4AG5A

Structure of virb4 of thermoanaerobacter pseudethanolicus
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
384
structure length
374
Chain Sequence
SGINDGSGIVLGKDRDGGLVLVDIWKRGGDRTNSNWTILAKPGAGKSFTAKMLLLREYMQGSRVIIIDPEREYKEMCRKLGGVWINCTGGEGKINPLQVRLRVFQSPLALHIQTLRTFFSLYLRDLTDTEKAALEDALVEVYKEAGITWDTDPRGVPNDKWPTVKELYEYCVKKAEENPETYGRLSVLLKRAAEGADSYLWAGPTAVEADSDFIVFDVHDLQNAEDQVKRAQYFNVLSFAWNILERDRRERTVLVVDEAWMLVDPQTPQAIAFLRDTSKRIRKYNGSLIVISQNVIDFLAPEVQRYGQALLDNPTYKLLLAQGEKDLEAITTLMNLSEAEHDLLVNAKRGEGLFVAGTQRIHIKIEAAPYEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IV SECRETORY PATHWAY VIRB4 COMPONENTS-LIKE PROTEIN
publication title Structure of the Virb4 ATPase, Alone and Bound to the Core Complex of a Type Iv Secretion System.
pubmed doi rcsb
source organism Thermoanaerobacter pseudethanolicus
molecule tags Hydrolase
total genus 140
structure length 374
sequence length 384
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01935 DUF87 Helicase HerA, central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.730 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ag5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ag5A01
2F1IA 3K9HA 1O3YA 5FUYA 1TL7C 3RLFA 2JJ1A 4XJXA 2H16A 2EWWA 1J8MF 1KHTA 2X1VA 4G5GA 4B75A 1KK3A 4JLMA 2A9KA 4YDHB 3PFIA 5SZIA 3SJZA 1XU4A 3REGA 1BOFA 4MKGA 3TJZA 2EWVA 1DAKA 1HT1E 2QQ0A 3K0CC 1MABA 4N0EA 4GDFA 1W4CA 5JRZA 1OXVA 1UEJA 1RYHA 2H1LA 3AF2A 5FTJA 1HT2E 4E5UA 3VU9A 1OYWA 3AVXA 2WICA 4GMXA 3TH5A 2HJGA 4RFSB 4HI0E 4TL9A 3R9WA 4R2IA 2QP9X 2DBYA 1J7KA 4S35A 3PV0A 4EQ6A 4TZ6A 1ZINA 1SXJE 5JWOA 1PJRA 2F7SA 3PUYA 2AN9A 5FTMA 4MRRA 1S1MA 2OM2A 1G3IA 2PLFA 4MITA 2WSSD 4GOKA 3GLHA 1N0VC 4ZPXA 3GCGA 3BB1A 3M6AA 2IWRA 2Y8EA 1CR4A 1P2SA 2QU8A 4NH0A 2MSCB 4WBSA 1DS6A 2IT1A 4Q9IA 4CEIB 1YR6A 4IOLA 4Q7LA 4K81B 1UPTA 5BW8A 2WJYA 3QXSA 4B2IA 1LF5A 4UNRA 1JR3A 2HF8A 2VP6A 3LBHA 1Q3TA 4MRVA 1Q22A 2C9CA 2V3CC 3AUYA 4NCHA 2MSEB 5FPHA 2ZU0C 4KODA 3AF4A 1WF3A 1FQJA 1Z47A 2RMKA 4MYCA 4O0MA 4WA7A 3K0CA 1P61B 1ZCAA 2DWQA 1RRPA 4E07A 3TE6A 4B35A 2IS6A 4QBFA 2A5JA 2GVZC 3I8XA 5CJPA 4C0AC 2ODNA 4LI0A 3QKSB 4Y0VA 1Y3AA 4TQ9A 2JLYA 2FV8A 2NO0A 1CR0A 1R6BX 5EE5B 4BLTA 3KQHA 5GJBA 3FFBA 5HZHA 3LW8A 2ZS7A 2ZRPA 4WZAE 1EFRA 2ZYVX 3TR0A 2ECKA 2QTFA 3EIEA 2FWRA 3MUFA 5HCIA 4JKYA 4UXJA 3RYTC 4G5RA 4DCVA 4HDOB 5C4MA 1X6VA 2WWWA 1ZM7A 3W8RA 2J59A 2ZJBA 4XSGA 4MUAA 3TBKA 2GA8A 3H86A 2WWFA 2ZETA 3L0IB 4O2LA 4F4CA 1S8FA 4Q02A 3GLGB 4W7SA 3F0TA 5DIFA 2IC5A 3IIJA 2ZRBA 3ETLA 5CB8A 1S3GA 5L3SB 4D80A 3U7EB 2NMVA 3PENA 1D2NA 1E1QD 3DKPA 3T1QA 4B74A 1NVUQ 2ZI9A 3K0SA 1BYUA 1G7RA 3NHAA 1ZNYA 3SYLA 2WOOA 4EPXA 4Z54A 3CPEA 1ZIPA 3O8BA 4PAQA 2VHQA 2JLQA 3AKCA 3K9LA 4JLNA 5DGXA 1NG9A 4D26A 2P5SA 1AN0A 3QQ5A 3TVTA 1WQ1R 4DDWA 2BJVA 4B3XA 1A82A 4IW3B 4AIIA 2RGGA 4MDEA 3E70C 1E96A 3ZS9A 4TYNA 1FP6A 2IYVA 1N3BA 5E7IA 5LDDC 3D7MA 5JEEA 4IEIA 1V43A 1UF9A 1GRRA 1W5SA 3SHWA 1J99A 3EIHA 2ZE7A 3NIBA 4URWR 4PC2A 4MKIA 2NTYC 3SJBA 3IPXA 4N3NA 4BFWA 2R6AA 2IK8A 4B2LA 1CJTC 2FSFA 1ELOA 5EZ6B 1SKYB 1M6NA 2ZAOA 3CF2A 3GJ5A 4GSYA 4TLAA 2F3RA 3WXMA 3ZVLA 2ZTSA 3QKRA 1VG1A 2QMHA 2QEQA 1YZUA 2ZITA 1JQLB 1XJ0A 2BMDA 3AVYA 3OHMA 2YOGA 1TTTA 1GNRA 1CP2A 2WJHA 3HR7A 2P5TB 2ZR9A 4A2WA 2GESA 4XIGS 1NMZA 1KI6A 3A1UA 4QGGA 5LB2A 2CVFA 5DI3A 3T35A 1IXSB 5TY0A 2QT1A 3TR5A 1ZNXA 5G3YA 4RD4A 4ACBA 1OFTA 5EP3A 2B6HA 4JVLA 1G41A 1E9RA 3B2EA 2NIPA 5FTNA 3W9YA 2ZVQX 2ERYA 1E0KA 4HAXA 2TMKA 1N6HA 1F2UB 3QVVA 2W0SA 4AYXA 1W7AA 1KOFA 5TVKA 4B3DA 4UNSA 5GJCA 2GETA 2GJ9A 4OHVA 4ZCLA 4D0GA 4PZZA 2IWHA 1FUUA 1Z29A 1FTNA 1EWQA 1EESA 2AK3A 2EFGA 721PA 4M4SA 2WAYA 5AWFC 3TAUA 3G0HA 3U44A 4AWXA 2OXCA 3PEVA 2ZYUX 2WIBA 2PZFA 2ZRMA 1IJEA 3A4MA 3QPUA 5J47A 2ZSDA 1D9ZA 3EARA 4PPNA 4B3FX 2RGXA 5L3RA 4RCZA 1CULC 4CEHB 1KK1A 3GJXC 5IDVA 3L2OB 4HZUA 3SJCA 3R9IA 2O8EB 2GBLA 2W6IA 4HYYA 4JLAA 1OW3B 5KNDA 3M4YA 1WMSA 4OYHA 1E69A 1Q3HA 2WWGA 4TMTA 2CNWD 2IYTA 2R6CA 5LPNA 4LJYA 4LYJA 2ZJ8A 4X8OA 1RW4A 2Q9CA 2ZSFA 3QXXA 1BH2A 1N5LA 4IXMA 2XITA 2ZRKA 1XTQA 3R20A 4PTLA 3RWOA 1H65A 4RZXA 5FBLB 2QN6A 4ZV4A 3LA6A 4KBFA 3AVWA 3KB1A 4D4MA 4F38A 2HLDD 2CE7A 4KO8A 4OK3A 1VCOA 2ANCA 2FJUA 3SU8A 4BQSA 1W44A 3O8DA 4TMXA 1Z0FA 4K8OA 1VG8A 3THWB 5D3MB 2W2VA 1GDDA 3N2IA 1ZMXA 2IF0A 4GZLA 4FMDB 3QEJA 4EFMA 5JSZB 2OSBA 4EFNA 4KLNA 3ZS8A 4DRZA 3B60A 2GWHA 4R98A 2BMFA 3L0OA 5AUOB 4TLDA 1VMAA 4CW7A 1DAGA 3D3QA 3GD7A 4RD2A 5FPTA 2GEVA 3J81k 1RJ9B 2CLSA 2KWIA 2F9MA 5DISB 3FFAA 3WRYC 1G8YA 3ZZUA 1UBCA 2W00A 4BLQA 4C0BA 2QP4A 2JEOA 3OESA 2GEDA 3THXA 4LHZA 1E2LA 4Q66C 2JASA 4IOJA 2D06A 5FUVA 3GLGE 2ORWA 1XCGB 2HUPA 1JBKA 4Q9KA 1NMYA 4BFXA 3EPKA 5CLQA 3HU3A 1GL9B 1II8A 1OKKD 1NJGA 1NI3A 1XJQA 4KITB 2G1KA 1CJVC 1Z06A 3R7WA 4U02A 1SHZA 3DZDA 4B3BA 2GJKA 3K8YA 2REOA 2OBMA 2OAP1 4MRNA 1Z5ZA 4DJTA 3K0AB 3SQWA 5F9FA 4QXAA 5L3QB 5DN6A 3D8BA 3JVUA 4NU0A 4PHFA 1R0ZA 4JLOA 3WNCA 4EPYA 3UATA 4YONB 1TF2A 2EYUA 2J7PD 1G5TA 1IJFA 1R0YA 4EKDA 3SE0A 3UMFA 2JLWA 4BRUA 2VSXA 1YHNA 4PQFA 3SFVA 5K8UA 3KQLA 4D25A 2O8CB 3H0KA 4AKEA 1SHKA 4OHYA 1SVKA 3R8CA 2PCJA 1E2MA 4DKXA 4NE2A 1H8HD 5H1YA 1DOAA 1G4UR 5CK5A 1E2KA 