4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna replication/isomerase
molecule keywords DNA TOPOISOMERASE 3-ALPHA
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CHTB 3NBIA 4CGYB
chains in the Genus database with same CATH superfamily
5KO3A 2R4EA 2UUCL 4KLKA 1QAOA 1V8QA 1CHPD 4L6TB 3T1YM 2CHBD 1DGSA 1T9HA 3MHVC 2R92B 2A74C 5IP7H 3PIP3 4L6V6 3FYDA 1GABA 4BB9A 1UWVA 3T1HM 1K0SA 3GLGE 1G59A 1I4XA 2B8FA 1PVOA 1LM0A 1XNQQ 1D0MA 1QZGA 2UUBM 1AH9A 4IBKA 2GVBA 1G6PA 1EUJA 2RGOA 1X3QA 4TUWA 2XEPA 4V190 1LTGD 1EIFA 1EWHA 1I4QA 4A93B 3TMEA 4BXXG 4JYAQ 1Z47A 5C3XA 2DVWB 1CZGA 2QDBA 2EE1A 2NUCA 1FYCA 1JC7A 2EYMA 2XNAC 2XRSD 1Q90A 1E32A 3S15B 2I5HA 1A3TA 4J1MA 1VMCA 2PNHA 1WVLA 2QCPX 5BN5A 1OJLA 4A3DH 1L2BA 3GTLH 3NBHA 3HOUB 3F8TA 2WINB 3FTFA 3NBXX 2K7VA 3AB9A 3I7FA 4XXEA 1XPRA 4DKAC 2MH8A 2KNZA 3C9PA 3TZDA 3MMPA 3RN5A 2UXBL 2YTVA 5KQ8A 4IO9A 4LJ5A 3ITPA 5HURA 1VQ7A 4HLQA 4JI8Q 4CDFC 4LF9M 1VQNA 3K5OA 3DHQA 1WD0A 3UMMA 2N78A 3H0GG 3NTHA 4A3KB 1L1OB 2MO1A 2NZ1D 1PH1A 3A5ZB 4RKLA 3LCUA 2K5WA 3AV0A 4NXNM 5ITUA 2F0LA 1JB0F 4DK6C 5LMNM 1SBBB 3S14H 4J8QA 3FMCA 3HJ8A 1N34Q 1YNJC 2L4EA 1WOCA 3EN2A 3RLFA 3HKPA 1BUVT 2KHJA 2OPFA 3TWKA 4JI3L 3J7ZC 4BY1H 2KUMA 1WTXA 1FNNA 3H4MA 4OWXB 3SYLA 1D2NA 2FS1A 3A98B 4PCZA 4XQQA 1IL8A 2JA7H 2KVMA 3LWUA 4DR4L 4I7ZC 1QVRA 5LMUM 1PFNA 2BJVA 2UUAQ 2NN6H 2QPAA 2R3ZA 4LG2A 4LFBM 1H9RA 2K9DA 5F2DA 1CSPA 1IHZA 4PQXA 2NBFA 4GN3B 4JI3M 1DXMA 4FDBA 1E2ZA 1HR0M 2A6EC 4LFCQ 4O42A 3S24A 3PIO3 2E5LQ 1D5ZC 4JI6M 1QNUA 5E4WC 3K5LA 4BY7H 4DAVA 4AKHA 2K01A 2GNOA 1A62A 3A7AB 1YVCA 3D4WA 2EVBA 3D3RA 1HA6A 4JN6A 4DUZL 1Y8NB 1JWMD 3HWSA 1DM0B 1M8AA 1UE1A 4X6AH 1JR0D 1V1PA 2XVSA 1XNRL 3R2TA 4A3KH 1BCPB 3SVMA 3KK7A 3RFWA 2N8NA 4LY6A 1NNJA 1IKLA 2Z4SA 1B9NA 1PYSB 2B3TA 1QUQA 1KIXA 1SJED 4KN7C 1B50A 3EIVA 3VR5A 1H9SA 4P73A 5C5MA 3GLHB 2HDMA 4MGYE 1MSGA 3CCRA 2EZVA 1SMYC 1QB5D 5IODA 4DR3Q 1MIUA 2KCMA 1DYQA 3CC2A 1MX0A 4FWDA 4F1IA 1VQLA 4A3FG 1EYCA 1K83B 2DAGA 2BJWA 4GC5A 3VKGA 4K2LA 2VF7A 3E5SA 1KC8C 3DWQA 2OOAA 3OPOA 4EQ5A 2ALYB 1PTOD 4JI1L 4A3CG 3PVSA 3HKZB 2JP7A 4CBVA 2MP1A 4DV5L 1IBML 1HR0Q 4G6ZA 2B2VA 2UXDM 2KBNA 1EQTA 2WKCA 1H9SB 1I3QH 5JOBA 4DF7A 1GLNA 1C48A 1HNXM 1ML0D 2JY8A 4L4UA 3B74A 1C9OA 1BQQT 4R4QA 5M3MG 5DFLA 4LJ9A 3VDPA 4PZ7A 5J22A 2WSEF 1ILQA 2FH0A 4DGZA 1N77A 1B1ZA 2KCTA 3MXPA 3CCLA 2NZOA 5C3EH 4L5RC 5ELCA 3ND9A 3TS2A 1EWIA 2F0EA 2K5VA 2EOTA 2RSOA 1Q3LA 1XWIA 1RHPA 1T5XD 2P5TA 3S2HH 5D3DA 1VEGA 3RN2A 1GVNA 1NHWC 3BDLA 4DAYB 3G6JB 4NC6A 1OXUA 1XXGA 2EPBA 2VS1A 4B3MQ 2KENA 4OONA 1PJJA 1K0RA 5GAEC 4D80A 4M0DA 5M9OA 2ZM6L 4RH6A 4Z6YA 3SK8A 2RA4A 1UFZA 3UDGA 2RCFA 4DUZQ 2OF1A 3GLHA 2AMCB 1VQ8A 1XNRQ 4HAEA 2L5TA 4FCVA 4LRSA 3NE5B 4DV2L 1RU3A 4IBBA 1U9RA 1Y8GA 3QYEA 4JYAM 3FP9A 4P2CB 5IGBA 4DV4Q 1YZ6A 4PDGA 2D5DA 1P16A 3NWSA 2EYOA 2YNMD 4IIWA 1CKMA 3TQYA 1EQVA 2UXCQ 2LNHC 4DV6Q 4X64L 2JA7B 3LX0A 4NW2A 5COYA 4JI0L 4LF6M 1RJTA 4FF4A 3CP0A 4LZZA 5ELBA 1LO5D 4R4CA 1Y69U 1E9RA 2DNAA 1EU3A 4KN4C 1QVGA 2JA8H 2EDGA 1QUQB 4BLCA 2E2DC 2EY6A 3J7A5 1W5SA 4PT5A 3QWNA 5DM73 4AIMA 3J81i 1SNCA 4L63B 2I7NA 3URYA 1YHAA 2JWSA 4ANRA 4XGIA 3B7ZA 5JVG3 3UK6A 3FDTA 4Q7JA 2Z1CA 3D8GA 1I94L 1GUGA 1MKHA 4EQPA 4LJ8A 2F0WA 3TRZA 1B3AA 3A55A 4ZLTF 3PF5A 2RSNA 3GTMH 1XNQM 1IYJB 1LTLA 1K3RA 4POGA 1STGA 4TQUS 2OTJA 2C35B 4GOPB 1K3WA 3K1JA 4CIZA 3HY5A 1N34M 1SN8A 5DNYA 4XT1B 4LF7L 3NPPA 1GM5A 1WR1B 1T6OA 5T1IA 4DUYL 4LCBA 3IECA 1KABA 4FNFA 3VR3A 3CF5A 1D0KA 3VDUA 1S40A 1NSFA 2JSOA 3NBIA 2JNHA 1PDQA 3MJ5A 1EFUB 1PH7A 3SC3A 2FINB 1WYDA 4UP7A 2DNCA 4X66M 2Z4IA 1X9NA 2PO4A 2XFSA 2AWNA 2UUCQ 1ASZA 4K5VA 2M00A 3SK5A 3AFPA 4R8NA 2DAKA 4B08A 5ITTA 2CH4W 2XGNA 1BBXC 2DAMA 2RDFA 3CPWA 1F2YA 3PO2B 1Z6TA 4QNMA 1EY7A 3S1RH 4DV4L 3QJYA 2IX1A 3GTJB 1LTID 2LSSA 5GROA 1KAWA 3GTPB 3SARA 5KNDA 2XSCA 3Q22A 4P16A 1X32A 4X65Q 2ZJQA 2KNVA 1OFHA 4IJLA 4RAUC 1GO5A 3IFDA 4KKTA 2IWHA 1ET9A 2F0TA 4AI6A 1VQ5A 4XBOA 4OX9L 2YU9B 5C4XB 1NR4A 5IGCA 1NHGC 4DR7M 2EY2A 1MBYA 2APLA 2PQAB 3HOYB 2M5ZA 2DKLA 4KJOA 2R4JA 3OW2A 1VF5C 2FMCA 1XX8A 4R4TA 3ICEA 3S1NH 5FO7B 4A3BH 4IFDJ 4KODA 3D8BA 4CHTB 2R45A 3GLGA 5EP2A 4A3IH 3PO3H 1I6HB 4QGUA 3PF4A 5EP4A 1NO1A 2H1EA 1XHBA 2C99A 2R65A 1HNZQ 2K5DA 2F4IA 4LF8Q 2ERCA 1QG7A 2VUMB 3I3CA 3U6EA 5FKAC 2UU9Q 1EYDA 3D6WA 3WHKA 3UDFA 4DXFA 5M3MH 3V05A 3HOXH 1PRBA 3SASA 4OEMB 5IWAQ 1IBKL 1T5EA 4C3JG 4L5TA 4JI5M 2F5NA 2JE6I 4N8FA 4ZQ3A 1D6EC 3DLLA 3HOVH 2LVNC 5KIXA 1GVPA 4OVZB 4C1NI 1ORYB 1JMCA 1U4PA 4ZRZA 3TP5A 3UE1A 1UE5A 1ZMWA 4KT0F 3SAWA 2G9HD 2GN5A 5C3WA 4IALA 4A3FH 1CUKA 1I5FA 5IYBG 2EYPA 1VQ6A 1Y1WG 2KEEA 3P1HA 2D2CC 2R93G 4W5WA 1Z5BA 3I4NH 2CKZB 1JB3A 1AIPC 1YJNA 3QIAA 2ZJRA 3HOZB 5IGEA 2P5ZX 3KOZE 2LS01 1BR9A 3SYKA 2B2WC 3EJIA 1IBLQ 4A3IB 3PO3B 4K14A 3JAML 3K80C 4O2DA 3VYUA 1WTOA 1ASYA 4A3KG 4AH6A 3TP8A 4LFAL 3K92A 1T43A 4Y7NB 4A3JG 1G8ZD 4XDXA 4IFDH 2O5RA 4EQNA 2JP1A 3U60B 4AKGA 3U6QA 1CK1A 3D4DA 3I4NG 1OXTA 4EVOA 3J80E 2JUJA 1UNSA 2JN4A 1LT6D 3L3OC 5FLXE 1VQ1A 1O80A 3T4AC 2HHHQ 4QUCA 5IY0A 1MHWC 3VK8A 2B8GA 2OTLA 4DV1M 4X64Q 4LUVA 3WHLA 2L4NA 3IRBA 2L11A 3DWPA 2CRUA 1SNPA 4KKUA 2QQ8A 3UE0A 2ZBKB 1HZAA 2HQEA 4OO1H 2A6HC 3OWEB 4POFA 3KF6B 3L26A 2G5DA 4AYBB 4WURA 1A6XA 1SSOA 5FOBB 3GTJH 4LFBL 3I4VA 2XWBB 4HL4A 1G4AE 4B3SM 3UDXA 2RGHA 2IX0A 1HR0W 1I50H 1EQQA 2K32A 3M6AA 4DXGA 1VQPA 1B8AA 1L1ZA 4M9ZA 1IM2A 1R9TB 1SYGA 1ESFA 4F8MA 4G57A 3GTQB 3HOYH 1OKSA 3AQQA 2PW7A 4A3EH 4AZFA 1SJHD 5EKIA 4ZUJA 3Q8DA 4IBIA 2IT1A 2VL6A 5FJ8G 1JQYD 4A3BG 2R93H 2KRUA 4L8JA 3W2DA 1XMQM 3SAVA 3ULJA 1IN8A 1IQPA 1E2VA 1PXUA 2I0QA 1R4GA 3GV3A 4G4RA 3K57A 4FCWA 4B3TL 4JI7Q 2VXWA 5M5XB 3M4YA 4X65L 1W6JA 5IE8A 5JPNC 1XMOM 4QOSA 2L9HA 1YEZA 1LV9A 4IPHA 5I2XA 2MGWA 2F0PA 2WKDA 3GTPH 1U5KA 2F1MA 4A3DG 4LFAQ 3U9OA 3NQTA 2Q2UA 4LNQA 1HFNA 1E24A 1S72A 1AN8A 1VF7A 5EJWA 1KFVA 4DU9A 1IN4A 3DFZA 4AW4A 1G6ZA 1QVCA 2A5YB 3CQZH 3RGPA 3FHWA 3NXWA 2WSFF 1N78A 5CBEE 3CC4A 5C44H 2GA4B 4XYOA 1HNZL 1HJPA 2DY8A 5C4XH 1ZKOA 2RQXA 5JEAG 4DPGA 1OAIA 2HL7A 1NBWA 1UUPA 1P3QQ 1KDAA 2PZWA 1BNZA 3T38A 1PTOH 2WIIB 5ELEA 2K52A 3BZDB 5CV9A 3EFXD 3KDFA 1K8AC 3J81L 1MU5A 2AUKA 3STBD 4NXML 3DEOA 2EKKA 4WORA 5FO9B 1I4HA 3MAQA 5KYIA 4ZKBB 1K9MC 2X4AA 3NEMA 2F52A 1PYBA 3I4NB 2X49A 3FRPB 1PFSA 1V92A 2XGTA 3HHWA 3CCMA 1I6HH 3KBGA 4DFAA 3MEFA 4IFDI 4QHSA 1SMYD 2D0PA 1SRUA 2VZAA 2LHCA 4BBSH 1LUZA 3PIOA 3TP6A 3L2PA 4OX9M 4ULLA 4C3IH 3HOXB 3KOWE 1Q46A 2RCNA 1R2YA 1H9MA 4YWKA 2EJGC 5M5XH 1N32L 1FVIA 3B6YA 3HZXA 2VW9A 3CKIB 1VQAA 5CMDA 2KECA 4PZ8A 2NQ8C 1Y1VH 4LFCL 4ZKCB 4CKBA 4JI2Q 3GLGB 2K5QA 3W1GA 2A8VA 5IWAL 4R8IA 3KDSE 3CHBD 3RLNA 1IBKQ 1EIGA 4J6HA 4Y52H 4G7OC 5A35A 4OVZA 1A2UA 1ZMUA 3KUPA 1WD1A 4IZ8A 3CMEA 4JI0Q 1D5XC 5KRUA 3F2UA 2B2VC 3SMPA 5KPZA 1PV4A 