4AG5A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
374
Chain Sequence
b'SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRVFQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
molecule tags Hydrolase
total genus 140
structure length 374
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag5A01
4H1VA 1LNZA 1CLUA 4BGDA 1XXHA 2QZ4A 2ZI6A 2O8DB 2VF7A 3B13B 4C0BA 3R7WA 1OIWA 5GJCA 4MYHA 2ASEA 3RDPA 4CVNA 3ZGXA 4C2UA 2X19A 4PO8A 3WRXC 1BYUA 4U5XA 2BKEA 5JEDA 4QNRA 3TSOA 1TQ4A 2EW1A 2CK3A 4KU4A 4LGMA 2ZR9A 2FFAA 2WJYA 2JJ2A 3HPRA 1Q0UA 3QPVA 1FP7A 1R2QA 3LVRE 1IN5A 4A82A 4CF7A 3DKVA 4OL0A 4CEJA 4OQXA 1XCGB 1NSTA 3TGPA 3LW7A 3ZD6A 4ZCMA 4RZUA 3EWSA 3OAAD 4M53A 2WHXA 2HYIC 5E4FA 2GILA 3CX6A 1Q44A 4N0EA 2VH5R 1FMJA 1QDEA 3TQFA 4IFEA 4JVMA 2G9NA 2J0QA 4M1KA 4DDVA 1S0UA 4RZ2A 5HPYB 3O8RA 1KY3A 3DM5A 2QAGC 4S35A 3TE6A 3UG6A 1NLZA 2P67A 1NN0A 1I4TD 2GWHA 5DO9A 5FBLB 1Q1BA 4HAYA 1T0JB 1UJ2A 1XD2B 2NQ2C 3ADBA 1ZC3A 3Q3JB 4EPYA 4PQYA 2CJWB 2Q9BA 2AHOA 2YWFA 2W0SA 1OJLA 3KKPA 3NHBA 1E9FA 1GKIA 3EZ2A 3A1UA 3TUJC 3RVBA 4JLOA 3RS5A 3DMDA 5F98A 1EFHA 2HF8A 1KNXA 5FR1A 1UADA 1OH6A 2PJRA 4D4JA 1VCOA 2F3TA 4LWZA 1KHTA 5DI9A 1G7TA 4C4PA 2B8TA 3HWSA 4Q21A 4DCSA 4D4LA 2WIAA 4K46A 4TL6A 3H0KA 3SE0A 2HXYA 5SZJA 2WWGA 4JLVA 2RKOA 2GXQA 4KFTA 1WE2A 4NH0A 3WMGA 3CRRA 2HEIA 2YOFA 5EE0A 4ZPXA 4Q4JA 4EDHA 4P4SB 3T1QA 3OEED 5EUQB 2PCLA 3RC3A 3AUYA 1EWQA 5FUXA 4QGAA 3LV8A 5JZVA 2TMKA 1TQDA 5GJWC 3EPLA 3I92A 1G3RA 3QKSB 1HH4A 4PPNA 1UM8A 3PEUA 4IOLA 4HAVA 3SYNA 2ZU6A 1CEEA 1YZNA 2ZRJA 2CMKA 3AF3A 4NL4H 2EYQA 4Q4HA 1SXJB 1EX6A 3T06B 1KI8A 3T12A 3TQCA 1YR7A 3GEEA 1HT2E 3WHLA 1E94E 2I1QA 2Q3MA 4F92B 1OE0A 2BMJA 3OE7A 4QGFA 3TR5A 3GP8A 2REOA 5JRJA 2N42A 4QGGA 5C4MA 1NVVQ 3CNLA 5JJKA 2FPMA 1HQCA 1KK0A 2LKDA 2H18A 3MUFA 3SYLA 2WMOB 4JLPA 4JLKA 1JJVA 4PPQA 2X1VA 4C0KA 1YJ5A 1MO6A 5TV2A 2IEYA 2QTVB 3FPAA 4LV5B 4XIGS 3W6OA 4DLTA 3U44A 5HE9A 2BHRA 2ZRGA 3KKMA 4KJZA 3ZS9A 2QPOA 1GIAA 2JGNA 4GOXA 4CT4B 2F7SA 4B2IA 1MABB 2VPPA 5EZ5A 1GZSA 2IXFA 2CL7X 4Q4AB 1HQYE 3UPUA 1AS2A 1U2RA 3RHFA 2EYUA 1CBUA 1ZAKA 1V5WA 1W2HA 3W5IA 3QSYA 4DLWA 3A6PC 3GLHE 1Z2AA 5E7MA 1MO3A 1KI2A 4BLTA 3GD7A 1YVDA 2FV8A 1A82A 5CM9C 3AF4A 3QBVA 1VYUA 4TSFD 5CB8A 4PO9A 4Q1FA 4L9SA 4RFSA 3R9XA 4Q9LA 3LX5A 4M9QA 3WXMA 3KQUA 4AC9A 2CCGA 1NLYA 1ZNXA 3CNOA 2HDNB 2IT1A 3DKPA 4B74A 2HCBA 3CR8A 3BERA 5HE8A 3WYFA 4M1OA 2DYKA 2VA8A 1HURA 3ADCA 5KDLA 1F2UB 2KI5A 2ZJ2A 4IVPA 3EG5A 4R7ZA 3K70B 1XCPA 1OXTA 1N0VC 2GAOA 4IKEA 3KXLA 1R10A 2WPDA 4PHFA 1DG3A 2ATXA 1GRNA 2OHFA 2WKPA 5P21A 2GHIA 1ETUA 4HDOB 3CX7A 4TLDA 4TMWA 4A0HA 2FMXA 2JASA 4QNMA 3AM1A 3D8BA 3KQHA 3I5YA 3AVQA 4PAOA 1SVMA 5CJPA 3SHFA 1FL9A 2LCFA 1OYYA 1G3UA 3ICQB 3KUDA 2AKAB 2JLQA 3DOEA 4L9WA 2MSCB 3FMPB 2OBLA 4V02A 2Z5FA 2AKYA 2B8WA 1Q1QA 3SJZA 1MO4A 1OHHD 2GCNA 2G1JA 1H8HA 2JJ8A 3WRYC 2VF8A 1KKLA 4PC3A 3SQWA 2D2EA 3ND9A 3UMRA 4DT1B 2QEQA 4EJSA 1N6PA 2DWPA 2VTKA 1YE8A 4XTCS 5FBWB 3RRYA 5M04A 5FI0B 4HZUA 1NN1A 3GJ0A 1CRQA 3GJ8A 3EIHA 1J70A 2K5UA 3RS4A 2O5VA 1ZM2A 1UDWA 1RPZA 5ELXA 3LBIA 3B1YA 4WZAE 1OF1A 2CNWA 4BZPA 1II8A 3NEYA 4NBSA 4WA7A 1U99A 4QKQA 1OFHA 4B71A 2IYXA 4LZZA 4EJSC 1NI3A 5HKKA 3QF4A 1IOZA 5KUTA 1A4RA 4YXWA 3RSLA 1IHUA 5LBIA 1P6XA 4RFVA 1DAKA 1H8EA 1QG2A 1ZM3A 5DN6D 2HLDD 3DZ8A 1XEWX 3TW4A 4W9MC 1E2GA 4UNNA 1UKZA 4RKEA 3GQBA 2ZYWX 2CBZA 4ZI3A 3NBYC 1L8QA 1YU9A 4OQNA 3THWA 1U0LA 3WBJA 4JJKA 3E1SA 4C0AC 4Q9HA 3CIOA 1RVDA 5L3QA 2H16A 1CJUC 1N6OA 4XOIA 4HB4A 3GLGE 5BYKA 3ZVNA 2MMCA 5JSZB 5F9FA 2NO9A 2D7DA 1ZD8A 1ZNYA 2R6FA 4NYJR 3VX3A 4EPXA 2NMVA 1G5TA 2LKCA 2QRNA 1E4VA 2XTZA 2ZJZA 3BXZA 3U3RA 1OB5A 2O8CB 1DTSA 1CJTC 3CM0A 4CZ2A 4TLBA 3AVXA 1N2CE 1GDDA 1XD8A 1T5IA 1G7SA 3I32A 1C9KA 2OO7A 1NJFA 4GI7A 3K9GA 4W5JA 1EFRA 2AD1A 5KOYA 1GG2A 1Q12A 1NP6A 4KSBA 1IN4A 3FKSA 4K8OA 1KDRA 2QBYB 2IK8A 2RGAA 2ZETA 4JT2A 3U3MA 2XXAA 2R9VA 1G18A 2CVHA 1AS0A 1TAGA 1U9IC 3B6EA 3OZXA 3RS7A 1YZUA 2J3EA 1KK2A 3CUEF 3F8TA 4RD1A 3VHXA 1KJZA 3VR2A 3QOFA 5F2EA 3O47A 2Z0MA 4TQ9A 3I8XA 2PJZA 2ODNA 3B2EA 5IHPA 4LJAA 2FFBA 2NPFA 1SVLA 5EP4A 3RANA 2VHQA 3BBPA 2CL6X 4C0HA 2J0UA 1DG1G 1M74A 2BIFA 2F3RA 3QNUA 1MKYA 3UXMA 4W5WA 5IK2D 1W36B 2RGXA 1E98A 2DY1A 2GJ8A 5L3VA 4P4UA 4TTRA 2PL3A 2OCBA 3KKOA 2J7PA 2YHSA 3CRMA 4PQRA 2ZRHA 4F4IA 3AVYA 1NBMD 1OLOA 1JPNA 2O8FB 3GPLA 2J41A 2ZJYA 2YJTD 2ZE5A 3RSOA 3GJ3A 2D2FA 1JXMA 4AKGA 3HR8A 2AWOA 2QMHA 3L43A 4W5HA 1NY5A 2NTYC 1VECA 5DI3A 2ANCA 1G41A 1Z22A 3NH9A 5FL7A 4ACBA 2BDTA 4R98A 3K9LA 2A7QA 2V8OA 2OXRA 5CM8B 4QJ5A 2P65A 4D4MA 2IUTA 4BFTA 3NWJA 2GJAA 2GVZC 3IKJA 3MMPA 1M8PA 4Q1EA 3L82B 1KOFA 4HB3A 4UNSA 4BLOA 2QL6A 3UMSA 1VMAA 1DO2A 4I99A 4XWOA 1YKSA 2CCJA 4Z1MD 3B85A 1E2HA 1FQJA 4NP6A 4QL3A 1LV7A 1DPFA 4HAUA 1IXZA 1UEJA 3C5HA 1CRPA 4LHXA 1E2EA 2IYZA 2VYFA 1DAIA 4LK2A 5GJBA 4Q4LA 3W34A 2QGZA 4MYUA 5HTKA 1KI6B 4KBGA 4QOSA 2WZQA 2FFHA 1NN3A 1UEIA 2AX4A 2FSFA 1IXRC 3G5UA 4CEIB 1XEXA 4HDCA 4P4TA 5KPJA 2ZRBA 3ZLJA 3EPHA 1P9WA 1WDTA 3QBTA 1KYIA 1XTRA 4TQAA 1DADA 1D2NA 1W4BA 2YWHA 3I8SA 3W6PA 3IIMA 