4AG5A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
374
Chain Sequence
SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRVFQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
total genus 140
structure length 374
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag5A01
3T5GA 1KK3A 2HF9A 3TSOA 3VKWA 3PR1A 5BYJA 3TJZA 3D6TB 3U7GA 4UXIA 5TVKA 2PEZA 5H70A 3W5IA 3TKLA 4QJ4A 1BIFA 1LY1A 2I1VB 3KKQA 5C4GB 3QVVA 3THYA 1Z0KA 2QQEA 2OLKA 2VIIA 2XITA 2XJ9A 1ZCAA 5FPKA 5FTLA 3IHWA 2MSEB 2WAYA 1TQ4A 5DHFA 3CX7A 3BGWA 2FNAA 1VYVA 4M1KA 1RJ9A 3CNNA 2C9OA 4N0EA 3ZZUA 2FDCA 3SR0A 3TUIC 3AF1A 2JIZD 3B78A 3ZLJA 2BJVA 2FPLA 4MRVA 4UXJA 1ZJ6A 2F43A 4W5WA 1P2TA 3FFBA 4YMVA 2IYTA 4BRWA 1EXMA 2GBLA 5LB4A 5J4HA 4Q1BA 4BQSA 1M7GA 4QOSA 3UPUA 3K0CC 1WB9A 4LC1A 3I72A 1OH6A 2H17A 3QKUA 1GUAA 2AXNA 4GBMA 5H1YA 5JI3E 5CM8B 3IPYA 1ONBA 4I4LA 3A1UA 1FNNA 2VP2A 3UG6A 2GF0A 4OK6A 1W0JD 2QEQA 4DLUA 1MO4A 4TTQA 2Q6TA 5CB6A 1IJEA 1RE0A 1H8ED 4U7DA 3PENA 4AC9A 1W36C 2XNSA 4BLOA 4MITA 1GNRA 4GZLA 3S1AB 2ZI3A 4CGZA 4Y0VA 1ZCBA 3IIMA 2RGNC 521PA 3GLIA 4JVNA 2NGRA 2IWHA 1WBBA 4TQUS 2OCBA 2VRWA 3U3MA 3DM9B 4HAZA 1JAHA 4PR0A 1SQ5A 2JATA 4PXAA 2C2HA 1RYHA 3KTAA 4EFMA 2Z6VA 1R8QA 2ZI9A 4P3YA 4DDTA 4ZDJA 4MDEA 1CXZA 1JAIA 4B73A 3WYGA 1CJKC 4PANA 1TX4B 1SVOA 3CH5A 3X1DA 1CP2A 3ZYCA 2IYZA 2XGJA 5DGXA 3QG5A 3BFXA 4WVFA 1W4AA 3GLGB 1A5TA 1AGRA 1FOEB 3W6NA 3C15C 3KKOA 3TBKA 3TR0A 2W58A 4HLDA 1KO1A 3LVQE 2ERXA 1KHTA 3DPUA 3LBNA 3T1TA 2AX4A 1W7AA 2D06A 2B8TA 2NMVA 2ZUDA 2EYUA 2SHKA 4IRUB 2GEUA 2X2FA 1ESNA 4M1YA 4M1WA 3L82B 4Z8YA 2PX3A 2GJ9A 4FD2A 1ZUIA 4PO8A 1P73A 2WWXA 4YMTA 5JS7A 4KLNA 5IDVA 1KI3A 5G41A 3ADDA 2JAQA 4KSCA 1D2MA 1TNDA 2BMFA 3WNBA 3BORA 3EZ7A 5JWRA 2CCGA 3K0AB 1VCOA 4NYIR 1JPJA 3B82A 5JLJA 1NIJA 4L15A 2AD1A 1AS0A 2IEZA 2ZRAA 2CE7A 2FFAA 3U3RA 4BECA 3Q5DA 2FF7A 3NDBB 3T34A 4DEXA 3CPEA 3FFAA 4B34A 3U7HB 1G4AE 4IJMA 2WTUA 2CLCX 621PA 4DSUA 4Q9LA 2HV8A 5KPDA 1II0A 2J1LA 4B43A 4M9SA 4LJ5A 1P2SA 2QSYA 1E9FA 4HDOB 3N70A 3HP1A 1FUUA 4W9MC 3VNUA 4MRRA 3I8SA 3NWJA 2QMEA 2NO9A 2ZUCA 2JDID 1A7JA 3DZ8A 4LCBA 2IYWA 2JLXA 2ZRCA 4I1VA 4IFEA 4GI7A 3IUYA 4H1UA 2R6CA 4BWYA 5JEEA 1Z28A 3C4JA 3X1XA 4BPBA 1B0UA 2XXAA 3K0FA 4AKGA 1K5GA 2O0HA 3ND9A 1WQ1R 5G3ZA 1L2TA 1XU4A 3OIVA 4EFNA 4Q1AA 2ECKA 2CK3A 3FHTA 1YZUA 1OFIA 3NHAA 3KZ1E 1TF2A 4MKFA 4QBIA 1T5LA 1N5KA 3P27A 3ND8A 1WBDA 1XFAA 1NN1A 4QRHA 4LV5B 4Q48A 4HAVA 3QI2A 1JQLB 3VHXA 1DO0A 2DR3A 4WOPA 5KHOC 3HYTA 3AKDA 4GOJA 1IM2A 5HKKA 5H68A 4YXWA 5A4JA 3SBDA 4M1OA 2B7BA 4EUNA 5HE8A 1NP6A 3VR1A 1G17A 3OIUA 3VR4A 5F98A 3A6PC 1BMFA 1Q57A 1XMVA 4BFTA 1US8A 4XTRA 3EIEA 3PCRB 1S4QA 1Z6GA 4Q9KA 4GMDA 2C9YA 4UNQA 1D6JA 2WJIA 4B47A 2ZRLA 1G6HA 3RS2A 3NHBA 1E32A 1M6NA 2AFHE 1IHUA 2A5YB 1OXVA 4TLAA 1XJCA 2WJHA 1CEEA 3QXSA 4DRZA 5E7MA 4FMCB 4DIDA 3LLUA 1DS6A 1E9BA 1NLYA 2XOKD 3FKSA 4A0FA 4AK9A 2IUSA 1XMJA 1VHTA 1YJ5A 3QKTA 1Q44A 3AVVA 4LX0A 5DO9A 4HSEA 2V3CC 4PPFA 2FH5B 1X3SA 2RB4A 2TMKA 3BWDD 1YZGA 3K0CA 3OF5A 1TUIA 2VHQA 1HURA 4NKRA 1Q21A 3EAQA 1C9KA 4JL5A 3ASYA 3BK7A 4FI3C 5JWOA 4BLTA 4TSFA 4EDHA 1G3RA 1NVVR 4LC0A 1OFUX 2CK3D 3B85A 1H65A 5H8WA 5AJZA 2IXGA 3TRFA 4D26A 4LZZA 4PQFA 1XTRA 3SYNA 2V8OA 2ZVPX 1YE8A 2VSOA 3TQFA 4KXFB 5KSZA 4JT2A 4Q7MB 1GL7A 1U99A 1DAMA 5DH9A 5JRZA 1R5NA 2ZRFA 2WJYA 2GVZC 1G8PA 2RGNA 4YLGA 5CITA 1G6OA 3R7WA 1YKSA 4WA7A 4B2IA 4ZPXA 4YXWD 1KDTA 3C5HA 3Q7PA 1A2BA 1T0JB 4UJ3A 4O2RA 1FX0A 5KYKA 3WMEA 1BMFD 2DB3A 3QXXA 3TK1A 4QNRA 1Q1BA 2ZITA 2J41A 4JLPA 3P4YA 1RFLA 3KL4A 1X86B 2C8VA 4W5JA 1P5ZB 2LKDA 1W46A 2BIFA 1XD2B 1Q3HA 2C77A 3GQBA 3GLFB 3SQXA 2QPTA 1F3OA 1II9A 1XMIA 2RCNA 3QUSA 3K0EA 5FBVB 2A7QA 1IN8A 5KNBA 1I4DD 1KMHA 2DYKA 4DSTA 4PO9A 1SXJB 3QIAA 4HZUA 2F1RA 1Y3AA 4TMZA 5A0FA 4EPVA 3FKSD 3IKJA 2O8FB 1UBCA 1WP9A 3LQQA 2OFOA 4PZLA 1GSIA 5E3HA 2QT0A 4V0NA 1T5IA 4IW3B 4AI6A 1ZNZA 2ODBA 1MR3F 1VG9B 5FOVA 4B2LA 2VTKA 4V02A 4A0RA 4DCTA 2J3EA 2KB0A 3GFTA 1CKEA 1GZSA 4MKHA 2YWEA 1UKVY 4EQ6A 1J8MF 1JR3E 2ZETA 1CJMA 1QG4A 1VCNA 5C18A 1NJFA 2IS4A 2GVDC 3W6OA 2ZSFA 3QEJA 4CDGA 1W36D 2O8CA 2J0UA 1FNMA 2CCJA 4NCJA 1P61B 2ZROA 1JXMA 5FPTA 4HI0E 4KBFA 1XEWX 2XSZA 3MLEA 4JLBA 1E2JA 1GWNA 4PQYA 4A1FA 2CBZA 2HLDA 1MH1A 1D5CA 2GRJA 2QRNA 4OI1A 4Z54A 2F9MA 1ZIOA 3WNCA 2GJ8A 5D3MA 1K8RA 3HYRA 5L3SA 1GAJA 3BFKA 4HLUC 5AK0A 3RS7A 3UATA 1NKSA 5BQ5A 3EA0A 1GDDA 3QPWA 3RS5A 4QG7A 3R9WA 1CTQA 3THYB 2JLWA 3IDQA 1G7RA 4OJKA 2GJAA 2CDNA 1OYWA 1IN6A 2CHGA 1XF9A 1DADA 1N6NA 3EPHA 2ZYWX 4MKGA 5J4LA 2AWNA 4BEJA 3W8RA 1RJ9B 3L43A 1VIAA 4K81B 4P4UA 3NDPA 4DVGA 3BB4A 2F43B 4LY6A 5FUXA 2RH5A 1RC8A 2ZRKA 3VHLB 4FMBB 2C96A 2O8DB 2ZJAA 2G1KA 3D8BA 4URUR 4WAUA 4TT3D 4YC7A 5HPYB 4H9GA 3QBTA 3HR7A 4IFBA 4Q1FA 1UEJA 4TMXA 5EJEA 1AJEA 3AKEA 1IY0A 5DN6A 1NY5A 2JA1A 1KK0A 3WYAA 4D4MA 5CYPA 1Q20A 2PL3A 4D0LB 1Q22A 4I81A 1OW3B 1J70A 1X8KA 4IXMA 1KZGB 2F1JA 2Q21A 1NBMD 4HUQA 3DKVA 2D62A 2W2XA 3EXAA 4HDQB 2ATXA 1CLUA 1KI1A 3GLIB 1GL6A 1O3YA 5KUTA 4B75A 3CF2A 1DAHA 4IVQA 2XSZD 1W0KD 3KTAB 1T3LA 3THWA 3LDAA 1GRQA 4M53A 3LY5A 