1GVNA

Crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSILON
publication title Crystal Structure of the Plasmid Maintenance System Epsilon /Zeta : Functional Mechanism of Toxin Zeta and Inactivation by Epsilon 2 Zeta 2 Complex Formation
pubmed doi rcsb
molecule tags Postsegregational killing system
total genus 35
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1gvnA00
3Q8XA 2P5TA 1GVNA
chains in the Genus database with same CATH superfamily
1QDRA 4QHTA 2Z7JA 2JY7A 1KYIA 4I4LA 3RFWA 1L2BA 2A5YB 2DAGA 5BPVA 2O25A 3J2PB 4KO8A 3FRHA 4OU7A 2ZTCA 4DR1M 3KFUG 1VG5A 3KXEC 1R2YA 2JZ0A 3CGWA 1N34M 4AZFA 4DR5M 2LNHC 1J09A 3FUXA 3KP0E 4Q7JA 4MGIE 1NHGC 2M5ZA 1G3IA 2R45A 4I81A 5IT9S 3THGA 2DVWB 4DR3M 3GLIA 3QAUA 2EKFA 5C18A 3HU1A 1D0MA 3GPYA 3U6SA 4LCBA 1IXSB 3KVWA 4PT5A 4JI5M 5LMUM 2EA0A 1HNXM 1PGYA 1DO2A 1W5SA 4RKUF 3H4JA 4OVZA 4YY3M 1HNZM 4G3OA 4M0DA 3RGSA 2L6OA 3B7QA 2WZJA 5ITUA 3BXWA 4JN6A 1XMQM 3HJ8A 4KODA 1DGHA 4AKHA 1H6UA 5EP2A 2CE7A 5ITXA 4B08A 3I01M 4AKGA 4P17A 2HCBA 2G5GX 1SXJE 3PNYA 4GMQA 1XXHB 4GC5A 4PD2A 3LVVA 4L8RC 3HJSA 5ITYA 1QAMA 1QQWA 3E21A 4LG2A 1E94E 3FTCA 2N35A 3E46A 3K9PA 3SC3A 2JNHA 4R7GA 2UUBM 4G4RA 5LMNM 2CEAA 1GLNA 1NV8A 4HEOA 4NSOB 4YHHM 2UXDM 5EXSA 2HL7A 1IM2A 3FUVA 2JY5A 2QP9X 2LBCA 2OO9A 4D81A 2XH9A 1C7YA 2KNVA 4JI7M 2YFQA 2F5PA 4FCVA 2F5QA 4S12A 2FFJA 4ANRA 4DUYM 3PNVA 2DHYA 3I4VA 1IXSA 3HGIA 5IWAM 3AV0A 4GC9A 5EP1A 4DR7M 2B3TA 3SASA 4QHSA 4MH0E 1Z5AA 2CV2A 3C3EA 3KW6A 3TL4X 2O5RA 5EXPA 3UK6A 2VF8A 4GH9A 1N77A 1N75A 5KPZA 1LTMA 2AHMA 1TH2A 3J81S 4IBBA 4B7FA 1E9RA 4MGKE 4B3TM 2GQFA 2DHRA 3B74A 4DV1M 1ZQ9A 1NJGA 5EXXA 3JR4A 3SAWA 4L78A 1GL6A 1PJTA 4DV2M 5FTKA 2DAMA 3A46A 1XXHA 4HLQA 1NHWC 2DNAA 4FWDA 3MHVC 1T3TA 2FNAA 1L2CA 2OOAA 5DFLA 4DV3M 3A45A 3SATA 1N32M 3FUUA 1N33M 2F4VM 2L4FA 1NNUC 1I94M 2KEBA 5FTNA 1T43A 2MJ5B 2R4EA 4GHAA 2L7IA 1D0LA 1DV0A 1NY5A 3A98B 3LCUA 5JI2E 2QHOB 1HJPA 1W5TA 1I4WA 4IBJA 2VQFM 2I7PA 1Z6TA 2XLJA 3KSXA 1ZMUA 3HX3A 4RF0A 3GQ3A 2XFSA 2KW0A 3HKPA 4DR4M 1XNQM 4LJ5A 3BOSA 1J7KA 4X66M 1TH4A 2DENA 1IN6A 3HY5A 4GHLA 3CTWB 2QBYB 3FTFA 4FD2A 2EO2A 1L1ZA 1WHCA 1N78A 4KT0F 4LF7M 2JP7A 3AOEC 1Q3CA 2R18A 4MGHA 3TE6A 1XWIA 3DFZA 4NXNM 3GLGB 5KQ8A 3SAUA 3M0EA 4IJFA 1ZV1A 1OTRA 1HT2E 3IG8A 3Q8GA 1TGUA 4Y28F 5JI3E 1K82A 3M6AA 3KS4A 1IBKM 7CATA 1TF0B 1NSFA 3GLIE 3T6PA 2KRKA 2CV1A 3JAMS 3K2LA 4LFBM 3QYBA 1R2ZA 2Z3XA 1F4IA 1Q02A 2MROB 3SYLA 3PFIA 3T15A 4AW4A 2C5RA 3GLFB 2UXBM 3U6PA 2EJSA 4IJEA 4M0WA 1NY6A 1T6OA 5E6JA 3AOEA 3AFHA 2RGHA 4JI0M 1GJTA 1VDLA 5ITXE 5IZ7D 3U6QA 2C96A 4D82A 1G8PA 2KZUA 4LGYA 2BJVA 1N36M 1IXZA 4WP2A 3KP1E 4MM3B 3ILKA 2L2DA 3SBJA 2QBYA 2K47A 3RE8A 1GABA 3C3DA 5ITTA 1RU3A 3ZH9B 1PJIA 4I5SA 1PJSA 3K8ZA 4BLCA 1R5LA 5F3WA 3B89A 4NOOB 1OIPA 2FOIC 3TQSA 4NL4H 3GLHB 3U6EA 1YE9A 3KDSE 3GLGA 2V1UA 1JR3E 4IIWA 4LJ4A 4XK8F 2ZBKB 2XFTA 1X37A 3FTDA 2UUCM 4LY6A 1TTEA 1QZEA 3GRRA 2APLA 4M9XA 1FJGM 4DV0M 4LJ8A 3VKGA 1IXRC 4IBKA 4FWGA 4EIWA 1Z5BA 3GLHE 2EKKA 4MB7A 1DGGA 3VK7A 1VDDA 2DI0A 4Z6YA 1PJQA 1GL7A 1QYRA 3R9XB 2Q2EB 4AG6A 1S3SA 3GO8A 2CRUA 2YQZA 3J27B 3VLFB 3FRIA 1XNRM 4IBGA 2KZSA 3GLFA 3VKHA 1GVNA 1HQCA 2QNJA 4REZA 1MN3A 1IFYA 4DV6M 4JI6M 1Z5CA 1VEKA 1JR3D 1IY1A 4LF8M 2L09A 3MMPA 1XB2B 1JQJC 2DWZB 2R62A 5DNYA 3GPXA 1JR3A 2LXEA 1WGNA 1AUAA 2WSFF 1XXHE 3AJIB 2QENA 4NRWA 3M7GA 4P16A 3V76A 1TR8A 1Q39A 4HL4A 3IG5A 3IHPA 3KSJA 3ZC7B 3MJ5A 5H37D 3B9PA 2LVPC 2QZ4A 2R4JA 3GLHA 2HWJA 4LGMA 4DUZM 2QSFX 3L28A 3A42A 1YSYA 3PXGA 4CJ6A 2LH0A 1PJJA 2W82A 1UFZA 2MGWA 3J80S 3BBZA 