1GVNA

Crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSILON
publication title Crystal Structure of the Plasmid Maintenance System Epsilon /Zeta : Functional Mechanism of Toxin Zeta and Inactivation by Epsilon 2 Zeta 2 Complex Formation
pubmed doi rcsb
molecule tags Postsegregational killing system
total genus 35
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1gvnA00
3Q8XA 1GVNA 2P5TA
chains in the Genus database with same CATH superfamily
5L8RF 1Z5AA 2XFSA 4IBJA 3TE6A 3ZH9B 4KO8A 4IJFA 5ITUA 3RE8A 4JI0M 4D81A 1QAQA 2QSFX 2MR9A 1NHWC 2JA2A 2R46A 5C1BA 3LQQA 2CUZA 3GPUA 2R45A 2EA0A 4B7HA 4DR3M 4CGYB 4PCZA 1WGLA 1I94M 1VQ1A 1IBKM 2FOIC 1MN3A 4NSRA 1XC8A 1SXJD 3IG5A 2LHCA 3SYLA 4HL4A 2CV2A 3LVWA 4NOOB 4G4NA 4IBFA 3GLIA 4ITQA 4I4LA 1IY0A 3RGSA 2EUCA 4B7FA 2KHHA 2QZ4A 2DHYA 1YSYA 2QQ8A 5KQDA 3KFUG 1ZMUA 2FE8A 3TWLA 4GHLA 4WURA 3FTEA 5EXXA 3TPZA 4DR2M 4LF8M 1NY5A 3HHYA 2KW0A 1IN5A 4LGMA 1ZV1A 4QOZC 1ZMWA 1N75A 3MK6A 1R6BX 3B7QA 3T1HM 4JI7M 1JR3D 1HNWM 2Z7JA 3CF0A 1X37A 2N35A 4M9SA 2XSZD 4Z8XA 2C5RA 1OAOC 5IREB 4DR4M 5IZ7D 2J5YA 3M6AA 2XZUA 4DV3M 2FH0A 4AKIA 1L2BA 1OIPA 2P5TA 4JI4M 4HEOA 1WHCA 1SXJE 2CRUA 4AG6A 2F5OA 2C9OA 2XH9A 1I4WA 2XEPA 3KOXE 1IM2A 2CP8A 3AJIB 4S12A 1T3TA 5ITRA 5LMNM 2HWJA 4FCWA 3PFIA 4G3OA 5FTLA 3FUUA 1NY6A 4IBEA 1VEGA 4GITA 4I5SA 1HQYE 3SARA 3U6PA 4Q7JA 2KRKA 4TUWA 2QBYB 2HKJA 3GO8A 5KQ8A 2Z4SA 3UMMA 4IBKA 2DZNB 2X8AA 3HJ8A 2QPAA 1VEKA 2MROB 3QWLA 1ORYB 4GC9A 2VQEM 1HJPA 1N36M 2LVNC 3FUTA 3GP1A 1JB0F 1MJGM 4AG5A 1HQCA 3W68A 1HR0M 4FCTA 1FNNA 3T6PA 1L1ZA 2HCBA 4K0KM 4LF5M 2WZJA 4IIWA 3THGA 1QAOA 1N33M 2DZLA 1C1KA 3I51A 2QP9X 4F2LA 2F5SA 1NO1A 3FTFA 3DA1A 5KPRA 1L2CA 5EJCA 5DFLA 1DGGA 3JR4A 4GRIA 2F5PA 2I7NA 3A45A 3J80S 2WSEF 5ITTA 1Q3BA 2LHGA 4DV6M 4REZA 1IN4A 1D2NA 3L29A 2G5GX 2JWSA 3GRVA 2C99A 3SBJA 3R9XB 3GPYA 2I7PA 3GQ5A 3MMPA 2LWXA 4FWHA 4YY3M 2Z8YM 2C96A 3AOEC 3M0EA 8CATA 1WIVA 1PGYA 1Z5CA 2X4AA 2YFQA 4OW0A 4UN2B 2M5ZA 4AKGA 4F1IA 1DV0A 2A5YB 1W5TA 1G59A 2DI0A 1L8QA 1LV7A 4FW9A 3VFDA 4M9ZA 4LF4M 1ZMVA 2QHOB 1T43A 1XB2B 2OOBA 1IBLM 2R6FA 3GPPA 2KEBA 2RGHA 4M9XA 5C18A 1OTRA 2H5XA 3HJQA 5ITXE 3L27A 3U5ZA 4YHHM 5ITYA 3PNYA 2EO2A 2J7NA 1DO0A 1PJJA 1NVMA 4BBAA 3GLFA 4GKJM 4M0DA 4M0WA 1TDHA 4DV1M 4RF0A 4GH9A 3VK7A 5KO3A 3AKZA 3GQ3A 3SAVA 3DZDA 5H37D 2JY5A 3VK8A 4JI6M 5E26A 3U6OA 1XXHA 2KDLA 2R18A 2R4EA 3AL0C 3SFZA 4ANRA 1AIPC 3GLHB 2F5QA 2L2DA 5KPZA 4LJ5A 2Y20A 2ZTCA 1KYIA 2HAKA 1QDRA 2O25A 4OVZB 3BBZA 4RKUF 2CV1A 2BJVA 2YR0A 4OX9M 1ZAEA 2Y0QA 1XWIA 4B3RM 2DENA 4PD2A 3A46A 2WSFF 1Z5BA 2ZAMA 1R5LA 3B74A 3LCUA 1OQYA 4G4RA 2CE7A 1Y8GA 3NWLA 3MHVC 4L8RC 5BR8M 2EKFA 4LZJA 2XFTA 3HY5A 3F92A 1QQWA 3H4JA 3PXGA 1GLNA 4XGIA 1SXJB 2VF8A 2J7OA 5EXTA 5KPTA 1G41A 3AV0A 3FYDA 4Y28F 1T6OA 4R3DA 4NRVA 3T15A 4PDIA 4QHSA 2XLJA 4XBOA 2DXIA 3KXEC 2NQ8C 1N32M 2CHVA 5FTMA 1NHGC 1QANA 1VEJA 2OPFA 1CUKA 3HKPA 2UUBM 3A98B 1NV8A 5IWAM 3KSXA 1J09A 3D8BA 1R2ZA 3SYKA 1K3XA 1IFYA 4GMQA 4L16A 4P17A 2CHGA 3UK6A 3U61A 4X65M 2L6OA 1GJTA 3FRIA 3PNVA 3W67A 1R4GA 2L4EA 4DR7M 3GLHE 4QHTA 1D0LA 2KNVA 3JR5A 1DGHB 2O5RA 4W5WA 1IXRC 5IT9S 1Z59A 3QYBA 3LMMA 4DV2M 1SG9A 1PM5A 3SASA 2R4JA 1QUSA 3CGWA 3J81S 2L7HA 4B7GA 4EIWA 4GHAA 2LVAA 1PJIA 5EP1A 5ITQA 4B3SM 1D0KA 1S3SA 4IJEA 4LRSA 4JYAM 2C9CA 2X49A 3SC3A 3HWSA 4XK8F 4DUZM 1VDDA 2C98A 3J2PB 5JI3E 3D8LA 3VDUA 5BPVA 1IN6A 2QENA 4L78A 3GLGE 4HLQA 3GRUA 4X66M 1V33A 4B08A 5GKNA 3FTDA 2OOAA 3ZCBB 2JZ0A 3J7BA 4NXNM 1WXQA 2ERCA 3T38A 4X62M 2D7GA 2L7IA 4OU7A 1EE8A 2OO9A 3I04M 3HGIA 5EP3A 