2EYHA 1F9PA 2VQEL 3GDEA 2YV5A 3K9PA 5F3WA 4MGIE 1IXSB 2J7ZA 4ZCKA 4NSOB 2V6ZM 1L2CA 2CW0C 2NVQH 3HOUH 1K28A 3H3VC 3HX3A 3PUYA 3J7BA 2DN8A 4KLNA 1CKNA 3FKIH 2R7ZH 1TH4A 1E1OA 1NAPA 1DV0A 2DNEA 3HOVB 5T1GA 1EU4A 4A3JH 4FXKC 4IFDG 3IG5A 3ILKA 3B9PA 2VQEM 4H02A 2BWEA 1LTSD 1VS0A 2F0MA 1E2WA 1QYRA 3H3VI 1Q8KA 4DV5Q 3W0LB 4CKEA 3F92A 2M60A 3M9BA 5IGFA 3SR1A 4IJEA 1VDDA 1IXZA 4MTNA 5KNBA 1JORA 3R9XB 3OOCA 2EY1A 2KCCA 1YIJA 4WW0A 4PMCA 4GKJM 1YSYA 2QEXA 2XH9A 1CQVA 5LL6X 1R4PB 1Z59A 3WOEA 1TH3A 3IAYA 1B53A 4DV3Q 2F0QA 3F2BA 1PTOC 1QJOA 1SXJD 4ZPXA 3RZDH 2K28A 2N88A 2R61A 1YHQA 4JPBW 1X65A 3I01M 2SEBD 3HKSA 3GTKH 1PZJD 1BCPC 1DGFA 2R18A 3NSWA 4LF8M 3T1YQ 2XTIA 1NSNS 3VKHA 2G5GX 4GKJL 2DAIA 1TWFB 1KL9A 3HOXG 2R0IA 1H9JA 1I4GA 4DR5L 4Q0FA 5D3IB 1NMGA 5EPLA 3TDQA 3SHFA 4DV7L 1VEKA 3GRRA 3KLSA 2JYOA 2IW3A 2K5NA 4G4QA 4UHVA 2DXIA 1TTEA 4M0WA 2OO9A 4L15A 1V9PA 3QOLA 3X3NA 1VQEA 3HKZE 5DLQE 4PDIA 1S5BD 3NTIA 1BDOA 3CU7A 4FXGC 4C2MB 3B7NA 1HQMC 1QZEA 4QHTA 1JJCB 3HOVG 3GTMB 3PIPA 3S1RB 3A8JE 3KP1E 1MGSA 4JOIC 1SLJA 1I4WA 5BPVA 2NB0A 2Z6BA 3PMFA 3SEBA 4DV0M 3UI2A 1MSHA 4GNXC 3GTGH 3AOGA 1AEXA 1DCZA 1II3A 2QENA 4LJAA 3A46A 1D8LA 2NVXH 2UU9L 1GJTA 3NHHA 4LZJA 1PH6A 3MVVA 5LHY1 1TS4A 1AE3A 1B7YB 4YHHQ 4S3SA 2JA9A 2UXDL 3OTOL 3MXNB 3PUVA 3Q24A 4YCWA 4XTCS 1PTOF 3SK6A 3T56B 1E1TA 2WAQE 1STBA 5DNFA 2C96A 4PMBA 3H6MA 2C98A 3VR6A 2IX3A 2DHYA 2KOLA 1FNWA 5LMNQ 2CP8A 3G4SA 3ERQA 3C3DA 2MR9A 1STHA 2WP8J 3BBZA 4JI4L 4JW0A 2HD3A 4BY1G 1LT4D 2A69D 4UDUC 1EE8A 2PZUA 4XT3B 3OTOM 3PSIA 1RIPA 1QAMA 7CATA 2MHVA 4JI6Q 4R71A 1HNWM 2EYJA 4LMQD 3HOZG 3W68A 1VDLA 3A8IE 1GL6A 2SNMA 1GJXA 1CKNB 1S3OA 3GV6A 2O01F 3MK6A 4X3TA 2A19A 2B63G 4JI4M 1NMFA 1FGBD 1Z9FA 3S9WA 3HJSA 3I4MG 4HIKA 2E5LM 1TS5A 1HFGA 4NRWA 1OXXK 1XB2B 5AFWA 3PCOB 1XPOA 4RGOS 1NNXA 4KD3A 2PI2E 3H4JA 5C4JH 2AKWB 3GTLB 1JE4A 4K0KM 2JA7G 3I4OA 1Q3CA 3S15H 1PZID 3GP7A 4LF6L 1IBMQ 2VIIA 1T3TA 5ITXA 2E2HB 1IXSA 1PRTD 1RTNA 3VA5A 1FJGQ 4DR2Q 4KHZA 1S5ED 2L12A 2OQ0A 4XIGS 1XXHA 1BOSA 1Y1VG 1TQOA 4JBKA 2K47A 2CHGA 2DZLA 3CCUA 1J5EL 1IZ6A 1NCVA 4IN3A 2V1UA 3U5ZA 2BNKA 3A45A 1ZAEA 3U61B 1FGUA 1L0XB 2DGYA 4BBSG 1CKOA 2ZAMA 2VQEQ 3MC0B 1XMQQ 2E8GA 4HCEA 5EXSA 2LXKA 1YI2A 1N36L 3BDCA 1STNA 4B3RM 1UE6A 2VY3A 3HEJA 3S1QB 5H1SE 3M3YH 1U4MA 2BE5C 3R3OA 1J5EM 4FF1A 4I81A 3PV0A 4AKIA 4KHPL 1S5CD 4LF9Q 1PRTF 1XTDA 1WTQA 1UAPA 2L6OA 1SNQA 2XN9C 4GN5A 1YJ9A 2UUBQ 4LF4M 3LVVA 4DUYM 1SNOA 2JA8G 4UP8A 2K75A 3LQRA 1S5DD 3BU2A 2AWOA 2F0VA 3S2DB 1EY0A 5IOCA 5C3EG 4A3GB 1G291 2KRKA 1TKWB 1TWFH 2KA6B 2ICIA 2ZTEA 5GADC 3HU1A 3KS8A 3TN2A 1GXDC 1TDHA 2D7HA 1TS3A 4C56C 2F0IA 1P8LA 5JVH3 2DHRA 5DAUA 4YY3M 4GOPC 4BXXH 4QIWB 3SE0A 1V1QA 4P72A 4LWCA 5AJ3Q 3E46A 3THGA 3TP7A 4IURA 3CCSA 4G4NA 4A3MB 2A1AA 4A3CH 1KSFX 1PMRA 1V43A 2E76C 3PO2H 2CW0D 1V33A 1KDCA 1VQGA 2Q8TA 1EOTA 4GNXA 1IKMA 1RF2D 1TR5A 3M4OB 5CR3A 1WIVA 1IFYA 3TEHB 3DM1A 2O25A 5E4XA 2K33A 4LF7Q 1KHIA 1DO2A 1X3PA 5FJ8H 2J4XA 1LABA 4KY7A 2L15A 3VDYA 5M5WB 2CQOA 4QIWE 1HHVA 3RR5A 1TWGB 2ZANA 1BO0A 1L8QA 1JOQA 2B2YC 3I90A 3T15A 4FP5D 4L78A 1WI5A 2XRQD 4M8AA 4C3HB 4YY3Q 2HHHL 1NV9A 4LF5L 2HCCA 4CKCA 5E7NA 1SNDA 4HN7A 4JI2M 4OGQC 2FNAA 2QZ4A 2WB1G 3SXHA 5ELNA 2LH0A 3K58A 5FO8B 4JYAL 5EP3A 2N35A 1HQRD 4JI1Q 1GJSA 1IBLM 4UP9A 5JJLA 5I9OA 4GLVB 3ER0A 1JR3E 1YITA 1N32M 2L4FA 1QE6A 1N33L 1E22A 3U5ZB 1A8VA 1Z7TA 4YCVA 3VR4A 2R93B 2F5QA 4JI0M 1CT1D 4LAAA 1IYUA 1SR3A 2IJ0A 3I4MB 3OYYA 1TWHB 3KDFB 4KMUC 1LTBD 4R7GA 3VFDA 2M9VA 2CCZA 1NJIC 4M1UB 1E94E 1A2TA 4YWMA 1EL0A 4NPSA 4DV0L 2UXBM 4ID6A 1WTVA 2K1BA 2MGSA 4HMIA 2AUJD 3U60A 2A68D 2AQ3B 1NJFA 4M9SA 3BZKA 2EXDA 1GUWA 1EIHA 1XJVA 3A0JA 3F1ZA 2VUMH 5ELOA 5M5WH 1I94M 1K8GA 4R4OA 4QL5A 1UEBA 4WJWA 5AJ3L 5EXPA 1SROA 2EQSA 2B2UA 4NOOB 1Z5AA 3FRIA 1SXJB 4QJFA 5IREB 1K73C 2LVPC 3G6EA 2G9DA 3L7ZC 4RHRA 1SYDA 1QZMA 4XQJA 1XXHE 4IBCA 3FKIG 3ZJYC 1VG5A 3JR5A 5ISRA 3GLFA 1VQKA 3BVGA 2KQ3A 3ZYYX 3IL8A 1R6BX 1V1PB 3W0FA 3JAMc 5ITQA 3W5OA 5K36G 2MNAA 5C4JB 4LUOA 1ZQ9A 4IBDA 3HOWH 4DR1M 3LMMA 2F3WA 1BBUA 4JVZA 3A8KE 3ERSX 1KRTA 1HTLD 1EEFD 5KPTA 4KI0A 1G91A 2QCUA 1GUSA 2F0SA 1MD2D 1X56A 4N8X1 1JB7A 2JA8B 2QP9X 2XFTA 5E1FA 1H6UA 1KDBA 3HG9A 3BVZA 4HCSA 1YNXA 5D65A 3KF8A 2HIXA 4HJ8A 3HJQA 3J80L 4MGZE 3T1YL 2CQAA 4KKSA 1SYBA 3U6CA 2KDLA 1DGGA 1HQCA 4CJ6A 5L37A 1I94Q 1QVFA 4QCLA 1DJRD 1SYCA 3FVQA 4KTAA 2BCOA 2QDLA 2NTSA 2X6LA 4TKOB 5C0XH 3VYSA 3EROA 2B2TA 5EGTA 2A6HD 1Q86C 5BN3A 1OO9B 4RHSA 2OT2A 4LW1A 1EWCA 3QR8A 4NMZA 4OO1I 2HWJA 5CGKA 1PJSA 4OIJA 1AFPA 3IG8A 4IJFA 3I73A 4C3HH 2A69C 1DOMA 5CV5A 5IP7G 5FK9C 3SDZA 3WWVA 4DV2Q 5FTMA 3FRHA 4JOIA 2Z6KA 1RDPD 4HSPA 5IT9c 1QDTA 3K5NA 1XMQL 3U4ZA 1HRJA 3GLHE 1I50B 2F4VM 1GUOA 2Q2TA 3C3EA 3FPUB 5FLXS 1JR3A 1M4VA 3M3YB 1DGBA 2EO2A 4DV6L 1N32Q 2CWAA 4DUZM 1QNKA 2XIWA 1A15A 1XMOL 2ZJPA 2XWJB 3GPXA 4BY7B 2NVYH 2SNSA 1L0YB 4DR4Q 4MH0E 1W5TA 1LYLA 3L0OA 4A3DB 4OXPA 3D8LA 3OIQA 5EQ0A 4PMWA 3T51B 4GH9A 3CQZB 4YIJA 5IGGA 3FTDA 3I70A 2XLJA 2QBYB 2RVLA 1Z5CA 4BA1I 2NVTH 4DAPA 4DR2L 1PJQA 2QSFX 2BH8A 3B89A 4NXNL 5JPMC 2XF3A 1Q3BA 1STEA 4DR6L 1Q82C 5KPRA 3IHPA 2X69A 4MN3A 1OXSC 4QQBX 2JA6H 3TL4X 3GTGB 5EQTA 1KNEA 2NTTA 2CFMA 4KO8A 1EEID 5LMNW 5IT9E 1QAQA 5CV4A 2L55A 1WFQA 3CAMA 3HGBA 2OWOA 4LF6Q 1XPUA 3S16B 5BR8M 1F2ZA 1PLFA 3S2HB 4LJZC 1D1IA 5KGUA 4DNTB 3GO5A 1FD7D 5EXXA 1SDFA 5M5YB 2RHSB 4GEWA 1WGNA 2SDFA 2TMPA 1Y1WB 4B3RQ 3GRVA 1GKIA 1WHCA 3FUTA 2F0OA 1Q12A 2E74C 4HEOA 2NVYB 4BBRG 1J6QA 4LF5Q 3MA2B 4JI6L 4AQYM 4H0LC 5CV8A 3BS1A 3AFQA 4ME3A 2F0JA 1L2DA 3PNVA 1G8PA 1V1OA 1DGHB 5ITRA 2C5CA 3AFHA 2JY5A 4A3FB 3G71A 2RRUA 3OSOA 4KV6A 5EPJA 2R62A 5EBDA 1TH2A 1EYAA 2MUYA 4DK3C 4IQZA 2AQ2B 4F88A 3GLIE 5EAYA 3RNUA 4Z8XA 3NBHB 4GIPA 5CYUA 1R4QB 3BYTB 3I51A 2XSZA 5GQOA 4X3KA 1O7ZA 3A56A 4YCUA 4DR3M 1NTGA 1XNQL 4O1NA 2HCBA 3I2ZA 1VQOA 3GPYA 4JCVE 2R7ZB 1PM5A 1YLAA 3CCVA 1D7QA 2DWLA 3S1MH 3SGIA 2VB2X 5IZ7D 3HGIA 3RZOB 3I55A 5ELDA 2LWXA 3K6OA 3GLIB 1CHQD 2B63H 5JJIA 1Y1WH 2Y21A 3OW7A 5K5PA 1Y8OB 4H7BA 2A73B 4DR7Q 2C9CA 4DR3L 2B2TC 3NP8A 2Z9HA 1RD9D 4KHPQ 1IY1A 4KHPM 3HOZH 2DJGC 4ABNA 4J15A 1HT1E 4APVA 1N75A 1G2SA 4A4IA 3G7LA 4ITQA 1EQRA 3CCJA 2XSZD 1QWYA 3J81E 1EZ6A 3GLIA 2F5OA 1ESRA 4XK8F 4I7AA 4NP5A 4A3GG 3FUVA 3R93A 1ZEQX 2KCNA 4LFBQ 2PMZB 5A2QL 2Z6KC 3W1BA 2UXBQ 1TT2A 3GRUA 1EYGA 1LTAD 4WRDA 3Q8XA 4HJ7A 2RDGA 2B3GA 3A7LA 2LXJA 4F7XA 1SAPA 1IN7A 4YHHM 5EPKA 4DV0Q 4TSSA 3OTOQ 2ZXPA 1NY4A 1BVSA 1X3FA 4QUFA 2E2HH 1HNWQ 4E6IA 2QGQA 2BA0A 4GNXB 4F87A 4FXDA 4B7FA 4C3IG 3GTKB 1FNVA 3JAME 3HHZA 1B2TA 4K8JA 1EOVA 4BS9A 5C6AA 5I9PA 2Y20A 3GQ3A 4RCNA 3TZUA 4JBJA 4X64M 4DV1Q 4NXNQ 4II7A 4LF5M 5C18A 1A0IA 3STBC 3FEWX 2C5RA 4AQYQ 2WZJA 1PA6A 2J7NA 1KAAA 3ND8A 3NTKA 3M85A 2O5JC 4RCOA 3K7AB 5JEAJ 2K4KA 