2LWXA

Solution structure of the c-terminal pdr1-activating domain of the j-protein zuo1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
GSKAAKKKNKRAIRNSAKEADYFGDADKATTIDEQVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAKTIVDSGKLPSSLLSYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unfolding of the C-terminal domain of the j-protein zuo1 releases autoinhibition and activates pdr1-dependent transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Zuotin
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lwxA00
4GMQA 2LWXA
chains in the Genus database with same CATH superfamily
3SMPA 4JI2M 3Q8GA 2UXDM 3VLFB 1DO0A 3W0FA 5EP1A 4B7GA 1NO1A 1OFHA 2K47A 3K2LA 4LRSA 5BR8M 1DGFA 4PDGA 3PNYA 1Y8GA 4AG6A 3TWKA 2Z8YM 2QSFX 3FRIA 1W5SA 5F3WA 2R18A 2ZAMA 2R65A 4IBEA 2VQEM 2JNHA 4GKJM 3VK7A 3GQ5A 3RGSA 2MGWA 3BOSA 3BBZA 1VG5A 4II7A 3KW6A 3J81S 2DWLA 1R5LA 5FTKA 1Z6TA 2R0IA 2XSZA 1ZQ9A 1N34M 1MX0A 1R4GA 1TGUA 2Y21A 3HY5A 3QYBA 2FFJA 3CTWB 2LVAA 4Q7JA 3SARA 4MGZE 4NRWA 4QHSA 1HJPA 4PT5A 4F2LA 4CISA 4OVZA 2X8AA 5BPVA 1N78A 4X65M 3RFWA 3GLGA 4CIZA 3HX3A 2Z4SA 4GEWA 2RGHA 3B7NA 3QYEA 4F1IA 4QOSA 1OJLA 3VFDA 1OIZA 3B9PA 4M0WA 1UM8A 2QZ4A 5EP3A 2DAKA 4Z6YA 5EQTA 3H4MA 3GPXA 7CATA 3E21A 3GLIA 4RKUF 5ITUA 3JR5A 1QVRA 2M60A 4DR2M 1XHBA 1QUTA 3T1HM 4NSOB 3LW5F 4M9XA 1HQCA 3U5ZA 3AOGA 3SFZA 1D2NA 2H1RA 2BNKA 4NSRA 2UUAM 5IZ7D 4FW9A 4LJ4A 1K82A 4CHTB 3HHXA 1AUAA 4LF8M 3HWSA 4LFAM 1D0MA 1WHCA 3AV0A 3T6PA 1QQWA 3J80S 2OQ4A 2QP9X 4A3VB 3F92A 4LZJA 3KP1E 2DHRA 4AW4A 2BWBA 3GLFA 2B3TA 2LTUA 4KHPM 4NC6A 3B74A 3L28A 4LF6M 2JZ1A 4M9ZA 1GKIA 3U5ZB 2G3QA 1R6BX 4DR7M 3SHGB 4IBBA 3UZUA 3M6AA 3NBIA 3DFZA 4I5SA 4MGKE 3PXGA 2OOAA 8CATA 5A2QS 1T43A 2DZOB 1HQYE 4DUYM 3KOXE 2CUZA 1G3IA 3A98B 4DV5M 3U6DA 4OW0A 4MGYE 5JI3E 2LVOC 4XK8F 1G59A 2ZBKB 4IBIA 2GNOA 3GRYA 2CHVA 3LCVB 4G3OA 4Y28F 3TPZA 5IT9S 4IBJA 2KNZA 2XEPA 1WXQA 4LCBA 4QHTA 4DUZM 4DV7M 3K92A 3GLHA 2V1UA 2I7PA 1GL6A 2WSFF 1T3TA 4W5WA 2XZUA 3A46A 2CFOA 3ZQJA 1SXJB 4GC5A 1YSYA 2Z7JA 1JQJC 1DGHB 2P5TA 2J7NA 1IXRC 5FTNA 1VDDA 1E9RA 1C1KA 2KNVA 1XNQM 3FTDA 3KOZE 3LVWA 3KSXA 2C9CA 4NXMM 3ZCBB 1K3WA 4LF9M 4FCTA 1J7KA 1PJTA 2JY6B 2BWEA 4KT0F 1QDRA 4FWHA 2UUCM 3KXEC 1QZMA 4KO8A 2VDBB 1V34A 1SXJA 4DR5M 3D8BA 1NHWC 4MB7A 3SATA 4LG2A 3HU3A 4GMQA 5KQ8A 1NNUC 5ITRA 1PJIA 2F5SA 1PJQA 3EIEA 1N33M 2XLJA 3UJNA 2Z3XA 4RF1A 1SXJD 2XFTA 2QENA 4LJ7A 4IJFA 4AZFA 4DV1M 3T15A 3LVVA 4WURA 2HKJA 2LHGA 3HJ8A 3SHFA 2FNAA 2CV1A 1L1TA 3U6CA 2RKOA 2CRUA 3AJIB 1IM2A 4FWGA 3HGIA 1HR0M 2DAEA 2A5YB 3KP0E 4I4LA 2CHGA 4GHAA 3FTCA 4G4RA 3K9PA 4X64M 4JXJA 4L15A 1ZV1A 4DR3M 3KDSE 3ILKA 3I4YA 1IFYA 1Q3BA 4LGMA 2KDLA 2MH8A 4BB9A 5FSWA 3E46A 2G8LA 2LWXA 1WGNA 1QYRA 2G5GX 4X62M 1N36M 2R45A 4DV3M 1IY1A 1L2CA 4LZZA 3QAUA 4IBGA 2UUBM 2DWNA 1GJTA 3B89A 2MR9A 1Q39A 2KZUA 2J7OA 2FS1A 1R7RA 4JI0M 2L4FA 3DZDA 2JA2A 3SYKA 2R4JA 2FH0A 4HEOA 2EO2A 2JP7A 5GKNA 3ZC7B 4YHHM 2F5OA 3GLFE 3T38A 4OU7A 1H6UA 2LBCA 2VF8A 1V33A 1DV0A 1JR3E 2CE7A 3Q8XA 3E9SA 1HT2E 3R8FA 2QPAA 3ZH9B 2DWZB 3UMMA 4G4OA 1XXHB 2APLA 3HJQA 4Z8XA 3TWLA 1VQ1A 3HJSA 4MM3B 3I04M 2C99A 1LTMA 1V92A 4LJ9A 4OVZB 3VDUA 1GVNA 3W68A 1JR3D 1VDLA 4DV0M 2YQZA 4JI3M 3U60A 4NOOB 3K9OA 1Z5AA 2HWJA 4GKKM 3K8ZA 1PM5A 1IBMM 4CJ6A 2L6OA 2Y20A 2QBYB 3I4VA 2JXNA 3SAVA 1IN6A 5E26A 3UK6A 3U61B 3FE3A 1S3SA 3GLIE 2CEAA 2QNJA 2WSCF 5KPZA 4JYAM 1TH3A 1GJSA 2KZSA 4LJAA 5ITXE 2D7HA 1R2YA 2V1CA 2CV2A 1J09A 1GL7A 4NXNM 3U6OA 1WGLA 4R71A 1E9SA 4PCZA 1K3XA 3QWLA 2BJWA 4BLCA 3SAWA 5E6JA 4B3MM 2KRUA 3PFIA 2O5RA 3AFHA 