4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna replication/isomerase
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CHTB 4CGYB 3NBIA
chains in the Genus database with same CATH superfamily
1S40A 1A2UA 4B3RQ 1HNWQ 2E2JB 3GTMH 3ULPA 1D6EC 4FD2A 1L8QA 2HUGA 4C3HB 8CATA 3D0FA 3PIP3 4DV5Q 2EY1A 4PMBA 1LTBD 4GITA 1BXTA 2GN5A 1EY7A 3QJYA 4RAUC 4B3SQ 3MFGA 1XPRA 1IQPA 4IPGA 4JI8L 4DR5M 3CMAA 1D5ZC 1FGUA 3K58A 1QUTA 5KYLA 1K82A 3KJPA 1EUJA 4IO9A 3HHWA 1XMOL 2XLJA 3NP8A 2WFWA 3R93A 1VDDA 3B6YA 4FF2A 2HWJA 3A74A 3K7UC 1KIXA 1SDFA 1Y1WG 4Z9CB 1RD9D 4DV0M 1GHJA 4JI7Q 4C1NK 4P17A 3HU1A 3AOEC 3VK7A 4WRDA 2F0KA 2WAQG 4OX9Q 2KVMA 3AL0C 1WFQA 1IL2A 3S17H 1NNUC 4X66M 3BZCA 3U4VA 1VMCA 2Z9HA 4DK0A 5DYGA 4O1NA 3C46A 1QOHA 2VNUD 2F0UA 1JOOA 1NNJA 3NWTA 1PJJA 4RWSC 3K5MA 2K4KA 3CCMA 1B3AA 1GKIA 3W1BA 4LMQD 4F87A 4Y7NB 1IKLA 2UUCM 1B50A 1HRJA 4K14A 2K5NA 2CH4W 1B8AA 4IJEA 1IL8A 1PH7A 4BY7B 1NR4A 1YNNC 3A98B 2X6LA 1WGNA 1Y1WH 3PO2B 2B2UC 2EYMA 2VIIA 1I5FA 2PQEA 5FTJA 1STYA 1LV9A 2CQOA 3VKHA 3VLFB 4OO1I 3G4SA 1EQVA 2EOTA 1XXGA 1A5TA 2OCEA 2JA5B 3HU2A 4AG6A 1WTQA 4KLKA 4IUUA 4DV6M 2LVNC 1TWAH 5KNBA 3SATA 1MX0A 1E0BA 1CKNA 4A3EG 4LF9L 5LMUQ 1PDQA 3TSSA 4DGZA 4X62M 1DOMA 1XHBA 1VQBA 2FFKB 2DZLA 1LTGD 4JI1L 1BCPC 4JI3L 4RFBA 1EYDA 3L3OC 4IPHA 2Z4SA 4RF0A 2OQKA 1JCKB 1HA5A 4II7A 2PZTA 2NZHA 2WB1E 1W5SA 2Q2TA 3VYUA 5M5YB 3DZDA 2G5GX 3PO3G 3PMFA 4ALPA 1VEGA 3B74A 2QDLA 4XXEA 4CJ6A 1QJOA 3A5ZB 5G3LD 4GNXC 3VYRA 2FH0A 1G41A 4A3EH 3ZJYC 2K0BX 3TPZA 3CPFA 5E6JA 1OFIA 4FF3A 1GJXA 2R18A 4FWDA 2UUBM 4IBEA 1AP0A 3S16B 4YWLA 1ZYRC 2F0GA 3J80S 5E7NA 5CC4A 2QBYB 5ELOA 4IJHA 3B9PA 4LFAQ 2C96A 4MGZE 1T6OA 1K83B 3I72A 4PT5A 2BA0A 4BXXG 3T56B 2WSEF 3R8FA 3GQBA 3J81S 3KW6A 2KEEA 5GAEC 2RA4A 2AHOB 3PO3H 4LF4Q 2RCNA 1PTOH 5LMNL 4A76A 2F5PA 3BU2A 1HR0M 4EQOA 3PV0A 4G7HC 3GO5A 4JI0Q 4DXGA 4GHLA 3UK6A 1I4XA 4JI8Q 3AOGA 5FLXc 2CRUA 1WGLA 2LXEA 1JQYD 1VG5A 3ZH9B 4LUZA 2PCFB 3SASA 3SHLA 1KNEA 3AFPA 4RCNA 1XMOQ 2XGTA 1M8AA 5C6AA 2B8FA 4B7FA 1TY0A 1VDZA 4XIGS 2RRUA 1O7LA 3KF8A 3U6QA 3FUWA 2UUAM 4CISA 3S1MB 1AEXA 1B70B 1U4PA 3QG1A 5FLMG 5BN4A 4A3DG 1JB7A 4OGQC 4IFDI 5DFLA 4DR4L 4K6DA 4DV1L 1N33L 3A54A 3VA5A 2B63B 2D2CC 3U5ZB 2MO1A 4LJZC 1STAA 2ZBKB 3EBEA 3KP1E 4Z8XA 1YHBA 4DAPA 4JV5M 5C3EB 1G8PA 1K28A 2JUJA 5BPVA 1GO3E 1D0LA 2PI2E 2NQ8C 4RKUF 4G4RA 1EY6A 1SLJA 2A6ED 3RN5A 3PVSA 4HSPA 3GTOB 1UFZA 5M3MB 4X64L 3H0GG 5C4XB 3BYTB 3TP6A 1EWIA 3HOZG 5CV5A 1Q1BA 3R9XB 4GZYC 2KCNA 4U673 1OIPA 1Y8OB 2F0WA 3IAYA 5FLMH 5CMDA 1PJSA 1VF5C 4IUPA 4A3DH 2F1MA 2YU9H 3P7JA 3GTPH 1RIPA 1WTPA 2L9HA 2EVBA 3ULJA 1MBYA 5EPJA 2CUZA 1K9MC 3P1HA 4L8RC 2GVAA 2Z0SA 1DGHB 2N55A 1QZHA 4JI1Q 1SROA 2F3WA 4OWXB 1IXZA 4DUYM 5JJLA 1JWUD 2VY3A 2M60A 1N75A 1LUZA 3OTOL 1WCMB 4DV0L 2NVYB 3MK6A 3OIPA 3HOZH 2QCUA 1UUPA 3DLLA 1A3VA 4LUOA 3SK4A 4KJNA 1BBUA 4L16A 4FF4A 1K73C 4A3JB 3QOLA 2OO9A 2LXJA 1EEID 3PUYA 3PUZA 2G3QA 4XDXA 3GLGE 3I4NB 1JC7A 3FRHA 4JI2M 2L2DA 3LX0A 3JAMc 2MGWA 1OTRA 1NSFA 1EQTA 2K14A 4PV1C 3M0EA 2UUCL 4EX5A 1JICA 4K5WA 2R92G 4FXDA 3OPOA 3MC0B 3B7NA 2OQ0A 3J7A5 4OO1G 1WJ7A 1EWHA 1PYWD 2VXWA 3V96A 2YTVA 3S2DB 1DO2A 2PZUA 1EE8A 3RZDH 3JAMi 4H7BA 4M9ZA 4DV3M 1E9SA 2CP8A 1S5FD 1IYJB 5IGGA 1K8GA 2E5LM 4L15A 3UDIA 2VUMG 1VQFA 2KA7A 3E4RA 3D4WA 4OVZB 1KQSA 1JR0D 4F88A 2C9CA 4LRSA 3NTIA 5LMNQ 3WHLA 3UE1A 5IODA 4M9SA 3K57A 3S2HB 1CTMA 3AFQA 3NWLA 1NE3A 3GLFE 1N78A 1SE3A 3CC4A 3GQ5A 1PYBA 3KF6B 4X62L 3BOSA 5KGUA 4IOCA 4MIUA 1N34M 2R92H 4DA2A 4G4NA 3SARA 4B3RM 4X3UA 3GLIB 3E46A 1PFBA 1EYAA 2NVQB 2JA6G 5DM63 2DKLA 2JY6B 2KBNA 3U61B 3HHYA 1Q8KA 3T13A 4DV5M 3KLSA 2QGQA 3KUPA 3ILKA 1J5EM 3I4LA 2VUMH 3C58A 3U60B 2N35A 4PZ8A 1F4IA 2DN8A 4DV1Q 1N33Q 4DR4Q 4LFBM 3TWMA 2L0CA 4HIMA 3SMPA 2F0TA 4KI0A 5EP1A 4O0AA 5ELDA 2WSFF 5KQDA 4IBCA 4XGIA 3J80c 3AMUA 1E2WA 1V1PB 1EYGA 1OJLA 1KC8C 3M4YA 1LT6D 2G9HD 1SRUA 3FDTA 3VYTA 2E2IH 2ZT9C 4JI7M 1QUQB 1ZKOA 4KY7A 4C3HG 4JBMA 2WINB 1CKOA 3J80i 3HKZE 3I4OA 5GAGC 4X64Q 2XNAC 2JA6H 1IY2A 1WTOA 4GKJM 2PNHA 1IM2A 1G91A 3HZJA 4TUWA 1RHPA 1X3QA 2I5HA 5LHY1 2LFNA 2R93B 4I7AA 4OONA 4LF8L 3T38A 3CC7A 1DJRD 3GTLB 4LWCA 3CF5A 1QILA 2CCZA 1TWHH 1HR0L 1QANA 4JXJA 4IURA 1C48A 4KO8A 1PH6A 1AW7A 2E2JH 5I2XA 2ZJRA 1K0SA 1EWCA 1HXYD 2PNRC 3NPPA 4IFDG 4QNMA 4C3HH 3OTOQ 1PFNA 2TMPA 3DEPA 2OQ4A 4K8IA 2BCOA 1IY1A 1Z6TA 2B2WA 4H44C 4OIKA 2UUAL 4NL4H 1JB0F 1TH3A 2MJ5B 1EFWA 4HR7B 2ZJQA 2IWHA 1G71A 5LMUM 3AOEA 1JWMD 4ZCKA 4BY7G 4K0KM 3HEJA 3R2TA 4HJAA 2Z4IA 3TZUA 4A3CH 4LAAA 3MEFA 4TKOB 3FE3A 3CW2C 3PO2G 1UWVA 2D9UA 4IIWA 2FE8A 4KJOA 2UUCQ 4F2LA 4LFCL 3PF5A 1GD7A 4XYOA 3KOYE 2XZUA 1E9RA 1L0YB 1D0MA 4HJ7A 2JA5G 4A3GB 2K32A 4QHSA 4WP2A 1BDOA 5KRUA 2X49A 1E24A 1F9QA 4QUCA 2JA7B 2VF7A 2BWEA 5L37A 2M00A 2ZTEA 4GOPB 1VQPA 1ET9A 1W5TA 4Y7NH 3T51B 4YHHQ 3CF0A 2EJSA 2Q2IA 1B9NA 1MJGM 3PNVA 3U6LA 2B39A 2QCPX 2J7ZA 4BY7H 1F9PA 2NTSA 1UE5A 2F0QA 3FYDA 2EY5A 2XH9A 3M7GA 4HEOA 2I46A 4K6LA 1ESFA 1K3XA 1G59A 5CBAE 3PO2H 4BA2I 2Y0SB 3SR1A 1TGUA 4X62Q 4IBJA 1E2VA 1UE7A 5C5LA 1QDTA 3LW5F 2JA5H 3L7ZC 4R4IA 3LNNA 5C0XI 3GLHA 2C5RA 5KYIA 4A93B 2V4DA 1NMGA 2RQXA 1PH1A 1BNZA 4LF4M 1NCVA 4KHZA 1KRTA 4JI0M 5ELBA 5GADC 1R9TB 1H9SB 1DD2A 3SYKA 1NV9A 2EYPA 3DXJC 3FTCA 1LT4D 4CBVA 4LUVA 2JA9A 2Z3XA 5DNYA 2LNHC 1XMOM 5EBCA 5ELEA 3DM1A 5JEAG 2EJGC 1R4QB 2DZNB 4GNXA 4G7OC 4AYBE 1H9KA 1B7YB 4RKBA 3FUXA 2R61A 5M5YH 5FTMA 1XNRQ 3NUCA 4JI6M 1VQGA 2E8GA 5CV6A 4DV3L 2FJ2A 1O7IA 2E5LL 1R2YA 1FNVA 2DWNA 1Q3CA 2AQ1B 3U4ZA 2F03A 1KLUD 3F1ZA 4LF8Q 3BXWA 4JI5M 2K75A 4CIZA 1QYRA 2RGHA 3CHBD 5GROA 3I4MB 2JE6I 3S16H 1HR0Q 1QVGA 1IXSB 1RF2D 2MFIA 2LY7A 3SDZA 2V1UA 3GPYA 1Q39A 2ICEC 2LKVA 1K83H 4MTNA 1QDRA 1K8OA 2N49A 1JR3A 3LMMA 4L6V6 2EXDA 2KHJA 3CCRA 1NJIC 1MHWC 3NE5B 4B3RL 4IBBA 1Q1EA 2X8AA 1TWFB 2UXCQ 3TBIB 2B63G 1O80A 1GXDC 4P75A 4R4QA 5M5XB 3MXNB 2UUAQ 4DV5L 1EFID 1BBWA 2J7OA 4GKKM 2OXPA 4IJFA 4HAEA 3SK6A 1J5EL 2KZUA 1F9SA 5C3EG 4LFBL 1S5DD 2VQFM 4CDCC 1XX8A 5M3MG 4JYAL 4JI1M 1Z9FA 3E0JA 1KL9A 3KDFA 5BR8Q 3TP8A 3KOWE 4XK8F 4B7HA 3HGIA 4LJAA 4EGVA 3S1NB 3T1HM 3KBXA 1GVNA 1GABA 3S1MH 4LFCQ 4JI7L 4BY1B 2PZWA 4IZ8A 5ITTA 1C4QA 1VQJA 1TY2A 4Y28F 2Z6BA 3RFWA 3SXHA 1SYCA 1I3QB 2LXKA 1V1QA 5FSWA 1L1OB 2B63H 3K92A 4GKJL 4FP5D 2YTYA 1EL0A 3Q0AA 1JORA 3I4YA 1SYGA 5HURA 2CH4A 5EXPA 2Y0TA 1EZ6A 4DV7Q 3I56A 1NJFA 1SSOA 2N3SA 3G48A 5FO8B 1D2NA 1GUNA 1T3TA 5C3EH 3M7NA 1B9MA 2XWBB 5EBDA 3GTOH 3OW2A 4O2DA 4B3MQ 5M3MH 1WCMG 3A7LA 2VF8A 4RHRA 1TKWB 5C4XH 2HQLA 1NY5A 3HGBA 3K2LA 1SJED 2Q8TA 4MGKE 1XYIA 4LJ4A 3AKZA 2K47A 1ICFB 1V34A 1BCPB 2ZJPA 3FTDA 3TDQA 4ULLA 4Y52H 3I4NG 4L4UA 1O7YA 1X37A 1HFGA 1E7ZA 1XNQL 2F0EA 2RGOA 4BBRB 4NXMM 2EYOA 3NBHB 1I94Q 5LMUL 3OMGA 4LNQA 1CSPA 4K0KL 1E94E 3PIOA 5M3FB 3H4MA 3Q8GA 1L0XB 5ELFA 1U4MA 2BJWA 1U4RA 2JN4A 3O13A 3IKJA 3K6OA 3S24A 3P75A 1XWIA 3PXGA 4OIJA 2OWOA 5FLXS 1KHIA 3GPPA 1Q46A 4PCZA 1Z5AA 2MH8A 4A3JH 1R6BX 2XIWA 4X65M 4DR4M 1N33M 4IPCA 4QIWE 3V05A 3U6SA 3G7LA 2E5LQ 3TS2A 1TWGH 3SAWA 2B2TA 3IECA 4D82A 1FVIA 4DAYB 5CGKA 1CQFA 4F1IA 5EP2A 2D0PA 1QWYA 3OHXC 4GIPA 2DWLA 1VQ9A 1X9NA 2IY5B 3RGPA 3M3YB 4PNYA 5C0XG 1CUKA 1Z59A 4X64M 1IFYA 2HIVA 5GAHC 4FCVA 1VQMA 1IN5A 1LT3D 4XT1B 2AQ3B 5JPNC 3EQLC 1SXJA 2ALYB 2CV1A 4DNTB 3S9WA 5BN3A 3CPWA 3HS0C 1SYBA 1IBKM 3S2HH 1M90C 4DXFA 2EO2A 1HT2E 1F2LA 4LF4L 2R65A 2FNAA 5E26A 3FTFA 5IT9E 1J5EQ 3KVWA 4HLQA 4C2MB 4JI0L 2XTIA 2JEAI 1SMXA 2QPAA 3PQIA 4LFBQ 1HTLD 1STGA 3TEHB 2DI0A 1WTWA 3EJIA 4X6AH 3T1YL 2NVQH 2V6ZM 4JYAQ 3HOWB 1G6PA 2J7NA 5C0XH 3G6JB 4L6TB 4LK1C 1BVSA 4PMWA 3OTOM 3VR2A 2AWOA 3Q24A 2R93G 3H6MA 2B8GA 2EJFC 1D5XC 1YZ6A 1LTMA 4JI6L 3C9PA 2K01A 3QWLA 3SC3A 4GKJQ 4XQNA 3NBXX 2JWSA 3HJ8A 3U58A 2RKOA 3RZOB 1EZ8A 4JI5L 3VDYA 1MKHA 5JI3E 4FWHA 1UEBA 4WJWA 1NAPA 3A8IE 1Q8IA 3ICEA 2R44A 5JJIA 3I51A 2CHVA 2Z8LA 5ITXA 3CP0A 2KA6B 1L1OC 3JAMS 2K05A 2XVSA 2K1BA 2L7IA 1BOSA 2LVAA 4KY5A 2R93H 4YWKA 2ES2A 4JVZA 2P5ZX 3TWKA 3WDNA 4BWGB 3ND9A 2K7VA 5NUCA 4YHHM 3CAMA 1GL7A 5AFWA 3F8TA 5KPRA 1XNQQ 4DN4M 2YR0A 2NVXB 1N34Q 4GKKL 3OOCA 4IPDA 4ABNA 1R4GA 2PQAB 1YITA 5DYIA 2VQFL 5F2DA 4L5SA 4K0KQ 1C7YA 4A3GG 1S72A 3W67A 1XXHA 1Z5BA 2KZSA 4R4TA 1VQDA 2JA7G 3H3VH 3T1HL 3MHVC 1DGHA 1LTID 1QCBD 3DWPA 1WVLA 1QVCA 4J8QA 5IYBG 3FYCA 3FUVA 3FKIB 4PD2A 1KAAA 2FHTA 3D4RA 3KYHC 4P73A 5FKAC 4C56C 3K81C 1QAOA 3FPUB 4KMUC 2KRKA 2QSFX 1AE3A 1UE6A 2PMZB 4FYDA 1PMRA 2HHHQ 1Z5CA 2KHHA 5EQTA 1F77A 2QKIC 2DY8A 4ANRA 3KOXE 2Y0SG 3HHXA 1ZAEA 1YHAA 3DMUA 4JI4Q 4EIWA 3UZUA 1Q3LA 1TF0B 4A3GH 4PG3A 2JNHA 1NUCA 3CC2A 3PUWA 3M4OB 3GLFB 5I2YA 2JA7H 4LF7L 1JT8A 3TP7A 2KCMA 4A93G 1XNRM 5E1FA 1I6HB 1EEFD 4NMZA 1I4RA 2O01F 1Y8PB 4EVOA 1W6KA 4C3JB 1PRTD 2KJXA 2RHSB 3BDOA 5ISRA 5IYBH 1QVFA 1OKSA 1AE2A 4N8FA 1LTAD 3KP0E 4HIKA 1KTKA 3CF6E 1V8QA 4LF8M 5ELCA 5EKKA 1EY8A 1XC8A 3TREA 3MFYA 4IFDJ 4NXML 1R5LA 1PJIA 4POGA 1CM9A 4OVZA 5C3XA 2QA4A 3I90A 1HUNA 3WOFA 1MSGA 4KLNA 3CD6A 3C2PA 1LO5D 2R6FA 4G3OA 1QAQA 1F9RA 3BJUA 4K2KA 2Q2UA 1HHVA 1D1IA 3KBGA 3J7YW 1Z47A 3T1YQ 1VQCA 4G4QA 5JPMC 3JC66 4RKLA 2ASBA 1XTCD 1TR5A 1HZBA 2B29A 4A93H 2NBFA 3E0EA 2UXCM 3HOXB 3FKEA 1B3QA 4DR1L 2LMCB 5JVG3 2BOSA 4P74A 2D62A 4I81A 3PCOB 4BXXH 3I4MG 3HKZB 4JI6Q 3K7AH 3U61A 1NO1A 4X65L 1YVCA 1CFMA 1GO5A 2JP7A 2HDMA 2R0IA 3U60A 4JI5Q 2MP1A 3U50C 4P72A 2UU9M 2O4XA 2NZOA 3ONAB 5BR8M 3PIO3 5H37D 4CGYB 3EIVA 1NHWC 1Y1VB 2FS1A 4LFCM 1OFHA 2DHYA 2B2VA 1YNJD 2F0FA 4AKGA 2QDBA 1M1KC 5I9OA 1DGFA 1L1ZA 1I4PA 3PNYA 3FRPB 1SXJD 4NKLA 1ENFA 3M85A 2QP9X 3K0YA 1SG9A 5A2QL 2L7HA 3DOAA 1PRTF 2DAEA 1XMQM 1W2BA 3VK8A 4DV7M 3I4MH 1WYDA 1IBKL 4S12A 1KDAA 2KHSA 5M5WB 5KEEA 1JJCB 4GKKQ 2VZAA 4FXKC 5JOBA 4RGOS 3K9OA 4AIMA 4B3MM 3MXPA 1WTRA 4ZKCB 2VQFQ 1VQOA 4BY1G 1QZMA 4PDIA 1P3QQ 1HUMA 1E3PA 2R7FA 1XWEA 1K3BC 3SK5A 1X56A 1PRBA 2C99A 4ID6A 3C3DA 1J6QA 5EP3A 1GUSA 1GL6A 4DNRB 2W82A 1V43A 2TSSA 5M5XH 2V1CC 4IUNA 3T1HQ 2YQZA 3H0GH 1ZEQX 4KTAA 1CKNB 3PUVA 2P5TA 4B7GA 5JEAJ 2DAMA 4ME3A 3QIAA 1NJGA 4DV4L 4QUFA 2H4OA 2EY2A 1I94M 3WWVA 4R9WA 1OAIA 2QHOB 2G5DA 1TS3A 2YTXA 2FMMA 1F2MA 1GUGA 3J27B 1FL0A 4MGIE 4LG2A 2MQHA 3S1NH 3UMMA 2NZ1D 4BY1H 1YI2A 3SHGB 2F4VM 1EY0A 3QR8A 1I3QH 2RBMA 1BR9A 3GTJH 3F2DA 4LF7Q 1L1TA 1UAPA 3QB3A 2OEOA 4BBRG 4CDDC 5IREB 2VQEL 3ERSX 5IOCA 5K5PA 4CHTB 4LGYA 3N6RA 4RGMA 1YSYA 4IBKA 1YJ9A 2K5HA 5IE8A 2J4XA 1VQ1A 1QB5D 2F0PA 5M3FG 4YHHL 1C0AA 3Q6SA 3R3OA 1X55A 2MUYA 2F3IA 3IG8A 4OEMB 3ULLA 5IGFA 5C44B 1GHKA 1NSNS 4NXMQ 5F3WA 1OQYA 2XGNA 4GOPA 1PJQA 3GV3A 1PZID 3FRIA 1SE4A 2B2YA 2D7HA 4LGMA 2JYOA 3EN2A 4JOIA 2H1RA 3H15A 1FD7D 4R71A 4MHEA 3S1QB 4KKUA 1QE6A 2F52A 2B3GA 4Q5VA 3B89A 2IHEA 4OO1H 3VR5A 2K5DA 2ZTCA 4LRTA 3UDFA 3K8ZA 1SNOA 2ZTDA 4M0WA 1L0WA 4BBRH 2Z6KC 4AYBB 2DNEA 1S5ED 1KDCA 1R4PB 1WJJA 2HIXA 3I2ZA 5IGBA 5KQ8A 4FWGA 3MWYW 2JXNA 2I5LX 3I7FA 2R7ZB 4ZK9B 1J09A 2A6EC 1IXRA 1X3FA 2Q2EB 1SAPA 4RCOA 4NRWA 1VQAA 4X65Q 5M3FH 4DR2Q 2EKFA 5HGQA 2EYHA 5LMNW 1JQJC 1SEBD 1SXJE 2KHIA 4B9WA 1EIHA 4JYAM 1II3A 4R1JA 1H9SA 4EQPA 2XSZA 4GEWA 3GD7A 1NNXA 3KF8B 1E22A 3KSXA 2PYKA 3N52A 3I70A 4DFAA 3H4JA 3I3CA 2Z4RA 4FW9A 2AMCB 4CKEA 5J39A 2X4AA 1PA6A 2HKJA 1ZMWA 1XNRL 4A3VB 5BN5A 1T5EA 1FYCA 3U9SA 4BBAA 3K0XA 4RHSA 5IT9L 3S17B 1TS2A 3M4QA 1WXQA 4QCLA 2F0HA 5CV7A 2JY5A 1ASZA 2CV2A 2OF1A 3ER0A 1IBKQ 4UHVA 2NWGA 2A5YB 4LF5M 3IHPA 1I50H 5EXXA 3HOWG 1V9PA 3M3YH 3M4PA 1CT1D 