1GVNA

Crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Postsegregational killing system
molecule keywords EPSILON
publication title Crystal Structure of the Plasmid Maintenance System Epsilon /Zeta : Functional Mechanism of Toxin Zeta and Inactivation by Epsilon 2 Zeta 2 Complex Formation
pubmed doi rcsb
total genus 35
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1gvnA00
2P5TA 3Q8XA 1GVNA
chains in the Genus database with same CATH superfamily
1MN3A 3MHVC 3U5ZA 1G41A 4DR5M 3A45A 1OQYA 3M0EA 4KHPM 1Z59A 4D80A 4IBIA 2H5XA 1G4AE 4G3OA 4LJ7A 3VDUA 4II7A 1TDHA 5EP3A 1FNNA 3UMMA 1AUAA 3FKEA 1R2YA 3W68A 3PVSA 4LF5M 4NSOB 3KFUG 1F4IA 5ITYA 4G4QA 3LQQA 2K0BX 1UM8A 3PNVA 3K8ZA 2C5RA 4A3VB 3E21A 1EE8A 2JZ0A 2Z4RA 2WSEF 4X66M 5JI2E 1EIJA 2D7EA 3AV0A 1NV9A 1OFHA 4FW9A 3SAVA 4AG6A 4NXMM 2QZ4A 4OVZB 2OQ4A 2FH0A 4HLQA 4JI6M 3WHKA 3M7GA 5DFLA 1IN7A 4B3RM 1PGYA 1YLAA 2LVNC 3HHXA 2CV2A 4DR4M 2QP9X 1NY5A 1IBLM 2KXEA 2P5TA 4X62M 2LBCA 1OAOC 3KS8A 2R4EA 1IBKM 4IBEA 4GH9A 1ZV1A 3CF6E 1IXZA 4AZFA 3K92A 1HT1E 3KXEC 3AOEA 4LGYA 2L09A 1VDLA 2X49A 1OIPA 1YUBA 1JQJC 1Z5CA 3VKHA 2CRUA 2FS1A 2R45A 3RE8A 2L7IA 4PCZA 3OTOM 2LHGA 3U60B 3HWSA 3I4YA 4GHAA 4OVZA 1R5LA 3AFHA 3B9PA 4PT5A 4NSRA 5EP1A 3KOWE 4MGZE 2R62A 1XWIA 4FCTA 4I81A 2JWSA 1VEGA 1DGBA 5KPZA 1GL7A 3RGPA 3MMPA 1V92A 3HGIA 2QNJA 1J7KA 1V33A 7CATA 4P16A 4KODA 3U6OA 4DV4M 1DGFA 2Q2EB 2DNAA 2BWEA 1WXQA 2XGNA 3LMMA 5LMUM 5KO3A 1WIVA 1IXSB 3D8LA 2DWNA 3B74A 2M60A 4LY6A 2LVPC 4PDIA 4JI1M 3B7QA 3TL4X 1XNRM 2XEPA 4DV7M 1J09A 1N32M 1C7YA 3J2PB 1XXHB 3HHWA 2XH9A 1Z6TA 5ITXE 4L15A 3QYBA 1Q02A 1E32A 1R2ZA 1E9SA 3SFZA 1D0MA 1RU3A 2Y0QA 5ITUA 2R4JA 1HQCA 3RGSA 4GHLA 1IN6A 2OOAA 4DUZM 3FTDA 2C98A 1GL6A 4XK8F 3SYKA 1W5SA 3VFDA 1IFYA 3HU1A 1SXJB 1PRBA 1IN8A 2H1RA 3GPUA 1IXSA 3FUVA 3L2AA 4CGYB 1IY0A 1A5TA 1VEJA 3SAUA 4NRVA 3JAMS 4L78A 2F5QA 3SHGB 4LFCM 1XXHA 2JP7A 2O01F 3K9PA 5IREB 4BB9A 3C3DA 3I4VA 3KP1E 3SASA 3CTWB 2CP8A 2DZOB 4IBCA 3TPZA 3VLFB 5L8RF 1N33M 2CHVA 2Y20A 1L2DA 1VG5A 4FCWA 4LZZA 5C1BA 2YNMD 3J7BA 4DV1M 2F5PA 2V1UA 3FTEA 1JR3E 2QENA 4HL4A 4MGHA 1QZEA 3L25A 1MX0A 1PJIA 1OFIA 2FFJA 2UUBM 1TH3A 2ZAMA 3F92A 3MJ5A 1SXJA 2CWBA 2LH0A 4CIZA 2L6OA 2I7NA 4OU7A 3JR4A 2CV1A 4MGYE 1QUSA 3FYCA 2Y0TA 1HJPA 2DZNB 2R46A 1Z5AA 1TR8A 1PJJA 3HHZA 4BBAA 1OTRA 2FNAA 5ITQA 3VK7A 3FUUA 3U61B 1XXHE 2L4FA 3GLFB 2HAKA 2DAMA 4RKUF 3AL0C 2LVOC 3SBJA 3HY5A 2UXCM 3GLHE 2VF7A 4LRTA 4WP2A 3ZH9B 2ZM6M 2CV0A 3SARA 3TE6A 1UFZA 1AIPC 4LGMA 1ZMVA 4LJ8A 3ZC7B 1XHBA 5E6JA 4P17A 3A46A 3DZDA 3GRUA 1T6OA 1SXJE 3FTCA 4KT0F 1VQ1A 3CF2A 2RRUA 4MB7A 3TQSA 1D0LA 5FSWA 3GLGB 1YE9A 3HU3A 4PDGA 2R18A 4MM3B 3L29A 3J80S 2CHGA 3EIHA 5DNYA 2LHCA 2MH8A 2EKFA 2ZAOA 4QHSA 3U61A 1K82A 3DOAA 3FD9A 3GLFA 4B3SM 2LVAA 3T38A 3R8FA 1I94M 1C1KA 4JI5M 2APLA 4DR7M 3U6SA 3GO8A 3U6MA 3FUXA 1WJ7A 2R6FA 3HJQA 4L8RC 2XZFA 5EXSA 1Q3BA 4B3MM 4JI2M 1ZMUA 2JA2A 3E46A 4DV5M 4IBGA 2VIIA 3LW5F 3A42A 4XGIA 3GLGA 2JXNA 3CGWA 4AG5A 2BWBA 4R3DA 4JYAM 3AKZA 2CHQA 3U6CA 4LG2A 1HQYE 4JI0M 1TTEA 4LFBM 1QANA 1VEKA 1ZQ9A 3BXWA 1V34A 5FTMA 2JY8A 3RFWA 3TWMA 1JR3D 2DENA 5E26A 4JI8M 1MJGM 3ILKA 1XC8A 2J7NA 1Q39A 1GABA 3I01M 3LCUA 2QQ8A 3UJNA 2K6BA 2EA0A 2L7HA 3SYLA 5EP2A 4WURA 5GKNA 3BOSA 5EXPA 4QOZC 1IM2A 5FLXS 2XZUA 2YR0A 4G4OA 4DV6M 3R9XB 2I7PA 3IECA 2WSCF 4IBBA 1DV0A 4FD2A 4D82A 3HKPA 2J5YA 1QAOA 1GLNA 3J7AS 4DR3M 3FUWA 2Z3XA 3Q8GA 5ITRA 4AI6A 3C3EA 3LCVB 1G3IA 4OW0A 1XMOM 3PFIA 2R0IA 4LF9M 3V76A 3I04M 1QZMA 3U6QA 3AOGA 2KNAA 5EXTA 3QWLA 5KPRA 2LWXA 2X4AA 1GVNA 