4AKIA 2L4EA 3SMSA 2DHYA 2O01F 4LGYA 2KW0A 4D80A 1IXSB 4B08A 3B7ZA 1NSFA 2DI0A 3KS4A 3HU1A 3J2PB 3GPUA 1N75A 1TDZA 1TDHA 4L8RC 3KFUG 3TE6A 1VEGA 3KOWE 4R3DA 3I01M 3E4RA 1TH2A 3C3DA 3FUXA 3GLGB 2VQFM 4LF4M 2LNHC 4IBKA 1I4WA 1QUSA 3C3EA 2XF3A 4LF7M 1IXSA 3KS8A 3TQSA 1IXZA 3SASA 1N32M 2L7HA 1MN3A 2JY8A 1TF0B 3MHVC 2UXBM 2D7GA 1HNWM 2CHQA 4WW0A 1YE9A 5FLXS 3V76A 1T6OA 2ERCA 3U6SA 4M0DA 4JI5M 4FCVA 4NL4H 1RU3A 4IBDA 1KFVA 4QNRA 2LH0A 3GPPA 1SXJC 3VKHA 1NHGC 3FTFA 2DAGA 3FTEA 1TR8A 5ITTA 1L8QA 1QDTA 3GLHB 2D7EA 3J7BA 4L6V6 2HL7A 5DNYA 2F5QA 1PGYA 2JY7A 2JZ0A 4DBGB 2DXIA 4OX9M 4DV2M 1GO5A 2EKFA 1R2ZA 1NY6A 4D82A 5DYIA 1MU5A 2E5LM 4JI8M 5ITQA 3VK8A 5FTMA 4ITQA 4GHLA 3A42A 3GLFB 2FE8A 2YNMD 2X4AA 3GPYA 3U6EA 4LJ5A 2JY5A 1NV9A 1OAIA 3UGJA 2LVPC 3I51A 1JR3A 1W5TA 1F4IA 1EFUB 3U6PA 4AKHA 2HCBA 3IG8A 4MGIE 3J27B 3AKZA 2OPFA 1YLAA 2XZFA 2L2DA 4K0KM 2UU9M 1XXHE 2OOBA 3L27A 1Q02A 3SC3A 2WSEF 4DV4M 3HHWA 4GIPA 1L2BA 1IBKM 1WIVA 3L25A 5KO3A 3GP1A 2Y0QA 1XMQM 4X66M 1NV8A 1NVMA 2LXEA 2X49A 3W0LB 5JI2E 3GQ3A 4KLNA 4IIWA 3CF0A 5KQDA 4JI7M 3U61A 2ZTCA 3K1JA 2LHCA 1OAOC 5LMUM 5EXSA 3HHYA 3IECA 1G4AE 2ZANA 3HZJA 1DGGA 2RGOA 1QANA 3GRRA 4IJEA 4L16A 1VEKA 3HU2A 3AL0C 3U6MA 2KHHA 1D0KA 3L26A 1KSFX 2KRKA 3L2AA 3RGPA 1DGHA 3PVSA 2WZJA 1A5TA 4B3TM 4AI6A 3FYCA 2DZLA 1ZMUA 4HLQA 2VIIA 3L29A 1MJGM 4L78A 3LMMA 5EJCA 2KA6B 2R44A 3FD9A 4AQYM 1FJGM 1ORYB 4B7FA 2LVQD 1TTEA 2L7IA 2YFQA 2W82A 4GRIA 2N35A 4CGYB 3GLIB 3THGA 2XFSA 4FD2A 5IWAM 3HHZA 3R9XB 4QOZC 4JN6A 1WJ7A 1Z5CA 1NJGA 3D8LA 5DFLA 3RE8A 1EIJA 4MGHA 1X37A 4LJ8A 3FUVA 2EKKA 1OTRA 4IBCA 1WR1B 1L1ZA 2MJ5B 4QNMA 2Y0TA 3FRHA 4JV5M 1OQYA 3DOAA 2ZM6M 4I8OA 5EXPA 2Q2EB 1NY5A 3MJ5A 1C7YA 2QHOB 2Z4RA 4GITA 2QQ8A 1Z5BA 4MH0E 1HT1E 3FKEA 4DV6M 2F5PA 2NQ8C 2K6BA 4IBFA 1E32A 1IN4A 4JI6M 3IG5A 4DR4M 3GRVA 2O25A 2EUCA 4LF5M 1G71A 2C96A 1ZMWA 1PRBA 1ZAEA 4G4QA 2K0BX 2C9OA 3SYLA 3GRUA 1QZEA 1XMOM 2R46A 1EE8A 1DO2A 1GLNA 2J5YA 3KOYE 1CUKA 4HL4A 2K9DA 3TWMA 1ZMVA 2DAMA 3C58A 3PNVA 1PJSA 3MMPA 2I7NA 3J7AS 2F4VM 2R6FA 4P17A 1G8PA 1AIPC 4PDIA 3CGWA 3LCUA 4B7HA 2GQFA 2QCUA 5ITXA 1HNXM 5EXTA 2R62A 4TUWA 1IN5A 1XB2B 3GQ4A 2OO9A 4KODA 4B3RM 1YUBA 1IQPA 5C18A 1JB0F 1FNNA 2DWMA 3T1YM 1QAOA 4BBAA 3VDPA 1UFZA 1XXHA 2JWSA 4UN2B 1IBLM 4REZA 1TH4A 3MK6A 1SG9A 3LQRA 2RRUA 4P16A 2DVWB 3C9PA 4FCWA 2UXCM 1OFIA 5KPTA 3CF6E 5DYGA 3M7GA 1QAMA 3HKPA 2QBYA 4LFBM 4AKGA 2CP8A 5C1BA 1VEJA 2R4EA 3M0EA 2LVNC 3WHLA 3BXWA 4M9SA 4B3SM 4WP2A 4PD2A 3U6LA 4S12A 3LQQA 2BJVA 5L8RF 4XGIA 1BVSA 4LY6A 5LMNM 2C5RA 4G4NA 3W67A 2JUJA 2V6ZM 3OTOM 2HHHM 3FUWA 3H4JA 4GC9A 5H37D 1IN8A 1Z59A 4G6ZA 3AOEA 4NRVA 1G41A 2KNAA 1L2DA 4DR1M 4GH9A 4I81A 4DR6M 1NJFA 3A45A 3GLGE 3JR4A 4L4UA 1IN7A 4ZPXA 4LRTA 2L09A 1PJJA 2XH9A 4LJ6A 1I94M 1OKSA 2CWBA 4EIWA 3GLHE 4FWDA 4R7GA 1E94E 2AHMA 2DNAA 3TL4X 1DGBA 2DAIA 2XGNA 4FVMA 2VF7A 5IREB 2DENA 1XC8A 4JI4M 5ITYA 1XWIA 2DZNB 2ZAOA 1P3QQ 3JAMS 1J5EM 2F5NA 2M5ZA 3FUTA 1Q3CA 3B7QA 3WHKA 3SBJA 3VKGA 4XBOA 1IY2A 1QAQA 3DA1A 3SAUA 2KEBA 2DKLA 2C98A 2FOIC 2KXEA 4ANRA 4D81A 5FTLA 1N77A 4JI1M 1D0LA 3KSJA 5KPRA 4RF0A 2YR0A 3IHPA 4AG5A 5EP4A 4YY3M 2CV0A 3NBXX 5EXXA 2EA0A 1SXJE 1KYIA 2XSZD 2ZTDA 2HAKA 5EP2A 1LV7A 1NNJA 3NWLA 2H5XA 3FYDA 1HNZM 1OIPA 3AOEC 3KVWA 2MROB 3FUUA 2EJSA 1IY0A 4LFCM 3U6QA 4RNAA 3CF2A 1GABA 3GO8A 1XNRM 3U60B 3EIHA 5FTJA
chains in the Genus database with same CATH topology