1MU5A 2HCBA 3RMHA 3SHFA 4JW0A 1AFPA 1SNPA 1HT1E 4AKIA 3NSWA 1P8LA 3U6DA 2R4EA 3I04M 3OWFA 4TVAB 3HOVB 1VQNA 4RF1A 3W68A 1SFOB 2UXCL 2MROB 2VDBB 3NENA 1YLAA 3RE8A 4ZUIA 4C2MH 1ASYA 4N9PA 3S1RB 2L4FA 4I5SA 3K59A 3GO8A 1XNQM 1ZXTA 3KS4A 1OO9B 1EY4A 3UJNA 4ZQ3A 3B7QA 4DV4Q 1PH2A 5AJ3L 1MIUA 3MXNA 2F0SA 4NB3A 4H02A 2K04A 3OMCA 3D6WA 3HOWH 1KNAA 1H6UA 2I7PA 3MJ5A 1SMYD 3NK9A 2UU9L 3AB9A 4L8JA 3GRVA 1SN8A 4B9XA 4DNIA 5BR8L 1PGYA 1BO0A 1SYFA 3J81E 4HJ8A 3CGWA 4G6ZA 5E4XA 3UDGA 2EY6A 4QF4A 5I9PA 5ELNA 2WIIB 4KY6A 5JJKA 1KFVA 2XFTA 1EY9A 5EKLA 5I4DA 4IFDH 4CDFC 1J7KA 5FK9C 2DUDA 1QNUA 5D3DA 3RZOH 2JA8B 1HQCA 1XXHE 1SNMA 3WOEA 2VQEQ 1G2TA 2HHHM 5C0XJ 1XMQL 1IN8A 4DV7L 4DV2M 2EKKA 1DV0A 3FEWX 2ZAOA 1CZGA 1G51A 1OXSC 4P16A 1EQQA 2B2UA 4JI4M 3IRBA 2ENBA 5EXSA 2BH2A 3VFDA 1PZJD 3A7AB 1GOZA 1TS4A 1YJNA 1K3RA 4A3LG 4DKAC 4B3ML 4I8OA 2F0NA 2DAIA 2GVBA 2IL8A 3BVGA 4XYQA 3FKIG 1JWSD 1V1OA 2AQ2B 3RLOA 3FP9A 4QQBX 1I4GA 1AUAA 2HQEA 1VQ4A 3D8LA 3OYYA 2FOIC 1HQMC 1EYCA 1OXTA 3HJQA 4Q0FA 1MSHA 3BS1A 4QGUA 2NVXH 1KRSA 1N9WA 1O7ZA 3X3NA 4NRVA 2PW5A 2B3TA 3NHHA 3K5LA 2R62A 1UE1A 2AHMA 4FO2A 2XZFA 2K28A 5E4WC 4DK3C 1I94L 1UNSA 3CCEA 1DOLA 4QIWB 4R7GA 4FVMA 4MM3B 3CQZB 1Y8GA 2LBCA 3T1YM 3FVQA 4A3LH 2ZXOA 4FXGC 1IY0A 1PXUA 1Z6HA 4C3JG 1X54A 1UM8A 4DR7M 2F4VL 3KFUG 4A3FB 3LCVB 2F0JA 4UP7A 3VR6A 5IGCA 4CKCA 2IJ0A 2DGYA 4DAMA 4K5XA 1W6JA 4FNFA 3T6PA 1D0KA 2A5HA 1OTCA 3BG3A 3VKGA 2I0QA 1OAOC 2APLA 3A46A 3D31A 1B53A 1YHQA 1G291 3L29A 3K5OA 2KNAA 7CATA 3LWUA 2M2LA 3M4OH 2E75C 2EZVA 1STNA 3W0FA 4E6IA 1W3SA 1PH9A 4DAYA 1VQ7A 1I6HH 2I07B 4NDXA 4GN3B 4F8MA 1ZQ9A 1RDPD 3HOXG 1VQ6A 2BH8A 2R45A 1PTOD 4C3JH 2SNMA 1IN7A 5JEAH 4IBIA 1VEJA 3HKZG 2JQOA 3L2AA 4WW0A 4GN4B 2Z1CA 1SMYC 2MPMA 1PH5A 1WTHA 1D2BA 3HY5A 3DM3A 1STHA 3EIEA 4REZA 2F3VA 4JC0A 2EYLA 4MN3A 1G4AE 3HFZB 3F92A 1B44D 2A69D 5A2QE 1WR1B 3J81j 3F2BA 1A63A 5AJ3Q 1Y1VG 3UE0A 1TWCB 2BE5D 3S15B 4GLVB 1HR0W 3KOJA 3VR4A 1SNCA 3GP1A 1NR2A 5EAYA 3SE0A 2UU9Q 1ORYB 4AI6A 3HOXH 1L2CA 1L2FA 2C5CA 4KD3A 3C3LA 5DNFA 3H94A 2LH0A 2HCCA 3ZCBB 2ZAMA 5ITRA 4G57A 4L63B 4RH6A 3HJSA 3NTHA 2Z7JA 2WAQE 4HJ9A 4MNOA 3T15A 4GH9A 1CZWA 2O5IC 5FLXL 2D5DA 1D7QA 3VDPA 1E1TA 4YCUA 1EY5A 3H09A 2C9OA 1A3TA 1XMQQ 3GPUA 3PGZA 3MVVA 1JJ2A 4JN6A 1Y1VH 3AQQA 1YJWA 2VB3X 2EJMA 4LF5L 4LZJA 3FD9A 5EJCA 3G71A 3Q23A 2CE7A 2EUCA 1HJPA 1HA6A 3GRRA 4HSVA 1XJVA 3V2TA 2WKCA 3A45A 4GLXA 4LF7M 3P20A 3HG9A 1S3SA 5IZ7D 2KENA 4OXPA 1PTOF 4XBOA 1TH2A 1IKMA 1Q02A 1U9RA 1DZ1A 2JP1A 2ZM6Q 3RZDB 5IYCG 4P71A 5M5WH 1FNNA 2JZ1A 2N88A 2JZ0A 3SBJA 1H95A 4R8IA 2OTJA 2WB1B 4CDEC 4TQUS 3U6MA 5E3FA 4NSRA 2V1CA 4HMIA 2KECA 4LJ5A 5CV9A 1DOKA 2F0LA 3PF4A 3GRYA 3PSIA 3ZQJA 1TVXA 2FINB 4ZLTF 3FUTA 2UXBM 1DCZA 1SNDA 1EOTA 1DGGA 5FTKA 3HRZC 1ZV1A 2PQAA 1LT5D 1MGSA 4HIDA 1IZ6A 1PH8A 4UY8C 3K80C 1WCMH 2NVYH 2K6AA 1DGSA 3GPXA 1V33A 4D80A 4C3IB 2E74C 3KS8A 2F4VQ 3A0JA 3A42A 1J9OA 4DR1M 1AZQA 1VDLA 1WTVA 4WJ4A 5IYCH 5C44G 2RF4A 1S4ZA 2DWMA 2Z8YM 3KK7A 4ZRZA 2RDFA 3IFDA 4AH6A 2D7GA 3I4NH 5D14A 2HHHL 4DR2M 4KHVA 3W0LB 5K36G 2BNKA 5DLQE 2Y0SE 2IX0A 3RGSA 4DV2L 1U0LA 5IT9c 2JY7A 3CU7A 4S3SA 4JI4L 3GTGB 4UDUC 4QY7A 2Z4HA 2ERCA 1HNZM 3S14B 1X65A 3S2DH 4MGHA 2Y0QA 4R4CA 4AYBG 2A69C 2HAKA 2JEBI 2E2IB 3Q22A 4OU7A 1SE2A 1EQRA 2A68D 1GM5A 2BE5C 2R7ZG 1Q86C 3SFZA 2LS01 3QAUA 1VEKA 3GLFA 4HL4A 1N8RC 3K9PA 3AYHB 3LQQA 4DF7A 3GTKB 4IUVA 2MHVA 2QBYA 5C44H 4JBWA 4BLCA 4NP5A 3LQRA 2VB2X 3BVZA 3NXWA 5K36H 4CJ2C 4GHAA 1GJSA 2KNZA 4KV6A 3QYBA 3A8JE 5D65A 3DWQA 3J2PB 4DR1Q 3I8ZA 2NVTB 2LHCA 3S1QH 4OWTB 3TQSA 2KEDA 1X3PA 5IWAM 3GQ3A 4KN4C 3RN2A 4J1MA 3HZXA 4R8NA 1SE8A 1K3WA 2DZOB 4DR7L 4A3KB 2R7ZH 2R3ZA 5FOBB 4IBGA 4AZFA 2OOAA 3TMEA 4JBKA 1ZYRD 3FPPA 3NQTA 4DV4M 3CTWB 4MZ9A 5LL6S 5JI2E 4KHPL 2LVQD 2IW3A 1A15A 2QW7A 1OXVA 3KDFB 1JMCA 3BDLA 4YCWA 1N32M 2AWNA 3T16A 1CA5A 1IBLL 1PV4A 2VL6A 4DUZM 1X3EA 4M1UB 1STEA 1YBYA 1SJHD 1GLNA 1A6XA 2E2HB 2B2WC 4LF5Q 3U5ZA 5C3WA 5C1BA 1LTRD 2EA0A 4A3MB 3HOVG 5COYA 3U9OA 3TN2A 1PHJA 3C3EA 3MXGA 1VMPA 2UXDQ 1JR3D 3DA1A 4G4KA 3A55A 2RSNA 4W5WA 2ID0A 3HX3A 4IBFA 2VQEM 3TS0A 2F0IA 4B08A 3W3AA 2RDHA 1QVRA 3TRZA 3HWSA 3J80L 3GTLH 1GKHA 2DVWB 4CJ1B 5KIXA 5IY0A 2O25A 4PMCA 1G2SA 2GA4B 1CK1A 4JCVE 3L28A 1BCPF 5JAVA 5J22A 2A8VA 5C4HA 3K1JA 1SBBB 2QILA 3A5UA 1S3OA 2LHGA 1LM0A 1D1KA 3E5SA 4IN3A 3EFXD 3J81L 2I5MX 5EPLA 4OELB 1VQHA 4LCBA 1LLRD 2R4JA 4AG5A 3D3RA 3RD4A 5CBEE 1PRTB 3GLGB 3HOVH 4IOAA 2C35B 1Y14B 1RCVD 3QO2A 1PH4A 1SFOH 1H9RA 2NN6I 5D3IB 4AQYQ 1XB2B 2JA8G 5GKNA 3S1RH 2A6HD 3J7ZC 1L2DA 5CYUA 3J7AF 2CWBA 1HNXM 1IN4A 3E21A 1EU4A 4UN2B 3SVMA 4DR3L 3CCSA 3RNUA 2GQFA 2QQ8A 3M9BA 2A68C 4YY3Q 5H1SE 4R3DA 4DV2Q 2NB0A 4LZZA 3GLHE 1VCIA 3LVVA 1B2TA 1VS0A 1TDHA 3ND8A 4NSOB 1CHQD 2SDFA 2XRSD 1QNKA 4RGNA 4XTCS 2JA8H 3HP3A 3QOJA 1ZMUA 3FTEA 2F5SA 2NYZD 1I4HA 3Q8XA 3CCLA 3HOUB 1GVPA 3HKPA 1CSQA 1HQRD 1JE5A 1S5BD 2EXZA 3OW7A 2XEPA 4NXNL 4ITQA 1A3UA 1HH2P 4B3TM 1Q7YC 3UDXA 2A19A 3IFTA 3GP7A 1ET6A 2EPBA 4PQXA 3CCJA 5C4ZA 5FJ8G 2OPFA 4A3FG 4G7ZC 1NY6A 1VF7A 4A3BB 2C98A 2UXBL 4QB4A 1SXJB 4QMGA 3IG5A 1XPOA 1WHCA 2N8NA 5L8RF 2JJQA 2L55A 1AH9A 3E3XA 4PDGA 4LF6L 2Y20A 4BBSB 2DJFC 3KF6A 4DR7Q 4IUQA 2QNJA 4GLAC 5C4JB 2JK8A 1Y8NB 1C8CA 3GLIA 4AKHA 2HT1A 2L09A 2F4IA 1TDZA 2KRUA 2WZJA 1R9TH 2DWZB 4XQQA 2EYJA 1JR3E 2AUKA 4KHPQ 3HOYB 2CKZB 5EJWA 3CQZH 4DR2L 3AJIB 1IBLQ 4ZAIA 3E6ZX 3CMEA 1HCZA 4X3KA 5FJ8H 1LV7A 4A3FH 2A1AA 2ICIA 4UP8A 3KLRA 2YFQA 1K8MA 2EE1A 1HNZL 2CHGA 1X32A 4J15A 2F0DA 5ITQA 4XT3B 1V1PA 2MR9A 4QHTA 1JOKA 4WURA 3FMCA 4KT0F 3JR5A 1N36M 1OIZA 1FJGM 1TR8A 2CHBD 1BF4A 4YCVA 1BKBA 1MJEA 1QUQA 1I6VC 1HTPA 1IBMM 1TS5A 2O5JC 1EIGA 4JPBW 4CJ0B 1U5KA 1X6OA 4A3IB 3STBD 4HCEA 3BVMA 2QF7A 4LY6A 4MH0E 1ILQA 2A6HC 5G3LF 3AFHA 5FLXE 3L26A 3C1FA 1FGBD 3LGJA 4DPGA 1WI5A 2WP8J 2XN9C 3H91A 3QYEA 5IWAL 2JA2A 3MMPA 4RG1A 3RLFA 2CFOA 1TWFH 3URYA 2IHFA 2ZM6M 1ILPA 2R6GA 2MGSA 3W1GA 4LJ7A 3SK8A 1D5MC 4GRIA 3JR4A 4HIOA 2K33A 1IW7D 1TWCH 2J5YA 3SEBA 4DR3Q 1VQLA 3SGIA 3S15H 4WJ3M 1MJCA 2KUMA 4LF9Q 1XXHB 3I91A 5HGTA 4DR5L 4M8AA 1JB3A 1N32L 3KXEC 1PRTC 4DUZL 5M9OA 4X3TA 3EIHA 4JI3Q 2DXIA 3I73A 4L5RC 2RCFA 2PPBC 1PJTA 4Q7JA 4QOSA 4L5TA 4Z6YA 4NPSA 2CEAA 4GMQA 3SYLA 2J0TD 1TU2B 2WB1G 1PVOA 2YYZA 2RHQB 4GC5A 3TQYA 3VYSA 3T4AC 4X66L 1WTXA 2BJVA 4IUTA 5KNCA 1VQ8A 3V76A 4NXNQ 1MI2A 1QG7A 1BUVT 2JSOA 1Q82C 1YIJA 1K8AC 4L78A 1XTDA 1TWGB 4TSSA 5HY6A 1V92A 5DAUA 2NN6G 5LL6X 3U6CA 2CV0A 2IPKD 4C3IG 5EXTA 1KYIA 1X3GA 4V0BA 1EIYB 2N78A 3HU3A 1AZPA 3GTQB 4BS9A 5A2QS 3MEHA 1D8LA 2EIFA 2UXBQ 1NBWA 2B2TC 4DBGB 4HJ5A 1CI3M 4JG2A 2PMZE 1EIFA 2QEXA 3RUZA 1R7RA 4LF6Q 1HZCA 5IIFA 4OWWB 2RVLA 1RU3A 4EQ5A 5IP9G 2QZ4A 1PFMA 2K03A 3GTMB 1KD1C 2YNMD 4CKBA 4DV6L 5DEHA 1HNXL 4DU9A 1ENCA 1SR3A 4DR6M 1YNJC 3L9AX 5EQ0A 3CXCA 5IP7G 3JAME 2KEBA 2KNVA 1SXJC 2RDGA 3RR5A 1CKMA 1TH4A 2NN6H 1JOQA 1RL2A 1HZAA 4C3IH 1HZ9A 1TXYA 2L6OA 3LVWA 3STBC 3LCUA 1HNWM 1HNZQ 3CRKC 4OW0A 2WACA 1ICWA 3MA2B 4ZYSA 1G6ZA 5FO7B 1RKNA 1TQOA 2F0MA 1U4LA 1H9JA 5JJZA 4O42A 3E9SA 3RLNA 2X6GA 5IP9H 4XQJA 4B3SM 1EU3A 5EPKA 5KPTA 1RTOA 2AKWB 3EROA 3C1EA 3GTGH 2DNAA 4K2LA 1A2TA 3D8BA 4B3TL 2XRQD 1QUSA 3S14H 3NTKA 1WIVA 4DAVA 5IP7H 2L4EA 1K0RA 4GC9A 3BZDB 3CRLC 2ATWA 2K5VA 3GRUA 1Y69U 2UUBL 2KQ3A 2JY8A 1KSFX 1IW7C 2SOBA 4A3KG 3DFZA 2HL7A 2UXDM 1DXMA 3I4VA 1T5XD 3J81c 4JK1C 5IWAQ 4OX9M 1JE4A 4FDBA 1WD0A 3GTKH 1IXSA 2ZANA 1YNXA 1FNWA 3PUXA 3QWNA 3TWLA 3A8KE 5ITUA 2LVOC 1Y1WB 4IALA 2MO0A 4JBJA 1T9HA 4RNAA 3J81i 1Q3BA 2WAQB 5ITXE 1STBA 2NUCA 1F2YA 2NVTH 5KPZA 1S5CD 5J3BA 2F5NA 4A3MG 2XSCA 1VQ5A 4A3CG 4H0LC 5I6WA 3J80E 2CVRA 2FMCA 5IYDG 2OT2A 2DAGA 1TWAB 4DR5Q 3NEMA 1N32Q 4HN7A 1DM0B 3M6AA 2K5WA 4DUZQ 2OOBA 4A75A 1ESRA 5CV8A 2IX3A 3MZ5A 1FNUA 5EKIA 5FTLA 4A3KH 2M5ZA 4AQYM 3PFIA 4L5QA 3TP5A 1PLFA 1Q12A 5I6YA 1O78A 5T1GA 4DV0Q 4HTHA 3AEVA 1N36L 1FJGL 2ZXPA 2CW0D 4ME5A 4P2CB 4X66Q 3CCUA 3AV0A 1IBML 4YY3M 3CKIB 2M9VA 4HEDA 1EIJA 5EGTA 2WKDA 4NW2A 2VW9A 5C5MA 1L1OA 2E2HH 1I4QA 4A3MH 2KXEA 1ZMVA 2KCTA 5IYDH 3DUZA 5EP4A 1ONLA 1KAWA 4JV5L 1EFUB 2F0VA 1CQVA 3FUUA 5JVH3 4A3EB 1SYDA 2F0OA 2D7EA 5IT9S 3VR3A 4KK7A 2RSOA 4GN5A 1E32A 2K9DA 4M9XA 2FXQA 3SAUA 1Z7TA 1IYUA 2MJ8A 4C1NI 3D4DA 4IQZA 3VDUA 2H1EA 4KKSA 2ZXRA 2R46A 4LJ6A 1RODA 2ZM6L 3PIPA 2FFJA 5ITYA 1KABA 1OXXK 3DHQA 2Q8IB 3F2CA 2BA1A 1E1OA 3EVQA 2HDLA 2WSCF 4F7XA 4DV6Q 1HNXQ 1MN3A 3L2PA 1L2BA 1LACA 2A74C 4IJLA 4BB9A 4MTKA 1TTEA 3BDCA 3ZYYX 2DNCA 3KSJA 3PO3B 1ML0D 1PTOB 3GV6A 2XWJB 1B1ZA 1GUOA 1YE9A 2O2LD 1OXUA 2KW0A 3NBHA 3L27A 1LTTD 4PZ7A 4LFAM 4DUYL 2G8LA 4N9TA 3FKIH 3ITPA 3HOUG 1AIPC 3NELA 4KODA 3D8GA 3L0OA 4RGTA 3HHZA 2F5QA 1JJGA 4KHPM 1P16A 3BZKA 3GDEA 1TT2A 2G9DA 2BDNA 3DEOA 3E9HA 2XF3A 2OTLA 4JI8M 3K7AB 1IBLM 3TZDA 1XPUA 4A3BG 1VQKA 1KXLA 3AU7A 4B3TQ 2DY7A 2IT1A 3KOZE 1IN6A 3BBZA 4R4OA 4JI2L 2K5QA 4HCSA 1J8IA 2LVPC 3GLIE 5GQOA 4MGYE 1DGBA 2JXMB 4QL5A 2F5OA 4BBSG 1SYEA 2K52A 2Q2HA 2UUBQ 1IYVA 3E9IA 1CA6A 1PH3A 1F2ZA 2RKSA 2SNSA 3K8AA 3K5NA 1R2ZA 1BBXC 1LYLA 1QQWA 3EA6A 5FTNA 3MAQA 3W2DA 4QNRA 4ILWA 3HOUH 3ERQA 4NC6A 1LTLA 4AW4A 2BDOA 4ZPXA 3CF2A 3MHBA 3HOYG 1DYQA 2PO4A 3A56A 5KO3A 4TRDA 1GJTA 2WV6D 2B2VC 3VA7A 1DONA 3W5OA 2CWPA 4DR6L 4A3DB 2PW7A 3UI2A 4A3BH 4RMFA 4U68A 3BYYB 4N8X1 2YU9B 1SXTA 1WOCA 4M0DA 1TIID 1YEZA 2CW0C 2VS1A 3NWSA 3GTPB 1PZKD 1RTNA 2XSZD 4LJ9A 4RA8A 1N34L 4BBSH 3X3MA 1DO0A 2L5TA 1AN8A 1A8VA 4GS3A 2DJGC 1LABA 1RJTA 2A73B 4QOZC 4YIJA 5C4JH 1HNWL 2EYFA 1PFSA 3THGA 2KDLA 2L1BA 3H3VI 4A3IG 3B7ZA 2DENA 4LW1A 4ZKBB 3IL8A 4FCWA 3H0GB 3HOYH 3FHWA 1N36Q 2QENA 1FJGQ 3I01M 1MD2D 3HOZB 4DR3M 2EDGA 1PM5A 1CHPD 3U6EA 4UP9A 2K6BA 1QZGA 2L11A 2PI2A 4LF9M 4B3SL 1IBMQ 4K5VA 4LJ8A 4FF1A 1Q90A 3CCQA 3DWAA 4FCTA 2L15A 2Y21A 5C4XG 5DM73 5FO9B 4OHJA 4JI3M 4KN7C 4JV5Q 4WORA 2CQAA 2SEBD 4I7ZC 3J7AS 2LSSA 4H13C 2E2DC 5IGEA 3H3VC 2L4NA 4DK1A 1G8ZD 1NTGA 2UXDL 5A35A 3R8BA 4QJFA 2YV5A 2I7NA 2XFSA 1E2ZA 3CCVA 1UEAB 4HMJA 4OX9L 3G6EA 3NBIA 3GTJB 2O5RA 4UAIA 2CHQA 4A3IH 2CFMA 3MTSA 2KCCA 3OWEB 2BWBA 4G4OA 3WHKA 1SNQA 3R2IA 1N77A 4OL7A 4YWMA 1GUTA 4APVA 3KDSE 3OSOA 4NXNM 1PYSB 2E76C 5CV4A 5T1IA 3TL4X 4WFN3 1NY4A 1M4VA 1BQQT 1T43A 4A4IA 1EOVA 1YUBA 1C9OA 1A62A 4ZUJA 3KJOA 3L25A 2HCIA 4POFA 1Q81C 4ODGA 1KLGD 3NQIA 3GLHB 5CORA 4DUYQ 2GNOA 4AQYL 4LF6M 4K8JA 4A3JG 3GLGA 2R92B 2X69A 4GOPC 2LTUA 2B2YC 2MNAA 1KDBA 2KOLA 3LWEA 5LMNM 4JOIC 1GUWA 4UPAA 1NVMA 5KNDA 1QZEA 1YNND 2CWAA 1PTOC 3KLWA 1NHGC 4YY3L 4D81A 1HQYE 3TE6A 2HD3A 1VQEA 2VUMB 2IX1A 1LTSD 2NTTA 4MB7A 2DAKA 1A0IA 1WD1A 4NOOB 2L12A 4GNXB 3Q8DA 1IHZA 4JI2Q 2D0OA 2DHRA 2R7DA 5IGDA 5J1ZA 4PZ6A 1H9MA 1G3IA 4I4LA 1I4WA 2EQSA 3U6OA 1IXRC 1QAMA 4V190 2Q8RE 4BA1I 2H5XA 4X3SA 2K50A 5TSSA 3ZC7B 3SAVA 3U6PA 3OIQA 4DV3Q 4KKTA 1B4OA 4J6HA 4DV1M 2JA6B 3J7BA 3KLSX 1BCPD 3T53B 3JAML 3MXUA 1NMFA 4I65A 3I55A 5C18A 4IBDA 3F2UA 4EQNA 1C1KA 1VQIA 3GQ4A 3KFUA 4DK6C 3GTQH 4DR6Q 1FR3A 2QEJC 3UGJA 5CR3A 2Z6KA 3J7AV 3HKSA 1TWHB 1NV8A 1I50B 3D6CA 4KD4A 3SMSA 2LWXA 1ENAA 2AUJD 1HFNA 4LFAL 1HPCA
chains in the Genus database with same CATH topology
