B 3FO8D 1GVNA 2FE8A 2R65A 2ZAMA 4FCVA 2WHXA 2F5PA 4DR1M 1XXHA 4LJ8A 1N77A 5C0UA 4HL4A 3U1IB 5CHBA 3T15A 1HNWM 4JYAM 2RGOA 4NXMM 1L8QA 4X64M 1E9RA 2XOKD 2XFSA 2YR0A 2KCYA 3ILKA 3JAMS 3AOGA 2LNHC 4M9SA 4MGYE 4W5WA 1I4WA 2Y0TA 3J27B 4LF5M 1Z59A 4L15A 4LF7M 4RI0A 1GKIA 5FPSA 3RFWA 1QVRA 4DR7M 4NXNM 1DY8A 3WW7A 2UXCM 5A2QS 3W0LB 2XCNA 2Z4SA 4OX9M 1DO2A 2CEAA 1DGGA 4LY6A 2KZSA 1YE9A 3ZCBB 4JV5M 2IJOB 2YMSC 4GHAA 2QZ4A 3SUFA 5ITTA 1R2ZA 2W6ID 2ZANA 4MGIE 3F3BA 3A98B 4LZZA 4LJAA 4I31A 3GRVA 1GL6A 2XFTA 3GLHA 4QNMA 2A4QA 1Z5BA 4RF0A 4X65M 2FOMB 3W1EA 1R7RA 2OC8A 5FTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6O A; 
#chains in the Genus database with same CATH topology
 2A45 B;  2STB E;  4ANR A;  2QP9 X;  4AZF A;  2A7H A;  2ZTC A;  4LXB H;  3MMG A;  1NM6 A;  3A8B A;  3PLK A;  1BHX B;  2HL7 A;  1UFZ A;  2XWA A;  2X8A A;  3VK8 A;  2A5Y B;  3UZU A;  1J16 A;  1Z1J A;  2BHG A;  1N34 M;  1WAY B;  3QZQ A;  3MYW A;  3KVW A;  1SXJ B;  2G51 A;  4QOZ C;  1Y59 T;  1IM2 A;  4TY7 A;  3H5C B;  2JJ2 D;  2BQ6 B;  1ZGI A;  3A7Y A;  1HDT H;  2KNZ A;  3NWL A;  1NSF A;  1SMF E;  1CUK A;  2QV1 A;  4OS6 A;  7EST E;  3EYD A;  2GQF A;  3KYF A;  1C1O A;  5EJZ A;  4FUH A;  1TPS A;  4GC9 A;  1UVS H;  3P6Z B;  3A84 A;  2W7U A;  2Z3E A;  1P11 E;  1NRQ H;  3RXK A;  3GCO A;  1FLE E;  1THR H;  4IIW A;  1BMM H;  4JI4 M;  2P3T B;  1WOF A;  1H9I E;  1C7Y A;  1QIX B;  2FOB A;  3S9B A;  2ZFP H;  1O37 A;  2O8M A;  1VCP A;  1O3H A;  4UON A;  4NA8 A;  3RXT A;  3SHC H;  4Y7A A;  1PPE E;  2TIO A;  4ZMA H;  5C20 A;  3FAO A;  3MOC A;  6CHA B;  2BD3 A;  3U8T H;  3ZZ6 A;  1EUF A;  3MQK C;  1EP5 A;  2ZTY A;  1GJ9 B;  1UK2 A;  1ZTK A;  2NU4 E;  4BAM B;  1C1S A;  2ZAO A;  1PM5 A;  2OQ5 A;  1J17 T;  4NFF A;  1GJS A;  3BTG E;  2I6S A;  1IHS H;  1H8E D;  4KLN A;  3AAV A;  5EXP A;  1EZQ A;  1LHD H;  1MKX H;  2XEP A;  2KCO A;  1WQS A;  5GWZ A;  4II7 A;  3U61 A;  3L2A A;  2Z9L A;  2WPL S;  3UK6 A;  3H09 A;  1QHR B;  1Z6E A;  4CR9 A;  3T1Y M;  3URE A;  1CT0 E;  3M36 A;  2GDD A;  1P03 A;  1FN6 A;  4JI0 M;  2P59 A;  2B0F A;  4DCD A;  2ZFF H;  2KFW A;  3PV5 A;  4DV0 M;  1LPG B;  1L1J A;  3A88 A;  4D7F A;  1FMG A;  1RIW B;  4A5T S;  3VFE A;  4LJ6 A;  1L2C A;  1NC6 A;  1LHF H;  8LPR A;  1OYT H;  3IG5 A;  1LHG H;  4MPV A;  4M7G A;  3TNT A;  4FUF A;  3F2G A;  5IYT A;  2C96 A;  1TIO A;  4AGK A;  1NT1 A;  1TMU H;  3S7K B;  5B6O A;  1OHH D;  1QAN A;  3GPX A;  1GG6 C;  1P04 A;  4F55 A;  1K21 H;  3ZZ8 A;  2CXV A;  2GD4 B;  3STJ A;  4AGJ A;  3HHY A;  1O3E A;  4GRI A;  1IXZ A;  1S0R A;  4BB9 A;  5HKK D;  1E94 E;  3SHA H;  4H6S B;  1K1J A;  1SL3 A;  2QA9 E;  3Q8X A;  1ZOM A;  4JK5 A;  2WSC F;  2O8U A;  2C99 A;  3GLG E;  1IN8 A;  2L74 A;  1N6X A;  2BY8 X;  4I8K A;  1QUR H;  4FOU C;  3Q8G A;  1AMH A;  2R45 A;  3ZC7 B;  3DSP A;  3E6P H;  1OTR A;  3M5N A;  2EI8 A;  4O3T A;  4AB9 A;  4DV6 M;  2ZBK B;  2QCY A;  4MGH A;  1IHT H;  4Y0Y E;  3FOA A;  4FU7 A;  2XTT B;  1KIG H;  2ZWL H;  2BDB A;  2J7N A;  1JRT A;  3JR5 A;  2QXI A;  4B08 A;  1IFY A;  1DGH A;  2KRK A;  3GCH C;  5HMA A;  1Y3X A;  3C9P A;  2Y82 A;  2RRU A;  1Z8G A;  1GHY H;  3RUO A;  1S85 A;  5JBA S;  4HLQ A;  2KNA A;  1E0F D;  2BB4 A;  5FCR A;  1C1V H;  2J92 A;  4FVB A;  1HLT H;  1K0H A;  3MI4 A;  3U6S A;  4Q63 A;  8GCH F;  6GCH F;  1LQD B;  1SXJ D;  4RKU F;  2LVA A;  1Y3W A;  3I77 A;  5IT9 S;  4HTC H;  1EOL A;  2JP7 A;  3E46 A;  4GKK M;  3FUT A;  3A46 A;  2IPH A;  2VWM A;  1EFR D;  3N7O A;  1UTM A;  3VB5 A;  4BNR A;  5L30 H;  2P16 A;  1CHO G;  1FON A;  3A85 A;  3PWC A;  3FUW A;  1O3F A;  3SZN A;  1AY6 H;  3VLF B;  3FYC A;  1FPC H;  3BIU H;  2ZHW H;  1WIV A;  3RXL A;  1ZPZ A;  2GTB A;  4LCB A;  1O2K A;  2ZDA H;  2DI0 A;  3HPT B;  2OPF A;  2LVQ D;  2R4E A;  3KQB A;  4L16 A;  1NV9 A;  1GL1 A;  1AVX A;  1GHZ A;  3T29 A;  1XNQ M;  4RN6 A;  3RXM A;  1K1P A;  1S3S A;  1GHB G;  1KXA A;  5LPE A;  4AG5 A;  3LDX H;  3MU8 A;  4A1V A;  3BBZ A;  2PWX A;  1G8P A;  4SGB E;  1SGY E;  1NY6 A;  4Z6Y A;  4Y7B A;  4LJ9 A;  2EQN A;  3U6D A;  1W12 U;  2PKA A;  1PYT C;  4JI3 M;  4L8R C;  1XXH E;  1OIZ A;  1ESA A;  4FVD A;  2TGT A;  1NBM D;  2FOA A;  2Y6T A;  1ZJD A;  1LQE A;  2ZGC A;  3KCG H;  4X6O A;  3SUG A;  1MN3 A;  4YLU A;  2QQ8 A;  4K8Y A;  3W94 A;  4AZ2 B;  1IQJ A;  1C5U A;  4LFA M;  3K2L A;  3SBJ A;  8KME 2;  4KKD A;  3BEF B;  1TGN A;  3DOA A;  4AKI A;  2DHR A;  1G71 A;  5KPZ A;  1A5H A;  1NS3 A;  1QRZ A;  3LQR A;  4K5Z A;  2C9C A;  1GMD G;  1NRR H;  2OO9 A;  2OTV A;  1CE5 A;  5T6G A;  2R4J A;  1ZMW A;  5BRR E;  2FDA A;  1TAB E;  4LZ4 B;  4G4Q A;  1EAS A;  4BAO B;  4IMZ A;  3K6Y A;  1MKW K;  1Q39 A;  3HZJ A;  2BXU H;  2VID A;  4LJ4 A;  1P9S A;  3SU4 A;  2F5N A;  1CBW C;  2BX3 A;  4JYT A;  1EOJ A;  2D7H A;  1MAX A;  2QBY B;  2BD8 A;  3V0X A;  1Y8G A;  5FX5 A;  2QN5 T;  3V76 A;  2O25 A;  1TBR H;  4FUD A;  2DAE A;  2PKA B;  4TYD A;  1JR3 A;  3SU1 A;  1E9S A;  2OLG A;  1G59 A;  1LVO A;  5H4I B;  2Q2E B;  1HXE H;  2QHO B;  4WH6 A;  1NU9 A;  2APL A;  1IXS B;  1ZHM A;  3KOY E;  2OBO A;  1SR5 C;  1BBR E;  3BTK E;  1DV0 A;  2BY6 X;  3B7Q A;  1YPH E;  1WUN H;  1YWU A;  5EQT A;  1UVT H;  5E8E H;  3LGI A;  5AFY H;  1U6Q A;  3N7D A;  3KSX A;  2DWL A;  4NG9 H;  1YM0 A;  1BIT A;  3A86 A;  4P17 A;  1DWC H;  1Y3U A;  3F68 H;  4ZHL U;  3RXR A;  3GCT F;  2PFE A;  3MH7 A;  1G3E A;  1NVM A;  2HNT C;  5HIZ A;  1TDZ A;  1R2Y A;  2THF B;  4AYV B;  2QY0 B;  1TPP A;  3TE6 A;  5A0B A;  1Y8T A;  1O2G H;  4IJE A;  4NWK A;  1NNU C;  3E4R A;  1AFE H;  3FVF B;  4ISN