1GJSA

Solution structure of the albumin binding domain of streptococcal protein g
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MKAIFVLNAQHDEAVDANSLAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Structure, Specificity, and Mode of Interaction for Bacterial Albumin-Binding Modules
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immunoglobulin-binding protein
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17573 GA-like GA-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gjsA00
1PRBA 2LHGA 2MH8A 1GJSA 1GJTA 2JWSA 2N35A 2LHCA 1TF0B 2VDBB 2FS1A 2KDLA 1GABA 2J5YA
chains in the Genus database with same CATH superfamily
1L2DA 2CHVA 3D8LA 2H1RA 4OU7A 2YNMD 5ITXE 5IZ7D 3A46A 4DUZM 2ZAMA 4PD2A 1WIVA 4LF6M 2I7PA 2DKLA 4NSOB 4DR3M 3U61B 2KNAA 3FYDA 4G4OA 4OVZB 2DZNB 3SATA 1QUSA 2QHOB 5FLXS 2P5TA 3KOZE 1GL7A 2L7HA 5BPVA 3CF6E 4OX9M 2OPFA 4X64M 2D7EA 1D0KA 1FJGM 3UMMA 1BVSA 3LCVB 4HEOA 2QSFX 2JY6B 3PNYA 4DV2M 4B3SM 3I4VA 3SYKA 3DZDA 1ZMVA 3SAVA 4M9SA 3BOSA 1PGYA 3OTOM 4LJ4A 4JI2M 2XLJA 4GKJM 2R4EA 4LZJA 4DV3M 2LVNC 2RKOA 4MB7A 1HT2E 1LV7A 3RGPA 1IN5A 2YFQA 2F5NA 3VKHA 1QQWA 1E9RA 1QZMA 2XH9A 3B89A 5FTJA 1PJJA 2L6OA 1IY1A 1OJLA 1TH3A 1TDZA 1FNNA 1AIPC 1SG9A 4IBBA 1D0MA 2MR9A 4KODA 2EKFA 2LTUA 4IBCA 3FRIA 1H6UA 2JP7A 1G41A 3H4JA 3HJQA 1J09A 1ZAEA 4MGIE 3ZH9B 5C1BA 3VK7A 1I94M 1GO5A 5EXPA 1N77A 3K9OA 4DR4M 1TH4A 5FTMA 4IIWA 1VEKA 2BWEA 3SHFA 1OIZA 4AQYM 4YHHM 2XEPA 4LF8M 3VDUA 3T15A 1Z6TA 4CIZA 2JXNA 3CF2A 1QANA 1XXHE 3I4YA 3NBIA 3A45A 3NBXX 5DYIA 3ZC7B 1XXHB 3B7ZA 4I81A 4LFAM 4JXJA 1Q39A 5ITXA 4XGIA 4LGMA 1NV9A 4OVZA 1D0LA 2KDLA 4RKUF 4ANRA 3GPXA 1E32A 1IY2A 3FUXA 3KS8A 2CFOA 4R3DA 2L2DA 3L29A 4DV4M 3FTEA 2VIIA 3DFZA 3NWLA 1SXJB 3HU1A 3MHVC 1LTMA 4IBKA 3K1JA 4M0DA 4II7A 5LMUM 1IN8A 1OFHA 4LCBA 3GLFB 2C5RA 1VG5A 4FCTA 4JI8M 4ZPXA 2XF3A 3TPZA 2DXIA 4I8OA 3L25A 4LJ9A 1XWIA 3UZUA 4DUYM 4GKKM 3SAWA 3W68A 4JI5M 3U6SA 2CE7A 2QBYA 3GLIE 1DGHA 2X49A 1HNWM 3C3DA 1G3IA 3HX3A 2F4VM 2DAIA 1EE8A 2UUCM 5F3WA 1QAQA 2R65A 3UJNA 3MJ5A 1MJGM 2F5QA 2R6FA 5KPRA 2V6ZM 4B08A 1R5LA 2J7NA 2RRUA 