4AG5A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
374
Chain Sequence
SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRVFQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
molecule tags Hydrolase
total genus 140
structure length 374
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag5A01
4WW0A 2EFDB 4KVGA 2PZGA 2HYIC 1NN1A 3QKUA 3B7GA 2IXEA 3B60A 3P20A 2O8FA 5F2EA 4S35A 2MSEB 1X8JA 3QXSA 1KI7A 5FI0B 2FH5B 4KBFA 4B47A 4U7DA 4OL0A 2IUTA 4BLOA 2BWJA 2IHBA 2K5UA 3LA6A 1K6MA 1CLUA 3HWSA 4Z54A 5JLJA 4D2IA 2LKDA 2QAJA 1XB2A 4JT2A 1HA3A 2HUPA 2V7QD 2F7SA 3MUFA 2CL7X 3ASYA 4XVRA 3JVUA 1NG9A 1ZJ6A 1IY2A 2JJ1A 2Q9CA 1KO4A 1R10A 4F93B 1HEIA 2C04A 2CK3D 2CXXA 1FZQA 2V8OA 2XJ9A 2RAPA 2QPAA 4Q1BA 5IRCD 2FU5C 1E2GA 3AVQA 2NZ8A 3REGA 4OK6A 3SOPA 4DLVA 3D31A 3AQ4A 2ONJA 2HT6A 4KFTA 4QXAA 5JI3E 2XXAB 2H1LA 1P62B 2ZVPX 4FIDA 1NF3A 2AN9A 3RWOA 4LYHA 3E70C 5GJWC 1MABA 1BKDR 3OEHA 3KDSE 3SDZA 1NBMA 1HE8B 5EXPA 1OW3B 2WIBA 2QEQA 1Z47A 3ONWA 4IVQA 1A2BA 1LY1A 1U8AA 1EWQA 1MO3A 4MGZR 2IBMA 1CIPA 1DG1G 4Q66C 3WBKA 3SHWA 1QHSA 3ZGXA 2GA8A 3RC8A 4FCTA 1BYUA 2GK6A 5K8LA 5JMTA 1GKUB 2KWIA 3CF0A 4ACAA 821PA 1DAEA 2RHDA 1CKEA 4XTRA 3FMIA 4UNQA 3HYRA 5J4VA 2VF8A 2XITA 1E9RA 2H18A 2ZI3A 1ZCAA 4I4LA 2GAAA 4YDSA 3VHLB 3FFBA 1XTJA 4TT3A 4ZDJA 3AF0A 3I61A 1SXJD 4RCYA 4ESHA 5HZKA 4W5HA 4QGAA 5EZ6B 5BYKA 1IBRA 1VCIA 3FPAA 5B57C 4PO8A 2O8BA 3C5HA 4C0KA 4A0FA 4P3YA 1OYWA 2Y8EA 1M7GA 1F3OA 3ZS9A 2IL1A 4XVUA 5ANRB 3P26A 2VSFA 4QC2A 2HF9A 1H8HA 3C15C 4PHGA 4JVLA 4LV5B 5AWFC 3TVTA 4JLBA 1FPMA 4XH9B 1MV5A 3WYFA 5FUVA 2GXUA 1GAJA 4JLKA 2HEIA 1W7AA 1OH7A 3AGPA 3SN6A 3NDPA 4NL4H 5CK5A 4OBEA 1E9EA 1QG4A 1YVDA 4ZV4A 1HURA 1SVMA 4Z8YA 4XSHA 4LYJA 2AK2A 3B6EA 3GLGA 2IUUA 2WAYA 5KSZA 2B6HA 1E4VA 2C99A 3KKQA 3LWNA 2BM1A 1JQJC 4NTZA 4L4UA 3IEUA 1OB5A 1YZQA 2C9OA 2WPDA 2WWWA 1LS1A 1IONA 1KY3A 4KFSA 2EFGA 3P1JA 4KFUA 2IX3A 4Q02A 4C0AC 1W48A 2JCSA 3OIUA 3CONA 3AGQA 2GBLA 1JJ7A 4LYAA 2FSIA 4ASUA 3F8TA 5DE3A 721PA 3KXKA 4QJ4A 3DO6A 2OT3B 2AWNA 1CU1A 1T4GA 2MMCA 3EWSA 5HKKD 2GCOA 4URZR 2WWHA 2XTNA 1MOZA 4CEIA 3CF2A 1G5RA 5ELXA 4ZCLA 4A2PA 5HTKA 1E2PA 5EUQB 3WRYC 4NBSA 3BFXA 3OZXA 3EW9A 1R0ZA 3L0IB 1Q57A 4IFEA 4V03A 2VBCA 3GEHA 1G8YA 4BGDA 4Q4LA 2ZIAA 3L82B 4IVPA 5CJ2A 5FTMA 4JYCA 3ADDA 1II9A 2NG1A 4A6PA 1KK2A 3H4MA 2JLSA 4AKGA 2VRWA 3P32A 1CS4C 3T1OA 1BIFA 3Q5EA 4LZZA 2RGNA 1NP6A 3V4RA 3RNLA 4AKHA 2ZJ2A 1S1CA 1UDXA 3IO5A 3B78A 4GOKA 1FL9A 1TF7A 5F9HA 4NU0A 2JLWA 3AB3A 1TMKA 1AKYA 1JECA 2PBRA 1NN3A 2VSXA 1KMHB 4UXJA 2KBEA 3EC2A 2NO0A 4B75A 4P0TA 2C95A 2PL3A 1ANKA 4QM6A 3T61A 2OZEA 1EK0A 1Z6YA 4QL3A 4Q4JB 3DMNA 3LVRE 3LBIA 1NVWQ 2CVHA 6Q21A 1IN5A 2WMOB 4Q47A 4URVR 2VP0A 5FR2A 3WRXC 2ZREA 2ZEJA 1W4CA 2QQEA 4TQAA 1IQPA 3BC1A 2FPKA 4JLNA 1SZPA 4NE2A 4BE7B 4OQFA 1J70A 1X6VA 2ZROA 3NWJA 1E2HA 4OI0A 2YV5A 2I3BA 1ZCBA 3N2EA 3S1AB 3IIMA 3THOA 2ANBA 3CX6A 1PLLA 3N2IA 1JNYA 5FPTA 2UZIR 1BYIA 2EWWA 1E9BA 4Z1MD 2WKRA 3V4FA 1G5PA 2EYQA 3RC3A 1TF5A 3U7HB 4MRSA 4TTQA 1II8A 2VYFA 2AXPA 1P7CA 2IXGA 3IO3A 4OJQA 3ZZUA 4C3ZA 2NOAA 5CM9C 4JJKA 4MKGA 4IEIA 1W5TA 3KJEA 4MKFA 2GAOA 1OXUA 3SS8A 1T3LA 3WNDA 1KSFX 1Z3IX 4QFMA 3NHAA 4A8JB 4BFSA 2BJWA 3UWKA 1IJFA 4RJLA 5TARA 3TUJC 3U44B 1B23P 3IHWA 4QHTA 3K09C 1BH2A 1CEEA 3CF6R 3N70A 4HSEA 4Q1CA 2IYLD 2GJSA 5L8VA 1ZINA 2A7QA 3AKEA 1RIFA 3ZYCA 4UNNA 5HR5A 4QM7A 4NCIA 4EQ6B 2P2LA 4BPBA 3EASA 2NO7A 3IDQA 4HDCA 3CW2A 4F4IA 2NQ2C 4GDFA 5EZ5A 3NC1C 2IT1A 3HR8A 1G20E 3QEJA 3IQXA 5DYIA 2H57A 3SNHA 2WJIA 3KQHA 2H8KA 4BFZA 3BIFA 2GEUA 2A3RA 1H65A 1JEEA 1EWRA 1S8FA 1EGAA 3EG5A 3W5IA 3KQUA 2HF8A 4DLZA 4HLDA 3KKOA 2GJKA 2IWHA 2QROA 4G5QA 1AIPA 2Z4SA 4PC6A 4JLMA 4LJ9A 3I73A 3WP0A 5IDVA 1FQJA 4L16A 4B6EA 3W6OA 2KI5A 4DSUA 2HDNB 3IPXA 3QIAA 4NYJQ 5J4LA 4DDUA 2RGEA 4YMTA 5KYKA 5AJWA 4AKIA 2GZDA 2PCJA 3RVBA 3X1DA 1NL3A 3TJZA 1KSHA 4IDQA 5AJXA 1KI3A 4Q7KA 5DIFA 5C18A 2AKYA 2ZJZA 4Q1FA 3QOFA 4BFXA 1SKYE 4EPTA 3AEZA 1US8B 1UJ2A 2B8WA 2ZI9A 4ACBA 4DCUA 1KO7A 3FMOB 5IK2D 1LS6A 1JB1A 221PA 3LDAA 4BLRA 3AKDA 2D4HA 3FDIA 1XPOA 3DKPA 2QTFA 2CNWD 1VYVA 5CLLA 1XJ0A 4POAA 4WOPA 2XXAA 3QSYA 3D6TB 3ZZ0A 3I72A 5DLQC 2RGGA 2QM8A 2BOVA 2QL6A 4G01B 4XD7D 1IN7A 1UBGA 1P2VA 3A1TA 3OHMA 2C8VA 1UKYA 2OSBA 1TPZA 1ZW6A 3TSZA 3BB4A 4Q9IA 4AWXA 1EFHA 4BEJA 3SZRA 3DL0A 3KQNA 1D5CA 4L9WA 1R0YA 5JSZB 2BHRA 2OBNA 3FMPB 3EZ7A 3KTAA 3M4YA 5BYJA 4DIDA 2RCNA 5JBQA 2WAXA 1NVUQ 1RRFA 3L8YA 2BJVA 1C4OA 2IA5A 2Q9BA 4I99A 2ZE6A 1TTTA 2F9MA 2A78A 4A1FA 1KK0A 2QAGC 1K5DA 2KE5A 2VHQA 2IWRA 2QRZA 3ZVRA 2BMFA 4EPYA 5IF9A 5HE8A 1E99A 4IDNA 5JWHA 5F3WB 2J5XA 1W49A 1GRRA 1D6JA 2ATXA 3NTUA 1VCMA 3BAFA 4OI1A 4JZKA 4GNKA 3PUYA 1G8HA 1XD9A 2DFLA 2ZPTX 4G5RA 3VX4A 1OB2A 3RLFA 2QBYB 1DEKA 2QENA 4TTPA 3ZIAD 1Z22A 1ZU4A 2OCYC 2XJ4A 1W36C 1E2MA 1OE0A 1YQTA 2WJVA 1AS3A 4QBHA 1XPUA 4ZDWA 2QSYA 4IOJA 2YWFA 1N6PA 5CB6A 1G18A 2LKCA 1OFTA 3U7FB 1VHTA 1KO1A 2EQBA 2F1JA 1OXTA 3RS4A 2YHSA 4GPTA 3AKCA 2FEMA 5A5GA 3O8RA 4Y0VA 4FD2A 3I4LA 4JSTA 2WWYA 3AH8A 3TUZC 4B6FA 1JBKA 2ZJ8A 3LLUA 1XMSA 4M1YA 1DARA 