2LWXA

Solution structure of the c-terminal pdr1-activating domain of the j-protein zuo1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'GSKAAKKKNKRAIRNSAKEADYFGDADKATTIDEQVGLIVDSLNDEELVSTADKIKANAAGAKEVLKESAKTIVDSGKLPSSLLSYFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zuotin
publication title Unfolding of the C-terminal domain of the j-protein zuo1 releases autoinhibition and activates pdr1-dependent transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2lwxA00
4GMQA 2LWXA
chains in the Genus database with same CATH superfamily
3J7AS 1D2NA 1SG9A 1MX0A 4G4RA 4FCWA 3LVVA 4BLCA 2JWSA 3D8BA 5IZ7D 4FVMA 1L1TA 3FTFA 2UU9M 2UXDM 1BVSA 5IWAM 3C58A 1WIVA 2ZM6M 4RF1A 2N35A 4D81A 3MMPA 1W5TA 2L4FA 3JR5A 3E9SA 3HKPA 1PJIA 3PXGA 3B9PA 4PT5A 5C1BA 2CHQA 4LFBM 1QYRA 1W5SA 3L27A 1XXHE 4IBCA 1Z59A 1SXJE 1TF0B 2C98A 4R7GA 2R62A 4GKJM 4PDIA 4I5SA 2Y20A 3JR4A 1JQJC 4JI4M 2BJVA 2JA2A 3KXEC 1GABA 3FTEA 4IBIA 2DVWB 4IJEA 1T3TA 3I51A 3M7GA 4NC6A 5EQTA 2YFQA 2OPFA 3VK7A 2APLA 2H5XA 1NJGA 3SHGB 2R44A 1ZMWA 2LXEA 2Y21A 4W5WA 4JI3M 2AHMA 2HAKA 4IBEA 4AG5A 1AUAA 1YUBA 3W68A 3A46A 1SXJD 2EO2A 2LBCA 3HU3A 1IQPA 1QDRA 3KSJA 4GHAA 3SATA 2QNJA 3FYDA 3KS4A 2KA6B 1GVNA 1NO1A 4MGHA 3UZUA 2DWNA 2X8AA 1HQCA 1HT1E 4LF4M 5H37D 1OFHA 3FUWA 4GH9A 3K1JA 4DR2M 1HNZM 4MGIE 2QCUA 4M9SA 4DR4M 3JAMS 4LF5M 2K9DA 1TDHA 1IN4A 4LRSA 1N75A 1LTMA 2DZLA 2LNHC 4GITA 1HNXM 3DOAA 3HU1A 2XFTA 2C5RA 2L2DA 2XSZA 1IN5A 4MB7A 3HHZA 4DR3M 2CUZA 3HY5A 4S12A 4IBGA 4II7A 4QOZC 1ORYB 2MGWA 3KOZE 1N32M 3H4JA 3HHXA 1FNNA 2D7EA 2MH8A 5KQDA 3GLGE 4LF7M 3U6QA 4TUWA 1DGBA 4AQYM 3V76A 4FWHA 3PFIA 1MJGM 4X65M 2QPAA 1PRBA 7CATA 5FTLA 4MGZE 3KOWE 3U5ZB 1GL7A 4WW0A 3D8LA 1R6BX 1MN3A 1R2YA 4JV5M 4F1IA 2QHOB 1DV0A 4G4OA 1NV8A 1KFVA 2QQ8A 2DWLA 1E9SA 4HEOA 3KP1E 1NJFA 1R5LA 3E4RA 4LGMA 2OQ4A 1NVMA 3KDSE 1Z5CA 3HJSA 3BBZA 4CHTB 4NSRA 2DAIA 5DNYA 2M5ZA 3U6SA 5FSWA 3TPZA 1OTRA 1CUKA 8CATA 5FLXS 3T15A 2C9OA 3K8ZA 4DR6M 3FTCA 4PCZA 4Z8XA 2CHVA 3FRIA 3LVWA 1N78A 3SHFA 1IN8A 1V33A 3WHLA 1IXSB 1QUSA 1GKIA 2DAGA 2K0BX 2LVQD 3K92A 4LF9M 1T43A 3LQQA 3HJQA 1OKSA 3KVWA 3HHYA 1Z5AA 2LVPC 4DR1M 2DKLA 4BBAA 2DZOB 4L4UA 3U60B 1K3WA 1YSYA 3HJ8A 2CFOA 3B89A 1TH3A 5DFLA 3SBJA 2LWXA 4RNAA 2JP7A 3E46A 3IG8A 3K2LA 3GLFA 2DI0A 5ITXA 1WHCA 4LJ5A 4LRTA 3GRYA 1E94E 1XXHB 4HLQA 1V34A 1PJTA 2J5YA 2KNAA 1SXJB 2QBYA 2EUCA 3TWMA 1NHGC 4IIWA 4MGYE 4MGKE 3PNVA 2R18A 1QAMA 1JR3E 3CF0A 5EP4A 3TWKA 3R8FA 4X66M 1DGFA 1WR1B 2KRKA 4REZA 4ITQA 5KPRA 3VKHA 3AV0A 3QAUA 1HR0M 2HKJA 1TDZA 5KPTA 2KXEA 3GPXA 1N77A 2JY8A 2JY7A 2QP9X 3EIEA 1IBMM 3L25A 3MK6A 2HL7A 2WZJA 4XGIA 3QYBA 4YHHM 1QDTA 4NL4H 1OIPA 3U6OA 3GLHE 4CGYB 2ZANA 2R4EA 4F2LA 5KPZA 1IY0A 2VIIA 3GLIB 2J7NA 3U61B 3GRUA 1JR3D 2R46A 5JI2E 3GLIA 1DO0A 3U6CA 2V1CA 1OAOC 4NRWA 1SXJC 1NY5A 1TGUA 4G6ZA 1L8QA 4UN2B 4LG2A 4G4NA 2CV2A 1G59A 2A5YB 4FCVA 3FUUA 1Q02A 1QQWA 5FTJA 4OVZB 1NHWC 3AFHA 2NQ8C 1TH2A 2FS1A 3I01M 1ZV1A 1VEKA 2YQZA 1I4WA 2VQFM 4IBFA 4M9XA 5EXSA 3CF6E 2O5RA 4B3MM 3OTOM 5E6JA 4DUZM 3E21A 1L1ZA 2EKFA 3J7BA 5C18A 4QOSA 1GO5A 2H1RA 4AZFA 4M9ZA 3ZQJA 5ITQA 3GLGB 2C99A 4DR7M 4WP2A 4KO8A 1NNJA 4NRVA 3SMPA 5EXPA 3NBIA 3U6LA 2EA0A 4I4LA 2VF7A 4LCBA 3I04M 3SAWA 1Z6TA 4GKKM 2X49A 4OX9M 2ZAOA 1PJQA 3R9XB 4GEWA 4JI8M 2XF3A 2LVAA 2G5GX 3SAUA 3GQ5A 4GRIA 1L2CA 4BB9A 2MR9A 2UXCM 1TR8A 5LMUM 2QSFX 3T1YM 4EIWA 4D80A 1WXQA 2WSEF 1G8PA 3U6DA 4QNRA 5KQ8A 1WGLA 4GC9A 3VK8A 4ANRA 1XNQM 2G3QA 1FJGM 1C1KA 4QHTA 2XZUA 2DENA 2DWMA 4WURA 4DV6M 4KODA 2B3TA 4LZJA 4GMQA 4JI0M 1UFZA 4R3DA 1VDLA 