1GJSA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immunoglobulin-binding protein
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjsA00
2FS1A 1GABA 2LHGA 2N35A 2VDBB 2KDLA 2MH8A 1TF0B 1GJTA 2J5YA 2JWSA 2LHCA 1PRBA 1GJSA
chains in the Genus database with same CATH superfamily
3ZC7B 4R71A 1ZV1A 2R65A 3GO8A 2XGNA 3IG8A 1K3WA 5KPTA 2WSEF 3W67A 2CUZA 4DV5M 4IBKA 1DGHB 2EJSA 4LY6A 4AKHA 3IHPA 3F92A 1Z6TA 2BNKA 7CATA 3SAVA 2JY6B 2JY7A 4NSOB 3SATA 3GLHE 4DUYM 1GJSA 3FUUA 4CGYB 3J80S 3GLIB 4GITA 3I01M 1WXQA 1WHCA 2LVNC 2F5QA 3SYKA 3TWKA 1SXJB 4Y28F 4XBOA 2DAEA 3Q8XA 3UJNA 3VKHA 1HT1E 1XWIA 1G41A 2RKOA 4CJ6A 4IBCA 3BXWA 2CV0A 2FOIC 3KVWA 1ORYB 2V1UA 3E4RA 1ZMVA 1D0LA 3A98B 1OIPA 4AZFA 4NXNM 1DGBA 2HKJA 4D80A 2OO9A 3KOXE 4L15A 4R7GA 3AOEA 1IY1A 3GRUA 4LRTA 4M9ZA 2XSZD 1IXRC 2H1RA 2ZANA 4KO8A 5IT9S 2UUAM 4L8RC 3GPPA 4PT5A 1NHWC 1ZAEA 2J5YA 2K6BA 1DO0A 4I81A 1FNNA 2QP9X 3B7NA 3FTDA 4IJEA 1XXHA 2DHYA 2FE8A 3L28A 1PRBA 1D0MA 2UXDM 1JQJC 2DWMA 1TDHA 3AOEC 3ZCBB 3A45A 1IXZA 2L6OA 3H4MA 2C99A 4I8OA 4RNAA 3SAUA 3SC3A 2C98A 3J81S 5DFLA 3EIEA 4FCTA 2DWZB 3GLGB 4HLQA 1PJJA 5C18A 1WJ7A 3E9SA 4GIPA 3T1YM 5EQTA 4LFAM 3U61A 2LVQD 2A5YB 2FS1A 3AV0A 1FJGM 4LFBM 2W82A 5DYIA 4JI2M 4QHSA 1IBMM 1N36M 1WR1B 2DI0A 1QZMA 3V76A 4LF6M 4NOOB 2D7HA 4G4QA 2L7IA 3AKZA 4DR4M 4DR7M 4GHLA 1LV7A 5FLXS 2KZSA 1EIJA 2Y0TA 3SBJA 2KA6B 2ERCA 3C3DA 2DVWB 1E32A 4FD2A 1DGGA 2OOAA 2X49A 2F4VM 4L78A 1L1TA 1TF0B 2XLJA 2CP8A 3SHGB 1EE8A 3WHLA 1TH4A 1QYRA 2R44A 3L26A 3KFUG 4AG6A 2MGWA 2DAMA 3FTCA 3LMMA 1T3TA 4LGYA 2WSCF 2QQ8A 1K3XA 4JYAM 3CTWB 5FTLA 4JI6M 5KQDA 2Z4SA 4AG5A 1UFZA 4MGZE 1XNQM 2WZJA 4RKUF 3GP1A 3J7AS 5H37D 4A3VB 4LFCM 3U5ZB 4IBFA 4G4OA 4JI5M 3LVWA 4CISA 1NY6A 1R7RA 3FE3A 3W68A 3SHFA 5ITUA 5LMUM 5E26A 3JR4A 1Q3CA 1R2YA 5DNYA 1IY2A 3QAUA 2BWEA 1WIVA 2R46A 2LXEA 1R4GA 3FRIA 4IJFA 4DUZM 2QBYB 4LCBA 1YE9A 5EP4A 2DWNA 4NC6A 4Z6YA 1TR8A 3GQ5A 2F5PA 1F4IA 2C96A 3RFWA 1IY0A 2G3QA 4FVMA 2R0IA 4FCVA 1IXSA 5EJCA 2K47A 2VF7A 3VLFB 3HHWA 3U6EA 2LH0A 4JI1M 3GLHB 1PJIA 4GC5A 4DV4M 4LG2A 