2DBYA 4G0NA 4XSGA 4JL8A 4DT1A 3OIWA 2QP3A 1SVIA 1ZVQA 4TN1A 2MMGA 4QBFA 1VPLA 4HDQB 3FFAA 5E7JA 2P5SA 2FGKA 3CPEA 4N1AA 1ZNZA 2J46A 2J7KA 2ODEA 4RZ3A 4JT4A 3MWKA 1G16A 2MSDB 2VP9A 3QNUA 3MD0A 2RB4A 1Z6AA 2C9YA 3CKLA 4KJZA 2WTUA 1GP2A 2C2HA 3LX8A 4KFRA 1KY2A 4DHEA 4IOMA 1U8YA 1KMQA 3LD9A 1P9NA 3P4XA 1JR3E 2VHUA 3QKTA 5B30A 2IF0A 2KB0A 2QE7D 2F1IA 4Q4AA 4NONA 2Q21A 1TL7C 3QKRA 1OKKA 3GFPA 2ZR9A 1ZIOA 3VHXA 1Q22A 4QHYA 5FBLB 4MUBA 4D0NA 1RRGA 3KFXA 4MYTA 4ZKDA 1XEXA 1Z2AA 5EE0A 4KHZA 4FCWA 5G3ZA 1VG0B 4MRVA 1G7CA 2O8BB 4F92B 3QENA 3IQWA 3V9PA 1H8ED 1X3SA 3AVOA 2JDIA 1DAFA 4KSCA 2NO9A 1T91A 2SHKA 4Q21A 2RHMA 2VEDA 3EZFA 3UWOA 4BLSA 1SVLA 3ZQ6A 1E1QD 5EJEA 5JEEA 5K8IA 1P2TA 2GEVA 5BQ5A 5CIWA 1NLFA 5LBIA 4R71A 3U61B 3Q72A 4TQUS 5L3RA 4DB2A 2BEKA 1Z0IA 1OSNA 3GJ6A 3L0SA 2D7CA 1XCMA 2O0JA 3I5YA 1W1WA 1SHKA 3S1AA 3WNCA 1O87A 2WSSA 3CNNA 2DCUA 3OIVA 3QF4A 1U99A 2GXSA 1JR6A 4P4UA 5CLQA 5FOUA 5FBQB 4N3NA 4V0OA 4ESVA 3SYLA 1N0WA 1KNXA 2FFHA 2XX3A 3NBXX 1VECA 2ZRBA 4PANA 4RKFA 2JLVA 1OIVA 1MO6A 421PA 1KSJA 3OFND 4WXPA 5JI2E 2VSOA 1VYUA 1Z2CA 3SU8A 3X1YA 1MR3F 2GCOB 1UAAA 2ODBA 3HR7A 2G1KA 4PQRA 4DXAA 4CEIB 1OFHA 3QXXA 4PO9A 3QG1A 4PC3A 4I1SA 2AKAB 2Z43A 2ZXUA 2FX3A 1AGRA 3LO5A 1DTSA 3K70C 4RZ2A 4O2LA 1OYYA 4DUGA 1KAGA 4JKYA 4NYMR 5FOTA 2VP4A 2X8AA 3KX2A 3A37A 4C2UA 3TRFA 1G7SA 3FHTA 1LNZA 1GL9B 5DYGA 2A5DA 4AC9A 4UNSA 1MT0A 4M9QA 2VP5A 3NDBB 5FL3A 1XXHE 3K0FA 1I4LD 2J59A 1FQKA 2BM0A 4LI0A 4DB4A 1ELOA 1FFHA 1KHTA 3P4YA 1ETUA 4JJZA 2ZJYA 2XEXA 4D82A 3NXSA 4M22A 2ZUCA 4Q5IA 5IHPA 3GFOA 4D26A 3AVTA 2N42A 4TYWA 1JR3A 1PUJA 2AHOA 2WVJA 1DELA 3TMKA 1W2GA 2FPMA 1E2FA 4BEBA 2HXYA 2QM7A 2W6JA 3NEYA 5CYPA 4IDPA 1KSGA 1CRPA 1JXOA 4PZLA 1JQLB 3GPLA 3QF7A 3CPJB 1EG7A 2D06A 3LW7A 2J41A 4V0ME 1E79D 4KLZA 2WJJA 3AF4A 4ARZA 1E0JA 4FN5A 4JMPA 4HLUC 3WXMA 3VR3A 4LOAA 3GCGA 2TMKA 2ZR0A 2QP9X 4D4KA 4LHYA 4HB3A 2GXQA 2OXRA 3NVAA 2DPXA 1AQUA 5FR1A 1HYQA 3HPQA 4FWTA 1W0JD 1XTSA 2L0XA 1QVRA 2F1HA 3DVLA 2BBTA 3QPVA 3VR4A 5CK4A 3BS4A 2UKDA 3U7GA 2XSZD 3FHCB 4HI0E 2V55B 3SYKA 1G4UR 2D7DA 1C1YA 3FB4A 3FE2A 2ZYTX 4IKEA 4MRRA 2BCJQ 1VDZA 2YJTD 4H1VA 2JJ2D 4QJ5A 5D3QA 1X86B 4EAQA 4FW9A 4MGYR 2DYKA 5TB5A 1N5LA 2G3YA 2F3TA 5DI3A 1II8B 2BVNA 1OV4A 4D4JA 4F38A 2BMJA 1RW4A 2A5FA 5TY0A 3VU9A 3U7EB 5GJBA 1B0UA 1HQCA 4A15A 4L5BA 4Q9HA 4LY6A 3KJIA 5FOSA 4TMKA 4YQFA 4RD2A 3SC3A 1XTRA 1NMYA 4E5UA 3T1TA 4CEHA 2CCGA 4D6PA 1A7JA 4MITA 2ZAMA 3TW8B 4LC1A 1IY0A 5AJVB 3ZD7A 3TR5A 2ERYA 2V1UA 4GMXA 1LFDB 4P4TA 4A0GA 2J0VA 1RKBA 1RZ3A 5HPYB 2P0EA 2E1RA 2OCAA 4GSYA 1L2TA 2C5LA 2PT7A 5FI1B 4HEJA 2ZJAA 4ZO4A 4YXWA 1AGPA 1VCOA 3T5GA 1F60A 2WOJA 4IXMA 4D80A 1U2RA 1TUEA 1UADA 1ESNA 5DN6D 2GJ8A 1VYTA 3ZVLA 5L3QA 1C9KA 3EXAA 3M1IA 1DAKA 2R65A 1XXHA 2B92A 4A0RA 1ZD8A 4HAXA 1W4AA 4CT5A 5BXQC 1GUAA 2C78A 2IK8A 1X8KA 4LX0A 4OJKA 4BASA 2JLXA 1M8PA 1CBUA 4JLDA 1YR6A 4JBYA 4JVSB 1A5TA 4C7OA 1JR3D 4FCVA 4XJXA 4WXRA 3VKWA 1S0UA 1R8QA 1F2UA 2PMKA 5EE9A 2XB4A 2BKUA 3R8CA 1X8LA 2UZ3A 4OK3A 1NJGA 4V0MA 2VHJA 1NMXA 1YZGA 2IEYA 2VQSA 2DR3A 2ZYVX 3PUXA 2Q3FA 1S2MA 1WE2A 2YWGA 3TBKA 1CJUC 3ND8A 2EW1A 2GDJA 3DPUA 5BN3A 3CNLA 4IRUB 1SXJC 2JLUA 1T3SA 2IS1A 1G17A 3B1ZA 3PQCA 4WVFA 1FUUA 4U02A 3THYA 1AJEA 2ODNA 5SZKB 3O8DA 3PXGA 2HJVA 2OUKA 4ILEA 2J3EA 2ZRLA 3RS0A 3B1XA 3ADBA 1XTIA 3IUYA 4LHWA 4CVNA 3W5JA 2BC9A 3F0TA 5FTLA 1E1RA 2FSHA 4DLRA 3TKLA 4ZKEA 1NLYA 2H16A 4PAMA 3DDCA 1XCGB 2XOKA 1VIYA 1N5JA 3UMRA 1NIJA 3W3AA 3BD9A 4JKIA 3KJHA 3C8UA 3WBJA 1KAOA 2RGAA 3A58B 3KTAB 4EJSC 4BLPA 4DLXA 5KSYA 1XD2A 5KNDA 2VA8A 1NSFA 1G3MA 1WRBA 1R8SA 1VCNA 2AD1A 3K0SA 1TQ6A 2V54A 4IEEA 2NTYC 1LF5A 2X19A 1W36B 3K8YA 2FJUA 4Q03A 4RD6A 1FTSA 5FBVB 1IHUA 4IDOA 3LFUA 3SBDA 4LYFA 4FINA 1ZM2A 2P67A 4HAWA 4MDEA 1LF0A 2GJAA 3R20A 4GP7A 2BBSA 3X1XA 1J99A 3DM5A 1JPJA 1X1SA 4JVNA 2YKGA 4B3DA 3RAPR 2OHFA 2LCFA 4AYXA 2RGCA 3QKSB 2I4IA 2RGXA 4PQYA 3CIOA 1KK3A 3CRQA 5L3VA 5E95A 4IXNA 4B32A 1GNPA 1XDBA 2JLQA 2ZRPA 4DLYA 3K1JA 1W0KD 4UJ5A 2J0SA 4PC2A 3OE7D 4LUCA 4TLAA 4IOKA 5FFMA 3TVDA 1KI9A 5SZJA 1UM8A 3LV8A 3TK1A 4KSBA 2NZJA 3B2EA 3KKMA 1KI2A 2YVUA 2JASA 3DOEA 3B85A 1N0VC 1XNJA 3REFA 3TQCA 4DDTA 2JIZD 1E98A 1QRAA 1JAIA 2BBWA 2P3SA 1Z5ZA 3GLHE 2CE2X 2J7PA 3CLVA 4BFYA 1WBBA 1D9ZA 4URYR 4QHSA 5GVRA 5LD2B 2GXAA 2NPIA 3LVQE 4M53A 4TWZA 4DT1B 2PH1A 3BBPA 4DRZA 4D0GA 2PX0A 2ONKA 3PEUA 1EX6A 4B2IA 1CJMA 3E2IA 3M6AA 4CDGA 2J45A 2BMDA 1SKYB 3U60B 2JJ1D 5JJKA 2XZPA 4A9AA 3AKYA 2JJ8A 2YWEA 1W2HA 2RGBA 4BFVA 2QGZA 3SEAA 2Z0MA 2ZR7A 2VHCA 3OF5A 2FE4A 1KNQA 4BECA 2Z83A 1E1RD 1R5NA 1OLOA 2W58A 1N5KA 2QP4A 2VH5R 1A4RA 4AKEA 2IYZA 5DGXA 3OEHD 1L7VC 2DWQA 4DCVA 1NBMD 4OI2A 1CJTC 3CR7A 4Q1AA 3TSWA 3W8RA 4EPRA 1KZGB 1LV7A 4R7ZA 3TLXA 2ZE8A 3A4NA 4A92A 4BLQA 4Q4AB 3U4QA 3ICEA 4RFSA 3QKRB 2ORWA 3P27A 2BMEA 3IEVA 3NBFA 4GMDA 4PQFA 4CRWB 4U5XA 4DJTA 5AUPB 1RYFA 5GJVC 1XEXB 4BUJA 2CMKA 2VLIA 4EFMA 4M9SA 3TAUA 2W6IA 1W46A 1G1MA 2NO6A 2YNMA 1SGWA 1KJWA 3K53A 2OAQ1 5JCPA 2OM2A 3VR1A 1TQDA 3KB2A 4TLEA 2FSGA 2GBLC 3ECCA 1G7RA 5KNBA 1WMSA 4TT3D 3T34A 