4QNRA 1N78A 5FSWA 4LJ6A 1XMOM 2I7NA 4L15A 4NOOB 3QWLA 1IXZA 1WGNA 1Z5CA 3K92A 3ZQJA 3GP1A 3T1HM 1L2BA 2YR0A 4GH9A 4JYAM 1R7RA 1OAOC 1R2YA 3KFUG 2MJ5B 3KOXE 2KNZA 4Y28F 4DV6M 2DWNA 4KO8A 4NL4H 1L2CA 4TUWA 1XB2B 5ITUA 3SYLA 3TWLA 4DV0M 3LMMA 4JI6M 2B3TA 3U5ZA 2LVOC 2FH0A 1VEJA 2KNVA 1S3SA 3LCUA 4GITA 3J81S 3GQ3A 4DR1M 1ZQ9A 2J7OA 5DFLA 3UK6A 2M60A 4X65M 3HHYA 5L8RF 5ITYA 4BBAA 3LW5F 4RNAA 1IN7A 5JI3E 1NJFA 3GQ5A 2WSCF 2LVQD 3KSJA 2MH8A 4QHSA 1N34M 1GJTA 2VDBB 2Y0TA 3U6DA 2L4EA 4GMQA 2APLA 2KRUA 2F5OA 3FUVA 4CJ6A 5KQ8A 4JI4M 1L1TA 2LNHC 3AOEC 5DYGA 4A3VB 2OO9A 3LVWA 1NNUC 1TF0B 3GLIA 2BWBA 3W67A 2DVWB 1D2NA 3FYCA 2KRKA 1GL6A 2V1CA 3KP0E 1VEGA 2FE8A 2M5ZA 4LRTA 4ITQA 3IG8A 1RU3A 2R18A 4MGZE 4EIWA 3FUTA 3UGJA 1GLNA 4AZFA 3TE6A 1Q3BA 4JN6A 3AL0C 2C96A 1PRBA 1QAMA 2K6BA 1OIPA 1IBMM 2UXBM 2LH0A 1HQYE 2DWZB 1G59A 4JI0M 3IECA 4PCZA 3J7BA 2LBCA 3FRHA 4CISA 1J7KA 2RGHA 3SARA 1TR8A 2BJVA 2LHCA 1W5TA 3AOEA 3E9SA 4LRSA 1HNZM 1AUAA 1MU5A 2FS1A 4MGKE 5EJCA 2XGNA 3H4MA 1C7YA 2GQFA 2QBYB 4AKGA 1DGHB 2MROB 3BBZA 2D7GA 2Z4RA 2CV2A 2DAGA 1GABA 2EO2A 2JY5A 2ZTCA 4DR2M 1L8QA 4FCVA 4QHTA 4WP2A 2EJSA 3HHXA 4FWHA 1OFIA 1OKSA 2ZANA 2DI0A 3M7GA 3U6EA 5EXXA 2BNKA 2FFJA 3IHPA 2CUZA 3PNVA 2WSEF 3E4RA 5EP4A 4DR6M 4FWGA 2Q2EB 1TGUA 4G3OA 3U60A 3L2AA 2G5GX 1HT1E 4HLQA 3GQ4A 1IQPA 1YSYA 4X62M 3HWSA 3SASA 2EKKA 1F4IA 2QENA 2QQ8A 4LGYA 2DAEA 2XFTA 2XSZD 2HCBA 4IBJA 2XZUA 4GC9A 2DAMA 4YY3M 1QUTA 2KZSA 3EIHA 2DNAA 4IJFA 1Y8GA 3QAUA 1GKIA 2DWLA 3U6QA 5EP1A 4P17A 1DGGA 3KXEC 1R6BX 3PVSA 3U6LA 5IT9S 2DHYA 3C58A 3GRVA 5KO3A 2UXDM 4M9ZA 2CV1A 4B7FA 3U5ZB 3M6AA 3JR5A 1V33A 1QVRA 4P16A 3QYBA 1X37A 1NO1A 2VQFM 3GRUA 1DGFA 2HKJA 4MM3B 2VQEM 4NXMM 2VF7A 3AOGA 3L26A 1XMQM 3R8FA 1QDTA 2OQ4A 1PJQA 5KQDA 4GRIA 2DENA 1VDLA 3A42A 1ORYB 4LZZA 5C18A 3E46A 2O25A 4REZA 2UU9M 1IN6A 3GLIB 4KHPM 3J27B 3KOWE 4D80A 4LJ8A 4OW0A 4MH0E 4B3TM 1N36M 4FD2A 7CATA 2A5YB 5ITRA 4PT5A 2O01F 4Z8XA 4IBEA 1E94E 4WURA 2JA2A 3L27A 3VFDA 3GO8A 1CUKA 2D7HA 2OOBA 1HR0M 4GHLA 2YQZA 2LWXA 4GEWA 3HJSA 5JI2E 3FTCA 4G4QA 3HGIA 3LVVA 5DNYA 2V1UA 2MGWA 3TL4X 2C99A 1TTEA 