3R8FA 4C0KA 3BIFA 4M2LA 3K70C 2A5YB 2ZSBA 1OH6A 5AJXA 1GP2A 5G53C 2IYQA 2J0UB 4D2IA 2XZLA 4I99A 1A2BA 1QVRA 3IIKA 1ZNZA 1GNPA 1SKYE 4JS0A 2IS1A 1QF9A 1UM8A 1P2UA 1X1RA 2W0MA 1FTSA 4WIAA 1AA9A 5H68A 1RKBA 2WOJA 1FZQA 5BN4A 2EU8A 3TW4A 1NN5A 2X8AA 4LUCA 2ZUDA 1BMFD 1W48A 3DHWC 4DSOA 3PEYA 3LXRA 2A2ZA 2J5XA 2YINC 1QHSA 5KTYA 1E9BA 3QOFA 3OIVA 1OT3A 2CVHA 1XJCA 4XH9B 4NHOA 2OBLA 2RKOA 3NC1C 1HEIA 4PQYA 1N0UA 2C78A 3SN6A 1HA3A 2DFKB 2FFBA 3NBZC 4Z8XA 4WXRA 4F93B 2O8DB 3QF4A 1E0AA 3WNDA 2XNDD 1JXMA 3QBVA 3K09C 2FSGA 4IOKA 4F7WA 4IVRA 1U98A 1DBSA 5CYPA 2ZE5A 3KTAA 1TX4B 3PITA 1FX0A 4QHSA 1GIAA 4TLEA 2O0JA 2YWEA 3U7FB 4B3CA 5A5GA 5FTLA 2E87A 2VSOA 4QG7A 2YWFA 2C03A 2QAJA 3M0EA 3C14C 5FI0B 2B7CA 2O0KA 2WJIA 3K1JA 3K9NA 2VSFA 1OXTA 4PPQA 1GKYA 2QM7A 3B1WA 3BH6A 1EFUA 4L4UA 4AG6A 3EX7C 3OZXA 2BBWA 1N2CE 1EFCA 2DHRA 1M7GA 3L82B 2GZHA 5J40A 1TAGA 2JGNA 1O87A 1RIFA 3L8ZA 1VIAA 4Q9LA 3CRW1 3VR4A 1XNJA 4P32A 2XXAB 5KSYA 4EJSA 2WJJA 4Q4AA 5HCNA 3P27A 1OHHD 3JVVA 3VR6A 1N6KA 4AG5A 3FKQA 1IONA 1WB9A 1G4AE 3L43A 2Z43A 2ZXUA 2EFHB 1TF7A 5JHGB 5TMPA 2O8BA 4BLPA 2IF2A 4PC7A 3EZ6A 4BGDA 5FBQB 3RSLA 3QNUA 4N0DA 4BWYA 3K09A 121PA 2LCFA 2WKQA 5KDLA 3BH0A 3ZIAA 3TRFA 4DIDA 2BBTA 3KQUA 1E2IA 3ASYA 2FGKA 2I4IA 1HE1C 3RS4A 2EFCB 5FPYA 3AVVA 1NLYA 3CPJB 4DDVA 2GXAA 3P20A 1D8TA 1ZBDA 5HPYB 1JQJC 2BMJA 4KHZA 1E9AA 4PR0A 2WMNB 3ZGXA 1ZM4A 2ASEA 3PUZA 3CH5A 2G3YA 1CBUA 2P65A 1RE0A 2JLSA 4UXHA 1T8TA 2VBCA 4BPBA 1XTSA 1YU9A 4IVPA 2ZI3A 1OIWA 4ASUD 2ZVPX 5L8VA 3BB4A 1QHHB 3KKPA 2CJWA 3F5FA 1BYIA 1E2FA 1P2VA 2G0TA 4KFTA 1KKMA 3VMFA 3B1XA 4Q9HA 2BEJA 2BVNA 1MO3A 4LJ6A 4PZYA 1OH5A 2NZ8A 4CEJB 2WSSA 1W2HA 2V7QD 2P6UA 3BJIC 3FMFA 1SZPA 1KMHB 1TU3A 1XMJA 3EA0A 4OKSA 4D82A 621PA 1XTJA 5CDFE 3QSYA 1Z6XA 4HAZA 2FF7A 3KQKA 1GL7A 3OE7D 2PEZA 3CIOA 4KFRA 5KNBA 1OH8A 2QORA 2GK6A 4C30A 5JCZA 3DDCA 3T1VA 4RD0A 3FTQA 4IOMA 1KO7A 1N6LA 2IXGA 2IYZA 2OCYC 2CEAA 2QTHA 3TVDA 4IDNA 2F55A 1LB1B 1IN5A 4HAYA 2Q3MA 4OQFA 3G5UA 1Z22A 4LPSA 4ERNA 4FN5A 2ZJZA 2W2TA 2W83A 4JJKA 2QGNA 3N2EA 3X2SA 2QM8A 3I3SR 4M1KA 4V0LA 1DE0A 1XTKA 2ZPTX 1C4OA 5F98A 3WBKA 1XMIA 2DCUA 4URZR 2VP5A 4LX0A 1S9HA 3FE2A 5JI3E 1F6BA 4M1YA 1Z08A 1RRFA 5J4KA 5J4LA 2BIFA 2REXB 4NKRA 2R62A 1FQKA 1BKDR 4Q4LA 2PBRA 3BERA 3TK1A 4AYWA 4JBWA 3KFVA 1YRAA 2IYSA 1TEVA 5CITA 2FDCA 3RS2A 2IL1A 3TSOA 2GVDC 3VU9B 1OXSC 4A8JC 4B47A 3W34A 4NBSA 3IEVA 3Q5DA 5AUQA 3V9PA 1I4DD 1CJKC 2VP9A 5GADl 4FMBB 4FIDA 2OILA 3JZAA 1G7SA 2XOKA 4B32A 3NWJA 2UVQA 3OF5A 1BIFA 2ZR7A 3OAAA 4BFVA 3THOA 1LS1A 4LWZA 1E1QA 1G7TA 3KJIA 3GLHB 3B82A 1NN0A 1NIJA 1U81A 3K9GA 1WXQA 4QRHA 1NSFA 4MUBA 3U3MA 2HEIA 1CTQA 1TU4A 4DLYA 4A6PA 2ZE6A 3HDTA 5E3HA 1YZTA 4YMTA 1I4TD 2LKCA 2PZEA 2YHSA 4TLBA 3K0EA 5TXGA 2WIAA 2ZUBA 3CF6R 4D81A 1A1VA 1QHIA 3A4NA 3NBXX 1E2QA 1WDTA 4MRSA 2J41A 1AS0A 3K70D 1W46A 1H8ED 4PO1A 4OHWA 4HAUA 1GNQA 4JVSB 1JR6A 2QTVB 3RC8A 4I81A 3KJHA 3BS4A 1GTVA 4B34A 1Z0DA 4JMPA 3U4QA 1UKEA 3FHOA 4DLXA 1EGAA 1ZM3A 4U00A 5FL7D 1P3JA 5JWHA 1FMJA 4DBLC 1AK2A 1XEWX 2N42A 5KYKA 5KSOA 4A2QA 4A8JA 1M74A 4RVCA 5CIQA 3AEZA 3BGWA 5HR5A 4A0GA 3FYHA 4MQBA 1AS2A 2FFQA 4EIWA 3X1WA 2AX4A 4PQRA 4Q7JB 3AVPA 1IN6A 2ORIA 1P9RA 3PR1A 4A36A 2JDID 1P60A 2PLRA 5F2EA 1JJ7A 3LX5A 1QDEA 1U9IC 4M0LA 1LVGA 3B8HA 4OBEA 1II9A 2IYUA 2OESA 4URXR 1JEEA 2KB0A 4JLBA 1M7BA 1E2EA 4LJ8A 5EZ5A 1P7CA 1TQ2A 2IYLD 4TYQA 1XXHB 5CIWA 2CHVA 4C3ZA 3CRQA 1MO4A 1YQTA 2RB4A 4TYWA 3TNFA 3I8SA 3KXLA 2HT1A 4D0LB 4B3GA 2XJ4A 3UG7A 2J0QA 2ZYWX 3AGQA 2O52A 1Z8FA 3ZVNA 1C1YA 3LLUA 4XD7D 3WMFA 4TTRA 3H2YA 3Q3JB 4HATA 4OK6A 1PVOA 1HUQA 4BECA 2F1HA 1VHLA 4US1R 2OG2A 2XSZD 2AXPA 1KO8A 2FEMA 2FFAA 4BRWA 2WVJA 4PPFA 2HXYA 1ZU5A 4P0TA 2AL7A 4DUGD 3OEED 5CLLA 3KX2A 1SQ5A 4CVNA 3TQFA 1IQPA 2HXSA 3CRRA 5P21A 2QE7D 4BFSA 3DM9B 5D3QA 1KO1A 3LBIA 1NG1A 3SR0A 1U9IA 2JJ8A 1KKLA 2IBMA 4JVMA 1KI2A 2QPAA 4LPKA 2VYFA 1SGWA 2JJ2D 3U7GA 3GLIA 1OV4A 1EX7A 2FZ4A 3CO5A 3IBGA 3ZJYA 821PA 3FOZA 1VKJA 2CNWA 4NCKA 4DCUA 1AQUA 3NXSA 6Q21A 2BKEA 2GDJA 1OB5A 1GZSA 2EQBA 1US8A 3VR3A 5AJZA 3U2QA 3U3KA 2F1RA 4QGHA 2VEDA 2AR7A 1KI6B 3IEUA 1E98A 5DLQC 1E6CA 3RANA 4V0ME 1KY2A 3VX4A 4YQFA 1NY5A 3CBQA 4OQMA 4ZKDA 3RAPR 2JLVA 1RYFA 4Q7MB 5TV2A 2ZYTX 1KAGA 5A0FA 2C9YA 4WVFA 4ZO4A 1G3MA 2R2AA 2J46A 2V6IA 3FKSD 3ND9A 3Q8XB 2QRZA 2R44A 3N5CA 1CXZA 3I72A 5AJWA 2DFLA 2OFOA 3X1DA 2ORVA 3PXGA 4NMMA 4B6EA 2QGZA 1MOZA 2HCBA 1SVLA 4HUTA 3NBFA 2NQ2C 1U90A 2PT5A 4GFDA 4GI7A 3B13B 4V0NA 1JJVA 5B2ZA 4AKGA 5LB4A 4GNKA 2QMOA 5DHAA 2Z0MA 1Z2CA 1YR9A 4CYMA 1KNXA 2YYZA 4UNNA 1N0WA 1QVAA 2A30A 4F4JA 1W47A 5JEDA 4LJ9A 2XB2A 5E4FA 4CGZA 1W5TA 3NHBA 2Q0HA 3GJ4A 4LHYA 3U44B 2IXEA 2FOLA 4LV5B 3BD9A 1NVWQ 4NCNA 5FBVB 3ZYCA 4O3MA 1KGDA 1X8KA 5DI9A 1FL9A 2RHMA 4M1MA 2WAXA 3GQBA 1K8RA 2CLDX 3B78A 5KUTA 3O8RA 3RS0A 3E2IA 4UXIA 4P33A 1L7VC 1IAQA 1A2KC 2WBLC 1OKKA 5FTKA 4L5BA 3W6OA 1QG2A 1E9SA 4JLKA 2ODEA 1T5LA 2QPTA 4LBZA 1N6RA 3AP1A 4ZDJA 4HAWA 2CXXA 3QEOA 1A5TA 3FWYA 2P0EA 3AKEA 3UMRA 3ZZ0A 3WYAA 1TPZA 1OIVA 4CT5A 1NBMA 3CX8A 4KFUA 4DWJA 3ZD7A 1P75A 5JI2E 2J7PA 3QXCA 2IYYA 3FDIA 2WHXA 3PQCA 4DVGA 4L15A 2JLXA 1KDOA 3R9XA 4Q01A 2X19A 1PLKA 1UKYA 5EQTA 4M1WA 