A;  4WVP E;  2XRC A;  2G8T A;  3ITI A;  1QY6 A;  2P8O B;  4NZQ A;  1FUJ A;  2F9N A;  1TNG A;  2FIR H;  2V6N A;  4ASH A;  4D82 A;  4I32 A;  1C1W H;  1O34 A;  1ZSJ A;  3GYM A;  3NK8 A;  3UWJ H;  1GLN A;  1LPZ B;  2XBY A;  3U6L A;  3L33 A;  3ZYD A;  1UVU H;  1IQG A;  5GXP A;  1P01 A;  2C8W B;  1V2R T;  1YGC H;  3VK7 A;  2VIO A;  4MPU A;  5EQQ A;  4M9X A;  1O33 A;  1TTE A;  1SOT A;  1NPM A;  1Q3X A;  4HGC A;  1O2U A;  2FX6 A;  1KXD A;  3EAJ A;  2V1U A;  4NSY A;  2R62 A;  4B2B A;  1NFY A;  1SFI A;  3AV0 A;  1OXG A;  1AO5 A;  1DM4 B;  3A8A A;  2FEQ H;  3UNQ A;  2A5K A;  4DR6 M;  3FD9 A;  1DSU A;  3RXC A;  2CV3 A;  1MTU A;  2LEL A;  1HAI H;  1F5R A;  1GL0 E;  1DIT H;  2F5Q A;  3LH1 A;  3RXI A;  1GCT B;  1MCT A;  2TGD A;  5F6M A;  1MTN C;  3F9G A;  4XE4 A;  1UM8 A;  1N78 A;  5E0H A;  4ZHM U;  3PRD A;  2ZEC A;  2CWB A;  3CF2 A;  2ZTD A;  2VIP A;  4YZU A;  3RDZ A;  2FS1 A;  1GJ5 H;  4OS7 A;  1D0M A;  5EXS A;  3SJI A;  5IDK A;  4QHS A;  3NBI A;  4JZF H;  1O35 A;  2RDE A;  2JY7 A;  4DV1 M;  1IQL A;  3HHX A;  1MTW A;  3W95 A;  1PJJ A;  4Q7Z A;  1C1T A;  3LCV B;  3QYE A;  2JY6 B;  3W0F A;  1O32 A;  2GDE H;  5EOK A;  1COW D;  4BAN B;  2DWN A;  4M9Z A;  3UJN A;  1BRB E;  5HIY A;  2PUQ H;  1NV8 A;  4DR5 M;  4AKH A;  2HAL A;  2KCA A;  2JY5 A;  1JBU H;  1WJ7 A;  2OC0 A;  2R3U A;  4R3D A;  2GZ8 A;  3TIU A;  4LGY A;  3T6P A;  1AIP C;  1A0L A;  1GHA F;  1IBL M;  7CAT A;  1ETR H;  1MAY A;  1KXE A;  4S12 A;  1SGQ E;  4JI1 M;  1ELE E;  1H8H D;  3MU0 A;  1GJB B;  1F92 A;  1GJT A;  2BDA A;  1V33 A;  1W0Z U;  4AI6 A;  5DP3 A;  3U6M A;  1QBV H;  1AGJ A;  2FTM A;  4IBE A;  5C1B A;  3SNA A;  5DP5 A;  4AOQ A;  2UWO A;  4LOY H;  5G4B A;  4CBO A;  3GLG A;  4X6N A;  4DY7 B;  1OFI A;  4AFZ A;  2F4L A;  1NO9 H;  3B7Z A;  5AVD A;  3HK6 B;  2JWS A;  1ZRB A;  1L2B A;  3RXO A;  1CT4 E;  3VB4 A;  5F53 A;  3O8C A;  1DXW A;  3U8O H;  1QTF A;  1GI0 A;  1HXF H;  2ERC A;  4MGZ E;  3D23 A;  2BDC A;  3OTJ E;  2KCP A;  1OAI A;  3EA7 A;  3SW2 B;  3P8N A;  2CF8 H;  1HUT H;  2XWB I;  2VDB B;  1ELB A;  1S84 A;  2ZPR A;  3UAI C;  1A2C H;  1C2M A;  3J81 S;  2GMT C;  8GCH G;  2BLO A;  6GCH G;  1AFQ C;  4OVZ A;  4X1N U;  1TQ7 B;  3RU4 E;  3SUE A;  4BBA A;  2FZZ A;  4NIW A;  3SBK A;  4TWW A;  3V12 A;  4FUC A;  2ZDK A;  4UEH H;  1B0F A;  3SQH E;  4JCN A;  3E90 B;  1XUH A;  1HB0 B;  3HJ8 A;  3PLP A;  1VDL A;  1BUI A;  2Z3X A;  1GCD A;  1TX7 A;  4K1T A;  5EJL A;  1O5B B;  1XWI A;  1K1N A;  3F0O A;  2VF8 A;  3KXE C;  4BTT B;  1HBT H;  2DAM A;  2F9O A;  1OWJ A;  4YLQ H;  2DAI A;  4HI3 A;  1BTX A;  2ZU2 A;  4JXJ A;  2AS9 A;  2K6B A;  1HQC A;  3A7V A;  2ZO3 H;  2F5O A;  2TPI Z;  1VIT H;  3MHV C;  3P8G A;  2BD4 A;  3F6U H;  2V35 A;  3PRO A;  4J1Y A;  2A31 A;  3VKH A;  2EI6 A;  1HJA C;  4UFG H;  4ABB A;  3ZZ7 A;  4X8U H;  2FNA A;  2DVW B;  1S6H A;  2FP7 B;  1C9T A;  2BDG A;  1IY0 A;  2NQ8 C;  1ZYO A;  1S83 A;  3R3G B;  2WIN I;  1O2L A;  3UQO A;  2Y0Q A;  2O01 F;  3B89 A;  1HAV A;  1B7X B;  2XNI A;  1QQ4 A;  2SGF E;  2B7D H;  2UUJ B;  2JY8 A;  3TNS A;  1P10 A;  3CS0 A;  2L2D A;  5DP6 A;  4AX9 H;  2DE8 A;  4VGC B;  2C90 B;  3ZQJ A;  1D3D B;  4DR1 M;  3UTU H;  1XXH A;  2KAI A;  1BMN H;  7GCH G;  1HNW M;  2HWJ A;  1M9U A;  2A4O A;  4X64 M;  4D9Q A;  5F8X A;  2EJS A;  1NFX A;  2ZFQ H;  2XFS A;  3RXH A;  1TMT H;  3PLB A;  1VG5 A;  4LF5 M;  2LNH C;  1Z59 A;  1V6D A;  4RI0 A;  1BTW A;  1DY8 A;  1DLK B;  1W14 U;  2J4I A;  1LPK B;  1TQ0 B;  2HVY B;  2V0B A;  1MJG M;  4X1P U;  1DGG A;  2ZGJ A;  2ZNK H;  3VGC C;  2YMS C;  3SUF A;  1F5L A;  2ZAN A;  4MGI E;  1UO6 A;  4OS1 A;  2BY7 X;  3SV2 H;  2C8Y B;  1TRY A;  1GL6 A;  2XFT A;  3GLH A;  4F1I A;  1PPB H;  1Z5B A;  1HAV B;  3NKK A;  3NUM A;  1QB9 A;  1L0Z A;  3BTT E;  2FOM B;  2OCV B;  3W1E A;  1R7R A;  2BVX H;  3Q3K A;  2DNA A;  4X2W A;  3MMP A;  2OP9 A;  4IJF A;  2GZ9 A;  1BQY A;  2AMD A;  2KAI B;  1ZSK A;  1C5M D;  2CFO A;  2W82 A;  3ZVA A;  4YT7 H;  1Q2W A;  2GCT C;  1JWT A;  1OWH A;  2OC1 A;  3LGU A;  3ZIA D;  1D3P B;  2JZ1 A;  3GDS A;  2H9E H;  1CGI E;  3UFA A;  1DE7 H;  2Z8Y M;  5FTK A;  1N36 M;  2ZDM A;  3UNR A;  2WSF F;  1AVW A;  1ELT A;  1GMH F;  1HJ9 A;  4FCW A;  1L4D A;  5TCC A;  3B23 B;  1YP9 A;  1DVA H;  2A7J A;  5EP4 A;  5CHA C;  3LC5 A;  3B9F H;  3LIW A;  1IQM A;  2I6Q A;  1GAB A;  3QGJ A;  2YQZ A;  3O8R A;  5LPR A;  3FTD A;  3GCT G;  4Y28 F;  5GIB A;  3UIR A;  1CSO E;  3D62 A;  1MKW H;  3RC4 A;  2BMG B;  1G2M A;  3M5L A;  4K69 A;  4HG6 A;  3VKG A;  2G8L A;  4ABH A;  4OGX A;  3GLH B;  3GPU A;  1O2Y A;  3VXE H;  3U5Z A;  1R5L A;  1P12 E;  1F0U A;  2BZ6 H;  1RU3 A;  3DFZ A;  4EIW A;  1VR1 H;  1E37 B;  4CRF A;  1W0Y H;  3SJ8 A;  4X8T H;  3GLF A;  1D9I A;  3OEE D;  1O2T A;  3E0N B;  4IBI A;  1ORY B;  5I25 A;  3QWC H;  3SYJ A;  3KDS E;  1MU8 B;  1BT7 A;  1IBK M;  3RXG A;  2LVO C;  2K9D A;  3VB6 A;  3TU7 H;  3BF6 H;  2SGP E;  1ARB A;  3F9F A;  1R6B X;  2B8O H;  1D0L A;  4JMY A;  1YYY 1;  4Z0K A;  1O3A A;  1NRP H;  3PYH A;  4TPY A;  3VDU A;  2A32 A;  3MH6 A;  4ZUH A;  2VBC A;  4YOI A;  4D8N A;  1Q3B A;  2WYJ A;  4DV3 M;  2QCU A;  1KYN A;  5EXN A;  2LTU A;  3U6O A;  1MZA A;  4NA7 A;  1EE8 A;  1PJS A;  4XSK U;  1TWX B;  3MNS A;  3LGY A;  1OWD A;  3SJO A;  3ODF A;  3SI3 H;  5CDF E;  1DWD H;  3KS8 A;  1GGD B;  1SG8 B;  4ABI A;  1G3B A;  4A1X A;  4JI5 M;  3GLF B;  3ZVD A;  1G9I E;  1A1R A;  3U6C A;  4J2Y B;  4IBD A;  1FI8 A;  4WMF A;  1K28 D;  2PLX A;  1AD8 H;  3TLO A;  4A7I B;  1TGB A;  2WYG A;  1FAK H;  1HJP A;  3U8R H;  4BTI