1G5TA 3Q5DA 4LDJA 4YMSA 3RWMB 4E09A 1XRJA 2CLCX 2XTMA 5JFGA 3MFYA 2FFQA 4N0DA 1EESA 4XWOA 4PO1A 1NI3A 1J2JA 2QY9A 2ZUBA 4P4SA 1P9WA 3LNCA 4PZZA 3RRZA 3R9XA 1H8HD 2WHXA 4HAVA 1GIAA 3B9PA 4JBXA 5HE9A 1EFCA 3QF4B 3TUIC 4LHVA 4LPKA 4B71A 1NNEA 3WY9A 2QI9C 4UKDA 3K09A 2ZM5A 3K70B 2DB3A 4ZCMA 4M0LA 2D62A 1R7RA 1YRAA 4HAYA 4DBLC 2IYUA 3LQRA 4CF7A 4B3CA 2IF2A 4NYIR 2PEYA 3CNOA 3LXXA 5E7MA 5FTKA 1VG1A 4MRNA 5FBWB 3AVWA 4LJ4A 4KVAA 1TAGA 2J7PD 3GLHA 1DO0A 1XZQA 4NCJA 2WPDD 3BJIC 3EC1A 4IW3B 2I1QA 4GFDA 4B33A 4Q1EA 2YINC 3F3YA 3FMFA 3NHBA 5EUMA 4ASUD 3GP8A 1YZKA 4PPNA 1KGDA 5CYOA 4B34A 2ECKA 4DIEA 5JS7A 3AVUA 1YZNA 2WJYA 3NIBA 2OO7A 3EIQA 3G5UA 4GZMA 2CBZA 4DLSA 3BFKA 4KU4A 2J0QA 3O47A 3ZH9B 4M8NE 1T6NA 2V9PA 4IHQA 3RS3A 2PLRA 5JZVA 3K0FB 2O52A 2W2VA 2CHQA 2OAP1 3A1VA 2F1RA 3Q3JB 4BZPA 5J47A 1XTKA 3EZ2A 3C41J 1NVXQ 2D2EA 1Z0AA 3GLIB 5AR1A 4LJ8A 3PITA 1YZTA 4JSYA 1ZNXA 4LJ7A 2R2AA 4NZYA 4WIAA 3KB1A 4DC9A 4A82A 1IXSB 4PHHA 5EQTA 2W00A 2O8DA 1J90A 4ZIRA 1ZAKA 3PG5A 1P73A 2FEOA 2ZITA 3EX7C 4DEYA 1FNNA 4AYWA 4DDWA 1OFUX 2JGNA 4ARZB 2ZSDA 4XOIA 4EPVA 3G82C 1WP9A 3ASZA 1XF9A 3RYTC 4CYMA 4XWKA 1BO6A 5FOXA 4QGGA 1KKLA 1OT3A 2R6CA 2BDTA 3RS2A 5EXXA 2UVQA 4Q19A 3UMSA 4A2QA 4TL7A 2FDCA 2BCGY 3BXZA 3CM0A 4OHWA 1I2MA 5EXTA 2BV3A 4PC7A 1WB9A 1M7HA 5JJLA 1AZSC 1RRCA 1XEWX 3KXLA 2XNSA 1Q1QA 3QVUA 4H9GA 5LB2A 1WBDA 2R6FA 3B1YA 5DI3B 5TV2A 5GVSA 1Z08A 1QHHB 3DEFA 2XZLA 3KQLA 2AX4A 3B1WA 3KKPA 2QNRA 3GJ3A 3VU9B 1HE1C 2GHIA 3BK7A 4OI4A 2BIFA 4M9XA 4G3XA 1Z0DA 2GETA 3JVVA 8OHMA 2QAGA 3U3JA 2FMXA 4LRWA 3WMEA 1HH4A 4CEHB 2IS6A 3C14C 3ZLJA 4FMDB 3RSLA 5K8TA 1GKYA 1GKIA 4OQLA 5A0FA 1HUQA 1Q0UA 4MKIA 2Q6TA 3ZS8A 1Q3HA 1IN6A 2PX3A 3ADCA 2IYVA 2IS4A 1O3YA 2DFNA 2QQ0A 1KYIA 1NKTA 4YC7A 4O25A 4H1UA 4QBIA 3AV0B 4ZDIA 5FPKA 1M34E 4D81A 3EPJA 1II0A 4AG5A 1EX7A 3QG5A 1KJZA 5L3QB 3UMFA 4OHZA 3SJZA 3T1VA 2AK3A 5CITA 3BH0A 4BFUA 3GEEA 1G7TA 1ZD9A 3MG9A 1XXHB 3QXHA 2P6RA 1SQ5A 1D2MA 3AUYA 1L4YA 3LLMA 2FA9A 1E9FA 4MYHA 3SBEA 1N2CE 2CLSA 3QKSA 4KBGA 2C96A 3LW8A 1XEWY 4TLBA 1TF2A 4MQBA 1J8MF 4NKRA 2ZS9A 4C7OB 3DM9B 2CDNA 4TLDA 1VIAA 1F2UB 5FUYA 4LV6A 2FOLA 4PSKA 3L0PA 4R2IA 1V43A 2OLKA 1TADA 2YOGA 4D4LA 2GILA 3ZD6A 3C4JA 2ANCA 3UIEA 2X1VA 4X8OA 5J4HA 3H1TA 4M1MA 4C0SA 4ZI3A 1QHXA 2CL0X 5DSZA 4KYIB 1WDTA 1AKEA 1X1RA 1GSIA 4LSGA 4RKEA 3VQTA 1I4DD 1S1MA 3CB4A 4ZPXA 1E2KA 4QBGB 1SVKA 3FKQA 3U6BA 1PZNA 1WA5A 1K5GA 2OBMA 3THYB 1S4QA 5BW8A 4NCHA 5EP2A 3RRNA 3KKNA 4LCBA 2G1JA 1XEFA 3IILA 4JLVA 3Q7PA 2J0UB 2JLRA 1G6OA 4MA4A 1F2TA 2WKPA 3LH5A 3LAWA 2WV9A 2XB2A 3G0HA 5C4MA 1Z83A 3FKSA 3SFVA 1E9AA 4PHTA 3IIKA 3W90A 3B13B 3A1WA 1N6IA 4KYUA 1DOAA 1G3IA 1QHGA 5J4KA 3EPHA 2PCLA 1XJCA 4MGIR 1W4BA 4HUTA 1AZTA 3E1SA 1U0HC 1GILA 4L9SA 3VKHA 1YR9A 1F48A 1FMLA 4AG6A 1UBFA 3LQQA 2CCJA 1XD2B 4NYJR 4Q1DA 4AURA 3GLIE 2QPOA 3DOFA 1E9CA 1SVSA 3L8ZA 4NCNA 2V6JA 3BH7A 3MSXA 1GZSA 4Q7JB 1Q1BA 3LRPA 3AM1A 4KV9A 1M1YE 3RRYA 3PR1A 3K9GA 1FX0A 2Z6VA 3PUWA 5CB8A 2V3CC 3PCRB 2EVWX 4C30A 4QJ3A 1CR0A 2ZQ5A 1KDRA 1W36D 3SR0A 1S3GA 1J8YF 3R7WA 1W4RA 1AS2A 1PLJA 1E2DA 2QT1A 4AIIA 3K0CC 4C4PA 4TYPA 1MH1A 1N3BA 2OFWA 1IAQA 1HTWA 5KNCA 3EWAA 5FPYA 1E2LA 1U0LA 1EFUA 1OJLA 1GL6A 521PA 2PJZA 4QGHA 1GRQA 4B48A 1GDDA 2BEJA 2ZRFA 1E3MA 3VNUA 4TMZA 1AS0A 1Z0FA 1XTQA 1FUKA 1HV8A 5EP4A 1UDWA 1VHLA 5SZHB 4DKXA 2DWOA 5HZHA 2GF0A 1E2QA 1OHHA 3TNFA 1G8GA 2EU8A 4HZUA 1TX4B 2GESA 1RFLA 1YR7A 3EIEA 4A4DA 4C9BA 4EPWA 1TU4A 4D25A 3ZQJA 1GOTA 4NHOA 1KI1A 4QGFA 3SJBA 1Z6GA 4W7SA 4TZ0A 5FOWA 1R0XA 5P21A 5KSOA 3OEEA 4PAOA 5CIQA 4HZIA 2ZAOA 3THWB 4DSOA 3SJCA 1G64A 2HCJB 5H1YA 2FGJA 2R6GA 5FL7A 3BH6A 4EUNA 4KI0A 1ZUHA 1AA9A 2D2FA 2O0KA 2QTVB 1IN8A 1ZUNB 2ZE7A 3B8HA 1ZC4A 4DLUA 3Q85A 3FHOA 1KTVA 5G3YA 4LBZA 4F4JA 4DVGA 3FKSD 2DFTA 3Q7QA 2N46A 1OFIA 2ZRJA 2JLZA 1WQ1R 3QI2A 2OEPA 3VFDA 1NVVR 3B82A 3T1QA 5TXGA 1N6RA 2NPFA 3EA5A 5L3SA 3U4QB 4HLUA 3BRWD 4RFSB 3I92A 4O3MA 3NBYC 1SVOA 1SXJE 2DWPA 5EE5B 2JLYA 5FH9A 5GADl 3GLIA 2DFKB 1N6OA 4BLTA 2I1VB 1G8PA 1IN4A 3NEJA 2QMEA 2V1XA 1KO8A 1JPNA 3EA0A 2Q3MA 4YMUA 4XVQA 1COWA 1OKKD 1NY6A 4CEJA 4TL6A 2IXFA 2QORA 2YC4C 3Q9LA 1NG1A 4KXFB 3PIRA 5K8UA 1PVOA 1G6HA 2WJHA 1BMFA 2J1LA 4A8JC 2ATVA 1Q1EA 4O0MA 5FBRB 4QKQA 2JDID 2HCBA 4F91B 5B64A 3QXCA 4YMWA 1AK2A 4P4SB 2AL7A 2P65A 2ZSBA 1XPRA 4PFSA 4US0R 1EFRA 4JL5A 5SZIA 4OQXA 3T5DA 1WXQA 1QG2A 3MCAA 2IYRA 4P33A 4TMWA 3BB1A 1KI4A 1ZM4A 3PEWA 4TLCA 3TIFA 2R9VA 3QUSA 1XWIA 1UBEA 2W2TA 5JEDA 1DBSA 3T06B 4MYCA 4IJMA 1K8RA 1NY5A 2QGNA 2G88A 2WSSD 1QHHA 3CZQA 3EARA 2A30A 2XZOA 3OESA 1N6NA 3GLHB 1DE0A 4Q9LA 3FOZA 3K70D 5FUWA 5KPDA 3AUXA 3THXA 1Z6TA 3NG1A 5JHGB 3GLFE 2ZVQX 3VKGA 4LGMA 1JALA 2CK3A 2ZRNA 5EP3A 1XMJA 2HV8A 5A4JA 2QRNA 4OHYA 1Z0KA 2FPLA 3U3RA 3ZZTA 4BFTA 2ZE5A 1M2OB 4NP6A 5KUTA 5JJIA 3VR2A 3CWQA 1PV4A 2F55A 4A0HA 4EPXA 2ASEA 2V6IA 3CRMA 2GCNA 2QMOA 3CX7A 5GJCA 3LBHA 1ZM9A 1Z06A 2P6UA 2V4ZA 2GJ9A 4WBSA 4A2WA 4AI6A 3WP1B 1VTKA 1L4UA 4DUGD 4V0LA 4GRAA 1YJ5A 1A82A 4M1TA 5D3MB 2CJWB 1KIMA 3U3KA 4TYNA 3EPLA 2A9KA 1S9HA 1CJKC 1Z07A 1CR4A 5B2ZA 