4FN5A 3R9WA 4DHEA 1ZBDA 3NVAA 4JIMA 4CYMA 5FR2A 1SZPA 3ASZA 2O0JA 3NEJA 2IYTA 4B75A 1SQ5A 2O8EA 2ATVA 3A4NA 3W3AA 4LHYA 4DDUA 2V54A 3CX8A 1W49A 2PZGA 3F0TA 3RWOA 1Z0IA 3GJ5A 4JLJA 2A9KA 1T91A 5JHHB 2D3WA 3RWMB 2GJSA 1QBKC 5J4HA 1ZUNB 3T5DA 5EE3A 4IJMA 4GDFA 2GRJA 1KJWA 2Z4RA 2CLSA 3FB4A 5FPHA 1XTIA 3ZIAD 2VP4A 3EXAA 3BIFA 1TQ6A 3WHKA 1KTVA 4BLSA 2ZANA 2QE7D 3FE2A 3P4YA 4HLQB 2IYQA 4B3CA 1BMFA 2PBRA 4LC1A 3W6NA 5DISB 2Q3HA 3PENA 4LX0A 4NHOA 4Q7KA 1OSNA 1R5BA 4RD4A 1P73A 2QENA 1RC8A 2AL7A 3OESA 5AUOB 3FYHA 2OSBA 1MT0A 1KI1A 4Q66C 1ZIPA 3CRQA 2BJWA 4A6PA 3K0AB 4D0LB 4EFLA 2HV8A 2Q6TA 1XZQA 3NHAA 3GLFB 5AUPB 3ADKA 3QI2A 3CW2A 4Q7JB 5FPKA 3TLXA 3P4XA 4DIDA 6Q21A 2XEXA 5CK5A 5DYIA 3W9YA 1XU4A 4DCTA 4MKHA 2IWHA 4FXPA 5C4GB 4EPTA 2I4IA 2RB4A 3VAAA 4WAUA 4A92A 4O2RA 1RIFA 4V03A 4Q9KA 2ZIAA 4F4JA 2PMDA 4IDHA 4PAMA 4ZV4A 2FEMA 2WVJA 5BYJA 3MRSA 1KZGB 3GCGA 1DS6A 1R8QA 3BOSA 1KO7A 3C14C 3IQWA 3AF0A 3LNCA 4GP7A 3DZDA 4IVRA 1KO4A 1N5IA 2GK7A 4WXRA 2P5SA 2C03A 2V6JA 1W0KD 3IPYA 1ANKA 3LBHA 1MO5A 4RD6A 1TNDA 3NBZC 3TSWA 3DMNA 4M1WA 4F4CA 4PSAA 1NBME 3EW9A 4OK6A 1Q3TA 4MGYR 5LB2A 2ZE8A 3A58B 4IXMA 3GLHA 3HU3A 2CHVA 3KTAA 1JQLB 1O3YA 1XCMA 3CNNA 4TL9A 1G3QA 4B3FX 4AK9A 2OCAA 1ZCBA 2VO1A 1R0WA 2Q21A 1QZXA 4DLRA 2OUKA 1W2GA 4L16A 4B43A 1P75A 1AA9A 2CE7A 1PLLA 2OCYC 2C99A 2QMEA 3ZS8A 1MOZA 2A30A 3U5ZB 5IDVA 2ZEJA 4PHHA 4TN1A 4B6FA 4LJYA 3IEUA 4YMTA 3IPXA 2ZR7A 3E70C 5HCNA 3O8BA 2ZRCA 4K81B 4Q1AA 5GVSA 4TYNA 1W5SA 1WF3A 3HR7A 5BN3A 1XJCA 4HSEA 1KMHB 1XPOA 1GL7A 1AZTA 2QPTA 3IDQA 1PUJA 1NJGA 3LQRA 2D74A 3BC1A 3QKRB 3QUSA 2IYWA 2W58A 2YNMA 1EG7A 4R9UC 4TT3D 4WOPA 4ZKEA 2B21A 1DVRA 3AVPA 3FOZA 2C5LA 3RYTC 1RYFA 4I81A 1GUAA 4NDZA 3PCRB 4C0QC 1JI0A 2JLSA 5F3WB 1OYWA 3LQQA 1E2MA 3KJHA 4HAZA 1HYQA 4KHZA 1ONBA 3B8HA 2QTFA 4OI1A 1CF4A 1W4RA 3R20A 4OKSA 1OFUX 1R5OA 2ZI3A 5C1BA 2E87A 3CLVA 1G5RA 2XZPA 1R4AA 3AKEA 4EAQA 2RCNA 4D6PA 3QXHA 3S1AB 3K9HA 3SI7A 3U3JA 4JVNA 4LSGA 5JI2E 5LPNA 2GCPA 3HP1A 3RAPR 2ZI7A 4M1TA 2FSGA 4EPVA 2W6JD 1K8RA 1SKQA 1UDXA 5AJXA 3CPJB 3U4QB 4KVGA 3FVQA 4KFUA 2QQ0A 1XJQA 1HV8A 3UK6A 2WWHA 3IBYA 2VHTA 5KNBA 4Q7LA 1GAJA 2FG5A 5L8VA 1PVOA 3DO6A 1G3IA 4TYPA 3IHWA 3REFA 3SJCA 2NO6A 1Q1ZA 2P6RA 2EFDB 1KSHA 1ZD9A 4A2WA 4ACAA 5GVRA 2WV9A 3ICEA 4U02A 3OEEA 1KAGA 2VP0A 5AK0A 2GEVA 4JMPA 4B2LA 4KITB 5IF9A 5KSZA 3DL0A 1GOTA 3IO3A 3CF0A 1Y63A 3HPQA 2OFWA 4X8OA 1YZKA 1N0WA 2BBTA 4JLNA 5DLQC 5SZKB 3GFTA 4TLCA 4LYAA 5J4KA 4NZYA 2W2XA 1X1SA 5DSZA 4DB2A 1M7GA 1FQKA 2P5TB 3J81k 1YR9A 4LC0A 2A2ZA 3K53A 4DCNA 2J7KA 3CH5A 3GLGA 1AM4D 1FNMA 3R7WB 3MJHA 3PEWA 3AVOA 4IOMA 1G16A 1ZUIA 2O52A 2ZUBA 3MG9A 1OH7A 1OT3A 2ZS9A 1RRGA 1F2TA 3EPJA 2BWJA 5KU1A 1NSFA 3U61B 2B7BA 3GFPA 2ZRPA 3TBKA 3OEHD 3IEVA 2Y8EA 5J4VA 2IX3A 3W8RA 2ZXUA 4B6EA 1ESMA 2QAGA 1I2DA 1SKYE 1XJ0A 1Y3AA 1E1RD 2ZI4A 1DAMA 1QHHA 1SVWA 4IOJA 4CEJB 4XSHA 4BFYA 2PMKA 4WIAA 1FOEB 4B35A 1KI9A 1Q22A 5A0FA 1XBTA 3LX8A 3GLIE 1W5TA 5FH9A 1N6KA 1JAHA 3Q5DA 1HT1E 1VCMA 3EIQA 1X1RA 4M22A 4PC2A 2WOJA 1BO6A 1NIJA 2XJ4A 5TDHA 4B3DA 3RRZA 3AGQA 1EX7A 4WZ6A 2CVFA 4US2R 4Z51A 2GJ9A 4I1OA 1MRSA 3IQXA 1WB9A 4TSFA 4ZI2A 2V7QA 2W00A 2NGRA 3K8YA 2QTHA 1U98A 3LAWA 3SJBA 1A5TA 2F1HA 2IEZA 5FI1B 4Q19A 2QP3A 3NH6A 4B44A 4LV6A 3TIFA 4YMUA 1P2VA 1G64A 3HU1A 4AD8A 1ZYUA 5CIWA 4N3NA 3IIJA 4FCTA 3W90A 1N6IA 2EQBA 3MD0A 4ESVA 2A5JA 1YZQA 4DDTA 4D25A 4URWR 3AVUA 1UKVY 1Q20A 3OHMA 3K09C 5DNYB 4P31A 5KNCA 4MDFA 5KSPA 1OKKD 4URXR 5KDOA 1CJVC 2C98A 1IAQA 1NIPA 1XD2A 1QVAA 5JCPA 4BFUA 2OM2A 4Z8XA 1UKEA 1GNRA 3WYAA 1DE0A 3AP2A 3EZ7A 4HDQB 2O8BA 4KO8A 4B2PA 3UWKA 1JR3D 2JEOA 4B32A 1TF5A 3JVUA 4EKDA 5KDDA 2J9RA 1FX0A 4E03A 2FA9A 2AFIE 2UVQA 2Q0HA 3C16C 3I73A 1OHHA 1W46A 2GEDA 3KKNA 4O25A 1DAHA 3PQCA 4KSCA 5G3ZA 5JWRA 4OI0A 3NG1A 2F1IA 1AQYA 4DIEA 2I1VB 4M9ZA 4O2LA 4X8MA 1E2PA 4Z54A 1E79D 2JJ1D 2ZSFA 5FTNA 3A8TA 3WMEA 2OILA 4ZDJA 3G82C 5FUYA 1G7CA 2ZM5A 1YRAA 2QU8A 2ZI5A 3A4MA 3NC0C 5JFGA 3CPHA 3A36A 1XP8A 2VRWA 2ZUCA 5BWMA 1E9CA 1JNYA 4DWJA 5JS7A 5D3MA 2GZDA 3VR5A 3OF5A 3SFZA 1OPXA 1U81A 4Q02A 821PA 1NMZA 4XVRA 4D81A 3WBKA 3K0CA 1GSIA 4ASUD 4BFXA 3N5CA 2P3SA 4QBFA 1VHLA 3WP0A 3TVDA 2ZAOA 1G8PA 5DN6A 5AWFC 2HLDA 2VSFA 5TB5A 4B3BA 4OK5A 3D6TB 2ODBA 4UJ5A 2XAUA 2GJKA 4DEXA 5AJWA 2VHJA 3CKLA 3SZRA 2ANBA 2DHRA 3RC8A 2R6DA 2RHMA 4XH9B 4TYQA 2J5XA 1AGRA 2HUPA 1OXXK 2XB4A 1CR4A 4UNRA 1TU3A 1KO5A 3PR1A 4C3ZA 5FOVA 2OE2A 2G0TA 3H4MA 1CP2A 2ERYA 3K0CC 4JBXA 2CDNA 2NZJA 4MUAA 1FUKA 1VTKA 4RFSB 3MAAC 2GXUA 1NY6A 2DCUA 2DFNA 3BB3A 4HAWA 2ZS8A 5SZIA 2DWQA 3K0FA 3OIUA 4WW0A 1W1WA 2B6HA 2JIZA 5IRCD 2F55A 3DEFA 4GT1A 2VHUA 4TQUS 3IHLA 2V55B 2XZLA 2NOAA 4BRWA 1IY1A 4EPRA 1D2EA 3THOA 1UAAA 4LJ5A 5EP1A 3AVVA 3SU8A 4BEJA 2J1LA 4NONA 2WOOA 1RZ3A 2IBMA 2IWRA 5EUMA 3KDSE 1CR1A 1NL3A 2WICA 4ARZA 2JDID 5LD2B 1OXSC 2BBSA 1T8UA 5FBQB 3ONWA 4TMXA 1ZMXA 3DPUA 4NCJA 1OB2A 2ZJOA 3VR6A 3KJEA 1JBKA 1XEWY 2QP9X 1ZU4A 4DLUA 4JSTA 5EE1A 2ZRKA 4LHVA 1KK3A 3G0HA 1G4AE 1C1YA 2G77B 3JVVA 8OHMA 2OCPA 1L7VC 4MRSA 1XTKA 4DC9A 3I72A 4YDHB 1IN8A 121PA 2FU5C 