3SMPA 4JI2M 2UXDM 3VLFB 1DO0A 3W0FA 5EP1A 4B7GA 1OFHA 2K47A 3K2LA 4LRSA 5BR8M 1DGFA 4PDGA 3PNYA 4AG6A 3TWKA 1W5SA 5F3WA 2R18A 2ZAMA 2R65A 4IBEA 2VQEM 4GKJM 3VK7A 3GQ5A 3RGSA 3BOSA 4II7A 3KW6A 3J81S 2DWLA 5FTKA 1Z6TA 2XSZA 1ZQ9A 1N34M 1MX0A 1TGUA 2Y21A 3SARA 2FFJA 3CTWB 4NRWA 4MGZE 4QHSA 4PT5A 1N78A 4CISA 4OVZA 2X8AA 5BPVA 4X65M 3RFWA 3GLGA 2Z4SA 2RGHA 4QOSA 1OJLA 3VFDA 3B9PA 4M0WA 1UM8A 2QZ4A 5EP3A 4Z6YA 5EQTA 3H4MA 3GPXA 7CATA 3GLIA 5ITUA 3JR5A 1QVRA 2M60A 4DR2M 1XHBA 3T1HM 4NSOB 4M9XA 1HQCA 3U5ZA 3AOGA 3SFZA 1D2NA 2H1RA 2BNKA 4NSRA 2UUAM 5IZ7D 4FW9A 4LJ4A 1K82A 4CHTB 3HHXA 4LF8M 3HWSA 4LFAM 3AV0A 1QQWA 3J80S 2OQ4A 2QP9X 4A3VB 4LZJA 3KP1E 2DHRA 4AW4A 3GLFA 4KHPM 3L28A 4LF6M 3U5ZB 4M9ZA 1GKIA 1R6BX 4DR7M 3SHGB 4IBBA 3UZUA 3M6AA 3NBIA 3DFZA 4I5SA 4MGKE 3PXGA 8CATA 5A2QS 2DZOB 4DUYM 1HQYE 3KOXE 2CUZA 1G3IA 3A98B 4DV5M 3U6DA 4OW0A 4MGYE 5JI3E 1G59A 2ZBKB 4IBIA 3GRYA 2CHVA 5IT9S 3TPZA 4IBJA 4LCBA 2XEPA 1WXQA 4DUZM 4QHTA 4DV7M 2V1UA 3K92A 3GLHA 2I7PA 1GL6A 1T3TA 4W5WA 2XZUA 3A46A 2CFOA 1SXJB 4GC5A 1YSYA 2Z7JA 1JQJC 1DGHB 2P5TA 2J7NA 1IXRC 5FTNA 1VDDA 1E9RA 1C1KA 1XNQM 3FTDA 3LVWA 3KOZE 3KSXA 2C9CA 4NXMM 3ZCBB 1K3WA 4LF9M 4FCTA 1J7KA 2UUCM 4FWHA 3KXEC 1QZMA 4KO8A 1SXJA 4DR5M 3D8BA 1NHWC 4MB7A 3SATA 4LG2A 3HU3A 4GMQA 5KQ8A 1NNUC 5ITRA 1PJIA 2F5SA 3EIEA 1N33M 2XLJA 3UJNA 2Z3XA 4RF1A 1SXJD 2XFTA 2QENA 4LJ7A 4IJFA 4AZFA 4DV1M 3T15A 3LVVA 4WURA 2HKJA 3SHFA 3HJ8A 2CV1A 2FNAA 1L1TA 3U6CA 2RKOA 3AJIB 1IM2A 4FWGA 3HGIA 1HR0M 2A5YB 3KP0E 4I4LA 2CHGA 4GHAA 3FTCA 4G4RA 4X64M 4JXJA 4L15A 4DR3M 3KDSE 3ILKA 3I4YA 1Q3BA 4LGMA 4BB9A 5FSWA 2G8LA 2LWXA 1QYRA 2G5GX 4X62M 1N36M 2R45A 4DV3M 1IY1A 1L2CA 4LZZA 3QAUA 4IBGA 2UUBM 2DWNA 1Q39A 2KZUA 2J7OA 4JI0M 1R7RA 3DZDA 2JA2A 3SYKA 2R4JA 2EO2A 5GKNA 3ZC7B 4YHHM 2F5OA 3T38A 4OU7A 1H6UA 2CE7A 3Q8XA 3E9SA 1HT2E 3R8FA 2QPAA 3ZH9B 2DWZB 3UMMA 4G4OA 1XXHB 3HJQA 4Z8XA 3TWLA 3HJSA 4MM3B 2C99A 4LJ9A 4OVZB 3VDUA 1GVNA 1JR3D 4DV0M 2YQZA 4JI3M 3U60A 4NOOB 1Z5AA 4GKKM 3K8ZA 1PM5A 1IBMM 2L6OA 2Y20A 2QBYB 3I4VA 3SAVA 1IN6A 5E26A 3UK6A 3U61B 1S3SA 2CEAA 5KPZA 4JYAM 1TH3A 2KZSA 4LJAA 5ITXE 2D7HA 1R2YA 2V1CA 2CV2A 1J09A 1GL7A 4NXNM 3U6OA 1K3XA 1E9SA 4PCZA 3QWLA 2BJWA 4BLCA 3SAWA 5E6JA 4B3MM 2KRUA 3PFIA 2O5RA 3AFHA 4AKIA 3SMSA 4LGYA 2KW0A 4D80A 1IXSB 4B08A 1NSFA 3KS4A 3HU1A 3J2PB 3GPUA 1N75A 1TDZA 1TDHA 4L8RC 3KFUG 3TE6A 4R3DA 3KOWE 3E4RA 1TH2A 3FUXA 3GLGB 2VQFM 4LF4M 2LNHC 4IBKA 1I4WA 4LF7M 3KS8A 2XF3A 3TQSA 1IXZA 3SASA 1N32M 2L7HA 3MHVC 2UXBM 2D7GA 1HNWM 2CHQA 4WW0A 1YE9A 5FLXS 2ERCA 3U6SA 4M0DA 4JI5M 4FCVA 4NL4H 4IBDA 1KFVA 4QNRA 2LH0A 3GPPA 1SXJC 3VKHA 1NHGC 3FTFA 3FTEA 5ITTA 1L8QA 2F5QA 3GLHB 2D7EA 3J7BA 5DNYA 2HL7A 2DXIA 4OX9M 4DV2M 1R2ZA 1NY6A 4D82A 5DYIA 1MU5A 2E5LM 4JI8M 5ITQA 3VK8A 5FTMA 4ITQA 4GHLA 3A42A 3GLFB 2FE8A 2YNMD 2X4AA 3GPYA 3U6EA 4LJ5A 3UGJA 3I51A 1JR3A 1W5TA 3U6PA 4AKHA 2HCBA 3IG8A 4MGIE 3J27B 3AKZA 2OPFA 2XZFA 4K0KM 2UU9M 3L27A 4DV4M 3SC3A 3HHWA 4GIPA 1L2BA 1IBKM 3L25A 5KO3A 3GP1A 2Y0QA 1XMQM 4X66M 2LXEA 1NVMA 2X49A 3W0LB 5JI2E 3GQ3A 4JI7M 4KLNA 4IIWA 3CF0A 5KQDA 3U61A 3K1JA 5LMUM 5EXSA 3HHYA 1G4AE 2ZANA 1DGGA 2RGOA 1QANA 3GRRA 4IJEA 4L16A 3AL0C 3HU2A 3U6MA 3L26A 1KSFX 2KRKA 3L2AA 3RGPA 1DGHA 3PVSA 4B3TM 4AI6A 3FYCA 4HLQA 2VIIA 3L29A 4L78A 3LMMA 5EJCA 2KA6B 3FD9A 4AQYM 1FJGM 1ORYB 4B7FA 2L7IA 2YFQA 2W82A 4GRIA 4CGYB 3GLIB 3THGA 2XFSA 4FD2A 5IWAM 3HHZA 3R9XB 4QOZC 4JN6A 1Z5CA 1NJGA 3D8LA 3RE8A 4MGHA 1X37A 4LJ8A 3FUVA 4IBCA 1L1ZA 4QNMA 2Y0TA 4JV5M 3DOAA 2ZM6M 4I8OA 5EXPA 2Q2EB 3MJ5A 1NY5A 2Z4RA 4GITA 4MH0E 1Z5BA 1HT1E 3FKEA 4DV6M 2F5PA 2NQ8C 4IBFA 1E32A 1IN4A 4JI6M 3IG5A 4DR4M 3GRVA 2EUCA 4LF5M 2C96A 4G4QA 1ZAEA 2C9OA 3SYLA 3GRUA 1XMOM 2R46A 1EE8A 1DO2A 1GLNA 3KOYE 