1A2UA 2E2JB 1D6EC 4FD2A 1L8QA 2HUGA 4C3HB 8CATA 3PIP3 2EY1A 4PMBA 1LTBD 4GITA 1BXTA 1EY7A 3QJYA 4RAUC 3MFGA 1IQPA 4DR5M 1D5ZC 3K58A 5KYLA 1K82A 3HHWA 2XLJA 3NP8A 3R93A 1VDDA 4FF2A 1SDFA 4Z9CB 1RD9D 4DV0M 1GHJA 4C1NK 3HU1A 3AOEC 3VK7A 4WRDA 2F0KA 2KVMA 3AL0C 1NNUC 4X66M 1VMCA 4DK0A 3C46A 5DYGA 4O1NA 1QOHA 2VNUD 2F0UA 1JOOA 1NNJA 3NWTA 1PJJA 4RWSC 3K5MA 1B3AA 1GKIA 4LMQD 4F87A 4Y7NB 1IKLA 2UUCM 1B50A 1HRJA 4K14A 4IJEA 1IL8A 4BY7B 1NR4A 1YNNC 3A98B 2X6LA 3PO2B 2B2UC 2EYMA 2VIIA 2PQEA 5FTJA 1STYA 1LV9A 3VKHA 3VLFB 4OO1I 1EQVA 2EOTA 1XXGA 2JA5B 3HU2A 4AG6A 1WTQA 4IUUA 4DV6M 5KNBA 3SATA 1MX0A 1E0BA 1PDQA 3TSSA 4DGZA 4X62M 1DOMA 1XHBA 2FFKB 1LTGD 1BCPC 4RFBA 1EYDA 3L3OC 2Z4SA 4RF0A 1JCKB 1HA5A 4II7A 2PZTA 1W5SA 3VYUA 5M5YB 3DZDA 2G5GX 3PMFA 4XXEA 1QJOA 5G3LD 3VYRA 1G41A 3TPZA 5E6JA 1OFIA 4FF3A 1GJXA 2R18A 4FWDA 2UUBM 4IBEA 1AP0A 3S16B 1ZYRC 2F0GA 3J80S 5CC4A 2QBYB 3B9PA 2C96A 4MGZE 1K83B 3I72A 4PT5A 2BA0A 3T56B 3R8FA 3GQBA 3J81S 3KW6A 2KEEA 2RA4A 1PTOH 2F5PA 1HR0M 4EQOA 3PV0A 4G7HC 3GO5A 4DXGA 4GHLA 3UK6A 1I4XA 3AOGA 2LXEA 1JQYD 3ZH9B 2PCFB 3SASA 3SHLA 1KNEA 4RCNA 1M8AA 5C6AA 2B8FA 4B7FA 1TY0A 1VDZA 4XIGS 1O7LA 3KF8A 3U6QA 3FUWA 2UUAM 4CISA 3S1MB 1AEXA 1U4PA 3QG1A 5BN4A 4IFDI 4OGQC 4K6DA 3A54A 3VA5A 2B63B 2D2CC 3U5ZB 4LJZC 1STAA 2ZBKB 3KP1E 4Z8XA 4DAPA 4JV5M 5C3EB 1G8PA 5BPVA 2A6ED 2NQ8C 4G4RA 1EY6A 3GTOB 3PVSA 4HSPA 5M3MB 5C4XB 3BYTB 3TP6A 5CV5A 1Q1BA 3R9XB 4GZYC 2KCNA 4U673 1Y8OB 2F0WA 3IAYA 5CMDA 1VF5C 4IUPA 2F1MA 3P7JA 1WTPA 2L9HA 2EVBA 1MBYA 5EPJA 2CUZA 3P1HA 4L8RC 1DGHB 2N55A 2F3WA 1IXZA 4DUYM 1JWUD 2M60A 1N75A 1WCMB 2NVYB 3MK6A 3OIPA 2QCUA 1UUPA 1A3VA 3SK4A 4KJNA 4L16A 4FF4A 4A3JB 3QOLA 3PUYA 1EEID 3PUZA 4XDXA 3I4NB 1JC7A 4JI2M 3LX0A 1NSFA 1EQTA 4PV1C 3M0EA 1JICA 4K5WA 4FXDA 3OPOA 3MC0B 4OO1G 1EWHA 1PYWD 2VXWA 3V96A 3S2DB 1DO2A 2PZUA 1EE8A 4H7BA 4M9ZA 4DV3M 1E9SA 1S5FD 5IGGA 2E5LM 4L15A 2KA7A 3E4RA 3D4WA 4OVZB 1JR0D 4F88A 2C9CA 4LRSA 3NTIA 3WHLA 3K57A 5IODA 4M9SA 3S2HB 1CTMA 3NWLA 1N78A 1SE3A 3GQ5A 3BOSA 5KGUA 4MIUA 1N34M 4DA2A 4G4NA 3SARA 4B3RM 4X3UA 3GLIB 1PFBA 1EYAA 2NVQB 5DM63 3U61B 3HHYA 3T13A 4DV5M 3KLSA 3KUPA 3ILKA 1J5EM 3I4LA 3C58A 3U60B 2DN8A 4LFBM 3TWMA 2L0CA 3SMPA 2F0TA 4KI0A 5EP1A 5ELDA 5KQDA 4IBCA 4XGIA 3AMUA 1E2WA 1V1PB 1OJLA 3M4YA 1LT6D 2G9HD 3FDTA 3VYTA 2ZT9C 4JI7M 1ZKOA 4KY7A 4C3HG 2WINB 2XNAC 1IY2A 1WTOA 4GKJM 1IM2A 1G91A 4TUWA 1RHPA 1X3QA 5LHY1 2LFNA 2R93B 3T38A 1DJRD 3GTLB 1QILA 1QANA 4JXJA 4IURA 1C48A 4KO8A 1AW7A 5I2XA 1EWCA 1HXYD 2PNRC 3NPPA 4IFDG 4QNMA 1PFNA 2TMPA 3DEPA 2OQ4A 4K8IA 2BCOA 1IY1A 1Z6TA 2B2WA 4H44C 4OIKA 4NL4H 1TH3A 4HR7B 2IWHA 5LMUM 3AOEA 1JWMD 4K0KM 3HEJA 3R2TA 2Z4IA 3TZUA 4LAAA 4TKOB 2D9UA 4IIWA 2FE8A 4KJOA 4XYOA 3KOYE 2XZUA 1E9RA 1L0YB 4A3GB 2K32A 4QHSA 1BDOA 5KRUA 2X49A 1F9QA 4QUCA 2JA7B 2M00A 1ET9A 1W5TA 3T51B 3CF0A 1B9NA 3PNVA 3U6LA 2B39A 2QCPX 2J7ZA 1F9PA 2NTSA 2F0QA 3FYDA 2EY5A 2XH9A 3M7GA 4K6LA 2I46A 5CBAE 1ESFA 1K3XA 1G59A 4BA2I 2Y0SB 3SR1A 1TGUA 4IBJA 1E2VA 5C5LA 3L7ZC 3LNNA 5C0XI 3GLHA 2C5RA 5KYIA 4A93B 2V4DA 1BNZA 2RQXA 4LF4M 1NCVA 4KHZA 4JI0M 5ELBA 1R9TB 1H9SB 1DD2A 3SYKA 2EYPA 3DXJC 3FTCA 1LT4D 4CBVA 2Z3XA 5DNYA 2LNHC 1XMOM 5EBCA 5ELEA 3DM1A 5JEAG 2EJGC 1R4QB 2DZNB 4G7OC 1H9KA 4RKBA 3FUXA 2R61A 5FTMA 3NUCA 4JI6M 5CV6A 2FJ2A 1R2YA 1FNVA 2DWNA 1Q3CA 2AQ1B 2F03A 1KLUD 4JI5M 1QYRA 2RGHA 3CHBD 3I4MB 2JE6I 1IXSB 1RF2D 2LY7A 3SDZA 2V1UA 3GPYA 1Q39A 2ICEC 2LKVA 1K8OA 1JR3A 3LMMA 3NE5B 4IBBA 1Q1EA 2X8AA 1TWFB 3TBIB 1O80A 1GXDC 5M5XB 1EFID 4HAEA 2J7OA 4GKKM 2OXPA 4IJFA 3SK6A 2KZUA 1F9SA 1S5DD 2VQFM 1XX8A 4JI1M 3E0JA 3TP8A 3KOWE 4B7HA 3HGIA 4LJAA 4EGVA 3S1NB 3T1HM 3KBXA 1GVNA 4BY1B 2PZWA 4IZ8A 5ITTA 1C4QA 1TY2A 3RFWA 3SXHA 1SYCA 1I3QB 5FSWA 3K92A 4FP5D 1EL0A 3Q0AA 1JORA 3I4YA 1SYGA 5HURA 5EXPA 2Y0TA 1EZ6A 1NJFA 1SSOA 5FO8B 1D2NA 1GUNA 1T3TA 3M7NA 1B9MA 2XWBB 5EBDA 3A7LA 4RHRA 1TKWB 1NY5A 3HGBA 3K2LA 1SJED 2Q8TA 4MGKE 1XYIA 4LJ4A 3AKZA 2K47A 1BCPB 3FTDA 3TDQA 4ULLA 4L4UA 1O7YA 1X37A 1HFGA 2F0EA 2RGOA 4BBRB 4NXMM 2EYOA 3OMGA 1E94E 5M3FB 3H4MA 1L0XB 5ELFA 1U4MA 2BJWA 1U4RA 3O13A 3IKJA 3K6OA 3P75A 1XWIA 3PXGA 4OIJA 5FLXS 3GPPA 4PCZA 1Z5AA 1R6BX 2XIWA 4X65M 4DR4M 1N33M 3V05A 3U6SA 3G7LA 3SAWA 2B2TA 4D82A 5CGKA 1CQFA 5EP2A 1QWYA 3OHXC 4GIPA 2DWLA 3RGPA 3M3YB 4PNYA 5C0XG 1Z59A 4X64M 4FCVA 1IN5A 1LT3D 4XT1B 2AQ3B 5JPNC 3EQLC 1SXJA 2CV1A 4DNTB 3S9WA 5BN3A 3HS0C 1SYBA 1IBKM 4DXFA 2EO2A 1HT2E 1F2LA 2R65A 2FNAA 5E26A 3FTFA 5IT9E 3KVWA 4HLQA 4C2MB 2JEAI 2QPAA 1HTLD 1STGA 1WTWA 3EJIA 2V6ZM 3HOWB 2J7NA 5C0XH 3G6JB 4L6TB 4LK1C 4PMWA 3OTOM 3VR2A 2AWOA 3Q24A 3H6MA 2B8GA 2EJFC 1D5XC 2K01A 3QWLA 3SC3A 4XQNA 3HJ8A 2RKOA 3RZOB 1EZ8A 5JI3E 4FWHA 4WJWA 1NAPA 3A8IE 1Q8IA 3I51A 2CHVA 2Z8LA 5ITXA 2KA6B 2XVSA 3JAMS 2K05A 2K1BA 2L7IA 1BOSA 4KY5A 3TWKA 3WDNA 4BWGB 3ND9A 2K7VA 5NUCA 4YHHM 1GL7A 5AFWA 5KPRA 2NVXB 4DN4M 2YR0A 3OOCA 4ABNA 5DYIA 5F2DA 1XXHA 1Z5BA 2KZSA 3MHVC 1DGHA 1LTID 1QCBD 3DWPA 1WVLA 4J8QA 3FYCA 3FUVA 3FKIB 4PD2A 1KAAA 2FHTA 3D4RA 5FKAC 4C56C 1QAOA 3FPUB 4KMUC 2KRKA 2PMZB 4FYDA 1PMRA 1Z5CA 5EQTA 1F77A 2QKIC 2DY8A 3KOXE 3HHXA 1ZAEA 3DMUA 4EIWA 3UZUA 1Q3LA 1NUCA 3PUWA 3M4OB 3GLFB 5I2YA 3TP7A 1XNRM 5E1FA 1I6HB 1EEFD 4NMZA 1I4RA 1Y8PB 4EVOA 1W6KA 4C3JB 1PRTD 2KJXA 3BDOA 5ISRA 1LTAD 3KP0E 1KTKA 3CF6E 1V8QA 4LF8M 5ELCA 5EKKA 1EY8A 1XC8A 3MFYA 4IFDJ 1PJIA 1CM9A 4OVZA 5C3XA 3I90A 1HUNA 3WOFA 1MSGA 4KLNA 3C2PA 1LO5D 1F9RA 1QAQA 4K2KA 1HHVA 1D1IA 3KBGA 3J7YW 1Z47A 4G4QA 5JPMC 4RKLA 1XTCD 1TR5A 2NBFA 2UXCM 3HOXB 3FKEA 2LMCB 5JVG3 2BOSA 2D62A 4I81A 3HKZB 3U61A 1CFMA 2HDMA 3U60A 2MP1A 2UU9M 2O4XA 3ONAB 5BR8M 3PIO3 5H37D 4CGYB 1NHWC 1Y1VB 4LFCM 1OFHA 2B2VA 1YNJD 2F0FA 4AKGA 2QDBA 5I9OA 1DGFA 1L1ZA 1I4PA 3PNYA 3FRPB 1SXJD 4NKLA 1ENFA 3M85A 2QP9X 3K0YA 5A2QL 2L7HA 3DOAA 1PRTF 1XMQM 3VK8A 4DV7M 4S12A 1KDAA 2KHSA 5M5WB 5KEEA 4FXKC 5JOBA 4RGOS 1WTRA 4B3MM 3MXPA 4ZKCB 1QZMA 4PDIA 1HUMA 1XWEA 3SK5A 2C99A 4ID6A 5EP3A 1GUSA 1GL6A 4DNRB 2W82A 1V43A 2TSSA 4IUNA 2YQZA 1ZEQX 4KTAA 3PUVA 2P5TA 4B7GA 5JEAJ 3QIAA 1NJGA 4QUFA 2H4OA 2EY2A 1I94M 4R9WA 1TS3A 2FMMA 1F2MA 1GUGA 3J27B 4MGIE 4LG2A 3UMMA 2NZ1D 3SHGB 2F4VM 1EY0A 2RBMA 1BR9A 1L1TA 1UAPA 3QB3A 2OEOA 5IREB 5IOCA 5K5PA 4CHTB 4LGYA 3N6RA 4RGMA 1YSYA 4IBKA 2J4XA 1QB5D 2F0PA 3Q6SA 3R3OA 2MUYA 5C44B 3IG8A 1GHKA 5IGFA 1NSNS 5F3WA 2XGNA 3GV3A 1PZID 1SE4A 2B2YA 2D7HA 4LGMA 2JYOA 2H1RA 1FD7D 4MHEA 3S1QB 4KKUA 1QE6A 4Q5VA 4OO1H 3VR5A 2K5DA 4LRTA 3K8ZA 1SNOA 4M0WA 4AYBB 5IGBA 2DNEA 1S5ED 1KDCA 1R4PB 5KQ8A 4FWGA 3MWYW 2R7ZB 4ZK9B 1J09A 2A6EC 2Q2EB 1SAPA 4RCOA 4NRWA 2EYHA 1JQJC 1SEBD 1SXJE 4B9WA 1EIHA 4JYAM 1II3A 1H9SA 4EQPA 2XSZA 3GD7A 3KSXA 2PYKA 3N52A 3I70A 4DFAA 3I3CA 2Z4RA 4FW9A 4CKEA 5J39A 2X4AA 2HKJA 4A3VB 5BN5A 1T5EA 1FYCA 3U9SA 4BBAA 4RHSA 5IT9L 3S17B 1TS2A 4QCLA 1WXQA 2F0HA 5CV7A 2CV2A 2OF1A 2NWGA 2A5YB 4LF5M 5EXXA 1CT1D 1MU5A 2HCBA 3RMHA 3SHFA 1AFPA 1SNPA 1HT1E 4AKIA 3NSWA 3U6DA 2R4EA 3OWFA 3HOVB 4RF1A 1SFOB 3RE8A 4ZUIA 4N9PA 3S1RB 4I5SA 3K59A 3GO8A 1XNQM 1ZXTA 3KS4A 1OO9B 1EY4A 3UJNA 4ZQ3A 3MXNA 2F0SA 2K04A 3OMCA 3D6WA 1KNAA 1H6UA 2I7PA 3MJ5A 1SMYD 3NK9A 3AB9A 4L8JA 3GRVA 4B9XA 1BO0A 1SYFA 3J81E 4G6ZA 5E4XA 2EY6A 4QF4A 5I9PA 2WIIB 4KY6A 1KFVA 2XFTA 1EY9A 5EKLA 5I4DA 4IFDH 1J7KA 5FK9C 1QNUA 5D3DA 2JA8B 1HQCA 1SNMA 3WOEA 1G2TA 2HHHM 5C0XJ 1IN8A 4DV2M 3FEWX 2ZAOA 1CZGA 1OXSC 4P16A 2B2UA 4JI4M 2ENBA 5EXSA 3VFDA 1PZJD 3A7AB 1GOZA 1TS4A 4I8OA 2F0NA 3BVGA 2IL8A 4XYQA 1JWSD 1V1OA 2AQ2B 1I4GA 2HQEA 3D8LA 2FOIC 1HQMC 1EYCA 1OXTA 3HJQA 4Q0FA 1MSHA 3BS1A 1O7ZA 3X3NA 4NRVA 2PW5A 3NHHA 3K5LA 2R62A 2AHMA 4FO2A 2XZFA 2K28A 5E4WC 1UNSA 1DOLA 4QIWB 4R7GA 4FVMA 4MM3B 3CQZB 3T1YM 3FVQA 2ZXOA 4FXGC 1IY0A 1PXUA 1Z6HA 4C3JG 1UM8A 4DR7M 3KFUG 4A3FB 2F0JA 3VR6A 5IGCA 4CKCA 2IJ0A 4K5XA 1W6JA 4FNFA 2A5HA 3BG3A 3VKGA 3A46A 3D31A 1B53A 1G291 3L29A 3K5OA 7CATA 3LWUA 2M2LA 2E75C 2EZVA 1STNA 3W0FA 4E6IA 4DAYA 2I07B 4NDXA 4F8MA 1ZQ9A 1RDPD 2R45A 1PTOD 2SNMA 1IN7A 5JEAH 4IBIA 3L2AA 4WW0A 2Z1CA 1SMYC 2MPMA 1D2BA 1STHA 3EIEA 4REZA 2F3VA 4MN3A 2EYLA 1G4AE 1B44D 2A69D 5A2QE 1TWCB 2BE5D 3S15B 3VR4A 1SNCA 3GP1A 1NR2A 3SE0A 1ORYB 4AI6A 1L2CA 2C5CA 4KD3A 3C3LA 5DNFA 3H94A 2LH0A 2HCCA 3ZCBB 2ZAMA 5ITRA 4G57A 4L63B 4RH6A 3HJSA 3NTHA 2Z7JA 3T15A 4GH9A 1CZWA 2O5IC 5FLXL 2D5DA 3VDPA 1EY5A 3H09A 2C9OA 1A3TA 3GPUA 3MVVA 4JN6A 2VB3X 2EJMA 4LZJA 3FD9A 5EJCA 3Q23A 2CE7A 2EUCA 1HA6A 3GRRA 4HSVA 3V2TA 2WKCA 3A45A 4LF7M 3P20A 3HG9A 1S3SA 5IZ7D 1PTOF 4XBOA 1TH2A 1IKMA 1U9RA 1DZ1A 2JP1A 3RZDB 1FNNA 2N88A 3SBJA 4R8IA 2WB1B 4TQUS 3U6MA 5E3FA 4NSRA 2V1CA 4HMIA 2KECA 4LJ5A 5CV9A 1DOKA 2F0LA 3GRYA 1TVXA 2FINB 4ZLTF 3FUTA 2UXBM 1DCZA 1SNDA 1EOTA 1DGGA 5FTKA 3HRZC 1LT5D 1MGSA 2K6AA 3GPXA 4D80A 4C3IB 2E74C 3KS8A 3A42A 1J9OA 4DR1M 1AZQA 1WTVA 1S4ZA 2DWMA 3KK7A 4ZRZA 2RDFA 3IFDA 2D7GA 5D14A 4DR2M 4KHVA 3W0LB 5K36G 2BNKA 2IX0A 3RGSA 3CU7A 4S3SA 3GTGB 4UDUC 2Z4HA 2ERCA 1HNZM 3S14B 4MGHA 2Y0QA 2A69C 2JEBI 2E2IB 3Q22A 4OU7A 1SE2A 2A68D 2BE5C 3SFZA 2LS01 3QAUA 3GLFA 4HL4A 4DF7A 3LQQA 3GTKB 4IUVA 2MHVA 2QBYA 4JBWA 4BLCA 4NP5A 3LQRA 2VB2X 3BVZA 3NXWA 5K36H 4CJ2C 4GHAA 4KV6A 3A8JE 5D65A 3DWQA 3J2PB 3I8ZA 2NVTB 3TQSA 2KEDA 1X3PA 5IWAM 3GQ3A 4KN4C 4J1MA 3HZXA 4R8NA 1K3WA 2DZOB 4A3KB 2R3ZA 5FOBB 4IBGA 4AZFA 3TMEA 1ZYRD 3FPPA 3NQTA 4DV4M 3CTWB 5LL6S 5JI2E 2IW3A 1A15A 1OXVA 3BDLA 3T16A 1N32M 2AWNA 1CA5A 4DUZM 4M1UB 1STEA 1SJHD 1GLNA 1A6XA 2E2HB 2B2WC 3U5ZA 5C3WA 5C1BA 1LTRD 2EA0A 4A3MB 5COYA 3U9OA 3TN2A 3MXGA 1VMPA 1JR3D 3DA1A 4G4KA 3A55A 2RSNA 4W5WA 2ID0A 4IBFA 2VQEM 2F0IA 4B08A 3W3AA 2RDHA 1QVRA 3HWSA 3J80L 2DVWB 4CJ1B 5KIXA 4PMCA 1G2SA 2GA4B 1CK1A 3L28A 1BCPF 5JAVA 5J22A 5C4HA 3K1JA 1SBBB 2QILA 1D1KA 3E5SA 4IN3A 3EFXD 3J81L 5EPLA 4LCBA 1LLRD 2R4JA 4AG5A 3D3RA 3RD4A 5CBEE 1PRTB 3GLGB 1RCVD 3QO2A 1H9RA 2NN6I 5D3IB 5GKNA 2A6HD 1L2DA 5CYUA 3J7AF 1HNXM 1IN4A 1EU4A 3SVMA 2A68C 4R3DA 2NB0A 4LZZA 1VCIA 3LVVA 1B2TA 1TDHA 3ND8A 4NSOB 1CHQD 2SDFA 2XRSD 1QNKA 4RGNA 4XTCS 3HP3A 3QOJA 3FTEA 2F5SA 2NYZD 1I4HA 3Q8XA 3HOUB 3HKPA 1S5BD 2EXZA 1HQRD 3OW7A 2XEPA 4ITQA 1A3UA 4B3TM 3IFTA 3GP7A 1ET6A 2EPBA 4PQXA 5C4ZA 2OPFA 4G7ZC 1NY6A 1VF7A 4A3BB 2C98A 4QB4A 1SXJB 4QMGA 3IG5A 2L55A 4PDGA 2Y20A 4BBSB 4IUQA 5C4JB 1Y8NB 1C8CA 3GLIA 4AKHA 2L09A 2F4IA 1TDZA 2KRUA 2DWZB 4XQQA 2EYJA 2AUKA 3HOYB 5EJWA 3AJIB 4ZAIA 3E6ZX 1HCZA 4X3KA 1LV7A 2ICIA 3KLRA 2YFQA 1K8MA 2EE1A 2CHGA 1X32A 2F0DA 5ITQA 4XT3B 1V1PA 4QHTA 1JOKA 4WURA 3FMCA 3JR5A 1N36M 1FJGM 2CHBD 1BF4A 1I6VC 1HTPA 1IBMM 1TS5A 2O5JC 1EIGA 4CJ0B 4A3IB 4HCEA 3BVMA 2QF7A 4LY6A 4MH0E 1ILQA 2A6HC 5G3LF 3AFHA 5FLXE 3L26A 3C1FA 1FGBD 2WP8J 2XN9C 3H91A 2JA2A 3RLFA 2CFOA 3URYA 2ZM6M 1ILPA 2R6GA 2MGSA 4LJ7A 3SK8A 1D5MC 4GRIA 3JR4A 2K33A 1IW7D 3SEBA 2KUMA 1XXHB 3I91A 5HGTA 4M8AA 1JB3A 3KXEC 1PRTC 5M9OA 4X3TA 3EIHA 2DXIA 3I73A 2PPBC 4QOSA 4Z6YA 2CEAA 4GMQA 3SYLA 2J0TD 1TU2B 2YYZA 4GC5A 3VYSA 1WTXA 3T4AC 2BJVA 4IUTA 5KNCA 1MI2A 1QG7A 1BUVT 2JSOA 4L78A 1TWGB 4TSSA 5DAUA 2NN6G 5LL6X 3U6CA 2CV0A 2IPKD 4C3IG 5EXTA 1KYIA 4V0BA 1AZPA 3HU3A 3GTQB 4BS9A 5A2QS 3MEHA 2B2TC 1CI3M 3RUZA 1R7RA 5IIFA 2RVLA 2QZ4A 1PFMA 2K03A 3GTMB 2YNMD 4CKBA 5DEHA 4DU9A 1ENCA 4DR6M 1YNJC 3L9AX 5EQ0A 3JAME 2KEBA 1SXJC 2RDGA 1TH4A 2NN6H 1JOQA 2L6OA 3LVWA 1HNWM 3CRKC 4OW0A 2WACA 1ICWA 3MA2B 4ZYSA 1G6ZA 5FO7B 1RKNA 1TQOA 2F0MA 1U4LA 1H9JA 5JJZA 4O42A 3E9SA 2X6GA 4XQJA 4B3SM 1EU3A 5EPKA 5KPTA 1RTOA 3EROA 3C1EA 4K2LA 1A2TA 3D8BA 2XRQD 3NTKA 4DAVA 4GC9A 3BZDB 3CRLC 3GRUA 1Y69U 2KQ3A 1KSFX 1IW7C 2SOBA 3DFZA 2HL7A 2UXDM 1DXMA 3I4VA 1T5XD 4JK1C 4OX9M 1JE4A 1WD0A 2ZANA 1FNWA 3PUXA 3QWNA 3TWLA 3A8KE 5ITUA 1Y1WB 4IALA 