1GVNA

Crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
87
structure length
87
Chain Sequence
VTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Plasmid Maintenance System Epsilon /Zeta : Functional Mechanism of Toxin Zeta and Inactivation by Epsilon 2 Zeta 2 Complex Formation
pubmed doi rcsb
molecule tags Postsegregational killing system
molecule keywords EPSILON
total genus 35
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08998 Epsilon_antitox Bacterial epsilon antitoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.130 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1gvnA00
2P5TA 3Q8XA 1GVNA
chains in the Genus database with same CATH superfamily
4S12A 3CGWA 3SHFA 1PJSA 2Y0QA 1HNXM 1T6OA 3QYEA 2R4EA 3RFWA 1OFIA 4NL4H 3VKGA 2ZBKB 3QYBA 3RGSA 3FUTA 5ITQA 1EE8A 4JI5M 2UXDM 4L8RC 4AKHA 1DO0A 1L8QA 3U5ZA 1DGFA 4X65M 3R8FA 2UUAM 3U5ZB 1IXSB 4RKUF 1GL6A 2CEAA 3E4RA 1T3TA 2L2DA 4DUZM 2ERCA 4MGZE 3WHKA 3PVSA 1Z5AA 1XXHA 4DV1M 2CFOA 2LVAA 1NNJA 2JA2A 2QP9X 3GRRA 3M6AA 4XGIA 4GITA 2F5SA 3A42A 4LJ6A 3VK7A 1L2CA 1GKIA 3BBZA 2Y0TA 2AHMA 5EXPA 1KSFX 4LJAA 2KNVA 4JI0M 2X4AA 2ZTDA 3GRVA 4NSOB 4NXMM 4DR5M 3U61A 3GLHA 3J80S 4JI7M 4LGMA 4DR4M 2UXBM 5KQDA 1YE9A 1TDZA 3VLFB 4LRSA 1Q39A 1E94E 1MU5A 3GQ5A 1K3XA 3B7ZA 2KNZA 2QENA 1AUAA 4R71A 4GC9A 1XHBA 1R4GA 2L7IA 4M9ZA 5EJCA 1D2NA 2R44A 2DZOB 1Q02A 4F1IA 3Q8XA 3AOEC 4IBEA 4LG2A 3KOZE 4B7FA 2Z4SA 4TUWA 1F4IA 2JY7A 3C9PA 3UK6A 2B3TA 3HZJA 4NOOB 2DHRA 4PDGA 3U60B 2CV0A 2DKLA 2MH8A 4PCZA 4GHAA 4JYAM 2JUJA 2CV2A 3U6QA 1SXJD 3AL0C 3GPPA 2CHVA 3VKHA 4OU7A 1NHGC 1NY6A 1QVRA 2KZSA 5LMUM 2MGWA 1VG5A 2DNAA 3IG5A 2F5OA 2CV1A 3KS4A 2YR0A 3J7BA 1YUBA 3GQ4A 2LTUA 4BLCA 2VQFM 1G71A 3C58A 3T1YM 2F5NA 4ITQA 3FTFA 2R45A 1Z59A 2WSCF 2OOBA 2MROB 1G8PA 2F4VM 2YNMD 3LW5F 3W0FA 2X49A 1J7KA 4XBOA 3NBXX 4CGYB 4GHLA 4M9SA 5C18A 4LJ7A 2HKJA 4AKGA 3GLGB 4I81A 2VF8A 4I4LA 4MGIE 1XB2B 1XMQM 1L2BA 5ITYA 4WP2A 3SYKA 2L6OA 3TWLA 5ITUA 3MJ5A 3MK6A 3U61B 4FWDA 2XF3A 2R18A 3FUXA 4NRVA 1VEJA 4I5SA 4B3RM 4GMQA 1J5EM 3THGA 3HHXA 1ORYB 4M0DA 2C96A 2DI0A 3AKZA 2QBYA 4MGYE 3U6PA 2KA6B 3M0EA 1IN5A 3L26A 1OJLA 2XH9A 2J5YA 4YHHM 1XXHB 3SMPA 3ZQJA 1R2ZA 7CATA 3U6SA 4JI1M 3CF0A 2KEBA 2OOAA 1IXSA 1N77A 2O25A 2I7PA 3D8BA 2XZUA 1G4AE 3FTDA 3GLFE 4B3MM 4DV7M 1ZV1A 2JZ1A 1PM5A 4WURA 2YFQA 1K3WA 2CHQA 1IN8A 4FW9A 2R46A 1ZAEA 2KNAA 2XLJA 3LQRA 2BWEA 2Z3XA 4II7A 4PD2A 2Z4RA 2D7GA 3C3DA 1SXJE 5L8RF 1N75A 4UN2B 3JAMS 1Z5BA 3L29A 3LCUA 4YY3M 3SASA 4Z6YA 4LFCM 3HWSA 2H1RA 4JN6A 2EUCA 5EP3A 2JNHA 2CUZA 4PDIA 3HU2A 4DBGB 5EP1A 4I8OA 1GABA 3L25A 3B9PA 1QAMA 1TGUA 2R65A 2VDBB 3B7QA 3BXWA 3T1HM 4QHTA 2P5TA 4MH0E 2HL7A 3LCVB 1ZMUA 4NC6A 4B7HA 3GLHE 1QZEA 1HNWM 4PT5A 2KW0A 2NQ8C 2X8AA 2DXIA 1DGGA 4QNMA 1VDLA 4AZFA 4NRWA 2JZ0A 4CJ6A 3FUWA 3IHPA 5KPZA 1NO1A 3W0LB 1IY0A 3IECA 3KP0E 5JI2E 3SFZA 2CWBA 4OVZB 5FTMA 5EQTA 4NXNM 3B7NA 4DV2M 2G3QA 1TTEA 2C9OA 5FTKA 3HGIA 2ZTCA 3U6OA 2LVQD 3SBJA 5E26A 1R7RA 3Q8GA 2LXEA 4IBIA 3CF6E 2RRUA 1UFZA 2DAEA 3DFZA 5KO3A 1G41A 3U60A 2DWZB 2QQ8A 1EFUB 4R3DA 1VQ1A 1HQYE 1OKSA 4EIWA 1DGHA 1IXRC 4IBKA 2I7NA 4G4OA 1P3QQ 4LF8M 2WSEF 2KRKA 1QUTA 1KFVA 3LVVA 3GRYA 2K47A 2LNHC 4LY6A 3BOSA 4AW4A 3GLIB 3E21A 3K9PA 5FTLA 1C7YA 4DR1M 3GLFA 3OTOM 1C1KA 3FUVA 3GPYA 4DR2M 1NVMA 1NSFA 4FWHA 1R6BX 1QANA 2KXEA 4IJFA 3RGPA 3GLFB 3H4JA 2DWMA 1E32A 4IBBA 4ZPXA 2KRUA 4LF7M 1IN6A 1L1TA 4L78A 3H4MA 2R62A 2V1CA 1Q3CA 5IREB 4AG6A 4LJ5A 2HAKA 2APLA 2UU9M 4NSRA 1W5SA 3ILKA 1X37A 3HU1A 2XEPA 2C5RA 1WHCA 2R6FA 3EIHA 3PNYA 2FOIC 2C99A 1FJGM 1OQYA 3A46A 