2LTUA 4DR5M 2JY7A 3M7GA 1L2DA 1MX0A 1NSFA 4Z6YA 1XMOM 1TH4A 1K3WA 2DHRA 3KSJA 2CV0A 4II7A 2BNKA 3KOWE 1JR3E 3UGJA 2UXCM 3FD9A 3C3EA 4FVMA 3RGPA 4NL4H 2GNOA 4MGYE 2RGOA 2HHHM 1IXSA 1V92A 4MH0E 3AOGA 1IXZA 3FUVA 3SAWA 2DZOB 2JY8A 1NNJA 7CATA 2JUJA 3GLIB 1WR1B 1H6UA 3KDSE 2D7HA 3BXWA 3SATA 1C7YA 3KW6A 4B3MM 3AOEA 3KP0E 4KODA 3SMSA 1GVNA 3OTOM 2KZSA 2DWLA 4BLCA 2ZTDA 3K8ZA 4CIZA 4FWDA 5JI2E 3GQ4A 5LMUM 4AZFA 3U6EA 2XZFA 4JI2M 1GKIA 2LNHC 4X64M 1XXHE 3KOZE 3SHGB 4DR6M 3U6DA 3L2AA 4AW4A 2DAEA 3CF6E 3HHWA 3IHPA 1G4AE 1A5TA 2LXEA 2O01F 3FE3A 4DV7M 1KSFX 2BWBA 3FUXA 3SAUA 5FLXS 3BOSA 4G4OA 4LJ6A 4NC6A 2G3QA 2QCUA 2F4VM 1HT2E 2CWBA 2CFOA 4MGKE 4IBBA 2XF3A 4ZPXA 3QYEA 3E9SA 1HNZM 2M60A 3HZJA 4LJ9A 1K82A 1LTMA 3PVSA 3UZUA 1YLAA 1OKSA 2JZ1A 1QZEA 4KT0F 3SMPA 3TWMA 1XNQM 4NSOB 4QOSA 1YE9A 1W5SA 4R7GA 3GLIE 1XMQM 2LVPC 4LF9M 2KXEA 2ZBKB 3E46A 4LZZA 2UXBM 2KNAA 4PT5A 1TH2A 2R62A 5EP2A 1J7KA 5A2QS 3K9OA 3K1JA 4GKKM 2V6ZM 2EKKA 3B7ZA 4JV5M 3HU2A 4LRTA 3U6CA 2UXDM 3U6SA 2BWEA 5FSWA 1E9RA 5DYGA 3HU1A 3U6LA 2RKOA 2KRUA 1QZMA 5EQTA 4JI1M 2EJSA 2KNZA 1QUTA 5E6JA 3ZQJA 4CISA 5EXPA 4LF7M 3I01M 3DFZA 4LJ7A 3HU3A 1E32A 3JAMS 1TDZA 2FS1A 4FWGA 2CEAA 1N77A 3KS8A 2D7EA 2W82A 5F3WA 1R2YA 1EIJA 2MJ5B 3FKEA 4CJ6A 3E21A 1R7RA 4DBGB 2QBYA 2MH8A 3IECA 4LCBA 3GLGB 1P3QQ 1OIZA 3FUWA 3I4YA 3RFWA 3FTCA 2HL7A 2MGWA 2E5LM 3CTWB 4R71A 2WSCF 2XGNA 3WHLA 4AI6A 2R0IA 1HT1E 4FD2A 3HX3A 3HHZA 4JN6A 2RRUA 4LY6A 5EXSA 1Q3CA 2JNHA 1VDLA 1XHBA 2GQFA 2LBCA 4D82A 4LG2A 4LJ4A 2DAIA 5ITXA 1IY1A 4RNAA 1QAMA 2FNAA 2LH0A 2AHMA 4PDGA 1GL7A 3HHXA 2V1UA 1TGUA 1V34A 3EIHA 3MJ5A 2Z3XA 3KOYE 4MM3B 4I81A 4IBIA 1OFIA 3NBXX 3HJSA 1NJFA 4RF1A 5FTJA 3ZC7B 2Q2EB 2YNMD 1GO5A 1BVSA 1DGBA 1D0MA 3L25A 3WHKA 3VDPA 3U5ZB 2LVOC 4DR1M 1IN7A 3LVVA 2LVQD 3IG8A 2DKLA 3CF2A 3GLFB 1Z6TA 2Y0TA 3GRYA 2UUAM 4KHPM 1TH3A 3U60B 2DWMA 3L26A 3A42A 1WGNA 1QYRA 1E9SA 1TF0B 5DNYA 1PJQA 2Z4RA 3FRHA 2ZAOA 4LJAA 2L09A 4MB7A 1XXHB 2VDBB 4QNRA 3DOAA 4DV0M 1J5EM 4MGZE 1KFVA 2ZANA 3LQRA 4JI5M 1QDTA 3H4MA 4WP2A 1HNXM 4LF6M 1G8PA 4G6ZA 3KVWA 3LCVB 4A3VB 2VIIA 1JQJC 3TL4X 1NV9A 3UJNA 2DNAA 4LFBM 3VLFB 2JXNA 1N78A 1NJGA 3EIEA 4JI3M 4JXJA 2VQFM 2F5NA 4NXMM 1G71A 2BJWA 1GL6A 3B7NA 4P16A 2KA6B 2YQZA 1G3IA 4BB9A 2DWNA 3T1YM 3VKHA 1QVRA 1OFHA 4IBGA 2DWZB 4IBDA 4D80A 2K0BX 2K6BA 3GLHA 4GEWA 3GRRA 2V1CA 1ZQ9A 1DO2A 1IQPA 4LJ8A 4OVZA 4G4QA 4MGIE 3GLFE 3K2LA 3SHFA 2G8LA 2QNJA 4GIPA 4L6V6 3J7AS 1RU3A 3U61B 3L28A 5DYIA 2K9DA 1MU5A 1PJSA 1UM8A 3I4VA 3C58A 2VF7A 3U6QA 3J27B 1DGFA 4FCVA 1GJSA 1SXJA 2OQ4A 3R8FA 3C3DA 1AUAA 3B9PA 5FTNA 4JI8M 3GLGA 1N34M 3W0LB 1TR8A 3E4RA 1IY2A 1VG5A 3C9PA 1E94E 3K92A 4GC5A 1SXJC 3AFHA 1TTEA 1Q39A 2DAKA 1IN8A 4DUYM 2UUCM 2CHQA 3NBIA 3Q8XA 3W0FA 4I8OA 3KS4A 3TQSA 1L1TA 4MGHA 4B3TM 1PJTA 2B3TA 1F4IA 2UU9M 1DGHA 4DV5M 3Q8GA 2R44A 1WJ7A 3KP1E 4KLNA 4QNMA 1JR3A 1XNRM 2XSZA 2H1RA 4AKHA 3U6MA 1OJLA 3FYCA 3V76A 4DV4M 1YUBA 1EFUB 2DAGA 1NNUC 2JY6B 3ILKA 4LFAM 2FFJA 3LW5F 4LFCM 5FTKA 2KZUA 1GABA 4NRWA 2R65A 4LGYA 1Q02A 1OAIA 2DVWB 1FJGM 4L15A 1PRBA 4L4UA 2ZM6M 4AQYM 3U60A 2JP7A 1IXSB 4WW0A 1IBMM 3VKGA 3B89A 1UFZA 5EP4A 2APLA 2DAMA 3QAUA 3GPXA 2K47A 4IBCA 3K9PA 2Y21A 4CHTB 2L4FA 3TWKA
chains in the Genus database with same CATH topology