2VQEM 1HJPA 1P3QQ 2QZ4A 5JI3E 4G4QA 3BXWA 1R2ZA 2RKOA 1IM2A 1EFUB 2LVNC 5DYIA 4CIZA 1Q3CA 4P17A 4JI2M 4KLNA 1VEJA 1KYIA 3A45A 4DV3M 4G3OA 3U6EA 1IN6A 1XNRM 3U5ZA 3GRRA 1OIZA 2L6OA 1D0KA 5EP2A 3SYKA 3I4YA 2P5TA 4B7FA 4M0DA 2JZ0A 3IECA 3SFZA 1NNUC 1DGGA 2KW0A 2F5SA 1G71A 2ERCA 2ZTDA 3HGIA 1D0MA 1UM8A 1YLAA 3FKEA 2F4VM 1NSFA 2ZAMA 3J80S 2F5PA 3J27B 1PJSA 4JI6M 3AKZA 2KRUA 1XMOM 2HWJA 4GHLA 4K0KM 2R65A 2YR0A 3CTWB 2UUAM 2KZUA 1IY2A 3SMSA 1QZEA 1HNWM 3FTDA 1IXSA 1MU5A 4PD2A 3U6MA 3CF2A 2XFSA 3GLHB 4DV7M 1IFYA 4AKGA 1QUTA 1WGNA 4NSOB 2XLJA 4DR5M 1EE8A 2JXNA 2W82A 1E9RA 3AOEC 1V92A 2DAKA 5A2QS 1XC8A 2BNKA 2D7HA 1IY1A 4MM3B 4D82A 3Q8GA 4AG6A 3FUVA 3U60A 4A3VB 2XZFA 1N36M 2OOAA 1NY6A 2LTUA 3W0FA 2G8LA 1Q39A 2GNOA 1GJSA 3GPPA 2FH0A 1XWIA 1ZQ9A 3DA1A 1XXHA 5EJCA 5FTNA 1SXJA 3QYEA 4MH0E 4LFAM 5FTKA 1VDDA 1TTEA 3THGA 1X37A 2BJWA 2CP8A 3UMMA 1N34M 3M6AA 1G41A 2MROB 3LCUA 3T1HM 4ZPXA 2DHYA 3KSXA 5KO3A 1IBKM 3EIHA 2YNMD 1R4GA 2Y0QA 2C96A 3LCVB 3GP1A 2XSZD 3SYLA 4CISA 1DGHB 4LF6M 3H4MA 4Z6YA 2Z3XA 3TWLA 3AOGA 4B7GA 4JN6A 4LJ6A 1QZMA 4DV5M 3Q8XA 2ZBKB 3SC3A 1IXRC 3HX3A 4L78A 3U61A 4FD2A 5BPVA 1QANA 3NWLA 3PNYA 5EXTA 2QENA 2CV0A 2LH0A 4P16A 3C3EA 1OAIA 3B7NA 2JUJA 2L09A 4NOOB 3KS8A 1KSFX 4X62M 2VDBB 3GPYA 1LV7A 3FYCA 2FE8A 4L8RC 2DAMA 1WJ7A 3HZJA 2V6ZM 3VLFB 2Z8YM 2I7NA 2DZNB 1ZMVA 4OVZA 1HT2E 2KNZA 3LMMA 4QHSA 4CJ6A 2R45A 1A5TA 3W0LB 2WSFF 4KHPM 1T6OA 2BWEA 2GQFA 2O01F 1AIPC 3M0EA 4QNMA 3ZCBB 3SASA 2LVOC 2BWBA 2KEBA 3GLFE 4OW0A 5ITTA 5ITXE 4AI6A 3FD9A 4I81A 4LJ7A 5IREB 3GLGA 4DV0M 4L15A 4IBKA 4LFCM 2CE7A 4XK8F 4PDGA 3L26A 3B74A 4X64M 3L29A 3MHVC 3L2AA 4DV4M 2V1UA 4B3RM 4IBJA 2DAEA 4L6V6 3ZC7B 3HWSA 3TE6A 3AJIB 2UUCM 3KFUG 1PGYA 4LJ9A 3KW6A 3T38A 5L8RF 1PJJA 2R6FA 1IBLM 1L2DA 3VKGA 2ZTCA 2F5QA 1VG5A 2FOIC 1JB0F 4LGYA 3K9OA 4B3TM 1RU3A 1J7KA 4FCTA 1K3XA 2OO9A 3QWLA 5DYGA 3GQ3A 1XMQM 1L2BA 2JY5A 4XBOA 4GC5A 1GLNA 2UUBM 2OOBA 3HHWA 1Q3BA 3GLIE 1J5EM 2JY6B 1OFIA 5EXXA 2F5OA 3A42A 2RRUA 2R0IA 1D0LA 3BOSA 3GPUA 2L7IA 2LHGA 3I4VA 3C9PA 4LJAA 1H6UA 3NBXX 4OU7A 3C3DA 4LJ4A 4DV1M 2JNHA 1TH4A 2XEPA 3LW5F 4YY3M 3RGSA 4DV2M 1IXZA 1HQYE 2O25A 5F3WA 3AL0C 3A98B 2C9CA 1Z5BA 4GIPA 1GJTA 3ILKA 4B7HA 3J81S 1R7RA 4M0WA 4IJFA 1PM5A 2KHHA 3DZDA 3B7ZA 2I7PA 2JZ1A 2FNAA 2KDLA 2F5NA 1DO2A 1C7YA 3CGWA 1E32A 3AOEA 1IN7A 4IBBA 3DFZA 2EKKA 2WSCF 2Z7JA 3FUTA 3KP0E 1QAOA 4I8OA 3ZH9B 4DUYM 3T6PA 3VFDA 5ITRA 3K9PA 4AKIA 5LMNM 3MJ5A 4JI1M 2DNAA 1GL6A 1JR3A 3FE3A 4B08A 3WHKA 1G4AE 3FRHA 2E5LM 2XGNA 3SARA 3KOYE 2UXBM 2KNVA 4B3SM 3L28A 3RGPA 4KT0F 4FWDA 3TL4X 2VF8A 3UJNA 3GLHA 4DBGB 2K47A 2M60A 4FWGA 5ITYA 3GRVA 3J2PB 5EP1A 1VEGA 2KZSA 4RF0A 2DXIA 2CHGA 1QVRA 2RGOA 1K82A 2D7GA 3IHPA 1F4IA 3PVSA 3TQSA 1J09A 4Y28F 5BR8M 2DWZB 2LHCA 4AKHA 4Q7JA 4RKUF 3VDPA 4JI5M 3U6PA 2CRUA 2Y0TA 3KOXE 3F92A 4HL4A 5GKNA 3SAVA 1OQYA 3RFWA 3W67A 5ITUA 2R4JA 1QAQA 5IT9S 3HU2A 1S3SA 3IG5A 2CEAA 2DHRA 4JYAM 4FW9A 4LY6A 2Z4SA 3LQRA 5E26A 1YE9A 2FFJA 2Z4RA 4AW4A 2J7OA 1XHBA 3GLFB 4JXJA 5FTMA 2HHHM 4IBDA 4LJ8A 4LF8M 4NXNM 1XB2B 1EIJA 4JI7M 2EJSA 2Q2EB 1VQ1A 2X4AA 4LZZA 1OJLA 3GQ4A 2QBYB 2XH9A 3FUXA 2CV1A 1DGHA 2MJ5B 3RE8A 3UK6A 4NXMM 1I94M 2L4EA 4L16A 5EP3A 1ZMUA 2RGHA 1Y8GA 3UGJA 1NV9A 4R71A 2K6BA 1N33M 1ZAEA 2CWBA 2HCBA 3VDUA 2L7HA 3B7QA 3GO8A 1G3IA
chains in the Genus database with same CATH topology