1F2UA 4XWKA 2BOVA 3EIEA 5TARA 1TX4B 2VSOA 3TH5A 1CU1A 3F5FA 5IK2A 5DHAA 4EJSB 2IYLD 2WJJA 4H9GA 4XJXA 1ZM4A 4Q03A 1IN6A 1CJKC 4R2IA 4NYIQ 2FH5B 3CZPA 4DUGD 2DPXA 2HYDA 1ZJ6A 4YMWA 2QMOA 2BBOA 3VQTA 1NBMA 4FMBB 2VLIA 1CS4C 1IJEA 4IDPA 5J4YA 1XWIA 4TMZA 2EU8A 2NIPA 2RGGA 1A1VA 4QM7A 4IOKA 4TTPA 3AGPA 5C2JB 1II8B 2UZIR 1ZINA 1DEKA 1N6NA 3CO5A 4P32A 1AK2A 2GESA 1P61B 1NMXA 3KL4A 3QF4B 4G5GA 4BZQA 4HB0A 3H84A 2IYVA 4QBIA 2YOHA 1T9HA 1S96A 1TF7A 4LYJA 1J2JA 4DT1A 5CIQA 4QRHA 1SXJD 1AGPA 3HU2A 1IXSB 3CWZA 4IRUB 4NMMA 4I1VA 3WNDA 3V9PA 3EAQA 1R8SA 1JR3E 2AK3A 4MQBA 5JLJA 3CBQA 4C2TA 1Z0AA 4M2LA 4FCWA 5FL3A 4KLNA 4Z1MA 2ZITA 1UFQA 5AJZA 2IYRA 2EFEB 2NPIA 5L3QB 1XF9A 1OV4A 1X8JA 1XMSA 5EE5B 4B34A 4GRAA 1G8HA 2IYYA 3QF7A 4FD2A 5JJLA 1UPTA 4Q1BA 3X1YA 2JLXA 4XD7D 1VIAA 4GP6A 1X6VA 1FUUA 4JBYA 1Z83A 2ZVPX 1LFDB 3A1VA 3T1OA 5L3SA 4KBFA 4GFDA 1U9IA 2SHKA 1RRFA 2IW3A 3LLMA 2GA8A 1JAIA 5KYKA 5JHGB 4OQMA 1D9ZA 1IY0A 2GXSA 3U3KA 2WTUA 4NYMR 1CXZA 4TYYA 2EFGA 2HXSA 2ZYVX 3PUXA 2OAQ1 2V3CC 4DZZA 2ZS7A 4CRWB 1EFCA 2XXAB 1S4QA 3BE4A 3U6KA 1ZIOA 2ZI9A 5FUWA 1YR8A 2GBLA 4PC1A 5JSZA 2EWVA 3IIKA 4Q18A 2XOKD 4B47A 3AKYA 2ZE7A 4EPWA 1XPRA 4TLEA 2R8RA 2JLUA 1CIPA 3MJRA 3Q72A 3MWKA 4FI3C 4M4SA 1T3HA 1Q21A 3BH7A 3FHOA 4C9BA 2J0UB 1OH5A 3GJ4A 2G83A 5DH9A 3PEYA 1Z5ZA 4L15A 3ZIAA 4OJKA 2D7CA 2FN4A 1P2TA 3AP3A 4IDNA 4C0LA 3K70D 2RGEA 2XTMA 2A3RA 1TEXA 5B64A 1W0JD 2QE7A 3U7EB 2GBLC 1VIYA 1E9EA 2A5DA 2FSIA 3EARA 1GRRA 3GEIA 2PZFA 4Q01A 5H1YA 3ZQ6A 421PA 2KSQA 1MV5A 4WZBE 3THXA 4IEEA 2X2EA 2YV5A 1EWRA 1G8GA 1R0YA 1KMQA 4KV9A 4C0JA 1FP6A 4LYHA 3QPWA 5KHOC 2F43B 1K5GA 3SFVA 2J45A 3ZH9B 2ZROA 2CHGA 2GVDC 1CULC 1F3OA 3ZJYA 1LF0A 2XSZD 3THYA 3BRWD 3D7MA 5BN4A 1P9NA 2X77A 3KFVA 2WM9B 3L0IB 2KE5A 4FMCB 1X3SA 1F60A 1ZNWA 1IY2A 1S9DA 4KFSA 1T6NA 2C95A 4G3XA 4LPKA 3QVUA 4URUR 3ZZTA 1TL7C 3KB1A 1AKEA 3FMOB 4CEHA 3PEVA 3OIVA 1WBDA 3H1TA 1XX6A 4I1UA 1Q3HA 1RRCA 3UATA 5AJYA 1SGWA 1U0JA 1R6BX 2ERXA 1WXQA 2GK6A 3BFKA 1GM5A 5JMTA 1U94A 4D2IA 4A4DA 3H2YA 3O8CA 3GJ7A 1GL9B 2IC5A 4LJ7A 4MKFA 1F6BA 2MMGA 4LJ9A 3TUZC 1JXOA 2R6AA 5B57C 1YRBA 4Y0AA 3LH5A 2HJGA 2FJUA 4M1SA 1E0AA 3GLIA 4HUTA 1W0KA 5CYPA 1M7BA 2P0EA 2OXCA 3AF1A 4RD3A 4JLDA 3SR0A 1XEXB 2O0KA 4MKGA 1K6MA 1A2KC 2O0HA 3T1VA 2IS2A 1G291 3AV0B 4OBEA 4PAQA 4PHTA 1KI3A 4ESHA 3I5XA 5JBQA 2IXGA 2IUUA 1I4LD 5BW8A 4KVAA 4AWXA 3CH4B 2EFHB 3B1XA 3UG7A 3EC1A 2O8EB 1OFTA 2CLDX 3PG5A 1T5LA 2BCGY 2GAAA 3SBEA 1FNNA 3I3SR 5EXSA 1AN0A 2ONJA 1E2QA 4JYBA 1XD9A 4B76A 1YZLA 2QT0A 1SXJE 3GMTA 3LXRA 3B5JA 3B9PA 5G41A 1J99A 1GKUB 1OXVA 1VG1A 1IJFA 2YKGA 1B0UA 3DDCA 2XB2A 1TPZA 3B82A 4G5RA 1QG4A 3TR0A 3AUXA 3LLUA 2Z4SA 3EPKA 3P32A 2GEUA 2PT5A 2VSXA 4AYWA 4HATA 2GNOA 1D5CA 1SVKA 3ZQJA 1S8FA 4ABYA 4QJ3A 1E9AA 1DAEA 4R2HA 4RSGA 3Q7QA 4FW9A 3U7FB 1YQTA 1Z6AA 3IUYA 5KTYA 2LWIA 4NCKA 1F5NA 4UNQA 4OK3A 5FPSA 1GVNB 1NVVR 1ZP6A 2PEYA 1FTNA 3T34A 3BK7A 1X8KA 1UBCA 2QAJA 2QUZA 4FMDB 3ZVRA 2QM7A 2QM8A 4LBWA 2QORA 2AR7A 4KYIB 4QGHA 1KGDA 2OLJA 4ITRC 1TQ2A 3TJZA 2NO1A 4TZ0A 1J90A 3IGFA 4ERNA 4JKYA 2PT7A 1J8MF 4UKDA 1TTTA 2G0NA 3AP1A 4TL8A 2VP9A 3WNCA 5LDDC 1P3JA 4KAXA 4LOAA 2H7VA 1NN5A 4IHQA 5B30A 3VNUA 2VEDA 1W36D 3W3ZB 2W6JA 1HE1C 4CT5A 2ZUDA 3TAHA 3X1ZA 5FTJA 5LB4A 1ZUHA 2JLWA 1COWD 2XTNA 1E9BA 3V4FA 1GP2A 3LDAA 1YZTA 4MRRA 4MYCA 2REXB 2CXXA 1M7HA 3EZFA 4KLZA 1U0HC 2IS1A 1NVXQ 3K0AA 5FOTA 3C4JA 4BQSA 4DSUA 2WIBA 4FIDA 1JEDA 4KFRA 4XWAA 3W8NA 2W83A 3VHLB 3ZD7A 4AYTA 1HUQA 3TK1A 1SVOA 1GWNA 3IBGA 1NKTA 2CL0X 2GCOA 3FFBA 5G3YA 4NKRA 4JJZA 4P33A 4PZYA 2FNAA 3KTAB 2RH5A 2AFHE 4C7OA 2D4HA 4V0KA 1GKYA 2AWNA 3PJRA 3VU9A 2XNDD 2R6CA 5HZHA 3UKDA 4FWTA 3C5CA 1P62B 1U8AA 2DR3A 1E69A 1KDOA 4DEYA 1VCIA 2GTPA 3I62A 2OAP1 3SBDA 4QJ4A 2PEZA 1S3SA 1E99A 1XNJA 4AURA 1GNPA 2GXAA 4H1UA 4ZO4A 2W2TA 2DFLA 3FDIA 1Z0DA 3KJIA 2Z43A 2IS6A 4EUNA 1XB2A 5FOUA 3SOPA 5C46F 4G5OA 3OEHA 1UBEA 3Q7PA 4Q1DA 4ZCLA 4EIWA 3KQLA 1US8A 1XEFA 4ZIRA 1KZ7B 2FX3A 4MGZR 3CB4A 1E1RA 1XMJA 1OXUA 2QP4A 1XMVA 1DOAA 3M4YA 1AKYA 3AEZA 5GJVC 4ZDKA 1LVGA 4MRVA 2ZJ5A 2D62A 5C18A 4OHWA 4O3MA 4HUQB 1RJ9B 1QHNA 4HI0E 5KNDA 2BCJQ 2WKRA 3UWOA 3OAAA 3SJAA 1BYIA 3V4RA 4HLUA 3ZZ0A 4LRWA 5JWHA 4HYYA 2Q9AA 3V00A 4A8JA 2V1UA 4UXIA 2AXPA 2ZTSA 1XPUA 3GJ6A 4GNKA 2ZSBA 1Z08A 3K0SA 3ECCA 4RZXA 5EQTA 4E22A 1S2MA 4NPHA 2JLVA 2CCKA 1TUEA 1S1MA 4JKIA 1LB1B 1MR3F 2UKDA 3RNLA 3K0EA 1AZSC 1HEIA 2ZPTX 4MITA 4NTZA 4LI0A 2C78A 2IYSA 1XMIA 1H65A 1T3LA 1ELOA 3TSZA 2PX0A 3QJYA 4QHTA 4HLUC 3NXSA 1PUIA 3HYTA 2GF0A 1P72A 4XSGA 3QKRA 5CK4A 2WWIA 3GEHA 3PUVA 3UIEA 4A8JC 2J59A 3E2IA 5H70A 3AQ4A 1J8YF 1E1QD 3ADDA 4GOKA 4YMVA 1G1MA 4JYCA 1RW4A 2GF9A 1E2NA 4ILEA 4L4UA 2DBYA 3EA5A 1OIXA 1JPJA 4OHVA 1G21E 4DLXA 1JQJC 2PX3A 5J4LA 1N6HA 2JAQA 1OKKA 3QIAA 4BFZA 4A2QA 1SVSA 1D9XA 1VDZA 2KBFA 4HZIA 1KJYA 3QEJA 4YLGA 2R6GA 2ZVQX 5DGXA 1I2MA 2YYZA 4URYR 3CRVA 2FOLA 4GOJA 1O87A 1N6RA 2ORIA 3K9NA 3U6BA 1W4CA 3L0OA 3S1AA 4JL5A 2OFXA 2OZEA 1ZRHA 4LJ8A 2C9OA 1JR3A 4NYJQ 2AN9A 3OFND 4GBMA 5J40A 1IM2A 2WSSD 4RVCA 4E09A 3B1ZA 1X86B 2J87A 