4Q4JA 3FVQA 4QJ3A 5E7JA 3TLXA 1J8YF 1H8HA 1OFUX 1ZP6A 4DIEA 1GUAA 2FEOA 1CRQA 1W0KD 4LC1A 3ZQ6A 1E99A 2QP3A 5C18A 5KO2A 4W5HA 4DT1A 4YC7A 1J90A 5JRJA 1GKUB 3G82C 1N6IA 4RFSA 4ZDWA 3LV8A 1TQ6A 1SXJD 2C98A 3AF0A 4KVGA 2NGRA 3AKYA 3C16C 4B48A 1UKVY 3HPQA 3NDPA 4QL3A 1G3RA 1LNZA 4QBGB 3W8NA 1WA5A 3A58B 2PCLA 3UXMA 1QHXA 3X1ZA 5JZVA 4P4TA 4P3YA 1VCMA 2F1JA 3QG5A 1QBKC 4OQNA 5M04A 1BMFA 3THXB 2HJVA 2EYQA 4FCWA 4JJZA 2ZJ2A 5G3ZA 4KSCA 2RGBA 2MMGA 1TQ4A 3BRWD 3C15C 1XXHE 3F3YA 3OIUA 1ZNWA 2XJ9A 3I73A 4FCVA 4MGYR 1U94A 2OUKA 3JZMA 4RJLA 1II8B 4FXPA 2QBYA 1IN8A 4XVUA 1EG7A 4BLRA 2XNDA 5IRCD 2IHBA 5KSPA 1DO0A 3BOSA 3S1AA 4BUJA 1GKIA 1DAMA 3NH9A 3SNHA 3ZVRA 4PO9A 2C95A 2DWPA 3QBTA 2GAOA 2WSMA 4DSTA 3X1YA 2BOVA 3OEHD 2Q9AA 3BWDD 1W0JD 2WM9B 2AXNA 2V1XA 4ITRC 3SBDA 1K6MA 1XFAA 2JJ1D 3IQXA 3IO5A 3U6BA 3OIWA 5FOSA 3GJ3A 4RZUA 3VNUA 1NLFA 4KCGA 4ZI3A 1PLJA 5BN5A 1VG0B 3BB3A 2WPDD 4IXNA 1SVWA 4EPVA 2GJAA 2KJQA 2BM0A 3NTUA 5FOWA 4BZQA 3KDSE 4FD2A 1GFIA 1IN7A 1W4AA 3E5HA 5FR1A 3D31A 4E22A 5J4YA 2AK2A 2RGNC 5C4GB 1G5RA 1OHHA 2I1QA 2OBNA 3KL4A 4G3XA 5DYIA 2O8FA 2BC9A 5FL3A 1R5BA 3BE4A 3X1XA 2YOFA 4HSEA 1NLZA 2GTPA 3NVAA 5B64A 1S96A 2IEYA 3GLGA 1XTIA 4BFUA 4C7OB 2BWJA 2XEXA 2WMOB 1GVNB 3GMTA 1NN1A 4C4PA 1FMLA 2G1JA 2E9SA 3EC1A 2HYIC 2V6JA 2F43A 4AY2A 1E2NA 5EP1A 1M7HA 5GVSA 5A4JA 1NY6A 5AJYA 2AHOA 1G1MA 3HR8A 3Q72A 1Z0AA 3EZFA 3VTKA 4HLDA 3TSZA 1OXXK 1WBDA 3SHFA 3EW9A 2GCOA 4UKDA 4ZKEA 2JA1A 4R71A 3SQXA 1NL3A 1SULA 3QF4B 1IXRC 4ZCIA 1NNEA 1E3MA 4TTQA 4KBGA 5EP4A 1G3QA 4XSHA 2RGCA 2OLKA 4M1SA 3KTAB 1FNMA 4WAUA 3THYB 5JMTA 4TTPA 2REBA 4ON9A 3DM5A 1FOEB 4ASUA 4GBMA 1W36B 2W2XA 3SYKA 3LAWA 2FU5C 2Z83A 4BE7B 1YVDA 2RGNA 4CZ2A 5DYGA 1UAAA 1E9DA 4DCSA 1OLOA 3AVTA 4IJMA 1N6PA 4JLPA 2C04A 5SZKB 4IHQA 5JBQA 5F3WB 5FUXA 1G16A 3VHXA 1I2DA 2WKPA 2C99A 4W5WA 5BWMA 1G8FA 1T5IA 1UADA 3EPJA 2V7QA 2GXQA 5DSZA 1HYQA 1KO4A 3HWSA 1GRQA 2ERXA 4I1OA 4BFYA 5KOYA 5LD2C 2QPOA 5B57C 4EJSB 4HEJA 4W5JA 1MV5A 1NSTA 3AQ4A 4Q4AB 3OE7A 1HH4A 3EC2A 2FPKA 2BJWA 2HF9A 4NL4H 1UBGA 4GP6A 5K8IA 3UG6A 1F2TA 5AJVB 4ILEA 1E0JA 5G41A 2VHCA 2ZE8A 2IA5A 1G7CA 2V4ZA 2FE4A 4LJAA 2O8BB 1U2RA 3WMGA 5KPDA 1QZXA 2V55B 1IXZA 4QBHA 1OJLA 2I1VB 2ZI4A 4QGFA 4MGKR 5KDOA 2PH1A 1F2UA 3ZH9B 1E9CA 2ZRHA 1DELA 2D7CA 2QY9A 3DL0A 2ATXA 3VQTA 2V9PA 2BHRA 2ZJAA 4GZMA 3IQWA 4PSAA 2IS2A 3PIRA 1CJUC 1R5NA 1M34E 3T61A 1PZNA 2YVUA 2D4HA 4DLVA 3HYRA 1P62B 2R6GA 4P4SA 3ND8A 1IOZA 2B92A 3TUIC 5SZJA 1FUKA 4OQXA 1KYIA 4A0HA 3GJ7A 2FX3A 5FOVA 1UKZA 1G5PA 3AUXA 2ZRCA 2KBEA 3OIYA 4U5XA 3MWYW 3ZQJA 3U60B 2BDTA 4ZIRB 1CR2A 4DLTA 3U3RA 2GF0A 4R2HA 1B23P 1ZAKA 2AWOA 2O8EA 4TZ0A 4G5QA 5KU1A 4HB4A 3KFXA 2DFTA 1VYUA 3Q85A 2H57A 5BYJA 2ZI6A 4ACAA 3EPLA 3ZDQA 3EZ2A 3L8YA 1IY2A 2OO7A 2WWXA 3EXAA 4YMWA 1MRSA 5L3VA 3PJRA 1KSJA 2QRNA 3IKJA 2ZRIA 2BCJQ 1SKQA 2PMDA 3PUXA 1G9XA 2ZS8A 1VHTA 1VIYA 3LLMA 5DO9A 4LYHA 4DC9A 1ESMA 2W58A 1SVIA 4MH0R 3CRMA 4HLUC 3AGPA 2XZOA 3A6PC 3VHLB 1H8EA 1Z63A 4ZI2A 1CS4C 2QAGC 2C96A 1Z6AA 4PSVA 5JSZA 2CCJA 3NG1A 5FL7A 3CH4B 2D74A 4LOAA 3QPWA 3H84A 3ZLJA 2CK3D 1N5IA 2NO6A 3IIMA 4Y0AA 2F6RA 4TL6A 3WMEA 3SJAA 3I32A 1Z2AA 4OHXA 1KMQA 2CHGA 2QL6A 4BLSA 1NKTA 1XB2A 1ZUIA 2X77A 2ZROA 5CJ2A 1FW6A 1JB1A 5F9HA 3ECCA 2WJVA 2BBSA 2JDIA 3CR8A 1P9NA 2GAAA 1DG1G 2HDNB 2ZRDA 2YKGA 1D2EA 2ODBA 1AKYA 3HU2A 4V0OA 2WWIA 2CCKA 1IN4A 4LGMA 1OB2A 4URVR 3KB2A 1JAIA 3GEEA 1N6OA 4TL8A 2YOHA 1KIMA 2CL6X 2D2FA 4HB0A 3U3JA 4KV9A 1GITA 1R0WA 3H1TA 3BFKA 1P73A 4Q4HA 1E2HA 1KK2A 1RVDA 4V0KA 3A36A 3FMOB 3EASA 3NEJA 3WYGA 2QROA 3RS7A 3SDZA 2RCNA 4HLUA 1U0JA 1JEDA 3LY5A 4XD7A 1Q1ZA 2GHIA 3T15A 1XD2A 4M1OA 3VR1A 2QAGA 2BV3A 1UFQA 2EVWX 2XSZA 1OFIA 1ZM9A 4NDZA 2R65A 3UK6A 1YKSA 4G5OA 2CL7X 4QGAA 3IHWA 1CLUA 2PJRA 1T4GA 1KJZA 3A8TA 2OFXA 4DUGA 3OEEA 5DNYB 4IEEA 2ZI5A 1T0HB 4O2RA 1E1RD 2ZUCA 5KSZA 1N25A 2IYRA 2QE7A 4ARZA 2BMEA 3GFTA 4HLQB 2FG5A 3C8UA 4EPWA 4MGIR 3K0FA 4QHYA 4URYR 4MA4A 5FUWA 2E1RA 2FSHA 2NZJA 4A8JB 4QJ5A 1KJYA 2VHUA 2CCGA 2H92A 1B0UA 4BLOA 3I62A 2JJ2A 5IT5A 1ZD8A 4LYAA 3V00A 3RNLA 4BASA 1J70A 3MMPA 4IDHA 3VKGA 1KSHA 1WP9A 2VHJA 3RRNA 3RS3A 4DLWA 5KPJA 1QHNA 4A92A 3RWMB 4A15A 3AVUA 3WNBA 2P67A 1E4VA 1NVXQ 4I1UA 4FMCF 2OCBA 1X8LA 1G3UA 2NPIA 5J5CA 3UPUA 4C2TA 2H17A 4LHVA 3LX8A 4TWZA 2O8DA 1KI4A 1Z6GA 2AKAB 3PUVA 2HCJB 2D2EA 4G1UC 4WXPA 5JCPA 2D3WA 1GILA 1WBBA 3FKSA 3I5XA 4X8MA 4YDSA 5HTKA 1KI9A 4Q1DA 2GXUA 4LHXA 1KI1A 4AKIA 2FFHA 3MSXA 5IHPA 4TSFD 2QMUA 4YMUA 5K8LA 5FBWB 4XVQA 3FPAA 3IUYA 5CM8B 4S2EA 3LWNA 1MABB 4OI1A 4A6XA 1JPNA 4KSBA 1AM4D 3CRVA 4Z1MD 4CIDA 1WCV1 4JBYA 4IFEA 1YJ5A 4WZ6A 4CRWB 2J9RA 3BH7A 1KSFX 1S2MA 5E7MA 3C41J 2VQSA 1OPXA 4EQ6B 4QM7A 4ESVA 2DB3A 1SXJC 2AKYA 4JIMA 4Q21A 4UJ3A 1FNNA 4NYJQ 3AP2A 3KKNA 4IRUB 4DZZA 4WOPA 5E95A 3GLFA 1AGRA 5K8TA 4MKFA 3AF3A 3QUSA 4RD1A 2OE2A 1XCPA 1DPFA 3GLIB 4GT1A 3QKTA 3B9QA 1FPMA 4A4DA 3WBJA 4AI6A 1R4AA 1UJ2A 3WYFA 1DG3A 1OXUA 1QHGA 2IEZA 2XNSA 4IVQA 2Q9BA 4PPGA 4ABYA 4HUQA 2C9OA 4URUR 4YLGA 4PFSA 2QI9C 3QG1A 1Q44A 4XTRA 1ZM2A 2G83A 1ZC3A 2H5EA 3VKHA 3B6EA 3WY9A 2YC4C 3V4FA 2Z4SA 2KSQA 4RZ3A 2VL7A 2NO9A 2BBOA 3LQRA 4L16A 2JCSA 1Q1BA 4MRPA 3U3OA 1GRNA 2LWIA 