4HL4A 3TWMA 3C58A 3PNVA 2I7NA 3J7AS 2F4VM 1G8PA 4PDIA 1HNXM 4TUWA 4B7HA 2QCUA 5ITXA 5EXTA 2R62A 1IN5A 3GQ4A 4KODA 4B3RM 1YUBA 1IQPA 5C18A 1FNNA 2DWMA 3T1YM 1QAOA 4BBAA 3VDPA 1XXHA 1IBLM 4REZA 1TH4A 3MK6A 3LQRA 4P16A 2DVWB 4FCWA 2UXCM 1OFIA 5KPTA 3CF6E 5DYGA 3M7GA 1QAMA 3HKPA 2QBYA 4LFBM 4AKGA 5C1BA 2R4EA 3M0EA 3WHLA 4B3SM 4M9SA 4PD2A 3U6LA 4S12A 3LQQA 2BJVA 4XGIA 4LY6A 5LMNM 2C5RA 4G4NA 2V6ZM 3OTOM 2HHHM 3FUWA 4GC9A 5H37D 1IN8A 1Z59A 4G6ZA 3AOEA 4NRVA 1G41A 1L2DA 4DR1M 4GH9A 4I81A 4DR6M 1NJFA 3A45A 3JR4A 4L4UA 1IN7A 4ZPXA 4LRTA 2L09A 1PJJA 2XH9A 4LJ6A 1I94M 4EIWA 4FWDA 4R7GA 1E94E 2AHMA 3TL4X 1DGBA 2XGNA 4FVMA 5IREB 1XC8A 4JI4M 5ITYA 1XWIA 2DZNB 2ZAOA 3JAMS 1J5EM 2F5NA 2M5ZA 3FUTA 1Q3CA 3WHKA 3SBJA 3VKGA 4XBOA 1IY2A 1QAQA 3DA1A 3SAUA 2FOIC 2KEBA 2C98A 5FTLA 2KXEA 4D81A 1N77A 4JI1M 3KSJA 5KPRA 4RF0A 2YR0A 4AG5A 5EP4A 4YY3M 2CV0A 5EXXA 2EA0A 1SXJE 1KYIA 2XSZD 5EP2A 1LV7A 1NNJA 3NWLA 3FYDA 1HNZM 3KVWA 3AOEC 3FUUA 1IY0A 4LFCM 3U6QA 4RNAA 3CF2A 3GO8A 1XNRM 3U60B 3EIHA 5FTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMQ A;  2LWX A; 
#chains in the Genus database with same CATH topology
 3SMP A;  4JI2 M;  3Q8G A;  2UXD M;  3VLF B;  1DO0 A;  3W0F A;  5EP1 A;  4B7G A;  1NO1 A;  1OFH A;  2K47 A;  3K2L A;  4LRS A;  5BR8 M;  1DGF A;  4PDG A;  3PNY A;  1Y8G A;  4AG6 A;  3TWK A;  2Z8Y M;  2QSF X;  3FRI A;  1W5S A;  5F3W A;  2R18 A;  2ZAM A;  2R65 A;  4IBE A;  2VQE M;  2JNH A;  4GKJ M;  3VK7 A;  3GQ5 A;  3RGS A;  2MGW A;  3BOS A;  3BBZ A;  1VG5 A;  4II7 A;  3KW6 A;  3J81 S;  2DWL A;  1R5L A;  5FTK A;  1Z6T A;  2R0I A;  2XSZ A;  1ZQ9 A;  1N34 M;  1MX0 A;  1R4G A;  1TGU A;  2Y21 A;  3HY5 A;  3QYB A;  2FFJ A;  3CTW B;  2LVA A;  4Q7J A;  3SAR A;  4MGZ E;  4NRW A;  4QHS A;  1HJP A;  4PT5 A;  4F2L A;  4CIS A;  4OVZ A;  2X8A A;  5BPV A;  1N78 A;  4X65 M;  3RFW A;  3GLG A;  4CIZ A;  3HX3 A;  2Z4S A;  4GEW A;  2RGH A;  3B7N A;  3QYE A;  4F1I A;  4QOS A;  1OJL A;  3VFD A;  1OIZ A;  3B9P A;  4M0W A;  1UM8 A;  2QZ4 A;  5EP3 A;  2DAK A;  4Z6Y A;  5EQT A;  3H4M A;  3GPX A;  7CAT A;  3E21 A;  3GLI A;  4RKU F;  5ITU A;  3JR5 A;  1QVR A;  2M60 A;  4DR2 M;  1XHB A;  1QUT A;  3T1H M;  4NSO B;  3LW5 F;  4M9X A;  1HQC A;  3U5Z A;  3AOG A;  3SFZ A;  1D2N A;  2H1R A;  2BNK A;  4NSR A;  2UUA M;  5IZ7 D;  4FW9 A;  4LJ4 A;  1K82 A;  4CHT B;  3HHX A;  1AUA A;  4LF8 M;  3HWS A;  4LFA M;  1D0M A;  1WHC A;  3AV0 A;  3T6P A;  1QQW A;  3J80 S;  2OQ4 A;  2QP9 X;  4A3V B;  3F92 A;  4LZJ A;  3KP1 E;  2DHR A;  4AW4 A;  2BWB A;  3GLF A;  2B3T A;  2LTU A;  4KHP M;  4NC6 A;  3B74 A;  3L28 A;  4LF6 M;  2JZ1 A;  4M9Z A;  1GKI A;  3U5Z B;  2G3Q A;  1R6B X;  4DR7 M;  3SHG B;  4IBB A;  3UZU A;  3M6A A;  3NBI A;  3DFZ A;  4I5S A;  4MGK E;  3PXG A;  2OOA A;  8CAT A;  5A2Q S;  1T43 A;  2DZO B;  1HQY E;  4DUY M;  3KOX E;  2CUZ A;  1G3I A;  3A98 B;  4DV5 M;  3U6D A;  4OW0 A;  4MGY E;  5JI3 E;  2LVO C;  4XK8 F;  1G59 A;  2ZBK B;  4IBI A;  2GNO A;  3GRY A;  2CHV A;  3LCV B;  4G3O A;  4Y28 F;  3TPZ A;  5IT9 S;  4IBJ A;  2KNZ A;  2XEP A;  1WXQ A;  4LCB A;  4QHT A;  4DUZ M;  4DV7 M;  3K92 A;  3GLH A;  2V1U A;  2I7P A;  1GL6 A;  2WSF F;  1T3T A;  4W5W A;  2XZU A;  3A46 A;  2CFO A;  3ZQJ A;  1SXJ B;  4GC5 A;  1YSY A;  2Z7J A;  1JQJ C;  1DGH B;  2P5T A;  2J7N A;  1IXR C;  5FTN A;  1VDD A;  1E9R A;  1C1K A;  2KNV A;  1XNQ M;  3FTD A;  3KOZ E;  3LVW A;  3KSX A;  2C9C A;  4NXM M;  3ZCB B;  1K3W A;  4LF9 M;  4FCT A;  1J7K A;  1PJT A;  2JY6 B;  2BWE A;  4KT0 F;  1QDR A;  4FWH A;  2UUC M;  3KXE C;  