1GVNA

Crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Plasmid Maintenance System Epsilon /Zeta : Functional Mechanism of Toxin Zeta and Inactivation by Epsilon 2 Zeta 2 Complex Formation
pubmed doi rcsb
molecule tags Postsegregational killing system
molecule keywords EPSILON
total genus 35
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1gvnA00
3Q8XA 1GVNA 2P5TA
chains in the Genus database with same CATH superfamily
1JB0F 3I04M 1G3IA 2MGWA 1NHGC 1ZMVA 2Y21A 3GLFB 2LXEA 1Z5AA 4GITA 2DWMA 3GP1A 1ZMWA 1WGLA 4IBEA 2QBYA 1N78A 1H6UA 4HEOA 4NSOB 5EJCA 3R8FA 1NO1A 2RGHA 3C9PA 2DENA 3FUWA 4FVMA 3SHFA 4LF8M 2K47A 3HJQA 4LJ5A 3W67A 2R44A 4Z8XA 1C1KA 4B7FA 4JI6M 5KPZA 4KT0F 1PM5A 2XGNA 3RE8A 2DXIA 2JP7A 3L29A 1TGUA 4B7HA 5JI2E 1HQCA 3KOYE 1OIPA 2ZANA 2CEAA 4IBKA 3V76A 1XB2B 2R18A 2CV2A 3UJNA 2JXNA 2DAMA 3SASA 2W82A 4B3MM 1HNWM 3M0EA 2L6OA 2EKKA 3LCUA 3IG5A 1L1TA 3HKPA 1QDRA 1WR1B 3E21A 4MGYE 4BBAA 5LMNM 3SAWA 4MB7A 3CF0A 4G4OA 2KNZA 1HT2E 3GRVA 3U6SA 3SATA 5FSWA 2UU9M 3K2LA 1ZQ9A 3M7GA 1JQJC 1LTMA 2C98A 3AOGA 3BOSA 1PJSA 3U6EA 2AHMA 3LW5F 1QZMA 4LJ7A 3QWLA 3JAMS 4PDIA 2DNAA 5ITRA 3FKEA 3GLIB 2CUZA 2FH0A 1FJGM 5F3WA 5EXPA 3SYLA 1N36M 4DR2M 4LF5M 3GQ3A 2ZBKB 3KFUG 1XHBA 1GO5A 4IJFA 5ITTA 4DV3M 4R3DA 4GKJM 2Z3XA 4WP2A 3U6OA 3IG8A 1E9SA 3HHWA 5ITXA 2CV0A 2UXCM 5FTKA 4X65M 1Z5CA 1IBMM 1YE9A 2L4FA 3B7QA 4B08A 4XGIA 2HKJA 1DGBA 3T15A 3GRYA 2XSZD 3U6PA 3LVWA 2JZ1A 3M6AA 4JI5M 1XC8A 3HHXA 3U61A 4LJAA 3AL0C 2XZUA 4OVZA 2UUAM 1IN7A 4QOZC 4G4RA 4B3SM 4GEWA 3C3DA 1I94M 1EFUB 3QAUA 2O5RA 1YSYA 1W5TA 4BLCA 4NSRA 3JR4A 3HU3A 4XBOA 2R65A 3FUVA 3MJ5A 3LCVB 4S12A 1Z6TA 1QAQA 4LJ4A 4MGIE 2C9CA 3PNVA 4LF6M 1HT1E 2BWBA 1KSFX 3E4RA 4OVZB 3RGPA 4JV5M 3RFWA 1SG9A 1EIJA 1K82A 1CUKA 1WHCA 4MGKE 4JI0M 1L8QA 2F4VM 2Z4SA 4DV0M 5DFLA 4LFCM 4GMQA 1E9RA 3KOXE 3KW6A 1R2YA 2K0BX 1OAOC 3WHKA 4GIPA 1E94E 2EUCA 4I4LA 3KDSE 4Y28F 1QUTA 3FE3A 4LJ6A 4G3OA 3ZC7B 1Y8GA 2DVWB 1NJFA 2JNHA 2M60A 3GO8A 3C58A 1VG5A 1PJIA 4Q7JA 1R7RA 5FTMA 3U6LA 4LJ9A 3DOAA 3LMMA 1DO2A 4XK8F 1E32A 4PCZA 1IFYA 1TDZA 4K0KM 3AV0A 1J09A 2MROB 3R9XB 3TWKA 2WZJA 4IBJA 1GL7A 1HNXM 5IZ7D 2OO9A 3K9PA 4DR7M 4LF4M 3K1JA 4AW4A 1N33M 5E26A 2G3QA 2XEPA 2JY8A 4REZA 4R7GA 1IY1A 3I4YA 4YY3M 4RF0A 3I4VA 2QQ8A 1NY5A 2LVAA 4KLNA 2K6BA 2DZOB 2CFOA 3GLIE 1Q3CA 3DFZA 4JI7M 2VF7A 3KS4A 2EA0A 2L2DA 2JA2A 1XWIA 4M9XA 5EP4A 2ZM6M 2X4AA 1SXJB 3U60A 5A2QS 1R2ZA 1G8PA 2XFTA 1WXQA 2DZNB 1G71A 1I4WA 1FNNA 1OJLA 2KXEA 2XSZA 2ZAOA 3EIEA 3J27B 3UK6A 4MGZE 1HR0M 3E9SA 3SFZA 2F5NA 2JUJA 3B74A 3DA1A 3J7BA 1SXJC 4B3TM 5C1BA 3PVSA 3FRIA 4NC6A 4X66M 1IY2A 3GLIA 3FTEA 2DKLA 4FCTA 3NBXX 5IREB 2L4EA 2Y0QA 1JR3D 2P5TA 3AFHA 1WIVA 3K8ZA 2ZAMA 3W68A 2Y0TA 4R71A 1TH2A 5FTJA 4WW0A 3FUXA 1DV0A 1IBLM 2FNAA 1QQWA 3DZDA 1QDTA 8CATA 5DNYA 3JR5A 4DV5M 3QYBA 3TWMA 2KHHA 3SARA 4PT5A 5EQTA 1WGNA 3KSJA 2KRKA 4NL4H 2R62A 4Z6YA 1EE8A 5BR8M 2F5SA 3B89A 1L2DA 3K9OA 2R45A 1OAIA 1AIPC 3HGIA 5C18A 2CV1A 2KEBA 4LF7M 4F1IA 1IN8A 1OTRA 4IJEA 4FCWA 1T6OA 1Q02A 1VDDA 3LQRA 1A5TA 1N77A 3BXWA 3QYEA 4QHSA 1XNQM 5ITUA 1N34M 4I81A 4DUYM 3FTFA 3W0LB 5KQ8A 1D0LA 5LMUM 2YNMD 4UN2B 1QAOA 3FUUA 4ZPXA 1PJTA 4LRTA 3I01M 2YR0A 1SXJE 4DR5M 4OX9M 1NJGA 2L7IA 4FW9A 2N35A 1NV9A 2DI0A 2O01F 1S3SA 2R4EA 4JI8M 4L4UA 5DYGA 4CGYB 1PJQA 2FOIC 2BJWA 3GRRA 2KRUA 3ILKA 1HQYE 4IBBA 4JI1M 3VLFB 5EXXA 2LHCA 4LG2A 2B3TA 1HJPA 1UM8A 2DWZB 3NBIA 5KPRA 4DR3M 2M5ZA 4GRIA 2YQZA 4B3RM 1D0KA 3MHVC 1TF0B 3D8LA 1MU5A 4QNRA 4AI6A 3KP0E 3SC3A 4ANRA 3HU1A 4M0WA 3CTWB 4D80A 2APLA 