4DV5M 3SAVA 1N36M 2LH0A 3PNVA 3I04M 2DVWB 1SG9A 2M5ZA 2D7HA 2L09A 2FE8A 1E9RA 2Y20A 2ZANA 3JR4A 4D81A 4JV5M 3FKEA 4GC5A 4Y28F 2XGNA 1QDTA 3U6EA 4F2LA 4QOSA 3HJQA 3SHGB 1WIVA 2EO2A 2CE7A 4CHTB 1XC8A 5EXSA 4G4NA 2F5QA 3GPUA 2CP8A 4KLNA 4JI8M 1JQJC 2DENA 2BNKA 3ZCBB 3TE6A 2A5YB 5GKNA 3SC3A 4DR3M 1RU3A 2MR9A 3PXGA 3GO8A 1HR0M 3U6MA 1HQCA 1D0MA 3EIEA 2GQFA 2QZ4A 3F92A 3T15A 3CTWB 1SXJA 3GP1A 2JY8A 5ITRA 4MM3B 1VEGA 4QHSA 4MGHA 1N78A 2DAIA 3PFIA 1V33A 4DUYM 2LVPC 1N34M 4X66M 3DOAA 1IBMM 3L27A 3HJSA 2QCUA 4RF0A 2F5PA 3V76A 1IBLM 1GLNA 1GVNA 3L2AA 2D7EA 2KHHA 1WGLA 1I94M 2LHCA 3TWKA 2Q2EB 4DV0M 3WHLA 2L7HA 3C3EA 4LJ9A 3D8LA 4IBGA 1NHWC 3K2LA 3KVWA 4L15A 1OIPA 2HWJA 1SXJC 5IT9S 2M60A 2WZJA 3I4VA 5EXTA 1QQWA 1IXZA 4FVMA 1J09A 4ANRA 2GNOA 3GPXA 4X62M 3VK8A 1TF0B 5BR8M 2O5RA 1V34A 3M7GA 3QWLA 4G6ZA 3VFDA 2OQ4A 4IJEA 4LF5M 1JR3A 1NNUC 4P17A 1VEKA 3DA1A 3FTEA 1S3SA 3B89A 5LMNM 4IBCA 3KOXE 5E6JA 1WR1B 1V92A 1TR8A 4L16A 5C1BA 4CIZA 1YLAA 3KFUG 2BWBA 2CHGA 2BJWA 2FFJA 3R9XB 3IG8A 4Q7JA 1MJGM 4WW0A 4R7GA 4RF1A 1XNQM 3VDUA 1HJPA 1DGBA 2H5XA 4W5WA 1HNZM 4KT0F 1H6UA 4LGYA 2K0BX 2EA0A 3J81S 2RGHA 1UM8A 3GLIA 3LVWA 3KSJA 5DYGA 2C98A 4AG5A 2QPAA 3FUUA 2XSZA 1KYIA 2OPFA 1R2YA 5DFLA 4AI6A 1MN3A 3B74A 3K1JA 1TDHA 4L6V6 1Y8GA 4AQYM 2EKKA 4Z8XA 3SATA 2XZFA 4LZJA 1OAIA 1Q3BA 1Z5CA 4DV3M 4FWGA 4JI2M 3TQSA 3FYDA 1IBKM 1N33M 1IY1A 3I4YA 3UZUA 1XMOM 3KOWE 4MB7A 2RKOA 3HHYA 1JB0F 4QNRA 2JXNA 4DR6M 1IN7A 1PJJA 2L4EA 4OVZA 1WGNA 1ZQ9A 4LFAM 4JXJA 4LF9M 4LJ8A 4M0WA 4FCVA 5FTJA 4LFBM 4CISA 1WXQA 2Y21A 3W67A 4HEOA 2K6BA 2VIIA 4K0KM 4GH9A 3KP1E 3E9SA 2CRUA 2MJ5B 2FNAA 5FLXS 4P16A 5H37D 1R5LA 1FNNA 3LQQA 1XWIA 2FH0A 5F3WA 2OO9A 1QDRA 3MHVC 2DWNA 3HU3A 1ZMWA 1WJ7A 2WSFF 1TH2A 3UGJA 5EXXA 1SXJB 3GLIE 1HT2E 1ZMVA 4A3VB 2RGOA 3A98B 1OIZA 3KSXA 1JR3E 3K8ZA 1MX0A 3FTCA 2J7OA 1IN4A 5ITTA 1PRBA 2Z7JA 4X64M 1PGYA 2JP7A 2HCBA 2W82A 3MMPA 4M9XA 3KOYE 5ITXA 4D82A 8CATA 2KDLA 4JI4M 3E46A 4REZA 4OW0A 1L2DA 2DZLA 4FCTA 1D0KA 4FD2A 4HLQA 4GKKM 2K9DA 2DWLA 4QOZC 1GJSA 3AV0A 3J27B 4FCWA 2N35A 2ZAMA 3TPZA 1Z6TA 3I51A 3UMMA 2R0IA 1BVSA 2ZAOA 3HX3A 4LZZA 5IZ7D 2EJSA 3VDPA 1I4WA 3TWMA 4KHPM 1NJFA 4G3OA 4G4RA 2UUBM 3K9OA 1W5TA 2G8LA 3KDSE 2LVOC 3GQ3A 3KW6A 5EP4A 4AKIA 1CUKA 4LF4M 4G4QA 2QSFX 4B7GA 3CF2A 1QAQA 1HT1E 1G59A 2QBYB 4JI3M 3HJ8A 1NV9A 3T38A 3QAUA 2BJVA 5JI3E 4KO8A 1EIJA 2C9CA 4GEWA 2VQEM 4RNAA 4DV4M 3A45A 3GRUA 3UJNA 4GKJM 3AJIB 3FE3A 4LJ4A 3I01M 3U6LA 2JY6B 1OTRA 3U6DA 1NJGA 2J7NA 5FSWA 1GJTA 3HKPA 1LV7A 3GLGA 4KODA 1PJTA 3U6CA 3KS8A 1TH3A 5KPRA 1PJIA 3RE8A 1YSYA 3FRIA 4B08A 1D0LA 1OFHA 1NY5A 2DAKA 3LMMA 5FTNA 3AOEA 4JI6M 3HHZA 5DYIA 1GO5A 2QNJA 2V1UA 1A5TA 4LRTA 4IBFA 3SAUA 2HHHM 3FD9A 1XNRM 1XXHE 3DZDA 3ZC7B 4B3TM 3L28A 4DV6M 2UXCM 4IBJA 4MGKE 1DGHB 5IWAM 1L1ZA 2O01F 3JR5A 1IFYA 3SAWA 1T43A 2V6ZM 3K92A 2DHYA 2DZNB 2XSZD 2JWSA 5A2QS 2DAGA 3GLGE 4GIPA 4LF6M 3J7AS 5DNYA 3SMSA 1AIPC 3FYCA 2EKFA 3ZH9B 2UUCM 5ITXE 2L4FA 4XK8F 4L4UA 2FS1A 3W68A 2R4JA 2Z8YM 3AOGA 4BBAA 1QAOA 4IIWA 2QHOB 4LCBA 1PJQA 3KXEC 5EP2A 3NWLA 2DAMA 4D80A 2XFTA 1IQPA 1N32M 1OAOC 2KZUA 2LBCA 3FRHA 1G3IA 3NBIA 2G5GX 1IM2A 1DO2A 5BPVA 4GRIA 3HHWA 1LTMA 3SYLA 1GL7A 4B3SM 3AFHA 1JR3D 1QYRA 2ZM6M 4DR7M 3TL4X 1QUSA 3T6PA 3J2PB 1TH4A 4BB9A 3GLHB 2JY5A 4HL4A 5KQ8A 5KPTA 1NV8A 1K82A 2E5LM 3SARA 3HY5A 4IBDA 2LVNC 2YQZA 4OX9M 2VF7A 1VDDA 1IY2A 2LWXA 2XFSA 1DV0A 1QZMA 2LHGA 1E9SA
chains in the Genus database with same CATH topology