1JR3E 1TH2A 3AFHA 3MMPA 3M0EA 4LF4M 2UXCM 5EQTA 5FTKA 1G4AE 2CHGA 1XHBA 4MGYE 1QAOA 4I4LA 3B7QA 1OQYA 2Y0QA 2LVAA 4I5SA 4PDIA 2RGOA 2Y20A 3AKZA 4G4NA 1UM8A 1DO0A 5EXTA 1NSFA 2G3QA 1KFVA 1NHWC 3PXGA 2F5SA 4G6ZA 4K0KM 4B7GA 1NY5A 2Z8YM 4DR7M 4GHAA 1UFZA 2DAKA 2DZOB 4L6V6 4DV7M 4G4RA 1K82A 3B7NA 1MX0A 2HAKA 2JY7A 4WW0A 4AKIA 2QCUA 3DA1A 3U6MA 3WHKA 3GLHE 4JI7M 3J7AS 1IXSA 3U60B 1IN4A 3KVWA 4LF9M 1NV8A 1Q3CA 3D8BA 2JZ0A 2DWMA 1PM5A 4NRWA 2N35A 3B9PA 1WGLA 2OOAA 2G8LA 3GPUA 1XNRM 2ERCA 1PJSA 2NQ8C 2JWSA 1JB0F 1QDRA 2CHQA 4MGHA 1KYIA 4IBGA 4CGYB 3AV0A 4IBIA 2QP9X 4AG5A 3E21A 4DV5M 1J5EM 4DV1M 3FTDA 2X8AA 4LJ5A 4M9XA 4QNMA 3GLGA 1TDHA 2CEAA 2H5XA 3KDSE 4LJ7A 4IBDA 1OAIA 1C1KA 2X4AA 3FD9A 2K9DA 4FCWA 4KLNA 4LY6A 3I04M 4NRVA 3SFZA 1IY0A 4D82A 4JV5M 1E9SA 4IBFA 1OTRA 2XFSA 1K3WA 1NHGC 4LFBM 4DBGB 2CWBA 2R4JA 3RFWA 1IBKM 5FTLA 1JR3A 3K2LA 4BB9A 3MK6A 3K8ZA 4QOSA 1JR3D 2Z3XA 1WJ7A 1T43A 1KSFX 2KW0A 1ZMUA 1GVNA 1V92A 2DZLA 4GC5A 4JI1M 2J5YA 3FKEA 3HU2A 3LQQA 1EFUB 4XK8F 1NNJA 4NC6A 1R2ZA 3W0FA 2EA0A 4KT0F 2WZJA 3K9PA 4AKHA 2UUAM 3FUUA 3GLHA 5FTNA 5BR8M 2XSZA 4RF1A 2XZFA 2LXEA 3SC3A 3CGWA 2JY8A 5IREB 5E6JA 5KPZA 1IXRC 3FE3A 4Q7JA 4F2LA 3T6PA 4HL4A 2HHHM 4F1IA 3SMPA 3GRYA 5ITTA 3TWKA 4LFCM 2KZUA 1WR1B 5E26A 2W82A 1IFYA 4D81A 4LF7M 3IG5A 3WHLA 1W5SA 2LVPC 2UUBM 1DO2A 4R7GA 3HJ8A 1A5TA 2K47A 2R44A 1N32M 1Z5AA 3I01M 1PJIA 3TWMA 2QZ4A 2ZBKB 3B74A 3HZJA 1K3XA 1HJPA 4W5WA 1G8PA 3GRRA 4AW4A 1IXSB 4CHTB 1NY6A 3U61A 3A98B 4NXNM 3SMSA 5A2QS 1SXJE 2FNAA 5EP2A 2JUJA 3RGSA 1VQ1A 1IBLM 3HHWA 2FOIC 2C98A 4LG2A 5KPTA 3GLFE 1PJTA 2Z4SA 4AG6A 3HHZA 1HQCA 1G71A 3VKGA 2Z7JA 1N75A 4X66M 1ZMWA 4L78A 3QYEA 5EP3A 3U6CA 1YLAA 1WHCA 3VK8A 3FTFA 1Z59A 3GLGE 4B3MM 1NVMA 3VDPA 2R62A 1T6OA 3GLGB 4S12A 4AI6A 2ZAOA 3JR4A 1I4WA 2ZM6M 2QPAA 3GPPA 1IM2A 1Z5BA 4UN2B 1R4GA 2O5RA 3HU3A 2L4FA 4L4UA 3Q8GA 3R9XB 1DV0A 3W0LB 2R46A 3GPYA 5IWAM 1SXJC 1VDDA 2JNHA 4IJEA 2ZTDA 4FW9A 3HY5A 3U6PA 3HKPA 2KHHA 1EIJA 1YE9A 2KA6B 1Q02A 1WXQA 2BJWA 2R45A 5EXSA 3I51A 3JAMS 3FUWA 1P3QQ 3LQRA 2R0IA 4DR5M 4B7HA 3EIEA 4L16A 4NSRA 3TQSA 4B3RM 1YUBA 3KOYE 1GJSA 