3J7AS 1D2NA 1MX0A 4G4RA 4FCWA 3LVVA 4BLCA 3D8BA 5IZ7D 4FVMA 1L1TA 3FTFA 2UU9M 2UXDM 5IWAM 3C58A 2ZM6M 4RF1A 4D81A 1W5TA 3JR5A 3E9SA 3HKPA 1PJIA 3PXGA 3B9PA 4PT5A 5C1BA 2CHQA 4LFBM 1QYRA 1W5SA 3L27A 4IBCA 1Z59A 1SXJE 2C98A 4R7GA 2R62A 4GKJM 4PDIA 4I5SA 2Y20A 3JR4A 1JQJC 4JI4M 2BJVA 2JA2A 3KXEC 3FTEA 4IBIA 2DVWB 4IJEA 1T3TA 3I51A 3M7GA 5EQTA 2YFQA 2OPFA 3VK7A 1NJGA 3SHGB 2Y21A 2LXEA 4JI3M 4W5WA 2AHMA 4IBEA 4AG5A 1YUBA 3A46A 1SXJD 2EO2A 3HU3A 1IQPA 3KSJA 4GHAA 3SATA 3FYDA 3KS4A 2KA6B 1GVNA 4MGHA 3UZUA 2DWNA 2X8AA 1HQCA 1HT1E 4LF4M 5H37D 1OFHA 3FUWA 4GH9A 3K1JA 4DR2M 1HNZM 4MGIE 2QCUA 4M9SA 4DR4M 3JAMS 4LF5M 1TDHA 1IN4A 4LRSA 1N75A 2LNHC 4GITA 1HNXM 3DOAA 3HU1A 2XFTA 2C5RA 3HHZA 2XSZA 1IN5A 4MB7A 4DR3M 2CUZA 4S12A 4IBGA 4II7A 4QOZC 1ORYB 3KOZE 1N32M 3HHXA 1FNNA 2D7EA 5KQDA 4LF7M 4TUWA 3U6QA 1DGBA 4AQYM 4FWHA 3PFIA 4X65M 2QPAA 7CATA 5FTLA 4MGZE 3KOWE 3U5ZB 1GL7A 4WW0A 3D8LA 1R6BX 1R2YA 4JV5M 4G4OA 1KFVA 2DWLA 1E9SA 3KP1E 1NJFA 3E4RA 4LGMA 2OQ4A 2F4VM 1NVMA 3KDSE 1Z5CA 3HJSA 4CHTB 4NSRA 5DNYA 2M5ZA 3U6SA 5FSWA 3TPZA 5FLXS 8CATA 3T15A 2C9OA 3K8ZA 4DR6M 3FTCA 4PCZA 4Z8XA 2CHVA 3LVWA 1N78A 3SHFA 1IN8A 3WHLA 1IXSB 3K92A 1GKIA 4LF9M 3LQQA 3HJQA 3KVWA 3HHYA 1Z5AA 4DR1M 4BBAA 2DZOB 4L4UA 3U60B 1K3WA 1YSYA 3HJ8A 2CFOA 1TH3A 3SBJA 2LWXA 4RNAA 3IG8A 3K2LA 3GLFA 5ITXA 4LJ5A 4LRTA 3GRYA 1E94E 1XXHB 4HLQA 1SXJB 2QBYA 2EUCA 3TWMA 1NHGC 4IIWA 4MGYE 4MGKE 3PNVA 2R18A 1QAMA 3CF0A 5EP4A 3TWKA 3R8FA 4X66M 1DGFA 2KRKA 4REZA 4ITQA 5KPRA 3VKHA 3AV0A 3QAUA 1HR0M 2HKJA 1TDZA 5KPTA 2KXEA 3GPXA 1N77A 2QP9X 3EIEA 1IBMM 3L25A 3MK6A 2HL7A 4XGIA 4YHHM 4NL4H 3U6OA 4CGYB 2ZANA 2R4EA 5KPZA 1IY0A 2VIIA 3GLIB 2J7NA 3U61B 3GRUA 1JR3D 2R46A 5JI2E 3GLIA 1DO0A 3U6CA 2V1CA 4NRWA 1SXJC 1NY5A 1TGUA 4G6ZA 1L8QA 4LG2A 4G4NA 2CV2A 1G59A 2A5YB 4FCVA 3FUUA 1QQWA 5FTJA 4OVZB 1NHWC 3AFHA 2NQ8C 1TH2A 2YQZA 1I4WA 2VQFM 4IBFA 4M9XA 5EXSA 3CF6E 2O5RA 4B3MM 3OTOM 5E6JA 4DUZM 1L1ZA 3J7BA 5C18A 4QOSA 2H1RA 4AZFA 4M9ZA 5ITQA 3GLGB 2C99A 4DR7M 4KO8A 1NNJA 4NRVA 3SMPA 5EXPA 3NBIA 3U6LA 2EA0A 4I4LA 4LCBA 3SAWA 4GKKM 1Z6TA 2X49A 4OX9M 2ZAOA 3R9XB 4JI8M 2XF3A 2G5GX 3SAUA 3GQ5A 4GRIA 1L2CA 4BB9A 2UXCM 5LMUM 3T1YM 4EIWA 4D80A 1WXQA 1G8PA 3U6DA 4QNRA 5KQ8A 4GC9A 3VK8A 1XNQM 1FJGM 1C1KA 4QHTA 2XZUA 2DWMA 4WURA 4DV6M 4KODA 4LZJA 4GMQA 4JI0M 4R3DA 2VQEM 5JI3E 2QZ4A 4G4QA 1R2ZA 2RKOA 1IM2A 5DYIA 1Q3CA 4JI2M 4KLNA 1KYIA 3A45A 4DV3M 3U6EA 1IN6A 1XNRM 3U5ZA 3GRRA 2L6OA 5EP2A 3SYKA 3I4YA 2P5TA 4B7FA 4M0DA 3SFZA 1NNUC 1DGGA 2KW0A 2F5SA 2ERCA 3HGIA 1UM8A 3FKEA 1NSFA 2ZAMA 3J80S 2F5PA 3J27B 4JI6M 3AKZA 2KRUA 1XMOM 4GHLA 4K0KM 2R65A 2YR0A 3CTWB 2UUAM 2KZUA 1IY2A 3SMSA 1HNWM 3FTDA 1MU5A 4PD2A 3U6MA 3CF2A 2XFSA 3GLHB 4DV7M 4AKGA 4NSOB 4DR5M 2XLJA 1EE8A 2W82A 1E9RA 3AOEC 1XC8A 5A2QS 2BNKA 2D7HA 1IY1A 4MM3B 4D82A 4AG6A 3U60A 3FUVA 2XZFA 4A3VB 1N36M 1NY6A 3W0FA 2G8LA 1Q39A 3GPPA 1XWIA 1ZQ9A 3DA1A 1XXHA 5EJCA 5FTNA 1SXJA 4MH0E 4LFAM 5FTKA 1VDDA 3THGA 1X37A 2BJWA 3UMMA 1N34M 3M6AA 1G41A 3T1HM 4ZPXA 3KSXA 5KO3A 1IBKM 3EIHA 2YNMD 2Y0QA 2C96A 3GP1A 2XSZD 3SYLA 4CISA 1DGHB 4LF6M 3H4MA 4Z6YA 2Z3XA 3TWLA 3AOGA 4B7GA 4JN6A 4LJ6A 1QZMA 4DV5M 3Q8XA 2ZBKB 3SC3A 1IXRC 4L78A 3U61A 4FD2A 5BPVA 1QANA 3NWLA 3PNYA 5EXTA 2QENA 2CV0A 2LH0A 4P16A 2L09A 4NOOB 3KS8A 1KSFX 4X62M 3GPYA 1LV7A 3FYCA 2FE8A 4L8RC 2V6ZM 3VLFB 2I7NA 2DZNB 4OVZA 1HT2E 3LMMA 4QHSA 2R45A 3W0LB 4KHPM 3M0EA 3SASA 4QNMA 3ZCBB 2KEBA 4OW0A 5ITTA 5ITXE 4AI6A 3FD9A 4I81A 4LJ7A 5IREB 3GLGA 4DV0M 4L15A 4IBKA 4LFCM 2CE7A 4PDGA 3L26A 4X64M 3L29A 3MHVC 3L2AA 4DV4M 2V1UA 4B3RM 4IBJA 3ZC7B 3HWSA 3TE6A 3AJIB 2UUCM 3KFUG 4LJ9A 3KW6A 3T38A 1PJJA 1IBLM 1L2DA 3VKGA 2F5QA 2FOIC 4LGYA 4B3TM 1J7KA 4FCTA 1K3XA 3QWLA 5DYGA 3GQ3A 1XMQM 1L2BA 4XBOA 2UUBM 4GC5A 1GLNA 3HHWA 1Q3BA 1J5EM 