2LWXA

Solution structure of the c-terminal pdr1-activating domain of the j-protein zuo1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
GSKAAKKKNKRAIRNSAKEADYFGDADKATTIDEQVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAKTIVDSGKLPSSLLSYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zuotin
publication title Unfolding of the C-terminal domain of the j-protein zuo1 releases autoinhibition and activates pdr1-dependent transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lwxA00
4GMQA 2LWXA
chains in the Genus database with same CATH superfamily
2RKOA 3DFZA 2R65A 2KW0A 3J80S 4X65M 1WIVA 3SASA 2DNAA 1IM2A 2HKJA 3UGJA 3W0LB 5E26A 1JR3E 2P5TA 3GRRA 2XFSA 2FNAA 1YSYA 2EJSA 2YFQA 3U6CA 2QBYB 3JR4A 3PVSA 3QYBA 1IY0A 3K92A 4FVMA 4XBOA 4II7A 1H6UA 2L2DA 3AJIB 1K3XA 2ZTCA 4JN6A 4FCVA 2FFJA 5KPRA 4L15A 1YUBA 2DZLA 5FTKA 2D7HA 3FTEA 4LZJA 3TQSA 5ITRA 2R44A 1SXJA 1HNXM 2DAEA 2Z8YM 3IG8A 3QAUA 4IBBA 2VQFM 4G6ZA 2XGNA 3M6AA 4FCWA 4NRWA 5BR8M 3FRIA 2FOIC 1A5TA 2LVOC 5A2QS 2DWNA 2Z4RA 2CV1A 3L25A 1YLAA 1JB0F 1DGFA 3H4MA 3GPUA 1W5SA 2XFTA 2CEAA 3GRYA 4DR3M 3VKHA 3HU2A 5EP2A 1QAQA 5FSWA 2HL7A 1XB2B 3E21A 1HR0M 3GLFA 4X62M 1NO1A 2Z3XA 5F3WA 2UU9M 2W82A 5EXTA 3HJSA 4MM3B 2XLJA 1PJJA 4LFBM 4IBGA 2J7OA 1G41A 3KSJA 2H5XA 4LRTA 1PM5A 4CGYB 1OTRA 3LMMA 1J7KA 3L2AA 2JXNA 3B74A 4HLQA 4QOZC 7CATA 2FS1A 3HWSA 2R0IA 4LJ8A 4NSRA 4R7GA 1VEJA 2CFOA 2EKFA 3GLHE 1TH3A 2CV0A 4JI2M 2G5GX 4DR7M 2HHHM 1XXHA 2FH0A 4RKUF 1P3QQ 3BBZA 4G3OA 3PNYA 2KXEA 3VK7A 1XWIA 4LG2A 3TWKA 3UMMA 3GQ3A 2XZFA 2MJ5B 5FTJA 4PCZA 4B3RM 2XEPA 3GQ5A 1S3SA 5KQDA 2XH9A 4D80A 3AOEA 5IREB 4NOOB 2WZJA 3QWLA 3K2LA 4DR4M 1ZMVA 1XMOM 3TPZA 3U60A 3FE3A 5EP4A 1IBMM 4DR6M 4KODA 4FW9A 4LCBA 3VFDA 2AHMA 5E6JA 5EXSA 1IXRC 1E94E 3B9PA 2K0BX 1V92A 2LNHC 3KS4A 1ZV1A 3GLHB 5EXXA 4X66M 3SAVA 3A42A 3FKEA 4A3VB 5IWAM 2JZ0A 2RGOA 1IY2A 1VDLA 1R6BX 3HZJA 3SAWA 2UUCM 3HGIA 4JYAM 1QAMA 1ORYB 4M0DA 2UUBM 2C98A 1XC8A 3HHZA 4I8OA 2LHCA 2Y0TA 2X8AA 1E9RA 4GHAA 3I01M 2DZOB 3UK6A 4G4RA 2QSFX 3J2PB 3C9PA 1PJQA 2QZ4A 3GLGA 4L6V6 1DGHB 3LCVB 4NXNM 4D82A 2DWLA 2LVNC 2K9DA 5EQTA 2F5NA 4DUZM 2L4EA 1ZQ9A 4YHHM 4S12A 3FTCA 3RGPA 4QHSA 2BJVA 3GPPA 4LF4M 3KSXA 3ZC7B 2KNAA 1SXJE 1OQYA 3M0EA 3W67A 3ZQJA 3BOSA 4B7HA 4LJAA 3WHLA 4EIWA 4B7FA 5IT9S 4REZA 3BXWA 4IIWA 4WP2A 2QENA 1PGYA 4DR2M 1KSFX 3VK8A 3L29A 3L26A 1NV8A 3FUWA 5IZ7D 2KRUA 2JNHA 3U6MA 1WR1B 2LVQD 1Z59A 4MGIE 3OTOM 2DAGA 2KRKA 4DR5M 1E32A 1FNNA 3VLFB 1NNJA 4LY6A 2LTUA 4L4UA 2L4FA 4Q7JA 2DHRA 2L09A 3SARA 3GLFE 1TH4A 1I4WA 3AV0A 4B3TM 3NBIA 3E46A 3MHVC 1N77A 2B3TA 4OW0A 2OPFA 2F5OA 1SXJB 2LHGA 4ZPXA 2UXDM 5EP1A 2BNKA 2JWSA 4GMQA 4CHTB 4JI3M 4LF6M 2ZANA 2KEBA 4LZZA 1TTEA 4BLCA 3J7AS 4PDGA 2JY8A 4Y28F 3ZCBB 1N32M 4P17A 3IHPA 3U6EA 2VIIA 1NJGA 3FRHA 3UZUA 3B89A 1TDZA 1GABA 4F1IA 1L2BA 3LCUA 4CIZA 2DI0A 3U61A 2BWEA 4L78A 1TDHA 2ZM6M 4G4OA 2DENA 3E9SA 5KPTA 3LVWA 3GLFB 2H1RA 2MH8A 4AKHA 4LF5M 3C3EA 3T1HM 5FLXS 2JY5A 4IBFA 1JQJC 4HEOA 3TWMA 3VKGA 2Y21A 3Q8GA 2X49A 1MX0A 2L7HA 4JI4M 2O01F 4DV3M 2MR9A 1D0LA 2C9CA 4GHLA 3U5ZA 1E9SA 2KHHA 4WW0A 1Z5CA 3JR5A 4JI1M 4TUWA 3B7NA 4GC5A 1L2DA 3EIHA 3A45A 1R2YA 1GKIA 3L28A 5KQ8A 2CRUA 2DVWB 4KHPM 1XMQM 2D7GA 4GH9A 3IG5A 3D8LA 4DV6M 2EUCA 4IJEA 2RGHA 5JI2E 1WHCA 1LV7A 2A5YB 3DZDA 3CF6E 1HNWM 1C1KA 1QVRA 3B7ZA 4FCTA 4DV5M 3D8BA 4L16A 2K47A 2VDBB 3SYKA 5L8RF 4DR1M 2F5SA 1L8QA 4OU7A 2FE8A 3U60B 4PD2A 2V1CA 1IXSA 1VEGA 2V6ZM 4M0WA 4M9SA 2CHQA 4AKIA 5EXPA 4Z6YA 2M5ZA 2X4AA 2JA2A 4W5WA 1K3WA 1GL7A 1GLNA 1SXJD 3KVWA 4UN2B 3SHFA 