4S12A 3SHFA 2Y0QA 2R4EA 3RFWA 1OFIA 4NL4H 3VKGA 2ZBKB 3RGSA 3FUTA 5ITQA 1EE8A 4JI5M 2UXDM 4L8RC 4AKHA 1DO0A 1L8QA 3U5ZA 1DGFA 4X65M 3R8FA 2UUAM 3U5ZB 1IXSB 1GL6A 2CEAA 3E4RA 1T3TA 4DUZM 2ERCA 4MGZE 3WHKA 3PVSA 1Z5AA 1XXHA 4DV1M 2CFOA 1NNJA 2JA2A 2QP9X 3GRRA 3M6AA 4XGIA 4GITA 2F5SA 3A42A 4LJ6A 3VK7A 1L2CA 1GKIA 5EXPA 2Y0TA 2AHMA 1KSFX 4LJAA 4JI0M 2X4AA 3GRVA 4NSOB 4NXMM 4DR5M 3U61A 3GLHA 3J80S 4JI7M 4LGMA 4DR4M 2UXBM 5KQDA 1YE9A 1TDZA 3VLFB 4LRSA 1Q39A 1E94E 1MU5A 3GQ5A 1K3XA 2QENA 4GC9A 1XHBA 4M9ZA 2L7IA 5EJCA 1D2NA 2DZOB 3Q8XA 3AOEC 4IBEA 4LG2A 3KOZE 4B7FA 2Z4SA 4TUWA 3UK6A 4NOOB 2DHRA 4PDGA 3U60B 2CV0A 4PCZA 4GHAA 4JYAM 2CV2A 3U6QA 1SXJD 3AL0C 3GPPA 2CHVA 4OU7A 1NHGC 1NY6A 1QVRA 2KZSA 5LMUM 3IG5A 2F5OA 2CV1A 3KS4A 2YR0A 3J7BA 1YUBA 3GQ4A 4BLCA 2VQFM 3T1YM 3C58A 2F5NA 4ITQA 3FTFA 2R45A 1Z59A 2F4VM 1G8PA 2YNMD 3W0FA 2X49A 1J7KA 4XBOA 4CGYB 4GHLA 4M9SA 5C18A 4LJ7A 2HKJA 4AKGA 3GLGB 4I81A 4I4LA 4MGIE 1L2BA 1XMQM 5ITYA 3SYKA 3TWLA 2L6OA 5ITUA 3U61B 3MJ5A 3MK6A 1HNXM 4FWDA 2XF3A 2R18A 3FUXA 4NRVA 4I5SA 4B3RM 4GMQA 1J5EM 3THGA 3HHXA 1ORYB 4M0DA 2C96A 3AKZA 2QBYA 4MGYE 3U6PA 2KA6B 3M0EA 1IN5A 3L26A 1OJLA 2XH9A 4YHHM 1XXHB 3SMPA 1R2ZA 7CATA 3U6SA 4JI1M 3CF0A 2KEBA 1N77A 3D8BA 2I7PA 2XZUA 1G4AE 3FTDA 4B3MM 4DV7M 1PM5A 4WURA 2YFQA 1K3WA 2CHQA 1IN8A 4FW9A 2R46A 1ZAEA 2XLJA 3LQRA 2Z3XA 4II7A 4PD2A 2Z4RA 2D7GA 1SXJE 1N75A 3JAMS 1Z5BA 3L29A 4YY3M 3SASA 4Z6YA 4LFCM 3HWSA 2H1RA 4JN6A 2EUCA 5EP3A 2CUZA 4PDIA 3HU2A 5EP1A 4I8OA 3L25A 3B9PA 1QAMA 1TGUA 2R65A 3T1HM 4QHTA 2P5TA 4MH0E 2HL7A 4B7HA 1HNWM 4PT5A 2KW0A 2NQ8C 2X8AA 2DXIA 1DGGA 4QNMA 4AZFA 4NRWA 3FUWA 5KPZA 3W0LB 1IY0A 3KP0E 5JI2E 3SFZA 4OVZB 5FTMA 5EQTA 4NXNM 4DV2M 2C9OA 5FTKA 3HGIA 3U6OA 3SBJA 5E26A 1R7RA 2LXEA 4IBIA 3CF6E 5KO3A 3DFZA 3U60A 1G41A 2DWZB 4R3DA 1HQYE 4EIWA 1DGHA 1IXRC 4IBKA 2I7NA 4G4OA 4LF8M 2KRKA 1KFVA 3LVVA 3GRYA 2K47A 2LNHC 4LY6A 3BOSA 4AW4A 3GLIB 5FTLA 4DR1M 3GLFA 3OTOM 1C1KA 3FUVA 3GPYA 4DR2M 1NVMA 1NSFA 4FWHA 1R6BX 1QANA 2KXEA 4IJFA 3RGPA 3GLFB 2DWMA 1E32A 4IBBA 4ZPXA 2KRUA 4LF7M 1IN6A 1L1TA 4L78A 3H4MA 2R62A 2V1CA 1Q3CA 5IREB 4AG6A 4LJ5A 2UU9M 4NSRA 1W5SA 3ILKA 1X37A 3HU1A 2XEPA 2C5RA 3EIHA 3PNYA 2FOIC 2C99A 1FJGM 3A46A 4DV5M 3SAVA 1N36M 2LH0A 3PNVA 2DVWB 2M5ZA 2D7HA 2L09A 2FE8A 1E9RA 2Y20A 2ZANA 3JR4A 4D81A 4JV5M 3FKEA 4GC5A 2XGNA 3U6EA 4QOSA 3HJQA 3SHGB 2EO2A 2CE7A 4CHTB 1XC8A 5EXSA 4G4NA 2F5QA 3GPUA 4KLNA 4JI8M 1JQJC 2BNKA 3ZCBB 3TE6A 2A5YB 5GKNA 3SC3A 4DR3M 3PXGA 3GO8A 1HR0M 3U6MA 1HQCA 3EIEA 2QZ4A 3T15A 3CTWB 1SXJA 3GP1A 5ITRA 4MM3B 4QHSA 4MGHA 1N78A 3PFIA 4DUYM 1N34M 4X66M 3DOAA 1IBMM 3L27A 3HJSA 2QCUA 4RF0A 2F5PA 1IBLM 3VKHA 1GLNA 1GVNA 3L2AA 2D7EA 1I94M 3TWKA 2Q2EB 4DV0M 3WHLA 2L7HA 4LJ9A 3D8LA 4IBGA 1NHWC 3K2LA 3KVWA 4L15A 5IT9S 1SXJC 2M60A 3I4VA 5EXTA 1QQWA 1IXZA 4FVMA 1J09A 3GPXA 4X62M 3VK8A 5BR8M 2O5RA 4G6ZA 3M7GA 3QWLA 3VFDA 2OQ4A 4IJEA 4LF5M 1JR3A 1NNUC 3DA1A 3FTEA 1S3SA 5LMNM 4IBCA 3KOXE 5E6JA 4L16A 5C1BA 3KFUG 2CHGA 2BJWA 2FFJA 3R9XB 3IG8A 4WW0A 4R7GA 4RF1A 1XNQM 3VDUA 1DGBA 4W5WA 1HNZM 1H6UA 4LGYA 2EA0A 3J81S 2RGHA 1UM8A 3GLIA 3LVWA 3KSJA 5DYGA 2C98A 4AG5A 2QPAA 3FUUA 2XSZA 1KYIA 2OPFA 1R2YA 4AI6A 3K1JA 1TDHA 4AQYM 3SATA 4Z8XA 2XZFA 4LZJA 4DV3M 1Q3BA 1Z5CA 4JI2M 4FWGA 3TQSA 3FYDA 1IBKM 1IY1A 3I4YA 3UZUA 1XMOM 3KOWE 4MB7A 2RKOA 3HHYA 4QNRA 4DR6M 1IN7A 1PJJA 4OVZA 1ZQ9A 4LFAM 4JXJA 4LF9M 4LJ8A 4M0WA 4FCVA 5FTJA 4LFBM 4CISA 1WXQA 2Y21A 2VIIA 4K0KM 4GH9A 3KP1E 3E9SA 2FNAA 5FLXS 4P16A 5H37D 5F3WA 1FNNA 3LQQA 1XWIA 3MHVC 2DWNA 3HU3A 1TH2A 3UGJA 5EXXA 1SXJB 1HT2E 4A3VB 2RGOA 3A98B 3KSXA 3K8ZA 1MX0A 3FTCA 2J7OA 1IN4A 5ITTA 2Z7JA 4X64M 2HCBA 2W82A 4M9XA 3KOYE 5ITXA 4D82A 