1OFIA 5EXXA 2F5OA 3A42A 3GPUA 3BOSA 2L7IA 3I4VA 4LJAA 1H6UA 4OU7A 4LJ4A 4DV1M 4YY3M 1TH4A 2XEPA 4DV2M 5F3WA 3RGSA 1IXZA 1HQYE 3AL0C 3A98B 2C9CA 1Z5BA 4GIPA 3J81S 3ILKA 4B7HA 1R7RA 4M0WA 4IJFA 1PM5A 3DZDA 2I7PA 2FNAA 2F5NA 1DO2A 1E32A 3AOEA 1IN7A 4IBBA 3DFZA 2Z7JA 3FUTA 3KP0E 1QAOA 4I8OA 3ZH9B 4DUYM 3VFDA 5ITRA 4AKIA 5LMNM 3MJ5A 4JI1M 1GL6A 1JR3A 4B08A 3WHKA 1G4AE 2E5LM 2XGNA 3SARA 3KOYE 2UXBM 4B3SM 3L28A 3RGPA 4FWDA 3TL4X 3UJNA 3GLHA 2K47A 2M60A 4FWGA 5ITYA 3GRVA 3J2PB 5EP1A 2KZSA 4RF0A 2DXIA 2CHGA 1QVRA 2RGOA 1K82A 2D7GA 3PVSA 3TQSA 1J09A 5BR8M 2DWZB 4AKHA 3VDPA 4JI5M 3U6PA 2Y0TA 3KOXE 4HL4A 5GKNA 3SAVA 5IT9S 3RFWA 5ITUA 2R4JA 1QAQA 3HU2A 1S3SA 3IG5A 2CEAA 2DHRA 4JYAM 4FW9A 4LY6A 2Z4SA 3LQRA 5E26A 1YE9A 2FFJA 2Z4RA 4AW4A 2J7OA 1XHBA 3GLFB 4JXJA 5FTMA 2HHHM 4IBDA 4LJ8A 4LF8M 4NXNM 4JI7M 2Q2EB 2X4AA 4LZZA 1OJLA 3GQ4A 2QBYB 2XH9A 3FUXA 2CV1A 1DGHA 3RE8A 3UK6A 4NXMM 1I94M 4L16A 5EP3A 2RGHA 3UGJA 1N33M 1ZAEA 2HCBA 3VDUA 2L7HA 3GO8A 1G3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMQ A;  2LWX A; 
#chains in the Genus database with same CATH topology
 3J7A S;  1D2N A;  1SG9 A;  1MX0 A;  4G4R A;  4FCW A;  3LVV A;  4BLC A;  2JWS A;  3D8B A;  5IZ7 D;  4FVM A;  1L1T A;  3FTF A;  2UU9 M;  2UXD M;  1BVS A;  5IWA M;  3C58 A;  1WIV A;  2ZM6 M;  4RF1 A;  2N35 A;  4D81 A;  3MMP A;  1W5T A;  2L4F A;  3JR5 A;  3E9S A;  3HKP A;  1PJI A;  3PXG A;  3B9P A;  4PT5 A;  5C1B A;  2CHQ A;  4LFB M;  1QYR A;  1W5S A;  3L27 A;  1XXH E;  4IBC A;  1Z59 A;  1SXJ E;  1TF0 B;  2C98 A;  4R7G A;  2R62 A;  4GKJ M;  4PDI A;  4I5S A;  2Y20 A;  3JR4 A;  1JQJ C;  4JI4 M;  2BJV A;  2JA2 A;  3KXE C;  1GAB A;  3FTE A;  4IBI A;  2DVW B;  4IJE A;  1T3T A;  3I51 A;  3M7G A;  4NC6 A;  5EQT A;  2YFQ A;  2OPF A;  3VK7 A;  2APL A;  2H5X A;  1NJG A;  3SHG B;  2R44 A;  1ZMW A;  2LXE A;  2Y21 A;  4W5W A;  4JI3 M;  2AHM A;  2HAK A;  4IBE A;  4AG5 A;  1AUA A;  1YUB A;  3W68 A;  3A46 A;  1SXJ D;  2EO2 A;  2LBC A;  3HU3 A;  1IQP A;  1QDR A;  3KSJ A;  4GHA A;  3SAT A;  2QNJ A;  3FYD A;  3KS4 A;  2KA6 B;  1GVN A;  1NO1 A;  4MGH A;  3UZU A;  2DWN A;  2X8A A;  1HQC A;  1HT1 E;  4LF4 M;  5H37 D;  1OFH A;  3FUW A;  4GH9 A;  3K1J A;  4DR2 M;  1HNZ M;  4MGI E;  2QCU A;  4M9S A;  4DR4 M;  3JAM S;  4LF5 M;  2K9D A;  1TDH A;  1IN4 A;  4LRS A;  1N75 A;  1LTM A;  2DZL A;  2LNH C;  4GIT A;  1HNX M;  3DOA A;  3HU1 A;  2XFT A;  2C5R A;  2L2D A;  2XSZ A;  1IN5 A;  4MB7 A;  3HHZ A;  4DR3 M;  2CUZ A;  3HY5 A;  4S12 A;  4IBG A;  4II7 A;  4QOZ C;  1ORY B;  2MGW A;  3KOZ E;  1N32 M;  3H4J A;  3HHX A;  1FNN A;  2D7E A;  2MH8 A;  5KQD A;  3GLG E;  4LF7 M;  3U6Q A;  4TUW A;  1DGB A;  4AQY M;  3V76 A;  4FWH A;  3PFI A;  1MJG M;  4X65 M;  2QPA A;  1PRB A;  7CAT A;  5FTL A;  4MGZ E;  3KOW E;  3U5Z B;  1GL7 A;  4WW0 A;  3D8L A;  1R6B X;  1MN3 A;  1R2Y A;  4JV5 M;  4F1I A;  2QHO B;  1DV0 A;  4G4O A;  1NV8 A;  1KFV A;  2QQ8 A;  2DWL A;  1E9S A;  4HEO A;  3KP1 E;  1NJF A;  1R5L A;  3E4R A;  4LGM A;  2OQ4 A;  1NVM A;  3KDS E;  1Z5C A;  3HJS A;  3BBZ A;  4CHT B;  4NSR A;  2DAI A;  5DNY A;  2M5Z A;  3U6S A;  5FSW A;  3TPZ A;  1OTR A;  1CUK A;  8CAT A;  5FLX S;  3T15 A;  2C9O A;  3K8Z A;  4DR6 M;  3FTC A;  4PCZ A;  4Z8X A;  2CHV A;  3FRI A;  3LVW A;  1N78 A;  3SHF A;  1IN8 A;  1V33 A;  3WHL A;  1IXS B;  1QUS A;  1GKI A;  2DAG A;  2K0B X;  2LVQ D;  3K92 A;  4LF9 M;  1T43 A;  3LQQ A;  3HJQ A;  1OKS A;  3KVW A;  3HHY A;  1Z5A A;  2LVP C;  4DR1 M;  2DKL A;  4BBA A;  2DZO B;  4L4U A;  3U60 B;  1K3W A;  1YSY A;  