4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna replication/isomerase
molecule keywords DNA TOPOISOMERASE 3-ALPHA
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CGYB 4CHTB 3NBIA
chains in the Genus database with same CATH superfamily
3S2HB 3KF8B 3W3AA 3KF6A 1DOKA 1SYCA 4Y28F 3BYYB 1R6BX 1IL8A 4EIWA 1VQBA 4DR4L 1F9SA 3FE3A 1OQYA 3K1JA 1DXMA 1HH2P 3I4MH 2LTUA 1H95A 3FP9A 1K73C 1D0MA 3EIVA 1STGA 1DGHB 2D2CC 2I5HA 2JA5B 1QAQA 4K14A 3C3EA 3A5ZB 3T1HL 2N55A 1ILQA 5M5WB 2QBYA 4K0KQ 2AHOB 3BYTB 3S15B 3IG5A 3SDZA 1BBXC 1I3QB 1YBYA 3SATA 2DI0A 1KAWA 3GLHE 4H02A 4NMZA 1FJGM 3CAMA 3WOFA 5M3MG 3CF6E 3CF5A 4OL7A 1N33M 2PO4A 3LMMA 4F87A 1HXYD 1STHA 5KO3A 4FXGC 1IW7C 5C3XA 1T43A 4L15A 1WTXA 2JA6H 1K82A 3PIP3 4MGYE 3OIQA 1D5XC 3K58A 4TRDA 4ZPXA 2WSEF 1H9JA 2RCFA 3PCOB 2Q8RE 3ER0A 1TY2A 1V1PA 2QA4A 3PQIA 5EQ0A 2PCFB 4JI7L 3GLFA 3VR6A 2X69A 4RKLA 1Y1VH 3E6ZX 3ULLA 1D1IA 2Z6KC 4QGUA 4XDXA 2J7NA 4KKUA 4EQPA 4LF4M 3I4NB 4D82A 3DA1A 4MGKE 1WGLA 3MXPA 3I72A 3QG1A 4GNXC 3SK8A 1IY2A 4LJ9A 5K36G 4Z6YA 1SE2A 2Z0SA 1G91A 1SSOA 3SYKA 2DNAA 1NNUC 3T1YL 1QB5D 3HRZC 4DV5L 1D5MC 4HMIA 1QVGA 3RZOB 1H9SB 3KVWA 2JA9A 4N8FA 2FNAA 2R93B 4C3HG 4DV7L 1H9MA 4ZKCB 4GH9A 3HOXH 2QNJA 1BCPD 1S5FD 2KRKA 1XPUA 5C3WA 4IOCA 2EJFC 5CORA 2XWJB 1DYQA 3QAUA 1CM9A 2R93H 3S1RB 1X3EA 1R2ZA 2EY1A 4M9SA 1DM0B 2L4FA 3UDFA 1MX0A 4MGHA 3JAMS 4HJ9A 3J7YW 3P7JA 1JR3D 4QNRA 3SFZA 4D80A 1OAOC 1IHZA 1N9WA 2F0FA 3MVVA 4LJ8A 5A2QL 4C3IG 4GNXB 1K3BC 4ALPA 4DR2L 4EGVA 4KY7A 1QCBD 1BF4A 3GTLB 5C4XG 2K7VA 2FMCA 1FD7D 5BN4A 2LHCA 1IBMM 5HY6A 4FWGA 2ZXRA 4DXGA 3QYEA 1ZQ9A 1TGUA 1QDRA 2UUAQ 1JOOA 2MHVA 1RU3A 1C1KA 2HQLA 4P73A 1SLJA 3OPOA 2R45A 1GKHA 5EQTA 3ND9A 1SBBB 2CH4A 4JI3Q 4LWCA 4A3FG 3E9SA 1PH9A 1L2CA 3MEFA 1Y8PB 3M4QA 4A3KH 2EQSA 1AH9A 2B2WA 4MM3B 1XMOM 1PH2A 3SARA 4A3EB 2GNOA 4FCVA 2F4VM 3H0GB 3AJIB 2Q2IA 4J1MA 3M4OH 5BN3A 1TH4A 3AKZA 3TP7A 4I81A 4JI5Q 3K9OA 3J80S 2NN6H 2OEOA 3N52A 4IZ8A 3C2PA 4RAUC 3K2LA 2SNSA 3OW2A 1E1OA 4DV1M 4APVA 3E9IA 1B44D 4FF2A 1NNXA 1STNA 2R46A 4PDIA 5JJIA 1STYA 5E4WC 2F5OA 1BCPF 4BWGB 1YNJD 1HJPA 2JY5A 2MPMA 3KLWA 5LMNL 4DAMA 3SVMA 5KPRA 1HA5A 4DV3Q 1WTQA 4OHJA 3QYBA 3U5ZB 4P74A 4BBRB 2UU9Q 2R92G 4X65M 3PO2G 3HOYB 3HKPA 1CKNB 1VEKA 4LRSA 1Q3BA 4JVZA 2DHRA 4QOZC 3A56A 4GKKQ 3L2AA 1EY5A 5I4DA 4A3IG 4DA2A 2LVOC 3HOYH 2OF1A 1R5LA 3U6SA 4KN7C 1AEXA 3KDFA 2IY5B 3A7LA 4IIWA 3D4DA 3Q24A 2IT1A 1YITA 3NTKA 2G9HD 3B7NA 2EDGA 3HHZA 3S1MH 1KYIA 1VDDA 3G7LA 5DFLA 4X65Q 1XXHA 3FUUA 4GEWA 3SMSA 1E7ZA 4NXNL 4Y7NB 4A3MB 2LMCB 2JA6G 1XXHE 2H5XA 1PFMA 2B29A 1I50B 2HT1A 4JV5M 3K7AH 4DR7L 4NPSA 2OXPA 2Y21A 1U0LA 4KN4C 5KGUA 3K5MA 4FNFA 3VYUA 4BY1B 2WAQB 3JR5A 2GN5A 2XSZD 3A54A 3RGPA 2Y0SG 3R2IA 4LMQD 4C3JG 4P17A 5IE8A 2PW7A 4KLKA 5JJZA 1SNCA 3HOVB 1GHJA 4A3BG 1EFID 1NJGA 2DY8A 1O78A 1CSPA 2NYZD 3MFGA 4NXNQ 4YY3M 4OO1H 2C9CA 2QHOB 2R65A 4JI8L 3B6YA 3J27B 1JB7A 2NZ1D 4QF4A 2JA7H 4DR1L 4LF4L 1GJSA 4LJ6A 1VF7A 1GUNA 3GTJH 1KDBA 4A3KG 1E2WA 4XQQA 1CUKA 2L4NA 1IY1A 3KLSA 4CKBA 1NJFA 1EY8A 2GA4B 1DGGA 2L09A 2KQ3A 3FUVA 4K6LA 1IL2A 3GP1A 2F3WA 1DD2A 2QDLA 1GHKA 1UE1A 2FH0A 1HZCA 5CV8A 1HQYE 1IXRC 1B70B 1L2BA 3OW7A 2Y0QA 1N77A 1PLFA 3I04M 1HNWQ 1P3QQ 3U6QA 3Q8XA 3CF0A 1N36M 1VF5C 2WB1B 2XSZA 4JOIC 4KI0A 4XTCS 4YWLA 4C2MB 4GRIA 2E5LL 1VQFA 4DV3L 3FTCA 1SYBA 3CD6A 2B63G 4C3IH 2WSFF 3D4RA 3KLRA 5IP9G 2L7IA 5C1BA 1E94E 3U9OA 3E46A 4GN4B 4B3TQ 3C3DA 4LF8M 1VQ4A 1SR3A 3H15A 5IT9S 2J5YA 4GKJL 2CUZA 3IHPA 3CQZH 1WI5A 3J81c 3CXCA 1BCPC 3D0FA 5IIFA 1N34M 3PUZA 1FJGQ 2XTIA 3ZYYX 3AOGA 1ZYRC 1R4QB 4LUVA 5I2YA 2KNZA 1HNXL 1NR2A 1XHBA 3KOXE 3IFDA 3U58A 2BJVA 2JA8B 2OOBA 4A3DG 2JY7A 1GABA 4KK7A 1TWFB 5C4ZA 1WTWA 4X62M 1IN7A 5ELNA 4A3DH 1VQKA 2CVRA 3DWQA 4DV6M 1BBWA 2HCCA 5IYCG 2PMZE 3Q22A 1SNOA 1V43A 1PZJD 1GVNA 3PNVA 4L6V6 1ICWA 1LTID 5KIXA 1XMOL 2UUCQ 1ZEQX 1FNWA 3AFHA 1PZKD 4QHSA 2F5SA 1SXJD 1J9OA 2ZTCA 3Q8GA 4IJHA 2K5DA 1MGSA 2MROB 4PZ7A 5IZ7D 3AOEC 1AW7A 2UXDQ 1UE6A 4OIKA 1JC7A 2F1MA 4XK8F 1PTOC 5ELBA 1GD7A 1SDFA 1T5XD 4ZYSA 2PPBC 1DV0A 2R3ZA 4HJ8A 2K6BA 3VR2A 3B7QA 1GKIA 3SEBA 4HIOA 1PH6A 3PUYA 4QB4A 2MH8A 1B4OA 3GPYA 2MGWA 2Z9HA 2I7NA 1XMQM 5ITUA 1IXRA 1ASYA 5F2DA 1IY0A 3GTKH 5BPVA 3T1YQ 4WP2A 4AH6A 3PUVA 1XX8A 3GTPB 1WOCA 1I6HB 4HTHA 3GLHA 2WB1G 1XMQQ 1BBUA 2ES2A 5JI3E 5FTJA 2JP7A 2C98A 2F0EA 2JNHA 2EYPA 3NBHA 5CV4A 1WJJA 1G6ZA 4RH6A 5A2QE 1DCZA 1ENAA 4HIMA 2C9OA 3CCVA 4XBOA 1PJQA 1WCMG 4GN3B 3U6MA 5ITQA 4IALA 2NBFA 3AB9A 2XF3A 2HUGA 3DFZA 4MB7A 3NWLA 3AL0C 1VDLA 3C1FA 4BBAA 1IM2A 1ENCA 4RNAA 3HGBA 4DAYB 3TPZA 1VCIA 3ULPA 1L1OC 1IBKL 1SE8A 2FHTA 3SAWA 5IT9c 1D6EC 3MJ5A 4A93H 4LFCQ 1HNWM 2R61A 3HU3A 3GRUA 3FKIB 1IYVA 1RDPD 1WCMH 4P2CB 3EJIA 1SE3A 1SRUA 3LNNA 2LVAA 4LCBA 1G59A 1SNQA 4DV7M 4G4QA 5C3EH 4RG1A 5CV9A 2SDFA 5C0XJ 5EJCA 4GLAC 4V190 1XXHB 4JI0M 1FNUA 2XLJA 1GXDC 4MGZE 3I4MG 1CI3M 2PW5A 1M1KC 3KFUG 1SYDA 4ZQ3A 4JI8M 3OYYA 4A3GG 3FKEA 3GLIE 1HNZL 4BY7H 1EWHA 2XN9C 4LW1A 1ZXTA 1LO5D 4JI4L 1E32A 4QHTA 1PH1A 5FLXc 4Z9CB 2F5PA 2CHQA 3H09A 1EQQA 1A2TA 2XEPA 4YHHM 2JZ0A 2CEAA 1LTMA 3AFQA 3N6RA 4BXXH 3GTOB 1X37A 4OXPA 4A3MG 2F0SA 2R44A 1T9HA 2PZUA 2BE5D 3HGIA 1WHCA 3GD7A 2PI2A 4HJ5A 1IBLQ 1G291 3JAML 2UUBL 1GUWA 1E24A 2VQEM 5FLMG 2F03A 1EYGA 3HHWA 3IG8A 5H37D 1ICFB 2ICEC 3HS0C 4X66L 3U6OA 3TP5A 1TS4A 4NXML 4DR5L 4LF9Q 3BVZA 2CV1A 3K8AA 2M60A 3GO5A 2O25A 1DZ1A 1FJGL 4B7GA 4DK3C 4LNQA 4KD4A 1GL6A 4K5XA 1A2UA 4A3CG 4R4TA 4IBFA 2BJWA 2NN6G 1RTOA 4C2MH 1YHBA 1AUAA 5FO7B 1HQRD 2QDBA 3HOYG 4DFAA 4KLNA 1VQEA 3HOUB 3DHQA 3ERQA 2B8GA 4XGIA 2BH2A 2EO2A 2B2YA 3GLGE 3STBD 3FRPB 3RLNA 3L9AX 1A63A 1PJSA 1CKMA 4LF5L 1NV9A 2BWBA 1N32L 4A3CH 1YI2A 2E5LQ 2PQAB 4DN4M 3U6CA 1PA6A 4B3SL 3TWKA 1YHAA 2JEAI 1EY4A 4DV1L 1ORYB 2PYKA 2A68C 3PO3G 3SMPA 3V76A 4JI6L 1IKLA 1EYDA 4ME5A 3TS0A 3KOYE 3DUZA 2D7GA 3SK6A 4U68A 4OU7A 2VNUD 3H0GG 1ET9A 1SMXA 3I4NH 3CCJA 3RGSA 5GQOA 4EQ5A 3ITPA 5KYIA 4DR6Q 2A69D 3B74A 1TR8A 1QNKA 4IPHA 1Q7YC 1VEGA 5LMNW 4ITQA 2OTLA 4J15A 4AYBE 3SXHA 3HU2A 1IZ6A 4CBVA 1SYGA 2L55A 2YFQA 1TT2A 4LF7M 2BA1A 3GV6A 3H0GH 2EIFA 1NMFA 1A6XA 4M0WA 1LYLA 1UEBA 3NTHA 1KFVA 3QB3A 1Y1WG 4A3BH 5LMUL 3D4WA 2B39A 4I7AA 4PNYA 5C3EG 1KQSA 4IBJA 1TTEA 3H4JA 3MWYW 1LT6D 1KLUD 1X6OA 3MHVC 1Q81C 4F1IA 3NXWA 5IREB 3GRRA 3VDPA 1OXUA 2E2JH 1U4PA 3HOZB 4BBSG 3I4VA 3F2BA 5EAYA 3RLOA 4A3JB 4LFCL 1JB0F 1Y8GA 5IP7G 4F2LA 4JV5L 1B9NA 5EBDA 1O80A 2QGQA 4H44C 4OVZB 4DAPA 1PXUA 4JK1C 1EIGA 1D1KA 1A3VA 4Y7NH 4A3MH 3T6PA 2WFWA 3E4RA 2VB3X 5HGTA 3A5UA 1U5KA 3HY5A 1I50H 3NHHA 4MN3A 1TKWB 1S3SA 3NEMA 4ZCKA 5I9PA 1PGYA 1VQDA 2NUCA 1D0KA 1KNAA 3W0LB 4GKJM 4KY5A 4NP5A 2JQOA 1RL2A 5JVH3 2R93G 1ILPA 2NQ8C 1IW7D 2AWOA 4KD3A 5HURA 4DV0L 3EIHA 1SXTA 4X3KA 4NB3A 2D7EA 1X55A 2F4VQ 3Q0AA 5D65A 3TE6A 1PMRA 1VQ7A 2EOTA 1LM0A 1S5BD 4DV1Q 4IUVA 1K83H 3SBJA 5LMNQ 4CGYB 2K01A 2Z1CA 4KHVA 1VS0A 3SGIA 2MNAA 3IECA 1VQOA 4QUFA 3NBXX 2DWZB 1X3FA 2DZOB 4KT0F 2IW3A 4WJ3M 4TQUS 1KTKA 4OWXB 3ZC7B 3P1HA 1TXYA 4LJAA 2YYZA 4NKLA 4JBWA 4J6HA 2HHHM 1LUZA 3W2DA 4LF6M 5I6WA 3I70A 2DKLA 3TP6A 2NVYH 4FF3A 2G8LA 2LVQD 1C4QA 3B7ZA 2KA7A 4A3IH 2JA5H 1ONLA 1AFPA 2E2DC 5EXPA 4NSOB 4HSVA 1I94Q 1I94M 3UDGA 2F0VA 4DPGA 4JI1M 2MFIA 2K33A 3CCLA 3DZDA 1N78A 3F8TA 3VYSA 4X66Q 2F3VA 5IYDH 1TR5A 1R4GA 2CRUA 4C1NK 2UUCL 1EUJA 2JE6I 4ZKBB 5K5PA 1T5EA 3D8GA 2L4EA 2FJ2A 4CKEA 1TS3A 5IYCH 2DWMA 5KEEA 5EJWA 1BVSA 2L2DA 5DYIA 3PGZA 2JUJA 1MU5A 2K14A 3WHKA 3EVQA 1R9TB 4DR4M 4X64Q 2EUCA 4JI4Q 4KV6A 2EY5A 3M9BA 4YCUA 1XC8A 3VA7A 2C5CA 3U6LA 3WWVA 1G6PA 3M85A 1U9RA 2FMMA 3T15A 5C5LA 4A3LH 5IYBG 3GO8A 4X64M 2D5DA 1PH3A 2X8AA 2AMCB 4A3JG 3VR5A 3FKIH 5E1FA 1K8AC 3E0EA 1TQOA 2F0MA 4N9PA 2EPBA 4DF7A 5ELEA 4I5SA 2K6AA 2DGYA 4DV7Q 1YUBA 1I6VC 2KBNA 3CRLC 3UI2A 3I4LA 1N33Q 2O5IC 3HOVH 3BOSA 5KQ8A 2DHYA 4JI6M 2VW9A 1Y1WH 1LT4D 4C3HH 3NE5B 1G4AE 3ULJA 4LRTA 2K4KA 3MC0B 2YTYA 1HR0W 1OFHA 4FD2A 1CK1A 3KOJA 1C0AA 2CP8A 1EY6A 4O42A 4EQNA 2XGNA 2A74C 2FE8A 1QZEA 1ZMVA 1HZBA 5LL6S 2AWNA 4ZAIA 1PM5A 4FCWA 2PZTA 3K0XA 1M8AA 3PSIA 4DBGB 3HKSA 1UEAB 4DR1Q 2Z4HA 2K5QA 2RKOA 4OX9L 1OXVA 2UXBM 4R4QA 1QZGA 1LTBD 1L1OB 2RHQB 1OIZA 2F0JA 4LF7L 4H0LC 4R8IA 1VQAA 4DV4M 4LJ5A 2EYHA 4JI0Q 1F2LA 1JOQA 1QNUA 1XNQL 2Q8IB 2UXCQ 5M9OA 3AOEA 2APLA 5KQDA 4LGYA 3T1HM 3RZDH 4LZJA 3M7NA 4W5WA 2VY3A 3T1HQ 5FLMH 3S14H 5FLXS 3HOUH 4DR7Q 4GLVB 4HJAA 1SJED 3KW6A 4R7GA 1FVIA 1VQ5A 1Z9FA 1L2DA 1K3RA 4DUZL 3U6DA 3SHFA 1K8MA 4IOAA 4Q7JA 1IN8A 1F4IA 3T4AC 1S5DD 3I4YA 5M5WH 4M9XA 2BNKA 5FTMA 5DLQE 1TWHB 1FL0A 2D62A 3K7UC 4LF6Q 3S14B 2QENA 1Z5AA 4UHVA 5ITRA 5IYDG 2A19A 3FUWA 4M0DA 1IBMQ 1EIHA 4JI7M 1EYAA 1J7KA 4LF5M 1JWMD 4UY8C 2KDLA 1N32M 3S1QH 4R71A 1H9RA 1HNZM 2I7PA 2K0BX 2F52A 2AQ3B 4CKCA 2O4XA 2CCZA 3BBZA 3M7GA 4GKKL 3KXEC 5M3FB 3H94A 3L3OC 4OW0A 4DV2L 2CWAA 3GTMH 4DUZQ 4IFDG 3QOLA 2R92H 3PO2H 2YTXA 1K3XA 2PNRC 1SEBD 4FDBA 2UUBM 2I5LX 1K0RA 1LTRD 5M3FH 1IN6A 3E21A 4QQBX 4IFDH 3A8IE 1LTLA 2VQEQ 4HJ7A 3ZH9B 4DAYA 1Z6HA 5KPZA 5FLXL 2DENA 2KHHA 1AZPA 5JEAG 4HIKA 3F1ZA 4LK1C 1HR0Q 4UDUC 3GTGH 1OAIA 3NPPA 4R4OA 2N8NA 4S12A 2VF8A 2H1RA 1QVCA 1UUPA 2B2UC 3NBHB 3EBEA 1G51A 5KNDA 1GVPA 4B08A 4OIJA 2BDOA 3SASA 1LABA 1K8OA 4PG3A 1D2NA 2JXMB 3PV0A 4OWTB 5E7NA 2LH0A 3U6EA 3TMEA 1YHQA 2Z6BA 5EXTA 1UM8A 1C9OA 1H6UA 2L1BA 3MXNA 1B7YB 4PDGA 4BY1H 4GC9A 1PRTF 2BOSA 5BR8M 1WCMB 4NRVA 3QWNA 4L5TA 4BBSH 1NUCA 1W5TA 4B3SM 1IQPA 3THGA 1V9PA 5C5MA 4I4LA 3CF2A 3CRKC 5M5XB 1YLAA 3SC3A 4CJ6A 2A5YB 1E9SA 2B2VC 1TWAB 4AKGA 3MA2B 3GPXA 5EKKA 1KLGD 4AW4A 2A73B 3PIOA 2CQOA 1KL9A 3G6EA 2XRQD 4WW0A 1N34Q 4RA8A 3HOZG 4ZK9B 3ICEA 4BBSB 2ZAOA 5JAVA 4KHPQ 4O0AA 2KCTA 3GLFE 3T51B 4GITA 5E6JA 1Y1WB 5IOCA 2QW7A 2TMPA 2WV6D 1S40A 1J5EM 3MHBA 3H3VC 1LT3D 1Q8IA 1WIVA 4WORA 1V1OA 4ULLA 1PHJA 1VQMA 3UZUA 1SXJC 1JMCA 1UWVA 3H6MA 1EEFD 4IBCA 1TS2A 1TWGH 1HTPA 2OCEA 4Z8XA 3T53B 1DGSA 3DM1A 3OTOM 1P8LA 1AE2A 1NAPA 4OONA 4JYAQ 4FYDA 4PMBA 2NWGA 4MHEA 1X32A 1W3SA 5C6AA 1I4GA 1G3IA 2HL7A 2HCIA 4LFCM 1NSNS 2AUJD 5C0XH 1GUSA 2BA0A 4LJ4A 4RHSA 3FUTA 8CATA 2J7OA 2QBYB 3KDFB 3R8FA 3NELA 4OO1I 4GMQA 3CGWA 3MAQA 1CHPD 1IN5A 4RGOS 3AV0A 1SNDA 2M5ZA 2QP9X 1U4RA 2A6HC 3EN2A 4TSSA 2KCNA 5DAUA 4DNRB 4NSRA 4PZ8A 1I94L 4JI7Q 1VQ6A 3EIEA 1PRTD 1KXLA 1P16A 1YNXA 1B3AA 2EYFA 3T13A 1G2TA 3NENA 1H9KA 3NBIA 4PZ6A 4A3DB 2JA8G 3DOAA 2F3IA 3J7ZC 2PMZB 4BS9A 3CMEA 3HOUG 2L12A 2BDNA 5FO8B 3PVSA 2DAEA 3GLGA 2E76C 1L8QA 2M9VA 3KLSX 5M3MH 4DV3M 4DR7M 2OOAA 2QSFX 2KHSA 2UU9M 3HG9A 1SXJE 1HPCA 4DK1A 2Q2EB 1EIJA 4IJFA 3NP8A 1PRTB 1NBWA 3ND8A 2O2LD 4DUZM 2DWLA 1GJXA 3CC4A 2YV5A 4LF8L 1VQLA 4POFA 3J7BA 2LXJA 3NSWA 2F4VL 3J80L 1PJIA 4LF7Q 1FYCA 1RF2D 4B3MM 4CIZA 1HZ9A 4R8NA 3J80c 4HEOA 4CHTB 1QQWA 2XGTA 2HKJA 2AUKA 5AFWA 5CC4A 4DNIA 1JJ2A 3U6PA 1OTRA 1HNXM 3Q8DA 1LTSD 1L0XB 4I7ZC 4Q0FA 2D7HA 1TWHH 1PTOB 4DR1M 1BQQT 1JT8A 3CKIB 3A98B 3H4MA 4BBRH 5JPMC 2KOLA 3L7ZC 1JR0D 1D5ZC 4G4NA 1IXSA 1E0BA 3LWUA 2VUMG 4P72A 1SXJA 4OVZA 2X4AA 1QZHA 3KS4A 3GLIA 2QILA 1IKMA 3R3OA 3PXGA 4JYAL 1KHIA 2O5RA 4EQOA 2XIWA 5IGFA 5E3FA 4K5WA 1L1ZA 2E5LM 2KCCA 5CMDA 1L1OA 3FKIG 2FFKB 2RCNA 2G9DA 4TKOB 3RN2A 1VQHA 2SOBA 2UXCM 5EPKA 3TWMA 4OX9M 4ABNA 5C4JB 5LMUQ 3CP0A 2FOIC 3H3VH 2KA6B 1XTCD 2Y0SB 2VS1A 4MIUA 1ML0D 2F0LA 4OO1G 4LZZA 4DV4L 4II7A 1PYBA 2B2VA 4R1JA 4NW2A 5EKIA 4YWMA 2F5NA 2MUYA 2W82A 3VKHA 4L4UA 2G3QA 3TQYA 2LFNA 1R9TH 