2LWXA

Solution structure of the c-terminal pdr1-activating domain of the j-protein zuo1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
GSKAAKKKNKRAIRNSAKEADYFGDADKATTIDEQVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAKTIVDSGKLPSSLLSYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Zuotin
publication title Unfolding of the C-terminal domain of the j-protein zuo1 releases autoinhibition and activates pdr1-dependent transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lwxA00
2LWXA 4GMQA
chains in the Genus database with same CATH superfamily
1XXHA 3ZH9B 3PFIA 5EXXA 4PDIA 2XFSA 1R2YA 2RGHA 4LF4M 4X62M 3FTDA 1XMOM 4JI4M 1AUAA 1QUTA 1MX0A 2F5NA 3MJ5A 1UM8A 2WSFF 3HJQA 4P17A 2CHQA 1QZEA 3SAVA 2V6ZM 1NJFA 1JR3A 1WR1B 3I4YA 2DHRA 3GRVA 1SXJA 4MGYE 3UK6A 2P5TA 1OQYA 1QAMA 2EKFA 3U60A 4LFBM 1T3TA 3EIEA 5FTJA 3FE3A 4LZZA 4OU7A 4NSOB 2Y21A 3E9SA 1PJJA 4NSRA 4R7GA 3MMPA 1CUKA 2J7OA 1TDHA 4KO8A 5EP3A 5EP1A 1R2ZA 4DV3M 1K3XA 3E21A 1N77A 2W82A 5IT9S 1N75A 2VQFM 5KPRA 2LNHC 2LVQD 1NVMA 2JUJA 4HEOA 3DFZA 4IJEA 1T6OA 3K8ZA 3VKHA 4M9ZA 2EJSA 4QOSA 3FUTA 2LVOC 4GHLA 3DZDA 1Q3BA 4LJ6A 1IFYA 3U61B 1OTRA 3GPPA 2C96A 1OAIA 1DGHB 3HY5A 4CHTB 1XNRM 2HHHM 1C1KA 1IN6A 2BJWA 1P3QQ 2ZANA 2QHOB 4DR2M 3B7NA 4B3RM 3AJIB 4DR6M 1IM2A 1GLNA 2I7PA 3T38A 1L1TA 1I94M 4AZFA 2DZLA 4EIWA 4AG6A 3T1YM 4LJ7A 4AKIA 2KEBA 1SG9A 1V34A 4ZPXA 3BOSA 1ZAEA 4GEWA 1WGLA 2JY6B 4GIPA 1OJLA 1Z5AA 1HNWM 2M60A 4M0DA 2LVNC 5ITRA 5FLXS 2Z4RA 2JY8A 2MR9A 3B7QA 4MGKE 3AFHA 3MK6A 4JXJA 3DOAA 2ZAMA 4DR3M 3M6AA 4G4NA 1QQWA 3FYCA 1KFVA 3SAWA 3FTEA 1Z6TA 3GLGB 3HHWA 1HR0M 1ORYB 1QDRA 2JY5A 2M5ZA 3T6PA 4DV5M 2DZNB 3SFZA 2O25A 3H4JA 4LJ8A 2MJ5B 4FWHA 2RRUA 4LJAA 2HCBA 2Z8YM 3FUWA 4QNMA 3U6EA 1YSYA 1VG5A 1XXHE 2B3TA 3KSJA 4Z6YA 1NO1A 4W5WA 4L15A 2RKOA 1YE9A 4IBIA 4IBBA 1PJTA 2CEAA 2Y0TA 3C3EA 3U6QA 3VFDA 4UN2B 1OIPA 3GLIA 1OAOC 4R71A 4L78A 4ITQA 3AKZA 2K0BX 1KSFX 1IQPA 1Z5CA 2R4JA 2YFQA 2L7HA 2MH8A 1IXSB 4PT5A 2DAEA 5FTLA 1G41A 2DAIA 1GABA 3FUVA 3HJSA 4B7FA 3GLHA 1HQYE 3TQSA 2C98A 4KLNA 4DR7M 2VF8A 3GQ3A 1NJGA 2JP7A 1G59A 1XWIA 4D81A 5A2QS 2QZ4A 5EQTA 3I51A 2C99A 4WP2A 2ZM6M 2KXEA 2DNAA 2KNAA 3U6DA 2H1RA 3B74A 1GL6A 2R6FA 3U5ZB 1Z59A 1W5SA 2CHGA 4NXNM 4G4RA 3B7ZA 4YY3M 1DV0A 4OVZA 2WZJA 1IN8A 2F5PA 3HKPA 2CRUA 1VDLA 3JR4A 4L4UA 1Z5BA 1XMQM 4JN6A 2UXCM 2CV0A 3QYEA 3KOZE 2JA2A 2YQZA 1DGBA 4DR4M 3ZCBB 2DENA 1DGGA 1I4WA 1VDDA 2CWBA 2HKJA 4M9SA 3GLFB 1J7KA 3LCVB 3ZC7B 2L4FA 2JWSA 2CFOA 3SC3A 3W68A 1G71A 4II7A 1TH2A 4JI2M 4LJ5A 1KYIA 1X37A 2R62A 2LVPC 2R4EA 3KS4A 4WW0A 4LF5M 1VEGA 3HU3A 4B3TM 1XXHB 2FOIC 3HGIA 1FJGM 3CF0A 3GLGE 2KW0A 3KP0E 4AG5A 1VEJA 3AOEC 2XFTA 1QZMA 3GP1A 3BBZA 4HL4A 2C5RA 1NHWC 2BNKA 3CF6E 4GC5A 1Q39A 1IN4A 2QBYA 4FVMA 1UFZA 1ZV1A 4LRTA 1K82A 3I4VA 4DV1M 1BVSA 2LHCA 4DBGB 5IWAM 2UXDM 1G4AE 3RE8A 3SBJA 1E9SA 3K9OA 1SXJB 3QAUA 1L1ZA 2WSCF 2XF3A 1PRBA 3B89A 2J5YA 4LGMA 3C3DA 3U60B 1R7RA 2JZ1A 5KPZA 4FCWA 3LVVA 3FTCA 4DV0M 3MHVC 3SATA 1WIVA 4Y28F 3RGSA 4LF7M 4GITA 4IJFA 7CATA 1NV9A 1W5TA 4GRIA 1LV7A 5IREB 4DR5M 5ITXA 4DV6M 2R18A 4KT0F 1PJIA 1YUBA 1GJTA 4AW4A 3JR5A 2R0IA 2V1UA 4NRWA 5IZ7D 3F92A 3ILKA 3I04M 1ZMUA 2KA6B 3L29A 2YNMD 1NNUC 1V92A 2XEPA 3IG5A 3SYLA 4BB9A 4PDGA 5JI2E 2HWJA 4RKUF 5EP2A 4AI6A 4JI6M 2BJVA 5ITUA 3AOGA 3FD9A 2QCUA 2DWMA 5FTMA 1XB2B 4JI1M 1J09A 1TF0B 2EO2A 2LWXA 2MGWA 1EFUB 3AOEA 3FUXA 2G3QA 3KSXA 4LZJA 4CJ6A 1ZMWA 2OPFA 3VLFB 3GLHE 2L4EA 1TDZA 2K47A 1C7YA 3L26A 4G4QA 1HT2E 2R65A 4D80A 3U6OA 1PM5A 2EUCA 3J7BA 2DZOB 4FCVA 5H37D 4JYAM 1N32M 