1G18A 3ASZA 3E1SA 3QI2A 2G0NA 1T91A 1W0KA 2OAQ1 2VH5R 5EE0A 2SHKA 2JLUA 1W36D 1EK0A 4RD6A 4RFVA 4KYUA 2XX3A 2CDNA 4I1SA 5AK0A 2OXRA 1SXJA 3DOFA 1W1WA 3T1OA 3VNVA 3AV0B 3C5HA 4I1VA 2GCPA 4NYMQ 1X8JA 2RAPA 1AKEA 2VO1A 3BFVA 1TF5A 4OJQA 4JYCA 4E03A 3NDBB 4EAQA 1LFDB 1NVVQ 4JLJA 2DPXA 4PANA 5ANRB 2ZIAA 3T12A 3KZ1E 3BAFA 4ZDIA 1AIPA 3KUCA 1E79D 2ZRFA 5FPKA 5JJIA 5EUMA 1OSNA 1K5GA 4BFZA 1DAIA 3P1JA 4NZYA 3I5YA 2IUTA 1KZ7B 1YZLA 3ADBA 5EXSA 4LCBA 3PEWA 3MWKA 1KSGA 1OH7A 1MH1A 3B7GA 4TT3D 4WZBE 1G6HA 5EXPA 1R5OA 4PX9A 5H8WA 3A1WA 1TUIA 4AKHA 4IDOA 1EFHA 2Q6TA 4CF7A 3CLVA 1YZQA 3GEIA 4Q1BA 3OEHA 5H70A 3SC3A 3ZIAD 2X2FA 1IY0A 1W0JA 4Q9JA 2WTUA 1YZNA 1WE2A 4NONA 3SBEA 2IS4A 4LBVA 2GF9A 5HKKD 1G6OA 2ZI7A 3CX6A 1GWNA 3EWSA 4LV6A 5J4VA 4Q48A 2ZSAA 1XTRA 2DY1A 4ZDKA 2HYDA 2Q21A 5EXXA 3M1IA 4GOXA 3EIQA 4LJ5A 1YR8A 3LW7A 5HE9A 4RSGA 2WPDA 2XTNA 4PXAA 2ZM5A 1KNQA 3SOPA 4Q4JB 3CNLA 3I1FA 3W5JA 1NRJB 3MG9A 3DZ8A 4POAA 2CHQA 1EXMA 3AB3A 2LKDA 5IK2D 2A5FA 2B8TA 4DT1B 4UJ5A 2GXSA 5BN3A 3VKWA 2KE5A 1II0A 2X2EA 3CWZA 3QY0A 5UKDA 3QKRB 1Z3IX 4E09A 2DR3A 1CIPA 1RZ3A 2GK7A 3W5IA 1KI3A 5FOUA 2Z5FA 3FGNA 4R7ZA 3LVRE 4HZIA 3OFND 2W6JD 2QNRA 4NP6A 1R10A 5JFGA 4CDGA 5DI3B 4DCNA 1VG9B 1G291 1R8QA 3D6TB 4L9SA 3FHTA 2C2HA 4QOSA 5HE8A 2WWYA 4LJ7A 1LV7A 1YZKA 2HLDA 2IYWA 2WZQA 4LC0A 2CE2X 3PEUA 2OCPA 3GEHA 3A1TA 4PHHA 4OK5A 3EG5A 2VPPA 5CYOA 2FPMA 4QBIA 2QBYB 2PL3A 2XGJA 2VF8A 3FMPB 4FINA 2IX3A 1L8QA 1RRGA 3S1AB 4JSTA 4TMVA 2VF7A 2VP4A 1V5WA 2ONJA 3MWLA 3T1TA 1KK0A 2PX0A 4HB2A 1X3SA 1T3LA 2ZANA 2KBFA 2V8OA 3U5ZB 1P72A 1P9WA 3CZQA 3MLEA 1NN3A 1RC8A 2ZREA 4D0NA 2J1LA 1CR1A 1LS6A 2PX3A 1Z6TA 1D9XA 2JIZD 2VHTA 4TMWA 3QVUA 4DDUA 5JLJA 1W2GA 1MO6A 3A4LA 3QIAA 3LO5A 4BEJA 3HU1A 1I2MA 2Z4RA 4C0LA 2V1UA 4Q1AA 1CRPA 2J45A 2ANBA 3MD0A 3VR2A 1ZUHA 3A1SA 4RY2A 1P6XA 3QJYA 2OCAA 4LZZA 4MYHA 4HZUB 1NF3A 3TSWA 4DDTA 3GLHE 2OHFA 2O8FB 1E32A 3GLIE 3LD9A 4AK9A 1OYYA 1XXHA 4DSUA 1XEXA 1XD8A 2PJZA 2XOKD 2R6FA 5SZHB 1A4RA 3LDAA 2DWOA 3B1VA 3SI7A 1XMVA 4JT2A 3OAAD 5BQ5A 2F43B 1JR3E 2OZEA 2AFHE 3CZPA 4M9ZA 1UDWA 2WKRA 4AD8A 1MO5A 3VFDA 3UIEA 1U99A 3BXZA 4XOIA 1L2TA 1YZGA 1ZD1A 3MRSA 2GCOB 5C46F 1AQYA 2BKUA 4NPHA 3EWAA 2YWHA 4C9BA 4M9QA 3TMKA 2J0SA 4Q19A 1XZPA 4B43A 1GG2A 1CF4A 4W9MC 3MCAA 3P4XA 4MYUA 3REFA 4JLVA 1E2JA 4MDFA 2KI5A 1P5ZB 2VIIA 2IHYA 3QE0A 2N46A 4OQLA 4P4UA 2XB4A 3WP0A 1JALA 2D7DA 3AH8A 1T0JB 4B73A 3WRXC 2GKSA 4GPTA 2XTMA 2EFDB 1LY1A 1F60A 4DEYA 3SEAA 3WHLA 2B8WA 1COWD 3RRYA 2CBZA 3NC0C 4CT4B 3EPHA 2MMCA 4PO8A 3I4LA 5IF9A 3QXJA 1D6JA 4MKHA 4NYJR 2NPFA 1LF0A 3CX7A 4B6FA 4CEIA 4LBWA 3W3AA 2B21A 2YNMA 4FMDF 4JL5A 1WRBA 1AJEA 3B85A 2C5LA 3IPYA 2IUSA 4IFBA 3R7WB 4UNQA 1ETUA 4XTCS 2C77A 3HP1A 1HQCA 1W4BA 3N70A 1XF9A 5EP2A 1DVRA 2GBLC 1JAHA 1Q1QA 1S9DA 4PAOA 1E9EA 2G9NA 1CEEA 1F2TB 4V02A 3PCRB 5AR1A 2BM1A 4NCJA 2YJTD 4AYTA 4YXWD 4Z51A 3CPHA 1MKYA 2AFIE 5JJLA 3ICEA 4M1TA 2RGAA 2OLJA 2DYKA 2RGDA 4PC6A 5FOTA 1EX6A 1Q12A 1ZIOA 1NBME 2QSZA 4H9GA 1G19A 3LRPA 3QKSA 4LSGA 4KFSA 1DEKA 1JI0A 1IBRA 1TMKA 4HDQB 1PLLA 4G01B 2CK3A 4M21A 1U8ZA 2NOAA 3B1YA 1HY3A 1I4LD 4Z8YA 1XZQA 3T06B 4EFLA 2ZRLA 3QPVA 2ZAMA 1YE8A 4P4SB 4PAMA 3A1VA 1UBEA 1Z07A 5ELXA 2ZR0A 3H4MA 1AZSC 3RRZA 1KI8A 1GL6A 1L4UA 1P4SA 1L4YA 1ZU4A 3F8TA 2A5GA 3GJ8A 4JKIA 3RHFA 1E4YA 1DO2A 3IDQA 4NYMR 5BYKA 2FZLA 3TKLA 3MFYA 5L3SA 1D5CA 4O25A 4Q7KA 5BXQC 5LD2B 3KXKA 4II7A 1NVVR 2NG1A 4L9WA 2G77B 2YZ2A 2P6NA 4QKQA 2OV2A 3IHLA 4LBYA 4US0R 1ESNA 2GJ8A 4KU4A 1EFTA 3P26A 5CK4A 1K5DA 3DPUA 2PMKA 2FN4A 1HQYE 4PHGA 3RABA 1JR3D 4FW9A 1Q20A 4JLDA 4TLCA 4RCYA 3KKMA 3ICQB 2FH5B 1FX0B 2V54A 4YMVA 1TADA 4UNPA 3AP3A 4X8HA 4A1FA 1LW7A 1KDRA 4B76A 1RPZA 4FWTA 3KJGA 2QMEA 4EPTA 421PA 3ZVMA 2QZ4A 1Z28A 3K70B 1AZTA 1MRNA 4Q1CA 5JWRA 1UDXA 1E1RA 1NIPA 4QM6A 3U61B 4Q03A 4NYIQ 1KTVA 1DAFA 1N6NA 4LY6A 1AS3A 5FOXA 5GJVC 1ZD9A 1CKEA 4QNMA 1EFRD 2K5UA 2PEYA 3CR7A 3NKVA 3UWKA 5AUNB 4LYFA 1VDZA 3TQCA 1XDBA 2QG6A 1W49A 5KDDA 3O47A 3DOEA 3NEYA 2VP0A 2ZRGA 3RC3A 3GPLA 3TUJC 2R6DA 1ZYUA 3AVOA 4M53A 4OL0A 2VP2A 2OT3B 4OI0A 1KY3A 3B9PA 3GFOA 2AWNA 2RH5A 1HV8A 3HPRA 1RFLA 3QENA 1OE0A 5KNCA 3ONWA 1IM2A 2O0HA 2N1BA 5B58C 1R2QA 1VYVA 4BEBA 1NP6A 1DTSA 4KVAA 2XZPA 4ZCMA 4Q4HB 4FCTA 4XWKA 5JJKA 1G64A 3HJNA 1SVMA 3RVBA 4HB3A 1M2OB 2VLIA 3SZRA 1XD9A 4NTZA 5GVRA 2QQEA 4EUNA 4DLUA 4UQOA 1T3SA 2JATA 4LHWA 4JT4A 3P4YA 1NBMD 4TSFA 1T9HA 5TDHA 4C2UA 3W3ZB 221PA 1U0LA 1XD2B 2AD1A 4DSNA 2F3TA 3DKVA 4LJ4A 4M9XA 2QAGB 4X8LA 4F91B 3LVQE 2JLZA 2DFNA 1JXOA 1D2MA 1G20E 5J4HA 3O8CA 3QKUA 3QF7A 4Z1MA 4JVNA 4JL8A 1HTWA 1NJFA 2Q3HA 4GOJA 3TW8B 4EDHA 4RKFA 1VTKA 2CJWB 4CEHA 1M1YE 5LBIA 4MYTA 1W36C 2GRJA 4H1VA 3KKOA 4G5SA 2ONKA 4IKEA 3ZZTA 3LXXA 4ARZB 4TYYA 5FPSA 1Q0UA 1T3HA 2NO1A 1F5NA 3K0FB 4YMSA 2R9VA 1JPJA 1JNYA 4J0QA 3K53A 1TQDA 1PUIA 4C7OA 1Z6YA 1ZCBA 1LTQA 3VAAA 1TNDA 3AF1A 1E2PA 1W4RA 4EJSC 3MWJA 3DMDA 1YRBA 3V4RA 1S4QA 3EZ7A 1N5JA 2ZJ5A 4QJ4A 1S3SA 1AGPA 4HLCA 3CF0A 2GJSA 2Z6VA 5FH9A 4U7DA 4PZLA 1G8PA 1GM5A 3FB4A 1DARA 3MJHA 2ZU6A 1F48A 2B7BA 3KJEA 4QHTA 2PZGA 3THWA 5D3MA 2GCNA 3CUEF 3RRMA 4KJZA 2OFWA 3I92A 4DHEA 3GFPA 2ZRNA 3DVLA 1Z0KA 4PC1A 2UZIR 3C7KA 3THYA 