4LFAM 5FTLA 3KP0E 3GLIA 3U6DA 3U6LA 1EIJA 1G59A 1N34M 4LRSA 4OVZA 2DWMA 1XNQM 2MROB 3LW5F 5ITTA 1V33A 1MU5A 2F4VM 1EE8A 4RF1A 3DA1A 3GRUA 1J09A 4I5SA 4NRVA 1PJTA 5DYGA 2XF3A 3GP1A 4AG5A 4DBGB 3R9XB 3I51A 1VDDA 2CHGA 4NL4H 2XZUA 2O25A 2CWBA 1OAOC 4BBAA 1KYIA 3RE8A 2GNOA 2DKLA 4MB7A 2I7PA 1JR3D 3SATA 3CF0A 4IJFA 1D0KA 3K1JA 1HQYE 1QZMA 3HU1A 3THGA 1IBLM 1SG9A 1L1TA 3FUVA 1IN7A 4M9XA 2UUAM 1OIPA 3KDSE 4GKKM 1ZMUA 2NQ8C 5LMNM 1AUAA 4DV0M 1YE9A 1IBKM 1NHGC 2JY7A 2CV2A 3MK6A 1IN5A 1GL6A 4LJ5A 5ITUA 4LF8M 1QUSA 4QHTA 1R4GA 3H4JA 1Q3BA 1Q3CA 2R6FA 2VF8A 4DV2M 3RFWA 3GO8A 1QYRA 4B3SM 5BPVA 3U6PA 1IXZA 2MGWA 3TWLA 4CISA 2OOBA 4KT0F 4JI6M 1RU3A 3NWLA 4MGKE 4F2LA 4DV7M 4JI5M 4B7GA 1QQWA 1OIZA 2F5PA 3W68A 4JI7M 4L8RC 4JXJA 1EFUB 3I4VA 3GQ4A 1IQPA 4FWHA 1WGLA 3MMPA 1WJ7A 2R4EA 4I4LA 4LJ9A 3PFIA 2DAMA 4QNMA 1D0MA 3CF2A 3Q8XA 1PJSA 3KOWE 1AIPC 3KW6A 5EJCA 1HT1E 1QZEA 4P16A 4DV1M 3FUXA 2ERCA 1XNRM 2K6BA 1D2NA 1IY1A 1WXQA 4QNRA 3FUTA 1IFYA 5DNYA 4OX9M 3KOZE 3SHGB 2EA0A 1C7YA 3GRVA 3TE6A 4K0KM 4AQYM 3W0FA 2UXCM 3DOAA 1F4IA 2R62A 4BB9A 1OFIA 1K82A 5EP3A 1TH2A 1N36M 2Y0QA 3KOXE 3U61B 1HNZM 3CTWB 4IBEA 4I81A 4NSOB 4LGYA 5DFLA 4JI0M 1W5TA 4RF0A 3SYLA 4AG6A 2OQ4A 1KFVA 5ITYA 4FWDA 2JZ1A 2HWJA 3K9PA 4IBCA 3SMSA 2L7IA 5FTNA 1G4AE 2C9OA 4PT5A 1IN6A 1X37A 1XXHE 2DZNB 3ZH9B 2HCBA 4ITQA 2KNVA 4LF7M 2LVAA 2Q2EB 3QYEA 4M9ZA 4GRIA 1N33M 2ZBKB 4MGYE 4R71A 1G71A 2LXEA 2CHVA 3U5ZB 3L27A 2F5QA 4MGHA 2XSZD 3M7GA 3F92A 3KOYE 4MGZE 3GLIE 3GPXA 3VDPA 3FTFA 1TF0B 2JP7A 1Q02A 2DHYA 2LWXA 3CGWA 3UJNA 4GIPA 2Z7JA 3T1YM 2QP9X 2BJWA 1L1ZA 3K9OA 1VQ1A 1OKSA 2EKKA 3R8FA 2Z4SA 3FUUA 3C3DA 4XGIA 4MH0E 2UXBM 1LTMA 1DGBA 5ITXA 5C18A 2KZUA 2R45A 4AW4A 3U6QA 2QBYA 2JUJA 1SXJC 1QDTA 3SFZA 4KLNA 3FYCA 2V1UA 1XXHB 2VF7A 4G4NA 2LBCA 4DV4M 3EIEA 3PNVA 2QCUA 1IXSB 3I4YA 2HAKA 2JY6B 1HT2E 2C99A 1XHBA 4JI8M 1PRBA 3SC3A 2DXIA 3RGSA 2CE7A 3HKPA 1GJTA 2N35A 1IN8A 4WURA 5C1BA 2R46A 3GLIB 4IBJA 3TL4X 1GJSA 1DO2A 2WSFF 1ZMWA 4RNAA 1TGUA 1WGNA 4OVZB 3U6SA 1T43A 3MJ5A 2R4JA 3HY5A 3GLGE 3IECA 2G3QA 4GEWA 1JR3A 4R3DA 1DO0A 5GKNA 1N75A 2KZSA 1QDRA 2APLA 2LH0A 3K8ZA 1NVMA 2E5LM 4NXMM 1G8PA 2CP8A 2QPAA 2WSEF 4G4QA 1V34A 1R5LA 1VG5A 1QUTA 2L6OA 4IBIA 2DWZB 4YY3M 2DAKA 5KPZA 3GPYA 3U6OA 1QANA 2J5YA 3AFHA 3HHYA 5LMUM 4LFCM 1DGGA 1UFZA 1L2CA 3T15A 3I04M 3HJQA 1UM8A 3FD9A 2YNMD 4Z8XA 4JV5M 3J7BA 4FWGA 1ZAEA 4LGMA 2VQEM 3VDUA 4B3MM 4AKGA 1TR8A 3GLGB 3KXEC 2OOAA 3KFUG 4IBDA 2R18A 3HU3A 1G3IA 1J5EM 4GITA 2OO9A 1MN3A 1NY5A 2ZAOA 4LJ6A 3AOEC 2D7EA 3J27B 1BVSA 1FJGM 1R2ZA 1N78A 3FYDA 1DV0A 1R7RA 1QAOA 4AZFA 4KO8A 3NBXX 3AL0C 4B08A 2ZAMA 2KA6B 2BWBA 3T38A 4AI6A 4DUYM 2KNZA 3HJ8A 4D81A 3SBJA 1GO5A 1MJGM 2I7NA 1VEKA 4FD2A 4ANRA 1Q39A 2QNJA 3SAUA 1HJPA 3A98B 4GKJM 2G8LA 3SMPA 2EO2A 3T6PA 3HHXA 4HL4A 1NHWC 4PDIA 4X64M 2YQZA 1Z5AA 5ITQA 3KP1E 2C96A 1Z5BA 4GC9A 5FTMA 4LJ4A 3GLHA 2QHOB 3E4RA 1Z6TA 1NSFA 2DAIA 3LVVA 1GVNA 3FTDA 3WHKA 1CUKA 1IN4A 5DYIA 1I94M 1NJFA 1PJIA 8CATA 3LQQA 2O5RA 2M60A 2WSCF 3B7QA 5JI3E 2CUZA 1T3TA 2C5RA 3AKZA 1T6OA 3JAMS 3PXGA 2ZTDA 4QOSA 3HX3A 2RRUA 2J7NA 4IBKA 1NNUC 2GQFA 5H37D 5ITXE 3J81S 2XSZA 3KS8A 4XK8F 1OAIA 2QQ8A 4LF9M 2Y20A 3A46A 4CJ6A 5KO3A 1DGHA 1OFHA 3LQRA 1NV9A 1HQCA 1OJLA 2KDLA 3HHWA 3V76A 1NY6A 2YR0A 4NC6A 3C58A 4LJ7A 2LVPC 1Y8GA 3AOGA 3ILKA
chains in the Genus database with same CATH topology