4IBIA 5KO3A 1J5EM 3LW5F 1WGLA 3J7BA 1IN7A 2MH8A 4JI2M 2LVAA 4M9SA 1XC8A 2DWMA 3QYEA 4A3VB 1XMOM 4IBEA 4B7HA 3K9OA 2YNMD 1VEGA 3KOZE 3C58A 4ITQA 5EP3A 3WHKA 4LFCM 1QVRA 5E26A 4QNMA 3U5ZB 1C1KA 4LJAA 1MX0A 4BBAA 5FSWA 2VQEM 3FE3A 2RGOA 4GKJM 1P3QQ 4MGYE 4CHTB 2O01F 4XBOA 5A2QS 1GKIA 2LTUA 4OW0A 4L15A 4CGYB 4F1IA 3U6DA 4B7GA 4DR6M 1QUTA 3I51A 1KSFX 2J7NA 3U6OA 3T1HM 2VF7A 4X64M 2DZNB 1XHBA 3DA1A 5KPRA 1A5TA 2OOBA 1IBLM 3UJNA 4F2LA 1HQYE 2I7NA 4RF1A 4D80A 5FLXS 1HR0M 2LVNC 2DZLA 4FCTA 4TUWA 2G8LA 1QAOA 3W67A 1WIVA 1IN8A 2XEPA 4R71A 2WSCF 2C98A 2Y20A 2F5NA 4WURA 4LZJA 2H5XA 2V1CA 3GRVA 1UM8A 2Y0TA 3AOGA 4FCWA 4CIZA 4CISA 2R6FA 4AKIA 1PRBA 2JWSA 3W0FA 2C9OA 2DAEA 3U6CA 4AQYM 3KS8A 3GRYA 4LJ6A 2BWEA 2UXCM 1PM5A 3HU3A 4QOZC 4LF5M 2JY8A 1ZAEA 3CF0A 3K92A 4X62M 3U5ZA 3FKEA 2M60A 1WJ7A 2DKLA 3SFZA 4QNRA 2LHGA 1OFHA 3L27A 4LF4M 4K0KM 2X4AA 2BWBA 3GRUA 4LZZA 3L29A 4NC6A 1VQ1A 2F5OA 4B3SM 4L4UA 3GLGE 4FWHA 4DBGB 4X65M 4KLNA 2DAKA 2DWNA 3DZDA 1BVSA 4LFAM 1VEJA 3UGJA 1QZMA 4R3DA 1K3WA 1Q3BA 2X8AA 1TDHA 3LVWA 2K6BA 1L8QA 2LVQD 2Z4RA 4JI4M 1OFIA 3T1YM 4NRVA 2J7OA 2FH0A 2VDBB 3LQRA 2XSZD 3HHWA 3LMMA 3SMSA 3SAVA 4G4NA 3ZQJA 3FYDA 1AIPC 2R44A 3W68A 4NXMM 4XGIA 2XSZA 3FYCA 3HHXA 3VK8A 3GLFE 2UUAM 1QDTA 1G4AE 2LWXA 1OIZA 8CATA 5L8RF 4L16A 2QPAA 4JI3M 1Y8GA 3HWSA 2ERCA 1EE8A 4GIPA 3GP1A 3U6MA 1KFVA 4DV4M 4L6V6 5DYIA 2BNKA 4B3MM 4BB9A 1NVMA 4DR2M 4FVMA 2CHGA 2CHQA 1NNJA 3D8LA 3R8FA 3NBXX 4JYAM 2FS1A 1OAIA 3FUTA 4PDIA 4B3RM 2VIIA 3E9SA 1DGBA 1IY2A 1E32A 2K0BX 5ITQA 3FTEA 3TWLA 3J7AS 1R7RA 2YR0A 5EXTA 2MR9A 3NBIA 3FUWA 1NO1A 2ZANA 3KOXE 3GPUA 1EIJA 3LQQA 5EJCA 2JA2A 3CF2A 2XZUA 2HKJA 4IBCA 3L25A 3C9PA 3KOWE 1QUSA 1SXJB 2CHVA 3KOYE 2RRUA 2D7HA 4NSRA 4G4QA 1ORYB 1G41A 3WHLA 2H1RA 1YUBA 2R46A 3U60B 1ZMWA 4PDGA 1IN4A 3B7ZA 1IQPA 2L7HA 1TDZA 3K1JA 3W0LB 3I4YA 2V6ZM 3UMMA 1SXJC 2ZM6M 1D0KA 2D7GA 4IBDA 1NV9A 3HHZA 5FTJA 3JR5A 2P5TA 5EQTA 3L2AA 2JUJA 3LCVB 4GEWA 3U61B 1IY0A 2KXEA 2GNOA 4LF6M 4GITA 2ZTDA 2F5SA 4LF9M 2Y0QA 2QQ8A 3TWMA 1IN5A 3QWLA 3L26A 4MGZE 1HT1E 2KNAA 1K3XA 4G4OA 2JZ1A 3EIEA 3Q8XA 4FW9A 1NJFA 2QCUA 2R0IA 2D7EA 2LVOC 1SXJD 2WSEF 4JI8M 1G59A 4DV5M 4RNAA 1V92A 1GJSA 3VDUA 1SXJA 4UN2B 2OPFA 1E9SA 3SARA 2CWBA 4IBFA 3ZCBB 1GO5A 3UZUA 2DWLA 2L4EA 1DO0A 5IREB 1Z59A 5BR8M 2KRUA 3GQ4A 3TPZA 1V34A 3I04M 3U60A 4JI1M 2HHHM 2LHCA 4JXJA 3PVSA 3EIHA 3H4MA 3F92A 2Z4SA 1HNWM 2X49A 1SG9A 3DOAA 3E4RA 3VFDA 2EUCA 4W5WA 5KPTA 2OQ4A 1FNNA 3IECA 4KHPM 3MK6A 2Y21A 4AG5A 4G6ZA 3HU2A 1G71A 1V33A 4M9ZA 3U61A 2DZOB 3GPPA 3NWLA 3SHGB 1OQYA 2E5LM 4LRTA 3T38A 4AI6A 2K9DA 3HJQA 4JV5M 3B7NA 2J5YA 2CUZA 3VDPA 4DV7M 3OTOM 4OX9M 3FD9A 1OJLA 2BJWA 2KDLA 5FTMA 3HHYA 1QANA 2XZFA 2C9CA 1OAOC 2CP8A 4ZPXA 3TWKA 4II7A 4PCZA 4Z8XA 1OKSA 4GRIA 1WXQA 5C1BA 5EP4A 1YLAA 2XGNA 4QOSA 1D2NA 1IBMM 3D8BA 5DYGA 4I8OA 2KHHA 2RKOA 3GLIB 2UU9M 3CF6E 2HAKA 4WW0A 1L1TA 3SMPA 5ITRA 3HZJA 1L2DA 1DGFA 1ZMVA 4LJ9A 2JXNA 1JB0F 1QAQA 2KNZA 4OVZB 2R65A 4LJ7A 2CV0A 3AKZA 2C99A 2FE8A 1LV7A 1WR1B 1EFUB 1R6BX 2KA6B 1MU5A 2XF3A 2Z8YM 5FTLA 3AL0C 2G3QA 2NQ8C 1R4GA 3RGPA 1DGHB 3SHFA 5KQDA 1CUKA 2JY6B 3SYKA 5GKNA 4LRSA 2ZAOA 2DXIA 2CFOA 1MJGM 2ZAMA 2DAIA 3GQ5A 4GKKM 3U6LA 1TH3A
chains in the Genus database with same CATH topology