3HJ8 A;  2CFO A;  3B89 A;  1TH3 A;  5DFL A;  3SBJ A;  2LWX A;  4RNA A;  2JP7 A;  3E46 A;  3IG8 A;  3K2L A;  3GLF A;  2DI0 A;  5ITX A;  1WHC A;  4LJ5 A;  4LRT A;  3GRY A;  1E94 E;  1XXH B;  4HLQ A;  1V34 A;  1PJT A;  2J5Y A;  2KNA A;  1SXJ B;  2QBY A;  2EUC A;  3TWM A;  1NHG C;  4IIW A;  4MGY E;  4MGK E;  3PNV A;  2R18 A;  1QAM A;  1JR3 E;  3CF0 A;  5EP4 A;  3TWK A;  3R8F A;  4X66 M;  1DGF A;  1WR1 B;  2KRK A;  4REZ A;  4ITQ A;  5KPR A;  3VKH A;  3AV0 A;  3QAU A;  1HR0 M;  2HKJ A;  1TDZ A;  5KPT A;  2KXE A;  3GPX A;  1N77 A;  2JY8 A;  2JY7 A;  2QP9 X;  3EIE A;  1IBM M;  3L25 A;  3MK6 A;  2HL7 A;  2WZJ A;  4XGI A;  3QYB A;  4YHH M;  1QDT A;  4NL4 H;  1OIP A;  3U6O A;  3GLH E;  4CGY B;  2ZAN A;  2R4E A;  4F2L A;  5KPZ A;  1IY0 A;  2VII A;  3GLI B;  2J7N A;  3U61 B;  3GRU A;  1JR3 D;  2R46 A;  5JI2 E;  3GLI A;  1DO0 A;  3U6C A;  2V1C A;  1OAO C;  4NRW A;  1SXJ C;  1NY5 A;  1TGU A;  4G6Z A;  1L8Q A;  4UN2 B;  4LG2 A;  4G4N A;  2CV2 A;  1G59 A;  2A5Y B;  4FCV A;  3FUU A;  1Q02 A;  1QQW A;  5FTJ A;  4OVZ B;  1NHW C;  3AFH A;  2NQ8 C;  1TH2 A;  2FS1 A;  3I01 M;  1ZV1 A;  1VEK A;  2YQZ A;  1I4W A;  2VQF M;  4IBF A;  4M9X A;  5EXS A;  3CF6 E;  2O5R A;  4B3M M;  3OTO M;  5E6J A;  4DUZ M;  3E21 A;  1L1Z A;  2EKF A;  3J7B A;  5C18 A;  4QOS A;  1GO5 A;  2H1R A;  4AZF A;  4M9Z A;  3ZQJ A;  5ITQ A;  3GLG B;  2C99 A;  4DR7 M;  4WP2 A;  4KO8 A;  1NNJ A;  4NRV A;  3SMP A;  5EXP A;  3NBI A;  3U6L A;  2EA0 A;  4I4L A;  2VF7 A;  4LCB A;  3I04 M;  3SAW A;  1Z6T A;  4GKK M;  2X49 A;  4OX9 M;  2ZAO A;  1PJQ A;  3R9X B;  4GEW A;  4JI8 M;  2XF3 A;  2LVA A;  2G5G X;  3SAU A;  3GQ5 A;  4GRI A;  1L2C A;  4BB9 A;  2MR9 A;  2UXC M;  1TR8 A;  5LMU M;  2QSF X;  3T1Y M;  4EIW A;  4D80 A;  1WXQ A;  2WSE F;  1G8P A;  3U6D A;  4QNR A;  5KQ8 A;  1WGL A;  4GC9 A;  3VK8 A;  4ANR A;  1XNQ M;  2G3Q A;  1FJG M;  1C1K A;  4QHT A;  2XZU A;  2DEN A;  2DWM A;  4WUR A;  4DV6 M;  4KOD A;  2B3T A;  4LZJ A;  4GMQ A;  4JI0 M;  1UFZ A;  4R3D A;  1VDL A;  2VQE M;  1HJP A;  1P3Q Q;  2QZ4 A;  5JI3 E;  4G4Q A;  3BXW A;  1R2Z A;  2RKO A;  1IM2 A;  1EFU B;  2LVN C;  5DYI A;  4CIZ A;  1Q3C A;  4P17 A;  4JI2 M;  4KLN A;  1VEJ A;  1KYI A;  3A45 A;  4DV3 M;  4G3O A;  3U6E A;  1IN6 A;  1XNR M;  3U5Z A;  3GRR A;  1OIZ A;  2L6O A;  1D0K A;  5EP2 A;  3SYK A;  3I4Y A;  2P5T A;  4B7F A;  4M0D A;  2JZ0 A;  3IEC A;  3SFZ A;  1NNU C;  1DGG A;  2KW0 A;  2F5S A;  1G71 A;  2ERC A;  2ZTD A;  3HGI A;  1D0M A;  1UM8 A;  1YLA A;  3FKE A;  2F4V M;  1NSF A;  2ZAM A;  3J80 S;  2F5P A;  3J27 B;  1PJS A;  4JI6 M;  3AKZ A;  2KRU A;  1XMO M;  2HWJ A;  4GHL A;  4K0K M;  2R65 A;  2YR0 A;  3CTW B;  2UUA M;  2KZU A;  1IY2 A;  3SMS A;  1QZE A;  1HNW M;  3FTD A;  1IXS A;  1MU5 A;  4PD2 A;  3U6M A;  3CF2 A;  2XFS A;  3GLH B;  4DV7 M;  1IFY A;  4AKG A;  1QUT A;  1WGN A;  4NSO B;  2XLJ A;  4DR5 M;  1EE8 A;  2JXN A;  2W82 A;  1E9R A;  3AOE C;  1V92 A;  2DAK A;  5A2Q S;  1XC8 A;  2BNK A;  2D7H A;  1IY1 A;  4MM3 B;  4D82 A;  3Q8G A;  4AG6 A;  3FUV A;  3U60 A;  4A3V B;  2XZF A;  1N36 M;  2OOA A;  1NY6 A;  2LTU A;  3W0F A;  2G8L A;  1Q39 A;  2GNO A;  1GJS A;  3GPP A;  2FH0 A;  1XWI A;  1ZQ9 A;  3DA1 A;  1XXH A;  5EJC A;  5FTN A;  1SXJ A;  3QYE A;  4MH0 E;  4LFA M;  5FTK A;  1VDD A;  1TTE A;  3THG A;  1X37 A;  2BJW A;  2CP8 A;  3UMM A;  1N34 M;  3M6A A;  1G41 A;  2MRO B;  3LCU A;  3T1H M;  4ZPX A;  2DHY A;  3KSX A;  5KO3 A;  1IBK M;  3EIH A;  2YNM D;  1R4G A;  2Y0Q A;  2C96 A;  3LCV B;  3GP1 A;  2XSZ D;  3SYL A;  4CIS A;  