1Z5AA 2XFSA 4IBJA 3TE6A 3ZH9B 4KO8A 4IJFA 5ITUA 3RE8A 4JI0M 4D81A 1QAQA 1NHWC 2JA2A 2R46A 5C1BA 3LQQA 2CUZA 3GPUA 2R45A 2EA0A 4B7HA 4DR3M 4CGYB 4PCZA 1I94M 1IBKM 2FOIC 4NSRA 1XC8A 1SXJD 3IG5A 3SYLA 4HL4A 2CV2A 3LVWA 4NOOB 4G4NA 4IBFA 3GLIA 4ITQA 4I4LA 1IY0A 3RGSA 2EUCA 4B7FA 2QZ4A 1YSYA 5KQDA 3KFUG 2FE8A 3TWLA 4GHLA 4WURA 3FTEA 5EXXA 3TPZA 4DR2M 4LF8M 1NY5A 3HHYA 2KW0A 1IN5A 4LGMA 4QOZC 1N75A 3MK6A 1R6BX 3T1HM 4JI7M 1JR3D 1HNWM 2Z7JA 3CF0A 1X37A 4M9SA 4Z8XA 2XSZD 2C5RA 5IREB 4DR4M 5IZ7D 3M6AA 2XZUA 4DV3M 4AKIA 1L2BA 2P5TA 4JI4M 1SXJE 4AG6A 2F5OA 2C9OA 2XH9A 1I4WA 2XEPA 3KOXE 1IM2A 3AJIB 4S12A 5LMNM 1T3TA 5ITRA 4FCWA 3PFIA 5FTLA 3FUUA 1NY6A 4IBEA 4GITA 4I5SA 1HQYE 3SARA 3U6PA 2KRKA 4TUWA 2QBYB 2HKJA 3GO8A 5KQ8A 2Z4SA 3UMMA 4IBKA 2DZNB 2X8AA 3HJ8A 2QPAA 3QWLA 1ORYB 4GC9A 2VQEM 1N36M 3FUTA 3GP1A 4AG5A 1HQCA 1HR0M 4FCTA 1FNNA 1L1ZA 2HCBA 4K0KM 4LF5M 4IIWA 3THGA 1QAOA 1N33M 1C1KA 3I51A 2QP9X 2F5SA 3DA1A 5KPRA 1L2CA 5EJCA 1DGGA 3JR4A 4GRIA 2F5PA 2I7NA 3A45A 3J80S 5ITTA 1Q3BA 4DV6M 4REZA 1IN4A 1D2NA 3L29A 2G5GX 3GRVA 2C99A 3SBJA 3R9XB 3GPYA 2I7PA 3GQ5A 2LWXA 4FWHA 4YY3M 8CATA 2C96A 3AOEC 3M0EA 1Z5CA 2X4AA 2YFQA 4OW0A 2M5ZA 4AKGA 2A5YB 1W5TA 1G59A 1L8QA 1LV7A 4FW9A 3VFDA 4M9ZA 4LF4M 1IBLM 3GPPA 2KEBA 2RGHA 4M9XA 5C18A 3HJQA 5ITXE 3L27A 3U5ZA 4YHHM 5ITYA 3PNYA 2EO2A 2J7NA 1DO0A 1PJJA 1NVMA 4BBAA 3GLFA 4GKJM 4M0DA 4M0WA 1TDHA 4DV1M 4RF0A 4GH9A 3VK7A 5KO3A 3AKZA 3GQ3A 3SAVA 3DZDA 5H37D 3VK8A 4JI6M 5E26A 3U6OA 1XXHA 2R4EA 2R18A 3AL0C 3SFZA 3GLHB 2F5QA 5KPZA 4LJ5A 2Y20A 1KYIA 4OVZB 2CV1A 4OX9M 2BJVA 2YR0A 1ZAEA 2Y0QA 1XWIA 4B3RM 4PD2A 3A46A 2ZAMA 1Z5BA 4G4RA 2CE7A 4L8RC 3NWLA 3MHVC 5BR8M 4LZJA 2XFTA 3PXGA 1QQWA 1GLNA 4XGIA 1SXJB 5EXTA 2J7OA 5KPTA 1G41A 3AV0A 3FYDA 4R3DA 4NRVA 3T15A 4PDIA 4QHSA 2XLJA 4XBOA 2DXIA 3KXEC 2NQ8C 1N32M 2CHVA 5FTMA 1NHGC 1QANA 2OPFA 2UUBM 3HKPA 3A98B 5IWAM 3KSXA 1J09A 3D8BA 1R2ZA 3SYKA 1K3XA 4GMQA 4L16A 3UK6A 2CHGA 3U61A 4X65M 2L6OA 3PNVA 4DR7M 4QHTA 3JR5A 1DGHB 2O5RA 4W5WA 1IXRC 5IT9S 1Z59A 4DV2M 3LMMA 1PM5A 3SASA 2R4JA 3J81S 2L7HA 4B7GA 4EIWA 4GHAA 1PJIA 5EP1A 5ITQA 4B3SM 1S3SA 4IJEA 4LRSA 4JYAM 2C9CA 2X49A 3SC3A 3HWSA 4DUZM 1VDDA 2C98A 3J2PB 5JI3E 3D8LA 3VDUA 5BPVA 1IN6A 2QENA 4L78A 4HLQA 3GRUA 4X66M 4B08A 5GKNA 3FTDA 3ZCBB 3J7BA 4NXNM 1WXQA 2ERCA 3T38A 4X62M 2D7GA 2L7IA 4OU7A 1EE8A 3HGIA 5EP3A 4DR5M 3M7GA 1L2DA 1MX0A 1NSFA 4Z6YA 1XMOM 1TH4A 1K3WA 2DHRA 3KSJA 2CV0A 4II7A 2BNKA 3KOWE 3UGJA 2UXCM 3FD9A 3RGPA 4FVMA 4NL4H 4MGYE 2RGOA 2HHHM 4MH0E 3AOGA 1IXZA 3FUVA 3SAWA 2DZOB 1NNJA 7CATA 3GLIB 1H6UA 3KDSE 2D7HA 3SATA 3KW6A 4B3MM 3AOEA 3KP0E 4KODA 3SMSA 1GVNA 3OTOM 2KZSA 2DWLA 4BLCA 5JI2E 3K8ZA 3GQ4A 4FWDA 5LMUM 3U6EA 2XZFA 4AZFA 4JI2M 1GKIA 2LNHC 4X64M 3KOZE 3SHGB 4DR6M 3U6DA 3L2AA 4AW4A 3CF6E 3HHWA 4DV7M 1G4AE 2LXEA 1KSFX 3FUXA 3SAUA 5FLXS 3BOSA 4G4OA 4LJ6A 2F4VM 2QCUA 1HT2E 2CFOA 4MGKE 4IBBA 2XF3A 4ZPXA 3E9SA 1HNZM 2M60A 4LJ9A 1K82A 3PVSA 3UZUA 3SMPA 3TWMA 1XNQM 4NSOB 4QOSA 1YE9A 1W5SA 4R7GA 1XMQM 4LF9M 2KXEA 2ZBKB 4LZZA 2UXBM 4PT5A 1TH2A 2R62A 5EP2A 1J7KA 5A2QS 3K1JA 4GKKM 2V6ZM 4JV5M 3HU2A 4LRTA 3U6CA 2UXDM 3U6SA 5FSWA 1E9RA 5DYGA 3HU1A 3U6LA 2RKOA 2KRUA 1QZMA 5EQTA 4JI1M 5E6JA 4CISA 5EXPA 4LF7M 3DFZA 4LJ7A 3HU3A 1E32A 3JAMS 1TDZA 4FWGA 2CEAA 1N77A 3KS8A 2D7EA 2W82A 5F3WA 1R2YA 3FKEA 2QBYA 1R7RA 4LCBA 3GLGB 3FUWA 3RFWA 3I4YA 3FTCA 2HL7A 2E5LM 3CTWB 2XGNA 3WHLA 4AI6A 4FD2A 1HT1E 3HHZA 4JN6A 4LY6A 5EXSA 1Q3CA 1XHBA 4D82A 4LG2A 4LJ4A 5ITXA 1IY1A 4RNAA 1QAMA 2FNAA 2LH0A 2AHMA 4PDGA 1GL7A 3HHXA 2V1UA 1TGUA 3EIHA 3MJ5A 2Z3XA 3KOYE 4MM3B 4I81A 4IBIA 1OFIA 3ZC7B 3HJSA 1NJFA 4RF1A 5FTJA 2Q2EB 2YNMD 1DGBA 3L25A 3WHKA 3VDPA 3U5ZB 4DR1M 1IN7A 3LVVA 3IG8A 2UUAM 3CF2A 3GLFB 1Z6TA 2Y0TA 3GRYA 4KHPM 1TH3A 3U60B 2DWMA 3L26A 3A42A 1QYRA 1E9SA 5DNYA 2Z4RA 2ZAOA 4LJAA 2L09A 4MB7A 1XXHB 