4QHTA 2Z7JA 1KYIA 4I4LA 3RFWA 1L2BA 2A5YB 5BPVA 3J2PB 4KO8A 4OU7A 4DR1M 3KFUG 3KXEC 1R2YA 1N34M 4AZFA 4DR5M 2LNHC 1J09A 3FUXA 3KP0E 4MGIE 1NHGC 2M5ZA 1G3IA 2R45A 4I81A 5IT9S 3THGA 2DVWB 4DR3M 3GLIA 3QAUA 5C18A 3GPYA 3HU1A 3U6SA 4LCBA 1IXSB 3KVWA 4PT5A 4JI5M 5LMUM 2EA0A 1HNXM 1DO2A 1W5SA 4YY3M 4OVZA 1HNZM 4M0DA 3RGSA 2L6OA 5ITUA 4JN6A 1XMQM 3HJ8A 4KODA 1DGHA 4AKHA 1H6UA 5EP2A 2CE7A 5ITXA 4B08A 4AKGA 2HCBA 2G5GX 1SXJE 3PNYA 4GMQA 1XXHB 4GC5A 4PD2A 3LVVA 4L8RC 3HJSA 5ITYA 1QAMA 1QQWA 4LG2A 1E94E 3FTCA 3SC3A 4R7GA 2UUBM 4G4RA 5LMNM 2CEAA 1GLNA 4YHHM 2UXDM 4NSOB 5EXSA 2HL7A 1IM2A 3FUVA 2QP9X 4D81A 2XH9A 4JI7M 2YFQA 2F5PA 4FCVA 2F5QA 4S12A 2FFJA 4DUYM 3PNVA 3I4VA 3HGIA 5IWAM 3AV0A 4GC9A 5EP1A 4DR7M 3SASA 4QHSA 4MH0E 1Z5AA 2CV2A 3KW6A 3TL4X 2O5RA 5EXPA 3UK6A 4GH9A 1N77A 1N75A 5KPZA 2AHMA 1TH2A 3J81S 4IBBA 4B7FA 1E9RA 4MGKE 4B3TM 2DHRA 4DV1M 1ZQ9A 1NJGA 5EXXA 3JR4A 3SAWA 4L78A 1GL6A 4DV2M 5FTKA 3A46A 1XXHA 4HLQA 1NHWC 4FWDA 3MHVC 1T3TA 2FNAA 1L2CA 4DV3M 3A45A 3SATA 1N32M 3FUUA 1N33M 2F4VM 1I94M 1NNUC 2KEBA 5FTNA 4GHAA 2R4EA 2L7IA 1NY5A 3A98B 5JI2E 1W5TA 1I4WA 4IBJA 2VQFM 2I7PA 1Z6TA 2XLJA 3KSXA 4RF0A 3GQ3A 2XFSA 2KW0A 3HKPA 4DR4M 1XNQM 4LJ5A 3BOSA 1J7KA 4X66M 1TH4A 1IN6A 4GHLA 3CTWB 2QBYB 3FTFA 4FD2A 2EO2A 1L1ZA 1N78A 4LF7M 3AOEC 1Q3CA 2R18A 4MGHA 3TE6A 1XWIA 3DFZA 4NXNM 3GLGB 5KQ8A 3SAUA 3M0EA 4IJFA 5JI3E 1K82A 1HT2E 3IG8A 1TGUA 3M6AA 3KS4A 1IBKM 7CATA 1NSFA 2KRKA 2CV1A 3JAMS 3K2LA 4LFBM 1R2ZA 2Z3XA 3SYLA 3PFIA 3T15A 4AW4A 2C5RA 3GLFB 2UXBM 3U6PA 4IJEA 4M0WA 1NY6A 5E6JA 3AOEA 3AFHA 2RGHA 4JI0M 5ITXE 5IZ7D 3U6QA 2C96A 4D82A 1G8PA 2KZUA 4LGYA 2BJVA 1N36M 1IXZA 3KP1E 4MM3B 3ILKA 3SBJA 2QBYA 2K47A 3RE8A 5ITTA 3ZH9B 1PJIA 4I5SA 3K8ZA 4BLCA 5F3WA 3TQSA 4NOOB 2FOIC 4NL4H 3GLHB 3U6EA 1YE9A 3KDSE 3GLGA 2V1UA 4LJ4A 4IIWA 2ZBKB 2XFTA 1X37A 3FTDA 2UUCM 4LY6A 3GRRA 4M9XA 1FJGM 4DV0M 4LJ8A 3VKGA 1IXRC 4IBKA 4FWGA 4EIWA 1Z5BA 4MB7A 1DGGA 3VK7A 1VDDA 4Z6YA 3R9XB 1GL7A 1QYRA 2Q2EB 4AG6A 1S3SA 3GO8A 2YQZA 3J27B 3VLFB 1XNRM 4IBGA 2KZSA 3GLFA 3VKHA 1GVNA 1HQCA 4REZA 4DV6M 4JI6M 1Z5CA 1JR3D 1IY1A 4LF8M 2L09A 1JQJC 2DWZB 2R62A 5DNYA 3GPXA 1JR3A 2LXEA 3AJIB 2QENA 4NRWA 3M7GA 4P16A 1Q39A 4HL4A 3IG5A 3ZC7B 3KSJA 5H37D 3MJ5A 3B9PA 2QZ4A 2R4JA 3GLHA 4LGMA 4DUZM 3L28A 3A42A 1YSYA 3PXGA 2LH0A 1PJJA 2W82A 3J80S 4IBIA 5KO3A 1J5EM 3J7BA 1IN7A 4JI2M 4M9SA 1XC8A 2DWMA 4A3VB 1XMOM 4IBEA 4B7HA 2YNMD 3KOZE 3C58A 4ITQA 5EP3A 3WHKA 4LFCM 1QVRA 5E26A 4QNMA 3U5ZB 1C1KA 4LJAA 1MX0A 4BBAA 5FSWA 2VQEM 2RGOA 4GKJM 4MGYE 4CHTB 4XBOA 5A2QS 1GKIA 4OW0A 4L15A 4CGYB 3U6DA 4B7GA 4DR6M 3I51A 3T1HM 1KSFX 2J7NA 3U6OA 4X64M 2DZNB 1XHBA 3DA1A 5KPRA 1IBLM 3UJNA 1HQYE 2I7NA 4RF1A 4D80A 5FLXS 1HR0M 4FCTA 4TUWA 2G8LA 1QAOA 1IN8A 2XEPA 2C98A 2Y20A 2F5NA 4WURA 4LZJA 2V1CA 3GRVA 1UM8A 2Y0TA 3AOGA 4FCWA 4CISA 4AKIA 3W0FA 2C9OA 3U6CA 4AQYM 3KS8A 3GRYA 4LJ6A 2UXCM 1PM5A 3HU3A 4QOZC 4LF5M 1ZAEA 3CF0A 3K92A 4X62M 3U5ZA 3FKEA 2M60A 3SFZA 4QNRA 1OFHA 3L27A 4LF4M 4K0KM 2X4AA 4LZZA 3GRUA 3L29A 2F5OA 4B3SM 4L4UA 4FWHA 4X65M 4KLNA 2DWNA 3DZDA 4LFAM 3UGJA 1QZMA 4R3DA 1K3WA 1Q3BA 2X8AA 1TDHA 3LVWA 1L8QA 2Z4RA 4JI4M 1OFIA 3T1YM 4NRVA 2J7OA 3LQRA 2XSZD 3HHWA 3LMMA 3SMSA 3SAVA 4G4NA 3FYDA 4NXMM 4XGIA 2XSZA 3FYCA 3HHXA 3VK8A 2UUAM 1G4AE 2LWXA 8CATA 4L16A 2QPAA 4JI3M 3GP1A 3HWSA 2ERCA 1EE8A 4GIPA 3U6MA 1KFVA 4DV4M 5DYIA 2BNKA 4B3MM 4BB9A 1NVMA 4DR2M 4FVMA 2CHGA 2CHQA 1NNJA 3D8LA 3R8FA 4JYAM 3FUTA 4PDIA 4B3RM 3E9SA 2VIIA 1DGBA 1IY2A 1E32A 5ITQA 3FTEA 3TWLA 3J7AS 1R7RA 2YR0A 5EXTA 3NBIA 3FUWA 2ZANA 3KOXE 3GPUA 3LQQA 5EJCA 2JA2A 3CF2A 2XZUA 2HKJA 4IBCA 3L25A 3KOWE 1SXJB 2CHVA 3KOYE 2D7HA 4NSRA 4G4QA 1ORYB 1G41A 3WHLA 2H1RA 1YUBA 2R46A 3U60B 4PDGA 1IN4A 1IQPA 2L7HA 1TDZA 3K1JA 3W0LB 3I4YA 2V6ZM 3UMMA 1SXJC 2ZM6M 2D7GA 4IBDA 3HHZA 5FTJA 3JR5A 2P5TA 5EQTA 3L2AA 3U61B 1IY0A 