4C0HA 3VX3A 1RJ9A 4GP7A 4ESHA 1ZVQA 4C0JA 1XPUA 2H18A 2ZS9A 5DHFA 1R0XA 1Q21A 3DO6A 4DLRA 3LH5A 1P2TA 1PV4A 3I61A 2ZRJA 1ZJ6A 1E2GA 3RDPA 4RKEA 4AC9A 2IXFA 4JL6A 5CM9C 5FR2A 4A82A 3U7HB 4F4IA 1XX6A 3TIFA 3IO3A 1GOTA 1XRJA 4I4LA 5AUPB 2F9LA 4GMDA 3T34A 4D6PA 1F3OA 1IY1A 1T6NA 3UMSA 5CDFA 2QSYA 2XTZA 4XWAA 1BO6A 1NKSA 3FMIA 4M22A 1G8GA 1NMXA 1E2DA 1GAJA 2FNAA 3SS8A 1XPOA 4LK2A 1E79A 4LRWA 2W6ID 3AM1A 3Q7PA 3DEFA 3WP1B 8OHMA 3PVSA 3C5CA 1U0HC 1OIXA 3K0AA 5EE1A 4DXAA 1ONBA 3C4JA 5L3QA 1KI7A 3GLFB 2ZRAA 3AKDA 2UKDA 4PSKA 1EWRA 1KZGB 4FI3C 1A7JA 1VECA 2HT6A 1E94E 4TT3A 5G40A 1DAEA 1RRCA 4PHTA 1Z0JA 3A37A 3BBPA 4Q00A 3SYNA 3Q9LA 2OEPA 4GRAA 3TGPA 4TMKA 2O8CA 1MR3F 2GZDA 4BZXA 5HZKA 4JYBA 4Q47A 4HUQB 5HKKA 5EJEA 3SFZA 1T8UA 1ZW6A 4C0SA 4TQAA 1E0SA 2A78A 2L0XA 3MGCA 3TUZC 3EZ9A 2RHDA 1FP7A 4A2PA 3U4QB 4TYPA 1HURA 2FMXA 2J0UA 3Q5EA 1G8HA 3UKDA 4V03A 4XWOA 3LQQA 3FHCB 5DH9A 1J2JA 4KYIB 4KXFB 1XBTA 2ZSEA 3RS5A 2EFEB 4OI2A 2J87A 4C0QC 4OI4A 4AURA 5IK2A 4M9SA 3WHKA 5EE9A 4Q18A 5EE3A 4WW0A 1E9FA 1CU1A 1SXJB 2GNOA 5JS8A 4RZ2A 4ZIRA 2ODWA 521PA 1ZC4A 1KAOA 4DB2A 1HE8B 2ZJOA 2IUUA 5EXTA 1YR7A 3OFNA 4JSYA 2W6JA 4B2PA 2A5DA 1DADA 2G6BA 1VYTA 3NH6A 2QA5A 4H1UA 1QHYA 4M8NE 1IHUA 1QRAA 4P31A 3TAHA 4B71A 4D4JA 4Q5IA 2XAUA 3Q7QA 3EA5A 3NBYC 5FFMA 1XCMA 4R9UC 5DE3A 2EW1A 2J7KA 3IGFA 5CB6A 4Q1FA 1C9KA 4DEXA 5DN6D 3MJRA 3IBYA 4KI0A 3T5GA 2AD5A 1VPLA 2FSIA 4DLSA 1KO5A 1XEFA 2A7QA 3CKLA 3CNNA 2PT7A 2VRWA 2I3BA 2QENA 4DB4A 5GJWC 3CB4A 1X86B 3RSOA 1ODFA 2P3SA 3DMNA 3KUDA 4G0NA 1Z0IA 2YWGA 3BFXA 1MT0A 2ATVA 3BK7A 1PUJA 3ADDA 4DCTA 1GSIA 4JBXA 1UEIA 1DAHA 2R8RA 2VTKA 1N5KA 3LBNA 1U8AA 1SVSA 2JIZA 3B5JA 3BC1A 4TQUS 5JECA 2XXAA 3L0PA 3P32A 5FI1B 2IW3A 2G88A 3CONA 4BZPA 4NYIR 3W6NA 1M8PA 4F92B 3HYTA 4A0RA 1OF1A 1XWIA 3IILA 4TMZA 1R7RA 4IDPA 3ADCA 4XVRA 4D4LA 4A0FA 1ZRHA 5FBRB 3W6PA 4QNRA 2P2LA 3PUWA 4N1AA 5KHOC 2NO7A 3QXHA 4MGZR 1XEWY 2MSDB 1VCNA 2WWHA 1ANKA 1S1CA 2WV9A 1VCIA 2CMKA 3LNCA 2RGEA 4US2R 2Q3FA 2BCGY 3MAAC 5B30A 1US8B 3ADKA 3GJ0A 3CNOA 5JS7A 2P6RA 4KAXA 2A3RA 2FA9A 1JECA 2BEKA 4TL7A 4DLZA 1G17A 2GILA 2H7VA 2ZEJA 4KLZA 2CL0X 2H8KA 1CJMA 1QG4A 1TEXA 2YV5A 2VA8A 2JAQA 4BFTA 3KQNA 1OFHA 4A9AA 4GL2A 4B44A 2YC2C 4L8GA 1XMSA 2J0VA 1BS1A 2O5VA 2GZAA 1Q1EA 1U8YA 4PC3A 1KJWA 4OHZA 4D4KA 4LV8B 1QHHA 5C1BA 3CWQA 3UANA 1TUEA 1XP8A 4LDJA 3ZD6A 4FMCB 5TARA 4FWIB 1G21E 4OJKA 2QUZA 1Y63A 5JHHB 4RD3A 2HV8A 1FFHA 5TB5A 3UWOA 2C8VA 3GP8A 4CEJA 4EPRA 3KKQA 3LFUA 3EAQA 3T5DA 1KDTA 1Z83A 1KMHA 3W90A 4B33A 2D62A 1R8SA 2ZQ5A 1COWA 2UZ3A 4HDCA 2WJGA 4TN1A 2FPLA 4Q1EA 1SVOA 2FGJA 2JLRA 1Q57A 1ZUNB 4HAVA 2IYXA 3GJ6A 4IDQA 3BORA 4JZKA 3PG5A 3U6KA 2CLCX 3CW2A 3GLFE 4V0MA 1X1SA 4K46A 3CM0A 3B1ZA 3VR5A 2ZJYA 3L0SA 5C2JB 2J3EA 4QFMA 2QT0A 5EUQB 3AVQA 4QC2A 3KXIA 1UBFA 1XEXB 2GEUA 4YXWA 1XPRA 4NCIA 1KDPA 1S0UA
chains in the Genus database with same CATH superfamily
4CODB 2A67A 2FOIC 3SQDA 4OU4A 1Y1LA 2CZGA 4EMUA 1BOFA 2ST1A 4KDRA 3AERB 2FWMX 1ZGCA 4FW8A 2II6A 4KX5A 3LX6A 4RFSB 2CYCA 4ES6A 3WBBA 5KYGA 4KTVE 2FE8A 1PJRA 2AN9A 2VRCD 3HA3A 2PLFA 3LPMA 3GLHA 1VJCA 1OGJA 2A9QA 4HDKA 4P7JA 5BW8A 3KL2A 3LBHA 2V3CC 2R5FA 1DGFA 3AUYA 4KK4A 1LQ2A 4NCHA 1JLHA 4KODA 5F7ZA 1WF3A 1XE3A 1RRPA 4UHHA 2NZWA 2O3SA 4Y0VA 3S27A 1G55A 3P52A 5BQ3A 2WSFF 4BYMA 3DAHA 1CR0A 4BLTA 3OCXA 3EIEA 1C5KA 3FF4A 3MJ5A 4QECA 4LHSA 1HWYA 3IIJA 3E2PA 2NMVA 1RM5A 2UAGA 3KLPX 3G79A 2W48A 2O0LA 1V41E 1N78A 4UUNA 2X1LA 3IUQA 3F78A 4AFNA 3GOQA 1BU8A 3E70C 3KVOA 2E18A 4UDNA 1PYDA 1X80B 3C7DB 4IZ6A 1N8TA 2PD6A 3IPXA 5KMGA 4K3UA 2NADA 4D9GA 1UXOA 1TLLA 1U2EA 2QMHA 1YZUA 1JQLB 1Y6RA 2ZR9A 2UYOA 5LB2A 3O3NB 1YA6A 3V97A 2UV8A 2TMKA 2I7TA 4RNDB 4OATA 1FVXA 1KOFA 3CGGA 1Z29A 3G9UA 2AK3A 2EFGA 1I2CA 1WZIA 5BV2P 1AKVA 2BFPA 3OX4A 2PZFA 2ZRMA 4I4TB 4Z49A 4RCZA 2YHIA 3M3DA 2AQKA 4MVJF 2Q1TA 2Y1LA 1UJBA 5A3JA 2BFBA 1YBMA 2A58A 2GX6A 3I6ZA 3AB8A 4XR4A 3IE1A 3FVVA 4PGFA 2QN6A 3FPHA 1DIBA 5F2KA 2WYHA 2ZIZA 1ZGHA 2CE7A 1P31A 4TWBA 4WD3A 2VJDA 1JEQB 4KLNA 3B60A 4R98A 5FO1A 1GKLA 3KKKA 3TTVA 3NYRA 3IP8A 1EVZA 3O4FA 3PTAA 1UBCA 2ZFUA 3HG7A 2X58A 3R77A 1RIIA 2GZSA 1CYDA 7AT1A 3R7SA 5A4KA 1NMYA 4BFXA 4TYMA 1Y3CE 1NJGA 1Z06A 4XPZA 4MRNA 4N65A 5AI6A 3LPNA 3AYXB 2OPHA 5AK4A 1F5SA 4PHFA 1R0ZA 2BPOA 3UATA 4XIFA 2J7PD 1IJFA 2JLWA 5GAJA 1E77A 3CVJA 2PCJA 2RHWA 3SLGA 1N0HA 4YIHA 2VAMA 3K70C 4LF4M 2ZIXB 3WLQA 4KN5A 4Y7DA 4CUJA 3KHKA 3PXEA 1YIDA 4G4SP 3BXWA 5BWBA 5LMNM 3N2KA 2RE8A 1AA9A 2ZYIA 5CVEA 3W5AA 4B84A 4JB3A 5A4DA 1E9BA 1ECLA 2AHRA 1F0KA 2RIRA 5L95A 4F93B 1U98A 5CYPA 4QHSA 3U7FB 2ADOA 1J4AA 3BPSA 2ZYSA 3PHJA 2FS1A 1ZAEA 2VSFA 5AM1A 1CT9A 5AW4A 3D5TA 1EMDA 1WCWA 4JHLA 2CLLB 1IONA 1P7WA 3L43A 1IWPB 1KJQA 4EP1A 1P2BA 1PP4A 2O07A 2RJOA 2EUCA 3FHLA 1GNSA 3WV5A 2O3JA 3HZZA 4KQ9A 3RW9A 4KXWA 5DLYA 2XODA 1XTSA 3O8OA 2VZ8A 3ZCPA 1P2VA 1KKMA 3ZWYA 3RK1A 4CV3A 2JGLA 4UHJA 3EODA 1XDZA 2NZ8A 4HQOA 3EGDB 3BXEA 4YALA 2P6UA 4UHBA 1SZPA 1XMJA 5I9TA 4MV9A 3ICOA 1GSOA 3OE7D 2QORA 4QGSA 2O7QA 2CEAA 2BFAA 1LBSA 1XNRB 3ESYA 5K0JA 1SM4A 2KRUA 1N3IA 4DCPA 2G0AA 2VP5A 4CL8A 4B4WA 3PNBA 4XEHA 1KXJA 2BIFA 3NASA 4JVOA 4NS4A 3EIFA 2I7NA 2X7XA 1U3VA 2CJYA 