1DGH B;  4LF6 M;  3H4M A;  4Z6Y A;  2Z3X A;  3TWL A;  3AOG A;  4B7G A;  4JN6 A;  4LJ6 A;  1QZM A;  4DV5 M;  3Q8X A;  2ZBK B;  3SC3 A;  1IXR C;  3HX3 A;  4L78 A;  3U61 A;  4FD2 A;  5BPV A;  1QAN A;  3NWL A;  3PNY A;  5EXT A;  2QEN A;  2CV0 A;  2LH0 A;  4P16 A;  3C3E A;  1OAI A;  3B7N A;  2JUJ A;  2L09 A;  4NOO B;  3KS8 A;  1KSF X;  4X62 M;  2VDB B;  3GPY A;  1LV7 A;  3FYC A;  2FE8 A;  4L8R C;  2DAM A;  1WJ7 A;  3HZJ A;  2V6Z M;  3VLF B;  2Z8Y M;  2I7N A;  2DZN B;  1ZMV A;  4OVZ A;  1HT2 E;  2KNZ A;  3LMM A;  4QHS A;  4CJ6 A;  2R45 A;  1A5T A;  3W0L B;  2WSF F;  4KHP M;  1T6O A;  2BWE A;  2GQF A;  2O01 F;  1AIP C;  3M0E A;  4QNM A;  3ZCB B;  3SAS A;  2LVO C;  2BWB A;  2KEB A;  3GLF E;  4OW0 A;  5ITT A;  5ITX E;  4AI6 A;  3FD9 A;  4I81 A;  4LJ7 A;  5IRE B;  3GLG A;  4DV0 M;  4L15 A;  4IBK A;  4LFC M;  2CE7 A;  4XK8 F;  4PDG A;  3L26 A;  3B74 A;  4X64 M;  3L29 A;  3MHV C;  3L2A A;  4DV4 M;  2V1U A;  4B3R M;  4IBJ A;  2DAE A;  4L6V 6;  3ZC7 B;  3HWS A;  3TE6 A;  3AJI B;  2UUC M;  3KFU G;  1PGY A;  4LJ9 A;  3KW6 A;  3T38 A;  5L8R F;  1PJJ A;  2R6F A;  1IBL M;  1L2D A;  3VKG A;  2ZTC A;  2F5Q A;  1VG5 A;  2FOI C;  1JB0 F;  4LGY A;  3K9O A;  4B3T M;  1RU3 A;  1J7K A;  4FCT A;  1K3X A;  2OO9 A;  3QWL A;  5DYG A;  3GQ3 A;  1XMQ M;  1L2B A;  2JY5 A;  4XBO A;  4GC5 A;  1GLN A;  2UUB M;  2OOB A;  3HHW A;  1Q3B A;  3GLI E;  1J5E M;  2JY6 B;  1OFI A;  5EXX A;  2F5O A;  3A42 A;  2RRU A;  2R0I A;  1D0L A;  3BOS A;  3GPU A;  2L7I A;  2LHG A;  3I4V A;  3C9P A;  4LJA A;  1H6U A;  3NBX X;  4OU7 A;  3C3D A;  4LJ4 A;  4DV1 M;  2JNH A;  1TH4 A;  2XEP A;  3LW5 F;  4YY3 M;  3RGS A;  4DV2 M;  1IXZ A;  1HQY E;  2O25 A;  5F3W A;  3AL0 C;  3A98 B;  2C9C A;  1Z5B A;  4GIP A;  1GJT A;  3ILK A;  4B7H A;  3J81 S;  1R7R A;  4M0W A;  4IJF A;  1PM5 A;  2KHH A;  3DZD A;  3B7Z A;  2I7P A;  2JZ1 A;  2FNA A;  2KDL A;  2F5N A;  1DO2 A;  1C7Y A;  3CGW A;  1E32 A;  3AOE A;  1IN7 A;  4IBB A;  3DFZ A;  2EKK A;  2WSC F;  2Z7J A;  3FUT A;  3KP0 E;  1QAO A;  4I8O A;  3ZH9 B;  4DUY M;  3T6P A;  3VFD A;  5ITR A;  3K9P A;  4AKI A;  5LMN M;  3MJ5 A;  4JI1 M;  2DNA A;  1GL6 A;  1JR3 A;  3FE3 A;  4B08 A;  3WHK A;  1G4A E;  3FRH A;  2E5L M;  2XGN A;  3SAR A;  3KOY E;  2UXB M;  2KNV A;  4B3S M;  3L28 A;  3RGP A;  4KT0 F;  4FWD A;  3TL4 X;  2VF8 A;  3UJN A;  3GLH A;  4DBG B;  2K47 A;  2M60 A;  4FWG A;  5ITY A;  3GRV A;  3J2P B;  5EP1 A;  1VEG A;  2KZS A;  4RF0 A;  2DXI A;  2CHG A;  1QVR A;  2RGO A;  1K82 A;  2D7G A;  3IHP A;  1F4I A;  3PVS A;  3TQS A;  1J09 A;  4Y28 F;  5BR8 M;  2DWZ B;  2LHC A;  4AKH A;  4Q7J A;  4RKU F;  3VDP A;  4JI5 M;  3U6P A;  2CRU A;  2Y0T A;  3KOX E;  3F92 A;  4HL4 A;  5GKN A;  3SAV A;  1OQY A;  3RFW A;  3W67 A;  5ITU A;  2R4J A;  1QAQ A;  5IT9 S;  3HU2 A;  1S3S A;  3IG5 A;  2CEA A;  2DHR A;  4JYA M;  4FW9 A;  4LY6 A;  2Z4S A;  3LQR A;  5E26 A;  1YE9 A;  2FFJ A;  2Z4R A;  4AW4 A;  2J7O A;  1XHB A;  3GLF B;  4JXJ A;  5FTM A;  2HHH M;  4IBD A;  4LJ8 A;  4LF8 M;  4NXN M;  1XB2 B;  1EIJ A;  4JI7 M;  2EJS A;  2Q2E B;  1VQ1 A;  2X4A A;  4LZZ A;  1OJL A;  3GQ4 A;  2QBY B;  2XH9 A;  3FUX A;  2CV1 A;  1DGH A;  2MJ5 B;  3RE8 A;  3UK6 A;  4NXM M;  1I94 M;  2L4E A;  4L16 A;  5EP3 A;  1ZMU A;  2RGH A;  1Y8G A;  3UGJ A;  1NV9 A;  4R71 A;  2K6B A;  1N33 M;  1ZAE A;  2CWB A;  2HCB A;  3VDU A;  2L7H A;  3B7Q A;  3GO8 A;  1G3I A; 
#chains in the Genus database with same CATH homology