4QNRA 3DOAA 4DV0M 1J5EM 4MGZE 1KFVA 2ZANA 3LQRA 4JI5M 3H4MA 1HNXM 4LF6M 1G8PA 4G6ZA 3KVWA 4A3VB 2VIIA 1JQJC 3TL4X 3UJNA 4LFBM 3VLFB 1N78A 1NJGA 3EIEA 4JI3M 4JXJA 2VQFM 2F5NA 4NXMM 2BJWA 1GL6A 4P16A 2KA6B 2YQZA 1G3IA 4BB9A 2DWNA 3T1YM 3VKHA 1QVRA 1OFHA 4IBGA 2DWZB 4IBDA 4D80A 3GLHA 3GRRA 2V1CA 1ZQ9A 1DO2A 1IQPA 4LJ8A 4OVZA 4G4QA 4MGIE 3K2LA 3SHFA 2G8LA 4GIPA 3J7AS 3U61B 3L28A 5DYIA 1MU5A 1UM8A 3I4VA 3C58A 3U6QA 3J27B 1DGFA 4FCVA 1SXJA 2OQ4A 3R8FA 3B9PA 5FTNA 4JI8M 3GLGA 1N34M 3W0LB 3E4RA 3K92A 1IY2A 1E94E 4GC5A 1SXJC 3AFHA 1Q39A 1IN8A 4DUYM 2UUCM 2CHQA 3NBIA 3Q8XA 3W0FA 4I8OA 3KS4A 3TQSA 1L1TA 4MGHA 4B3TM 2UU9M 1DGHA 4DV5M 3KP1E 4KLNA 4QNMA 1JR3A 1XNRM 2XSZA 2H1RA 4AKHA 3U6MA 1OJLA 3FYCA 4DV4M 1YUBA 1NNUC 3ILKA 4LFAM 2FFJA 4LFCM 5FTKA 2KZUA 4NRWA 2R65A 4LGYA 2DVWB 1FJGM 4L15A 2ZM6M 4L4UA 4AQYM 3U60A 1IXSB 4WW0A 1IBMM 3VKGA 5EP4A 3GPXA 3QAUA 2K47A 4IBCA 2Y21A 4CHTB 3FTFA 3TWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  1GVN A;  2P5T A; 
#chains in the Genus database with same CATH topology
 5L8R F;  1Z5A A;  2XFS A;  4IBJ A;  3TE6 A;  3ZH9 B;  4KO8 A;  4IJF A;  5ITU A;  3RE8 A;  4JI0 M;  4D81 A;  1QAQ A;  2QSF X;  2MR9 A;  1NHW C;  2JA2 A;  2R46 A;  5C1B A;  3LQQ A;  2CUZ A;  3GPU A;  2R45 A;  2EA0 A;  4B7H A;  4DR3 M;  4CGY B;  4PCZ A;  1WGL A;  1I94 M;  1VQ1 A;  1IBK M;  2FOI C;  1MN3 A;  4NSR A;  1XC8 A;  1SXJ D;  3IG5 A;  2LHC A;  3SYL A;  4HL4 A;  2CV2 A;  3LVW A;  4NOO B;  4G4N A;  4IBF A;  3GLI A;  4ITQ A;  4I4L A;  1IY0 A;  3RGS A;  2EUC A;  4B7F A;  2KHH A;  2QZ4 A;  2DHY A;  1YSY A;  2QQ8 A;  5KQD A;  3KFU G;  1ZMU A;  2FE8 A;  3TWL A;  4GHL A;  4WUR A;  3FTE A;  5EXX A;  3TPZ A;  4DR2 M;  4LF8 M;  1NY5 A;  3HHY A;  2KW0 A;  1IN5 A;  4LGM A;  1ZV1 A;  4QOZ C;  1ZMW A;  1N75 A;  3MK6 A;  1R6B X;  3B7Q A;  3T1H M;  4JI7 M;  1JR3 D;  1HNW M;  2Z7J A;  3CF0 A;  1X37 A;  2N35 A;  4M9S A;  2XSZ D;  4Z8X A;  2C5R A;  1OAO C;  5IRE B;  4DR4 M;  5IZ7 D;  2J5Y A;  3M6A A;  2XZU A;  4DV3 M;  2FH0 A;  4AKI A;  1L2B A;  1OIP A;  2P5T A;  4JI4 M;  4HEO A;  1WHC A;  1SXJ E;  2CRU A;  4AG6 A;  2F5O A;  2C9O A;  2XH9 A;  1I4W A;  2XEP A;  3KOX E;  1IM2 A;  2CP8 A;  3AJI B;  4S12 A;  1T3T A;  5ITR A;  5LMN M;  2HWJ A;  4FCW A;  3PFI A;  4G3O A;  5FTL A;  3FUU A;  1NY6 A;  4IBE A;  1VEG A;  4GIT A;  4I5S A;  1HQY E;  3SAR A;  3U6P A;  4Q7J A;  2KRK A;  4TUW A;  2QBY B;  2HKJ A;  3GO8 A;  5KQ8 A;  2Z4S A;  3UMM A;  4IBK A;  2DZN B;  2X8A A;  3HJ8 A;  2QPA A;  1VEK A;  2MRO B;  3QWL A;  1ORY B;  4GC9 A;  2VQE M;  1HJP A;  1N36 M;  2LVN C;  3FUT A;  3GP1 A;  1JB0 F;  1MJG M;  4AG5 A;  1HQC A;  3W68 A;  1HR0 M;  4FCT A;  1FNN A;  3T6P A;  1L1Z A;  2HCB A;  4K0K M;  4LF5 M;  2WZJ A;  4IIW A;  3THG A;  1QAO A;  1N33 M;  2DZL A;  1C1K A;  3I51 A;  2QP9 X;  4F2L A;  2F5S A;  1NO1 A;  3FTF A;  3DA1 A;  5KPR A;  1L2C A;  5EJC A;  5DFL A;  1DGG A;  3JR4 A;  4GRI A;  2F5P A;  2I7N A;  3A45 A;  3J80 S;  2WSE F;  5ITT A;  1Q3B A;  2LHG A;  4DV6 M;  4REZ A;  1IN4 A;  1D2N A;  3L29 A;  2G5G X;  2JWS A;  3GRV A;  2C99 A;  3SBJ A;  3R9X B;  3GPY A;  2I7P A;  3GQ5 A;  3MMP A;  2LWX A;  4FWH A;  4YY3 M;  2Z8Y M;  2C96 A;  3AOE C;  3M0E A;  8CAT A;  1WIV A;  1PGY A;  1Z5C A;  2X4A A;  2YFQ A;  4OW0 A;  4UN2 B;  2M5Z A;  4AKG A;  4F1I A;  1DV0 A;  2A5Y B;  1W5T A;  1G59 A;  2DI0 A;  1L8Q A;  1LV7 A;  4FW9 A;  3VFD A;  4M9Z A;  4LF4 M;  1ZMV A;  2QHO B;  1T43 A;  1XB2 B;  2OOB A;  1IBL M;  2R6F A;  3GPP A;  2KEB A;  2RGH A;  4M9X A;  