2RKOA 3DFZA 2R65A 2KW0A 3J80S 4X65M 3SASA 2HKJA 1IM2A 3UGJA 3W0LB 5E26A 2P5TA 3GRRA 2XFSA 2FNAA 1YSYA 2YFQA 3U6CA 2QBYB 3JR4A 3PVSA 1IY0A 3K92A 4FVMA 4XBOA 4II7A 1H6UA 3AJIB 1K3XA 4JN6A 4FCVA 2FFJA 5KPRA 4L15A 1YUBA 5FTKA 2D7HA 3FTEA 4LZJA 3TQSA 5ITRA 1SXJA 1HNXM 3QAUA 3IG8A 4IBBA 2VQFM 4G6ZA 2XGNA 3M6AA 4FCWA 4NRWA 5BR8M 2FOIC 5A2QS 2DWNA 2Z4RA 2CV1A 3L25A 1DGFA 3H4MA 3GPUA 1W5SA 2XFTA 2CEAA 3GRYA 4DR3M 3VKHA 3HU2A 5EP2A 1QAQA 5FSWA 2HL7A 1HR0M 3GLFA 4X62M 2Z3XA 5F3WA 2UU9M 2W82A 5EXTA 3HJSA 4MM3B 2XLJA 1PJJA 4LFBM 4IBGA 2J7OA 1G41A 3KSJA 4LRTA 1PM5A 4CGYB 3LMMA 1J7KA 3L2AA 4HLQA 4QOZC 7CATA 3HWSA 4LJ8A 4NSRA 4R7GA 2CFOA 2CV0A 1TH3A 4JI2M 2G5GX 4DR7M 2HHHM 1XXHA 3PNYA 2KXEA 3VK7A 1XWIA 4LG2A 3TWKA 3UMMA 3GQ3A 2XZFA 5FTJA 4PCZA 4B3RM 2XEPA 3GQ5A 1S3SA 5KQDA 2XH9A 4D80A 3AOEA 5IREB 4NOOB 3QWLA 3K2LA 1XMOM 3TPZA 3U60A 5EP4A 1IBMM 4DR6M 4KODA 4FW9A 4LCBA 3VFDA 2AHMA 5E6JA 5EXSA 1IXRC 1E94E 3B9PA 2LNHC 3GLHB 5EXXA 4X66M 3SAVA 3A42A 3FKEA 4A3VB 5IWAM 2RGOA 1IY2A 2UUCM 1R6BX 3SAWA 3HGIA 4JYAM 1QAMA 1ORYB 4M0DA 2UUBM 2C98A 1XC8A 3HHZA 4I8OA 2Y0TA 2X8AA 1E9RA 4GHAA 2DZOB 3UK6A 4G4RA 3J2PB 2QZ4A 3GLGA 1DGHB 4NXNM 4D82A 2DWLA 2F5NA 5EQTA 4DUZM 1ZQ9A 4YHHM 4S12A 3FTCA 3RGPA 4QHSA 2BJVA 3GPPA 4LF4M 3KSXA 3ZC7B 3M0EA 1SXJE 4B7HA 4EIWA 4DR4M 5IT9S 3BOSA 4LJAA 3WHLA 4B7FA 4REZA 4IIWA 2QENA 4DR2M 1KSFX 3VK8A 3L29A 3L26A 3FUWA 5IZ7D 2KRUA 3U6MA 4MGIE 1Z59A 3OTOM 2KRKA 4DR5M 1E32A 1FNNA 3VLFB 1NNJA 4LY6A 4L4UA 2DHRA 2L09A 3SARA 1TH4A 1I4WA 3AV0A 4B3TM 3NBIA 3MHVC 1N77A 4OW0A 2OPFA 2F5OA 1SXJB 4ZPXA 2UXDM 5EP1A 2BNKA 4GMQA 4CHTB 4JI3M 4LF6M 2ZANA 2KEBA 4LZZA 4BLCA 3J7AS 4PDGA 3ZCBB 1N32M 3U6EA 2VIIA 1NJGA 3UZUA 1TDZA 1L2BA 3U61A 4L78A 1TDHA 2ZM6M 4G4OA 3E9SA 5KPTA 3LVWA 3GLFB 2H1RA 4AKHA 4LF5M 3T1HM 5FLXS 4IBFA 1JQJC 3TWMA 3VKGA 2Y21A 2X49A 1MX0A 2L7HA 4JI4M 4DV3M 2C9CA 4GHLA 3U5ZA 1E9SA 4WW0A 1Z5CA 3JR5A 4JI1M 4TUWA 4GC5A 1L2DA 3EIHA 3A45A 1R2YA 1GKIA 3L28A 5KQ8A 2DVWB 4KHPM 1XMQM 2D7GA 4GH9A 3IG5A 3D8LA 4DV6M 2EUCA 4IJEA 2RGHA 5JI2E 2A5YB 1LV7A 3DZDA 3CF6E 1HNWM 1C1KA 1QVRA 4FCTA 4DV5M 3D8BA 4L16A 2K47A 3SYKA 4DR1M 2F5SA 1L8QA 4OU7A 2FE8A 3U60B 4PD2A 2V1CA 2V6ZM 4M9SA 4M0WA 2CHQA 4AKIA 5EXPA 4Z6YA 2M5ZA 2X4AA 2JA2A 4W5WA 1K3WA 1GL7A 1GLNA 1SXJD 3KVWA 3SHFA 5FTLA 4LFAM 3U6DA 3KP0E 3GLIA 3U6LA 1G59A 1N34M 4LRSA 4OVZA 2DWMA 1XNQM 5ITTA 1MU5A 2F4VM 1EE8A 4RF1A 3DA1A 3GRUA 1J09A 4I5SA 4NRVA 5DYGA 2XF3A 3GP1A 4AG5A 3R9XB 3I51A 1VDDA 2CHGA 4NL4H 2XZUA 4BBAA 1KYIA 3RE8A 4MB7A 2I7PA 1JR3D 3SATA 3CF0A 4IJFA 3K1JA 1HQYE 1QZMA 3HU1A 3THGA 1IBLM 1L1TA 3FUVA 1IN7A 4M9XA 2UUAM 4GKKM 3KDSE 2NQ8C 5LMNM 4DV0M 1YE9A 1IBKM 1NHGC 2CV2A 3MK6A 1IN5A 1GL6A 4LJ5A 5ITUA 4LF8M 4QHTA 1Q3BA 1Q3CA 4DV2M 3RFWA 3GO8A 1QYRA 4B3SM 5BPVA 3U6PA 1IXZA 4CISA 3TWLA 4JI6M 4MGKE 3NWLA 4DV7M 4JI5M 4B7GA 1QQWA 2F5PA 4JI7M 4L8RC 4JXJA 3I4VA 3GQ4A 1IQPA 4FWHA 2R4EA 4I4LA 4LJ9A 3PFIA 4QNMA 3CF2A 3Q8XA 5EJCA 4YY3M 3KOWE 3KW6A 1HT1E 4P16A 4DV1M 3FUXA 2ERCA 1XNRM 1D2NA 1IY1A 1WXQA 4QNRA 3FUTA 5DNYA 4OX9M 3KOZE 3SHGB 2EA0A 3GRVA 3TE6A 4K0KM 4AQYM 3W0FA 2UXCM 3DOAA 2R62A 4BB9A 1OFIA 1K82A 5EP3A 1TH2A 1N36M 2Y0QA 3KOXE 3U61B 1HNZM 3CTWB 4IBEA 4I81A 4NSOB 4LGYA 4JI0M 3SYLA 1W5TA 4RF0A 4AG6A 2OQ4A 1KFVA 5ITYA 3AOGA 4FWDA 4IBCA 3SMSA 2L7IA 5FTNA 1G4AE 2C9OA 4PT5A 1IN6A 1X37A 2DZNB 3ZH9B 2HCBA 4ITQA 4LF7M 2Q2EB 4M9ZA 4GRIA 1N33M 2ZBKB 4MGYE 2LXEA 2CHVA 3U5ZB 3L27A 2F5QA 4MGHA 2XSZD 3M7GA 4MGZE 3KOYE 3FTFA 3GPXA 3VDPA 2LWXA 3T1YM 3UJNA 4GIPA 2Z7JA 2QP9X 2BJWA 1L1ZA 3R8FA 2Z4SA 3FUUA 4XGIA 4MH0E 2UXBM 1DGBA 5ITXA 5C18A 2KZUA 2R45A 4AW4A 3U6QA 2QBYA 1SXJC 3SFZA 4KLNA 3FYCA 2V1UA 1XXHB 4G4NA 4DV4M 3EIEA 3PNVA 2QCUA 1IXSB 3I4YA 1HT2E 2C99A 1XHBA 4JI8M 3SC3A 2DXIA 3RGSA 2CE7A 3HKPA 4WURA 