2XX3A 3DVLA 1PLKA 4KI0A 4MYTA 1GL6A 5KSOA 4EQ6A 2NO0A 2RGBA 3GLGB 1XXHB 2E1RA 4JS0A 1U90A 2WJHA 4S2EA 3LWNA 2OV2A 4F93B 1E79A 2JJ1A 1ZM7A 4ZKDA 1R7RA 1E96A 4U7DA 2ZQ5A 3TUIC 2JLRA 3ASYA 2A78A 3CF6R 1LY1A 1E2LA 4LPSA 1E9DA 2F9LA 3L8ZA 3BFVA 1Z6GA 1F2TB 1WBBA 1VG8A 3BGWA 3AH8A 3BAFA 3SHWA 3FTQA 2A5FA 4PXAA 2QAGB 2QI9C 2C2HA 1NG9A 3SN6A 1PV4A 2WJGA 3F3YA 3MLEA 4A6XA 1QHHB 4US0R 4XVQA 2OT3B 2YC4C 1IONA 4F7WA 1YHNA 4ASUA 2ZREA 1TF2A 3AB3A 1MRNA 4Q5IA 1QHYA 5CJ2A 1M1YE 1OFIA 5G40A 2O8DA 3AF2A 3OIYA 4FMCF 1C4OA 4D4KA 2J0VA 1ZVQA 2J46A 2AXNA 1FW6A 3W5JA 4MH0R 2HT1A 3K1JA 4ON9A 4LHWA 1KY2A 3Q85A 2RGNC 3QY0A 1NVWQ 3CONA 2F1JA 4DXAA 1DELA 5B58C 3VTKA 2HCJB 2BJVA 1LS6A 3K09A 4GZMA 4BEBA 1J7KA 4YONB 721PA 3A4LA 5A5GA 2UZ3A 4D0GA 1P4SA 2W6ID 2CEAA 2WKQA 1JJ7A 4GPTA 2IHYA 3L0PA 1Z6YA 2YZ2A 3NIBA 1ZW6A 2VL7A 4M21A 4X8HA 2ORWA 4FWIB 4II7A 4IXNA 3EC2A 4PANA 1UBFA 1AJEA 2V9PA 3AKDA 3WNBA 1G9XA 4YMSA 4BE7B 1SVIA 3VR1A 1HTWA 2WSMA 2ZRAA 3IO5A 1S9HA 2JDIA 1N5LA 5AUQA 3VR3A 1PLJA 1Z47A 4Q4JB 4AI6A 3AVTA 4PSKA 5BQ5A 1P60A 3U2QA 1M34E 1RKBA 2O8BB 1SHZA 1KSJA 4IVQA 1XTQA 2CJWA 2RHDA 4L5BA 1P2SA 2NO7A 1AIPA 3QXXA 2P2LA 1KK1A 1E0KA 4QBHA 1FX0B 3X1XA 1W48A 1FTSA 2OEPA 5H68A 3L0SA 5K8LA 4IDOA 3A37A 3ZYCA 4M1MA 4TTQA 4HLDA 4TMVA 2ZRFA 4N1AA 5CDFE 4WVFA 3PV0A 3JZAA 4Q4HB 5FTLA 4G01B 4PPGA 3T61A 3U7HB 4CDGA 2FF7A 2WAYA 1VYTA 2GKSA 1XFAA 3PXGA 4DUGA 1G5PA 1QRAA 4CGZA 4RJLA 4XVUA 2VIIA 5TMPA 5E7JA 2IXEA 2XNSA 3CZQA 3QVVA 4POAA 4HAXA 1PZNA 3AKCA 4MRPA 4P4SA 2C77A 5D3MB 2EWWA 1E6CA 4ZDIA 1Z06A 1DAFA 4MA4A 3NDBB 3LO5A 4QHSA 5KO2A 1E2DA 4V0ME 1BH2A 3LFUA 2PLRA 3PUZA 1II0A 3KUCA 2QQEA 2V1XA 4FMDF 4AG6A 2JLYA 4AKHA 1D6JA 3QKSA 3FKQA 4LV8B 4PPFA 2C96A 4BASA 2CE2X 3KX2A 3VX4A 3B7GA 3Q9LA 5UKDA 3U44B 1RE0A 4UXHA 4A2PA 3U60B 5EE9A 1Z0JA 1SXJA 4Q00A 4B33A 5AR1A 2NZ8A 2WWFA 1Z0FA 3GLFE 1VG9B 4NCHA 3T1TA 4DJTA 3BFXA 1KO1A 4LYFA 3WMFA 4BFWA 1DARA 4TWZA 1W44A 2N1BA 5F9HA 1E9RA 4WXPA 4RY2A 3KB2A 4G5SA 4DLYA 3T35A 2YWEA 4LJ4A 5L3RA 2CK3D 2EVWX 3MWYW 3QXJA 4Q47A 3R8FA 4MDEA 2OG2A 3L8YA 1AQUA 3A1WA 2BBWA 1CKEA 4PSVA 3RS2A 2JJ2D 2WAXA 3I1FA 2YVUA 3FWYA 3C41J 3BORA 4AG5A 1E2IA 3KXKA 1R0XA 5J47A 2G6BA 4XD7A 1SXJC 221PA 1FFHA 4CIDA 3A1TA 3DHWC 3K0FB 3CRW1 4FCVA 4BLQA 5JCZA 4JZKA 521PA 2QGNA 1Z28A 1TMKA 3N2IA 4PC6A 1KI4A 4PO1A 3RRMA 3SEAA 1E4YA 2IUSA 1R5NA 2ZRLA 4BECA 1EESA 2ZJ8A 1MABA 4M9XA 1G6OA 2QPAA 4Q4AA 5DYGA 2QSYA 1TU4A 3X2SA 1TEVA 4LHZA 2VP6A 4OI4A 4ARZB 5HCIA 1UKYA 3QXCA 1V43A 3PFIA 3ZDQA 3LVQE 5FPYA 1CR2A 1TUIA 4JBWA 2XJ9A 4TL7A 4DBLC 2V7QD 1VKJA 4TMTA 1NLFA 5FOWA 3TAUA 4I1SA 3EX7C 1JR6A 1YR6A 2XOKA 2ZJBA 4IDQA 1WQ1R 5E95A 2GZHA 2Q3FA 1JEEA 3QKUA 2P6UA 2F9MA 1WCV1 3ZZUA 1NG1A 4PZZA 4B48A 1MH1A 4AKIA 3NBFA 3REGA 2C04A 4GSYA 1FMLA 2VBCA 3CPEA 2FDCA 3MFYA 2QG6A 2HT6A 3X1WA 1Z3IX 3C8UA 1HA3A 2OFOA 1KKMA 1UBGA 1UF9A 2FZ4A 4OI2A 5FBRB 1W0JA 4GMXA 2IL1A 2ZR0A 2ZRNA 2QROA 4HZUB 5E7IA 5CB6A 2BMEA 2R65A 4G1UC 3VR4A 4DB4A 2ZE6A 5JI3E 3IILA 4AIIA 4D82A 1E9SA 1D8TA 1PJRA 3ETLA 1P5ZB 1IN7A 4DSNA 3KFXA 3PUWA 4PR0A 1FZQA 2WBLC 1GNQA 3K70C 3GFOA 1M2OB 2ORVA 4JLBA 2XSZA 3EZ6A 3VKHA 1G8FA 1W4AA 2R44A 3O8DA 5HR5A 4OQFA 2Z6VA 5LD2C 2CHQA 1N25A 5JRZA 2JATA 2RMKA 2YOGA 3CR7A 4LBYA 1XTJA 2IS4A 2YINC 2GETA 3RS3A 2ZU0C 2ZRMA 4RZ3A 3VMFA 3FMFA 3OE7D 3UMFA 1N3BA 2HF9A 1G19A 4QC2A 3THWB 4E07A 2QRZA 5A4JA 4NE2A 5EXXA 3R9IA 4AY2A 3BS4A 2CLCX 2QSZA 1RFLA 2BVNA 1Z29A 1G7RA 1N0UA 2FWRA 2OBMA 3RLFA 1JECA 2FEOA 4GMDA 4Q9JA 3B9QA 3BJIC 1VPLA 3RABA 4XTRA 5B2ZA 3TW8B 5CITA 1W7AA 3SC3A 2WJVA 3T5GA 5FBVB 5L3SB 2Z83A 3LA6A 2FZLA 4M9SA 2F1RA 1P7CA 4JL6A 4QG7A 3JZMA 3WY9A 3T15A 4MGKR 3BB1A 4FINA 4O0MA 4V0LA 5D3QA 1IQPA 4DCUA 2W2VA 2H5EA 1W47A 3QXSA 1KNQA 3GJXC 1BKDR 1XZPA 1OH8A 3R8CA 1NF3A 3FGNA 1NVUQ 4HB2A 3PUYA 3QPUA 1XXHE 1E2KA 2GDJA 1VYVA 5EZ6B 2RGDA 1Z63A 1VG0B 2IF0A 3N2EA 1ZCAA 5JWOA 2YWGA 1U8ZA 1G8YA 4UJ3A 3BB4A 2G88A 1Q57A 2YC2C 1QHXA 2XZOA 4KODA 2C9CA 2O8CA 3KZ1E 2BM1A 3TRFA 3X1DA 2JIZD 3QQ5A 5AJVB 4BFSA 2WMNB 4Q1CA 1QVRA 1YZGA 4A0GA 3FMIA 3WYGA 3RS0A 2KBEA 4GZLA 4BZXA 4OHZA 4BUJA 1Z8FA 2WPDD 4LJ6A 3U7GA 2MSDB 5ANRB 5FTMA 1XDBA 4RCYA 3FFAA 4DRZA 1D2MA 1G4UR 2FGJA 3M6AA 3KJGA 1KO8A 5FTKA 4A9AA 2WWYA 2IF2A 4LBZA 1ZC4A 2DWOA 5EJEA 3THXB 2QBYA 1E2FA 4BWYA 1KIMA 4AYXA 5BXQC 2PH1A 4V0NA 4ZCIA 4JSYA 4JVLA 4EFNA 3P27A 4L8GA 1ESNA 1RRPA 3SS8A 5DI3B 3UANA 2F6RA 4PX9A 1N5JA 2PZEA 1CR0A 3THYB 4KXFB 3LRPA 2B7CA 4DDWA 1H8HD 4URVR 4P3YA 4QBGB 2QA5A 3VNVA 1QHSA 4RCZA 3TNFA 3HYRA 4N0DA 4CEHB 1VHTA 1ZM9A 2JCSA 4MGIR 3MWLA 2QMUA 5CLQA 2ZSDA 3QG1A 4R71A 4IW3B 2BMDA 4NCNA 1COWA 2N46A 1SKYB 4YQFA 2O8FA 1K5DA 3PVSA 2F43A 3RRNA 4OJQA 5DE3A 2VHCA 2BC9A 2CNWD 2QY9A 5FFMA 3GLIB 4HLCA 4A36A 4DCVA 4OYHA 3EA0A 4P0TA 5HKKD 1LW7A 1W36C 3SNHA 3NKVA 2QT1A 3U3OA 3N70A 2HJVA 1S1CA 4DKXA 4YXWD 2EFCB 1H8ED 1EK0A 2AD5A 4DLZA 1M6NA 1EFTA 2VQSA 3NC1C 4F91B 4HEJA 5TXGA 4M1YA 2OLKA 3A1SA 2XNDA 2FSHA 3TMKA 4OHYA 1T3SA 2OESA 3ZVMA 4C30A 1G17A 2KJQA 4A0FA 3E5HA 4PHGA 1I4DD 3WP1B 3EWAA 3P20A 4PC7A 3VKWA 2XITA 4BPBA 1DO0A 1N5KA 