4PC6A 2B92A 4A82A 5FR2A 3RC3A 5HCNA 4OL0A 4RVCA 5B64A 1N5LA 2O8EA 1F2UA 4XJXA 1DG3A 1Q3TA 1RRGA 4F4CA 1DAEA 4V0ME 5K8IA 4UXHA 3EZ2A 2IBMA 1YZKA 4P0TA 3TVDA 4FXPA 1KK1A 3VKHA 2FG5A 2HYDA 5FOSA 2WHXA 2GWHA 2W2VA 3A36A 4FWIB 1RVDA 2CEAA 1D9XA 1YHNA 4OQFA 5KSOA 1YU9A 2QN6A 3P20A 2DWQA 4WZAE 3ZS9A 3GLHA 1SHKA 1ZYUA 4OHWA 4BLSA 4LHZA 4C0LA 4A9AA 1TTTA 3NTUA 5EXSA 1EG7A 2GXAA 4TYQA 3C41J 5AJYA 2R9VA 1CRQA 3HDTA 2Q9CA 3OHMA 3A8TA 3PEVA 2GXUA 5IRCD 3UXMA 2XZOA 1EGAA 2FSHA 3SYLA 2V1XA 1CJTC 2A5GA 2QTHA 2X1VA 1II8A 3K53A 3UMRA 4AYTA 1BYUA 5DN6D 1NRJB 2J7PD 4TZ6A 2QG6A 5FUWA 5EQTA 1GILA 4HLCA 2WICA 3ZQJA 1TUEA 1GOTA 4I99A 4Q7KA 4Q4HA 2GJKA 3AGPA 3PUZA 1U0JA 2O0KA 5TXGA 4C0QC 2YOHA 1ZU5A 1OV4A 3GJ6A 5DYGA 4IOKA 4EAQA 2PEYA 2J5XA 3WBKA 2IYUA 1S9DA 2PCLA 3Q7QA 1XEWY 3PEUA 1E0KA 1HA3A 1X1SA 2GK6A 2YOGA 2GZAA 1LS1A 3EG5A 3NIBA 3QJYA 3TR5A 4C0HA 1G8HA 2BCGY 5EE9A 4RFSA 1QZXA 1S8FA 1BS1A 2ZR9A 1D9ZA 1KI9A 1ZAKA 2AD5A 2XEXA 3QKSA 1NNEA 1N6LA 1NVVQ 5DIFA 3FMOB 3K9HA 3D7MA 2XXAB 3K0FB 4AG6A 1IY2A 1XDBA 4TYNA 1E94E 1OH5A 1N6RA 2H18A 4CZ2A 5BW8A 1M7HA 1SKYB 4Q7LA 1LV7A 2VBCA 4A2QA 3TAHA 2BMJA 4EJSC 1AA9A 3GJXC 3AF0A 3OAAD 4DHEA 4DDVA 2HCBA 1OF1A 1M1YE 3BB1A 4KSBA 1KO5A 2FU5C 2JJ8A 4RJLA 1NG1A 3ETLA 2C9CA 1ZM7A 5GADl 4KJZA 3I5XA 2YKGA 3A1TA 3MWYW 1SVSA 2HT6A 2DHRA 3LX8A 4GP6A 1IXSB 3IILA 5ANRB 4ZKEA 4E03A 4ZCMA 1F60A 2FV8A 1P2UA 3MWJA 2EFHB 2REXB 3B1YA 4FW9A 2WWGA 3Q8XB 1G291 2P6RA 3MAAC 3KX2A 2AFIE 3IBYA 1US8B 3MCAA 3U5ZB 4EKDA 5LPNA 4HLUA 2ODNA 1ZINA 2PMDA 4A6XA 1HUQA 4EFLA 5L3QA 3TUZC 2DFKB 1GNQA 1IY1A 2GTPA 2ZU6A 1P62B 1TQ6A 5TARA 3AVOA 2FPMA 3KXLA 1E4VA 1XTJA 5FBWB 1U81A 2VHJA 4HZIA 3C16C 1JR6A 1RRPA 3C14C 1HEIA 1OHHA 4CEJA 1RIFA 4QBGB 1Z6XA 1EFTA 2NQ2C 2OXCA 4RFVA 3SJZA 2XAUA 4G01B 2IYLD 5JEDA 1PZNA 1ZM9A 3BIFA 4D80A 3KQNA 4QC2A 3B1WA 1L4YA 3AKYA 1FMLA 2MSCB 3LXRA 3REGA 4N1AA 4QL3A 4BZPA 3R20A 3UK6A 3AVYA 4DIEA 1JXOA 2BV3A 4P4SA 4I1SA 3A58B 3NEJA 4I1OA 3WP0A 4BASA 1N6HA 4K8OA 1TL7C 3GJ5A 3KQUA 4XD7A 3M1IA 2CMKA 2FN4A 3JZAA 4B32A 4BLRA 3R9XA 4QHTA 5KU1A 3GLGE 3NKVA 1VECA 2VLIA 2VHTA 1W36B 4O2LA 1TQ2A 1LF0A 4XSGA 5AR1A 2O52A 5C1BA 3GFPA 5EP1A 2R6DA 4HB0A 4Q9HA 2C95A 4JLAA 2C03A 4GP7A 5EE3A 3RS0A 5F3WB 4WBSA 3R7WB 2GXQA 4PC3A 1BH2A 1SVKA 4LYJA 1N0VC 1VYUA 2R6FA 1Z6AA 3BH0A 2ANBA 5EXXA 5B57C 1FX0B 1XCGB 3TSZA 3FGNA 4OI0A 2FA9A 3K9LA 3I32A 3F8TA 5B2ZA 1SZPA 4A92A 4KFUA 2PZGA 1R2QA 1XXHB 3LBIA 4RD0A 3FVQA 4ZKDA 4JSYA 4NHOA 5CDFA 1NVXQ 1GITA 2Z0MA 1AM4D 3K70C 1G5TA 1U2RA 2AL7A 1YZLA 2IA5A 1YRBA 1OHHD 4ACBA 1LNZA 4N0DA 3T61A 3UMFA 2H16A 3KFVA 4XWAA 2R6AA 1KMHB 2VF8A 2Q9BA 2ZJ2A 2G88A 4HZUB 1XJQA 2I4IA 3VMFA 1QHIA 2QPOA 4JIMA 4ITRC 3B8HA 1EX7A 4G5SA 4A6PA 4QFMA 1IOZA 3FB4A 1GL9B 1COWA 2FEMA 3CPHA 4LBYA 2ZE8A 3U2QA 4ZV4A 4F7WA 2REOA 1OKKD 1J2JA 2QRZA 3QVUA 1R6BX 3K8YA 3MWKA 5CIWA 3VTKA 4ARZA 2WWFA 2ZSBA 4DLZA 5GVRA 1E3MA 1KJYA 1DO2A 1XJ0A 2PZEA 4NPHA 3BJIC 3ASZA 1A82A 2O8CB 1CRPA 2IHYA 2KBFA 1E0AA 3I5YA 2K5UA 5J5CA 1ODFA 5L3VA 3QXHA 1NMXA 2RAPA 3UKDA 2ZTSA 4PSKA 3AGQA 4MA4A 1OLOA 2OV2A 5SZHB 3TQCA 4HB2A 2W6IA 2ZR7A 1AK2A 1TAGA 1Z2CA 1W5SA 3CWZA 3FTQA 5D3MB 1Z6YA 3OESA 4PC7A 2G0NA 3ZGXA 1AQYA 5K8UA 1SXJD 5L3SB 1MO3A 1KZ7B 3LNCA 2BKUA 3ZQ6A 3LRPA 4BZQA 5CJPA 1QVAA 4A2PA 8OHMA 4YMWA 4FINA 5KNDA 2AXPA 3QENA 4QGHA 4R2IA 2YVUA 1NIPA 5AJVB 3WHKA 2NIPA 3DOFA 3VR2A 4B3FX 4Z1MA 2ZRMA 4IDNA 2HXSA 1W44A 4JL6A 1DTSA 1DELA 1W2GA 2VHCA 3X2SA 3ZJYA 1NY6A 1ZD1A 4LYHA 3THXA 4O3MA 4EJSA 4LPSA 2FOLA 3DHWC 4OBEA 1NSTA 2GEDA 2FMXA 1Q12A 3ZVMA 3VNVA 4KI0A 4URZR 1IAQA 4OQXA 4LPKA 1N0UA 1UEIA 4V0LA 3Q85A 4TQAA 3NBZC 1WCV1 2NPIA 4P31A 4RD6A 2GZHA 2QBYA 1UBEA 4PZZA 3LA6A 1ZM3A 2F1IA 1E2NA 1AKEA 1VCIA 1MT0A 2VHUA 2C78A 2CJWA 2ZYUX 2GXSA 2A2ZA 3KFXA 2ZJYA 4YMSA 2AR7A 3B2EA 1A4RA 1MKYA 2O0JA 4HUQB 4OI4A 4U5XA 4BE7B 1OFTA 1G3QA 2R8RA 3LQRA 2QAJA 3W6PA 2R44A 3LV8A 2ASEA 1Z29A 4ZCLA 5FI0B 4OHYA 2MMGA 2G9NA 3QEOA 3THWB 1E99A 3RC8A 1DPFA 4JLDA 3CRVA 2IYXA 2W00A 4WZBE 2W6ID 5UKDA 2EFEB 1QF9A 3U7EB 1G20E 1OT3A 2O5VA 3H2YA 4YQFA 5EUMA 3FKQA 2F1HA 2VP9A 4R71A 2O8EB 1F2UB 5CYOA 1HTWA 3N5CA 2ERYA 4LHVA 2ZRNA 3A4MA 1CULC 3V4RA 1RYFA 1EWQA 1RZ3A 2GILA 2ZAOA 5DE3A 4URXR 3ZD7A 4Z1MD 1DG1G 1XTKA 2CHVA 4JJKA 3KDSE 2ZREA 4C0KA 1ESMA 2G77B 2OCPA 3EZ6A 1GFIA 1GRRA 1FTSA 3BBPA 5SZIA 4DLYA 4ASUA 4RZXA 4F38A 4AYWA 1GM5A 3ICEA 2WJGA 3B9QA 3G5UA 4CEHA 1S3GA 2XZLA 2ZVQX 2IYRA 4QHYA 3RS3A 2GHIA 1Z0FA 3GLHB 4HAUA 2IF0A 3PXGA 2OEPA 2WKRA 5AUPB 3MFYA 4V0KA 2HEIA 4HB4A 3C5CA 5C4MA 2NZ8A 4OHVA 2FZ4A 2WIAA 3L8YA 5EE1A 2XX3A 1JR3A 2ZJ8A 1G7TA 3NVAA 1LVGA 1NVWQ 2ZR0A 1II8B 4TMVA 1FW6A 5EZ6B 1JNYA 3ADKA 4C0AC 2PT5A 3DO6A 4LV6A 2KE5A 3CX8A 3VKGA 1IN5A 3HWSA 4Q4HB 5GJVC 2VQSA 4PSAA 4V03A 3CIOA 4Q00A 1VTKA 5EP3A 2ZXUA 2BMEA 3U3OA 4ACAA 1FQKA 3U4QB 1R5OA 3UWOA 4E07A 1UKYA 1FUKA 4P33A 4IOLA 1PV4A 2DWOA 2EFDB 4IDHA 2JJ2A 3CB4A 1GKYA 3IPXA 2Z4SA 4RFSB 1FZQA 3GEHA 1R4AA 3QKSB 4WIAA 2G3YA 2D7CA 1N0WA 3ZD6A 3X1WA 4JKIA 5JCPA 3SU8A 3ZH9B 5B30A 1JEEA 1G18A 2OAQ1 5FBQB 1IN7A 3SDZA 1JALA 3REFA 1E0JA 