5I2YA 3RE8A 1S5FD 4XYQA 1VQJA 2W82A 1PYWD 1BF4A 3C3LA 3A42A 5DEHA 1SNMA 4DV7Q 1D2BA 4OWTB 3KLSX 3U6PA 2DWZB 4HJ5A 2HUGA 4OW0A 1ZYRD 4A3GH 2R7DA 1ENFA 4G4OA 2NWGA 4DV6M 5FTKA 5J3BA 4K6DA 3DEPA 5IP9H 2D7GA 3FKEA 4IBGA 1XTCD 2JA6B 3J7AF 2Y0SE 2CV2A 1N33Q 4OO1G 2BA1A 1I4RA 1L1TA 4JV5L 1PZKD 2PQEA 4B3SQ 1Q1BA 2JZ1A 2V1CC 1EIYB 1TXYA 4G4KA 2NVXB 3N52A 5CC4A 1HCZA 4FVMA 1CSQA 3NUCA 4DK1A 2VF8A 4IOCA 4HR7B 4DR2M 1CQFA 5BR8Q 3J7YW 4RFBA 1HNWL 5LL6S 1WXQA 1I6VC 4QY7A 4ZYSA 1GHJA 5KEEA 4H13C 2KA7A 4V0BA 4A3EG 1DZ1A 1BCPF 5JAVA 4JV5M 4DR6Q 3U6LA 2ZXOA 4FO2A 4JI7L 2CWPA 4LJ6A 4EIWA 1X3EA 2I5MX 2KW0A 3QO2A 4KJNA 1HR0L 4GC9A 2MFIA 1QUSA 1EY5A 4DV4M 3FTCA 3NWTA 4TVAB 4DAYA 3OWFA 1N9WA 4DR1L 2VUMG 2ZXRA 4FD2A 1S4ZA 3U58A 3S16H 3H91A 4Y7NH 2R6GA 4KD4A 3QWLA 3ZCBB 4BBSB 2R6FA 1L1OC 3Q0AA 4C3IB 4PG3A 2I07B 1SMXA 4QMGA 1VQFA 4CISA 4NB3A 3JAMS 4Z9CB 3HKZG 1PJTA 4UAIA 4FF2A 3WDNA 2WSCF 2DY7A 2IL8A 5J39A 4DR5M 1KNAA 4GOPA 2ES2A 1IW7D 1Q7YC 2YR0A 3LCVB 1RTOA 2UUAL 2ZAOA 2K0BX 4DR4M 3I72A 1DO0A 2QILA 4IUTA 4UPAA 2D9UA 3LWEA 4OX9Q 3J81S 3JR4A 2HQLA 4IUUA 3L25A 4RGTA 4WJ4A 2H1RA 4FYDA 1X6OA 4HMJA 2Q2EB 2Z8YM 3H15A 2E2IB 5G3LD 1TY0A 4IUVA 5J1ZA 3KF8B 1ONLA 3DMUA 1A63A 2CV1A 2JXMB 2JA6G 4A76A 3UZUA 1EFID 1IBKM 3L27A 3AJIB 1VQCA 2UUAM 3RLOA 5M3FB 4A93H 3FYCA 1OXVA 2HT1A 3EIEA 2IPKD 2G3QA 3CPFA 2YYZA 3KYHC 4NSRA 1O7LA 1YNNC 4A3IG 3PO3G 1IYVA 4OL7A 1PHJA 1YNND 4D81A 3T6PA 2R92H 4CGYB 1EIJA 4WJ3M 2EYLA 2L2DA 3HU3A 4P75A 3G48A 5GKNA 5M3MB 1WGLA 1O7IA 3DWAA 3KBXA 3D0FA 1LT5D 1TWCH 3L2AA 4JI3Q 3P75A 4DR5Q 1IXRC 2OQ4A 1SE8A 4P17A 3D6CA 1K8OA 5C4ZA 5LMUQ 1HUNA 5JEAH 3MFYA 1N36Q 4NXMQ 4RKBA 3KS4A 3MXUA 4FWGA 4OWWB 5C0XJ 3I4LA 4MGHA 5JI2E 2ZTDA 2J0TD 3OHXC 2DAEA 4LRTA 2DENA 1IW7C 2BDOA 4IUQA 4IUNA 4ME5A 4BBRB 4RGNA 3CGWA 5HGQA 4JG2A 1VQDA 4X65M 4N9PA 1HNXL 1X3GA 5EXTA 2CEAA 3SMSA 2JY6B 3S1QH 1LLRD 4L5SA 4S12A 4DN4M 2CHVA 4R9WA 2EA0A 1J7KA 1ICWA 5KYLA 3E6ZX 1NVMA 2EJFC 1B9MA 2B2UC 5E26A 3GPPA 1FNUA 5C1BA 3I04M 1X55A 5JI3E 4A75A 4IPGA 1CTMA 1PH9A 4X62M 3MEHA 4CDDC 2LXEA 1IN6A 2L7HA 2Z0SA 2KHIA 1HTPA 2MJ8A 3GQBA 4R1JA 2AHOB 1J9OA 1OAOC 1S3SA 5L8RF 1F2MA 5C5LA 2F03A 1ILPA 5DYGA 2ZM6M 3A74A 5HGTA 4K0KL 4DK0A 1JE5A 2Y0SG 2OCEA 5C4HA 4B3SL 1FR3A 1GD7A 2X8AA 2OEOA 1NNUC 5JJZA 2VQFM 2HCIA 5IIFA 3S14B 1SXJC 5I6WA 4PNYA 4AQYL 4QNRA 4I65A 1W6KA 3CMAA 3T1HQ 1EFWA 4FW9A 3GQ5A 1NE3A 1V34A 5TSSA 3P20A 2Z7JA 1VQBA 2F0NA 1TF0B 4RF0A 1E7ZA 2LMCB 2F3IA 2F3VA 3I4YA 2JA5H 4OU7A 5E3FA 2L09A 2FFKB 2I7PA 2A6ED 1NJGA 3K0XA 2CE7A 2Y0TA 3PFIA 4LF4Q 1LV7A 3ONAB 4B3TQ 2FE8A 3B7QA 3ZQJA 3EA6A 3BZCA 4JI5L 4REZA 2ID0A 3KSXA 3MZ5A 4NKLA 1Q39A 3S17B 3HOYG 3FKIB 2UXCL 2K6BA 1AZQA 3BG3A 3AU7A 3H94A 5A2QS 4N9TA 1WJ7A 1RCVD 3CRKC 2J7OA 1TY2A 2F4VQ 3Q8GA 2IHFA 1K8MA 3SBJA 3K8ZA 1OFIA 3DXJC 3TS0A 3PXGA 4OELB 2ZTCA 2Z3XA 1NY5A 2F0KA 1NUCA 3M7NA 4RKUF 1JQJC 2EIFA 2JA2A 3RGSA 3TWLA 1SE4A 4LF7M 2ICEC 5NUCA 4HJ9A 2LVOC 1RL2A 2JQOA 3FD9A 2Q2IA 1PH8A 3ULLA 3U6OA 5D14A 2GVAA 1R5LA 2HKJA 4IPDA 2AHMA 1E0BA 4K0KQ 1ENCA 2B2WA 1W2BA 4MHEA 3VK7A 4L5QA 3K0YA 2R46A 1SXJE 1WJJA 3FPPA 4LUZA 1H9KA 2Y0SB 2VB3X 3WOFA 4C3JH 3HFZB 3M7GA 2N3SA 3IFTA 4R3DA 4BBRH 5C3EB 1B70B 3M4QA 1GL7A 1EY9A 1KRSA 2TSSA 3S17H 1IXRA 4LFCM 1SYEA 1VEJA 3BDOA 1SFOB 3FUXA 1AP0A 5IYCG 4KK7A 1Q02A 4LK1C 1EZ8A 3J7AV 2FJ2A 3HHYA 2K14A 3K81C 3TWMA 2BDNA 3CRLC 3CC7A 3GTQH 1OIPA 2KNAA 3S2DH 1VQ4A 1XYIA 1XNRM 3FUUA 1RKNA 1VCIA 1STAA 2Q8RE 3L9AX 2KHHA 4X62Q 1ICFB 5ITYA 1TWAB 5IT9L 2DI0A 2JZ0A 1HZ9A 2R7FA 3MHBA 5I4DA 2VQFQ 4DV7M 4JI4Q 2A5HA 2WFWA 3Q23A 4CJ2C 3KOYE 3FUWA 1DOLA 4IPCA 3RUZA 1HT2E 5JJKA 4Y28F 3FTEA 1ET6A 2BE5D 2QKIC 3HS0C 4GITA 5FLXc 3M4OH 4L16A 3AKZA 1H95A 1IY2A 1KD1C 2MQHA 3SK4A 1BXTA 2FOIC 4FWHA 4BY7G 4GKKQ 1GOZA 1JR3D 1ZMVA 4NDXA 2EUCA 1N8RC 3J7AS 1IY0A 1IBMM 4K2KA 3SHLA 2YQZA 3UJNA 1D1KA 3BVMA 3SFZA 3CF2A 1BKBA 2JEBI 4UY8C 4GLXA 2H5XA 1GUNA 2PI2A 2LVQD 1SXJA 4RGMA 5CORA 2CVRA 4PV1C 4DR6M 4C2MH 4A3JB 4JV5Q 4CDEC 4A93G 4DNIA 3OMGA 1F2LA 1F77A 5IYCH 1K3XA 1GUTA 3CCQA 1VQMA 2CHQA 4HEDA 3PUZA 4JXJA 1SG9A 4P71A 3FE3A 4LF9L 3CXCA 2F0HA 2LBCA 2YTXA 4C3HG 5BR8L 1MN3A 2QF7A 1C1KA 1O7YA 4A3LH 1F9QA 3K8AA 1SE2A 2F0UA 1W3SA 1VQHA 1LTMA 1WTPA 1LACA 1QANA 1GKHA 2PYKA 2DWMA 1WTRA 4BY1B 5EKKA 1TGUA 2EYFA 2EXZA 2B29A 2EY5A 1WCMH 2RKOA 1QILA 3TQSA 1ZYRC 5C0XG 3HOUG 1JOKA 3JAMi 1JICA 4X62L 2F0DA 2CH4A 3KJOA 4JC0A 4PD2A 5IGDA 3I8ZA 3TREA 1A5TA 2Z4RA 1PFMA 4JBWA 4DNRB 5FLXL 4RF1A 4LGYA 1CA5A 2G8LA 2LVAA 1JOOA 1YNJD 3E0JA 3PGZA 4DV1L 1B44D 4GN4B 3I4MH 4U68A 1PFBA 5EP1A 3GO8A 3C2PA 4B3TM 1M90C 3V96A 2D62A 2RKSA 4EGVA 2B2YA 1PH3A 3BOSA 4JI5Q 1SEBD 2YU9H 3MFGA 3KW6A 1K83H 1JJGA 1Q1EA 4UN2B 2QW7A 5K36H 1WCMG 3C46A 4ILWA 1OTCA 3GRYA 1OQYA 1QUTA 3P7JA 4LJ4A 3NENA 3J80c 2OXPA 3C1EA 4JI8M 4IJHA 1QZHA 2PMZE 2B63B 1HNZM 3HOWB 1NR2A 3AOEC 4P74A 1VQIA 4RWSC 4QOZC 5KQDA 1Q8IA 2OQKA 2E2JH 3GTOH 3KFUA 4K5XA 5IT9S 3KFUG 4RA8A 1WTWA 5IP9G 4B9XA 2R44A 4NXMM 3QB3A 5GAHC 4B7GA 3C58A 2K6AA 2VDBB 1E3PA 3A54A 3RZOH 3CF6E 1RODA 2ENBA 3U6SA 1F4IA 3QOJA 3M0EA 4JI8L 4C3JB 3DUZA 5C44G 2FHTA 4DV5M 2NZHA 2MJ5B 1JJ2A 3ZH9B 4DA2A 4A3VB 1C4QA 1PH5A 4GLAC 1D0LA 1KXLA 3DM3A 4HTHA 2N49A 3EIHA 2L1BA 3J81j 3R2IA 4CJ0B 1NY6A 2FMMA 1G41A 2KZUA 2K50A 1YJWA 1HPCA 2LKVA 4AG6A 2H4OA 4G3OA 4GKJQ 3EBEA 3HU2A 3PQIA 3DA1A 3X3MA 3TBIB 2XZUA 3W3AA 1A3UA 4MM3B 3E3XA 2FFJA 4IBJA 1HNXQ 5EJCA 2QBYA 1ENAA 3LGJA 4LF8L 2PW5A 4M9XA 5CBAE 3J81c 3T1HL 1HXYD 4RMFA 4BBAA 3E9SA 2ZT9C 2ASBA 1DONA 5EBCA 1FJGM 3HZJA 5FSWA 4X66Q 4HJAA 1SFOH 3GP1A 3CTWB 4B3MM 5M3FH 1EY8A 2V4DA 2OOBA 1U0LA 2K04A 1M1KC 2Z4HA 3NWLA 1WCMB 3V2TA 3K7AH 1E9SA 4DV3M 2O5IC 3NELA 3SATA 2XZFA 2LHGA 3UDIA 3CD6A 3VYRA 1G71A 3F2CA 3BYYB 1FJGL 2LFNA 4DBGB 4GKKM 4FCTA 2WB1B 3PUWA 1AE2A 1WTHA 2VQFL 2R92G 3U50C 3KOXE 1OIZA 4JI2L 1L1OA 1R9TH 4B3RL 1DD2A 3J80S 2QNJA 1I4PA 1BBWA 5IWAM 1C7YA 5FLMG 2DJFC 1XXHB 2NN6G 2UXDQ 2JY7A 3E21A 2D7EA 1CI3M 2KEBA 3RMHA 2PCFB 3LW5F 2A68C 4BWGB 1PH4A 2HAKA 1K3BC 3VLFB 4MB7A 4LF4L 3HP3A 3U61A 1HA5A 3K5MA 3TE6A 4GKKL 3CF0A 1YE9A 4U673 2CFOA 5FTNA 4EX5A 4GS3A 4KY6A 2KZSA 4B7HA 3U6DA 3H0GB 4G7HC 4ZK9B 3J27B 3T53B 1KLGD 2JEAI 4JK1C 1HZBA 4X3UA 2CV0A 2UXCM 5BN4A 4NL4H 2K05A 2KEDA 3KVWA 3MXNA 1N34L 4O0AA 2LY7A 4JI7M 2HDLA 1VMPA 4MNOA 4GZYC 1XMOQ 5H37D 2N55A 2PZTA 3R8BA 4IBEA 3GTOB 2E2JB 1EY6A 4GMQA 1AUAA 4K5WA 4LFAM 1R2ZA 1MJGM 1CFMA 4LGMA 1LTRD 1TU2B 2L0CA 5IYBH 4KY5A 5CV7A 3O13A 2QEJC 3U6MA 2KHSA 1MJCA 5LMUL 3BJUA 5EKLA 5I6YA 3U4VA 4CJ1B 4YHHL 3N6RA 2DZNB 4NRVA 1SE3A 1AZPA 5M3FG 1JCKB 1L2FA 2Q8IB 1Q81C 2YFQA 4ALPA 4QB4A 1VQ9A 2E5LL 4A3BB 1DGHA 4AYBE 4HIMA 3TSSA 4L8RC 3PUXA 2WAQB 1B4OA 3E9IA 4CDCC 5FTJA 4D82A 1FL0A 2I46A 3H0GH 1IL2A 3D4RA 2HIVA 3E0EA 2JJQA 3J80i 1N33M 4DR7L 3KSJA 2UUBL 