1QDRA 1HNXM 2O5RA 3B89A 5LMNM 2GQFA 1L2CA 4X65M 2DAGA 3EIEA 2YQZA 2JY6B 2JY7A 3CF0A 2EKKA 1BVSA 2QPAA 1YSYA 4G4RA 4QNRA 1PJQA 2LVQD 1GJTA 1NV8A 1H6UA 1NJFA 2MR9A 2XSZD 2HHHM 1HNWM 2DZLA 1NVMA 1ZMWA 2QCUA 1N36M 2M5ZA 2MGWA 4AKGA 2DWLA 2D7GA 1TH4A 2KNZA 1XMQM 3FRHA 1DO0A 2C9CA 3GPXA 1T43A 1GJSA 3J81S 4REZA 2Z8YM 1NJGA 1EFUB 3NBXX 1HNZM 2DVWB 5A2QS 3KP0E 1QAQA 2L2DA 3KVWA 5DYGA 1KSFX 1HT2E 4I8OA 1Z5BA 4GKJM 4B7FA 4WW0A 3L28A 1W5TA 4DR6M 1TH2A 3HZJA 3T1YM 3FUTA 2EO2A 1NO1A 4GRIA 5KQ8A 1L2BA 2ZTDA 2D7HA 3I51A 3DA1A 4GMQA 4LRSA 4M0WA 1LTMA 2DAKA 4GITA 4D81A 2XLJA 3IG5A 1X37A 4M9SA 4B08A 2KEBA 2MROB 5EP4A 1WHCA 2RKOA 2KRUA 4FWHA 3SHFA 4L16A 4KLNA 1PJTA 4CISA 4G6ZA 2BJWA 1PM5A 4DBGB 4BLCA 1N34M 5EQTA 2F5NA 2LNHC 1G71A 1QAMA 2LTUA 3QAUA 3KSJA 2JNHA 2E5LM 4JI4M 4OX9M 2C9OA 2CEAA 1XB2B 2ZTCA 3W0FA 3VKGA 2FE8A 1WGNA 3AOEC 1I4WA 4LJ5A 1IY2A 2L4EA 2QSFX 2UXDM 1DO2A 4RNAA 2DAIA 2V1CA 2YFQA 4GEWA 4JN6A 3W67A 4HEOA 3T15A 2FOIC 4M9XA 2XFTA 3SMPA 4YY3M 4IIWA 3U6PA 3GLIB 5DYIA 4IJFA 3PNYA 2ZANA 2DWZB 3GRRA 3MK6A 4AQYM 4TUWA 2KZUA 3U6EA 4FWDA 2UXBM 4XBOA 1KFVA 3H4MA 1VDDA 2GNOA 2Z7JA 4KO8A 3E9SA 4LF6M 1ZAEA 4NL4H 2G5GX 2QBYB 1NNUC 1R4GA 2JUJA 2KDLA 3SAWA 2RGHA 3AJIB 1OJLA 3NWLA 4IBKA 2B3TA 2A5YB 2KW0A 3PXGA 3GPYA 4FWGA 3GQ3A 1QVRA 1S3SA 4B7GA 1IQPA 1KYIA 1QDTA 5BR8M 4DR2M 2HWJA 5FTNA 3IG8A 4LF4M 2XF3A 2WSFF 3KOZE 1ORYB 4RF0A 3GLIA 4DR1M 3J27B 2UU9M 1QYRA 3FTFA 1IY1A 3GQ4A 4LZJA 3UZUA 2KA6B 3UGJA 2CFOA 2JY5A 4CJ6A 3GRVA 4X64M 2G8LA 5H37D 3GLFE 3U6LA 8CATA 4AKIA 4LJAA 1DGHB 5IWAM 4AKHA 3JR5A 3K9OA 3B7ZA 2QBYA 4JXJA 3KOXE 2OOBA 2UUAM 2HKJA 1L1TA 1GKIA 2EUCA 2CE7A 2Y21A 2ZBKB 4AW4A 1DGGA 2JZ1A 2DAEA 3B7NA 4B3TM 4F1IA 2DKLA 3HJSA 4Y28F 3Q8XA 5F3WA 3GLGE 4DV0M 2EJSA 2AHMA 2DXIA 4W5WA 4LFAM 5BPVA 3KW6A 2KNVA 1QUTA 2NQ8C 3ZQJA 3FYDA 1NY6A 3KS4A 2MJ5B 3GLIE 1GO5A 4IBDA 1JB0F 3LVVA 5EJCA 5ITXA 1T3TA 1SXJC 2C96A 1N77A 1DGHA 4QHTA 2W82A 3T6PA 4CHTB 2KRKA 1E94E 2V6ZM 4GC5A 2VQEM 4S12A 4JI7M 2BNKA 2KHHA 1SXJD 2F4VM 1G59A 4Z8XA 4ITQA 4GKKM 4FCVA 1L1ZA 1NHWC 3IHPA 4I5SA 2ERCA 3T1HM 2C99A 1IN5A 3GQ5A 5C18A 2G3QA 3ZCBB 3KOYE 2VDBB 4MGKE 4JI3M 1WR1B 1XNQM 2CUZA 1R7RA 4R7GA 3C9PA 1OKSA 1P3QQ 3W0LB 5ITTA 3U60A 1HR0M 3NBIA 2HCBA 1SG9A 2HL7A 2VF8A 2Z4SA 5FTJA 3TWKA 4NOOB 4Q7JA 1D2NA 1Q3CA 3FRIA 2J7OA 2OO9A 1WGLA 3L27A 3QYEA 5FTKA 3UK6A 3VK8A 3K1JA 2F5OA 1JR3A 1Y8GA 1QQWA 4ZPXA 3GLHB 4M0DA 4L6V6 2DHYA 2DWMA 3GPPA 1R6BX 2WZJA 4L4UA 1TGUA 3SATA 5IZ7D 1NHGC 3TWLA 4NXNM 1NSFA 3BBZA 3WHLA 4F2LA 4B7HA 4MH0E 3DFZA 1MU5A 4RF1A 2QHOB 1L8QA 4QOSA 3FE3A 5KQDA 3SC3A 3HHYA 4DUYM 2LXEA 3THGA 1N75A 4NC6A 1D0KA 2XFSA 5JI3E 3HX3A 3H4JA 3GP1A 3K2LA 4MGIE 1IBMM 2N35A 1K3XA 1CUKA 3L26A 2UUCM 2BJVA 1N78A 3LQRA 4UN2B 3GLHA 2O25A 1IXRC 1PJSA 4M9ZA 4DV2M 3HJ8A 3D8BA 4GIPA 4ANRA 3SMSA 4R71A 2K9DA 1OIZA 3KSXA 5FTLA 4FVMA 2R44A 4PD2A 1J5EM 1NNJA 4LF7M 3LVWA 1TDZA 1FJGM 4GC9A 1K3WA 3A98B 3U5ZB 3U6DA 4K0KM 3GRYA 2DHRA 4LJ9A 2OPFA 4IJEA 2R65A 4LCBA 1IN4A 4DV3M 2K47A 4IBJA 1G8PA 4Z6YA 2DI0A 1LV7A 4LJ6A 4NRWA 2X8AA 2XSZA 5EXXA 4EIWA 1OAIA 3E4RA 3HU2A 3M6AA 1TF0B 2RGOA 4I4LA 4LJ4A 3VDPA 3C58A 2KZSA 2VQFM 4QNMA 1E9RA 5IT9S 4JV5M 3KDSE 4G4NA 4YHHM 4LF8M 2F5SA 5KPTA 4IBFA
chains in the Genus database with same CATH topology