1G59A 4ITQA 1D0MA 4NXNM 3NWLA 3I51A 2R6FA 1X37A 4II7A 4MGHA 3GLGB 3AOEC 2QNJA 2VF8A 3L28A 4PD2A 4NRWA 3H4JA 3KP1E 1N75A 4IIWA 4OU7A 2XLJA 2QP9X 2R0IA 3VKHA 3TL4X 1IXZA 5E6JA 1NSFA 1OFIA 4CISA 4IBFA 2ERCA 2HCBA 1GKIA 1R6BX 1KYIA 3GLGE 3GQ4A 4LCBA 1NNJA 2LH0A 3F92A 4JI3M 1GJSA 3UZUA 1IN4A 1XNRM 3KVWA 3FD9A 2MR9A 4GC9A 1Q39A 3GPYA 4MM3B 2DAGA 1GJTA 2CP8A 4GHAA 2V1UA 3ZH9B 2VQEM 3U60B 3U5ZB 3MMPA 2DAEA 1IBKM 2WSEF 4JYAM 4PDGA 2Q2EB 5EXSA 2A5YB 2Z4RA 1YLAA 2H1RA 3RGSA 3FYDA 3L27A 3SYKA 1GL6A 2QPAA 4AG6A 3OTOM 4FWGA 2KZSA 2DAKA 4L8RC 3VDUA 4DV2M 1IN6A 2H5XA 4FWDA 2L09A 1DGHB 4IBDA 3IHPA 4QHTA 5KPTA 1SXJA 2DZLA 3UGJA 1PJJA 2X49A 1QANA 2FFJA 2JZ0A 2HHHM 1JR3E 3GLHA 2VQFM 2X8AA 4L78A 4TUWA 4P17A 4M0DA 1TH4A 3E46A 3ZCBB 4P16A 2QCUA 1ORYB 1Q3BA 1QYRA 4JI2M 2UXBM 4LGMA 1TTEA 1DGHA 3U6QA 3FRHA 2CE7A 3VDPA 1L2BA 1NV8A 2NQ8C 2Z7JA 2UUCM 5FLXS 2OOBA 2J7NA 1Z5BA 3GLHB 1DO0A 5FTNA 5FTLA 4RKUF 3SAUA 1IXRC 2QENA 3A42A 4MH0E 5EXTA 3SHGB 1YUBA 5JI3E 4X64M 4DR6M 1P3QQ 3L2AA 4DV7M 1SXJD 3U6MA 2RKOA 3TWLA 4I5SA 2JWSA 3SMPA 3GPUA 4G4NA 1G41A 2KW0A 3KS8A 2ZTCA 3LVVA 2EKFA 1ZAEA 1L2CA 4FD2A 3GQ5A 4AQYM 3A46A 1J5EM 2F5OA 2GNOA 4LFBM 1IXSA 3VK8A 2FS1A 3A45A 1XXHE 2LVNC 4M9ZA 3WHLA 1OFHA 4CJ6A 3GPPA 2DAIA 1R4GA 2QHOB 1K3XA 4AKHA 5ITYA 5EP1A 3KXEC 3U6DA 4LGYA 3TE6A 2LTUA 1BVSA 4LFAM 3VFDA 3HX3A 3FTDA 4JN6A 3GRUA 3AOEA 1GABA 2CRUA 1OKSA 4G6ZA 1N32M 4QOSA 2F5QA 2RRUA 1NHWC 2QSFX 4NRVA 5EP2A 2XH9A 3U6CA 1TH3A 3T1YM 4GHLA 5GKNA 4GH9A 4GC5A 4D81A 1XXHB 2KZUA 2R4JA 2KNVA 2XF3A 2ZTDA 1VEGA 3GLGA 4BB9A 4IBGA 4A3VB 2GQFA 2QZ4A 2DHYA 3PFIA 2CHQA 4WURA 4DV4M 1IN5A 4AZFA 3GLFA 1NVMA 4M9SA 1IQPA 1MJGM 4AG5A 2OPFA 3B9PA 4DV1M 2XZFA 1DGGA 1MN3A 4DBGB 2L7HA 3IECA 3HWSA 3T6PA 2D7GA 3J81S 2LWXA 2I7NA 3Q8GA 5EP3A 2UUBM 3KSXA 2LVQD 2XFSA 3LQQA 2VDBB 1T3TA 2EO2A 4DR1M 3U5ZA 2CHGA 2KDLA 3FYCA 2KNAA 3SMSA 1UFZA 2C99A 2JY7A 2RGOA 1MX0A 3B7NA 2OQ4A 4AKGA 2CWBA 1VEKA 3KOZE 4DR4M 1V92A 4EIWA 3SBJA 1DGFA 7CATA 3HHZA 1ZV1A 1J7KA 1G4AE 2MJ5B 3C3EA 5BPVA 4I8OA 3T1HM 3B7ZA 3BBZA 4YHHM 3H4MA 1GVNA 5L8RF 2K9DA 3L26A 2C96A 3T38A 2E5LM 2V1CA 1IM2A 1QUSA 1XMOM 1NNUC 3L25A 3HHYA 3SAVA 3PXGA 1GLNA 1RU3A 1NY6A 2LVPC 2VIIA 4G4QA 1R5LA 1D2NA 4CHTB 2MH8A 4NXMM 1V33A 1V34A 5KO3A 1OQYA 1HNZM 1VDLA 2DHRA 2OOAA 4W5WA 4AKIA 1W5SA 2V6ZM 3VK7A 2LHGA 2YFQA 3HZJA 3CF6E 4JXJA 3K92A 2BNKA 4LZZA 1VQ1A 2FE8A 4L6V6 3TQSA 3TPZA 3Q8XA 5ITQA 4RF1A 4B7GA 2D7HA 3AJIB 3UMMA 2D7EA 4D82A 1TDHA 2HWJA 3CGWA 1JR3A 3GLHE 3J7AS 3FTCA 4L15A 1XMQM 3GLFE 1VEJA 4HLQA 1K3WA 2BWEA 3HJ8A 3W0FA 2BJVA 4NOOB 2G8LA 2I7PA 2F5PA 2HAKA 1IXSB 1ZMUA 1QAMA 2LBCA 4RNAA 4JI4M 3HY5A 2G5GX 1WJ7A 3U61B 2HL7A 4LY6A 4X62M 5IT9S 1PRBA 4FWHA 5IWAM 2DWNA 4IBCA 3GPXA 2JY6B 4KO8A 1TR8A 1QVRA 2WSFF 3D8BA 3MK6A 2O25A 3ZQJA 3THGA 2R46A 4CIZA 5KQDA 2C5RA 1C7YA 4GKKM 2KA6B 3EIHA 2EJSA 1Z59A 2WSCF 3CF2A 4HL4A 2J5YA 4LJ8A 1F4IA 3VKGA 5DYIA 1XXHA 4OW0A 4LZJA 1L1ZA 1OIZA 3HU2A 5H37D 3J2PB 2C9OA 2DWLA 2Y20A 4KHPM 2LNHC 1PGYA 3KOWE 3HJSA 4LRSA 2JY5A 4IBIA 4KODA 5ITXE 2QBYB 1LV7A 4DV6M 2LVOC 4FCVA 3J80S 2Z8YM 3A98B 1AUAA 2J7OA 1KFVA 2UXDM 3AKZA 1IY0A 1T43A 4QNMA 4LF9M 4L16A 2CHVA 3PNYA 4F2LA 4DUZM 3FUTA 1QZEA
chains in the Genus database with same CATH topology