3UZUA 4JI3M 1I4WA 3L27A 4D82A 5KPRA 4HL4A 1N34M 5ITQA 1I94M 2O01F 3K9PA 3ZQJA 1NV8A 3UMMA 1KFVA 2XZUA 3MK6A 4DR2M 3FKEA 3HKPA 4DR1M 1L2DA 2DZLA 2VIIA 1OAOC 2DAGA 4S12A 1NO1A 4DBGB 3FTFA 2YNMD 4LRSA 1D0KA 4B7HA 4X62M 2M60A 1R5LA 4MB7A 4LF5M 5ITTA 1V34A 3NWLA 4YY3M 2OQ4A 3TL4X 1XC8A 5BR8M 3Q8GA 3U60B 3J2PB 4ITQA 5A2QS 4OVZA 3AJIB 2LWXA 4WW0A 3MHVC 1IN7A 3R8FA 1QDRA 2EKKA 2X4AA 1E9RA 4LZZA 3AOGA 3C3EA 1PJSA 4AKGA 3LVVA 1ZQ9A 2HAKA 4LJ4A 4GC9A 1Z5AA 2JNHA 2JXNA 3U6OA 1TTEA 2K9DA 4HEOA 2DZNB 3R9XB 2HCBA 2L7HA 2BJVA 4OW0A 3A46A 4GKKM 1NNUC 3KS4A 1OFHA 3LQQA 4DR5M 1WGNA 2CHQA 1JB0F 1GKIA 2CFOA 2RGHA 5FTMA 3VDUA 3HU2A 4AKIA 5EP2A 2BJWA 4BBAA 3K9OA 4JI4M 4MGYE 2H5XA 4NL4H 1G3IA 3LQRA 3FYDA 2F5SA 4LF8M 5IZ7D 2C9CA 1DO2A 2DHRA 4F1IA 3C58A 2O25A 2ZTCA 2LHGA 4BLCA 3BBZA 5ITXA 1Q3BA 1NJGA 2Y0QA 1QAQA 3HHZA 2KRUA 4I5SA 3U6CA 2DXIA 1N33M 1TDZA 1XMOM 5EP3A 3U6SA 1PM5A 1VEJA 2CV1A 3GRRA 3H4JA 3NBXX 3FUTA 3K8ZA 3M6AA 1VDLA 2LVPC 1Z59A 4DV3M 3VKGA 1HQCA 2DNAA 1XNRM 2MR9A 5FSWA 4OX9M 2G5GX 2KEBA 4FWDA 2C9OA 2EKFA 1MJGM 4LF7M 1DGFA 2YR0A 1OKSA 1PJTA 3QWLA 4QHTA 1Q02A 1MU5A 3HWSA 3U6PA 4L6V6 2XF3A 2F5OA 2F5NA 1QANA 5FTJA 4IIWA 4PDIA 4LJ6A 3HU3A 4PD2A 1BVSA 4MGIE 1R2ZA 5DYGA 5EXSA 2KNVA 3HU1A 4B7FA 4PDGA 1KYIA 1VQ1A 1IN5A 2KW0A 3HY5A 4B3RM 2EO2A 5EXXA 3T1HM 2QPAA 2R4EA 1XHBA 1NNJA 3SASA 3U6QA 3BOSA 2LNHC 3AFHA 4G3OA 1VEKA 3A42A 4LF4M 4ANRA 2XH9A 4FW9A 2XEPA 4JI7M 1NHGC 5IWAM 3GLFA 1VG5A 1XXHB 2GNOA 1ZMUA 1N78A 1OJLA 2LVAA 4PCZA 1IBLM 3DZDA 3L29A 4OU7A 4M0WA 1V33A 1IN8A 4DV1M 2D7EA 4LJ7A 4CHTB 5JI3E 1JR3A 2NQ8C 4X65M 3SARA 1DGHA 2RGOA 4G6ZA 1QAMA 2J7NA 2QNJA 2Y20A 5ITYA 2X8AA 1HNXM 4B3SM 3HHYA 4AQYM 3CGWA 2HWJA 4EIWA 3FUWA 2DZOB 4W5WA 3PVSA 3KOWE 3TPZA 4DR6M 1OQYA 1QQWA 3DOAA 4FWGA 4F2LA 4AI6A 3KSJA 3GLIA 3U61B 2BWBA 3VK7A 2Z8YM 3EIHA 1T43A 3JR5A 1SXJA 4DV2M 1QUTA 1XXHE 2CHVA 3FTEA 4QOZC 1AIPC 2LTUA 3U6DA 1S3SA 3HZJA 1N75A 1L2CA 4GRIA 2JY5A 4JV5M 2KZUA 2ZAOA 3TQSA 3CF0A 4G4NA 1Z5BA 5ITXE 2CRUA 1W5SA 3JAMS 3ZH9B 1YSYA 3VK8A 2JZ1A 4JN6A 2V6ZM 2WSFF 3SMPA 5KQ8A 