3MHVC 3U5ZA 1G41A 4DR5M 3A45A 3M0EA 4KHPM 1Z59A 4D80A 4IBIA 1G4AE 4LJ7A 4JI5M 3VDUA 4II7A 1TDHA 5EP3A 1FNNA 3UMMA 3FKEA 1R2YA 3PVSA 4LF5M 4NSOB 3KFUG 5ITYA 4G4QA 3LQQA 1UM8A 3PNVA 3K8ZA 2C5RA 4A3VB 1EE8A 2Z4RA 4X66M 5JI2E 2D7EA 3AV0A 1OFHA 4FW9A 3SAVA 4AG6A 4NXMM 2QZ4A 4OVZB 2OQ4A 4JI6M 4HLQA 3WHKA 3M7GA 1IN7A 4B3RM 3HHXA 2CV2A 4DR4M 2QP9X 1NY5A 1IBLM 2KXEA 2P5TA 4X62M 3KS8A 2R4EA 1IBKM 4IBEA 4GH9A 3CF6E 1IXZA 4AZFA 3K92A 1HT1E 3KXEC 3AOEA 4LGYA 2L09A 2X49A 1YUBA 1JQJC 1Z5CA 3VKHA 2R45A 3RE8A 4PCZA 4GHAA 2L7IA 3OTOM 3U60B 3HWSA 3I4YA 4OVZA 3AFHA 3B9PA 4PT5A 4NSRA 5EP1A 3KOWE 4MGZE 2R62A 1XWIA 4FCTA 4I81A 1DGBA 5KPZA 1GL7A 3RGPA 3HGIA 1J7KA 7CATA 4P16A 4KODA 3U6OA 4DV4M 1DGFA 2Q2EB 1WXQA 2XGNA 3LMMA 5LMUM 5KO3A 1IXSB 3D8LA 2DWNA 4LY6A 2M60A 4JI1M 4PDIA 3TL4X 1XNRM 2XEPA 4DV7M 1J09A 1N32M 3J2PB 1XXHB 3HHWA 2XH9A 1Z6TA 5ITXE 4L15A 1E32A 1R2ZA 1E9SA 3SFZA 2Y0QA 5ITUA 2R4JA 1HQCA 3RGSA 4GHLA 1IN6A 4DUZM 3FTDA 2C98A 1GL6A 3SYKA 3VFDA 1W5SA 3HU1A 1SXJB 2H1RA 1IN8A 3GPUA 3FUVA 3L2AA 4CGYB 1IY0A 3SAUA 4NRVA 3JAMS 4L78A 2F5QA 3SHGB 4LFCM 1XXHA 5IREB 4BB9A 3I4VA 3KP1E 3SASA 3CTWB 2DZOB 3TPZA 4IBCA 1N33M 3VLFB 2CHVA 2Y20A 1L2DA 4DV1M 4FCWA 4LZZA 5C1BA 2YNMD 3J7BA 3FTEA 2F5PA 2V1UA 2QENA 4HL4A 4MGHA 3L25A 1MX0A 1PJIA 1OFIA 2FFJA 2UUBM 1TH3A 2ZAMA 3MJ5A 1SXJA 2LH0A 3JR4A 2L6OA 2I7NA 4OU7A 2CV1A 4MGYE 3FYCA 2Y0TA 2DZNB 2R46A 1Z5AA 1PJJA 3HHZA 4BBAA 2FNAA 5ITQA 3VK7A 3FUUA 3U61B 3GLFB 3AL0C 3SBJA 2UXCM 4LRTA 3ZH9B 2ZM6M 2CV0A 3SARA 3TE6A 4LGMA 4LJ8A 3ZC7B 1XHBA 5E6JA 3A46A 3DZDA 3GRUA 1SXJE 3FTCA 3GLGB 3CF2A 4MB7A 3TQSA 5FSWA 1YE9A 3HU3A 4PDGA 2R18A 4MM3B 3L29A 3J80S 2CHGA 3EIHA 5DNYA 2ZAOA 4QHSA 3U61A 1K82A 3DOAA 3FD9A 3GLFA 4B3SM 3T38A 3R8FA 1I94M 1C1KA 4DR7M 3U6SA 3GO8A 3U6MA 3FUXA 3HJQA 4L8RC 2XZFA 5EXSA 1Q3BA 4B3MM 4JI2M 4DV5M 2JA2A 4IBGA 2VIIA 3A42A 4XGIA 3GLGA 4AG5A 4R3DA 4JYAM 3AKZA 2CHQA 3U6CA 4LG2A 1HQYE 4JI0M 4LFBM 1QANA 1ZQ9A 5FTMA 3RFWA 3TWMA 1JR3D 5E26A 4JI8M 3ILKA 1XC8A 2J7NA 1Q39A 3UJNA 2EA0A 2L7HA 3SYLA 5EP2A 4WURA 5GKNA 3BOSA 5EXPA 4QOZC 1IM2A 5FLXS 2XZUA 2YR0A 4G4OA 4DV6M 3R9XB 2I7PA 4IBBA 4FD2A 4D82A 3HKPA 1QAOA 1GLNA 3J7AS 4DR3M 3FUWA 2Z3XA 5ITRA 4AI6A 1G3IA 4OW0A 1XMOM 3PFIA 4LF9M 1QZMA 3U6QA 3AOGA 5EXTA 3QWLA 5KPRA 2LWXA 2X4AA 1GVNA 1HNXM 2O5RA 5LMNM 1L2CA 4X65M 3EIEA 2YQZA 3CF0A 2QPAA 1YSYA 4G4RA 4QNRA 1H6UA 1NJFA 2XSZD 2HHHM 1HNWM 1N36M 1NVMA 2QCUA 4AKGA 2M5ZA 2DWLA 2D7GA 1TH4A 1XMQM 1DO0A 2C9CA 3GPXA 3J81S 4REZA 1NJGA 1HNZM 2DVWB 5A2QS 3KP0E 1QAQA 3KVWA 5DYGA 1KSFX 1HT2E 4I8OA 1Z5BA 4GKJM 4B7FA 4WW0A 3L28A 1W5TA 4DR6M 1TH2A 3T1YM 3FUTA 2EO2A 4GRIA 5KQ8A 1L2BA 2D7HA 3I51A 3DA1A 4GMQA 4LRSA 4M0WA 4D81A 4GITA 2XLJA 3IG5A 1X37A 4M9SA 4B08A 2KEBA 5EP4A 2RKOA 2KRUA 4FWHA 3SHFA 4L16A 4KLNA 4CISA 4G6ZA 2BJWA 1PM5A 4BLCA 1N34M 5EQTA 2F5NA 2LNHC 1QAMA 3QAUA 3KSJA 2E5LM 4JI4M 4OX9M 2C9OA 2CEAA 3W0FA 3VKGA 2FE8A 3AOEC 1I4WA 4LJ5A 1IY2A 2UXDM 1DO2A 4RNAA 2V1CA 2YFQA 4JN6A 3T15A 2FOIC 4M9XA 2XFTA 3SMPA 4YY3M 4IIWA 3U6PA 3GLIB 5DYIA 4IJFA 3PNYA 2ZANA 2DWZB 3GRRA 3MK6A 4AQYM 4TUWA 2KZUA 3U6EA 4FWDA 2UXBM 4XBOA 1KFVA 3H4MA 1VDDA 4KO8A 2Z7JA 4LF6M 3E9SA 1ZAEA 4NL4H 2G5GX 2QBYB 1NNUC 3SAWA 2RGHA 3AJIB 1OJLA 3NWLA 4IBKA 3GPYA 2A5YB 2KW0A 3PXGA 4FWGA 3GQ3A 1QVRA 1S3SA 4B7GA 1IQPA 1KYIA 5BR8M 4DR2M 5FTNA 3IG8A 4LF4M 2XF3A 3KOZE 1ORYB 4RF0A 3GLIA 4DR1M 3J27B 2UU9M 1QYRA 3FTFA 1IY1A 3GQ4A 4LZJA 3UZUA 2KA6B 3UGJA 2CFOA 3GRVA 4X64M 2G8LA 5H37D 3U6LA 8CATA 4AKIA 4LJAA 1DGHB 5IWAM 4AKHA 3JR5A 2QBYA 4JXJA 3KOXE 2UUAM 2HKJA 1L1TA 1GKIA 2EUCA 2CE7A 2Y21A 2ZBKB 4AW4A 1DGGA 4B3TM 3HJSA 3Q8XA 5F3WA 4DV0M 2AHMA 2DXIA 4W5WA 4LFAM 5BPVA 3KW6A 2NQ8C 3FYDA 1NY6A 3KS4A 4IBDA 3LVVA 5EJCA 5ITXA 1T3TA 1SXJC 2C96A 1N77A 1DGHA 4QHTA 2W82A 4CHTB 2KRKA 1E94E 2V6ZM 4GC5A 2VQEM 4S12A 4JI7M 2BNKA 1SXJD 2F4VM 1G59A 4Z8XA 