2NIPA 2QTHA 1GNQA 4MUAA 3GJ4A 4PXAA 2O8DB 2XTZA 2QN6A 4LHXA 4ZIRB 2P5TB 1CJVC 3ZVMA 2B21A 3CUEF 1U8ZA 1R5BA 3K9HA 1XZPA 1SXJA 1SHZA 3K0AA 3SQWA 4C0HA 3I32A 1Z6XA 5KPJA 2REOA 2W6JD 5DNYB 2HJGA 3R9IA 2REBA 1ZRHA 4R2HA 1QHIA 5C4GB 1OPXA 4AK9A 1BMFD 3EAQA 1CR1A 2QMHA 1I2DA 1OH5A 1XMVA 2W83A 4GBMA 2CEAA 1SULA 4FXPA 4G5GA 4IOLA 5E4FA 1YZLA 2G6BA 2A5YB 4UXHA 1KDOA 1D2NA 2FZLA 1GL7A 3IBGA 1CF4A 1PJRA 3BOSA 2IEZA 4JBWA 1G8FA 5H68A 3VX3A 4EJSA 3HP1A 621PA 1E9SA 2GF9A 1NN0A 2G9NA 2J0UA 4A36A 2D74A 1KKMA 1FW6A 4Q7MB 2QAGB 1YR8A 4B74A 2IHYA 1Q3TA 2VO1A 1HY3A 4JLOA 1LVGA 3PEVA 4R98A 3B9QA 4TMXA 2VIIA 1MRSA 5HKKA 4RCZA 3QY0A 1U9IC 2VTKA 2HYDA 3KXIA 4MYUA 3GLFA 2WWFA 4LHZA 2O0HA 4FMBB 1TQ4A 2ZJBA 2ZRIA 2JIZA 1RC8A 3VR5A 3I3SR 1RE0A 4GP6A 2W0SA 4BQSA 3SE0A 4MGKR 2J87A 5E7IA 1S9DA 5JS8A 1KI8A 1ONBA 2ZS8A 1U81A 5AJZA 2N1BA 3KUCA 4PPFA 3T12A 4L8GA 5KTYA 1P2UA 4HB4A 3BWDD 2EFEB 1ZBDA 1U90A 2JAQA 2W2XA 5KO2A 3Q8XB 3PJRA 1Y3AA 1Z0JA 4UQOA 4YXWD 3MMPA 4US1R 2KBFA 2ZU0C 4W9MC 2KSQA 2B7BA 2GVDC 2F43A 3H84A 4FMCF 4Q4HA 2O8EA 1UKZA 4HUQA 4WZ6A 3SJAA 1G19A 1M7BA 3CR8A 3MWYW 3VMFA 4J0QA 5AUNB 2XGJA 3KZ1E 3FWYA 4O2RA 4L15A 4NYIQ 2ZRDA 3WYGA 4FI3C 5BN5A 1XP8A 4LWZA 3EIHA 4KITB 1ZC3A 3AF2A 4B73A 4IFBA 4W5WA 1E0AA 4B44A 2WSMA 1G3RA 1T8TA 1T9HA 1XCPA 4QG7A 4BWYA 4BZQA 4EFLA 1UBCA 2QZ4A 2ZSAA 3CH4B 3GFTA 1Y63A 2ORIA 3IIJA 1YZUA 3ICQB 3V00A 2ZRKA 4C0QC 2Z4RA 4GL2A 1TNDA 1VKJA 1E2EA 2NGRA 1A2KC 4DCTA 1IJEA 4IDHA 4BZXA 2ZI7A 1M6NA 4M2LA 1F2TB 1LW7A 3U3OA 3RRMA 1EFTA 3GEIA 2ZYWX 4Z1MA 2WICA 4Q9KA 2B8TA 3THWA 4WZBE 1NSTA 3I1FA 3D8BA 2NMVA 3E5HA 4JLAA 3W6NA 1XBTA 3D7MA 4B2LA 1ZIPA 4A6XA 4JL6A 2O8CA 4HLQB 3W8NA 4PR0A 3UKDA 1VMAA 4I1VA 5KDLA 4C0BA 5DH9A 3TW4A 1XFAA 1TEXA 2CLDX 2R44A 2YYZA 5KHOC 1GVNB 2XOKD 2OG2A 4RD3A 1QZXA 4TL9A 4YLGA 2QA5A 5EXSA 2BKEA 2E87A 2WIAA 2HT1A 1XMIA 1DAGA 5CM8B 1G291 2FNAA 1G3QA 2ZI5A 2WJGA 3U2QA 5J40A 1FX0B 5B58C 1UEIA 3QBTA 4XTCS 4QRHA 1P5ZB 4M21A 3RS5A 1Q1ZA 2HLDA 1Z28A 3DKVA 3GJ0A 3R7WB 2QSZA 2CVFA 2ZRCA 5JECA 2FV8A 1P9RA 3PVSA 4M1SA 1P72A 2MSCB 3SYNA 1E94E 5F9FA 4HB2A 2RMKA 2QPTA 2ZTSA 4HAZA 3R8FA 4RD4A 3RANA 1IXZA 2Z5FA 5KDDA 5LPNA 5CDFE 1OF1A 5JWRA 1OIWA 4RD0A 2CHGA 1CXZA 1JJVA 1KI6B 3MJHA 2H92A 4GT1A 4KO8A 5JHHB 1GG2A 4HZUB 4RY2A 1S96A 3UATA 4URWR 1DVRA 4E22A 1JAHA 3IHLA 1DPFA 1UFQA 1Q21A 4JLJA 4II7A 2WWGA 2EYUA 3KL4A 4LJ6A 4G1UC 2RGNC 3H86A 2IYXA 3BERA 3EZ9A 3MJRA 4TQ9A 5DO9A 4Z8XA 1FOEB 4B43A 2O5VA 2VP2A 4LBYA 3UANA 2QU8A 1UPTA 5IK2A 4GI7A 1DAMA 3L0OA 2GTPA 2C77A 4GOXA 4PTLA 4C0LA 3AVYA 4V02A 3HU2A 3SFZA 4LBWA 2OE2A 3A6PC 5HCNA 4ABYA 2CNWA 1UEJA 1GITA 1M74A 2VPPA 4TZ6A 4LJAA 4PPGA 3LX5A 4V0KA 3RS7A 2CE7A 4M1WA 1WCV1 1ZM3A 4URUR 3CX8A 4XD7A 4PZYA 3I8XA 1N6LA 3UG7A 2AR7A 4ITRC 4PX9A 4OQNA 4D0LB 1E4YA 4B3BA 5L3SB 4LC0A 5FTJA 4K46A 2Q9AA 5DHFA 2ZSFA 1XJQA 2ZRMA 4B2PA 1N6KA 2WMNB 4Y0AA 5D3MA 2CJWA 1HT1E 2F3RA 4JVMA 1FMJA 2VL7A 4NDZA 4PSVA 2X2EA 3ZJYA 3AF1A 3X2SA 4B35A 3QJYA 3X1ZA 1LB1B 4QNRA 1KZ7B 4GOJA 1ZU5A 4PAQA 4PPQA 4CEJB 4P32A 1XX6A 5E3HA 5KOYA 1S3SA 1ZM7A 3GJ8A 3WHKA 4IVRA 2OCPA 1YE8A 4I1OA 4URXR 1CP2A 2WZQA 2ZJ5A 3QE0A 2P6NA 2W6ID 3IPYA 3HU1A 2H17A 2HLDD 1R0WA 3W3ZB 2YZ2A 2GRJA 1ZMXA 1VG9B 2ZSEA 1L8QA 5TMPA 1GM5A 4M1OA 5AJYA 4F4CA 3RABA 2G0TA 5AUQA 4NMMA 3ZIAA 2QMUA 4B3GA 4TYQA 4FWIB 4JYBA 2B7CA 3LXRA 4TYYA 2EWVA 3GJXC 1FNMA 3PEYA 4TMTA 4HYYA 1BS1A 1EXMA 3A1UA 3FTQA 4HAUA 1MKYA 1RVDA 5CDFA 4RZXA 1T0HB 3MAAC 4CT4B 2F6RA 1MO5A 4TSFA 5AK0A 5KDOA 4QNMA 5FPSA 2RKOA 2X2FA 4M9ZA 1I4TD 1ZNYA 4D4MA 2EFHB 3THXB 2AFIE 2ZRAA 5G40A 1R5OA 1SKQA 3AVXA 1N0UA 4CIDA 1R6BX 4CGZA 1E6CA 1P60A 2Q0HA 4NPHA 4OHVA 1U0JA 2G77B 1HQYE 5KSPA 1XU4A 3RHFA 3DMDA 5IT5A 1G3UA 4Z51A 4UNRA 2IYWA 3FYHA 3ETLA 5LB4A 1NN5A 1T5LA 5BWMA 3U5ZB 5JWOA 3BFVA 2CHVA 5H70A 3K0EA 3UPUA 1GRNA 1MRNA 1E9DA 2IS2A 3AF3A 4ON9A 4Q00A 4WAUA 2GNOA 4DWJA 2FZ4A 4LBVA 4K8OA 1E0SA 2QE7A 4DEXA 2CCKA 4JS0A 3PENA 1T5IA 1W5SA 4DSNA 3DHWC 3TE6A 2C98A 1SXJB 4JLPA 1RJ9B 2H5EA 3W9YA 3K0AB 3MLEA 4RD1A 3RSOA 4C0JA 4JIMA 2OLJA 4XWAA 5FTNA 1F5NA 1RRPA 4RSGA 1H8EA 3KQKA 3A36A 3MRSA 3FVQA 3TR0A 3ND9A 2GKSA 1DAIA 2DHRA 4PSAA 3C5CA 4TMVA 1E1QA 2JATA 1NIPA 3IBYA 4S2EA 3HJNA 3WNBA 1CR2A 2IYTA 5EE3A 1P3JA 2IUSA 2ZS7A 4E07A 1GTVA 4DZZA 1OH6A 3CBQA 1Z29A 5DHAA 1KDTA 2VF7A 1T3HA 3HYTA 2IW3A 1A1VA 1YRBA 4EJSB 2GEDA 3GJ5A 2O8FB 2FWRA 4NYMQ 3UK6A 2ODWA 1DG3A 4US2R 3I5XA 2G83A 2R62A 3QBVA 1V5WA 4EDHA 2XNDA 2PT5A 5DI9A 1NVVQ 1AN0A 4MDFA 1U98A 3QQ5A 2OFOA 1QHNA 4Q7LA 4TSFD 3QXJA 1QF9A 1IM2A 1D9XA 3OFNA 3NC0C 2DY1A 2YOFA 1AM4D 1T0JB 1E0KA 5HCIA 4K81B 4HATA 3GLFB 1E96A 2W0MA 3PV0A 1QVAA 1P61B 1CRQA 3IKJA 1JEDA 1N5IA 4X8MA 5C2JB 1RPZA 3K0CA 3OIYA 3QVVA 3CO5A 3QPWA 4B3XA 4CW7A 1R2QA 4G5SA 1TU3A 1FP6A 2G0NA 2WBLC 2ZRHA 5G41A 5J5CA 3TQFA 1VG8A 1MABB 3AVVA 1E2JA 1GNRA 2OFXA 4P31A 4ZDKA 5FOVA 1DADA 1P75A 4LPSA 1W44A 5LD2C 1D8TA 1KO5A 2A5JA 1DS6A 2PZEA 3K9NA 1KK1A 3BGWA 3O8BA 1NJFA 2F43B 2FFAA 1UKVY 4Q4HB 4W5JA 4FMCB 2O8EB 2BBOA 3OAAA 1WF3A 4HUQB 3H2YA 1NMZA 3DZDA 4AYTA 5G53C 5DISB 4G5OA 2WWXA 