2KXEA 4LF6M 4GITA 2F5SA 4LF9M 2Y0QA 3TWMA 1IN5A 3QWLA 3L26A 4MGZE 1HT1E 1K3XA 4G4OA 3Q8XA 3EIEA 4FW9A 1NJFA 2QCUA 2D7EA 1SXJD 4JI8M 1G59A 4DV5M 4RNAA 3VDUA 1SXJA 2OPFA 1E9SA 3SARA 4IBFA 3ZCBB 3UZUA 2DWLA 5IREB 1DO0A 1Z59A 5BR8M 2KRUA 3GQ4A 3TPZA 3U60A 4JI1M 2HHHM 4JXJA 3PVSA 3EIHA 3H4MA 2Z4SA 1HNWM 2X49A 3DOAA 3E4RA 3VFDA 5KPTA 2EUCA 4W5WA 2OQ4A 1FNNA 4KHPM 3MK6A 2Y21A 4AG5A 4G6ZA 3HU2A 4M9ZA 3U61A 2DZOB 3GPPA 3NWLA 3SHGB 2E5LM 4LRTA 3T38A 4AI6A 3HJQA 4JV5M 2CUZA 3VDPA 4DV7M 3OTOM 4OX9M 3FD9A 1OJLA 2BJWA 5FTMA 3HHYA 1QANA 2XZFA 2C9CA 4ZPXA 3TWKA 4II7A 4PCZA 4Z8XA 4GRIA 1WXQA 5C1BA 5EP4A 4QOSA 2XGNA 1D2NA 1IBMM 3D8BA 5DYGA 4I8OA 2RKOA 3GLIB 2UU9M 3CF6E 4WW0A 1L1TA 3SMPA 5ITRA 1L2DA 1DGFA 4LJ9A 1QAQA 4OVZB 2R65A 4LJ7A 2CV0A 3AKZA 2C99A 2FE8A 1LV7A 1R6BX 2XF3A 2KA6B 1MU5A 5FTLA 3AL0C 2NQ8C 3RGPA 1DGHB 3SHFA 5KQDA 3SYKA 5GKNA 4LRSA 2ZAOA 2DXIA 2CFOA 2ZAMA 4GKKM 3GQ5A 3U6LA 1TH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  2P5T A;  1GVN A; 
#chains in the Genus database with same CATH topology
 1QDR A;  4QHT A;  2Z7J A;  2JY7 A;  1KYI A;  4I4L A;  3RFW A;  1L2B A;  2A5Y B;  2DAG A;  5BPV A;  2O25 A;  3J2P B;  4KO8 A;  3FRH A;  4OU7 A;  2ZTC A;  4DR1 M;  3KFU G;  1VG5 A;  3KXE C;  1R2Y A;  2JZ0 A;  3CGW A;  1N34 M;  4AZF A;  4DR5 M;  2LNH C;  1J09 A;  3FUX A;  3KP0 E;  4Q7J A;  4MGI E;  1NHG C;  2M5Z A;  1G3I A;  2R45 A;  4I81 A;  5IT9 S;  3THG A;  2DVW B;  4DR3 M;  3GLI A;  3QAU A;  2EKF A;  5C18 A;  3HU1 A;  1D0M A;  3GPY A;  3U6S A;  4LCB A;  1IXS B;  3KVW A;  4PT5 A;  4JI5 M;  5LMU M;  2EA0 A;  1HNX M;  1PGY A;  1DO2 A;  1W5S A;  4RKU F;  3H4J A;  4OVZ A;  4YY3 M;  1HNZ M;  4G3O A;  4M0D A;  3RGS A;  2L6O A;  3B7Q A;  2WZJ A;  5ITU A;  3BXW A;  4JN6 A;  1XMQ M;  3HJ8 A;  4KOD A;  1DGH A;  4AKH A;  1H6U A;  5EP2 A;  2CE7 A;  5ITX A;  4B08 A;  3I01 M;  4AKG A;  4P17 A;  2HCB A;  2G5G X;  1SXJ E;  3PNY A;  4GMQ A;  1XXH B;  4GC5 A;  4PD2 A;  3LVV A;  4L8R C;  3HJS A;  5ITY A;  1QAM A;  1QQW A;  3E21 A;  4LG2 A;  1E94 E;  3FTC A;  2N35 A;  3E46 A;  3K9P A;  3SC3 A;  2JNH A;  4R7G A;  2UUB M;  4G4R A;  5LMN M;  2CEA A;  1GLN A;  1NV8 A;  4HEO A;  4NSO B;  4YHH M;  2UXD M;  5EXS A;  2HL7 A;  1IM2 A;  3FUV A;  2JY5 A;  2QP9 X;  2LBC A;  2OO9 A;  4D81 A;  2XH9 A;  1C7Y A;  2KNV A;  4JI7 M;  2YFQ A;  2F5P A;  4FCV A;  2F5Q A;  4S12 A;  2FFJ A;  4ANR A;  4DUY M;  3PNV A;  2DHY A;  3I4V A;  1IXS A;  3HGI A;  5IWA M;  3AV0 A;  4GC9 A;  5EP1 A;  4DR7 M;  2B3T A;  3SAS A;  4QHS A;  4MH0 E;  1Z5A A;  2CV2 A;  3C3E A;  3KW6 A;  3TL4 X;  2O5R A;  5EXP A;  3UK6 A;  2VF8 A;  4GH9 A;  1N77 A;  1N75 A;  5KPZ A;  1LTM A;  2AHM A;  1TH2 A;  3J81 S;  4IBB A;  4B7F A;  1E9R A;  4MGK E;  4B3T M;  2GQF A;  2DHR A;  3B74 A;  4DV1 M;  1ZQ9 A;  1NJG A;  5EXX A;  3JR4 A;  3SAW A;  4L78 A;  1GL6 A;  1PJT A;  4DV2 M;  5FTK A;  2DAM A;  3A46 A;  1XXH A;  4HLQ A;  1NHW C;  2DNA A;  4FWD A;  3MHV C;  1T3T A;  2FNA A;  1L2C A;  2OOA A;  5DFL A;  4DV3 M;  3A45 A;  3SAT A;  1N32 M;  3FUU A;  1N33 M;  2F4V M;  2L4F A;  1NNU C;  1I94 M;  2KEB A;  5FTN A;  1T43 A;  2MJ5 B;  2R4E A;  4GHA A;  2L7I A;  1D0L A;  1DV0 A;  1NY5 A;  3A98 B;  3LCU A;  5JI2 E;  2QHO B;  1HJP A;  1W5T A;  1I4W A;  4IBJ A;  2VQF M;  2I7P A;  1Z6T A;  2XLJ A;  3KSX A;  1ZMU A;  3HX3 A;  4RF0 A;  3GQ3 A;  2XFS A;  2KW0 A;  3HKP A;  4DR4 M;  1XNQ M;  4LJ5 A;  3BOS A;  1J7K A;  4X66 M;  1TH4 A;  2DEN A;  1IN6 A;  3HY5 A;  4GHL A;  3CTW B;  2QBY B;  3FTF A;  4FD2 A;  2EO2 A;  