1JECA 3L2OB 2RKOA 1G8GA 4S35A 2OBNA 5EP4A 4CEIA 3W90A 4ASUD 1F6BA 5KOYA 5JJLA 1X1RA 4CYMA 2XJ4A 4PC2A 4XWOA 3TVTA 3RLFA 4D2IA 4GL2A 2XB2A 4B3XA 2D2EA 1HYQA 3VQTA 3MD0A 1OXUA 1K6MA 1KIMA 2EU8A 3CM0A 1VCMA 2JLRA 4Q7JB 1JQJC 4DLTA 4QM7A 4P32A 1T9HA 2QROA 2V54A 3PITA 2BEJA 1L7VC 2WWHA 3D3QA 1FMJA 3CRMA 4R98A 4TYWA 4ILEA 1JBKA 2H8KA 3EA5A 2GEVA 1G19A 4DZZA 1E4YA 2NO0A 3BAFA 3SE0A 2WM9B 2ATVA 1KSGA 2CHQA 5KTYA 2OESA 4CEJB 1FP6A 3A37A 3LW7A 5EZ5A 2NPFA 1PLJA 4HYYA 2A5FA 4DT1A 3K70D 3E2IA 3GLIE 2J9RA 2JJ2D 2LKCA 3WYFA 1U0HC 4V0MA 3TMKA 3PUVA 3EASA 4L4UA 1S3SA 2Z43A 1UBFA 4M9QA 5HKKD 2XNDA 4B35A 2IX3A 2ORVA 4P4SB 2ORWA 1VDZA 3CX6A 2IUUA 4ZCIA 1F2TB 1Z47A 1CIPA 3P26A 4B3GA 1X8LA 1IJFA 3OE7A 4DC9A 4US1R 4CT5A 4XIGS 3KJEA 5AUNB 3IO3A 3PUXA 3HU1A 1VG8A 4KAXA 1T4GA 1WDTA 3E1SA 3I3SR 4WZ6A 4B71A 1OE0A 5FPYA 4DEYA 1NJGA 3IGFA 3IBGA 3LVRE 3SHFA 2FJUA 3IEVA 3PFIA 3JZMA 4KU4A 3IQWA 4ON9A 3M0EA 3EIQA 4NU0A 1UF9A 1E69A 3LBHA 3V9PA 1GIAA 1XMSA 3N2IA 2DFTA 4RD2A 4U02A 5CLQA 1JJ7A 4Q1EA 3LO5A 4HAXA 4UNSA 4YDHB 4GFDA 4RZ3A 3ZS8A 3RWMB 4RKFA 4Q01A 4DB2A 5KDLA 2YNMA 4LOAA 2ZI4A 1D2NA 4TLBA 1OIWA 1PJRA 2V6IA 1AGPA 1UBGA 3L0PA 2NG1A 4WXPA 1TQDA 5P21A 4TSFD 1LF5A 3NC1C 5AJWA 4GRAA 1T8TA 1XCPA 4Q1CA 4LJ4A 1XBTA 4MYUA 3AVXA 4BFUA 4W5HA 1KMQA 2MMCA 3OZXA 2AKYA 1Q1QA 3FMIA 2QNRA 4BFXA 1P7CA 3QOFA 2J0QA 1G7CA 2CNWA 5EE0A 3N2EA 5HE9A 1NN0A 2YV5A 4JLNA 1MO5A 3GFOA 4Q18A 5BN5A 4AWXA 4D82A 4M1MA 4URVR 3UG7A 2OCYC 5DISB 5TMPA 4FWTA 1M8PA 1KNQA 2OM2A 1WF3A 1ZNYA 1N6PA 4KODA 4TTPA 3L8ZA 1N2CE 1OXSC 3RAPR 3SQWA 3R9IA 3OE7D 4ARZB 3BB3A 4GOKA 3DZDA 4JLOA 1OPXA 2C99A 2ZQ5A 2P6NA 4LHYA 1SKYE 2F9LA 5FOUA 5JI2E 3F0TA 2QU8A 4F92B 4DDUA 1DAGA 5DLQC 1KDOA 5D3QA 1U94A 2H92A 1A1VA 2ZUBA 3LFUA 1M34E 2R6GA 4Q9JA 221PA 2BKEA 1XTQA 2QQ0A 4LYFA 4TMTA 3T12A 5L3RA 3PEWA 2D4HA 3DOEA 3KQLA 3VFDA 2AN9A 1Z22A 3BC1A 4IHQA 2REBA 2VP4A 2YOFA 2ZRBA 4LV8B 3RHFA 4LSGA 3EX7C 5DSZA 1V43A 4KFSA 3L0IB 4C0SA 3PV0A 1HT2E 5C2JB 3AVWA 2WOJA 3CZPA 3O8RA 4DB4A 1PVOA 1E2DA 1ZUHA 2GNOA 3HJNA 2N46A 3EC2A 4FCTA 2ZSEA 3FPAA 1EFHA 4JYCA 3FMPB 2ORIA 4D6PA 3THXB 2D7DA 3A4NA 3QF7A 3K09C 5FL3A 2PLRA 4OYHA 1CF4A 1E9DA 1ZD8A 2ZI5A 4C2UA 2FSFA 1LS6A 1OIXA 3CW2A 1DAIA 3GEIA 1KSJA 1P9WA 1Z8FA 4C0JA 2E87A 5FPHA 3I1FA 1J8YF 2HLDD 3T1VA 2CNWD 1R8SA 4OK5A 4ZI2A 3KXKA 4KBGA 4Z8XA 2QBYB 4NE2A 3L0OA 4Q1DA 1Z63A 1N3BA 2BC9A 5JBQA 1QHHA 3EWSA 3OEEA 3U3JA 2CJWB 2P5SA 3KUDA 2X8AA 3UMSA 3BS4A 4BZXA 2J87A 2JLSA 4BGDA 2IXEA 1OH8A 2Q3FA 4TTRA 3NXSA 4FIDA 5IF9A 1KKLA 4LJ6A 4NMMA 4JYBA 2Q3MA 2CL6X 1S96A 4QBHA 4F4JA 2WIBA 6Q21A 4TWZA 2ZIAA 1AN0A 3KQKA 3VR6A 1NMZA 3MMPA 1I2MA 4IEEA 2WSMA 3SHWA 2B8WA 4IEIA 4JVLA 4JT4A 2N42A 5FTKA 3QXCA 2W2TA 1E0SA 2ZSDA 3WNDA 5CLLA 5BN4A 3W8NA 5J4YA 2BM1A 2QL6A 3KKPA 3K0SA 4LBWA 1K5DA 4C30A 2KWIA 3C7KA 5GJCA 1G5PA 1MOZA 2AK3A 4OQNA 3SBEA 1QHXA 1XPUA 5BXQC 2V4ZA 1XWIA 5BN3A 1NLFA 3BOSA 1GG2A 4JS0A 1GVNB 1XXHE 4KVGA 2ZJZA 3VX4A 1VYTA 1NN5A 4G5QA 5JECA 4LUCA 3UANA 4CEHB 1HQCA 2ZSAA 1OB2A 2FEOA 1HV8A 1GKUB 2OE2A 3OIWA 3PUWA 2IS6A 2WWWA 1AQUA 2BOVA 4BUJA 1G3IA 4IXNA 4JMPA 2V7QA 4LWZA 1KSHA 3QQ5A 4Q4LA 3AP3A 2QE7A 1JI0A 3QPVA 1XD8A 4HAYA 3EPJA 3OEED 4MQBA 2IYQA 1XPRA 4UJ5A 4LJ9A 3NG1A 4G5GA 3B60A 3AP1A 2PZFA 4HAWA 5JSZA 3SN6A 3ECCA 2ZAMA 2QTFA 4MGIR 5E95A 1G4UR 2CLSA 1EFUA 2CXXA 2RMKA 1SKQA 3VR3A 2ZYTX 1KO7A 4LJYA 1NBME 2HF8A 1N5JA 1AZTA 3K70B 2C98A 3DEFA 3NEYA 5E7JA 2R2AA 3Q3JB 3AF2A 3GPLA 4FCVA 1HT1E 4AKEA 1AIPA 4D25A 3R8FA 5LD2B 4LHWA 2ZYVX 4F4IA 3KUCA 2W83A 2DFNA 2UZ3A 821PA 1YZNA 1ZIPA 421PA 1ZNWA 1ZM2A 4R2HA 4XWKA 1LB1B 4DLWA 1VG0B 3K9NA 2QY9A 1T3SA 4DUGA 4M4SA 5CJ2A 2ZJ5A 4FMDF 3J81k 4Q4JA 4KLZA 4AY2A 1IXZA 3FOZA 3ZZ0A 1DOAA 1E2HA 3R8CA 1QHNA 1HE1C 2WZQA 2ZE7A 1KI8A 2OBLA 5JJIA 3BH7A 1G41A 1RW4A 3QG1A 2H1LA 3QBVA 3RVBA 4DWJA 2IF2A 3MRSA 4NYJR 1P4SA 2BEKA 4MRNA 3VX3A 2JLYA 4TZ0A 5K8TA 2P6UA 2ZI7A 1CR1A 2QUZA 4QKQA 1YRAA 2CL0X 3QF4A 1F48A 1VMAA 4M22A 3PUYA 1E2KA 1PLLA 1R0XA 3W34A 2Q3HA 1G8FA 2X2EA 1OIVA 3PIRA 2VSFA 3NBYC 1BO6A 2QE7D 3RDPA 3AP2A 4ERNA 3QKRA 4B44A 1E2IA 5JCZA 2BBTA 3CNOA 1EFCA 4MGKR 2HT1A 5JJKA 1P75A 1JJVA 2D74A 4UNRA 2X19A 1T6NA 1UM8A 4F93B 5GVSA 1EWRA 4GT1A 4B3BA 1ZM4A 4BLQA 5M04A 1XX6A 2QP4A 4OQMA 2WMNB 4HEJA 3QXJA 4JLMA 5AWFC 5LBIA 2IS2A 3BXZA 2IYYA 3FE2A 3IO5A 1GNPA 1B23P 1JEDA 2WBLC 4DT1B 1QHSA 2VPPA 3BFVA 3JVUA 3K09A 3CRRA 3OIYA 2L0XA 4TL7A 2FGJA 3EPKA 1KTVA 1ZC3A 1TEVA 2NOAA 2PH1A 4PHFA 4CW7A 4US2R 4NCKA 1XB2A 3P4XA 4QGAA 4DUGD 1I2DA 2QI9C 2QPAA 4DLVA 2IHBA 4DBLC 4EPXA 4PO1A 2EWVA 3AQ4A 4PQRA 1R0WA 4O25A 3I62A 2ZRGA 2RGAA 4NBSA 4HATA 2CE2X 2JIZA 2MSDB 1WRBA 4RY2A 1SULA 2JLZA 3RANA 2YZ2A 1ZC4A 4C7OA 4GNKA 4WW0A 4IDOA 3TW8B 3AH8A 2JEOA 1YZQA 2VO1A 3H84A 4OHZA 5JRJA 4ZDKA 5AJXA 4TMKA 1Q1ZA 2ODEA 2WVJA 1QRAA 1KO8A 3DDCA 1LTQA 5FTMA 2V55B 4Q5IA 3ZVNA 1ZU4A 3GLHE 5FOTA 3I92A 4ZO4A 1TPZA 2AWOA 3L0SA 1N6OA 5KDOA 1MV5A 1R10A 5IT5A 4MUAA 2HYIC 1LFDB 1MRNA 1TU3A 3V4FA 3B6EA 3WRYC 1QHGA 2GCNA 2N1BA 3RABA 5L8VA 2V6JA 2AK2A 2I3BA 3EZ9A 4XD7D 1Z5ZA 4NTZA 2UKDA 4IDQA 