4RNAA 1Q3BA 2WAQB 5ITXE 1STBA 2NUCA 1F2YA 5KPZA 1S5CD 2F5NA 2XSCA 4H0LC 5I6WA 3J80E 2CVRA 2FMCA 2OT2A 1TWAB 4HN7A 1DM0B 3M6AA 2K5WA 1ESRA 5CV8A 2IX3A 3MZ5A 1FNUA 5EKIA 5FTLA 2M5ZA 4AQYM 3PFIA 3TP5A 1PLFA 1Q12A 5I6YA 1O78A 5T1GA 4HTHA 2ZXPA 2CW0D 4ME5A 4P2CB 3AV0A 4YY3M 3CKIB 2M9VA 4HEDA 5EGTA 2WKDA 4NW2A 5C5MA 1I4QA 2KXEA 3DUZA 5EP4A 1ONLA 4A3EB 2F0VA 1CQVA 3FUUA 5JVH3 1SYDA 2F0OA 2D7EA 5IT9S 3VR3A 4KK7A 2RSOA 1E32A 4M9XA 3SAUA 1Z7TA 1IYUA 2MJ8A 4C1NI 3D4DA 4IQZA 3VDUA 2H1EA 4KKSA 2ZXRA 2R46A 4LJ6A 1RODA 2FFJA 5ITYA 1OXXK 1KABA 3DHQA 2Q8IB 2BA1A 3EVQA 2HDLA 4F7XA 1L2BA 1LACA 2A74C 4BB9A 3BDCA 3ZYYX 2DNCA 3KSJA 3PO3B 1ML0D 1PTOB 3GV6A 2XWJB 1B1ZA 1GUOA 1YE9A 2O2LD 1OXUA 2KW0A 3NBHA 3L27A 1LTTD 4LFAM 2G8LA 4N9TA 3ITPA 4KODA 3D8GA 4RGTA 3HHZA 2F5QA 4KHPM 1TT2A 2G9DA 2BDNA 3DEOA 2XF3A 4JI8M 3K7AB 1IBLM 3TZDA 3AU7A 2DY7A 2IT1A 3KOZE 1IN6A 2K5QA 4HCSA 1J8IA 4MGYE 1DGBA 2JXMB 2F5OA 1SYEA 1IYVA 1CA6A 1F2ZA 2RKSA 2SNSA 3K5NA 1BBXC 1R2ZA 3MAQA 1QQWA 3EA6A 5FTNA 3W2DA 4QNRA 4ILWA 3ERQA 4AW4A 2BDOA 4ZPXA 3CF2A 3MHBA 1DYQA 2PO4A 3A56A 5KO3A 4TRDA 2WV6D 2B2VC 3VA7A 1DONA 4A3DB 2PW7A 3UI2A 4U68A 3BYYB 2YU9B 1SXTA 3GTPB 4M0DA 1TIID 2CW0C 3NWSA 1PZKD 1RTNA 2XSZD 4LJ9A 4RA8A 3X3MA 1DO0A 2L5TA 1AN8A 1LABA 1RJTA 2A73B 4QOZC 4YIJA 2EYFA 3THGA 2L1BA 4ZKBB 3IL8A 4FCWA 3H0GB 2QENA 1MD2D 3HOZB 4DR3M 2EDGA 1PM5A 1CHPD 3U6EA 2L11A 4LF9M 4K5VA 4LJ8A 4FF1A 1Q90A 3DWAA 4FCTA 2Y21A 5DM73 5FO9B 4OHJA 4JI3M 4KN7C 4WORA 2CQAA 2SEBD 4I7ZC 3J7AS 4H13C 5IGEA 2E2DC 3H3VC 2L4NA 4DK1A 1G8ZD 5A35A 3R8BA 2I7NA 2XFSA 1E2ZA 1UEAB 4HMJA 3NBIA 3GTJB 2O5RA 4UAIA 2CHQA 3MTSA 2KCCA 3OWEB 4G4OA 3WHKA 1SNQA 3R2IA 1N77A 4OL7A 1GUTA 3KDSE 3OSOA 4NXNM 2E76C 5CV4A 5T1IA 3TL4X 4WFN3 1M4VA 1BQQT 1YUBA 4ZUJA 3L25A 2HCIA 4ODGA 1KLGD 3NQIA 3GLHB 5CORA 4LF6M 4K8JA 3GLGA 2R92B 2X69A 2B2YC 1KDBA 2KOLA 3LWEA 5LMNM 1GUWA 1NVMA 5KNDA 1YNND 1PTOC 1NHGC 4D81A 1HQYE 3TE6A 2VUMB 2IX1A 1LTSD 2NTTA 4MB7A 1WD1A 4NOOB 2L12A 1IHZA 2DHRA 5IGDA 5J1ZA 1H9MA 1G3IA 4I4LA 1I4WA 3U6OA 1IXRC 1QAMA 4V190 2Q8RE 4BA1I 4X3SA 5TSSA 3ZC7B 3SAVA 3U6PA 3OIQA 4KKTA 1B4OA 4J6HA 4DV1M 2JA6B 3J7BA 3KLSX 1BCPD 3T53B 3JAML 3MXUA 4I65A 5C18A 4IBDA 3F2UA 4EQNA 1C1KA 3GQ4A 1FR3A 2QEJC 3UGJA 5CR3A 3J7AV 1TWHB 1I50B 3D6CA 4KD4A 3SMSA 2LWXA 1ENAA 2AUJD 1HFNA 1HPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHT B;  4CGY B;  3NBI A; 
#chains in the Genus database with same CATH topology
 1S40 A;  1A2U A;  4B3R Q;  1HNW Q;  2E2J B;  3GTM H;  3ULP A;  1D6E C;  4FD2 A;  1L8Q A;  2HUG A;  4C3H B;  8CAT A;  3D0F A;  3PIP 3;  4DV5 Q;  2EY1 A;  4PMB A;  1LTB D;  4GIT A;  1BXT A;  2GN5 A;  1EY7 A;  3QJY A;  4RAU C;  4B3S Q;  3MFG A;  1XPR A;  1IQP A;  4IPG A;  4JI8 L;  4DR5 M;  3CMA A;  1D5Z C;  1FGU A;  3K58 A;  1QUT A;  5KYL A;  1K82 A;  3KJP A;  1EUJ A;  4IO9 A;  3HHW A;  1XMO L;  2XLJ A;  3NP8 A;  2WFW A;  3R93 A;  1VDD A;  3B6Y A;  4FF2 A;  2HWJ A;  3A74 A;  3K7U C;  1KIX A;  1SDF A;  1Y1W G;  4Z9C B;  1RD9 D;  4DV0 M;  1GHJ A;  4JI7 Q;  4C1N K;  4P17 A;  3HU1 A;  3AOE C;  3VK7 A;  4WRD A;  2F0K A;  2WAQ G;  4OX9 Q;  2KVM A;  3AL0 C;  1WFQ A;  1IL2 A;  3S17 H;  1NNU C;  4X66 M;  3BZC A;  3U4V A;  1VMC A;  2Z9H A;  4DK0 A;  5DYG A;  4O1N A;  3C46 A;  1QOH A;  2VNU D;  2F0U A;  1JOO A;  1NNJ A;  3NWT A;  1PJJ A;  4RWS C;  3K5M A;  2K4K A;  3CCM A;  1B3A A;  1GKI A;  3W1B A;  4LMQ D;  4F87 A;  4Y7N B;  1IKL A;  2UUC M;  1B50 A;  1HRJ A;  4K14 A;  2K5N A;  2CH4 W;  1B8A A;  4IJE A;  1IL8 A;  1PH7 A;  4BY7 B;  1NR4 A;  1YNN C;  3A98 B;  2X6L A;  1WGN A;  1Y1W H;  3PO2 B;  2B2U C;  2EYM A;  2VII A;  1I5F A;  2PQE A;  5FTJ A;  1STY A;  1LV9 A;  2CQO A;  3VKH A;  3VLF B;  4OO1 I;  3G4S A;  1EQV A;  2EOT A;  1XXG A;  1A5T A;  2OCE A;  2JA5 B;  3HU2 A;  4AG6 A;  1WTQ A;  4KLK A;  4IUU A;  4DV6 M;  2LVN C;  1TWA H;  5KNB A;  3SAT A;  1MX0 A;  1E0B A;  1CKN A;  4A3E G;  4LF9 L;  5LMU Q;  1PDQ A;  3TSS A;  4DGZ A;  4X62 M;  1DOM A;  1XHB A;  1VQB A;  2FFK B;  2DZL A;  1LTG D;  4JI1 L;  1BCP C;  4JI3 L;  4RFB A;  1EYD A;  3L3O C;  4IPH A;  2Z4S A;  4RF0 A;  2OQK A;  1JCK B;  1HA5 A;  4II7 A;  2PZT A;  2NZH A;  2WB1 E;  1W5S A;  2Q2T A;  3VYU A;  5M5Y B;  3DZD A;  2G5G X;  3PO3 G;  3PMF A;  4ALP A;  1VEG A;  3B74 A;  2QDL A;  4XXE A;  4CJ6 A;  1QJO A;  3A5Z B;  5G3L D;  4GNX C;  3VYR A;  2FH0 A;  1G41 A;  4A3E H;  3ZJY C;  2K0B X;  3TPZ A;  3CPF A;  5E6J A;  1OFI A;  4FF3 A;  1GJX A;  2R18 A;  4FWD A;  2UUB M;  4IBE A;  1AP0 A;  3S16 B;  4YWL A;  1ZYR C;  2F0G A;  3J80 S;  5E7N A;  5CC4 A;  2QBY B;  5ELO A;  4IJH A;  3B9P A;  4LFA Q;  2C96 A;  4MGZ E;  1T6O A;  1K83 B;  3I72 A;  4PT5 A;  2BA0 A;  4BXX G;  3T56 B;  2WSE F;  3R8F A;  3GQB A;  3J81 S;  3KW6 A;  2KEE A;  5GAE C;  2RA4 A;  2AHO B;  3PO3 H;  4LF4 Q;  2RCN A;  1PTO H;  5LMN L;  4A76 A;  2F5P A;  3BU2 A;  1HR0 M;  4EQO A;  3PV0 A;  4G7H C;  3GO5 A;  4JI0 Q;  4DXG A;  4GHL A;  3UK6 A;  1I4X A;  4JI8 Q;  3AOG A;  5FLX c;  2CRU A;  1WGL A;  2LXE A;  1JQY D;  1VG5 A;  3ZH9 B;  4LUZ A;  2PCF B;  3SAS A;  3SHL A;  1KNE A;  3AFP A;  4RCN A;  1XMO Q;  2XGT A;  1M8A A;  5C6A A;  2B8F A;  4B7F A;  1TY0 A;  1VDZ A;  4XIG S;  2RRU A;  1O7L A;  3KF8 A;  3U6Q A;  3FUW A;  2UUA M;  4CIS A;  3S1M B;  1AEX A;  1B70 B;  1U4P A;  3QG1 A;  5FLM G;  5BN4 A;  4A3D G;  1JB7 A;  4OGQ C;  4IFD I;  5DFL A;  4DR4 L;  4K6D A;  4DV1 L;  1N33 L;  3A54 A;  3VA5 A;  2B63 B;  2D2C C;  3U5Z B;  2MO1 A;  4LJZ C;  1STA A;  2ZBK B;  3EBE A;  3KP1 E;  4Z8X A;  1YHB A;  4DAP A;  4JV5 M;  5C3E B;  1G8P A;  1K28 A;  2JUJ A;  5BPV A;  1GO3 E;  1D0L A;  2PI2 E;  2NQ8 C;  4RKU F;  4G4R A;  1EY6 A;  1SLJ A;  2A6E D;  3RN5 A;  3PVS A;  4HSP A;  3GTO B;  1UFZ A;  5M3M B;  4X64 L;  3H0G G;  5C4X B;  3BYT B;  3TP6 A;  1EWI A;  3HOZ G;  5CV5 A;  1Q1B A;  3R9X B;  4GZY C;  2KCN A;  4U67 3;  1OIP A;  1Y8O B;  2F0W A;  3IAY A;  5FLM H;  5CMD A;  1PJS A;  1VF5 C;  4IUP A;  4A3D H;  2F1M A;  2YU9 H;  3P7J A;  3GTP H;  1RIP A;  1WTP A;  2L9H A;  2EVB A;  3ULJ A;  1MBY A;  5EPJ A;  2CUZ A;  1K9M C;  3P1H A;  4L8R C;  2GVA A;  2Z0S A;  1DGH B;  2N55 A;  1QZH A;  4JI1 Q;  1SRO A;  2F3W A;  4OWX B;  1IXZ A;  4DUY M;  5JJL A;  1JWU D;  2VY3 A;  2M60 A;  1N75 A;  1LUZ A;  3OTO L;  1WCM B;  4DV0 L;  2NVY B;  3MK6 A;  3OIP A;  3HOZ H;  2QCU A;  1UUP A;  3DLL A;  1A3V A;  4LUO A;  3SK4 A;  4KJN A;  1BBU A;  4L16 A;  4FF4 A;  1K73 C;  4A3J B;  3QOL A;  2OO9 A;  2LXJ A;  1EEI D;  3PUY A;  3PUZ A;  2G3Q A;  4XDX A;  3GLG E;  3I4N B;  1JC7 A;  3FRH A;  4JI2 M;  2L2D A;  3LX0 A;  3JAM c;  2MGW A;  1OTR A;  1NSF A;  1EQT A;  2K14 A;  4PV1 C;  3M0E A;  2UUC L;  4EX5 A;  1JIC A;  4K5W A;  2R92 G;  4FXD A;  3OPO A;  3MC0 B;  3B7N A;  2OQ0 A;  3J7A 5;  4OO1 G;  1WJ7 A;  1EWH A;  1PYW D;  2VXW A;  3V96 A;  2YTV A;  3S2D B;  1DO2 A;  2PZU A;  1EE8 A;  3RZD H;  3JAM i;  4H7B A;  4M9Z A;  4DV3 M;  1E9S A;  2CP8 A;  1S5F D;  1IYJ B;  5IGG A;  1K8G A;  2E5L M;  4L15 A;  3UDI A;  2VUM G;  1VQF A;  2KA7 A;  3E4R A;  3D4W A;  4OVZ B;  1KQS A;  1JR0 D;  4F88 A;  2C9C A;  4LRS A;  3NTI A;  5LMN Q;  3WHL A;  3UE1 A;  5IOD A;  4M9S A;  3K57 A;  3S2H B;  1CTM A;  3AFQ A;  3NWL A;  1NE3 A;  3GLF E;  1N78 A;  1SE3 A;  3CC4 A;  3GQ5 A;  1PYB A;  3KF6 B;  4X62 L;  3BOS A;  5KGU A;  4IOC A;  4MIU A;  1N34 M;  2R92 H;  4DA2 A;  4G4N A;  3SAR A;  4B3R M;  4X3U A;  3GLI B;  3E46 A;  1PFB A;  1EYA A;  2NVQ B;  2JA6 G;  5DM6 3;  2DKL A;  2JY6 B;  2KBN A;  3U61 B;  3HHY A;  1Q8K A;  3T13 A;  4DV5 M;  3KLS A;  2QGQ A;  3KUP A;  3ILK A;  1J5E M;  3I4L A;  2VUM H;  3C58 A;  3U60 B;  2N35 A;  4PZ8 A;  1F4I A;  2DN8 A;  4DV1 Q;  1N33 Q;  4DR4 Q;  4LFB M;  3TWM A;  2L0C A;  4HIM A;  3SMP A;  2F0T A;  4KI0 A;  5EP1 A;  4O0A A;  5ELD A;  2WSF F;  5KQD A;  4IBC A;  4XGI A;  3J80 c;  3AMU A;  1E2W A;  1V1P B;  1EYG A;  1OJL A;  1KC8 C;  3M4Y A;  1LT6 D;  2G9H D;  1SRU A;  3FDT A;  3VYT A;  2E2I H;  2ZT9 C;  4JI7 M;  1QUQ B;  1ZKO A;  4KY7 A;  4C3H G;  4JBM A;  2WIN B;  1CKO A;  3J80 i;  3HKZ E;  3I4O A;  5GAG C;  4X64 Q;  2XNA C;  2JA6 H;  1IY2 A;  1WTO A;  4GKJ M;  2PNH A;  1IM2 A;  1G91 A;  3HZJ A;  4TUW A;  1RHP A;  1X3Q A;  2I5H A;  5LHY 1;  2LFN A;  2R93 B;  4I7A A;  4OON A;  4LF8 L;  3T38 A;  3CC7 A;  1DJR D;  3GTL B;  4LWC A;  3CF5 A;  1QIL A;  2CCZ A;  1TWH H;  1HR0 L;  1QAN A;  4JXJ A;  4IUR A;  1C48 A;  4KO8 A;  1PH6 A;  1AW7 A;  2E2J H;  5I2X A;  2ZJR A;  1K0S A;  1EWC A;  1HXY D;  2PNR C;  3NPP A;  4IFD G;  4QNM A;  4C3H H;  3OTO Q;  1PFN A;  2TMP A;  3DEP A;  2OQ4 A;  4K8I A;  2BCO A;  1IY1 A;  1Z6T A;  2B2W A;  4H44 C;  4OIK A;  2UUA L;  4NL4 H;  1JB0 F;  1TH3 A;  2MJ5 B;  1EFW A;  4HR7 B;  2ZJQ A;  2IWH A;  1G71 A;  5LMU M;  3AOE A;  1JWM D;  4ZCK A;  4BY7 G;  4K0K M;  3HEJ A;  3R2T A;  4HJA A;  2Z4I A;  3TZU A;  4A3C H;  4LAA A;  3MEF A;  4TKO B;  3FE3 A;  3CW2 C;  3PO2 G;  1UWV A;  2D9U A;  4IIW A;  2FE8 A;  4KJO A;  2UUC Q;  4F2L A;  4LFC L;  3PF5 A;  1GD7 A;  4XYO A;  3KOY E;  2XZU A;  1E9R A;  1L0Y B;  1D0M A;  4HJ7 A;  2JA5 G;  4A3G B;  2K32 A;  4QHS A;  4WP2 A;  1BDO A;  5KRU A;  2X49 A;  1E24 A;  1F9Q A;  4QUC A;  2JA7 B;  2VF7 A;  2BWE A;  5L37 A;  2M00 A;  2ZTE A;  4GOP B;  1VQP A;  1ET9 A;  1W5T A;  4Y7N H;  3T51 B;  4YHH Q;  3CF0 A;  2EJS A;  2Q2I A;  1B9N A;  1MJG M;  3PNV A;  3U6L A;  2B39 A;  2QCP X;  2J7Z A;  4BY7 H;  1F9P A;  2NTS A;  1UE5 A;  2F0Q A;  3FYD A;  2EY5 A;  2XH9 A;  3M7G A;  4HEO A;  2I46 A;  4K6L A;  1ESF A;  1K3X A;  1G59 A;  5CBA E;  3PO2 H;  4BA2 I;  2Y0S B;  3SR1 A;  1TGU A;  4X62 Q;  4IBJ A;  1E2V A;  1UE7 A;  5C5L A;  1QDT A;  3LW5 F;  2JA5 H;  3L7Z C;  4R4I A;  3LNN A;  5C0X I;  3GLH A;  2C5R A;  5KYI A;  4A93 B;  2V4D A;  1NMG A;  2RQX A;  1PH1 A;  1BNZ A;  4LF4 M;  1NCV A;  4KHZ A;  1KRT A;  4JI0 M;  5ELB A;  5GAD C;  1R9T B;  1H9S B;  1DD2 A;  3SYK A;  1NV9 A;  2EYP A;  3DXJ C;  3FTC A;  1LT4 D;  4CBV A;  4LUV A;  2JA9 A;  2Z3X A;  5DNY A;  2LNH C;  1XMO M;  5EBC A;  5ELE A;  3DM1 A;  5JEA G;  2EJG C;  1R4Q B;  2DZN B;  4GNX A;  4G7O C;  4AYB E;  1H9K A;  1B7Y B;  4RKB A;  3FUX A;  2R61 A;  5M5Y H;  5FTM A;  1XNR Q;  3NUC A;  4JI6 M;  1VQG A;  2E8G A;  5CV6 A;  4DV3 L;  2FJ2 A;  1O7I A;  2E5L L;  1R2Y A;  1FNV A;  2DWN A;  1Q3C A;  2AQ1 B;  3U4Z A;  2F03 A;  1KLU D;  3F1Z A;  4LF8 Q;  3BXW A;  4JI5 M;  2K75 A;  4CIZ A;  1QYR A;  2RGH A;  3CHB D;  5GRO A;  3I4M B;  2JE6 I;  3S16 H;  1HR0 Q;  1QVG A;  1IXS B;  1RF2 D;  2MFI A;  2LY7 A;  3SDZ A;  2V1U A;  3GPY A;  1Q39 A;  2ICE C;  2LKV A;  1K83 H;  4MTN A;  1QDR A;  1K8O A;  2N49 A;  1JR3 A;  3LMM A;  4L6V 6;  2EXD A;  2KHJ A;  3CCR A;  1NJI C;  1MHW C;  3NE5 B;  4B3R L;  4IBB A;  1Q1E A;  2X8A A;  1TWF B;  2UXC Q;  3TBI B;  2B63 G;  1O80 A;  1GXD C;  4P75 A;  4R4Q A;  5M5X B;  3MXN B;  2UUA Q;  4DV5 L;  1EFI D;  1BBW A;  2J7O A;  4GKK M;  2OXP A;  4IJF A;  4HAE A;  3SK6 A;  1J5E L;  2KZU A;  1F9S A;  5C3E G;  4LFB L;  1S5D D;  2VQF M;  4CDC C;  1XX8 A;  5M3M G;  4JYA L;  4JI1 M;  1Z9F A;  3E0J A;  1KL9 A;  3KDF A;  5BR8 Q;  3TP8 A;  3KOW E;  4XK8 F;  4B7H A;  3HGI A;  4LJA A;  4EGV A;  3S1N B;  3T1H M;  3KBX A;  1GVN A;  1GAB A;  3S1M H;  4LFC Q;  4JI7 L;  