4WP2A 1W5TA 2KNAA 2G8LA 2I7PA 4KLNA 3I4YA 3KDSE 3FUVA 1C1KA 8CATA 1SXJC 4KODA 3IECA 4P17A 2R62A 4LJAA 1YLAA 2HL7A 5EP1A 1PGYA 1G8PA 5E6JA 3W0FA 3K1JA 2Z3XA 4B3TM 4IBGA 2CV2A 4DR3M 1QZEA 4XK8F 4K0KM 3LCVB 2N35A 3PNVA 3CF2A 2KXEA 3UGJA 2UXCM 1OIZA 3RE8A 3GLFB 3HJ8A 1NV9A 4M0DA 4Z8XA 4QOSA 4LZJA 1GL7A 4JI8M 3D8LA 2LBCA 4IBEA 3TWMA 2DAKA 3IG5A 2B3TA 2XZFA 1D2NA 2GQFA 3U6MA 2KNZA 1PJQA 1KSFX 1A5TA 3T38A 3GLGA 1SXJD 1NJFA 3GQ4A 2L4EA 2MH8A 2UUBM 4LF9M 2FNAA 4UN2B 3GRVA 2M5ZA 1MN3A 4FCWA 1G59A 1K82A 3GQ3A 5C1BA 2DWLA 2VDBB 5EXPA 2R4JA 2KDLA 3HJSA 3L2AA 2AHMA 1IXSB 1QDTA 3FYCA 3KSXA 3B9PA 4D81A 5KO3A 4MGKE 3GLFE 1CUKA 3KOZE 5GKNA 3HHXA 3GRYA 1GL6A 3PNYA 4BB9A 2CWBA 2VQFM 2JP7A 1QVRA 1EFUB 3K92A 4JXJA 2ZM6M 2E5LM 1JR3E 1VEGA 2DAIA 3FUXA 3LCUA 2Z7JA 3QYEA 4LJ8A 4AW4A 2JZ0A 1H6UA 2CEAA 1OAIA 3NBIA 3PXGA 4ZPXA 2O5RA 1C7YA 2I7NA 4KT0F 3W0LB 2QCUA 4X66M 3GLIE 1NVMA 2V1CA 3J27B 4YHHM 4IBJA 1WGLA 1SXJE 5LMNM 1N32M 1NY5A 1GLNA 4GMQA 3HJQA 4OVZB 2EA0A 1GO5A 2UU9M 3TWLA 5ITRA 3B7ZA 1IQPA 2J7OA 3L25A 1DV0A 2K0BX 3M0EA 4GH9A 2QZ4A 4MH0E 1J7KA 2XFSA 4LJ5A 1UM8A 3GPUA 1L2BA 3VDPA 2CE7A 4RF0A 3U5ZA 2UXBM 2EUCA 2MROB 4XGIA 3KS8A 4NSRA 3T6PA 3C9PA 3B74A 3I4VA 4M9SA 4MM3B 2HHHM 1HQYE 3SYLA 3J7BA 1GJTA 4NRWA 4KHPM 2R18A 3RGSA 4REZA 1L1ZA 4WURA 3B7QA 3E21A 2QBYA 4B7GA 1HNWM 4R3DA 3MMPA 2ZBKB 2JUJA 2LHCA 2R6FA 4X64M 2Y21A 4LJ9A 4B08A 5BPVA 1TH3A 3MJ5A 3U6LA 1XB2B 2CHGA 3RGPA 1OTRA 1HJPA 1L8QA 3GLHA 1IBKM 1Y8GA 4IBDA 4LGMA 5EXTA 4I4LA 3THGA 2OPFA 1J09A 4IBBA 5JI2E 4B3MM 4JI0M 3TE6A 2QSFX 3CF6E 3I51A 2KRKA 2OOBA 4DV6M 3KOYE 5FTKA 3GLGE 1GVNA 3T15A 2APLA 3KP1E 3SAWA 2JY8A 3WHKA 3KW6A 2UUCM 4DV0M 3I04M 1IM2A 2QHOB 2XFTA 1T6OA 1QUSA 3D8BA 1E94E 1HNZM 5IREB 5F3WA 4MGHA 2LVOC 3U60A 1G4AE 1X37A 2D7GA 3E46A 1HR0M 4GHAA 1YUBA 3UK6A 1NSFA 1XMQM 2DKLA 1P3QQ 4TUWA 2R45A 2YQZA 2QENA 3SMSA 1R6BX 3PFIA 4NRVA 3SFZA 1Z5CA 1IN4A 3VFDA 4CIZA 3OTOM 2ZAMA 4GKJM 2KHHA 2ZTDA 1HT2E 2L09A 5L8RF 3DFZA 2RRUA 3LW5F 1GABA 2MJ5B 1E9SA 2Q2EB 4Q7JA 3FRHA 2P5TA 3HGIA 1LTMA 4L16A 3FD9A 3GPXA 2VQEM 4P16A 