4ITQA 4GKKM 4FCVA 1L1ZA 1NHWC 4I5SA 2ERCA 3T1HM 2C99A 1IN5A 3GQ5A 5C18A 3ZCBB 3KOYE 4MGKE 4JI3M 1XNQM 2CUZA 1R7RA 4R7GA 3W0LB 5ITTA 3U60A 1HR0M 3NBIA 2HCBA 2HL7A 2Z4SA 5FTJA 3TWKA 4NOOB 1D2NA 1Q3CA 3L27A 2J7OA 5FTKA 3UK6A 2F5OA 3VK8A 3K1JA 1JR3A 1QQWA 4ZPXA 3GLHB 4M0DA 2DWMA 3GPPA 1R6BX 4L4UA 1TGUA 3SATA 5IZ7D 1NHGC 3TWLA 4NXNM 1NSFA 3WHLA 4B7HA 4MH0E 3DFZA 1MU5A 4RF1A 1L8QA 4QOSA 5KQDA 3SC3A 3HHYA 4DUYM 2LXEA 3THGA 1N75A 2XFSA 5JI3E 3GP1A 3K2LA 4MGIE 1IBMM 1K3XA 3L26A 2UUCM 2BJVA 1N78A 3LQRA 3GLHA 1IXRC 4M9ZA 4DV2M 3HJ8A 3D8BA 4GIPA 3SMSA 3KSXA 5FTLA 4FVMA 4PD2A 1J5EM 1NNJA 4LF7M 3LVWA 1TDZA 1FJGM 4GC9A 1K3WA 3A98B 3U5ZB 3U6DA 4K0KM 3GRYA 2DHRA 4LJ9A 2OPFA 4IJEA 2R65A 4LCBA 1IN4A 4DV3M 2K47A 4IBJA 1G8PA 4Z6YA 4LJ6A 1LV7A 4NRWA 2X8AA 2XSZA 5EXXA 4EIWA 3E4RA 3HU2A 3M6AA 2RGOA 4I4LA 4LJ4A 3VDPA 3C58A 2KZSA 2VQFM 4QNMA 1E9RA 5IT9S 4JV5M 3KDSE 4G4NA 4YHHM 4LF8M 2F5SA 5KPTA 4IBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5T A;  3Q8X A;  1GVN A; 
#chains in the Genus database with same CATH topology
 1MN3 A;  3MHV C;  3U5Z A;  1G41 A;  4DR5 M;  3A45 A;  1OQY A;  3M0E A;  4KHP M;  1Z59 A;  4D80 A;  4IBI A;  2H5X A;  1G4A E;  4G3O A;  4LJ7 A;  3VDU A;  4II7 A;  1TDH A;  5EP3 A;  1FNN A;  3UMM A;  1AUA A;  3FKE A;  1R2Y A;  3W68 A;  3PVS A;  4LF5 M;  4NSO B;  3KFU G;  1F4I A;  5ITY A;  4G4Q A;  3LQQ A;  2K0B X;  1UM8 A;  3PNV A;  3K8Z A;  2C5R A;  4A3V B;  3E21 A;  1EE8 A;  2JZ0 A;  2Z4R A;  2WSE F;  4X66 M;  5JI2 E;  1EIJ A;  2D7E A;  3AV0 A;  1NV9 A;  1OFH A;  4FW9 A;  3SAV A;  4AG6 A;  4NXM M;  2QZ4 A;  4OVZ B;  2OQ4 A;  2FH0 A;  4HLQ A;  4JI6 M;  3WHK A;  3M7G A;  5DFL A;  1IN7 A;  4B3R M;  1PGY A;  1YLA A;  2LVN C;  3HHX A;  2CV2 A;  4DR4 M;  2QP9 X;  1NY5 A;  1IBL M;  2KXE A;  2P5T A;  4X62 M;  2LBC A;  1OAO C;  3KS8 A;  2R4E A;  1IBK M;  4IBE A;  4GH9 A;  1ZV1 A;  3CF6 E;  1IXZ A;  4AZF A;  3K92 A;  1HT1 E;  3KXE C;  3AOE A;  4LGY A;  2L09 A;  1VDL A;  2X49 A;  1OIP A;  1YUB A;  1JQJ C;  1Z5C A;  3VKH A;  2CRU A;  2FS1 A;  2R45 A;  3RE8 A;  2L7I A;  4PCZ A;  3OTO M;  2LHG A;  3U60 B;  3HWS A;  3I4Y A;  4GHA A;  4OVZ A;  1R5L A;  3AFH A;  3B9P A;  4PT5 A;  4NSR A;  5EP1 A;  3KOW E;  4MGZ E;  2R62 A;  1XWI A;  4FCT A;  4I81 A;  2JWS A;  1VEG A;  1DGB A;  5KPZ A;  1GL7 A;  3RGP A;  3MMP A;  1V92 A;  3HGI A;  2QNJ A;  1J7K A;  1V33 A;  7CAT A;  4P16 A;  4KOD A;  3U6O A;  4DV4 M;  1DGF A;  2Q2E B;  2DNA A;  2BWE A;  1WXQ A;  2XGN A;  3LMM A;  5LMU M;  5KO3 A;  1WIV A;  1IXS B;  3D8L A;  2DWN A;  3B74 A;  2M60 A;  4LY6 A;  2LVP C;  4PDI A;  4JI1 M;  3B7Q A;  3TL4 X;  1XNR M;  2XEP A;  4DV7 M;  1J09 A;  1N32 M;  1C7Y A;  3J2P B;  1XXH B;  3HHW A;  2XH9 A;  1Z6T A;  5ITX E;  4L15 A;  3QYB A;  1Q02 A;  1E32 A;  1R2Z A;  1E9S A;  3SFZ A;  1D0M A;  1RU3 A;  2Y0Q A;  5ITU A;  2R4J A;  1HQC A;  3RGS A;  4GHL A;  1IN6 A;  2OOA A;  4DUZ M;  3FTD A;  2C98 A;  1GL6 A;  4XK8 F;  3SYK A;  1W5S A;  3VFD A;  1IFY A;  3HU1 A;  1SXJ B;  1PRB A;  1IN8 A;  2H1R A;  3GPU A;  1IXS A;  3FUV A;  3L2A A;  4CGY B;  1IY0 A;  1A5T A;  1VEJ A;  3SAU A;  4NRV A;  3JAM S;  4L78 A;  2F5Q A;  3SHG B;  4LFC M;  1XXH A;  2JP7 A;  2O01 F;  3K9P A;  5IRE B;  4BB9 A;  3C3D A;  3I4V A;  3KP1 E;  3SAS A;  3CTW B;  2CP8 A;  2DZO B;  4IBC A;  3TPZ A;  3VLF B;  5L8R F;  1N33 M;  2CHV A;  2Y20 A;  1L2D A;  1VG5 A;  4FCW A;  4LZZ A;  5C1B A;  2YNM D;  3J7B A;  4DV1 M;  2F5P A;  2V1U A;  3FTE A;  1JR3 E;  2QEN A;  4HL4 A;  4MGH A;  1QZE A;  3L25 A;  1MX0 