2C9YA 1ZNZA 3SQXA 1JALA 2X2FA 2H17A 3D31A 2ZRDA 1KI6A 4LUCA 1JB1A 2DFTA 1N6LA 3NDPA 2IYUA 5FPTA 4CEIA 1QHGA 4OHXA 4YDSA 2ZRIA 3QENA 4JVSB 4UXJA 2PLFA 3KQKA 3CF2A 2MSEB 1L2TA 5FOXA 4Y0VA 1A7JA 2WWWA 3MSXA 1EFRD 4MUBA 2E9SA 3I4LA 4I4LA 4TZ6A 2IHBA 5FUVA 2L0XA 4PZLA 2RAPA 4TT3A 3FKSD 2A5YB 3LXXA 2FFQA 4BLRA 5JECA 1E2JA 2ZSEA 4NCIA 2R2AA 4A1FA 4CW7A 1LF5A 5JEEA 1GFIA 5EXPA 4A0RA 2Q9CA 3KKQA 1EGAA 2ZYTX 1SHKA 4QM6A 2VP5A 4V0OA 3C15C 1EFUA 2I3BA 3MGCA 3QEOA 4DSTA 4Q9IA 2GZAA 5CDFA 1NRJB 1G20E 1NMYA 5BN5A 2BEKA 3HJNA 4QFMA 1CTQA 3C7KA 2ZYUX 3EZ9A 5EP2A 1Z07A 3Q5EA 4X8LA 1U8YA 1LS1A 5J5CA 3PITA 1E1QA 4DSOA 2KWIA 1R0ZA 2J7PD 4V0MA 1P9RA 2FPKA 2P6NA 1WRBA 2IA5A 1T0HB 4MRNA 4D26A 4Z8YA 1BIFA 3AVWA 4AKEA 1QF9A 3H86A 4B3GA 5E3HA 5CLLA 1KDPA 4RKFA 2W0MA 4OQLA 3M0EA 1T4GA 4M0LA 5FL7D 3GLFA 4TYWA 4RD0A 2GCOB 1HE8B 3BD9A 3LW8A 3OFNA 2AK2A 2WSSA 3ZVLA 1X8LA 4B73A 2G1KA 3VKGA 1S3GA 4QHYA 4C7OB 3GLHB 4PQFA 3L2OB 1EXMA 1P2UA 3BWDD 3VU9B 1RYHA 1KSFX 3EASA 1BOFA 1XRJA 2H92A 1OIVA 3D3QA 2V6IA 4JL8A 3MWJA 4EFMA 1KAOA 4LCBA 2B92A 3TKLA 1E3MA 1KI7A 3NTUA 3TVTA 1OW3B 2ZAMA 2ECKA 4C0SA 4DLVA 1DAGA 1WMSA 4QXAA 2ZSAA 1BS1A 1E0JA 1TADA 2H8KA 4F38A 2H57A 1US8B 2QN6A 3B1VA 3I61A 2VP2A 3QE0A 4ZIRB 3LY5A 4MKIA 4YC7A 1ZU5A 4JLAA 2BM0A 4RD2A 5EP3A 4LY6A 1IBRA 3M1IA 4URZR 4ZDWA 5IT5A 2J0SA 4LDJA 4NYIR 2JLZA 3BH0A 3NBXX 2BV3A 3QG5A 1L4UA 4A8JB 1E32A 4GL2A 3SYKA 1FPMA 4IEIA 2PCJA 4B3XA 2ZJAA 2R62A 5G53C 1NKSA 5JJIA 3VFDA 4Q48A 5JS8A 2JA1A 4E5UA 1KDTA 4WBSA 1SULA 2NG1A 2V4ZA 1II9A 5KPDA 1AS3A 1QHIA 5FOSA 3DOFA 1DBSA 1Z6TA 2FGKA 2FPLA 1F48A 4J0QA 5SZHB 2REBA 2W6IA 1WP9A 4BFVA 4HUQA 3ND8A 1KMHA 1RJ9A 4KYUA 1GITA 2D06A 2QNRA 4LBVA 4BLPA 5K8TA 1G3MA 2KB0A 2XGJA 4UQOA 3Q8XB 2DB3A 1BMFD 1Q1EA 2BKUA 3DM9B 2FE4A 3QKTA 3OIWA 2ODWA 4D80A 5DHFA 1T8TA 1LTQA 3B60A 4UNPA 3KQNA 2H1LA 2BEJA 5K8IA 5DIFA 1CJMA 3FHCB 4G5QA 1G6HA 5TVKA 4DVGA 1GRQA 2BMFA 2RGCA 3CWQA 3PIRA 3KXIA 4KCGA 5TY0A 2C8VA 2ODEA 4DLSA 5H8WA 1Z6XA 1Z0KA 5HZKA 4EQ6B 5GADl 1GTVA 3MCAA 4TLAA 621PA 3B1WA 2WJIA 4PFSA 1VCNA 5AUNB 5K8UA 1L4YA 1ZD1A 4TMKA 3U4QA 1NNEA 3FHTA 1ODFA 4NU0A 4PTLA 3LBNA 4W7SA 1KSGA 1XTSA 3P1JA 3HDTA 4NYMQ 4BRUA 1WA5A 1E0SA 1Z2CA 4JLMA 1GILA 5KSYA 4G0NA 4D0NA 3P26A 4A15A 4IFBA 3LD9A 2OBNA 2WWXA 5CYOA 3SDZA 2X8AA 2ONKA 1A2BA 1HY3A 4JT4A 4Q7MB 4US1R 3B78A 5EXTA 4M8NE 4U00A 2A5GA 2DFKB 2G3YA 2RGNA 3BH6A 1B23P
chains in the Genus database with same CATH superfamily
1XNRM 1LNZA 1OV6A 1PVVA 3U49A 4IIYA 2QZ4A 2ZI6A 3AR2A 3B13B 3LYUA 5FO1A 4WXEA 2UYYA 1V4BA 1DO8A 4ML3A 4HAOA 4DIBA 2P6MA 1H9AA 1BDJA 1D09A 3C3BA 3U61A 3HPRA 1XZKA 4BX9A 2QLJA 2RAUA 4CEJA 2YNMD 2IPNA 4N0EA 3P2JA 1QDEA 4JP3A 1ECCA 1S0UA 3O8RA 3DDOA 2GWHA 3WLNA 4YWJA 2WUEA 1AUVA 4U9UA 5DGIA 3ZDYB 1VHDA 3WLHA 2X0IA 2F4NA 3L4KA 2IIBA 4I4CA 4DV3M 3RW9A 5ELMA 2GA9A 3A3OA 2ZT8A 1RKXA 2ZUVA 2WT9A 4FYYA 2Z9BA 4HAVA 3T7EA 1T5OA 2EYQA 1TAHA 2WZBA 3DVAA 2UU9B 4AG3A 1U80A 5HILA 1PI3A 3TBFA 5IDXA 4UE2A 3INYA 3HABA 4C0KA 1FDUA 4JP1A 1NQOA 5TV2A 4NNOA 3MCTA 2V7UA 1EWVA 2ZRGA 2VJDA 1WZEA 1NF2A 4N76A 4DGSA 3QSYA 1LCIA 4AJNA 1F0YA 1IJBA 5CB8A 1C2YA 1NLYA 3ADCA 4B3IA 2ZJ2A 1SHUX 4RVOA 2HU7A 1OVMA 5KQSA 2FW7A 4WECA 1ETUA 5A5EA 4KXMA 4JYZA 3JQCA 4PAOA 4CISA 4N5MA 5CJPA 4CQJA 1N2ZA 1G3UA 2AKAB 1XHEA 1JWLA 1PNRA 4JI5B 3UMRA 5I5GA 3RYIA 3JQDA 1CRQA 4GF5A 3UXHA 1KEZA 1ZM2A 3IPRA 3B1YA 4NBSA 4WA7A 4QKQA 4B71A 4MWOA 3DT9A 4LZZA 1ZVKA 2FR8A 1E1LA 5CNIA 3AG6A 1A4RA 4UU0A 2EBHX 5DN6D 2E82A 3GUVA 3PJDA 1JI3A 4RVDA 4JK3A 2A88A 1L8QA 1YU9A 4JJKA 5I51A 3AC0A 4Q9HA 5I01A 4H7FA 4UMDA 3H2ZA 3VX3A 2Y66A 3N8NA 1CB0A 1FA9A 2O23A 1GDDA 2XKBA 3MM4A 1EFRA 4KR0A 1WDWB 4YR7A 1Z2OX 3C7AA 4GVXA 5IAOA 4YAOA 4ZHQA 4HNRA 2XXAA 1U9IC 1YGPA 2A9JA 1KK2A 4DARA 3V2IA 2Z0MA 3TI7A 2WZDA 5IHPA 3OE1A 4ND8B 3C8DA 2R85A 3U4AA 5L3VA 2QQ8A 1XRRA 3OQIA 4HH1A 1SD2A 5EA2A 1GCIA 2EZTA 2JHPA 2F62A 5B6JA 1QF6A 1Z26A 4UBMA 1FVFA 3HB0A 1K2VN 5FL7A 4XWGA 4R98A 2OXRA 2P78A 4E2WA 4FKMA 3TJRA 5K03A 3UHFA 1ZI8A 5A5DA 4BQQA 2W8BB 1HSOA 3C5HA 1R4MB 2FXIA 4TUYA 1XQ9A 1TM4E 5KOHB 4P8RA 1P9WA 3DB2A 1D2NA 3WDMA 1ZBDA 5THXA 1SQGA 1SZPA 4LHYA 1J9EA 4Y18A 4OUKX 3AM3A 2FUEA 2FWPA 5CTJA 2GJSA 5JH7F 4CDNA 2ODAA 3REOA 2D5LA 2WIGA 3RROA 3EGXA 1HXHA 1JMYA 4RWEA 4LC1A 2FTKE 1IBKB 3WC4A 3N2ZB 2QTBA 2IYOA 1U31A 2OO9A 3ML1A 1Z74A 1R64A 1G2QA 3DTYA 4MKHA 4O2RA 2WVJA 4U0JA 3R5XA 3L4JA 2JKZA 4INOA 1JSRA 3SF8B 5C8YF 3AWDA 4KN9S 3DMYA 4KQGA 4GICA 4MGYR 4DG9A 4L4SA 4IIGA 3CNNA 1LDYA 5E2IA 2CB0A 4NJEB 3HJRA 4H7PA 3HKBA 4FP9A 4BLCA 1RHJA 1NI4B 1XKXA 4EZEA 1QFYA 1IL0A 4YCDA 4OF4A 1KYQA 2DNAA 4COKA 5JQGA 4DV3B 4DQLA 4R9UC 4ZKEA 2XUPA 1EG7A 4LI3X 3PHGA 1OYWA 2N35A 2B35A 4OI1A 1ONBA 3ZV5A 5LJLA 1H05A 3ZHBA 3MHVC 4LW8A 1L1FA 3FVQA 2VQEB 4KFUA 4KR9A 5K0GA 4V1CB 1I6MA 2DH5A 2M9MA 3HCAA 3IHWA 2P6RA 1ZD9A 4A2WA 1L5FA 2GEVA 3GYGA 3CF0A 4CE6A 4WADA 4X84A 1A50B 1ULZA 5B37A 5HA5A 3MVEA 4FYKA 4DCNA 3TLJA 2R7MA 2LVBA 1I5RA 1UKCA 1FTYA 4ISBA 3DNMA 3DT6A 1G16A 2O52A 2QVLA 2RIPA 1OT3A 2Y0CA 2X4DA 4BMOB 2FUG6 2B7BA 1P81A 3H2SA 3IP3A 