1QZM A;  4KO8 A;  2VDB B;  1V34 A;  1SXJ A;  4DR5 M;  3D8B A;  1NHW C;  4MB7 A;  3SAT A;  4LG2 A;  3HU3 A;  4GMQ A;  5KQ8 A;  1NNU C;  5ITR A;  1PJI A;  2F5S A;  1PJQ A;  3EIE A;  1N33 M;  2XLJ A;  3UJN A;  2Z3X A;  4RF1 A;  1SXJ D;  2XFT A;  2QEN A;  4LJ7 A;  4IJF A;  4AZF A;  4DV1 M;  3T15 A;  3LVV A;  4WUR A;  2HKJ A;  2LHG A;  3HJ8 A;  3SHF A;  2FNA A;  2CV1 A;  1L1T A;  3U6C A;  2RKO A;  2CRU A;  3AJI B;  1IM2 A;  4FWG A;  3HGI A;  1HR0 M;  2DAE A;  2A5Y B;  3KP0 E;  4I4L A;  2CHG A;  4GHA A;  3FTC A;  4G4R A;  3K9P A;  4X64 M;  4JXJ A;  4L15 A;  1ZV1 A;  4DR3 M;  3KDS E;  3ILK A;  3I4Y A;  1IFY A;  1Q3B A;  4LGM A;  2KDL A;  2MH8 A;  4BB9 A;  5FSW A;  3E46 A;  2G8L A;  2LWX A;  1WGN A;  1QYR A;  2G5G X;  4X62 M;  1N36 M;  2R45 A;  4DV3 M;  1IY1 A;  1L2C A;  4LZZ A;  3QAU A;  4IBG A;  2UUB M;  2DWN A;  1GJT A;  3B89 A;  2MR9 A;  1Q39 A;  2KZU A;  2J7O A;  2FS1 A;  1R7R A;  4JI0 M;  2L4F A;  3DZD A;  2JA2 A;  3SYK A;  2R4J A;  2FH0 A;  4HEO A;  2EO2 A;  2JP7 A;  5GKN A;  3ZC7 B;  4YHH M;  2F5O A;  3GLF E;  3T38 A;  4OU7 A;  1H6U A;  2LBC A;  2VF8 A;  1V33 A;  1DV0 A;  1JR3 E;  2CE7 A;  3Q8X A;  3E9S A;  1HT2 E;  3R8F A;  2QPA A;  3ZH9 B;  2DWZ B;  3UMM A;  4G4O A;  1XXH B;  2APL A;  3HJQ A;  4Z8X A;  3TWL A;  1VQ1 A;  3HJS A;  4MM3 B;  3I04 M;  2C99 A;  1LTM A;  1V92 A;  4LJ9 A;  4OVZ B;  3VDU A;  1GVN A;  3W68 A;  1JR3 D;  1VDL A;  4DV0 M;  2YQZ A;  4JI3 M;  3U60 A;  4NOO B;  3K9O A;  1Z5A A;  2HWJ A;  4GKK M;  3K8Z A;  1PM5 A;  1IBM M;  4CJ6 A;  2L6O A;  2Y20 A;  2QBY B;  3I4V A;  2JXN A;  3SAV A;  1IN6 A;  5E26 A;  3UK6 A;  3U61 B;  3FE3 A;  1S3S A;  3GLI E;  2CEA A;  2QNJ A;  2WSC F;  5KPZ A;  4JYA M;  1TH3 A;  1GJS A;  2KZS A;  4LJA A;  5ITX E;  2D7H A;  1R2Y A;  2V1C A;  2CV2 A;  1J09 A;  1GL7 A;  4NXN M;  3U6O A;  1WGL A;  4R71 A;  1E9S A;  4PCZ A;  1K3X A;  3QWL A;  2BJW A;  4BLC A;  3SAW A;  5E6J A;  4B3M M;  2KRU A;  3PFI A;  2O5R A;  3AFH A;  4AKI A;  2L4E A;  3SMS A;  2DHY A;  2O01 F;  4LGY A;  2KW0 A;  4D80 A;  1IXS B;  4B08 A;  3B7Z A;  1NSF A;  2DI0 A;  3KS4 A;  3HU1 A;  3J2P B;  3GPU A;  1N75 A;  1TDZ A;  1TDH A;  4L8R C;  3KFU G;  3TE6 A;  1VEG A;  3KOW E;  4R3D A;  3I01 M;  3E4R A;  1TH2 A;  3C3D A;  3FUX A;  3GLG B;  2VQF M;  4LF4 M;  2LNH C;  4IBK A;  1I4W A;  1QUS A;  3C3E A;  2XF3 A;  4LF7 M;  1IXS A;  3KS8 A;  3TQS A;  1IXZ A;  3SAS A;  1N32 M;  2L7H A;  1MN3 A;  2JY8 A;  1TF0 B;  3MHV C;  2UXB M;  2D7G A;  1HNW M;  2CHQ A;  4WW0 A;  1YE9 A;  5FLX S;  3V76 A;  1T6O A;  2ERC A;  3U6S A;  4M0D A;  4JI5 M;  4FCV A;  4NL4 H;  1RU3 A;  4IBD A;  1KFV A;  4QNR A;  2LH0 A;  3GPP A;  1SXJ C;  3VKH A;  1NHG C;  3FTF A;  2DAG A;  3FTE A;  1TR8 A;  5ITT A;  1L8Q A;  1QDT A;  3GLH B;  2D7E A;  3J7B A;  4L6V 6;  2HL7 A;  5DNY A;  2F5Q A;  1PGY A;  2JY7 A;  2JZ0 A;  4DBG B;  2DXI A;  4OX9 M;  4DV2 M;  1GO5 A;  2EKF A;  1R2Z A;  1NY6 A;  4D82 A;  5DYI A;  1MU5 A;  2E5L M;  4JI8 M;  5ITQ A;  3VK8 A;  5FTM A;  4ITQ A;  4GHL A;  3A42 A;  3GLF B;  2FE8 A;  2YNM D;  2X4A A;  3GPY A;  3U6E A;  4LJ5 A;  2JY5 A;  1NV9 A;  1OAI A;  3UGJ A;  2LVP C;  3I51 A;  1JR3 A;  1W5T A;  1F4I A;  1EFU B;  3U6P A;  4AKH A;  2HCB A;  3IG8 A;  4MGI E;  3J27 B;  3AKZ A;  2OPF A;  1YLA A;  2XZF A;  2L2D A;  4K0K M;  2UU9 M;  1XXH E;  2OOB A;  3L27 A;  1Q02 A;  3SC3 A;  2WSE F;  4DV4 M;  3HHW A;  4GIP A;  1L2B A;  1IBK M;  1WIV A;  3L25 A;  5KO3 A;  3GP1 A;  2Y0Q A;  1XMQ M;  4X66 M;  1NV8 A;  1NVM A;  2LXE A;  2X49 A;  3W0L B;  5JI2 E;  3GQ3 