4PDGA 2HWJA 1L1ZA 3SHGB 2CV0A 3T38A 5ITQA 2WSFF 3Q8XA 2CRUA 4FWDA 1QZEA 1N33M 2LHGA 2VF8A 3BXWA 1DGBA 2JZ1A 3C9PA 1JQJC 1XXHA 2L09A 4M0WA 8CATA 3T1YM 2F5PA 5GKNA 4QOZC 3GLHB 4RF0A 2QNJA 3KP1E 2EUCA 1XC8A 2HL7A 1V34A 4LJAA 4JI3M 3ZCBB 2E5LM 1NJGA 4XBOA 1QYRA 3V76A 2DHRA 1SXJA 2L7IA 1MN3A 3CF0A 3J80S 3J2PB 2Y21A 3KSXA 3VLFB 3ILKA 5LMNM 1T3TA 1SXJD 2AHMA 4FVMA 4LF5M 2C9OA 3RE8A 3GLFA 2GNOA 1ZV1A 3CTWB 4BLCA 1HNXM 4L8RC 4GIPA 3C3EA 3U6OA 2KXEA 2K0BX 5H37D 3KS4A 3KW6A 3L28A 1XNQM 3AJIB 3SAUA 3F92A 3PFIA 4R71A 4Z6YA 2KEBA 3THGA 3DOAA 2CP8A 2C9CA 3SBJA
chains in the Genus database with same CATH topology
1PRBA 2LHGA 2MH8A 1GJSA 1GJTA 2JWSA 2N35A 2LHCA 1TF0B 2VDBB 2FS1A 2KDLA 1GABA 2J5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRB A;  2LHG A;  2MH8 A;  1GJS A;  1GJT A;  2JWS A;  2N35 A;  2LHC A;  1TF0 B;  2VDB B;  2FS1 A;  2KDL A;  1GAB A;  2J5Y A; 
#chains in the Genus database with same CATH topology
 1L2D A;  2CHV A;  3D8L A;  2H1R A;  4OU7 A;  2YNM D;  5ITX E;  5IZ7 D;  3A46 A;  4DUZ M;  2ZAM A;  4PD2 A;  1WIV A;  4LF6 M;  2I7P A;  2DKL A;  4NSO B;  4DR3 M;  3U61 B;  2KNA A;  3FYD A;  4G4O A;  4OVZ B;  2DZN B;  3SAT A;  1QUS A;  2QHO B;  5FLX S;  2P5T A;  3KOZ E;  1GL7 A;  2L7H A;  5BPV A;  3CF6 E;  4OX9 M;  2OPF A;  4X64 M;  2D7E A;  1D0K A;  1FJG M;  3UMM A;  1BVS A;  3LCV B;  4HEO A;  2QSF X;  2JY6 B;  3PNY A;  4DV2 M;  4B3S M;  3I4V A;  3SYK A;  3DZD A;  1ZMV A;  3SAV A;  4M9S A;  3BOS A;  1PGY A;  3OTO M;  4LJ4 A;  4JI2 M;  2XLJ A;  4GKJ M;  2R4E A;  4LZJ A;  4DV3 M;  2LVN C;  2RKO A;  4MB7 A;  1HT2 E;  1LV7 A;  3RGP A;  1IN5 A;  2YFQ A;  2F5N A;  3VKH A;  1QQW A;  1E9R A;  1QZM A;  2XH9 A;  3B89 A;  5FTJ A;  1PJJ A;  2L6O A;  1IY1 A;  1OJL A;  1TH3 A;  1TDZ A;  1FNN A;  1AIP C;  1SG9 A;  4IBB A;  1D0M A;  2MR9 A;  4KOD A;  2EKF A;  2LTU A;  4IBC A;  3FRI A;  1H6U A;  2JP7 A;  1G41 A;  3H4J A;  3HJQ A;  1J09 A;  1ZAE A;  4MGI E;  3ZH9 B;  5C1B A;  3VK7 A;  1I94 M;  1GO5 A;  5EXP A;  1N77 A;  3K9O A;  4DR4 M;  1TH4 A;  5FTM A;  4IIW A;  1VEK A;  2BWE A;  3SHF A;  1OIZ A;  