4KLNA 2R6AA 3KJGA 2Q3HA 2YC2C 3F5FA 4X8HA 5M04A 1JXMA 1OXVA 1QDEA 5CJPA 1E32A 4TTRA 5UKDA 4OK5A 2OV2A 2RGDA 121PA 1E79A 3WMFA 3CRRA 2GZHA 4EFNA 1ZUIA 4PHFA 3R9WA 3WYAA 1KMHA 1P4SA 4V0NA 5LDDC 4HDOB 2PMDA 1KI6A 3SI7A 2WM9B 4NCKA 4OKSA 3I62A 2NO1A 1FTNA 1W0JA 3CRVA 3K9LA 4Q4JA 1ESMA 1W47A 2FFBA 4R9UC 4Q01A 3SHFA 3N5CA 2ZRGA 5KU1A 1TQ2A 2XSZA 1QHYA 4B3FX 1BOFA 1NRJB 1P2SA 3A8TA 4DDVA 1IXRC 4M1KA 4AY2A 2JJ2A 1DAHA 1P6XA 1FP7A 3KFVA 4KAXA 5JRZA 1N25A 4I1UA 3GLGB 2XAUA 1AQYA 4TL8A 1UF9A 2OCBA 3LBNA 2HXSA 2R8RA 4PC1A 2O8CB 2OBLA 3BB3A 2R6DA 1GFIA 3JZAA 3J81k 2OXCA 2XNDD 3GQBA 3CZPA 2ZYUX 3UG6A 2ZU6A 1ZYUA 3X1WA 2D3WA 2H7VA 2WKQA 2RH5A 4DCNA 3TGPA 4BFWA 1Z8FA 1J7KA 4CZ2A 4A8JA 2VP6A 2IC5A 3D3QA 2FSFA 4UXIA 1OIXA 3TSOA 1KJYA 3WMGA 2A2ZA 3C16C 1SVWA 3L43A 3U44A 2F9LA 4I81A 1TEVA 5C1BA 3LY5A 2GVZC 2ZI4A 1UKEA 4UJ3A 2J9RA 4C2TA 3M0EA 2OILA 4Q9JA 5TVKA 5DN6A 5AUOB 3A1SA 2WOOA 4LJ5A 1R4AA 1NKSA 1XD8A 4EQ6A 4KODA 3T35A 4XIGS 4U00A 3HU3A 1KOFA 5F98A 3GMTA 2ZANA 3NH6A 3B5JA 3H0KA 3GJ7A 4BRUA 2FF7A 5BN4A 4ZI2A 1PLKA 1GWNA 1G4AE 3W6PA 2ZUDA 4DLWA 5J4YA 2REXB 3OAAD 3A4MA 3EZ6A 1CTQA 3B1VA 4DSTA 1TUIA 1HT2E 2FG5A 3AVPA 2GZAA 1OH8A 3TH5A 2EFCB 3NBZC 3O8CA 3SQXA 3UXMA 3MWLA 1DO2A 1U94A 3ZDQA 4MRPA 1YHNA 3L2OB 4UNPA 4DLTA 4ZCIA 3EPKA 5EE1A 1D2EA 3VR6A 1OXXK 2ZI6A 3NKVA 1OHHD 2V7QA 2ZJOA 1Q20A 3VAAA 3AP2A 3A4LA 3FGNA 4YMVA 4NH0A 2AXNA 2LWIA 2C9CA 1F6BA 2E9SA 1ZP6A 4LV8B 4AD8A 1Q44A 2PEZA 1IY1A 4OHXA 2ERXA 5TDHA 4QOSA 2OESA 3BORA 4MKHA 2PLFA 5JCZA 1IOZA 2C03A 4RFVA 4BRWA 1US8A 3CPHA 3OEED 5JRJA 1KDPA 4RZUA 4M4SA 1NBME 1LTQA 3JZMA 2PZFA 5FL7D 4F7WA 3VNVA 3I8SA 1ZD1A 4LJYA 1E2IA 1ZNWA 4B76A 5H8WA 1ODFA 2QG6A 3AP1A 4MH0R 2AFHE 3HPRA 4LK2A 4YONB 3CH5A 3MWJA 2IYYA 4WA7A 4OQMA 3BE4A 3ZVNA 1G41A 3U6KA 2IYSA 4OYHA 1Z63A 1YKSA 3CWZA 4FMDF 3TAHA 4E03A 1JI0A 1OXSC 3PUZA 3GD7A 3NH9A 4RVCA 2GCPA 4X8LA 2ZETA 1T8UA 1NLZA 1QBKC 1Q12A 4Q48A 1CULC 5JSZA 2GK7A 2GWHA 4EKDA 3T15A 3ADKA 2YWHA 1RJ9A 3C7KA 3PUVA 1YU9A 3IGFA 2AWOA 4WZAE 4DCSA 4HLCA 4Q18A 4YDHB 4EIWA 1E69A 1PUIA 3U3MA 3RDPA 1COWD 3VTKA 2QUZA 4KCGA 5EP1A 3QEOA 1G21E 2JEOA 5FPHA 3HDTA 2AD5A 3W34A 3WHLA 2YOHA 1W0KA 3MGCA 2FN4A 3DZ8A 2A5GA 3OE7A 2ORVA 3QPUA 4HB0A 5C46F 2CL6X 3AP3A 5FUXA 1N6HA 2VHTA 2WWIA 1RYHA 2X77A 2QT0A 3CRW1 1MO4A 1E2NA 3PFIA 4GZLA 2QBYA 2PJRA 2JA1A 3GLGE 1U9IA 2IYQA 4ERNA 3KUDA 1G9XA 2KJQA 4N0EA 1EFRD
chains in the Genus database with same CATH superfamily
1QMGA 2IXEA 2PZAA 2XMQA 2B8NA 4B47A 1UXGA 2BWJA 4FGUA 5H82A 3X2FA 5LQUA 2WA2A 3WSWA 1NG9A 3H42B 1R10A 1HEIA 1T1GA 3PD7A 3R7DA 3AVQA 2I3ZA 4DLVA 1OU0A 4MI6A 4W8GA 4WFIA 4I9FA 2J5BA 1NBMA 5FYDA 2WIBA 1A2BA 2IBMA 3LWDA 2UXBB 4FCTA 3DR3A 3CF0A 2RHDA 3BCHA 4E2XA 4ESHA 1IBRA 3AZPA 1Z68A 5J2UA 1OYWA 1XZLA 4MGZE 1TYEB 2X42A 4KR0A 3O38A 3RVRA 3F3KA 4LV5B 1M1ZA 1FLAA 4YAEA 1FC0A 2CFIA 1NM5C 3BSWA 2W6CX 3CEMA 1HURA 6REQA 2JIQA 3U49A 4I36A 5DMHA 3IEUA 1VMIA 1YZHA 3ER9A 2WWWA 3F2IA 3TGLA 1RBYA 2MMCA 1JKJB 4Q05A 4X1IA 1LU9A 3EW9A 1DZ3A 4IFEA 5JAPA 4R54A 1DOZA 2ZIAA 3L6DA 4DUYM 4OQPA 1Z12A 3TFQA 1QIDA 4NZZA 3O4IA 2PZMA 5TE9A 3AIKA 3B78A 4NU0A 4RHUA 3EC2A 2PD3A 2C95A 1ESEA 4OGWA 2P2YA 3PC8C 5AIAA 4J0IA 5EIFA 2WMOB 3QV2A 4JCOA 3NWJA 1C3LA 3N2EA 1JHAA 1DKPA 5LKRA 4NECA 1PLLA 1K98A 5FPTA 2UZIR 4YN3A 4JVOA 2G9VA 3Q7TA 1G5PA 3Q7IA 1TVMA 5H80A 3IO3A 3R0VA 5CM9C 4Q4CA 2Y9PB 3E18A 4QFMA 3MOGA 5CNKA 3W77A 4LFBB 4N49A 4GMKA 3IHWA 1JQAA 4R2LA 3K09C 1BH2A 3TXYA 3TW8A 3WAKA 3FOFC 5INTA 3FYUA 1H23A 4HDCA 3AK4A 1FJ2A 5K4HA 2IIQA 3HBAA 1A3CA 1V8OA 3EG5A 1BOOA 1Y7LA 5JAUA 1D4AA 1X9GA 2C7RA 4Z7QB 2XGOA 3WP0A 4YWHA 3O83A 1C7EA 2J3JA 3RTAA 5HYVA 5LQMA 4X6UA 3HVIA 2PCJA 5HIIA 2ZJZA 4MUGA 4EPTA 2ZI9A 2PUCA 4K6HA 1SN7A 3CEHA 2HBQA 4Z9FA 1PQPA 4HLNA 2GYVA 1CYDA 4G1EB 1SRRA 4FT4A 3A9WA 3QSYA 2C00A 1PJJA 1TECE 4XQ0A 1TPZA 4AWXA 3SZRA 1KFBB 3AWDA 4P5PA 1DEXA 3FUXA 3TZ6A 2XCRB 3DE5X 1KK0A 4BCCA 4EF6A 4UFPA 5JWHA 1GSAA 3NTUA 3SFTA 2WU3A 2O7NA 1U7ZA 4ZHQA 3QLTA 1PR5A 3FB1A 1Z22A 4JJ7A 2YXDA 3JASB 5CB6A 1NF2A 5AVKA 4FGZA 3U7FB 5LZ2A 5B1HA 4XGNA 3RYIB 2HAEA 5JASA 1DG9A 2EBUA 4MPDA 5LU9A 3FTEA 3SOZA 4KNYA 2VNAA 1FJXA 2OB1A 1Z6AA 3T7DA 5EINA 4V24A 5KTSA 2Q2WA 4KE7A 2IHUA 3JQCA 4OGFA 1Y3BE 3MBIA 3F5DA 2JFBA 4D0NA 3H5WA 2WUWE 3DFZA 1CPYA 4U6SA 2Q27A 4ZODA 3AVOA 2FFJA 5DXAA 4UHKA 1SVLA 1SKBA 5K8IA 1GU1A 5BQ5A 3HQ4O 4GM1A 4QVIA 1NLFA 2CKDA 2I78A 2E37A 5AW3A 5BXYA 1Z0IA 1V8DA 2YS7A 2NYVA 2JS7A 2WC1A 1SHKA 4YRKA 1VDMA 4ESVA 5KOJB 3JZFA 3OT1B 4RKFA 421PA 1Z2CA 3SU8A 5JXWA 1UAAA 1H3EA 5B58T 1E3IA 2X9QA 4D57A 1GPAA 3IKLA 1WZEA 4NBUA 2G80A 3SZGA 1WO8A 2XOEA 3AM3A 4JDUA 5HBGA 3JR3A 1W2GA 1CUCA 4PXSA 5ADVA 1B1CA 1HYEA 4QAQA 2WJJA 1FQWA 4JMPA 3HCOA 1AQUA 4CL3A 2NZVG 3OQIA 2ZYTX 1J42A 3T7JA 5FX2A 5TB5A 2YIVX 2NV2B 4J1TA 1AOXA 3ORFA 4BVJA 4AJNA 1TVKA 2Y1EA 1RVV1 1DXOA 2BSXA 4O2BA 4YAFA 4EUFA 3CC8A 3CMCO 5DXJA 3TR5A 4K9RA 1RKBA 3A05A 3HH8A 3SWWA 4D80A 1ESNA 4YRNA 2CRUA 4RSRA 3LPMA 1UOQA 3HHPA 5ED0A 1ZK3A 3UGQA 1QRTA 2KQUA 4DS3A 1A5TA 2YZGA 2ERCA 1J20A 3VKWA 1ISHA 2ONCA 2YIMA 