B;  3SJK A;  2ZI2 H;  2GV7 A;  3GQ5 A;  2QF4 A;  3NWU A;  4ABF A;  3VPK A;  2WZJ A;  4KT0 F;  3BEU A;  3PRB A;  5A09 A;  1XMQ M;  1ZR0 A;  3E1X B;  2BWB A;  1SGF G;  4UFD H;  3KP0 E;  1SLX B;  2A5I A;  4GMQ A;  2BQ7 B;  1GBJ A;  1K2I 1;  1DGB A;  3SGA E;  3FZD A;  1BML A;  5KPR A;  4CJ6 A;  3GCN A;  3KQC A;  1GHA G;  4B1T A;  3TQS A;  3PM3 A;  4ZPX A;  5JI2 E;  4JZ1 A;  2H2Z A;  3NZI A;  3ZZ9 A;  4AFQ A;  1PJQ A;  1SFQ B;  3M0E A;  3QDZ B;  3FP6 E;  3ATK A;  5JPM H;  3SU3 A;  2AGI X;  1D3T B;  3F1S B;  1GHX H;  1QCP A;  4P16 A;  1BCU H;  1GMD F;  1SXJ A;  2O5R A;  3LVV A;  3SC3 A;  4DR4 M;  2CP8 A;  3E8L A;  3UMM A;  3A7X A;  3OX7 U;  1LHC H;  4KP0 A;  4NOO B;  2JH6 D;  4QHT A;  2ZCH P;  2R6F A;  2BOK A;  4B2C A;  5LH8 A;  2KEB A;  4IMQ A;  3VXF H;  4LRT A;  3PTB A;  3RLY H;  3SYK A;  3ZZC A;  2W3K A;  4NRV A;  3RXS A;  1BBR K;  1BMA A;  2FTL E;  2ZPS A;  1ZMV A;  3ZZB A;  1YY3 A;  3A45 A;  3AK5 A;  1BTY A;  2STA E;  2HRV A;  1DPO A;  5DN6 D;  3UPE A;  1E38 B;  1ZTJ A;  2ZDL A;  4NGA H;  4FWG A;  2K0Q A;  1DO0 A;  3I29 A;  3LJJ A;  3MH4 A;  1C2J A;  1YC0 A;  1W2K H;  1WXR A;  4LFC M;  2F9B H;  1C1U H;  2KM0 A;  1VQ1 A;  3L28 A;  2Z9G A;  3N7E A;  3KN2 A;  5DFL A;  1BTU A;  3DCL A;  5EQS A;  2QEN A;  2V1C A;  3KNX A;  4X1S U;  1AHT H;  1C1R A;  3T28 A;  1K1I A;  1P2N A;  3GS9 A;  6LPR A;  1QRW A;  4RT1 A;  1LTM A;  4X8V H;  4X62 M;  2UUY A;  3HKP A;  3LT3 A;  2O9Q A;  2TGA A;  5EXX A;  2F3C E;  1VJ9 U;  3MK6 A;  1HAP H;  1SQA A;  2FMJ A;  1LKB A;  4MDS A;  4HZH A;  1C5P A;  1G3I A;  3RE8 A;  2Z94 A;  4Z8X A;  5EW1 H;  4UD9 H;  1HAX B;  1QDT A;  3W67 A;  1L1N A;  4BOH A;  4Q7X A;  3AVZ A;  5JI3 E;  3SMP A;  2Z3D A;  1NHW C;  2QGR A;  1VGC B;  1GI1 A;  2D2D A;  2YMS D;  3LQQ A;  1ZZZ A;  1C4V 2;  4B6F A;  3AOE A;  5B6L A;  4FU8 A;  1AB9 B;  1FNI A;  4OGY A;  1THP B;  1PPH E;  1ZGV A;  1O3N A;  2JZ0 A;  4GC5 A;  1GI3 A;  1L2E A;  3DSO A;  5EW2 H;  1DAN H;  1Y5B T;  1WR1 B;  4DVA U;  2FX4 A;  1PQA A;  2R0K A;  1HGT H;  2C4F H;  4K2Y A;  5C5N A;  3H4M A;  1MCV A;  4AKG A;  1GVK B;  3SZE A;  2WPK S;  3E9S A;  5C1Y A;  3BG4 C;  5DP7 A;  5EPY A;  4B74 A;  4MNV A;  3HU3 A;  4F2L A;  1FX0 B;  1P02 A;  1TBQ H;  4INL A;  5JBT A;  3HJQ A;  3SNB A;  1XNR M;  2VVU A;  1PRB A;  2J98 A;  2VII A;  1TLD A;  2AMQ A;  3DFJ A;  3OSY A;  1WGN A;  5K0H A;  3LGW A;  3SU0 A;  2YNB A;  2ZU5 A;  4Q2K A;  4WW0 A;  5DP8 A;  2WSE F;  4R71 A;  2ZGH A;  4CH8 B;  1T8N A;  1WU1 A;  2J2U A;  4K1S A;  3T2N A;  3THG A;  1VJA U;  5CMX H;  2HPQ H;  4E7R G;  1YPK H;  4I8O A;  3B9P A;  1B0E A;  2OOB A;  1O2O A;  2Y7Z A;  2VIQ A;  3PMB B;  3G01 A;  2C9O A;  4TY6 A;  4DV7 M;  4G4R A;  3WWB A;  1OAO C;  4Z6A H;  1GMH G;  4ABE A;  5JYI A;  2VIV A;  1AI8 H;  2HCB A;  1W3C A;  2PV9 B;  5H37 D;  4Y8X A;  2AER H;  4ACB A;  1IY1 A;  4IBJ A;  5ITR A;  2JXN A;  2DXI A;  1TX6 A;  2J98 B;  1UHB B;  1V2O T;  4B3S M;  2VU8 E;  2RDL A;  3Q00 A;  4DOQ A;  4I33 A;  1FPH H;  2ZIQ H;  3FTC A;  4PDI A;  2XGN A;  4DR2 M;  1QB6 A;  3SGB E;  1Q31 A;  3BTF E;  4JK6 A;  1E1R D;  1O2W A;  3EA9 A;  1TH4 A;  5EP2 A;  1UCY H;  2WV4 A;  3FP8 E;  5TJX A;  9LPR A;  5E6J A;  2FOH A;  2Y80 A;  3K9X B;  2RA3 A;  3GY2 A;  2BD9 A;  5FTL A;  4K0K M;  2FXR A;  2V3O H;  3C1K A;  3LGT A;  1HFD A;  5GCH F;  2OK5 A;  3FKS D;  4DT4 A;  2CV1 A;  2BJW A;  3B8J A;  3V7T A;  3DD2 H;  4KHP M;  4A92 A;  1FY3 A;  1QJ7 B;  4BAK B;  1TH3 A;  2A1D B;  1NFU A;  5IK2 D;  1BMF D;  2V3H H;  3RMO H;  5EXM A;  4MTB A;  1C2F A;  1F0R A;  3LJO A;  2UUA M;  3A42 A;  3HGI A;  2X49 A;  1OP0 A;  1AWF H;  3KSJ A;  1GJA B;  3MH5 A;  1E36 B;  3SV6 A;  3TIT A;  1GJC B;  3LCU A;  1ID5 H;  1N6Y A;  1P3Q Q;  1KLT A;  1Q02 A;  4IBC A;  1V3X A;  1QA0 A;  1YLN A;  2A5A A;  2GVF A;  4GPG A;  1XKB C;  2XF3 A;  3H7T A;  3BN9 A;  4DT7 B;  1O3J A;  3M7T A;  2UU9 M;  1O2V A;  4DUZ M;  1V2J T;  1WSS H;  4MB7 A;  3DHK H;  2M5Z A;  1IQP A;  5EPN A;  4LZ1 H;  1N8O C;  2LHG A;  3DUX H;  2VIW A;  1GG6 B;  3CP7 A;  3LPR A;  1GWA A;  2KDL A;  4WP2 A;  1SGF A;  1GI8 B;  2W5E A;  3FUV A;  1TB6 H;  2GT8 A;  1MU5 A;  4MNY A;  3U6P A;  5E0J A;  1GI2 A;  1GBB A;  4XGI A;  1VIT F;  2KR7 A;  3OEH D;  2Q6G A;  3BTD E;  3SHG B;  2Y81 A;  3LKW A;  1OSS A;  2QBY A;  2B5T B;  1P2O A;  1O31 A;  3TPZ A;  2VGC C;  4XBO A;  2DAK A;  4AG6 A;  2BDI A;  2ZHF H;  1HJ8 A;  1O2H A;  2IOT A;  3ENS B;  5A8Y A;  2A4G A;  3OFN D;  2AGG X;  4Y0Z E;  1GL7 A;  2J38 A;  7GCH F;  2BZA A;  1IXS A;  2MRO B;  4KOD A;  2ZA5 A;  3GCH B;  2QPA A;  2AGE X;  4WXI A;  4B75 A;  3SJ9 A;  3JZ1 B;  5FAH A;  2G81 E;  3L3T A;  1ETS H;  1RTF B;  5C5O A;  2FI5 E;  3ZVB A;  5GJ4 B;  9EST A;  1YCP K;  2XH9 A;  2VWL A;  3Q77 A;  1ZSL A;  1Z5A A;  5C94 A;  4AOR A;  2RG3 A;  4YO9 A;  4YHH M;  1H9H E;  2XXL A;  3NPS A;  1XMN B;  3QTO H;  4B7H A;  4NSR A;  3LMM A;  2UUB M;  3T38 A;  3TK5 A;  1W11 U;  5FXL A;  4LK4 A;  4E05 H;  4IBF A;  4CBN A;  4LF6 M;  3SND A;  1PFX C;  3GLH E;  3RMM H;  2FYQ A;  1A5I A;  3STI A;  1FNN A;  1EFU B;  4LZJ A;  3GLI A;  1AND A;  1O5A B;  3I78 A;  3QO6 A;  4NCY A;  1OJL A;  2H1R A;  2L4E A;  3HU1 A;  4JI2 M;  3M3T A;  2G00 A;  4IBB A;  4NZL A;  2W26 A;  1SGC A;  3FN8 A;  3ZZA A;  1C1K A;  3DSG A;  5JBC S;  5GDS H;  1HAH H;  3PO1 C;  3C27 B;  3HHZ A;  3GRY A;  1XM1 A;  5ABW A;  1F5K U;  4XBC A;  3HY5 A;  3R9X B;  4HFP B;  1MAB B;  3KQ5 A;  1ZQ9 A;  2Z4R A;  1GVZ A;  3PMA B;  1DOJ A;  4B71 A;  1E1Q D;  1V2W T;  3IG6 B;  3LOX A;  1EZX C;  4EST E;  3PTN A;  1GBL