1G3IA 1NHGC 2Y21A 3GLFB 2DWMA 2LXEA 1Z5AA 4GITA 3GP1A 4IBEA 2QBYA 1N78A 1H6UA 4NSOB 5EJCA 3R8FA 2RGHA 3FUWA 3SHFA 4JI7M 4FVMA 4LF8M 2K47A 3HJQA 4LJ5A 4Z8XA 1C1KA 4B7FA 4JI6M 5KPZA 1PM5A 2XGNA 3RE8A 2DXIA 3L29A 1TGUA 4B7HA 5JI2E 1HQCA 3KOYE 2ZANA 4IBKA 2CEAA 2R18A 2CV2A 3UJNA 3SASA 2W82A 4B3MM 1HNWM 3M0EA 2L6OA 2F5PA 3IG5A 1L1TA 3HKPA 4BBAA 4MGYE 5LMNM 3SAWA 4MB7A 3CF0A 4G4OA 3U6SA 1HT2E 3GRVA 3SATA 5FSWA 2UU9M 3K2LA 1ZQ9A 3M7GA 1JQJC 2C98A 3AOGA 3BOSA 3U6EA 2AHMA 4LJ7A 1QZMA 4PDIA 3QWLA 3JAMS 5ITRA 3FKEA 3GLIB 2CUZA 1FJGM 5F3WA 5EXPA 3SYLA 1N36M 4DR2M 4LF5M 3GQ3A 2ZBKB 3KFUG 1XHBA 4IJFA 5ITTA 4DV3M 4R3DA 4GKJM 2Z3XA 3U6OA 2CV0A 3IG8A 1E9SA 3HHWA 5ITXA 2UXCM 5FTKA 4X65M 1Z5CA 1IBMM 1YE9A 4B08A 4XGIA 2HKJA 1DGBA 3T15A 3GRYA 2XSZD 3U6PA 3LVWA 3M6AA 4JI5M 1XC8A 3HHXA 3U61A 4LJAA 3AL0C 2XZUA 4OVZA 2UUAM 1IN7A 4QOZC 4G4RA 4B3SM 1I94M 3QAUA 2O5RA 1YSYA 1W5TA 4BLCA 4NSRA 3JR4A 3HU3A 4XBOA 2R65A 3FUVA 3MJ5A 4S12A 1Z6TA 1QAQA 4LJ4A 4MGIE 2C9CA 3PNVA 4LF6M 1HT1E 3RGPA 1KSFX 3E4RA 4OVZB 4JV5M 3RFWA 1K82A 4JI0M 4MGKE 1L8QA 2F4VM 2Z4SA 4DV0M 4LFCM 4GMQA 1E9RA 3KOXE 3KW6A 1R2YA 3WHKA 4GIPA 1E94E 2EUCA 4I4LA 3KDSE 4LJ6A 3ZC7B 2DVWB 1NJFA 3GO8A 2M60A 3C58A 1PJIA 1R7RA 5FTMA 3U6LA 4LJ9A 3DOAA 3LMMA 1DO2A 4PCZA 1E32A 1TDZA 4K0KM 3AV0A 1J09A 3R9XB 3TWKA 4IBJA 1GL7A 1HNXM 5IZ7D 4DR7M 4LF4M 3K1JA 4AW4A 1N33M 5E26A 2XEPA 4REZA 4R7GA 1IY1A 3I4YA 4YY3M 4RF0A 3I4VA 1NY5A 4KLNA 2DZOB 2CFOA 1Q3CA 3DFZA 2EA0A 3KS4A 2JA2A 1XWIA 4M9XA 5EP4A 2ZM6M 2X4AA 1SXJB 3U60A 5A2QS 1R2ZA 1G8PA 2XFTA 1WXQA 2DZNB 1I4WA 2XSZA 1FNNA 1OJLA 2KXEA 2ZAOA 3EIEA 3J27B 3UK6A 1HR0M 4MGZE 3E9SA 3SFZA 2F5NA 3DA1A 3J7BA 1SXJC 4B3TM 5C1BA 3PVSA 4X66M 1IY2A 3GLIA 3FTEA 4FCTA 5IREB 2Y0QA 1JR3D 2P5TA 3AFHA 3K8ZA 2Y0TA 1TH2A 5FTJA 4WW0A 3FUXA 1IBLM 2FNAA 1QQWA 3DZDA 8CATA 5DNYA 3JR5A 4DV5M 3TWMA 3SARA 4PT5A 5EQTA 3KSJA 2KRKA 4NL4H 2R62A 4Z6YA 1EE8A 5BR8M 2F5SA 1L2DA 2R45A 3HGIA 2CV1A 5C18A 2KEBA 4LF7M 1IN8A 4IJEA 4FCWA 1VDDA 3LQRA 1N77A 4QHSA 1XNQM 5ITUA 1N34M 4I81A 4DUYM 3FTFA 3W0LB 5KQ8A 5LMUM 2YNMD 1QAOA 3FUUA 4ZPXA 4LRTA 2YR0A 1SXJE 4DR5M 4OX9M 1NJGA 2L7IA 4FW9A 4JI8M 1S3SA 2R4EA 4L4UA 5DYGA 4CGYB 2FOIC 2BJWA 3GRRA 2KRUA 3ILKA 1HQYE 4IBBA 4JI1M 3VLFB 5EXXA 4LG2A 4DR3M 1UM8A 2DWZB 3NBIA 5KPRA 4B3RM 2M5ZA 4GRIA 2YQZA 3MHVC 3D8LA 1MU5A 4QNRA 4AI6A 3KP0E 3SC3A 3HU1A 4M0WA 3CTWB 4D80A 1G59A 4ITQA 4NXNM 3NWLA 3I51A 1X37A 4II7A 4MGHA 3GLGB 3AOEC 3L28A 4PD2A 4NRWA 4OU7A 3KP1E 1N75A 4IIWA 2XLJA 2QP9X 3VKHA 3TL4X 1IXZA 5E6JA 1NSFA 1OFIA 4CISA 4IBFA 2ERCA 2HCBA 1GKIA 1R6BX 1KYIA 3GQ4A 4LCBA 1NNJA 2LH0A 4JI3M 3UZUA 1IN4A 1XNRM 3KVWA 3FD9A 4GC9A 1Q39A 3GPYA 4MM3B 4GHAA 2V1UA 3ZH9B 2VQEM 3U60B 3U5ZB 1IBKM 4JYAM 4PDGA 2Q2EB 5EXSA 2A5YB 2Z4RA 2H1RA 3RGSA 3FYDA 3L27A 3SYKA 1GL6A 2QPAA 4AG6A 3OTOM 4FWGA 2KZSA 4L8RC 3VDUA 4DV2M 1IN6A 4FWDA 2L09A 1DGHB 4IBDA 4QHTA 5KPTA 1SXJA 3UGJA 1PJJA 2X49A 1QANA 2FFJA 2HHHM 3GLHA 2VQFM 2X8AA 4L78A 4TUWA 4M0DA 1TH4A 3ZCBB 4P16A 2QCUA 1ORYB 1Q3BA 1QYRA 4JI2M 2UXBM 4LGMA 1DGHA 3U6QA 2CE7A 3VDPA 1L2BA 2NQ8C 2Z7JA 2UUCM 5FLXS 2J7NA 1Z5BA 3GLHB 1DO0A 5FTNA 5FTLA 3SAUA 1IXRC 2QENA 3A42A 4MH0E 5EXTA 3SHGB 1YUBA 5JI3E 4X64M 4DR6M 3L2AA 4DV7M 1SXJD 3U6MA 2RKOA 3TWLA 4I5SA 3SMPA 3GPUA 3KS8A 4G4NA 1G41A 2KW0A 3LVVA 1L2CA 1ZAEA 4FD2A 3GQ5A 4AQYM 3A46A 1J5EM 2F5OA 4LFBM 3VK8A 3A45A 4M9ZA 3WHLA 1OFHA 3GPPA 4AKHA 1K3XA 5ITYA 5EP1A 3KXEC 3U6DA 4LGYA 3TE6A 4LFAM 3VFDA 3FTDA 4JN6A 3GRUA 3AOEA 4G6ZA 1N32M 4QOSA 2F5QA 1NHWC 5EP2A 4NRVA 2XH9A 3U6CA 1TH3A 3T1YM 4GHLA 5GKNA 4GH9A 4GC5A 4D81A 1XXHB 2KZUA 2R4JA 2XF3A 3GLGA 4BB9A 4IBGA 4A3VB 2QZ4A 3PFIA 2CHQA 4WURA 4DV4M 1IN5A 4AZFA 3GLFA 1NVMA 4M9SA 1IQPA 4AG5A 2OPFA 2XZFA 3B9PA 4DV1M 1DGGA 2L7HA 3HWSA 2D7GA 3J81S 2LWXA 2I7NA 5EP3A 2UUBM 3KSXA 2XFSA 3LQQA 1T3TA 2EO2A 4DR1M 3U5ZA 2CHGA 3FYCA 3SMSA 2C99A 2RGOA 1MX0A 