2EZ8A 1E1RD 4XSHA 1M2FA 1UT6A 4HGPA 1LK7A 5JDIC 2A9PA 1KL7A 3ESZA 3CH6A 5AVWA 1FF9A 2UVPB 3AGQA 2RDMA 2CVFA 1C3OB 3L41A 2HK7A 4KZKA 1C14A 4FJ2A 3WLMA 3LDHA 4I8OA 1FBTA 2X9NA 4YMUA 1UAGA 5CIWA 1E5QA 4ESVA 5DNYB 5ICFA 3TSYA 4R1LA 4KE8A 3R0QA 2HAEA 1W5EA 2YYAA 1OTXA 4OYYA 1UKEA 1WHCA 2GZ2A 2P9FA 2ZIEA 5KDDA 4R9VA 4L74A 2F1IA 3BMNB 2I1VB 5EIAA 3F4KA 5K3BA 4O4JB 3KOYE 3QYJA 2HWWA 1VL0A 4NG4A 1LQTA 3CHYA 5JFGA 4RGQA 2ZUCA 1E9CA 2BGRA 3VR5A 4Q02A 4XM1A 4K7JA 1LU9A 1CG6A 3O84A 4E31A 1YZFA 4IVNA 5T6BA 3H2IA 2WABA 5DNVA 5TRTA 1V71A 1DWPA 2CL5A 2DHRA 3ILSA 4UNRA 2WNHA 5FOVA 4MUAA 3KSXA 1H94A 4WCFA 2C4WA 4IIUA 4RV4A 4E21A 1BH6A 1WHTB 3V1YA 3UWDA 2C00A 5JVDF 2BSAA 5FJJA 2CDBA 2BYTA 1KBQA 1F14A 3BMOB 4E2XA 4LHVA 4ZTUB 3EVZA 8OHMA 4W8GA 1XTKA 3I72A 1JWBB 5LR6A 4XJXA 2EV9A 2QLNA 4B7FA 1ZMBA 3OU2A 2GD2A 2SECE 4AWBA 4PYOA 4RV9A 2TSYB 4TVBA 2IHZA 1G8KA 1R8SA 2XADA 1PFYA 3ZDAA 2IYRA 1PDVA 1YCGA 1DI0A 1U4NA 3QY9A 5AVKA 1ZK3A 4D02A 2F8SA 1FUUA 3JZFA 5L3SA 3SBOA 1P1JA 3W7BA 3OQPA 1MUUA 2IH2A 2JGIA 4E5KA 2EFGA 1TYZA 1T8RA 2ZTHA 1S4QA 1YZVA 3Q72A 4YROA 2KNVA 1OH5A 5CA0F 1ZO8A 1P2TA 1JEJA 1W0JD 3VH2A 5E2AA 1SA0A 2X2EA 1EWRA 4C0JA 4MPDA 1ZK1A 2NU8B 3ZH9B 3Q2IA 3JD1A 4D44A 1JNXX 1FFWA 3BRWD 3QTLA 4PIVA 1KXJA 4FMCB 2G6TA 5AW4A 1U94A 5KJ6A 3BHNA 3GJ7A 1C0LA 4Y0AA 2X8JB 4ZT7A 1JV2B 1NW5A 4WH0A 1A2KC 2C3PA 1G291 1WUKS 3A06A 5LDGA 3UC5A 2IUUA 3UB4A 3UG7A 1DSSG 2YWRA 1L7PA 2ONJA 3R3XA 4R8MA 3B5JA 3DDCA 3AIKA 4CQMD 3EPKA 4EKEA 4FPXA 2KW5A 2V7VA 4R2HA 1Z6AA 4D0SA 5IXJA 1VLJA 3O8QB 2AFIA 4WGFA 2P6PA 4RK7A 2QUZA 2CZGA 2QM7A 2Z2XA 3TJZA 1TQ2A 2EGUA 4U2FA 1YS1X 3IGFA 3BGVA 2PD3A 3P71T 4TL8A 4GQAA 3EMBA 2PHZA 4MAMA 2XXBA 4RH0A 4NESA 1HE1C 1X1AA 3HR4A 5AKYA 4D3XA 1V25A 4F8JA 3KS8A 3L6CA 4WGGA 3PNKA 2LZ0A 5TQ2A 2PBZA 1P5FA 4BQSA 3K8QA 4BN5A 5HKOA 1SB8A 3VHLB 2EKBA 4EFDA 2WNSA 4RK6A 4O33A 1MX3A 2HSDA 4RA9B 5BWLA 1IDN1 4QRIA 4CR8A 1GRCA 2H5IA 3SE7A 4UPVA 3KW6A 1ZCJA 4IZOA 2BGNA 3ZGLA 2VPIA 4A1OA 3COSA 4WLNA 4DEYA 3SBDA 4V3BA 1VJGA 4BAGA 1Z0DA 1WF6A 2GAIA 1MW8X 2W2NA 2ZM6M 3BK2A 3HCFA 4QO8A 5T8KC 3M4YA 4D7AA 5HHTA 4HI0E 3LYHA 2ARKA 1BYIA 2HB6A 3LZDA 4Z53A 4G5HA 2XF3A 3K0SA 3K16A 3LVVA 5JSQA 1S1MA 3KJQA 2UKDA 1KRXA 2X9QA 1PUIA 4L95C 1QKIA 5H70A 1Z5VA 5BQXA 4QUBA 2BKVA 4AZ3A 3BN3A 5JNVA 4BFZA 2LBPA 4UFPA 4WFQA 1YS4A 4QE3A 3QEJA 2LP4Y 3CXRA 5EESA 1N6RA 2Z3XA 1I30A 2OZEA 4P1ZA 1FDVA 5TE9A 1IM2A 1T6BY 4O4HB 2CNKA 3DVLA 1MNAA 2ZKLA 1B76A 1WSDA 1IB6A 2H3EA 1E96A 3O3OB 5BQ3A 3PDUA 1Z2PX 5EJ8A 2BZGA 5JNUA 3TLEA 2Y1GA 3UV7A 4EUKA 5JAIA 3E2MA 3OIYA 3R5HA 1JB9A 3W2GA 2I4LA 2VDKB 4PWZA 1S02A 2GAFA 4LHWA 2BTOA 2C94A 1B00A 3K09A 3QYEA 3A1NA 1S7CA 3FLBA 1T2EA 4NZZA 4ZODA 4GPTA 3E7PA 2PQMA 3SQNA 1SEVA 2Q8QA 1UBFA 3GT3A 2LWXA 3HJUA 4YAKA 1AKMA 1S9HA 3AVTA 4KKXB 3B7ZA 4YT2A 1P2SA 1FVOA 3UAXA 1QUSA 4DCPA 5H68A 1WW8A 4M1MA 3IXQA 2Y4OA 4QYIA 2YV4A 3PQ2A 3KTOA 3W4IA 2A9FA 3QVVA 2I91A 1RWKA 1D0LA 1R0SA 2FI1A 1E2DA 3E53A 3MCVA 5CCEA 5WRFA 1OFUA 4WEOA 3WB9A 1D1PA 5GIOE 3UTCA 1YOVA 4A2PA 2XQGA 4K9KA 2BFBA 1CWUA 3WMFA 1MOQA 1DARA 1XF1A 4TWZA 2GUWA 3HM9A 5H3HA 3MWYW 2WMDA 4BKPA 1CKEA 3Q3CA 1T35A 5LOVF 3ZE9A 5FNVF 4FYXA 4A3VB 3TTTA 3UC9A 2ZPAA 4JJAA 3MBKA 2RHTA 1YNSA 4JBWA 2IHTA 3T1HM 2OGWA 1EP1B 3PPIA 3HV2A 4IDQA 3OPVA 1Q6ZA 2PYIA 2OO5C 3QMVA 5TT1A 1RACA 3PTZA 3OG9A 4YT4A 3GDFA 2AFHA 4MUEA 3DLBA 4M1QA 3OD1A 2QTAA 4CDRA 1PR0A 1KOJA 2Z5GA 4EB8A 3OZRA 3JQBC 4TN5A 1GEGA 2G9RA 3UMFA 2O2ZA 2QRZA 2EZ4A 3RFFA 1TA4A 3TS1A 3TWMA 1VPLA 1HE2A 4Y2XA 1R0KA 5FKJA 5IU6A 1PV2A 3T0FA 2HA0A 7YASA 1NI5A 2KEBA 2IDKA 1VE3A 4O0MA 4V0LA 4DCUA 2AFVA 4Y9SA 1X80B 2QTZA 3QOYA 2WD7A 3GJXC 5EJ7A 4GC5A 3IAXA 1R37A 4IDGA 3EXHC 3QPUA 3IDZA 4BB9A 4DJ5X 5C5IA 1CJSA 2B25A 1ZCAA 1X2EA 4KT0F 2LD4A 1VMIA 1ODLA 4L9AA 1QGYA 3QJ5A 2KBEA 4AWAA 3S7ZA 4HVLA 1PD0A 5ANRB 4ZVQA 5HRUA 2HC9A 5FEMA 1TH4A 2NXEA 2GN1A 5HZMA 2PH1A 4FFSA 3IQIX 4XR9A 1ESNA 1RRPA 3DLIA 2LW7A 5BN4B 3ZC7B 1H8HD 3C5VA 3QWFA 3IVMA 5C3UA 2ZM6B 3F1KA 1NA5A 4J1TA 1K86A 4TUYB 3GRVA 3EIUA 3OPXA 1GPH1 5TJ9A 4GLLA 1EAMA 3BJZA 3BREA 3UMVA 2HJVA 3G6WA 3PLAE 4DLPA 3KOZE 3UUWA 1Q74A 4OHYA 1HDCA 3F71A 2ISSD 5A4KA 3DCJA 1ZNZA 4IDCA 5BW5A 5TQ0B 2BY4A 5A71A 1FJ2A 3QENA 2HMUA 4BX3A 5H80A 3PXAA 3K73O 1CY6A 5H02A 3DLPX 4OGGA 4Q9IA 1JB0F 1H6UA 4GU5A 2XNCA 5HMMA 5CB4F 3OZDA 1E4OA 3FF4A 5GMOA 3TD2A 3QVJA 1IOWA 1E1QA 3FZEA 3FHLA 1P9RA 5MN4A 1RAHA 4FOPA 4PNHA 4Z8YA 2IPLA 3VYUB 4WFKA 2X0DA 2NXNA 3DSRA 3WQQA 1P0FA 5CT8A 4I66A 3LW8A 3WL8A 3ZU2A 2QRVA 1QIMA 1KSFX 2CXOA 1Q1GA 1WMSA 1GU0A 5HKBA 3GRCA 2QN6A 5C52B 2B4YA 5EP3A 1EA7A 4LDJA 1EQUA 1OBVA 4A8JB 2H1HA 2VDUE 2QG4A 1E60A 3WGLA 3AONB 1QAQA 2Y0DA 3EXIB 5ALOA 4QU9A 4BNGA 2PSEA 5EJ6A 4R9SA 3RGPA 4OHRA 3TIIA 3U3ZA 3GB9A 3GGJA 4JX9A 2QNRA 1INLA 3ZCTA 4N0MA 4BLPA 4M36A 3Q8XB 3KOMA 3ENZA 2QTWB 4F3RA 3HNPA 5K8IA 1XQYA 4FONA 3V76A 3NWLA 2FUG1 1ZONA 3KXIA 3VXKA 4EI7A 1Z6XA 4EQ6B 4QLBA 3K9WA 4TMKA 1U65A 4TXLA 3HVHA 1ODFA 4MUHA 4LZLA 3G1UA 1WA5A 2D3TA 1Z2CA 1FU4A 3ND5A 2GASA 1MOSA 4DBZA 1A9XA 2VN8A 1PK8A 1PJLA 3V1NA 2BHNA 3IEKA 1YVRA 