A;  1XC8 A;  1SQT A;  1ESB A;  1TNH A;  1UVO A;  2GNO A;  3VFD A;  3KHV A;  1IQF A;  4B76 A;  3TK9 A;  2C8X B;  2H5D A;  4I8G A;  3VB7 A;  2I7P A;  1UW7 A;  1QJ1 B;  1KLJ H;  3BTE E;  4X66 M;  2B9L A;  5EXL A;  3F9E A;  1SSX A;  1UK4 A;  4Q80 A;  4CRD A;  1NJF A;  3U69 H;  1X37 A;  2M60 A;  1LO6 A;  3GLI B;  3HU2 A;  1P06 A;  1TAW A;  1FY8 E;  2KZ4 A;  1HT2 E;  2UXD M;  3SU6 A;  4ISH H;  2I7N A;  1EAX A;  3AFH A;  1DIC A;  2ZTX A;  3RXV A;  4FD2 A;  4YT6 H;  1TRN A;  4XFQ A;  1EJN A;  2P5T A;  1LVM A;  1EX3 A;  3GLF E;  1O5C B;  2BNK A;  1LCY A;  2HWL B;  4ASU D;  1FZZ A;  2FE8 A;  2WHX A;  4XBD A;  5DK1 A;  1A4W H;  2GKV E;  4HL4 A;  5C0U A;  1YPJ H;  1YCP M;  2RGO A;  1ELF A;  3ATW A;  4GAW A;  1MTV A;  1C5S A;  2Y5F A;  1E9R A;  4MVN A;  2XOK D;  4ZKO U;  4Q7J A;  1CBW B;  2KCY A;  1C2H A;  4CHA C;  1C5T A;  1KLI H;  3AOG A;  4M9S A;  4W5W A;  2BM2 A;  3J27 B;  3CEN A;  1GKI A;  5FPS A;  1QVR A;  2Q6D A;  1CGH A;  1GVL A;  2P95 A;  3WW7 A;  2UXC M;  3OY6 U;  5A2Q S;  1EXF A;  4IN1 A;  3W0L B;  2XCN A;  3CS7 A;  5KEC A;  1C2K A;  2ASU B;  1DO2 A;  2CEA A;  3ZCB B;  1Z8I B;  4YOG A;  1YE9 A;  2UUK B;  1MMJ N;  2QZ4 A;  1R2Z A;  2HOB A;  2W6I D;  2RCE A;  3F3B A;  4LZZ A;  1QQU A;  1DFP A;  5EU8 A;  1X7A C;  4RF0 A;  1O39 A;  3TGK E;  1WYK A;  5JB8 S;  2KX4 A;  1ZTL A;  3A7Z A;  3BXW A;  1EJA A;  2VVC A;  4ACA A;  3J7B A;  1P2M A;  3RC6 A;  2DUC A;  3AW0 A;  2VQF M;  2KRU A;  2EI7 A;  4D7G A;  1T31 A;  1C1P A;  5LMU M;  4NRW A;  1MQ5 A;  1S82 A;  2QF0 A;  1F0T A;  1E34 B;  3IWM A;  4I8H A;  1T8M A;  4LF4 M;  2R0L A;  1QBN A;  3GY7 A;  1AIX H;  4IGD A;  2GZ7 A;  1FAX A;  3F0P A;  5JDU B;  2CN0 H;  5FX6 A;  5T6D A;  4XK8 F;  1O3L A;  1ETT H;  4FWD A;  5K7R A;  5EJ1 A;  1QA7 A;  1TMB H;  2JIZ D;  3T1H M;  1O3C A;  4ISO A;  1LV7 A;  3M37 A;  2P93 A;  1RTL A;  2GJG A;  2PTC E;  4GHQ A;  3T27 A;  3WHL A;  3SUD A;  1SI5 H;  1QYR A;  2ANK H;  1P8V C;  2VB0 A;  4X2V A;  3GY8 A;  1C4U 2;  4F4O C;  1YSY A;  1SXJ E;  4BLC A;  1HV7 A;  2SNW A;  1H9L B;  1GBI A;  2ZQ2 A;  2V7Q D;  1KFV A;  2VWN A;  1EIJ A;  1W5T A;  3GY4 A;  3E21 A;  3P17 H;  2VF7 A;  4AB8 A;  5A0C A;  1HNE E;  1YPE H;  5EXT A;  5FTN A;  4LF8 M;  3P8O A;  1KSN A;  1FJS A;  1UTN A;  2XBX A;  3FAN A;  3NRL A;  2HKJ A;  5GCH G;  4A3V B;  1FN8 A;  2V6Z M;  1F0S A;  3DZD A;  2YNM D;  5GND A;  4NIV A;  3M5M A;  1O2N A;  3KEE A;  3J7A S;  4INK A;  4INH A;  4ZXY H;  3TH3 H;  5HXF A;  3SAU A;  4XD7 D;  1PQ5 A;  2ZP0 H;  4AN7 A;  1MTN B;  1IBM M;  1FY5 A;  1QR3 E;  2OQ4 A;  3M3V A;  3L6P A;  4TT3 D;  3NXP A;  2ZHE H;  1HT1 E;  4OS5 A;  1J7K A;  3U28 C;  1PYT D;  4E7N A;  2C5R A;  1CGJ E;  5T6F A;  1LHE H;  3FRI A;  1XXD A;  1PPC E;  3A7W A;  1QBO A;  1SQO A;  4FUE A;  3QK1 A;  3BV9 B;  1AVG H;  2PR3 A;  3AW1 A;  5E2P A;  1QZ8 A;  4RKJ B;  3I01 M;  3ZH9 B;  2DE9 A;  2UWL A;  1HQY E;  3L27 A;  2AH4 X;  5BR8 M;  3ATM A;  2PKS C;  1NBM E;  1VKY A;  2ZEB A;  1D6R A;  1PQ8 A;  1N75 A;  4ITQ A;  1UK3 A;  4LRS A;  2Y7X A;  3TGJ E;  2ODY B;  3KOZ E;  2L7H A;  2R3Y A;  2D8W A;  1CA0 C;  1OYQ A;  4THN H;  2WPH S;  2DZO B;  3GPP A;  1XXF A;  1EZU C;  2QIQ A;  3A82 A;  3FYD A;  4Y8Y A;  2F4V M;  3BTW E;  5DJ7 A;  1CA8 B;  1VIT G;  3HAT H;  3U6E A;  4LJ7 A;  2UXB M;  1RFN A;  5C18 A;  1V2L T;  1V2T T;  5EG4 A;  2H5X A;  5L6N H;  3K92 A;  3BIV H;  4NA9 H;  3RGP A;  3SV7 A;  1BJU A;  1FXY A;  1SC8 U;  4OW0 A;  1LTO A;  1HAG E;  1JR3 D;  5BPE A;  3Q76 A;  3QUM P;  1UVP A;  1O2J A;  4GSO A;  2BD7 A;  3FTE A;  3UWI A;  3BG8 A;  2XC5 A;  5A2M H;  1MQ6 A;  5F8T A;  2NU1 E;  2D1J A;  2R0I A;  4B7G A;  3GQ4 A;  2O8W A;  2YNA A;  3M3S A;  2K0B X;  1SB1 H;  4JI7 M;  1VEG A;  2WPD D;  3AAU A;  2CHQ A;  5HGG A;  5C67 A;  2RA0 A;  2IN2 A;  1ARC A;  2LVP C;  3GIS B;  4NSV A;  1TNI A;  2GMT B;  3HX3 A;  1JMO H;  4SGA E;  3VDP A;  3F92 A;  1AFQ B;  8CAT A;  1W7G H;  1GI9 B;  1JRS A;  2F83 A;  2HNT F;  2XND D;  3UNS A;  4AYY B;  1RGQ A;  4OU7 A;  4BTU B;  3MWI U;  2EY4 C;  3SOS A;  1DXP A;  4GKJ M;  3MNX A;  4Y71 A;  3UGJ A;  1QDR A;  1T6O A;  2DZL A;  1KTS B;  1KSF X;  5KGO A;  3S9C A;  2BY5 X;  4REZ A;  1J9C H;  4CR5 A;  1E35 B;  1VEK A;  4R0I A;  4YY3 M;  4K8B A;  2TGP Z;  3HGP A;  3TWL A;  1E32 A;  1Z7K A;  3SV9 A;  3BSQ A;  2CUZ A;  5EGM A;  3LON A;  1DWB H;  1XUG A;  3FP7 E;  4MQA A;  8EST E;  4CRE A;  5DGJ A;  1H4W A;  1UMA H;  2H6M A;  4B7F A;  2FLB H;  4MG3 A;  2PKS B;  1TA6 A;  3MO3 A;  1UTJ A;  1BRC E;  1YPH C;  1L1T A;  1BTH H;  3KOW E;  1WTG H;  2L6O A;  1HJA B;  1A5G H;  1SBW A;  5E0G A;  3T5F H;  1IQI A;  4WF8 A;  2AFQ B;  2VJ1 A;  2ZCK P;  3UOP A;  3TJN A;  1JIM A;  2JET C;  4OS2 A;  1UTO A;  4IBG A;  2FWW A;  3T25 A;  2WPJ S;  1GDQ A;  3FFG A;  4ISL A;  4RSP A;  1KXB A;  3SI4 H;  1TGC A;  4ZKS U;  3HKI B;  4WUR A;  1ABI H;  2MH8 A;  1VCW A;  2CMY A;  1CT2 E;  4PT5 A;  2VWO A;  1C9P A;  1WHC A;  4IW4 E;  3VG8 A;  4FW9 A;  1G36 A;  1OP2 A;  1KTT B;  2O8T A;  1NY5 A;  1AQ7 A;  2PSY A;  1TX8 A;  1DLE A;  1QL9 A;  4XDE A;  2OQU A;  2G5V A;  2ODQ A;  2KZU A;  3B7N A;  2EA3 A;  4CGY B;  2JH5 D;  1S6L A;  2L4F A;  3QX5 H;  3GO8 A;  3FKE A;  4JYU H;  4QT8 C;  3K9P A;  3FUU A;  3VGC B;  1OFH A;  2YMS B;  2FS8 A;  5KQ8 A;  4CRB A;  2DWM A;  3D49 H;  1YLA A;  1D6W A;  5C1X A;  2BJV A;  4FWH A;  2FI3 E;  1SGE E;  2LP6 A;  3BTM E;  4B73 A;  4O9V A;  3TK6 A;  1T8L A;  1O38 A;  5AF9 H;  1NHG C;  1GBM A;  5AHG H;  4KTC A;  4UE7 H;  4YTA A;  1C2I A;  6EST A;  3DA9 B;  2GGV B;  2ZU3 A;  