2OQ4A 4AKGA 3KOZE 4DR4M 4EIWA 3SBJA 1DGFA 7CATA 3HHZA 1J7KA 1G4AE 5BPVA 4I8OA 3T1HM 4YHHM 3H4MA 1GVNA 3L26A 2C96A 3T38A 2E5LM 2V1CA 1IM2A 1XMOM 1NNUC 3L25A 3HHYA 3SAVA 3PXGA 1GLNA 1NY6A 2VIIA 4G4QA 1D2NA 4CHTB 4NXMM 5KO3A 1HNZM 4AKIA 2DHRA 4W5WA 1W5SA 2V6ZM 3VK7A 2YFQA 3CF6E 4JXJA 3K92A 2BNKA 4LZZA 2FE8A 3TQSA 3TPZA 3Q8XA 5ITQA 4RF1A 4B7GA 2D7HA 3AJIB 3UMMA 2D7EA 4D82A 1TDHA 3J7AS 1JR3A 3FTCA 4L15A 1XMQM 4HLQA 1K3WA 3HJ8A 3W0FA 2BJVA 4NOOB 2G8LA 2I7PA 1IXSB 1QAMA 4RNAA 4JI4M 2G5GX 3U61B 2HL7A 4LY6A 4X62M 5IT9S 4FWHA 5IWAM 2DWNA 4IBCA 3GPXA 4KO8A 1QVRA 3D8BA 3MK6A 5KQDA 4GKKM 3THGA 2R46A 2C5RA 2KA6B 3EIHA 1Z59A 3CF2A 4HL4A 4LJ8A 3VKGA 5DYIA 1XXHA 4OW0A 4LZJA 1L1ZA 3HU2A 5H37D 3J2PB 2C9OA 2DWLA 2Y20A 4KHPM 2LNHC 3KOWE 3HJSA 4LRSA 4IBIA 4KODA 5ITXE 2QBYB 1LV7A 4DV6M 3J80S 4FCVA 1KFVA 3A98B 2J7OA 2UXDM 3AKZA 1IY0A 4QNMA 4LF9M 4L16A 2CHVA 3PNYA 4DUZM 3FUTA 2ZAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8X A;  1GVN A;  2P5T A; 
#chains in the Genus database with same CATH topology
 1JB0 F;  3I04 M;  1G3I A;  2MGW A;  1NHG C;  1ZMV A;  2Y21 A;  3GLF B;  2LXE A;  1Z5A A;  4GIT A;  2DWM A;  3GP1 A;  1ZMW A;  1WGL A;  4IBE A;  2QBY A;  1N78 A;  1H6U A;  4HEO A;  4NSO B;  5EJC A;  3R8F A;  1NO1 A;  2RGH A;  3C9P A;  2DEN A;  3FUW A;  4FVM A;  3SHF A;  4LF8 M;  2K47 A;  3HJQ A;  4LJ5 A;  3W67 A;  2R44 A;  4Z8X A;  1C1K A;  4B7F A;  4JI6 M;  5KPZ A;  4KT0 F;  1PM5 A;  2XGN A;  3RE8 A;  2DXI A;  2JP7 A;  3L29 A;  1TGU A;  4B7H A;  5JI2 E;  1HQC A;  3KOY E;  1OIP A;  2ZAN A;  2CEA A;  4IBK A;  3V76 A;  1XB2 B;  2R18 A;  2CV2 A;  3UJN A;  2JXN A;  2DAM A;  3SAS A;  2W82 A;  4B3M M;  1HNW M;  3M0E A;  2L6O A;  2EKK A;  3LCU A;  3IG5 A;  1L1T A;  3HKP A;  1QDR A;  1WR1 B;  3E21 A;  4MGY E;  4BBA A;  5LMN M;  3SAW A;  4MB7 A;  3CF0 A;  4G4O A;  2KNZ A;  1HT2 E;  3GRV A;  3U6S A;  3SAT A;  5FSW A;  2UU9 M;  3K2L A;  1ZQ9 A;  3M7G A;  1JQJ C;  1LTM A;  2C98 A;  3AOG A;  3BOS A;  1PJS A;  3U6E A;  2AHM A;  3LW5 F;  1QZM A;  4LJ7 A;  3QWL A;  3JAM S;  4PDI A;  2DNA A;  5ITR A;  3FKE A;  3GLI B;  2CUZ A;  2FH0 A;  1FJG M;  5F3W A;  5EXP A;  3SYL A;  1N36 M;  4DR2 M;  4LF5 M;  3GQ3 A;  2ZBK B;  3KFU G;  1XHB A;  1GO5 A;  4IJF A;  5ITT A;  4DV3 M;  4R3D A;  4GKJ M;  2Z3X A;  4WP2 A;  3U6O A;  3IG8 A;  1E9S A;  3HHW A;  5ITX A;  2CV0 A;  2UXC M;  5FTK A;  4X65 M;  1Z5C A;  1IBM M;  1YE9 A;  2L4F A;  3B7Q A;  4B08 A;  4XGI A;  2HKJ A;  1DGB A;  3T15 A;  3GRY A;  2XSZ D;  3U6P A;  3LVW A;  2JZ1 A;  3M6A A;  4JI5 M;  1XC8 A;  3HHX A;  3U61 A;  4LJA A;  3AL0 C;  2XZU A;  4OVZ A;  2UUA M;  1IN7 A;  4QOZ C;  4G4R A;  4B3S M;  4GEW A;  3C3D A;  1I94 M;  1EFU B;  3QAU A;  2O5R A;  1YSY A;  1W5T A;  4BLC A;  4NSR A;  3JR4 A;  3HU3 A;  4XBO A;  2R65 A;  3FUV A;  3MJ5 A;  3LCV B;  4S12 A;  1Z6T A;  1QAQ A;  4LJ4 A;  4MGI E;  2C9C A;  3PNV A;  4LF6 M;  1HT1 E;  2BWB A;  1KSF X;  3E4R A;  4OVZ B;  3RGP A;  4JV5 M;  3RFW A;  1SG9 A;  1EIJ A;  1K82 A;  1CUK A;  1WHC A;  4MGK E;  4JI0 M;  1L8Q A;  2F4V M;  2Z4S A;  4DV0 M;  5DFL A;  4LFC M;  4GMQ A;  1E9R A;  3KOX E;  3KW6 A;  1R2Y A;  2K0B X;  1OAO C;  3WHK A;  4GIP A;  1E94 E;  2EUC A;  4I4L A;  3KDS E;  4Y28 F;  1QUT A;  3FE3 A;  4LJ6 A;  4G3O A;  3ZC7 B;  1Y8G A;  2DVW B;  1NJF A;  2JNH A;  2M60 A;  3GO8 A;  3C58 A;  1VG5 A;  1PJI A;  4Q7J A;  1R7R A;  5FTM A;  3U6L A;  4LJ9 A;  3DOA A;  3LMM A;  1DO2 A;  4XK8 F;  1E32 A;  4PCZ A;  1IFY A;  1TDZ A;  4K0K M;  3AV0 A;  1J09 A;  2MRO B;  