4BY1 B;  2PZW A;  4IZ8 A;  5ITT A;  1C4Q A;  1VQJ A;  1TY2 A;  4Y28 F;  2Z6B A;  3RFW A;  3SXH A;  1SYC A;  1I3Q B;  2LXK A;  1V1Q A;  5FSW A;  1L1O B;  2B63 H;  3K92 A;  4GKJ L;  4FP5 D;  2YTY A;  1EL0 A;  3Q0A A;  1JOR A;  3I4Y A;  1SYG A;  5HUR A;  2CH4 A;  5EXP A;  2Y0T A;  1EZ6 A;  4DV7 Q;  3I56 A;  1NJF A;  1SSO A;  2N3S A;  3G48 A;  5FO8 B;  1D2N A;  1GUN A;  1T3T A;  5C3E H;  3M7N A;  1B9M A;  2XWB B;  5EBD A;  3GTO H;  3OW2 A;  4O2D A;  4B3M Q;  5M3M H;  1WCM G;  3A7L A;  2VF8 A;  4RHR A;  1TKW B;  5C4X H;  2HQL A;  1NY5 A;  3HGB A;  3K2L A;  1SJE D;  2Q8T A;  4MGK E;  1XYI A;  4LJ4 A;  3AKZ A;  2K47 A;  1ICF B;  1V34 A;  1BCP B;  2ZJP A;  3FTD A;  3TDQ A;  4ULL A;  4Y52 H;  3I4N G;  4L4U A;  1O7Y A;  1X37 A;  1HFG A;  1E7Z A;  1XNQ L;  2F0E A;  2RGO A;  4BBR B;  4NXM M;  2EYO A;  3NBH B;  1I94 Q;  5LMU L;  3OMG A;  4LNQ A;  1CSP A;  4K0K L;  1E94 E;  3PIO A;  5M3F B;  3H4M A;  3Q8G A;  1L0X B;  5ELF A;  1U4M A;  2BJW A;  1U4R A;  2JN4 A;  3O13 A;  3IKJ A;  3K6O A;  3S24 A;  3P75 A;  1XWI A;  3PXG A;  4OIJ A;  2OWO A;  5FLX S;  1KHI A;  3GPP A;  1Q46 A;  4PCZ A;  1Z5A A;  2MH8 A;  4A3J H;  1R6B X;  2XIW A;  4X65 M;  4DR4 M;  1N33 M;  4IPC A;  4QIW E;  3V05 A;  3U6S A;  3G7L A;  2E5L Q;  3TS2 A;  1TWG H;  3SAW A;  2B2T A;  3IEC A;  4D82 A;  1FVI A;  4DAY B;  5CGK A;  1CQF A;  4F1I A;  5EP2 A;  2D0P A;  1QWY A;  3OHX C;  4GIP A;  2DWL A;  1VQ9 A;  1X9N A;  2IY5 B;  3RGP A;  3M3Y B;  4PNY A;  5C0X G;  1CUK A;  1Z59 A;  4X64 M;  1IFY A;  2HIV A;  5GAH C;  4FCV A;  1VQM A;  1IN5 A;  1LT3 D;  4XT1 B;  2AQ3 B;  5JPN C;  3EQL C;  1SXJ A;  2ALY B;  2CV1 A;  4DNT B;  3S9W A;  5BN3 A;  3CPW A;  3HS0 C;  1SYB A;  1IBK M;  3S2H H;  1M90 C;  4DXF A;  2EO2 A;  1HT2 E;  1F2L A;  4LF4 L;  2R65 A;  2FNA A;  5E26 A;  3FTF A;  5IT9 E;  1J5E Q;  3KVW A;  4HLQ A;  4C2M B;  4JI0 L;  2XTI A;  2JEA I;  1SMX A;  2QPA A;  3PQI A;  4LFB Q;  1HTL D;  1STG A;  3TEH B;  2DI0 A;  1WTW A;  3EJI A;  4X6A H;  3T1Y L;  2NVQ H;  2V6Z M;  4JYA Q;  3HOW B;  1G6P A;  2J7N A;  5C0X H;  3G6J B;  4L6T B;  4LK1 C;  1BVS A;  4PMW A;  3OTO M;  3VR2 A;  2AWO A;  3Q24 A;  2R93 G;  3H6M A;  2B8G A;  2EJF C;  1D5X C;  1YZ6 A;  1LTM A;  4JI6 L;  3C9P A;  2K01 A;  3QWL A;  3SC3 A;  4GKJ Q;  4XQN A;  3NBX X;  2JWS A;  3HJ8 A;  3U58 A;  2RKO A;  3RZO B;  1EZ8 A;  4JI5 L;  3VDY A;  1MKH A;  5JI3 E;  4FWH A;  1UEB A;  4WJW A;  1NAP A;  3A8I E;  1Q8I A;  3ICE A;  2R44 A;  5JJI A;  3I51 A;  2CHV A;  2Z8L A;  5ITX A;  3CP0 A;  2KA6 B;  1L1O C;  3JAM S;  2K05 A;  2XVS A;  2K1B A;  2L7I A;  1BOS A;  2LVA A;  4KY5 A;  2R93 H;  4YWK A;  2ES2 A;  4JVZ A;  2P5Z X;  3TWK A;  3WDN A;  4BWG B;  3ND9 A;  2K7V A;  5NUC A;  4YHH M;  3CAM A;  1GL7 A;  5AFW A;  3F8T A;  5KPR A;  1XNQ Q;  4DN4 M;  2YR0 A;  2NVX B;  1N34 Q;  4GKK L;  3OOC A;  4IPD A;  4ABN A;  1R4G A;  2PQA B;  1YIT A;  5DYI A;  2VQF L;  5F2D A;  4L5S A;  4K0K Q;  1C7Y A;  4A3G G;  1S72 A;  3W67 A;  1XXH A;  1Z5B A;  2KZS A;  4R4T A;  1VQD A;  2JA7 G;  3H3V H;  3T1H L;  3MHV C;  1DGH A;  1LTI D;  1QCB D;  3DWP A;  1WVL A;  1QVC A;  4J8Q A;  5IYB G;  3FYC A;  3FUV A;  3FKI B;  4PD2 A;  1KAA A;  2FHT A;  3D4R A;  3KYH C;  4P73 A;  5FKA C;  4C56 C;  3K81 C;  1QAO A;  3FPU B;  4KMU C;  2KRK A;  2QSF X;  1AE3 A;  1UE6 A;  2PMZ B;  4FYD A;  1PMR A;  2HHH Q;  1Z5C A;  2KHH A;  5EQT A;  1F77 A;  2QKI C;  2DY8 A;  4ANR A;  3KOX E;  2Y0S G;  3HHX A;  1ZAE A;  1YHA A;  3DMU A;  4JI4 Q;  4EIW A;  3UZU A;  1Q3L A;  1TF0 B;  4A3G H;  4PG3 A;  2JNH A;  1NUC A;  3CC2 A;  3PUW A;  3M4O B;  3GLF B;  5I2Y A;  2JA7 H;  4LF7 L;  1JT8 A;  3TP7 A;  2KCM A;  4A93 G;  1XNR M;  5E1F A;  1I6H B;  1EEF D;  4NMZ A;  1I4R A;  2O01 F;  1Y8P B;  4EVO A;  1W6K A;  4C3J B;  1PRT D;  2KJX A;  2RHS B;  3BDO A;  5ISR A;  5IYB H;  1QVF A;  1OKS A;  1AE2 A;  4N8F A;  1LTA D;  3KP0 E;  4HIK A;  1KTK A;  3CF6 E;  1V8Q A;  4LF8 M;  5ELC A;  5EKK A;  1EY8 A;  1XC8 A;  3TRE A;  3MFY A;  4IFD J;  4NXM L;  1R5L A;  1PJI A;  4POG A;  1CM9 A;  4OVZ A;  5C3X A;  2QA4 A;  3I90 A;  1HUN A;  3WOF A;  1MSG A;  4KLN A;  3CD6 A;  3C2P A;  1LO5 D;  2R6F A;  4G3O A;  1QAQ A;  1F9R A;  3BJU A;  4K2K A;  2Q2U A;  1HHV A;  1D1I A;  3KBG A;  3J7Y W;  1Z47 A;  3T1Y Q;  1VQC A;  4G4Q A;  5JPM C;  3JC6 6;  4RKL A;  2ASB A;  1XTC D;  1TR5 A;  1HZB A;  2B29 A;  4A93 H;  2NBF A;  3E0E A;  2UXC M;  3HOX B;  3FKE A;  1B3Q A;  4DR1 L;  2LMC B;  5JVG 3;  2BOS A;  4P74 A;  2D62 A;  4I81 A;  3PCO B;  4BXX H;  3I4M G;  3HKZ B;  4JI6 Q;  3K7A H;  3U61 A;  1NO1 A;  4X65 L;  1YVC A;  1CFM A;  1GO5 A;  2JP7 A;  2HDM A;  2R0I A;  3U60 A;  4JI5 Q;  2MP1 A;  3U50 C;  4P72 A;  2UU9 M;  2O4X A;  2NZO A;  3ONA B;  5BR8 M;  3PIO 3;  5H37 D;  4CGY B;  3EIV A;  1NHW C;  1Y1V B;  2FS1 A;  4LFC M;  1OFH A;  2DHY A;  2B2V A;  1YNJ D;  2F0F A;  4AKG A;  2QDB A;  1M1K C;  5I9O A;  1DGF A;  1L1Z A;  1I4P A;  3PNY A;  3FRP B;  1SXJ D;  4NKL A;  1ENF A;  3M85 A;  2QP9 X;  3K0Y A;  1SG9 A;  5A2Q L;  2L7H A;  3DOA A;  1PRT F;  2DAE A;  1XMQ M;  1W2B A;  3VK8 A;  4DV7 M;  3I4M H;  1WYD A;  1IBK L;  4S12 A;  1KDA A;  2KHS A;  5M5W B;  5KEE A;  1JJC B;  4GKK Q;  2VZA A;  4FXK C;  5JOB A;  4RGO S;  3K9O A;  4AIM A;  4B3M M;  3MXP A;  1WTR A;  4ZKC B;  2VQF Q;  1VQO A;  4BY1 G;  1QZM A;  4PDI A;  1P3Q Q;  1HUM A;  1E3P A;  2R7F A;  1XWE A;  1K3B C;  3SK5 A;  1X56 A;  1PRB A;  2C99 A;  4ID6 A;  3C3D A;  1J6Q A;  5EP3 A;  1GUS A;  1GL6 A;  4DNR B;  2W82 A;  1V43 A;  2TSS A;  5M5X H;  2V1C C;  4IUN A;  3T1H Q;  2YQZ A;  3H0G H;  1ZEQ X;  4KTA A;  1CKN B;  3PUV A;  2P5T A;  4B7G A;  5JEA J;  2DAM A;  4ME3 A;  3QIA A;  1NJG A;  4DV4 L;  4QUF A;  2H4O A;  2EY2 A;  1I94 M;  3WWV A;  4R9W A;  1OAI A;  2QHO B;  2G5D A;  1TS3 A;  2YTX A;  2FMM A;  1F2M A;  1GUG A;  3J27 B;  1FL0 A;  4MGI E;  4LG2 A;  2MQH A;  3S1N H;  3UMM A;  2NZ1 D;  4BY1 H;  1YI2 A;  3SHG B;  2F4V M;  1EY0 A;  3QR8 A;  1I3Q H;  2RBM A;  1BR9 A;  3GTJ H;  3F2D A;  4LF7 Q;  1L1T A;  1UAP A;  3QB3 A;  2OEO A;  4BBR G;  4CDD C;  5IRE B;  2VQE L;  3ERS X;  5IOC A;  5K5P A;  4CHT B;  4LGY A;  3N6R A;  4RGM A;  1YSY A;  4IBK A;  1YJ9 A;  2K5H A;  5IE8 A;  2J4X A;  1VQ1 A;  1QB5 D;  2F0P A;  5M3F G;  4YHH L;  1C0A A;  3Q6S A;  3R3O A;  1X55 A;  2MUY A;  2F3I A;  3IG8 A;  4OEM B;  3ULL A;  5IGF A;  5C44 B;  1GHK A;  1NSN S;  4NXM Q;  5F3W A;  1OQY A;  2XGN A;  4GOP A;  1PJQ A;  3GV3 A;  1PZI D;  3FRI A;  1SE4 A;  2B2Y A;  2D7H A;  4LGM A;  2JYO A;  3EN2 A;  4JOI A;  2H1R A;  3H15 A;  1FD7 D;  4R71 A;  4MHE A;  3S1Q B;  4KKU A;  1QE6 A;  2F52 A;  2B3G A;  4Q5V A;  3B89 A;  2IHE A;  4OO1 H;  3VR5 A;  2K5D A;  2ZTC A;  4LRT A;  3UDF A;  3K8Z A;  1SNO A;  2ZTD A;  4M0W A;  1L0W A;  4BBR H;  2Z6K C;  4AYB B;  2DNE A;  1S5E D;  1KDC A;  1R4P B;  1WJJ A;  2HIX A;  3I2Z A;  5IGB A;  5KQ8 A;  4FWG A;  3MWY W;  2JXN A;  2I5L X;  3I7F A;  2R7Z B;  4ZK9 B;  1J09 A;  2A6E C;  1IXR A;  1X3F A;  2Q2E B;  1SAP A;  4RCO A;  4NRW A;  1VQA A;  4X65 Q;  5M3F H;  4DR2 Q;  2EKF A;  5HGQ A;  2EYH A;  5LMN W;  1JQJ C;  1SEB D;  1SXJ E;  2KHI A;  4B9W A;  1EIH A;  4JYA M;  1II3 A;  4R1J A;  1H9S A;  4EQP A;  2XSZ A;  4GEW A;  3GD7 A;  1NNX A;  3KF8 B;  1E22 A;  3KSX A;  2PYK A;  3N52 A;  3I70 A;  4DFA A;  3H4J A;  3I3C A;  2Z4R A;  4FW9 A;  2AMC B;  4CKE A;  5J39 A;  2X4A A;  1PA6 A;  2HKJ A;  1ZMW A;  1XNR L;  4A3V B;  5BN5 A;  1T5E A;  1FYC A;  3U9S A;  4BBA A;  3K0X A;  4RHS A;  5IT9 L;  3S17 B;  1TS2 A;  3M4Q A;  1WXQ A;  4QCL A;  2F0H A;  5CV7 A;  2JY5 A;  1ASZ A;  2CV2 A;  2OF1 A;  3ER0 A;  1IBK Q;  4UHV A;  2NWG A;  2A5Y B;  4LF5 M;  3IHP A;  1I50 H;  5EXX A;  3HOW G;  1V9P A;  3M3Y H;  3M4P A;  1CT1 D;  1MU5 A;  2HCB A;  3RMH A;  3SHF A;  4JW0 A;  1AFP A;  1SNP A;  1HT1 E;  4AKI A;  3NSW A;  1P8L A;  3U6D A;  2R4E A;  3I04 M;  3OWF A;  4TVA B;  3HOV B;  1VQN A;  4RF1 A;  3W68 A;  1SFO B;  2UXC L;  2MRO B;  2VDB B;  3NEN A;  1YLA A;  3RE8 A;  4ZUI A;  4C2M H;  1ASY A;  4N9P A;  3S1R B;  2L4F A;  4I5S A;  3K59 A;  3GO8 A;  1XNQ M;  1ZXT A;  3KS4 A;  1OO9 B;  1EY4 A;  3UJN A;  4ZQ3 A;  3B7Q A;  4DV4 Q;  1PH2 A;  5AJ3 L;  1MIU A;  3MXN A;  2F0S A;  4NB3 A;  4H02 A;  2K04 A;  3OMC A;  3D6W A;  3HOW H;  1KNA A;  1H6U A;  2I7P A;  3MJ5 A;  1SMY D;  3NK9 A;  2UU9 L;  3AB9 A;  4L8J A;  3GRV A;  1SN8 A;  4B9X A;  4DNI A;  5BR8 L;  1PGY A;  1BO0 A;  1SYF A;  3J81 E;  4HJ8 A;  3CGW A;  4G6Z A;  5E4X A;  3UDG A;  2EY6 A;  4QF4 A;  5I9P A;  5ELN A;  2WII B;  4KY6 A;  5JJK A;  1KFV A;  2XFT A;  1EY9 A;  5EKL A;  5I4D A;  4IFD H;  4CDF C;  1J7K A;  5FK9 C;  2DUD A;  1QNU A;  5D3D A;  3RZO H;  2JA8 B;  1HQC A;  1XXH E;  1SNM A;  3WOE A;  2VQE Q;  1G2T A;  2HHH M;  5C0X J;  1XMQ L;  1IN8 A;  4DV7 L;  4DV2 M;  2EKK A;  1DV0 A;  3FEW X;  2ZAO A;  1CZG A;  1G51 A;  1OXS C;  4P16 A;  1EQQ A;  2B2U A;  4JI4 M;  3IRB A;  2ENB A;  5EXS A;  2BH2 A;  3VFD A;  1PZJ D;  3A7A B;  1GOZ A;  1TS4 A;  1YJN A;  1K3R A;  4A3L G;  4DKA C;  4B3M L;  4I8O A;  2F0N A;  2DAI A;  2GVB A;  2IL8 A;  3BVG A;  4XYQ A;  3FKI G;  1JWS D;  1V1O A;  2AQ2 B;  3RLO A;  3FP9 A;  4QQB X;  1I4G A;  1AUA A;  2HQE A;  1VQ4 A;  3D8L A;  3OYY A;  2FOI C;  1HQM C;  1EYC A;  1OXT A;  3HJQ A;  4Q0F A;  1MSH A;  3BS1 A;  4QGU A;  2NVX H;  1KRS A;  1N9W A;  1O7Z A;  3X3N A;  4NRV A;  2PW5 A;  2B3T A;  3NHH A;  3K5L A;  2R62 A;  1UE1 A;  2AHM A;  4FO2 A;  2XZF A;  2K28 A;  5E4W C;  4DK3 C;  1I94 L;  1UNS A;  3CCE A;  1DOL A;  4QIW B;  4R7G A;  4FVM A;  4MM3 B;  3CQZ B;  1Y8G A;  2LBC A;  3T1Y M;  3FVQ A;  4A3L H;  2ZXO A;  4FXG C;  1IY0 A;  1PXU A;  1Z6H A;  4C3J G;  1X54 A;  1UM8 A;  4DR7 M;  2F4V L;  3KFU G;  4A3F B;  3LCV B;  2F0J A;  4UP7 A;  3VR6 A;  5IGC A;  4CKC A;  2IJ0 A;  2DGY A;  4DAM A;  4K5X A;  1W6J A;  4FNF A;  3T6P A;  1D0K A;  2A5H A;  1OTC A;  3BG3 A;  3VKG A;  2I0Q A;  1OAO C;  2APL A;  3A46 A;  3D31 A;  1B53 A;  1YHQ A;  1G29 1;  3L29 A;  3K5O A;  2KNA A;  7CAT A;  3LWU A;  2M2L A;  3M4O H;  2E75 C;  2EZV A;  1STN A;  3W0F A;  4E6I A;  1W3S A;  1PH9 A;  4DAY A;  1VQ7 A;  1I6H H;  2I07 B;  4NDX A;  4GN3 B;  4F8M A;  1ZQ9 A;  1RDP D;  3HOX G;  1VQ6 A;  2BH8 A;  2R45 A;  1PTO D;  4C3J H;  2SNM A;  1IN7 A;  5JEA H;  4IBI A;  1VEJ A;  3HKZ G;  2JQO A;  3L2A A;  4WW0 A;  4GN4 B;  2Z1C A;  1SMY C;  2MPM A;  1PH5 A;  1WTH A;  1D2B A;  3HY5 A;  3DM3 A;  1STH A;  3EIE A;  4REZ A;  2F3V A;  4JC0 A;  2EYL A;  4MN3 A;  1G4A E;  3HFZ B;  3F92 A;  1B44 D;  2A69 D;  5A2Q E;  1WR1 B;  3J81 j;  3F2B A;  1A63 A;  5AJ3 Q;  1Y1V G;  3UE0 A;  1TWC B;  2BE5 D;  3S15 B;  4GLV B;  1HR0 W;  3KOJ A;  3VR4 A;  1SNC A;  3GP1 A;  1NR2 A;  5EAY A;  3SE0 A;  2UU9 Q;  1ORY B;  4AI6 A;  3HOX H;  1L2C A;  1L2F A;  2C5C A;  4KD3 A;  3C3L A;  5DNF A;  3H94 A;  2LH0 A;  2HCC A;  3ZCB B;  2ZAM A;  5ITR A;  4G57 A;  4L63 B;  4RH6 A;  3HJS A;  3NTH A;  2Z7J A;  2WAQ E;  4HJ9 A;  4MNO A;  3T15 A;  4GH9 A;  1CZW A;  2O5I C;  5FLX L;  2D5D A;  1D7Q A;  3VDP A;  1E1T A;  4YCU A;  1EY5 A;  3H09 A;  2C9O A;  1A3T A;  1XMQ Q;  3GPU A;  3PGZ A;  3MVV A;  1JJ2 A;  4JN6 A;  1Y1V H;  3AQQ A;  1YJW A;  2VB3 X;  2EJM A;  4LF5 L;  4LZJ A;  3FD9 A;  5EJC A;  