4I81A 2UUAM 2DAKA 5ITTA 3R9XB 3QYBA 3D8LA 2LTUA 3GLFE 4DV2M 1L2BA 3PNVA 1QUSA 3UMMA 3SMPA 4A3VB 4GMQA 2CP8A 4G6ZA 5C1BA 1QAQA 1RU3A 1GJSA 4XK8F 1Y8GA 2CV1A 2FS1A 3PXGA 2EKKA 3LW5F 3M0EA 4XGIA 1N34M 2UUBM 4IBFA 1IN7A 2DI0A 3NBXX 3QWLA 3W0LB 4X66M 4LY6A 2OO9A 2FH0A 3LCUA 1MU5A 3UGJA 3Q8GA 4NRVA 2CHVA 1JB0F 1HT1E 2VIIA 2Q2EB 2APLA 4IBJA 1DO2A 3CGWA 1IY1A 3IG8A 3KOXE 1OIZA 4RNAA 2G8LA 3HHYA 2L09A 4FWGA 2X8AA 4IBEA 2KZUA 2KNZA 3L28A 1S3SA 1R5LA 1LTMA 2KNVA 3A46A 3J80S 1JR3E 1Q3CA 2BWBA 1EIJA 2Y0QA 2QNJA 4LRSA 2J7NA 4LFAM 3FUUA 1SXJE 3W0FA 1F4IA 4AKHA 3SASA 1TH4A 4MB7A 5FTKA 4ANRA 3KVWA 3HU1A 5L8RF 3TPZA 4F1IA 1MJGM 3U6CA 3Q8XA 1G3IA 2ZBKB 4FD2A 3GLIB 2DWLA 2QSFX 2KRUA 3WHKA 1TTEA 1EE8A 3IHPA 3K9PA 4BLCA 4DV4M 3SARA 3A42A 5ITYA 2F5SA 2JXNA 1GKIA 3KXEC 4M9XA 1IY0A 2VDBB 4DUYM 2ZTDA 4B3MM 2L2DA 2F4VM 5EXPA 4GC9A 1D0MA 1QAOA 2XZFA 1K3WA 1R4GA 3GLHB 4CIZA 1VEKA 2D7GA 2YR0A 3GRYA 4B08A 2N35A 4IBKA 3U6PA 1IBMM 2X49A 1ZQ9A 3ZQJA 3L25A 1D0KA 2ERCA 1QANA 3NBIA 4GH9A 5FTNA 3HU2A 2WSEF 5ITXE 3UZUA 2JY7A 4CGYB 1WHCA 2C9OA 2QENA 3DA1A 4M0WA 5DNYA 2F5QA 4L8RC 2XLJA 2UXBM 4OVZB 5C18A 2Y20A 2I7NA 2LBCA 3HHZA 4GKKM 2L7IA 4MGIE 2DWZB 3K1JA 5EJCA 3KOYE 2UUCM 5GKNA 3KP1E 3VDUA 3C58A 1NY5A 3R8FA 4JI5M 1DO0A 3GRUA 4PCZA 3FTFA 2O5RA 4FWDA 4NL4H 3KS8A 2DKLA 5E6JA 2KRKA 5FSWA 2O01F 2XZUA 2AHMA 2X4AA 2DHYA 3AL0C 4QHTA 2K6BA 2R46A 3GPYA 3L27A 4KHPM 3U6SA 1AIPC 2D7EA 2XGNA 1E32A 3IECA 4GHAA 2NQ8C 1IY2A 1ZMVA 4GKJM 4IBDA 3SAUA 4JI8M 2H5XA 4QOZC 5E26A 5DYIA 4K0KM 2QPAA 2XH9A 5LMUM 3U6LA 4DV7M 4KODA 3T1HM 4AKGA 3LQQA 2LVAA 5ITQA 3H4MA 2EA0A 2R44A 4FCTA 2QBYB 3RFWA 1T43A 3BXWA 4TUWA 4HLQA 4LF9M 2F5OA 8CATA 1NV8A 1HJPA 2QQ8A 4PD2A 3LQRA 1N78A 4YHHM 2Z3XA 2C9CA 4XBOA 4IBCA 4JV5M 3VK7A 1J5EM 4JI0M 2LH0A 3KOWE 4DUZM 2OOBA 3THGA 3J7AS 1N33M 1A5TA 3RGPA 3U61A 4CISA 1DGHA 4P16A 3GLIE 1H6UA 3LVWA 1D2NA 4LF8M 4LJ4A 1E9RA 3AV0A 1WGNA 3GQ5A 3GO8A 3C9PA 2HL7A 2R45A 3GPXA 1PJSA 2UU9M 4B3SM 3VK8A 4LCBA 5KPTA 1Q02A 4IIWA 4RF1A 4BBAA 5JI3E 1IXZA 3I01M 4B7HA 2XSZD 2VF7A 3JAMS 2OOAA 2QP9X 4RF0A 2FFJA 1L2CA 1NSFA 1WJ7A 2DXIA 1OFHA 5BR8M 4DR1M 1L2DA 3VKGA 2KDLA 4LJ9A 2DVWB 1TR8A 1IBKM 1NNJA 2KZSA 1L8QA 3GQ4A 2FE8A 3FRIA 1TGUA 3J81S 2Z4SA 4LG2A 2ZAOA 3HJ8A 2HAKA 4JI3M 3B9PA 4OX9M 2ZTCA 4AQYM 3GLGA 3K2LA 1G8PA 1YLAA 2LXEA 2V1CA 4S12A 2G5GX 5KO3A 1OFIA 1V33A 3D8BA 1N36M 2DAMA 4NXMM 3FRHA 3GRRA 1MN3A 1PGYA 1NHGC 3W67A 2JNHA 4I8OA 5EP4A 1GO5A 1JQJC 5EXSA 3KW6A 4IBGA 4MGHA 1HNXM 4R3DA 3T15A 4G3OA 1JR3D 4NC6A 3TE6A 4D82A 3SHGB 2OQ4A 3UJNA 4X64M 3KDSE 2RGOA 2Z7JA 3V76A 1SXJD 1R6BX 4LGYA 4OW0A 3K92A 4G4OA 4I5SA 4QNRA 1FNNA 2L6OA 3OTOM 5F3WA 4B7GA 1D0LA 3FYDA 3E4RA 3TWLA 1XNQM 1IXSA 3CF2A 3L2AA 2DWNA 3HZJA 3A98B 3GPUA 2K9DA 4FW9A 1WXQA 4I4LA 3WHLA 5DYGA 3HX3A 1QYRA 5KQ8A 1XC8A 3U6MA 4REZA 1NY6A 3EIHA 3PNYA 3TWKA 1HNZM 1HQCA 2GQFA 3U5ZA 1IXRC 2BWEA 2MROB 5KQDA 3CTWB 1XHBA 2CE7A 1E94E 1TH3A 3SMSA 3KFUG 1SXJC 1GVNA 4L16A 3FKEA 4MM3B 5BPVA 5LMNM 2DAGA 3SYKA 1OKSA 1VQ1A 2LHGA 2CV2A 2XSZA 4MGZE 4QHSA 1IBLM 3J27B 3VDPA 5EXTA 3TWMA 4LFCM 2JZ0A 4MH0E 4WURA 4LF6M 1PJQA 1IN5A 2FNAA 3SHFA 1GL7A 3TL4X 3GLFA 3NWLA 4NOOB 3E46A 3A45A 2CUZA 3M7GA 3J2PB 4F2LA 2GNOA 4Q7JA 3HHXA 3LMMA 2A5YB 2KHHA 4Z8XA 1DGFA 3PVSA 2VQEM 4X65M 3HWSA 5DFLA 2E5LM 4JI7M 2D7HA 1QDTA 4L6V6 1QVRA
chains in the Genus database with same CATH topology