 3J7A S;  1D2N A;  1MX0 A;  4G4R A;  4FCW A;  3LVV A;  4BLC A;  3D8B A;  5IZ7 D;  4FVM A;  1L1T A;  3FTF A;  2UU9 M;  2UXD M;  5IWA M;  3C58 A;  2ZM6 M;  4RF1 A;  4D81 A;  1W5T A;  3JR5 A;  3E9S A;  3HKP A;  1PJI A;  3PXG A;  3B9P A;  4PT5 A;  5C1B A;  2CHQ A;  4LFB M;  1QYR A;  1W5S A;  3L27 A;  4IBC A;  1Z59 A;  1SXJ E;  2C98 A;  4R7G A;  2R62 A;  4GKJ M;  4PDI A;  4I5S A;  2Y20 A;  3JR4 A;  1JQJ C;  4JI4 M;  2BJV A;  2JA2 A;  3KXE C;  3FTE A;  4IBI A;  2DVW B;  4IJE A;  1T3T A;  3I51 A;  3M7G A;  5EQT A;  2YFQ A;  2OPF A;  3VK7 A;  1NJG A;  3SHG B;  2Y21 A;  2LXE A;  4JI3 M;  4W5W A;  2AHM A;  4IBE A;  4AG5 A;  1YUB A;  3A46 A;  1SXJ D;  2EO2 A;  3HU3 A;  1IQP A;  3KSJ A;  4GHA A;  3SAT A;  3FYD A;  3KS4 A;  2KA6 B;  1GVN A;  4MGH A;  3UZU A;  2DWN A;  2X8A A;  1HQC A;  1HT1 E;  4LF4 M;  5H37 D;  1OFH A;  3FUW A;  4GH9 A;  3K1J A;  4DR2 M;  1HNZ M;  4MGI E;  2QCU A;  4M9S A;  4DR4 M;  3JAM S;  4LF5 M;  1TDH A;  1IN4 A;  4LRS A;  1N75 A;  2LNH C;  4GIT A;  1HNX M;  3DOA A;  3HU1 A;  2XFT A;  2C5R A;  3HHZ A;  2XSZ A;  1IN5 A;  4MB7 A;  4DR3 M;  2CUZ A;  4S12 A;  4IBG A;  4II7 A;  4QOZ C;  1ORY B;  3KOZ E;  1N32 M;  3HHX A;  1FNN A;  2D7E A;  5KQD A;  4LF7 M;  4TUW A;  3U6Q A;  1DGB A;  4AQY M;  4FWH A;  3PFI A;  4X65 M;  2QPA A;  7CAT A;  5FTL A;  4MGZ E;  3KOW E;  3U5Z B;  1GL7 A;  4WW0 A;  3D8L A;  1R6B X;  1R2Y A;  4JV5 M;  4G4O A;  1KFV A;  2DWL A;  1E9S A;  3KP1 E;  1NJF A;  3E4R A;  4LGM A;  2OQ4 A;  2F4V M;  1NVM A;  3KDS E;  1Z5C A;  3HJS A;  4CHT B;  4NSR A;  5DNY A;  2M5Z A;  3U6S A;  5FSW A;  3TPZ A;  5FLX S;  8CAT A;  3T15 A;  2C9O A;  3K8Z A;  4DR6 M;  3FTC A;  4PCZ A;  4Z8X A;  2CHV A;  3LVW A;  1N78 A;  3SHF A;  1IN8 A;  3WHL A;  1IXS B;  3K92 A;  1GKI A;  4LF9 M;  3LQQ A;  3HJQ A;  3KVW A;  3HHY A;  1Z5A A;  4DR1 M;  4BBA A;  2DZO B;  4L4U A;  3U60 B;  1K3W A;  1YSY A;  3HJ8 A;  2CFO A;  1TH3 A;  3SBJ A;  2LWX A;  4RNA A;  3IG8 A;  3K2L A;  3GLF A;  5ITX A;  4LJ5 A;  4LRT A;  3GRY A;  1E94 E;  1XXH B;  4HLQ A;  1SXJ B;  2QBY A;  2EUC A;  3TWM A;  1NHG C;  4IIW A;  4MGY E;  4MGK E;  3PNV A;  2R18 A;  1QAM A;  3CF0 A;  5EP4 A;  3TWK A;  3R8F A;  4X66 M;  1DGF A;  2KRK A;  4REZ A;  4ITQ A;  5KPR A;  3VKH A;  3AV0 A;  3QAU A;  1HR0 M;  2HKJ A;  1TDZ A;  5KPT A;  2KXE A;  3GPX A;  1N77 A;  2QP9 X;  3EIE A;  1IBM M;  3L25 A;  3MK6 A;  2HL7 A;  4XGI A;  4YHH M;  4NL4 H;  3U6O A;  4CGY B;  2ZAN A;  2R4E A;  5KPZ A;  1IY0 A;  2VII A;  3GLI B;  2J7N A;  3U61 B;  3GRU A;  1JR3 D;  2R46 A;  5JI2 E;  3GLI A;  1DO0 A;  3U6C A;  2V1C A;  4NRW A;  1SXJ C;  1NY5 A;  1TGU A;  4G6Z A;  1L8Q A;  4LG2 A;  4G4N A;  2CV2 A;  1G59 A;  2A5Y B;  4FCV A;  3FUU A;  1QQW A;  5FTJ A;  4OVZ B;  1NHW C;  3AFH A;  2NQ8 C;  1TH2 A;  2YQZ A;  1I4W A;  2VQF M;  4IBF A;  4M9X A;  5EXS A;  3CF6 E;  2O5R A;  4B3M M;  3OTO M;  5E6J A;  4DUZ M;  1L1Z A;  3J7B A;  5C18 A;  4QOS A;  2H1R A;  4AZF A;  4M9Z A;  5ITQ A;  3GLG B;  2C99 A;  4DR7 M;  4KO8 A;  1NNJ A;  4NRV A;  3SMP A;  5EXP A;  3NBI A;  3U6L A;  2EA0 A;  4I4L A;  4LCB A;  3SAW A;  4GKK M;  1Z6T A;  2X49 A;  4OX9 M;  2ZAO A;  3R9X B;  4JI8 M;  2XF3 A;  2G5G X;  3SAU A;  3GQ5 A;  4GRI A;  1L2C A;  4BB9 A;  2UXC M;  5LMU M;  3T1Y M;  4EIW A;  4D80 A;  1WXQ A;  1G8P A;  3U6D A;  4QNR A;  5KQ8 A;  4GC9 A;  3VK8 A;  1XNQ M;  1FJG M;  1C1K A;  4QHT A;  2XZU A;  2DWM A;  4WUR A;  4DV6 M;  4KOD A;  4LZJ A;  4GMQ A;  4JI0 M;  4R3D A;  2VQE M;  5JI3 E;  2QZ4 A;  4G4Q A;  1R2Z A;  2RKO A;  1IM2 A;  5DYI A;  1Q3C A;  4JI2 M;  4KLN A;  1KYI A;  3A45 A;  4DV3 M;  3U6E A;  1IN6 A;  1XNR