1YCHA 1T2DA 1IHDA 2CXTA 3KEGA 2UV8A 2D4AA 3GEPA 2D6FA 1NBOA 2J5RA 1RI4A 3THYA 1E77A 2OUKA 1JT9A 1E1RA 1KYXA 3PXXA 4NCAA 5DM2A 4QVGA 3FNFA 2JD1A 3K8QA 2ZYRA 4JCCA 5MDHA 3OLVA 3K8ZA 2V54A 1BXZA 4FHCA 4PSDA 4G1FA 3LFUA 1G0OA 3WJAA 1LF0A 3AI7A 3CZRA 4DE5A 2LCFA 1PS8A 2HHHB 3QKSB 1QUTA 4RJKA 1XDBA 1V4VA 4HQFA 4HNSA 3I05A 2QG9A 3FWHA 4UE2A 4BBAA 1JQ5A 5CU7A 2AA3A 3UH0A 4O4JB 3G85A 2XVZA 2Q5FA 3HGMA 3M6VA 4NBWA 2ONKA 5JZOA 3UOWA 4DCMA 4ND5A 10MHA 1VXRA 1CX9B 4NFHA 2SNIE 3GAMA 3WQQA 1QTRA 4ZU3A 3RIMA 2NUPA 3DO5A 1DQPA 4DV3B 2VH5R 4Q1AA 2C7QA 1CJTC 3TZCA 4A92A 3ICEA 2OHOA 1M0TA 2GCGA 5KNDD 5IF3A 3VK7A 1DEOA 1XCOA 3RBZA 5CMLA 1G7RA 3RWMB 1SKAA 1B8OA 1XRJA 4IQ8A 4WGFA 3QNWA 3C4VA 4XWOA 1U0SY 1B0AA 1NLUA 2H0QA 5HE9A 4BP9A 3L7NA 3ELUA 4CFYA 4B71A 3K9QO 4N5NA 4DBLC 1TK9A 2X5NA 3C87A 2XCOA 1XZQA 4LKRA 4FNOA 3I01A 1TAHA 2YH2A 3F3YA 4MCJA 2UU9M 2EWMA 3OJWA 1Y8GA 4EMSA 3J2PB 4K9DA 1YOVA 3AVUA 1MB9A 4Z9YA 2HHAA 1VL8A 5KVQA 2P9YA 1E3DA 4QATA 3C41J 1N2OA 5B7NA 4RDHA 4WKBA 4TWJA 1JDVA 1WXIA 5BSMA 5F1KA 3WWZA 3A42A 3LVVA 3TEMA 1PT8A 1WY5A 4I55A 5J58A 4AJOA 4JHLA 4NS1A 1J2RA 2Q50A 4B3TM 3WK7A 4OXNA 3PUHA 2KA6B 2IIPA 2P9JA 2NZ2A 5DI3B 3L5KA 2WD7B 3GJ3A 4OI4A 1DTWB 1CEXA 2FVYA 4I3GA 2QAGA 4LRWA 1HH4A 1VC2A 4FMDB 5HNKA 4G24A 2AOTA 1T4BA 3HVRA 4O25A 5ENVA 3B89A 2EG5A 2DR0A 1KVUA 1POWA 3ROFA 4FKZA 3LWBA 4OHZA 2BGMA 1TCUA 1LLCA 1R66A 4HF7A 1E3TA 1L5QA 1XQXA 4Q3BA 3WA6A 4YJDA 2A1IA 4ZI3A 3DBOB 1JG7A 1CQJB 2QD5A 3LFHA 5H0IA 4WCFC 1I4DD 3L7JA 5C34B 2HW8A 1WXHA 5DGDA 3ASVA 3LAWA 2QPLA 1Z83A 4F46A 3FW1A 2EHJA 5A9SA 2W48A 1SEPA 2OHVA 2J3DA 3TINA 1HNXB 4BBJA 5B3JA 3GPCA 4HDMB 1SVSA 4R1MA 4WNYA 1U2DA 5B6IA 1KP2A 5AVOA 1Z37A 3ODGA 4NFLA 1AGNA 4CQJA 1K3FA 1CR0A 2ZQ5A 2DGDA 1MH1A 3BGIA 4I4NA 5B53A 1YJAA 2BM8A 2IKQA 1SIOA 4E4YA 4BE9A 3S4YA 3TZQA 1FUKA 5EP4A 4JB3A 3BE8A 1M6VA 3EOAI 3C5WP 3JQ7A 4C9BA 3A3YA 1TU4A 4ZEWA 3VDNB 1DGFA 3ESBA 4ARUA 1DPGA 1SKMA 2MGWA 2O0KA 2QTVB 4D9GA 1NUTA 3DMTA 1BW9B 1OCEA 1PO7A 4DTCA 4C29A 4RXMA 4TV9B 2OEPA 4RKQA 4DJEC 2HZBA 3I6BA 2PGAA 3IQEA 2PE5A 2V0NA 3LC0A 3QW4B 4DUZM 1G8PA 1IN4A 3HZJA 4NEGA 3WO1A 1NG1A 1M2FA 5B64A 3OLXA 3T4XA 3H5IA 2B1QA 3EMKA 3RKUA 4JJEA 3U6OA 3VVCA 5HJEA 3HA5A 3BB1A 4UFOA 4ALMA 1YS7A 3QU9A 3GLHB 3DBHB 1JZQA 4X62B 3VKGA 2JLBA 2EV9A 2O7SA 2HV8A 1QZMA 2QRNA 3AFHA 3I42A 2WU0A 1QORA 2PAAA 5HIAA 1P1RA 1TYZA 2ZIVB 4KQGA 1E60A 1D1SA 3AJIB 4PZPA 3NX4A 4F5ZA 4RPCA 4ALKA 1QRRA 2PL5A 3B7QA 4PXAA 3W1VA 4YMGA 2P5TB 3MQ2A 7ABPA 3TM4A 1R5BA 5IKXA 2QU7A 1GSOA 3K0AA 2XADA 1VGVA 2WB4A 3NEAA 3TD9A 2XMBA 4GP9A 4D8YA 2GSDA 4KHPB 4DIFA 1I3MA 4LQ4A 1LPOA 2VDMB 3IBGA 2HFKA 5KTTA 1CF4A 3ZQ4A 5AW1A 4MEBA 4QWMA 3UUFA 2YXLA 4IYJA 1RKQA 5EXDA 1SXGA 3MF4A 4FDTA 3CZ9A 5GTDA 3L7YA 1L2BA 1W8DA 4YREA 5AM2A 3ZBUA 1RCTE 5KX5F 1K7YA 2H9IA 1E0DA 1TK2A 3ANNA 1M2HA 1VLZA 5E7IA 1KJ9A 3MELA 1CQIB 3R23A 4KWCA 3AMVA 1NTRA 2XH9A 3MWYW 4IMJB 3B5IA 3CXRA 3SXUA 4FI3C 3DFFA 3DMYA 3AF2A 4QDTA 2WSMA 1T9HA 1UEXC 1BCSB 2HCTA 2EJTA 2ORIA 3T1YM 5E8RA 3ICQB 4DIMA 1THTA 1TNDA 4UBLA 1GCOA 3AEUB 1E3WB 2K4MA 4K0KB 3A3OA 4KO1S 4JP2A 4FYYA 2P9CA 4M76B 4Z1MA 1KJJA 3SS7X 3TCKA 2EC5A 4WZBE 1O5OA 4RTOA 4QTZA 4KR2A 4F4FA 5H4GA 3QVXA 3CGWA 2O8CA 2A0YA 4FFBB 2HRDA 4NDNE 1Y6GA 5BV2P 1OGYA 3VV2A 4DDMA 2WFMA 2WJGA 3TS1A 3L29A 5B58C 1WUJS 5GZ3A 1C2TA 3JX9A 3RS5A 2QLTA 3FG9A 4FFRA 1G8MA 2RBKA 4NV0A 5E9QA 2QSUA 2E82A 5BRAA 5DM1A 2QPTA 4XXHA 1EQUA 3STUA 3OCVA 1E7WA 1VPWA 5CT6A 3B2QA 3I12A 4AUKA 1KI6B 5IAEA 4OX9M 4MHTA 1ZH8A 1VIDA 5IYZA 1H9BA 4RZSA 5A1JA 1EQAA 3RYFA 1LLFA 3IP5A 5JXHA 4WASA 1OTXA 4G1VA 2GHRA 5I5GA 4CQMD 2HNAA 1NVBA 4PTLA 3MHTA 5C7OO 2FY8A 4YRQA 4C01A 2B5OA 3MOIA 4AN1A 1N5DA 1VIVA 3NONA 4H0NA 5AM0A 1BCRA 4R4JA 2DUNA 4XGRA 2F3RA 4EG1A 4XDHA 4PSVA 2BZ0A 1U7XA 3ZJYA 1B00A 1KZ7B 3REOA 1SCIA 2K2QB 2WZQA 5BP7A 2EARA 2IDJA 2I33A 3DV0A 1D2GA 4J03A 4TYQA 4MLDA 4TM7A 4ZT5A 3LIIA 3CLTD 5G40A 2BFDB 3I5UA 5JH7A 2JLCA 5KSPA 4TQGA 3OCZA 2X0DA 5IXYA 2C92A 1DMSA 1NONA 2XVAA 4D97A 4NPAA 5BWCA 1TYAE 4BNKA 1X7WB 1MP0A 2Q5EA 4OG2A 4DEXA 3VKUA 4V0QA 1F5NA 4R1SA 1H8EA 1J33A 5CFQA 2WFLA 2FQYA 4J4HA 2RI6A 5T67A 2OD9A 2CLLB 3C5CA 4TMVA 4GI3A 2ZTLA 2K9DA 5TF0A 5F7OA 3Q8KA 1PD1A 3P9KA 1JQDA 5AOAA 3PUIA 4MDFA 4WD3A 3NC0C 1E0KA 2IUYA 4M0MA 2AFIA 4PV7A 4ND8A 1UUFA 1JEDA 1TFRA 5KJFA 3GLTA 3VU0A 1R2QA 1TU3A 4MVJM 4ZDKA 4LXHA 4FHDA 4UDOA 1P75A 5LD2C 4PAWA 4Z3OA 4AYTA 5G53C 4WN9B 5G0SA 3F5FA 4RZHA 121PA 1D4FA 4U2KA 2KPOA 5HA5A 3R3VA 4EBFA 2FFBA 3K92A 2X5OA 3PC6A 1U2SA 4ZAVA 3UT5A 3ZNNA 4MAAA 1TC2A 1F2DA 1CSEE 3D0RA 5ERXA 3UBTA 3I01M 3BKWA 5DWDA 4XJSA 5F77A 3LBNA 2NU8B 4EH1A 3SDSA 4LZOA 2X5KO 3OC6A 2XBMA 1MENA 2NSDA 3CZPA 2WKQA 4DCNA 2X23A 4F5YA 3OA0A 2GB4A 5CW2A 3TSOA 3EGDA 1T26A 3L43A 2B4KA 4HAIA 3MA0A 5L7TA 5C1BA 3ANLA 4AWBA 2R4EA 4BRSA 5H83A 4Q9JA 3JYNA 2VWQA 3BIXA 3NV7A 2H1WA 4R8LA 1KDVA 4AY4A 1IZ7A 3LT1A 3U6MA 4DSTA 1TUIA 3U7JA 1A71A 3AR3A 3RF6A 5D87A 1GTRA 1I7LA 2OK8A 1FP1D 3EPKA 2WU1A 4IXDA 5HM6A 4OB8A 1OHHD 3L7AA 2GK3A 1U2QA 3FXAA 2OESA 2ACEA 3S8EA 2QW8A 3CPHA 4Q16A 4IH4A 2ODQA 