4EQ6B 5HR5A 4URYR 3P1JA 2QORA 4DDWA 1RKBA 3AEZA 3TW4A 1BYIA 1TADA 2IW3A 4NCNA 1XNJA 4TN1A 1P3JA 1ZW6A 2J0UB 3UWKA 1P9NA 1QBKC 2FFBA 3AVQA 2EFCB 4TQ9A 1E2MA 2RGGA 1AS3A 4TL9A 3ZDQA 4DCVA 3IIKA 1NKTA 3CO5A 5AUOB 2F55A 1PUIA 3HU2A 4ABYA 4C0BA 1ELOA 1UKZA 5TB5A 1DAKA 2PMKA 5DHAA 3NC0C 2GCPA 1G7SA 4B48A 5CK5A 4CF7A 1G21E 2Q0HA 2G6BA 4MYCA 4M1TA 1SVLA 1L8QA 3EARA 3KQHA 4QM6A 2CCKA 1KGDA 1XZQA 3TLXA 2A78A 3FWYA 3WP1B 2P3SA 1U8ZA 1EK0A 4QXAA 2EVWX 2ONJA 4F91B 1S2MA 1W4CA 3SJCA 4PSVA 4XH9B 1PLKA 3KB2A 3KKNA 1KOFA 3MG9A 2O8DA 1OFHA 3GJ4A 4C2TA 2W6JA 1IQPA 1G64A 2BBOA 4JKYA 1W48A 3TAUA 5EP2A 1OXTA 1EESA 2QAGC 4G0NA 1IXRC 4B2PA 3WXMA 4MGZR 2NO6A 4KFRA 1R0ZA 2PBRA 4ZIRA 1COWD 2A5DA 3NBFA 2ZI6A 3SZRA 3U6BA 2ZEJA 1J7KA 5HCIA 1SVIA 1QG2A 4A8JC 3A4LA 4EPWA 3AF3A 3GEEA 4PAQA 5FOWA 2YWHA 5TY0A 4FCWA 5KO2A 3WMFA 1E98A 4KYUA 4URWR 1O87A 3RRZA 4D81A 1FP7A 2J45A 2P0EA 1NVUQ 1W1WA 1Y63A 2NZJA 3OFNA 1Q0UA 2VSXA 1E2EA 2IL1A 1KI2A 4NL4H 3SS8A 1PUJA 5KSYA 2WJVA 4DLSA 2JDIA 3AM1A 3U3KA 1E2GA 1SVWA 3FYHA 4Q66C 1UADA 1XZPA 1M2OB 2ZJBA 2OSBA 1I4LD 2GZDA 1T8UA 5DYIA 3O8DA 1S1CA 1S0UA 1QDEA 1W4BA 3MGCA 2E1RA 4JZKA 5FL7A 1M7BA 2LCFA 3SJAA 1SVMA 3GJ3A 3U44A 4QHSA 1QHHB 3RS4A 2QMUA 3B1XA 4KVAA 1M74A 5FH9A 3T35A 2ZS8A 1OH7A 1XEXA 1WE2A 5FI1B 2F7SA 2WV9A 2WKPA 3IEUA 3DMNA 2HDNB 5HZKA 5G40A 2PJZA 3VR5A 1W47A 1H8HA 3A1WA 4PPGA 1E9AA 2FX3A 1XTSA 3BD9A 2RGBA 2A3RA 2Z5FA 2ZRJA 4LI0A 1NLZA 4AKHA 2FSIA 2RGCA 2GDJA 2W6JD 4FN5A 5G3YA 4PTLA 3T06B 5DI9A 3AVTA 3Q72A 1VG1A 2BVNA 5DI3A 3H0KA 3GLFE 3E5HA 4Z51A 2FFHA 1E2LA 1SXJE 3W3AA 3MUFA 2ZU0C 1ZD9A 2FFQA 3AF4A 4E09A 4HLQB 2IEYA 5C46F 4NYJQ 2V1UA 2KJQA 2UVQA 4R7ZA 4QGFA 4XVUA 1D8TA 3I61A 2OUKA 1MRSA 2OFWA 5IHPA 1Z2AA 2OG2A 3PQCA 5CDFE 3OFND 3AKCA 2F3TA 2JLVA 2Z83A 1KYIA 2QP3A 2GCOA 2XOKA 3MJRA 5B58C 4NCIA 4TLCA 1D2EA 4JBYA 2P67A 2IYVA 2WAXA 4CT4B 5J4VA 1NN3A 4UQOA 1W5TA 5CIQA 3ZVLA 1UFQA 4JLKA 4RZUA 4ESVA 5FL7D 4ZDIA 3AV0B 2A30A 1KJWA 3B9PA 1YR9A 1U0LA 3RSLA 5JSZB 2Z4RA 4Q19A 5LDDC 4RKEA 4G1UC 1UJ2A 1E9CA 4II7A 4EIWA 4J0QA 1H8HD 4AKIA 3EZFA 3MJHA 2G0TA 3B1VA 1Z3IX 1XP8A 3LAWA 3ONWA 3SYKA 2KSQA 1E2PA 1U8AA 1X6VA 1C4OA 2VF7A 1ZVQA 1V5WA 4GMXA 1KY2A 3SOPA 1XTIA 4B3DA 4PPNA 4GZMA 3C8UA 3B7GA 4IKEA 4Q47A 1OYYA 1AZSC 4IOJA 3CRW1 2CVHA 1JB1A 1Z83A 2DPXA 2ODWA 1OSNA 4Q4JB 4BFVA 1JR3D 5F2EA 1GTVA 2WWIA 4M9XA 3PVSA 1GKIA 3W9YA 3AB3A 2G83A 3IHLA 4W7SA 4NYMR 5L3QB 2KI5A 1GP2A 1G8YA 4TLEA 2IXFA 5IK2A 4BLPA 3CRQA 2ZS9A 3G82C 4NONA 3Q9LA 2JLQA 1Z0DA 1E1QA 4JLJA 4LBZA 1CJUC 3WY9A 1T3HA 4H1VA 4LJAA 5SZJA 2B6HA 2CL7X 4L5BA 2DY1A 2C5LA 1ANKA 3GD7A 3QF4B 3KJGA 2VP5A 3DM5A 2R62A 3I4LA 3E70C 4KV9A 4JJZA 3GJ0A 4DCNA 3TSWA 3QKRB 1T0HB 4UNNA 3CH4B 3ZIAA 3T1QA 4UKDA 1Q1EA 2QAGA 2QSZA 1KAOA 2YJTD 1Z6TA 2PJRA 1E9RA 1P9RA 1RRCA 1E2QA 4L9WA 1CBUA 1DE0A 2ZM5A 1ZBDA 1Z06A 2DWPA 2ZRHA 4A8JA 5J47A 1QHYA 3PG5A 3WHLA 3D31A 3CPJB 4BFSA 4DKXA 4PAOA 1Z0JA 3KB1A 2BCJQ 3QPUA 2QA5A 5EE5B 1SGWA 3DMDA 3VU9A 2BBSA 4DCUA 4PHHA 2EWWA 3LX5A 1MABA 4LDJA 4DLXA 3TE6A 5JFGA 5KDDA 4GOXA 1KI6A 3GJ8A 2ZE6A 5KNCA 2UZIR 2BM0A 1JPNA 2QENA 3QNUA 4PHGA 2EFGA 2GJSA 5BWMA 2XTNA 1FPMA 3U61B 4XVQA 1XXHA 1Z07A 1UKEA 2FGKA 4O0MA 3SEAA 1HH4A 4A36A 4PAMA 1E6CA 5GJWC 4MKIA 1OJLA 2O8BA 4KHZA 1TMKA 3KKMA 4Q4AA 4EPYA 3HPQA 5IK2D 1YZTA 2QM7A 4EPTA 1RPZA 4M21A 4IVPA 4C7OB 2GK7A 2ZE5A 1I4TD 4G5OA 2FZLA 1E1QD 5FFMA 3TGPA 3AVPA 4M9ZA 1UPTA 1XCMA 2VH5R 1AS2A 2ZRPA 4RCYA 3LD9A 3SFVA 2HJGA 1S9HA 1DARA 3OEHA 4TT3A 4X8HA 4BFYA 3EIHA 5CM9C 5HTKA 5FTNA 2YWFA 4ZI3A 2GETA 5TDHA 2OILA 1R7RA 3M6AA 3EPLA 2XNDD 4FMDB 3ZIAD 1F5NA 2QTVB 1DAFA 2H5EA 1KNXA 4RD4A 1VPLA 2Y8EA 4DSOA 1YR6A 5K8LA 3MSXA 2XZPA 3GMTA 1NBMA 2BHRA 2CVFA 2GESA 4PX9A 3ADCA 1IN4A 1KJZA 3EW9A 4B3CA 1Z0AA 3TUJC 4TLDA 3W5JA 5DNYB 1RRFA 4NDZA 3CF0A 1XPOA 4KFTA 3RWOA 3V00A 4JBWA 3B5JA 4PZYA 4XVRA 5KPJA 2HJVA 1UAAA 1W0KA 1WMSA 3I8XA 4NCHA 1TU4A 2QT1A 4IDPA 2OBMA 2IK8A 4HUTA 4C9BA 3AUYA 1G3MA 1E96A 1UDXA 4OQLA 3PJRA 4GSYA 5LB2A 1KY3A 1IBRA 2F6RA 2XTMA 1CR4A 4GPTA 2RGEA 4KCGA 5G53C 4JLVA 2IT1A 1ZRHA 2BMDA 2QGZA 2OT3B 4S2EA 1HQYE 1ETUA 5E7IA 1YQTA 3LLMA 1KK2A 3T15A 2YC4C 4JSTA 1DBSA 3LWNA 4A15A 2OFXA 2GAOA 3W3ZB 4YMUA 2LWIA 2ZS7A 4QGGA 4JBXA 3S1AA 3O47A 4MRSA 3B13B 3MWLA 4EJSB 5JS8A 3X1ZA 1E1RA 1NI3A 4CIDA 4DCSA 5F9HA 2QZ4A 2YYZA 4E22A 1U9IC 4M8NE 4NYIQ 4MH0R 4R9UC 3OEHD 1G1MA 4A0GA 1J90A 4JL8A 1KI4A 2ZRDA 2VP0A 3UIEA 5JHHB 2W0SA 2WOOA 3K1JA 4ZIRB 1YR8A 1ZP6A 4XOIA 3VAAA 2J7PA 2YWGA 5JZVA 3SI7A 1NMYA 2ZRIA 1E9SA 2DBYA 2OO7A 1W4RA 3HU3A 3GLGA 4DLRA 3AUXA 3CONA 4DJTA 5E4FA 3RRNA 4US0R 3I73A 2H7VA 2R65A 2I1QA 1DVRA 1X8JA 1N25A 1XD9A 2JCSA 1AKYA 1N6KA 4QJ5A 2EQBA 4M1SA 4DSNA 1SXJC 3RSOA 4CVNA 2D3WA 3RRMA 2BBWA 2QP9X 3ADBA 2EW1A 4NZYA 2AHOA 1A2KC 1U90A 2IC5A 4FMCF 3EC1A 4IOMA 3G0HA 3GCGA 4LK2A 3WMGA 1C1YA 4RSGA 4DXAA 3X1YA 1XEFA 3H1TA 1R5BA 2YHSA 3GJ7A 3CWQA 3U44B 2NTYC 4V0OA 2JASA 3K0AA 2QGNA 2VL7A 4D0NA 2XTZA 4C4PA 5J4KA 1FTNA 1GRNA 2VP6A 3BERA 1CS4C 1XEXB 2JGNA 4YDSA 1EX6A 2PCJA 3SC3A 3OAAA 1SHZA 4B74A 3BRWD 3NBXX 2IYSA 4JVMA 