3LKBA 2IL1A 5GIPE 2LBPA 1UL1X 3FPKA 3RF6A 4Y98A 1KJ8A 1UP4A 2UVQA 2Q3JA 3HN6A 3V6MA 3OAAA 1ADCA 1LS1A 1E8DA 3D6HA 3GLHB 5KJ6A 2XDWA 2O06A 2LIVA 3QITA 4HDKB 5TXGA 2AMJA 3EZGA 3GPXA 5I51A 1UK7A 1C3JA 1GNQA 1I7NA 1B1AA 2JHGA 3GT7A 1N2HA 3K9QO 3ZWCA 4DBLC 3WMWA 5KYKA 4X91A 1C80A 2PWYA 2FFQA 2Z58A 1F1JA 3PR1A 3KKEA 3LX5A 3EDRA 4NNOA 2H54A 4LE2A 1RAGA 1II9A 3A10A 4Y1FA 1JEEA 4XRGA 1ZL0A 5AVUA 1IRIA 2X4LA 4B0OA 4DW8A 4RTMA 4CCYA 1L7NA 3DV2A 2WIFA 3AJ8A 3D2AA 2AW3A 4MICA 4P0TA 4JUBA 1XTPA 3OEED 2FPIA 3KX2A 4RHFA 4P7GA 3EDCA 3CRRA 4R1UA 3I9V1 1QLHA 3VZDA 1AUVA 3THSA 5KMGB 2VYFA 4LFAM 2JJ2D 2WF5A 1POWA 4K9PA 2CWWA 3AHJA 4YO8A 5TC4A 2IOFK 3U3KA 2AR7A 3NWPA 4LI3X 3RAPR 4Q7MB 5K0SA 4CMIA 1MC4A 4AN4A 4J2HA 1U1FA 3NPAA 1MOZA 2VC2B 2A9FA 1PV1A 2R6ZA 4AKGA 1AE1A 4JH0A 1Z2CA 5DHAA 3K0HA 2A30A 2M1XA 1PN3A 5DCYA 3RV3A 2FSVA 4PINA 4JX9A 5KQ8A 4FKMA 5EIHA 3NI2A 1VLVA 4MQFA 1FFXA 4YJFA 2DH5A 1HRKA 3OFVA 4AJOA 4OHKA 2YHIB 4CF3A 1QG2A 2B8EA 1M8JA 4M9CA 5C3UA 4FD3A 3VAZA 2BFBB 1SC6A 3PNOA 3QEOA 3WJ7A 4FGLA 3WYAA 3OZBA 1P75A 1Z8NA 2JLXA 5TT0A 3R9XA 2H2GA 1ORWA 1PLKA 5EMMA 3MT9A 4M55A 4X95A 1SXGA 1TQ6A 2NGRA 3NS7A 3QPCA 4GKAA 1S2IA 3A58B 3JQEA 1BMFA 2JHFA 3I30X 5H4HA 3I34X 2O3QA 3AI2A 1GKIA 2WSMA 3JR7A 4ZZ1A 1RC8A 1XFAA 4ALKA 5MFPA 5U1PA 1E6WA 2WYVA 2BM0A 4D97A 2QZPA 3U56A 5CIYA 1X9HA 1O89A 3V7FA 4DQDA 1R5BA 4L6IA 4C7OB 2WMOB 2X0NA 2QD1A 3HB7A 5E2AA 4DUZM 4RU1A 4HQFA 5CUQA 3EZFA 2IBSA 3TQHA 1WBDA 1GU7A 4ZCIA 5BXYA 3UAWA 1IPEA 3RB8A 3DM5A 1FXWA 4A03A 2Z83A 3Q3VA 5DYGA 4DCSA 1A72A 3MERA 1T5IA 3GCZA 4JXXA 5E4TA 1MV5A 1NSTA 3ZV3A 5F2NA 1YR3A 4E7OA 3I5UA 4ML3A 3O1HB 5DZSA 2CDAA 1F2TA 4R1QA 2Q2QA 2V4ZA 2CBXA 5DW3A 1VI5A 4GXRA 5BR7A 3RNOA 5KDOA 4RJTA 3D3JA 5AKZA 1GQFA 3H3FA 3WRYA 1R5NA 2YVUA 5BUZA 4W7IA 2PUDA 4H6XA 4S1PA 1TLFA 1ZOOA 1CR2A 2BGMA 3ANMA 1XA0A 2R96A 4XB6B 1T9CA 3AOEA 1GGFA 3EVZA 3T9FA 1G9XA 4CM6A 4B7XA 1QTNA 2FWNA 4HLUC 4TXNA 3V4LA 5K0ZA 4FB4A 1APBA 4K3VA 1RWBA 2XMZA 3DOIA 1DFHA 3C6XA 4LGVA 4MUIA 2HMYB 1Y4AE 1FDIA 4UZFA 1NUHA 1OC4A 4V2IA 4RQAA 4MS3A 5HZMA 1N7IA 2QROA 3J80A 1Q74A 3RUDA 3OE5A 3ESAA 1Q1ZA 4GL4A 3CWCA 2QAGA 2B1GA 3E46A 3NYWA 5B36A 3Q7RA 3GYGA 2PJRA 4GSLA 3R75A 5FULA 2FTKE 1ZVJA 2ZUCA 5IBRA 3L7JA 1W25A 2QYOA 1LQTA 1J39A 5KPZA 3SLKA 2QN1A 3CR3C 4BOYA 3RRNA 3RS3A 3CUTA 1TC1A 4ZFNA 3LQYA 2PZKA 3L1IA 1E5QA 2AKAB 2JWSA 4LF7M 4NPAA 5HTKA 4QUHA 1W87A 1E1DA 3MSXA 4XVQA 4E3ZA 2V59A 5COQA 4XW2A 5K3OA 5H7XA 3FBWA 2PGJA 2FPIB 3DB1A 1VE7A 2X40A 3FAKA 2DB3A 1TD9A 2AKYA 4GNRA 1KY5A 3K9CA 4YI3A 2B5WA 3CZ5A 3LK7A 2YQ4A 1L1ZA 2H2HA 1YC5A 4GT1A 2VNJA 3QKTA 3B9QA 1T6XA 3DV9A 4R8VA 5ECGC 1HNZM 2BFOA 1IUKA 1SIWA 4C7VA 5EGSA 2PSEA 4URUR 3CN9A 4M88A 3QG1A 1RRVA 4A3SA 2G83A 5HOEA 3VSBA 1K8YB 4L74A 4CMIB 4CMGA 2GQFA 1VXRA 4MI3A 1W75A 3E1SA 4NFSA 5EE0A 1P0PA 5BN1A 3DJFA 3F67A 2ECQA 3W8EA 4LJLA 1JDBB 2XNHA 1ZK2A 4ZAWA 4TRMA 2O1XA 1KDZA 3AL2A 4MQFB 1FFXB 3T1HM 4C0XA 5H59A 2WB2A 3RVJA 3H99A 3B7GA 1KQNA 3DDOA 3P19A 2HC9A 5GPBA 4Y6OA 3GEIA 3SC3A 4B5LA 1HYEA 3LT1A 3EWSA 3R9XB 3NV9A 4PVCA 4S04A 1E64A 3SOPA 3W5JA 3ODGA 4E09A 2PZBA 2VWPA 1NVEA 4S1TA 3U39A 4CDGA 3TNLA 3K96A 3CZRA 4YP0A 1PNVA 1NV8A 3I1YA 4BMSA 3PNKA 3FMPB 2H1CA 1Z5UA 1L8QA 1MNQA 1AHPA 1CY0A 2PPVA 4UDOA 2PX0A 1P0CA 2ZREA 1QORA 2J1LA 3GGGA 2OO5C 4RMGA 2XQKA 1UIMA 4NE7A 1KVUA 4HXFB 2AMLA 1KEZA 2FX5A 3JQRA 1NNI1 1LZLA 2ECPA 1L4EA 3DFIA 3LDAA 1UBUS 4NU8X 5IN5A 4EB6A 1Y4UA 4L0QA 4RFLA 2BFDA 3GA0A 3IESA 3W2IA 1G8AA 3A45A 4C9BA 1MJFA 5KYVA 4W9MC 4X61A 4JOQA 2K47A 2NV0A 3PTZA 3QE0A 4YAUA 5EUCA 3AH8A 2MINA 4TWIA 5EJ4A 5HQJA 3EPHA 4PO8A 4C5AA 1R27A 1CYEA 4DSZA 2DM6A 4UNQA 2YJGA 1NVFA 4BHTA 4XWWA 1XF9A 2Q0QA 1CEEA 1U8TA 2HRZA 2RAUA 4CE6A 1F2TB 2LVBA 3CPHA 1C3OA 3HXOA 2RGDA 3H1BA 4K6OA 4LFBB 4L4XA 5G1OA 4O4IF 3ZE2B 1T9ZA 4CN8A 4OX9B 5IULC 2P7HA 4KRYA 1ISHA 1K4YA 3OTOB 3HZRA 5DSTA 3TYXA 1GL6A 2QNBA 3F8TA 3OOJA 4JKIA 4TWAA 4NYMR 1YE3A 2CNOA 3UYLA 4QNNA 2NG1A 3GP5A 2OV2A 3IHLA 4G86A 4ZQFA 4G07A 2EKQA 3MTJA 2BZGA 4ALIA 5AIBA 4E21A 2DHEA 4R1OA 3DEKA 1BEZA 4TLCA 4JLDA 4RJ2A 4WY5A 5B58T 1FX0B 1JXQA 1MW8X 1KDRA 3KJGA 3H9BA 4FR5A 4XIJA 1Y1QA 3IQFA 3ER6A 4DV1M 3KNZA 1W52X 1NFQA 1XZHA 5GJVC 2QG9A 2PEYA 5KDDA 2YY5A 3O47A 3BJZA 2YWXA 5HM8A 1KFVA 1OE0A 2N1BA 5C1PA 4NDAA 1XMQM 5F5XA 2WT8A 4NTZA 4MS3B 2R6JA 4MB0A 4TSFA 5TDHA 1T9HA 4YMLA 4BGVA 2XVYA 2P2YA 2AD1A 3AFMA 3D6NB 2QAGB 4I1RA 4MZDA 3VH1A 1JXOA 1ZFNA 1SZDA 1JG6A 4EDHA 2XIJA 5D87A 2RGWA 3TOVA 2O7VA 3MWJA 3M9WA 3V4RA 4QXQA 1ZOLA 5IM4F 1ZRSA 3FB4A 1NT2A 3VSDA 2QKYA 3TE7A 1TJ5A 3BE8A 3CUEF 1RAHA 5AVTA 1W5EA 2QN2A 5CPFA 1YS2X 1UJ4A 4QYXA 4ARUA 4DLRA 3GUHA 4JXJA 1XX6A 4DWOA 3KT6A 1F3OA 2XWBF 4MV0A 3L0CA 1BO6A 4MCJA 3D4PA 3AM1A 3WP1B 3UJ6A 5SYNA 5KNDD 4CLXA 1VECA 2WT9A 4Y6LA 3H5VA 4PHTA 1Z0JA 3A37A 2XCQA 4GRAA 3TGPA 1MR3F 1XZMA 3O2QB 2W71A 2B1IA 3GPBA 3Q3HA 3JQGA 2RHDA 4IDAA 5FD8A 2FZCA 1H0KA 3HDJA 5GONF 5IK2A 3P9NA 2REQB 1CU1A 5JS8A 3R3JA 1XKQA 1IWBB 5I4BA 4KQIA 4N3AA 1WCIA 4HXYA 5KQMA 2CLOB 5IF3A 5JARA 4R83A 1QRAA 4AXXA 1VJRA 4G4JA 4P3XA 1NW6A 5AVYA 4ZQHA 3RSFA 5HS4A 2A7QA 4ZOEA 4OKNA 1K2WA 2V8BA 1EGHA 2IW3A 3WNZA 3UM9A 1Z4LA 4CIBA 2NO7A 3P0IA 2HB6A 2B8NA 