1N34L 4X64L 3I3CA 3KJPA 3RE8A 5T1IA 1XNRM 1SMYD 2RSNA 4QIWB 4E6IA 2B2TA 2WAQE 1VG5A 3FYCA 2K50A 2G5GX 2VQFM 2L15A 3CW2C 2ZM6L 2ZJRA 3SHGB 3CCEA 3S2DH 1OJLA 1BKBA 2E2HB 5FKAC 3A42A 2V4DA 1FNNA 1MSGA 1Z7TA 4HSPA 4WJ4A 2K75A 1PH5A 4IUQA 3MTSA 3IL8A 3S1MB 4JI6Q 1IN4A 1Q8KA 1NR4A 4L8RC 2VZAA 2JA8H 5DNYA 2QZ4A 4OGQC 2F4IA 4B3SQ 1SAPA 2VL6A 5IWAQ 1ESRA 4A3IB 5ELCA 3K5LA 3FRHA 4JI2M 1UNSA 1SN8A 3VLFB 1WYDA 2JEBI 2GQFA 3VYTA 5EBCA 1CA5A 3CHBD 4K2LA 3G4SA 2N88A 4MGIE 1G2SA 1HR0L 4NOOB 1Q86C 3JAMi 1C8CA 3PO2B 2R92B 5IWAM 2J0TD 2RBMA 1KDCA 1UE7A 5NUCA 3KP0E 1XPOA 1SXJB 1B3QA 1GOZA 4L6TB 3TSSA 3EROA 4C56C 2WB1E 3KFUA 4IURA 5IGCA 3KS8A 1XWIA 2Q2UA 1XB2B 3NWTA 4K0KL 2DAIA 4DR3Q 2K03A 2X6LA 3NK9A 3BG3A 4HCSA 5BN5A 1PH8A 4DGZA 1NJIC 3KSXA 3KOWE 3J7AV 1V1PB 3GP7A 1LV7A 1QG7A 3FTFA 1MKHA 1CSQA 4XT1B 3J81E 1S5ED 3GTOH 4YHHQ 3GLGB 3TL4X 3OMGA 3IRBA 5H1SE 3ZQJA 3FVQA 1QOHA 1I4HA 4DR4Q 2R4JA 4JI1Q 4OELB 1Q3LA 2LHGA 4LG2A 2NVXH 1Q02A 3UE1A 4LUZA 4YHHL 3KF6B 1BUVT 3KF8A 5LMUM 5J22A 1JWUD 1HNZQ 3J7AF 3PFIA 1TWFH 3FPUB 4B3RQ 1B50A 5EP2A 1Q90A 3URYA 1QZMA 2K5NA 4LGMA 1Z47A 1PTOF 1HT2E 3U4VA 3PF5A 1JICA 2Z4IA 2D0OA 1DO2A 1DGHA 1NY5A 4XQJA 5EP3A 2EZVA 4NXMM 2ATWA 2R7ZB 2CQAA 1HFGA 4GKKM 3CC7A 2OWOA 5C4XB 1JJCB 2YNMD 4REZA 1DOMA 1I4RA 2L0CA 2Z6KA 3KBGA 5FOBB 1K9MC 1C48A 2P5TA 3NWSA 3HHXA 4KKSA 1II3A 4FF4A 2E2IB 1Y14B 1Q1BA 3D8BA 2F0UA 3KK7A 4L63B 1QVRA 1UAPA 3R93A 1XXGA 5GAEC 5E26A 2CFMA 2WIIB 1HUMA 4JI0L 1WVLA 1VDZA 1QUTA 1Z5CA 4WURA 1TWGB 4JBJA 4DV0M 4RCOA 2IWHA 3LW5F 2F5QA 4WJWA 4G7OC 3W67A 1KABA 2KHJA 3RLFA 1V33A 5ITXA 3D31A 4C3HB 4A3KB 3I4OA 4AG5A 1HRJA 2EJMA 1NHWC 1BCPB 1EY9A 2Z4SA 4MTNA 4OX9Q 4A3LG 3I7FA 3F2DA 4H13C 1DONA 3HOZH 2E2JB 3OOCA 2NB0A 3VK7A 1AN8A 4L5QA 1F9RA 3A8JE 2K52A 4IBBA 1L1TA 3L28A 4XT3B 1TS5A 4K8JA 1SFOB 4DR6M 2RKSA 1XWEA 3U60A 4KODA 1MIUA 2TSSA 5GROA 3QO2A 1QWYA 1WTPA 1DGFA 3HFZB 1QE6A 1RD9D 1OFIA 1BO0A 3HKZG 4C3JB 1JB3A 3LWEA 3FHWA 3J81i 2MJ5B 2KZUA 2C96A 1WR1B 1E2ZA 2WAQG 1CA6A 4U673 1ZAEA 3S17B 1RCVD 1MJEA 4DV4Q 3HKZE 4LF5Q 2KNAA 2DZLA 3BS1A 3ERSX 3J7A5 3RNUA 1QAOA 1LTGD 2XZUA 1X3PA 1WXQA 2AHMA 1TU2B 4ZUIA 4M8AA 3X3MA 5AJ3Q 4FCTA 1PTOD 1J09A 1STEA 5ELOA 3HU1A 4XYQA 3AQQA 3S15H 4G4RA 2HQEA 4FW9A 3KUPA 5EXXA 3WHLA 3AU7A 3GTQH 3U4ZA 2EE1A 1TVXA 3DEOA 1J6QA 4JI3M 2WP8J 5KNCA 2EYMA 4UPAA 1CZGA 3TBIB 1EWCA 3LVVA 4V0BA 1KAAA 3P75A 3HJQA 2HAKA 2EKFA 1ET6A 1VQJA 4HCEA 4JN6A 1UFZA 2WZJA 4GHAA 4X62Q 5EKLA 3W0FA 4A75A 1FR3A 3OSOA 4LF9M 2K32A 3HOWG 2K5WA 2NVTB 4DV2M 4B3RM 2F0NA 4GOPA 4AQYL 1PH4A 3OTOQ 2ZTEA 3I01M 4WFN3 1O7ZA 1JQJC 1N75A 4BA1I 4KY6A 4YCVA 5KRUA 1Y69U 5IY0A 1GL7A 3H91A 1IBLM 2ZJQA 1M90C 3DM3A 4BBRG 1TH2A 2EJGC 1TIID 3LVWA 1A0IA 3V05A 2N3SA 4BY7G 1EFUB 4B3TM 4S3SA 3CPFA 3O13A 4LF8Q 4JXJA 2LXKA 3KOZE 5TSSA 2MQHA 2Y0TA 1X9NA 2DWNA 2O5JC 4K8IA 1PZID 1F2ZA 3ZCBB 1PJJA 1KRSA 4LJ7A 4IBIA 3OWFA 3TS2A 2KRUA 4GLXA 5GADC 4G4OA 3CCMA 3SAVA 4DR3M 5JVG3 1JR3E 4FVMA 4TUWA 1X56A 4FXKC 4BB9A 4G3OA 1FGBD 2YTVA 1KD1C 3I56A 3GQ5A 3TWLA 1U4LA 1S5CD 2V1CA 3RN5A 1O7IA 3KYHC 1HQMC 4X66M 1PJTA 1GLNA 3PO3H 2MO0A 1Z59A 3AFPA 4IJEA 3HJ8A 3C46A 1EYCA 3BVMA 2UXBL 1EOVA 2NZHA 4JBKA 3M3YH 5EGTA 3C9PA 2BCOA 2EYOA 2JYOA 3FDTA 3CU7A 2VDBB 4PCZA 2I46A 1KRTA 4IO9A 4C3IB 3KP1E 2DNEA 1D7QA 3S1RH 1K28A 3I8ZA 5L8RF 3PIPA 4JW0A 1J5EL 1VQ8A 2BWEA 1EQRA 1WTVA 2RGHA 5FTNA 4JCVE 5D3IB 4RWSC 3SR1A 4DNTB 5L37A 3B89A 2BH8A 4EVOA 4JV5Q 1ENFA 2RA4A 3I55A 2M00A 1VEJA 1SE4A 3HOXG 5CYUA 1TF0B 4KO8A 1Q12A 4A3VB 2V1UA 4GNXA 4KJOA 1DO0A 3VYRA 5JJLA 3TN2A 1WGNA 4DUYM 3OMCA 4UP7A 2CW0D 2OT2A 4DAVA 4Y52H 3U5ZA 3STBC 2RDHA 1G41A 1RJTA 4IBDA 4J8QA 5FTLA 5K36H 5KPTA 1XYIA 1NV8A 5HGQA 3M4PA 3IKJA 1YNNC 2B63H 3RZOH 1ASZA 4NRWA 1YSYA 4A3GH 2KJXA 4JI1L 1CZWA 4GIPA 1EU4A 4LFAL 3BZKA 1H9SA 5DNFA 5J1ZA 4DR6L 5JI2E 2IHFA 2Q2HA 4FP5D 5E4XA 4DV5M 1T6OA 1JE5A 3NQIA 3VDUA 4ANRA 2KZSA 2K5VA 1QVFA 1D2BA 4HEDA 1IYJB 4F88A 4L8JA 5GAHC 2UUAM 1X3QA 1ZMWA 4IBGA 3A0JA 3AEVA 2XWBB 3F2CA 4A93G 4G4KA 3HZJA 4CJ1B 5ITYA 2OQ0A 1OTCA 1EY0A 2SEBD 1E1TA 5JOBA 1N32Q 4GKJQ 4GC5A 2B3GA 5T1GA 4BXXG 3S1QB 3EQLC 1YE9A 3SK4A 3FPPA 4HMJA 1LTTD 4BLCA 1NNJA 3W1BA 3ILKA 4IFDJ 3VFDA 1I3QH 2EY6A 2JA5G 4FF1A 2LNHC 2E75C 4IBEA 4JI5L 2Y20A 3MZ5A 4PMCA 1T3TA 4M1UB 2DY7A 3UDXA 3QJYA 2XVSA 1PVOA 2XSCA 1B1ZA 3RFWA 3W5OA 2JY8A 1STAA 3OWEB 2LKVA 3E9HA 2DAMA 5IWAL 5IT9L 4LY6A 3G48A 4GOPC 5CV7A 1M4VA 4AKIA 1EOTA 2R7FA 3CCRA 1EEID 1D0LA 3FTEA 4DR5Q 4LF9L 3GTQB 1TDHA 3X3NA 1TWCB 2GVBA 4AQYM 1VQCA 1N8RC 3BU2A 4HR7B 3AYHB 2JK8A 3QOJA 2YQZA 1VQ9A 4LFAQ 4BY7B 2LSSA 4KMUC 3BXWA 1QAMA 3W1GA 1IBLL 3VK8A 1EQVA 2A6EC 2KENA 4B3MQ 4LF4Q 2ERCA 1V92A 3KDSE 2AQ1B 2LBCA 4GZYC 4LF6L 3TDQA 4ODGA 2Q8TA 1Q39A 3PIO3 3G71A 1F77A 4IPCA 3UJNA 4H7BA 2NTSA 3HP3A 4AKHA 1LLRD 3SE0A 1BXTA 2CKZB 3H3VI 3DMUA 1CFMA 3F92A 3HOWB 1YNND 3UE0A 1R7RA 4YY3Q 4QY7A 1OXXK 4X3UA 5C3EB 3J80i 3L2PA 2NVQH 4UAIA 1LACA 3CPWA 4HN7A 2EXZA 2QQ8A 3I2ZA 5C18A 2RF4A 1XNQM 4P16A 4R9WA 4FWDA 4ILWA 4AIMA 2V1CC 1GO5A 4QUCA 1HTLD 3F2UA 4K5VA 4G7HC 4AZFA 2CE7A 4MNOA 4L5SA 3GTGB 3K92A 3HWSA 3R2TA 3E3XA 1YZ6A 5CV6A 2XZFA 5C44G 4R3DA 1JR3A 3M3YB 2R4EA 1XNQQ 2A69C 2MR9A 3T16A 1J5EQ 1EQTA 3LQRA 2EKKA 4L5RC 2QPAA 1L2FA 4PD2A 3IAYA 1NCVA 1OIPA 5BR8Q 3TZUA 3KJOA 3SYLA 4KHPM 1VQNA 1GM5A 3TZDA 4RFBA 2MP1A 4QJFA 2K5HA 4RKUF 1LTAD 2KEDA 3LGJA 3PO3B 4K6DA 1R2YA 4JBMA 2XH9A 1KIXA 4FXDA 3HKZB 1PYSB 4QOSA 1MI2A 1Y8NB 4ZUJA 2L7HA 3RR5A 1HA6A 4PT5A 1TWAH 4FWHA 4F8MA 4NXNM 1EFWA 1HQCA 2JJQA 4RCNA 4A4IA 2NVXB 5IP7H 5BR8L 1XPRA 1Q3CA 4LAAA 1A8VA 4NDXA 1QDTA 2UU9L 4N9TA 1GUOA 1LT5D 4L16A 4X6AH 1EIFA 1QYRA 3Q6SA 4XIGS 1WTOA 1EL0A 2IL8A 2DXIA 5LMNM 1NTGA 4IUTA 3S1NB 1PTOH 7CATA 2R6FA 2XRSD 4X3TA 1XNRQ 4MZ9A 1ZYRD 5C4XH 4L78A 2L9HA 1EE8A 2N35A 3DWPA 2A6ED 3GTMB 1NY6A 1I5FA 5JJKA 4IUUA 3SK5A 4YY3L 1FGUA 2E2IH 1JWSD 1PRTC 3MEHA 3D6WA 4I65A 4YIJA 1CHQD 3J81S 4QIWE 2HWJA 1CT1D 2IPKD 4K2KA 5D14A 2D9UA 1QUQA 2R7ZG 2CH4W 1ZMUA 2KNVA 1Q46A 4P75A 5KNBA 3OHXC 3S2HH 2B8FA 5IP9H 3NQTA 2E8GA 1E9RA 1E2VA 3OTOL 3MMPA 2HDLA 1NVMA 4NC6A 2PQAA 1XMOQ 5EPJA 3PUXA 2K47A 4UP8A 4JI3L 3JAME 1OXTA 2LS01 3U61A 2JY6B 4A3GB 3I4MB 4RGNA 1CQVA 3EA6A 2ZAMA 3RMHA 4DK6C 1CTMA 2C99A 2KEEA 2UUAL 5M5YB 2J4XA 4B9WA 2JZ1A 4HIDA 2DJFC 2UXDM 1QUQB 5IYBH 4OWWB 3T56B 2RGOA 4IFDI 3M4OB 4DV6Q 2BE5C 3D3RA 1HNXQ 1GUGA 2B2WC 5ITXE 4A3JH 2OO9A 4ZLTF 2DN8A 4LFBL 4PV1C 1TDZA 5IGEA 4RHRA 4DK0A 1PYWD 4JC0A 2PNHA 2RQXA 4B3TL 3PF4A 1EZ6A 1PDQA 4AYBG 4CDEC 1XNRL 1VQGA 2FXQA 1B2TA 2IX3A 1OO9B 1F2YA 3MK6A 1IYUA 3BJUA 3I91A 5C44H 5FSWA 2YU9H 1VQ1A 1RODA 3A7AB 1AP0A 4IPGA 3QR8A 2IX0A 5A35A 3DEPA 4I8OA 2LVNC 2F0TA 3GQBA 2NN6I 3IFTA 4XQNA 2GVAA 1HNWL 4M9ZA 3S17H 2JWSA 3TP8A 2R18A 5ELDA 2RHSB 5FJ8H 3BZDB 3S2DB 1K3WA 2JA7B 4JOIA 2WSCF 4DV0Q 3BZCA 1PFSA 2NZOA 4ID6A 1RTNA 4G6ZA 2OQKA 2I07B 1GJTA 2VF7A 4KTAA 5EXSA 2CV2A 1XTDA 3PMFA 2IX1A 2Q2TA 3V2TA 1WJ7A 2QCPX 3OIPA 3TREA 2DUDA 2EYLA 3RD4A 3U9SA 2Z4RA 1MHWC 4NL4H 4DXFA 3NUCA 1RHPA 2KCMA 2CWBA 4IBKA 2IHEA 4C3JH 4GHLA 1NSFA 1B9MA 1ESFA 2SNMA 4YCWA 3S24A 3K7AB 5C0XI 2F0HA 5COYA 1Y1VB 5M5XH 2KW0A 2ALYB 3KBXA 4MTKA 1VMCA 2ZTDA 4OEMB 3K6OA 4JYAM 5IODA 4R4IA 5C4JH 3HOWH 1A3TA 4GN5A 2VQEL 1IXSB 1NE3A 2EVBA 2RRUA 5FJ8G 3JR4A 2MGSA 5ISRA 1S4ZA 3K5NA 4JG2A 1KC8C 5CGKA 1U4MA 2FINB 1MBYA 3JC66 3GLIB 1FNVA 5GKNA 2A68D 2KECA 3CMAA 2ZXOA 4B3RL 3WDNA 3FYDA 4DV2Q 5EP1A 1NO1A 2LVPC 3FEWX 4F7XA 4RKBA 2F0IA 1TH3A 3VDYA 3J81L 1ZKOA 5CBEE 2R7ZH 2EA0A 1O7YA 5FTKA 3L0OA 3L27A 2B2UA 4G7ZC 4B3ML 2QKIC 2AQ2B 1G71A 1K8GA 2IJ0A 5I2XA 2NVTH 4BA2I 5LHY1 1IBML 4RGMA 4KHZA 2VUMB 2VB2X 4JI2Q 4CDDC 5DYGA 2B2TC 4UP9A 3K0YA 3NTIA 1DGBA 2ICIA 2X6GA 1JJGA 1S72A 1GO3E 3KSJA 5G3LF 2ZANA 5J39A 1Q1EA 4DR3L 1AIPC 3GPPA 1QANA 3DLLA 1YIJA 2K04A 2B63B 1PRBA 3UGJA 1I4XA 4QL5A 2A8VA 4HL4A 1F9PA 1PFBA 1IFYA 1SYFA 2R7DA 1N36L 4CISA 3K80C 1Z5BA 3LCUA 2L11A 3J81j 2ID0A 2DAKA 2L6OA 1BR9A 1EZ8A 2AKWB 2UXCL 1MJGM 1HR0M 1YVCA 4KKTA 2HHHQ 2LXEA 3SHLA 3S1NH 4B9XA 1EU3A 2A6HD 4WRDA 4JI4M 3HZXA 4IPDA 1OKSA 4EX5A 2Z3XA 4QCLA 1WD1A 5DM73 3J2PB 1X3GA 5EP4A 3BDLA 4K0KM 1HCZA 3A45A 3HJSA 2XNAC 4PMWA 4QMGA 2ASBA 2JXNA 3GLHB 3K81C 2F0OA 4RGTA 3L26A 1L0WA 4CJ2C 2UUBQ 4G57A 2ZM6M 4UN2B 3MFYA 4IN3A 2VQFL 1YJWA 3VKGA 4AQYQ 4MH0E 2ZJPA 3HOVG 4A3BB 4DR5M 2A5HA 1YJ9A 5D3DA 1KDAA 4X62L 3B9PA 3VR4A 3I73A 2K1BA 4GS3A 1N33L 1O7LA 1X54A 1F2MA 2XFSA 3TRZA 4BY1G 2HIXA 3RZDB 4CDFC 1QJOA 4DU9A 1W5SA 2CHGA 2XFTA 3M0EA 1DJRD 4IQZA 4DR2M 4LFBM 1ZV1A 3PNYA 1E22A 4DR2Q 3GPUA 2HD3A 2H4OA 3BVGA 3GDEA 1BNZA 1V34A 1Y1VG 5I9OA 3K59A 1PFNA 2RDGA 2PI2E 1A62A 3RUZA 2MO1A 5G3LD 2DVWB 2JA6B 5C0XG 1HUNA 1Z6TA 3GRYA 2DZNB 2YR0A 1A3UA 2A1AA 4X3SA 1MSHA 1J8IA 1TY0A 2N49A 2K9DA 3K5OA 5CBAE 1IBKQ 4O2DA 4KJNA 3K8ZA 5CV5A 4AG6A 2OPFA 1V8QA 3C1EA 1G8ZD 3E5SA 3A74A 3HEJA 3MXUA 2K28A 2CHVA 2RVLA 3FTDA 2OTJA 2LWXA 1CQFA 5ITTA 4TVAB 3S16B 4P71A 4ZRZA 1MJCA 3GTKB 1I4QA 4DV5Q 1R4PB 3J80E 2I5MX 1GUTA 2JA7G 3J7AS 1YNJC 4DKAC 1DOLA 1W6KA 3MXNB 1S3OA 2OQ4A 4R4CA 1WTRA 1SFOH 1VMPA 1XMQL 2L5TA 3DXJC 2FS1A 5IGGA 4YWKA 1KSFX 5IGDA 3LCVB 4PQXA 5EPLA 3R8BA 2HIVA 2VXWA 3P20A 2F0QA 2RDFA 2UXBQ 3Q23A 3D6CA 1MN3A 4N8X1 2ZBKB 2B3TA 3DWAA 4HAEA 5DEHA 2EYJA 2Y0SE 2DAGA 4AYBB 2EY2A 5CR3A 2UUCM 2P5ZX 2ZXPA 3CCSA 1KNEA 3FD9A 1TWCH 2JN4A 2R0IA 2NVQB 2H1EA 1QILA 3JAMc 1N36Q 1STBA 2CHBD 2R6GA 3SAUA 2WKCA 4A3FH 2X49A 1NY4A 3UMMA 4LUOA 4CJ0B 5JPNC 1SG9A 1AZQA 2DNCA 1C7YA 2MJ8A 3VA5A 4A3EG 3K57A 1Q82C 1CKNA 1YEZA 5KYLA 2UXDL 2DJGC 3S9WA 4JPBW 5IT9E 3C3LA 1JORA 4O1NA 2JA2A 1V1QA 2PQEA 3U50C 2VUMH 4RF0A 3MXGA 3E0JA 4A3FB 3FRIA 4FO2A 2ZT9C 2E2HH 3CCQA 1HT1E 4JI2L 4IJLA 3GTJB 3A8KE 3K9PA 3CCUA 2NTTA 3BDCA 2WACA 3A46A 5JEAH 2QF7A 4A93B 3WOEA 3GV3A 1K83B 1EIYB 1Y8OB 2VIIA 2KXEA 2F0PA 5M3FG 3TEHB 3CQZB 1E3PA 2F0GA 4IUNA 3U61B 4A76A 1PV4A 2F0WA 4HLQA 2G5DA 3T1YM 3R9XB 2Z8YM 1I4PA 3CTWB 3QWLA 4QNMA 1EWIA 2JP1A 1SNPA 2Z8LA 5LL6X 1MD2D 4DUYL 1XJVA 5JEAJ 2KEBA 3PUWA 2ENBA 3VR3A 3BDOA 2C5RA 1AE3A 1EY7A 1A5TA 1NHGC 4XXEA 2B2YC 2WINB 1W2BA 3EFXD 5AJ3L 3UK6A 4B7HA 1CKOA 3G6JB 3GTLH 1K0SA 2JSOA 1B8AA 3M4YA 1NMGA 1JQYD 2KUMA 2HCBA 4KHPL 2KHIA 4GOPB 1VQPA 1UE5A 4LFAM 3HOXB 2EXDA 1IXZA 2QEJC 3L29A 2QEXA 3I4NG 1D8LA 3ONAB 2FFJA 3W68A 2CWPA 3LX0A 3A55A 3GTPH 1YJNA 1I6HH 2CFOA 2WKDA 2E74C 1RKNA 2KVMA 3QIAA 3I51A 2F0DA 5FO9B 1JOKA 1SNMA 3V96A 2VQFQ 5FK9C 1PH7A 4B7FA 2HDMA 3FMCA 1W6JA 3GQ3A 5I6YA 4C1NI 5GAGC 1QUSA 4RMFA 2EJSA 2CW0C 3M6AA 1WTHA 2M2LA 5FLXE 4CDCC 2ZM6Q 2I0QA 1LV9A 4IUPA 5C44B 2YU9B 3ZJYC 5ELFA 2Z7JA 4JI8Q 2D0PA 1SROA 4LJZC 1JE4A 3HX3A 5A2QS 4POGA 3T38A 5M3MB 4ME3A 1WD0A 1HHVA 3L25A 5J3BA 2CV0A 1BOSA 3FUXA 4D81A 2R62A 4RF1A 4JI5M 1WFQA 3CC2A 1VQIA 2HHHL 3HHYA 1SMYC 1X65A 3S16H 5DM63 2LY7A 1OXSC 3LQQA 3GQ4A 2K05A 3UDIA 4LFBQ 1JCKB 2F0KA 2O01F 3U60B 3C58A 2PZWA 2C35B 4A3EH 1IBKM 3D8LA 3TQSA 5C4HA 1SYEA 4DV6L 4Q5VA 5M5YH 3GRVA 5F3WA 1HZAA 1RIPA 1SJHD 2J7ZA 2QCUA 4DUYQ 2NVYB 1G8PA 3AMUA 1B53A 1F9QA 4NXMQ 4AI6A 4X65L 3GLFB 1A15A 1I4WA 5IGBA 2RSOA 3I90A 2V6ZM 1L0YB 1BDOA 4XYOA 2N78A 1HFNA
chains in the Genus database with same CATH topology