M;  3U5Z A;  3GRR A;  2L6O A;  5EP2 A;  3SYK A;  3I4Y A;  2P5T A;  4B7F A;  4M0D A;  3SFZ A;  1NNU C;  1DGG A;  2KW0 A;  2F5S A;  2ERC A;  3HGI A;  1UM8 A;  3FKE A;  1NSF A;  2ZAM A;  3J80 S;  2F5P A;  3J27 B;  4JI6 M;  3AKZ A;  2KRU A;  1XMO M;  4GHL A;  4K0K M;  2R65 A;  2YR0 A;  3CTW B;  2UUA M;  2KZU A;  1IY2 A;  3SMS A;  1HNW M;  3FTD A;  1MU5 A;  4PD2 A;  3U6M A;  3CF2 A;  2XFS A;  3GLH B;  4DV7 M;  4AKG A;  4NSO B;  4DR5 M;  2XLJ A;  1EE8 A;  2W82 A;  1E9R A;  3AOE C;  1XC8 A;  5A2Q S;  2BNK A;  2D7H A;  1IY1 A;  4MM3 B;  4D82 A;  4AG6 A;  3U60 A;  3FUV A;  2XZF A;  4A3V B;  1N36 M;  1NY6 A;  3W0F A;  2G8L A;  1Q39 A;  3GPP A;  1XWI A;  1ZQ9 A;  3DA1 A;  1XXH A;  5EJC A;  5FTN A;  1SXJ A;  4MH0 E;  4LFA M;  5FTK A;  1VDD A;  3THG A;  1X37 A;  2BJW A;  3UMM A;  1N34 M;  3M6A A;  1G41 A;  3T1H M;  4ZPX A;  3KSX A;  5KO3 A;  1IBK M;  3EIH A;  2YNM D;  2Y0Q A;  2C96 A;  3GP1 A;  2XSZ D;  3SYL A;  4CIS A;  1DGH B;  4LF6 M;  3H4M A;  4Z6Y A;  2Z3X A;  3TWL A;  3AOG A;  4B7G A;  4JN6 A;  4LJ6 A;  1QZM A;  4DV5 M;  3Q8X A;  2ZBK B;  3SC3 A;  1IXR C;  4L78 A;  3U61 A;  4FD2 A;  5BPV A;  1QAN A;  3NWL A;  3PNY A;  5EXT A;  2QEN A;  2CV0 A;  2LH0 A;  4P16 A;  2L09 A;  4NOO B;  3KS8 A;  1KSF X;  4X62 M;  3GPY A;  1LV7 A;  3FYC A;  2FE8 A;  4L8R C;  2V6Z M;  3VLF B;  2I7N A;  2DZN B;  4OVZ A;  1HT2 E;  3LMM A;  4QHS A;  2R45 A;  3W0L B;  4KHP M;  3M0E A;  3SAS A;  4QNM A;  3ZCB B;  2KEB A;  4OW0 A;  5ITT A;  5ITX E;  4AI6 A;  3FD9 A;  4I81 A;  4LJ7 A;  5IRE B;  3GLG A;  4DV0 M;  4L15 A;  4IBK A;  4LFC M;  2CE7 A;  4PDG A;  3L26 A;  4X64 M;  3L29 A;  3MHV C;  3L2A A;  4DV4 M;  2V1U A;  4B3R M;  4IBJ A;  3ZC7 B;  3HWS A;  3TE6 A;  3AJI B;  2UUC M;  3KFU G;  4LJ9 A;  3KW6 A;  3T38 A;  1PJJ A;  1IBL M;  1L2D A;  3VKG A;  2F5Q A;  2FOI C;  4LGY A;  4B3T M;  1J7K A;  4FCT A;  1K3X A;  3QWL A;  5DYG A;  3GQ3 A;  1XMQ M;  1L2B A;  4XBO A;  2UUB M;  4GC5 A;  1GLN A;  3HHW A;  1Q3B A;  1J5E M;  1OFI A;  5EXX A;  2F5O A;  3A42 A;  3GPU A;  3BOS A;  2L7I A;  3I4V A;  4LJA A;  1H6U A;  4OU7 A;  4LJ4 A;  4DV1 M;  4YY3 M;  1TH4 A;  2XEP A;  4DV2 M;  5F3W A;  3RGS A;  1IXZ A;  1HQY E;  3AL0 C;  3A98 B;  2C9C A;  1Z5B A;  4GIP A;  3J81 S;  3ILK A;  4B7H A;  1R7R A;  4M0W A;  4IJF A;  1PM5 A;  3DZD A;  2I7P A;  2FNA A;  2F5N A;  1DO2 A;  1E32 A;  3AOE A;  1IN7 A;  4IBB A;  3DFZ A;  2Z7J A;  3FUT A;  3KP0 E;  1QAO A;  4I8O A;  3ZH9 B;  4DUY M;  3VFD A;  5ITR A;  4AKI A;  5LMN M;  3MJ5 A;  4JI1 M;  1GL6 A;  1JR3 A;  4B08 A;  3WHK A;  1G4A E;  2E5L M;  2XGN A;  3SAR A;  3KOY E;  2UXB M;  4B3S M;  3L28 A;  3RGP A;  4FWD A;  3TL4 X;  3UJN A;  3GLH A;  2K47 A;  2M60 A;  4FWG A;  5ITY A;  3GRV A;  3J2P B;  5EP1 A;  2KZS A;  4RF0 A;  2DXI A;  2CHG A;  1QVR A;  2RGO A;  1K82 A;  2D7G A;  3PVS A;  3TQS A;  1J09 A;  5BR8 M;  2DWZ B;  4AKH A;  3VDP A;  4JI5 M;  3U6P A;  2Y0T A;  3KOX E;  4HL4 A;  5GKN A;  3SAV A;  5IT9 S;  3RFW A;  5ITU A;  2R4J A;  1QAQ A;  3HU2 A;  1S3S A;  3IG5 A;  2CEA A;  2DHR A;  4JYA M;  4FW9 A;  4LY6 A;  2Z4S A;  3LQR A;  5E26 A;  1YE9 A;  2FFJ A;  2Z4R A;  4AW4 A;  2J7O A;  1XHB A;  3GLF B;  4JXJ A;  5FTM A;  2HHH M;  4IBD A;  4LJ8 A;  4LF8 M;  4NXN M;  4JI7 M;  2Q2E B;  2X4A A;  4LZZ A;  1OJL A;  3GQ4 A;  2QBY B;  2XH9 A;  3FUX A;  2CV1 A;  1DGH A;  3RE8 A;  3UK6 A;  4NXM M;  1I94 M;  4L16 A;  5EP3 A;  2RGH A;  3UGJ A;  1N33 M;  1ZAE A;  2HCB A;  3VDU A;  2L7H A;  3GO8 A;  1G3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...