1L1Z A;  1WHC A;  1N78 A;  4KT0 F;  4LF7 M;  2JP7 A;  3AOE C;  1Q3C A;  2R18 A;  4MGH A;  3TE6 A;  1XWI A;  3DFZ A;  4NXN M;  3GLG B;  5KQ8 A;  3SAU A;  3M0E A;  4IJF A;  1ZV1 A;  1OTR A;  1HT2 E;  3IG8 A;  3Q8G A;  1TGU A;  4Y28 F;  5JI3 E;  1K82 A;  3M6A A;  3KS4 A;  1IBK M;  7CAT A;  1TF0 B;  1NSF A;  3GLI E;  3T6P A;  2KRK A;  2CV1 A;  3JAM S;  3K2L A;  4LFB M;  3QYB A;  1R2Z A;  2Z3X A;  1F4I A;  1Q02 A;  2MRO B;  3SYL A;  3PFI A;  3T15 A;  4AW4 A;  2C5R A;  3GLF B;  2UXB M;  3U6P A;  2EJS A;  4IJE A;  4M0W A;  1NY6 A;  1T6O A;  5E6J A;  3AOE A;  3AFH A;  2RGH A;  4JI0 M;  1GJT A;  1VDL A;  5ITX E;  5IZ7 D;  3U6Q A;  2C96 A;  4D82 A;  1G8P A;  2KZU A;  4LGY A;  2BJV A;  1N36 M;  1IXZ A;  4WP2 A;  3KP1 E;  4MM3 B;  3ILK A;  2L2D A;  3SBJ A;  2QBY A;  2K47 A;  3RE8 A;  1GAB A;  3C3D A;  5ITT A;  1RU3 A;  3ZH9 B;  1PJI A;  4I5S A;  1PJS A;  3K8Z A;  4BLC A;  1R5L A;  5F3W A;  3B89 A;  4NOO B;  1OIP A;  2FOI C;  3TQS A;  4NL4 H;  3GLH B;  3U6E A;  1YE9 A;  3KDS E;  3GLG A;  2V1U A;  1JR3 E;  4IIW A;  4LJ4 A;  4XK8 F;  2ZBK B;  2XFT A;  1X37 A;  3FTD A;  2UUC M;  4LY6 A;  1TTE A;  1QZE A;  3GRR A;  2APL A;  4M9X A;  1FJG M;  4DV0 M;  4LJ8 A;  3VKG A;  1IXR C;  4IBK A;  4FWG A;  4EIW A;  1Z5B A;  3GLH E;  2EKK A;  4MB7 A;  1DGG A;  3VK7 A;  1VDD A;  2DI0 A;  4Z6Y A;  1PJQ A;  1GL7 A;  1QYR A;  3R9X B;  2Q2E B;  4AG6 A;  1S3S A;  3GO8 A;  2CRU A;  2YQZ A;  3J27 B;  3VLF B;  3FRI A;  1XNR M;  4IBG A;  2KZS A;  3GLF A;  3VKH A;  1GVN A;  1HQC A;  2QNJ A;  4REZ A;  1MN3 A;  1IFY A;  4DV6 M;  4JI6 M;  1Z5C A;  1VEK A;  1JR3 D;  1IY1 A;  4LF8 M;  2L09 A;  3MMP A;  1XB2 B;  1JQJ C;  2DWZ B;  2R62 A;  5DNY A;  3GPX A;  1JR3 A;  2LXE A;  1WGN A;  1AUA A;  2WSF F;  1XXH E;  3AJI B;  2QEN A;  4NRW A;  3M7G A;  4P16 A;  3V76 A;  1TR8 A;  1Q39 A;  4HL4 A;  3IG5 A;  3IHP A;  3KSJ A;  3ZC7 B;  3MJ5 A;  5H37 D;  3B9P A;  2LVP C;  2QZ4 A;  2R4J A;  3GLH A;  2HWJ A;  4LGM A;  4DUZ M;  2QSF X;  3L28 A;  3A42 A;  1YSY A;  3PXG A;  4CJ6 A;  2LH0 A;  1PJJ A;  2W82 A;  1UFZ A;  2MGW A;  3J80 S;  3BBZ A;  4IBI A;  5KO3 A;  1J5E M;  3LW5 F;  1WGL A;  3J7B A;  1IN7 A;  2MH8 A;  4JI2 M;  2LVA A;  4M9S A;  1XC8 A;  2DWM A;  3QYE A;  4A3V B;  1XMO M;  4IBE A;  4B7H A;  3K9O A;  2YNM D;  1VEG A;  3KOZ E;  3C58 A;  4ITQ A;  5EP3 A;  3WHK A;  4LFC M;  1QVR A;  5E26 A;  4QNM A;  3U5Z B;  1C1K A;  4LJA A;  1MX0 A;  4BBA A;  5FSW A;  2VQE M;  3FE3 A;  2RGO A;  4GKJ M;  1P3Q Q;  4MGY E;  4CHT B;  2O01 F;  4XBO A;  5A2Q S;  1GKI A;  2LTU A;  4OW0 A;  4L15 A;  4CGY B;  4F1I A;  3U6D A;  4B7G A;  4DR6 M;  1QUT A;  3I51 A;  1KSF X;  2J7N A;  3U6O A;  3T1H M;  2VF7 A;  4X64 M;  2DZN B;  1XHB A;  3DA1 A;  5KPR A;  1A5T A;  2OOB A;  1IBL M;  3UJN A;  4F2L A;  1HQY E;  2I7N A;  4RF1 A;  4D80 A;  5FLX S;  1HR0 M;  2LVN C;  2DZL A;  4FCT A;  4TUW A;  2G8L A;  1QAO A;  3W67 A;  1WIV A;  1IN8 A;  2XEP A;  4R71 A;  2WSC F;  2C98 A;  2Y20 A;  2F5N A;  4WUR A;  4LZJ A;  2H5X A;  2V1C A;  3GRV A;  1UM8 A;  2Y0T A;  3AOG A;  4FCW A;  4CIZ A;  4CIS A;  2R6F A;  4AKI A;  1PRB A;  2JWS A;  3W0F A;  2C9O A;  2DAE A;  3U6C A;  4AQY M;  3KS8 A;  3GRY A;  4LJ6 A;  2BWE A;  2UXC M;  1PM5 A;  3HU3 A;  4QOZ C;  4LF5 M;  2JY8 A;  1ZAE A;  3CF0 A;  3K92 A;  4X62 M;  3U5Z A;  3FKE A;  2M60 A;  1WJ7 A;  2DKL A;  3SFZ A;  4QNR A;  2LHG A;  1OFH A;  3L27 A;  4LF4 M;  4K0K M;  2X4A A;  2BWB A;  3GRU A;  4LZZ A;  3L29 A;  4NC6 A;  1VQ1 A;  2F5O A;  4B3S M;  4L4U A;  3GLG E;  4FWH