1K1M A;  3A80 A;  1OIP A;  2M2A A;  1PJI A;  4KTU A;  2OXS A;  1Y3Y A;  2GCT B;  1TOM H;  1C5X B;  1SHY A;  5T3H A;  1YPM H;  2WUC A;  1GJ7 B;  1AZ8 A;  4RF1 A;  1H1B A;  1ZMN A;  1MH0 A;  2GP9 B;  2PGB B;  3ATL A;  3T62 A;  1RXP A;  3HJS A;  3OTP A;  1IN7 A;  4I5S A;  1I94 M;  1TA2 A;  4ZKN U;  1SG9 A;  1G41 A;  5KED A;  2JET B;  3GDU A;  2BLW A;  3OU0 A;  5KPT A;  5F3W A;  1GMC F;  5CHA B;  5EIY A;  4MM3 B;  1BTZ A;  2MR9 A;  1GI5 A;  2WSS D;  3SGQ E;  2QNJ A;  1EPT C;  1FY1 A;  2SNV A;  5A8Z A;  3MO9 A;  2CHA C;  3K1J A;  1D0K A;  2HHH M;  3RLW H;  1KY9 A;  3MU4 A;  4X0W U;  1MD8 A;  2XBV A;  2XBW A;  4WME A;  3PFI A;  4X2X A;  1Z5C A;  1BVS A;  5FBE A;  2C98 A;  1TPO A;  3AL0 C;  2ZHD A;  4F49 A;  1FDP A;  1G3C A;  1GJ8 B;  4QNR A;  1TBZ H;  4DUY M;  2WZQ A;  1TH2 A;  1DST A;  4O03 A;  2PP6 A;  1AWH B;  4X1Q U;  4Q7Y A;  1IN6 A;  4MPW A;  3A81 A;  3ZZD A;  1UTL M;  5ITX E;  1DT2 A;  3LU9 B;  3OAA D;  2DWZ B;  3OY5 U;  2VQE M;  1MX0 A;  3U6Q A;  2PW8 H;  2ZQ1 A;  1XKA C;  1PJT A;  1L2D A;  4CIZ A;  2A0Q B;  3GOV B;  3LVW A;  1MZD A;  1HNZ M;  1Z6T A;  2K1Q A;  2Z9K A;  3R0F A;  2A4R A;  3K8Z A;  4KO8 A;  1LMW B;  2Q6F A;  3E3T A;  1FY4 A;  4GEW A;  2FM2 A;  3GLI E;  2J95 A;  3RXA A;  1QAQ A;  1NES E;  1FQ3 A;  2AHM E;  4NWL A;  5ETX A;  4GLY A;  5DO4 H;  4NIY A;  3O8B A;  1OOK B;  1FJG M;  1O5E H;  3K6Z A;  2BVR H;  1JIR A;  5EP1 A;  1Y3V A;  1D4P B;  2WPM S;  4P00 A;  1SLW B;  1NFW A;  5FBI A;  2VH6 A;  4R8T B;  1YBW A;  1Z1I A;  4H42 U;  1GI6 A;  5DYI A;  3OYP A;  3PB1 E;  6CHA C;  4G4N A;  3SAV A;  3RU4 T;  3OE7 D;  2ANY A;  3PNV A;  1K82 A;  1CQQ A;  2DEN A;  1FIZ A;  3GPY A;  2UUC M;  3A8D A;  3TL4 X;  2PGQ B;  4Y6D A;  2AYW A;  2E5L M;  1VDD A;  1ZPB A;  3GYL B;  1ELG A;  2P3U B;  3RXU A;  4MH0 E;  3SHF A;  1GJD B;  4NFE A;  3P95 A;  4ZH8 A;  1UTK A;  1QUS A;  5PTP A;  1BJV A;  4I4L A;  2XLJ A;  2G3Q A;  1S5S A;  1ZHR A;  1Q3C A;  2Z7F E;  1R4G A;  1GI4 A;  3AOE C;  2D7E A;  2Z9J A;  1HAO H;  1XUI A;  1UJ1 A;  2A7C A;  3TJV A;  1RIW C;  3R8F A;  1QAO A;  4R7G A;  1SKY E;  2XCF A;  4JYV H;  1FV9 A;  4PCZ A;  3FTF A;  2ZGB H;  1CHG A;  1SLU B;  1GDN A;  3KOX E;  3GIC B;  1ORF A;  3BTQ E;  1EJM A;  2BLQ A;  2HNT E;  2IJD 1;  1W13 U;  3U60 A;  1W7X H;  1G30 B;  1XX9 A;  5CE1 A;  1NO1 A;  4CHT B;  3IIT A;  3NBX X;  2F91 A;  2KNV A;  1C2E A;  3ZVG A;  4DV4 M;  2Y5G A;  1V2N T;  2L7I A;  2HLC A;  3VB3 A;  1OS8 A;  3PXG A;  1QNJ A;  3MNC A;  4K1E A;  1V2S T;  1UTQ A;  1C5N H;  1T7C A;  1MD7 A;  2Y21 A;  2EKF A;  1G37 A;  1A61 H;  1A7S A;  3QGN B;  2CE7 A;  4MGK E;  2XC4 A;  2BOH B;  2Y20 A;  1SOZ A;  1UHB A;  3GY5 A;  3URD A;  2FH0 A;  2OOA A;  3I04 M;  4AQY M;  2FOF A;  2KHH A;  3O8D A;  2ZFS A;  1P2I A;  3QZR A;  5DSF A;  2CHV A;  2PUX B;  2Z6B D;  3DT0 H;  3Q3X A;  2OIN A;  3ELA H;  3KP1 E;  2G55 A;  1VEJ A;  1ZAE A;  5A8X A;  2BWE A;  3QAU A;  3RXD A;  1IQK A;  4CIS A;  3BTH E;  3U60 B;  1RRK A;  1NN6 A;  3MU5 A;  3PV2 A;  4Y10 E;  3RXQ A;  2J97 A;  3HGN A;  1EAW A;  5FTM A;  1PJP A;  1CU1 A;  4FVM A;  3SYL A;  1L4Z A;  3SNE A;  3H4J A;  1WDI A;  4YXW D;  1P3C A;  3I51 A;  1BA8 B;  7KME H;  4TWY A;  1JXP A;  1O3O A;  2OBQ A;  2B3T A;  2BQW B;  5DKM A;  1J8A A;  4FCT A;  1C5R A;  3URC A;  4JN6 A;  2XSZ D;  1O30 A;  3CTW B;  1SLV B;  3EE0 B;  1UCY E;  1O3P B;  1TFX A;  1GDU A;  1HYL A;  2ZG0 H;  4KTS A;  2F5S A;  1KYI A;  4AG1 A;  3N99 A;  3BG4 B;  4PDG A;  1Z8R A;  2W3I A;  3U61 B;  3FO8 D;  3SN8 A;  2ZAM A;  3SOR A;  4FCV A;  2EC9 H;  3CNR A;  1RJX B;  4LJ8 A;  4XBB A;  1OWI A;  1OKX A;  4DG4 A;  5CHB A;  2PSX A;  3T15 A;  3EA8 A;  2VH0 A;  2QYI A;  1L8Q A;  1Z6J H;  1TOC B;  4FUJ A;  1OPH B;  1H8D H;  1BRU P;  2CGA A;  3JAM S;  4MGY E;  2ZFT A;  4ZHA A;  3ODD A;  1I4W A;  3MO6 A;  3W68 A;  4LF7 M;  1C5V A;  2QXG A;  2FO9 A;  2VIN A;  3LGV A;  4IC6 A;  3TPI Z;  4DR7 M;  4HEO A;  1BHX F;  1A0H B;  1Z71 A;  1NRO H;  4D9R A;  3P92 A;  4I8L A;  1ZMJ A;  4OX9 M;  1DUE A;  2ZU1 A;  2KZS A;  4GHA A;  3AAS A;  2ZDN A;  5TCA A;  1ZRK A;  4DW2 U;  5C1U A;  4LJA A;  1G2L A;  2ZKS A;  4QNM A;  4U30 A;  2BYA X;  4X65 M;  3P70 B;  2FFJ A;  5C0T A;  5FTJ A;  3CF6 E;  1AUJ A;  1H6U A;  1BB0 B;  1C1M A;  3GP1 A;  1O2Q A;  2AEI H;  1GMC G;  1YUB A;  2QXH A;  2CK3 D;  2BD5 A;  1JB0 F;  1AE8 H;  1ELA A;  1O5G H;  1YKT A;  2SFA A;  2EA0 A;  1XUK A;  1TR8 A;  3ZZ4 A;  1XB2 B;  2GCH G;  3ZV9 A;  1ELC A;  1AZZ A;  2AMP A;  1P3E A;  2AIP A;  2FOD A;  2BLV A;  2LNC A;  3DFL A;  4FXG H;  4RKO B;  5ESB A;  4LGM A;  1QZM A;  1B5G H;  1UTP A;  3TWM A;  3H7O A;  1ZMU A;  2R9P A;  3QLP H;  3L25 A;  1K1L A;  4DV5 M;  1ZPC A;  1F2S E;  4GIT A;  1ZLR A;  3EE7 A;  4B6E A;  2ZF0 H;  3K9O A;  2R2M B;  5SGA E;  1EP6 A;  5IRE B;  1T4U H;  2ZU4 A;  1DGH B;  3RU4 D;  2V3M A;  3FE3 A;  1DWE H;  3KW6 A;  2LBC A;  1N1L A;  1TNK A;  2SGE E;  3HKJ B;  1GBE A;  1T43 A;  2NU3 E;  5ITX A;  1O3B A;  1ELD E;  1KMH B;  1DGF A;  2H1U A;  1O3M A;  2ANW A;  4CH2 B;  4U32 A;  1N32 M;  3ATI A;  1O5D H;  2WPI S;  1O2P A;  1LKA A;  3QN7 A;  1V34 A;  4O97 A;  3TJO A;  1THS H;  1C1N A;  4NC6 A;  2H5C A;  1NRN H;  3SV8 A;  2JNH A;  3IEC A;  3KYG A;  4WMD A;  2NWN A;  1ABJ H;  1EKB B;  2RGH A;  1QQW A;  1K3W A;  2SGQ E;  2P8O C;  5HYO A;  1C2G A;  1LVB A;  1T3T A;  1TGS Z;  2R18 A;  2AHM A;  1OP8 A;  5A0A E;  3D8L A;  1S81 A;  1EAT A;  4CRA A;  1O2I A;  3C3D A;  1A3B H;  3S7H B;  1RS0 A;  1GI7 B;  1N8O B;  1O2S A;  3SNC A;  3U98 H;  2HLD D;  1NZQ H;  2JDI D;  