1IN8A 5C1BA 2R46A 3GLIB 4IBJA 3TL4X 1DO2A 4RNAA 1TGUA 4OVZB 3U6SA 3MJ5A 2R4JA 1JR3A 4R3DA 1DO0A 5GKNA 1N75A 2KZSA 2LH0A 3K8ZA 1NVMA 2E5LM 4NXMM 1G8PA 2QPAA 4G4QA 2L6OA 4IBIA 2DWZB 5KPZA 3GPYA 3U6OA 1QANA 3AFHA 3HHYA 5LMUM 4LFCM 1DGGA 1L2CA 3T15A 3HJQA 1UM8A 3FD9A 2YNMD 4Z8XA 4JV5M 3J7BA 4FWGA 1ZAEA 4LGMA 2VQEM 3VDUA 4B3MM 4AKGA 3GLGB 3KXEC 3KFUG 4IBDA 2R18A 3HU3A 1G3IA 1J5EM 4GITA 1NY5A 2ZAOA 4LJ6A 3AOEC 2D7EA 3J27B 1FJGM 1R2ZA 1N78A 3FYDA 1R7RA 1QAOA 4AZFA 4KO8A 3AL0C 4B08A 2ZAMA 2KA6B 3T38A 4AI6A 4DUYM 3HJ8A 4D81A 3SBJA 2I7NA 4FD2A 1Q39A 3SAUA 3A98B 4GKJM 2G8LA 3SMPA 2EO2A 3HHXA 4HL4A 1NHWC 4PDIA 4X64M 2YQZA 1Z5AA 5ITQA 3KP1E 2C96A 1Z5BA 4GC9A 5FTMA 4LJ4A 3GLHA 3E4RA 1Z6TA 1NSFA 3LVVA 1GVNA 3FTDA 3WHKA 1IN4A 5DYIA 1I94M 1NJFA 1PJIA 8CATA 3LQQA 2O5RA 2M60A 5JI3E 2CUZA 1T3TA 2C5RA 3AKZA 3JAMS 3PXGA 4QOSA 2J7NA 4IBKA 1NNUC 5H37D 5ITXE 3J81S 2XSZA 3KS8A 4LF9M 2Y20A 3A46A 5KO3A 1DGHA 1OFHA 3LQRA 1OJLA 1HQCA 3HHWA 1NY6A 2YR0A 3C58A 4LJ7A 3KS4A 3ILKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMQ A;  2LWX A; 
#chains in the Genus database with same CATH topology
 2RKO A;  3DFZ A;  2R65 A;  2KW0 A;  3J80 S;  4X65 M;  1WIV A;  3SAS A;  2DNA A;  1IM2 A;  2HKJ A;  3UGJ A;  3W0L B;  5E26 A;  1JR3 E;  2P5T A;  3GRR A;  2XFS A;  2FNA A;  1YSY A;  2EJS A;  2YFQ A;  3U6C A;  2QBY B;  3JR4 A;  3PVS A;  3QYB A;  1IY0 A;  3K92 A;  4FVM A;  4XBO A;  4II7 A;  1H6U A;  2L2D A;  3AJI B;  1K3X A;  2ZTC A;  4JN6 A;  4FCV A;  2FFJ A;  5KPR A;  4L15 A;  1YUB A;  2DZL A;  5FTK A;  2D7H A;  3FTE A;  4LZJ A;  3TQS A;  5ITR A;  2R44 A;  1SXJ A;  1HNX M;  2DAE A;  2Z8Y M;  3IG8 A;  3QAU A;  4IBB A;  2VQF M;  4G6Z A;  2XGN A;  3M6A A;  4FCW A;  4NRW A;  5BR8 M;  3FRI A;  2FOI C;  1A5T A;  2LVO C;  5A2Q S;  2DWN A;  2Z4R A;  2CV1 A;  3L25 A;  1YLA A;  1JB0 F;  1DGF A;  3H4M A;  3GPU A;  1W5S A;  2XFT A;  2CEA A;  3GRY A;  4DR3 M;  3VKH A;  3HU2 A;  5EP2 A;  1QAQ A;  5FSW A;  2HL7 A;  1XB2 B;  3E21 A;  1HR0 M;  3GLF A;  4X62 M;  1NO1 A;  2Z3X A;  5F3W A;  2UU9 M;  2W82 A;  5EXT A;  3HJS A;  4MM3 B;  2XLJ A;  1PJJ A;  4LFB M;  4IBG A;  2J7O A;  1G41 A;  3KSJ A;  2H5X A;  4LRT A;  1PM5 A;  4CGY B;  1OTR A;  3LMM A;  1J7K A;  3L2A A;  2JXN A;  3B74 A;  4HLQ A;  4QOZ C;  7CAT A;  2FS1 A;  3HWS A;  2R0I A;  4LJ8 A;  4NSR A;  4R7G A;  1VEJ A;  2CFO A;  2EKF A;  3GLH E;  1TH3 A;  2CV0 A;  4JI2 M;  2G5G X;  4DR7 M;  2HHH M;  1XXH A;  2FH0 A;  4RKU F;  1P3Q Q;  3BBZ A;  4G3O A;  3PNY A;  2KXE A;  3VK7 A;  1XWI A;  4LG2 A;  3TWK A;  3UMM A;  3GQ3 A;  2XZF A;  2MJ5 B;  5FTJ A;  4PCZ A;  4B3R M;  2XEP A;  3GQ5 A;  1S3S A;  5KQD A;  2XH9 A;  4D80 A;  3AOE A;  5IRE B;  4NOO B;  2WZJ A;  3QWL A;  3K2L A;  4DR4 M;  1ZMV A;  1XMO M;  3TPZ A;  3U60 A;  3FE3 A;  5EP4 A;  1IBM M;  4DR6 M;  4KOD A;  4FW9 A;  4LCB A;  3VFD A;  2AHM A;  5E6J A;  5EXS A;  1IXR C;  1E94 E;  3B9P A;  2K0B X;  1V92 A;  2LNH C;  3KS4 A;  1ZV1 A;  3GLH B;  5EXX A;  4X66 M;  3SAV A;  3A42 A;  3FKE A;  4A3V B;  5IWA M;  2JZ0 A;  2RGO A;  1IY2 A;  1VDL A;  1R6B X;  3HZJ A;  3SAW A;  2UUC M;  3HGI A;  4JYA M;  1QAM A;  1ORY B;  4M0D A;  2UUB M;  2C98 A;  1XC8 A;  3HHZ A;  4I8O A;  2LHC A;  2Y0T A;  2X8A A;  1E9R A;  4GHA A;  3I01 M;  2DZO B;  3UK6 A;  4G4R A;  2QSF X;  3J2P B;  3C9P A;  1PJQ A;  2QZ4 A;  3GLG A;  4L6V 6;  1DGH B;  3LCV B;  4NXN M;  4D82 A;  2DWL A;  2LVN C;  2K9D A;  5EQT A;  2F5N A;  4DUZ M;  2L4E A;  1ZQ9 A;  4YHH M;  4S12 A;  3FTC A;  3RGP A;  4QHS A;  2BJV A;  3GPP A;  4LF4 M;  