3S2HB 3W3AA 1DOKA 1SYCA 3BYYB 1R6BX 1IL8A 4EIWA 1F9SA 3K1JA 1DXMA 1STGA 1DGHB 2D2CC 2JA5B 1QAQA 4K14A 2N55A 1ILQA 5M5WB 2QBYA 3BYTB 3S15B 3IG5A 3SDZA 1BBXC 1I3QB 3SATA 3WOFA 4NMZA 1FJGM 3CF6E 4OL7A 1N33M 2PO4A 3LMMA 4F87A 1HXYD 1STHA 5KO3A 4FXGC 1IW7C 5C3XA 1WTXA 4L15A 1K82A 3PIP3 4MGYE 3OIQA 1D5XC 3K58A 4TRDA 4ZPXA 1H9JA 2Q8RE 1TY2A 1V1PA 5EQ0A 2PCFB 3GLFA 3VR6A 2X69A 4RKLA 3E6ZX 1D1IA 4XDXA 2J7NA 4KKUA 4EQPA 4LF4M 3I4NB 4D82A 3DA1A 4MGKE 3MXPA 3I72A 3QG1A 3SK8A 1IY2A 4LJ9A 5K36G 4Z6YA 1SE2A 1G91A 1SSOA 3SYKA 1NNUC 1QB5D 3HRZC 1D5MC 4HMIA 3RZOB 1H9SB 3KVWA 2FNAA 2R93B 4C3HG 1H9MA 4ZKCB 4GH9A 1BCPD 1S5FD 2KRKA 5C3WA 2EJFC 5CORA 2XWJB 1DYQA 3QAUA 1CM9A 3S1RB 1R2ZA 2EY1A 4M9SA 1DM0B 1MX0A 4MGHA 3JAMS 3J7YW 3P7JA 1JR3D 4QNRA 3SFZA 4D80A 1IHZA 2F0FA 3MVVA 4LJ8A 5A2QL 4C3IG 4EGVA 4KY7A 1QCBD 1BF4A 3GTLB 2K7VA 2FMCA 1FD7D 5BN4A 1IBMM 4FWGA 2ZXRA 4DXGA 1ZQ9A 1TGUA 1JOOA 2MHVA 1C1KA 3OPOA 2R45A 5EQTA 3ND9A 1SBBB 3E9SA 1L2CA 1Y8PB 2B2WA 4MM3B 1XMOM 3SARA 4A3EB 4FCVA 2F4VM 3H0GB 3AJIB 4J1MA 5BN3A 1TH4A 3AKZA 3TP7A 4I81A 3J80S 2NN6H 2OEOA 3N52A 4IZ8A 3C2PA 4RAUC 3K2LA 2SNSA 4DV1M 1B44D 4FF2A 1STNA 2R46A 4PDIA 1STYA 5E4WC 2F5OA 1BCPF 4BWGB 1YNJD 2MPMA 3SVMA 5KPRA 1HA5A 1WTQA 4OHJA 3U5ZB 4BBRB 4X65M 3HOYB 3HKPA 4LRSA 1Q3BA 2DHRA 4QOZC 3A56A 3L2AA 1EY5A 5I4DA 4DA2A 2OF1A 3U6SA 4KN7C 1AEXA 3A7LA 4IIWA 3D4DA 3Q24A 2IT1A 3NTKA 2G9HD 2EDGA 3HHZA 1KYIA 1VDDA 3G7LA 1XXHA 3FUUA 3SMSA 4Y7NB 4A3MB 2LMCB 1PFMA 1I50B 4JV5M 2OXPA 2Y21A 4KN4C 5KGUA 3K5MA 4FNFA 3VYUA 4BY1B 2WAQB 3JR5A 2XSZD 3A54A 3RGPA 3R2IA 4LMQD 4C3JG 2PW7A 5JJZA 1SNCA 3HOVB 1GHJA 1EFID 1NJGA 2DY8A 1O78A 2NYZD 3MFGA 4YY3M 4OO1H 2C9CA 2R65A 3J27B 2NZ1D 4QF4A 4LJ6A 1VF7A 1GUNA 1KDBA 1E2WA 4XQQA 2L4NA 1IY1A 3KLSA 4CKBA 1NJFA 1EY8A 2GA4B 1DGGA 2L09A 2KQ3A 3FUVA 4K6LA 3GP1A 2F3WA 1DD2A 1GHKA 5CV8A 1HQYE 1IXRC 1L2BA 3OW7A 2Y0QA 1N77A 1PLFA 3U6QA 2WB1B 3Q8XA 3CF0A 1N36M 1VF5C 4KI0A 2XSZA 4XTCS 4C2MB 4GRIA 3FTCA 1SYBA 3D4RA 3KLRA 2L7IA 5C1BA 1E94E 3U9OA 4LF8M 5IT9S 2CUZA 1BCPC 5IIFA 1N34M 3PUZA 3ZYYX 3AOGA 1ZYRC 1R4QB 5I2YA 1NR2A 1XHBA 3KOXE 3IFDA 2BJVA 2JA8B 4KK7A 1TWFB 5C4ZA 1WTWA 4X62M 1IN7A 2CVRA 3DWQA 4DV6M 2HCCA 3Q22A 1SNOA 1V43A 1PZJD 1GVNA 3PNVA 1ICWA 1LTID 5KIXA 1ZEQX 1FNWA 3AFHA 1PZKD 4QHSA 2F5SA 1SXJD 1J9OA 2K5DA 1MGSA 5IZ7D 3AOEC 1AW7A 4OIKA 1JC7A 2F1MA 1PTOC 5ELBA 1SDFA 1T5XD 4ZYSA 2PPBC 2R3ZA 3VR2A 1GKIA 3SEBA 3PUYA 4QB4A 1B4OA 3GPYA 2I7NA 1XMQM 5ITUA 5F2DA 1IY0A 5BPVA 3PUVA 1XX8A 3GTPB 1I6HB 4HTHA 3GLHA 5JI3E 5FTJA 2C98A 2F0EA 2EYPA 3NBHA 5CV4A 1G6ZA 4RH6A 5A2QE 1DCZA 1ENAA 2C9OA 4XBOA 3U6MA 5ITQA 4IALA 2NBFA 3AB9A 2XF3A 2HUGA 3DFZA 4MB7A 3NWLA 3AL0C 3C1FA 4BBAA 1IM2A 1ENCA 4RNAA 3HGBA 3TPZA 1VCIA 2FHTA 3SAWA 1D6EC 3MJ5A 1HNWM 2R61A 3HU3A 3GRUA 3FKIB 1IYVA 1RDPD 4P2CB 3EJIA 1SE3A 3LNNA 4LCBA 1G59A 1SNQA 4DV7M 4G4QA 5CV9A 2SDFA 5C0XJ 5EJCA 1XXHB 4JI0M 1FNUA 2XLJA 1GXDC 4MGZE 1CI3M 2PW5A 3KFUG 1SYDA 4ZQ3A 4JI8M 3FKEA 1EWHA 2XN9C 1ZXTA 1LO5D 1E32A 4QHTA 4Z9CB 2F5PA 2CHQA 3H09A 1A2TA 2XEPA 4YHHM 3N6RA 2CEAA 3GTOB 1X37A 2F0SA 2PZUA 2BE5D 3HGIA 3GD7A 1G291 3JAML 1GUWA 2VQEM 2F03A 3HHWA 3IG8A 5H37D 2ICEC 3HS0C 3U6OA 3TP5A 1TS4A 3BVZA 2CV1A 2M60A 3GO5A 1DZ1A 4B7GA 4KD4A 1GL6A 4K5XA 1A2UA 4IBFA 2BJWA 2NN6G 1RTOA 5FO7B 2QDBA 1HQRD 3HOUB 4DFAA 4KLNA 3DHQA 3ERQA 2B8GA 4XGIA 2EO2A 2B2YA 3FRPB 3L9AX 4DN4M 3U6CA 3TWKA 2JEAI 1EY4A 1ORYB 2PYKA 2A68C 3SMPA 1IKLA 1EYDA 4ME5A 3KOYE 3DUZA 2D7GA 3SK6A 4U68A 4OU7A 2VNUD 1ET9A 3RGSA 3ITPA 5KYIA 2A69D 1QNKA 4ITQA 3SXHA 3HU2A 4CBVA 1SYGA 2L55A 2YFQA 1TT2A 4LF7M 2BA1A 3GV6A 1A6XA 4M0WA 3NTHA 1KFVA 3QB3A 3D4WA 2B39A 4PNYA 4IBJA 3MWYW 1LT6D 1KLUD 3MHVC 3NXWA 5IREB 3GRRA 3VDPA 1OXUA 3HOZB 1U4PA 3I4VA 4A3JB 1B9NA 5EBDA 1O80A 4H44C 4OVZB 4DAPA 1PXUA 4JK1C 1EIGA 1D1KA 1A3VA 5HGTA 3E4RA 2VB3X 3NHHA 4MN3A 1TKWB 1S3SA 5I9PA 2NUCA 1KNAA 4NP5A 3W0LB 4GKJM 4KY5A 5JVH3 1ILPA 2NQ8C 1IW7D 2AWOA 4KD3A 5HURA 3EIHA 1SXTA 4X3KA 2D7EA 3Q0AA 5D65A 3TE6A 1PMRA 2EOTA 1S5BD 4IUVA 3SBJA 4CGYB 2K01A 2Z1CA 4KHVA 4QUFA 2DWZB 2DZOB 2IW3A 4TQUS 1KTKA 3ZC7B 3P1HA 4LJAA 2YYZA 4NKLA 4JBWA 4J6HA 2HHHM 3W2DA 4LF6M 5I6WA 3I70A 3TP6A 4FF3A 2G8LA 1C4QA 2KA7A 1ONLA 1AFPA 2E2DC 5EXPA 4NSOB 4HSVA 1I94M 2F0VA 4JI1M 2K33A 3DZDA 1N78A 3VYSA 2F3VA 1TR5A 4C1NK 2JE6I 4ZKBB 5K5PA 1T5EA 3D8GA 2FJ2A 4CKEA 1TS3A 2DWMA 5KEEA 5EJWA 5DYIA 1MU5A 3WHKA 3EVQA 1R9TB 4DR4M 2EUCA 4KV6A 2EY5A 1XC8A 3VA7A 2C5CA 3U6LA 3M85A 1U9RA 2FMMA 3T15A 5C5LA 3GO8A 4X64M 2D5DA 2X8AA 3VR5A 5E1FA 1TQOA 2F0MA 4N9PA 2EPBA 4DF7A 5ELEA 4I5SA 2K6AA 1YUBA 1I6VC 3CRLC 3UI2A 3I4LA 2O5IC 3BOSA 5KQ8A 4JI6M 1LT4D 3NE5B 1G4AE 4LRTA 3MC0B 1OFHA 4FD2A 1CK1A 4O42A 1EY6A 4EQNA 2XGNA 2A74C 2FE8A 5LL6S 2AWNA 4ZAIA 1PM5A 4FCWA 2PZTA 1M8AA 1UEAB 2Z4HA 2K5QA 2RKOA 1OXVA 2UXBM 1LTBD 2F0JA 4H0LC 4R8IA 4DV4M 4LJ5A 2EYHA 1F2LA 1JOQA 1QNUA 2Q8IB 5M9OA 3AOEA 5KQDA 4LGYA 3T1HM 4LZJA 3M7NA 4W5WA 5FLXS 1SJED 3KW6A 4R7GA 1L2DA 3U6DA 3SHFA 1K8MA 1IN8A 3T4AC 1S5DD 3I4YA 4M9XA 2BNKA 5FTMA 1TWHB 2D62A 3S14B 2QENA 1Z5AA 5ITRA 3FUWA 4M0DA 1EIHA 4JI7M 1EYAA 1J7KA 4LF5M 1JWMD 1N32M 1H9RA 1HNZM 2I7PA 4CKCA 2AQ3B 2O4XA 3M7GA 3KXEC 5M3FB 3H94A 3L3OC 4OW0A 4IFDG 3QOLA 1K3XA 2PNRC 1SEBD 2UUBM 1LTRD 1IN6A 4IFDH 3A8IE 3ZH9B 4DAYA 1Z6HA 5KPZA 5FLXL 1AZPA 5JEAG 4LK1C 4UDUC 3NPPA 4S12A 2H1RA 1UUPA 2B2UC 5KNDA 4B08A 4OIJA 2BDOA 3SASA 1LABA 1K8OA 1D2NA 2JXMB 3PV0A 3TMEA 2LH0A 3U6EA 5EXTA 1UM8A 1H6UA 2L1BA 3MXNA 4PDGA 4GC9A 1PRTF 2BOSA 5BR8M 1WCMB 4NRVA 3QWNA 1NUCA 1W5TA 4B3SM 1IQPA 3THGA 5C5MA 5M5XB 4I4LA 3CF2A 3CRKC 3SC3A 2B2VC 2A5YB 1E9SA 1TWAB 4AKGA 3MA2B 3GPXA 5EKKA 1KLGD 4AW4A 2A73B 2XRQD 4WW0A 4BBSB 4RA8A 4ZK9B 2ZAOA 5JAVA 3T51B 4GITA 5E6JA 1Y1WB 5IOCA 2TMPA 2WV6D 1J5EM 3MHBA 3H3VC 1LT3D 1Q8IA 4WORA 1V1OA 4ULLA 3UZUA 1SXJC 3H6MA 1EEFD 4IBCA 1TS2A 1HTPA 3T53B 4Z8XA 3DM1A 3OTOM 1NAPA 4FYDA 4PMBA 2NWGA 4MHEA 1X32A 5C6AA 1I4GA 1G3IA 2HL7A 2HCIA 4LFCM 1NSNS 2AUJD 5C0XH 1GUSA 2BA0A 4LJ4A 4RHSA 3FUTA 8CATA 2J7OA 2QBYB 3R8FA 4OO1I 4GMQA 3MAQA 1CHPD 1IN5A 4RGOS 3AV0A 1SNDA 2M5ZA 2QP9X 1U4RA 2A6HC 4TSSA 5DAUA 2KCNA 4DNRB 4NSRA 3EIEA 1PRTD 3T13A 1B3AA 2EYFA 1G2TA 1H9KA 3NBIA 4A3DB 3DOAA 2PMZB 4BS9A 2L12A 2BDNA 5FO8B 3PVSA 2E76C 3GLGA 1L8QA 2M9VA 3KLSX 4DV3M 4DR7M 2KHSA 2UU9M 3HG9A 1SXJE 1HPCA 4DK1A 2Q2EB 4IJFA 3NP8A 1PRTB 3ND8A 2O2LD 4DUZM 2DWLA 1GJXA 3J7BA 3NSWA 3J80L 1PJIA 1FYCA 1RF2D 4B3MM 4R8NA 4CHTB 1QQWA 2HKJA 2AUKA 5AFWA 5CC4A 3U6PA 1HNXM 1L0XB 1LTSD 4I7ZC 4Q0FA 2D7HA 1PTOB 4DR1M 1BQQT 3CKIB 3A98B 3H4MA 5JPMC 2KOLA 3L7ZC 1JR0D 1D5ZC 4G4NA 1E0BA 3LWUA 1SXJA 4OVZA 2X4AA 3KS4A 2QILA 3GLIA 1IKMA 3R3OA 3PXGA 2O5RA 4EQOA 2XIWA 5IGFA 5E3FA 4K5WA 1L1ZA 2E5LM 2KCCA 5CMDA 2FFKB 2G9DA 4TKOB 2SOBA 2UXCM 5EPKA 3TWMA 4OX9M 4ABNA 5C4JB 2FOIC 2KA6B 1XTCD 2Y0SB 4MIUA 1ML0D 2F0LA 4OO1G 4LZZA 4II7A 2B2VA 4NW2A 5EKIA 2F5NA 2MUYA 2W82A 3VKHA 4L4UA 2LFNA 3I3CA 3RE8A 5T1IA 1XNRM 1SMYD 2RSNA 4QIWB 4E6IA 2B2TA 3FYCA 2G5GX 2VQFM 3SHGB 1OJLA 2E2HB 5FKAC 3A42A 2V4DA 1FNNA 1MSGA 1Z7TA 4HSPA 4IUQA 3MTSA 3IL8A 3S1MB 1IN4A 1NR4A 4L8RC 5DNYA 2QZ4A 4OGQC 2F4IA 1SAPA 1ESRA 4A3IB 5ELCA 3K5LA 4JI2M 1UNSA 3VLFB 2JEBI 3VYTA 5EBCA 1CA5A 3CHBD 4K2LA 2N88A 4MGIE 1G2SA 4NOOB 1C8CA 3PO2B 2R92B 5IWAM 2J0TD 2RBMA 1KDCA 5NUCA 3KP0E 1SXJB 4L6TB 1GOZA 3TSSA 3EROA 4C56C 4IURA 5IGCA 3KS8A 1XWIA 3NWTA 2K03A 2X6LA 3NK9A 3BG3A 4HCSA 5BN5A 4DGZA 3KSXA 3KOWE 3J7AV 1V1PB 3GP7A 1LV7A 1QG7A 3FTFA 4XT1B 3J81E 1S5ED 3GLGB 3TL4X 3OMGA 3FVQA 1QOHA 1I4HA 2R4JA 1Q3LA 4LG2A 1BUVT 3KF8A 5LMUM 5J22A 1JWUD 3J7AF 3PFIA 3FPUB 1B50A 5EP2A 1Q90A 3URYA 1QZMA 4LGMA 1Z47A 1PTOF 1HT2E 1JICA 2Z4IA 1DO2A 1DGHA 1NY5A 4XQJA 5EP3A 2EZVA 4NXMM 2R7ZB 2CQAA 1HFGA 4GKKM 5C4XB 2YNMD 4REZA 1DOMA 1I4RA 2L0CA 3KBGA 5FOBB 1C48A 2P5TA 3NWSA 3HHXA 4KKSA 1II3A 4FF4A 2E2IB 1Q1BA 3D8BA 2F0UA 3KK7A 4L63B 1QVRA 1UAPA 3R93A 1XXGA 5E26A 2WIIB 1HUMA 1WVLA 1VDZA 1Z5CA 4WURA 1TWGB 4RCOA 2IWHA 4DV0M 2F5QA 4WJWA 4G7OC 1KABA 3RLFA 5ITXA 3D31A 4C3HB 4A3KB 1HRJA 4AG5A 2EJMA 1NHWC 1BCPB 1EY9A 2Z4SA 1DONA 4H13C 2E2JB 3OOCA 2NB0A 3VK7A 1AN8A 1F9RA 3A8JE 4IBBA 1L1TA 3L28A 4XT3B 1TS5A 4K8JA 1SFOB 4DR6M 2RKSA 1XWEA 3U60A 4KODA 2TSSA 3QO2A 1QWYA 1WTPA 1DGFA 1QE6A 1RD9D 1OFIA 1BO0A 4C3JB 1JB3A 3LWEA 2KZUA 2C96A 1CA6A 1E2ZA 4U673 1ZAEA 3S17B 1RCVD 3BS1A 1QAOA 1LTGD 2XZUA 1X3PA 1WXQA 2AHMA 1TU2B 4ZUIA 4M8AA 3X3MA 4FCTA 1PTOD 1J09A 1STEA 3HU1A 4XYQA 4G4RA 2HQEA 4FW9A 3KUPA 5EXXA 3WHLA 3AU7A 2EE1A 1TVXA 3DEOA 2WP8J 4JI3M 5KNCA 2EYMA 1CZGA 3TBIB 3LVVA 1EWCA 4V0BA 1KAAA 3P75A 3HJQA 1ET6A 4HCEA 4JN6A 4GHAA 5EKLA 3W0FA 1FR3A 3OSOA 4LF9M 2K32A 2K5WA 2NVTB 4DV2M 4B3RM 2F0NA 4WFN3 1O7ZA 1JQJC 1N75A 4BA1I 4KY6A 5KRUA 1Y69U 1GL7A 3H91A 1IBLM 1TH2A 2EJGC 1TIID 3LVWA 3V05A 4B3TM 4S3SA 3O13A 4JXJA 3KOZE 5TSSA 2Y0TA 2DWNA 2O5JC 4K8IA 1F2ZA 3ZCBB 1PJJA 1PZID 4LJ7A 4IBIA 3OWFA 2KRUA 4G4OA 3SAVA 4DR3M 5JVG3 4FVMA 4TUWA 4FXKC 4BB9A 1FGBD 3GQ5A 3TWLA 1U4LA 1S5CD 2V1CA 1HQMC 4X66M 1GLNA 1Z59A 4IJEA 3HJ8A 3C46A 1EYCA 3BVMA 5EGTA 2BCOA 2EYOA 2JYOA 3FDTA 3CU7A 4PCZA 2I46A 4C3IB 3KP1E 2DNEA 3I8ZA 1WTVA 2RGHA 5FTNA 3SR1A 5D3IB 4RWSC 4DNTB 4EVOA 1ENFA 2RA4A 2M00A 1SE4A 5CYUA 4KO8A 1Q12A 4A3VB 2V1UA 4KJOA 1DO0A 3VYRA 3TN2A 4DUYM 3OMCA 2CW0D 2OT2A 4DAVA 3U5ZA 2RDHA 1G41A 1RJTA 4IBDA 4J8QA 5FTLA 5K36H 5KPTA 1XYIA 3IKJA 1YNNC 4NRWA 1YSYA 2KJXA 1CZWA 4GIPA 1EU4A 1H9SA 5DNFA 5J1ZA 5JI2E 4FP5D 5E4XA 4DV5M 3NQIA 3VDUA 2KZSA 1D2BA 4HEDA 4F88A 4L8JA 2UUAM 1X3QA 4IBGA 2XWBB 4G4KA 4CJ1B 5ITYA 1EY0A 2SEBD 5JOBA 4GC5A 5T1GA 3S1QB 3EQLC 1YE9A 3SK4A 3FPPA 4HMJA 1LTTD 4BLCA 1NNJA 3ILKA 4IFDJ 3VFDA 2EY6A 4FF1A 2LNHC 2E75C 4IBEA 2Y20A 3MZ5A 4PMCA 1T3TA 4M1UB 2DY7A 3QJYA 2XVSA 2XSCA 1B1ZA 3RFWA 1STAA 3OWEB 2LKVA 5IT9L 4LY6A 5CV7A 1M4VA 4AKIA 1EOTA 1EEID 3FTEA 3GTQB 1TDHA 3X3NA 1TWCB 4AQYM 4HR7B 3QOJA 2YQZA 4BY7B 4KMUC 1QAMA 3VK8A 1EQVA 2A6EC 2ERCA 3KDSE 2AQ1B 4GZYC 3TDQA 4ODGA 2Q8TA 1Q39A 3PIO3 1F77A 3UJNA 4H7BA 2NTSA 3HP3A 4AKHA 1LLRD 3SE0A 1BXTA 3DMUA 1CFMA 3HOWB 1YNND 1R7RA 1OXXK 4X3UA 5C3EB 4UAIA 1LACA 4HN7A 2EXZA 5C18A 1XNQM 4P16A 4R9WA 4FWDA 4ILWA 4QUCA 1HTLD 3F2UA 4K5VA 4G7HC 4AZFA 2CE7A 3GTGB 3K92A 3HWSA 3R2TA 5CV6A 2XZFA 4R3DA 1JR3A 3M3YB 2R4EA 2A69C 3T16A 1EQTA 3LQRA 2QPAA 4PD2A 3IAYA 1NCVA 3TZUA 3SYLA 4KHPM 3TZDA 4RFBA 2MP1A 3PO3B 1LTAD 2KEDA 4K6DA 1R2YA 2XH9A 4FXDA 3HKZB 4QOSA 1MI2A 1Y8NB 4ZUJA 2L7HA 1HA6A 4PT5A 4FWHA 4F8MA 4NXNM 2NVXB 1HQCA 4RCNA 1Q3CA 4LAAA 4NDXA 4N9TA 1GUOA 1LT5D 4L16A 1QYRA 3Q6SA 4XIGS 1WTOA 1EL0A 2IL8A 2DXIA 5LMNM 4IUTA 3S1NB 1PTOH 7CATA 2XRSD 4X3TA 1ZYRD 4L78A 2L9HA 1EE8A 3DWPA 2A6ED 3GTMB 1NY6A 4IUUA 3SK5A 1JWSD 1PRTC 3MEHA 3D6WA 4I65A 4YIJA 1CHQD 3J81S 1CT1D 2IPKD 4K2KA 5D14A 2D9UA 5KNBA 3OHXC 2B8FA 3NQTA 1E9RA 1E2VA 2HDLA 1NVMA 5EPJA 3PUXA 2K47A 3JAME 1OXTA 2LS01 3U61A 4A3GB 3I4MB 4RGNA 1CQVA 3EA6A 2ZAMA 3RMHA 1CTMA 2C99A 2KEEA 5M5YB 2J4XA 4B9WA 2UXDM 3T56B 2RGOA 4IFDI 3M4OB 2BE5C 3D3RA 1GUGA 2B2WC 5ITXE 4ZLTF 2DN8A 4PV1C 1TDZA 5IGEA 4RHRA 4DK0A 1PYWD 2RQXA 1EZ6A 1PDQA 1B2TA 2IX3A 1OO9B 1F2YA 3MK6A 1IYUA 3I91A 5FSWA 1RODA 3A7AB 1AP0A 2IX0A 5A35A 3DEPA 4I8OA 2F0TA 3GQBA 2NN6I 3IFTA 4XQNA 4M9ZA 3TP8A 2R18A 5ELDA 3S2DB 3BZDB 1K3WA 2JA7B 4ID6A 1RTNA 4G6ZA 2I07B 4KTAA 5EXSA 2CV2A 3PMFA 2IX1A 3V2TA 2QCPX 3OIPA 2EYLA 3RD4A 3U9SA 2Z4RA 4NL4H 4DXFA 3NUCA 1RHPA 4IBKA 4GHLA 1NSFA 1B9MA 1ESFA 2SNMA 3K7AB 5C0XI 2F0HA 5COYA 1Y1VB 2KW0A 3KBXA 1VMCA 3K6OA 4JYAM 5IODA 1A3TA 1IXSB 2EVBA 3JR4A 2MGSA 5ISRA 1S4ZA 3K5NA 5CGKA 1U4MA 2FINB 1MBYA 3GLIB 1FNVA 5GKNA 2A68D 2KECA 2ZXOA 3WDNA 3FYDA 5EP1A 3FEWX 4F7XA 4RKBA 2F0IA 1TH3A 3J81L 