4AQY M;  4YHH M;  2XEP A;  4LF8 M;  3VDU A;  3T15 A;  1Z6T A;  4CIZ A;  2JXN A;  3CF2 A;  1QAN A;  1XXH E;  3I4Y A;  3NBI A;  3A45 A;  3NBX X;  5DYI A;  3ZC7 B;  1XXH B;  3B7Z A;  4I81 A;  4LFA M;  4JXJ A;  1Q39 A;  5ITX A;  4XGI A;  4LGM A;  1NV9 A;  4OVZ A;  1D0L A;  2KDL A;  4RKU F;  4ANR A;  3GPX A;  1E32 A;  1IY2 A;  3FUX A;  3KS8 A;  2CFO A;  4R3D A;  2L2D A;  3L29 A;  4DV4 M;  3FTE A;  2VII A;  3DFZ A;  3NWL A;  1SXJ B;  3HU1 A;  3MHV C;  1LTM A;  4IBK A;  3K1J A;  4M0D A;  4II7 A;  5LMU M;  1IN8 A;  1OFH A;  4LCB A;  3GLF B;  2C5R A;  1VG5 A;  4FCT A;  4JI8 M;  4ZPX A;  2XF3 A;  3TPZ A;  2DXI A;  4I8O A;  3L25 A;  4LJ9 A;  1XWI A;  3UZU A;  4DUY M;  4GKK M;  3SAW A;  3W68 A;  4JI5 M;  3U6S A;  2CE7 A;  2QBY A;  3GLI E;  1DGH A;  2X49 A;  1HNW M;  3C3D A;  1G3I A;  3HX3 A;  2F4V M;  2DAI A;  1EE8 A;  2UUC M;  5F3W A;  1QAQ A;  2R65 A;  3UJN A;  3MJ5 A;  1MJG M;  2F5Q A;  2R6F A;  5KPR A;  2V6Z M;  4B08 A;  1R5L A;  2J7N A;  2RRU A;  4QNR A;  1N78 A;  5FSW A;  4LJ6 A;  1XMO M;  2I7N A;  4L15 A;  4NOO B;  3QWL A;  1IXZ A;  1WGN A;  1Z5C A;  3K92 A;  3ZQJ A;  3GP1 A;  3T1H M;  1L2B A;  2YR0 A;  4GH9 A;  4JYA M;  1R7R A;  1OAO C;  1R2Y A;  3KFU G;  2MJ5 B;  3KOX E;  2KNZ A;  4Y28 F;  4DV6 M;  2DWN A;  4KO8 A;  4NL4 H;  1L2C A;  4TUW A;  1XB2 B;  5ITU A;  3SYL A;  3TWL A;  4DV0 M;  3LMM A;  4JI6 M;  2B3T A;  3U5Z A;  2LVO C;  2FH0 A;  1VEJ A;  2KNV A;  1S3S A;  3LCU A;  4GIT A;  3J81 S;  3GQ3 A;  4DR1 M;  1ZQ9 A;  2J7O A;  5DFL A;  3UK6 A;  2M60 A;  4X65 M;  3HHY A;  5L8R F;  5ITY A;  4BBA A;  3LW5 F;  4RNA A;  1IN7 A;  5JI3 E;  1NJF A;  3GQ5 A;  2WSC F;  2LVQ D;  3KSJ A;  2MH8 A;  4QHS A;  1N34 M;  1GJT A;  2VDB B;  2Y0T A;  3U6D A;  2L4E A;  4GMQ A;  2APL A;  2KRU A;  2F5O A;  3FUV A;  4CJ6 A;  5KQ8 A;  4JI4 M;  1L1T A;  2LNH C;  3AOE C;  5DYG A;  4A3V B;  2OO9 A;  3LVW A;  1NNU C;  1TF0 B;  3GLI A;  2BWB A;  3W67 A;  2DVW B;  1D2N A;  3FYC A;  2KRK A;  1GL6 A;  2V1C A;  3KP0 E;  1VEG A;  2FE8 A;  2M5Z A;  4LRT A;  4ITQ A;  3IG8 A;  1RU3 A;  2R18 A;  4MGZ E;  4EIW A;  3FUT A;  