1XXHA 3ZH9B 3PFIA 5EXXA 4PDIA 2XFSA 1R2YA 2RGHA 4LF4M 4X62M 3FTDA 1XMOM 4JI4M 1MX0A 2F5NA 3MJ5A 1UM8A 3HJQA 2CHQA 3SAVA 2V6ZM 1NJFA 1JR3A 3I4YA 2DHRA 3GRVA 1SXJA 4MGYE 3UK6A 2P5TA 1QAMA 3U60A 4LFBM 1T3TA 3EIEA 5FTJA 4LZZA 4OU7A 4NSOB 2Y21A 3E9SA 1PJJA 4NSRA 4R7GA 4KO8A 2J7OA 1TDHA 5EP3A 5EP1A 1R2ZA 4DV3M 1K3XA 1N77A 2W82A 5IT9S 1N75A 2VQFM 5KPRA 2LNHC 1NVMA 3DFZA 4IJEA 3K8ZA 3VKHA 4M9ZA 4QOSA 3FUTA 4GHLA 3DZDA 1Q3BA 4LJ6A 3U61B 3GPPA 2C96A 1DGHB 4CHTB 1XNRM 2HHHM 1C1KA 1IN6A 2BJWA 2ZANA 4DR2M 4B3RM 4DR6M 3AJIB 1IM2A 1GLNA 2I7PA 3T38A 1L1TA 1I94M 4AZFA 4EIWA 4AG6A 3T1YM 4LJ7A 4AKIA 2KEBA 4ZPXA 3BOSA 1ZAEA 4GIPA 1OJLA 1Z5AA 2M60A 4M0DA 5ITRA 5FLXS 2Z4RA 4MGKE 3AFHA 3MK6A 4JXJA 3DOAA 2ZAMA 3M6AA 1QQWA 3FYCA 1KFVA 3SAWA 3FTEA 1Z6TA 3GLGB 3HHWA 1HR0M 1ORYB 2M5ZA 4DV5M 2DZNB 3SFZA 4DR3M 4LJAA 4LJ8A 4FWHA 2HCBA 3FUWA 4QNMA 3U6EA 1YSYA 4Z6YA 3KSJA 4W5WA 4L15A 2RKOA 1YE9A 4IBIA 4IBBA 2CEAA 2Y0TA 3U6QA 3VFDA 3GLIA 4L78A 4ITQA 3AKZA 1KSFX 1IQPA 1Z5CA 2R4JA 2YFQA 2L7HA 1IXSB 4PT5A 5FTLA 1G41A 3FUVA 3HJSA 4B7FA 3GLHA 1HQYE 3TQSA 2C98A 4KLNA 4DR7M 3GQ3A 1NJGA 1G59A 1XWIA 4D81A 5A2QS 2QZ4A 5EQTA 3I51A 2C99A 2ZM6M 2KXEA 3U6DA 3U5ZB 2H1RA 1GL6A 1Z59A 1W5SA 2CHGA 4NXNM 4G4RA 4YY3M 4OVZA 1IN8A 2F5PA 3HKPA 3JR4A 4L4UA 1Z5BA 1XMQM 4JN6A 2CV0A 3KOZE 2JA2A 2YQZA 1DGBA 4DR4M 3ZCBB 1DGGA 1I4WA 1VDDA 2HKJA 4M9SA 3GLFB 1J7KA 3ZC7B 2CFOA 3SC3A 4II7A 1TH2A 4JI2M 4LJ5A 1KYIA 1X37A 2R62A 2R4EA 3KS4A 4WW0A 4LF5M 3HU3A 4B3TM 1XXHB 2FOIC 3HGIA 1FJGM 3CF0A 2KW0A 3KP0E 4AG5A 3AOEC 2XFTA 1QZMA 3GP1A 4HL4A 2C5RA 1NHWC 2BNKA 3CF6E 4GC5A 1Q39A 1IN4A 2QBYA 4FVMA 4LRTA 1K82A 3I4VA 4DV1M 5IWAM 2UXDM 1G4AE 3RE8A 3SBJA 1E9SA 1SXJB 3QAUA 1L1ZA 2XF3A 4LGMA 3U60B 1R7RA 5KPZA 4FCWA 3LVVA 3FTCA 4DV0M 3MHVC 3SATA 3RGSA 4LF7M 4GITA 4IJFA 7CATA 1W5TA 4GRIA 1LV7A 5IREB 4DR5M 5ITXA 4DV6M 2R18A 1PJIA 1YUBA 4AW4A 3JR5A 2V1UA 4NRWA 5IZ7D 3ILKA 3L29A 2KA6B 2YNMD 1NNUC 3IG5A 2XEPA 3SYLA 4BB9A 4PDGA 5JI2E 5EP2A 4AI6A 4JI6M 2BJVA 5ITUA 3AOGA 3FD9A 2QCUA 2DWMA 5FTMA 4JI1M 3FUXA 1J09A 2LWXA 2EO2A 3AOEA 2OPFA 4G4NA 2UXCM 3KSXA 4LZJA 3VLFB 1TDZA 2K47A 3L26A 4G4QA 1HT2E 2R65A 4D80A 3U6OA 1PM5A 2EUCA 3J7BA 2DZOB 4FCVA 5H37D 4JYAM 1N32M 4I81A 2UUAM 5ITTA 3R9XB 3D8LA 4DV2M 1L2BA 3PNVA 3UMMA 3SMPA 4A3VB 4GMQA 4G6ZA 5C1BA 1QAQA 2CV1A 3PXGA 1N34M 3M0EA 4XGIA 2UUBM 4IBFA 1IN7A 3QWLA 3W0LB 4X66M 4LY6A 1MU5A 3UGJA 4NRVA 2CHVA 1HT1E 2VIIA 2Q2EB 4IBJA 1DO2A 1IY1A 3KOXE 3IG8A 4RNAA 2G8LA 3HHYA 2L09A 4FWGA 2X8AA 4IBEA 2KZUA 3L28A 1S3SA 3A46A 3J80S 1Q3CA 2Y0QA 4LRSA 2J7NA 4LFAM 3FUUA 1SXJE 3W0FA 4AKHA 3SASA 1TH4A 4MB7A 5FTKA 3KVWA 3HU1A 3TPZA 3U6CA 3Q8XA 1G3IA 2ZBKB 4FD2A 3GLIB 2DWLA 2KRUA 3WHKA 4DV4M 1EE8A 4BLCA 3SARA 3A42A 5ITYA 2F5SA 1GKIA 3KXEC 4M9XA 1IY0A 4DUYM 4B3MM 2F4VM 5EXPA 4GC9A 1QAOA 2XZFA 1K3WA 3GLHB 3GRYA 2D7GA 2YR0A 3U6PA 4B08A 4IBKA 1IBMM 2X49A 1ZQ9A 3L25A 2ERCA 1QANA 3NBIA 4GH9A 5FTNA 3HU2A 5ITXE 3UZUA 4CGYB 2C9OA 2QENA 3DA1A 4M0WA 5DNYA 2F5QA 4L8RC 2XLJA 2UXBM 4OVZB 5C18A 2Y20A 2I7NA 3HHZA 4GKKM 2L7IA 4MGIE 2DWZB 3K1JA 5EJCA 3KOYE 2UUCM 5GKNA 3KP1E 3VDUA 3C58A 1NY5A 3R8FA 4JI5M 1DO0A 3GRUA 4PCZA 3FTFA 2O5RA 4FWDA 4NL4H 3KS8A 5E6JA 2KRKA 5FSWA 2XZUA 2AHMA 2X4AA 3AL0C 4QHTA 2R46A 3GPYA 4KHPM 3L27A 3U6SA 2D7EA 2XGNA 1E32A 4GHAA 2NQ8C 1IY2A 4GKJM 4IBDA 3SAUA 4JI8M 4QOZC 5E26A 5DYIA 4K0KM 2QPAA 2XH9A 5LMUM 3U6LA 4DV7M 4KODA 3T1HM 3LQQA 5ITQA 3H4MA 2EA0A 4FCTA 2QBYB 3RFWA 4TUWA 4HLQA 4LF9M 2F5OA 8CATA 4PD2A 3LQRA 1N78A 4YHHM 2Z3XA 2C9CA 4XBOA 4IBCA 4JV5M 3VK7A 1J5EM 4JI0M 2LH0A 3KOWE 4DUZM 4AKGA 3THGA 3J7AS 1N33M 3U61A 3RGPA 4CISA 1DGHA 4P16A 1H6UA 3LVWA 1D2NA 4LF8M 4LJ4A 1E9RA 3AV0A 3GQ5A 3GO8A 2HL7A 2R45A 3GPXA 2UU9M 4B3SM 3VK8A 4LCBA 5KPTA 4IIWA 4RF1A 4BBAA 5JI3E 1IXZA 4B7HA 