4MYTA 1KAGA 1NL3A 4LBVA 4B33A 5CB8A 2FE4A 4Q21A 4YONB 4BFWA 3P32A 2VA8A 3LXXA 1EFRA 2BDTA 1TEXA 2J46A 1E1RD 1U8YA 4NP6A 1P2VA 2QM8A 4LJ7A 3JVVA 3F3YA 3CUEF 4AYXA 2IS1A 3CR7A 5DI3B 5JMTA 1E9EA 4AG5A 3H86A 4M2LA 3ZVRA 3EWAA 3Q5EA 2NO7A 3KJHA 2WSSA 1FL9A 1FFHA 2RHDA 4IVRA 4A0HA 4L9SA 2F3RA 1R0YA 4NYMQ 1YR7A 4TMWA 4ESHA 4B76A 1KI7A 4RCZA 4AIIA 1CU1A 4KO8A 5KSPA 1KDPA 2DFLA 1MO6A 3DKPA 4LRWA 2DCUA 2JJ1A 5TV2A 1KDRA 2WJJA 4KITB 3U4QA 2GBLC 4JVSB 4OK3A 1VIYA 4C3ZA 4ZDWA 2GCOB 2PLFA 1P6XA 3TNFA 2OZEA 5AUQA 4K46A 2OAP1 1ZUNB 2OLJA 4TL8A 2PT7A 3FDIA 1Z08A 4PPQA 3KJIA 2WPDA 1UDWA 3WRXC 2J59A 2ZJOA 3CBQA 1P72A 4BRUA 4E5UA 3BH6A 2FWRA 2CLDX 1BKDR 1J99A 2B7CA 1ZNXA 3PEYA 1U98A 3ICQB 4D0GA 1DEKA 3ZZTA 2B21A 2HUPA 4XSHA 121PA 3RNLA 721PA 4MDFA 2P5TB 1WXQA 2WKQA 1ZMXA 5FPSA 4A4DA 4D4JA 2A9KA 2J0VA 2A5JA 5FOXA 4RZ2A 4D4KA 2KBEA 5FUYA 2VYFA 5F9FA 4CEIB 5FTJA 1EFRD 3SJBA 1W2HA 5JWHA 1NF3A 5CK4A 3AVUA 3U6KA 4BFZA 1WA5A 3U60B 1KO4A 1FQJA 2IUTA 4AURA 2PX0A 2VEDA 3LW8A 1Z0IA 3RRYA 4BEBA 5FBLB 5GJBA 5SZKB 2V7QD 2WSSD 3B1ZA 1OB5A 4LJ8A 2NO1A 3CKLA 3SNHA 5EXPA 2RHMA 5FBRB 4B6EA 4P4TA 1CR0A 4N3NA 5A5GA 2P2LA 2YC2C 2P65A 1CR2A 2ZPTX 3IQXA 4KYIB 5FR1A 3QSYA 3FMFA 2E9SA 2FPKA 4MRPA 4QNMA 1G3UA 1E79A 3BE4A 2G1JA 3CZQA 2JLUA 1QVRA 2JJ1D 4I1UA 4LYAA 4POAA 2HXYA 4PC1A 2C04A 2GF9A 2AKAB 5JHGB 1NG9A 3A1SA 1P60A 3TIFA 1OXXK 4QJ3A 2J0SA 2Q9AA 3WBJA 1L4UA 5EXTA 5ELXA 3NH9A 3HR8A 4L16A 2WPDD 1NSFA 2ZANA 2ONKA 4HB3A 4Q03A 5EUQB 1KKMA 4G3XA 4UNPA 3THOA 2IWRA 4Q9IA 5FUVA 1IONA 1OKKA 1U9IA 4OHXA 2QMHA 4L8GA 4LHXA 1HE8B 1TF7A 3SFZA 3A1VA 2QAGB 1E2FA 1F2TA 1TF5A 4PFSA 3T5DA 4B6FA 4TYYA 2OXRA 4MGYR 2ANCA 3NH6A 2J7KA 1XRJA 2D2FA 2H57A 4WXRA 4Y0AA 3RYTC 1VHLA 3O8BA 1HY3A 2GAAA 2OCAA 2GA8A 3F5FA 1G16A 1W49A 3IIJA 3M4YA 1LW7A 4A8JB 2XB4A 4MYHA 4RD1A 1XD2A 3FHCB 3O8CA 4GDFA 2RGXA 4OI2A 1BOFA 4X8OA 3VU9B 3GLFA 3QY0A 4X8LA 4A2WA 4AD8A 2QMOA 4RD3A 4TYPA 1VKJA 4QBFA 3DVLA 4TL6A 1MABB 2OHFA 3CLVA 1N6IA 1SXJA 1G9XA 2V9PA 3FHOA 2WMOB 2GKSA 4M0LA 1YVDA 2O8FA 4HDCA 2BWJA 1KI6B 3U7FB 4XTCS 3HPRA 2EYQA 3CNLA 4X8MA 2RGDA 1S1MA 2W0MA 5J40A 2X77A 1W0JA 3QE0A 4OJQA 4D4LA 2FSGA 3LH5A 4LGMA 1H8EA 1CJVC 4CRWB 4U00A 2O8BB 1KSFX 4Q4AB 5HZHA 3GP8A 1E79D 2YINC 4OKSA 4Q02A 1T91A 4EPRA 3CR8A 4G5RA 3T1OA 5LD2C 3KXIA 3CF6R 3DL0A 4PHTA 2WWYA 4MUBA 5BYKA 3H4MA 1G5RA 3K9GA 3TH5A 2HCJB 4NH0A 2BJWA 1N5IA
chains in the Genus database with same CATH superfamily
1KK3A 1A95A 2J4FA 2LPMA 3PR1A 3W5HA 3EBPA 4LXQA 1OV6A 4TLLB 3DBRB 2ID4A 3KKQA 2JFNA 2Z2IA 1BXGA 3TZ6A 2XITA 2ZW9A 3TB6A 1EXWA 3K1AB 4N0EA 1O9HA 2Y99A 1VHDA 4IVNA 3VU0A 1QRUA 3H97A 3K0CC 3DVAB 2XF2A 4GBMA 3L7AA 4FHDA 3A1UA 3X2FA 4ZPJA 4ZOEA 2JKYA 1M2EA 2BUAA 1OXKB 4AECA 2OG1A 1E59A 4IXDA 1J2YA 4C7MA 3ZYCA 1JEYB 5H81A 5EJCA 4WVFA 3KLNA 3SXUA 1YK1A 2VDKB 3N28A 2AX4A 1DQNA 4PNEA 4Y9SA 1DHRA 1L8XA 3G2LA 1ZGJA 4IWYA 3PHIA 4LK3A 2VZLA 1LBSA 5CURA 1TA4A 2Q2OA 3M4XA 2CCGA 2FFAA 2CNDA 4PLZA 1L5WA 3HBJA 1T8SA 5F2NA 2WTUA 5IN5A 4M99A 4DR5M 2XLCA 4U7GA 3SYRA 1R4NA 4BQEA 4MS3A 2H5LA 2Y1DA 3VA7A 2BF4A 2D7HA 2WAAA 4CF3A 10MHA 2XXAA 3K0FA 1CY2A 3OIVA 5E3JA 3D6HA 2VBIA 2PZJA 5JVDB 1MAHA 2MTBA 1JQLB 1ULZA 4OFWA 5KHOC 4CM5A 3LU1A 3D7SA 3A2LA 1VG5A 1DRJA 1ZGZA 3H9BA 1QTRA 1TQHA 3BXEA 4XTRA 1Q11A 1DQRA 5C1OA 1G6HA 1RHJA 3PC8C 4KQWA 1XP5A 2A5YB 3JPYA 4IG4A 2E5LB 1MU5A 5FI5A 4DV6B 3QEAZ 2QG9A 3G79A 1P2FA 3H16A 4HSEA 1V39A 4CIWA 3BWDD 2X8WA 3PE6A 4EG6A 3N0TA 5CIYA 2IXGA 2IOHA 2ACKA 3EZGA 4F0JA 5F3WA 2RGNA 1DUVG 2CB0A 5J2UA 3P2KA 2DY0A 2X40A 1BMFD 4HH0A 3EVBA 3EMVA 1SC6A 2HSJA 4H6PA 1CRLA 2ZDQA 4UFNA 1L3CA 3GQBA 4Q24A 1UMDA 3OIGA 4KIWA 2F5OA 2ADFA 2E4AA 2LHGA 2ZB7A 2YWEA 4EQ6A 3N53A 1HSZA 4U0KA 3R3YA 1D09A 4PSDA 5K6RA 4NEQA 4WNAA 3W6OA 2ZSFA 1BROA 1AX9A 2F4VM 3I2JA 3SX4A 5LNK1 2JIPA 2R4JA 3HUUA 1LC3A 3G0IA 3FW1A 3Q0EA 4IZHA 2NWQA 3HDYA 2YXEA 1VI5A 1QFYA 5DYTA 3AUKA 1VJGA 1H4QA 1Z12A 5CA0F 2F43B 1X9HA 3AEUB 2GOYA 1RXSA 1SHTX 4AG3A 1VRWA 4FFVA 3AKEA 2RBKA 3EN0A 3KPYA 1GQ2A 3OIDA 4IXMA 4Q6WA 1VC2A 1Z4QA 4CG2A 3R0IA 5FR2A 1XDGA 2OHVA 4KUGA 3G88A 3K9BA 1F2UA 1NMSA 4V0ME 1PJTA 4CKBA 4EW6A 1Z6QA 4JI1M 2HYDA 2GWHA 3A36A 1VBMA 3AILA 4QBKA 1QP0A 3NTUA 1EG7A 4BP9A 4BNTA 5KI6A 1RTTA 2XZOA 1BKYA 2FSHA 2JD2A 3VRHA 4JI2M 2NUAA 2GFQA 1Q0QA 2WICA 4E1VA 4Q4HA 4G0WA 3GWZA 4XFDA 4CNBA 2DBQA 1EAYA 4KZKA 4EVIA 2GK6A 4QULA 4WOJA 2WJ4A 3N86A 1MC4A 1Z88A 2APJA 2YFYA 2KA6B 5DIFA 3O90A 5BW8A 1O58A 4XRRA 1C7IA 1IZ7A 4P6VF 3NS7A 3E2MA 5DASA 3SDBA 2L2DA 4E1AA 4HNAB 1JKJA 4NU6A 4E03A 1BFDA 2X1MA 1XHEA 4RL4A 3NQ41 3TUZC 1GNQA 3B53X 4QOFA 3NONA 4DDHA 4CLRB 3EXHC 2FXVA 1QIIA 2C4TA 3PUJA 1B6SA 3B1WA 4CM8A 2QX6A 1FJXA 3G5AA 2JGRA 5ESXA 4F1IA 3S2IA 2DBRA 3A58B 2IV3A 1XKQA 1N6HA 5AI5A 4NXMM 3BF8A 3HGMA 3A1FA 1OCEA 4UUPA 4MPDA 1EA5A 1KOGA 2AQIA 1NKVA 4Q9HA 2DR2A 1K3UB 2ISSD 2Z5VA 3LSTA 1Z6AA 2W8BA 5FNVB 5EWJB 1L3IA 3FGNA 3B5EA 1OBOA 5BSWA 4KFUA 5LXTA 4OUDA 4RTKA 1D6SA 1AM4D 1YZLA 5EZYA 1UT8A 1H4TA 1E3WA 4PU0A 4CQLB 4A6PA 1HKHA 1E5XA 1COWA 5FD8A 3CPHA 2VR1A 3WZ2A 3EQ7A 2J4DA 1M6EX 2DUWA 