1HH2P 8CATA 2EJSA 1HQYE 1QCBD 1F9SA 1J8IA 3OMCA 3HRZC 4G7ZC 3CCEA 1TR8A 1JWSD 1F9RA 4A3LG 2ATWA 5IYDH 2RDHA 3GLFB 2F5SA 3IKJA 4F2LA 1YBYA 1Z6HA 5C0XI 5IYDG 1L0WA 3KXEC 3AEVA 1KTKA 1PRTB 2E2IH 1AW7A 4GHLA 4JI1M 2F5PA 1TWHH 4KHVA 2Y0QA 1SYFA 3LQQA 1UEAB 2V1CA 4IUPA 1QOHA 2JXNA 4MGKE 1TWCB 3TPZA 3ZC7B 1G2TA 2YTYA 1ZXTA 1VDZA 1C8CA 1Y1VB 1JT8A 5C4XG 3J2PB 2E75C 2DWNA 3UGJA 4PZ6A 3Q6SA 3H09A 3LNNA 2UU9M 2RHQB 4X3SA 1C0AA 2VNUD 1MI2A 3KOJA 4ZUIA 3JC66 3K9OA 1K82A 1D5MC 4OHJA 2F4VL 4QF4A 3MTSA 2GQFA 4DAMA 3W67A 4GRIA 1JWUD 3I56A 4MTKA 1PRTC 2PNRC 1CM9A 1G51A 5LMNL 4IOAA 4RG1A 3GD7A 2DZOB 1G3IA 2JK8A 2KXEA 1R7RA 2BOSA 3M4PA 2ZM6Q 2NVQB 3BXWA 2K03A 3VR2A 2FXQA 2SOBA 2Z8LA 1KYIA 4C1NK 1YUBA 2DUDA 3KF6A 3RZDB 3KJPA 1TS2A 3V76A 4DV2M 1KQSA 1GHKA 4I4LA 4GHAA 3K7UC 1TWAH 3E4RA 3NQIA 3HHXA 2JA5G 4K6LA 3VA7A 2EKFA 2F0GA 3E9HA 3DZDA 3EQLC 5M5YH 1B3QA 1UE7A 1XC8A 2WAQG 2RBMA 5HY6A 3D31A 2QHOB 4I5SA 2B39A 3F2DA 3QG1A 2QA4A 4A3MG 4EQOA 4B3ML 3GLFE 4K8IA 1CZWA 4RNAA 3R8FA 4AG5A 1UM8A 2LTUA 3NK9A 4ZAIA 4YWLA 1U4LA 4HSVA 5A2QE 5FTLA 4B9WA 3KLWA 4DV3L 1CA6A 5FLMH 1A3VA 2J5YA 5DYIA 2MO0A 4XQNA 1MJEA 5ELFA 1TDZA 2I5LX 1U4RA 2MPMA 3HOWG 3C1FA 1PJIA 3AMUA 1NV8A 1PTOB 1HZCA 1LT3D 1QQWA 2CWBA 4MZ9A 2WB1E 4A3EB 3RD4A 4ODGA 5GAGC 5DM63 4BA2I 5G3LF 2O4XA 3MWYW 5CV6A 2MROB 3LVWA 3OIPA 4WFN3 4YY3L 3AOEA 4MIUA 1X54A 4DR1Q 3GQ4A 3S1NB 2KJXA 3S1MB 1X37A 2IY5B 1J09A 1N36M 5ITXE 3CW2C 1TVXA 1QDRA 4HIOA 1IN5A 2Q2HA 1SXTA 3L29A 4R4IA 3L28A 2R7ZG 1Y14B 2WACA 1EY4A 1I3QB 4H44C 3QAUA 4TRDA 4X66L 2RF4A 3ULPA 4AYBG 4LJ7A 1LTTD 3VYTA 1O78A 3I91A 1PH2A 3QYBA 4OIKA 1KLUD 5E6JA 2AQ1B 2M2LA 3T13A 3GPUA 1YHBA 2PQAA 3AYHB 3K59A 4A3MH 1XWEA 2NN6I 4HIDA 3K2LA 4WP2A 2HHHM 3KLRA 5C44B 4FF3A 3PO2G 3T16A 1GO3E 4Q5VA 2NYZD 2L7IA 3SAUA 1OTRA 2UUCM 2JA5B 2NVTB 1HUMA 2BH2A 3DOAA 1DOKA 3U9SA 4I8OA 2PPBC 3AL0C 2EJMA 2F0FA 2O2LD 4DUYQ 3EVQA 3SHGB 3PNYA 1PGYA 4IBFA 2X6GA 1TWGH 1IBLL 3H3VH 1STYA 1ZV1A 1J5EQ 2BWBA 2CUZA 2C9OA 1BCPD 3KP0E 2D0OA 2K5HA 2WV6D 3MXGA 5KNCA 3A5UA 1Y8PB 4JBMA 1TIID 2IHEA
chains in the Genus database with same CATH topology
5KO3A 2R4EA 1QAOA 1V8QA 1CHPD 4L6TB 3T1YM 2CHBD 2R92B 3MHVC 2A74C 3PIP3 3FYDA 4BB9A 3T1HM 1G59A 1I4XA 2B8FA 2UUBM 4IBKA 2RGOA 1X3QA 4TUWA 2XEPA 4V190 1LTGD 1EWHA 1I4QA 4A93B 3TMEA 1Z47A 5C3XA 2DVWB 1CZGA 2QDBA 2EE1A 2NUCA 1FYCA 1JC7A 2EYMA 2XNAC 2XRSD 1Q90A 1E32A 3S15B 1A3TA 4J1MA 1VMCA 1WVLA 2QCPX 5BN5A 1OJLA 1L2BA 3NBHA 3HOUB 2WINB 3FTFA 2K7VA 3AB9A 4XXEA 3TZDA 5KQ8A 4LJ5A 3ITPA 5HURA 4HLQA 4LF9M 3K5OA 3DHQA 1WD0A 3UMMA 3NTHA 4A3KB 2NZ1D 4RKLA 2K5WA 3AV0A 4NXNM 5ITUA 2F0LA 5LMNM 1SBBB 4J8QA 3FMCA 3HJ8A 1YNJC 3RLFA 3HKPA 1BUVT 2OPFA 3TWKA 2KUMA 1WTXA 1FNNA 3H4MA 3SYLA 1D2NA 4PCZA 3A98B 4XQQA 1IL8A 2KVMA 3LWUA 4I7ZC 1QVRA 5LMUM 1PFNA 2BJVA 2NN6H 2QPAA 2R3ZA 4LG2A 4LFBM 1H9RA 5F2DA 1IHZA 4PQXA 2NBFA 4JI3M 1DXMA 1E2ZA 1HR0M 2A6EC 4O42A 3PIO3 1D5ZC 4JI6M 1QNUA 5E4WC 3K5LA 4DAVA 4AKHA 2K01A 3A7AB 3D4WA 1HA6A 2EVBA 3D3RA 4JN6A 1Y8NB 1JWMD 3HWSA 1DM0B 1M8AA 1JR0D 1V1PA 2XVSA 3R2TA 1BCPB 3SVMA 3KK7A 3RFWA 4LY6A 1NNJA 1IKLA 2Z4SA 1B9NA 1SJED 4KN7C 1B50A 3VR5A 1H9SA 5C5MA 3GLHB 2HDMA 4MGYE 1MSGA 2EZVA 1SMYC 1QB5D 5IODA 1DYQA 1MX0A 4FWDA 1EYCA 1K83B 2BJWA 4GC5A 3VKGA 4K2LA 3E5SA 3DWQA 3OPOA 1PTOD 3PVSA 3HKZB 4CBVA 2MP1A 4G6ZA 2B2VA 2UXDM 1EQTA 2WKCA 1H9SB 4DF7A 5JOBA 1GLNA 1HNXM 1C48A 1ML0D 4L4UA 1BQQT 4LJ9A 3VDPA 5J22A 1ILQA 4DGZA 1N77A 1B1ZA 3MXPA 5ELCA 3ND9A 2F0EA 2EOTA 2RSOA 1Q3LA 1XWIA 1RHPA 1T5XD 2P5TA 5D3DA 1GVNA 1NHWC 3BDLA 3G6JB 1XXGA 1OXUA 2EPBA 1PJJA 4D80A 4M0DA 5M9OA 4RH6A 4Z6YA 3SK8A 2RA4A 2OF1A 3GLHA 4HAEA 2L5TA 4FCVA 4LRSA 3NE5B 4IBBA 1U9RA 4JYAM 4P2CB 5IGBA 2D5DA 4PDGA 3NWSA 2EYOA 2YNMD 4IIWA 1EQVA 2LNHC 2JA7B 3LX0A 4NW2A 5COYA 4LF6M 1RJTA 4FF4A 4LZZA 5ELBA 1LO5D 1Y69U 1E9RA 4KN4C 1EU3A 2EDGA 4BLCA 2E2DC 2EY6A 1W5SA 4PT5A 3QWNA 5DM73 1SNCA 4L63B 2I7NA 3URYA 4XGIA 5JVG3 3UK6A 3FDTA 2Z1CA 3D8GA 1GUGA 4EQPA 4LJ8A 2F0WA 1B3AA 3A55A 4ZLTF 2RSNA 1XNQM 1STGA 4TQUS 1K3WA 3K1JA 1N34M 5DNYA 4XT1B 3NPPA 5T1IA 4LCBA 1KABA 3VR3A 4FNFA 3VDUA 1NSFA 2JSOA 3NBIA 1PDQA 3MJ5A 3SC3A 2FINB 2DNCA 4X66M 2Z4IA 2PO4A 2XFSA 2AWNA 4K5VA 2M00A 3SK5A 4R8NA 4B08A 5ITTA 2XGNA 1BBXC 2RDFA 3PO2B 1F2YA 1Z6TA 4QNMA 1EY7A 3QJYA 2IX1A 3GTJB 1LTID 3GTPB 3SARA 5KNDA 2XSCA 3Q22A 4P16A 1X32A 1OFHA 4RAUC 3IFDA 4KKTA 2IWHA 1ET9A 2F0TA 4AI6A 4XBOA 2YU9B 5C4XB 1NR4A 5IGCA 1NHGC 4DR7M 2EY2A 1MBYA 3HOYB 2M5ZA 4KJOA 2R4JA 1VF5C 2FMCA 1XX8A 4IFDJ 5FO7B 4KODA 3D8BA 4CHTB 2R45A 3GLGA 5EP2A 1I6HB 5EP4A 2H1EA 1XHBA 2C99A 2R65A 2K5DA 2F4IA 2ERCA 1QG7A 2VUMB 3I3CA 3U6EA 5FKAC 1EYDA 3D6WA 3WHKA 4DXFA 3V05A 3SASA 1T5EA 4C3JG 4JI5M 2F5NA 2JE6I 4ZQ3A 1D6EC 5KIXA 4OVZB 4C1NI 1ORYB 1U4PA 4ZRZA 3TP5A 3SAWA 2G9HD 5C3WA 4IALA 2EYPA 2KEEA 3P1HA 2D2CC 4W5WA 1Z5BA 1JB3A 3QIAA 3HOZB 5IGEA 3KOZE 2LS01 1BR9A 3SYKA 2B2WC 3EJIA 4A3IB 3PO3B 4K14A 3JAML 3VYUA 1WTOA 3TP8A 3K92A 4Y7NB 4IFDH 1G8ZD 4XDXA 2O5RA 4EQNA 2JP1A 3U60B 4AKGA 3U6QA 1CK1A 3D4DA 1OXTA 4EVOA 3J80E 1UNSA 3L3OC 1LT6D 5FLXE 1O80A 3T4AC 4QUCA 3VK8A 2B8GA 4DV1M 3WHLA 2L4NA 2L11A 3DWPA 1SNPA 4KKUA 2ZBKB 2HQEA 4OO1H 2A6HC 3OWEB 3L26A 4AYBB 4WURA 1A6XA 1SSOA 5FOBB 3I4VA 2XWBB 4HL4A 1G4AE 4B3SM 2RGHA 2IX0A 2K32A 3M6AA 4DXGA 1L1ZA 4M9ZA 1IM2A 1R9TB 1SYGA 1ESFA 4F8MA 4G57A 3GTQB 2PW7A 4AZFA 1SJHD 5EKIA 4ZUJA 4IBIA 2IT1A 1JQYD 2KRUA 4L8JA 3W2DA 1XMQM 3SAVA 1IN8A 1IQPA 1E2VA 1PXUA 3GV3A 4G4RA 3K57A 4FCWA 2VXWA 5M5XB 3M4YA 1W6JA 5JPNC 1XMOM 4QOSA 2L9HA 1LV9A 5I2XA 2F0PA 2WKDA 2F1MA 3U9OA 3NQTA 1HFNA 1AN8A 1VF7A 5EJWA 1KFVA 4DU9A 1IN4A 3DFZA 4AW4A 1G6ZA 2A5YB 3RGPA 3NXWA 1N78A 5CBEE 2GA4B 4XYOA 2DY8A 1ZKOA 2RQXA 5JEAG 2HL7A 1UUPA 1BNZA 1KDAA 2PZWA 3T38A 1PTOH 2WIIB 5ELEA 3BZDB 5CV9A 3EFXD 3J81L 1MU5A 2AUKA 3DEOA 4WORA 5FO9B 1I4HA 3MAQA 5KYIA 4ZKBB 2X4AA 3I4NB 2X49A 3FRPB 3HHWA 3KBGA 4DFAA 4IFDI 4QHSA 1SMYD 3TP6A 4OX9M 4ULLA 3HOXB 3KOWE 1R2YA 1H9MA 2EJGC 3HZXA 3CKIB 5CMDA 2KECA 2NQ8C 4ZKCB 4CKBA 3GLGB 2K5QA 4R8IA 3KDSE 3CHBD 1EIGA 4J6HA 4G7OC 5A35A 4OVZA 1A2UA 3KUPA 1WD1A 4IZ8A 1D5XC 5KRUA 3F2UA 2B2VC 3SMPA 5KPZA 2EYHA 1F9PA 5F3WA 4MGIE 1IXSB 2J7ZA 4NSOB 2V6ZM 1L2CA 2CW0C 3H3VC 3PUYA 3J7BA 2DN8A 4KLNA 1TH4A 1NAPA 2DNEA 3HOVB 5T1GA 1EU4A 4IFDG 4FXKC 3IG5A 3ILKA 3B9PA 2VQEM 1LTSD 2F0MA 1E2WA 1QYRA 3W0LB 4CKEA 2M60A 5IGFA 3SR1A 4IJEA 1VDDA 1IXZA 1JORA 5KNBA 3R9XB 3OOCA 2EY1A 2KCCA 4WW0A 4PMCA 4GKJM 1YSYA 2XH9A 1CQVA 5LL6X 1R4PB 1Z59A 3WOEA 1TH3A 3IAYA 1B53A 2F0QA 1PTOC 1QJOA 1SXJD 4ZPXA 2K28A 2N88A 2R61A 2SEBD 1PZJD 1BCPC 1DGFA 2R18A 3NSWA 4LF8M 1NSNS 3VKHA 2G5GX 1TWFB 1H9JA 1I4GA 4Q0FA 5D3IB 3TDQA 5EPLA 3SHFA 3GRRA 3KLSA 2JYOA 2IW3A 4G4QA 2DXIA 4M0WA 4L15A 3QOLA 3X3NA 4PDIA 1S5BD 3NTIA 1BDOA 3CU7A 4FXGC 