1J14 A;  1ZHP A;  4IBL H;  1OQY A;  4AC9 A;  1HAZ B;  3B74 A;  3MTY A;  1GBK A;  1LDT T;  1AUA A;  1W10 U;  1F4I A;  5HM9 A;  1CVW H;  1H8I H;  3ZVE A;  4FUG A;  1NTP A;  1TGU A;  2W6J D;  3BEI B;  3U1J B;  1XUJ A;  3MNB A;  7LPR A;  5GKN A;  2FYR A;  3RXJ A;  2WV9 A;  1QJ6 B;  2F9P A;  2ULL A;  3M7Q A;  1A46 H;  2XYA A;  5F8Z A;  2VGC B;  1QB1 A;  3F9H A;  1J15 A;  4LF9 M;  3HK3 B;  4Z1M D;  2RFK C;  2FOC A;  2SGD E;  3A83 A;  5T1V A;  4CRC A;  5KO3 A;  1YF4 A;  1GHV H;  1SHH B;  4BAH B;  4JI6 M;  1O2M A;  1MTS A;  2LPR A;  4I7Y H;  3TJU A;  1BBR H;  1GCT C;  1KXF A;  4DII H;  3RXP A;  5C17 A;  2NU2 E;  3SAR A;  1Z8J B;  4Y8Z A;  2DAG A;  1AN1 E;  1ELV A;  3UR9 A;  5L2Y H;  1QL7 A;  1DUA A;  4ABJ A;  4D81 A;  1ANC A;  2G4T A;  3CF0 A;  1TYN A;  4TUW A;  1GBD A;  1J5E M;  1BTP A;  2D26 C;  4GCH F;  1QRX A;  2ZCL P;  4Y79 A;  2LHC A;  1C5O H;  3PMJ A;  1BZX E;  3A87 A;  1PPG E;  1GPZ A;  4IBK A;  3FZZ A;  1K22 H;  4Y76 A;  2QSF X;  1O3K A;  2QC2 A;  3TH4 H;  3UOU A;  1IN5 A;  4U01 A;  2RKO A;  3RM2 H;  1J09 A;  2DZN B;  1Y5A T;  2HVX A;  2ZDV H;  3M7U A;  3GY6 A;  3PO1 B;  1MBQ A;  2Y5H A;  4UDW H;  2OUA A;  4WJG 2;  4ABG A;  1AU8 A;  4GHL A;  2Q1J A;  2X4A A;  2LWX A;  4U2W A;  3C58 A;  2D7G A;  1IQN A;  3DA1 A;  1HRT H;  2L09 A;  1XUF A;  5JBB S;  3L29 A;  4AFS A;  2BTC E;  1K1O A;  1D2N A;  1C5Y B;  1C4Y 2;  1P2K A;  3ZYE A;  4JZE H;  5J4S A;  5FSW A;  3SFZ A;  2BX4 A;  3FRH A;  3E16 B;  3K2U A;  1WV7 H;  3UY9 A;  2BDY A;  3UUZ A;  3M7G A;  1O3D A;  4ISI H;  3KGP A;  3SU5 A;  4M0D A;  1SPJ A;  1E79 D;  1ANE A;  3A89 A;  1YLD A;  2HPP H;  2QE7 D;  1EZS C;  1SGT A;  1V2P T;  2JKH A;  1SGI B;  3PVS A;  2ZM6 M;  4JZD H;  4X8S H;  5E26 A;  5J4Q A;  3QYB A;  5DNY A;  2BXT H;  5E2O A;  3Q3Y A;  4IN2 A;  1QFK H;  2N35 A;  2LXE A;  2G52 A;  3QWL A;  2C8Z B;  3F2F A;  1O3G A;  4ZCN A;  2FPZ A;  3E0P B;  3J80 S;  2K8I A;  4CHA B;  4TSF D;  2FOI C;  2R2W U;  1BOQ A;  3M61 U;  1DY9 A;  3M5O A;  4X2Y A;  4KEL A;  5KQD A;  2P3F H;  1GBH A;  1W5S A;  2ALP A;  4GVU A;  4XOJ A;  2W7S A;  4RT0 A;  4B3T M;  4LG2 A;  1V2Q T;  2WUB A;  4RNA A;  2ZZU H;  4GH9 A;  1PPZ A;  1TE0 A;  1C5W B;  1AUT C;  4DUR A;  1KXC A;  2OC7 A;  3I4Y A;  2G4U A;  4DGJ A;  1GBC A;  4AW4 A;  1WBG B;  3QTV H;  5EQR A;  4ZRO A;  4MPX A;  5HM2 A;  3GRU A;  1A3E H;  3KF2 A;  1AE5 A;  4VGC C;  4M9F A;  2JJ1 D;  1N33 M;  2WV5 A;  4O3U A;  2YOL A;  1EQ9 A;  3V13 A;  5DG6 A;  3UB0 A;  4GHT A;  3M6A A;  1SGN E;  5F03 A;  4A6L A;  2XZU A;  2H9H A;  4L78 A;  2ODP A;  1W0J D;  4K60 A;  2P94 A;  1EAU A;  1QUT A;  2ZHQ H;  2ZPQ A;  2K47 A;  3KL6 A;  4KGA A;  1BRA A;  1TON A;  4E06 H;  1SVP A;  4P02 A;  3CGW A;  2JA2 A;  4PD2 A;  1MBM A;  5GPI B;  4H6T A;  3PNY A;  4X1R U;  3EIH A;  2DHY A;  4B3M M;  3UQV A;  1MUE B;  2JH0 D;  1S6F A;  3RXE A;  1HAY B;  2BDH A;  1GO5 A;  1TPA E;  2TRM A;  4UFF H;  5DP4 A;  1GBT A;  3RM0 H;  3WWF A;  1PPF E;  2SGA A;  2PHB A;  5EJC A;  2O8L A;  3MFJ A;  1SGR E;  4A1T A;  4BAQ B;  1YLC A;  4F48 B;  2HAK A;  3GLG B;  1QGF A;  2CV2 A;  1P57 B;  3MU1 A;  4GUX A;  5EST E;  4MNW A;  1JQJ C;  4YES B;  2J94 A;  2FOE A;  1MKX K;  1XMO M;  3V3M A;  3JZ2 B;  2CF9 H;  3PWB A;  4JI8 M;  3D8B A;  3KS4 A;  1T32 A;  4NL4 H;  5EOD A;  3JR4 A;  5ITU A;  3EGK H;  2Z7J A;  3M35 A;  3U9A H;  1P0S H;  1YPL H;  1HIA A;  4FUI A;  1TDH A;  1O5F H;  2MJ5 B;  4OVZ B;  2F9U A;  3S9A A;  1P9U A;  2R46 A;  1OX1 A;  3SAW A;  3RXF A;  3EQ0 H;  1L1Z A;  1WTH D;  2CV0 A;  1GJ6 A;  4TPI Z;  1A0J A;  5FPT A;  3P8F A;  4D76 A;  4B3R M;  4GIP A;  1QL8 A;  1TNJ A;  2ZFR H;  3TGI E;  5DPA A;  1FIW A;  1NRS H;  1T4V H;  3SQE E;  3ZV8 A;  4IC5 A;  2A2Q H;  2EST E;  3MJ5 A;  3KQE A;  1RTK A;  4YM9 A;  2J34 A;  4B2A A;  1O2Z A;  4H4F A;  5FLX S;  1EB1 H;  1IN4 A;  1SGD E;  3J2P B;  1V2U T;  2PTN A;  2M5T A;  1ZJK A;  3D65 E;  1DDJ A;  2VNT A;  3F2H A;  3LC3 A;  5JB9 S;  1G32 B;  1G3D A;  1SQR A;  2F9V A;  2J5U A;  2XZF A;  2QF5 A;  3WHK A;  5I46 H;  1A5T A;  5L8R F;  5FPY A;  1RD3 B;  1CA0 B;  1IQH A;  1GBF A;  4FET A;  1HIA B;  1ANB A;  1YCP H;  3SAS A;  4K3J A;  4ABA A;  5C3N A;  4LFB M;  4BXS A;  2FI4 E;  2ZGX H;  1UCY K;  2GV6 A;  3ZVF A;  2QAA A;  5LPF A;  1ACB E;  1IOE A;  4G6Z A;  1VZQ H;  4NIX A;  3ZVC A;  1JOU B;  4FUB A;  5IZ7 D;  1P2Q A;  1XXH B;  1P05 A;  4M0W A;  5LMN M;  2H9T H;  1TRM A;  4AG2 A;  2CHG A;  2Z9I A;  2EUC A;  3EIE A;  4G3O A;  5DYG A;  3GY3 A;  3PMH B;  3PV4 A;  2FS9 A;  4OM9 A;  3TH2 H;  5EP3 A;  3EST A;  1V92 A;  3TVJ B;  2C93 B;  4Q4L A;  1IQE A;  1GGD C;  3A7T A;  3RML H;  4D80 A;  4YOJ A;  1C2D A;  1NNJ A;  1GHW H;  1O36 A;  1PQ7 A;  1WCZ A;  4PRO A;  1IAU A;  2QXJ A;  2LVN C;  3E91 A;  2Z3C A;  1W8B H;  1YPG H;  4DR3 M;  3AKZ A;  2HGT H;  4WY3 A;  3RGS A;  5L2Z H;  3SAT A;  2FES H;  1NU7 B;  1C5L H;  1XHB A;  4LJ5 A;  4QOS A;  2R44 A;  1SGP E;  2UUF B;  4GCH G;  2BVS H;  1IXR C;  4X6M A;  3SU2 A;  1WGL A;  3VEQ B;  2CJI A;  4G4O A;  2ILN A;  3BOS A;  1BIO A;  2FOG A;  2OD3 B;  1TNL A;  3NCL A;  1P2J A;  4OS4 A;  1V2V T;  2TBS A;  1HR0 M;  4UFE H;  3KFU G;  1P09 A;  4CRG A;  2J7O A;  4ZKR U;  2NU0 E;  3A8C A;  1EAI A;  1C2L A;  2CRU A;  1OWE A;  1TAL A;  1C1Q A;  1TGT A;  2BY9 X;  2EO2 A;  1G4A E;  3S0N A;  1XVO A;  4BXW A;  2MGW A;  1HCG A;  4WXV A;  1ZML A;  4ZAE A;  3IHP A;  3HWS A;  4AFU A;  4DV2 M;  1D3Q B;  2EKK A;  1O3I A;  4FU9 A;  3SMS A;  2GT7 A;  3TWK A;  4MLF B;  1OWK A;  3ZZ3 A;  2IPQ X;  4XRN A;  2QF3 A;  2J5Y A;  5ITQ A;  