5C18 A;  1OTR A;  2H5X A;  3HJQ A;  5ITX E;  3L27 A;  3U5Z A;  4YHH M;  5ITY A;  3PNY A;  2EO2 A;  2J7N A;  1DO0 A;  1PJJ A;  1NVM A;  4BBA A;  3GLF A;  4GKJ M;  4M0D A;  4M0W A;  1TDH A;  4DV1 M;  4RF0 A;  4GH9 A;  3VK7 A;  5KO3 A;  3AKZ A;  3GQ3 A;  3SAV A;  3DZD A;  5H37 D;  2JY5 A;  3VK8 A;  4JI6 M;  5E26 A;  3U6O A;  1XXH A;  2KDL A;  2R18 A;  2R4E A;  3AL0 C;  3SFZ A;  4ANR A;  1AIP C;  3GLH B;  2F5Q A;  2L2D A;  5KPZ A;  4LJ5 A;  2Y20 A;  2ZTC A;  1KYI A;  2HAK A;  1QDR A;  2O25 A;  4OVZ B;  3BBZ A;  4RKU F;  2CV1 A;  2BJV A;  2YR0 A;  4OX9 M;  1ZAE A;  2Y0Q A;  1XWI A;  4B3R M;  2DEN A;  4PD2 A;  3A46 A;  2WSF F;  1Z5B A;  2ZAM A;  1R5L A;  3B74 A;  3LCU A;  1OQY A;  4G4R A;  2CE7 A;  1Y8G A;  3NWL A;  3MHV C;  4L8R C;  5BR8 M;  2EKF A;  4LZJ A;  2XFT A;  3HY5 A;  3F92 A;  1QQW A;  3H4J A;  3PXG A;  1GLN A;  4XGI A;  1SXJ B;  2VF8 A;  2J7O A;  5EXT A;  5KPT A;  1G41 A;  3AV0 A;  3FYD A;  4Y28 F;  1T6O A;  4R3D A;  4NRV A;  3T15 A;  4PDI A;  4QHS A;  2XLJ A;  4XBO A;  2DXI A;  3KXE C;  2NQ8 C;  1N32 M;  2CHV A;  5FTM A;  1NHG C;  1QAN A;  1VEJ A;  2OPF A;  1CUK A;  3HKP A;  2UUB M;  3A98 B;  1NV8 A;  5IWA M;  3KSX A;  1J09 A;  3D8B A;  1R2Z A;  3SYK A;  1K3X A;  1IFY A;  4GMQ A;  4L16 A;  4P17 A;  2CHG A;  3UK6 A;  3U61 A;  4X65 M;  2L6O A;  1GJT A;  3FRI A;  3PNV A;  3W67 A;  1R4G A;  2L4E A;  4DR7 M;  3GLH E;  4QHT A;  1D0L A;  2KNV A;  3JR5 A;  1DGH B;  2O5R A;  4W5W A;  1IXR C;  5IT9 S;  1Z59 A;  3QYB A;  3LMM A;  4DV2 M;  1SG9 A;  1PM5 A;  3SAS A;  2R4J A;  1QUS A;  3CGW A;  3J81 S;  2L7H A;  4B7G A;  4EIW A;  4GHA A;  2LVA A;  1PJI A;  5EP1 A;  5ITQ A;  4B3S M;  1D0K A;  1S3S A;  4IJE A;  4LRS A;  4JYA M;  2C9C A;  2X49 A;  3SC3 A;  3HWS A;  4XK8 F;  4DUZ M;  1VDD A;  2C98 A;  3J2P B;  5JI3 E;  3D8L A;  3VDU A;  5BPV A;  1IN6 A;  2QEN A;  4L78 A;  3GLG E;  4HLQ A;  3GRU A;  4X66 M;  1V33 A;  4B08 A;  5GKN A;  3FTD A;  2OOA A;  3ZCB B;  2JZ0 A;  3J7B A;  4NXN M;  1WXQ A;  2ERC A;  3T38 A;  4X62 M;  2D7G A;  2L7I A;  4OU7 A;  1EE8 A;  2OO9 A;  3I04 M;  3HGI A;  5EP3 A;  2LTU A;  4DR5 M;  2JY7 A;  3M7G A;  1L2D A;  1MX0 A;  1NSF A;  4Z6Y A;  1XMO M;  1TH4 A;  1K3W A;  2DHR A;  3KSJ A;  2CV0 A;  4II7 A;  2BNK A;  3KOW E;  1JR3 E;  3UGJ A;  2UXC M;  3FD9 A;  3C3E A;  4FVM A;  3RGP A;  4NL4 H;  2GNO A;  4MGY E;  2RGO A;  2HHH M;  1IXS A;  1V92 A;  4MH0 E;  3AOG A;  1IXZ A;  3FUV A;  3SAW A;  2DZO B;  2JY8 A;  1NNJ A;  7CAT A;  2JUJ A;  3GLI B;  1WR1 B;  1H6U A;  3KDS E;  2D7H A;  3BXW A;  3SAT A;  1C7Y A;  3KW6 A;  4B3M M;  3AOE A;  3KP0 E;  4KOD A;  3SMS A;  1GVN A;  3OTO M;  2KZS A;  2DWL A;  4BLC A;  2ZTD A;  3K8Z A;  4CIZ A;  4FWD A;  5JI2 E;  3GQ4 A;  5LMU M;  4AZF A;  3U6E A;  2XZF A;  4JI2 M;  1GKI A;  2LNH C;  4X64 M;  1XXH E;  3KOZ E;  3SHG B;  4DR6 M;  3U6D A;  3L2A A;  4AW4 A;  2DAE A;  3CF6 E;  3HHW A;  3IHP A;  1G4A E;  1A5T A;  2LXE A;  2O01 F;  3FE3 A;  4DV7 M;  1KSF X;  2BWB A;  3FUX A;  3SAU A;  5FLX S;  3BOS A;  4G4O A;  4LJ6 A;  4NC6 A;  2G3Q A;  2QCU A;  2F4V M;  1HT2 E;  2CWB A;  2CFO A;  4MGK E;  4IBB A;  2XF3 A;  4ZPX A;  3QYE A;  3E9S A;  1HNZ M;  2M60 A;  3HZJ A;  4LJ9 A;  1K82 A;  1LTM A;  3PVS A;  3UZU A;  1YLA A;  1OKS A;  2JZ1 A;  1QZE A;  4KT0 F;  3SMP A;  3TWM A;  1XNQ M;  4NSO B;  4QOS A;  1YE9 A;  1W5S A;  4R7G A;  3GLI E;  1XMQ M;  2LVP C;  4LF9 M;  2KXE A;  2ZBK B;  3E46 A;  4LZZ A;  2UXB M;  2KNA A;  4PT5 A;  1TH2 A;  2R62 A;  5EP2 A;  1J7K A;  5A2Q S;  3K9O A;  3K1J