A;  4DBG B;  4X65 M;  4KLN A;  2DAK A;  2DWN A;  3DZD A;  1BVS A;  4LFA M;  1VEJ A;  3UGJ A;  1QZM A;  4R3D A;  1K3W A;  1Q3B A;  2X8A A;  1TDH A;  3LVW A;  2K6B A;  1L8Q A;  2LVQ D;  2Z4R A;  4JI4 M;  1OFI A;  3T1Y M;  4NRV A;  2J7O A;  2FH0 A;  2VDB B;  3LQR A;  2XSZ D;  3HHW A;  3LMM A;  3SMS A;  3SAV A;  4G4N A;  3ZQJ A;  3FYD A;  1AIP C;  2R44 A;  3W68 A;  4NXM M;  4XGI A;  2XSZ A;  3FYC A;  3HHX A;  3VK8 A;  3GLF E;  2UUA M;  1QDT A;  1G4A E;  2LWX A;  1OIZ A;  8CAT A;  5L8R F;  4L16 A;  2QPA A;  4JI3 M;  1Y8G A;  3HWS A;  2ERC A;  1EE8 A;  4GIP A;  3GP1 A;  3U6M A;  1KFV A;  4DV4 M;  4L6V 6;  5DYI A;  2BNK A;  4B3M M;  4BB9 A;  1NVM A;  4DR2 M;  4FVM A;  2CHG A;  2CHQ A;  1NNJ A;  3D8L A;  3R8F A;  3NBX X;  4JYA M;  2FS1 A;  1OAI A;  3FUT A;  4PDI A;  4B3R M;  2VII A;  3E9S A;  1DGB A;  1IY2 A;  1E32 A;  2K0B X;  5ITQ A;  3FTE A;  3TWL A;  3J7A S;  1R7R A;  2YR0 A;  5EXT A;  2MR9 A;  3NBI A;  3FUW A;  1NO1 A;  2ZAN A;  3KOX E;  3GPU A;  1EIJ A;  3LQQ A;  5EJC A;  2JA2 A;  3CF2 A;  2XZU A;  2HKJ A;  4IBC A;  3L25 A;  3C9P A;  3KOW E;  1QUS A;  1SXJ B;  2CHV A;  3KOY E;  2RRU A;  2D7H A;  4NSR A;  4G4Q A;  1ORY B;  1G41 A;  3WHL A;  2H1R A;  1YUB A;  2R46 A;  3U60 B;  1ZMW A;  4PDG A;  1IN4 A;  3B7Z A;  1IQP A;  2L7H A;  1TDZ A;  3K1J A;  3W0L B;  3I4Y A;  2V6Z M;  3UMM A;  1SXJ C;  2ZM6 M;  1D0K A;  2D7G A;  4IBD A;  1NV9 A;  3HHZ A;  5FTJ A;  3JR5 A;  2P5T A;  5EQT A;  3L2A A;  2JUJ A;  3LCV B;  4GEW A;  3U61 B;  1IY0 A;  2KXE A;  2GNO A;  4LF6 M;  4GIT A;  2ZTD A;  2F5S A;  4LF9 M;  2Y0Q A;  2QQ8 A;  3TWM A;  1IN5 A;  3QWL A;  3L26 A;  4MGZ E;  1HT1 E;  2KNA A;  1K3X A;  4G4O A;  2JZ1 A;  3EIE A;  3Q8X A;  4FW9 A;  1NJF A;  2QCU A;  2R0I A;  2D7E A;  2LVO C;  1SXJ D;  2WSE F;  4JI8 M;  1G59 A;  4DV5 M;  4RNA A;  1V92 A;  1GJS A;  3VDU A;  1SXJ A;  4UN2 B;  2OPF A;  1E9S A;  3SAR A;  2CWB A;  4IBF A;  3ZCB B;  1GO5 A;  3UZU A;  2DWL A;  2L4E A;  1DO0 A;  5IRE B;  1Z59 A;  5BR8 M;  2KRU A;  3GQ4 A;  3TPZ A;  1V34 A;  3I04 M;  3U60 A;  4JI1 M;  2HHH M;  2LHC A;  4JXJ A;  3PVS A;  3EIH A;  3H4M A;  3F92 A;  2Z4S A;  1HNW M;  2X49 A;  1SG9 A;  3DOA A;  3E4R A;  3VFD A;  2EUC A;  4W5W A;  5KPT A;  2OQ4 A;  1FNN A;  3IEC A;  4KHP M;  3MK6 A;  2Y21 A;  4AG5 A;  4G6Z A;  3HU2 A;  1G71 A;  1V33 A;  4M9Z A;  3U61 A;  2DZO B;  3GPP A;  3NWL A;  3SHG B;  1OQY A;  2E5L M;  4LRT A;  3T38 A;  4AI6 A;  2K9D A;  3HJQ A;  4JV5 M;  3B7N A;  2J5Y A;  2CUZ A;  3VDP A;  4DV7 M;  3OTO M;  4OX9 M;  3FD9 A;  1OJL A;  2BJW A;  2KDL A;  5FTM A;  3HHY A;  1QAN A;  2XZF A;  2C9C A;  1OAO C;  2CP8 A;  4ZPX A;  3TWK A;  4II7 A;  4PCZ A;  4Z8X A;  1OKS A;  4GRI A;  1WXQ A;  5C1B A;  5EP4 A;  1YLA A;  2XGN A;  4QOS A;  1D2N A;  1IBM M;  3D8B A;  5DYG A;  4I8O A;  2KHH A;  2RKO A;  3GLI B;  2UU9 M;  3CF6 E;  2HAK A;  4WW0 A;  1L1T A;  3SMP A;  5ITR A;  3HZJ A;  1L2D A;  1DGF A;  1ZMV A;  4LJ9 A;  2JXN A;  1JB0 F;  1QAQ A;  2KNZ A;  4OVZ B;  2R65 A;  4LJ7 A;  2CV0 A;  3AKZ A;  2C99 A;  2FE8 A;  1LV7 A;  1WR1 B;  1EFU B;  1R6B X;  2KA6 B;  1MU5 A;  2XF3 A;  2Z8Y M;  5FTL A;  3AL0 C;  2G3Q A;  2NQ8 C;  1R4G A;  3RGP A;  1DGH B;  3SHF A;  5KQD A;  1CUK A;  2JY6 B;  3SYK A;  5GKN A;  4LRS A;  2ZAO A;  2DXI A;  2CFO A;  1MJG M;  2ZAM A;  2DAI A;  3GQ5 A;  4GKK M;  3U6L A;  1TH3 A; 
#chains in the Genus database with same CATH homology