2XSZD 3JAMS 2QP9X 4RF0A 2FFJA 1L2CA 1NSFA 2DXIA 1OFHA 5BR8M 4DR1M 1L2DA 3VKGA 4LJ9A 2DVWB 1IBKM 1NNJA 2KZSA 1L8QA 3GQ4A 2FE8A 1TGUA 3J81S 2Z4SA 4LG2A 2ZAOA 3HJ8A 4JI3M 3B9PA 4OX9M 4AQYM 3GLGA 3K2LA 1G8PA 2LXEA 2V1CA 4S12A 2G5GX 5KO3A 1OFIA 3D8BA 1N36M 4NXMM 3GRRA 1NHGC 4I8OA 5EP4A 1JQJC 5EXSA 3KW6A 4IBGA 4MGHA 1HNXM 4R3DA 3T15A 1JR3D 2OQ4A 3TE6A 4D82A 3SHGB 3UJNA 4X64M 3KDSE 2RGOA 2Z7JA 1SXJD 1R6BX 4LGYA 4OW0A 3K92A 4G4OA 4I5SA 4QNRA 1FNNA 2L6OA 3OTOM 5F3WA 4B7GA 3FYDA 3E4RA 3TWLA 1XNQM 3CF2A 3L2AA 2DWNA 3A98B 3GPUA 4FW9A 1WXQA 4I4LA 3WHLA 5DYGA 1QYRA 5KQ8A 1XC8A 3U6MA 4REZA 1NY6A 3EIHA 3PNYA 3TWKA 1HNZM 1HQCA 3U5ZA 1IXRC 5KQDA 3CTWB 1XHBA 2CE7A 1E94E 1TH3A 3SMSA 3KFUG 1SXJC 1GVNA 4L16A 3FKEA 4MM3B 5BPVA 5LMNM 3SYKA 2CV2A 2XSZA 4MGZE 4QHSA 1IBLM 3J27B 3VDPA 5EXTA 3TWMA 4LFCM 4MH0E 4WURA 4LF6M 1IN5A 2FNAA 3SHFA 1GL7A 3TL4X 3GLFA 3NWLA 4NOOB 3A45A 2CUZA 3M7GA 3J2PB 1HNWM 3HHXA 3LMMA 2A5YB 4Z8XA 2VQEM 1DGFA 3PVSA 4X65M 3HWSA 2E5LM 4JI7M 2D7HA 1QVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWX A;  4GMQ A; 
#chains in the Genus database with same CATH topology
 1XXH A;  3ZH9 B;  3PFI A;  5EXX A;  4PDI A;  2XFS A;  1R2Y A;  2RGH A;  4LF4 M;  4X62 M;  3FTD A;  1XMO M;  4JI4 M;  1AUA A;  1QUT A;  1MX0 A;  2F5N A;  3MJ5 A;  1UM8 A;  2WSF F;  3HJQ A;  4P17 A;  2CHQ A;  1QZE A;  3SAV A;  2V6Z M;  1NJF A;  1JR3 A;  1WR1 B;  3I4Y A;  2DHR A;  3GRV A;  1SXJ A;  4MGY E;  3UK6 A;  2P5T A;  1OQY A;  1QAM A;  2EKF A;  3U60 A;  4LFB M;  1T3T A;  3EIE A;  5FTJ A;  3FE3 A;  4LZZ A;  4OU7 A;  4NSO B;  2Y21 A;  3E9S A;  1PJJ A;  4NSR A;  4R7G A;  3MMP A;  1CUK A;  2J7O A;  1TDH A;  4KO8 A;  5EP3 A;  5EP1 A;  1R2Z A;  4DV3 M;  1K3X A;  3E21 A;  1N77 A;  2W82 A;  5IT9 S;  1N75 A;  2VQF M;  5KPR A;  2LNH C;  2LVQ D;  1NVM A;  2JUJ A;  4HEO A;  3DFZ A;  4IJE A;  1T6O A;  3K8Z A;  3VKH A;  4M9Z A;  2EJS A;  4QOS A;  3FUT A;  2LVO C;  4GHL A;  3DZD A;  1Q3B A;  4LJ6 A;  1IFY A;  3U61 B;  1OTR A;  3GPP A;  2C96 A;  1OAI A;  1DGH B;  3HY5 A;  4CHT B;  1XNR M;  2HHH M;  1C1K A;  1IN6 A;  2BJW A;  1P3Q Q;  2ZAN A;  2QHO B;  4DR2 M;  3B7N A;  4B3R M;  3AJI B;  4DR6 M;  1IM2 A;  1GLN A;  2I7P A;  3T38 A;  1L1T A;  1I94 M;  4AZF A;  2DZL A;  4EIW A;  4AG6 A;  3T1Y M;  4LJ7 A;  4AKI A;  2KEB A;  1SG9 A;  1V34 A;  4ZPX A;  3BOS A;  1ZAE A;  4GEW A;  1WGL A;  2JY6 B;  4GIP A;  1OJL A;  1Z5A A;  1HNW M;  2M60 A;  4M0D A;  2LVN C;  5ITR A;  5FLX S;  2Z4R A;  2JY8 A;  2MR9 A;  3B7Q A;  4MGK E;  3AFH A;  3MK6 A;  4JXJ A;  3DOA A;  2ZAM A;  4DR3 M;  3M6A A;  4G4N A;  1QQW A;  3FYC A;  1KFV A;  3SAW A;  3FTE A;  1Z6T A;  3GLG B;  3HHW A;  1HR0 M;  1ORY B;  1QDR A;  2JY5 A;  2M5Z A;  3T6P A;  4DV5 M;  2DZN B;  3SFZ A;  2O25 A;  3H4J A;  4LJ8 A;  2MJ5 B;  4FWH A;  2RRU A;  4LJA A;  2HCB A;  2Z8Y M;  3FUW A;  4QNM A;  3U6E A;  1YSY A;  1VG5 A;  1XXH E;  2B3T A;  3KSJ A;  4Z6Y A;  1NO1 A;  4W5W A;  4L15 A;  2RKO A;  1YE9 A;  4IBI A;  4IBB A;  1PJT A;  2CEA A;  2Y0T A;  3C3E A;  3U6Q A;  3VFD A;  4UN2 B;  1OIP A;  3GLI A;  1OAO C;  4R71 A;  4L78 A;  4ITQ A;  3AKZ A;  2K0B X;  1KSF X;  1IQP A;  1Z5C A;  2R4J A;  2YFQ A;  2L7H A;  2MH8 A;  1IXS B;  4PT5 A;  2DAE A;  5FTL A;  1G41 A;  2DAI A;  1GAB A;  3FUV A;  3HJS A;  4B7F A;  3GLH A;  1HQY E;  3TQS A;  2C98 A;  4KLN A;  4DR7 M;  2VF8 A;  3GQ3 A;  1NJG A;  2JP7 A;  1G59 A;  1XWI A;  4D81 A;  5A2Q S;  2QZ4 A;  5EQT A;  3I51 A;  2C99 A;  4WP2 A;  2ZM6 M;  2KXE A;  2DNA A;  2KNA A;  3U6D A;  2H1R A;  3B74 A;  1GL6 A;  