A;  4GKK M;  2V6Z M;  2EKK A;  3B7Z A;  4JV5 M;  3HU2 A;  4LRT A;  3U6C A;  2UXD M;  3U6S A;  2BWE A;  5FSW A;  1E9R A;  5DYG A;  3HU1 A;  3U6L A;  2RKO A;  2KRU A;  1QZM A;  5EQT A;  4JI1 M;  2EJS A;  2KNZ A;  1QUT A;  5E6J A;  3ZQJ A;  4CIS A;  5EXP A;  4LF7 M;  3I01 M;  3DFZ A;  4LJ7 A;  3HU3 A;  1E32 A;  3JAM S;  1TDZ A;  2FS1 A;  4FWG A;  2CEA A;  1N77 A;  3KS8 A;  2D7E A;  2W82 A;  5F3W A;  1R2Y A;  1EIJ A;  2MJ5 B;  3FKE A;  4CJ6 A;  3E21 A;  1R7R A;  4DBG B;  2QBY A;  2MH8 A;  3IEC A;  4LCB A;  3GLG B;  1P3Q Q;  1OIZ A;  3FUW A;  3I4Y A;  3RFW A;  3FTC A;  2HL7 A;  2MGW A;  2E5L M;  3CTW B;  4R71 A;  2WSC F;  2XGN A;  3WHL A;  4AI6 A;  2R0I A;  1HT1 E;  4FD2 A;  3HX3 A;  3HHZ A;  4JN6 A;  2RRU A;  4LY6 A;  5EXS A;  1Q3C A;  2JNH A;  1VDL A;  1XHB A;  2GQF A;  2LBC A;  4D82 A;  4LG2 A;  4LJ4 A;  2DAI A;  5ITX A;  1IY1 A;  4RNA A;  1QAM A;  2FNA A;  2LH0 A;  2AHM A;  4PDG A;  1GL7 A;  3HHX A;  2V1U A;  1TGU A;  1V34 A;  3EIH A;  3MJ5 A;  2Z3X A;  3KOY E;  4MM3 B;  4I81 A;  4IBI A;  1OFI A;  3NBX X;  3HJS A;  1NJF A;  4RF1 A;  5FTJ A;  3ZC7 B;  2Q2E B;  2YNM D;  1GO5 A;  1BVS A;  1DGB A;  1D0M A;  3L25 A;  3WHK A;  3VDP A;  3U5Z B;  2LVO C;  4DR1 M;  1IN7 A;  3LVV A;  2LVQ D;  3IG8 A;  2DKL A;  3CF2 A;  3GLF B;  1Z6T A;  2Y0T A;  3GRY A;  2UUA M;  4KHP M;  1TH3 A;  3U60 B;  2DWM A;  3L26 A;  3A42 A;  1WGN A;  1QYR A;  1E9S A;  1TF0 B;  5DNY A;  1PJQ A;  2Z4R A;  3FRH A;  2ZAO A;  4LJA A;  2L09 A;  4MB7 A;  1XXH B;  2VDB B;  4QNR A;  3DOA A;  4DV0 M;  1J5E M;  4MGZ E;  1KFV A;  2ZAN A;  3LQR A;  4JI5 M;  1QDT A;  3H4M A;  4WP2 A;  1HNX M;  4LF6 M;  1G8P A;  4G6Z A;  3KVW A;  3LCV B;  4A3V B;  2VII A;  1JQJ C;  3TL4 X;  1NV9 A;  3UJN A;  2DNA A;  4LFB M;  3VLF B;  2JXN A;  1N78 A;  1NJG A;  3EIE A;  4JI3 M;  4JXJ A;  2VQF M;  2F5N A;  4NXM M;  1G71 A;  2BJW A;  1GL6 A;  3B7N A;  4P16 A;  2KA6 B;  2YQZ A;  1G3I A;  4BB9 A;  2DWN A;  3T1Y M;  3VKH A;  1QVR A;  1OFH A;  4IBG A;  2DWZ B;  4IBD A;  4D80 A;  2K0B X;  2K6B A;  3GLH A;  4GEW A;  3GRR A;  2V1C A;  1ZQ9 A;  1DO2 A;  1IQP A;  4LJ8 A;  4OVZ A;  4G4Q A;  4MGI E;  3GLF E;  3K2L A;  3SHF A;  2G8L A;  2QNJ A;  4GIP A;  4L6V 6;  3J7A S;  1RU3 A;  3U61 B;  3L28 A;  5DYI A;  2K9D A;  1MU5 A;  1PJS A;  1UM8 A;  3I4V A;  3C58 A;  2VF7 A;  3U6Q A;  3J27 B;  1DGF A;  4FCV A;  1GJS A;  1SXJ A;  2OQ4 A;  3R8F A;  3C3D A;  1AUA A;  3B9P A;  5FTN A;  4JI8 M;  3GLG A;  1N34 M;  3W0L B;  1TR8 A;  3E4R A;  1IY2 A;  1VG5 A;  3C9P A;  1E94 E;  3K92 A;  4GC5 A;  1SXJ C;  3AFH A;  1TTE A;  1Q39 A;  2DAK A;  1IN8 A;  4DUY M;  2UUC M;  2CHQ A;  3NBI A;  3Q8X A;  3W0F A;  4I8O A;  3KS4 A;  3TQS A;  1L1T A;  4MGH A;  4B3T M;  1PJT A;  2B3T A;  1F4I A;  2UU9 M;  1DGH A;  4DV5 M;  3Q8G A;  2R44 A;  1WJ7 A;  3KP1 E;  4KLN A;  4QNM A;  1JR3 A;  1XNR M;  2XSZ A;  2H1R A;  4AKH A;  3U6M A;  1OJL A;  3FYC A;  3V76 A;  4DV4 M;  1YUB A;  1EFU B;  2DAG A;  1NNU C;  2JY6 B;  3ILK A;  4LFA M;  2FFJ A;  3LW5 F;  4LFC M;  5FTK A;  2KZU A;  1GAB A;  4NRW A;  2R65 A;  4LGY A;  1Q02 A;  1OAI A;  2DVW B;  1FJG M;  4L15 A;  1PRB A;  4L4U A;  2ZM6 M;  4AQY M;  3U60 A;  2JP7 A;  1IXS B;  4WW0 A;  1IBM M;  3VKG A;  3B89 A;  1UFZ A;  5EP4 A;  2APL A;  2DAM A;  3QAU A;  3GPX A;  2K47 A;  4IBC A;  3K9P A;  2Y21 A;  4CHT B;  2L4F A;  3TWK A; 
#chains in the Genus database with same CATH homology