1NM5C 3HBLA 2H4WA 2WUGA 4F1IA 1VI6A 1L5HA 3GJ0A 3OI7A 5DJ5A 5KOHA 4IDBA 3D6FA 3ZHTA 3PNLA 3HABA 3OQ6A 3UFXA 4LXTA 2I67A 1ZO8A 4EI9A 3P2MA 3H5AA 4PC3A 4RPJA 1UJMA 1ECFA 3CWQA 5L45A 5DX1A 2Q41A 4OJKA 5IPFA 2BL4A 5J2TA 1MAVA 5ALLA 4ARSA 5KWIA 2Y2VA 5KQRA 3NUZA 3DLHA 4JENA 3BDAA 1YJQA 3ELWA 1FDWA 1Q57A 2C31A 3NRJA 4B81A 5LJIA 1LK5A 4LF5B 4L3VA 3AR2A 1CUJA 3L6RA 4BCDA 1DV1A 3RLFA 5JD6A 4Z4CA 4EB8A 1AQNA 4ND3A 2A9KA 4A3VB 4EB6B 1MABA 2GD0A 1Y48E 3IUJA 2BFDB 3AF2A 3DDHA 2YHAA 1SB9A 2HHLA 1J7KA 4RMHA 3BXPA 4WV3A 1YXMA 2MINB 1NW5A 4QQFA 3BB1A 1VL0A 3NBMA 3BSSA 1L5FA 4YY3B 2FHPA 3OPYI 2ZAIA 3ZI4A 2MSEB 1GN9A 1FQJA 3AONB 2QTVA 1DPGA 2I3ZA 4FUTA 4WA7A 4G1CA 1C3OB 3IEPA 4IHJF 3M3HA 2PLAA 4HR7A 4F6CA 3F8SA 5GJBA 5ADUS 5BQXA 4G5RA 2VAVA 1MAHA 5HBRA 1D03A 2JKVA 2ZETA 2N1MA 1S8FA 4L0DA 3E4RA 4M0FA 1XMQB 4NSRA 4G9GA 1GRCA 1ZNQO 1L6IA 1BMQA 4C22A 3TLMA 3WLNA 1B93A 2BJVA 1T26A 1U65A 1X94A 4TM8A 2XECA 4EVIA 3EIHA 2PRZA 4N3NA 1P5FA 1E6UA 4FE4A 5LA6A 1ML3A 2VOJA 3QKRA 1XJ0A 2YOGA 2WHQA 3HM9A 4BIIA 1QB8A 2QT1A 5G3YA 3JW8A 4I5FA 3DQZA 2D5IA 3MJCA 3B2EA 2G9QA 4HAXA 1O96B 4EDFA 2C9DA 2H51A 4D0GA 4UM7A 2WAYA 3LX4A 3Q6NA 3CJRA 4UN2B 4Q16A 3WXBA 1ABBA 1PZXA 3BCRA 4CQLA 4HD8A 2RGXA 3WNVA 2ZXEA 1CULC 5H4GA 4WECA 3R9IA 4TGLA 4PO3X 1IJBA 1XDUA 3M4YA 1WMSA 4TMTA 4FYPA 5LPNA 3B6MA 1JU3A 2O14A 5AHOA 3KB1A 2HLDD 1J0DA 1Q11A 1PJJA 2A1UA 2FUKA 5JSZB 3K16A 3EDYA 1YE5A 4P0QB 2O01F 1M10A 3SAUA 2OHJA 2O20A 5CJJA 3NXKA 2HWWA 3JD3A 2HUPA 3KXPA 1DJMA 4RESA 4JI7B 3QYFA 4PU0A 2OBMA 3W8DA 3KETA 3SQWA 2C7RA 1R64A 1A71A 3HUFA 3DFUA 4J94A 2Z3WA 4C06A 4P81A 4D25A 3ZIUA 1PKEA 2YJ5A 1RXSA 4XDZA 1QUEA 3LQ2A 3JQGB 1UZNA 3SSOA 4I99A 3DC2A 2B2NA 4DCGA 1P6QA 2W0MA 1U11A 3ROXA 3SHQA 1QNFA 4RDXA 1NX9A 1NWCA 1TRKA 1WCIB 4DV3M 1D7OA 3HCAA 1D04A 1HA3A 1XYYA 1R2ZA 4YRAA 3CLTC 4EOGA 2ZE5A 5T3YA 1TW2A 2H29A 2NWQA 5E4JA 2X41A 2LNDA 3ZHQA 3H8SA 4JELA 3BH6A 5KJ1A 4JYMA 1C7EA 1OZHA 1HE3A 1IEVA 5JIBA 2JFUA 4CKZA 4JB0A 3BVPA 1QPGA 2QXUA 5HCNA 4EBBA 4HBGA 1C7QA 2J09A 1G4AE 2OB1A 3ZV6A 3ETCA 4F1KA 4LWQA 1L5HB 5KOHB 3S2ZA 2BSAA 2VSNA 3AK4A 1D6SA 1E9AA 3DAOA 5BUCA 1Z5WA 1AK9A 2G3YA 4XZ3A 3DNFA 4OJMX 3H2GA 2VBCA 4JSRA 1YL5A 3UQZA 3DULA 2IZ5A 2VYND 4UOQA 3W3AH 3E8XA 4NX2A 3T4XA 5J2TB 3K5PA 1EHCA 2JGRA 1ZONA 1H1TA 3BYZA 3TDMA 3SCZA 1XN1A 4HVCA 3QX9A 4G0PA 1UOOA 1NHWA 2X8BA 5FHRA 3O4JA 4AG3A 4AULA 1PE0A 3PE3A 3TPCA 5JYBA 3SX0A 4M1YA 2EX1A 3RFUA 3L6DA 1QJ4A 4HNAA 1YBAA 3LY8A 3VZCA 3BERA 4FXOA 1DC7A 1YRAA 5CYGA 5A5VA 1SB8A 5B1IA 1FQWA 1XZBA 3IEVA 4Q12A 5KNDH 1I4DD 1IVSA 2J3KA 1WZCA 2G7ZA 3DEIA 3FLEA 3R3SA 4MGEA 3FHJA 4UUOA 3THOA 2ZYRA 4L3OA 4XCXA 3HXKA 2GN2A 1YMQA 5B6PA 1E2QA 4IBBA 1RWMA 4XUEA 3RT1A 2P4EA 2QTVB 4C1NA 1UKEA 1XEWX 3RIEA 2DP4E 3USCS 4MM3B 1Z2DA 5HKBA 4MQUA 3NGLA 5AFSA 1U9IC 3BK1A 2Z5GA 3A9CA 2IYUA 1MB9A 1C9EA 1Z7YA 1JH9A 2P9JA 4B3GA 4EJFA 1Z8FA 1KMMA 2PBLA 2Q2WA 3TOZA 4K9LA 4DDHA 3GDGA 3WKDA 4F7DA 1YDEA 1GT6A 2XADA 3O7WA 4LX8A 2YJ3A 2QTNA 5BRJA 1U02A 1WABA 2AFVA 3ZJYA 4CR7A 1IY8A 2YYYA 5LA6B 3CXUA 1GZSA 3T1NA 4P4GA 1YE9A 4CIZA 2ZWAA 1E6KA 5H9VA 2BR4A 1G3MA 1FLVA 4LFCM 2DFLA 4QPCA 1IQRA 1UJ6A 5IKXA 2DCMA 1P4GA 2YUIA 5DT2A 4DR2B 1N2SA 3K9PA 2BTOA 5KTPA 5JEDA 2A0WA 4LHYA 3P2IA 4DGQA 3HVKA 4LV5B 4IHAA 5DI9A 4O8CA 2KDLA 3KQPA 4EB0A 2AOTA 3IIIA 2AFIA 2GFIA 2HBZA 4DR1M 1BGXT 3CX8A 4KR9A 3FGOA 4CNBA 2WHXA 1V71A 5EQFA 2QN7A 4M1WA 4QJ3A 3Q8WA 2GASA 2YXBA 4IILA 4RFSA 2E1PA 3T0FA 3ZY4A 1UKVY 3HPQA 1Z16A 3UXEA 1LNZA 1WA5A 1QBKC 5ERXA 2H08A 2VF5X 2JD2A 5ECWA 2XJ9A 5HQ3A 4GPIB 3TEJA 4DREA 4RJLA 4QXRA 4F97A 1A5BB 3DA8A 2DWPA 1YS6A 1KMIY 2AXNA 4I1PA 3UGTA 5K3BA 1H2YA 4GYKA 3SQLA 1S02A 1NNSA 1KKUA 5ALSA 4YUXA 1GFIA 1XI2A 2G25A 2QNIA 3QP9A 4G3XA 1D4AA 1FYWA 3RJ9A 3CQ9A 3MJEA 5JNVA 5CB4F 1DXHA 3F97A 1WUYA 2G1JA 3SQOA 4PQEA 4JASB 3EVNA 3FR8A 3RVKA 4JUDX 4GBGA 1QUTA 1X1DA 2YN2A 3HCPA 1RBYA 1A7UA 3KHSA 3H2JA 3GBVA 4NZ9A 2DG2A 4KBGA 1WXIA 1ULHA 1FNMA 3PVCA 1O94C 3STHA 1X80A 3FDXA 2W2XA 2YYSA 4BE7B 3BGIA 3TLJA 2D4AA 3OE4A 3IIEA 4IJMA 1N6PA 3O3MB 4I14A 3OZUA 3S7ZA 1A8QA 3INRA 3UJBA 5LD2C 1JXAA 3IURA 5J5VA 3I9V6 4HX2A 4RBNA 2GA9A 3WBFA 4ZZ3A 2P77A 4ZHQA 4I5DA 3IXLA 2FF5A 1MX1A 1QYDA 2X5XA 3BDVA 4HWSA 2VXBA 5HIMA 4O2BA 3WLJA 5EKXA 4FN4A 3S2GA 4DDKA 4XUCA 1VBMA 1NHGC 1OA1A 1ITZA 3FMVA 2BLLA 1I13A 3GVXA 4UVHA 3E35A 4HB4A 3GZTB 3IKJA 1SKQA 4MV7A 3DJYA 3W1WA 4CLRA 5ALTA 3DMHA 1DBRA 5I9BA 3A6PC 3AGPA 2R1UA 1O5OA 1IDN1 1ECJA 2C96A 1T6ZA 4HNAB 3NCHA 2CHGA 4BLSA 1ZUIA 1OTRA 3ETGA 3AJEA 2H48A 2JXNA 2W4QA 3P9KA 1S8AA 3I05A 1NXOA 4MUJA 4J3JA 3LCUA 3WYGA 3A6HA 3RS7A 4C07A 4N8SA 2Q1YA 3SWWA 1YCHA 3MF4A 3GNLA 3NUQA 1UFQA 1ZM9A 3KCQA 3L46A 4IEEA 4C88A 2ZBGA 1T0HB 4BC0A 1M33A 4WH0A 2ZIXA 3PFWO 1W581 4GM4A 2K6BA 2RJ3A 1KEWA 2XUKA 5GY7A 3UFBA 1PL7A 4OM7A 2G8NA 3V00A 2X0DA 1ECPA 4K9KA 1Q6YA 4A92A 3RWMB 1Z5NA 5CDSA 1YS1X 4UOZA 1R5JA 13PKA 1DIOB 1GILA 2J9XB 1E7QA 1ZXLA 5J3JA 4LFCB 2GXUA 2HMAA 2HW8A 1I4OA 4M1QA 4HH1A 4PLCA 3DE2X 3IA7A 1Z88A 2YY7A 5CM8B 3LWNA 4IZOA 2HREA 1M2KA 4NECA 3A9VA 4U3JB 2JG3A 2PFGA 4RNAA 1S2MA 4EHJA 1T9DA 2VQSA 3N3AC 1QMGA 2QDXA 3GLFA 2QLTA 3X2FA 1OXUA 1QHGA 2R0IA 2ZPUA 1F2VA 3EY4A 2H5EA 2JFBA 1SBCA 