3R9X B;  3TWK A;  2WZJ A;  4IBJ A;  1GL7 A;  1HNX M;  5IZ7 D;  2OO9 A;  3K9P A;  4DR7 M;  4LF4 M;  3K1J A;  4AW4 A;  1N33 M;  5E26 A;  2G3Q A;  2XEP A;  2JY8 A;  4REZ A;  4R7G A;  1IY1 A;  3I4Y A;  4YY3 M;  4RF0 A;  3I4V A;  2QQ8 A;  1NY5 A;  2LVA A;  4KLN A;  2K6B A;  2DZO B;  2CFO A;  3GLI E;  1Q3C A;  3DFZ A;  4JI7 M;  2VF7 A;  3KS4 A;  2EA0 A;  2L2D A;  2JA2 A;  1XWI A;  4M9X A;  5EP4 A;  2ZM6 M;  2X4A A;  1SXJ B;  3U60 A;  5A2Q S;  1R2Z A;  1G8P A;  2XFT A;  1WXQ A;  2DZN B;  1G71 A;  1I4W A;  1FNN A;  1OJL A;  2KXE A;  2XSZ A;  2ZAO A;  3EIE A;  3J27 B;  3UK6 A;  4MGZ E;  1HR0 M;  3E9S A;  3SFZ A;  2F5N A;  2JUJ A;  3B74 A;  3DA1 A;  3J7B A;  1SXJ C;  4B3T M;  5C1B A;  3PVS A;  3FRI A;  4NC6 A;  4X66 M;  1IY2 A;  3GLI A;  3FTE A;  2DKL A;  4FCT A;  3NBX X;  5IRE B;  2L4E A;  2Y0Q A;  1JR3 D;  2P5T A;  3AFH A;  1WIV A;  3K8Z A;  2ZAM A;  3W68 A;  2Y0T A;  4R71 A;  1TH2 A;  5FTJ A;  4WW0 A;  3FUX A;  1DV0 A;  1IBL M;  2FNA A;  1QQW A;  3DZD A;  1QDT A;  8CAT A;  5DNY A;  3JR5 A;  4DV5 M;  3QYB A;  3TWM A;  2KHH A;  3SAR A;  4PT5 A;  5EQT A;  1WGN A;  3KSJ A;  2KRK A;  4NL4 H;  2R62 A;  4Z6Y A;  1EE8 A;  5BR8 M;  2F5S A;  3B89 A;  1L2D A;  3K9O A;  2R45 A;  1OAI A;  1AIP C;  3HGI A;  5C18 A;  2CV1 A;  2KEB A;  4LF7 M;  4F1I A;  1IN8 A;  1OTR A;  4IJE A;  4FCW A;  1T6O A;  1Q02 A;  1VDD A;  3LQR A;  1A5T A;  1N77 A;  3BXW A;  3QYE A;  4QHS A;  1XNQ M;  5ITU A;  1N34 M;  4I81 A;  4DUY M;  3FTF A;  3W0L B;  5KQ8 A;  1D0L A;  5LMU M;  2YNM D;  4UN2 B;  1QAO A;  3FUU A;  4ZPX A;  1PJT A;  4LRT A;  3I01 M;  2YR0 A;  1SXJ E;  4DR5 M;  4OX9 M;  1NJG A;  2L7I A;  4FW9 A;  2N35 A;  1NV9 A;  2DI0 A;  2O01 F;  1S3S A;  2R4E A;  4JI8 M;  4L4U A;  5DYG A;  4CGY B;  1PJQ A;  2FOI C;  2BJW A;  3GRR A;  2KRU A;  3ILK A;  1HQY E;  4IBB A;  4JI1 M;  3VLF B;  5EXX A;  2LHC A;  4LG2 A;  2B3T A;  1HJP A;  1UM8 A;  2DWZ B;  3NBI A;  5KPR A;  4DR3 M;  2M5Z A;  4GRI A;  2YQZ A;  4B3R M;  1D0K A;  3MHV C;  1TF0 B;  3D8L A;  1MU5 A;  4QNR A;  4AI6 A;  3KP0 E;  3SC3 A;  4ANR A;  3HU1 A;  4M0W A;  3CTW B;  4D80 A;  2APL A;  1G59 A;  4ITQ A;  1D0M A;  4NXN M;  3NWL A;  3I51 A;  2R6F A;  1X37 A;  4II7 A;  4MGH A;  3GLG B;  3AOE C;  2QNJ A;  2VF8 A;  3L28 A;  4PD2 A;  4NRW A;  3H4J A;  3KP1 E;  1N75 A;  4IIW A;  4OU7 A;  2XLJ A;  2QP9 X;  2R0I A;  3VKH A;  3TL4 X;  1IXZ A;  5E6J A;  1NSF A;  1OFI A;  4CIS A;  4IBF A;  2ERC A;  2HCB A;  1GKI A;  1R6B X;  1KYI A;  3GLG E;  3GQ4 A;  4LCB A;  1NNJ A;  2LH0 A;  3F92 A;  4JI3 M;  1GJS A;  3UZU A;  1IN4 A;  1XNR M;  3KVW A;  3FD9 A;  2MR9 A;  4GC9 A;  1Q39 A;  3GPY A;  4MM3 B;  2DAG A;  1GJT A;  2CP8 A;  4GHA A;  2V1U A;  3ZH9 B;  2VQE M;  3U60 B;  3U5Z B;  3MMP A;  2DAE A;  1IBK M;  2WSE F;  4JYA M;  4PDG A;  2Q2E B;  5EXS A;  2A5Y B;  2Z4R A;  1YLA A;  2H1R A;  3RGS A;  3FYD A;  3L27 A;  3SYK A;  1GL6 A;  2QPA A;  4AG6 A;  3OTO M;  4FWG A;  2KZS A;  2DAK A;  4L8R C;  3VDU A;  4DV2 M;  1IN6 A;  2H5X A;  4FWD A;  2L09 A;  1DGH B;  4IBD A;  3IHP A;  4QHT A;  5KPT A;  1SXJ A;  2DZL A;  3UGJ A;  1PJJ A;  2X49 A;  1QAN A;  2FFJ A;  2JZ0 A;  2HHH M;  1JR3 E;  3GLH A;  2VQF M;  2X8A A;  4L78 A;  4TUW A;  4P17 A;  4M0D A;  1TH4 A;  3E46 A;  3ZCB B;  4P16 A;  2QCU A;  1ORY B;  1Q3B A;  1QYR A;  4JI2 M;  2UXB M;  4LGM A;  1TTE A;  1DGH A;  3U6Q A;  3FRH A;  2CE7 A;  3VDP A;  1L2B A;  1NV8 A;  2NQ8 C;  2Z7J A;  2UUC M;  5FLX S;  2OOB A;  2J7N A;  1Z5B A;  3GLH B;  1DO0 A;  5FTN A;  5FTL A;  4RKU F;  3SAU