A;  4KLN A;  4IIW A;  3CF0 A;  5KQD A;  4JI7 M;  3U61 A;  2ZTC A;  3K1J A;  2LHC A;  1OAO C;  5LMU M;  5EXS A;  3HHY A;  3IEC A;  1G4A E;  2ZAN A;  3HZJ A;  1DGG A;  2RGO A;  1QAN A;  3GRR A;  4IJE A;  4L16 A;  1VEK A;  3HU2 A;  3AL0 C;  3U6M A;  2KHH A;  1D0K A;  3L26 A;  1KSF X;  2KRK A;  3L2A A;  3RGP A;  1DGH A;  3PVS A;  2WZJ A;  1A5T A;  4B3T M;  4AI6 A;  3FYC A;  2DZL A;  1ZMU A;  4HLQ A;  2VII A;  3L29 A;  1MJG M;  4L78 A;  3LMM A;  5EJC A;  2KA6 B;  2R44 A;  3FD9 A;  4AQY M;  1FJG M;  1ORY B;  4B7F A;  2LVQ D;  1TTE A;  2L7I A;  2YFQ A;  2W82 A;  4GRI A;  2N35 A;  4CGY B;  3GLI B;  3THG A;  2XFS A;  4FD2 A;  5IWA M;  3HHZ A;  3R9X B;  4QOZ C;  4JN6 A;  1WJ7 A;  1Z5C A;  1NJG A;  3D8L A;  5DFL A;  3RE8 A;  1EIJ A;  4MGH A;  1X37 A;  4LJ8 A;  3FUV A;  2EKK A;  1OTR A;  4IBC A;  1WR1 B;  1L1Z A;  2MJ5 B;  4QNM A;  2Y0T A;  3FRH A;  4JV5 M;  1OQY A;  3DOA A;  2ZM6 M;  4I8O A;  5EXP A;  2Q2E B;  1NY5 A;  3MJ5 A;  1C7Y A;  2QHO B;  2Z4R A;  4GIT A;  2QQ8 A;  1Z5B A;  4MH0 E;  1HT1 E;  3FKE A;  4DV6 M;  2F5P A;  2NQ8 C;  2K6B A;  4IBF A;  1E32 A;  1IN4 A;  4JI6 M;  3IG5 A;  4DR4 M;  3GRV A;  2O25 A;  2EUC A;  4LF5 M;  1G71 A;  2C96 A;  1ZMW A;  1PRB A;  1ZAE A;  4G4Q A;  2K0B X;  2C9O A;  3SYL A;  3GRU A;  1QZE A;  1XMO M;  2R46 A;  1EE8 A;  1DO2 A;  1GLN A;  2J5Y A;  3KOY E;  1CUK A;  4HL4 A;  2K9D A;  3TWM A;  1ZMV A;  2DAM A;  3C58 A;  3PNV A;  1PJS A;  3MMP A;  2I7N A;  3J7A S;  2F4V M;  2R6F A;  4P17 A;  1G8P A;  1AIP C;  4PDI A;  3CGW A;  3LCU A;  4B7H A;  2GQF A;  2QCU A;  5ITX A;  1HNX M;  5EXT A;  2R62 A;  4TUW A;  1IN5 A;  1XB2 B;  3GQ4 A;  2OO9 A;  4KOD A;  4B3R M;  1YUB A;  1IQP A;  5C18 A;  1JB0 F;  1FNN A;  2DWM A;  3T1Y M;  1QAO A;  4BBA A;  3VDP A;  1UFZ A;  1XXH A;  2JWS A;  4UN2 B;  1IBL M;  4REZ A;  1TH4 A;  3MK6 A;  1SG9 A;  3LQR A;  2RRU A;  4P16 A;  2DVW B;  3C9P A;  4FCW A;  2UXC M;  1OFI A;  5KPT A;  3CF6 E;  5DYG A;  3M7G A;  1QAM A;  3HKP A;  2QBY A;  4LFB M;  4AKG A;  2CP8 A;  5C1B A;  1VEJ A;  2R4E A;  3M0E A;  2LVN C;  3WHL A;  3BXW A;  4M9S A;  4B3S M;  4WP2 A;  4PD2 A;  3U6L A;  4S12 A;  3LQQ A;  2BJV A;  5L8R F;  4XGI A;  1BVS A;  4LY6 A;  5LMN M;  2C5R A;  4G4N A;  3W67 A;  2JUJ A;  2V6Z M;  3OTO M;  2HHH M;  3FUW A;  3H4J A;  4GC9 A;  5H37 D;  1IN8 A;  1Z59 A;  4G6Z A;  3AOE A;  4NRV A;  1G41 A;  2KNA A;  1L2D A;  4DR1 M;  4GH9 A;  4I81 A;  4DR6 M;  1NJF A;  3A45 A;  3GLG E;  3JR4 A;  4L4U A;  1IN7 A;  4ZPX A;  4LRT A;  2L09 A;  1PJJ A;  2XH9 A;  4LJ6 A;  1I94 M;  1OKS A;  2CWB A;  4EIW A;  3GLH E;  4FWD A;  4R7G A;  1E94 E;  2AHM A;  2DNA A;  3TL4 X;  1DGB A;  2DAI A;  2XGN A;  4FVM A;  2VF7 A;  5IRE B;  2DEN A;  1XC8 A;  4JI4 M;  5ITY A;  1XWI A;  2DZN B;  2ZAO A;  1P3Q Q;  3JAM S;  1J5E M;  2F5N A;  2M5Z A;  3FUT A;  1Q3C A;  3B7Q A;  3WHK A;  3SBJ A;  3VKG A;  4XBO A;  1IY2 A;  1QAQ A;  3DA1 A;  3SAU A;  2KEB A;  2DKL A;  2C98 A;  2FOI C;  2KXE A;  4ANR A;  4D81 A;  5FTL A;  1N77 A;  4JI1 M;  1D0L A;  3KSJ A;  5KPR A;  4RF0 A;  2YR0 A;  3IHP A;  4AG5 A;  5EP4 A;  4YY3 M;  2CV0 A;  3NBX X;  5EXX A;  2EA0 A;  1SXJ E;  1KYI A;  2XSZ D;  2ZTD A;  2HAK A;  5EP2 A;  1LV7 A;  1NNJ A;  3NWL A;  2H5X A;  3FYD A;  1HNZ M;  1OIP A;  3AOE C;  3KVW A;  2MRO B;  3FUU A;  2EJS A;  1IY0 A;  4LFC M;  3U6Q A;  4RNA A;  3CF2 A;  1GAB A;  3GO8 A;  1XNR M;  3U60 B;  3EIH A;  5FTJ A; 
#chains in the Genus database with same CATH homology