3G71 A;  3Q23 A;  2CE7 A;  2EUC A;  1HJP A;  1HA6 A;  3GRR A;  4HSV A;  1XJV A;  3V2T A;  2WKC A;  3A45 A;  4GLX A;  4LF7 M;  3P20 A;  3HG9 A;  1S3S A;  5IZ7 D;  2KEN A;  4OXP A;  1PTO F;  4XBO A;  1TH2 A;  1IKM A;  1Q02 A;  1U9R A;  1DZ1 A;  2JP1 A;  2ZM6 Q;  3RZD B;  5IYC G;  4P71 A;  5M5W H;  1FNN A;  2JZ1 A;  2N88 A;  2JZ0 A;  3SBJ A;  1H95 A;  4R8I A;  2OTJ A;  2WB1 B;  4CDE C;  4TQU S;  3U6M A;  5E3F A;  4NSR A;  2V1C A;  4HMI A;  2KEC A;  4LJ5 A;  5CV9 A;  1DOK A;  2F0L A;  3PF4 A;  3GRY A;  3PSI A;  3ZQJ A;  1TVX A;  2FIN B;  4ZLT F;  3FUT A;  2UXB M;  1DCZ A;  1SND A;  1EOT A;  1DGG A;  5FTK A;  3HRZ C;  1ZV1 A;  2PQA A;  1LT5 D;  1MGS A;  4HID A;  1IZ6 A;  1PH8 A;  4UY8 C;  3K80 C;  1WCM H;  2NVY H;  2K6A A;  1DGS A;  3GPX A;  1V33 A;  4D80 A;  4C3I B;  2E74 C;  3KS8 A;  2F4V Q;  3A0J A;  3A42 A;  1J9O A;  4DR1 M;  1AZQ A;  1VDL A;  1WTV A;  4WJ4 A;  5IYC H;  5C44 G;  2RF4 A;  1S4Z A;  2DWM A;  2Z8Y M;  3KK7 A;  4ZRZ A;  2RDF A;  3IFD A;  4AH6 A;  2D7G A;  3I4N H;  5D14 A;  2HHH L;  4DR2 M;  4KHV A;  3W0L B;  5K36 G;  2BNK A;  5DLQ E;  2Y0S E;  2IX0 A;  3RGS A;  4DV2 L;  1U0L A;  5IT9 c;  2JY7 A;  3CU7 A;  4S3S A;  4JI4 L;  3GTG B;  4UDU C;  4QY7 A;  2Z4H A;  2ERC A;  1HNZ M;  3S14 B;  1X65 A;  3S2D H;  4MGH A;  2Y0Q A;  4R4C A;  4AYB G;  2A69 C;  2HAK A;  2JEB I;  2E2I B;  3Q22 A;  4OU7 A;  1SE2 A;  1EQR A;  2A68 D;  1GM5 A;  2BE5 C;  2R7Z G;  1Q86 C;  3SFZ A;  2LS0 1;  3QAU A;  1VEK A;  3GLF A;  4HL4 A;  1N8R C;  3K9P A;  3AYH B;  3LQQ A;  4DF7 A;  3GTK B;  4IUV A;  2MHV A;  2QBY A;  5C44 H;  4JBW A;  4BLC A;  4NP5 A;  3LQR A;  2VB2 X;  3BVZ A;  3NXW A;  5K36 H;  4CJ2 C;  4GHA A;  1GJS A;  2KNZ A;  4KV6 A;  3QYB A;  3A8J E;  5D65 A;  3DWQ A;  3J2P B;  4DR1 Q;  3I8Z A;  2NVT B;  2LHC A;  3S1Q H;  4OWT B;  3TQS A;  2KED A;  1X3P A;  5IWA M;  3GQ3 A;  4KN4 C;  3RN2 A;  4J1M A;  3HZX A;  4R8N A;  1SE8 A;  1K3W A;  2DZO B;  4DR7 L;  4A3K B;  2R7Z H;  2R3Z A;  5FOB B;  4IBG A;  4AZF A;  2OOA A;  3TME A;  4JBK A;  1ZYR D;  3FPP A;  3NQT A;  4DV4 M;  3CTW B;  4MZ9 A;  5LL6 S;  5JI2 E;  4KHP L;  2LVQ D;  2IW3 A;  1A15 A;  2QW7 A;  1OXV A;  3KDF B;  1JMC A;  3BDL A;  4YCW A;  1N32 M;  2AWN A;  3T16 A;  1CA5 A;  1IBL L;  1PV4 A;  2VL6 A;  4DUZ M;  1X3E A;  4M1U B;  1STE A;  1YBY A;  1SJH D;  1GLN A;  1A6X A;  2E2H B;  2B2W C;  4LF5 Q;  3U5Z A;  5C3W A;  5C1B A;  1LTR D;  2EA0 A;  4A3M B;  3HOV G;  5COY A;  3U9O A;  3TN2 A;  1PHJ A;  3C3E A;  3MXG A;  1VMP A;  2UXD Q;  1JR3 D;  3DA1 A;  4G4K A;  3A55 A;  2RSN A;  4W5W A;  2ID0 A;  3HX3 A;  4IBF A;  2VQE M;  3TS0 A;  2F0I A;  4B08 A;  3W3A A;  2RDH A;  1QVR A;  3TRZ A;  3HWS A;  3J80 L;  3GTL H;  1GKH A;  2DVW B;  4CJ1 B;  5KIX A;  5IY0 A;  2O25 A;  4PMC A;  1G2S A;  2GA4 B;  1CK1 A;  4JCV E;  3L28 A;  1BCP F;  5JAV A;  5J22 A;  2A8V A;  5C4H A;  3K1J A;  1SBB B;  2QIL A;  3A5U A;  1S3O A;  2LHG A;  1LM0 A;  1D1K A;  3E5S A;  4IN3 A;  3EFX D;  3J81 L;  2I5M X;  5EPL A;  4OEL B;  1VQH A;  4LCB A;  1LLR D;  2R4J A;  4AG5 A;  3D3R A;  3RD4 A;  5CBE E;  1PRT B;  3GLG B;  3HOV H;  4IOA A;  2C35 B;  1Y14 B;  1RCV D;  3QO2 A;  1PH4 A;  1SFO H;  1H9R A;  2NN6 I;  5D3I B;  4AQY Q;  1XB2 B;  2JA8 G;  5GKN A;  3S1R H;  2A6H D;  3J7Z C;  1L2D A;  5CYU A;  3J7A F;  2CWB A;  1HNX M;  1IN4 A;  3E21 A;  1EU4 A;  4UN2 B;  3SVM A;  4DR3 L;  3CCS A;  3RNU A;  2GQF A;  2QQ8 A;  3M9B A;  2A68 C;  4YY3 Q;  5H1S E;  4R3D A;  4DV2 Q;  2NB0 A;  4LZZ A;  3GLH E;  1VCI A;  3LVV A;  1B2T A;  1VS0 A;  1TDH A;  3ND8 A;  4NSO B;  1CHQ D;  2SDF A;  2XRS D;  1QNK A;  4RGN A;  4XTC S;  2JA8 H;  3HP3 A;  3QOJ A;  1ZMU A;  3FTE A;  2F5S A;  2NYZ D;  1I4H A;  3Q8X A;  3CCL A;  3HOU B;  1GVP A;  3HKP A;  1CSQ A;  1HQR D;  1JE5 A;  1S5B D;  2EXZ A;  3OW7 A;  2XEP A;  4NXN L;  4ITQ A;  1A3U A;  1HH2 P;  4B3T M;  1Q7Y C;  3UDX A;  2A19 A;  3IFT A;  3GP7 A;  1ET6 A;  2EPB A;  4PQX A;  3CCJ A;  5C4Z A;  5FJ8 G;  2OPF A;  4A3F G;  4G7Z C;  1NY6 A;  1VF7 A;  4A3B B;  2C98 A;  2UXB L;  4QB4 A;  1SXJ B;  4QMG A;  3IG5 A;  1XPO A;  1WHC A;  2N8N A;  5L8R F;  2JJQ A;  2L55 A;  1AH9 A;  3E3X A;  4PDG A;  4LF6 L;  2Y20 A;  4BBS B;  2DJF C;  3KF6 A;  4DR7 Q;  4IUQ A;  2QNJ A;  4GLA C;  5C4J B;  2JK8 A;  1Y8N B;  1C8C A;  3GLI A;  4AKH A;  2HT1 A;  2L09 A;  2F4I A;  1TDZ A;  2KRU A;  2WZJ A;  1R9T H;  2DWZ B;  4XQQ A;  2EYJ A;  1JR3 E;  2AUK A;  4KHP Q;  3HOY B;  2CKZ B;  5EJW A;  3CQZ H;  4DR2 L;  3AJI B;  1IBL Q;  4ZAI A;  3E6Z X;  3CME A;  1HCZ A;  4X3K A;  5FJ8 H;  1LV7 A;  4A3F H;  2A1A A;  2ICI A;  4UP8 A;  3KLR A;  2YFQ A;  1K8M A;  2EE1 A;  1HNZ L;  2CHG A;  1X32 A;  4J15 A;  2F0D A;  5ITQ A;  4XT3 B;  1V1P A;  2MR9 A;  4QHT A;  1JOK A;  4WUR A;  3FMC A;  4KT0 F;  3JR5 A;  1N36 M;  1OIZ A;  1FJG M;  1TR8 A;  2CHB D;  1BF4 A;  4YCV A;  1BKB A;  1MJE A;  1QUQ A;  1I6V C;  1HTP A;  1IBM M;  1TS5 A;  2O5J C;  1EIG A;  4JPB W;  4CJ0 B;  1U5K A;  1X6O A;  4A3I B;  3STB D;  4HCE A;  3BVM A;  2QF7 A;  4LY6 A;  4MH0 E;  1ILQ A;  2A6H C;  5G3L F;  3AFH A;  5FLX E;  3L26 A;  3C1F A;  1FGB D;  3LGJ A;  4DPG A;  1WI5 A;  2WP8 J;  2XN9 C;  3H91 A;  3QYE A;  5IWA L;  2JA2 A;  3MMP A;  4RG1 A;  3RLF A;  2CFO A;  1TWF H;  3URY A;  2IHF A;  2ZM6 M;  1ILP A;  2R6G A;  2MGS A;  3W1G A;  4LJ7 A;  3SK8 A;  1D5M C;  4GRI A;  3JR4 A;  4HIO A;  2K33 A;  1IW7 D;  1TWC H;  2J5Y A;  3SEB A;  4DR3 Q;  1VQL A;  3SGI A;  3S15 H;  4WJ3 M;  1MJC A;  2KUM A;  4LF9 Q;  1XXH B;  3I91 A;  5HGT A;  4DR5 L;  4M8A A;  1JB3 A;  1N32 L;  3KXE C;  1PRT C;  4DUZ L;  5M9O A;  4X3T A;  3EIH A;  4JI3 Q;  2DXI A;  3I73 A;  4L5R C;  2RCF A;  2PPB C;  1PJT A;  4Q7J A;  4QOS A;  4L5T A;  4Z6Y A;  4NPS A;  2CEA A;  4GMQ A;  3SYL A;  2J0T D;  1TU2 B;  2WB1 G;  1PVO A;  2YYZ A;  2RHQ B;  4GC5 A;  3TQY A;  3VYS A;  3T4A C;  4X66 L;  1WTX A;  2BJV A;  4IUT A;  5KNC A;  1VQ8 A;  3V76 A;  4NXN Q;  1MI2 A;  1QG7 A;  1BUV T;  2JSO A;  1Q82 C;  1YIJ A;  1K8A C;  4L78 A;  1XTD A;  1TWG B;  4TSS A;  5HY6 A;  1V92 A;  5DAU A;  2NN6 G;  5LL6 X;  3U6C A;  2CV0 A;  2IPK D;  4C3I G;  5EXT A;  1KYI A;  1X3G A;  4V0B A;  1EIY B;  2N78 A;  3HU3 A;  1AZP A;  3GTQ B;  4BS9 A;  5A2Q S;  3MEH A;  1D8L A;  2EIF A;  2UXB Q;  1NBW A;  2B2T C;  4DBG B;  4HJ5 A;  1CI3 M;  4JG2 A;  2PMZ E;  1EIF A;  2QEX A;  3RUZ A;  1R7R A;  4LF6 Q;  1HZC A;  5IIF A;  4OWW B;  2RVL A;  1RU3 A;  4EQ5 A;  5IP9 G;  2QZ4 A;  1PFM A;  2K03 A;  3GTM B;  1KD1 C;  2YNM D;  4CKB A;  4DV6 L;  5DEH A;  1HNX L;  4DU9 A;  1ENC A;  1SR3 A;  4DR6 M;  1YNJ C;  3L9A X;  5EQ0 A;  3CXC A;  5IP7 G;  3JAM E;  2KEB A;  2KNV A;  1SXJ C;  2RDG A;  3RR5 A;  1CKM A;  1TH4 A;  2NN6 H;  1JOQ A;  1RL2 A;  1HZA A;  4C3I H;  1HZ9 A;  1TXY A;  2L6O A;  3LVW A;  3STB C;  3LCU A;  1HNW M;  1HNZ Q;  3CRK C;  4OW0 A;  2WAC A;  1ICW A;  3MA2 B;  4ZYS A;  1G6Z A;  5FO7 B;  1RKN A;  1TQO A;  2F0M A;  1U4L A;  1H9J A;  5JJZ A;  4O42 A;  3E9S A;  3RLN A;  2X6G A;  5IP9 H;  4XQJ A;  4B3S M;  1EU3 A;  5EPK A;  5KPT A;  1RTO A;  2AKW B;  3ERO A;  3C1E A;  3GTG H;  2DNA A;  4K2L A;  1A2T A;  3D8B A;  4B3T L;  2XRQ D;  1QUS A;  3S14 H;  3NTK A;  1WIV A;  4DAV A;  5IP7 H;  2L4E A;  1K0R A;  4GC9 A;  3BZD B;  3CRL C;  2ATW A;  2K5V A;  3GRU A;  1Y69 U;  2UUB L;  2KQ3 A;  2JY8 A;  1KSF X;  1IW7 C;  2SOB A;  4A3K G;  3DFZ A;  2HL7 A;  2UXD M;  1DXM A;  3I4V A;  1T5X D;  3J81 c;  4JK1 C;  5IWA Q;  4OX9 M;  1JE4 A;  4FDB A;  1WD0 A;  3GTK H;  1IXS A;  2ZAN A;  1YNX A;  1FNW A;  3PUX A;  3QWN A;  3TWL A;  3A8K E;  5ITU A;  2LVO C;  1Y1W B;  4IAL A;  2MO0 A;  4JBJ A;  1T9H A;  4RNA A;  3J81 i;  1Q3B A;  2WAQ B;  5ITX E;  1STB A;  2NUC A;  1F2Y A;  2NVT H;  5KPZ A;  1S5C D;  5J3B A;  2F5N A;  4A3M G;  2XSC A;  1VQ5 A;  4A3C G;  4H0L C;  5I6W A;  3J80 E;  2CVR A;  2FMC A;  5IYD G;  2OT2 A;  2DAG A;  1TWA B;  4DR5 Q;  3NEM A;  1N32 Q;  4HN7 A;  1DM0 B;  3M6A A;  2K5W A;  4DUZ Q;  2OOB A;  4A75 A;  1ESR A;  5CV8 A;  2IX3 A;  3MZ5 A;  1FNU A;  5EKI A;  5FTL A;  4A3K H;  2M5Z A;  4AQY M;  3PFI A;  4L5Q A;  3TP5 A;  1PLF A;  1Q12 A;  5I6Y A;  1O78 A;  5T1G A;  4DV0 Q;  4HTH A;  3AEV A;  1N36 L;  1FJG L;  2ZXP A;  2CW0 D;  4ME5 A;  4P2C B;  4X66 Q;  3CCU A;  3AV0 A;  1IBM L;  4YY3 M;  3CKI B;  2M9V A;  4HED A;  1EIJ A;  5EGT A;  2WKD A;  4NW2 A;  2VW9 A;  5C5M A;  1L1O A;  2E2H H;  1I4Q A;  4A3M H;  2KXE A;  1ZMV A;  2KCT A;  5IYD H;  3DUZ A;  5EP4 A;  1ONL A;  1KAW A;  4JV5 L;  1EFU B;  2F0V A;  1CQV A;  3FUU A;  5JVH 3;  4A3E B;  1SYD A;  2F0O A;  2D7E A;  5IT9 S;  3VR3 A;  4KK7 A;  2RSO A;  4GN5 A;  1E32 A;  2K9D A;  4M9X A;  2FXQ A;  3SAU A;  1Z7T A;  1IYU A;  2MJ8 A;  4C1N I;  3D4D A;  4IQZ A;  3VDU A;  2H1E A;  4KKS A;  2ZXR A;  2R46 A;  4LJ6 A;  1ROD A;  2ZM6 L;  3PIP A;  2FFJ A;  5ITY A;  1KAB A;  1OXX K;  3DHQ A;  2Q8I B;  3F2C A;  2BA1 A;  1E1O A;  3EVQ A;  2HDL A;  2WSC F;  4F7X A;  4DV6 Q;  1HNX Q;  1MN3 A;  3L2P A;  1L2B A;  1LAC A;  2A74 C;  4IJL A;  4BB9 A;  4MTK A;  1TTE A;  3BDC A;  3ZYY X;  2DNC A;  3KSJ A;  3PO3 B;  1ML0 D;  1PTO B;  3GV6 A;  2XWJ B;  1B1Z A;  1GUO A;  1YE9 A;  2O2L D;  1OXU A;  2KW0 A;  3NBH A;  3L27 A;  1LTT D;  4PZ7 A;  4LFA M;  4DUY L;  2G8L A;  4N9T A;  3FKI H;  3ITP A;  3HOU G;  1AIP C;  3NEL A;  4KOD A;  3D8G A;  3L0O A;  4RGT A;  3HHZ A;  2F5Q A;  1JJG A;  4KHP M;  1P16 A;  3BZK A;  3GDE A;  1TT2 A;  2G9D A;  2BDN A;  3DEO A;  3E9H A;  2XF3 A;  2OTL A;  4JI8 M;  3K7A B;  1IBL M;  3TZD A;  1XPU A;  4A3B G;  1VQK A;  1KXL A;  3AU7 A;  4B3T Q;  2DY7 A;  2IT1 A;  3KOZ E;  1IN6 A;  3BBZ A;  4R4O A;  4JI2 L;  2K5Q A;  4HCS A;  1J8I A;  2LVP C;  3GLI E;  5GQO A;  4MGY E;  1DGB A;  2JXM B;  4QL5 A;  2F5O A;  4BBS G;  1SYE A;  2K52 A;  2Q2H A;  2UUB Q;  1IYV A;  3E9I A;  1CA6 A;  1PH3 A;  1F2Z A;  2RKS A;  2SNS A;  3K8A A;  3K5N A;  1R2Z A;  1BBX C;  1LYL A;  1QQW A;  3EA6 A;  5FTN A;  3MAQ A;  3W2D A;  4QNR A;  4ILW A;  3HOU H;  3ERQ A;  4NC6 A;  1LTL A;  4AW4 A;  2BDO A;  4ZPX A;  3CF2 A;  3MHB A;  3HOY G;  1DYQ A;  2PO4 A;  3A56 A;  5KO3 A;  4TRD A;  1GJT A;  2WV6 D;  2B2V C;  3VA7 A;  1DON A;  3W5O A;  2CWP A;  4DR6 L;  4A3D B;  2PW7 A;  3UI2 A;  4A3B H;  4RMF A;  4U68 A;  3BYY B;  4N8X 1;  2YU9 B;  1SXT A;  1WOC A;  4M0D A;  1TII D;  1YEZ A;  2CW0 C;  2VS1 A;  3NWS A;  3GTP B;  1PZK D;  1RTN A;  2XSZ D;  4LJ9 A;  4RA8 A;  1N34 L;  4BBS H;  3X3M A;  1DO0 A;  2L5T A;  1AN8 A;  1A8V A;  4GS3 A;  2DJG C;  1LAB A;  1RJT A;  2A73 B;  4QOZ C;  4YIJ A;  5C4J H;  1HNW L;  2EYF A;  1PFS A;  3THG A;  2KDL A;  2L1B A;  3H3V I;  4A3I G;  3B7Z A;  2DEN A;  4LW1 A;  4ZKB B;  3IL8 A;  4FCW A;  3H0G B;  3HOY H;  3FHW A;  1N36 Q;  2QEN A;  1FJG Q;  3I01 M;  1MD2 D;  3HOZ B;  4DR3 M;  2EDG A;  1PM5 A;  1CHP D;  3U6E A;  4UP9 A;  2K6B A;  1QZG A;  2L11 A;  2PI2 A;  4LF9 M;  4B3S L;  1IBM Q;  4K5V A;  4LJ8 A;  4FF1 A;  1Q90 A;  3CCQ A;  3DWA A;  4FCT A;  2L15 A;  2Y21 A;  5C4X G;  5DM7 3;  5FO9 B;  4OHJ A;  4JI3 M;  4KN7 C;  4JV5 Q;  4WOR A;  2CQA A;  2SEB D;  4I7Z C;  3J7A S;  2LSS A;  4H13 C;  2E2D C;  5IGE A;  3H3V C;  2L4N A;  4DK1 A;  1G8Z D;  1NTG A;  2UXD L;  5A35 A;  3R8B A;  4QJF A;  2YV5 A;  2I7N A;  2XFS A;  1E2Z A;  3CCV A;  1UEA B;  4HMJ A;  4OX9 L;  3G6E A;  3NBI A;  3GTJ B;  2O5R A;  4UAI A;  2CHQ A;  4A3I H;  2CFM A;  3MTS A;  2KCC A;  3OWE B;  2BWB A;  4G4O A;  3WHK A;  1SNQ A;  3R2I A;  1N77 A;  4OL7 A;  4YWM A;  1GUT A;  4APV A;  3KDS E;  3OSO A;  4NXN M;  1PYS B;  2E76 C;  5CV4 A;  5T1I A;  3TL4 X;  4WFN 3;  1NY4 A;  1M4V A;  1BQQ T;  1T43 A;  4A4I A;  1EOV A;  1YUB A;  1C9O A;  1A62 A;  4ZUJ A;  3KJO A;  3L25 A;  2HCI A;  4POF A;  1Q81 C;  4ODG A;  1KLG D;  3NQI A;  3GLH B;  5COR A;  4DUY Q;  2GNO A;  4AQY L;  4LF6 M;  4K8J A;  4A3J G;  3GLG A;  2R92 B;  2X69 A;  4GOP C;  2LTU A;  2B2Y C;  2MNA A;  1KDB A;  2KOL A;  3LWE A;  5LMN M;  4JOI C;  1GUW A;  4UPA A;  1NVM A;  5KND A;  1QZE A;  1YNN D;  2CWA A;  1PTO C;  3KLW A;  1NHG C;  4YY3 L;  4D81 A;  1HQY E;  3TE6 A;  2HD3 A;  1VQE A;  2VUM B;  2IX1 A;  1LTS D;  2NTT A;  4MB7 A;  2DAK A;  1A0I A;  1WD1 A;  4NOO B;  2L12 A;  4GNX B;  3Q8D A;  1IHZ A;  4JI2 Q;  2D0O A;  2DHR A;  2R7D A;  5IGD A;  5J1Z A;  4PZ6 A;  1H9M A;  1G3I A;  4I4L A;  1I4W A;  2EQS A;  3U6O A;  1IXR C;  1QAM A;  4V19 0;  2Q8R E;  4BA1 I;  2H5X A;  4X3S A;  2K50 A;  5TSS A;  3ZC7 B;  3SAV A;  3U6P A;  3OIQ A;  4DV3 Q;  4KKT A;  1B4O A;  4J6H A;  4DV1 M;  2JA6 B;  3J7B A;  3KLS X;  1BCP D;  3T53 B;  3JAM L;  3MXU A;  1NMF A;  4I65 A;  3I55 A;  5C18 A;  4IBD A;  3F2U A;  4EQN A;  1C1K A;  1VQI A;  3GQ4 A;  3KFU A;  4DK6 C;  3GTQ H;  4DR6 Q;  1FR3 A;  2QEJ C;  3UGJ A;  5CR3 A;  2Z6K A;  3J7A V;  3HKS A;  1TWH B;  1NV8 A;  1I50 B;  3D6C A;  4KD4 A;  3SMS A;  2LWX A;  1ENA A;  2AUJ D;  1HFN A;  4LFA L;  1HPC A; 