A;  1IXR C;  2QEN A;  3A42 A;  4MH0 E;  5EXT A;  3SHG B;  1YUB A;  5JI3 E;  4X64 M;  4DR6 M;  1P3Q Q;  3L2A A;  4DV7 M;  1SXJ D;  3U6M A;  2RKO A;  3TWL A;  4I5S A;  2JWS A;  3SMP A;  3GPU A;  4G4N A;  1G41 A;  2KW0 A;  3KS8 A;  2ZTC A;  3LVV A;  2EKF A;  1ZAE A;  1L2C A;  4FD2 A;  3GQ5 A;  4AQY M;  3A46 A;  1J5E M;  2F5O A;  2GNO A;  4LFB M;  1IXS A;  3VK8 A;  2FS1 A;  3A45 A;  1XXH E;  2LVN C;  4M9Z A;  3WHL A;  1OFH A;  4CJ6 A;  3GPP A;  2DAI A;  1R4G A;  2QHO B;  1K3X A;  4AKH A;  5ITY A;  5EP1 A;  3KXE C;  3U6D A;  4LGY A;  3TE6 A;  2LTU A;  1BVS A;  4LFA M;  3VFD A;  3HX3 A;  3FTD A;  4JN6 A;  3GRU A;  3AOE A;  1GAB A;  2CRU A;  1OKS A;  4G6Z A;  1N32 M;  4QOS A;  2F5Q A;  2RRU A;  1NHW C;  2QSF X;  4NRV A;  5EP2 A;  2XH9 A;  3U6C A;  1TH3 A;  3T1Y M;  4GHL A;  5GKN A;  4GH9 A;  4GC5 A;  4D81 A;  1XXH B;  2KZU A;  2R4J A;  2KNV A;  2XF3 A;  2ZTD A;  1VEG A;  3GLG A;  4BB9 A;  4IBG A;  4A3V B;  2GQF A;  2QZ4 A;  2DHY A;  3PFI A;  2CHQ A;  4WUR A;  4DV4 M;  1IN5 A;  4AZF A;  3GLF A;  1NVM A;  4M9S A;  1IQP A;  1MJG M;  4AG5 A;  2OPF A;  3B9P A;  4DV1 M;  2XZF A;  1DGG A;  1MN3 A;  4DBG B;  2L7H A;  3IEC A;  3HWS A;  3T6P A;  2D7G A;  3J81 S;  2LWX A;  2I7N A;  3Q8G A;  5EP3 A;  2UUB M;  3KSX A;  2LVQ D;  2XFS A;  3LQQ A;  2VDB B;  1T3T A;  2EO2 A;  4DR1 M;  3U5Z A;  2CHG A;  2KDL A;  3FYC A;  2KNA A;  3SMS A;  1UFZ A;  2C99 A;  2JY7 A;  2RGO A;  1MX0 A;  3B7N A;  2OQ4 A;  4AKG A;  2CWB A;  1VEK A;  3KOZ E;  4DR4 M;  1V92 A;  4EIW A;  3SBJ A;  1DGF A;  7CAT A;  3HHZ A;  1ZV1 A;  1J7K A;  1G4A E;  2MJ5 B;  3C3E A;  5BPV A;  4I8O A;  3T1H M;  3B7Z A;  3BBZ A;  4YHH M;  3H4M A;  1GVN A;  5L8R F;  2K9D A;  3L26 A;  2C96 A;  3T38 A;  2E5L M;  2V1C A;  1IM2 A;  1QUS A;  1XMO M;  1NNU C;  3L25 A;  3HHY A;  3SAV A;  3PXG A;  1GLN A;  1RU3 A;  1NY6 A;  2LVP C;  2VII A;  4G4Q A;  1R5L A;  1D2N A;  4CHT B;  2MH8 A;  4NXM M;  1V33 A;  1V34 A;  5KO3 A;  1OQY A;  1HNZ M;  1VDL A;  2DHR A;  2OOA A;  4W5W A;  4AKI A;  1W5S A;  2V6Z M;  3VK7 A;  2LHG A;  2YFQ A;  3HZJ A;  3CF6 E;  4JXJ A;  3K92 A;  2BNK A;  4LZZ A;  1VQ1 A;  2FE8 A;  4L6V 6;  3TQS A;  3TPZ A;  3Q8X A;  5ITQ A;  4RF1 A;  4B7G A;  2D7H A;  3AJI B;  3UMM A;  2D7E A;  4D82 A;  1TDH A;  2HWJ A;  3CGW A;  1JR3 A;  3GLH E;  3J7A S;  3FTC A;  4L15 A;  1XMQ M;  3GLF E;  1VEJ A;  4HLQ A;  1K3W A;  2BWE A;  3HJ8 A;  3W0F A;  2BJV A;  4NOO B;  2G8L A;  2I7P A;  2F5P A;  2HAK A;  1IXS B;  1ZMU A;  1QAM A;  2LBC A;  4RNA A;  4JI4 M;  3HY5 A;  2G5G X;  1WJ7 A;  3U61 B;  2HL7 A;  4LY6 A;  4X62 M;  5IT9 S;  1PRB A;  4FWH A;  5IWA M;  2DWN A;  4IBC A;  3GPX A;  2JY6 B;  4KO8 A;  1TR8 A;  1QVR A;  2WSF F;  3D8B A;  3MK6 A;  2O25 A;  3ZQJ A;  3THG A;  2R46 A;  4CIZ A;  5KQD A;  2C5R A;  1C7Y A;  4GKK M;  2KA6 B;  3EIH A;  2EJS A;  1Z59 A;  2WSC F;  3CF2 A;  4HL4 A;  2J5Y A;  4LJ8 A;  1F4I A;  3VKG A;  5DYI A;  1XXH A;  4OW0 A;  4LZJ A;  1L1Z A;  1OIZ A;  3HU2 A;  5H37 D;  3J2P B;  2C9O A;  2DWL A;  2Y20 A;  4KHP M;  2LNH C;  1PGY A;  3KOW E;  3HJS A;  4LRS A;  2JY5 A;  4IBI A;  4KOD A;  5ITX E;  2QBY B;  1LV7 A;  4DV6 M;  2LVO C;  4FCV A;  3J80 S;  2Z8Y M;  3A98 B;  1AUA A;  2J7O A;  1KFV A;  2UXD M;  3AKZ A;  1IY0 A;  1T43 A;  4QNM A;  4LF9 M;  4L16 A;  2CHV A;  3PNY A;  4F2L A;  4DUZ M;  3FUT A;  1QZE A; 
#chains in the Genus database with same CATH homology