8CATA 4JI4M 4REZA 4OW0A 1L2DA 4FCTA 4FD2A 4HLQA 4GKKM 2DWLA 4QOZC 3AV0A 3J27B 4FCWA 3TPZA 2ZAMA 1Z6TA 3I51A 3UMMA 2ZAOA 5IZ7D 4LZZA 4KHPM 3TWMA 3VDPA 1I4WA 1NJFA 4G4RA 2UUBM 1W5TA 2G8LA 3KDSE 3GQ3A 3KW6A 5EP4A 4AKIA 4LF4M 4G4QA 4B7GA 3CF2A 1QAQA 1HT1E 1G59A 2QBYB 4JI3M 3HJ8A 3T38A 3QAUA 2BJVA 5JI3E 4KO8A 2C9CA 2VQEM 4RNAA 4DV4M 3A45A 3GRUA 3UJNA 4GKJM 3AJIB 4LJ4A 3U6LA 3U6DA 1NJGA 2J7NA 5FSWA 3HKPA 1LV7A 3GLGA 4KODA 3U6CA 3KS8A 1TH3A 5KPRA 1PJIA 3RE8A 1YSYA 4B08A 1OFHA 1NY5A 3LMMA 5FTNA 3AOEA 4JI6M 3HHZA 5DYIA 2V1UA 4LRTA 3SAUA 4IBFA 2HHHM 1XNRM 3FD9A 1N33M 4B3TM 3DZDA 3ZC7B 3L28A 4DV6M 2UXCM 4IBJA 4MGKE 1DGHB 5IWAM 1L1ZA 3JR5A 3SAWA 2V6ZM 3K92A 2DZNB 2XSZD 5A2QS 4GIPA 4LF6M 3J7AS 5DNYA 3SMSA 3FYCA 2UUCM 3ZH9B 5ITXE 4L4UA 2R4JA 3AOGA 4BBAA 1QAOA 4IIWA 4LCBA 3KXEC 5EP2A 3NWLA 4D80A 2XFTA 1IQPA 1N32M 2KZUA 1G3IA 3NBIA 2G5GX 1IM2A 1DO2A 5BPVA 4GRIA 3HHWA 3SYLA 1GL7A 4B3SM 3AFHA 1JR3D 1QYRA 2ZM6M 4DR7M 3TL4X 3J2PB 1TH4A 4BB9A 3GLHB 4HL4A 5KQ8A 5KPTA 1K82A 2E5LM 3SARA 4IBDA 2YQZA 4OX9M 1VDDA 1IY2A 2LWXA 2XFSA 1QZMA 1E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5T A;  3Q8X A;  1GVN A; 
#chains in the Genus database with same CATH topology
 4S12 A;  3CGW A;  3SHF A;  1PJS A;  2Y0Q A;  1HNX M;  1T6O A;  3QYE A;  2R4E A;  3RFW A;  1OFI A;  4NL4 H;  3VKG A;  2ZBK B;  3QYB A;  3RGS A;  3FUT A;  5ITQ A;  1EE8 A;  4JI5 M;  2UXD M;  4L8R C;  4AKH A;  1DO0 A;  1L8Q A;  3U5Z A;  1DGF A;  4X65 M;  3R8F A;  2UUA M;  3U5Z B;  1IXS B;  4RKU F;  1GL6 A;  2CEA A;  3E4R A;  1T3T A;  2L2D A;  4DUZ M;  2ERC A;  4MGZ E;  3WHK A;  3PVS A;  1Z5A A;  1XXH A;  4DV1 M;  2CFO A;  2LVA A;  1NNJ A;  2JA2 A;  2QP9 X;  3GRR A;  3M6A A;  4XGI A;  4GIT A;  2F5S A;  3A42 A;  4LJ6 A;  3VK7 A;  1L2C A;  1GKI A;  3BBZ A;  2Y0T A;  2AHM A;  5EXP A;  1KSF X;  4LJA A;  2KNV A;  4JI0 M;  2X4A A;  2ZTD A;  3GRV A;  4NSO B;  4NXM M;  4DR5 M;  3U61 A;  3GLH A;  3J80 S;  4JI7 M;  4LGM A;  4DR4 M;  2UXB M;  5KQD A;  1YE9 A;  1TDZ A;  3VLF B;  4LRS A;  1Q39 A;  1E94 E;  1MU5 A;  3GQ5 A;  1K3X A;  3B7Z A;  2KNZ A;  2QEN A;  1AUA A;  4R71 A;  4GC9 A;  1XHB A;  1R4G A;  2L7I A;  4M9Z A;  5EJC A;  1D2N A;  2R44 A;  2DZO B;  1Q02 A;  4F1I A;  3Q8X A;  3AOE C;  4IBE A;  4LG2 A;  3KOZ E;  4B7F A;  2Z4S A;  4TUW A;  1F4I A;  2JY7 A;  3C9P A;  3UK6 A;  2B3T A;  3HZJ A;  4NOO B;  2DHR A;  4PDG A;  3U60 B;  2CV0 A;  2DKL A;  2MH8 A;  4PCZ A;  4GHA A;  4JYA M;  2JUJ A;  2CV2 A;  3U6Q A;  1SXJ D;  3AL0 C;  3GPP A;  2CHV A;  3VKH A;  4OU7 A;  1NHG C;  1NY6 A;  1QVR A;  2KZS A;  5LMU M;  2MGW A;  1VG5 A;  2DNA A;  3IG5 A;  2F5O A;  2CV1 A;  3KS4 A;  2YR0 A;  3J7B A;  1YUB A;  3GQ4 A;  2LTU A;  4BLC A;  2VQF M;  1G71 A;  3C58 A;  3T1Y M;  2F5N A;  4ITQ A;  3FTF A;  2R45 A;  1Z59 A;  2WSC F;  2OOB A;  2MRO B;  1G8P A;  2F4V M;  2YNM D;  3LW5 F;  3W0F A;  2X49 A;  1J7K A;  4XBO A;  3NBX X;  4CGY B;  4GHL A;  4M9S A;  5C18 A;  4LJ7 A;  2HKJ A;  4AKG A;  3GLG B;  4I81 A;  2VF8 A;  4I4L A;  4MGI E;  1XB2 B;  1XMQ M;  1L2B A;  5ITY A;  4WP2 A;  3SYK A;  2L6O A;  3TWL A;  5ITU A;  3MJ5 A;  3MK6 A;  3U61 B;  4FWD A;  2XF3 A;  2R18 A;  3FUX A;  4NRV A;  1VEJ A;  4I5S A;  4B3R M;  4GMQ A;  1J5E M;  3THG A;  3HHX A;  1ORY B;  4M0D A;  2C96 A;  2DI0 A;  3AKZ A;  2QBY A;  4MGY E;  3U6P A;  2KA6 B;  3M0E A;  1IN5 A;  3L26 A;  1OJL A;  2XH9 A;  2J5Y A;  4YHH M;  1XXH B;  3SMP A;  3ZQJ A;  1R2Z A;  7CAT A;  3U6S A;  4JI1 M;  3CF0 A;  2KEB A;  2OOA A;  1IXS A;  1N77 A;  2O25 A;  2I7P A;  3D8B A;  2XZU A;  1G4A E;  