1VDDA 1Q39A 1SG9A 4DV7M 1TGUA 1AUAA 3KXEC 2YFQA 3KP0E 4QNMA 4IBIA 1OFIA 1IFYA 3B89A 1RU3A 3GPYA 1G71A 1MX0A 3K2LA 4GEWA 3HX3A 2FFJA 2JA2A 4M9XA 2L2DA 3DA1A 4II7A 4QNRA 3AL0C 1IN6A 4L4UA 1QAOA 1V92A 4NXMM 3M7GA 2C5RA 5KPZA 4RF1A 2Z4RA 1N77A 5FTNA 2VF8A 1ZMWA 4G4RA 2XSZA 1J5EM 2FH0A 2DENA 1JR3D 1TH2A 2JWSA 4FWHA 2L4FA 3ILKA 3QYBA
chains in the Genus database with same CATH topology
2FS1A 1GABA 2LHGA 2N35A 2VDBB 2KDLA 2MH8A 1TF0B 1GJTA 2J5YA 2JWSA 2LHCA 1PRBA 1GJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS1 A;  1GAB A;  2LHG A;  2N35 A;  2VDB B;  2KDL A;  2MH8 A;  1TF0 B;  1GJT A;  2J5Y A;  2JWS A;  2LHC A;  1PRB A;  1GJS A; 
#chains in the Genus database with same CATH topology
 3ZC7 B;  4R71 A;  1ZV1 A;  2R65 A;  3GO8 A;  2XGN A;  3IG8 A;  1K3W A;  5KPT A;  2WSE F;  3W67 A;  2CUZ A;  4DV5 M;  4IBK A;  1DGH B;  2EJS A;  4LY6 A;  4AKH A;  3IHP A;  3F92 A;  1Z6T A;  2BNK A;  7CAT A;  3SAV A;  2JY6 B;  2JY7 A;  4NSO B;  3SAT A;  3GLH E;  4DUY M;  1GJS A;  3FUU A;  4CGY B;  3J80 S;  3GLI B;  4GIT A;  3I01 M;  1WXQ A;  1WHC A;  2LVN C;  2F5Q A;  3SYK A;  3TWK A;  1SXJ B;  4Y28 F;  4XBO A;  2DAE A;  3Q8X A;  3UJN A;  3VKH A;  1HT1 E;  1XWI A;  1G41 A;  2RKO A;  4CJ6 A;  4IBC A;  3BXW A;  2CV0 A;  2FOI C;  3KVW A;  1ORY B;  2V1U A;  3E4R A;  1ZMV A;  1D0L A;  3A98 B;  1OIP A;  4AZF A;  4NXN M;  1DGB A;  2HKJ A;  4D80 A;  2OO9 A;  3KOX E;  4L15 A;  4R7G A;  3AOE A;  1IY1 A;  3GRU A;  4LRT A;  4M9Z A;  2XSZ D;  1IXR C;  2H1R A;  2ZAN A;  4KO8 A;  5IT9 S;  2UUA M;  4L8R C;  3GPP A;  4PT5 A;  1NHW C;  1ZAE A;  2J5Y A;  2K6B A;  1DO0 A;  4I81 A;  1FNN A;  2QP9 X;  3B7N A;  3FTD A;  4IJE A;  1XXH A;  2DHY A;  2FE8 A;  3L28 A;  1PRB A;  1D0M A;  2UXD M;  1JQJ C;  2DWM A;  1TDH A;  3AOE C;  3ZCB B;  3A45 A;  1IXZ A;  2L6O A;  3H4M A;  2C99 A;  4I8O A;  4RNA A;  3SAU A;  3SC3 A;  2C98 A;  3J81 S;  5DFL A;  3EIE A;  4FCT A;  2DWZ B;  3GLG B;  4HLQ A;  1PJJ A;  5C18 A;  1WJ7 A;  3E9S A;  4GIP A;  3T1Y M;  5EQT A;  4LFA M;  3U61 A;  2LVQ D;  2A5Y B;  