3KSX A;  3ZC7 B;  2KNA A;  1SXJ E;  1OQY A;  3M0E A;  3W67 A;  3ZQJ A;  3BOS A;  4B7H A;  4LJA A;  3WHL A;  4EIW A;  4B7F A;  5IT9 S;  4REZ A;  3BXW A;  4IIW A;  4WP2 A;  2QEN A;  1PGY A;  4DR2 M;  1KSF X;  3VK8 A;  3L29 A;  3L26 A;  1NV8 A;  3FUW A;  5IZ7 D;  2KRU A;  2JNH A;  3U6M A;  1WR1 B;  2LVQ D;  1Z59 A;  4MGI E;  3OTO M;  2DAG A;  2KRK A;  4DR5 M;  1E32 A;  1FNN A;  3VLF B;  1NNJ A;  4LY6 A;  2LTU A;  4L4U A;  2L4F A;  4Q7J A;  2DHR A;  2L09 A;  3SAR A;  3GLF E;  1TH4 A;  1I4W A;  3AV0 A;  4B3T M;  3NBI A;  3E46 A;  3MHV C;  1N77 A;  2B3T A;  4OW0 A;  2OPF A;  2F5O A;  1SXJ B;  2LHG A;  4ZPX A;  2UXD M;  5EP1 A;  2BNK A;  2JWS A;  4GMQ A;  4CHT B;  4JI3 M;  4LF6 M;  2ZAN A;  2KEB A;  4LZZ A;  1TTE A;  4BLC A;  3J7A S;  4PDG A;  2JY8 A;  4Y28 F;  3ZCB B;  1N32 M;  4P17 A;  3IHP A;  3U6E A;  2VII A;  1NJG A;  3FRH A;  3UZU A;  3B89 A;  1TDZ A;  1GAB A;  4F1I A;  1L2B A;  3LCU A;  4CIZ A;  2DI0 A;  3U61 A;  2BWE A;  4L78 A;  1TDH A;  2ZM6 M;  4G4O A;  2DEN A;  3E9S A;  5KPT A;  3LVW A;  3GLF B;  2H1R A;  2MH8 A;  4AKH A;  4LF5 M;  3C3E A;  3T1H M;  5FLX S;  2JY5 A;  4IBF A;  1JQJ C;  4HEO A;  3TWM A;  3VKG A;  2Y21 A;  3Q8G A;  2X49 A;  1MX0 A;  2L7H A;  4JI4 M;  2O01 F;  4DV3 M;  2MR9 A;  1D0L A;  2C9C A;  4GHL A;  3U5Z A;  1E9S A;  2KHH A;  4WW0 A;  1Z5C A;  3JR5 A;  4JI1 M;  4TUW A;  3B7N A;  4GC5 A;  1L2D A;  3EIH A;  3A45 A;  1R2Y A;  1GKI A;  3L28 A;  5KQ8 A;  2CRU A;  2DVW B;  4KHP M;  1XMQ M;  2D7G A;  4GH9 A;  3IG5 A;  3D8L A;  4DV6 M;  2EUC A;  4IJE A;  2RGH A;  5JI2 E;  1WHC A;  1LV7 A;  2A5Y B;  3DZD A;  3CF6 E;  1HNW M;  1C1K A;  1QVR A;  3B7Z A;  4FCT A;  4DV5 M;  3D8B A;  4L16 A;  2K47 A;  2VDB B;  3SYK A;  5L8R F;  4DR1 M;  2F5S A;  1L8Q A;  4OU7 A;  2FE8 A;  3U60 B;  4PD2 A;  2V1C A;  1IXS A;  1VEG A;  2V6Z M;  4M0W A;  4M9S A;  2CHQ A;  4AKI A;  5EXP A;  4Z6Y A;  2M5Z A;  2X4A A;  2JA2 A;  4W5W A;  1K3W A;  1GL7 A;  1GLN A;  1SXJ D;  3KVW A;  4UN2 B;  3SHF A;  4LFA M;  5FTL A;  3KP0 E;  3GLI A;  3U6D A;  3U6L A;  1EIJ A;  1G59 A;  1N34 M;  4LRS A;  4OVZ A;  2DWM A;  1XNQ M;  2MRO B;  3LW5 F;  5ITT A;  1V33 A;  1MU5 A;  2F4V M;  1EE8 A;  4RF1 A;  3DA1 A;  3GRU A;  1J09 A;  4I5S A;  4NRV A;  1PJT A;  5DYG A;  2XF3 A;  3GP1 A;  4AG5 A;  4DBG B;  3R9X B;  3I51 A;  1VDD A;  2CHG A;  4NL4 H;  2XZU A;  2O25 A;  2CWB A;  1OAO C;  4BBA A;  1KYI A;  3RE8 A;  2GNO A;  2DKL A;  4MB7 A;  2I7P A;  1JR3 D;  3SAT A;  3CF0 A;  4IJF A;  1D0K A;  3K1J A;  1HQY E;  1QZM A;  3HU1 A;  3THG A;  1IBL M;  1SG9 A;  1L1T A;  3FUV A;  1IN7 A;  4M9X A;  2UUA M;  1OIP A;  3KDS E;  4GKK M;  1ZMU A;  2NQ8 C;  5LMN M;  1AUA A;  4DV0 M;  1YE9 A;  1IBK M;  1NHG C;  2JY7 A;  2CV2 A;  3MK6 A;  1IN5 A;  1GL6 A;  4LJ5 A;  5ITU A;  4LF8 M;  1QUS A;  4QHT A;  1R4G A;  3H4J A;  1Q3B A;  1Q3C A;  2R6F A;  2VF8 A;  4DV2 M;  3RFW A;  3GO8 A;  1QYR A;  4B3S M;  5BPV A;  3U6P A;  1IXZ A;  2MGW A;  3TWL A;  4CIS A;  2OOB A;  4KT0 F;  4JI6 M;  1RU3 A;  3NWL A;  4MGK E;  4F2L A;  4DV7 M;  4JI5 M;  4B7G A;  1QQW A;  1OIZ A;  2F5P A;  3W68 A;  4JI7 M;  4L8R C;  4JXJ A;  1EFU B;  3I4V A;  3GQ4 A;  1IQP A;  4FWH A;  1WGL A;  3MMP A;  1WJ7 A;  2R4E A;  4I4L A;  4LJ9 A;  3PFI A;  2DAM A;  4QNM A;  1D0M A;  3CF2 A;  3Q8X A;  1PJS A;  3KOW E;  1AIP C;  3KW6 A;  5EJC A;  1HT1 E;  1QZE A;  4P16 A;  4DV1 M;  3FUX A;  2ERC A;  1XNR M;  2K6B A;  1D2N A;  1IY1 A;  1WXQ A;  4QNR A;  3FUT A;  1IFY A;  5DNY A;  4OX9 M;  3KOZ E;  3SHG B;  2EA0 A;  1C7Y A;  3GRV A;  