4C2MB 1HQMC 4QHTA 3GTMB 3S1RB 3A8JE 3KP1E 1MGSA 1I4WA 5BPVA 2NB0A 3PMFA 3SEBA 4DV0M 3UI2A 1MSHA 3AOGA 1AEXA 1DCZA 3A46A 2QENA 4LJAA 1II3A 3NHHA 4LZJA 3MVVA 5LHY1 1TS4A 4S3SA 3PUVA 3Q24A 4XTCS 1PTOF 3SK6A 3T56B 1STBA 5DNFA 2C96A 4PMBA 3H6MA 2C98A 3VR6A 2IX3A 2KOLA 1FNWA 3ERQA 1STHA 2WP8J 2A69D 1LT4D 4UDUC 2PZUA 1EE8A 4XT3B 3OTOM 2MHVA 1QAMA 7CATA 1HNWM 2EYJA 4LMQD 3A8IE 1GL6A 2SNMA 1GJXA 3GV6A 3MK6A 4X3TA 4JI4M 1FGBD 3S9WA 3HJSA 2E5LM 1TS5A 1HFGA 4NRWA 1OXXK 5AFWA 4RGOS 4KD3A 3GTLB 1JE4A 4K0KM 1Q3CA 1PZID 3GP7A 2VIIA 1T3TA 5ITXA 2E2HB 1PRTD 1RTNA 3VA5A 4KHZA 1S5ED 2L12A 4XIGS 1XXHA 1BOSA 1TQOA 2K47A 2CHGA 1NCVA 4IN3A 2V1UA 3U5ZA 2BNKA 3A45A 1ZAEA 3U61B 1L0XB 2ZAMA 3MC0B 4HCEA 5EXSA 3BDCA 1STNA 4B3RM 3HEJA 3S1QB 1U4MA 2BE5C 3R3OA 1J5EM 4FF1A 4I81A 3PV0A 4AKIA 1S5CD 1PRTF 1WTQA 1UAPA 2L6OA 1SNQA 2XN9C 4LF4M 3LVVA 4DUYM 1SNOA 3LQRA 1S5DD 2AWOA 2F0VA 3S2DB 1EY0A 5IOCA 4A3GB 1G291 2KRKA 1TKWB 2ICIA 2KA6B 3HU1A 3KS8A 3TN2A 1GXDC 1TDHA 2D7HA 1TS3A 4C56C 2F0IA 5JVH3 2DHRA 5DAUA 4YY3M 4QIWB 3SE0A 3THGA 3TP7A 4IURA 4G4NA 4A3MB 1KSFX 1PMRA 1V43A 2E76C 2CW0D 1KDCA 2Q8TA 1EOTA 1IKMA 1RF2D 1TR5A 3M4OB 5CR3A 3DM1A 5E4XA 2K33A 1DO2A 1X3PA 2J4XA 1LABA 4KY7A 5M5WB 1HHVA 1TWGB 2ZANA 1BO0A 1L8QA 1JOQA 2B2YC 3I90A 3T15A 4FP5D 4L78A 4M8AA 2XRQD 4C3HB 2HCCA 4CKCA 1SNDA 4HN7A 4JI2M 4OGQC 2FNAA 2QZ4A 3SXHA 2LH0A 3K58A 5FO8B 5EP3A 1HQRD 1IBLM 5I9OA 1N32M 1QE6A 1Z7TA 3U5ZB 3VR4A 2R93B 2F5QA 4JI0M 1CT1D 4LAAA 1IYUA 3I4MB 2IJ0A 1TWHB 4KMUC 1LTBD 4R7GA 3VFDA 2M9VA 4M1UB 1E94E 1A2TA 1EL0A 2UXBM 4ID6A 1WTVA 2K1BA 2MGSA 4HMIA 2AUJD 3U60A 2A68D 2AQ3B 1NJFA 4M9SA 1GUWA 1EIHA 1I94M 4WJWA 5EXPA 2B2UA 4NOOB 1Z5AA 1SXJB 5IREB 2G9DA 3L7ZC 4RHRA 1SYDA 1QZMA 4XQJA 4IBCA 5ISRA 3JR5A 3GLFA 3BVGA 2KQ3A 3ZYYX 3IL8A 1R6BX 1V1PB 3W0FA 5ITQA 5K36G 5C4JB 1ZQ9A 4IBDA 4DR1M 3LMMA 2F3WA 3A8KE 1HTLD 1EEFD 5KPTA 4KI0A 1G91A 2QCUA 1GUSA 2F0SA 1MD2D 2JA8B 2QP9X 2XFTA 5E1FA 1H6UA 1KDBA 3HG9A 3BVZA 4HCSA 5D65A 3KF8A 3HJQA 3J80L 4MGZE 2CQAA 4KKSA 1SYBA 3U6CA 1DGGA 1HQCA 4QCLA 1DJRD 1SYCA 3FVQA 4KTAA 2BCOA 2NTSA 2X6LA 4TKOB 5C0XH 3VYSA 3EROA 2B2TA 5EGTA 2A6HD 5BN3A 1OO9B 4RHSA 2OT2A 1EWCA 4NMZA 4OO1I 5CGKA 4OIJA 1AFPA 3IG8A 4IJFA 3I73A 2A69C 1DOMA 5CV5A 5FK9C 3SDZA 5FTMA 4HSPA 1RDPD 3K5NA 1HRJA 1I50B 2F4VM 1GUOA 3FPUB 5FLXS 1JR3A 1M4VA 3M3YB 1DGBA 2EO2A 4DUZM 1QNKA 2XIWA 1A15A 2XWJB 3GPXA 4BY7B 2SNSA 1L0YB 4MH0E 1W5TA 4A3DB 3D8LA 3OIQA 5EQ0A 4PMWA 3T51B 4GH9A 3CQZB 4YIJA 5IGGA 3FTDA 3I70A 2XLJA 2QBYB 2RVLA 1Z5CA 4BA1I 4DAPA 5JPMC 2XF3A 1Q3BA 1STEA 5KPRA 2X69A 4MN3A 1OXSC 3TL4X 3GTGB 5EQTA 1KNEA 2NTTA 4KO8A 1EEID 5IT9E 1QAQA 5CV4A 2L55A 3S16B 3HGBA 3S2HB 5BR8M 1F2ZA 1PLFA 4LJZC 1D1IA 5KGUA 4DNTB 3GO5A 1FD7D 5EXXA 1SDFA 5M5YB 2SDFA 2TMPA 1Y1WB 3GRVA 1GKIA 3FUTA 2F0OA 1Q12A 2E74C 2NVYB 3MA2B 4AQYM 4H0LC 5CV8A 3BS1A 2F0JA 1L2DA 3PNVA 1G8PA 1V1OA 1DGHB 5ITRA 2C5CA 3AFHA 4A3FB 3OSOA 4KV6A 5EPJA 2R62A 5EBDA 1TH2A 1EYAA 2MUYA 4IQZA 2AQ2B 4F88A 4Z8XA 4GIPA 5CYUA 1R4QB 3BYTB 3I51A 2XSZA 4X3KA 1O7ZA 3A56A 4DR3M 4O1NA 2HCBA 3GPYA 2R7ZB 1PM5A 2DWLA 2VB2X 5IZ7D 3HGIA 3RZOB 5ELDA 2LWXA 3K6OA 3GLIB 1CHQD 2Y21A 3OW7A 5K5PA 1Y8OB 4H7BA 2A73B 2C9CA 2B2TC 3NP8A 1RD9D 1IY1A 4KHPM 4ABNA 1HT1E 1N75A 1G2SA 3G7LA 4ITQA 2XSZD 1QWYA 3J81E 1EZ6A 3GLIA 2F5OA 1ESRA 4NP5A 3FUVA 3R93A 1ZEQX 2KCNA 2PMZB 5A2QL 1TT2A 3GRUA 1LTAD 4WRDA 3Q8XA 2RDGA 3A7LA 4F7XA 1SAPA 1IN7A 4YHHM 5EPKA 4TSSA 2ZXPA 4QUFA 4E6IA 2BA0A 4F87A 4FXDA 4B7FA 4C3IG 3GTKB 1FNVA 3JAME 3HHZA 1B2TA 4K8JA 4BS9A 5C6AA 5I9PA 2Y20A 3GQ3A 4RCNA 3TZUA 4X64M 4II7A 4LF5M 5C18A 3FEWX 2C5RA 2J7NA 1KAAA 3ND8A 3NTKA 3M85A 2O5JC 4RCOA 3K7AB 5JEAJ 5I2YA 3RE8A 1S5FD 4XYQA 2W82A 1PYWD 1BF4A 3C3LA 3A42A 5DEHA 1SNMA 1D2BA 3KLSX 3U6PA 2DWZB 2HUGA 4OW0A 1ZYRD 1ENFA 4G4OA 2NWGA 4DV6M 5FTKA 4K6DA 3DEPA 2D7GA 3FKEA 4IBGA 1XTCD 2JA6B 3J7AF 2CV2A 4OO1G 2BA1A 1I4RA 1L1TA 1PZKD 2PQEA 1Q1BA 2NVXB 4G4KA 3N52A 5CC4A 1HCZA 4FVMA 3NUCA 4DK1A 4HR7B 4DR2M 1CQFA 3J7YW 4RFBA 5LL6S 1WXQA 1I6VC 4ZYSA 1GHJA 5KEEA 4H13C 2KA7A 4V0BA 1DZ1A 1BCPF 5JAVA 4JV5M 3U6LA 2ZXOA 4FO2A 4LJ6A 4EIWA 2KW0A 3QO2A 4KJNA 4GC9A 3NWTA 1EY5A 4DV4M 3FTCA 4DAYA 3OWFA 2ZXRA 4FD2A 1S4ZA 3H91A 2R6GA 4KD4A 3QWLA 3ZCBB 4BBSB 3Q0AA 4C3IB 2I07B 4QMGA 4CISA 4Z9CB 3JAMS 4UAIA 4FF2A 3WDNA 2DY7A 2IL8A 5J39A 4DR5M 1KNAA 1IW7D 2YR0A 1RTOA 2ZAOA 4DR4M 3I72A 4IUTA 1DO0A 2QILA 2D9UA 3LWEA 3J81S 3JR4A 4IUUA 3L25A 4RGTA 2H1RA 4FYDA 4HMJA 2Q2EB 2E2IB 5G3LD 1TY0A 4IUVA 5J1ZA 1ONLA 3DMUA 2CV1A 2JXMB 3UZUA 1EFID 1IBKM 3L27A 3AJIB 5M3FB 2UUAM 3FYCA 1OXVA 3EIEA 2IPKD 2YYZA 4NSRA 1YNNC 1O7LA 1IYVA 4OL7A 1YNND 4D81A 4CGYB 2EYLA 3HU3A 5GKNA 5M3MB 3DWAA 3KBXA 1LT5D 3L2AA 3P75A 1IXRC 2OQ4A 3D6CA 1K8OA 5C4ZA 1HUNA 5JEAH 3MFYA 4RKBA 3KS4A 3MXUA 4FWGA 5C0XJ 3I4LA 4MGHA 5JI2E 2J0TD 3OHXC 4LRTA 1IW7C 2BDOA 4IUQA 4IUNA 4ME5A 4BBRB 4RGNA 4N9PA 4X65M 5EXTA 2CEAA 3SMSA 1LLRD 4S12A 4DN4M 2CHVA 4R9WA 2EA0A 1J7KA 1ICWA 5KYLA 3E6ZX 1NVMA 2EJFC 1B9MA 2B2UC 5E26A 3GPPA 1FNUA 5C1BA 5JI3E 1CTMA 4X62M 3MEHA 2L7HA 1IN6A 2LXEA 3GQBA 1HTPA 2MJ8A 1J9OA 1S3SA 1F2MA 5C5LA 2F03A 1ILPA 5DYGA 2ZM6M 5HGTA 4DK0A 5C4HA 1FR3A 2X8AA 2OEOA 1NNUC 5JJZA 2VQFM 2HCIA 5IIFA 3S14B 1SXJC 5I6WA 4PNYA 4QNRA 4I65A 1W6KA 4FW9A 3GQ5A 5TSSA 3P20A 2Z7JA 2F0NA 4RF0A 2LMCB 2F3VA 3I4YA 4OU7A 5E3FA 2L09A 2FFKB 2I7PA 2A6ED 1NJGA 2CE7A 2Y0TA 3PFIA 1LV7A 3ONAB 2FE8A 3EA6A 4REZA 2ID0A 3KSXA 3MZ5A 4NKLA 1Q39A 3S17B 3FKIB 1AZQA 3BG3A 3AU7A 3H94A 5A2QS 4N9TA 1RCVD 3CRKC 2J7OA 1TY2A 1K8MA 3SBJA 3K8ZA 1OFIA 3DXJC 3PXGA 2Z3XA 1NY5A 2F0KA 1NUCA 3M7NA 1JQJC 2JA2A 3RGSA 3TWLA 1SE4A 4LF7M 2ICEC 5NUCA 3FD9A 3U6OA 5D14A 2HKJA 2AHMA 1E0BA 1ENCA 2B2WA 4MHEA 3VK7A 3K0YA 2R46A 1SXJE 3FPPA 1H9KA 2Y0SB 2VB3X 3WOFA 3M7GA 3IFTA 4R3DA 5C3EB 1GL7A 1EY9A 2TSSA 4LFCM 1SYEA 3BDOA 1SFOB 1AP0A 3FUXA 4KK7A 4LK1C 1EZ8A 3J7AV 2FJ2A 3HHYA 3TWMA 2BDNA 3CRLC 1XYIA 1XNRM 3FUUA 1RKNA 1VCIA 1STAA 2Q8RE 3L9AX 5ITYA 1TWAB 5IT9L 3MHBA 5I4DA 4DV7M 2A5HA 3Q23A 4CJ2C 3KOYE 3FUWA 1DOLA 3RUZA 1HT2E 3FTEA 1ET6A 2BE5D 2QKIC 3HS0C 4GITA 4L16A 3AKZA 1IY2A 3SK4A 1BXTA 2FOIC 4FWHA 1GOZA 1JR3D 4NDXA 2EUCA 3J7AS 1IY0A 1IBMM 4K2KA 3SHLA 2YQZA 3UJNA 1D1KA 3BVMA 3SFZA 3CF2A 2JEBI 1GUNA 1SXJA 4RGMA 5CORA 2CVRA 4PV1C 4DR6M 4A3JB 3OMGA 1F2LA 1F77A 1K3XA 1GUTA 2CHQA 4HEDA 3PUZA 4JXJA 2F0HA 4C3HG 2QF7A 1C1KA 1O7YA 1F9QA 1SE2A 2F0UA 1WTPA 1QANA 1LACA 2PYKA 2DWMA 1WTRA 4BY1B 5EKKA 1TGUA 2EYFA 2EXZA 2EY5A 2RKOA 1QILA 3TQSA 1ZYRC 5C0XG 1JOKA 1JICA 2F0DA 4PD2A 5IGDA 3I8ZA 2Z4RA 1PFMA 4JBWA 4DNRB 5FLXL 4RF1A 4LGYA 1CA5A 2G8LA 1JOOA 1YNJD 3E0JA 1B44D 4U68A 1PFBA 5EP1A 3GO8A 3C2PA 4B3TM 3V96A 2D62A 2RKSA 4EGVA 2B2YA 3BOSA 1SEBD 3MFGA 3KW6A 1Q1EA 5K36H 3C46A 4ILWA 3GRYA 3P7JA 4LJ4A 2OXPA 3C1EA 4JI8M 2B63B 1HNZM 