1QGED 3K8YA 2WJZB 3V1YA 3CA8A 1X1DA 3W6ZA 4ARZA 1NR7A 4PQGA 1XJ0A 4RZSA 1JMVA 1K6IA 1OLOA 2D0OB 5SZHB 1W5SA 1GHTA 2G0NA 2Z1NA 3LNCA 3GLTA 1EUZA 1JSRA 3SFTA 2YVUA 3GYBA 4DEVA 2IXAA 3DVQX 1IZ0A 5IZ7D 2F8TA 3ED5A 3WLAA 3LOQA 5BRNA 1N0UA 1OZ0A 1UEIA 4W8GA 4WDRA 3DDSA 4DIMA 4RADA 1CE8A 4BNNA 2XQFA 2R6HA 1H4VB 1QKKA 3R8XA 3WLRA 3HWWA 2W6PA 4BE7B 1OFTA 3LQRA 4XIJA 4OHYA 4Y0NA 3ZY3A 4ZEXA 1H5QA 2YNMC 1HTBA 2GILA 2OSVA 1YZYA 2ZREA 3KPVA 3BBPA 3SK0A 3KCQA 1L4BA 3AF5A 2HW8A 2B0JA 4D44A 3M3HA 1UJ4A 1JQ3A 2J3IA 3GGDA 1ZMVA 1XELA 2HU8A 4ENVA 4B3MB 1ZS9A 3VVBA 1NVWQ 1YJCA 1C1KA 3QH4A 4TKUB 4PSAA 3C9PA 1DGFA 2YXLA 2ZB3A 4IDHA 3A4IA 4J6EA 2G40A 1V1MB 3QLJA 4PTZA 4ZC1A 3T4UA 1IWBB 4BAUA 4MIYA 4PC2A 1M8FA 4G97A 4GL2A 4LF9M 5ITZA 2ODTX 1JQJC 4QQFA 3ZCVA 1U0EA 2BE9A 1VYHA 3DEAA 2X4DA 4G67A 4D9FA 4DR4B 2O59A 5C31A 5C5EA 3K72B 3EVCA 4KXQA 4JVOA 4XQ9A 5EIAA 2H1OA 2YTZA 3R5HA 2IUUA 1SD2A 1J0BA 4B3GA 4HNTA 1ILEA 4KAFA 3SASA 2ZZMA 3PUXA 3IR5A 2BFDA 4DEYA 1D0SA 2XWBF 2CDCA 5FPYA 3BUSA 3OM1A 3IXMA 3IBGA 1JG3A 3GZJA 4HL4A 4EMTA 1KEPA 3IRUA 4LYDA 1JAZA 3RKSA 1LSUA 1JYSA 4GFDA 4L95C 5CDYA 3L0PA 2NG1A 4MW9A 5P21A 1ZWLA 6GPBA 4IBKA 2AEMA 4KTVE 5LZ5A 1T9GR 1QQAA 1KMQA 4OQZA 4E4YA 4DR7B 4MP6A 4MUMA 1RLMA 3CNHA 4FYYA 1XZIA 4ZV9A 4Q18A 3GFOA 3GPUA 4D82A 4GL4A 2VJPA 4ER6A 5AVOA 4GOKA 1EJ2A 1VQ1A 4DDUA 1SBCA 2H92A 1XTQA 1W6RA 3LMKA 3WHPA 3KKKA 4KFSA 4OSEA 3HJNA 2VZ0A 4G09A 4K1XA 1E3JA 3EGVA 1VLLA 4JN6B 3NUGA 4D6PA 5B2FA 1AT1A 3R3VA 2ODPA 2FSFA 2XUHA 2HLDD 3T1VA 2XGNA 2QD4A 2HWYA 4NBTA 4Z8XA 2WSYB 3KAKA 5JMWA 4OU5A 1JG7A 2HI0A 3HUDA 2CL6X 5IUJC 4I0WB 4QYXA 2BPOA 2C5EA 2R96A 1D2HA 5SICE 1OBHA 5J5AA 4FOLA 4G65A 2W6NA 2D13A 2DPMA 4HRAA 1MW9X 3QTTA 4YXFA 4EABA 2VJLA 3IG8A 1XPUA 1SO8A 1GVNB 2Q5JA 4XX0B 1LPPA 4H18A 5FCDA 5JECA 3MTEA 5A7GA 4ZJYA 4O4JA 4E21A 4TXMA 2A6PA 4FJ2A 2P2ZA 2NO4A 4LJ9A 3NG1A 2PZFA 1OC4A 3SN6A 5E95A 4OY3A 5C3UA 2R2AA 4CTJA 4Z9XA 4D5EA 3K1ZA 3L2AA 5JSQA 3AR5A 1JR2A 1YZNA 5CYGA 5AW7A 3MBOA 4FMDF 3FRJA 3VSCA 1U4OA 1N34M 4EAAA 3MK6A 2GHTA 1ZG3A 2ZYRA 2ZE7A 4DWJA 3JARA 2B99A 3CLRC 2HJHA 3VX3A 5E8RA 4GRIA 1CR1A 3UJCA 3LRXA 3PIRA 3BGSA 2ENUA 1RYZA 2X5OA 2D74A 3JTEA 4MPRA 1EHCA 1UM8A 1MG0A 4WK2B 4GT1A 3TLAA 2IYYA 2Q5FA 1DX6A 3Q3GE 1QHSA 2CZCA 3NFRA 4OXKA 3ORQA 5EKSA 3LXUX 4QGAA 2G3QA 4DUGD 2QI9C 2QPAA 1VLMA 2ZUWA 3H5IA 1SULA 2B1QA 2JLZA 2VO1A 2GFHA 4EOGA 5BYAA 5BQFA 3I92A 3L0SA 4L9AA 1GGJA 4UAJA 3L4EA 2HYIC 1XQ1A 2VQFM 5BSTA 3GG2A 2OV4A 1PGJA 1RCFA 3PEEA 2XA9A 4R1LA 5CNIA 2AYXA 2FS1A 2DWNA 4RTSA 3UMJA 2BHNA 4NCNA 1P3JA 1ZW6A 1KQNA 3AC0A 4XPIA 5ADWA 1EFLA 4MUEA 3IPAA 1REQA 1UKZA 2KDLA 2VSNA 3ZLTA 3Q2OA 4YV1A 4ZQFA 4QXOA 3MBIA 2PLAA 1KS2A 3WMRA 3D2AA 1P7VA 2P3SA 1YRHA 3SVZA 3LL7A 5GOZA 1KOFA 1U3CA 3HCOA 1L5MA 3TPFA 1TR8A 4B2PA 3E5NA 4ZEOA 3WGGA 1ML4A 1AQIA 2PBRA 1J8FA 3AEQA 1BVRA 4CIXA 2UVPB 4H0FA 1LDEA 2A9RA 1SCDA 4CGYA 4WLUA 5TY0A 2M6SA 2YMLA 2NZJA 3V1UA 2B4YA 1Z2EA 4UUNA 5H80A 1N2JA 2PG3A 2VSYA 3SARA 3DZKA 1OAIA 4KVAA 1XMQB 3I04M 3DMNA 2HDNB 5HS4A 5IH7A 1A5SB 4NFHA 5LYJB 3NT2A 5A6SB 2MSNA 4LGYA 1WWKA 4KIJA 2CKDA 4A23A 4CNQA 3RRXA 4BX2A 2FFHA 1OLUA 4RKUF 2JAWA 1TVCA 1X1BA 1K3FA 4P54A 4NJEA 4PYRA 4KIGA 1Z2AA 4YI5A 2IHJA 1OBVA 1RJWA 2XOKA 2IYVA 1VIDA 3OM0A 3GRUA 4R2KA 1W5TA 3ZVLA 4HRYA 4IIJB 1HOXA 5E2IA 3B9PA 1Z75A 3RSLA 5ES3A 1UJ2A 5CVVA 1EM6A 1DXYA 3GNTA 2F48A 3GWGA 2XMCA 3AUAA 1KJQA 1XL1A 5IMSA 1ZGAA 2H4YA 4IO1A 4G0MA 4E2XA 1OSNA 1GGEA 3P9ZA 1JR3D 2WW8A 4W7SA 2PO7A 2IXFA 3OJFA 3PWZA 3A9RA 3R7LA 1U0OC 4JLJA 3PJEA 1XRPA 2GZ1A 4P4NA 1PFGA 2B6HA 4D96A 2C5LA 2DSNA 3GPPA 2YX1A 3DM5A 4KV9A 4JJZA 1OREA 1TH3A 3TSWA 4UNNA 3CH4B 5EIBC 2RAUA 5C51B 3MILA 4FONA 5ALVA 5KTRA 3QU4A 1J42A 3UMCA 2FZCA 2R3SA 3WHLA 3PG5A 2FK7A 2GPJA 5EE5B 1RWXA 2XB9A 3FPHA 4GOXA 4PHGA 1DC5A 2EFGA 3WWDA 4INZA 1WZCA 2PQ6A 1S4MA 3NEPX 3NUZA 3PKIA 4YR7A 5DZSA 3DO5A 3BJMA 4C7OB 2ZE5A 1XZAA 3TGPA 5BY2A 4TGLA 4V0SA 2PHZA 5A5VA 1CUYA 3OEHA 2WF8A 5CM9C 4C4OA 4M87A 3PQFA 4P3NA 3BXGA 4IIYA 1DAFA 3HM9A 3HA5A 3WL4A 3IMCA 1UZUA 3TUJC 3W5JA 3EVNA 1QGUA 1MNQA 2HJVA 2B2XA 4RPHA 1W0KA 3N0XA 1XCOA 1ESZA 5HIJA 5KOJB 4NV3A 4EDFA 3AUYA 3HJBA 5E4JA 3RU2A 4AB1A 1KVTA 1VXRA 2WJAA 2XTMA 4TV9A 4AUNA 2QGZA 5D3ZA 2JA2A 1LDYA 1GDHA 3OTGA 2NTEA 4RXMA 3ZDEA 3S1AA 3O47A 4TS9A 3B13B 3MWLA 3QEBZ 2GZSA 3X1ZA 5GM1A 1J1IA 1WHSA 4LOKA 2Z9CA 4QX6A 3TNJA 4XOIA 2DBYA 3WFIA 2OO7A 1W4RA 1YDMA 3KQTA 3FX2A 1B73A 2D5CA 4NMLA 2YY6A 1N6KA 2DZOB 3PNQA 4CVNA 2QP9X 3V33A 5ALZA 3F6CA 2IC5A 4IOMA 3HJAA 2YUTA 3GCGA 1KP3A 1XEFA 3QHAA 3A05A 3MXTA 5F1YA 4V0OA 3EIFA 4EF5A 1ENPA 4YDSA 1EX6A 4LRTB 2PCJA 1FTYA 2V7XA 4JVMA 3SSNA 1Y7LA 4MYTA 1KAGA 1G55A 4HL6A 1UWKA 2BFBA 2V6FA 3DR3A 1USGA 1FF9A 1Y8RB 2VBFA 2JZ0A 4MCJA 3HN7A 1RAGA 4M2LA 3ZVRA 3KJHA 3IULA 1R0YA 3AETB 2W71A 2HADA 3MT0A 3DHEA 1T3TA 2SNIE 2ZJ1A 3NATA 3HY4A 1PD1A 2JVIA 1Y9EA 4L9RA 1I7PA 1PYOA 3P19A 4HPXB 5HFNA 4DQVA 3ZBTA 4LCJA 4LSZA 1XA3A 2GPSA 3HJSA 2O2YA 3OBBA 4BNLA 4XSHA 2X5NA 2AYZA 1NJ1A 4YP9A 5LLDA 5F1OA 3KEGA 5FTJA 4J4HA 1EFRD 1NF3A 2YW9A 5I47A 4JP3A 4OP1A 