1ZKOA 5CBEE 2EA0A 1O7YA 5FTKA 3L27A 2B2UA 4G7ZC 2QKIC 2AQ2B 2IJ0A 5I2XA 4BA2I 5LHY1 4RGMA 4KHZA 2VUMB 2VB2X 5DYGA 2B2TC 3K0YA 3NTIA 1DGBA 2ICIA 2X6GA 3KSJA 5G3LF 2ZANA 5J39A 1Q1EA 3GPPA 1QANA 2K04A 2B63B 3UGJA 1I4XA 4HL4A 1F9PA 1PFBA 1SYFA 4CISA 1Z5BA 2L11A 2ID0A 2L6OA 1BR9A 1EZ8A 1HR0M 4KKTA 2LXEA 3SHLA 4B9XA 1EU3A 2A6HD 4WRDA 4JI4M 3HZXA 2Z3XA 4QCLA 1WD1A 5DM73 3J2PB 5EP4A 3BDLA 4K0KM 1HCZA 3A45A 3HJSA 2XNAC 4PMWA 4QMGA 3GLHB 2F0OA 4RGTA 3L26A 4CJ2C 4G57A 2ZM6M 3MFYA 4IN3A 3VKGA 4MH0E 4A3BB 4DR5M 2A5HA 5D3DA 1KDAA 3B9PA 3VR4A 3I73A 2K1BA 1O7LA 1F2MA 2XFSA 3RZDB 4DU9A 1QJOA 1W5SA 2CHGA 2XFTA 3M0EA 1DJRD 4IQZA 4DR2M 4LFBM 3PNYA 3GPUA 2H4OA 3BVGA 1BNZA 5I9OA 3K59A 1PFNA 2RDGA 3RUZA 5G3LD 2DVWB 2JA6B 5C0XG 1HUNA 1Z6TA 3GRYA 2DZNB 2YR0A 1A3UA 4X3SA 1MSHA 1J8IA 1TY0A 3K5OA 5CBAE 4KJNA 3K8ZA 5CV5A 4AG6A 2OPFA 1V8QA 3C1EA 1G8ZD 3E5SA 3HEJA 3MXUA 2K28A 2CHVA 2RVLA 3FTDA 2LWXA 1CQFA 5ITTA 3S16B 4ZRZA 3GTKB 1I4QA 1R4PB 3J80E 1GUTA 3J7AS 1YNJC 1DOLA 1W6KA 1WTRA 2OQ4A 1VMPA 2L5TA 3DXJC 5IGGA 1KSFX 5IGDA 4PQXA 5EPLA 3R8BA 2VXWA 3P20A 2F0QA 2RDFA 3Q23A 3D6CA 2ZBKB 4HAEA 3DWAA 5DEHA 2EYJA 4AYBB 2EY2A 5CR3A 2UUCM 2ZXPA 1KNEA 3FD9A 2NVQB 2H1EA 1QILA 2R6GA 1STBA 2CHBD 3SAUA 2WKCA 2X49A 3UMMA 4CJ0B 5JPNC 1AZQA 2DNCA 2MJ8A 3VA5A 3K57A 5KYLA 3S9WA 5IT9E 3C3LA 1JORA 4O1NA 2JA2A 2PQEA 4RF0A 3MXGA 3E0JA 4A3FB 4FO2A 2ZT9C 1HT1E 3GTJB 3A8KE 2NTTA 3BDCA 2WACA 3A46A 5JEAH 2QF7A 4A93B 3WOEA 3GV3A 1K83B 1Y8OB 2VIIA 2KXEA 2F0PA 3CQZB 2F0GA 4IUNA 3U61B 2F0WA 4HLQA 3T1YM 3R9XB 1I4PA 3CTWB 3QWLA 4QNMA 2JP1A 1SNPA 2Z8LA 5LL6X 1MD2D 5JEAJ 2KEBA 3PUWA 2ENBA 3VR3A 3BDOA 2C5RA 1EY7A 1NHGC 4XXEA 2B2YC 2WINB 3EFXD 3UK6A 4B7HA 3G6JB 2JSOA 3M4YA 1JQYD 2KUMA 2HCBA 4LFAM 3HOXB 1IXZA 2QEJC 3L29A 3ONAB 2FFJA 3LX0A 3A55A 2CFOA 2WKDA 2E74C 2KVMA 1RKNA 3QIAA 3I51A 2F0DA 5FO9B 1JOKA 1SNMA 3V96A 5FK9C 4B7FA 2HDMA 3FMCA 1W6JA 3GQ3A 5I6YA 4C1NI 2CW0C 3M6AA 5FLXE 2M2LA 1LV9A 4IUPA 5C44B 2YU9B 5ELFA 2Z7JA 4LJZC 1JE4A 5A2QS 3T38A 5M3MB 1WD0A 1HHVA 3L25A 2CV0A 1BOSA 3FUXA 4D81A 2R62A 4RF1A 4JI5M 3HHYA 1SMYC 5DM63 2LY7A 1OXSC 3GQ4A 2K05A 3LQQA 1JCKB 2F0KA 3U60B 3C58A 2PZWA 1IBKM 3D8LA 3TQSA 5C4HA 1SYEA 4Q5VA 3GRVA 5F3WA 1SJHD 2J7ZA 2QCUA 2NVYB 1G8PA 3AMUA 1B53A 1F9QA 4AI6A 3GLFB 1A15A 1I4WA 5IGBA 2RSOA 3I90A 2V6ZM 1L0YB 1BDOA 4XYOA 4V190 1HFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGY B;  4CHT B;  3NBI A; 
#chains in the Genus database with same CATH topology
 3S2H B;  3KF8 B;  3W3A A;  3KF6 A;  1DOK A;  1SYC A;  4Y28 F;  3BYY B;  1R6B X;  1IL8 A;  4EIW A;  1VQB A;  4DR4 L;  1F9S A;  3FE3 A;  1OQY A;  3K1J A;  1DXM A;  1HH2 P;  3I4M H;  2LTU A;  1H95 A;  3FP9 A;  1K73 C;  1D0M A;  3EIV A;  1STG A;  1DGH B;  2D2C C;  2I5H A;  2JA5 B;  1QAQ A;  4K14 A;  3C3E A;  3A5Z B;  3T1H L;  2N55 A;  1ILQ A;  5M5W B;  2QBY A;  4K0K Q;  2AHO B;  3BYT B;  3S15 B;  3IG5 A;  3SDZ A;  1BBX C;  1I3Q B;  1YBY A;  3SAT A;  2DI0 A;  1KAW A;  3GLH E;  4H02 A;  4NMZ A;  1FJG M;  3CAM A;  3WOF A;  5M3M G;  3CF6 E;  3CF5 A;  4OL7 A;  1N33 M;  2PO4 A;  3LMM A;  4F87 A;  1HXY D;  1STH A;  5KO3 A;  4FXG C;  1IW7 C;  5C3X A;  1T43 A;  4L15 A;  1WTX A;  2JA6 H;  1K82 A;  3PIP 3;  4MGY E;  3OIQ A;  1D5X C;  3K58 A;  4TRD A;  4ZPX A;  2WSE F;  1H9J A;  2RCF A;  3PCO B;  2Q8R E;  3ER0 A;  1TY2 A;  1V1P A;  2QA4 A;  3PQI A;  5EQ0 A;  2PCF B;  4JI7 L;  3GLF A;  3VR6 A;  2X69 A;  4RKL A;  1Y1V H;  3E6Z X;  3ULL A;  1D1I A;  2Z6K C;  4QGU A;  4XDX A;  2J7N A;  4KKU A;  4EQP A;  4LF4 M;  3I4N B;  4D82 A;  3DA1 A;  4MGK E;  1WGL A;  3MXP A;  3I72 A;  3QG1 A;  4GNX C;  3SK8 A;  1IY2 A;  4LJ9 A;  5K36 G;  4Z6Y A;  1SE2 A;  2Z0S A;  1G91 A;  1SSO A;  3SYK A;  2DNA A;  1NNU C;  3T1Y L;  1QB5 D;  3HRZ C;  4DV5 L;  1D5M C;  4HMI A;  1QVG A;  3RZO B;  1H9S B;  3KVW A;  2JA9 A;  4N8F A;  2FNA A;  2R93 B;  4C3H G;  4DV7 L;  1H9M A;  4ZKC B;  4GH9 A;  3HOX H;  2QNJ A;  1BCP D;  1S5F D;  2KRK A;  1XPU A;  5C3W A;  4IOC A;  2EJF C;  5COR A;  2XWJ B;  1DYQ A;  3QAU A;  1CM9 A;  2R93 H;  3S1R B;  1X3E A;  1R2Z A;  2EY1 A;  4M9S A;  1DM0 B;  2L4F A;  3UDF A;  1MX0 A;  4MGH A;  3JAM S;  4HJ9 A;  3J7Y W;  3P7J A;  1JR3 D;  4QNR A;  3SFZ A;  4D80 A;  1OAO C;  1IHZ A;  1N9W A;  2F0F A;  3MVV A;  4LJ8 A;  5A2Q L;  4C3I G;  4GNX B;  1K3B C;  4ALP A;  4DR2 L;  4EGV A;  4KY7 A;  1QCB D;  1BF4 A;  3GTL B;  5C4X G;  2K7V A;  2FMC A;  1FD7 D;  5BN4 A;  2LHC A;  1IBM M;  5HY6 A;  4FWG A;  2ZXR A;  4DXG A;  3QYE A;  1ZQ9 A;  1TGU A;  1QDR A;  2UUA Q;  1JOO A;  2MHV A;  1RU3 A;  1C1K A;  2HQL A;  4P73 A;  1SLJ A;  3OPO A;  2R45 A;  1GKH A;  5EQT A;  3ND9 A;  1SBB B;  2CH4 A;  4JI3 Q;  4LWC A;  4A3F G;  3E9S A;  1PH9 A;  1L2C A;  3MEF A;  1Y8P B;  3M4Q A;  4A3K H;  2EQS A;  1AH9 A;  2B2W A;  4MM3 B;  1XMO M;  1PH2 A;  3SAR A;  4A3E B;  2GNO A;  4FCV A;  2F4V M;  3H0G B;  3AJI B;  2Q2I A;  4J1M A;  3M4O H;  5BN3 A;  1TH4 A;  3AKZ A;  3TP7 A;  4I81 A;  4JI5 Q;  3K9O A;  3J80 S;  2NN6 H;  2OEO A;  3N52 A;  4IZ8 A;  3C2P A;  4RAU C;  3K2L A;  2SNS A;  3OW2 A;  1E1O A;  4DV1 M;  4APV A;  3E9I A;  1B44 D;  4FF2 A;  1NNX A;  1STN A;  2R46 A;  4PDI A;  5JJI A;  1STY A;  5E4W C;  2F5O A;  1BCP F;  4BWG B;  1YNJ D;  1HJP A;  2JY5 A;  2MPM A;  3KLW A;  5LMN L;  4DAM A;  3SVM A;  5KPR A;  1HA5 A;  4DV3 Q;  1WTQ A;  4OHJ A;  3QYB A;  3U5Z B;  4P74 A;  4BBR B;  2UU9 Q;  2R92 G;  4X65 M;  3PO2 G;  3HOY B;  3HKP A;  1CKN B;  1VEK A;  4LRS A;  1Q3B A;  4JVZ A;  2DHR A;  4QOZ C;  3A56 A;  4GKK Q;  3L2A A;  1EY5 A;  5I4D A;  4A3I G;  4DA2 A;  2LVO C;  3HOY H;  2OF1 A;  1R5L A;  3U6S A;  4KN7 C;  1AEX A;  3KDF A;  2IY5 B;  3A7L A;  4IIW A;  3D4D A;  3Q24 A;  2IT1 A;  1YIT A;  3NTK A;  2G9H D;  3B7N A;  2EDG A;  3HHZ A;  3S1M H;  1KYI A;  1VDD A;  3G7L A;  5DFL A;  4X65 Q;  1XXH A;  3FUU A;  4GEW A;  3SMS A;  1E7Z A;  4NXN L;  4Y7N B;  4A3M B;  2LMC B;  2JA6 G;  1XXH E;  2H5X A;  1PFM A;  2B29 A;  1I50 B;  2HT1 A;  4JV5 M;  3K7A H;  4DR7 L;  4NPS A;  2OXP A;  2Y21 A;  1U0L A;  4KN4 C;  5KGU A;  3K5M A;  4FNF A;  3VYU A;  4BY1 B;  2WAQ B;  3JR5 A;  2GN5 A;  2XSZ D;  3A54 A;  3RGP A;  2Y0S G;  3R2I A;  4LMQ D;  4C3J G;  4P17 A;  5IE8 A;  2PW7 A;  4KLK A;  5JJZ A;  1SNC A;  3HOV B;  1GHJ A;  4A3B G;  1EFI D;  1NJG A;  2DY8 A;  1O78 A;  1CSP A;  2NYZ D;  3MFG A;  4NXN Q;  4YY3 M;  4OO1 H;  2C9C A;  2QHO B;  2R65 A;  4JI8 L;  3B6Y A;  3J27 B;  1JB7 A;  2NZ1 D;  4QF4 A;  2JA7 H;  4DR1 L;  4LF4 L;  1GJS A;  4LJ6 A;  1VF7 A;  1GUN A;  3GTJ H;  1KDB A;  4A3K G;  1E2W A;  4XQQ A;  1CUK A;  2L4N A;  1IY1 A;  3KLS A;  4CKB A;  1NJF A;  1EY8 A;  2GA4 B;  1DGG A;  2L09 A;  2KQ3 A;  3FUV A;  4K6L A;  1IL2 A;  3GP1 A;  2F3W A;  1DD2 A;  2QDL A;  1GHK A;  1UE1 A;  2FH0 A;  1HZC A;  5CV8 A;  1HQY E;  1IXR C;  1B70 B;  1L2B A;  3OW7 A;  2Y0Q A;  1N77 A;  1PLF A;  3I04 M;  1HNW Q;  1P3Q Q;  3U6Q A;  3Q8X A;  3CF0 A;  1N36 M;  1VF5 C;  2WB1 B;  2XSZ A;  4JOI C;  4KI0 A;  4XTC S;  4YWL A;  4C2M B;  4GRI A;  2E5L L;  1VQF A;  4DV3 L;  3FTC A;  1SYB A;  3CD6 A;  2B63 G;  4C3I H;  2WSF F;  3D4R A;  3KLR A;  5IP9 G;  2L7I A;  5C1B A;  1E94 E;  3U9O A;  3E46 A;  4GN4 B;  4B3T Q;  3C3D A;  4LF8 M;  1VQ4 A;  1SR3 A;  3H15 A;  5IT9 S;  2J5Y A;  4GKJ L;  2CUZ A;  3IHP A;  3CQZ H;  1WI5 A;  3J81 c;  3CXC A;  1BCP C;  3D0F A;  5IIF A;  1N34 M;  3PUZ A;  1FJG Q;  2XTI A;  3ZYY X;  3AOG A;  1ZYR C;  1R4Q B;  4LUV A;  5I2Y A;  2KNZ A;  1HNX L;  1NR2 A;  1XHB A;  3KOX E;  3IFD A;  3U58 A;  2BJV A;  2JA8 B;  2OOB A;  4A3D G;  2JY7 A;  1GAB A;  4KK7 A;  1TWF B;  5C4Z A;  1WTW A;  4X62 M;  1IN7 A;  5ELN A;  4A3D H;  1VQK A;  2CVR A;  3DWQ A;  4DV6 M;  1BBW A;  2HCC A;  5IYC G;  2PMZ E;  3Q22 A;  1SNO A;  1V43 A;  1PZJ D;  1GVN A;  3PNV A;  4L6V 6;  1ICW A;  1LTI D;  5KIX A;  1XMO L;  2UUC Q;  1ZEQ X;  1FNW A;  3AFH A;  1PZK D;  4QHS A;  2F5S A;  1SXJ D;  1J9O A;  2ZTC A;  3Q8G A;  4IJH A;  2K5D A;  1MGS A;  2MRO B;  4PZ7 A;  5IZ7 D;  3AOE C;  1AW7 A;  2UXD Q;  1UE6 A;  4OIK A;  1JC7 A;  2F1M A;  4XK8 F;  1PTO C;  5ELB A;  1GD7 A;  1SDF A;  1T5X D;  4ZYS A;  2PPB C;  1DV0 A;  2R3Z A;  4HJ8 A;  2K6B A;  3VR2 A;  3B7Q A;  1GKI A;  3SEB A;  4HIO A;  1PH6 A;  3PUY A;  4QB4 A;  2MH8 A;  1B4O A;  3GPY A;  2MGW A;  2Z9H A;  2I7N A;  1XMQ M;  5ITU A;  1IXR A;  1ASY A;  5F2D A;  1IY0 A;  3GTK H;  5BPV A;  3T1Y Q;  4WP2 A;  4AH6 A;  3PUV A;  1XX8 A;  3GTP B;  1WOC A;  1I6H B;  4HTH A;  3GLH A;  2WB1 G;  1XMQ Q;  1BBU A;  2ES2 A;  5JI3 E;  5FTJ A;  2JP7 A;  2C98 A;  2F0E A;  2JNH A;  2EYP A;  3NBH A;  5CV4 A;  1WJJ A;  1G6Z A;  4RH6 A;  5A2Q E;  1DCZ A;  1ENA A;  4HIM A;  2C9O A;  3CCV A;  4XBO A;  1PJQ A;  1WCM G;  4GN3 B;  3U6M A;  5ITQ A;  4IAL A;  2NBF A;  3AB9 A;  2XF3 A;  2HUG A;  3DFZ A;  4MB7 A;  3NWL A;  3AL0 C;  1VDL A;  3C1F A;  4BBA A;  1IM2 A;  1ENC A;  4RNA A;  3HGB A;  4DAY B;  3TPZ A;  1VCI A;  3ULP A;  1L1O C;  1IBK L;  1SE8 A;  2FHT A;  3SAW A;  5IT9 c;  1D6E C;  3MJ5 A;  4A93 H;  4LFC Q;  1HNW M;  2R61 A;  3HU3 A;  3GRU A;  3FKI B;  1IYV A;  1RDP D;  1WCM H;  4P2C B;  3EJI A;  1SE3 A;  1SRU A;  3LNN A;  2LVA A;  4LCB A;  1G59 A;  1SNQ A;  4DV7 M;  4G4Q A;  5C3E H;  4RG1 A;  5CV9 A;  2SDF A;  5C0X J;  5EJC A;  4GLA C;  4V19 0;  1XXH B;  4JI0 M;  1FNU A;  2XLJ A;  1GXD C;  4MGZ E;  3I4M G;  1CI3 M;  2PW5 A;  1M1K C;  3KFU G;  1SYD A;  4ZQ3 A;  4JI8 M;  3OYY A;  4A3G G;  3FKE A;  3GLI E;  1HNZ L;  4BY7 H;  1EWH A;  2XN9 C;  4LW1 A;  1ZXT A;  1LO5 D;  4JI4 L;  1E32 A;  4QHT A;  1PH1 A;  5FLX c;  4Z9C B;  2F5P A;  2CHQ A;  3H09 A;  1EQQ A;  1A2T A;  2XEP A;  4YHH M;  2JZ0 A;  2CEA A;  1LTM A;  3AFQ A;  3N6R A;  4BXX H;  3GTO B;  1X37 A;  4OXP A;  4A3M G;  2F0S A;  2R44 A;  1T9H A;  2PZU A;  2BE5 D;  3HGI A;  1WHC A;  3GD7 A;  2PI2 A;  4HJ5 A;  1IBL Q;  1G29 1;  3JAM L;  2UUB L;  1GUW A;  1E24 A;  2VQE M;  5FLM G;  2F03 A;  1EYG A;  3HHW A;  3IG8 A;  5H37 D;  1ICF B;  2ICE C;  3HS0 C;  4X66 L;  3U6O A;  3TP5 A;  1TS4 A;  4NXM L;  4DR5 L;  4LF9 Q;  3BVZ A;  2CV1 A;  3K8A A;  2M60 A;  3GO5 A;  2O25 A;  1DZ1 A;  1FJG L;  4B7G A;  4DK3 C;  4LNQ A;  4KD4 A;  1GL6 A;  4K5X A;  1A2U A;  4A3C G;  4R4T A;  4IBF A;  2BJW A;  2NN6 G;  1RTO A;  4C2M H;  1YHB A;  1AUA A;  5FO7 B;  1HQR D;  2QDB A;  3HOY G;  4DFA A;  4KLN A;  1VQE A;  3HOU B;  3DHQ A;  3ERQ A;  2B8G A;  4XGI A;  2BH2 A;  2EO2 A;  2B2Y A;  3GLG E;  3STB D;  3FRP B;  3RLN A;  3L9A X;  1A63 A;  1PJS A;  1CKM A;  4LF5 L;  1NV9 A;  2BWB A;  1N32 L;  4A3C H;  1YI2 A;  2E5L Q;  2PQA B;  4DN4 M;  3U6C A;  1PA6 A;  4B3S L;  3TWK A;  1YHA A;  2JEA I;  1EY4 A;  4DV1 L;  1ORY B;  2PYK A;  2A68 C;  3PO3 G;  3SMP A;  3V76 A;  4JI6 L;  1IKL A;  1EYD A;  4ME5 A;  3TS0 A;  3KOY E;  3DUZ A;  2D7G A;  3SK6 A;  4U68 A;  4OU7 A;  2VNU D;  3H0G G;  1ET9 A;  1SMX A;  3I4N H;  3CCJ A;  3RGS A;  5GQO A;  4EQ5 A;  3ITP A;  5KYI A;  4DR6 Q;  2A69 D;  3B74 A;  1TR8 A;  1QNK A;  4IPH A;  1Q7Y C;  1VEG A;  5LMN W;  4ITQ A;  2OTL A;  4J15 A;  4AYB E;  3SXH A;  3HU2 A;  1IZ6 A;  4CBV A;  1SYG A;  2L55 A;  2YFQ A;  1TT2 A;  4LF7 M;  2BA1 A;  3GV6 A;  3H0G H;  2EIF A;  1NMF A;  1A6X A;  4M0W A;  1LYL A;  1UEB A;  3NTH A;  1KFV A;  3QB3 A;  1Y1W G;  4A3B