3TE6 A;  4K0K M;  4AQY M;  3W0F A;  2UXC M;  3DOA A;  1F4I A;  2R62 A;  4BB9 A;  1OFI A;  1K82 A;  5EP3 A;  1TH2 A;  1N36 M;  2Y0Q A;  3KOX E;  3U61 B;  1HNZ M;  3CTW B;  4IBE A;  4I81 A;  4NSO B;  4LGY A;  5DFL A;  4JI0 M;  1W5T A;  4RF0 A;  3SYL A;  4AG6 A;  2OQ4 A;  1KFV A;  5ITY A;  4FWD A;  2JZ1 A;  2HWJ A;  3K9P A;  4IBC A;  3SMS A;  2L7I A;  5FTN A;  1G4A E;  2C9O A;  4PT5 A;  1IN6 A;  1X37 A;  1XXH E;  2DZN B;  3ZH9 B;  2HCB A;  4ITQ A;  2KNV A;  4LF7 M;  2LVA A;  2Q2E B;  3QYE A;  4M9Z A;  4GRI A;  1N33 M;  2ZBK B;  4MGY E;  4R71 A;  1G71 A;  2LXE A;  2CHV A;  3U5Z B;  3L27 A;  2F5Q A;  4MGH A;  2XSZ D;  3M7G A;  3F92 A;  3KOY E;  4MGZ E;  3GLI E;  3GPX A;  3VDP A;  3FTF A;  1TF0 B;  2JP7 A;  1Q02 A;  2DHY A;  2LWX A;  3CGW A;  3UJN A;  4GIP A;  2Z7J A;  3T1Y M;  2QP9 X;  2BJW A;  1L1Z A;  3K9O A;  1VQ1 A;  1OKS A;  2EKK A;  3R8F A;  2Z4S A;  3FUU A;  3C3D A;  4XGI A;  4MH0 E;  2UXB M;  1LTM A;  1DGB A;  5ITX A;  5C18 A;  2KZU A;  2R45 A;  4AW4 A;  3U6Q A;  2QBY A;  2JUJ A;  1SXJ C;  1QDT A;  3SFZ A;  4KLN A;  3FYC A;  2V1U A;  1XXH B;  2VF7 A;  4G4N A;  2LBC A;  4DV4 M;  3EIE A;  3PNV A;  2QCU A;  1IXS B;  3I4Y A;  2HAK A;  2JY6 B;  1HT2 E;  2C99 A;  1XHB A;  4JI8 M;  1PRB A;  3SC3 A;  2DXI A;  3RGS A;  2CE7 A;  3HKP A;  1GJT A;  2N35 A;  1IN8 A;  4WUR A;  5C1B A;  2R46 A;  3GLI B;  4IBJ A;  3TL4 X;  1GJS A;  1DO2 A;  2WSF F;  1ZMW A;  4RNA A;  1TGU A;  1WGN A;  4OVZ B;  3U6S A;  1T43 A;  3MJ5 A;  2R4J A;  3HY5 A;  3GLG E;  3IEC A;  2G3Q A;  4GEW A;  1JR3 A;  4R3D A;  1DO0 A;  5GKN A;  1N75 A;  2KZS A;  1QDR A;  2APL A;  2LH0 A;  3K8Z A;  1NVM A;  2E5L M;  4NXM M;  1G8P A;  2CP8 A;  2QPA A;  2WSE F;  4G4Q A;  1V34 A;  1R5L A;  1VG5 A;  1QUT A;  2L6O A;  4IBI A;  2DWZ B;  4YY3 M;  2DAK A;  5KPZ A;  3GPY A;  3U6O A;  1QAN A;  2J5Y A;  3AFH A;  3HHY A;  5LMU M;  4LFC M;  1DGG A;  1UFZ A;  1L2C A;  3T15 A;  3I04 M;  3HJQ A;  1UM8 A;  3FD9 A;  2YNM D;  4Z8X A;  4JV5 M;  3J7B A;  4FWG A;  1ZAE A;  4LGM A;  2VQE M;  3VDU A;  4B3M M;  4AKG A;  1TR8 A;  3GLG B;  3KXE C;  2OOA A;  3KFU G;  4IBD A;  2R18 A;  3HU3 A;  1G3I A;  1J5E M;  4GIT A;  2OO9 A;  1MN3 A;  1NY5 A;  2ZAO A;  4LJ6 A;  3AOE C;  2D7E A;  3J27 B;  1BVS A;  1FJG M;  1R2Z A;  1N78 A;  3FYD A;  1DV0 A;  1R7R A;  1QAO A;  4AZF A;  4KO8 A;  3NBX X;  3AL0 C;  4B08 A;  2ZAM A;  2KA6 B;  2BWB A;  3T38 A;  4AI6 A;  4DUY M;  2KNZ A;  3HJ8 A;  4D81 A;  3SBJ A;  1GO5 A;  1MJG M;  2I7N A;  1VEK A;  4FD2 A;  4ANR A;  1Q39 A;  2QNJ A;  3SAU A;  1HJP A;  3A98 B;  4GKJ M;  2G8L A;  3SMP A;  2EO2 A;  3T6P A;  3HHX A;  4HL4 A;  1NHW C;  4PDI A;  4X64 M;  2YQZ A;  1Z5A A;  5ITQ A;  3KP1 E;  2C96 A;  1Z5B A;  4GC9 A;  5FTM A;  4LJ4 A;  3GLH A;  2QHO B;  3E4R A;  1Z6T A;  1NSF A;  2DAI A;  3LVV A;  1GVN A;  3FTD A;  3WHK A;  1CUK A;  1IN4 A;  5DYI A;  1I94 M;  1NJF A;  1PJI A;  8CAT A;  3LQQ A;  2O5R A;  2M60 A;  2WSC F;  3B7Q A;  5JI3 E;  2CUZ A;  1T3T A;  2C5R A;  3AKZ A;  1T6O A;  3JAM S;  3PXG A;  2ZTD A;  4QOS A;  3HX3 A;  2RRU A;  2J7N A;  4IBK A;  1NNU C;  2GQF A;  5H37 D;  5ITX E;  3J81 S;  2XSZ A;  3KS8 A;  4XK8 F;  1OAI A;  2QQ8 A;  4LF9 M;  2Y20 A;  3A46 A;  4CJ6 A;  5KO3 A;  1DGH A;  1OFH A;  3LQR A;  1NV9 A;  1HQC A;  1OJL A;  2KDL A;  3HHW A;  3V76 A;  1NY6 A;  2YR0 A;  4NC6 A;  3C58 A;  4LJ7 A;  2LVP C;  1Y8G A;  3AOG A;  3ILK A; 
#chains in the Genus database with same CATH homology