3HOWB 1NR2A 3AOEC 4RWSC 4QOZC 5KQDA 1Q8IA 4K5XA 5IT9S 3KFUG 4RA8A 1WTWA 4B9XA 4NXMM 3QB3A 4B7GA 3C58A 2K6AA 3A54A 3CF6E 1RODA 2ENBA 3U6SA 3QOJA 3M0EA 4C3JB 3DUZA 2FHTA 4DV5M 3ZH9B 4DA2A 4A3VB 1C4QA 4HTHA 3EIHA 2L1BA 3R2IA 4CJ0B 1NY6A 2FMMA 1G41A 2KZUA 1HPCA 2LKVA 4AG6A 2H4OA 3HU2A 3DA1A 3X3MA 3TBIB 2XZUA 3W3AA 1A3UA 4MM3B 2FFJA 4IBJA 5EJCA 2QBYA 1ENAA 2PW5A 4M9XA 5CBAE 1HXYD 4BBAA 3E9SA 2ZT9C 1DONA 5EBCA 1FJGM 5FSWA 3GP1A 3CTWB 4B3MM 1EY8A 2V4DA 2K04A 2Z4HA 3NWLA 1WCMB 3V2TA 1E9SA 4DV3M 2O5IC 3SATA 2XZFA 3VYRA 3BYYB 2LFNA 4GKKM 4FCTA 2WB1B 3PUWA 3KOXE 1DD2A 3J80S 1I4PA 5IWAM 1XXHB 2NN6G 1CI3M 2D7EA 2KEBA 3RMHA 2PCFB 2A68C 4BWGB 3VLFB 4MB7A 3HP3A 3U61A 1HA5A 3K5MA 3TE6A 3CF0A 1YE9A 4U673 2CFOA 5FTNA 4KY6A 2KZSA 4B7HA 3U6DA 3H0GB 4G7HC 4ZK9B 3J27B 3T53B 1KLGD 2JEAI 4JK1C 4X3UA 2CV0A 2UXCM 5BN4A 4NL4H 2K05A 2KEDA 3KVWA 3MXNA 2LY7A 4JI7M 2HDLA 1VMPA 4GZYC 5H37D 2N55A 2PZTA 3R8BA 4IBEA 3GTOB 2E2JB 4GMQA 1EY6A 4K5WA 4LFAM 2L0CA 1R2ZA 1CFMA 4LGMA 1LTRD 1TU2B 4KY5A 5CV7A 3O13A 2QEJC 3U6MA 2KHSA 5EKLA 5I6YA 4CJ1B 3N6RA 2DZNB 4NRVA 1SE3A 1AZPA 1JCKB 2Q8IB 2YFQA 4QB4A 4A3BB 1DGHA 3TSSA 4L8RC 3PUXA 2WAQB 1B4OA 5FTJA 4D82A 2I46A 3D4RA 1N33M 3KSJA 8CATA 1HQYE 1QCBD 1F9SA 1J8IA 3OMCA 3HRZC 4G7ZC 1JWSD 1F9RA 2RDHA 3GLFB 2F5SA 3IKJA 1Z6HA 5C0XI 3KXEC 1KTKA 1PRTB 1AW7A 4GHLA 4JI1M 2F5PA 4KHVA 2Y0QA 1SYFA 3LQQA 1UEAB 2V1CA 4IUPA 1QOHA 4MGKE 1TWCB 3TPZA 3ZC7B 1G2TA 1ZXTA 1VDZA 1C8CA 1Y1VB 3J2PB 2E75C 2DWNA 3UGJA 3Q6SA 3H09A 3LNNA 2UU9M 4X3SA 2VNUD 1MI2A 4ZUIA 1K82A 1D5MC 4OHJA 4QF4A 3MTSA 4GRIA 1JWUD 1PRTC 2PNRC 1CM9A 3GD7A 2DZOB 1G3IA 2KXEA 1R7RA 2BOSA 2NVQB 2K03A 3VR2A 2SOBA 2Z8LA 1KYIA 4C1NK 1YUBA 3RZDB 1TS2A 4DV2M 1GHKA 4I4LA 4GHAA 3E4RA 3NQIA 3HHXA 4K6LA 3VA7A 2F0GA 3DZDA 3EQLC 1XC8A 2RBMA 3D31A 4I5SA 2B39A 3QG1A 4EQOA 4K8IA 1CZWA 4AG5A 3R8FA 4RNAA 1UM8A 3NK9A 4ZAIA 1U4LA 4HSVA 5A2QE 5FTLA 4B9WA 1CA6A 1A3VA 5DYIA 4XQNA 5ELFA 1TDZA 1U4RA 2MPMA 3C1FA 1PJIA 3AMUA 1PTOB 1LT3D 1QQWA 4A3EB 3RD4A 4ODGA 5DM63 4BA2I 5G3LF 2O4XA 3MWYW 5CV6A 3LVWA 3OIPA 4WFN3 3AOEA 4MIUA 3GQ4A 3S1NB 2KJXA 3S1MB 1X37A 1J09A 1N36M 5ITXE 1TVXA 1IN5A 1SXTA 3L29A 3L28A 2WACA 1EY4A 1I3QB 4H44C 3QAUA 4TRDA 4LJ7A 1LTTD 3VYTA 1O78A 3I91A 4OIKA 1KLUD 5E6JA 2AQ1B 2M2LA 3T13A 3GPUA 3K59A 1XWEA 2NN6I 3K2LA 3KLRA 2HHHM 4FF3A 5C44B 3T16A 4Q5VA 2NYZD 2L7IA 3SAUA 2UUCM 2JA5B 2NVTB 1HUMA 3DOAA 1DOKA 3U9SA 4I8OA 2PPBC 3AL0C 2EJMA 2F0FA 2O2LD 3EVQA 3SHGB 3PNYA 4IBFA 2X6GA 1STYA 2CUZA 3MXGA 2C9OA 1BCPD 3KP0E 2WV6D 5KNCA 1Y8PB 1TIID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHT B;  3NBI A;  4CGY B; 
#chains in the Genus database with same CATH topology
 5KO3 A;  2R4E A;  2UUC L;  4KLK A;  1QAO A;  1V8Q A;  1CHP D;  4L6T B;  3T1Y M;  2CHB D;  1DGS A;  1T9H A;  3MHV C;  2R92 B;  2A74 C;  5IP7 H;  3PIP 3;  4L6V 6;  3FYD A;  1GAB A;  4BB9 A;  1UWV A;  3T1H M;  1K0S A;  3GLG E;  1G59 A;  1I4X A;  2B8F A;  1PVO A;  1LM0 A;  1XNQ Q;  1D0M A;  1QZG A;  2UUB M;  1AH9 A;  4IBK A;  2GVB A;  1G6P A;  1EUJ A;  2RGO A;  1X3Q A;  4TUW A;  2XEP A;  4V19 0;  1LTG D;  1EIF A;  1EWH A;  1I4Q A;  4A93 B;  3TME A;  4BXX G;  4JYA Q;  1Z47 A;  5C3X A;  2DVW B;  1CZG A;  2QDB A;  2EE1 A;  2NUC A;  1FYC A;  1JC7 A;  2EYM A;  2XNA C;  2XRS D;  1Q90 A;  1E32 A;  3S15 B;  2I5H A;  1A3T A;  4J1M A;  1VMC A;  2PNH A;  1WVL A;  2QCP X;  5BN5 A;  1OJL A;  4A3D H;  1L2B A;  3GTL H;  3NBH A;  3HOU B;  3F8T A;  2WIN B;  3FTF A;  3NBX X;  2K7V A;  3AB9 A;  3I7F A;  4XXE A;  1XPR A;  4DKA C;  2MH8 A;  2KNZ A;  3C9P A;  3TZD A;  3MMP A;  3RN5 A;  2UXB L;  2YTV A;  5KQ8 A;  4IO9 A;  4LJ5 A;  3ITP A;  5HUR A;  1VQ7 A;  4HLQ A;  4JI8 Q;  4CDF C;  4LF9 M;  1VQN A;  3K5O A;  3DHQ A;  1WD0 A;  3UMM A;  2N78 A;  3H0G G;  3NTH A;  4A3K B;  1L1O B;  2MO1 A;  2NZ1 D;  1PH1 A;  3A5Z B;  4RKL A;  3LCU A;  2K5W A;  3AV0 A;  4NXN M;  5ITU A;  2F0L A;  1JB0 F;  4DK6 C;  5LMN M;  1SBB B;  3S14 H;  4J8Q A;  3FMC A;  3HJ8 A;  1N34 Q;  1YNJ C;  2L4E A;  1WOC A;  3EN2 A;  3RLF A;  3HKP A;  1BUV T;  2KHJ A;  2OPF A;  3TWK A;  4JI3 L;  3J7Z C;  4BY1 H;  2KUM A;  1WTX A;  1FNN A;  3H4M A;  4OWX B;  3SYL A;  1D2N A;  2FS1 A;  3A98 B;  4PCZ A;  4XQQ A;  1IL8 A;  2JA7 H;  2KVM A;  3LWU A;  4DR4 L;  4I7Z C;  1QVR A;  5LMU M;  1PFN A;  2BJV A;  2UUA Q;  2NN6 H;  2QPA A;  2R3Z A;  4LG2 A;  4LFB M;  1H9R A;  2K9D A;  5F2D A;  1CSP A;  1IHZ A;  4PQX A;  2NBF A;  4GN3 B;  4JI3 M;  1DXM A;  4FDB A;  1E2Z A;  1HR0 M;  2A6E C;  4LFC Q;  4O42 A;  3S24 A;  3PIO 3;  2E5L Q;  1D5Z C;  4JI6 M;  1QNU A;  5E4W C;  3K5L A;  4BY7 H;  4DAV A;  4AKH A;  2K01 A;  2GNO A;  1A62 A;  3A7A B;  1YVC A;  3D4W A;  2EVB A;  3D3R A;  1HA6 A;  4JN6 A;  4DUZ L;  1Y8N B;  1JWM D;  3HWS A;  1DM0 B;  1M8A A;  1UE1 A;  4X6A H;  1JR0 D;  1V1P A;  2XVS A;  1XNR L;  3R2T A;  4A3K H;  1BCP B;  3SVM A;  3KK7 A;  3RFW A;  2N8N A;  4LY6 A;  1NNJ A;  1IKL A;  2Z4S A;  1B9N A;  1PYS B;  2B3T A;  1QUQ A;  1KIX A;  1SJE D;  4KN7 C;  1B50 A;  3EIV A;  3VR5 A;  1H9S A;  4P73 A;  5C5M A;  3GLH B;  2HDM A;  4MGY E;  1MSG A;  3CCR A;  2EZV A;  1SMY C;  1QB5 D;  5IOD A;  4DR3 Q;  1MIU A;  2KCM A;  1DYQ A;  3CC2 A;  1MX0 A;  4FWD A;  4F1I A;  1VQL A;  4A3F G;  1EYC A;  1K83 B;  2DAG A;  2BJW A;  4GC5 A;  3VKG A;  4K2L A;  2VF7 A;  3E5S A;  1KC8 C;  3DWQ A;  2OOA A;  3OPO A;  4EQ5 A;  2ALY B;  1PTO D;  4JI1 L;  4A3C G;  3PVS A;  3HKZ B;  2JP7 A;  4CBV A;  2MP1 A;  4DV5 L;  1IBM L;  1HR0 Q;  4G6Z A;  2B2V A;  2UXD M;  2KBN A;  1EQT A;  2WKC A;  1H9S B;  1I3Q H;  5JOB A;  4DF7 A;  1GLN A;  1C48 A;  1HNX M;  1ML0 D;  2JY8 A;  4L4U A;  3B74 A;  1C9O A;  1BQQ T;  4R4Q A;  5M3M G;  5DFL A;  4LJ9 A;  3VDP A;  4PZ7 A;  5J22 A;  2WSE F;  1ILQ A;  2FH0 A;  4DGZ A;  1N77 A;  1B1Z A;  2KCT A;  3MXP A;  3CCL A;  2NZO A;  5C3E H;  4L5R C;  5ELC A;  3ND9 A;  3TS2 A;  1EWI A;  2F0E A;  2K5V A;  2EOT A;  2RSO A;  1Q3L A;  1XWI A;  1RHP A;  1T5X D;  2P5T A;  3S2H H;  5D3D A;  1VEG A;  3RN2 A;  1GVN A;  1NHW C;  3BDL A;  4DAY B;  3G6J B;  4NC6 A;  1OXU A;  1XXG A;  2EPB A;  2VS1 A;  4B3M Q;  2KEN A;  4OON A;  1PJJ A;  1K0R A;  5GAE C;  4D80 A;  4M0D A;  5M9O A;  2ZM6 L;  4RH6 A;  4Z6Y A;  3SK8 A;  2RA4 A;  1UFZ A;  3UDG A;  2RCF A;  4DUZ Q;  2OF1 A;  3GLH A;  2AMC B;  1VQ8 A;  1XNR Q;  4HAE A;  2L5T A;  4FCV A;  4LRS A;  3NE5 B;  4DV2 L;  1RU3 A;  4IBB A;  1U9R A;  1Y8G A;  3QYE A;  4JYA M;  3FP9 A;  4P2C B;  5IGB A;  4DV4 Q;  1YZ6 A;  4PDG A;  2D5D A;  1P16 A;  3NWS A;  2EYO A;  2YNM D;  4IIW A;  1CKM A;  3TQY A;  1EQV A;  2UXC Q;  2LNH C;  4DV6 Q;  4X64 L;  2JA7 B;  3LX0 A;  4NW2 A;  5COY A;  4JI0 L;  4LF6 M;  1RJT A;  4FF4 A;  3CP0 A;  4LZZ A;  5ELB A;  