H;  5LMU L;  3D4W A;  2B39 A;  4I7A A;  4PNY A;  5C3E G;  1KQS A;  4IBJ A;  1TTE A;  3H4J A;  3MWY W;  1LT6 D;  1KLU D;  1X6O A;  3MHV C;  1Q81 C;  4F1I A;  3NXW A;  5IRE B;  3GRR A;  3VDP A;  1OXU A;  2E2J H;  1U4P A;  3HOZ B;  4BBS G;  3I4V A;  3F2B A;  5EAY A;  3RLO A;  4A3J B;  4LFC L;  1JB0 F;  1Y8G A;  5IP7 G;  4F2L A;  4JV5 L;  1B9N A;  5EBD A;  1O80 A;  2QGQ A;  4H44 C;  4OVZ B;  4DAP A;  1PXU A;  4JK1 C;  1EIG A;  1D1K A;  1A3V A;  4Y7N H;  4A3M H;  3T6P A;  2WFW A;  3E4R A;  2VB3 X;  5HGT A;  3A5U A;  1U5K A;  3HY5 A;  1I50 H;  3NHH A;  4MN3 A;  1TKW B;  1S3S A;  3NEM A;  4ZCK A;  5I9P A;  1PGY A;  1VQD A;  2NUC A;  1D0K A;  1KNA A;  3W0L B;  4GKJ M;  4KY5 A;  4NP5 A;  2JQO A;  1RL2 A;  5JVH 3;  2R93 G;  1ILP A;  2NQ8 C;  1IW7 D;  2AWO A;  4KD3 A;  5HUR A;  4DV0 L;  3EIH A;  1SXT A;  4X3K A;  4NB3 A;  2D7E A;  1X55 A;  2F4V Q;  3Q0A A;  5D65 A;  3TE6 A;  1PMR A;  1VQ7 A;  2EOT A;  1LM0 A;  1S5B D;  4DV1 Q;  4IUV A;  1K83 H;  3SBJ A;  5LMN Q;  4CGY B;  2K01 A;  2Z1C A;  4KHV A;  1VS0 A;  3SGI A;  2MNA A;  3IEC A;  1VQO A;  4QUF A;  3NBX X;  2DWZ B;  1X3F A;  2DZO B;  4KT0 F;  2IW3 A;  4WJ3 M;  4TQU S;  1KTK A;  4OWX B;  3ZC7 B;  3P1H A;  1TXY A;  4LJA A;  2YYZ A;  4NKL A;  4JBW A;  4J6H A;  2HHH M;  1LUZ A;  3W2D A;  4LF6 M;  5I6W A;  3I70 A;  2DKL A;  3TP6 A;  2NVY H;  4FF3 A;  2G8L A;  2LVQ D;  1C4Q A;  3B7Z A;  2KA7 A;  4A3I H;  2JA5 H;  1ONL A;  1AFP A;  2E2D C;  5EXP A;  4NSO B;  4HSV A;  1I94 Q;  1I94 M;  3UDG A;  2F0V A;  4DPG A;  4JI1 M;  2MFI A;  2K33 A;  3CCL A;  3DZD A;  1N78 A;  3F8T A;  3VYS A;  4X66 Q;  2F3V A;  5IYD H;  1TR5 A;  1R4G A;  2CRU A;  4C1N K;  2UUC L;  1EUJ A;  2JE6 I;  4ZKB B;  5K5P A;  1T5E A;  3D8G A;  2L4E A;  2FJ2 A;  4CKE A;  1TS3 A;  5IYC H;  2DWM A;  5KEE A;  5EJW A;  1BVS A;  2L2D A;  5DYI A;  3PGZ A;  2JUJ A;  1MU5 A;  2K14 A;  3WHK A;  3EVQ A;  1R9T B;  4DR4 M;  4X64 Q;  2EUC A;  4JI4 Q;  4KV6 A;  2EY5 A;  3M9B A;  4YCU A;  1XC8 A;  3VA7 A;  2C5C A;  3U6L A;  3WWV A;  1G6P A;  3M85 A;  1U9R A;  2FMM A;  3T15 A;  5C5L A;  4A3L H;  5IYB G;  3GO8 A;  4X64 M;  2D5D A;  1PH3 A;  2X8A A;  2AMC B;  4A3J G;  3VR5 A;  3FKI H;  5E1F A;  1K8A C;  3E0E A;  1TQO A;  2F0M A;  4N9P A;  2EPB A;  4DF7 A;  5ELE A;  4I5S A;  2K6A A;  2DGY A;  4DV7 Q;  1YUB A;  1I6V C;  2KBN A;  3CRL C;  3UI2 A;  3I4L A;  1N33 Q;  2O5I C;  3HOV H;  3BOS A;  5KQ8 A;  2DHY A;  4JI6 M;  2VW9 A;  1Y1W H;  1LT4 D;  4C3H H;  3NE5 B;  1G4A E;  3ULJ A;  4LRT A;  2K4K A;  3MC0 B;  2YTY A;  1HR0 W;  1OFH A;  4FD2 A;  1CK1 A;  3KOJ A;  1C0A A;  2CP8 A;  1EY6 A;  4O42 A;  4EQN A;  2XGN A;  2A74 C;  2FE8 A;  1QZE A;  1ZMV A;  1HZB A;  5LL6 S;  2AWN A;  4ZAI A;  1PM5 A;  4FCW A;  2PZT A;  3K0X A;  1M8A A;  3PSI A;  4DBG B;  3HKS A;  1UEA B;  4DR1 Q;  2Z4H A;  2K5Q A;  2RKO A;  4OX9 L;  1OXV A;  2UXB M;  4R4Q A;  1QZG A;  1LTB D;  1L1O B;  2RHQ B;  1OIZ A;  2F0J A;  4LF7 L;  4H0L C;  4R8I A;  1VQA A;  4DV4 M;  4LJ5 A;  2EYH A;  4JI0 Q;  1F2L A;  1JOQ A;  1QNU A;  1XNQ L;  2Q8I B;  2UXC Q;  5M9O A;  3AOE A;  2APL A;  5KQD A;  4LGY A;  3T1H M;  3RZD H;  4LZJ A;  3M7N A;  4W5W A;  2VY3 A;  3T1H Q;  5FLM H;  3S14 H;  5FLX S;  3HOU H;  4DR7 Q;  4GLV B;  4HJA A;  1SJE D;  3KW6 A;  4R7G A;  1FVI A;  1VQ5 A;  1Z9F A;  1L2D A;  1K3R A;  4DUZ L;  3U6D A;  3SHF A;  1K8M A;  4IOA A;  4Q7J A;  1IN8 A;  1F4I A;  3T4A C;  1S5D D;  3I4Y A;  5M5W H;  4M9X A;  2BNK A;  5FTM A;  5DLQ E;  1TWH B;  1FL0 A;  2D62 A;  3K7U C;  4LF6 Q;  3S14 B;  2QEN A;  1Z5A A;  4UHV A;  5ITR A;  5IYD G;  2A19 A;  3FUW A;  4M0D A;  1IBM Q;  1EIH A;  4JI7 M;  1EYA A;  1J7K A;  4LF5 M;  1JWM D;  4UY8 C;  2KDL A;  1N32 M;  3S1Q H;  4R71 A;  1H9R A;  1HNZ M;  2I7P A;  2K0B X;  2F52 A;  2AQ3 B;  4CKC A;  2O4X A;  2CCZ A;  3BBZ A;  3M7G A;  4GKK L;  3KXE C;  5M3F B;  3H94 A;  3L3O C;  4OW0 A;  4DV2 L;  2CWA A;  3GTM H;  4DUZ Q;  4IFD G;  3QOL A;  2R92 H;  3PO2 H;  2YTX A;  1K3X A;  2PNR C;  1SEB D;  4FDB A;  2UUB M;  2I5L X;  1K0R A;  1LTR D;  5M3F H;  1IN6 A;  3E21 A;  4QQB X;  4IFD H;  3A8I E;  1LTL A;  2VQE Q;  4HJ7 A;  3ZH9 B;  4DAY A;  1Z6H A;  5KPZ A;  5FLX L;  2DEN A;  2KHH A;  1AZP A;  5JEA G;  4HIK A;  3F1Z A;  4LK1 C;  1HR0 Q;  4UDU C;  3GTG H;  1OAI A;  3NPP A;  4R4O A;  2N8N A;  4S12 A;  2VF8 A;  2H1R A;  1QVC A;  1UUP A;  2B2U C;  3NBH B;  3EBE A;  1G51 A;  5KND A;  1GVP A;  4B08 A;  4OIJ A;  2BDO A;  3SAS A;  1LAB A;  1K8O A;  4PG3 A;  1D2N A;  2JXM B;  3PV0 A;  4OWT B;  5E7N A;  2LH0 A;  3U6E A;  3TME A;  1YHQ A;  2Z6B A;  5EXT A;  1UM8 A;  1C9O A;  1H6U A;  2L1B A;  3MXN A;  1B7Y B;  4PDG A;  4BY1 H;  4GC9 A;  1PRT F;  2BOS A;  5BR8 M;  1WCM B;  4NRV A;  3QWN A;  4L5T A;  4BBS H;  1NUC A;  1W5T A;  4B3S M;  1IQP A;  3THG A;  1V9P A;  5C5M A;  4I4L A;  3CF2 A;  3CRK C;  5M5X B;  1YLA A;  3SC3 A;  4CJ6 A;  2A5Y B;  1E9S A;  2B2V C;  1TWA B;  4AKG A;  3MA2 B;  3GPX A;  5EKK A;  1KLG D;  4AW4 A;  2A73 B;  3PIO A;  2CQO A;  1KL9 A;  3G6E A;  2XRQ D;  4WW0 A;  1N34 Q;  4RA8 A;  3HOZ G;  4ZK9 B;  3ICE A;  4BBS B;  2ZAO A;  5JAV A;  4KHP Q;  4O0A A;  2KCT A;  3GLF E;  3T51 B;  4GIT A;  5E6J A;  1Y1W B;  5IOC A;  2QW7 A;  2TMP A;  2WV6 D;  1S40 A;  1J5E M;  3MHB A;  3H3V C;  1LT3 D;  1Q8I A;  1WIV A;  4WOR A;  1V1O A;  4ULL A;  1PHJ A;  1VQM A;  3UZU A;  1SXJ C;  1JMC A;  1UWV A;  3H6M A;  1EEF D;  4IBC A;  1TS2 A;  1TWG H;  1HTP A;  2OCE A;  4Z8X A;  3T53 B;  1DGS A;  3DM1 A;  3OTO M;  1P8L A;  1AE2 A;  1NAP A;  4OON A;  4JYA Q;  4FYD A;  4PMB A;  2NWG A;  4MHE A;  1X32 A;  1W3S A;  5C6A A;  1I4G A;  1G3I A;  2HL7 A;  2HCI A;  4LFC M;  1NSN S;  2AUJ D;  5C0X H;  1GUS A;  2BA0 A;  4LJ4 A;  4RHS A;  3FUT A;  8CAT A;  2J7O A;  2QBY B;  3KDF B;  3R8F A;  3NEL A;  4OO1 I;  4GMQ A;  3CGW A;  3MAQ A;  1CHP D;  1IN5 A;  4RGO S;  3AV0 A;  1SND A;  2M5Z A;  2QP9 X;  1U4R A;  2A6H C;  3EN2 A;  4TSS A;  2KCN A;  5DAU A;  4DNR B;  4NSR A;  4PZ8 A;  1I94 L;  4JI7 Q;  1VQ6 A;  3EIE A;  1PRT D;  1KXL A;  1P16 A;  1YNX A;  1B3A A;  2EYF A;  3T13 A;  1G2T A;  3NEN A;  1H9K A;  3NBI A;  4PZ6 A;  4A3D B;  2JA8 G;  3DOA A;  2F3I A;  3J7Z C;  2PMZ B;  4BS9 A;  3CME A;  3HOU G;  2L12 A;  2BDN A;  5FO8 B;  3PVS A;  2DAE A;  3GLG A;  2E76 C;  1L8Q A;  2M9V A;  3KLS X;  5M3M H;  4DV3 M;  4DR7 M;  2OOA A;  2QSF X;  2KHS A;  2UU9 M;  3HG9 A;  1SXJ E;  1HPC A;  4DK1 A;  2Q2E B;  1EIJ A;  4IJF A;  3NP8 A;  1PRT B;  1NBW A;  3ND8 A;  2O2L D;  4DUZ M;  2DWL A;  1GJX A;  3CC4 A;  2YV5 A;  4LF8 L;  1VQL A;  4POF A;  3J7B A;  2LXJ A;  3NSW A;  2F4V L;  3J80 L;  1PJI A;  4LF7 Q;  1FYC A;  1RF2 D;  4B3M M;  4CIZ A;  1HZ9 A;  4R8N A;  3J80 c;  4HEO A;  4CHT B;  1QQW A;  2XGT A;  2HKJ A;  2AUK A;  5AFW A;  5CC4 A;  4DNI A;  1JJ2 A;  3U6P A;  1OTR A;  1HNX M;  3Q8D A;  1LTS D;  1L0X B;  4I7Z C;  4Q0F A;  2D7H A;  1TWH H;  1PTO B;  4DR1 M;  1BQQ T;  1JT8 A;  3CKI B;  3A98 B;  3H4M A;  4BBR H;  5JPM C;  2KOL A;  3L7Z C;  1JR0 D;  1D5Z C;  4G4N A;  1IXS A;  1E0B A;  3LWU A;  2VUM G;  4P72 A;  1SXJ A;  4OVZ A;  2X4A A;  1QZH A;  3KS4 A;  3GLI A;  2QIL A;  1IKM A;  3R3O A;  3PXG A;  4JYA L;  1KHI A;  2O5R A;  4EQO A;  2XIW A;  5IGF A;  5E3F A;  4K5W A;  1L1Z A;  2E5L M;  2KCC A;  5CMD A;  1L1O A;  3FKI G;  2FFK B;  2RCN A;  2G9D A;  4TKO B;  3RN2 A;  1VQH A;  2SOB A;  2UXC M;  5EPK A;  3TWM A;  4OX9 M;  4ABN A;  5C4J B;  5LMU Q;  3CP0 A;  2FOI C;  3H3V H;  2KA6 B;  1XTC D;  2Y0S B;  2VS1 A;  4MIU A;  1ML0 D;  2F0L A;  4OO1 G;  4LZZ A;  4DV4 L;  4II7 A;  1PYB A;  2B2V A;  4R1J A;  4NW2 A;  5EKI A;  4YWM A;  2F5N A;  2MUY A;  2W82 A;  3VKH A;  4L4U A;  2G3Q A;  3TQY A;  2LFN A;  1R9T H;  1N34 L;  4X64 L;  3I3C A;  3KJP A;  3RE8 A;  5T1I A;  1XNR M;  1SMY D;  2RSN A;  4QIW B;  4E6I A;  2B2T A;  2WAQ E;  1VG5 A;  3FYC A;  2K50 A;  2G5G X;  2VQF M;  2L15 A;  3CW2 C;  2ZM6 L;  2ZJR A;  3SHG B;  3CCE A;  3S2D H;  1OJL A;  1BKB A;  2E2H B;  5FKA C;  3A42 A;  2V4D A;  1FNN A;  1MSG A;  1Z7T A;  4HSP A;  4WJ4 A;  2K75 A;  1PH5 A;  4IUQ A;  3MTS A;  3IL8 A;  3S1M B;  4JI6 Q;  1IN4 A;  1Q8K A;  1NR4 A;  4L8R C;  2VZA A;  2JA8 H;  5DNY A;  2QZ4 A;  4OGQ C;  2F4I A;  4B3S Q;  1SAP A;  2VL6 A;  5IWA Q;  1ESR A;  4A3I B;  5ELC A;  3K5L A;  3FRH A;  4JI2 M;  1UNS A;  1SN8 A;  3VLF B;  1WYD A;  2JEB I;  2GQF A;  3VYT A;  5EBC A;  1CA5 A;  3CHB D;  4K2L A;  3G4S A;  2N88 A;  4MGI E;  1G2S A;  1HR0 L;  4NOO B;  1Q86 C;  3JAM i;  1C8C A;  3PO2 B;  2R92 B;  5IWA M;  2J0T D;  2RBM A;  1KDC A;  1UE7 A;  5NUC A;  3KP0 E;  1XPO A;  1SXJ B;  1B3Q A;  1GOZ A;  4L6T B;  3TSS A;  3ERO A;  4C56 C;  2WB1 E;  3KFU A;  4IUR A;  5IGC A;  3KS8 A;  1XWI A;  2Q2U A;  1XB2 B;  3NWT A;  4K0K L;  2DAI A;  4DR3 Q;  2K03 A;  2X6L A;  3NK9 A;  3BG3 A;  4HCS A;  5BN5 A;  1PH8 A;  4DGZ A;  1NJI C;  3KSX A;  3KOW E;  3J7A V;  1V1P B;  3GP7 A;  1LV7 A;  1QG7 A;  3FTF A;  1MKH A;  1CSQ A;  4XT1 B;  3J81 E;  1S5E D;  3GTO H;  4YHH Q;  3GLG B;  3TL4 X;  3OMG A;  3IRB A;  5H1S E;  3ZQJ A;  3FVQ A;  1QOH A;  1I4H A;  4DR4 Q;  2R4J A;  4JI1 Q;  4OEL B;  1Q3L A;  2LHG A;  4LG2 A;  2NVX H;  1Q02 A;  3UE1 A;  4LUZ A;  4YHH L;  3KF6 B;  1BUV T;  3KF8 A;  5LMU M;  5J22 A;  1JWU D;  1HNZ Q;  3J7A F;  3PFI A;  1TWF H;  3FPU B;  4B3R Q;  1B50 A;  5EP2 A;  1Q90 A;  3URY A;  1QZM A;  2K5N A;  4LGM A;  1Z47 A;  1PTO F;  1HT2 E;  3U4V A;  3PF5 A;  1JIC A;  2Z4I A;  2D0O A;  1DO2 A;  1DGH A;  1NY5 A;  4XQJ A;  5EP3 A;  2EZV A;  4NXM M;  2ATW A;  2R7Z B;  2CQA A;  1HFG A;  4GKK M;  3CC7 A;  2OWO A;  5C4X B;  1JJC B;  2YNM D;  4REZ A;  1DOM A;  1I4R A;  2L0C A;  2Z6K A;  3KBG A;  5FOB B;  1K9M C;  1C48 A;  2P5T A;  3NWS A;  3HHX A;  4KKS A;  1II3 A;  4FF4 A;  2E2I B;  1Y14 B;  1Q1B A;  3D8B A;  2F0U A;  3KK7 A;  4L63 B;  1QVR A;  1UAP A;  3R93 A;  1XXG A;  5GAE C;  5E26 A;  2CFM A;  2WII B;  1HUM A;  4JI0 L;  1WVL A;  1VDZ A;  1QUT A;  1Z5C A;  4WUR A;  1TWG B;  4JBJ A;  4DV0 M;  4RCO A;  2IWH A;  3LW5 F;  2F5Q A;  4WJW A;  4G7O C;  3W67 A;  1KAB A;  2KHJ A;  3RLF A;  1V33 A;  5ITX A;  3D31 A;  4C3H B;  4A3K B;  3I4O A;  4AG5 A;  1HRJ A;  2EJM A;  1NHW C;  1BCP B;  1EY9 A;  2Z4S A;  4MTN A;  4OX9 Q;  4A3L G;  3I7F A;  3F2D A;  4H13 C;  1DON A;  3HOZ H;  2E2J B;  3OOC A;  2NB0 A;  3VK7 A;  1AN8 A;  4L5Q A;  1F9R A;  3A8J E;  2K52 A;  4IBB A;  1L1T A;  3L28 A;  4XT3 B;  1TS5 A;  4K8J A;  1SFO B;  4DR6 M;  2RKS A;  1XWE A;  3U60 A;  4KOD A;  1MIU A;  2TSS A;  5GRO A;  3QO2 A;  1QWY A;  1WTP A;  1DGF A;  3HFZ B;  1QE6 A;  1RD9 D;  1OFI A;  1BO0 A;  3HKZ G;  4C3J B;  1JB3 A;  3LWE A;  3FHW A;  3J81 i;  2MJ5 B;  2KZU A;  2C96 A;  1WR1 B;  1E2Z A;  2WAQ G;  1CA6 A;  4U67 3;  1ZAE A;  3S17 B;  1RCV D;  1MJE A;  4DV4 Q;  3HKZ E;  4LF5 Q;  2KNA A;  2DZL A;  3BS1 A;  3ERS X;  3J7A 5;  3RNU A;  1QAO A;  1LTG D;  2XZU A;  1X3P A;  1WXQ A;  2AHM A;  1TU2 B;  4ZUI A;  4M8A A;  3X3M A;  5AJ3 Q;  4FCT A;  1PTO D;  1J09 A;  1STE A;  5ELO A;  3HU1 A;  4XYQ A;  3AQQ A;  3S15 H;  4G4R A;  2HQE A;  4FW9 A;  3KUP A;  5EXX A;  3WHL A;  3AU7 A;  3GTQ H;  3U4Z A;  2EE1 A;  1TVX A;  3DEO A;  1J6Q A;  4JI3 M;  2WP8 J;  5KNC A;  2EYM A;  4UPA A;  1CZG A;  3TBI B;  1EWC A;  3LVV A;  4V0B