3FTD A;  3GLF E;  4B3M M;  4DV7 M;  1ZV1 A;  2JZ1 A;  1PM5 A;  4WUR A;  2YFQ A;  1K3W A;  2CHQ A;  1IN8 A;  4FW9 A;  2R46 A;  1ZAE A;  2KNA A;  2XLJ A;  3LQR A;  2BWE A;  2Z3X A;  4II7 A;  4PD2 A;  2Z4R A;  2D7G A;  3C3D A;  1SXJ E;  5L8R F;  1N75 A;  4UN2 B;  3JAM S;  1Z5B A;  3L29 A;  3LCU A;  4YY3 M;  3SAS A;  4Z6Y A;  4LFC M;  3HWS A;  2H1R A;  4JN6 A;  2EUC A;  5EP3 A;  2JNH A;  2CUZ A;  4PDI A;  3HU2 A;  4DBG B;  5EP1 A;  4I8O A;  1GAB A;  3L25 A;  3B9P A;  1QAM A;  1TGU A;  2R65 A;  2VDB B;  3B7Q A;  3BXW A;  3T1H M;  4QHT A;  2P5T A;  4MH0 E;  2HL7 A;  3LCV B;  1ZMU A;  4NC6 A;  4B7H A;  3GLH E;  1QZE A;  1HNW M;  4PT5 A;  2KW0 A;  2NQ8 C;  2X8A A;  2DXI A;  1DGG A;  4QNM A;  1VDL A;  4AZF A;  4NRW A;  2JZ0 A;  4CJ6 A;  3FUW A;  3IHP A;  5KPZ A;  1NO1 A;  3W0L B;  1IY0 A;  3IEC A;  3KP0 E;  5JI2 E;  3SFZ A;  2CWB A;  4OVZ B;  5FTM A;  5EQT A;  4NXN M;  3B7N A;  4DV2 M;  2G3Q A;  1TTE A;  2C9O A;  5FTK A;  3HGI A;  2ZTC A;  3U6O A;  2LVQ D;  3SBJ A;  5E26 A;  1R7R A;  3Q8G A;  2LXE A;  4IBI A;  3CF6 E;  2RRU A;  1UFZ A;  2DAE A;  3DFZ A;  5KO3 A;  1G41 A;  3U60 A;  2DWZ B;  2QQ8 A;  1EFU B;  4R3D A;  1VQ1 A;  1HQY E;  1OKS A;  4EIW A;  1DGH A;  1IXR C;  4IBK A;  2I7N A;  4G4O A;  1P3Q Q;  4LF8 M;  2WSE F;  2KRK A;  1QUT A;  1KFV A;  3LVV A;  3GRY A;  2K47 A;  2LNH C;  4LY6 A;  3BOS A;  4AW4 A;  3GLI B;  3E21 A;  3K9P A;  5FTL A;  1C7Y A;  4DR1 M;  3GLF A;  3OTO M;  1C1K A;  3FUV A;  3GPY A;  4DR2 M;  1NVM A;  1NSF A;  4FWH A;  1R6B X;  1QAN A;  2KXE A;  4IJF A;  3RGP A;  3GLF B;  3H4J A;  2DWM A;  1E32 A;  4IBB A;  4ZPX A;  2KRU A;  4LF7 M;  1IN6 A;  1L1T A;  4L78 A;  3H4M A;  2R62 A;  2V1C A;  1Q3C A;  5IRE B;  4AG6 A;  4LJ5 A;  2HAK A;  2APL A;  2UU9 M;  4NSR A;  1W5S A;  3ILK A;  1X37 A;  3HU1 A;  2XEP A;  2C5R A;  1WHC A;  2R6F A;  3EIH A;  3PNY A;  2FOI C;  2C99 A;  1FJG M;  1OQY A;  3A46 A;  4DV5 M;  3SAV A;  1N36 M;  2LH0 A;  3PNV A;  3I04 M;  2DVW B;  1SG9 A;  2M5Z A;  2D7H A;  2L09 A;  2FE8 A;  1E9R A;  2Y20 A;  2ZAN A;  3JR4 A;  4D81 A;  4JV5 M;  3FKE A;  4GC5 A;  4Y28 F;  2XGN A;  1QDT A;  3U6E A;  4F2L A;  4QOS A;  3HJQ A;  3SHG B;  1WIV A;  2EO2 A;  2CE7 A;  4CHT B;  1XC8 A;  5EXS A;  4G4N A;  2F5Q A;  3GPU A;  2CP8 A;  4KLN A;  4JI8 M;  1JQJ C;  2DEN A;  2BNK A;  3ZCB B;  3TE6 A;  2A5Y B;  5GKN A;  3SC3 A;  4DR3 M;  1RU3 A;  2MR9 A;  3PXG A;  3GO8 A;  1HR0 M;  3U6M A;  1HQC A;  1D0M A;  3EIE A;  2GQF A;  2QZ4 A;  3F92 A;  3T15 A;  3CTW B;  1SXJ A;  3GP1 A;  2JY8 A;  5ITR A;  4MM3 B;  1VEG A;  4QHS A;  4MGH A;  1N78 A;  2DAI A;  3PFI A;  1V33 A;  4DUY M;  2LVP C;  1N34 M;  4X66 M;  3DOA A;  1IBM M;  3L27 A;  3HJS A;  2QCU A;  4RF0 A;  2F5P A;  3V76 A;  1IBL M;  1GLN A;  1GVN A;  3L2A A;  2D7E A;  2KHH A;  1WGL A;  1I94 M;  2LHC A;  3TWK A;  2Q2E B;  4DV0 M;  3WHL A;  2L7H A;  3C3E A;  4LJ9 A;  3D8L A;  4IBG A;  1NHW C;  3K2L A;  3KVW A;  4L15 A;  1OIP A;  2HWJ A;  1SXJ C;  5IT9 S;  2M60 A;  2WZJ A;  3I4V A;  5EXT A;  1QQW A;  1IXZ A;  4FVM A;  1J09 A;  4ANR A;  2GNO A;  3GPX A;  4X62 M;  3VK8 A;  1TF0 B;  5BR8 M;  2O5R A;  1V34 A;  3M7G A;  3QWL A;  4G6Z A;  3VFD A;  2OQ4 A;  4IJE A;  4LF5 M;  1JR3 A;  1NNU C;  4P17 A;  1VEK A;  3DA1 A;  3FTE A;  1S3S A;  3B89 A;  5LMN M;  4IBC A;  3KOX E;  5E6J A;  1WR1 B;  1V92 A;  1TR8 A;  4L16 A;  5C1B A;  4CIZ A;  1YLA A;  3KFU G;  2BWB A;  2CHG A;  2BJW A;  2FFJ A;  3R9X B;  3IG8 A;  4Q7J A;  1MJG M;  4WW0 A;  4R7G A;  4RF1 A;  1XNQ M;  3VDU A;  1HJP A;  1DGB A;  2H5X A;  4W5W A;  