 4QHT A;  2Z7J A;  1KYI A;  4I4L A;  3RFW A;  1L2B A;  2A5Y B;  5BPV A;  3J2P B;  4KO8 A;  4OU7 A;  4DR1 M;  3KFU G;  3KXE C;  1R2Y A;  1N34 M;  4AZF A;  4DR5 M;  2LNH C;  1J09 A;  3FUX A;  3KP0 E;  4MGI E;  1NHG C;  2M5Z A;  1G3I A;  2R45 A;  4I81 A;  5IT9 S;  3THG A;  2DVW B;  4DR3 M;  3GLI A;  3QAU A;  5C18 A;  3GPY A;  3HU1 A;  3U6S A;  4LCB A;  1IXS B;  3KVW A;  4PT5 A;  4JI5 M;  5LMU M;  2EA0 A;  1HNX M;  1DO2 A;  1W5S A;  4YY3 M;  4OVZ A;  1HNZ M;  4M0D A;  3RGS A;  2L6O A;  5ITU A;  4JN6 A;  1XMQ M;  3HJ8 A;  4KOD A;  1DGH A;  4AKH A;  1H6U A;  5EP2 A;  2CE7 A;  5ITX A;  4B08 A;  4AKG A;  2HCB A;  2G5G X;  1SXJ E;  3PNY A;  4GMQ A;  1XXH B;  4GC5 A;  4PD2 A;  3LVV A;  4L8R C;  3HJS A;  5ITY A;  1QAM A;  1QQW A;  4LG2 A;  1E94 E;  3FTC A;  3SC3 A;  4R7G A;  2UUB M;  4G4R A;  5LMN M;  2CEA A;  1GLN A;  4YHH M;  2UXD M;  4NSO B;  5EXS A;  2HL7 A;  1IM2 A;  3FUV A;  2QP9 X;  4D81 A;  2XH9 A;  4JI7 M;  2YFQ A;  2F5P A;  4FCV A;  2F5Q A;  4S12 A;  2FFJ A;  4DUY M;  3PNV A;  3I4V A;  3HGI A;  5IWA M;  3AV0 A;  4GC9 A;  5EP1 A;  4DR7 M;  3SAS A;  4QHS A;  4MH0 E;  1Z5A A;  2CV2 A;  3KW6 A;  3TL4 X;  2O5R A;  5EXP A;  3UK6 A;  4GH9 A;  1N77 A;  1N75 A;  5KPZ A;  2AHM A;  1TH2 A;  3J81 S;  4IBB A;  4B7F A;  1E9R A;  4MGK E;  4B3T M;  2DHR A;  4DV1 M;  1ZQ9 A;  1NJG A;  5EXX A;  3JR4 A;  3SAW A;  4L78 A;  1GL6 A;  4DV2 M;  5FTK A;  3A46 A;  1XXH A;  4HLQ A;  1NHW C;  4FWD A;  3MHV C;  1T3T A;  2FNA A;  1L2C A;  4DV3 M;  3A45 A;  3SAT A;  1N32 M;  3FUU A;  1N33 M;  2F4V M;  1I94 M;  1NNU C;  2KEB A;  5FTN A;  4GHA A;  2R4E A;  2L7I A;  1NY5 A;  3A98 B;  5JI2 E;  1W5T A;  1I4W A;  4IBJ A;  2VQF M;  2I7P A;  1Z6T A;  2XLJ A;  3KSX A;  4RF0 A;  3GQ3 A;  2XFS A;  2KW0 A;  3HKP A;  4DR4 M;  1XNQ M;  4LJ5 A;  3BOS A;  1J7K A;  4X66 M;  1TH4 A;  1IN6 A;  4GHL A;  3CTW B;  2QBY B;  3FTF A;  4FD2 A;  2EO2 A;  1L1Z A;  1N78 A;  4LF7 M;  3AOE C;  1Q3C A;  2R18 A;  4MGH A;  3TE6 A;  1XWI A;  3DFZ A;  4NXN M;  3GLG B;  5KQ8 A;  3SAU A;  3M0E A;  4IJF A;  5JI3 E;  1K82 A;  1HT2 E;  3IG8 A;  1TGU A;  3M6A A;  3KS4 A;  1IBK M;  7CAT A;  1NSF A;  2KRK A;  2CV1 A;  3JAM S;  3K2L A;  4LFB M;  1R2Z A;  2Z3X A;  3SYL A;  3PFI A;  3T15 A;  4AW4 A;  2C5R A;  3GLF B;  2UXB M;  3U6P A;  4IJE A;  4M0W A;  1NY6 A;  5E6J A;  3AOE A;  3AFH A;  2RGH A;  4JI0 M;  5ITX E;  5IZ7 D;  3U6Q A;  2C96 A;  4D82 A;  1G8P A;  2KZU A;  4LGY A;  2BJV A;  1N36 M;  1IXZ A;  3KP1 E;  4MM3 B;  3ILK A;  3SBJ A;  2QBY A;  2K47 A;  3RE8 A;  5ITT A;  3ZH9 B;  1PJI A;  4I5S A;  3K8Z A;  4BLC A;  5F3W A;  3TQS A;  4NOO B;  2FOI C;  4NL4 H;  3GLH B;  3U6E A;  1YE9 A;  3KDS E;  3GLG A;  2V1U A;  4LJ4 A;  4IIW A;  2ZBK B;  2XFT A;  1X37 A;  3FTD A;  2UUC M;  4LY6 A;  3GRR A;  4M9X A;  1FJG M;  4DV0 M;  4LJ8 A;  3VKG A;  1IXR C;  4IBK A;  4FWG A;  4EIW A;  1Z5B A;  4MB7 A;  1DGG A;  3VK7 A;  1VDD A;  4Z6Y A;  3R9X B;  1GL7 A;  1QYR A;  2Q2E B;  4AG6 A;  1S3S A;  3GO8 A;  2YQZ A;  3J27 B;  3VLF B;  1XNR M;  4IBG A;  2KZS A;  3GLF A;  3VKH A;  1GVN A;  1HQC A;  4REZ A;  4DV6 M;  4JI6 M;  1Z5C A;  1JR3 D;  1IY1 A;  4LF8 M;  2L09 A;  1JQJ C;  2DWZ B;  2R62 A;  5DNY A;  3GPX A;  1JR3 A;  2LXE A;  3AJI B;  2QEN A;  4NRW A;  3M7G A;  4P16 A;  1Q39 A;  4HL4 A;  3IG5 A;  3ZC7 B;  3KSJ A;  5H37 D;  3MJ5 A;  3B9P A;  2QZ4 A;  2R4J A;  3GLH A;  4LGM A;  4DUZ M;  3L28 A;  3A42 A;  1YSY A;  3PXG A;  2LH0 A;  1PJJ A;  2W82 A;  3J80 S;  4IBI A;  5KO3 A;  1J5E M;  3J7B A;  1IN7 A;  4JI2 M;  4M9S A;  1XC8 A;  2DWM A;  4A3V B;  1XMO M;  4IBE A;  4B7H A;  2YNM D;  3KOZ E;  3C58 A;  4ITQ A;  5EP3 A;  