 1G3I A;  1NHG C;  2Y21 A;  3GLF B;  2DWM A;  2LXE A;  1Z5A A;  4GIT A;  3GP1 A;  4IBE A;  2QBY A;  1N78 A;  1H6U A;  4NSO B;  5EJC A;  3R8F A;  2RGH A;  3FUW A;  3SHF A;  4JI7 M;  4FVM A;  4LF8 M;  2K47 A;  3HJQ A;  4LJ5 A;  4Z8X A;  1C1K A;  4B7F A;  4JI6 M;  5KPZ A;  1PM5 A;  2XGN A;  3RE8 A;  2DXI A;  3L29 A;  1TGU A;  4B7H A;  5JI2 E;  1HQC A;  3KOY E;  2ZAN A;  4IBK A;  2CEA A;  2R18 A;  2CV2 A;  3UJN A;  3SAS A;  2W82 A;  4B3M M;  1HNW M;  3M0E A;  2L6O A;  2F5P A;  3IG5 A;  1L1T A;  3HKP A;  4BBA A;  4MGY E;  5LMN M;  3SAW A;  4MB7 A;  3CF0 A;  4G4O A;  3U6S A;  1HT2 E;  3GRV A;  3SAT A;  5FSW A;  2UU9 M;  3K2L A;  1ZQ9 A;  3M7G A;  1JQJ C;  2C98 A;  3AOG A;  3BOS A;  3U6E A;  2AHM A;  4LJ7 A;  1QZM A;  4PDI A;  3QWL A;  3JAM S;  5ITR A;  3FKE A;  3GLI B;  2CUZ A;  1FJG M;  5F3W A;  5EXP A;  3SYL A;  1N36 M;  4DR2 M;  4LF5 M;  3GQ3 A;  2ZBK B;  3KFU G;  1XHB A;  4IJF A;  5ITT A;  4DV3 M;  4R3D A;  4GKJ M;  2Z3X A;  3U6O A;  2CV0 A;  3IG8 A;  1E9S A;  3HHW A;  5ITX A;  2UXC M;  5FTK A;  4X65 M;  1Z5C A;  1IBM M;  1YE9 A;  4B08 A;  4XGI A;  2HKJ A;  1DGB A;  3T15 A;  3GRY A;  2XSZ D;  3U6P A;  3LVW A;  3M6A A;  4JI5 M;  1XC8 A;  3HHX A;  3U61 A;  4LJA A;  3AL0 C;  2XZU A;  4OVZ A;  2UUA M;  1IN7 A;  4QOZ C;  4G4R A;  4B3S M;  1I94 M;  3QAU A;  2O5R A;  1YSY A;  1W5T A;  4BLC A;  4NSR A;  3JR4 A;  3HU3 A;  4XBO A;  2R65 A;  3FUV A;  3MJ5 A;  4S12 A;  1Z6T A;  1QAQ A;  4LJ4 A;  4MGI E;  2C9C A;  3PNV A;  4LF6 M;  1HT1 E;  3RGP A;  1KSF X;  3E4R A;  4OVZ B;  4JV5 M;  3RFW A;  1K82 A;  4JI0 M;  4MGK E;  1L8Q A;  2F4V M;  2Z4S A;  4DV0 M;  4LFC M;  4GMQ A;  1E9R A;  3KOX E;  3KW6 A;  1R2Y A;  3WHK A;  4GIP A;  1E94 E;  2EUC A;  4I4L A;  3KDS E;  4LJ6 A;  3ZC7 B;  2DVW B;  1NJF A;  3GO8 A;  2M60 A;  3C58 A;  1PJI A;  1R7R A;  5FTM A;  3U6L A;  4LJ9 A;  3DOA A;  3LMM A;  1DO2 A;  4PCZ A;  1E32 A;  1TDZ A;  4K0K M;  3AV0 A;  1J09 A;  3R9X B;  3TWK A;  4IBJ A;  1GL7 A;  1HNX M;  5IZ7 D;  4DR7 M;  4LF4 M;  3K1J A;  4AW4 A;  1N33 M;  5E26 A;  2XEP A;  4REZ A;  4R7G A;  1IY1 A;  3I4Y A;  4YY3 M;  4RF0 A;  3I4V A;  1NY5 A;  4KLN A;  2DZO B;  2CFO A;  1Q3C A;  3DFZ A;  2EA0 A;  3KS4 A;  2JA2 A;  1XWI A;  4M9X A;  5EP4 A;  2ZM6 M;  2X4A A;  1SXJ B;  3U60 A;  5A2Q S;  1R2Z A;  1G8P A;  2XFT A;  1WXQ A;  2DZN B;  1I4W A;  2XSZ A;  1FNN A;  1OJL A;  2KXE A;  2ZAO A;  3EIE A;  3J27 B;  3UK6 A;  1HR0 M;  4MGZ E;  3E9S A;  3SFZ A;  2F5N A;  3DA1 A;  3J7B A;  1SXJ C;  4B3T M;  5C1B A;  3PVS A;  4X66 M;  1IY2 A;  3GLI A;  3FTE A;  4FCT A;  5IRE B;  2Y0Q A;  1JR3 D;  2P5T A;  3AFH A;  3K8Z A;  2Y0T A;  1TH2 A;  5FTJ A;  4WW0 A;  3FUX A;  1IBL M;  2FNA A;  1QQW A;  3DZD A;  8CAT A;  5DNY A;  3JR5 A;  4DV5 M;  3TWM A;  3SAR A;  4PT5 A;  5EQT A;  3KSJ A;  2KRK A;  4NL4 H;  2R62 A;  4Z6Y A;  1EE8 A;  5BR8 M;  2F5S A;  1L2D A;  2R45 A;  3HGI A;  2CV1 A;  5C18 A;  2KEB A;  4LF7 M;  1IN8 A;  4IJE A;  4FCW A;  1VDD A;  3LQR A;  1N77 A;  4QHS A;  1XNQ M;  5ITU A;  1N34 M;  4I81 A;  4DUY M;  3FTF A;  3W0L B;  5KQ8 A;  5LMU M;  2YNM D;  1QAO A;  3FUU A;  4ZPX A;  4LRT A;  2YR0 A;  1SXJ E;  4DR5 M;  4OX9 M;  1NJG A;  2L7I A;  4FW9 A;  4JI8 M;  1S3S A;  2R4E A;  4L4U A;  5DYG A;  4CGY B;  2FOI C;  2BJW A;  3GRR A;  2KRU A;  3ILK A;  1HQY E;  4IBB A;  4JI1 M;  3VLF B;  5EXX A;  4LG2 A;  4DR3 M;  1UM8 A;  2DWZ B;  3NBI A;  5KPR A;  4B3R M;  2M5Z A;  4GRI A;  2YQZ A;  3MHV C;  3D8L A;  1MU5 A;  4QNR A;  4AI6 A;  3KP0 E;  3SC3 A;  3HU1 A;  4M0W A;  3CTW B;  4D80 A;  1G59 A;  4ITQ A;  4NXN M;  3NWL A;  3I51 A;  1X37 A;  4II7 A;  4MGH A;  3GLG B;  3AOE C;  