2FS1 A;  3AV0 A;  1FJG M;  4LFB M;  2W82 A;  5DYI A;  4JI2 M;  4QHS A;  1IBM M;  1N36 M;  1WR1 B;  2DI0 A;  1QZM A;  3V76 A;  4LF6 M;  4NOO B;  2D7H A;  4G4Q A;  2L7I A;  3AKZ A;  4DR4 M;  4DR7 M;  4GHL A;  1LV7 A;  5FLX S;  2KZS A;  1EIJ A;  2Y0T A;  3SBJ A;  2KA6 B;  2ERC A;  3C3D A;  2DVW B;  1E32 A;  4FD2 A;  1DGG A;  2OOA A;  2X49 A;  2F4V M;  4L78 A;  1L1T A;  1TF0 B;  2XLJ A;  2CP8 A;  3SHG B;  1EE8 A;  3WHL A;  1TH4 A;  1QYR A;  2R44 A;  3L26 A;  3KFU G;  4AG6 A;  2MGW A;  2DAM A;  3FTC A;  3LMM A;  1T3T A;  4LGY A;  2WSC F;  2QQ8 A;  1K3X A;  4JYA M;  3CTW B;  5FTL A;  4JI6 M;  5KQD A;  2Z4S A;  4AG5 A;  1UFZ A;  4MGZ E;  1XNQ M;  2WZJ A;  4RKU F;  3GP1 A;  3J7A S;  5H37 D;  4A3V B;  4LFC M;  3U5Z B;  4IBF A;  4G4O A;  4JI5 M;  3LVW A;  4CIS A;  1NY6 A;  1R7R A;  3FE3 A;  3W68 A;  3SHF A;  5ITU A;  5LMU M;  5E26 A;  3JR4 A;  1Q3C A;  1R2Y A;  5DNY A;  1IY2 A;  3QAU A;  2BWE A;  1WIV A;  2R46 A;  2LXE A;  1R4G A;  3FRI A;  4IJF A;  4DUZ M;  2QBY B;  4LCB A;  1YE9 A;  5EP4 A;  2DWN A;  4NC6 A;  4Z6Y A;  1TR8 A;  3GQ5 A;  2F5P A;  1F4I A;  2C96 A;  3RFW A;  1IY0 A;  2G3Q A;  4FVM A;  2R0I A;  4FCV A;  1IXS A;  5EJC A;  2K47 A;  2VF7 A;  3VLF B;  3HHW A;  3U6E A;  2LH0 A;  4JI1 M;  3GLH B;  1PJI A;  4GC5 A;  4DV4 M;  4LG2 A;  3UZU A;  4JI3 M;  1I4W A;  3L27 A;  4D82 A;  5KPR A;  4HL4 A;  1N34 M;  5ITQ A;  1I94 M;  2O01 F;  3K9P A;  3ZQJ A;  1NV8 A;  3UMM A;  1KFV A;  2XZU A;  3MK6 A;  4DR2 M;  3FKE A;  3HKP A;  4DR1 M;  1L2D A;  2DZL A;  2VII A;  1OAO C;  2DAG A;  4S12 A;  1NO1 A;  4DBG B;  3FTF A;  2YNM D;  4LRS A;  1D0K A;  4B7H A;  4X62 M;  2M60 A;  1R5L A;  4MB7 A;  4LF5 M;  5ITT A;  1V34 A;  3NWL A;  4YY3 M;  2OQ4 A;  3TL4 X;  1XC8 A;  5BR8 M;  3Q8G A;  3U60 B;  3J2P B;  4ITQ A;  5A2Q S;  4OVZ A;  3AJI B;  2LWX A;  4WW0 A;  3MHV C;  1IN7 A;  3R8F A;  1QDR A;  2EKK A;  2X4A A;  1E9R A;  4LZZ A;  3AOG A;  3C3E A;  1PJS A;  4AKG A;  3LVV A;  1ZQ9 A;  2HAK A;  4LJ4 A;  4GC9 A;  1Z5A A;  2JNH A;  2JXN A;  3U6O A;  1TTE A;  2K9D A;  