A;  1KAA A;  3P75 A;  3HJQ A;  2HAK A;  2EKF A;  1ET6 A;  1VQJ A;  4HCE A;  4JN6 A;  1UFZ A;  2WZJ A;  4GHA A;  4X62 Q;  5EKL A;  3W0F A;  4A75 A;  1FR3 A;  3OSO A;  4LF9 M;  2K32 A;  3HOW G;  2K5W A;  2NVT B;  4DV2 M;  4B3R M;  2F0N A;  4GOP A;  4AQY L;  1PH4 A;  3OTO Q;  2ZTE A;  3I01 M;  4WFN 3;  1O7Z A;  1JQJ C;  1N75 A;  4BA1 I;  4KY6 A;  4YCV A;  5KRU A;  1Y69 U;  5IY0 A;  1GL7 A;  3H91 A;  1IBL M;  2ZJQ A;  1M90 C;  3DM3 A;  4BBR G;  1TH2 A;  2EJG C;  1TII D;  3LVW A;  1A0I A;  3V05 A;  2N3S A;  4BY7 G;  1EFU B;  4B3T M;  4S3S A;  3CPF A;  3O13 A;  4LF8 Q;  4JXJ A;  2LXK A;  3KOZ E;  5TSS A;  2MQH A;  2Y0T A;  1X9N A;  2DWN A;  2O5J C;  4K8I A;  1PZI D;  1F2Z A;  3ZCB B;  1PJJ A;  1KRS A;  4LJ7 A;  4IBI A;  3OWF A;  3TS2 A;  2KRU A;  4GLX A;  5GAD C;  4G4O A;  3CCM A;  3SAV A;  4DR3 M;  5JVG 3;  1JR3 E;  4FVM A;  4TUW A;  1X56 A;  4FXK C;  4BB9 A;  4G3O A;  1FGB D;  2YTV A;  1KD1 C;  3I56 A;  3GQ5 A;  3TWL A;  1U4L A;  1S5C D;  2V1C A;  3RN5 A;  1O7I A;  3KYH C;  1HQM C;  4X66 M;  1PJT A;  1GLN A;  3PO3 H;  2MO0 A;  1Z59 A;  3AFP A;  4IJE A;  3HJ8 A;  3C46 A;  1EYC A;  3BVM A;  2UXB L;  1EOV A;  2NZH A;  4JBK A;  3M3Y H;  5EGT A;  3C9P A;  2BCO A;  2EYO A;  2JYO A;  3FDT A;  3CU7 A;  2VDB B;  4PCZ A;  2I46 A;  1KRT A;  4IO9 A;  4C3I B;  3KP1 E;  2DNE A;  1D7Q A;  3S1R H;  1K28 A;  3I8Z A;  5L8R F;  3PIP A;  4JW0 A;  1J5E L;  1VQ8 A;  2BWE A;  1EQR A;  1WTV A;  2RGH A;  5FTN A;  4JCV E;  5D3I B;  4RWS C;  3SR1 A;  4DNT B;  5L37 A;  3B89 A;  2BH8 A;  4EVO A;  4JV5 Q;  1ENF A;  2RA4 A;  3I55 A;  2M00 A;  1VEJ A;  1SE4 A;  3HOX G;  5CYU A;  1TF0 B;  4KO8 A;  1Q12 A;  4A3V B;  2V1U A;  4GNX A;  4KJO A;  1DO0 A;  3VYR A;  5JJL A;  3TN2 A;  1WGN A;  4DUY M;  3OMC A;  4UP7 A;  2CW0 D;  2OT2 A;  4DAV A;  4Y52 H;  3U5Z A;  3STB C;  2RDH A;  1G41 A;  1RJT A;  4IBD A;  4J8Q A;  5FTL A;  5K36 H;  5KPT A;  1XYI A;  1NV8 A;  5HGQ A;  3M4P A;  3IKJ A;  1YNN C;  2B63 H;  3RZO H;  1ASZ A;  4NRW A;  1YSY A;  4A3G H;  2KJX A;  4JI1 L;  1CZW A;  4GIP A;  1EU4 A;  4LFA L;  3BZK A;  1H9S A;  5DNF A;  5J1Z A;  4DR6 L;  5JI2 E;  2IHF A;  2Q2H A;  4FP5 D;  5E4X A;  4DV5 M;  1T6O A;  1JE5 A;  3NQI A;  3VDU A;  4ANR A;  2KZS A;  2K5V A;  1QVF A;  1D2B A;  4HED A;  1IYJ B;  4F88 A;  4L8J A;  5GAH C;  2UUA M;  1X3Q A;  1ZMW A;  4IBG A;  3A0J A;  3AEV A;  2XWB B;  3F2C A;  4A93 G;  4G4K A;  3HZJ A;  4CJ1 B;  5ITY A;  2OQ0 A;  1OTC A;  1EY0 A;  2SEB D;  1E1T A;  5JOB A;  1N32 Q;  4GKJ Q;  4GC5 A;  2B3G A;  5T1G A;  4BXX G;  3S1Q B;  3EQL C;  1YE9 A;  3SK4 A;  3FPP A;  4HMJ A;  1LTT D;  4BLC A;  1NNJ A;  3W1B A;  3ILK A;  4IFD J;  3VFD A;  1I3Q H;  2EY6 A;  2JA5 G;  4FF1 A;  2LNH C;  2E75 C;  4IBE A;  4JI5 L;  2Y20 A;  3MZ5 A;  4PMC A;  1T3T A;  4M1U B;  2DY7 A;  3UDX A;  3QJY A;  2XVS A;  1PVO A;  2XSC A;  1B1Z A;  3RFW A;  3W5O A;  2JY8 A;  1STA A;  3OWE B;  2LKV A;  3E9H A;  2DAM A;  5IWA L;  5IT9 L;  4LY6 A;  3G48 A;  4GOP C;  5CV7 A;  1M4V A;  4AKI A;  1EOT A;  2R7F A;  3CCR A;  1EEI D;  1D0L A;  3FTE A;  4DR5 Q;  4LF9 L;  3GTQ B;  1TDH A;  3X3N A;  1TWC B;  2GVB A;  4AQY M;  1VQC A;  1N8R C;  3BU2 A;  4HR7 B;  3AYH B;  2JK8 A;  3QOJ A;  2YQZ A;  1VQ9 A;  4LFA Q;  4BY7 B;  2LSS A;  4KMU C;  3BXW A;  1QAM A;  3W1G A;  1IBL L;  3VK8 A;  1EQV A;  2A6E C;  2KEN A;  4B3M Q;  4LF4 Q;  2ERC A;  1V92 A;  3KDS E;  2AQ1 B;  2LBC A;  4GZY C;  4LF6 L;  3TDQ A;  4ODG A;  2Q8T A;  1Q39 A;  3PIO 3;  3G71 A;  1F77 A;  4IPC A;  3UJN A;  4H7B A;  2NTS A;  3HP3 A;  4AKH A;  1LLR D;  3SE0 A;  1BXT A;  2CKZ B;  3H3V I;  3DMU A;  1CFM A;  3F92 A;  3HOW B;  1YNN D;  3UE0 A;  1R7R A;  4YY3 Q;  4QY7 A;  1OXX K;  4X3U A;  5C3E B;  3J80 i;  3L2P A;  2NVQ H;  4UAI A;  1LAC A;  3CPW A;  4HN7 A;  2EXZ A;  2QQ8 A;  3I2Z A;  5C18 A;  2RF4 A;  1XNQ M;  4P16 A;  4R9W A;  4FWD A;  4ILW A;  4AIM A;  2V1C C;  1GO5 A;  4QUC A;  1HTL D;  3F2U A;  4K5V A;  4G7H C;  4AZF A;  2CE7 A;  4MNO A;  4L5S A;  3GTG B;  3K92 A;  3HWS A;  3R2T A;  3E3X A;  1YZ6 A;  5CV6 A;  2XZF A;  5C44 G;  4R3D A;  1JR3 A;  3M3Y B;  2R4E A;  1XNQ Q;  2A69 C;  2MR9 A;  3T16 A;  1J5E Q;  1EQT A;  3LQR A;  2EKK A;  4L5R C;  2QPA A;  1L2F A;  4PD2 A;  3IAY A;  1NCV A;  1OIP A;  5BR8 Q;  3TZU A;  3KJO A;  3SYL A;  4KHP M;  1VQN A;  1GM5 A;  3TZD A;  4RFB A;  2MP1 A;  4QJF A;  2K5H A;  4RKU F;  1LTA D;  2KED A;  3LGJ A;  3PO3 B;  4K6D A;  1R2Y A;  4JBM A;  2XH9 A;  1KIX A;  4FXD A;  3HKZ B;  1PYS B;  4QOS A;  1MI2 A;  1Y8N B;  4ZUJ A;  2L7H A;  3RR5 A;  1HA6 A;  4PT5 A;  1TWA H;  4FWH A;  4F8M A;  4NXN M;  1EFW A;  1HQC A;  2JJQ A;  4RCN A;  4A4I A;  2NVX B;  5IP7 H;  5BR8 L;  1XPR A;  1Q3C A;  4LAA A;  1A8V A;  4NDX A;  1QDT A;  2UU9 L;  4N9T A;  1GUO A;  1LT5 D;  4L16 A;  4X6A H;  1EIF A;  1QYR A;  3Q6S A;  4XIG S;  1WTO A;  1EL0 A;  2IL8 A;  2DXI A;  5LMN M;  1NTG A;  4IUT A;  3S1N B;  1PTO H;  7CAT A;  2R6F A;  2XRS D;  4X3T A;  1XNR Q;  4MZ9 A;  1ZYR D;  5C4X H;  4L78 A;  2L9H A;  1EE8 A;  2N35 A;  3DWP A;  2A6E D;  3GTM B;  1NY6 A;  1I5F A;  5JJK A;  4IUU A;  3SK5 A;  4YY3 L;  1FGU A;  2E2I H;  1JWS D;  1PRT C;  3MEH A;  3D6W A;  4I65 A;  4YIJ A;  1CHQ D;  3J81 S;  4QIW E;  2HWJ A;  1CT1 D;  2IPK D;  4K2K A;  5D14 A;  2D9U A;  1QUQ A;  2R7Z G;  2CH4 W;  1ZMU A;  2KNV A;  1Q46 A;  4P75 A;  5KNB A;  3OHX C;  3S2H H;  2B8F A;  5IP9 H;  3NQT A;  2E8G A;  1E9R A;  1E2V A;  3OTO L;  3MMP A;  2HDL A;  1NVM A;  4NC6 A;  2PQA A;  1XMO Q;  5EPJ A;  3PUX A;  2K47 A;  4UP8 A;  4JI3 L;  3JAM E;  1OXT A;  2LS0 1;  3U61 A;  2JY6 B;  4A3G B;  3I4M B;  4RGN A;  1CQV A;  3EA6 A;  2ZAM A;  3RMH A;  4DK6 C;  1CTM A;  2C99 A;  2KEE A;  2UUA L;  5M5Y B;  2J4X A;  4B9W A;  2JZ1 A;  4HID A;  2DJF C;  2UXD M;  1QUQ B;  5IYB H;  4OWW B;  3T56 B;  2RGO A;  4IFD I;  3M4O B;  4DV6 Q;  2BE5 C;  3D3R A;  1HNX Q;  1GUG A;  2B2W C;  5ITX E;  4A3J H;  2OO9 A;  4ZLT F;  2DN8 A;  4LFB L;  4PV1 C;  1TDZ A;  5IGE A;  4RHR A;  4DK0 A;  1PYW D;  4JC0 A;  2PNH A;  2RQX A;  4B3T L;  3PF4 A;  1EZ6 A;  1PDQ A;  4AYB G;  4CDE C;  1XNR L;  1VQG A;  2FXQ A;  1B2T A;  2IX3 A;  1OO9 B;  1F2Y A;  3MK6 A;  1IYU A;  3BJU A;  3I91 A;  5C44 H;  5FSW A;  2YU9 H;  1VQ1 A;  1ROD A;  3A7A B;  1AP0 A;  4IPG A;  3QR8 A;  2IX0 A;  5A35 A;  3DEP A;  4I8O A;  2LVN C;  2F0T A;  3GQB A;  2NN6 I;  3IFT A;  4XQN A;  2GVA A;  1HNW L;  4M9Z A;  3S17 H;  2JWS A;  3TP8 A;  2R18 A;  5ELD A;  2RHS B;  5FJ8 H;  3BZD B;  3S2D B;  1K3W A;  2JA7 B;  4JOI A;  2WSC F;  4DV0 Q;  3BZC A;  1PFS A;  2NZO A;  4ID6 A;  1RTN A;  4G6Z A;  2OQK A;  2I07 B;  1GJT A;  2VF7 A;  4KTA A;  5EXS A;  2CV2 A;  1XTD A;  3PMF A;  2IX1 A;  2Q2T A;  3V2T A;  1WJ7 A;  2QCP X;  3OIP A;  3TRE A;  2DUD A;  2EYL A;  3RD4 A;  3U9S A;  2Z4R A;  1MHW C;  4NL4 H;  4DXF A;  3NUC A;  1RHP A;  2KCM A;  2CWB A;  4IBK A;  2IHE A;  4C3J H;  4GHL A;  1NSF A;  1B9M A;  1ESF A;  2SNM A;  4YCW A;  3S24 A;  3K7A B;  5C0X I;  2F0H A;  5COY A;  1Y1V B;  5M5X H;  2KW0 A;  2ALY B;  3KBX A;  4MTK A;  1VMC A;  2ZTD A;  4OEM B;  3K6O A;  4JYA M;  5IOD A;  4R4I A;  5C4J H;  3HOW H;  1A3T A;  4GN5 A;  2VQE L;  1IXS B;  1NE3 A;  2EVB A;  2RRU A;  5FJ8 G;  3JR4 A;  2MGS A;  5ISR A;  1S4Z A;  3K5N A;  4JG2 A;  1KC8 C;  5CGK A;  1U4M A;  2FIN B;  1MBY A;  3JC6 6;  3GLI B;  1FNV A;  5GKN A;  2A68 D;  2KEC A;  3CMA A;  2ZXO A;  4B3R L;  3WDN A;  3FYD A;  4DV2 Q;  5EP1 A;  1NO1 A;  2LVP C;  3FEW X;  4F7X A;  4RKB A;  2F0I A;  1TH3 A;  3VDY A;  3J81 L;  1ZKO A;  5CBE E;  2R7Z H;  2EA0 A;  1O7Y A;  5FTK A;  3L0O A;  3L27 A;  2B2U A;  4G7Z C;  4B3M L;  2QKI C;  2AQ2 B;  1G71 A;  1K8G A;  2IJ0 A;  5I2X A;  2NVT H;  4BA2 I;  5LHY 1;  1IBM L;  4RGM A;  4KHZ A;  2VUM B;  2VB2 X;  4JI2 Q;  4CDD C;  5DYG A;  2B2T C;  4UP9 A;  3K0Y A;  3NTI A;  1DGB A;  2ICI A;  2X6G A;  1JJG A;  1S72 A;  1GO3 E;  3KSJ A;  5G3L F;  2ZAN A;  5J39 A;  1Q1E A;  4DR3 L;  1AIP C;  3GPP A;  1QAN A;  3DLL A;  1YIJ A;  2K04 A;  2B63 B;  1PRB A;  3UGJ A;  1I4X A;  4QL5 A;  2A8V A;  4HL4 A;  1F9P A;  1PFB A;  1IFY A;  1SYF A;  2R7D A;  1N36 L;  4CIS A;  3K80 C;  1Z5B A;  3LCU A;  2L11 A;  3J81 j;  2ID0 A;  2DAK A;  2L6O A;  1BR9 A;  1EZ8 A;  2AKW B;  2UXC L;  1MJG M;  1HR0 M;  1YVC A;  4KKT A;  2HHH Q;  2LXE A;  3SHL A;  3S1N H;  4B9X A;  1EU3 A;  2A6H D;  4WRD A;  4JI4 M;  3HZX A;  4IPD A;  1OKS A;  4EX5 A;  2Z3X A;  4QCL A;  1WD1 A;  5DM7 3;  3J2P B;  1X3G A;  5EP4 A;  3BDL A;  4K0K M;  1HCZ A;  3A45 A;  3HJS A;  2XNA C;  4PMW A;  4QMG A;  2ASB A;  2JXN A;  3GLH B;  3K81 C;  2F0O A;  4RGT A;  3L26 A;  1L0W A;  4CJ2 C;  2UUB Q;  4G57 A;  2ZM6 M;  4UN2 B;  3MFY A;  4IN3 A;  2VQF L;  1YJW A;  3VKG A;  4AQY Q;  4MH0 E;  2ZJP A;  3HOV G;  4A3B B;  4DR5 M;  2A5H A;  1YJ9 A;  5D3D A;  1KDA A;  4X62 L;  3B9P A;  3VR4 A;  3I73 A;  2K1B A;  4GS3 A;  1N33 L;  1O7L A;  1X54 A;  1F2M A;  2XFS A;  3TRZ A;  4BY1 G;  2HIX A;  3RZD B;  4CDF C;  1QJO A;  4DU9 A;  1W5S A;  2CHG A;  2XFT A;  3M0E A;  1DJR D;  4IQZ A;  4DR2 M;  4LFB M;  1ZV1 A;  3PNY A;  1E22 A;  4DR2 Q;  3GPU A;  2HD3 A;  2H4O A;  3BVG A;  3GDE A;  1BNZ A;  1V34 A;  1Y1V G;  5I9O A;  3K59 A;  1PFN A;  2RDG A;  2PI2 E;  1A62 A;  3RUZ A;  2MO1 A;  5G3L D;  2DVW B;  2JA6 B;  5C0X G;  1HUN A;  1Z6T A;  3GRY A;  2DZN B;  2YR0 A;  1A3U A;  2A1A A;  4X3S A;  1MSH A;  1J8I A;  1TY0 A;  2N49 A;  2K9D A;  3K5O A;  5CBA E;  1IBK Q;  4O2D A;  4KJN A;  3K8Z A;  5CV5 A;  4AG6 A;  2OPF A;  1V8Q A;  3C1E A;  1G8Z D;  3E5S A;  3A74 A;  3HEJ A;  3MXU A;  2K28 A;  2CHV A;  2RVL A;  3FTD A;  2OTJ A;  2LWX A;  1CQF A;  5ITT A;  4TVA B;  3S16 B;  4P71 A;  4ZRZ A;  1MJC A;  3GTK B;  1I4Q A;  4DV5 Q;  1R4P B;  3J80 E;  2I5M X;  1GUT A;  2JA7 G;  3J7A S;  1YNJ C;  4DKA C;  1DOL A;  1W6K A;  3MXN B;  1S3O A;  2OQ4 A;  4R4C A;  1WTR A;  1SFO H;  1VMP A;  1XMQ L;  2L5T A;  3DXJ C;  2FS1 A;  5IGG A;  4YWK A;  1KSF X;  5IGD A;  3LCV B;  4PQX A;  5EPL A;  3R8B A;  2HIV A;  2VXW A;  3P20 A;  2F0Q A;  2RDF A;  2UXB Q;  3Q23 A;  3D6C A;  1MN3 A;  4N8X 1;  2ZBK B;  2B3T A;  3DWA A;  4HAE A;  5DEH A;  2EYJ A;  2Y0S E;  2DAG A;  4AYB B;  2EY2 A;  5CR3 A;  2UUC M;  2P5Z X;  2ZXP A;  3CCS A;  1KNE A;  3FD9 A;  1TWC H;  2JN4 A;  2R0I A;  2NVQ B;  2H1E A;  1QIL A;  3JAM c;  1N36 Q;  1STB A;  2CHB D;  2R6G A;  3SAU A;  2WKC A;  4A3F H;  2X49 A;  1NY4 A;  3UMM A;  4LUO A;  4CJ0 B;  5JPN C;  1SG9 A;  1AZQ A;  2DNC A;  1C7Y A;  2MJ8 A;  3VA5 A;  4A3E G;  3K57 A;  1Q82 C;  1CKN A;  1YEZ A;  5KYL A;  2UXD L;  2DJG C;  3S9W A;  4JPB W;  5IT9 E;  3C3L A;  1JOR A;  4O1N A;  2JA2 A;  1V1Q A;  2PQE A;  3U50 C;  2VUM H;  4RF0 A;  3MXG A;  3E0J A;  4A3F B;  3FRI A;  4FO2 A;  2ZT9 C;  2E2H H;  3CCQ A;  1HT1 E;  4JI2 L;  4IJL A;  3GTJ B;  3A8K E;  3K9P A;  3CCU A;  2NTT A;  3BDC A;  2WAC A;  3A46 A;  5JEA H;  2QF7 A;  4A93 B;  3WOE A;  3GV3 A;  1K83 B;  1EIY B;  1Y8O B;  2VII A;  2KXE A;  2F0P A;  5M3F G;  3TEH B;  3CQZ B;  1E3P A;  2F0G A;  4IUN A;  3U61 B;  4A76 A;  1PV4 A;  2F0W A;  4HLQ A;  2G5D A;  3T1Y M;  3R9X B;  2Z8Y M;  1I4P A;  3CTW B;  3QWL A;  4QNM A;  1EWI A;  2JP1 A;  1SNP A;  2Z8L A;  5LL6 X;  1MD2 D;  4DUY L;  1XJV A;  5JEA J;  2KEB A;  3PUW A;  2ENB A;  3VR3 A;  3BDO A;  2C5R A;  1AE3 A;  1EY7 A;  1A5T A;  1NHG C;  4XXE A;  2B2Y C;  2WIN B;  1W2B A;  3EFX D;  5AJ3 L;  3UK6 A;  4B7H A;  1CKO A;  3G6J B;  3GTL H;  1K0S A;  2JSO A;  1B8A A;  3M4Y A;  1NMG A;  1JQY D;  2KUM A;  2HCB A;  4KHP L;  2KHI A;  4GOP B;  1VQP A;  1UE5 A;  4LFA M;  3HOX B;  2EXD A;  1IXZ A;  2QEJ C;  3L29 A;  2QEX A;  3I4N G;  1D8L A;  3ONA B;  2FFJ A;  3W68 A;  2CWP A;  3LX0 A;  3A55 A;  3GTP H;  1YJN A;  1I6H H;  2CFO A;  2WKD A;  2E74 C;  1RKN A;  2KVM A;  3QIA A;  3I51 A;  2F0D A;  5FO9 B;  1JOK A;  1SNM A;  3V96 A;  2VQF Q;  5FK9 C;  1PH7 A;  4B7F A;  2HDM A;  3FMC A;  1W6J A;  3GQ3 A;  5I6Y A;  4C1N I;  5GAG C;  1QUS A;  4RMF A;  2EJS A;  2CW0 C;  3M6A A;  1WTH A;  2M2L A;  5FLX E;  4CDC C;  2ZM6 Q;  2I0Q A;  1LV9 A;  4IUP A;  5C44 B;  2YU9 B;  3ZJY C;  5ELF A;  2Z7J A;  4JI8 Q;  2D0P A;  1SRO A;  4LJZ C;  1JE4 A;  3HX3 A;  5A2Q S;  4POG A;  3T38 A;  5M3M B;  4ME3 A;  1WD0 A;  1HHV A;  3L25 A;  5J3B A;  2CV0 A;  1BOS A;  3FUX A;  4D81 A;  2R62 A;  4RF1 A;  4JI5 M;  1WFQ A;  3CC2 A;  1VQI A;  2HHH L;  3HHY A;  1SMY C;  1X65 A;  3S16 H;  5DM6 3;  2LY7 A;  1OXS C;  3LQQ A;  3GQ4 A;  2K05 A;  3UDI A;  4LFB Q;  1JCK B;  2F0K A;  2O01 F;  3U60 B;  3C58 A;  2PZW A;  2C35 B;  4A3E H;  1IBK M;  3D8L A;  3TQS A;  5C4H A;  1SYE A;  4DV6 L;  4Q5V A;  5M5Y H;  3GRV A;  5F3W A;  1HZA A;  1RIP A;  1SJH D;  2J7Z A;  2QCU A;  4DUY Q;  2NVY B;  1G8P A;  3AMU A;  1B53 A;  1F9Q A;  4NXM Q;  4AI6 A;  4X65 L;  3GLF B;  1A15 A;  1I4W A;  5IGB A;  2RSO A;  3I90 A;  2V6Z M;  1L0Y B;  1BDO A;  4XYO A;  2N78 A;  1HFN A; 