1LO5 D;  4R4C A;  1Y69 U;  1E9R A;  2DNA A;  1EU3 A;  4KN4 C;  1QVG A;  2JA8 H;  2EDG A;  1QUQ B;  4BLC A;  2E2D C;  2EY6 A;  3J7A 5;  1W5S A;  4PT5 A;  3QWN A;  5DM7 3;  4AIM A;  3J81 i;  1SNC A;  4L63 B;  2I7N A;  3URY A;  1YHA A;  2JWS A;  4ANR A;  4XGI A;  3B7Z A;  5JVG 3;  3UK6 A;  3FDT A;  4Q7J A;  2Z1C A;  3D8G A;  1I94 L;  1GUG A;  1MKH A;  4EQP A;  4LJ8 A;  2F0W A;  3TRZ A;  1B3A A;  3A55 A;  4ZLT F;  3PF5 A;  2RSN A;  3GTM H;  1XNQ M;  1IYJ B;  1LTL A;  1K3R A;  4POG A;  1STG A;  4TQU S;  2OTJ A;  2C35 B;  4GOP B;  1K3W A;  3K1J A;  4CIZ A;  3HY5 A;  1N34 M;  1SN8 A;  5DNY A;  4XT1 B;  4LF7 L;  3NPP A;  1GM5 A;  1WR1 B;  1T6O A;  5T1I A;  4DUY L;  4LCB A;  3IEC A;  1KAB A;  4FNF A;  3VR3 A;  3CF5 A;  1D0K A;  3VDU A;  1S40 A;  1NSF A;  2JSO A;  3NBI A;  2JNH A;  1PDQ A;  3MJ5 A;  1EFU B;  1PH7 A;  3SC3 A;  2FIN B;  1WYD A;  4UP7 A;  2DNC A;  4X66 M;  2Z4I A;  1X9N A;  2PO4 A;  2XFS A;  2AWN A;  2UUC Q;  1ASZ A;  4K5V A;  2M00 A;  3SK5 A;  3AFP A;  4R8N A;  2DAK A;  4B08 A;  5ITT A;  2CH4 W;  2XGN A;  1BBX C;  2DAM A;  2RDF A;  3CPW A;  1F2Y A;  3PO2 B;  1Z6T A;  4QNM A;  1EY7 A;  3S1R H;  4DV4 L;  3QJY A;  2IX1 A;  3GTJ B;  1LTI D;  2LSS A;  5GRO A;  1KAW A;  3GTP B;  3SAR A;  5KND A;  2XSC A;  3Q22 A;  4P16 A;  1X32 A;  4X65 Q;  2ZJQ A;  2KNV A;  1OFH A;  4IJL A;  4RAU C;  1GO5 A;  3IFD A;  4KKT A;  2IWH A;  1ET9 A;  2F0T A;  4AI6 A;  1VQ5 A;  4XBO A;  4OX9 L;  2YU9 B;  5C4X B;  1NR4 A;  5IGC A;  1NHG C;  4DR7 M;  2EY2 A;  1MBY A;  2APL A;  2PQA B;  3HOY B;  2M5Z A;  2DKL A;  4KJO A;  2R4J A;  3OW2 A;  1VF5 C;  2FMC A;  1XX8 A;  4R4T A;  3ICE A;  3S1N H;  5FO7 B;  4A3B H;  4IFD J;  4KOD A;  3D8B A;  4CHT B;  2R45 A;  3GLG A;  5EP2 A;  4A3I H;  3PO3 H;  1I6H B;  4QGU A;  3PF4 A;  5EP4 A;  1NO1 A;  2H1E A;  1XHB A;  2C99 A;  2R65 A;  1HNZ Q;  2K5D A;  2F4I A;  4LF8 Q;  2ERC A;  1QG7 A;  2VUM B;  3I3C A;  3U6E A;  5FKA C;  2UU9 Q;  1EYD A;  3D6W A;  3WHK A;  3UDF A;  4DXF A;  5M3M H;  3V05 A;  3HOX H;  1PRB A;  3SAS A;  4OEM B;  5IWA Q;  1IBK L;  1T5E A;  4C3J G;  4L5T A;  4JI5 M;  2F5N A;  2JE6 I;  4N8F A;  4ZQ3 A;  1D6E C;  3DLL A;  3HOV H;  2LVN C;  5KIX A;  1GVP A;  4OVZ B;  4C1N I;  1ORY B;  1JMC A;  1U4P A;  4ZRZ A;  3TP5 A;  3UE1 A;  1UE5 A;  1ZMW A;  4KT0 F;  3SAW A;  2G9H D;  2GN5 A;  5C3W A;  4IAL A;  4A3F H;  1CUK A;  1I5F A;  5IYB G;  2EYP A;  1VQ6 A;  1Y1W G;  2KEE A;  3P1H A;  2D2C C;  2R93 G;  4W5W A;  1Z5B A;  3I4N H;  2CKZ B;  1JB3 A;  1AIP C;  1YJN A;  3QIA A;  2ZJR A;  3HOZ B;  5IGE A;  2P5Z X;  3KOZ E;  2LS0 1;  1BR9 A;  3SYK A;  2B2W C;  3EJI A;  1IBL Q;  4A3I B;  3PO3 B;  4K14 A;  3JAM L;  3K80 C;  4O2D A;  3VYU A;  1WTO A;  1ASY A;  4A3K G;  4AH6 A;  3TP8 A;  4LFA L;  3K92 A;  1T43 A;  4Y7N B;  4A3J G;  1G8Z D;  4XDX A;  4IFD H;  2O5R A;  4EQN A;  2JP1 A;  3U60 B;  4AKG A;  3U6Q A;  1CK1 A;  3D4D A;  3I4N G;  1OXT A;  4EVO A;  3J80 E;  2JUJ A;  1UNS A;  2JN4 A;  1LT6 D;  3L3O C;  5FLX E;  1VQ1 A;  1O80 A;  3T4A C;  2HHH Q;  4QUC A;  5IY0 A;  1MHW C;  3VK8 A;  2B8G A;  2OTL A;  4DV1 M;  4X64 Q;  4LUV A;  3WHL A;  2L4N A;  3IRB A;  2L11 A;  3DWP A;  2CRU A;  1SNP A;  4KKU A;  2QQ8 A;  3UE0 A;  2ZBK B;  1HZA A;  2HQE A;  4OO1 H;  2A6H C;  3OWE B;  4POF A;  3KF6 B;  3L26 A;  2G5D A;  4AYB B;  4WUR A;  1A6X A;  1SSO A;  5FOB B;  3GTJ H;  4LFB L;  3I4V A;  2XWB B;  4HL4 A;  1G4A E;  4B3S M;  3UDX A;  2RGH A;  2IX0 A;  1HR0 W;  1I50 H;  1EQQ A;  2K32 A;  3M6A A;  4DXG A;  1VQP A;  1B8A A;  1L1Z A;  4M9Z A;  1IM2 A;  1R9T B;  1SYG A;  1ESF A;  4F8M A;  4G57 A;  3GTQ B;  3HOY H;  1OKS A;  3AQQ A;  2PW7 A;  4A3E H;  4AZF A;  1SJH D;  5EKI A;  4ZUJ A;  3Q8D A;  4IBI A;  2IT1 A;  2VL6 A;  5FJ8 G;  1JQY D;  4A3B G;  2R93 H;  2KRU A;  4L8J A;  3W2D A;  1XMQ M;  3SAV A;  3ULJ A;  1IN8 A;  1IQP A;  1E2V A;  1PXU A;  2I0Q A;  1R4G A;  3GV3 A;  4G4R A;  3K57 A;  4FCW A;  4B3T L;  4JI7 Q;  2VXW A;  5M5X B;  3M4Y A;  4X65 L;  1W6J A;  5IE8 A;  5JPN C;  1XMO M;  4QOS A;  2L9H A;  1YEZ A;  1LV9 A;  4IPH A;  5I2X A;  2MGW A;  2F0P A;  2WKD A;  3GTP H;  1U5K A;  2F1M A;  4A3D G;  4LFA Q;  3U9O A;  3NQT A;  2Q2U A;  4LNQ A;  1HFN A;  1E24 A;  1S72 A;  1AN8 A;  1VF7 A;  5EJW A;  1KFV A;  4DU9 A;  1IN4 A;  3DFZ A;  4AW4 A;  1G6Z A;  1QVC A;  2A5Y B;  3CQZ H;  3RGP A;  3FHW A;  3NXW A;  2WSF F;  1N78 A;  5CBE E;  3CC4 A;  5C44 H;  2GA4 B;  4XYO A;  1HNZ L;  1HJP A;  2DY8 A;  5C4X H;  1ZKO A;  2RQX A;  5JEA G;  4DPG A;  1OAI A;  2HL7 A;  1NBW A;  1UUP A;  1P3Q Q;  1KDA A;  2PZW A;  1BNZ A;  3T38 A;  1PTO H;  2WII B;  5ELE A;  2K52 A;  3BZD B;  5CV9 A;  3EFX D;  3KDF A;  1K8A C;  3J81 L;  1MU5 A;  2AUK A;  3STB D;  4NXM L;  3DEO A;  2EKK A;  4WOR A;  5FO9 B;  1I4H A;  3MAQ A;  5KYI A;  4ZKB B;  1K9M C;  2X4A A;  3NEM A;  2F52 A;  1PYB A;  3I4N B;  2X49 A;  3FRP B;  1PFS A;  1V92 A;  2XGT A;  3HHW A;  3CCM A;  1I6H H;  3KBG A;  4DFA A;  3MEF A;  4IFD I;  4QHS A;  1SMY D;  2D0P A;  1SRU A;  2VZA A;  2LHC A;  4BBS H;  1LUZ A;  3PIO A;  3TP6 A;  3L2P A;  4OX9 M;  4ULL A;  4C3I H;  3HOX B;  3KOW E;  1Q46 A;  2RCN A;  1R2Y A;  1H9M A;  4YWK A;  2EJG C;  5M5X H;  1N32 L;  1FVI A;  3B6Y A;  3HZX A;  2VW9 A;  3CKI B;  1VQA A;  5CMD A;  2KEC A;  4PZ8 A;  2NQ8 C;  1Y1V H;  4LFC L;  4ZKC B;  4CKB A;  4JI2 Q;  3GLG B;  2K5Q A;  3W1G A;  2A8V A;  5IWA L;  4R8I A;  3KDS E;  3CHB D;  3RLN A;  1IBK Q;  1EIG A;  4J6H A;  4Y52 H;  4G7O C;  5A35 A;  4OVZ A;  1A2U A;  1ZMU A;  3KUP A;  1WD1 A;  4IZ8 A;  3CME A;  4JI0 Q;  1D5X C;  5KRU A;  3F2U A;  2B2V C;  3SMP A;  5KPZ A;  1PV4 A;  2EYH A;  1F9P A;  2VQE L;  3GDE A;  2YV5 A;  3K9P A;  5F3W A;  4MGI E;  1IXS B;  2J7Z A;  4ZCK A;  4NSO B;  2V6Z M;  1L2C A;  2CW0 C;  2NVQ H;  3HOU H;  1K28 A;  3H3V C;  3HX3 A;  3PUY A;  3J7B A;  2DN8 A;  4KLN A;  1CKN A;  3FKI H;  2R7Z H;  1TH4 A;  1E1O A;  1NAP A;  1DV0 A;  2DNE A;  3HOV B;  5T1G A;  1EU4 A;  4A3J H;  4FXK C;  4IFD G;  3IG5 A;  3ILK A;  3B9P A;  2VQE M;  4H02 A;  2BWE A;  1LTS D;  1VS0 A;  2F0M A;  1E2W A;  1QYR A;  3H3V I;  1Q8K A;  4DV5 Q;  3W0L B;  4CKE A;  3F92 A;  2M60 A;  3M9B A;  5IGF A;  3SR1 A;  4IJE A;  1VDD A;  1IXZ A;  4MTN A;  5KNB A;  1JOR A;  3R9X B;  3OOC A;  2EY1 A;  2KCC A;  1YIJ A;  4WW0 A;  4PMC A;  4GKJ M;  1YSY A;  2QEX A;  2XH9 A;  1CQV A;  5LL6 X;  1R4P B;  1Z59 A;  3WOE A;  1TH3 A;  3IAY A;  1B53 A;  4DV3 Q;  2F0Q A;  3F2B A;  1PTO C;  1QJO A;  1SXJ D;  4ZPX A;  3RZD H;  2K28 A;  2N88 A;  2R61 A;  1YHQ A;  4JPB W;  1X65 A;  3I01 M;  2SEB D;  3HKS A;  3GTK H;  1PZJ D;  1BCP C;  1DGF A;  2R18 A;  3NSW A;  4LF8 M;  3T1Y Q;  2XTI A;  1NSN S;  3VKH A;  2G5G X;  4GKJ L;  