#chains in the Genus database with same CATH homology
 1A2U A;  2E2J B;  1D6E C;  4FD2 A;  1L8Q A;  2HUG A;  4C3H B;  8CAT A;  3PIP 3;  2EY1 A;  4PMB A;  1LTB D;  4GIT A;  1BXT A;  1EY7 A;  3QJY A;  4RAU C;  3MFG A;  1IQP A;  4DR5 M;  1D5Z C;  3K58 A;  5KYL A;  1K82 A;  3HHW A;  2XLJ A;  3NP8 A;  3R93 A;  1VDD A;  4FF2 A;  1SDF A;  4Z9C B;  1RD9 D;  4DV0 M;  1GHJ A;  4C1N K;  3HU1 A;  3AOE C;  3VK7 A;  4WRD A;  2F0K A;  2KVM A;  3AL0 C;  1NNU C;  4X66 M;  1VMC A;  4DK0 A;  3C46 A;  5DYG A;  4O1N A;  1QOH A;  2VNU D;  2F0U A;  1JOO A;  1NNJ A;  3NWT A;  1PJJ A;  4RWS C;  3K5M A;  1B3A A;  1GKI A;  4LMQ D;  4F87 A;  4Y7N B;  1IKL A;  2UUC M;  1B50 A;  1HRJ A;  4K14 A;  4IJE A;  1IL8 A;  4BY7 B;  1NR4 A;  1YNN C;  3A98 B;  2X6L A;  3PO2 B;  2B2U C;  2EYM A;  2VII A;  2PQE A;  5FTJ A;  1STY A;  1LV9 A;  3VKH A;  3VLF B;  4OO1 I;  1EQV A;  2EOT A;  1XXG A;  2JA5 B;  3HU2 A;  4AG6 A;  1WTQ A;  4IUU A;  4DV6 M;  5KNB A;  3SAT A;  1MX0 A;  1E0B A;  1PDQ A;  3TSS A;  4DGZ A;  4X62 M;  1DOM A;  1XHB A;  2FFK B;  1LTG D;  1BCP C;  4RFB A;  1EYD A;  3L3O C;  2Z4S A;  4RF0 A;  1JCK B;  1HA5 A;  4II7 A;  2PZT A;  1W5S A;  3VYU A;  5M5Y B;  3DZD A;  2G5G X;  3PMF A;  4XXE A;  1QJO A;  5G3L D;  3VYR A;  1G41 A;  3TPZ A;  5E6J A;  1OFI A;  4FF3 A;  1GJX A;  2R18 A;  4FWD A;  2UUB M;  4IBE A;  1AP0 A;  3S16 B;  1ZYR C;  2F0G A;  3J80 S;  5CC4 A;  2QBY B;  3B9P A;  2C96 A;  4MGZ E;  1K83 B;  3I72 A;  4PT5 A;  2BA0 A;  3T56 B;  3R8F A;  3GQB A;  3J81 S;  3KW6 A;  2KEE A;  2RA4 A;  1PTO H;  2F5P A;  1HR0 M;  4EQO A;  3PV0 A;  4G7H C;  3GO5 A;  4DXG A;  4GHL A;  3UK6 A;  1I4X A;  3AOG A;  2LXE A;  1JQY D;  3ZH9 B;  2PCF B;  3SAS A;  3SHL A;  1KNE A;  4RCN A;  1M8A A;  5C6A A;  2B8F A;  4B7F A;  1TY0 A;  1VDZ A;  4XIG S;  1O7L A;  3KF8 A;  3U6Q A;  3FUW A;  2UUA M;  4CIS A;  3S1M B;  1AEX A;  1U4P A;  3QG1 A;  5BN4 A;  4IFD I;  4OGQ C;  4K6D A;  3A54 A;  3VA5 A;  2B63 B;  2D2C C;  3U5Z B;  4LJZ C;  1STA A;  2ZBK B;  3KP1 E;  4Z8X A;  4DAP A;  4JV5 M;  5C3E B;  1G8P A;  5BPV A;  2A6E D;  2NQ8 C;  4G4R A;  1EY6 A;  3GTO B;  3PVS A;  4HSP A;  5M3M B;  5C4X B;  3BYT B;  3TP6 A;  5CV5 A;  1Q1B A;  3R9X B;  4GZY C;  2KCN A;  4U67 3;  1Y8O B;  2F0W A;  3IAY A;  5CMD A;  1VF5 C;  4IUP A;  2F1M A;  3P7J A;  1WTP A;  2L9H A;  2EVB A;  1MBY A;  5EPJ A;  2CUZ A;  3P1H A;  4L8R C;  1DGH B;  2N55 A;  2F3W A;  1IXZ A;  4DUY M;  1JWU D;  2M60 A;  1N75 A;  1WCM B;  2NVY B;  3MK6 A;  3OIP A;  2QCU A;  1UUP A;  1A3V A;  3SK4 A;  4KJN A;  4L16 A;  4FF4 A;  4A3J B;  3QOL A;  3PUY A;  1EEI D;  3PUZ A;  4XDX A;  3I4N B;  1JC7 A;  4JI2 M;  3LX0 A;  1NSF A;  1EQT A;  4PV1 C;  3M0E A;  1JIC A;  4K5W A;  4FXD A;  3OPO A;  3MC0 B;  4OO1 G;  1EWH A;  1PYW D;  2VXW A;  3V96 A;  3S2D B;  1DO2 A;  2PZU A;  1EE8 A;  4H7B A;  4M9Z A;  4DV3 M;  1E9S A;  1S5F D;  5IGG A;  2E5L M;  4L15 A;  2KA7 A;  3E4R A;  3D4W A;  4OVZ B;  1JR0 D;  4F88 A;  2C9C A;  4LRS A;  3NTI A;  3WHL A;  3K57 A;  5IOD A;  4M9S A;  3S2H B;  1CTM A;  3NWL A;  1N78 A;  1SE3 A;  3GQ5 A;  3BOS A;  5KGU A;  4MIU A;  1N34 M;  4DA2 A;  4G4N A;  3SAR A;  4B3R M;  4X3U A;  3GLI B;  1PFB A;  1EYA A;  2NVQ B;  5DM6 3;  3U61 B;  3HHY A;  3T13 A;  4DV5 M;  3KLS A;  3KUP A;  3ILK A;  1J5E M;  3I4L A;  3C58 A;  3U60 B;  2DN8 A;  4LFB M;  3TWM A;  2L0C A;  3SMP A;  2F0T A;  4KI0 A;  5EP1 A;  5ELD A;  5KQD A;  4IBC A;  4XGI A;  3AMU A;  1E2W A;  1V1P B;  1OJL A;  3M4Y A;  1LT6 D;  2G9H D;  3FDT A;  3VYT A;  2ZT9 C;  4JI7 M;  1ZKO A;  4KY7 A;  4C3H G;  2WIN B;  2XNA C;  1IY2 A;  1WTO A;  4GKJ M;  1IM2 A;  1G91 A;  4TUW A;  1RHP A;  1X3Q A;  5LHY 1;  2LFN A;  2R93 B;  3T38 A;  1DJR D;  3GTL B;  1QIL A;  1QAN A;  4JXJ A;  4IUR A;  1C48 A;  4KO8 A;  1AW7 A;  5I2X A;  1EWC A;  1HXY D;  2PNR C;  3NPP A;  4IFD G;  4QNM A;  1PFN A;  2TMP A;  3DEP A;  2OQ4 A;  4K8I A;  2BCO A;  1IY1 A;  1Z6T A;  2B2W A;  4H44 C;  4OIK A;  4NL4 H;  1TH3 A;  4HR7 B;  2IWH A;  5LMU M;  3AOE A;  1JWM D;  4K0K M;  3HEJ A;  3R2T A;  2Z4I A;  3TZU A;  4LAA A;  4TKO B;  2D9U A;  4IIW A;  2FE8 A;  4KJO A;  4XYO A;  3KOY E;  2XZU A;  1E9R A;  1L0Y B;  4A3G B;  2K32 A;  4QHS A;  1BDO A;  5KRU A;  2X49 A;  1F9Q A;  4QUC A;  2JA7 B;  2M00 A;  1ET9 A;  1W5T A;  3T51 B;  3CF0 A;  1B9N A;  3PNV A;  3U6L A;  2B39 A;  2QCP X;  2J7Z A;  1F9P A;  2NTS A;  2F0Q A;  3FYD A;  2EY5 A;  2XH9 A;  3M7G A;  4K6L A;  2I46 A;  5CBA E;  1ESF A;  1K3X A;  1G59 A;  4BA2 I;  2Y0S B;  3SR1 A;  1TGU A;  4IBJ A;  1E2V A;  5C5L A;  3L7Z C;  3LNN A;  5C0X I;  3GLH A;  2C5R A;  5KYI A;  4A93 B;  2V4D A;  1BNZ A;  2RQX A;  4LF4 M;  1NCV A;  4KHZ A;  4JI0 M;  5ELB A;  1R9T B;  1H9S B;  1DD2 A;  3SYK A;  2EYP A;  3DXJ C;  3FTC A;  1LT4 D;  4CBV A;  2Z3X A;  5DNY A;  2LNH C;  1XMO M;  5EBC A;  5ELE A;  3DM1 A;  5JEA G;  2EJG C;  1R4Q B;  2DZN B;  4G7O C;  1H9K A;  4RKB A;  3FUX A;  2R61 A;  5FTM A;  3NUC A;  4JI6 M;  5CV6 A;  2FJ2 A;  1R2Y A;  1FNV A;  2DWN A;  1Q3C A;  2AQ1 B;  2F03 A;  1KLU D;  4JI5 M;  1QYR A;  2RGH A;  3CHB D;  3I4M B;  2JE6 I;  1IXS B;  1RF2 D;  2LY7 A;  3SDZ A;  2V1U A;  3GPY A;  1Q39 A;  2ICE C;  2LKV A;  1K8O A;  1JR3 A;  3LMM A;  3NE5 B;  4IBB A;  1Q1E A;  2X8A A;  1TWF B;  3TBI B;  1O80 A;  1GXD C;  5M5X B;  1EFI D;  4HAE A;  2J7O A;  4GKK M;  2OXP A;  4IJF A;  3SK6 A;  2KZU A;  1F9S A;  1S5D D;  2VQF M;  1XX8 A;  4JI1 M;  3E0J A;  3TP8 A;  3KOW E;  4B7H A;  3HGI A;  4LJA A;  4EGV A;  3S1N B;  3T1H M;  3KBX A;  1GVN A;  4BY1 B;  2PZW A;  4IZ8 A;  5ITT A;  1C4Q A;  1TY2 A;  3RFW A;  3SXH A;  1SYC A;  1I3Q B;  5FSW A;  3K92 A;  4FP5 D;  1EL0 A;  3Q0A A;  1JOR A;  3I4Y A;  1SYG A;  5HUR A;  5EXP A;  2Y0T A;  1EZ6 A;  1NJF A;  1SSO A;  5FO8 B;  1D2N A;  1GUN A;  1T3T A;  3M7N A;  1B9M A;  2XWB B;  5EBD A;  3A7L A;  4RHR A;  1TKW B;  1NY5 A;  3HGB A;  3K2L A;  1SJE D;  2Q8T A;  4MGK E;  1XYI A;  4LJ4 A;  3AKZ A;  2K47 A;  1BCP B;  3FTD A;  3TDQ A;  4ULL A;  4L4U A;  1O7Y A;  1X37 A;  1HFG A;  2F0E A;  2RGO A;  4BBR B;  4NXM M;  2EYO A;  3OMG A;  1E94 E;  5M3F B;  3H4M A;  1L0X B;  5ELF A;  1U4M A;  2BJW A;  1U4R A;  3O13 A;  3IKJ A;  3K6O A;  3P75 A;  1XWI A;  3PXG A;  4OIJ A;  5FLX S;  3GPP A;  4PCZ A;  1Z5A A;  1R6B X;  2XIW A;  4X65 M;  4DR4 M;  1N33 M;  3V05 A;  3U6S A;  3G7L A;  3SAW A;  2B2T A;  4D82 A;  5CGK A;  1CQF A;  5EP2 A;  1QWY A;  3OHX C;  4GIP A;  2DWL A;  3RGP A;  3M3Y B;  4PNY A;  5C0X G;  1Z59 A;  4X64 M;  4FCV A;  1IN5 A;  1LT3 D;  4XT1 B;  2AQ3 B;  5JPN C;  3EQL C;  1SXJ A;  2CV1 A;  4DNT B;  3S9W A;  5BN3 A;  3HS0 C;  1SYB A;  1IBK M;  4DXF A;  2EO2 A;  1HT2 E;  1F2L A;  2R65 A;  2FNA A;  5E26 A;  3FTF A;  5IT9 E;  3KVW A;  4HLQ A;  4C2M B;  2JEA I;  2QPA A;  1HTL D;  1STG A;  1WTW A;  3EJI A;  2V6Z M;  3HOW B;  2J7N A;  5C0X H;  3G6J B;  4L6T B;  4LK1 C;  4PMW A;  3OTO M;  3VR2 A;  2AWO A;  3Q24 A;  3H6M A;  2B8G A;  2EJF C;  1D5X C;  2K01 A;  3QWL A;  3SC3 A;  4XQN A;  3HJ8 A;  2RKO A;  3RZO B;  1EZ8 A;  5JI3 E;  4FWH A;  4WJW A;  1NAP A;  3A8I E;  1Q8I A;  3I51 A;  2CHV A;  2Z8L A;  5ITX A;  2KA6 B;  2XVS A;  3JAM S;  2K05 A;  2K1B A;  2L7I A;  1BOS A;  4KY5 A;  3TWK A;  3WDN A;  4BWG B;  3ND9 A;  2K7V A;  5NUC A;  4YHH M;  1GL7 A;  5AFW A;  5KPR A;  2NVX B;  4DN4 M;  2YR0 A;  3OOC A;  4ABN A;  5DYI A;  5F2D A;  1XXH A;  1Z5B A;  2KZS A;  3MHV C;  1DGH A;  1LTI D;  1QCB D;  3DWP A;  1WVL A;  4J8Q A;  3FYC A;  3FUV A;  3FKI B;  4PD2 A;  1KAA A;  2FHT A;  3D4R A;  5FKA C;  4C56 C;  1QAO A;  3FPU B;  4KMU C;  2KRK A;  2PMZ B;  4FYD A;  1PMR A;  1Z5C A;  5EQT A;  1F77 A;  2QKI C;  2DY8 A;  3KOX E;  3HHX A;  1ZAE A;  3DMU A;  4EIW A;  3UZU A;  1Q3L A;  1NUC A;  3PUW A;  3M4O B;  3GLF B;  5I2Y A;  3TP7 A;  1XNR M;  5E1F A;  1I6H B;  1EEF D;  4NMZ A;  1I4R A;  1Y8P B;  4EVO A;  1W6K A;  4C3J B;  1PRT D;  2KJX A;  3BDO A;  5ISR A;  1LTA D;  3KP0 E;  1KTK A;  3CF6 E;  1V8Q A;  4LF8 M;  5ELC A;  5EKK A;  1EY8 A;  1XC8 A;  3MFY A;  4IFD J;  1PJI A;  1CM9 A;  4OVZ A;  5C3X A;  3I90 A;  1HUN A;  3WOF A;  1MSG A;  4KLN A;  3C2P A;  1LO5 D;  1F9R A;  1QAQ A;  4K2K A;  1HHV A;  1D1I A;  3KBG A;  3J7Y W;  1Z47 A;  4G4Q A;  5JPM C;  4RKL A;  1XTC D;  1TR5 A;  2NBF A;  2UXC M;  3HOX B;  3FKE A;  2LMC B;  5JVG 3;  2BOS A;  2D62 A;  4I81 A;  3HKZ B;  3U61 A;  1CFM A;  2HDM A;  3U60 A;  2MP1 A;  2UU9 M;  2O4X A;  3ONA B;  5BR8 M;  3PIO 3;  5H37 D;  4CGY B;  1NHW C;  1Y1V B;  4LFC M;  1OFH A;  2B2V A;  1YNJ D;  2F0F A;  4AKG A;  2QDB A;  5I9O A;  1DGF A;  1L1Z A;  1I4P A;  3PNY A;  3FRP B;  1SXJ D;  4NKL A;  1ENF A;  3M85 A;  2QP9 X;  3K0Y A;  5A2Q L;  2L7H A;  3DOA A;  1PRT F;  1XMQ M;  3VK8 A;  4DV7 M;  4S12 A;  1KDA A;  2KHS A;  5M5W B;  5KEE A;  4FXK C;  5JOB A;  4RGO S;  1WTR A;  4B3M M;  3MXP A;  4ZKC B;  1QZM A;  4PDI A;  1HUM A;  1XWE A;  3SK5 A;  2C99 A;  4ID6 A;  5EP3 A;  1GUS A;  1GL6 A;  4DNR B;  2W82 A;  1V43 A;  2TSS A;  4IUN A;  2YQZ A;  1ZEQ X;  4KTA A;  3PUV A;  2P5T A;  4B7G A;  5JEA J;  3QIA A;  1NJG A;  4QUF A;  2H4O A;  2EY2 A;  1I94 M;  4R9W A;  1TS3 A;  2FMM A;  1F2M A;  1GUG A;  3J27 B;  4MGI E;  4LG2 A;  3UMM A;  2NZ1 D;  3SHG B;  2F4V M;  1EY0 A;  2RBM A;  1BR9 A;  1L1T A;  1UAP A;  3QB3 A;  2OEO A;  5IRE B;  5IOC A;  5K5P A;  4CHT B;  4LGY A;  3N6R A;  4RGM A;  1YSY A;  4IBK A;  2J4X A;  1QB5 D;  2F0P A;  3Q6S A;  3R3O A;  2MUY A;  5C44 B;  3IG8 A;  1GHK A;  5IGF A;  1NSN S;  5F3W A;  2XGN A;  3GV3 A;  1PZI D;  1SE4 A;  2B2Y A;  2D7H A;  4LGM A;  2JYO A;  2H1R A;  1FD7 D;  4MHE A;  3S1Q B;  4KKU A;  1QE6 