#chains in the Genus database with same CATH homology
 3S2H B;  3W3A A;  1DOK A;  1SYC A;  3BYY B;  1R6B X;  1IL8 A;  4EIW A;  1F9S A;  3K1J A;  1DXM A;  1STG A;  1DGH B;  2D2C C;  2JA5 B;  1QAQ A;  4K14 A;  2N55 A;  1ILQ A;  5M5W B;  2QBY A;  3BYT B;  3S15 B;  3IG5 A;  3SDZ A;  1BBX C;  1I3Q B;  3SAT A;  3WOF A;  4NMZ A;  1FJG M;  3CF6 E;  4OL7 A;  1N33 M;  2PO4 A;  3LMM A;  4F87 A;  1HXY D;  1STH A;  5KO3 A;  4FXG C;  1IW7 C;  5C3X A;  1WTX A;  4L15 A;  1K82 A;  3PIP 3;  4MGY E;  3OIQ A;  1D5X C;  3K58 A;  4TRD A;  4ZPX A;  1H9J A;  2Q8R E;  1TY2 A;  1V1P A;  5EQ0 A;  2PCF B;  3GLF A;  3VR6 A;  2X69 A;  4RKL A;  3E6Z X;  1D1I A;  4XDX A;  2J7N A;  4KKU A;  4EQP A;  4LF4 M;  3I4N B;  4D82 A;  3DA1 A;  4MGK E;  3MXP A;  3I72 A;  3QG1 A;  3SK8 A;  1IY2 A;  4LJ9 A;  5K36 G;  4Z6Y A;  1SE2 A;  1G91 A;  1SSO A;  3SYK A;  1NNU C;  1QB5 D;  3HRZ C;  1D5M C;  4HMI A;  3RZO B;  1H9S B;  3KVW A;  2FNA A;  2R93 B;  4C3H G;  1H9M A;  4ZKC B;  4GH9 A;  1BCP D;  1S5F D;  2KRK A;  5C3W A;  2EJF C;  5COR A;  2XWJ B;  1DYQ A;  3QAU A;  1CM9 A;  3S1R B;  1R2Z A;  2EY1 A;  4M9S A;  1DM0 B;  1MX0 A;  4MGH A;  3JAM S;  3J7Y W;  3P7J A;  1JR3 D;  4QNR A;  3SFZ A;  4D80 A;  1IHZ A;  2F0F A;  3MVV A;  4LJ8 A;  5A2Q L;  4C3I G;  4EGV A;  4KY7 A;  1QCB D;  1BF4 A;  3GTL B;  2K7V A;  2FMC A;  1FD7 D;  5BN4 A;  1IBM M;  4FWG A;  2ZXR A;  4DXG A;  1ZQ9 A;  1TGU A;  1JOO A;  2MHV A;  1C1K A;  3OPO A;  2R45 A;  5EQT A;  3ND9 A;  1SBB B;  3E9S A;  1L2C A;  1Y8P B;  2B2W A;  4MM3 B;  1XMO M;  3SAR A;  4A3E B;  4FCV A;  2F4V M;  3H0G B;  3AJI B;  4J1M A;  5BN3 A;  1TH4 A;  3AKZ A;  3TP7 A;  4I81 A;  3J80 S;  2NN6 H;  2OEO A;  3N52 A;  4IZ8 A;  3C2P A;  4RAU C;  3K2L A;  2SNS A;  4DV1 M;  1B44 D;  4FF2 A;  1STN A;  2R46 A;  4PDI A;  1STY A;  5E4W C;  2F5O A;  1BCP F;  4BWG B;  1YNJ D;  2MPM A;  3SVM A;  5KPR A;  1HA5 A;  1WTQ A;  4OHJ A;  3U5Z B;  4BBR B;  4X65 M;  3HOY B;  3HKP A;  4LRS A;  1Q3B A;  2DHR A;  4QOZ C;  3A56 A;  3L2A A;  1EY5 A;  5I4D A;  4DA2 A;  2OF1 A;  3U6S A;  4KN7 C;  1AEX A;  3A7L A;  4IIW A;  3D4D A;  3Q24 A;  2IT1 A;  3NTK A;  2G9H D;  2EDG A;  3HHZ A;  1KYI A;  1VDD A;  3G7L A;  1XXH A;  3FUU A;  3SMS A;  4Y7N B;  4A3M B;  2LMC B;  1PFM A;  1I50 B;  4JV5 M;  2OXP A;  2Y21 A;  4KN4 C;  5KGU A;  3K5M A;  4FNF A;  3VYU A;  4BY1 B;  2WAQ B;  3JR5 A;  2XSZ D;  3A54 A;  3RGP A;  3R2I A;  4LMQ D;  4C3J G;  2PW7 A;  5JJZ A;  1SNC A;  3HOV B;  1GHJ A;  1EFI D;  1NJG A;  2DY8 A;  1O78 A;  2NYZ D;  3MFG A;  4YY3 M;  4OO1 H;  2C9C A;  2R65 A;  3J27 B;  2NZ1 D;  4QF4 A;  4LJ6 A;  1VF7 A;  1GUN A;  1KDB A;  1E2W A;  4XQQ A;  2L4N A;  1IY1 A;  3KLS A;  4CKB A;  1NJF A;  1EY8 A;  2GA4 B;  1DGG A;  2L09 A;  2KQ3 A;  3FUV A;  4K6L A;  3GP1 A;  2F3W A;  1DD2 A;  1GHK A;  5CV8 A;  1HQY E;  1IXR C;  1L2B A;  3OW7 A;  2Y0Q A;  1N77 A;  1PLF A;  3U6Q A;  2WB1 B;  3Q8X A;  3CF0 A;  1N36 M;  1VF5 C;  4KI0 A;  2XSZ A;  4XTC S;  4C2M B;  4GRI A;  3FTC A;  1SYB A;  3D4R A;  3KLR A;  2L7I A;  5C1B A;  1E94 E;  3U9O A;  4LF8 M;  5IT9 S;  2CUZ A;  1BCP C;  5IIF A;  1N34 M;  3PUZ A;  3ZYY X;  3AOG A;  1ZYR C;  1R4Q B;  5I2Y A;  1NR2 A;  1XHB A;  3KOX E;  3IFD A;  2BJV A;  2JA8 B;  4KK7 A;  1TWF B;  5C4Z A;  1WTW A;  4X62 M;  1IN7 A;  2CVR A;  3DWQ A;  4DV6 M;  2HCC A;  3Q22 A;  1SNO A;  1V43 A;  1PZJ D;  1GVN A;  3PNV A;  1ICW A;  1LTI D;  5KIX A;  1ZEQ X;  1FNW A;  3AFH A;  1PZK D;  4QHS A;  2F5S A;  1SXJ D;  1J9O A;  2K5D A;  1MGS A;  5IZ7 D;  3AOE C;  1AW7 A;  4OIK A;  1JC7 A;  2F1M A;  1PTO C;  5ELB A;  1SDF A;  1T5X D;  4ZYS A;  2PPB C;  2R3Z A;  3VR2 A;  1GKI A;  3SEB A;  3PUY A;  4QB4 A;  1B4O A;  3GPY A;  2I7N A;  1XMQ M;  5ITU A;  5F2D A;  1IY0 A;  5BPV A;  3PUV A;  1XX8 A;  3GTP B;  1I6H B;  4HTH A;  3GLH A;  5JI3 E;  5FTJ A;  2C98 A;  2F0E A;  2EYP A;  3NBH A;  5CV4 A;  1G6Z A;  4RH6 A;  5A2Q E;  1DCZ A;  1ENA A;  2C9O A;  4XBO A;  3U6M A;  5ITQ A;  4IAL A;  2NBF A;  3AB9 A;  2XF3 A;  2HUG A;  3DFZ A;  4MB7 A;  3NWL A;  3AL0 C;  3C1F A;  4BBA A;  1IM2 A;  1ENC A;  4RNA A;  3HGB A;  3TPZ A;  1VCI A;  2FHT A;  3SAW A;  1D6E C;  3MJ5 A;  1HNW M;  2R61 A;  3HU3 A;  3GRU A;  3FKI B;  1IYV A;  1RDP D;  4P2C B;  3EJI A;  1SE3 A;  3LNN A;  4LCB A;  1G59 A;  1SNQ A;  4DV7 M;  4G4Q A;  5CV9 A;  2SDF A;  5C0X J;  5EJC A;  1XXH B;  4JI0 M;  1FNU A;  2XLJ A;  1GXD C;  4MGZ E;  1CI3 M;  2PW5 A;  3KFU G;  1SYD A;  4ZQ3 A;  4JI8 M;  3FKE A;  1EWH A;  2XN9 C;  1ZXT A;  1LO5 D;  1E32 A;  4QHT A;  4Z9C B;  2F5P A;  2CHQ A;  3H09 A;  1A2T A;  2XEP A;  4YHH M;  3N6R A;  2CEA A;  3GTO B;  1X37 A;  2F0S A;  2PZU A;  2BE5 D;  3HGI A;  3GD7 A;  1G29 1;  3JAM L;  1GUW A;  2VQE M;  2F03 A;  3HHW A;  3IG8 A;  5H37 D;  2ICE C;  3HS0 C;  3U6O A;  3TP5 A;  1TS4 A;  3BVZ A;  2CV1 A;  2M60 A;  3GO5 A;  1DZ1 A;  4B7G A;  4KD4 A;  1GL6 A;  4K5X A;  1A2U A;  4IBF A;  2BJW A;  2NN6 G;  1RTO A;  5FO7 B;  2QDB A;  1HQR D;  3HOU B;  4DFA A;  4KLN A;  3DHQ A;  3ERQ A;  2B8G A;  4XGI A;  2EO2 A;  2B2Y A;  3FRP B;  3L9A X;  4DN4 M;  3U6C A;  3TWK A;  2JEA I;  1EY4 A;  1ORY B;  2PYK A;  2A68 C;  3SMP A;  1IKL A;  1EYD A;  4ME5 A;  3KOY E;  3DUZ A;  2D7G A;  3SK6 A;  4U68 A;  4OU7 A;  2VNU D;  1ET9 A;  3RGS A;  3ITP A;  5KYI A;  2A69 D;  1QNK A;  4ITQ A;  3SXH A;  3HU2 A;  4CBV A;  1SYG A;  2L55 A;  2YFQ A;  1TT2 A;  4LF7 M;  2BA1 A;  3GV6 A;  1A6X A;  4M0W A;  3NTH A;  1KFV A;  3QB3 A;  3D4W A;  2B39 A;  4PNY A;  4IBJ A;  3MWY W;  1LT6 D;  1KLU D;  3MHV C;  3NXW A;  5IRE B;  3GRR A;  3VDP A;  1OXU A;  3HOZ B;  1U4P A;  3I4V A;  4A3J B;  1B9N A;  5EBD A;  1O80 A;  4H44 C;  4OVZ B;  4DAP A;  1PXU A;  4JK1 C;  1EIG A;  1D1K A;  1A3V A;  5HGT A;  3E4R A;  2VB3 X;  3NHH A;  4MN3 A;  1TKW B;  1S3S A;  5I9P A;  2NUC A;  1KNA A;  4NP5 A;  3W0L B;  4GKJ M;  4KY5 A;  5JVH 3;  1ILP A;  2NQ8 C;  1IW7 D;  2AWO A;  4KD3 A;  5HUR A;  3EIH A;  1SXT A;  4X3K A;  2D7E A;  3Q0A A;  5D65 A;  3TE6 A;  1PMR A;  2EOT A;  1S5B D;  4IUV A;  3SBJ A;  4CGY B;  2K01 A;  2Z1C A;  4KHV A;  4QUF A;  2DWZ B;  2DZO B;  2IW3 A;  4TQU S;  1KTK A;  3ZC7 B;  3P1H A;  4LJA A;  2YYZ A;  4NKL A;  4JBW A;  4J6H A;  2HHH M;  3W2D A;  4LF6 M;  5I6W A;  3I70 A;  3TP6 A;  4FF3 A;  2G8L A;  1C4Q A;  2KA7 A;  1ONL A;  1AFP A;  2E2D C;  5EXP A;  4NSO B;  4HSV A;  1I94 M;  2F0V A;  4JI1 M;  2K33 A;  3DZD A;  1N78 A;  3VYS A;  2F3V A;  1TR5 A;  4C1N K;  2JE6 I;  4ZKB B;  5K5P A;  1T5E A;  3D8G A;  2FJ2 A;  4CKE A;  1TS3 A;  2DWM A;  5KEE A;  5EJW A;  5DYI A;  1MU5 A;  3WHK A;  3EVQ A;  1R9T B;  4DR4 M;  2EUC A;  4KV6 A;  2EY5 A;  1XC8 A;  3VA7 A;  2C5C A;  3U6L A;  3M85 A;  1U9R A;  2FMM A;  3T15 A;  5C5L A;  3GO8 A;  4X64 M;  2D5D A;  2X8A A;  3VR5 A;  5E1F A;  1TQO A;  2F0M A;  4N9P A;  2EPB A;  4DF7 A;  5ELE A;  4I5S A;  2K6A A;  1YUB A;  1I6V C;  3CRL C;  3UI2 A;  3I4L A;  2O5I C;  3BOS A;  5KQ8 A;  4JI6 M;  1LT4 D;  3NE5 B;  1G4A E;  4LRT A;  3MC0 B;  1OFH A;  4FD2 A;  1CK1 A;  4O42 A;  1EY6 A;  4EQN A;  2XGN A;  2A74 C;  2FE8 A;  5LL6 S;  2AWN A;  4ZAI A;  1PM5 A;  4FCW A;  2PZT A;  1M8A A;  1UEA B;  2Z4H A;  2K5Q A;  2RKO A;  1OXV A;  2UXB M;  1LTB D;  2F0J A;  4H0L C;  4R8I A;  4DV4 M;  4LJ5 A;  2EYH A;  1F2L A;  1JOQ A;  1QNU A;  2Q8I B;  5M9O A;  3AOE A;  5KQD A;  4LGY A;  3T1H M;  4LZJ A;  3M7N A;  4W5W A;  5FLX S;  1SJE D;  3KW6 A;  4R7G A;  1L2D A;  3U6D A;  3SHF A;  1K8M A;  1IN8 A;  3T4A C;  1S5D D;  3I4Y A;  4M9X A;  2BNK A;  5FTM A;  1TWH B;  2D62 A;  3S14 B;  2QEN A;  1Z5A A;  5ITR A;  3FUW A;  4M0D A;  1EIH A;  4JI7 M;  1EYA A;  1J7K A;  4LF5 M;  1JWM D;  1N32 M;  1H9R A;  1HNZ M;  2I7P A;  4CKC A;  2AQ3 B;  2O4X A;  3M7G A;  3KXE C;  5M3F B;  3H94 A;  3L3O C;  4OW0 A;  4IFD G;  3QOL A;  1K3X A;  2PNR C;  1SEB D;  2UUB M;  1LTR D;  1IN6 A;  4IFD H;  3A8I E;  3ZH9 B;  4DAY A;  1Z6H A;  5KPZ A;  5FLX L;  1AZP A;  5JEA G;  4LK1 C;  4UDU C;  3NPP A;  4S12 A;  2H1R A;  1UUP A;  2B2U C;  5KND A;  4B08 A;  4OIJ A;  2BDO A;  3SAS A;  1LAB A;  1K8O A;  1D2N A;  2JXM B;  3PV0 A;  3TME A;  2LH0 A;  3U6E A;  5EXT A;  1UM8 A;  1H6U A;  2L1B A;  3MXN A;  4PDG A;  4GC9 A;  1PRT F;  2BOS A;  5BR8 M;  1WCM B;  4NRV A;  3QWN A;  1NUC A;  1W5T A;  4B3S M;  1IQP A;  3THG A;  5C5M A;  5M5X B;  4I4L A;  3CF2 A;  3CRK C;  3SC3 A;  2B2V C;  2A5Y B;  1E9S A;  1TWA B;  4AKG A;  3MA2 B;  3GPX A;  5EKK A;  1KLG D;  4AW4 A;  2A73 B;  2XRQ D;  4WW0 A;  4BBS B;  4RA8 A;  4ZK9 B;  2ZAO A;  5JAV A;  3T51 B;  4GIT A;  5E6J A;  1Y1W B;  5IOC A;  2TMP A;  2WV6 D;  1J5E M;  3MHB A;  3H3V C;  1LT3 D;  1Q8I A;  4WOR A;  1V1O A;  4ULL A;  3UZU A;  1SXJ C;  3H6M A;  1EEF D;  4IBC A;  1TS2 A;  1HTP A;  3T53 B;  4Z8X A;  3DM1 A;  3OTO M;  1NAP A;  4FYD A;  4PMB A;  2NWG A;  4MHE A;  1X32 A;  5C6A A;  1I4G A;  1G3I A;  2HL7 A;  2HCI A;  4LFC M;  1NSN S;  2AUJ D;  5C0X H;  1GUS A;  2BA0 A;  4LJ4 A;  4RHS A;  3FUT A;  8CAT A;  2J7O A;  2QBY B;  3R8F A;  4OO1 I;  4GMQ A;  3MAQ A;  1CHP D;  1IN5 A;  4RGO S;  3AV0 A;  1SND A;  2M5Z A;  2QP9 X;  1U4R A;  2A6H C;  4TSS A;  5DAU A;  2KCN A;  4DNR B;  4NSR A;  3EIE A;  1PRT D;  3T13 A;  1B3A A;  2EYF A;  1G2T A;  1H9K A;  3NBI A;  4A3D B;  3DOA A;  2PMZ B;  4BS9 A;  2L12 A;  2BDN A;  5FO8 B;  3PVS A;  2E76 C;  3GLG A;  1L8Q A;  2M9V A;  3KLS X;  4DV3 M;  4DR7 M;  2KHS A;  2UU9 M;  3HG9 A;  1SXJ E;  1HPC A;  4DK1 A;  2Q2E B;  4IJF A;  3NP8 A;  1PRT B;  3ND8 A;  2O2L D;  4DUZ M;  2DWL A;  1GJX A;  3J7B A;  3NSW A;  3J80 L;  1PJI A;  1FYC A;  1RF2 D;  4B3M M;  4R8N A;  4CHT B;  1QQW A;  