3UR6 A;  2UWP A;  3C3E A;  1C5Z B;  2F43 B;  5ITY A;  2XSZ A;  1DS2 E;  3I4V A;  1QAM A;  2GCH F;  3ZZ5 A;  1CHO F;  2ZTZ A;  1HPG A;  1NJG A;  4I86 A;  2G5G X;  5FL7 D;  4WWY A;  3U5Z B;  5DP9 A;  1BDA A;  5BPV A;  1IY2 A;  5FCK A;  1QZE A;  3HHW A;  2XW9 A;  4MNX A;  1S0Q A;  1AKS A;  2AIQ A;  2J9N A;  1WXQ A;  2EEK A;  3FUX A;  1NY2 2;  1LVY A;  1GJ4 H;  1KDQ A;  2FLR H;  2YFQ A;  2BD2 A;  4NSO B;  2XC0 A;  1MU6 B;  2KXE A;  2ALV A;  3GQ3 A;  1O2R A;  5IWA M;  1GBA A;  3LW5 F;  3L26 A;  1PGY A;  1GHB F;  2KW0 A;  1T8O A;  3OTO M;  3IG8 A;  1SXJ C;  2KA6 B;  3RXB A;  1WQV H;  1HNX M;  4X6P A;  3KID U;  3AJI B;  1F7Z A;  1EPT A;  3K65 B;  1K3X A;  4I81 A;  5LGO A;  3RC5 A;  3GRR A;  4ABD A;  4L6V 6;  4WH8 A;  1W0K D;  3GDV A;  1Y5U T;  2LH0 A;  1EB2 A;  1V2K T;  1ZV1 A;  1GVN A;  2R65 A;  4UN2 B;  2F5P A;  1OKS A;  1N77 A;  1VCQ A;  3MHW U;  3U1I B;  5AFZ H;  2A2X H;  2ZC9 H;  4JYA M;  4NXM M;  1O0D H;  3S69 A;  4Y11 E;  1XVM A;  2GX4 A;  1AKS B;  2YR0 A;  1O2X A;  3EDX B;  1VGC C;  4I8J A;  3ILK A;  1KDQ B;  1EST A;  1DX5 M;  2C3S A;  1INC A;  2G5N A;  3LH3 A;  1AB9 C;  2Y0T A;  3WY8 A;  4DJZ B;  4DIH H;  5C2Z A;  4L15 A;  5FHT A;  4DBG B;  1CO7 E;  3RFW A;  1K9O E;  4NXN M;  2VVV A;  3T26 A;  4IS5 A;  2ANM H;  3KQD A;  2Z4S A;  1C5Q A;  2IJO B;  4JV5 M;  2DKL A;  4LY6 A;  5ITT A;  1L1G A;  1EPT B;  3A98 B;  4JZI A;  4I31 A;  3RMN H;  1TF0 B;  3GRV A;  2A4Q A;  2CHA B;  3SO3 A;  3RP2 A;  1JR3 E;  1V2M T;  4ZXX H;  4L4U A;  2OC8 A;  2JUJ A; 
#chains in the Genus database with same CATH homology
 3J7B A;  3CF6 E;  4AZF A;  2QP9 X;  3RC6 A;  1H6U A;  2KRU A;  2VQF M;  4IJF A;  3GP1 A;  5LMU M;  4NRW A;  1YUB A;  2CK3 D;  2CFO A;  2HL7 A;  2W82 A;  4LF4 M;  2EA0 A;  2X8A A;  2OC1 A;  3ZIA D;  3VK8 A;  2A5Y B;  3UZU A;  3F0P A;  1N34 M;  5FTK A;  1N36 M;  3KVW A;  1SXJ B;  5ESB A;  4FCW A;  4LGM A;  1QZM A;  4QOZ C;  1IM2 A;  3TWM A;  4FWD A;  5EP4 A;  2JJ2 D;  3L25 A;  4DV5 M;  3NWL A;  1NSF A;  4GIT A;  2QV1 A;  4B6E A;  2JIZ D;  2YQZ A;  3EYD A;  3T1H M;  3O8R A;  3FTD A;  5IRE B;  1LV7 A;  1DGH B;  1RTL A;  3RC4 A;  3WHL A;  3M5L A;  4GC9 A;  3SUD A;  1QYR A;  3KW6 A;  2G8L A;  3VKG A;  1N1L A;  3GLH B;  3GPU A;  1YSY A;  1SXJ E;  4BLC A;  5ITX A;  3U5Z A;  4IIW A;  1KMH B;  1DGF A;  4JI4 M;  3DFZ A;  4EIW A;  2V7Q D;  1KFV A;  1N32 M;  1W5T A;  2O8M A;  3GLF A;  5EXT A;  5FTN A;  4LF8 M;  3OEE D;  3P8O A;  4IBI A;  1ORY B;  3SV8 A;  3NRL A;  2HKJ A;  4A3V B;  3SYJ A;  2V6Z M;  2RGH A;  1QQW A;  2YNM D;  3DZD A;  3KDS E;  5GND A;  3M5M A;  1BT7 A;  1K3W A;  1IBK M;  3KEE A;  3J7A S;  1T3T A;  2ZAO A;  2R18 A;  2AHM A;  1PM5 A;  3SAU A;  4XD7 D;  1R6B X;  3D8L A;  4JMY A;  1H8E D;  4KLN A;  1IBM M;  5EXP A;  2OQ4 A;  3VDU A;  3L6P A;  2XEP A;  2HLD D;  2KCO A;  2VBC A;  4II7 A;  3U61 A;  1Q3B A;  3L2A A;  2JDI D;  4TT3 D;  1HT1 E;  3UK6 A;  4DV3 M;  3H09 A;  1J7K A;  2QCU A;  3U6O A;  3T1Y M;  2C5R A;  1EE8 A;  4JI0 M;  2P59 A;  1TGU A;  2W6J D;  3U1J B;  5GKN A;  5CDF E;  2KFW A;  2WV9 A;  3ZH9 B;  4DV0 M;  3KS8 A;  3PV5 A;  4A1X A;  1HQY E;  3L27 A;  5BR8 M;  3GLF B;  4JI5 M;  1NBM E;  1A1R A;  3U6C A;  4LF9 M;  4IBD A;  4LJ6 A;  1L2C A;  1N75 A;  4ITQ A;  4Z1M D;  4LRS A;  3KOZ E;  2L7H A;  5T1V A;  2FFJ A;  5KO3 A;  2DZO B;  3IG5 A;  3GPP A;  5C0T A;  3F2G A;  3FYD A;  4JI6 M;  2C96 A;  2F4V M;  3GQ5 A;  2QF4 A;  3U6E A;  4LJ7 A;  2UXB M;  3PRB A;  5C18 A;  1XMQ M;  5C17 A;  3K92 A;  3SAR A;  3RGP A;  1QAN A;  3GPX A;  3KP0 E;  1OHH D;  3SV7 A;  4GMQ A;  4F55 A;  1DGB A;  4OW0 A;  1JR3 D;  3HHY A;  4GRI A;  1IXZ A;  5KPR A;  4BB9 A;  4D81 A;  3TQS A;  4ZPX A;  3CF0 A;  5JI2 E;  4TUW A;  3FTE A;  1J5E M;  5HKK D;  1E94 E;  3M0E A;  3Q8X A;  3SU3 A;  4B7G A;  3GQ4 A;  2C99 A;  1IN8 A;  4JI7 M;  2WPD D;  4P16 A;  2CHQ A;  1SXJ A;  2O5R A;  3LVV A;  3SC3 A;  4DR4 M;  4IBK A;  2R45 A;  3ZC7 B;  3UMM A;  3DSP A;  3M5N A;  1IN5 A;  4U01 A;  2RKO A;  4DV6 M;  2ZBK B;  4NOO B;  4MGH A;  1J09 A;  2DZN B;  4QHT A;  3VDP A;  3FOA A;  8CAT A;  2XND D;  2J7N A;  1RGQ A;  4OU7 A;  3JR5 A;  4B08 A;  2KEB A;  1DGH A;  2KRK A;  2LWX A;  2X4A A;  4GHL A;  3UGJ A;  4GKJ M;  1DXP A;  4LRT A;  3C58 A;  2D7G A;  1KSF X;  3DA1 A;  4REZ A;  3SYK A;  2L09 A;  4HLQ A;  4NRV A;  3L29 A;  4YY3 M;  4K8B A;  3TWL A;  1E32 A;  3SV9 A;  2CUZ A;  3A45 A;  3U6S A;  4Q63 A;  3AK5 A;  3LON A;  1SXJ D;  5DN6 D;  1D2N A;  5IT9 S;  4FWG A;  4GKK M;  1DO0 A;  3SFZ A;  5FSW A;  2K0Q A;  4B7F A;  3FUT A;  1WXR A;  3A46 A;  4LFC M;  2KM0 A;  3L28 A;  1EFR D;  1L1T A;  3KOW E;  3N7E A;  2L6O A;  3KN2 A;  3FUW A;  3DCL A;  5EQS A;  2QEN A;  2V1C A;  3FYC A;  3M7G A;  3VLF B;  3KNX A;  4WF8 A;  3SU5 A;  4M0D A;  4IBG A;  4L4U A;  1E79 D;  3GS9 A;  4LCB A;  2OPF A;  2QE7 D;  2R4E A;  4X62 M;  3HKP A;  4L16 A;  3PVS A;  2ZM6 M;  5EXX A;  5E26 A;  3MK6 A;  4WUR A;  1XNQ M;  5DNY A;  1S3S A;  4AG5 A;  4PT5 A;  4A1V A;  2LXE A;  1G3I A;  3QWL A;  3RE8 A;  4Z8X A;  3F2F A;  4ZCN A;  1G8P A;  3VG8 A;  1NY6 A;  4FW9 A;  5JI3 E;  3J80 S;  3SMP A;  1NHW C;  2K8I A;  4Z6Y A;  1NY5 A;  2YMS D;  4TSF D;  3LQQ A;  2FOI C;  4LJ9 A;  4B6F A;  3AOE A;  5B6L A;  1DY9 A;  3M5O A;  3U6D A;  5KQD A;  4JI3 M;  4GC5 A;  3DSO A;  4L8R C;  1W5S A;  2KZU A;  4CGY B;  4B3T M;  1NBM D;  4LG2 A;  3SUG A;  4RNA A;  1S6L A;  4GH9 A;  3GO8 A;  3FKE A;  3FUU A;  3H4M A;  1OFH A;  2YMS B;  4LFA M;  3K2L A;  5KQ8 A;  3SBJ A;  3I4Y A;  2DWM A;  2OC7 A;  4AKG A;  4AW4 A;  2BJV