2R6F A;  3U5Z B;  1Z59 A;  1W5S A;  2CHG A;  4NXN M;  4G4R A;  3B7Z A;  4YY3 M;  1DV0 A;  4OVZ A;  2WZJ A;  1IN8 A;  2F5P A;  3HKP A;  2CRU A;  1VDL A;  3JR4 A;  4L4U A;  1Z5B A;  1XMQ M;  4JN6 A;  2UXC M;  2CV0 A;  3QYE A;  3KOZ E;  2JA2 A;  2YQZ A;  1DGB A;  4DR4 M;  3ZCB B;  2DEN A;  1DGG A;  1I4W A;  1VDD A;  2CWB A;  2HKJ A;  4M9S A;  3GLF B;  1J7K A;  3LCV B;  3ZC7 B;  2L4F A;  2JWS A;  2CFO A;  3SC3 A;  3W68 A;  1G71 A;  4II7 A;  1TH2 A;  4JI2 M;  4LJ5 A;  1KYI A;  1X37 A;  2R62 A;  2LVP C;  2R4E A;  3KS4 A;  4WW0 A;  4LF5 M;  1VEG A;  3HU3 A;  4B3T M;  1XXH B;  2FOI C;  3HGI A;  1FJG M;  3CF0 A;  3GLG E;  2KW0 A;  3KP0 E;  4AG5 A;  1VEJ A;  3AOE C;  2XFT A;  1QZM A;  3GP1 A;  3BBZ A;  4HL4 A;  2C5R A;  1NHW C;  2BNK A;  3CF6 E;  4GC5 A;  1Q39 A;  1IN4 A;  2QBY A;  4FVM A;  1UFZ A;  1ZV1 A;  4LRT A;  1K82 A;  3I4V A;  4DV1 M;  1BVS A;  2LHC A;  4DBG B;  5IWA M;  2UXD M;  1G4A E;  3RE8 A;  3SBJ A;  1E9S A;  3K9O A;  1SXJ B;  3QAU A;  1L1Z A;  2WSC F;  2XF3 A;  1PRB A;  3B89 A;  2J5Y A;  4LGM A;  3C3D A;  3U60 B;  1R7R A;  2JZ1 A;  5KPZ A;  4FCW A;  3LVV A;  3FTC A;  4DV0 M;  3MHV C;  3SAT A;  1WIV A;  4Y28 F;  3RGS A;  4LF7 M;  4GIT A;  4IJF A;  7CAT A;  1NV9 A;  1W5T A;  4GRI A;  1LV7 A;  5IRE B;  4DR5 M;  5ITX A;  4DV6 M;  2R18 A;  4KT0 F;  1PJI A;  1YUB A;  1GJT A;  4AW4 A;  3JR5 A;  2R0I A;  2V1U A;  4NRW A;  5IZ7 D;  3F92 A;  3ILK A;  3I04 M;  1ZMU A;  2KA6 B;  3L29 A;  2YNM D;  1NNU C;  1V92 A;  2XEP A;  3IG5 A;  3SYL A;  4BB9 A;  4PDG A;  5JI2 E;  2HWJ A;  4RKU F;  5EP2 A;  4AI6 A;  4JI6 M;  2BJV A;  5ITU A;  3AOG A;  3FD9 A;  2QCU A;  2DWM A;  5FTM A;  1XB2 B;  4JI1 M;  1J09 A;  1TF0 B;  2EO2 A;  2LWX A;  2MGW A;  1EFU B;  3AOE A;  3FUX A;  2G3Q A;  3KSX A;  4LZJ A;  4CJ6 A;  1ZMW A;  2OPF A;  3VLF B;  3GLH E;  2L4E A;  1TDZ A;  2K47 A;  1C7Y A;  3L26 A;  4G4Q A;  1HT2 E;  2R65 A;  4D80 A;  3U6O A;  1PM5 A;  2EUC A;  3J7B A;  2DZO B;  4FCV A;  5H37 D;  4JYA M;  1N32 M;  4I81 A;  2UUA M;  2DAK A;  5ITT A;  3R9X B;  3QYB A;  3D8L A;  2LTU A;  3GLF E;  4DV2 M;  1L2B A;  3PNV A;  1QUS A;  3UMM A;  3SMP A;  4A3V B;  4GMQ A;  2CP8 A;  4G6Z A;  5C1B A;  1QAQ A;  1RU3 A;  1GJS A;  4XK8 F;  1Y8G A;  2CV1 A;  2FS1 A;  3PXG A;  2EKK A;  3LW5 F;  3M0E A;  4XGI A;  1N34 M;  2UUB M;  4IBF A;  1IN7 A;  2DI0 A;  3NBX X;  3QWL A;  3W0L B;  4X66 M;  4LY6 A;  2OO9 A;  2FH0 A;  3LCU A;  1MU5 A;  3UGJ A;  3Q8G A;  4NRV A;  2CHV A;  1JB0 F;  1HT1 E;  2VII A;  2Q2E B;  2APL A;  4IBJ A;  1DO2 A;  3CGW A;  1IY1 A;  3IG8 A;  3KOX E;  1OIZ A;  4RNA A;  2G8L A;  3HHY A;  2L09 A;  4FWG A;  2X8A A;  4IBE A;  2KZU A;  2KNZ A;  3L28 A;  1S3S A;  1R5L A;  1LTM A;  2KNV A;  3A46 A;  3J80 S;  1JR3 E;  1Q3C A;  2BWB A;  1EIJ A;  2Y0Q A;  2QNJ A;  4LRS A;  2J7N A;  4LFA M;  3FUU A;  1SXJ E;  3W0F A;  1F4I A;  4AKH A;  3SAS A;  1TH4 A;  4MB7 A;  5FTK A;  4ANR A;  3KVW A;  3HU1 A;  5L8R F;  3TPZ A;  4F1I A;  1MJG M;  3U6C A;  3Q8X A;  1G3I A;  2ZBK B;  4FD2 A;  3GLI B;  2DWL A;  2QSF X;  2KRU A;  3WHK A;  1TTE A;  1EE8 A;  3IHP A;  3K9P A;  4BLC A;  4DV4 M;  3SAR A;  3A42 A;  5ITY A;  2F5S A;  2JXN A;  1GKI A;  3KXE C;  4M9X A;  1IY0 A;  2VDB B;  4DUY M;  2ZTD A;  4B3M M;  2L2D A;  2F4V M;  5EXP A;  4GC9 A;  1D0M A;  1QAO A;  2XZF A;  1K3W A;  1R4G A;  3GLH B;  4CIZ A;  1VEK A;  2D7G A;  2YR0 A;  3GRY A;  4B08 A;  2N35 A;  4IBK A;  3U6P A;  1IBM M;  2X49 A;  1ZQ9 A;  3ZQJ A;  3L25 A;  1D0K A;  2ERC A;  1QAN A;  3NBI A;  4GH9 A;  5FTN A;  3HU2 A;  