1Q15A 4OSOA 5JYDA 3I8SA 2I66A 1TKAA 5B4UA 1I9GA 2AVNA 3CH5A 1E5LA 2VRNA 4NLLA 5LOVB 1GZ6A 1REQB 5DHUA 4X8LA 5IDXA 2C4MA 1IZ8A 1NLZA 2YXEA 4MMYB 4WZAE 1TIPA 1MGPA 1D4OA 5DT2A 1E69A 3K4HA 3SIXA 5FPHA 2BFCA 3TLGB 2CL6X 5I6DA 5BO5A 1YKFA 2VJYA 4FJ2A 3RJ9A 3FOCA 4KVGA 1CV2A 3B60A 2PL9A 2C59A 3M6FA 3Q87B 3ZHSA 2WILA 1XB2A 2HUPA 2F67A 3UHJA 1KO4A 4JOBA 4C07A 4Q1BA 1IY9A 3L26A 1OI4A 4EG5A 3AQ4A 1ZK2A 2HT6A 4F5DA 2HA2A 1SUAA 3PC7A 1B8VA 2H0AA 4IVQA 3BGSA 1FTWA 4MVJE 1MA0A 2N35A 2GPYA 3TLBA 3KC2A 2ICAA 2Q9UA 2ZAGA 2RG7A 2ZI3A 3AF0A 3E7PA 3HNRA 1QDTA 3KTFA 3UFBA 1QHFA 1YFZA 1TM1E 2ZIXB 5EMLA 4MYRA 2IL1A 1VLVA 5LC1A 3P0HA 1DT5A 2VSFA 4CL2A 4QC2A 4EUEA 3HSSA 4B4WA 3URKA 3VHRA 3NP7A 2NXWA 4M55A 2HJ9A 2PUEA 4Z8YA 3KKQA 4NTZA 2WPDA 4L95C 1IONA 1CIJA 3FCXA 4GO1A 3WB9A 5EI5A 3AGQA 3ZCXA 2L82A 4QODA 4CM8A 3ECSA 3FYTA 3V76A 5HKKD 2HSWA 2NQTA 2OOSA 4DN6A 1GTG1 3O4FA 3OZXA 1R0ZA 2BP7A 4RF0A 4UZSA 1M2GA 1ZESA 3L06A 5FTMA 5IM5A 4RX1A 4UU7A 4BB9A 1K8XB 4C7KA 5AJHA 3CRZA 1TO6A 3OC0A 3KOMA 2G08A 4UXJA 4UHEA 4DPLA 2AI1A 4X1KA 3FJOA 4QM6A 2OZEA 2BRUC 4RK0A 3DMNA 2ZYDA 2GPAA 1NVWQ 2GS9A 2A1UB 3BC1A 1SZPA 1YKGA 1VLHA 3AJDA 1LVUA 1E2HA 4ARSA 1Y1KE 1YDMA 1XRRA 4IHJA 3WWPA 1I1HA 2QD4A 3ZDZB 2IXGA 4NJEB 1V4NA 4HSGA 3KJEA 2Z6AA 1GZHB 2AT1A 2HRQA 4BFSA 2BJWA 3AXTA 4JI0B 1PGPA 4OHCA 3V8BA 2X9LA 3A2MA 3EJWA 5L8VA 5FA5A 3OZEA 1PYOA 1FS4A 1ULAA 1YCFA 1F0PA 2VHVA 1XXLA 2E55A 1BDMA 1WJ7A 1P1HA 1RAGA 3VZPA 3MIIA 5DK4A 1WABA 4IZOA 3RREA 5HZGA 3B53X 4N3AA 4G5QA 3L8DA 5AW4A 1USIA 4KTVE 5DULA 4YMTA 2GZDA 4PWYA 3VISA 4UE6A 2X3UA 4LOKA 4IG4A 4EUHA 4NJMA 1US8B 5U1PA 5JYBA 3G0BA 1RU3A 3LDAA 3D8UA 4JEIA 1ILWA 2CNWD 2GPTA 5KYYA 3R74A 3EXHB 1XZGA 3PKIA 2RGGA 4N9WA 1UBGA 2TS1A 2IV7A 2C2WA 3BWXA 3KQNA 4YO7A 1NVUQ 2VTVA 1OX5A 2IOYA 4PZAA 1TTTA 2A78A 4Y0NA 4NBKA 3HJTA 4UEQA 3JYOA 4XVCA 4Y1GA 4TWBA 4RA9B 1JAXA 2LH0A 1K6EA 2ZPTX 4PLHA 1OB2A 1TM5E 4F3NA 1MV8A 1E2MA 3H11B 2ZWOA 1ORRA 2I2XB 3GGPA 2JJYA 4BHTA 2Z9BA 2YN2A 3UMMA 1JMYA 4QREA 2WF8A 2JI4A 2UZ1B 5BWNA 1QZTA 3Q0TA 1XMSA 3CLKA 3RFUA 2O5EA 5JARA 5CDUA 2VLBA 2XDWA 2ARKA 2ZBDA 5K0TA 4I5EA 4Q7EA 1L7MA 1XVTA 1RADA 5BSTA 4IOMA 2QD1A 3HUFA 4B3RB 3RVQA 1G7CA 3FD8A 3N76A 4GH5A 2M32A 5GV7A 4Y2SA 1Q1AA 3KHUA 5EJEA 5ERYA 2P3LA 5L4SA 3OTOB 2XA1A 2R3SA 5GM2A 2ZBPA 5K3CA 2GBPA 3ORYA 2ZRBA 3NT2A 4MLPA 3QHPA 1MO6A 1V8PA 4A03A 2IPNA 3OZCA 3H5LA 3KIPA 3EH2A 3EF1A 5C9ZA 3SF8B 3QG1A 4OD0A 3CLHA 3GEGA 3QMVA 4QA9A 3VDXA 4MW7A 4C2UA 1TRKA 3RAEC 2YFQA 4M9QA 3KSUA 1XXHE 3FR8A 4H6VA 3E7DA 4XLLA 3T54A 4BU1A 3MWFA 5U4XA 4G0MA 2HHJA 4FSDA 3NEYA 1XRMA 5DHRA 4CFSA 1TQHA 3F6EX 1C3OA 1RTTA 4QUJA 1P39A 3WXMA 4J0JA 5CLGA 3QLUC 1XTSA 3WL6A 3W0LB 2BBTA 3FOWA 1IBMB 3UGKA 3KZKA 3AOGA 4EYEA 5CVVA 5LA6F 4L02A 3H8JA 1OMOA 2BVNA 1OWOA 1QYVA 5EWMB 4ZT3A 3LVWA 2FPIB 3ZWMA 4RD2A 5CVDA 3TRJA 4YJHA 1KH2A 4UEWA 2P0EA 2Z5VA 3WVNA 4JQSA 2GN6A 4HX5A 2RAUA 3I53A 1ZW1A 5IMBA 4RKYA 1QFJA 3K20A 1M8PA 5F7XA 1YR6A 2W2OA 1XZBA 4NNPA 3EXEA 3CUUA 1SBIA 1RKUA 2BKUA 4U0KA 1X8LA 1UZMA 2QUBA 1K82A 2ZB8A 3ZU2A 4R2WA 3K71B 3KHKA 5BN3A 5JC8A 4IIDA 2PA0A 3PQCA 1FDIA 4ILEA 2J3EA 1XDUA 2IDMA 1XTIA 4MLZA 1GCAA 1WNTA 3AUJB 5C7YA 1Q0ZA 3SVLA 2X4LA 1JE0A 1OR8A 3ROXA 3BJMA 3DLCA 5KCMA 4FU0A 4BJ5A 4IEEA 3NTRA 3U37A 1YBVA 5JMPA 1I3KA 2O2DA 3CNHA 3BWMA 3CRQA 3BXOA 4TKUB 2WHRA 1P4AA 2J0SA 1WJGA 3LV8A 1SH7A 1TD1A 5E2IA 4BFLA 3M6IA 3UJ3X 4PX2A 2P3SA 2BW0A 2CE2X 3NHLA 2OGWA 3HFGA 4F04A 5DM4A 1TUGA 4HDKB 5FA6A 4TWZA 4DT1B 1QK3A 3PEUA 2QYOA 1KZHA 1GJRA 3BAZA 2FZEA 1IJBA 5JY1A 1GPH1 1X7YB 1KNQA 1XLVA 1T43A 1TYDE 5LYJB 1BHJA 4RF5A 1SBTA 2BD0A 2C3YA 4PQFA 4EATA 4K6FA 3VR1A 4Z4QA 2CZCA 4KIFA 3HB9A 2YHAA 1ORYB 4N0DA 2B99A 4A8TA 5TEVA 5K7SA 2D2VA 2WHXA 2WM3A 4WEOA 4C06A 1ST2A 4TS3A 4JEMA 2WJPA 3STYA 4BQQA 1E63A 1H4SA 1FNBA 4XJTA 1RLTA 4QTTB 3TDNA 5DK6A 4Q1EA 1ENZA 4ED9A 1I80A 2JHAA 1MPTA 3CLTC 1E2UA 1PJBA 1KYZA 5TMBA 3FNEA 2O52A 3CQ9A 4LCJA 1ZH4A 3KJXA 1T6ZA 4LF8M 4PHHA 3QGMA 4E32A 3EX7C 3ZHYA 3O0DA 4AYWA 1OFUX 4MO9A 2O05A 2YNMD 1XAIA 3I6ZA 1DV0A 3KQVA 5AQ1A 4S05A 1MDBA 3QEAZ 1K89A 3ZDCA 4AZ0A 4G0WA 2DI0A 4JJ6A 4A2QA 3HN7A 3E3MA 3NFYA 1PEDA 3KXLA 2BDUA 5REQB 4AECA 1WBDA 3ZZNA 1Z08A 1N5OX 3SICE 1WSWA 4G3XA 3B3GA 1GGNA 2FRDC 4O59O 3A31A 3I9LA 3QEMA 1VKHA 4FDLA 4XGQA 2J5QA 1O3YA 3GGGA 3ZU5A 2OYRA 3MBOA 3BE5A 1II0A 4IXWA 5THKA 4J0KA 1NSYA 4CKBA 3MG9A 3LY7A 2H52A 4B7FA 1L4YA 3GCZA 2CLSA 3DE2X 3H1GA 3PGJA 3QMMA 4BCBA 4YVFA 4XB6B 1GPKA 3E6AA 3E22B 3L0PA 1O94A 3BK2A 1VPEA 4S0ZA 5DFAA 4LSMA 3HP7A 1AKEA 3GZNB 3DGFC 3ZW8A 2P7IA 4CV0A 4COKA 5JNWA 4NCHA 3WA7A 4H35A 5LMZA 4N47A 3D4IA 5LWHA 1DOAA 2PCLA 2AJBA 1WDLA 1FMLA 4BZWA 1QOZA 3CB2A 2BLLA 1HDCA 3O7MA 3ZE2B 1GZSA 1FVFA 4PBSA 2QX6A 2EP5A 2GUGA 4E13A 3TTSA 3SR0A 4C7JA 2HMSA 3ZWNA 2X49A 2B20A 1XHEA 4NVRA 1M0EA 3BTSA 4NBNA 4UVIA 4X93A 1DGBA 4HVCA 4DKXA 4HN2A 4OUDB 1B8PA 4YA6A 2XMRA 3ZGLA 2LCQA 3OICA 4QGFA 5MN5A 4TZ0A 3SZLA 1C1HA 3ZHOA 3TE7A 2D7EA 2X13A 3LDUA 4WI1A 1G64A 4FOOA 3OF3A 2WLTA 1FLVA 4HJXA 1AHIA 4LF5M 5A0VA 4LBZA 1Q3KA 4X7RA 4ZVVA 3FROA 3D3EA 