1HNZ M;  4KT0 F;  1H6U A;  4LGY A;  2K0B X;  2EA0 A;  3J81 S;  2RGH A;  1UM8 A;  3GLI A;  3LVW A;  3KSJ A;  5DYG A;  2C98 A;  4AG5 A;  2QPA A;  3FUU A;  2XSZ A;  1KYI A;  2OPF A;  1R2Y A;  5DFL A;  4AI6 A;  1MN3 A;  3B74 A;  3K1J A;  1TDH A;  4L6V 6;  1Y8G A;  4AQY M;  2EKK A;  4Z8X A;  3SAT A;  2XZF A;  4LZJ A;  1OAI A;  1Q3B A;  1Z5C A;  4DV3 M;  4FWG A;  4JI2 M;  3TQS A;  3FYD A;  1IBK M;  1N33 M;  1IY1 A;  3I4Y A;  3UZU A;  1XMO M;  3KOW E;  4MB7 A;  2RKO A;  3HHY A;  1JB0 F;  4QNR A;  2JXN A;  4DR6 M;  1IN7 A;  1PJJ A;  2L4E A;  4OVZ A;  1WGN A;  1ZQ9 A;  4LFA M;  4JXJ A;  4LF9 M;  4LJ8 A;  4M0W A;  4FCV A;  5FTJ A;  4LFB M;  4CIS A;  1WXQ A;  2Y21 A;  3W67 A;  4HEO A;  2K6B A;  2VII A;  4K0K M;  4GH9 A;  3KP1 E;  3E9S A;  2CRU A;  2MJ5 B;  2FNA A;  5FLX S;  4P16 A;  5H37 D;  1R5L A;  1FNN A;  3LQQ A;  1XWI A;  2FH0 A;  5F3W A;  2OO9 A;  1QDR A;  3MHV C;  2DWN A;  3HU3 A;  1ZMW A;  1WJ7 A;  2WSF F;  1TH2 A;  3UGJ A;  5EXX A;  1SXJ B;  3GLI E;  1HT2 E;  1ZMV A;  4A3V B;  2RGO A;  3A98 B;  1OIZ A;  3KSX A;  1JR3 E;  3K8Z A;  1MX0 A;  3FTC A;  2J7O A;  1IN4 A;  5ITT A;  1PRB A;  2Z7J A;  4X64 M;  1PGY A;  2JP7 A;  2HCB A;  2W82 A;  3MMP A;  4M9X A;  3KOY E;  5ITX A;  4D82 A;  8CAT A;  2KDL A;  4JI4 M;  3E46 A;  4REZ A;  4OW0 A;  1L2D A;  2DZL A;  4FCT A;  1D0K A;  4FD2 A;  4HLQ A;  4GKK M;  2K9D A;  2DWL A;  4QOZ C;  1GJS A;  3AV0 A;  3J27 B;  4FCW A;  2N35 A;  2ZAM A;  3TPZ A;  1Z6T A;  3I51 A;  3UMM A;  2R0I A;  1BVS A;  2ZAO A;  3HX3 A;  4LZZ A;  5IZ7 D;  2EJS A;  3VDP A;  1I4W A;  3TWM A;  4KHP M;  1NJF A;  4G3O A;  4G4R A;  2UUB M;  3K9O A;  1W5T A;  2G8L A;  3KDS E;  2LVO C;  3GQ3 A;  3KW6 A;  5EP4 A;  4AKI A;  1CUK A;  4LF4 M;  4G4Q A;  2QSF X;  4B7G A;  3CF2 A;  1QAQ A;  1HT1 E;  1G59 A;  2QBY B;  4JI3 M;  3HJ8 A;  1NV9 A;  3T38 A;  3QAU A;  2BJV A;  5JI3 E;  4KO8 A;  1EIJ A;  2C9C A;  4GEW A;  2VQE M;  4RNA A;  4DV4 M;  3A45 A;  3GRU A;  3UJN A;  4GKJ M;  3AJI B;  3FE3 A;  4LJ4 A;  3I01 M;  3U6L A;  2JY6 B;  1OTR A;  3U6D A;  1NJG A;  2J7N A;  5FSW A;  1GJT A;  3HKP A;  1LV7 A;  3GLG A;  4KOD A;  1PJT A;  3U6C A;  3KS8 A;  1TH3 A;  5KPR A;  1PJI A;  3RE8 A;  1YSY A;  3FRI A;  4B08 A;  1D0L A;  1OFH A;  1NY5 A;  2DAK A;  3LMM A;  5FTN A;  3AOE A;  4JI6 M;  3HHZ A;  5DYI A;  1GO5 A;  2QNJ A;  2V1U A;  1A5T A;  4LRT A;  4IBF A;  3SAU A;  2HHH M;  3FD9 A;  1XNR M;  1XXH E;  3DZD A;  3ZC7 B;  4B3T M;  3L28 A;  4DV6 M;  2UXC M;  4IBJ A;  4MGK E;  1DGH B;  5IWA M;  1L1Z A;  2O01 F;  3JR5 A;  1IFY A;  3SAW A;  1T43 A;  2V6Z M;  3K92 A;  2DHY A;  2DZN B;  2XSZ D;  2JWS A;  5A2Q S;  2DAG A;  3GLG E;  4GIP A;  4LF6 M;  3J7A S;  5DNY A;  3SMS A;  1AIP C;  3FYC A;  2EKF A;  3ZH9 B;  2UUC M;  5ITX E;  2L4F A;  4XK8 F;  4L4U A;  2FS1 A;  3W68 A;  2R4J A;  2Z8Y M;  3AOG A;  4BBA A;  1QAO A;  4IIW A;  2QHO B;  4LCB A;  1PJQ A;  3KXE C;  5EP2 A;  3NWL A;  2DAM A;  4D80 A;  2XFT A;  1IQP A;  1N32 M;  1OAO C;  2KZU A;  2LBC A;  3FRH A;  1G3I A;  3NBI A;  2G5G X;  1IM2 A;  1DO2 A;  5BPV A;  4GRI A;  3HHW A;  1LTM A;  3SYL A;  1GL7 A;  4B3S M;  3AFH A;  1JR3 D;  1QYR A;  2ZM6 M;  4DR7 M;  3TL4 X;  1QUS A;  3T6P A;  3J2P B;  1TH4 A;  4BB9 A;  3GLH B;  2JY5 A;  4HL4 A;  5KQ8 A;  5KPT A;  1NV8 A;  1K82 A;  2E5L M;  3SAR A;  3HY5 A;  4IBD A;  2LVN C;  2YQZ A;  4OX9 M;  2VF7 A;  1VDD A;  1IY2 A;  2LWX A;  2XFS A;  1DV0 A;  1QZM A;  2LHG A;  1E9S A; 
#chains in the Genus database with same CATH homology