 1Z5A A;  2XFS A;  4IBJ A;  3TE6 A;  3ZH9 B;  4KO8 A;  4IJF A;  5ITU A;  3RE8 A;  4JI0 M;  4D81 A;  1QAQ A;  1NHW C;  2JA2 A;  2R46 A;  5C1B A;  3LQQ A;  2CUZ A;  3GPU A;  2R45 A;  2EA0 A;  4B7H A;  4DR3 M;  4CGY B;  4PCZ A;  1I94 M;  1IBK M;  2FOI C;  4NSR A;  1XC8 A;  1SXJ D;  3IG5 A;  3SYL A;  4HL4 A;  2CV2 A;  3LVW A;  4NOO B;  4G4N A;  4IBF A;  3GLI A;  4ITQ A;  4I4L A;  1IY0 A;  3RGS A;  2EUC A;  4B7F A;  2QZ4 A;  1YSY A;  5KQD A;  3KFU G;  2FE8 A;  3TWL A;  4GHL A;  4WUR A;  3FTE A;  5EXX A;  3TPZ A;  4DR2 M;  4LF8 M;  1NY5 A;  3HHY A;  2KW0 A;  1IN5 A;  4LGM A;  4QOZ C;  1N75 A;  3MK6 A;  1R6B X;  3T1H M;  4JI7 M;  1JR3 D;  1HNW M;  2Z7J A;  3CF0 A;  1X37 A;  4M9S A;  4Z8X A;  2XSZ D;  2C5R A;  5IRE B;  4DR4 M;  5IZ7 D;  3M6A A;  2XZU A;  4DV3 M;  4AKI A;  1L2B A;  2P5T A;  4JI4 M;  1SXJ E;  4AG6 A;  2F5O A;  2C9O A;  2XH9 A;  1I4W A;  2XEP A;  3KOX E;  1IM2 A;  3AJI B;  4S12 A;  5LMN M;  1T3T A;  5ITR A;  4FCW A;  3PFI A;  5FTL A;  3FUU A;  1NY6 A;  4IBE A;  4GIT A;  4I5S A;  1HQY E;  3SAR A;  3U6P A;  2KRK A;  4TUW A;  2QBY B;  2HKJ A;  3GO8 A;  5KQ8 A;  2Z4S A;  3UMM A;  4IBK A;  2DZN B;  2X8A A;  3HJ8 A;  2QPA A;  3QWL A;  1ORY B;  4GC9 A;  2VQE M;  1N36 M;  3FUT A;  3GP1 A;  4AG5 A;  1HQC A;  1HR0 M;  4FCT A;  1FNN A;  1L1Z A;  2HCB A;  4K0K M;  4LF5 M;  4IIW A;  3THG A;  1QAO A;  1N33 M;  1C1K A;  3I51 A;  2QP9 X;  2F5S A;  3DA1 A;  5KPR A;  1L2C A;  5EJC A;  1DGG A;  3JR4 A;  4GRI A;  2F5P A;  2I7N A;  3A45 A;  3J80 S;  5ITT A;  1Q3B A;  4DV6 M;  4REZ A;  1IN4 A;  1D2N A;  3L29 A;  2G5G X;  3GRV A;  2C99 A;  3SBJ A;  3R9X B;  3GPY A;  2I7P A;  3GQ5 A;  2LWX A;  4FWH A;  4YY3 M;  8CAT A;  2C96 A;  3AOE C;  3M0E A;  1Z5C A;  2X4A A;  2YFQ A;  4OW0 A;  2M5Z A;  4AKG A;  2A5Y B;  1W5T A;  1G59 A;  1L8Q A;  1LV7 A;  4FW9 A;  3VFD A;  4M9Z A;  4LF4 M;  1IBL M;  3GPP A;  2KEB A;  2RGH A;  4M9X A;  5C18 A;  3HJQ A;  5ITX E;  3L27 A;  3U5Z A;  4YHH M;  5ITY A;  3PNY A;  2EO2 A;  2J7N A;  1DO0 A;  1PJJ A;  1NVM A;  4BBA A;  3GLF A;  4GKJ M;  4M0D A;  4M0W A;  1TDH A;  4DV1 M;  4RF0 A;  4GH9 A;  3VK7 A;  5KO3 A;  3AKZ A;  3GQ3 A;  3SAV A;  3DZD A;  5H37 D;  3VK8 A;  4JI6 M;  5E26 A;  3U6O A;  1XXH A;  2R4E A;  2R18 A;  3AL0 C;  3SFZ A;  3GLH B;  2F5Q A;  5KPZ A;  4LJ5 A;  2Y20 A;  1KYI A;  4OVZ B;  2CV1 A;  4OX9 M;  2BJV A;  2YR0 A;  1ZAE A;  2Y0Q A;  1XWI A;  4B3R M;  4PD2 A;  3A46 A;  2ZAM A;  1Z5B A;  4G4R A;  2CE7 A;  4L8R C;  3NWL A;  3MHV C;  5BR8 M;  4LZJ A;  2XFT A;  3PXG A;  1QQW A;  1GLN A;  4XGI A;  1SXJ B;  5EXT A;  2J7O A;  5KPT A;  1G41 A;  3AV0 A;  3FYD A;  4R3D A;  4NRV A;  3T15 A;  4PDI A;  4QHS A;  2XLJ A;  4XBO A;  2DXI A;  3KXE C;  2NQ8 C;  1N32 M;  2CHV A;  5FTM A;  1NHG C;  1QAN A;  2OPF A;  2UUB M;  3HKP A;  3A98 B;  5IWA M;  3KSX A;  1J09 A;  3D8B A;  1R2Z A;  3SYK A;  1K3X A;  4GMQ A;  4L16 A;  3UK6 A;  2CHG A;  3U61 A;  4X65 M;  2L6O A;  3PNV A;  4DR7 M;  4QHT A;  3JR5 A;  1DGH B;  2O5R A;  4W5W A;  1IXR C;  5IT9 S;  1Z59 A;  4DV2 M;  3LMM A;  1PM5 A;  3SAS A;  2R4J A;  3J81 S;  2L7H A;  4B7G A;  4EIW A;  4GHA A;  1PJI A;  5EP1 A;  5ITQ A;  4B3S M;  1S3S A;  4IJE A;  4LRS A;  4JYA M;  2C9C A;  2X49 A;  3SC3 A;  3HWS A;  4DUZ M;  1VDD A;  2C98 A;  3J2P B;  5JI3 E;  3D8L A;  3VDU A;  5BPV A;  1IN6 A;  2QEN A;  4L78 A;  4HLQ A;  3GRU A;  4X66 M;  4B08 A;  5GKN A;  3FTD A;  3ZCB B;  3J7B A;  4NXN M;  1WXQ A;  2ERC A;  3T38 A;  4X62 M;  2D7G A;  2L7I A;  4OU7 A;  1EE8 A;  3HGI A;  5EP3 A;  4DR5 M;  3M7G A;  1L2D A;  1MX0 A;  1NSF A;  4Z6Y A;  1XMO M;  1TH4 A;  1K3W A;  2DHR A;  3KSJ A;  2CV0 A;  