1LPNA 4JNKA 8ATCA 4N8DA 1E20A 1T26A 2I4LA 3FWZA 4ME6A 3HCPA 2RHMA 4HOYA 2QVXX 1KU0A 2PPVA 5ALXA 2FPKA 4MRPA 5EWMB 3BE4A 2PX4A 1VJ0A 3R23A 2PVCA 4DXHA 1WMEA 2HMSA 1XJWA 4NPCA 2HXYA 4LQCA 1P60A 3B2NA 4YJ2F 2OXTA 1PWHA 3RI3A 3EQ6A 4C4SA 4CLXA 3UMGA 4J0JA 1IJBA 5A71A 1WPXA 3INNA 1ZN2A 4YCSA 1JFLA 1TF7A 3EMKA 2ZIXA 4DLLA 3FIUA 1TO6A 1R6XA 4PINA 3P71T 1KFCB 4OI2A 7ADHA 1IFYA 4P84A 4MJXA 1PDOA 1AC5A 4HYEA 3UCFA 4N4AA 3LQ1A 3FTPA 2FUNB 2EL9A 3DA1A 3RGWS 4YS6A 4AU1A 4R0VA 5BMVA 5CXQA 4ZI7B 2HA2A 3PQDA 3FB1A 4XE5A 5C1DA 3C1TA 1SCUA 4XUGB 5ECWA 2QHOB 3GEPA 4BLWA 1K4KA 2OLKA 3RUPA 2WAYA 1VYVA 4L5IA 4M1KA 4YJDA 2I3ZA 3BGOS 1P2TA 1QZZA 4GZ3A 3UHPA 3ABOB 5ARCA 1SN7A 2V6ZM 3R7DA 1CDZA 1CHNA 2VP2A 4DUYB 1Y5RA 4JOQA 2XQKA 4WRRA 1H8ED 4U7DA 1O77A 4MITA 5FKJA 4Q34A 4ZO6A 3R3SA 4WP2A 2NGRA 2CD9A 1JAHA 2AOVA 3RK1A 2Z6VA 4QTTB 1MUUA 1TH4A 2P2SA 3ZWQA 4B73A 2KQUA 3X1DA 4ATNA 2XGJA 3P4UA 2JIMA 2WG0A 1XZJA 2A1TS 4KEAA 3L7DA 3IE1A 3D43A 3SOZA 4BP8A 1QIMA 4FNOA 3LVQE 3DPUA 3VPFA 8CATA 2YCBA 2VG8A 2QUHA 2E82A 1T3ZA 3C8HA 3OG9A 4KKVA 3KD2A 5DNVA 4GKJM 2FF5A 4ND6A 4M0PA 1GY8A 3PD1A 3U7HB 1I33A 1II0A 1MC8A 3D8NA 2H6EA 5EYPB 4H1UA 3E22A 3EDCA 4GSLA 5B1HA 1FSFA 5DT2A 4FEAA 3ZGNA 4MKFA 4D1YA 4AJ1A 2OO5A 1NN1A 4PLHA 2DR3A 4AN0A 3ZK7A 3KZMA 2VA9A 4X3PA 5A4JA 1XCLA 4M1OA 2I2BA 1U1EA 1BHSA 3VSAA 2PGJA 4FS8A 2UXDB 3BQMB 1GT6A 1MC1A 3GU3A 4AZ0B 4Q9KA 3TZLA 1XU9A 1FY2A 4CT0A 1CEYA 1FW8A 1MVOA 4N41A 3QHPA 2HMTA 3QXSA 5ALPA 4BP3A 2R5FA 2FXIA 3AVVA 1Y6ZA 2FR8C 2TMKA 1TUIA 1HURA 2IY9A 2NXEA 3ASYA 5LA6B 4WCFA 1Z5BA 2CK3D 5JRDS 1O94A 1G2QA 2F90A 2UZAA 1DAMA 4LFAB 3JQ8B 1V5IA 1V7PC 4LZAA 2C58A 1CUKA 2W2PA 2EV9A 2LIPA 2YV4A 3I2YX 1YJXA 2BP7A 1TK2A 1QJCA 2C1XA 2C8VA 1JSCA 2ZAIA 1VLVA 3F5QA 1K75A 2RCNA 1YVRA 3QIAA 3RFUA 3ZWBA 1CY1A 5AXBA 1T5IA 3GZ4A 4KPGA 4BXOA 1KTIA 1AURA 1IUPA 1CKEA 1GZSA 1CJMA 4KMSA 3MUNA 1UBMS 5AVJA 4CE6A 1NKSA 2WJ6A 1Q7CA 2QLNA 4MKGA 1RJ9B 1A72A 1VE9A 4K81B 2V3WA 3NDPA 2BGRA 1TM1E 4FMBB 1HK7A 5ALGA 4TVKA 2C96A 4BNWA 5JAMA 3QLUA 1BXRB 3E5RA 4WAUA 3V7YA 1PIWA 4TT3D 1WABA 3U56A 4D4MA 3OT5A 1YB6A 3R3WA 4W5QA 3EXAA 4XJSA 3ZDDA 2L4EA 1TTPB 3VUEA 3EUWA 2XSZD 2W2OA 1T3LA 1A8HA 3FLAA 1YE5A 4M53A 2ETXA 5A7FA 1IUNA 4IHJB 1KEEA 2WTXA 1ABFA 1DBWA 3NBQA 4W63A 3TNLA 5DNWA 2IBMA 2N35A 4N5NA 3W7BA 3ZGOA 4JDUA 2J9FA 2N47A 1ZYUA 3UKJA 3L27A 4B8YA 3UMRA 2QJOA 1FDTA 5AK3A 5FUWA 2AZXA 4UBIA 4JT8A 2VHXA 2C8KA 2GCGA 1N7GA 3GJ6A 1UPAA 2IYUA 4IIXA 1D7AA 3OF2A 4FGZA 3GF4A 3Q88A 5ICCA 3DMTA 2AD5A 3T9BA 2VPXA 3DZCA 1MAVA 4CL0A 3RF7A 1AA9A 3RSQA 2QX8A 4F4UA 2FU5C 1GA4A 4QUDA 2R79A 3I5XA 3K5PA 3IOBA 3ZG6A 1J9GA 4NIMA 2C4WA 1NVBA 1XOIA 1JHMA 3GGSA 3JYNA 3I2KA 1QV6A 3NAMA 1RYDA 1WXEA 1U81A 1ZPDA 1SK8A 2RJNA 3KU4A 2QLFA 3HJCA 5E6SB 3R20A 3UK6A 1UK6A 1Y48E 4U9UA 3DKRA 3GJ5A 5DV9A 4JC5A 2W2NA 3EB9A 2A92A 3WSVA 5COBA 4YY3M 3S55A 4HFMA 3VYTB 1JQBA 1G63A 1IEQA 1ADJA 3MIZA 4B84A 5G4KB 1SKAA 1FX0B 3F5SA 4P7BA 3BGVA 3IAXA 1R2QA 4BBJA 1RZUA 3NASA 2HQSA 2H16A 1P2GA 1J09A 1KMHB 2H3EA 3PGXA 4ZV4A 4CIBA 1KXZA 4ZYUA 2OHOA 3QVUA 4CI0B 4CR8A 4QARA 3OZEA 4UEWA 4DLZA 4Q9DA 1TUGA 3K6SA 1XA0A 5FEUA 3IVCA 3H2HA 3ICCA 1K4MA 3VZQA 1KH1A 2FMUA 3JSAA 3AHGA 3ZGXA 3MAGA 1X7WA 3LY7A 3AUSA 4ZOLB 1YJ8A 5B58T 3NPAA 4WY8A 1KVSA 3TD6A 3AWDA 1ZD1A 3LE8A 1RWOA 2ONYA 4IJQA 5B7NA 2GEDA 4LF8M 5TX7A 2Q29A 3KLBA 3RTEA 2C5HA 3MWEA 2RDMA 3QX3A 1MT0A 1PWXA 2ZYUX 3T7DA 3CH6A 4RORA 4UU7A 2ASEA 1H0KA 2MJLA 1YAJA 3MW8A 3HFGA 2YZMA 4I5IA 4EHIA 1QPZA 5GZ1A 3E9ZA 4HQ0A 3HMQA 3RIXA 1R27A 3A9UA 3R6GA 1H22A 3EZ6A 3AFOA 4DLYA 1L8OA 1O7JA 3E35A 5DOZA 2GS9A 3B9QA 4JUDX 3EFEA 1AVTA 3W8EA 3OFSA 2WKRA 4JBNA 5C4MA 5CAEA 1U04A 2FZ4A 2XX3A 2X0FA 4CM9A 1P4HA 2PSJA 3R3XA 5EP3A 1MJGA 4ACAA 4WKOA 5CTAA 1MEJA 4C6SA 3ROZA 1V8PA 3DF9A 1G21B 2CJYA 1C81A 2LXEA 5CDSA 3ZH9B 3SDZA 3U37A 2WKWA 3ZZMA 1SXQA 2OBNA 4CEIA 1F6BA 5JANA 1IVYA 4CYMA 5CFNA 3KQYA 3LT0A 2PBLA 1QIEA 5DEOA 1V6CA 2DULA 1VCMA 3EF1A 4P32A 1T9HA 3DE7X 3O31A 2H8KA 1E5DA 2XDQB 1NW4A 3OQNA 4Y1GA 4AO6A 3O7WA 2JIOA 5ITXE 2Y93A 4OQDA 3TLCA 1QZMA 3C3EA 1UC5B 3KOWE 3PUVA 3PE3A 1G4HA 3UJ7A 3SVTA 4O2AA 1UQUA 1EGMB 4HVTA 4US1R 3THSA 3VR4H 1RI2A 1ODCA 2NQTA 2NX2A 1JQDA 1U6IA 4N6OA 4XLZA 2Q4TA 3C8DA 2Z08A 3LYLA 5ITTA 1V11A 1LGYA 3CC8A 1L5YA 4B4WA 2CYCA 3QOXA 4XZ3A 3AVXA 3RTGA 4E7PA 3OZXA 1RWNA 3MN1A 1P9OA 4XDYA 4JA2A 3ND5A 1P5FA 3WB1A 2V59A 1X92A 4M1MA 4I46A 2OM2A 1WF3A 1N2CE 3EZNA 2V74B 1DCTA 2XNKA 1BD3A 1CYEA 4JQOA 1FTQA 4LYFA 1UPCA 1VB5A 4EHKA 3VFDA 2QRHA 2YIJA 2P9EA 2WIJA 3KOYE 4FR5A 3BIJA 4EYKA 3GO4A 2WSBA 3O8RA 1E2DA 2WM2A 1E9VA 4FZ3A 1PX2A 1LI5A 1PKXA 3IAM1 3H11B 4FCTA 4PLFA 4WK6A 1R9NA 4FGUA 2IPNA 1NGSA 4U7HA 3ZVKA 4NF2A 1R0CA 2PUFA 5EGNA 1YS6A 1R8SA 1NVGA 2X0JA 2BE7A 3NTRA 3TDNA 1Z63A 2J6CA 1W1UA 2Z2ZA 4OIFA 4BGDA 3QOYA 4QBHA 2YV2A 4A6DA 5C1IA 4MW2A 4Y2XA 5A0TA 2DVWB 1U2ZA 3L3BA 3EAGA 3KKPA 2R8BA 1K5DA 1JG6A 1CHDA 4HWRA 1PNOA 1NN5A 3PQ6A 3OQJA 4CEHB 2BOVA 2PGOA 1ZGGA 4UUBA 3AP3A 1R9JA 5LMUB 1JI0A 2O3JA 4XGQA 2WVAA 3LNTA 5K6AA 2XUAA 5D7NA 4KVZA 1OZFA 4WJKB 3QK7A 1G4UR 