2FYTA 2Q3DA 1ETHA 4NZOA 1KYYA 1SFRA 5LZ5A 5JBNA 4HRYA 3T1HB 4YP6A 1VJTA 4MQEA 3IT1A 4M7OA 3T9FA 3KT8A 1F4IA 1X87A 5ITUA 4UUQA 5GV7A 4JJIA 1Y0BA 4OW0A 3SP1A 2GPTA 3QBJA 4IG4A 2H65A 4RTRA 2DC1A 3SKXA 4KMSA 4TS3A 4NBWA 3LUBA 3TGPA 3NHFA 1HGXA 1Z8HA 4M1KA 1X3LA 3EXG2 4D9NA 4CKZA 5FBLB 1QRUA 1VIDA 3PUJA 3SKYA 3FSGD 1GKIA 4JXKA 3QVXA 2HF8A 5F52A 5K2MA 1KERA 2KDLA 2RKOA 1C29B 3JAWA 4WN3A 3FGPA 4GZ3A 4M0UA 1KS2A 4LIPD 3PGA1 2ZB4A 4OB8A 1G3RA 3JCZA 3ZLBA 2K87A 2CMKA 5IT9S 4L0QA 5FLEX 4AMVA 2ZAIA 1E5DA 1PR4A 2QD5A 4U8GA 3WHLA 4F92B 3O03A 2Y1KA 2O4UX 2ZAGA 3ANTA 3GP8A 2QM0A 5C4MA 3EVEA 1KEWA 3H5VA 2ZFUA 4R8VA 1XQVA 2DUJA 1P4RA 4WCFB 3KSBC 3JX9A 4NEHB 1DUVG 1CQXA 3CVWA 3GDOA 1GIAA 3HZRA 5KVSA 4PICA 4MAAA 1UBHS 4KR3A 3G3EA 3VV2A 1G9SA 1ZAKA 1GA4A 3LKBA 3A6PC 1J23A 1Z2AA 1L3BA 1KJJA 2J9GA 2B3TA 5MN6A 3EODA 4BJHB 2PBFA 4IKEA 3KXLA 2A58A 2R8PA 1TK3A 4BO6A 1FPQA 4CDMA 1ISRA 4EUSA 5KTMA 3FVRA 1XRMA 2DCMA 2XFSA 1Q1NA 1TTQB 3NC4A 4PG5A 3A14A 2G1JA 4FB4A 4YO7A 1N6PA 4KP7A 3AU8A 3RQSA 2NUTA 3P9NA 1FU7A 5K2OA 2PQ6A 2GEJA 3HLKA 2JS7A 3EUAA 1EFVA 4N5HX 4WZAE 1HNWM 3CNEA 1BG6A 4UVEA 4DE5A 5JT1A 2R1TB 4YXWA 3RSLA 9GPBA 1SUAA 1QG2A 4TRRA 1E2GA 4U7GA 2ADOA 3RUCA 1F0PA 1IXSA 2DTDA 1OZ0A 5L4SA 2AJCA 1UIRA 5E6JA 2NSYA 4I1IA 1PHRA 3F7TA 3TQHA 2NO9A 1XRQA 2QRNA 1J21A 2JANA 4CQMB 2XRYA 1NJFA 2PX4A 4EVQA 4FDTA 4CG1A 2BFDB 1S8OA 3B3QA 1KDRA 2JZOA 1H1LA 2QBYB 4FVTA 2IK8A 3U3MA 3MS7A 2Z09A 2VF5X 3GUZA 3QOFA 5ALXA 4EY5A 1HWYA 4BLWA 1MVLA 4HGZA 4CF5A 4PQRA 3VRHA 3QVLA 3H2HA 1M1NB 2ZE5A 3P0IA 3P9YA 4EHHA 5IWAM 1I01A 2DKLA 4L51A 3E2PA 2DBRA 4C1NA 1E6WA 2EJUA 3RFXA 4K9QA 5DMHA 4B8WA 3IKJA 1QYIA 1XXLA 4UNSA 4WSOA 2A6PA 4GWGA 4RVUA 4LHXA 2JF0A 3I64A 1MG0A 4P93A 4KBGA 4Z1OA 1V9SA 5ADHA 3P2IA 2O19A 5LYJA 3BJEA 3NVAA 4PTZA 4LOJA 1U9CA 3OTGA 4WUTA 1IZYA 3TCXB 4JLJA 3ZZ1A 3E81A 2ODPA 4GDFA 4E5NA 1Y37A 4CQLA 1Y3HA 1XLVA 4JC5A 4EW6A 3SBXA 4G84A 3SC2A 1TQ6A 3T8YA 2P11A 4JZYA 2Q3HA 3PENA 4ZGWA 2G4VA 4LY0A 3OESA 5AUOB 2ZJ1A 1DXQA 2Q1TA 3A70A 1NW8A 4Q7JB 1N1EA 4R7GA 4LF8B 3MZ0A 3W9YA 5C4GB 1E2UA 3DZDA 4IVRA 4KWHA 2HL6A 5K0JA 4OK6A 1GG9A 4XFDA 2H06A 3RR2A 3HU3A 1XCMA 4AK9A 4H60A 1T0IA 1P75A 1AA9A 2PVCA 2HSEA 3KT0A 4XCQA 3OQMA 5IJXA 3ITNA 3C1TA 4LJYA 2H59A 5HCNA 3DFMA 2ZRCA 1RQPA 4B40A 4TYNA 1W5SA 5LZ9A 2OOBA 2R00A 2XHZA 2Y1LA 2IYWA 3FGOA 4UREA 4P22A 1DT5A 4K8RB 3FR8A 1JI0A 2JLSA 5JPDA 4KHZA 2GN9A 2LVQD 1T6XA 3L8FA 4M7PA 1OFUX 4L6CA 3U7QA 4X66M 4D6PA 3B89A 4RZIA 1ULAA 5MF6A 1VM6A 2QZZA 1K8RA 2OA0A 4WP2A 2XEDA 2XH9A 2FG5A 1K97A 1PVOA 5JD5A 3RC2A 1KSHA 4LNUB 1KAGA 3HCBA 2GD0A 4DYDA 1O97C 2F8LA 3LLCA 4EO4A 4RLFA 3HVIA 2ACVA 5SZKB 4IBOA 4BQNA 1QPGA 3MJHA 3QPCA 4IOMA 1JG1A 3EQ8A 5HP4A 2NZVG 1CHNA 2BJHA 1F2TA 3KQQA 4WN9B 3JAMA 3ZTTA 2O57A 2ATCA 3HUFA 3I5AA 3M4ZA 4U2KA 3NCHA 3ER8A 1QQBA 2J5QA 2AN1A 3TFWA 3EY4A 1MRSA 3M8KA 2ZTDA 4YPOA 4IIFA 3TEFA 2IEZA 4IGIA 3LDGA 3ZQ4A 4MQMA 4BBJA 3K2EA 4QYIB 1QSGA 3GPBA 3FTFA 3ISTA 1OKKD 1HNWB 1Y3BE 4JOCA 3OPMA 2RHGB 5C51B 4JB2A 2BFCA 1R3UA 2ETXA 1A8SA 1FFBA 3B9RA 1KA9H 1JR3D 3H5WA 2X4IA 1TF5A 3C1OA 5DASA 3V7NA 4Z9YA 1Z7BA 4DV4M 3J7AC 4Y2SA 1CY2A 1YOVB 1ST2A 1CUHA 5FUYA 4YPFA 3SFZA 3G9UA 1BX0A 4EB6A 1KVRA 4KWEA 3TVDA 1E5XA 2ODBA 3ACDA 2CSUA 1OC4A 5AJWA 3PNPA 5ITTA 4HDMB 4TYQA 1TU3A 3H4MA 2NZ2A 3V34A 1M67A 4ZPJA 3GLQA 3G2PA 2RD2A 4WHMA 2AOXA 2JIZA 4TQUS 4QATA 5IWAB 5EP1A 3UEOA 1C41A 3QUQA 2IWRA 5EUMA 1NL3A 3AUFA 4NRVA 4BAUA 3DPUA 2M6LA 1A5BB 1ECBA 2B1IA 1QFJA 5E6UA 4F6LA 4JHLA 3JVVA 2XUFA 4GM1A 2BOVA 2UXCM 2IYLD 4XLLA 4B8YA 3FCSB 5I7VA 1WAMA 5J4YA 5KPRA 2BGMA 1VGVA 1P61B 4MLPA 2FS1A 3B7WA 4TZTA 3H84A 5FULA 3OOHA 3G2IA 2OOSA 1T9HA 2BSXA 2JCBA 5CFLA 1AHIA 2XYVA 3CWZA 2ZW9A 2QR5A 5AJZA 2A57A 3L7MA 3B9BA 1ZGBA 1IK4A 5L51A 1W96A 3EG9A 2IYYA 1Z5WA 1JJAA 3X1YA 3DFFA 3MTAA 4HH4A 4GFDA 5FBHA 4CN8A 4QXQA 3ZKWB 2QZJA 4RLHA 4ARUA 2J33A 3VU8A 3AR5A 1QGAA 3PI6A 1J8QA 3C6YA 1N92A 5T4EA 2EWVA 4Q18A 2L4FA 1OLXA 4FFWA 4TLEA 2R8RA 1JP7A 4CGYB 3WTBA 3L8HA 2HGSA 1Y6GA 5JXGA 3K70D 1NSYA 2GR9A 1WTAA 2P91A 4WK2B 1I80A 5F73A 3IKLA 1P0QA 4BCDA 3TQIA 3NUQA 1MJGA 1BEUB 4OGFA 3THYA 1CP3A 3GFSA 1S9DA 4KDFA 3L46A 3KB1A 1WBDA 1EVLA 3M3HA 3BGSA 4NCXA 1U8CB 1GFWA 4MKFA 1YRBA 2CZQA 1K68A 1E0AA 5DOZA 4HUTA 4EYKA 1HEUA 3OD5A 1KYZA 4OBEA 1RZVA 3V4SA 1LBQA 5FA8A 3VH3A 3EC1A 5IUKC 4GMFA 1QDUA 3SXUA 4RVFA 3L7KA 4JYBA 3ROPA 3BWCA 3LOPA 5G41A 4XRGA 1K98A 4HWTA 3V2UA 2GEUA 3MUEA 4S1TA 3F46A 1S8FA 4QJ3A 1LFAA 4LGCA 3Q40A 1E9AA 3AHFA 3L29A 1ZP6A 2YBEA 5ALQA 5LQKA 4DTIA 3HXOA 3MS4A 1CDEA 3GP3A 4NG5A 2JY8A 3NCTA 2QRVB 1ACJA 4X1OA 2RC6A 5DNWA 4AW9A 2XTNA 1O95D 5BOSA 1GP2A 3LDAA 4MRRA 1AZLA 1I5OA 3DO5A 4FJ0A 3V4OA 1UBSB 3ZD7A 1SVOA 2EBWA 2B8JA 1U8XX 4XIFA 3AERA 2BZ0A 3BWXA 1VQ1A 5CT6A 3BXEA 4MICA 4RNAA 1ZVMA 2Z6UA 4FWTA 5FI5A 1BA2A 4OB6A 3FPEA 4FNAA 2B1JA 1S3SA 2GXAA 4ZO4A 2OKGA 1DFHA 1FYXA 1KBOA 1XB2A 3KG2A 3RFWA 3V6MA 2H1VA 3O0DA 1CX9B 1FVHA 2FVYA 3PQ4A 1J49A 1XMJA 3C4QA 3WV4A 1CUUA 2D62A 5DK6A 4CMHA 5U4QA 1R5LA 2WKRA 1YI8A 1JHRA 3U5ZA 4YQYA 2GH1A 1YFJA 1U8UA 1KR5A 4HH3C 