 2RKO A;  3DFZ A;  2R65 A;  2KW0 A;  3J80 S;  4X65 M;  3SAS A;  2HKJ A;  1IM2 A;  3UGJ A;  3W0L B;  5E26 A;  2P5T A;  3GRR A;  2XFS A;  2FNA A;  1YSY A;  2YFQ A;  3U6C A;  2QBY B;  3JR4 A;  3PVS A;  1IY0 A;  3K92 A;  4FVM A;  4XBO A;  4II7 A;  1H6U A;  3AJI B;  1K3X A;  4JN6 A;  4FCV A;  2FFJ A;  5KPR A;  4L15 A;  1YUB A;  5FTK A;  2D7H A;  3FTE A;  4LZJ A;  3TQS A;  5ITR A;  1SXJ A;  1HNX M;  3QAU A;  3IG8 A;  4IBB A;  2VQF M;  4G6Z A;  2XGN A;  3M6A A;  4FCW A;  4NRW A;  5BR8 M;  2FOI C;  5A2Q S;  2DWN A;  2Z4R A;  2CV1 A;  3L25 A;  1DGF A;  3H4M A;  3GPU A;  1W5S A;  2XFT A;  2CEA A;  3GRY A;  4DR3 M;  3VKH A;  3HU2 A;  5EP2 A;  1QAQ A;  5FSW A;  2HL7 A;  1HR0 M;  3GLF A;  4X62 M;  2Z3X A;  5F3W A;  2UU9 M;  2W82 A;  5EXT A;  3HJS A;  4MM3 B;  2XLJ A;  1PJJ A;  4LFB M;  4IBG A;  2J7O A;  1G41 A;  3KSJ A;  4LRT A;  1PM5 A;  4CGY B;  3LMM A;  1J7K A;  3L2A A;  4HLQ A;  4QOZ C;  7CAT A;  3HWS A;  4LJ8 A;  4NSR A;  4R7G A;  2CFO A;  2CV0 A;  1TH3 A;  4JI2 M;  2G5G X;  4DR7 M;  2HHH M;  1XXH A;  3PNY A;  2KXE A;  3VK7 A;  1XWI A;  4LG2 A;  3TWK A;  3UMM A;  3GQ3 A;  2XZF A;  5FTJ A;  4PCZ A;  4B3R M;  2XEP A;  3GQ5 A;  1S3S A;  5KQD A;  2XH9 A;  4D80 A;  3AOE A;  5IRE B;  4NOO B;  3QWL A;  3K2L A;  1XMO M;  3TPZ A;  3U60 A;  5EP4 A;  1IBM M;  4DR6 M;  4KOD A;  4FW9 A;  4LCB A;  3VFD A;  2AHM A;  5E6J A;  5EXS A;  1IXR C;  1E94 E;  3B9P A;  2LNH C;  3GLH B;  5EXX A;  4X66 M;  3SAV A;  3A42 A;  3FKE A;  4A3V B;  5IWA M;  2RGO A;  1IY2 A;  2UUC M;  1R6B X;  3SAW A;  3HGI A;  4JYA M;  1QAM A;  1ORY B;  4M0D A;  2UUB M;  2C98 A;  1XC8 A;  3HHZ A;  4I8O A;  2Y0T A;  2X8A A;  1E9R A;  4GHA A;  2DZO B;  3UK6 A;  4G4R A;  3J2P B;  2QZ4 A;  3GLG A;  1DGH B;  4NXN M;  4D82 A;  2DWL A;  2F5N A;  5EQT A;  4DUZ M;  1ZQ9 A;  4YHH M;  4S12 A;  3FTC A;  3RGP A;  4QHS A;  2BJV A;  3GPP A;  4LF4 M;  3KSX A;  3ZC7 B;  3M0E A;  1SXJ E;  4B7H A;  4EIW A;  4DR4 M;  5IT9 S;  3BOS A;  4LJA A;  3WHL A;  4B7F A;  4REZ A;  4IIW A;  2QEN A;  4DR2 M;  1KSF X;  3VK8 A;  3L29 A;  3L26 A;  3FUW A;  5IZ7 D;  2KRU A;  3U6M A;  4MGI E;  1Z59 A;  3OTO M;  2KRK A;  4DR5 M;  1E32 A;  1FNN A;  3VLF B;  1NNJ A;  4LY6 A;  4L4U A;  2DHR A;  2L09 A;  3SAR A;  1TH4 A;  1I4W A;  3AV0 A;  4B3T M;  3NBI A;  3MHV C;  1N77 A;  4OW0 A;  2OPF A;  2F5O A;  1SXJ B;  4ZPX A;  2UXD M;  5EP1 A;  2BNK A;  4GMQ A;  4CHT B;  4JI3 M;  4LF6 M;  2ZAN A;  2KEB A;  4LZZ A;  4BLC A;  3J7A S;  4PDG A;  3ZCB B;  1N32 M;  3U6E A;  2VII A;  1NJG A;  3UZU A;  1TDZ A;  1L2B A;  3U61 A;  4L78 A;  1TDH A;  2ZM6 M;  4G4O A;  3E9S A;  5KPT A;  3LVW A;  3GLF B;  2H1R A;  4AKH A;  4LF5 M;  3T1H M;  5FLX S;  4IBF A;  1JQJ C;  3TWM A;  3VKG A;  2Y21 A;  2X49 A;  1MX0 A;  2L7H A;  4JI4 M;  4DV3 M;  2C9C A;  4GHL A;  3U5Z A;  1E9S A;  4WW0 A;  1Z5C A;  3JR5 A;  4JI1 M;  4TUW A;  4GC5 A;  1L2D A;  3EIH A;  3A45 A;  1R2Y A;  1GKI A;  3L28 A;  5KQ8 A;  2DVW B;  4KHP M;  1XMQ M;  2D7G A;  4GH9 A;  3IG5 A;  3D8L A;  4DV6 M;  2EUC A;  4IJE A;  2RGH A;  5JI2 E;  2A5Y B;  1LV7 A;  3DZD A;  3CF6 E;  1HNW M;  1C1K A;  1QVR A;  4FCT A;  4DV5 M;  3D8B A;  4L16 A;  2K47 A;  3SYK A;  4DR1 M;  2F5S A;  1L8Q A;  4OU7 A;  2FE8 A;  3U60 B;  4PD2 A;  2V1C A;  2V6Z M;  4M9S A;  4M0W A;  2CHQ A;  4AKI A;  5EXP A;  4Z6Y A;  2M5Z A;  2X4A A;  2JA2 A;  4W5W A;  1K3W A;  1GL7 A;  1GLN A;  1SXJ D;  3KVW A;  3SHF A;  5FTL A;  4LFA M;  3U6D A;  3KP0 E;  3GLI A;  3U6L A;  1G59 A;  1N34 M;  4LRS A;  4OVZ A;  2DWM A;  1XNQ M;  5ITT A;  1MU5 A;  2F4V M;  1EE8 A;  4RF1 A;  3DA1 A;  3GRU A;  1J09 A;  4I5S A;  4NRV A;  5DYG