3UGJ A;  1GLN A;  4AZF A;  3TE6 A;  1Q3B A;  4JN6 A;  3AL0 C;  2C96 A;  1PRB A;  1QAM A;  2K6B A;  1OIP A;  1IBM M;  2UXB M;  2LH0 A;  1HQY E;  2DWZ B;  1G59 A;  4JI0 M;  3IEC A;  4PCZ A;  3J7B A;  2LBC A;  3FRH A;  4CIS A;  1J7K A;  2RGH A;  3SAR A;  1TR8 A;  2BJV A;  2LHC A;  1W5T A;  3AOE A;  3E9S A;  4LRS A;  1HNZ M;  1AUA A;  1MU5 A;  2FS1 A;  4MGK E;  5EJC A;  2XGN A;  3H4M A;  1C7Y A;  2GQF A;  2QBY B;  4AKG A;  1DGH B;  2MRO B;  3BBZ A;  2D7G A;  2Z4R A;  2CV2 A;  2DAG A;  1GAB A;  2EO2 A;  2JY5 A;  2ZTC A;  4DR2 M;  1L8Q A;  4FCV A;  4QHT A;  4WP2 A;  2EJS A;  3HHX A;  4FWH A;  1OFI A;  1OKS A;  2ZAN A;  2DI0 A;  3M7G A;  3U6E A;  5EXX A;  2BNK A;  2FFJ A;  3IHP A;  2CUZ A;  3PNV A;  2WSE F;  3E4R A;  5EP4 A;  4DR6 M;  4FWG A;  2Q2E B;  1TGU A;  4G3O A;  3U60 A;  3L2A A;  2G5G X;  1HT1 E;  4HLQ A;  3GQ4 A;  1IQP A;  1YSY A;  4X62 M;  3HWS A;  3SAS A;  2EKK A;  1F4I A;  2QEN A;  2QQ8 A;  4LGY A;  2DAE A;  2XFT A;  2XSZ D;  2HCB A;  4IBJ A;  2XZU A;  4GC9 A;  2DAM A;  4YY3 M;  1QUT A;  2KZS A;  3EIH A;  2DNA A;  4IJF A;  1Y8G A;  3QAU A;  1GKI A;  2DWL A;  3U6Q A;  5EP1 A;  4P17 A;  1DGG A;  3KXE C;  1R6B X;  3PVS A;  3U6L A;  5IT9 S;  2DHY A;  3C58 A;  3GRV A;  5KO3 A;  2UXD M;  4M9Z A;  2CV1 A;  4B7F A;  3U5Z B;  3M6A A;  3JR5 A;  1V33 A;  1QVR A;  4P16 A;  3QYB A;  1X37 A;  1NO1 A;  2VQF M;  3GRU A;  1DGF A;  2HKJ A;  4MM3 B;  2VQE M;  4NXM M;  2VF7 A;  3AOG A;  3L26 A;  1XMQ M;  3R8F A;  1QDT A;  2OQ4 A;  1PJQ A;  5KQD A;  4GRI A;  2DEN A;  1VDL A;  3A42 A;  1ORY B;  4LZZ A;  5C18 A;  3E46 A;  2O25 A;  4REZ A;  2UU9 M;  1IN6 A;  3GLI B;  4KHP M;  3J27 B;  3KOW E;  4D80 A;  4LJ8 A;  4OW0 A;  4MH0 E;  4B3T M;  1N36 M;  4FD2 A;  7CAT A;  2A5Y B;  5ITR A;  4PT5 A;  2O01 F;  4Z8X A;  4IBE A;  1E94 E;  4WUR A;  2JA2 A;  3L27 A;  3VFD A;  3GO8 A;  1CUK A;  2D7H A;  2OOB A;  1HR0 M;  4GHL A;  2YQZ A;  2LWX A;  4GEW A;  3HJS A;  5JI2 E;  3FTC A;  4G4Q A;  3HGI A;  3LVV A;  5DNY A;  2V1U A;  2MGW A;  3TL4 X;  2C99 A;  1TTE A;  1JR3 E;  1TH2 A;  3AFH A;  3MMP A;  3M0E A;  4LF4 M;  