1A7UA 2Z3VA 2MYTA 2L19A 5JCOA 1N1GA 3GDWA 3QX8A 4OQZA 5HZGA 2C88A 2F48A 3WK4A 1DP4A 1GR1A 1L4NA 1V1MB 1D0MA 3L06A 4KR7A 3KU1A 4IQ8A 4UBKA 4IQGA 3GH1A 2PX3A 1J7JA 4MVJF 3ORSA 1I2MA 4FIZA 2FOLA 4JDUA 4QYWA 3U6BA 1A77A 2WYWA 2XQKA 5ITVA 4MUJA 5CMLA 1MORA 1X86B 1VJCA 1K8XB 3T5MA 3HBJA 4J0DA 3U13A 3FDXA 1V8FA 3LHKA 2H31A 3T3PB 5CT4A 3PDCA 2C2HA 1USVA 4J6FA 1C30A 2OT3B 4E5YA 4EH1A 1UPBA 4JAVC 1MRNA 2VZLA 2O8DA 5ETJA 5REQB 4KSYA 5D6NA 3WGVA 2J46A 3EEBA 3UJ6A 2HT1A 1DBQA 2PBLA 3BEOA 3KJXA 2J85A 4TKZA 5BYAA 3IOEA 4HO1X 5AJUA 1MN6A 1QVVA 2W6ID 4K1LA 1DUSA 2QTRA 4AAYA 1U6KA 4M21A 5FAKA 3EC2A 4PANA 4PGGA 3AIOA 1BU8A 3IV9A 2JBAA 3VGJA 1D1SA 3ORHA 2I4MA 4J7XA 1RKBA 4ZJPA 2P2LA 1FTSA 3NP7A 2JFNA 4R1NA 3Q88A 3A37A 4DV2M 3JZAA 2WIDA 4U2DA 4AO6A 3L77A 2WAYA 4DCCA 2VIIA 2W42A 3ENNA 3WYCA 1DAFA 3TLMA 4MV0A 1FYFA 3K6SB 3E84A 2JLYA 4EA6A 2PYDA 5ALZA 2ASVA 5F5LA 1WZIA 4D6XA 2EA0A 2FR0A 3GLFE 3O7MA 4RTQA 5T3YA 4G5SA 3T35A 5JH7A 3RS2A 3E9EA 4ONEA 4P08A 4YMLA 3E9MA 3VNBA 1E4YA 5DYGA 1E5VA 1GU7A 4ARZB 2PKCA 5BO5A 1I24A 3TM5A 1NW6A 2ZJBA 1NF8A 5AKJA 1C7EA 2F9MA 5EJIA 3T0IA 4PZZA 4E7OA 5SYAA 4AKIA 3OIGA 8ATCA 4IH4A 3MFYA 4CF3A 3UT6A 1KKMA 1UF9A 3LVFO 3LBFA 5C8YA 4DB4A 3NM5A 2NNWB 4XGNA 4OAPA 3KHSA 5EKTA 5B4TA 5HIKA 2FMIA 3OM1A 2WBLC 1TC1A 4JLBA 2XSZA 3T3EA 1UWKA 2PUHA 3CR7A 1WR8A 4D3DA 5CD1A 3BE6A 1PR1A 1JECA 4P5PA 4GMDA 3UH1A 2XZTA 5J23A 2AKEA 2Y0QA 4QUJA 5D3QA 4I5EA 3SVLA 2W2VA 1GU1A 3I2GA 4G24A 3QXSA 4N8DA 2D59A 4KO2S 2NYRA 1XZPA 3R8CA 1QQ7A 4QOHA 4BN0A 4AJLA 3B2QA 4ENQA 4QOJA 2C5HA 1QHXA 5ICCA 2BM1A 3X1DA 5AW2A 2LHCA 4OHZA 4LOLA 3VNRA 5FTMA 1QVWA 4RCYA 3AHHA 4PYMA 3YASA 4GE0A 3I9OA 4ALNA 3KJGA 4TTSA 4AYXA 1JVNA 4RK0A 4JSYA 1L1EA 2WU8A 4EEXA 1U0BB 3WBBA 3FNQA 2QA5A 1FLDA 3EVAA 4NENB 1ZM9A 1IEWA 2AZMA 1WKBA 1JH9A 5FT9A 2FKAA 2VRBA 3OJFA 1GEEA 3N2KA 3MXTA 5BUSA 3P9RA 3I51A 4OYHA 1W36C 3LFHA 4ZOAA 5JCXA 5TSDA 4LRYA 5CXSA 4ZQBA 3HCDA 4JI0M 2B4QA 2AC7A 3HHXA 1MO2A 3ZVMA 1F9EA 2OECA 1X1QA 3CSUA 3I2YX 1E61A 1HLGA 1QC5A 3TR6A 2FPOA 1OD6A 3MSXA 1EFRD 1M34A 4MIOA 1EDDA 4MR9A 5A0VA 1LBTA 1YB1A 3MGCA 3WGMA 3IEPA 2PX8A 4MUXA 4WKCA 4MWEA 1YSCA 3DBLA 4G41A 3S0JA 1VI2A 4B31A 1U8YA 3NM6B 3N05A 2NXCA 1DGBA 2IUYA 1XNRB 5IM5A 3NBKA 5FL7D 4TSRA 3WHIA 1GGFA 4J1SA 2DBQA 1O8CA 2ZXFA 1P2UA 3FRIA 3HXMA 1MJGM 4Q12A 1AK1A 4L5JA 5JS1A 2V6IA 2DQKA 3MGBA 4EA9A 4LCBA 3GFFA 3TKLA 1KI7A 1W6RA 4QXAA 2X5KO 2LVOC 1BS1A 1Y34E 3UENA 2OQ4A 3V8PA 1TKAA 4FFOA 1XDDA 4F3TA 3NBQA 2VDNB 5JVDA 1BOOA 3NDRA 3C74A 2ZAYA 3NHLA 2BTEA 2NSHA 5JJIA 2VUUA 3GZNA 1A3CA 3T52A 3DDZX 2YIJA 4PGHA 5MFPA 4KYUA 1GITA 2IBTA 4LBVA 5K8TA 2D8MA 1IZ9A 4IQ0A 3OKAA 2FE4A 5JJBA 4ZVOA 1ZGCA 4YRJA 3O95A 4UNPA 4ED9A 2JGAA 1N57A 2WYIA 1K27A 3DB1A 3RAJA 5A62A 3HM2A 2VPWA 1GTVA 2PL9A 4PFSA 2JD0A 5AUNB 1NT2A 4R2LA 4NU0A 5KSYA 4G0NA 4I55F 2VJYA 4LJRA 1C4XA 1PR6A 1MQ9A 2O2SA 4HG2A 1CQIB 3IQDB 4US1R 4GVPA 4D9JA 2C4UA 4H1VA 2C3YA 3ET4A 4RIFA 5JY1A 2FZGA 2A86A 5EHQA 1ODSA 3STVA 3AY7A 1LW6E 1K06A 2XMCA 3WRXC 4RJJA 4LGMA 2WF7A 4UAJA 4RHXA 3OF2A 4BO2A 2RHBA 5DW0A 4RZUA 4WXMA 5I45A 2VH1A 4QDZA 1Q44A 3RPEA 2O6HA 3K3PA 1U0SY 1VI6A 5ITRA 4QICA 2QAGC 3EPRA 1T0JB 1D4FA 4I9UA 5IJ0A 3ERCA 3BK1A 5L7WA 5K0NA 4NARA 4EUHA 1GAEO 1FYWA 3OPYA 3IUQA 2PU5A 4XRRA 3BIWA 4F9FA 2P0YA 4OHCA 4MV3A 2EFJA 3WL4A 4QGBA 4U7PB 1JKJB 5CH8A 2GAJA 1N3LA 4E33A 2WHEA 1EX6A 1W30A 3WRWA 1HT2E 3TZLA 3N2NA 3MUFA 1C7JA 3OC0A 3N39C 4JI6M 2BGKA 1CS0A 4WINA 2QR3A 3PHCA 4GOXA 4B2IA 2VJOA 4L72A 1MTZA 4UHDA 2H00A 3K5WA 1K66A 3IVGA 4BS9A 1YVDA 1YA4A 5TF0A 3STHA 4X92A 3N75A 3SXJA 4M9QA 2ZIZA 1CB7A 1Y8ZA 4RDHA 5HE8A 1C3EA 2E89A 3E9YA 5ALIA 3GW8A 2XNHA 3K70B 2OD7A 3M4JA 1R10A 3C48A 2GBPA 1KY5A 2GHIA 4RTJA 4BDTA 5F7OA 5J2UA 3KPYA 5EEHA 3UCFA 2JEZA 3KUDA 3G7SA 4COOA 5A7GA 5J63A 1P1IA 3SJZA 3VZDA 4P81A 1E77A 2CYAA 4L8FA 3FNFA 2QEQA 5JMWA 5FI0B 3AEUA 4M83A 3IA2A 3VR5D 5CVCA 1OF1A 1VEKA 3EDMA 3UZUA 5HXAA 1QH1A 3QKIA 3QA3E 4REQA 2BM9A 3TMAA 1UP7A 4CM9A 2PKQO 4ZQGA 5HQ3A 1CUVA 1LSJA 4OQNA 1C7ZA 1O1YA 1QF7A 4LXXA 2CFOA 3TSAA 4XOIA 1V95A 3TTVA 4AKTA 5CGQB 2MMCA 4IM7A 2D7DA 1OLUA 2LNDA 5LA6B 1XZCA 4GNRA 1A76A 1N2CE 4NJMB 3WKAA 4KH1A 2QSUA 4GEWA 2VR1A 4K8OA 3FLEA 2XMPA 2DKOA 3ADOA 2NU7B 2IH5A 2XECA 5F78A 5IZ4A 1NWHA 1T10A 1MKYA 2RGXA 1GGEA 5EGSA 4J4BA 3WV5A 1MF7A 4U5QA 5L53A 3VSBA 1YK0A 2J41A 2QVYX 2PUEA 3DAYA 1EYZA 3OE4A 4JUDX 4AKGA 3P9ZA 1M1YB 2ZK7A 2R8EA 3K9LA 4I6GA 1Q91A 2IUTA 1KU6A 4JQSA 2GVZC 3PFKA 3L82B 3N0VA 4I99A 4PCVA 1IUPA 4DFDA 1Z8DA 3IAEA 1S4MA 3SXUB 1FXSA 3S55A 2JD1A 4YRIA 3VSAA 4YUVA 3D5TA 4Q34A 4B80A 1Q17A 2O3TA 4NF2A 3NYQA 3GFBA 1ZIYA 4FN5A 2VAVA 4CLEA 5BUCA 2ATVA 1V3UA 5ICMA 1LI4A 2V7TA 4IIXA 3PNLA 1ZXLA 3A6KA 3NWOA 3INNA 1K6JA 4ENWA 2H9AA 5ALUA 4L50A 4KR2A 2R4EA 3HUDA 2ZANA 3MWFA 2WINI 3W6NA 3COZA 2GM9A 4CMIB 3FGZA 2TRSB 1QJ4A 4FGWA 1VG5A 1BHO1 3O4GA 2C7VA 5AUPB 4ANRA 1UC4B 2YJ4A 3KVOA 3NORA 3A27A 3P4XA 1FUEA 2VK4A 2P9ZA 3SIRA 3W68A 1KO7A 2HMWA 1EFKA 4O2AB 1XVUA 2HQRA 1JQAA 3SMSA 1ADFA 1MO5A 4FGSA 4GOND 3V4PB 4FS3A 3D0RA 4EEZA 5IMSA 3NWPA 1V16B 2A92A