 4S12 A;  3SHF A;  2Y0Q A;  2R4E A;  3RFW A;  1OFI A;  4NL4 H;  3VKG A;  2ZBK B;  3RGS A;  3FUT A;  5ITQ A;  1EE8 A;  4JI5 M;  2UXD M;  4L8R C;  4AKH A;  1DO0 A;  1L8Q A;  3U5Z A;  1DGF A;  4X65 M;  3R8F A;  2UUA M;  3U5Z B;  1IXS B;  1GL6 A;  2CEA A;  3E4R A;  1T3T A;  4DUZ M;  2ERC A;  4MGZ E;  3WHK A;  3PVS A;  1Z5A A;  1XXH A;  4DV1 M;  2CFO A;  1NNJ A;  2JA2 A;  2QP9 X;  3GRR A;  3M6A A;  4XGI A;  4GIT A;  2F5S A;  3A42 A;  4LJ6 A;  3VK7 A;  1L2C A;  1GKI A;  5EXP A;  2Y0T A;  2AHM A;  1KSF X;  4LJA A;  4JI0 M;  2X4A A;  3GRV A;  4NSO B;  4NXM M;  4DR5 M;  3U61 A;  3GLH A;  3J80 S;  4JI7 M;  4LGM A;  4DR4 M;  2UXB M;  5KQD A;  1YE9 A;  1TDZ A;  3VLF B;  4LRS A;  1Q39 A;  1E94 E;  1MU5 A;  3GQ5 A;  1K3X A;  2QEN A;  4GC9 A;  1XHB A;  4M9Z A;  2L7I A;  5EJC A;  1D2N A;  2DZO B;  3Q8X A;  3AOE C;  4IBE A;  4LG2 A;  3KOZ E;  4B7F A;  2Z4S A;  4TUW A;  3UK6 A;  4NOO B;  2DHR A;  4PDG A;  3U60 B;  2CV0 A;  4PCZ A;  4GHA A;  4JYA M;  2CV2 A;  3U6Q A;  1SXJ D;  3AL0 C;  3GPP A;  2CHV A;  4OU7 A;  1NHG C;  1NY6 A;  1QVR A;  2KZS A;  5LMU M;  3IG5 A;  2F5O A;  2CV1 A;  3KS4 A;  2YR0 A;  3J7B A;  1YUB A;  3GQ4 A;  4BLC A;  2VQF M;  3T1Y M;  3C58 A;  2F5N A;  4ITQ A;  3FTF A;  2R45 A;  1Z59 A;  2F4V M;  1G8P A;  2YNM D;  3W0F A;  2X49 A;  1J7K A;  4XBO A;  4CGY B;  4GHL A;  4M9S A;  5C18 A;  4LJ7 A;  2HKJ A;  4AKG A;  3GLG B;  4I81 A;  4I4L A;  4MGI E;  1L2B A;  1XMQ M;  5ITY A;  3SYK A;  3TWL A;  2L6O A;  5ITU A;  3U61 B;  3MJ5 A;  3MK6 A;  1HNX M;  4FWD A;  2XF3 A;  2R18 A;  3FUX A;  4NRV A;  4I5S A;  4B3R M;  4GMQ A;  1J5E M;  3THG A;  3HHX A;  1ORY B;  4M0D A;  2C96 A;  3AKZ A;  2QBY A;  4MGY E;  3U6P A;  2KA6 B;  3M0E A;  1IN5 A;  3L26 A;  1OJL A;  2XH9 A;  4YHH M;  1XXH B;  3SMP A;  1R2Z A;  7CAT A;  3U6S A;  4JI1 M;  3CF0 A;  2KEB A;  1N77 A;  3D8B A;  2I7P A;  2XZU A;  1G4A E;  3FTD A;  4B3M M;  4DV7 M;  1PM5 A;  4WUR A;  2YFQ A;  1K3W A;  2CHQ A;  1IN8 A;  4FW9 A;  2R46 A;  1ZAE A;  2XLJ A;  3LQR A;  2Z3X A;  4II7 A;  4PD2 A;  2Z4R A;  2D7G A;  1SXJ E;  1N75 A;  3JAM S;  1Z5B A;  3L29 A;  4YY3 M;  3SAS A;  4Z6Y A;  4LFC M;  3HWS A;  2H1R A;  4JN6 A;  2EUC A;  5EP3 A;  2CUZ A;  4PDI A;  3HU2 A;  5EP1 A;  4I8O A;  3L25 A;  3B9P A;  1QAM A;  1TGU A;  2R65 A;  3T1H M;  4QHT A;  2P5T A;  4MH0 E;  2HL7 A;  4B7H A;  1HNW M;  4PT5 A;  2KW0 A;  2NQ8 C;  2X8A A;  2DXI A;  1DGG A;  4QNM A;  4AZF A;  4NRW A;  3FUW A;  5KPZ A;  3W0L B;  1IY0 A;  3KP0 E;  5JI2 E;  3SFZ A;  4OVZ B;  5FTM A;  5EQT A;  4NXN M;  4DV2 M;  2C9O A;  5FTK A;  3HGI A;  3U6O A;  3SBJ A;  5E26 A;  1R7R A;  2LXE A;  4IBI A;  3CF6 E;  5KO3 A;  3DFZ A;  3U60 A;  1G41 A;  2DWZ B;  4R3D A;  1HQY E;  4EIW A;  1DGH A;  1IXR C;  4IBK A;  2I7N A;  4G4O A;  4LF8 M;  2KRK A;  1KFV A;  3LVV A;  3GRY A;  2K47 A;  2LNH C;  4LY6 A;  3BOS A;  4AW4 A;  3GLI B;  5FTL A;  4DR1 M;  3GLF A;  3OTO M;  1C1K A;  3FUV A;  3GPY A;  4DR2 M;  1NVM A;  1NSF A;  4FWH A;  1R6B X;  1QAN A;  2KXE A;  4IJF A;  3RGP A;  3GLF B;  2DWM A;  1E32 A;  4IBB A;  4ZPX A;  2KRU A;  4LF7 M;  1IN6 A;  1L1T A;  4L78 A;  3H4M A;  2R62 A;  2V1C A;  1Q3C A;  5IRE B;  4AG6 A;  4LJ5 A;  2UU9 M;  4NSR A;  1W5S A;  3ILK A;  1X37 A;  3HU1 A;  2XEP A;  2C5R A;  3EIH A;  3PNY A;  2FOI C;  2C99 A;  1FJG M;  3A46 A;  4DV5 M;  3SAV A;  1N36 M;  2LH0 A;  3PNV A;  2DVW B;  2M5Z A;  2D7H A;  2L09 A;  2FE8 A;  1E9R A;  2Y20 A;  2ZAN A;  3JR4 A;  4D81 A;  4JV5 M;  3FKE A;  4GC5 A;  2XGN A;  3U6E A;  4QOS A;  3HJQ A;  3SHG B;  2EO2 A;  2CE7 A;  4CHT B;  1XC8 A;  5EXS A;  4G4N A;  2F5Q A;  3GPU