2UXC M;  5EQT A;  5FTK A;  1G4A E;  2CHG A;  1XHB A;  4MGY E;  1QAO A;  4I4L A;  3B7Q A;  1OQY A;  2Y0Q A;  2LVA A;  4I5S A;  4PDI A;  2RGO A;  2Y20 A;  3AKZ A;  4G4N A;  1UM8 A;  1DO0 A;  5EXT A;  1NSF A;  2G3Q A;  1KFV A;  1NHW C;  3PXG A;  2F5S A;  4G6Z A;  4K0K M;  4B7G A;  1NY5 A;  2Z8Y M;  4DR7 M;  4GHA A;  1UFZ A;  2DAK A;  2DZO B;  4L6V 6;  4DV7 M;  4G4R A;  1K82 A;  3B7N A;  1MX0 A;  2HAK A;  2JY7 A;  4WW0 A;  4AKI A;  2QCU A;  3DA1 A;  3U6M A;  3WHK A;  3GLH E;  4JI7 M;  3J7A S;  1IXS A;  3U60 B;  1IN4 A;  3KVW A;  4LF9 M;  1NV8 A;  1Q3C A;  3D8B A;  2JZ0 A;  2DWM A;  1PM5 A;  4NRW A;  2N35 A;  3B9P A;  1WGL A;  2OOA A;  2G8L A;  3GPU A;  1XNR M;  2ERC A;  1PJS A;  2NQ8 C;  2JWS A;  1JB0 F;  1QDR A;  2CHQ A;  4MGH A;  1KYI A;  4IBG A;  4CGY B;  3AV0 A;  4IBI A;  2QP9 X;  4AG5 A;  3E21 A;  4DV5 M;  1J5E M;  4DV1 M;  3FTD A;  2X8A A;  4LJ5 A;  4M9X A;  4QNM A;  3GLG A;  1TDH A;  2CEA A;  2H5X A;  3KDS E;  4LJ7 A;  4IBD A;  1OAI A;  1C1K A;  2X4A A;  3FD9 A;  2K9D A;  4FCW A;  4KLN A;  4LY6 A;  3I04 M;  4NRV A;  3SFZ A;  1IY0 A;  4D82 A;  4JV5 M;  1E9S A;  4IBF A;  1OTR A;  2XFS A;  1K3W A;  1NHG C;  4LFB M;  4DBG B;  2CWB A;  2R4J A;  3RFW A;  1IBK M;  5FTL A;  1JR3 A;  3K2L A;  4BB9 A;  3MK6 A;  3K8Z A;  4QOS A;  1JR3 D;  2Z3X A;  1WJ7 A;  1T43 A;  1KSF X;  2KW0 A;  1ZMU A;  1GVN A;  1V92 A;  2DZL A;  4GC5 A;  4JI1 M;  2J5Y A;  3FKE A;  3HU2 A;  3LQQ A;  1EFU B;  4XK8 F;  1NNJ A;  4NC6 A;  1R2Z A;  3W0F A;  2EA0 A;  4KT0 F;  2WZJ A;  3K9P A;  4AKH A;  2UUA M;  3FUU A;  3GLH A;  5FTN A;  5BR8 M;  2XSZ A;  4RF1 A;  2XZF A;  2LXE A;  3SC3 A;  3CGW A;  2JY8 A;  5IRE B;  5E6J A;  5KPZ A;  1IXR C;  3FE3 A;  4Q7J A;  4F2L A;  3T6P A;  4HL4 A;  2HHH M;  4F1I A;  3SMP A;  3GRY A;  5ITT A;  3TWK A;  4LFC M;  2KZU A;  1WR1 B;  5E26 A;  2W82 A;  1IFY A;  4D81 A;  4LF7 M;  3IG5 A;  3WHL A;  1W5S A;  2LVP C;  2UUB M;  1DO2 A;  4R7G A;  3HJ8 A;  1A5T A;  2K47 A;  2R44 A;  1N32 M;  1Z5A A;  3I01 M;  1PJI A;  3TWM A;  2QZ4 A;  2ZBK B;  3B74 A;  3HZJ A;  1K3X A;  1HJP A;  4W5W A;  1G8P A;  3GRR