4HEO A;  2DZN B;  3R9X B;  2HCB A;  2L7H A;  2BJV A;  4OW0 A;  3A46 A;  4GKK M;  1NNU C;  3KS4 A;  1OFH A;  3LQQ A;  4DR5 M;  1WGN A;  2CHQ A;  1JB0 F;  1GKI A;  2CFO A;  2RGH A;  5FTM A;  3VDU A;  3HU2 A;  4AKI A;  5EP2 A;  2BJW A;  4BBA A;  3K9O A;  4JI4 M;  4MGY E;  2H5X A;  4NL4 H;  1G3I A;  3LQR A;  3FYD A;  2F5S A;  4LF8 M;  5IZ7 D;  2C9C A;  1DO2 A;  2DHR A;  4F1I A;  3C58 A;  2O25 A;  2ZTC A;  2LHG A;  4BLC A;  3BBZ A;  5ITX A;  1Q3B A;  1NJG A;  2Y0Q A;  1QAQ A;  3HHZ A;  2KRU A;  4I5S A;  3U6C A;  2DXI A;  1N33 M;  1TDZ A;  1XMO M;  5EP3 A;  3U6S A;  1PM5 A;  1VEJ A;  2CV1 A;  3GRR A;  3H4J A;  3NBX X;  3FUT A;  3K8Z A;  3M6A A;  1VDL A;  2LVP C;  1Z59 A;  4DV3 M;  3VKG A;  1HQC A;  2DNA A;  1XNR M;  2MR9 A;  5FSW A;  4OX9 M;  2G5G X;  2KEB A;  4FWD A;  2C9O A;  2EKF A;  1MJG M;  4LF7 M;  1DGF A;  2YR0 A;  1OKS A;  1PJT A;  3QWL A;  4QHT A;  1Q02 A;  1MU5 A;  3HWS A;  3U6P A;  4L6V 6;  2XF3 A;  2F5O A;  2F5N A;  1QAN A;  5FTJ A;  4IIW A;  4PDI A;  4LJ6 A;  3HU3 A;  4PD2 A;  1BVS A;  4MGI E;  1R2Z A;  5DYG A;  5EXS A;  2KNV A;  3HU1 A;  4B7F A;  4PDG A;  1KYI A;  1VQ1 A;  1IN5 A;  2KW0 A;  3HY5 A;  4B3R M;  2EO2 A;  5EXX A;  3T1H M;  2QPA A;  2R4E A;  1XHB A;  1NNJ A;  3SAS A;  3U6Q A;  3BOS A;  2LNH C;  3AFH A;  4G3O A;  1VEK A;  3A42 A;  4LF4 M;  4ANR A;  2XH9 A;  4FW9 A;  2XEP A;  4JI7 M;  1NHG C;  5IWA M;  3GLF A;  1VG5 A;  1XXH B;  2GNO A;  1ZMU A;  1N78 A;  1OJL A;  2LVA A;  4PCZ A;  1IBL M;  3DZD A;  3L29 A;  4OU7 A;  4M0W A;  1V33 A;  1IN8 A;  4DV1 M;  2D7E A;  4LJ7 A;  4CHT B;  5JI3 E;  1JR3 A;  2NQ8 C;  4X65 M;  3SAR A;  1DGH A;  2RGO A;  4G6Z A;  1QAM A;  2J7N A;  2QNJ A;  2Y20 A;  5ITY A;  2X8A A;  1HNX M;  4B3S M;  3HHY A;  4AQY M;  3CGW A;  2HWJ A;  4EIW A;  3FUW A;  2DZO B;  4W5W A;  3PVS A;  3KOW E;  3TPZ A;  4DR6 M;  1OQY A;  1QQW A;  3DOA A;  4FWG A;  4F2L A;  4AI6 A;  3KSJ A;  3GLI A;  3U61 B;  2BWB A;  3VK7 A;  2Z8Y M;  3EIH A;  1T43 A;  3JR5 A;  1SXJ A;  4DV2 M;  1QUT A;  1XXH E;  2CHV A;  3FTE A;  4QOZ C;  1AIP