4II7 A;  2BNK A;  3KOW E;  3UGJ A;  2UXC M;  3FD9 A;  3RGP A;  4FVM A;  4NL4 H;  4MGY E;  2RGO A;  2HHH M;  4MH0 E;  3AOG A;  1IXZ A;  3FUV A;  3SAW A;  2DZO B;  1NNJ A;  7CAT A;  3GLI B;  1H6U A;  3KDS E;  2D7H A;  3SAT A;  3KW6 A;  4B3M M;  3AOE A;  3KP0 E;  4KOD A;  3SMS A;  1GVN A;  3OTO M;  2KZS A;  2DWL A;  4BLC A;  5JI2 E;  3K8Z A;  3GQ4 A;  4FWD A;  5LMU M;  3U6E A;  2XZF A;  4AZF A;  4JI2 M;  1GKI A;  2LNH C;  4X64 M;  3KOZ E;  3SHG B;  4DR6 M;  3U6D A;  3L2A A;  4AW4 A;  3CF6 E;  3HHW A;  4DV7 M;  1G4A E;  2LXE A;  1KSF X;  3FUX A;  3SAU A;  5FLX S;  3BOS A;  4G4O A;  4LJ6 A;  2F4V M;  2QCU A;  1HT2 E;  2CFO A;  4MGK E;  4IBB A;  2XF3 A;  4ZPX A;  3E9S A;  1HNZ M;  2M60 A;  4LJ9 A;  1K82 A;  3PVS A;  3UZU A;  3SMP A;  3TWM A;  1XNQ M;  4NSO B;  4QOS A;  1YE9 A;  1W5S A;  4R7G A;  1XMQ M;  4LF9 M;  2KXE A;  2ZBK B;  4LZZ A;  2UXB M;  4PT5 A;  1TH2 A;  2R62 A;  5EP2 A;  1J7K A;  5A2Q S;  3K1J A;  4GKK M;  2V6Z M;  4JV5 M;  3HU2 A;  4LRT A;  3U6C A;  2UXD M;  3U6S A;  5FSW A;  1E9R A;  5DYG A;  3HU1 A;  3U6L A;  2RKO A;  2KRU A;  1QZM A;  5EQT A;  4JI1 M;  5E6J A;  4CIS A;  5EXP A;  4LF7 M;  3DFZ A;  4LJ7 A;  3HU3 A;  1E32 A;  3JAM S;  1TDZ A;  4FWG A;  2CEA A;  1N77 A;  3KS8 A;  2D7E A;  2W82 A;  5F3W A;  1R2Y A;  3FKE A;  2QBY A;  1R7R A;  4LCB A;  3GLG B;  3FUW A;  3RFW A;  3I4Y A;  3FTC A;  2HL7 A;  2E5L M;  3CTW B;  2XGN A;  3WHL A;  4AI6 A;  4FD2 A;  1HT1 E;  3HHZ A;  4JN6 A;  4LY6 A;  5EXS A;  1Q3C A;  1XHB A;  4D82 A;  4LG2 A;  4LJ4 A;  5ITX A;  1IY1 A;  4RNA A;  1QAM A;  2FNA A;  2LH0 A;  2AHM A;  4PDG A;  1GL7 A;  3HHX A;  2V1U A;  1TGU A;  3EIH A;  3MJ5 A;  2Z3X A;  3KOY E;  4MM3 B;  4I81 A;  4IBI A;  1OFI A;  3ZC7 B;  3HJS A;  1NJF A;  4RF1 A;  5FTJ A;  2Q2E B;  2YNM D;  1DGB A;  3L25 A;  3WHK A;  3VDP A;  3U5Z B;  4DR1 M;  1IN7 A;  3LVV A;  3IG8 A;  2UUA M;  3CF2 A;  3GLF B;  1Z6T A;  2Y0T A;  3GRY A;  4KHP M;  1TH3 A;  3U60 B;  2DWM A;  3L26 A;  3A42 A;  1QYR A;  1E9S A;  5DNY A;  2Z4R A;  2ZAO A;  4LJA A;  2L09 A;  4MB7 A;  1XXH B;  4QNR A;  3DOA A;  4DV0 M;  1J5E M;  4MGZ E;  1KFV A;  2ZAN A;  3LQR A;  4JI5 M;  3H4M A;  1HNX M;  4LF6 M;  1G8P A;  4G6Z A;  3KVW A;  4A3V B;  2VII A;  1JQJ C;  3TL4 X;  3UJN A;  4LFB M;  3VLF B;  1N78 A;  1NJG A;  3EIE A;  4JI3 M;  4JXJ A;  2VQF M;  2F5N A;  4NXM M;  2BJW A;  1GL6 A;  4P16 A;  2KA6 B;  2YQZ A;  1G3I A;  4BB9 A;  2DWN A;  3T1Y M;  3VKH A;  1QVR A;  1OFH A;  4IBG A;  2DWZ B;  4IBD A;  4D80 A;  3GLH A;  3GRR A;  2V1C A;  1ZQ9 A;  1DO2 A;  1IQP A;  4LJ8 A;  4OVZ A;  4G4Q A;  4MGI E;  3K2L A;  3SHF A;  2G8L A;  4GIP A;  3J7A S;  3U61 B;  3L28 A;  5DYI A;  1MU5 A;  1UM8 A;  3I4V A;  3C58 A;  3U6Q A;  3J27 B;  1DGF A;  4FCV A;  1SXJ A;  2OQ4 A;  3R8F A;  3B9P A;  5FTN A;  4JI8 M;  3GLG A;  1N34 M;  3W0L B;  3E4R A;  3K92 A;  1IY2 A;  1E94 E;  4GC5 A;  1SXJ C;  3AFH A;  1Q39 A;  1IN8 A;  4DUY M;  2UUC M;  2CHQ A;  3NBI A;  3Q8X A;  3W0F A;  4I8O A;  3KS4 A;  3TQS A;  1L1T A;  4MGH A;  4B3T M;  2UU9 M;  1DGH A;  4DV5 M;  3KP1 E;  4KLN A;  4QNM A;  1JR3 A;  1XNR M;  2XSZ A;  2H1R A;  4AKH A;  3U6M A;  1OJL A;  3FYC A;  4DV4 M;  1YUB A;  1NNU C;  3ILK A;  4LFA M;  2FFJ A;  4LFC M;  5FTK A;  2KZU A;  4NRW A;  2R65 A;  4LGY A;  2DVW B;  1FJG M;  4L15 A;  2ZM6 M;  4L4U A;  4AQY M;  3U60 A;  1IXS B;  4WW0 A;  1IBM M;  3VKG A;  5EP4 A;  3GPX A;  3QAU A;  2K47 A;  4IBC A;  2Y21 A;  4CHT B;  3FTF A;  3TWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...