 3SMP A;  4JI2 M;  2UXD M;  3VLF B;  1DO0 A;  3W0F A;  5EP1 A;  4B7G A;  1OFH A;  2K47 A;  3K2L A;  4LRS A;  5BR8 M;  1DGF A;  4PDG A;  3PNY A;  4AG6 A;  3TWK A;  1W5S A;  5F3W A;  2R18 A;  2ZAM A;  2R65 A;  4IBE A;  2VQE M;  4GKJ M;  3VK7 A;  3GQ5 A;  3RGS A;  3BOS A;  4II7 A;  3KW6 A;  3J81 S;  2DWL A;  5FTK A;  1Z6T A;  2XSZ A;  1ZQ9 A;  1N34 M;  1MX0 A;  1TGU A;  2Y21 A;  3SAR A;  2FFJ A;  3CTW B;  4NRW A;  4MGZ E;  4QHS A;  4PT5 A;  1N78 A;  4CIS A;  4OVZ A;  2X8A A;  5BPV A;  4X65 M;  3RFW A;  3GLG A;  2Z4S A;  2RGH A;  4QOS A;  1OJL A;  3VFD A;  3B9P A;  4M0W A;  1UM8 A;  2QZ4 A;  5EP3 A;  4Z6Y A;  5EQT A;  3H4M A;  3GPX A;  7CAT A;  3GLI A;  5ITU A;  3JR5 A;  1QVR A;  2M60 A;  4DR2 M;  1XHB A;  3T1H M;  4NSO B;  4M9X A;  1HQC A;  3U5Z A;  3AOG A;  3SFZ A;  1D2N A;  2H1R A;  2BNK A;  4NSR A;  2UUA M;  5IZ7 D;  4FW9 A;  4LJ4 A;  1K82 A;  4CHT B;  3HHX A;  4LF8 M;  3HWS A;  4LFA M;  3AV0 A;  1QQW A;  3J80 S;  2OQ4 A;  2QP9 X;  4A3V B;  4LZJ A;  3KP1 E;  2DHR A;  4AW4 A;  3GLF A;  4KHP M;  3L28 A;  4LF6 M;  3U5Z B;  4M9Z A;  1GKI A;  1R6B X;  4DR7 M;  3SHG B;  4IBB A;  3UZU A;  3M6A A;  3NBI A;  3DFZ A;  4I5S A;  4MGK E;  3PXG A;  8CAT A;  5A2Q S;  2DZO B;  4DUY M;  1HQY E;  3KOX E;  2CUZ A;  1G3I A;  3A98 B;  4DV5 M;  3U6D A;  4OW0 A;  4MGY E;  5JI3 E;  1G59 A;  2ZBK B;  4IBI A;  3GRY A;  2CHV A;  5IT9 S;  3TPZ A;  4IBJ A;  4LCB A;  2XEP A;  1WXQ A;  4DUZ M;  4QHT A;  4DV7 M;  2V1U A;  3K92 A;  3GLH A;  2I7P A;  1GL6 A;  1T3T A;  4W5W A;  2XZU A;  3A46 A;  2CFO A;  1SXJ B;  4GC5 A;  1YSY A;  2Z7J A;  1JQJ C;  1DGH B;  2P5T A;  2J7N A;  1IXR C;  5FTN A;  1VDD A;  1E9R A;  1C1K A;  1XNQ M;  3FTD A;  3LVW A;  3KOZ E;  3KSX A;  2C9C A;  4NXM M;  3ZCB B;  1K3W A;  4LF9 M;  4FCT A;  1J7K A;  2UUC M;  4FWH A;  3KXE C;  1QZM A;  4KO8 A;  1SXJ A;  4DR5 M;  3D8B A;  1NHW C;  4MB7 A;  3SAT A;  4LG2 A;  3HU3 A;  4GMQ A;  5KQ8 A;  1NNU C;  5ITR A;  1PJI A;  2F5S A;  3EIE A;  1N33 M;  2XLJ A;  3UJN A;  2Z3X A;  4RF1 A;  1SXJ D;  2XFT A;  2QEN A;  4LJ7 A;  4IJF A;  4AZF A;  4DV1 M;  3T15 A;  3LVV A;  4WUR A;  2HKJ A;  3SHF A;  3HJ8 A;  2CV1 A;  2FNA A;  1L1T A;  3U6C A;  2RKO A;  3AJI B;  1IM2 A;  4FWG A;  3HGI A;  1HR0 M;  2A5Y B;  3KP0 E;  4I4L A;  2CHG A;  4GHA A;  3FTC A;  4G4R A;  4X64 M;  4JXJ A;  4L15 A;  4DR3 M;  3KDS E;  3ILK A;  3I4Y A;  1Q3B A;  4LGM A;  4BB9 A;  5FSW A;  2G8L A;  2LWX A;  1QYR A;  2G5G X;  4X62 M;  1N36 M;  2R45 A;  4DV3 M;  1IY1 A;  1L2C A;  4LZZ A;  3QAU A;  4IBG A;  2UUB M;  2DWN A;  1Q39 A;  2KZU A;  2J7O A;  4JI0 M;  1R7R A;  3DZD A;  2JA2 A;  3SYK A;  2R4J A;  2EO2 A;  5GKN A;  3ZC7 B;  4YHH M;  2F5O A;  3T38 A;  4OU7 A;  1H6U A;  2CE7 A;  3Q8X A;  3E9S A;  1HT2 E;  3R8F A;  2QPA A;  3ZH9 B;  2DWZ B;  3UMM A;  4G4O A;  1XXH B;  3HJQ A;  4Z8X A;  3TWL A;  3HJS A;  4MM3 B;  2C99 A;  4LJ9 A;  4OVZ B;  3VDU A;  1GVN A;  1JR3 D;  4DV0 M;  2YQZ A;  4JI3 M;  3U60 A;  4NOO B;  1Z5A A;  4GKK M;  3K8Z A;  1PM5 A;  1IBM M;  2L6O A;  2Y20 A;  2QBY B;  3I4V A;  3SAV A;  1IN6 A;  5E26 A;  3UK6 A;  3U61 B;  1S3S A;  2CEA A;  5KPZ A;  4JYA M;  1TH3 A;  2KZS A;  4LJA A;  5ITX E;  2D7H A;  1R2Y A;  2V1C A;  2CV2 A;  1J09 A;  1GL7 A;  4NXN M;  3U6O A;  1K3X A;  1E9S A;  4PCZ A;  3QWL A;  2BJW A;  4BLC A;  3SAW A;  5E6J A;  4B3M M;  2KRU A;  3PFI A;  2O5R A;  3AFH A;  4AKI A;  3SMS A;  4LGY A;  2KW0 A;  4D80 A;  1IXS B;  4B08 A;  1NSF A;  3KS4 A;  3HU1 A;  3J2P B;  3GPU A;  1N75 A;  1TDZ A;  1TDH A;  4L8R C;  3KFU G;  3TE6 A;  4R3D A;  3KOW E;  3E4R A;  1TH2 A;  3FUX A;  3GLG B;  2VQF M;  4LF4 M;  