A;  1PJI A;  1OFI A;  2FFJ A;  2UUB M;  1TH3 A;  2ZAM A;  3F92 A;  3MJ5 A;  1SXJ A;  2CWB A;  2LH0 A;  4CIZ A;  2L6O A;  2I7N A;  4OU7 A;  3JR4 A;  2CV1 A;  4MGY E;  1QUS A;  3FYC A;  2Y0T A;  1HJP A;  2DZN B;  2R46 A;  1Z5A A;  1TR8 A;  1PJJ A;  3HHZ A;  4BBA A;  1OTR A;  2FNA A;  5ITQ A;  3VK7 A;  3FUU A;  3U61 B;  1XXH E;  2L4F A;  3GLF B;  2HAK A;  2DAM A;  4RKU F;  3AL0 C;  2LVO C;  3SBJ A;  3HY5 A;  2UXC M;  3GLH E;  2VF7 A;  4LRT A;  4WP2 A;  3ZH9 B;  2ZM6 M;  2CV0 A;  3SAR A;  3TE6 A;  1UFZ A;  1AIP C;  4LGM A;  1ZMV A;  4LJ8 A;  3ZC7 B;  1XHB A;  5E6J A;  4P17 A;  3A46 A;  3DZD A;  3GRU A;  1T6O A;  1SXJ E;  3FTC A;  4KT0 F;  1VQ1 A;  3CF2 A;  2RRU A;  4MB7 A;  3TQS A;  1D0L A;  5FSW A;  3GLG B;  1YE9 A;  3HU3 A;  4PDG A;  2R18 A;  4MM3 B;  3L29 A;  3J80 S;  2CHG A;  3EIH A;  5DNY A;  2LHC A;  2MH8 A;  2EKF A;  2ZAO A;  4QHS A;  3U61 A;  1K82 A;  3DOA A;  3FD9 A;  3GLF A;  4B3S M;  2LVA A;  3T38 A;  3R8F A;  1I94 M;  1C1K A;  4JI5 M;  2APL A;  4DR7 M;  3U6S A;  3GO8 A;  3U6M A;  3FUX A;  1WJ7 A;  2R6F A;  3HJQ A;  4L8R C;  2XZF A;  5EXS A;  1Q3B A;  4B3M M;  4JI2 M;  1ZMU A;  2JA2 A;  3E46 A;  4DV5 M;  4IBG A;  2VII A;  3LW5 F;  3A42 A;  4XGI A;  3GLG A;  2JXN A;  3CGW A;  4AG5 A;  2BWB A;  4R3D A;  4JYA M;  3AKZ A;  2CHQ A;  3U6C A;  4LG2 A;  1HQY E;  4JI0 M;  1TTE A;  4LFB M;  1QAN A;  1VEK A;  1ZQ9 A;  3BXW A;  1V34 A;  5FTM A;  2JY8 A;  3RFW A;  3TWM A;  1JR3 D;  2DEN A;  5E26 A;  4JI8 M;  1MJG M;  3ILK A;  1XC8 A;  2J7N A;  1Q39 A;  1GAB A;  3I01 M;  3LCU A;  2QQ8 A;  3UJN A;  2K6B A;  2EA0 A;  2L7H A;  3SYL A;  5EP2 A;  4WUR A;  5GKN A;  3BOS A;  5EXP A;  4QOZ C;  1IM2 A;  5FLX S;  2XZU A;  2YR0 A;  4G4O A;  4DV6 M;  3R9X B;  2I7P A;  3IEC A;  2WSC F;  4IBB A;  1DV0 A;  4FD2 A;  4D82 A;  3HKP A;  2J5Y A;  1QAO A;  1GLN A;  3J7A S;  4DR3 M;  3FUW A;  2Z3X A;  3Q8G A;  5ITR A;  4AI6 A;  3C3E A;  3LCV B;  1G3I A;  4OW0 A;  1XMO M;  3PFI A;  2R0I A;  4LF9 M;  3V76 A;  3I04 M;  1QZM A;  3U6Q A;  3AOG A;  2KNA A;  5EXT A;  3QWL A;  5KPR A;  2LWX A;  2X4A A;  1GVN A;  1QDR A;  1HNX M;  2O5R A;  3B89 A;  5LMN M;  2GQF A;  1L2C A;  4X65 M;  2DAG A;  3EIE A;  2YQZ A;  2JY6 B;  2JY7 A;  3CF0 A;  2EKK A;  1BVS A;  2QPA A;  1YSY A;  4G4R A;  4QNR A;  1PJQ A;  2LVQ D;  1GJT A;  1NV8 A;  1H6U A;  1NJF A;  2MR9 A;  2XSZ D;  2HHH M;  1HNW M;  2DZL A;  1NVM A;  1ZMW A;  2QCU A;  1N36 M;  2M5Z A;  2MGW A;  4AKG A;  2DWL A;  2D7G A;  1TH4 A;  2KNZ A;  1XMQ M;  3FRH A;  1DO0 A;  2C9C A;  3GPX A;  1T43 A;  1GJS A;  3J81 S;  4REZ A;  2Z8Y M;  1NJG A;  1EFU B;  3NBX X;  1HNZ M;  2DVW B;  5A2Q S;  3KP0 E;  1QAQ A;  2L2D A;  3KVW A;  5DYG A;  1KSF X;  1HT2 E;  4I8O A;  1Z5B A;  4GKJ M;  4B7F A;  4WW0 A;  3L28 A;  1W5T A;  4DR6 M;  1TH2 A;  3HZJ A;  3T1Y M;  3FUT A;  2EO2 A;  1NO1 A;  4GRI A;  5KQ8 A;  1L2B A;  2ZTD A;  2D7H A;  3I51 A;  3DA1 A;  4GMQ A;  4LRS A;  4M0W A;  1LTM A;  2DAK A;  4GIT A;  4D81 A;  2XLJ A;  3IG5 A;  1X37 A;  4M9S A;  4B08 A;  2KEB A;  2MRO B;  5EP4 A;  1WHC A;  2RKO A;  2KRU A;  4FWH A;  3SHF A;  4L16 A;  4KLN A;  1PJT A;  4CIS A;  4G6Z A;  2BJW A;  1PM5 A;  4DBG B;  4BLC A;  1N34 M;  5EQT A;  2F5N A;  2LNH C;  1G71 A;  1QAM A;  2LTU A;  3QAU A;  3KSJ A;  2JNH A;  2E5L M;  4JI4 M;  4OX9 M;  2C9O A;  2CEA A;  1XB2 B;  2ZTC A;  3W0F A;  3VKG A;  2FE8 A;  1WGN A;  3AOE C;  1I4W A;  4LJ5 A;  1IY2 A;  2L4E A;  2QSF X;  2UXD M;  1DO2 A;  4RNA A;  2DAI A;  2V1C A;  2YFQ A;  4GEW A;  4JN6 A;  3W67 A;  