3L28 A;  4PD2 A;  4NRW A;  4OU7 A;  3KP1 E;  1N75 A;  4IIW A;  2XLJ A;  2QP9 X;  3VKH A;  3TL4 X;  1IXZ A;  5E6J A;  1NSF A;  1OFI A;  4CIS A;  4IBF A;  2ERC A;  2HCB A;  1GKI A;  1R6B X;  1KYI A;  3GQ4 A;  4LCB A;  1NNJ A;  2LH0 A;  4JI3 M;  3UZU A;  1IN4 A;  1XNR M;  3KVW A;  3FD9 A;  4GC9 A;  1Q39 A;  3GPY A;  4MM3 B;  4GHA A;  2V1U A;  3ZH9 B;  2VQE M;  3U60 B;  3U5Z B;  1IBK M;  4JYA M;  4PDG A;  2Q2E B;  5EXS A;  2A5Y B;  2Z4R A;  2H1R A;  3RGS A;  3FYD A;  3L27 A;  3SYK A;  1GL6 A;  2QPA A;  4AG6 A;  3OTO M;  4FWG A;  2KZS A;  4L8R C;  3VDU A;  4DV2 M;  1IN6 A;  4FWD A;  2L09 A;  1DGH B;  4IBD A;  4QHT A;  5KPT A;  1SXJ A;  3UGJ A;  1PJJ A;  2X49 A;  1QAN A;  2FFJ A;  2HHH M;  3GLH A;  2VQF M;  2X8A A;  4L78 A;  4TUW A;  4M0D A;  1TH4 A;  3ZCB B;  4P16 A;  2QCU A;  1ORY B;  1Q3B A;  1QYR A;  4JI2 M;  2UXB M;  4LGM A;  1DGH A;  3U6Q A;  2CE7 A;  3VDP A;  1L2B A;  2NQ8 C;  2Z7J A;  2UUC M;  5FLX S;  2J7N A;  1Z5B A;  3GLH B;  1DO0 A;  5FTN A;  5FTL A;  3SAU A;  1IXR C;  2QEN A;  3A42 A;  4MH0 E;  5EXT A;  3SHG B;  1YUB A;  5JI3 E;  4X64 M;  4DR6 M;  3L2A A;  4DV7 M;  1SXJ D;  3U6M A;  2RKO A;  3TWL A;  4I5S A;  3SMP A;  3GPU A;  3KS8 A;  4G4N A;  1G41 A;  2KW0 A;  3LVV A;  1L2C A;  1ZAE A;  4FD2 A;  3GQ5 A;  4AQY M;  3A46 A;  1J5E M;  2F5O A;  4LFB M;  3VK8 A;  3A45 A;  4M9Z A;  3WHL A;  1OFH A;  3GPP A;  4AKH A;  1K3X A;  5ITY A;  5EP1 A;  3KXE C;  3U6D A;  4LGY A;  3TE6 A;  4LFA M;  3VFD A;  3FTD A;  4JN6 A;  3GRU A;  3AOE A;  4G6Z A;  1N32 M;  4QOS A;  2F5Q A;  1NHW C;  5EP2 A;  4NRV A;  2XH9 A;  3U6C A;  1TH3 A;  3T1Y M;  4GHL A;  5GKN A;  4GH9 A;  4GC5 A;  4D81 A;  1XXH B;  2KZU A;  2R4J A;  2XF3 A;  3GLG A;  4BB9 A;  4IBG A;  4A3V B;  2QZ4 A;  3PFI A;  2CHQ A;  4WUR A;  4DV4 M;  1IN5 A;  4AZF A;  3GLF A;  1NVM A;  4M9S A;  1IQP A;  4AG5 A;  2OPF A;  2XZF A;  3B9P A;  4DV1 M;  1DGG A;  2L7H A;  3HWS A;  2D7G A;  3J81 S;  2LWX A;  2I7N A;  5EP3 A;  2UUB M;  3KSX A;  2XFS A;  3LQQ A;  1T3T A;  2EO2 A;  4DR1 M;  3U5Z A;  2CHG A;  3FYC A;  3SMS A;  2C99 A;  2RGO A;  1MX0 A;  2OQ4 A;  4AKG A;  3KOZ E;  4DR4 M;  4EIW A;  3SBJ A;  1DGF A;  7CAT A;  3HHZ A;  1J7K A;  1G4A E;  5BPV A;  4I8O A;  3T1H M;  4YHH M;  3H4M A;  1GVN A;  3L26 A;  2C96 A;  3T38 A;  2E5L M;  2V1C A;  1IM2 A;  1XMO M;  1NNU C;  3L25 A;  3HHY A;  3SAV A;  3PXG A;  1GLN A;  1NY6 A;  2VII A;  4G4Q A;  1D2N A;  4CHT B;  4NXM M;  5KO3 A;  1HNZ M;  4AKI A;  2DHR A;  4W5W A;  1W5S A;  2V6Z M;  3VK7 A;  2YFQ A;  3CF6 E;  4JXJ A;  3K92 A;  2BNK A;  4LZZ A;  2FE8 A;  3TQS A;  3TPZ A;  3Q8X A;  5ITQ A;  4RF1 A;  4B7G A;  2D7H A;  3AJI B;  3UMM A;  2D7E A;  4D82 A;  1TDH A;  3J7A S;  1JR3 A;  3FTC A;  4L15 A;  1XMQ M;  4HLQ A;  1K3W A;  3HJ8 A;  3W0F A;  2BJV A;  4NOO B;  2G8L A;  2I7P A;  1IXS B;  1QAM A;  4RNA A;  4JI4 M;  2G5G X;  3U61 B;  2HL7 A;  4LY6 A;  4X62 M;  5IT9 S;  4FWH A;  5IWA M;  2DWN A;  4IBC A;  3GPX A;  4KO8 A;  1QVR A;  3D8B A;  3MK6 A;  5KQD A;  4GKK M;  3THG A;  2R46 A;  2C5R A;  2KA6 B;  3EIH A;  1Z59 A;  3CF2 A;  4HL4 A;  4LJ8 A;  3VKG A;  5DYI A;  1XXH A;  4OW0 A;  4LZJ A;  1L1Z A;  3HU2 A;  5H37 D;  3J2P B;  2C9O A;  2DWL A;  2Y20 A;  4KHP M;  2LNH C;  3KOW E;  3HJS A;  4LRS A;  4IBI A;  4KOD A;  5ITX E;  2QBY B;  1LV7 A;  4DV6 M;  3J80 S;  4FCV A;  1KFV A;  3A98 B;  2J7O A;  2UXD M;  3AKZ A;  1IY0 A;  4QNM A;  4LF9 M;  4L16 A;  2CHV A;  3PNY A;  4DUZ M;  3FUT A;  2ZAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...