2HKJ A;  2AUK A;  5AFW A;  5CC4 A;  3U6P A;  1HNX M;  1L0X B;  1LTS D;  4I7Z C;  4Q0F A;  2D7H A;  1PTO B;  4DR1 M;  1BQQ T;  3CKI B;  3A98 B;  3H4M A;  5JPM C;  2KOL A;  3L7Z C;  1JR0 D;  1D5Z C;  4G4N A;  1E0B A;  3LWU A;  1SXJ A;  4OVZ A;  2X4A A;  3KS4 A;  2QIL A;  3GLI A;  1IKM A;  3R3O A;  3PXG A;  2O5R A;  4EQO A;  2XIW A;  5IGF A;  5E3F A;  4K5W A;  1L1Z A;  2E5L M;  2KCC A;  5CMD A;  2FFK B;  2G9D A;  4TKO B;  2SOB A;  2UXC M;  5EPK A;  3TWM A;  4OX9 M;  4ABN A;  5C4J B;  2FOI C;  2KA6 B;  1XTC D;  2Y0S B;  4MIU A;  1ML0 D;  2F0L A;  4OO1 G;  4LZZ A;  4II7 A;  2B2V A;  4NW2 A;  5EKI A;  2F5N A;  2MUY A;  2W82 A;  3VKH A;  4L4U A;  2LFN A;  3I3C A;  3RE8 A;  5T1I A;  1XNR M;  1SMY D;  2RSN A;  4QIW B;  4E6I A;  2B2T A;  3FYC A;  2G5G X;  2VQF M;  3SHG B;  1OJL A;  2E2H B;  5FKA C;  3A42 A;  2V4D A;  1FNN A;  1MSG A;  1Z7T A;  4HSP A;  4IUQ A;  3MTS A;  3IL8 A;  3S1M B;  1IN4 A;  1NR4 A;  4L8R C;  5DNY A;  2QZ4 A;  4OGQ C;  2F4I A;  1SAP A;  1ESR A;  4A3I B;  5ELC A;  3K5L A;  4JI2 M;  1UNS A;  3VLF B;  2JEB I;  3VYT A;  5EBC A;  1CA5 A;  3CHB D;  4K2L A;  2N88 A;  4MGI E;  1G2S A;  4NOO B;  1C8C A;  3PO2 B;  2R92 B;  5IWA M;  2J0T D;  2RBM A;  1KDC A;  5NUC A;  3KP0 E;  1SXJ B;  4L6T B;  1GOZ A;  3TSS A;  3ERO A;  4C56 C;  4IUR A;  5IGC A;  3KS8 A;  1XWI A;  3NWT A;  2K03 A;  2X6L A;  3NK9 A;  3BG3 A;  4HCS A;  5BN5 A;  4DGZ A;  3KSX A;  3KOW E;  3J7A V;  1V1P B;  3GP7 A;  1LV7 A;  1QG7 A;  3FTF A;  4XT1 B;  3J81 E;  1S5E D;  3GLG B;  3TL4 X;  3OMG A;  3FVQ A;  1QOH A;  1I4H A;  2R4J A;  1Q3L A;  4LG2 A;  1BUV T;  3KF8 A;  5LMU M;  5J22 A;  1JWU D;  3J7A F;  3PFI A;  3FPU B;  1B50 A;  5EP2 A;  1Q90 A;  3URY A;  1QZM A;  4LGM A;  1Z47 A;  1PTO F;  1HT2 E;  1JIC A;  2Z4I A;  1DO2 A;  1DGH A;  1NY5 A;  4XQJ A;  5EP3 A;  2EZV A;  4NXM M;  2R7Z B;  2CQA A;  1HFG A;  4GKK M;  5C4X B;  2YNM D;  4REZ A;  1DOM A;  1I4R A;  2L0C A;  3KBG A;  5FOB B;  1C48 A;  2P5T A;  3NWS A;  3HHX A;  4KKS A;  1II3 A;  4FF4 A;  2E2I B;  1Q1B A;  3D8B A;  2F0U A;  3KK7 A;  4L63 B;  1QVR A;  1UAP A;  3R93 A;  1XXG A;  5E26 A;  2WII B;  1HUM A;  1WVL A;  1VDZ A;  1Z5C A;  4WUR A;  1TWG B;  4RCO A;  2IWH A;  4DV0 M;  2F5Q A;  4WJW A;  4G7O C;  1KAB A;  3RLF A;  5ITX A;  3D31 A;  4C3H B;  4A3K B;  1HRJ A;  4AG5 A;  2EJM A;  1NHW C;  1BCP B;  1EY9 A;  2Z4S A;  1DON A;  4H13 C;  2E2J B;  3OOC A;  2NB0 A;  3VK7 A;  1AN8 A;  1F9R A;  3A8J E;  4IBB A;  1L1T A;  3L28 A;  4XT3 B;  1TS5 A;  4K8J A;  1SFO B;  4DR6 M;  2RKS A;  1XWE A;  3U60 A;  4KOD A;  2TSS A;  3QO2 A;  1QWY A;  1WTP A;  1DGF A;  1QE6 A;  1RD9 D;  1OFI A;  1BO0 A;  4C3J B;  1JB3 A;  3LWE A;  2KZU A;  2C96 A;  1CA6 A;  1E2Z A;  4U67 3;  1ZAE A;  3S17 B;  1RCV D;  3BS1 A;  1QAO A;  1LTG D;  2XZU A;  1X3P A;  1WXQ A;  2AHM A;  1TU2 B;  4ZUI A;  4M8A A;  3X3M A;  4FCT A;  1PTO D;  1J09 A;  1STE A;  3HU1 A;  4XYQ A;  4G4R A;  2HQE A;  4FW9 A;  3KUP A;  5EXX A;  3WHL A;  3AU7 A;  2EE1 A;  1TVX A;  3DEO A;  2WP8 J;  4JI3 M;  5KNC A;  2EYM A;  1CZG A;  3TBI B;  3LVV A;  1EWC A;  4V0B A;  1KAA A;  3P75 A;  3HJQ A;  1ET6 A;  4HCE A;  4JN6 A;  4GHA A;  5EKL A;  3W0F A;  1FR3 A;  3OSO A;  4LF9 M;  2K32 A;  2K5W A;  2NVT B;  4DV2 M;  4B3R M;  2F0N A;  4WFN 3;  1O7Z A;  1JQJ C;  1N75 A;  4BA1 I;  4KY6 A;  5KRU A;  1Y69 U;  1GL7 A;  3H91 A;  1IBL M;  1TH2 A;  2EJG C;  1TII D;  3LVW A;  3V05 A;  4B3T M;  4S3S A;  3O13 A;  4JXJ A;  3KOZ E;  5TSS A;  2Y0T A;  2DWN A;  2O5J C;  4K8I A;  1F2Z A;  3ZCB B;  1PJJ A;  1PZI D;  4LJ7 A;  4IBI A;  3OWF A;  2KRU A;  4G4O A;  3SAV A;  4DR3 M;  5JVG 3;  4FVM A;  4TUW A;  4FXK C;  4BB9 A;  1FGB D;  3GQ5 A;  3TWL A;  1U4L A;  1S5C D;  2V1C A;  1HQM C;  4X66 M;  1GLN A;  1Z59 A;  4IJE A;  3HJ8 A;  3C46 A;  1EYC A;  3BVM A;  5EGT A;  2BCO A;  2EYO A;  2JYO A;  3FDT A;  3CU7 A;  4PCZ A;  2I46 A;  4C3I B;  3KP1 E;  2DNE A;  3I8Z A;  1WTV A;  2RGH A;  5FTN A;  3SR1 A;  5D3I B;  4RWS C;  4DNT B;  4EVO A;  1ENF A;  2RA4 A;  2M00 A;  1SE4 A;  5CYU A;  4KO8 A;  1Q12 A;  4A3V B;  2V1U A;  4KJO A;  1DO0 A;  3VYR A;  3TN2 A;  4DUY M;  3OMC A;  2CW0 D;  2OT2 A;  4DAV A;  3U5Z A;  2RDH A;  1G41 A;  1RJT A;  4IBD A;  4J8Q A;  5FTL A;  5K36 H;  5KPT A;  1XYI A;  3IKJ A;  1YNN C;  4NRW A;  1YSY A;  2KJX A;  1CZW A;  4GIP A;  1EU4 A;  1H9S A;  5DNF A;  5J1Z A;  5JI2 E;  4FP5 D;  5E4X A;  4DV5 M;  3NQI A;  3VDU A;  2KZS A;  1D2B A;  4HED A;  4F88 A;  4L8J A;  2UUA M;  1X3Q A;  4IBG A;  2XWB B;  4G4K A;  4CJ1 B;  5ITY A;  1EY0 A;  2SEB D;  5JOB A;  4GC5 A;  5T1G A;  3S1Q B;  3EQL C;  1YE9 A;  3SK4 A;  3FPP A;  4HMJ A;  1LTT D;  4BLC A;  1NNJ A;  3ILK A;  4IFD J;  3VFD A;  2EY6 A;  4FF1 A;  2LNH C;  2E75 C;  4IBE A;  2Y20 A;  3MZ5 A;  4PMC A;  1T3T A;  4M1U B;  2DY7 A;  3QJY A;  2XVS A;  2XSC A;  1B1Z A;  3RFW A;  1STA A;  3OWE B;  2LKV A;  5IT9 L;  4LY6 A;  5CV7 A;  1M4V A;  4AKI A;  1EOT A;  1EEI D;  3FTE A;  3GTQ B;  1TDH A;  3X3N A;  1TWC B;  4AQY M;  4HR7 B;  3QOJ A;  2YQZ A;  4BY7 B;  4KMU C;  1QAM A;  3VK8 A;  1EQV A;  2A6E C;  2ERC A;  3KDS E;  2AQ1 B;  4GZY C;  3TDQ A;  4ODG A;  2Q8T A;  1Q39 A;  3PIO 3;  1F77 A;  3UJN A;  4H7B A;  2NTS A;  3HP3 A;  4AKH A;  1LLR D;  3SE0 A;  1BXT A;  3DMU A;  1CFM A;  3HOW B;  1YNN D;  1R7R A;  1OXX K;  4X3U A;  5C3E B;  4UAI A;  1LAC A;  4HN7 A;  2EXZ A;  5C18 A;  1XNQ M;  4P16 A;  4R9W A;  4FWD A;  4ILW A;  4QUC A;  1HTL D;  3F2U A;  4K5V A;  4G7H C;  4AZF A;  2CE7 A;  3GTG B;  3K92 A;  3HWS A;  3R2T A;  5CV6 A;  2XZF A;  4R3D A;  1JR3 A;  3M3Y B;  2R4E A;  2A69 C;  3T16 A;  1EQT A;  3LQR A;  2QPA A;  4PD2 A;  3IAY A;  1NCV A;  3TZU A;  3SYL A;  4KHP M;  3TZD A;  4RFB A;  2MP1 A;  3PO3 B;  1LTA D;  2KED A;  4K6D A;  1R2Y A;  2XH9 A;  4FXD A;  3HKZ B;  4QOS A;  1MI2 A;  1Y8N B;  4ZUJ A;  2L7H A;  1HA6 A;  4PT5 A;  4FWH A;  4F8M A;  4NXN M;  2NVX B;  1HQC A;  4RCN A;  1Q3C A;  4LAA A;  4NDX A;  4N9T A;  1GUO A;  1LT5 D;  4L16 A;  1QYR A;  3Q6S A;  4XIG S;  1WTO A;  1EL0 A;  2IL8 A;  2DXI A;  5LMN M;  4IUT A;  3S1N B;  1PTO H;  7CAT A;  2XRS D;  4X3T A;  1ZYR D;  4L78 A;  2L9H A;  1EE8 A;  3DWP A;  2A6E D;  3GTM B;  1NY6 A;  4IUU A;  3SK5 A;  1JWS D;  1PRT C;  3MEH A;  3D6W A;  4I65 A;  4YIJ A;  1CHQ D;  3J81 S;  1CT1 D;  2IPK D;  4K2K A;  5D14 A;  2D9U A;  5KNB A;  3OHX C;  2B8F A;  3NQT A;  1E9R A;  1E2V A;  2HDL A;  1NVM A;  5EPJ A;  3PUX A;  2K47 A;  3JAM E;  1OXT A;  2LS0 1;  3U61 A;  4A3G B;  3I4M B;  4RGN A;  1CQV A;  3EA6 A;  2ZAM A;  3RMH A;  1CTM A;  2C99 A;  2KEE A;  5M5Y B;  2J4X A;  4B9W A;  2UXD M;  3T56 B;  2RGO A;  4IFD I;  3M4O B;  2BE5 C;  3D3R A;  1GUG A;  2B2W C;  5ITX E;  4ZLT F;  2DN8 A;  4PV1 C;  1TDZ A;  5IGE A;  4RHR A;  4DK0 A;  1PYW D;  2RQX A;  1EZ6 A;  1PDQ A;  1B2T A;  2IX3 A;  1OO9 B;  1F2Y A;  3MK6 A;  1IYU A;  3I91 A;  5FSW A;  1ROD A;  3A7A B;  1AP0 A;  2IX0 A;  5A35 A;  3DEP A;  4I8O A;  2F0T A;  3GQB A;  2NN6 I;  3IFT A;  4XQN A;  4M9Z A;  3TP8 A;  2R18 A;  5ELD A;  3S2D B;  3BZD B;  1K3W A;  2JA7 B;  4ID6 A;  1RTN A;  4G6Z A;  2I07 B;  4KTA A;  5EXS A;  2CV2 A;  3PMF A;  2IX1 A;  3V2T A;  2QCP X;  3OIP A;  2EYL A;  3RD4 A;  3U9S A;  2Z4R A;  4NL4 H;  4DXF A;  3NUC A;  1RHP A;  4IBK A;  4GHL A;  1NSF A;  1B9M A;  1ESF A;  2SNM A;  3K7A B;  5C0X I;  2F0H A;  5COY A;  1Y1V B;  2KW0 A;  3KBX A;  1VMC A;  3K6O A;  4JYA M;  5IOD A;  1A3T A;  1IXS B;  2EVB A;  3JR4 A;  2MGS A;  5ISR A;  1S4Z A;  3K5N A;  5CGK A;  1U4M A;  2FIN B;  1MBY A;  3GLI B;  1FNV A;  5GKN A;  2A68 D;  2KEC A;  2ZXO A;  3WDN A;  3FYD A;  5EP1 A;  3FEW X;  4F7X A;  4RKB A;  2F0I A;  1TH3 A;  3J81 L;  1ZKO A;  5CBE E;  2EA0 A;  1O7Y A;  5FTK A;  3L27 A;  2B2U A;  4G7Z C;  2QKI C;  2AQ2 B;  2IJ0 A;  5I2X A;  4BA2 I;  5LHY 1;  4RGM A;  4KHZ A;  2VUM B;  2VB2 X;  5DYG A;  2B2T C;  3K0Y A;  3NTI A;  1DGB A;  2ICI A;  2X6G A;  3KSJ A;  5G3L F;  2ZAN A;  5J39 A;  1Q1E A;  3GPP A;  1QAN A;  2K04 A;  2B63 B;  3UGJ A;  1I4X A;  4HL4 A;  1F9P A;  1PFB A;  1SYF A;  4CIS A;  1Z5B A;  2L11 A;  2ID0 A;  2L6O A;  1BR9 A;  1EZ8 A;  1HR0 M;  4KKT A;  2LXE A;  3SHL A;  4B9X A;  1EU3 A;  2A6H D;  4WRD A;  4JI4 M;  3HZX A;  2Z3X A;  4QCL A;  1WD1 A;  5DM7 3;  3J2P B;  5EP4 A;  3BDL A;  4K0K M;  1HCZ A;  3A45 A;  3HJS A;  2XNA C;  4PMW A;  4QMG A;  3GLH B;  2F0O A;  4RGT A;  3L26 A;  4CJ2 C;  4G57 A;  2ZM6 M;  3MFY A;  4IN3 A;  3VKG A;  4MH0 E;  4A3B B;  4DR5 M;  2A5H A;  5D3D A;  1KDA A;  3B9P A;  3VR4 A;  3I73 A;  2K1B A;  1O7L A;  1F2M A;  2XFS A;  3RZD B;  4DU9 A;  1QJO A;  1W5S A;  2CHG A;  2XFT A;  3M0E A;  1DJR D;  4IQZ A;  4DR2 M;  4LFB M;  3PNY A;  3GPU A;  2H4O A;  3BVG A;  1BNZ A;  5I9O A;  3K59 A;  1PFN A;  2RDG A;  3RUZ A;  5G3L D;  2DVW B;  2JA6 B;  5C0X G;  1HUN A;  1Z6T A;  3GRY A;  2DZN B;  2YR0 A;  1A3U A;  4X3S A;  1MSH A;  1J8I A;  1TY0 A;  3K5O A;  5CBA E;  4KJN A;  3K8Z A;  5CV5 A;  4AG6 A;  2OPF A;  1V8Q A;  3C1E A;  1G8Z D;  3E5S A;  3HEJ A;  3MXU A;  2K28 A;  2CHV A;  2RVL A;  3FTD A;  2LWX A;  1CQF A;  5ITT A;  3S16 B;  4ZRZ A;  3GTK B;  1I4Q A;  1R4P B;  3J80 E;  1GUT A;  3J7A S;  1YNJ C;  1DOL A;  1W6K A;  1WTR A;  2OQ4 A;  1VMP A;  2L5T A;  3DXJ C;  5IGG A;  1KSF X;  5IGD A;  4PQX A;  5EPL A;  3R8B A;  2VXW A;  3P20 A;  2F0Q A;  2RDF A;  3Q23 A;  3D6C A;  2ZBK B;  4HAE A;  3DWA A;  5DEH A;  2EYJ A;  4AYB B;  2EY2 A;  5CR3 A;  2UUC M;  2ZXP A;  1KNE A;  3FD9 A;  2NVQ B;  2H1E A;  1QIL A;  2R6G A;  1STB A;  2CHB D;  3SAU A;  2WKC A;  2X49 A;  3UMM A;  4CJ0 B;  5JPN C;  1AZQ A;  2DNC A;  2MJ8 A;  3VA5 A;  3K57 A;  5KYL A;  3S9W A;  5IT9 E;  3C3L A;  1JOR A;  4O1N A;  2JA2 A;  2PQE A;  4RF0 A;  3MXG A;  3E0J A;  4A3F B;  4FO2 A;  2ZT9 C;  1HT1 E;  3GTJ B;  3A8K E;  2NTT A;  3BDC A;  2WAC A;  3A46 A;  5JEA H;  2QF7 A;  4A93 B;  3WOE A;  3GV3 A;  1K83 B;  1Y8O B;  2VII A;  2KXE A;  2F0P A;  3CQZ B;  2F0G A;  4IUN A;  3U61 B;  2F0W A;  4HLQ A;  3T1Y M;  3R9X B;  1I4P A;  3CTW B;  3QWL A;  4QNM A;  2JP1 A;  1SNP A;  2Z8L A;  5LL6 X;  1MD2 D;  5JEA J;  2KEB A;  3PUW A;  2ENB A;  3VR3 A;  3BDO A;  2C5R A;  1EY7 A;  1NHG C;  4XXE A;  2B2Y C;  2WIN B;  3EFX D;  3UK6 A;  4B7H A;  3G6J B;  2JSO A;  3M4Y A;  1JQY D;  2KUM A;  2HCB A;  4LFA M;  3HOX B;  1IXZ A;  2QEJ C;  3L29 A;  3ONA B;  2FFJ A;  3LX0 A;  3A55 A;  2CFO A;  2WKD A;  2E74 C;  2KVM A;  1RKN A;  3QIA A;  3I51 A;  2F0D A;  5FO9 B;  1JOK A;  1SNM A;  3V96 A;  5FK9 C;  4B7F A;  2HDM A;  3FMC A;  1W6J A;  3GQ3 A;  5I6Y A;  4C1N I;  2CW0 C;  3M6A A;  5FLX E;  2M2L A;  1LV9 A;  4IUP A;  5C44 B;  2YU9 B;  5ELF A;  2Z7J A;  4LJZ C;  1JE4 A;  5A2Q S;  3T38 A;  5M3M B;  1WD0 A;  1HHV A;  3L25 A;  2CV0 A;  1BOS A;  3FUX A;  4D81 A;  2R62 A;  4RF1 A;  4JI5 M;  3HHY A;  1SMY C;  5DM6 3;  2LY7 A;  1OXS C;  3GQ4 A;  2K05 A;  3LQQ A;  1JCK B;  2F0K A;  3U60 B;  3C58 A;  2PZW A;  1IBK M;  3D8L A;  3TQS A;  5C4H A;  1SYE A;  4Q5V A;  3GRV A;  5F3W A;  1SJH D;  2J7Z A;  2QCU A;  2NVY B;  1G8P A;  3AMU A;  1B53 A;  1F9Q A;  4AI6 A;  3GLF B;  1A15 A;  1I4W A;  5IGB A;  2RSO A;  3I90 A;  2V6Z M;  1L0Y B;  1BDO A;  4XYO A;  4V19 0;  1HFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...