4GOOD 2JCSA 3ZE1B 3U3OA 4C7JA 1T91A 4IIJA 3PGA1 5DBHX 1SXJA 1RZUA 2VO1A 4JR1A 1T4DA 1HZJA 3EGDA 2WF8A 3D7SA 4G09A 1KZ7B 5EXSA 5DGIA 2V1CA 3FD9A 2AOTB 1E7RA 1KSGA 5FWNA 2Q6TA 2AFIB 5H70A 1YZNA 4FR0A 1JHMA 5HKKD 2ZI7A 3E61A 1Y6ZA 4ZDKA 2HYDA 2Q21A 3M1IA 3FNHA 4QUGA 4PXAA 3U48A 4B85A 3QVOA 3A0RB 3CNLA 4G4IA 3QOYA 2O54A 2A5FA 2G04A 1C2TA 3E21A 1X38A 1WW2A 3WLSA 3OFND 4N03A 2J3LA 1JLMA 3AESB 2I4NA 3FHTA 2C2HA 4ONEA 1AG9A 5HQ3B 3KVVA 1EFDN 2J5QA 1PNTA 2OZVA 3K05A 4JJ4A 1XNRM 1NZFA 2GARA 1PR9A 3S8EA 7ADHA 4KLRA 1EFPB 3QWIA 2V8OA 4DEVA 3H2HA 3K1YA 3TPFA 1Z6TA 4EJ6A 5E9JA 4C0LA 1N3LA 4XGQA 2O2XA 1ZUNA 1JWBB 3L3BA 4DDTA 1DCFA 1ECCA 2ONYA 1Y5RA 5COBA 2CB0A 2WKRA 4AD8A 5JDIC 1GGJA 2DZNB 4YUAA 4BVKA 1X37A 4PYOA 1L2TA 1FYVA 2WU0A 3C4QA 1URPA 4JZYA 3GG2A 2Q6IA 4R2XA 2P75A 1QE0A 2I4TA 1JHRA 3TZCA 1ZK3A 3NYQA 3SARA 3P2EA 1BE0A 1HPLA 4F86A 3INNA 4UBMA 1NU8A 1TM4E 3QA9A 3PPWA 3HP1A 2DHCA 4GEKA 4ZHQB 1S9DA 5DGCA 4GH9A 2YJTD 1Z7WA 4XCVA 2AFIE 3DQQA 5LXTB 1B43A 1G38A 1HDRA 1OLXA 4EZIA 1DEKA 4G5XA 4O2BB 1RBZA 1K3XA 1YB4A 3VO8A 4BX9A 5CVJA 4MWOA 3PRKE 2NOAA 1Z15A 4DXDA 4Q34A 4WASA 3IOBA 2ORED 4DC0A 5L3SA 4US0R 4DQXA 2QLJA 2QX6A 3TD2A 2LR0A 3R3YA 3WGLA 4ECEA 1GQQA 3LT0A 3KKMA 4XYGA 4CLRB 4UNPA 4WFKA 3SEZA 1RPZA 4FWTA 2B4QA 3ZCSA 5HXAA 1P3QQ 2AG1A 2EHDA 1CR6A 2IDKA 1H3EA 1XDBA 2JB9A 2WTEA 4UMFA 4RAQA 4ZA2A 1IXSA 4BO2A 3B9PA 4QLOA 2W9XA 4YCCA 2WSIA 4ZQIA 4NATA 1G64A 1XD9A 4RIIA 4N5MA 1VLZA 2DFNA 4DV2B 1NF9A 3HJAA 3TX2A 5IANA 3B1JA 1QKJA 1Y8AA 3QTLA 3N5KA 1U0OC 1PUIA 2Q62A 4C7OA 1Z6YA 4ARVA 2DBRA 3HI4A 4DMGA 1D5WA 3PSHA 5EMJA 4QJ4A 4GRIA 3H8JA 2ZKIA 3ZU6A 5FH9A 3MC1A 2VPTA 4LIPD 4FGWA 1EXVA 4H7PA 5ARDA 2P5YA 1M1NA 3RFXA 2FW8A 4PC1A 4HAIA 1KVQA 1ZVQA 2IXTA 3TTUA 3N2NA 1HFKA 2E85A 3GD5A 2EZUA 5GZ1A 1VOTA 4GMDA 3OJ0A 1LLFA 4Y2QA 5LNK1 2VG8A 2RG1A 1W76A 3KYJB 1G8GA 2XIQA 2C5RA 1ACJA 2OHGA 3O92A 4DXAA 3GLFB 3WWPA 3LIIA 1LDYA 3GO4A 4ZAZA 3Q9LA 1GG5A 3RTDA 2O8CA 2GZDA 1PGNA 3JAWA 2ZJ7A 4G41A 3MW8A 5LCXA 4NQRA 1T8UA 1ZW6A 5JAHA 3HJTA 4O2AF 3EZ9A 2C5EA 2I55A 4KYIB 2EFEB 4IIJB 2RC5A 1RTTA 5EE9A 4G97A 1E9FA 1SXJB 4C7MA 4B8ZA 2JJYA 1UKBA 3VTFA 1HE8B 3GGSA 3MSCA 3M6MD 4AXBA 4I1IA 3WB1A 4B71A 4Q5IA 2R46A 2EKDA 1MVLA 4Q1FA 2XF2A 3ZH2A 2AD5A 5A3QA 5ULLA 5AVSA 2O48X 4ND7A 4J0DA 2JFXA 1U8AA 2YX1A 3VDPA 3CVYA 2G88A 1M8PA 3RFFA 3C8HA 5DT9A 1LI7A 5KAPA 5K3AA 5BMVF 4N1AA 3V7NA 4JD5A 3HS3A 3PR2B 2C83A 1XKXA 4MQMA 3KEQA 3NJRA 3EIXA 1CJMA 4AY6A 1L3BA 4DNXA 3CBGA 3E15A 1X19A 3LUFA 3JPYA 4MA0A 1TXGA 4EA7A 5HP4A 2JIOA 4FWIB 3CJQA 1QB7A 4RETA 2C4UA 2UXBB 3DV0B 1VIVA 4M0DA 1OA0A 2C7PA 4H4EA 4HDCA 3GQBB 1AUOA 1ZUNB 1DJOA 3GLFE 3BCHA 3BKWA 4KQJA 1QIJA 4RVGA 3DMTA 2J3EA 4QFMA 4S0XA 3UXYA 1BTOA 2XAAA 5IAOA 4MO2A 4DWWA 1H23A 2X1VA 3SSAA 1BX1A 3WLTA 2EWVA 2QQ0A 2P7IA 2P9EA 1OYWA 4AO6A 4RF0A 4G2NA 5FOQA 1LH0A 1SXJE 4M76B 5AJHA 3EEOA 4ZPXA 1GPMA 2PNFA 3H5OA 4NH0A 1WX1A 1QFSA 3Q40A 1KH3A 3BTOA 1ZMWA 4LZWA 3UKJA 2OFFA 4E07A 2GVZC 3WLEA 4IIBA 2ODNA 1OLXB 1FUYB 4N7BA 4YASA 2BZ1A 2DKFA 3B6ZA 2NO0A 4BMDA 2XOEA 3TR0A 3QWLA 3L8MA 3EXIB 3A6LA 3S5UA 3TTXA 4EY8A 4TOIA 2KYRA 4KSYA 3T9DA 3SSMA 3TIXB 4RL6A 5L3SB 3RK4A 5DHUA 1XNQB 3LYHA 4TRRA 2B0JA 1D2NA 2IZOA 1R6XA 4OHPA 1BS2A 3ON5A 4RDCA 4DMRA 4RK0A 4JLNA 1NG9A 4DLNA 4RM2A 4JI5B 1IOWA 4DDWA 3FAZA 2C7QA 4MPPA 4AAYA 1QGZA 3Q0EA 2WD7B 2XRYA 3RRXA 2W98A 2NTYC 4C4TA 1VG5A 5EJ8A 4B2LA 1ELOA 1AD2A 1L1RA 5K6AC 2PRJA 4RJJA 5A7GA 4YQZA 3OHMA 5G0WA 2CLIB 1RAFA 2MDTA 5I47A 3TI7A 2YUTA 3A70A 4CETA 3T35A 1IXSB 1V92A 2I2AA 3ET5A 5ICCA 4OB6A 3TMAA 1MIOA 4LKOA 2VK2A 4BB5A 4YI5A 2HLHA 2EEZA 2NUPA 1Z4PX 1E89A 1EESA 1PZFA 4F4DA 5HJEA 4C2BA 2WSYB 2FWBA 1UANA 1I3NA 4MYSA 4F04A 1D9ZA 1THTA 1BXKA 3ZZNA 1TVKA 2ID8A 2NZYA 3L2OB 3NNNA 4ETWA 1TW3A 1WCXA 3HB9A 4HYYA 3M1YA 1TK9A 1IDOA 1OW3B 4IUBS 2IBTA 3ZWOA 1E69A 1Q3HA 3WV4A 1QZMA 2ODQA 3GGCA 1RW4A 1TAUA 1V1JA 3ZI0A 3STYA 5F4ZA 1GGVA 4LZPA 4CM9A 4OK3A 1G8JA 5IXSA 3AEUA 3GA7A 1M1NB 2OY0A 4EG1A 2BMFA 3WMRA 4ETMA 1OAOC 3KM0A 2F64A 2F9MA 4LSMA 1XAJA 4HADA 3IUBA 4DNQA 1ZUD1 4L6V6 1UJCA 1S2GA 3MUNA 2VQEM 3AUFA 2XCOA 1UBTS 2W2OA 2GHTA 1SQSA 3Q3GE 2AUMA 1M0TA 3PJEA 1Z33A 3M9LA 5FF9A 4CLEA 3CTMA 4Z9FA 4LNUA 4IIXA 1RTKA 3NTQA 3D6VA 1WPGA 2O8CB 2XBUA 3LDGA 3JAWB 4HPXB 1SVKA 4BX2A 1G4UR 5CDYA 5MGNA 1OD6A 3M1LA 1JP7A 4RABA 2LVOC 2QTLA 4JR0A 4GYWA 5CT4A 3PUJA 1P91A 4LUCA 4HQRA 1E0AA 4WXRA 1OYOA 4N8EA 3GW8A 5BMOA 1W2WB 3PITA 1FX0A 3Q6MA 3M0EA 2R79A 3ACBA 1GEEA 3RGPA 4LFBM 3H87A 1EFUA 4AG6A 2BBWA 1EFCA 3CVXA 2GZHA 2GLTA 4OX9M 4Q9LA 4BJ5A 1VIAA 1UQUA 2G80A 3LUBA 1QVZA 3RQIA 3OTOM 4OCZA 5B1DA 2E7ZA 2IF2A 1RJFA 4MAFA 3GVCA 3B9BA 1SBTA 1SHLA 3ST7A 2ETVA 1KZYC 3B2NA 4MVJA 1OYVA 4I8IA 4BWGA 2O25A 1HKHA 2BMJA 3GK3A 5CHYA 4ZAFA 1TA4A 1JLKA 3X1MA 5A0TA 1BVHA 1T2NA 3ZXYA 4LJ6A 1FF9A 1U5BA 2XMPA 3DWGA 4OKSA 4C3VA 2UDPA 3I1JA 4RELA 4GUAA 3QVJA 4C30A 4F2DA 2UUCB 3FTQA 5E8JA 2I8CA 1QIHA 1YH3A 4LQ4A 2FP4B 2WYIA 1LB1B 1YS4A 3VXKA 3JYOA 4LPSA 2X5NA 5L7YA 3I3SR 2DCUA 2BEUA 3QW4B 1RYNA 1WXXA 1XTZA 2NO4A 4ISCA 4R84A 5E4YA 3HSYA 2IYSA 5CITA 4M8SA 4LOIA 1QVWA 1XKTA 1G7SA 3OURA 4LQLA 4NF2A 4P93A 4XSVA 2W2KA 2ZR7A 1YHZA 4LVNA 3B82A 2EP5A 2QQFA