A;  4KLN A;  4JI8 M;  1JQJ C;  2BNK A;  3ZCB B;  3TE6 A;  2A5Y B;  5GKN A;  3SC3 A;  4DR3 M;  3PXG A;  3GO8 A;  1HR0 M;  3U6M A;  1HQC A;  3EIE A;  2QZ4 A;  3T15 A;  3CTW B;  1SXJ A;  3GP1 A;  5ITR A;  4MM3 B;  4QHS A;  4MGH A;  1N78 A;  3PFI A;  4DUY M;  1N34 M;  4X66 M;  3DOA A;  1IBM M;  3L27 A;  3HJS A;  2QCU A;  4RF0 A;  2F5P A;  1IBL M;  3VKH A;  1GLN A;  1GVN A;  3L2A A;  2D7E A;  1I94 M;  3TWK A;  2Q2E B;  4DV0 M;  3WHL A;  2L7H A;  4LJ9 A;  3D8L A;  4IBG A;  1NHW C;  3K2L A;  3KVW A;  4L15 A;  5IT9 S;  1SXJ C;  2M60 A;  3I4V A;  5EXT A;  1QQW A;  1IXZ A;  4FVM A;  1J09 A;  3GPX A;  4X62 M;  3VK8 A;  5BR8 M;  2O5R A;  4G6Z A;  3M7G A;  3QWL A;  3VFD A;  2OQ4 A;  4IJE A;  4LF5 M;  1JR3 A;  1NNU C;  3DA1 A;  3FTE A;  1S3S A;  5LMN M;  4IBC A;  3KOX E;  5E6J A;  4L16 A;  5C1B A;  3KFU G;  2CHG A;  2BJW A;  2FFJ A;  3R9X B;  3IG8 A;  4WW0 A;  4R7G A;  4RF1 A;  1XNQ M;  3VDU A;  1DGB A;  4W5W A;  1HNZ M;  1H6U A;  4LGY A;  2EA0 A;  3J81 S;  2RGH A;  1UM8 A;  3GLI A;  3LVW A;  3KSJ A;  5DYG A;  2C98 A;  4AG5 A;  2QPA A;  3FUU A;  2XSZ A;  1KYI A;  2OPF A;  1R2Y A;  4AI6 A;  3K1J A;  1TDH A;  4AQY M;  3SAT A;  4Z8X A;  2XZF A;  4LZJ A;  4DV3 M;  1Q3B A;  1Z5C A;  4JI2 M;  4FWG A;  3TQS A;  3FYD A;  1IBK M;  1IY1 A;  3I4Y A;  3UZU A;  1XMO M;  3KOW E;  4MB7 A;  2RKO A;  3HHY A;  4QNR A;  4DR6 M;  1IN7 A;  1PJJ A;  4OVZ A;  1ZQ9 A;  4LFA M;  4JXJ A;  4LF9 M;  4LJ8 A;  4M0W A;  4FCV A;  5FTJ A;  4LFB M;  4CIS A;  1WXQ A;  2Y21 A;  2VII A;  4K0K M;  4GH9 A;  3KP1 E;  3E9S A;  2FNA A;  5FLX S;  4P16 A;  5H37 D;  5F3W A;  1FNN A;  3LQQ A;  1XWI A;  3MHV C;  2DWN A;  3HU3 A;  1TH2 A;  3UGJ A;  5EXX A;  1SXJ B;  1HT2 E;  4A3V B;  2RGO A;  3A98 B;  3KSX A;  3K8Z A;  1MX0 A;  3FTC A;  2J7O A;  1IN4 A;  5ITT A;  2Z7J A;  4X64 M;  2HCB A;  2W82 A;  4M9X A;  3KOY E;  5ITX A;  4D82 A;  8CAT A;  4JI4 M;  4REZ A;  4OW0 A;  1L2D A;  4FCT A;  4FD2 A;  4HLQ A;  4GKK M;  2DWL A;  4QOZ C;  3AV0 A;  3J27 B;  4FCW A;  3TPZ A;  2ZAM A;  1Z6T A;  3I51 A;  3UMM A;  2ZAO A;  5IZ7 D;  4LZZ A;  4KHP M;  3TWM A;  3VDP A;  1I4W A;  1NJF A;  4G4R A;  2UUB M;  1W5T A;  2G8L A;  3KDS E;  3GQ3 A;  3KW6 A;  5EP4 A;  4AKI A;  4LF4 M;  4G4Q A;  4B7G A;  3CF2 A;  1QAQ A;  1HT1 E;  1G59 A;  2QBY B;  4JI3 M;  3HJ8 A;  3T38 A;  3QAU A;  2BJV A;  5JI3 E;  4KO8 A;  2C9C A;  2VQE M;  4RNA A;  4DV4 M;  3A45 A;  3GRU A;  3UJN A;  4GKJ M;  3AJI B;  4LJ4 A;  3U6L A;  3U6D A;  1NJG A;  2J7N A;  5FSW A;  3HKP A;  1LV7 A;  3GLG A;  4KOD A;  3U6C A;  3KS8 A;  1TH3 A;  5KPR A;  1PJI A;  3RE8 A;  1YSY A;  4B08 A;  1OFH A;  1NY5 A;  3LMM A;  5FTN A;  3AOE A;  4JI6 M;  3HHZ A;  5DYI A;  2V1U A;  4LRT A;  3SAU A;  4IBF A;  2HHH M;  1XNR M;  3FD9 A;  1N33 M;  4B3T M;  3DZD A;  3ZC7 B;  3L28 A;  4DV6 M;  2UXC M;  4IBJ A;  4MGK E;  1DGH B;  5IWA M;  1L1Z A;  3JR5 A;  3SAW A;  2V6Z M;  3K92 A;  2DZN B;  2XSZ D;  5A2Q S;  4GIP A;  4LF6 M;  3J7A S;  5DNY A;  3SMS A;  3FYC A;  2UUC M;  3ZH9 B;  5ITX E;  4L4U A;  2R4J A;  3AOG A;  4BBA A;  1QAO A;  4IIW A;  4LCB A;  3KXE C;  5EP2 A;  3NWL A;  4D80 A;  2XFT A;  1IQP A;  1N32 M;  2KZU A;  1G3I A;  3NBI A;  2G5G X;  1IM2 A;  1DO2 A;  5BPV A;  4GRI A;  3HHW A;  3SYL A;  1GL7 A;  4B3S M;  3AFH A;  1JR3 D;  1QYR A;  2ZM6 M;  4DR7 M;  3TL4 X;  3J2P B;  1TH4 A;  4BB9 A;  3GLH B;  4HL4 A;  5KQ8 A;  5KPT A;  1K82 A;  2E5L M;  3SAR A;  4IBD A;  2YQZ A;  4OX9 M;  1VDD A;  1IY2 A;  2LWX A;  2XFS A;  1QZM A;  1E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...