A;  4AW4 A;  1IXS B;  4CHT B;  1NY6 A;  3U61 A;  3A98 B;  4NXN M;  3SMS A;  5A2Q S;  1SXJ E;  2FNA A;  5EP2 A;  2JUJ A;  3RGS A;  1VQ1 A;  1IBL M;  3HHW A;  2FOI C;  2C98 A;  4LG2 A;  5KPT A;  3GLF E;  1PJT A;  2Z4S A;  4AG6 A;  3HHZ A;  1HQC A;  1G71 A;  3VKG A;  2Z7J A;  1N75 A;  4X66 M;  1ZMW A;  4L78 A;  3QYE A;  5EP3 A;  3U6C A;  1YLA A;  1WHC A;  3VK8 A;  3FTF A;  1Z59 A;  3GLG E;  4B3M M;  1NVM A;  3VDP A;  2R62 A;  1T6O A;  3GLG B;  4S12 A;  4AI6 A;  2ZAO A;  3JR4 A;  1I4W A;  2ZM6 M;  2QPA A;  3GPP A;  1IM2 A;  1Z5B A;  4UN2 B;  1R4G A;  2O5R A;  3HU3 A;  2L4F A;  4L4U A;  3Q8G A;  3R9X B;  1DV0 A;  3W0L B;  2R46 A;  3GPY A;  5IWA M;  1SXJ C;  1VDD A;  2JNH A;  4IJE A;  2ZTD A;  4FW9 A;  3HY5 A;  3U6P A;  3HKP A;  2KHH A;  1EIJ A;  1YE9 A;  2KA6 B;  1Q02 A;  1WXQ A;  2BJW A;  2R45 A;  5EXS A;  3I51 A;  3JAM S;  3FUW A;  1P3Q Q;  3LQR A;  2R0I A;  4DR5 M;  4B7H A;  3EIE A;  4L16 A;  4NSR A;  3TQS A;  4B3R M;  1YUB A;  3KOY E;  1GJS A;  4PDG A;  2HWJ A;  1L1Z A;  3SHG B;  2CV0 A;  3T38 A;  5ITQ A;  2WSF F;  3Q8X A;  2CRU A;  4FWD A;  1QZE A;  1N33 M;  2LHG A;  2VF8 A;  3BXW A;  1DGB A;  2JZ1 A;  3C9P A;  1JQJ C;  1XXH A;  2L09 A;  4M0W A;  8CAT A;  3T1Y M;  2F5P A;  5GKN A;  4QOZ C;  3GLH B;  4RF0 A;  2QNJ A;  3KP1 E;  2EUC A;  1XC8 A;  2HL7 A;  1V34 A;  4LJA A;  4JI3 M;  3ZCB B;  2E5L M;  1NJG A;  4XBO A;  1QYR A;  3V76 A;  2DHR A;  1SXJ A;  2L7I A;  1MN3 A;  3CF0 A;  3J80 S;  3J2P B;  2Y21 A;  3KSX A;  3VLF B;  3ILK A;  5LMN M;  1T3T A;  1SXJ D;  2AHM A;  4FVM A;  4LF5 M;  2C9O A;  3RE8 A;  3GLF A;  2GNO A;  1ZV1 A;  3CTW B;  4BLC A;  1HNX M;  4L8R C;  4GIP A;  3C3E A;  3U6O A;  2KXE A;  2K0B X;  5H37 D;  3KS4 A;  3KW6 A;  3L28 A;  1XNQ M;  3AJI B;  3SAU A;  3F92 A;  3PFI A;  4R71 A;  4Z6Y A;  2KEB A;  3THG A;  3DOA A;  2CP8 A;  2C9C A;  3SBJ A; 
#chains in the Genus database with same CATH homology
 1PRB A;  2LHG A;  2MH8 A;  1GJS A;  1GJT A;  2JWS A;  2N35 A;  2LHC A;  1TF0 B;  2VDB B;  2FS1 A;  2KDL A;  1GAB A;  2J5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...