C;  2LTU A;  3U6D A;  1S3S A;  3HZJ A;  1N75 A;  1L2C A;  4GRI A;  2JY5 A;  4JV5 M;  2KZU A;  2ZAO A;  3TQS A;  3CF0 A;  4G4N A;  1Z5B A;  5ITX E;  2CRU A;  1W5S A;  3JAM S;  3ZH9 B;  1YSY A;  3VK8 A;  2JZ1 A;  4JN6 A;  2V6Z M;  2WSF F;  3SMP A;  5KQ8 A;  4WP2 A;  1W5T A;  2KNA A;  2G8L A;  2I7P A;  4KLN A;  3I4Y A;  3KDS E;  3FUV A;  1C1K A;  8CAT A;  1SXJ C;  4KOD A;  3IEC A;  4P17 A;  2R62 A;  4LJA A;  1YLA A;  2HL7 A;  5EP1 A;  1PGY A;  1G8P A;  5E6J A;  3W0F A;  3K1J A;  2Z3X A;  4B3T M;  4IBG A;  2CV2 A;  4DR3 M;  1QZE A;  4XK8 F;  4K0K M;  3LCV B;  2N35 A;  3PNV A;  3CF2 A;  2KXE A;  3UGJ A;  2UXC M;  1OIZ A;  3RE8 A;  3GLF B;  3HJ8 A;  1NV9 A;  4M0D A;  4Z8X A;  4QOS A;  4LZJ A;  1GL7 A;  4JI8 M;  3D8L A;  2LBC A;  4IBE A;  3TWM A;  2DAK A;  3IG5 A;  2B3T A;  2XZF A;  1D2N A;  2GQF A;  3U6M A;  2KNZ A;  1PJQ A;  1KSF X;  1A5T A;  3T38 A;  3GLG A;  1SXJ D;  1NJF A;  3GQ4 A;  2L4E A;  2MH8 A;  2UUB M;  4LF9 M;  2FNA A;  4UN2 B;  3GRV A;  2M5Z A;  1MN3 A;  4FCW A;  1G59 A;  1K82 A;  3GQ3 A;  5C1B A;  2DWL A;  2VDB B;  5EXP A;  2R4J A;  2KDL A;  3HJS A;  3L2A A;  2AHM A;  1IXS B;  1QDT A;  3FYC A;  3KSX A;  3B9P A;  4D81 A;  5KO3 A;  4MGK E;  3GLF E;  1CUK A;  3KOZ E;  5GKN A;  3HHX A;  3GRY A;  1GL6 A;  3PNY A;  4BB9 A;  2CWB A;  2VQF M;  2JP7 A;  1QVR A;  1EFU B;  3K92 A;  4JXJ A;  2ZM6 M;  2E5L M;  1JR3 E;  1VEG A;  2DAI A;  3FUX A;  3LCU A;  2Z7J A;  3QYE A;  4LJ8 A;  4AW4 A;  2JZ0 A;  1H6U A;  2CEA A;  1OAI A;  3NBI A;  3PXG A;  4ZPX A;  2O5R A;  1C7Y A;  2I7N A;  4KT0 F;  3W0L B;  2QCU A;  4X66 M;  3GLI E;  1NVM A;  2V1C A;  3J27 B;  4YHH M;  4IBJ A;  1WGL A;  1SXJ E;  5LMN M;  1N32 M;  1NY5 A;  1GLN A;  4GMQ A;  3HJQ A;  4OVZ B;  2EA0 A;  1GO5 A;  2UU9 M;  3TWL A;  5ITR A;  3B7Z A;  1IQP A;  2J7O A;  3L25 A;  1DV0 A;  2K0B X;  3M0E A;  4GH9 A;  2QZ4 A;  4MH0 E;  1J7K A;  2XFS A;  4LJ5 A;  1UM8 A;  3GPU A;  1L2B A;  3VDP A;  2CE7 A;  4RF0 A;  3U5Z A;  2UXB M;  2EUC A;  2MRO B;  4XGI A;  3KS8 A;  4NSR A;  3T6P A;  3C9P A;  3B74 