A;  3SZE A;  3DOA A;  4FWH A;  2DHR A;  5KPZ A;  4AKI A;  3E9S A;  1NS3 A;  5EQR A;  3LQR A;  2C9C A;  4B73 A;  5EPY A;  3GRU A;  4B74 A;  3HU3 A;  1FX0 B;  3KF2 A;  2R4J A;  1NHG C;  4M9F A;  3HJQ A;  1XNR M;  2JJ1 D;  4G4Q A;  1N33 M;  4KTC A;  2VII A;  2YOL A;  1Q39 A;  3UB0 A;  2GGV B;  3M6A A;  4LJ4 A;  3SU4 A;  2XZU A;  2M2A A;  1PJI A;  4L78 A;  2F5N A;  1W0J D;  3SU0 A;  2D7H A;  2K47 A;  2QBY B;  4WW0 A;  4RF1 A;  3HJS A;  3OTP A;  2JA2 A;  1IN7 A;  4I5S A;  3THG A;  4PD2 A;  1I94 M;  4TYD A;  1JR3 A;  1G41 A;  3PNY A;  5GPI B;  1E9S A;  3SU1 A;  5KPT A;  3EIH A;  5F3W A;  2Q2E B;  1G59 A;  4B3M M;  4WH6 A;  5H4I B;  4I8O A;  3B9P A;  4MM3 B;  2WSS D;  1IXS B;  2OBO A;  3KOY E;  2C9O A;  3WWF A;  3K1J A;  5EQT A;  4DV7 M;  5EJC A;  2HHH M;  4G4R A;  4A1T A;  3WWB A;  3GLG B;  3N7D A;  2CV2 A;  3PFI A;  3KSX A;  1Z5C A;  2DWL A;  2C98 A;  3AL0 C;  2HCB A;  1W3C A;  5H37 D;  1JQJ C;  1IY1 A;  4IBJ A;  5ITR A;  2DXI A;  4QNR A;  1XMO M;  4DUY M;  2WZQ A;  1TH2 A;  4B3S M;  1NVM A;  1TDZ A;  1R2Y A;  4I33 A;  1IN6 A;  3D8B A;  4JI8 M;  3TE6 A;  3KS4 A;  5ITX E;  3OAA D;  3FTC A;  4NL4 H;  2DWZ B;  2XGN A;  4IJE A;  4PDI A;  4DR2 M;  1NNU C;  3E4R A;  5ITU A;  3JR4 A;  4NWK A;  2Z7J A;  2VQE M;  1MX0 A;  3U6Q A;  1E1R D;  1TH4 A;  1TDH A;  5EP2 A;  4OVZ B;  2F9U A;  1L2D A;  5E6J A;  2R46 A;  3LVW A;  3SAW A;  1HNZ M;  4D82 A;  1Z6T A;  5FTL A;  1L1Z A;  4K0K M;  2K1Q A;  4I32 A;  2A4R A;  3K8Z A;  2CV0 A;  5FPT A;  1GLN A;  4KO8 A;  4B3R M;  4GIP A;  2FM2 A;  2OK5 A;  3U6L A;  1QAQ A;  3FKS D;  4DT4 A;  2CV1 A;  2BJW A;  4KHP M;  4A92 A;  2AHM E;  4NWL A;  5ETX A;  1TH3 A;  3MJ5 A;  3O8B A;  3VK7 A;  5IK2 D;  1BMF D;  1FJG M;  5EQQ A;  4M9X A;  5FLX S;  1IN4 A;  3J2P B;  5EP1 A;  2UUA M;  3A42 A;  3HGI A;  2V1U A;  2R62 A;  2X49 A;  3F2H A;  4R8T B;  3AV0 A;  2F9V A;  2J5U A;  3KSJ A;  3OYP A;  5DYI A;  2XZF A;  2QF5 A;  3SV6 A;  4G4N A;  3WHK A;  3SAV A;  3OE7 D;  4DR6 M;  3FD9 A;  5FPY A;  3PNV A;  1K82 A;  4IBC A;  2LEL A;  2GVF A;  4FET A;  2XF3 A;  3GPY A;  2UUC M;  3TL4 X;  3SAS A;  2F5Q A;  2E5L M;  4LFB M;  2UU9 M;  4DUZ M;  1VDD A;  1UM8 A;  1N78 A;  4MB7 A;  5EPN A;  2M5Z A;  1IQP A;  3PRD A;  4G6Z A;  4MH0 E;  3SHF A;  3CF2 A;  5IZ7 D;  5IDK A;  5EXS A;  1XXH B;  4QHS A;  3NBI A;  4M0W A;  5LMN M;  3FUV A;  4DV1 M;  1MU5 A;  2CHG A;  3HHX A;  4I4L A;  2XLJ A;  3U6P A;  1PJJ A;  2EUC A;  1Q3C A;  3EIE A;  4XGI A;  5DYG A;  2KR7 A;  3W0F A;  3OEH D;  4OM9 A;  1COW D;  5EP3 A;  3SHG B;  3LKW A;  3AOE C;  4Q4L A;  2DWN A;  2D7E A;  4M9Z A;  3UJN A;  4D80 A;  2QBY A;  3TPZ A;  4DR5 M;  1NNJ A;  4XBO A;  4AKH A;  2KCA A;  2OC0 A;  4AG6 A;  3R8F A;  4R3D A;  1QAO A;  4R7G A;  1SKY E;  2XCF A;  4LGY A;  4PCZ A;  3FTF A;  2A4G A;  4DR3 M;  3AKZ A;  7CAT A;  1IBL M;  3OFN D;  3KOX E;  3RGS A;  1GL7 A;  3SAT A;  4S12 A;  4JI1 M;  1H8H D;  1XHB A;  4LJ5 A;  4QOS A;  2IJD 1;  4KOD A;  3U60 A;  2QPA A;  4B75 A;  1IXR C;  4AI6 A;  3U6M A;  3SU2 A;  4CHT B;  4IBE A;  5C1B A;  5GJ4 B;  4DV4 M;  4G4O A;  2XH9 A;  3BOS A;  2L7I A;  1Z5A A;  3GLG A;  1OFI A;  3PXG A;  4YHH M;  1HR0 M;  2F4L A;  4B7H A;  4NSR A;  3LMM A;  2UUB M;  3T38 A;  2Y21 A;  3KFU G;  1L2B A;  2CE7 A;  2J7O A;  4MGK E;  5F53 A;  2Y20 A;  3O8C A;  1DXW A;  4IBF A;  4LF6 M;  2ERC A;  4MGZ E;  4AQY M;  2EO2 A;  2KCP A;  1G4A E;  3O8D A;  1FNN A;  4LZJ A;  3GLI A;  3P8N A;  5DSF A;  2CHV A;  1OJL A;  2H1R A;  3HU1 A;  4JI2 M;  3HWS A;  4IBB A;  4DV2 M;  2OIN A;  3FN8 A;  3J81 S;  1C1K A;  3KP1 E;  3SMS A;  3TWK A;  1ZAE A;  4OVZ A;  3SUE A;  4BBA A;  3HHZ A;  3GRY A;  3QAU A;  5ITQ A;  3R9X B;  1MAB B;  4CIS A;  2F43 B;  1ZQ9 A;  2Z4R A;  5ITY A;  3E90 B;  3U60 B;  2XSZ A;  3HJ8 A;  3I4V A;  1QAM A;  2Z3X A;  3PV2 A;  4B71 A;  1E1Q D;  1NJG A;  2G5G X;  3LOX A;  5FL7 D;  1XWI A;  3U5Z B;  5FTM A;  3KXE C;  3F0O A;  1XC8 A;  5BPV A;  1IY2 A;  4FVM A;  3SYL A;  3VFD A;  1CU1 A;  3HHW A;  4B76 A;  4YXW D;  1WXQ A;  4JXJ A;  3FUX A;  1HQC A;  3I51 A;  2I7P A;  2YFQ A;  4NSO B;  2F5O A;  4X66 M;  2KXE A;  3MHV C;  3GQ3 A;  1JXP A;  2OBQ A;  4FCT A;  5IWA M;  1NJF A;  3VKH A;  3L26 A;  1X37 A;  4JN6 A;  2M60 A;  2KW0 A;  3GLI B;  3HU2 A;  2FNA A;  2DVW B;  2XSZ D;  3CTW B;  3IG8 A;  1SXJ C;  1HT2 E;  3OTO M;  2UXD M;  2KA6 B;  2FP7 B;  2KZ4 A;  3SU6 A;  2I7N A;  1HNX M;  1IY0 A;  2NQ8 C;  3AJI B;  3AFH A;  4FD2 A;  4I81 A;  1K3X A;  2Y0Q A;  3RC5 A;  2P5T A;  3GRR A;  2F5S A;  1KYI A;  2XNI A;  3N99 A;  2BNK A;  4WH8 A;  1W0K D;  4PDG A;  4ASU D;  2LH0 A;  3U61 B;  3FO8 D;  1GVN A;  2FE8 A;  2R65 A;  2ZAM A;  4FCV A;  2WHX A;  2F5P A;  4DR1 M;  1XXH A;  4LJ8 A;  1N77 A;  5C0U A;  4HL4 A;  3U1I B;  5CHB A;  3T15 A;  1HNW M;  4JYA M;  2RGO A;  4NXM M;  1L8Q A;  4X64 M;  1E9R A;  2XOK D;  2XFS A;  2YR0 A;  2KCY A;  3ILK A;  3JAM S;  3AOG A;  2LNH C;  4M9S A;  4MGY E;  4W5W A;  1I4W A;  2Y0T A;  3J27 B;  4LF5 M;  1Z59 A;  4L15 A;  4LF7 M;  4RI0 A;  1GKI A;  5FPS A;  3RFW A;  1QVR A;  4DR7 M;  4NXN M;  1DY8 A;  3WW7 A;  2UXC M;  5A2Q S;  3W0L B;  2XCN A;  2Z4S A;  4OX9 M;  1DO2 A;  2CEA A;  1DGG A;  4LY6 A;  2KZS A;  1YE9 A;  3ZCB B;  4JV5 M;  2IJO B;  2YMS C;  4GHA A;  2QZ4 A;  3SUF A;  5ITT A;  1R2Z A;  2W6I D;  2ZAN A;  4MGI E;  3F3B A;  3A98 B;  4LZZ A;  4LJA A;  4I31 A;  3GRV A;  1GL6 A;  2XFT A;  3GLH A;  4QNM A;  2A4Q A;  1Z5B A;  4RF0 A;  4X65 M;  2FOM B;  3W1E A;  1R7R A;  2OC8 A;  5FTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...