1U4SA 2A9VA 1Y4UA 2HF8A 4YJ3B 2AZTA 1YHYA 3K70B 4FBGA 4II3A 5E7JA 3SPXA 3R8FA 4WFQA 5TT0A 4QA9A 2UZ3A 5C9ZA 1G71A 1V45E 1AHPA 4D46A 4KDRA 4NZ9A 4KLZA 4X66B 1CDOA 2AYYA 1RWQA 3HK2A 2DECA 3ZZ0A 3JASB 3R8CA 2WILA 1M0SA 4K5QA 5DLDA 2N3ZA 5CT6A 4GR4A 3TPZA 2C5RA 2C54A 1BN7A 3ZUGA 1V8BA 4DMKA 1XLUA 4QKQA 1AUOA 3PUYA 1R0XA 1B16A 2PE5A 3FPEA 1KEUA 2AQ8A 1EE1A 2GARA 2XNJA 4RDXA 4GKJB 2H4XA 1XAGA 3CRRA 2ETVA 4AWBA 3OIYA 1B14A 4D9HA 2SKDA 2OCIA 2QNBA 3L92A 1J21A 1AGYA 3DE2X 3KZVA 2QZSA 4XR9A 4IH1A 3TECE 3TEFA 3ABSB 1NR1A 4A5SA 1QRAA 4NR0A 3EGEA 3GP5A 4XR4A 3GLHE 3HACA 2JFBA 5IVHA 3GW8A 2PFKA 1LFDB 2QYSA 1KYZA 3LPAA 1XZGA 4G23A 1TCBA 3SMQA 4DZTA 5IUKC 3T0IA 3V48A 5B3KA 3AG6A 1QBKC 3ZXUB 5CX4A 2D7GA 4J0KA 5TB5A 3BMQB 3D7NA 4ZT6A 1JAXA 5C4IA 1Z7EA 3DEJA 1ONPA 1VPTA 1RPAA 4ND8A 5FEMA 2BBOA 1ZOIA 2XTAA 3JAWB 4JB8A 3VUFA 1DTWA 5G0UA 3K2LA 3BDIA 1MZVA 5A5EA 3TNDA 2FUEA 3PU6A 1COWD 1GA1A 5ALTA 3IG5A 3LI2A 3L41A 4E33A 4AMZA 5AOAA 3AF3A 2GN0A 4FCWA 3COYA 5EKUA 3V7FA 2KNAA 3TYXA 1KI2A 5TQ0B 1L5KA 2AI3A 2EDAA 1S1CA 1ORYB 3BXFA 1S0UA 3KO8A 2IYNA 5HDQA 2WV9A 3QELA 1I30A 3LVBA 3UTDA 1DB3A 1LZLA 5IN4A 4E14A 4PPGA 4BQPA 2FX3A 1NQ5A 4AKHA 4BC1A 4TS3A 5G3YA 1QE0A 3EJ6A 3IQGX 1EM8A 4CMJA 1UFKA 1YDHA 2Y6VA 4N5MA 1NP3A 1NNUA 4YNBA 2OG2A 3AKCA 1EVLA 3FCXA 2WB2A 1GA6A 1P18A 5BWOA 4RULA 4Z2YA 3PXXA 1J25A 5H02A 4MVYA 1FA9A 4N65A 3O5AA 4G1UC 1JEOA 4IINA 1PZFA 1H8HD 3DH0A 5FV7A 1JU9A 1XP8A 4FFNA 1B3RA 5KHAA 5JCXA 4ZHQF 1YI0A 4F86A 4QYIB 4DY4A 3UPDA 3M6WA 3CRW1 4KB5A 2DPXA 1VMKA 3T1HM 1WW3A 4GM0A 1VA4A 1I3NA 5FA8A 3P0FA 1J22A 1YXMA 3IOMA 4AKSA 5DT9A 2H1RA 4H1VA 2CL7X 3B70A 4F45A 3E70C 1ECJA 3GJ0A 1P19A 5BSRA 2XF8A 3B1JA 4HXEB 1E7RA 4RKYA 5PNTA 1ICIA 4TTIA 1L7XA 1T2AA 1MABA 4K9MA 4LDJA 4EJ2A 4MW6A 2V97A 3QWHA 5AW9A 4BY9E 3P2IA 1Z07A 1UKEA 4QQ8A 5GINE 4MKIA 3KKMA 1M75A 1I4TD 4DG5A 2JARA 2FZLA 4DANA 1D6MA 3D0KA 4QOHA 3L8HA 4C89A 2HJGA 2D0IA 2QMZA 4GMQA 5FTNA 4KGVA 3KEQA 1UZLA 2H4WA 1I01A 5J3JA 1VPLA 4HAIA 1WL8A 3I5MA 3IUBA 2BHRA 2CVFA 2VUSA 4HRVA 1IN4A 5DNYB 2VDBB 1JTVA 2O07A 1XPOA 2CLLB 4XVRA 3RCBA 4NULA 5ULLA 1XTZA 2QN1A 2IDJA 3R5XA 3D7RA 1GSAA 4YMUA 1PL7A 2IXBA 5AK6A 4MRSA 2G9VA 1W34A 3M4JA 3PZBA 5CT4A 4GKBA 1U9IC 4YY3B 5HBGA 2CWWA 1RFGE 1WHTA 4XOUA 3ABIA 4EJ0A 1SQ0A 4YCBA 2ZRIA 4KOEC 3SC2A 3ANMA 3ZZ1A 2I87A 5A2QA 4NZYA 4LY3A 3NIFB 3LKBA 2RI0A 2HAKA 5B1DA 4K9QA 1CS4C 4DAEA 5EMKA 2M1ZA 5FTWA 3F9CA 4K7JA 5JDIC 4LDZA 5JS1A 4BPRA 4PZEA 1G9TA 2Q3DA 4QGSA 1VBKA 1YR7A 3F6PA 1MV8A 1MO6A 4X63A 5TV2A 1KDRA 1TGYA 1WP4A 4CWAA 4C3ZA 2GCOB 4OX9B 3P9YA 4H59A 5JZBA 4GUDA 1IDN1 5E7QA 4JJ8A 5ERGB 1GDTA 5TF4A 2X0RA 2VPIA 2QTCA 2J0VA 2VYFA 5F9FA 3SJBA 4Z9AA 1EHIA 5B1EA 1KYWA 4DV3B 1Q7GA 3BMCA 4RTLA 2SECE 4AM8A 1NM5C 1JLHA 3TB4A 2P65A 2ZPTX 1E79A 2JLUA 1KP9A 2IYOA 3HVIA 3OMXA 3A1SA 3AJDA 1XHFA 3DYIA 2R18A 4Q03A 3UUGA 5FUVA 1R88A 4L8GA 4LHXA 3S5UA 3IQZA 4TYYA 4NECA 1O6BA 3I51A 5TR9A 3IKVA 2GA8A 4LOJA 1OAOC 1UMBA 3KOUA 1PM5A 4L73A 4PIPA 1XD2A 3FHCB 3P52A 1BOFA 5DHSA 4KQJA 2QUIA 4RD3A 2V7TA 4M49A 3STUA 4OA5A 2BWJA 4CIYA 3JRWA 2ZIVB 1A9SA 2W0MA 2RHTA 1LFAA 1W0JA 4C7KA 4U00A 3OCJA 1FDVA 4QJBA 4MARA 3OP1A 5BP7A 1TI7A 1P4RA 3RVKA 2LVPC 1W29A 3WR5A 1QORA 5TVKA 5C4GB 1T9KA 3KOOA 3SR0A 5D85A 5AHXA 2K4MA 2IYTA 1INLA 1C0PA 1GZDA 3ZU3A 2XUQA 3U62A 2LVAA 1LA2A 4LC1A 2QTMA 2YUIA 1M2KA 4JODA 3CYFA 4WGGA 5BSFA 4KOAA 1NU8A 2UUBB 2GF0A 4NZMA 4RF0A 3OZSA 4BLOA 3R5SA 2H9AA 4RJJA 4ZYXA 1CUAA 2ZKIA 1C1DB 4KR9A 2PT9A 5IYZA 1CXZA 2DUUA 3LUAA 4F1JA 2IYZA 5F51A 2D59A 1ZEJA 4BKOA 4ITQA 1AGRA 3IJ5A 1GT91 1XE3A 5DHUA 1V41E 1DGHA 1L7OA 2D06A 4X6UA 2IE0A 2Y1CA 4MV3A 4Z8YA 1RKVA 3AO0B 2VK1A 2H2FA 4E1BA 2IEZA 3U3RA 4R2XA 1M6YA 3ICOA 1NC1A 2REQB 3KJXA 3TLJA 1SG9A 1E9FA 3BHJA 1KMNA 3AMVA 2XD9A 1NBAA 1A50B 3Q11A 4FDMA 3BRCA 4C76A 6PFKA 1A4XA 2IDKA 3HHPA 3ROFA 1N2CA 1TFRA 1K4YA 1QVZA 4Z6KA 1V1RA 2JFHA 4ZAXA 4P34A 3QJGA 1G8MA 4MB2A 2BSAA 5K2OA 2EA0A 5JCJA 4K05A 2GNAA 3RGPA 3KOYA 4WOPA 1I2AA 3Q7TA 1IXSA 5DTIA 1SUAA 2OECA 2BFNA 1EDDA 2OZLB 1WETA 1A96A 3U26A 4KMRA 1FLVA 2C9YA 4B47A 2ZRLA 1FVOA 4ER3A 4X64M 1C9MA 1JLSA 2GO1A 4GXNA 3BT7A 2XOKD 3GJRA 2QTTA 4JX9A 4OTZA 3P7MA 3K0CA 3OF5A 4FI3C 4PLVA 1WAMA 4FGLA 2M6KA 5KYYA 2PS1A 1HMPA 2YRWA 1YR3A 4M7PA 4QEZA 4B2IA 1PVVA 3T1YB 2WUGA 3TK1A 2AEEA 1UXKA 2ZITA 1SZCA 1YS7A 4W5JA 1HYHA 4C3OB 1N7JA 4RHCA 4XYBA 3IP6A 4W7IA 3EDMA 3HN6A 4FFDA 4HNGA 2XMPA 5E3HA 4V0NA 1T4DA 1QWSA 3HCEA 4M98A 1T2VA 1QG4A 1R3DA 2JJYA 5DBIA 4MROA 1DZIA 5C52B 3EXG1 1JXMA 1QPGA 4OI1A 2GJ8A 3I9V1 3ZDZB 3WGUA 3ZY5A 4BEJA 2NU6A 2VUHB 3OH8A 3HKPA 1GPMA 3AM5A 4LY6A 3PNYA 2D54A 2RH5A 4J4BA 2DFVA 2YYSA 1NQXA 2I29A 4OU7A 3AHEA 4YC7A 5E38A 4P7FA 4TLMB 3HR7A 2BR4A 1UEJA 2DE0X 1AJEA 1H05A 4GW3A 3C87A 5BSHA 1OW3B 4FC6A 5ALMA 2EUCA 1ACMA 1YFLA 1DAHA 1W0KD 3PC8A 4X1KA 1U0TA 1RJFA 5HGXA 5ED4A 4AJ4A 1YDFA 3B48A 3K1TA 3AIOA 3I12A 2WTAA 5JY1A 5K8IA 4UXHA 2VJMA 5LP1A 4DV7M 4HEA1 2WHXA 4DCGA 3DP7A 3KB6A 1N2ZA 3UJ9A 4EUKA 3GLHA 2P2CA 5EXSA 4CLHA 3MS7A 2HPHA 1GQQA 1Z8NA 1CRQA 3HDTA 2GXUA 2OM6A 3EULA 3T6PA