2LNH C;  4IBK A;  1I4W A;  4LF7 M;  3KS8 A;  2XF3 A;  3TQS A;  1IXZ A;  3SAS A;  1N32 M;  2L7H A;  3MHV C;  2UXB M;  2D7G A;  1HNW M;  2CHQ A;  4WW0 A;  1YE9 A;  5FLX S;  2ERC A;  3U6S A;  4M0D A;  4JI5 M;  4FCV A;  4NL4 H;  4IBD A;  1KFV A;  4QNR A;  2LH0 A;  3GPP A;  1SXJ C;  3VKH A;  1NHG C;  3FTF A;  3FTE A;  5ITT A;  1L8Q A;  2F5Q A;  3GLH B;  2D7E A;  3J7B A;  5DNY A;  2HL7 A;  2DXI A;  4OX9 M;  4DV2 M;  1R2Z A;  1NY6 A;  4D82 A;  5DYI A;  1MU5 A;  2E5L M;  4JI8 M;  5ITQ A;  3VK8 A;  5FTM A;  4ITQ A;  4GHL A;  3A42 A;  3GLF B;  2FE8 A;  2YNM D;  2X4A A;  3GPY A;  3U6E A;  4LJ5 A;  3UGJ A;  3I51 A;  1JR3 A;  1W5T A;  3U6P A;  4AKH A;  2HCB A;  3IG8 A;  4MGI E;  3J27 B;  3AKZ A;  2OPF A;  2XZF A;  4K0K M;  2UU9 M;  3L27 A;  4DV4 M;  3SC3 A;  3HHW A;  4GIP A;  1L2B A;  1IBK M;  3L25 A;  5KO3 A;  3GP1 A;  2Y0Q A;  1XMQ M;  4X66 M;  2LXE A;  1NVM A;  2X49 A;  3W0L B;  5JI2 E;  3GQ3 A;  4JI7 M;  4KLN A;  4IIW A;  3CF0 A;  5KQD A;  3U61 A;  3K1J A;  5LMU M;  5EXS A;  3HHY A;  1G4A E;  2ZAN A;  1DGG A;  2RGO A;  1QAN A;  3GRR A;  4IJE A;  4L16 A;  3AL0 C;  3HU2 A;  3U6M A;  3L26 A;  1KSF X;  2KRK A;  3L2A A;  3RGP A;  1DGH A;  3PVS A;  4B3T M;  4AI6 A;  3FYC A;  4HLQ A;  2VII A;  3L29 A;  4L78 A;  3LMM A;  5EJC A;  2KA6 B;  3FD9 A;  4AQY M;  1FJG M;  1ORY B;  4B7F A;  2L7I A;  2YFQ A;  2W82 A;  4GRI A;  4CGY B;  3GLI B;  3THG A;  2XFS A;  4FD2 A;  5IWA M;  3HHZ A;  3R9X B;  4QOZ C;  4JN6 A;  1Z5C A;  1NJG A;  3D8L A;  3RE8 A;  4MGH A;  1X37 A;  4LJ8 A;  3FUV A;  4IBC A;  1L1Z A;  4QNM A;  2Y0T A;  4JV5 M;  3DOA A;  2ZM6 M;  4I8O A;  5EXP A;  2Q2E B;  3MJ5 A;  1NY5 A;  2Z4R A;  4GIT A;  4MH0 E;  1Z5B A;  1HT1 E;  3FKE A;  4DV6 M;  2F5P A;  2NQ8 C;  4IBF A;  1E32 A;  1IN4 A;  4JI6 M;  3IG5 A;  4DR4 M;  3GRV A;  2EUC A;  4LF5 M;  2C96 A;  4G4Q A;  1ZAE A;  2C9O A;  3SYL A;  3GRU A;  1XMO M;  2R46 A;  1EE8 A;  1DO2 A;  1GLN A;  3KOY E;  4HL4 A;  3TWM A;  3C58 A;  3PNV A;  2I7N A;  3J7A S;  2F4V M;  1G8P A;  4PDI A;  1HNX M;  4TUW A;  4B7H A;  2QCU A;  5ITX A;  5EXT A;  2R62 A;  1IN5 A;  3GQ4 A;  4KOD A;  4B3R M;  1YUB A;  1IQP A;  5C18 A;  1FNN A;  2DWM A;  3T1Y M;  1QAO A;  4BBA A;  3VDP A;  1XXH A;  1IBL M;  4REZ A;  1TH4 A;  3MK6 A;  3LQR A;  4P16 A;  2DVW B;  4FCW A;  2UXC M;  1OFI A;  5KPT A;  3CF6 E;  5DYG A;  3M7G A;  1QAM A;  3HKP A;  2QBY A;  4LFB M;  4AKG A;  5C1B A;  2R4E A;  3M0E A;  3WHL A;  4B3S M;  4M9S A;  4PD2 A;  3U6L A;  4S12 A;  3LQQ A;  2BJV A;  4XGI A;  4LY6 A;  5LMN M;  2C5R A;  4G4N A;  2V6Z M;  3OTO M;  2HHH M;  3FUW A;  4GC9 A;  5H37 D;  1IN8 A;  1Z59 A;  4G6Z A;  3AOE A;  4NRV A;  1G41 A;  1L2D A;  4DR1 M;  4GH9 A;  4I81 A;  4DR6 M;  1NJF A;  3A45 A;  3JR4 A;  4L4U A;  1IN7 A;  4ZPX A;  4LRT A;  2L09 A;  1PJJ A;  2XH9 A;  4LJ6 A;  1I94 M;  4EIW A;  4FWD A;  4R7G A;  1E94 E;  2AHM A;  3TL4 X;  1DGB A;  2XGN A;  4FVM A;  5IRE B;  1XC8 A;  4JI4 M;  5ITY A;  1XWI A;  2DZN B;  2ZAO A;  3JAM S;  1J5E M;  2F5N A;  2M5Z A;  3FUT A;  1Q3C A;  3WHK A;  3SBJ A;  3VKG A;  4XBO A;  1IY2 A;  1QAQ A;  3DA1 A;  3SAU A;  2FOI C;  2KEB A;  2C98 A;  5FTL A;  2KXE A;  4D81 A;  1N77 A;  4JI1 M;  3KSJ A;  5KPR A;  4RF0 A;  2YR0 A;  4AG5 A;  5EP4 A;  4YY3 M;  2CV0 A;  5EXX A;  2EA0 A;  1SXJ E;  1KYI A;  2XSZ D;  5EP2 A;  1LV7 A;  1NNJ A;  3NWL A;  3FYD A;  1HNZ M;  3KVW A;  3AOE C;  3FUU A;  1IY0 A;  4LFC M;  3U6Q A;  4RNA A;  3CF2 A;  3GO8 A;  1XNR M;  3U60 B;  3EIH A;  5FTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...