4HEO A;  3T15 A;  2FOI C;  4M9X A;  2XFT A;  3SMP A;  4YY3 M;  4IIW A;  3U6P A;  3GLI B;  5DYI A;  4IJF A;  3PNY A;  2ZAN A;  2DWZ B;  3GRR A;  3MK6 A;  4AQY M;  4TUW A;  2KZU A;  3U6E A;  4FWD A;  2UXB M;  4XBO A;  1KFV A;  3H4M A;  1VDD A;  2GNO A;  2Z7J A;  4KO8 A;  3E9S A;  4LF6 M;  1ZAE A;  4NL4 H;  2G5G X;  2QBY B;  1NNU C;  1R4G A;  2JUJ A;  2KDL A;  3SAW A;  2RGH A;  3AJI B;  1OJL A;  3NWL A;  4IBK A;  2B3T A;  2A5Y B;  2KW0 A;  3PXG A;  3GPY A;  4FWG A;  3GQ3 A;  1QVR A;  1S3S A;  4B7G A;  1IQP A;  1KYI A;  1QDT A;  5BR8 M;  4DR2 M;  2HWJ A;  5FTN A;  3IG8 A;  4LF4 M;  2XF3 A;  2WSF F;  3KOZ E;  1ORY B;  4RF0 A;  3GLI A;  4DR1 M;  3J27 B;  2UU9 M;  1QYR A;  3FTF A;  1IY1 A;  3GQ4 A;  4LZJ A;  3UZU A;  2KA6 B;  3UGJ A;  2CFO A;  2JY5 A;  4CJ6 A;  3GRV A;  4X64 M;  2G8L A;  5H37 D;  3GLF E;  3U6L A;  8CAT A;  4AKI A;  4LJA A;  1DGH B;  5IWA M;  4AKH A;  3JR5 A;  3K9O A;  3B7Z A;  2QBY A;  4JXJ A;  3KOX E;  2OOB A;  2UUA M;  2HKJ A;  1L1T A;  1GKI A;  2EUC A;  2CE7 A;  2Y21 A;  2ZBK B;  4AW4 A;  1DGG A;  2JZ1 A;  2DAE A;  3B7N A;  4B3T M;  4F1I A;  2DKL A;  3HJS A;  4Y28 F;  3Q8X A;  5F3W A;  3GLG E;  4DV0 M;  2EJS A;  2AHM A;  2DXI A;  4W5W A;  4LFA M;  5BPV A;  3KW6 A;  2KNV A;  1QUT A;  2NQ8 C;  3ZQJ A;  3FYD A;  1NY6 A;  3KS4 A;  2MJ5 B;  3GLI E;  1GO5 A;  4IBD A;  1JB0 F;  3LVV A;  5EJC A;  5ITX A;  1T3T A;  1SXJ C;  2C96 A;  1N77 A;  1DGH A;  4QHT A;  2W82 A;  3T6P A;  4CHT B;  2KRK A;  1E94 E;  2V6Z M;  4GC5 A;  2VQE M;  4S12 A;  4JI7 M;  2BNK A;  2KHH A;  1SXJ D;  2F4V M;  1G59 A;  4Z8X A;  4ITQ A;  4GKK M;  4FCV A;  1L1Z A;  1NHW C;  3IHP A;  4I5S A;  2ERC A;  3T1H M;  2C99 A;  1IN5 A;  3GQ5 A;  5C18 A;  2G3Q A;  3ZCB B;  3KOY E;  2VDB B;  4MGK E;  4JI3 M;  1WR1 B;  1XNQ M;  2CUZ A;  1R7R A;  4R7G A;  3C9P A;  1OKS A;  1P3Q Q;  3W0L B;  5ITT A;  3U60 A;  1HR0 M;  3NBI A;  2HCB A;  1SG9 A;  2HL7 A;  2VF8 A;  2Z4S A;  5FTJ A;  3TWK A;  4NOO B;  4Q7J A;  1D2N A;  1Q3C A;  3FRI A;  2J7O A;  2OO9 A;  1WGL A;  3L27 A;  3QYE A;  5FTK A;  3UK6 A;  3VK8 A;  3K1J A;  2F5O A;  1JR3 A;  1Y8G A;  1QQW A;  4ZPX A;  3GLH B;  4M0D A;  4L6V 6;  2DHY A;  2DWM A;  3GPP A;  1R6B X;  2WZJ A;  4L4U A;  1TGU A;  3SAT A;  5IZ7 D;  1NHG C;  3TWL A;  4NXN M;  1NSF A;  3BBZ A;  3WHL A;  4F2L A;  4B7H A;  4MH0 E;  3DFZ A;  1MU5 A;  4RF1 A;  2QHO B;  1L8Q A;  4QOS A;  3FE3 A;  5KQD A;  3SC3 A;  3HHY A;  4DUY M;  2LXE A;  3THG A;  1N75 A;  4NC6 A;  1D0K A;  2XFS A;  5JI3 E;  3HX3 A;  3H4J A;  3GP1 A;  3K2L A;  4MGI E;  1IBM M;  2N35 A;  1K3X A;  1CUK A;  3L26 A;  2UUC M;  2BJV A;  1N78 A;  3LQR A;  4UN2 B;  3GLH A;  2O25 A;  1IXR C;  1PJS A;  4M9Z A;  4DV2 M;  3HJ8 A;  3D8B A;  4GIP A;  4ANR A;  3SMS A;  4R71 A;  2K9D A;  1OIZ A;  3KSX A;  5FTL A;  4FVM A;  2R44 A;  4PD2 A;  1J5E M;  1NNJ A;  4LF7 M;  3LVW A;  1TDZ A;  1FJG M;  4GC9 A;  1K3W A;  3A98 B;  3U5Z B;  3U6D A;  4K0K M;  3GRY A;  2DHR A;  4LJ9 A;  2OPF A;  4IJE A;  2R65 A;  4LCB A;  1IN4 A;  4DV3 M;  2K47 A;  4IBJ A;  1G8P A;  4Z6Y A;  2DI0 A;  1LV7 A;  4LJ6 A;  4NRW A;  2X8A A;  2XSZ A;  5EXX A;  4EIW A;  1OAI A;  3E4R A;  3HU2 A;  3M6A A;  1TF0 B;  2RGO A;  4I4L A;  4LJ4 A;  3VDP A;  3C58 A;  2KZS A;  2VQF M;  4QNM A;  1E9R A;  5IT9 S;  4JV5 M;  3KDS E;  4G4N A;  4YHH M;  4LF8 M;  2F5S A;  5KPT A;  4IBF A; 
#chains in the Genus database with same CATH homology
 3MHV C;  3U5Z A;  1G41 A;  4DR5 M;  3A45 A;  3M0E A;  4KHP M;  1Z59 A;  4D80 A;  4IBI A;  1G4A E;  4LJ7 A;  4JI5 M;  3VDU A;  4II7 A;  1TDH A;  5EP3 A;  1FNN A;  3UMM A;  3FKE A;  1R2Y A;  3PVS A;  4LF5 M;  4NSO B;  3KFU G;  5ITY A;  4G4Q A;  3LQQ A;  1UM8 A;  3PNV A;  3K8Z A;  2C5R A;  4A3V B;  1EE8 A;  2Z4R A;  4X66 M;  5JI2 E;  2D7E A;  3AV0 A;  1OFH A;  4FW9 A;  3SAV A;  4AG6 A;  4NXM M;  2QZ4 A;  4OVZ B;  2OQ4 A;  4JI6 M;  4HLQ A;  3WHK A;  3M7G A;  1IN7 A;  4B3R M;  3HHX A;  2CV2 A;  4DR4 M;  2QP9 X;  1NY5 A;  1IBL M;  2KXE A;  2P5T A;  4X62 M;  3KS8 A;  2R4E A;  1IBK M;  4IBE A;  4GH9 A;  3CF6 E;  1IXZ A;  4AZF A;  3K92 A;  1HT1 E;  3KXE C;  3AOE A;  4LGY A;  2L09 A;  2X49 A;  1YUB A;  1JQJ C;  1Z5C A;  3VKH A;  2R45 A;  3RE8 A;  4PCZ A;  4GHA A;  2L7I A;  3OTO M;  3U60 B;  3HWS A;  3I4Y A;  4OVZ A;  3AFH A;  3B9P A;  4PT5 A;  4NSR A;  5EP1 A;  3KOW E;  4MGZ E;  2R62 A;  1XWI A;  4FCT A;  4I81 A;  1DGB A;  5KPZ A;  1GL7 A;  3RGP A;  3HGI A;  1J7K A;  7CAT A;  4P16 A;  4KOD A;  3U6O A;  4DV4 M;  1DGF A;  2Q2E B;  1WXQ A;  2XGN A;  3LMM A;  5LMU M;  5KO3 A;  1IXS B;  3D8L A;  2DWN A;  4LY6 A;  2M60 A;  4JI1 M;  4PDI A;  3TL4 X;  1XNR M;  2XEP A;  4DV7 M;  1J09 A;  1N32 M;  3J2P B;  1XXH B;  3HHW A;  2XH9 A;  1Z6T A;  5ITX E;  4L15 A;  1E32 A;  1R2Z A;  1E9S A;  3SFZ A;  2Y0Q A;  5ITU A;  2R4J A;  1HQC A;  3RGS A;  4GHL A;  1IN6 A;  4DUZ M;  3FTD A;  2C98 A;  1GL6 A;  3SYK A;  3VFD A;  1W5S A;  3HU1 A;  1SXJ B;  2H1R A;  1IN8 A;  3GPU A;  3FUV A;  3L2A A;  4CGY B;  1IY0 A;  3SAU A;  4NRV A;  3JAM S;  4L78 A;  2F5Q A;  3SHG B;  4LFC M;  1XXH A;  5IRE B;  4BB9 A;  3I4V A;  3KP1 E;  3SAS A;  3CTW B;  2DZO B;  3TPZ A;  4IBC A;  1N33 M;  3VLF B;  2CHV A;  2Y20 A;  1L2D A;  4DV1 M;  4FCW A;  4LZZ A;  5C1B A;  2YNM D;  3J7B A;  3FTE A;  2F5P A;  2V1U A;  2QEN A;  4HL4 A;  4MGH A;  3L25 A;  1MX0 A;  1PJI A;  1OFI A;  2FFJ A;  2UUB M;  1TH3 A;  2ZAM A;  3MJ5 A;  1SXJ A;  2LH0 A;  3JR4 A;  2L6O A;  2I7N A;  4OU7 A;  2CV1 A;  4MGY E;  3FYC A;  2Y0T A;  2DZN B;  2R46 A;  1Z5A A;  1PJJ A;  3HHZ A;  4BBA A;  2FNA A;  5ITQ A;  3VK7 A;  3FUU A;  3U61 B;  3GLF B;  3AL0 C;  3SBJ A;  2UXC M;  4LRT A;  3ZH9 B;  2ZM6 M;  2CV0 A;  3SAR A;  3TE6 A;  4LGM A;  4LJ8 A;  3ZC7 B;  1XHB A;  5E6J A;  3A46 A;  3DZD A;  3GRU A;  1SXJ E;  3FTC A;  3GLG B;  3CF2 A;  4MB7 A;  3TQS A;  5FSW A;  1YE9 A;  3HU3 A;  4PDG A;  2R18 A;  4MM3 B;  3L29 A;  3J80 S;  2CHG A;  3EIH A;  5DNY A;  2ZAO A;  4QHS A;  3U61 A;  1K82 A;  3DOA A;  3FD9 A;  3GLF A;  4B3S M;  3T38 A;  3R8F A;  1I94 M;  1C1K A;  4DR7 M;  3U6S A;  3GO8 A;  3U6M A;  3FUX A;  3HJQ A;  4L8R C;  2XZF A;  5EXS A;  1Q3B A;  4B3M M;  4JI2 M;  4DV5 M;  2JA2 A;  4IBG A;  2VII A;  3A42 A;  4XGI A;  3GLG A;  4AG5 A;  4R3D A;  4JYA M;  3AKZ A;  2CHQ A;  3U6C A;  4LG2 A;  1HQY E;  4JI0 M;  4LFB M;  1QAN A;  1ZQ9 A;  5FTM A;  3RFW A;  3TWM A;  1JR3 D;  5E26 A;  4JI8 M;  3ILK A;  1XC8 A;  2J7N A;  1Q39 A;  3UJN A;  2EA0 A;  2L7H A;  3SYL A;  5EP2 A;  4WUR A;  5GKN A;  3BOS A;  5EXP A;  4QOZ C;  1IM2 A;  5FLX S;  2XZU A;  2YR0 A;  4G4O A;  4DV6 M;  3R9X B;  2I7P A;  4IBB A;  4FD2 A;  4D82 A;  3HKP A;  1QAO A;  1GLN A;  3J7A S;  4DR3 M;  3FUW A;  2Z3X A;  5ITR A;  4AI6 A;  1G3I A;  4OW0 A;  1XMO M;  3PFI A;  4LF9 M;  1QZM A;  3U6Q A;  3AOG A;  5EXT A;  3QWL A;  5KPR A;  2LWX A;  2X4A A;  1GVN A;  1HNX M;  2O5R A;  5LMN M;  1L2C A;  4X65 M;  3EIE A;  2YQZ A;  3CF0 A;  2QPA A;  1YSY A;  4G4R A;  4QNR A;  1H6U A;  1NJF A;  2XSZ D;  2HHH M;  1HNW M;  1N36 M;  1NVM A;  2QCU A;  4AKG A;  2M5Z A;  2DWL A;  2D7G