A;  4Q5V A;  4OO1 H;  3VR5 A;  2K5D A;  4LRT A;  3K8Z A;  1SNO A;  4M0W A;  4AYB B;  5IGB A;  2DNE A;  1S5E D;  1KDC A;  1R4P B;  5KQ8 A;  4FWG A;  3MWY W;  2R7Z B;  4ZK9 B;  1J09 A;  2A6E C;  2Q2E B;  1SAP A;  4RCO A;  4NRW A;  2EYH A;  1JQJ C;  1SEB D;  1SXJ E;  4B9W A;  1EIH A;  4JYA M;  1II3 A;  1H9S A;  4EQP A;  2XSZ A;  3GD7 A;  3KSX A;  2PYK A;  3N52 A;  3I70 A;  4DFA A;  3I3C A;  2Z4R A;  4FW9 A;  4CKE A;  5J39 A;  2X4A A;  2HKJ A;  4A3V B;  5BN5 A;  1T5E A;  1FYC A;  3U9S A;  4BBA A;  4RHS A;  5IT9 L;  3S17 B;  1TS2 A;  4QCL A;  1WXQ A;  2F0H A;  5CV7 A;  2CV2 A;  2OF1 A;  2NWG A;  2A5Y B;  4LF5 M;  5EXX A;  1CT1 D;  1MU5 A;  2HCB A;  3RMH A;  3SHF A;  1AFP A;  1SNP A;  1HT1 E;  4AKI A;  3NSW A;  3U6D A;  2R4E A;  3OWF A;  3HOV B;  4RF1 A;  1SFO B;  3RE8 A;  4ZUI A;  4N9P A;  3S1R B;  4I5S A;  3K59 A;  3GO8 A;  1XNQ M;  1ZXT A;  3KS4 A;  1OO9 B;  1EY4 A;  3UJN A;  4ZQ3 A;  3MXN A;  2F0S A;  2K04 A;  3OMC A;  3D6W A;  1KNA A;  1H6U A;  2I7P A;  3MJ5 A;  1SMY D;  3NK9 A;  3AB9 A;  4L8J A;  3GRV A;  4B9X A;  1BO0 A;  1SYF A;  3J81 E;  4G6Z A;  5E4X A;  2EY6 A;  4QF4 A;  5I9P A;  2WII B;  4KY6 A;  1KFV A;  2XFT A;  1EY9 A;  5EKL A;  5I4D A;  4IFD H;  1J7K A;  5FK9 C;  1QNU A;  5D3D A;  2JA8 B;  1HQC A;  1SNM A;  3WOE A;  1G2T A;  2HHH M;  5C0X J;  1IN8 A;  4DV2 M;  3FEW X;  2ZAO A;  1CZG A;  1OXS C;  4P16 A;  2B2U A;  4JI4 M;  2ENB A;  5EXS A;  3VFD A;  1PZJ D;  3A7A B;  1GOZ A;  1TS4 A;  4I8O A;  2F0N A;  3BVG A;  2IL8 A;  4XYQ A;  1JWS D;  1V1O A;  2AQ2 B;  1I4G A;  2HQE A;  3D8L A;  2FOI C;  1HQM C;  1EYC A;  1OXT A;  3HJQ A;  4Q0F A;  1MSH A;  3BS1 A;  1O7Z A;  3X3N A;  4NRV A;  2PW5 A;  3NHH A;  3K5L A;  2R62 A;  2AHM A;  4FO2 A;  2XZF A;  2K28 A;  5E4W C;  1UNS A;  1DOL A;  4QIW B;  4R7G A;  4FVM A;  4MM3 B;  3CQZ B;  3T1Y M;  3FVQ A;  2ZXO A;  4FXG C;  1IY0 A;  1PXU A;  1Z6H A;  4C3J G;  1UM8 A;  4DR7 M;  3KFU G;  4A3F B;  2F0J A;  3VR6 A;  5IGC A;  4CKC A;  2IJ0 A;  4K5X A;  1W6J A;  4FNF A;  2A5H A;  3BG3 A;  3VKG A;  3A46 A;  3D31 A;  1B53 A;  1G29 1;  3L29 A;  3K5O A;  7CAT A;  3LWU A;  2M2L A;  2E75 C;  2EZV A;  1STN A;  3W0F A;  4E6I A;  4DAY A;  2I07 B;  4NDX A;  4F8M A;  1ZQ9 A;  1RDP D;  2R45 A;  1PTO D;  2SNM A;  1IN7 A;  5JEA H;  4IBI A;  3L2A A;  4WW0 A;  2Z1C A;  1SMY C;  2MPM A;  1D2B A;  1STH A;  3EIE A;  4REZ A;  2F3V A;  4MN3 A;  2EYL A;  1G4A E;  1B44 D;  2A69 D;  5A2Q E;  1TWC B;  2BE5 D;  3S15 B;  3VR4 A;  1SNC A;  3GP1 A;  1NR2 A;  3SE0 A;  1ORY B;  4AI6 A;  1L2C A;  2C5C A;  4KD3 A;  3C3L A;  5DNF A;  3H94 A;  2LH0 A;  2HCC A;  3ZCB B;  2ZAM A;  5ITR A;  4G57 A;  4L63 B;  4RH6 A;  3HJS A;  3NTH A;  2Z7J A;  3T15 A;  4GH9 A;  1CZW A;  2O5I C;  5FLX L;  2D5D A;  3VDP A;  1EY5 A;  3H09 A;  2C9O A;  1A3T A;  3GPU A;  3MVV A;  4JN6 A;  2VB3 X;  2EJM A;  4LZJ A;  3FD9 A;  5EJC A;  3Q23 A;  2CE7 A;  2EUC A;  1HA6 A;  3GRR A;  4HSV A;  3V2T A;  2WKC A;  3A45 A;  4LF7 M;  3P20 A;  3HG9 A;  1S3S A;  5IZ7 D;  1PTO F;  4XBO A;  1TH2 A;  1IKM A;  1U9R A;  1DZ1 A;  2JP1 A;  3RZD B;  1FNN A;  2N88 A;  3SBJ A;  4R8I A;  2WB1 B;  4TQU S;  3U6M A;  5E3F A;  4NSR A;  2V1C A;  4HMI A;  2KEC A;  4LJ5 A;  5CV9 A;  1DOK A;  2F0L A;  3GRY A;  1TVX A;  2FIN B;  4ZLT F;  3FUT A;  2UXB M;  1DCZ A;  1SND A;  1EOT A;  1DGG A;  5FTK A;  3HRZ C;  1LT5 D;  1MGS A;  2K6A A;  3GPX A;  4D80 A;  4C3I B;  2E74 C;  3KS8 A;  3A42 A;  1J9O A;  4DR1 M;  1AZQ A;  1WTV A;  1S4Z A;  2DWM A;  3KK7 A;  4ZRZ A;  2RDF A;  3IFD A;  2D7G A;  5D14 A;  4DR2 M;  4KHV A;  3W0L B;  5K36 G;  2BNK A;  2IX0 A;  3RGS A;  3CU7 A;  4S3S A;  3GTG B;  4UDU C;  2Z4H A;  2ERC A;  1HNZ M;  3S14 B;  4MGH A;  2Y0Q A;  2A69 C;  2JEB I;  2E2I B;  3Q22 A;  4OU7 A;  1SE2 A;  2A68 D;  2BE5 C;  3SFZ A;  2LS0 1;  3QAU A;  3GLF A;  4HL4 A;  4DF7 A;  3LQQ A;  3GTK B;  4IUV A;  2MHV A;  2QBY A;  4JBW A;  4BLC A;  4NP5 A;  3LQR A;  2VB2 X;  3BVZ A;  3NXW A;  5K36 H;  4CJ2 C;  4GHA A;  4KV6 A;  3A8J E;  5D65 A;  3DWQ A;  3J2P B;  3I8Z A;  2NVT B;  3TQS A;  2KED A;  1X3P A;  5IWA M;  3GQ3 A;  4KN4 C;  4J1M A;  3HZX A;  4R8N A;  1K3W A;  2DZO B;  4A3K B;  2R3Z A;  5FOB B;  4IBG A;  4AZF A;  3TME A;  1ZYR D;  3FPP A;  3NQT A;  4DV4 M;  3CTW B;  5LL6 S;  5JI2 E;  2IW3 A;  1A15 A;  1OXV A;  3BDL A;  3T16 A;  1N32 M;  2AWN A;  1CA5 A;  4DUZ M;  4M1U B;  1STE A;  1SJH D;  1GLN A;  1A6X A;  2E2H B;  2B2W C;  3U5Z A;  5C3W A;  5C1B A;  1LTR D;  2EA0 A;  4A3M B;  5COY A;  3U9O A;  3TN2 A;  3MXG A;  1VMP A;  1JR3 D;  3DA1 A;  4G4K A;  3A55 A;  2RSN A;  4W5W A;  2ID0 A;  4IBF A;  2VQE M;  2F0I A;  4B08 A;  3W3A A;  2RDH A;  1QVR A;  3HWS A;  3J80 L;  2DVW B;  4CJ1 B;  5KIX A;  4PMC A;  1G2S A;  2GA4 B;  1CK1 A;  3L28 A;  1BCP F;  5JAV A;  5J22 A;  5C4H A;  3K1J A;  1SBB B;  2QIL A;  1D1K A;  3E5S A;  4IN3 A;  3EFX D;  3J81 L;  5EPL A;  4LCB A;  1LLR D;  2R4J A;  4AG5 A;  3D3R A;  3RD4 A;  5CBE E;  1PRT B;  3GLG B;  1RCV D;  3QO2 A;  1H9R A;  2NN6 I;  5D3I B;  5GKN A;  2A6H D;  1L2D A;  5CYU A;  3J7A F;  1HNX M;  1IN4 A;  1EU4 A;  3SVM A;  2A68 C;  4R3D A;  2NB0 A;  4LZZ A;  1VCI A;  3LVV A;  1B2T A;  1TDH A;  3ND8 A;  4NSO B;  1CHQ D;  2SDF A;  2XRS D;  1QNK A;  4RGN A;  4XTC S;  3HP3 A;  3QOJ A;  3FTE A;  2F5S A;  2NYZ D;  1I4H A;  3Q8X A;  3HOU B;  3HKP A;  1S5B D;  2EXZ A;  1HQR D;  3OW7 A;  2XEP A;  4ITQ A;  1A3U A;  4B3T M;  3IFT A;  3GP7 A;  1ET6 A;  2EPB A;  4PQX A;  5C4Z A;  2OPF A;  4G7Z C;  1NY6 A;  1VF7 A;  4A3B B;  2C98 A;  4QB4 A;  1SXJ B;  4QMG A;  3IG5 A;  2L55 A;  4PDG A;  2Y20 A;  4BBS B;  4IUQ A;  5C4J B;  1Y8N B;  1C8C A;  3GLI A;  4AKH A;  2L09 A;  2F4I A;  1TDZ A;  2KRU A;  2DWZ B;  4XQQ A;  2EYJ A;  2AUK A;  3HOY B;  5EJW A;  3AJI B;  4ZAI A;  3E6Z X;  1HCZ A;  4X3K A;  1LV7 A;  2ICI A;  3KLR A;  2YFQ A;  1K8M A;  2EE1 A;  2CHG A;  1X32 A;  2F0D A;  5ITQ A;  4XT3 B;  1V1P A;  4QHT A;  1JOK A;  4WUR A;  3FMC A;  3JR5 A;  1N36 M;  1FJG M;  2CHB D;  1BF4 A;  1I6V C;  1HTP A;  1IBM M;  1TS5 A;  2O5J C;  1EIG A;  4CJ0 B;  4A3I B;  4HCE A;  3BVM A;  2QF7 A;  4LY6 A;  4MH0 E;  1ILQ A;  2A6H C;  5G3L F;  3AFH A;  5FLX E;  3L26 A;  3C1F A;  1FGB D;  2WP8 J;  2XN9 C;  3H91 A;  2JA2 A;  3RLF A;  2CFO A;  3URY A;  2ZM6 M;  1ILP A;  2R6G A;  2MGS A;  4LJ7 A;  3SK8 A;  1D5M C;  4GRI A;  3JR4 A;  2K33 A;  1IW7 D;  3SEB A;  2KUM A;  1XXH B;  3I91 A;  5HGT A;  4M8A A;  1JB3 A;  3KXE C;  1PRT C;  5M9O A;  4X3T A;  3EIH A;  2DXI A;  3I73 A;  2PPB C;  4QOS A;  4Z6Y A;  2CEA A;  4GMQ A;  3SYL A;  2J0T D;  1TU2 B;  2YYZ A;  4GC5 A;  3VYS A;  1WTX A;  3T4A C;  2BJV A;  4IUT A;  5KNC A;  1MI2 A;  1QG7 A;  1BUV T;  2JSO A;  4L78 A;  1TWG B;  4TSS A;  5DAU A;  2NN6 G;  5LL6 X;  3U6C A;  2CV0 A;  2IPK D;  4C3I G;  5EXT A;  1KYI A;  4V0B A;  1AZP A;  3HU3 A;  3GTQ B;  4BS9 A;  5A2Q S;  3MEH A;  2B2T C;  1CI3 M;  3RUZ A;  1R7R A;  5IIF A;  2RVL A;  2QZ4 A;  1PFM A;  2K03 A;  3GTM B;  2YNM D;  4CKB A;  5DEH A;  4DU9 A;  1ENC A;  4DR6 M;  1YNJ C;  3L9A X;  5EQ0 A;  3JAM E;  2KEB A;  1SXJ C;  2RDG A;  1TH4 A;  2NN6 H;  1JOQ A;  2L6O A;  3LVW A;  1HNW M;  3CRK C;  4OW0 A;  2WAC A;  1ICW A;  3MA2 B;  4ZYS A;  1G6Z A;  5FO7 B;  1RKN A;  1TQO A;  2F0M A;  1U4L A;  1H9J A;  5JJZ A;  4O42 A;  3E9S A;  2X6G A;  4XQJ A;  4B3S M;  1EU3 A;  5EPK A;  5KPT A;  1RTO A;  3ERO A;  3C1E A;  4K2L A;  1A2T A;  3D8B A;  2XRQ D;  3NTK A;  4DAV A;  4GC9 A;  3BZD B;  3CRL C;  3GRU A;  1Y69 U;  2KQ3 A;  1KSF X;  1IW7 C;  2SOB A;  3DFZ A;  2HL7 A;  2UXD M;  1DXM A;  3I4V A;  1T5X D;  4JK1 C;  4OX9 M;  1JE4 A;  1WD0 A;  2ZAN A;  1FNW A;  3PUX A;  3QWN A;  3TWL A;  3A8K E;  5ITU A;  1Y1W B;  4IAL A;  4RNA A;  1Q3B A;  2WAQ B;  5ITX E;  1STB A;  2NUC A;  1F2Y A;  5KPZ A;  1S5C D;  2F5N A;  2XSC A;  4H0L C;  5I6W A;  3J80 E;  2CVR A;  2FMC A;  2OT2 A;  1TWA B;  4HN7 A;  1DM0 B;  3M6A A;  2K5W A;  1ESR A;  5CV8 A;  2IX3 A;  3MZ5 A;  1FNU A;  5EKI A;  5FTL A;  2M5Z A;  4AQY M;  3PFI A;  3TP5 A;  1PLF A;  1Q12 A;  5I6Y A;  1O78 A;  5T1G A;  4HTH A;  2ZXP A;  2CW0 D;  4ME5 A;  4P2C B;  3AV0 A;  4YY3 M;  3CKI B;  2M9V A;  4HED A;  5EGT A;  2WKD A;  4NW2 A;  5C5M A;  1I4Q A;  2KXE A;  3DUZ A;  5EP4 A;  1ONL A;  4A3E B;  2F0V A;  1CQV A;  3FUU A;  5JVH 3;  1SYD A;  2F0O A;  2D7E A;  5IT9 S;  3VR3 A;  4KK7 A;  2RSO A;  1E32 A;  4M9X A;  3SAU A;  1Z7T A;  1IYU A;  2MJ8 A;  4C1N I;  3D4D A;  4IQZ A;  3VDU A;  2H1E A;  4KKS A;  2ZXR A;  2R46 A;  4LJ6 A;  1ROD A;  2FFJ A;  5ITY A;  1OXX K;  1KAB A;  3DHQ A;  2Q8I B;  2BA1 A;  3EVQ A;  2HDL A;  4F7X A;  1L2B A;  1LAC A;  2A74 C;  4BB9 A;  3BDC A;  3ZYY X;  2DNC A;  3KSJ A;  3PO3 B;  1ML0 D;  1PTO B;  3GV6 A;  2XWJ B;  1B1Z A;  1GUO A;  1YE9 A;  2O2L D;  1OXU A;  2KW0 A;  3NBH A;  3L27 A;  1LTT D;  4LFA M;  2G8L A;  4N9T A;  3ITP A;  4KOD A;  3D8G A;  4RGT A;  3HHZ A;  2F5Q A;  4KHP M;  1TT2 A;  2G9D A;  2BDN A;  3DEO A;  2XF3 A;  4JI8 M;  3K7A B;  1IBL M;  3TZD A;  3AU7 A;  2DY7 A;  2IT1 A;  3KOZ E;  1IN6 A;  2K5Q A;  4HCS A;  1J8I A;  4MGY E;  1DGB A;  2JXM B;  2F5O A;  1SYE A;  1IYV A;  1CA6 A;  1F2Z A;  2RKS A;  2SNS A;  3K5N A;  1BBX C;  1R2Z A;  3MAQ A;  1QQW A;  3EA6 A;  5FTN A;  3W2D A;  4QNR A;  4ILW A;  3ERQ A;  4AW4 A;  2BDO A;  4ZPX A;  3CF2 A;  3MHB A;  1DYQ A;  2PO4 A;  3A56 A;  5KO3 A;  4TRD A;  2WV6 D;  2B2V C;  3VA7 A;  1DON A;  4A3D B;  2PW7 A;  3UI2 A;  4U68 A;  3BYY B;  2YU9 B;  1SXT A;  3GTP B;  4M0D A;  1TII D;  2CW0 C;  3NWS A;  1PZK D;  1RTN A;  2XSZ D;  4LJ9 A;  4RA8 A;  3X3M A;  1DO0 A;  2L5T A;  1AN8 A;  1LAB A;  1RJT A;  2A73 B;  4QOZ C;  4YIJ A;  2EYF A;  3THG A;  2L1B A;  4ZKB B;  3IL8 A;  4FCW A;  3H0G B;  2QEN A;  1MD2 D;  3HOZ B;  4DR3 M;  2EDG A;  1PM5 A;  1CHP D;  3U6E A;  2L11 A;  4LF9 M;  4K5V A;  4LJ8 A;  4FF1 A;  1Q90 A;  3DWA A;  4FCT A;  2Y21 A;  5DM7 3;  5FO9 B;  4OHJ A;  4JI3 M;  4KN7 C;  4WOR A;  2CQA A;  2SEB D;  4I7Z C;  3J7A S;  4H13 C;  5IGE A;  2E2D C;  3H3V C;  2L4N A;  4DK1 A;  1G8Z D;  5A35 A;  3R8B A;  2I7N A;  2XFS A;  1E2Z A;  1UEA B;  4HMJ A;  3NBI A;  3GTJ B;  2O5R A;  4UAI A;  2CHQ A;  3MTS A;  2KCC A;  3OWE B;  4G4O A;  3WHK A;  1SNQ A;  3R2I A;  1N77 A;  4OL7 A;  1GUT A;  3KDS E;  3OSO A;  4NXN M;  2E76 C;  5CV4 A;  5T1I A;  3TL4 X;  4WFN 3;  1M4V A;  1BQQ T;  1YUB A;  4ZUJ A;  3L25 A;  2HCI A;  4ODG A;  1KLG D;  3NQI A;  3GLH B;  5COR A;  4LF6 M;  4K8J A;  3GLG A;  2R92 B;  2X69 A;  2B2Y C;  1KDB A;  2KOL A;  3LWE A;  5LMN M;  1GUW A;  1NVM A;  5KND A;  1YNN D;  1PTO C;  1NHG C;  4D81 A;  1HQY E;  3TE6 A;  2VUM B;  2IX1 A;  1LTS D;  2NTT A;  4MB7 A;  1WD1 A;  4NOO B;  2L12 A;  1IHZ A;  2DHR A;  5IGD A;  5J1Z A;  1H9M A;  1G3I A;  4I4L A;  1I4W A;  3U6O A;  1IXR C;  1QAM A;  4V19 0;  2Q8R E;  4BA1 I;  4X3S A;  5TSS A;  3ZC7 B;  3SAV A;  3U6P A;  3OIQ A;  4KKT A;  1B4O A;  4J6H A;  4DV1 M;  2JA6 B;  3J7B A;  3KLS X;  1BCP D;  3T53 B;  3JAM L;  3MXU A;  4I65 A;  5C18 A;  4IBD A;  3F2U A;  4EQN A;  1C1K A;  3GQ4 A;  1FR3 A;  2QEJ C;  3UGJ A;  5CR3 A;  3J7A V;  1TWH B;  1I50 B;  3D6C A;  4KD4 A;  3SMS A;  2LWX A;  1ENA A;  2AUJ D;  1HFN A;  1HPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...