2WSE F;  5ITX E;  3UZU A;  2JY7 A;  4CGY B;  1WHC A;  2C9O A;  2QEN A;  3DA1 A;  4M0W A;  5DNY A;  2F5Q A;  4L8R C;  2XLJ A;  2UXB M;  4OVZ B;  5C18 A;  2Y20 A;  2I7N A;  2LBC A;  3HHZ A;  4GKK M;  2L7I A;  4MGI E;  2DWZ B;  3K1J A;  5EJC A;  3KOY E;  2UUC M;  5GKN A;  3KP1 E;  3VDU A;  3C58 A;  1NY5 A;  3R8F A;  4JI5 M;  1DO0 A;  3GRU A;  4PCZ A;  3FTF A;  2O5R A;  4FWD A;  4NL4 H;  3KS8 A;  2DKL A;  5E6J A;  2KRK A;  5FSW A;  2O01 F;  2XZU A;  2AHM A;  2X4A A;  2DHY A;  3AL0 C;  4QHT A;  2K6B A;  2R46 A;  3GPY A;  3L27 A;  4KHP M;  3U6S A;  1AIP C;  2D7E A;  2XGN A;  1E32 A;  3IEC A;  4GHA A;  2NQ8 C;  1IY2 A;  1ZMV A;  4GKJ M;  4IBD A;  3SAU A;  4JI8 M;  2H5X A;  4QOZ C;  5E26 A;  5DYI A;  4K0K M;  2QPA A;  2XH9 A;  5LMU M;  3U6L A;  4DV7 M;  4KOD A;  3T1H M;  4AKG A;  3LQQ A;  2LVA A;  5ITQ A;  3H4M A;  2EA0 A;  2R44 A;  4FCT A;  2QBY B;  3RFW A;  1T43 A;  3BXW A;  4TUW A;  4HLQ A;  4LF9 M;  2F5O A;  8CAT A;  1NV8 A;  1HJP A;  2QQ8 A;  4PD2 A;  3LQR A;  1N78 A;  4YHH M;  2Z3X A;  2C9C A;  4XBO A;  4IBC A;  4JV5 M;  3VK7 A;  1J5E M;  4JI0 M;  2LH0 A;  3KOW E;  4DUZ M;  2OOB A;  3THG A;  3J7A S;  1N33 M;  1A5T A;  3RGP A;  3U61 A;  4CIS A;  1DGH A;  4P16 A;  3GLI E;  1H6U A;  3LVW A;  1D2N A;  4LF8 M;  4LJ4 A;  1E9R A;  3AV0 A;  1WGN A;  3GQ5 A;  3GO8 A;  3C9P A;  2HL7 A;  2R45 A;  3GPX A;  1PJS A;  2UU9 M;  4B3S M;  3VK8 A;  4LCB A;  5KPT A;  1Q02 A;  4IIW A;  4RF1 A;  4BBA A;  5JI3 E;  1IXZ A;  3I01 M;  4B7H A;  2XSZ D;  2VF7 A;  3JAM S;  2OOA A;  2QP9 X;  4RF0 A;  2FFJ A;  1L2C A;  1NSF A;  1WJ7 A;  2DXI A;  1OFH A;  5BR8 M;  4DR1 M;  1L2D A;  3VKG A;  2KDL A;  4LJ9 A;  2DVW B;  1TR8 A;  1IBK M;  1NNJ A;  2KZS A;  1L8Q A;  3GQ4 A;  2FE8 A;  3FRI A;  1TGU A;  3J81 S;  2Z4S A;  4LG2 A;  2ZAO A;  3HJ8 A;  2HAK A;  4JI3 M;  3B9P A;  4OX9 M;  2ZTC A;  4AQY M;  3GLG A;  3K2L A;  1G8P A;  1YLA A;  2LXE A;  2V1C A;  4S12 A;  2G5G X;  5KO3 A;  1OFI A;  1V33 A;  3D8B A;  1N36 M;  2DAM A;  4NXM M;  3FRH A;  3GRR A;  1MN3 A;  1PGY A;  1NHG C;  3W67 A;  2JNH A;  4I8O A;  5EP4 A;  1GO5 A;  1JQJ C;  5EXS A;  3KW6 A;  4IBG A;  4MGH A;  1HNX M;  4R3D A;  3T15 A;  4G3O A;  1JR3 D;  4NC6 A;  3TE6 A;  4D82 A;  3SHG B;  2OQ4 A;  3UJN A;  4X64 M;  3KDS E;  2RGO A;  2Z7J A;  3V76 A;  1SXJ D;  1R6B X;  4LGY A;  4OW0 A;  3K92 A;  4G4O A;  4I5S A;  4QNR A;  1FNN A;  2L6O A;  3OTO M;  5F3W A;  4B7G A;  1D0L A;  3FYD A;  3E4R A;  3TWL A;  1XNQ M;  1IXS A;  3CF2 A;  3L2A A;  2DWN A;  3HZJ A;  3A98 B;  3GPU A;  2K9D A;  4FW9 A;  1WXQ A;  4I4L A;  3WHL A;  5DYG A;  3HX3 A;  1QYR A;  5KQ8 A;  1XC8 A;  3U6M A;  4REZ A;  1NY6 A;  3EIH A;  3PNY A;  3TWK A;  1HNZ M;  1HQC A;  2GQF A;  3U5Z A;  1IXR C;  2BWE A;  2MRO B;  5KQD A;  3CTW B;  1XHB A;  2CE7 A;  1E94 E;  1TH3 A;  3SMS A;  3KFU G;  1SXJ C;  1GVN A;  4L16 A;  3FKE A;  4MM3 B;  5BPV A;  5LMN M;  2DAG A;  3SYK A;  1OKS A;  1VQ1 A;  2LHG A;  2CV2 A;  2XSZ A;  4MGZ E;  4QHS A;  1IBL M;  3J27 B;  3VDP A;  5EXT A;  3TWM A;  4LFC M;  2JZ0 A;  4MH0 E;  4WUR A;  4LF6 M;  1PJQ A;  1IN5 A;  2FNA A;  3SHF A;  1GL7 A;  3TL4 X;  3GLF A;  3NWL A;  4NOO B;  3E46 A;  3A45 A;  2CUZ A;  3M7G A;  3J2P B;  4F2L A;  2GNO A;  4Q7J A;  3HHX A;  3LMM A;  2A5Y B;  2KHH A;  4Z8X A;  1DGF A;  3PVS A;  2VQE M;  4X65 M;  3HWS A;  5DFL A;  2E5L M;  4JI7 M;  2D7H A;  1QDT A;  4L6V 6;  1QVR A; 
#chains in the Genus database with same CATH homology