A;  1TH4 A;  1XMQ M;  1DO0 A;  2C9C A;  3GPX A;  3J81 S;  4REZ A;  1NJG A;  1HNZ M;  2DVW B;  5A2Q S;  3KP0 E;  1QAQ A;  3KVW A;  5DYG A;  1KSF X;  1HT2 E;  4I8O A;  1Z5B A;  4GKJ M;  4B7F A;  4WW0 A;  3L28 A;  1W5T A;  4DR6 M;  1TH2 A;  3T1Y M;  3FUT A;  2EO2 A;  4GRI A;  5KQ8 A;  1L2B A;  2D7H A;  3I51 A;  3DA1 A;  4GMQ A;  4LRS A;  4M0W A;  4D81 A;  4GIT A;  2XLJ A;  3IG5 A;  1X37 A;  4M9S A;  4B08 A;  2KEB A;  5EP4 A;  2RKO A;  2KRU A;  4FWH A;  3SHF A;  4L16 A;  4KLN A;  4CIS A;  4G6Z A;  2BJW A;  1PM5 A;  4BLC A;  1N34 M;  5EQT A;  2F5N A;  2LNH C;  1QAM A;  3QAU A;  3KSJ A;  2E5L M;  4JI4 M;  4OX9 M;  2C9O A;  2CEA A;  3W0F A;  3VKG A;  2FE8 A;  3AOE C;  1I4W A;  4LJ5 A;  1IY2 A;  2UXD M;  1DO2 A;  4RNA A;  2V1C A;  2YFQ A;  4JN6 A;  3T15 A;  2FOI C;  4M9X A;  2XFT A;  3SMP A;  4YY3 M;  4IIW A;  3U6P A;  3GLI B;  5DYI A;  4IJF A;  3PNY A;  2ZAN A;  2DWZ B;  3GRR A;  3MK6 A;  4AQY M;  4TUW A;  2KZU A;  3U6E A;  4FWD A;  2UXB M;  4XBO A;  1KFV A;  3H4M A;  1VDD A;  4KO8 A;  2Z7J A;  4LF6 M;  3E9S A;  1ZAE A;  4NL4 H;  2G5G X;  2QBY B;  1NNU C;  3SAW A;  2RGH A;  3AJI B;  1OJL A;  3NWL A;  4IBK A;  3GPY A;  2A5Y B;  2KW0 A;  3PXG A;  4FWG A;  3GQ3 A;  1QVR A;  1S3S A;  4B7G A;  1IQP A;  1KYI A;  5BR8 M;  4DR2 M;  5FTN A;  3IG8 A;  4LF4 M;  2XF3 A;  3KOZ E;  1ORY B;  4RF0 A;  3GLI A;  4DR1 M;  3J27 B;  2UU9 M;  1QYR A;  3FTF A;  1IY1 A;  3GQ4 A;  4LZJ A;  3UZU A;  2KA6 B;  3UGJ A;  2CFO A;  3GRV A;  4X64 M;  2G8L A;  5H37 D;  3U6L A;  8CAT A;  4AKI A;  4LJA A;  1DGH B;  5IWA M;  4AKH A;  3JR5 A;  2QBY A;  4JXJ A;  3KOX E;  2UUA M;  2HKJ A;  1L1T A;  1GKI A;  2EUC A;  2CE7 A;  2Y21 A;  2ZBK B;  4AW4 A;  1DGG A;  4B3T M;  3HJS A;  3Q8X A;  5F3W A;  4DV0 M;  2AHM A;  2DXI A;  4W5W A;  4LFA M;  5BPV A;  3KW6 A;  2NQ8 C;  3FYD A;  1NY6 A;  3KS4 A;  4IBD A;  3LVV A;  5EJC A;  5ITX A;  1T3T A;  1SXJ C;  2C96 A;  1N77 A;  1DGH A;  4QHT A;  2W82 A;  4CHT B;  2KRK A;  1E94 E;  2V6Z M;  4GC5 A;  2VQE M;  4S12 A;  4JI7 M;  2BNK A;  1SXJ D;  2F4V M;  1G59 A;  4Z8X A;  4ITQ A;  4GKK M;  4FCV A;  1L1Z A;  1NHW C;  4I5S A;  2ERC A;  3T1H M;  2C99 A;  1IN5 A;  3GQ5 A;  5C18 A;  3ZCB B;  3KOY E;  4MGK E;  4JI3 M;  1XNQ M;  2CUZ A;  1R7R A;  4R7G A;  3W0L B;  5ITT A;  3U60 A;  1HR0 M;  3NBI A;  2HCB A;  2HL7 A;  2Z4S A;  5FTJ A;  3TWK A;  4NOO B;  1D2N A;  1Q3C A;  3L27 A;  2J7O A;  5FTK A;  3UK6 A;  2F5O A;  3VK8 A;  3K1J A;  1JR3 A;  1QQW A;  4ZPX A;  3GLH B;  4M0D A;  2DWM A;  3GPP A;  1R6B X;  4L4U A;  1TGU A;  3SAT A;  5IZ7 D;  1NHG C;  3TWL A;  4NXN M;  1NSF A;  3WHL A;  4B7H A;  4MH0 E;  3DFZ A;  1MU5 A;  4RF1 A;  1L8Q A;  4QOS A;  5KQD A;  3SC3 A;  3HHY A;  4DUY M;  2LXE A;  3THG A;  1N75 A;  2XFS A;  5JI3 E;  3GP1 A;  3K2L A;  4MGI E;  1IBM M;  1K3X A;  3L26 A;  2UUC M;  2BJV A;  1N78 A;  3LQR A;  3GLH A;  1IXR C;  4M9Z A;  4DV2 M;  3HJ8 A;  3D8B A;  4GIP A;  3SMS A;  3KSX A;  5FTL A;  4FVM A;  4PD2 A;  1J5E M;  1NNJ A;  4LF7 M;  3LVW A;  1TDZ A;  1FJG M;  4GC9 A;  1K3W A;  3A98 B;  3U5Z B;  3U6D A;  4K0K M;  3GRY A;  2DHR A;  4LJ9 A;  2OPF A;  4IJE A;  2R65 A;  4LCB A;  1IN4 A;  4DV3 M;  2K47 A;  4IBJ A;  1G8P A;  4Z6Y A;  4LJ6 A;  1LV7 A;  4NRW A;  2X8A A;  2XSZ A;  5EXX A;  4EIW A;  3E4R A;  3HU2 A;  3M6A A;  2RGO A;  4I4L A;  4LJ4 A;  3VDP A;  3C58 A;  2KZS A;  2VQF M;  4QNM A;  1E9R A;  5IT9 S;  4JV5 M;  3KDS E;  4G4N A;  4YHH M;  4LF8 M;  2F5S A;  5KPT A;  4IBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...