5K3DA 3ZGYA 2BSQA 4RFSB 4F12A 2AUTA 1SVOA 1CY4A 2HO4A 5D7BA 2DFKB 3EVDA 5JSKA 3EDYA 2VPYA 1GTJ1 1D0LA 2Z2ZA 4E5PA 4CTJA 3CLRC 2P65A 3JPWA 3SZ3A 5IWAM 5SZIA 1CY6A 4BO5A 2YY7A 1QG2A 5HFJA 1E6LA 3TEFA 3NYWA 4CMBA 1LJ8A 2ZSUA 4PG5A 3WLTA 2B9EA 1CDDA 3GLFE 2H7CA 3U7IA 3K5WA 3ICVA 2CJPA 5K4GA 2ZQYA 1R37A 1TCCA 1CD5A 3GFFA 1H0KA 4NZPA 1T5DX 1GT91 1KMMA 1BXRB 2V4ZA 2LP4Y 4CKCA 1L4UA 1PHPA 5HUQA 4KQ2A 1KIMA 5C31A 3O3MB 1IBLB 3HE3A 3M70A 2VTBA 4M0EA 4R3DA 1LNSA 2JY7A 2QDXA 3SBOA 2WUVA 4B8ZA 4IDBA 4MS4A 1N7JA 4R2HA 4F3KA 2WZBA 1CR1A 4JNCA 1O6CA 2Y67A 4LG2A 4GYYA 2OQIA 3W79A 1E9SA 3KR9A 4DTIA 1T2VA 4MK4A 3ANSA 1WHSA 3DAGA 2QRVA 3OH8A 1PW5A 1ODIA 4RCZA 1G63A 2B5WA 3CW8X 2VAMA 2WY2D 2FDXA 1USUA 3T12A 4EGJA 2RFLA 2Q4BA 3JQBA 3V33A 1TW3A 3L0CA 1V2GA 5KAPA 2CFCA 2KW5A 3PE3A 3KZ1E 1U80A 4L2IA 5J43A 2JNHA 1ULUA 1L5OA 3MW8A 3VDPA 4QG7A 1FFCA 1E1NA 5GP1A 4BO2A 2XY4A 4C0QC 2Z4RA 2XHZA 1A2KC 5F3DA 2ZI7A 1VG5A 1F2TB 3I9MA 3W8DA 3GRVA 4ZQFA 2AOXA 4I1VA 4ZXFA 5JBNA 5D6NA 4GF5A 1U3FA 4CU2A 1OYVA 2Q3LA 2PMBA 4GPD1 1QMPA 5IJXA 1G291 4LNUB 1H2FA 1FUYB 1SXQA 1SUCA 4I50A 3LBFA 3GJ0A 3ZNPA 1M34B 5BSFA 1PSDA 2WYOA 4LJRA 1QYXA 4A3VB 1XTUA 1U3DA 4KO8A 1GG2A 2C94A 3OWXA 5KPRA 4E22A 3K9FC 1VYHA 3G0GA 2OCGA 2YN0A 1DX9A 4CLEA 4TQ9A 3C8HA 1DEAA 4PZ9A 1HDZA 3FCAA 4UAGA 1UPTA 4B08A 3FLAA 4GOXA 1L7BA 3IEIA 5TS3A 4V02A 2R5WA 5HF9A 4DGSA 5LQDA 4OXIA 3FRIA 1ZN2A 4WZBA 2Q29A 1VPDA 4CXMA 3Q3CA 1N6LA 4GM4A 4HADA 3G8BA 3UPTA 4XWWA 3OU6A 4REQB 2WMNB 4Q4DA 3ELWA 3V4VB 3ZY6A 4LZLA 3QJYA 1IZ0A 4BWFB 3O8QB 3HO8A 4YRCA 5KKNB 1L4HA 4P32A 4ODIA 2SECE 5E3HA 2H7YA 5IAAA 4HR7A 4FS8A 3ZIAA 2IELA 2K87A 3L4JA 2FPPB 2CGEA 4YQZA 3M4JA 1OC2A 4RPKA 2X2FA 4C14A 3NNSA 3AJEA 2EFHB 4RAQA 3I5AA 2BFMA 3RASA 1AIPC 3WBFA 1S5PA 3K4PA 5CUQA 1JB0F 1OQAA 5EAIA 5JWOA 3BFVA 1AKTA 2HLPA 4ON9A 2F00A 4DV6B 2LTUA 1OX6A 4YIHA 1J0XO 2PZKA 4FQ5A 4LYYA 1M83A 5DNAA 3ENZA 4K9PA 4LWPA 2LNHC 3A0UA 4YY3M 3HJNA 2FCAA 3GOQA 3UEOA 1XQWA 1BHO1 3FHLA 2VF7A 4V0SA 2W9XA 4ZVUA 1YRBA 4NYMQ 5C8DA 4HYQA 1YL7A 5DVZA 3QBVA 1GAEO 1O54A 1UBRS 3P9SA 1AM4D 5HCIA 2QCUA 4XWGA 2DX7A 3DEHA 5TGTA 1DJLA 1C3JA 2J48A 1H2EA 1DXQA 3K0CA 2J7OA 3M1LA 3FPKA 4BY9E 2WBLC 1J22A 1IVYA 1GAQA 5C1OA 3G2HA 2Q4EA 3ZJTA 1XCLA 1H2XA 1O5TA 1A77A 4HQLA 2I65A 3RVSA 3PRJA 3ABRB 4PHFA 3L4SO 1M8GA 3M6LA 2DE0X 4OHPA 1N1DA 2ZRGA 1QE3A 3KG2A 3H6KA 4JI5B 4U7PB 3NBAA 5BSRA 3RYHA 1NXPA 1QU2A 4A5OA 3ZBQA 4PC1A 1HXHA 1CZOA 1YFJA 3TTTA 3Q3IA 4CIBA 2XD4A 2VP6A 3D3QA 1WY7A 3ZY3A 1SVWA 5IU6A 1QQ5A 2IOFK 2O2CA 4UJ3A 2OILA 8AT1A 1K97A 2BAGA 2WTXA 4XYMA 3GJ7A 4F96A 4ZI2A 1G4AE 3NS7A 4XDGA 3VM6A 4MV6A 4WEQA 1E7SA 3LK6A 3ZNQA 2MYTA 1Z15A 2EFCB 4ZOAA 3UK2A 3SQXA 4JI7B 4FR2A 1YHNA 2Z1MA 5I7VA 4BVFA 1U4NA 3K32A 1NQTA 4MGEA 5JRDS 2R4TA 1WR8A 2DP4E 3TI9A 1U8TA 3GPIA 4KFCA 3PYMA 5JRJA 2PS9A 1X9HA 3C3CA 1EZZA 2A9PA 4NK4A 3VNVA 3AF6A 2UZAA 4B76A 4J7XA 1BE8A 4KNWA 2O20A 1G41A 4J91A 5EJ2A 3QX7A 3WYBA 1K88A 2R47A 3ESDA 5ETJA 4CR7A 4Q3KA 4HLCA 3ZWPA 2AF3C 5FDFA 2PT9A 2W22A 3VTKA 2V7XA 1ZJWA 4BQNA 3W34A 3R4VA 1WIWA 3OE7A 5FNVB 3AP3A 2JGEA 3KUDA 2XQGA 3V4PB 2XMGA 3ZKWA 4MA0A 1N78A 2Q41A 1W59A 3WQHA 1UT6A 3ZXUB 3RO7A 1Z4KA 1HMPA 2PM8A 4JT2A 3PDWA 2E5LB 1Q2UA 4MDHA 1SQ0A 1QKIA 1APBA 1QCZA 3TBHA 5BOVA 3RWOA 2A4MA 3ORRA 3NAZA 4EB8A 3CVUA 1EWQA 3HBFA 4QXMA 3PXBA 4WCFB 1A5SB 2J4DA 2WUGA 2ZVDA 1GKUB 3HI6A 2GQ0A 1FXWA 1R6XA 2XUHA 4I4LA 1ZCAA 4TT3A 3HV0A 5ITYA 3ZXIA 4E70A 5EVJA 1A0OA 4P7GA 5B57C 4WZAA 4C0KA 4UAUA 2BEWA 5A6VA 5ALGA 3C3MA 4C7MA 4YECA 5ES4B 2EGHA 4XH9B 2YZKA 4ZTBA 1F3LA 4U8GA 3WJ7A 3F97A 2RE8A 1JQJC 3E61A 5BWLA 1L4KA 4C0AC 2XODA 1MQSA 4FYPA 4UPEA 2Q0SA 4BNTA 2AZTA 3FA2A 1Q57A 3GP5A 3HU5A 4MULA 1QRSA 4H16A 4BKMA 3FI0A 1CVRA 1H0HA 3HK2A 3N58A 5J59A 4MVJA 1UDXA 1NW3A 1JECA 3WOVA 3JWHA 3SMVA 1UL1X 3RAGA 1J24A 3V4ZA 2ZJ1A 3K1TA 1YQGA 4QQKA 1U1CA 4ZGWA 4F85A 4ZEMA 2AMJA 2KMLA 4B45A 2YNMC 3G9UA 4Z4IA 3RKRA 1E9BA 3QVKA 2WKRA 1P2GA 4L3VA 3ZZUA 3H8WA 3A1NA 2WKSA 2OO3A 4EI8A 2VJCA 3OIFA 1LPMA 3ZYCA 1GN9A 2J6IA 4E5MA 4NCIA 3A46A 3OPNA 4RHXA 4QYMA 4F4IA 2NUAA 1W9HA 4CL8A 3WWOA 4LFAM 4BFZA 3H9QA 5CLIA 4FFOA 4LRUA 4K6OA 2FW1A 3C6QA 3HDYA 2G9QA 1HFEL 3W6OA 2YWJA 3QIAA 4AT1A 2KX7A 2NTJA 2XVYA 2RGEA 4LVOA 5AJWA 1TC1A 2YQ5A 5DIFA 1WXWA 2FWJA 4WERA 4P08A 1PD0A 1QS0B 5B6JA 2EJSA 2I8CA 1HTTA 1KYWA 2YICA 2OQVA 1RZRD 5A3RA 2Q5HA 3O9VA 1PSWA 3U16A 1XZFA 2Q9BA 2ZE6A 1E99A 1E18A 2JKVA 1K92A 1U3VA 1LBIA 3BAFA 4JZKA 4GHLA 1ZU4A 3WR5A 3BK1A 5EHNA 1Y1QA 5LFAA 2HNKA 2ZZKA 4B6QA 2DAGA 1ZIDA 2F1JA 4O4JF 4GPTA 3QFSA 3AH8A 4EVQA 5A05A 4G0NA 3WIEA 2Q6LA 3BGOS 1CJCA 4JR2A 5ALIA 5E7JA 2G70A 3E9SA 4DJAA 2H5XA 4LRSB 1G59A 1DJNA 2V59A 4MKZA 4WUVA 1DGHB 5CHEA 4P5EA 4YJFB 3KLMX 4RHFA 1AB5A 4UUBA 3V1LA 2QZSA 4MUBA 1K7XB 5EE0A 3LC2O 4KQMA 4MRVA 4ZVPA 5JQGB 3ROEA 2FH0A 5G1NA 3DCYA 4OO3A 3AZOA 2RDMA 4JI8B 3BMNB 3AUFA 2ECFA 3L0SA 5AK5A 1XCMA 1NVMA 2ODTX 3OIVA 2DCUA 1IK4A 4V0OA 4RVOA 1GTMA 1OIVA 4WXPA 2W5UA 3DAOA 1VYUA 5JAQA 4RTJA 4ENPA 4CI9A 2VJNA 5FWXA 1E5QA 5BW4A 5G02A 2AKAB 5I7FA 1DTSA 3A37A 4Y18A 4J75A 3TRDA