A;  2XF3 A;  3GP1 A;  4AG5 A;  3R9X B;  3I51 A;  1VDD A;  2CHG A;  4NL4 H;  2XZU A;  4BBA A;  1KYI A;  3RE8 A;  4MB7 A;  2I7P A;  1JR3 D;  3SAT A;  3CF0 A;  4IJF A;  3K1J A;  1HQY E;  1QZM A;  3HU1 A;  3THG A;  1IBL M;  1L1T A;  3FUV A;  1IN7 A;  4M9X A;  2UUA M;  4GKK M;  3KDS E;  2NQ8 C;  5LMN M;  4DV0 M;  1YE9 A;  1IBK M;  1NHG C;  2CV2 A;  3MK6 A;  1IN5 A;  1GL6 A;  4LJ5 A;  5ITU A;  4LF8 M;  4QHT A;  1Q3B A;  1Q3C A;  4DV2 M;  3RFW A;  3GO8 A;  1QYR A;  4B3S M;  5BPV A;  3U6P A;  1IXZ A;  4CIS A;  3TWL A;  4JI6 M;  4MGK E;  3NWL A;  4DV7 M;  4JI5 M;  4B7G A;  1QQW A;  2F5P A;  4JI7 M;  4L8R C;  4JXJ A;  3I4V A;  3GQ4 A;  1IQP A;  4FWH A;  2R4E A;  4I4L A;  4LJ9 A;  3PFI A;  4QNM A;  3CF2 A;  3Q8X A;  5EJC A;  4YY3 M;  3KOW E;  3KW6 A;  1HT1 E;  4P16 A;  4DV1 M;  3FUX A;  2ERC A;  1XNR M;  1D2N A;  1IY1 A;  1WXQ A;  4QNR A;  3FUT A;  5DNY A;  4OX9 M;  3KOZ E;  3SHG B;  2EA0 A;  3GRV A;  3TE6 A;  4K0K M;  4AQY M;  3W0F A;  2UXC M;  3DOA A;  2R62 A;  4BB9 A;  1OFI A;  1K82 A;  5EP3 A;  1TH2 A;  1N36 M;  2Y0Q A;  3KOX E;  3U61 B;  1HNZ M;  3CTW B;  4IBE A;  4I81 A;  4NSO B;  4LGY A;  4JI0 M;  3SYL A;  1W5T A;  4RF0 A;  4AG6 A;  2OQ4 A;  1KFV A;  5ITY A;  3AOG A;  4FWD A;  4IBC A;  3SMS A;  2L7I A;  5FTN A;  1G4A E;  2C9O A;  4PT5 A;  1IN6 A;  1X37 A;  2DZN B;  3ZH9 B;  2HCB A;  4ITQ A;  4LF7 M;  2Q2E B;  4M9Z A;  4GRI A;  1N33 M;  2ZBK B;  4MGY E;  2LXE A;  2CHV A;  3U5Z B;  3L27 A;  2F5Q A;  4MGH A;  2XSZ D;  3M7G A;  4MGZ E;  3KOY E;  3FTF A;  3GPX A;  3VDP A;  2LWX A;  3T1Y M;  3UJN A;  4GIP A;  2Z7J A;  2QP9 X;  2BJW A;  1L1Z A;  3R8F A;  2Z4S A;  3FUU A;  4XGI A;  4MH0 E;  2UXB M;  1DGB A;  5ITX A;  5C18 A;  2KZU A;  2R45 A;  4AW4 A;  3U6Q A;  2QBY A;  1SXJ C;  3SFZ A;  4KLN A;  3FYC A;  2V1U A;  1XXH B;  4G4N A;  4DV4 M;  3EIE A;  3PNV A;  2QCU A;  1IXS B;  3I4Y A;  1HT2 E;  2C99 A;  1XHB A;  4JI8 M;  3SC3 A;  2DXI A;  3RGS A;  2CE7 A;  3HKP A;  4WUR A;  1IN8 A;  5C1B A;  2R46 A;  3GLI B;  4IBJ A;  3TL4 X;  1DO2 A;  4RNA A;  1TGU A;  4OVZ B;  3U6S A;  3MJ5 A;  2R4J A;  1JR3 A;  4R3D A;  1DO0 A;  5GKN A;  1N75 A;  2KZS A;  2LH0 A;  3K8Z A;  1NVM A;  2E5L M;  4NXM M;  1G8P A;  2QPA A;  4G4Q A;  2L6O A;  4IBI A;  2DWZ B;  5KPZ A;  3GPY A;  3U6O A;  1QAN A;  3AFH A;  3HHY A;  5LMU M;  4LFC M;  1DGG A;  1L2C A;  3T15 A;  3HJQ A;  1UM8 A;  3FD9 A;  2YNM D;  4Z8X A;  4JV5 M;  3J7B A;  4FWG A;  1ZAE A;  4LGM A;  2VQE M;  3VDU A;  4B3M M;  4AKG A;  3GLG B;  3KXE C;  3KFU G;  4IBD A;  2R18 A;  3HU3 A;  1G3I A;  1J5E M;  4GIT A;  1NY5 A;  2ZAO A;  4LJ6 A;  3AOE C;  2D7E A;  3J27 B;  1FJG M;  1R2Z A;  1N78 A;  3FYD A;  1R7R A;  1QAO A;  4AZF A;  4KO8 A;  3AL0 C;  4B08 A;  2ZAM A;  2KA6 B;  3T38 A;  4AI6 A;  4DUY M;  3HJ8 A;  4D81 A;  3SBJ A;  2I7N A;  4FD2 A;  1Q39 A;  3SAU A;  3A98 B;  4GKJ M;  2G8L A;  3SMP A;  2EO2 A;  3HHX A;  4HL4 A;  1NHW C;  4PDI A;  4X64 M;  2YQZ A;  1Z5A A;  5ITQ A;  3KP1 E;  2C96 A;  1Z5B A;  4GC9 A;  5FTM A;  4LJ4 A;  3GLH A;  3E4R A;  1Z6T A;  1NSF A;  3LVV A;  1GVN A;  3FTD A;  3WHK A;  1IN4 A;  5DYI A;  1I94 M;  1NJF A;  1PJI A;  8CAT A;  3LQQ A;  2O5R A;  2M60 A;  5JI3 E;  2CUZ A;  1T3T A;  2C5R A;  3AKZ A;  3JAM S;  3PXG A;  4QOS A;  2J7N A;  4IBK A;  1NNU C;  5H37 D;  5ITX E;  3J81 S;  2XSZ A;  3KS8 A;  4LF9 M;  2Y20 A;  3A46 A;  5KO3 A;  1DGH A;  1OFH A;  3LQR A;  1OJL A;  1HQC A;  3HHW A;  1NY6 A;  2YR0 A;  3C58 A;  4LJ7 A;  3KS4 A;  3ILK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...