 1XXH A;  3ZH9 B;  3PFI A;  5EXX A;  4PDI A;  2XFS A;  1R2Y A;  2RGH A;  4LF4 M;  4X62 M;  3FTD A;  1XMO M;  4JI4 M;  1MX0 A;  2F5N A;  3MJ5 A;  1UM8 A;  3HJQ A;  2CHQ A;  3SAV A;  2V6Z M;  1NJF A;  1JR3 A;  3I4Y A;  2DHR A;  3GRV A;  1SXJ A;  4MGY E;  3UK6 A;  2P5T A;  1QAM A;  3U60 A;  4LFB M;  1T3T A;  3EIE A;  5FTJ A;  4LZZ A;  4OU7 A;  4NSO B;  2Y21 A;  3E9S A;  1PJJ A;  4NSR A;  4R7G A;  4KO8 A;  2J7O A;  1TDH A;  5EP3 A;  5EP1 A;  1R2Z A;  4DV3 M;  1K3X A;  1N77 A;  2W82 A;  5IT9 S;  1N75 A;  2VQF M;  5KPR A;  2LNH C;  1NVM A;  3DFZ A;  4IJE A;  3K8Z A;  3VKH A;  4M9Z A;  4QOS A;  3FUT A;  4GHL A;  3DZD A;  1Q3B A;  4LJ6 A;  3U61 B;  3GPP A;  2C96 A;  1DGH B;  4CHT B;  1XNR M;  2HHH M;  1C1K A;  1IN6 A;  2BJW A;  2ZAN A;  4DR2 M;  4B3R M;  4DR6 M;  3AJI B;  1IM2 A;  1GLN A;  2I7P A;  3T38 A;  1L1T A;  1I94 M;  4AZF A;  4EIW A;  4AG6 A;  3T1Y M;  4LJ7 A;  4AKI A;  2KEB A;  4ZPX A;  3BOS A;  1ZAE A;  4GIP A;  1OJL A;  1Z5A A;  2M60 A;  4M0D A;  5ITR A;  5FLX S;  2Z4R A;  4MGK E;  3AFH A;  3MK6 A;  4JXJ A;  3DOA A;  2ZAM A;  3M6A A;  1QQW A;  3FYC A;  1KFV A;  3SAW A;  3FTE A;  1Z6T A;  3GLG B;  3HHW A;  1HR0 M;  1ORY B;  2M5Z A;  4DV5 M;  2DZN B;  3SFZ A;  4DR3 M;  4LJA A;  4LJ8 A;  4FWH A;  2HCB A;  3FUW A;  4QNM A;  3U6E A;  1YSY A;  4Z6Y A;  3KSJ A;  4W5W A;  4L15 A;  2RKO A;  1YE9 A;  4IBI A;  4IBB A;  2CEA A;  2Y0T A;  3U6Q A;  3VFD A;  3GLI A;  4L78 A;  4ITQ A;  3AKZ A;  1KSF X;  1IQP A;  1Z5C A;  2R4J A;  2YFQ A;  2L7H A;  1IXS B;  4PT5 A;  5FTL A;  1G41 A;  3FUV A;  3HJS A;  4B7F A;  3GLH A;  1HQY E;  3TQS A;  2C98 A;  4KLN A;  4DR7 M;  3GQ3 A;  1NJG A;  1G59 A;  1XWI A;  4D81 A;  5A2Q S;  2QZ4 A;  5EQT A;  3I51 A;  2C99 A;  2ZM6 M;  2KXE A;  3U6D A;  3U5Z B;  2H1R A;  1GL6 A;  1Z59 A;  1W5S A;  2CHG A;  4NXN M;  4G4R A;  4YY3 M;  4OVZ A;  1IN8 A;  2F5P A;  3HKP A;  3JR4 A;  4L4U A;  1Z5B A;  1XMQ M;  4JN6 A;  2CV0 A;  3KOZ E;  2JA2 A;  2YQZ A;  1DGB A;  4DR4 M;  3ZCB B;  1DGG A;  1I4W A;  1VDD A;  2HKJ A;  4M9S A;  3GLF B;  1J7K A;  3ZC7 B;  2CFO A;  3SC3 A;  4II7 A;  1TH2 A;  4JI2 M;  4LJ5 A;  1KYI A;  1X37 A;  2R62 A;  2R4E A;  3KS4 A;  4WW0 A;  4LF5 M;  3HU3 A;  4B3T M;  1XXH B;  2FOI C;  3HGI A;  1FJG M;  3CF0 A;  2KW0 A;  3KP0 E;  4AG5 A;  3AOE C;  2XFT A;  1QZM A;  3GP1 A;  4HL4 A;  2C5R A;  1NHW C;  2BNK A;  3CF6 E;  4GC5 A;  1Q39 A;  1IN4 A;  2QBY A;  4FVM A;  4LRT A;  1K82 A;  3I4V A;  4DV1 M;  5IWA M;  2UXD M;  1G4A E;  3RE8 A;  3SBJ A;  1E9S A;  1SXJ B;  3QAU A;  1L1Z A;  2XF3 A;  4LGM A;  3U60 B;  1R7R A;  5KPZ A;  4FCW A;  3LVV A;  3FTC A;  4DV0 M;  3MHV C;  3SAT A;  3RGS A;  4LF7 M;  4GIT A;  4IJF A;  7CAT A;  1W5T A;  4GRI A;  1LV7 A;  5IRE B;  4DR5 M;  5ITX A;  4DV6 M;  2R18 A;  1PJI A;  1YUB A;  4AW4 A;  3JR5 A;  2V1U A;  4NRW A;  5IZ7 D;  3ILK A;  3L29 A;  2KA6 B;  2YNM D;  1NNU C;  3IG5 A;  2XEP A;  3SYL A;  4BB9 A;  4PDG A;  5JI2 E;  5EP2 A;  4AI6 A;  4JI6 M;  2BJV A;  5ITU A;  3AOG A;  3FD9 A;  2QCU A;  2DWM A;  5FTM A;  4JI1 M;  3FUX A;  1J09 A;  2LWX A;  2EO2 A;  3AOE A;  2OPF A;  4G4N A;  2UXC M;  3KSX A;  4LZJ A;  3VLF B;  1TDZ A;  2K47 A;  3L26 A;  4G4Q A;  1HT2 E;  2R65 A;  4D80 A;  3U6O A;  1PM5 A;  2EUC A;  3J7B A;  2DZO B;  4FCV A;  5H37 D;  4JYA M;  1N32 M;  4I81 A;  2UUA M;  5ITT A;  3R9X B;  3D8L A;  4DV2 M;  1L2B A;  3PNV A;  3UMM A;  3SMP A;  4A3V B;  4GMQ A;  4G6Z A;  5C1B A;  1QAQ A;  2CV1 A;  3PXG A;  1N34 M;  3M0E A;  4XGI A;  2UUB M;  4IBF A;  1IN7 A;  3QWL A;  3W0L B;  4X66 M;  4LY6 A;  1MU5 A;  3UGJ A;  4NRV A;  2CHV A;  1HT1 E;  2VII A;  2Q2E B;  4IBJ A;  1DO2 A;  1IY1 A;  3KOX E;  3IG8 A;  4RNA A;  2G8L A;  3HHY A;  2L09 A;  4FWG A;  2X8A A;  4IBE A;  2KZU A;  3L28 A;  1S3S A;  3A46 A;  3J80 S;  1Q3C A;  2Y0Q A;  4LRS A;  2J7N A;  4LFA M;  3FUU A;  1SXJ E;  3W0F A;  4AKH A;  3SAS A;  1TH4 A;  4MB7 A;  5FTK A;  3KVW A;  3HU1 A;  3TPZ A;  3U6C A;  3Q8X A;  1G3I A;  2ZBK B;  4FD2 A;  3GLI B;  2DWL A;  2KRU A;  3WHK A;  4DV4 M;  1EE8 A;  4BLC A;  3SAR A;  3A42 A;  5ITY A;  2F5S A;  1GKI A;  3KXE C;  4M9X A;  1IY0 A;  4DUY M;  4B3M M;  2F4V M;  5EXP A;  4GC9 A;  1QAO A;  2XZF A;  1K3W A;  3GLH B;  3GRY A;  2D7G A;  2YR0 A;  3U6P A;  4B08 A;  4IBK A;  1IBM M;  2X49 A;  1ZQ9 A;  3L25 A;  2ERC A;  1QAN A;  3NBI A;  4GH9 A;  5FTN A;  3HU2 A;  5ITX E;  3UZU A;  4CGY B;  2C9O A;  2QEN A;  3DA1 A;  4M0W A;  5DNY A;  2F5Q A;  4L8R C;  2XLJ A;  2UXB M;  4OVZ B;  5C18 A;  2Y20 A;  2I7N A;  3HHZ A;  4GKK M;  2L7I A;  4MGI E;  2DWZ B;  3K1J A;  5EJC A;  3KOY E;  2UUC M;  5GKN A;  3KP1 E;  3VDU A;  3C58 A;  1NY5 A;  3R8F A;  4JI5 M;  1DO0 A;  3GRU A;  4PCZ A;  3FTF A;  2O5R A;  4FWD A;  4NL4 H;  3KS8 A;  5E6J A;  2KRK A;  5FSW A;  2XZU A;  2AHM A;  2X4A A;  3AL0 C;  4QHT A;  2R46 A;  3GPY A;  4KHP M;  3L27 A;  3U6S A;  2D7E A;  2XGN A;  1E32 A;  4GHA A;  2NQ8 C;  1IY2 A;  4GKJ M;  4IBD A;  3SAU A;  4JI8 M;  4QOZ C;  5E26 A;  5DYI A;  4K0K M;  2QPA A;  2XH9 A;  5LMU M;  3U6L A;  4DV7 M;  4KOD A;  3T1H M;  3LQQ A;  5ITQ A;  3H4M A;  2EA0 A;  4FCT A;  2QBY B;  3RFW A;  4TUW A;  4HLQ A;  4LF9 M;  2F5O A;  8CAT A;  4PD2 A;  3LQR A;  1N78 A;  4YHH M;  2Z3X A;  2C9C A;  4XBO A;  4IBC A;  4JV5 M;  3VK7 A;  1J5E M;  4JI0 M;  2LH0 A;  3KOW E;  4DUZ M;  4AKG A;  3THG A;  3J7A S;  1N33 M;  3U61 A;  3RGP A;  4CIS A;  1DGH A;  4P16 A;  1H6U A;  3LVW A;  1D2N A;  4LF8 M;  4LJ4 A;  1E9R A;  3AV0 A;  3GQ5 A;  3GO8 A;  2HL7 A;  2R45 A;  3GPX A;  2UU9 M;  4B3S M;  3VK8 A;  4LCB A;  5KPT A;  4IIW A;  4RF1 A;  4BBA A;  5JI3 E;  1IXZ A;  4B7H A;  2XSZ D;  3JAM S;  2QP9 X;  4RF0 A;  2FFJ A;  1L2C A;  1NSF A;  2DXI A;  1OFH A;  5BR8 M;  4DR1 M;  1L2D A;  3VKG A;  4LJ9 A;  2DVW B;  1IBK M;  1NNJ A;  2KZS A;  1L8Q A;  3GQ4 A;  2FE8 A;  1TGU A;  3J81 S;  2Z4S A;  4LG2 A;  2ZAO A;  3HJ8 A;  4JI3 M;  3B9P A;  4OX9 M;  4AQY M;  3GLG A;  3K2L A;  1G8P A;  2LXE A;  2V1C A;  4S12 A;  2G5G X;  5KO3 A;  1OFI A;  3D8B A;  1N36 M;  4NXM M;  3GRR A;  1NHG C;  4I8O A;  5EP4 A;  1JQJ C;  5EXS A;  3KW6 A;  4IBG A;  4MGH A;  1HNX M;  4R3D A;  3T15 A;  1JR3 D;  2OQ4 A;  3TE6 A;  4D82 A;  3SHG B;  3UJN A;  4X64 M;  3KDS E;  2RGO A;  2Z7J A;  1SXJ D;  1R6B X;  4LGY A;  4OW0 A;  3K92 A;  4G4O A;  4I5S A;  4QNR A;  1FNN A;  2L6O A;  3OTO M;  5F3W A;  4B7G A;  3FYD A;  3E4R A;  3TWL A;  1XNQ M;  3CF2 A;  3L2A A;  2DWN A;  3A98 B;  3GPU A;  4FW9 A;  1WXQ A;  4I4L A;  3WHL A;  5DYG A;  1QYR A;  5KQ8 A;  1XC8 A;  3U6M A;  4REZ A;  1NY6 A;  3EIH A;  3PNY A;  3TWK A;  1HNZ M;  1HQC A;  3U5Z A;  1IXR C;  5KQD A;  3CTW B;  1XHB A;  2CE7 A;  1E94 E;  1TH3 A;  3SMS A;  3KFU G;  1SXJ C;  1GVN A;  4L16 A;  3FKE A;  4MM3 B;  5BPV A;  5LMN M;  3SYK A;  2CV2 A;  2XSZ A;  4MGZ E;  4QHS A;  1IBL M;  3J27 B;  3VDP A;  5EXT A;  3TWM A;  4LFC M;  4MH0 E;  4WUR A;  4LF6 M;  1IN5 A;  2FNA A;  3SHF A;  1GL7 A;  3TL4 X;  3GLF A;  3NWL A;  4NOO B;  3A45 A;  2CUZ A;  3M7G A;  3J2P B;  1HNW M;  3HHX A;  3LMM A;  2A5Y B;  4Z8X A;  2VQE M;  1DGF A;  3PVS A;  4X65 M;  3HWS A;  2E5L M;  4JI7 M;  2D7H A;  1QVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...