A;  3I4V A;  4M9S A;  4MM3 B;  2HHH M;  1HQY E;  3SYL A;  3J7B A;  1GJT A;  4NRW A;  4KHP M;  2R18 A;  3RGS A;  4REZ A;  1L1Z A;  4WUR A;  3B7Q A;  3E21 A;  2QBY A;  4B7G A;  1HNW M;  4R3D A;  3MMP A;  2ZBK B;  2JUJ A;  2LHC A;  2R6F A;  4X64 M;  2Y21 A;  4LJ9 A;  4B08 A;  5BPV A;  1TH3 A;  3MJ5 A;  3U6L A;  1XB2 B;  2CHG A;  3RGP A;  1OTR A;  1HJP A;  1L8Q A;  3GLH A;  1IBK M;  1Y8G A;  4IBD A;  4LGM A;  5EXT A;  4I4L A;  3THG A;  2OPF A;  1J09 A;  4IBB A;  5JI2 E;  4B3M M;  4JI0 M;  3TE6 A;  2QSF X;  3CF6 E;  3I51 A;  2KRK A;  2OOB A;  4DV6 M;  3KOY E;  5FTK A;  3GLG E;  1GVN A;  3T15 A;  2APL A;  3KP1 E;  3SAW A;  2JY8 A;  3WHK A;  3KW6 A;  2UUC M;  4DV0 M;  3I04 M;  1IM2 A;  2QHO B;  2XFT A;  1T6O A;  1QUS A;  3D8B A;  1E94 E;  1HNZ M;  5IRE B;  5F3W A;  4MGH A;  2LVO C;  3U60 A;  1G4A E;  1X37 A;  2D7G A;  3E46 A;  1HR0 M;  4GHA A;  1YUB A;  3UK6 A;  1NSF A;  1XMQ M;  2DKL A;  1P3Q Q;  4TUW A;  2R45 A;  2YQZ A;  2QEN A;  3SMS A;  1R6B X;  3PFI A;  4NRV A;  3SFZ A;  1Z5C A;  1IN4 A;  3VFD A;  4CIZ A;  3OTO M;  2ZAM A;  4GKJ M;  2KHH A;  2ZTD A;  1HT2 E;  2L09 A;  5L8R F;  3DFZ A;  2RRU A;  3LW5 F;  1GAB A;  2MJ5 B;  1E9S A;  2Q2E B;  4Q7J A;  3FRH A;  2P5T A;  3HGI A;  1LTM A;  4L16 A;  3FD9 A;  3GPX A;  2VQE M;  4P16 A;  1VDD A;  1Q39 A;  1SG9 A;  4DV7 M;  1TGU A;  1AUA A;  3KXE C;  2YFQ A;  3KP0 E;  4QNM A;  4IBI A;  1OFI A;  1IFY A;  3B89 A;  1RU3 A;  3GPY A;  1G71 A;  1MX0 A;  3K2L A;  4GEW A;  3HX3 A;  2FFJ A;  2JA2 A;  4M9X A;  2L2D A;  3DA1 A;  4II7 A;  4QNR A;  3AL0 C;  1IN6 A;  4L4U A;  1QAO A;  1V92 A;  4NXM M;  3M7G A;  2C5R A;  5KPZ A;  4RF1 A;  2Z4R A;  1N77 A;  5FTN A;  2VF8 A;  1ZMW A;  4G4R A;  2XSZ A;  1J5E M;  2FH0 A;  2DEN A;  1JR3 D;  1TH2 A;  2JWS A;  4FWH A;  2L4F A;  3ILK A;  3QYB A; 
#chains in the Genus database with same CATH homology
 2FS1 A;  1GAB A;  2LHG A;  2N35 A;  2VDB B;  2KDL A;  2MH8 A;  1TF0 B;  1GJT A;  2J5Y A;  2JWS A;  2LHC A;  1PRB A;  1GJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...