3WHK A;  4LFC M;  1QVR A;  5E26 A;  4QNM A;  3U5Z B;  1C1K A;  4LJA A;  1MX0 A;  4BBA A;  5FSW A;  2VQE M;  2RGO A;  4GKJ M;  4MGY E;  4CHT B;  4XBO A;  5A2Q S;  1GKI A;  4OW0 A;  4L15 A;  4CGY B;  3U6D A;  4B7G A;  4DR6 M;  3I51 A;  3T1H M;  1KSF X;  2J7N A;  3U6O A;  4X64 M;  2DZN B;  1XHB A;  3DA1 A;  5KPR A;  1IBL M;  3UJN A;  1HQY E;  2I7N A;  4RF1 A;  4D80 A;  5FLX S;  1HR0 M;  4FCT A;  4TUW A;  2G8L A;  1QAO A;  1IN8 A;  2XEP A;  2C98 A;  2Y20 A;  2F5N A;  4WUR A;  4LZJ A;  2V1C A;  3GRV A;  1UM8 A;  2Y0T A;  3AOG A;  4FCW A;  4CIS A;  4AKI A;  3W0F A;  2C9O A;  3U6C A;  4AQY M;  3KS8 A;  3GRY A;  4LJ6 A;  2UXC M;  1PM5 A;  3HU3 A;  4QOZ C;  4LF5 M;  1ZAE A;  3CF0 A;  3K92 A;  4X62 M;  3U5Z A;  3FKE A;  2M60 A;  3SFZ A;  4QNR A;  1OFH A;  3L27 A;  4LF4 M;  4K0K M;  2X4A A;  4LZZ A;  3GRU A;  3L29 A;  2F5O A;  4B3S M;  4L4U A;  4FWH A;  4X65 M;  4KLN A;  2DWN A;  3DZD A;  4LFA M;  3UGJ A;  1QZM A;  4R3D A;  1K3W A;  1Q3B A;  2X8A A;  1TDH A;  3LVW A;  1L8Q A;  2Z4R A;  4JI4 M;  1OFI A;  3T1Y M;  4NRV A;  2J7O A;  3LQR A;  2XSZ D;  3HHW A;  3LMM A;  3SMS A;  3SAV A;  4G4N A;  3FYD A;  4NXM M;  4XGI A;  2XSZ A;  3FYC A;  3HHX A;  3VK8 A;  2UUA M;  1G4A E;  2LWX A;  8CAT A;  4L16 A;  2QPA A;  4JI3 M;  3GP1 A;  3HWS A;  2ERC A;  1EE8 A;  4GIP A;  3U6M A;  1KFV A;  4DV4 M;  5DYI A;  2BNK A;  4B3M M;  4BB9 A;  1NVM A;  4DR2 M;  4FVM A;  2CHG A;  2CHQ A;  1NNJ A;  3D8L A;  3R8F A;  4JYA M;  3FUT A;  4PDI A;  4B3R M;  3E9S A;  2VII A;  1DGB A;  1IY2 A;  1E32 A;  5ITQ A;  3FTE A;  3TWL A;  3J7A S;  1R7R A;  2YR0 A;  5EXT A;  3NBI A;  3FUW A;  2ZAN A;  3KOX E;  3GPU A;  3LQQ A;  5EJC A;  2JA2 A;  3CF2 A;  2XZU A;  2HKJ A;  4IBC A;  3L25 A;  3KOW E;  1SXJ B;  2CHV A;  3KOY E;  2D7H A;  4NSR A;  4G4Q A;  1ORY B;  1G41 A;  3WHL A;  2H1R A;  1YUB A;  2R46 A;  3U60 B;  4PDG A;  1IN4 A;  1IQP A;  2L7H A;  1TDZ A;  3K1J A;  3W0L B;  3I4Y A;  2V6Z M;  3UMM A;  1SXJ C;  2ZM6 M;  2D7G A;  4IBD A;  3HHZ A;  5FTJ A;  3JR5 A;  2P5T A;  5EQT A;  3L2A A;  3U61 B;  1IY0 A;  2KXE A;  4LF6 M;  4GIT A;  2F5S A;  4LF9 M;  2Y0Q A;  3TWM A;  1IN5 A;  3QWL A;  3L26 A;  4MGZ E;  1HT1 E;  1K3X A;  4G4O A;  3Q8X A;  3EIE A;  4FW9 A;  1NJF A;  2QCU A;  2D7E A;  1SXJ D;  4JI8 M;  1G59 A;  4DV5 M;  4RNA A;  3VDU A;  1SXJ A;  2OPF A;  1E9S A;  3SAR A;  4IBF A;  3ZCB B;  3UZU A;  2DWL A;  5IRE B;  1DO0 A;  1Z59 A;  5BR8 M;  2KRU A;  3GQ4 A;  3TPZ A;  3U60 A;  4JI1 M;  2HHH M;  4JXJ A;  3PVS A;  3EIH A;  3H4M A;  2Z4S A;  1HNW M;  2X49 A;  3DOA A;  3E4R A;  3VFD A;  5KPT A;  2EUC A;  4W5W A;  2OQ4 A;  1FNN A;  4KHP M;  3MK6 A;  2Y21 A;  4AG5 A;  4G6Z A;  3HU2 A;  4M9Z A;  3U61 A;  2DZO B;  3GPP A;  3NWL A;  3SHG B;  2E5L M;  4LRT A;  3T38 A;  4AI6 A;  3HJQ A;  4JV5 M;  2CUZ A;  3VDP A;  4DV7 M;  3OTO M;  4OX9 M;  3FD9 A;  1OJL A;  2BJW A;  5FTM A;  3HHY A;  1QAN A;  2XZF A;  2C9C A;  4ZPX A;  3TWK A;  4II7 A;  4PCZ A;  4Z8X A;  4GRI A;  1WXQ A;  5C1B A;  5EP4 A;  4QOS A;  2XGN A;  1D2N A;  1IBM M;  3D8B A;  5DYG A;  4I8O A;  2RKO A;  3GLI B;  2UU9 M;  3CF6 E;  4WW0 A;  1L1T A;  3SMP A;  5ITR A;  1L2D A;  1DGF A;  4LJ9 A;  1QAQ A;  4OVZ B;  2R65 A;  4LJ7 A;  2CV0 A;  3AKZ A;  2C99 A;  2FE8 A;  1LV7 A;  1R6B X;  2XF3 A;  2KA6 B;  1MU5 A;  5FTL A;  3AL0 C;  2NQ8 C;  3RGP A;  1DGH B;  3SHF A;  5KQD A;  3SYK A;  5GKN A;  4LRS A;  2ZAO A;  2DXI A;  2CFO A;  2ZAM A;  4GKK M;  3GQ5 A;  3U6L A;  1TH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...