2DAI A;  1TWF B;  1KL9 A;  3HOX G;  2R0I A;  1H9J A;  1I4G A;  4DR5 L;  4Q0F A;  5D3I B;  1NMG A;  5EPL A;  3TDQ A;  3SHF A;  4DV7 L;  1VEK A;  3GRR A;  3KLS A;  2JYO A;  2IW3 A;  2K5N A;  4G4Q A;  4UHV A;  2DXI A;  1TTE A;  4M0W A;  2OO9 A;  4L15 A;  1V9P A;  3QOL A;  3X3N A;  1VQE A;  3HKZ E;  5DLQ E;  4PDI A;  1S5B D;  3NTI A;  1BDO A;  3CU7 A;  4FXG C;  4C2M B;  3B7N A;  1HQM C;  1QZE A;  4QHT A;  1JJC B;  3HOV G;  3GTM B;  3PIP A;  3S1R B;  3A8J E;  3KP1 E;  1MGS A;  4JOI C;  1SLJ A;  1I4W A;  5BPV A;  2NB0 A;  2Z6B A;  3PMF A;  3SEB A;  4DV0 M;  3UI2 A;  1MSH A;  4GNX C;  3GTG H;  3AOG A;  1AEX A;  1DCZ A;  1II3 A;  2QEN A;  4LJA A;  3A46 A;  1D8L A;  2NVX H;  2UU9 L;  1GJT A;  3NHH A;  4LZJ A;  1PH6 A;  3MVV A;  5LHY 1;  1TS4 A;  1AE3 A;  1B7Y B;  4YHH Q;  4S3S A;  2JA9 A;  2UXD L;  3OTO L;  3MXN B;  3PUV A;  3Q24 A;  4YCW A;  4XTC S;  1PTO F;  3SK6 A;  3T56 B;  1E1T A;  2WAQ E;  1STB A;  5DNF A;  2C96 A;  4PMB A;  3H6M A;  2C98 A;  3VR6 A;  2IX3 A;  2DHY A;  2KOL A;  1FNW A;  5LMN Q;  2CP8 A;  3G4S A;  3ERQ A;  3C3D A;  2MR9 A;  1STH A;  2WP8 J;  3BBZ A;  4JI4 L;  4JW0 A;  2HD3 A;  4BY1 G;  1LT4 D;  2A69 D;  4UDU C;  1EE8 A;  2PZU A;  4XT3 B;  3OTO M;  3PSI A;  1RIP A;  1QAM A;  7CAT A;  2MHV A;  4JI6 Q;  4R71 A;  1HNW M;  2EYJ A;  4LMQ D;  3HOZ G;  3W68 A;  1VDL A;  3A8I E;  1GL6 A;  2SNM A;  1GJX A;  1CKN B;  1S3O A;  3GV6 A;  2O01 F;  3MK6 A;  4X3T A;  2A19 A;  2B63 G;  4JI4 M;  1NMF A;  1FGB D;  1Z9F A;  3S9W A;  3HJS A;  3I4M G;  4HIK A;  2E5L M;  1TS5 A;  1HFG A;  4NRW A;  1OXX K;  1XB2 B;  5AFW A;  3PCO B;  1XPO A;  4RGO S;  1NNX A;  4KD3 A;  2PI2 E;  3H4J A;  5C4J H;  2AKW B;  3GTL B;  1JE4 A;  4K0K M;  2JA7 G;  3I4O A;  1Q3C A;  3S15 H;  1PZI D;  3GP7 A;  4LF6 L;  1IBM Q;  2VII A;  1T3T A;  5ITX A;  2E2H B;  1IXS A;  1PRT D;  1RTN A;  3VA5 A;  1FJG Q;  4DR2 Q;  4KHZ A;  1S5E D;  2L12 A;  2OQ0 A;  4XIG S;  1XXH A;  1BOS A;  1Y1V G;  1TQO A;  4JBK A;  2K47 A;  2CHG A;  2DZL A;  3CCU A;  1J5E L;  1IZ6 A;  1NCV A;  4IN3 A;  2V1U A;  3U5Z A;  2BNK A;  3A45 A;  1ZAE A;  3U61 B;  1FGU A;  1L0X B;  2DGY A;  4BBS G;  1CKO A;  2ZAM A;  2VQE Q;  3MC0 B;  1XMQ Q;  2E8G A;  4HCE A;  5EXS A;  2LXK A;  1YI2 A;  1N36 L;  3BDC A;  1STN A;  4B3R M;  1UE6 A;  2VY3 A;  3HEJ A;  3S1Q B;  5H1S E;  3M3Y H;  1U4M A;  2BE5 C;  3R3O A;  1J5E M;  4FF1 A;  4I81 A;  3PV0 A;  4AKI A;  4KHP L;  1S5C D;  4LF9 Q;  1PRT F;  1XTD A;  1WTQ A;  1UAP A;  2L6O A;  1SNQ A;  2XN9 C;  4GN5 A;  1YJ9 A;  2UUB Q;  4LF4 M;  3LVV A;  4DUY M;  1SNO A;  2JA8 G;  4UP8 A;  2K75 A;  3LQR A;  1S5D D;  3BU2 A;  2AWO A;  2F0V A;  3S2D B;  1EY0 A;  5IOC A;  5C3E G;  4A3G B;  1G29 1;  2KRK A;  1TKW B;  1TWF H;  2KA6 B;  2ICI A;  2ZTE A;  5GAD C;  3HU1 A;  3KS8 A;  3TN2 A;  1GXD C;  1TDH A;  2D7H A;  1TS3 A;  4C56 C;  2F0I A;  1P8L A;  5JVH 3;  2DHR A;  5DAU A;  4YY3 M;  4GOP C;  4BXX H;  4QIW B;  3SE0 A;  1V1Q A;  4P72 A;  4LWC A;  5AJ3 Q;  3E46 A;  3THG A;  3TP7 A;  4IUR A;  3CCS A;  4G4N A;  4A3M B;  2A1A A;  4A3C H;  1KSF X;  1PMR A;  1V43 A;  2E76 C;  3PO2 H;  2CW0 D;  1V33 A;  1KDC A;  1VQG A;  2Q8T A;  1EOT A;  4GNX A;  1IKM A;  1RF2 D;  1TR5 A;  3M4O B;  5CR3 A;  1WIV A;  1IFY A;  3TEH B;  3DM1 A;  2O25 A;  5E4X A;  2K33 A;  4LF7 Q;  1KHI A;  1DO2 A;  1X3P A;  5FJ8 H;  2J4X A;  1LAB A;  4KY7 A;  2L15 A;  3VDY A;  5M5W B;  2CQO A;  4QIW E;  1HHV A;  3RR5 A;  1TWG B;  2ZAN A;  1BO0 A;  1L8Q A;  1JOQ A;  2B2Y C;  3I90 A;  3T15 A;  4FP5 D;  4L78 A;  1WI5 A;  2XRQ D;  4M8A A;  4C3H B;  4YY3 Q;  2HHH L;  1NV9 A;  4LF5 L;  2HCC A;  4CKC A;  5E7N A;  1SND A;  4HN7 A;  4JI2 M;  4OGQ C;  2FNA A;  2QZ4 A;  2WB1 G;  3SXH A;  5ELN A;  2LH0 A;  3K58 A;  5FO8 B;  4JYA L;  5EP3 A;  2N35 A;  1HQR D;  4JI1 Q;  1GJS A;  1IBL M;  4UP9 A;  5JJL A;  5I9O A;  4GLV B;  3ER0 A;  1JR3 E;  1YIT A;  1N32 M;  2L4F A;  1QE6 A;  1N33 L;  1E22 A;  3U5Z B;  1A8V A;  1Z7T A;  4YCV A;  3VR4 A;  2R93 B;  2F5Q A;  4JI0 M;  1CT1 D;  4LAA A;  1IYU A;  1SR3 A;  2IJ0 A;  3I4M B;  3OYY A;  1TWH B;  3KDF B;  4KMU C;  1LTB D;  4R7G A;  3VFD A;  2M9V A;  2CCZ A;  1NJI C;  4M1U B;  1E94 E;  1A2T A;  4YWM A;  1EL0 A;  4NPS A;  4DV0 L;  2UXB M;  4ID6 A;  1WTV A;  2K1B A;  2MGS A;  4HMI A;  2AUJ D;  3U60 A;  2A68 D;  2AQ3 B;  1NJF A;  4M9S A;  3BZK A;  2EXD A;  1GUW A;  1EIH A;  1XJV A;  3A0J A;  3F1Z A;  2VUM H;  5ELO A;  5M5W H;  1I94 M;  1K8G A;  4R4O A;  4QL5 A;  1UEB A;  4WJW A;  5AJ3 L;  5EXP A;  1SRO A;  2EQS A;  2B2U A;  4NOO B;  1Z5A A;  3FRI A;  1SXJ B;  4QJF A;  5IRE B;  1K73 C;  2LVP C;  3G6E A;  2G9D A;  3L7Z C;  4RHR A;  1SYD A;  1QZM A;  4XQJ A;  1XXH E;  4IBC A;  3FKI G;  3ZJY C;  1VG5 A;  3JR5 A;  5ISR A;  3GLF A;  1VQK A;  3BVG A;  2KQ3 A;  3ZYY X;  3IL8 A;  1R6B X;  1V1P B;  3W0F A;  3JAM c;  5ITQ A;  3W5O A;  5K36 G;  2MNA A;  5C4J B;  4LUO A;  1ZQ9 A;  4IBD A;  3HOW H;  4DR1 M;  3LMM A;  2F3W A;  1BBU A;  4JVZ A;  3A8K E;  3ERS X;  1KRT A;  1HTL D;  1EEF D;  5KPT A;  4KI0 A;  1G91 A;  2QCU A;  1GUS A;  2F0S A;  1MD2 D;  1X56 A;  4N8X 1;  1JB7 A;  2JA8 B;  2QP9 X;  2XFT A;  5E1F A;  1H6U A;  1KDB A;  3HG9 A;  3BVZ A;  4HCS A;  1YNX A;  5D65 A;  3KF8 A;  2HIX A;  4HJ8 A;  3HJQ A;  3J80 L;  4MGZ E;  3T1Y L;  2CQA A;  4KKS A;  1SYB A;  3U6C A;  2KDL A;  1DGG A;  1HQC A;  4CJ6 A;  5L37 A;  1I94 Q;  1QVF A;  4QCL A;  1DJR D;  1SYC A;  3FVQ A;  4KTA A;  2BCO A;  2QDL A;  2NTS A;  2X6L A;  4TKO B;  5C0X H;  3VYS A;  3ERO A;  2B2T A;  5EGT A;  2A6H D;  1Q86 C;  5BN3 A;  1OO9 B;  4RHS A;  2OT2 A;  4LW1 A;  1EWC A;  3QR8 A;  4NMZ A;  4OO1 I;  2HWJ A;  5CGK A;  1PJS A;  4OIJ A;  1AFP A;  3IG8 A;  4IJF A;  3I73 A;  4C3H H;  2A69 C;  1DOM A;  5CV5 A;  5IP7 G;  5FK9 C;  3SDZ A;  3WWV A;  4DV2 Q;  5FTM A;  3FRH A;  4JOI A;  2Z6K A;  1RDP D;  4HSP A;  5IT9 c;  1QDT A;  3K5N A;  1XMQ L;  3U4Z A;  1HRJ A;  3GLH E;  1I50 B;  2F4V M;  1GUO A;  2Q2T A;  3C3E A;  3FPU B;  5FLX S;  1JR3 A;  1M4V A;  3M3Y B;  1DGB A;  2EO2 A;  4DV6 L;  1N32 Q;  2CWA A;  4DUZ M;  1QNK A;  2XIW A;  1A15 A;  1XMO L;  2ZJP A;  2XWJ B;  3GPX A;  4BY7 B;  2NVY H;  2SNS A;  1L0Y B;  4DR4 Q;  4MH0 E;  1W5T A;  1LYL A;  3L0O A;  4A3D B;  4OXP A;  3D8L A;  3OIQ A;  5EQ0 A;  4PMW A;  3T51 B;  4GH9 A;  3CQZ B;  4YIJ A;  5IGG A;  3FTD A;  3I70 A;  2XLJ A;  2QBY B;  2RVL A;  1Z5C A;  4BA1 I;  2NVT H;  4DAP A;  4DR2 L;  1PJQ A;  2QSF X;  2BH8 A;  3B89 A;  4NXN L;  5JPM C;  2XF3 A;  1Q3B A;  1STE A;  4DR6 L;  1Q82 C;  5KPR A;  3IHP A;  2X69 A;  4MN3 A;  1OXS C;  4QQB X;  2JA6 H;  3TL4 X;  3GTG B;  5EQT A;  1KNE A;  2NTT A;  2CFM A;  4KO8 A;  1EEI D;  5LMN W;  5IT9 E;  1QAQ A;  5CV4 A;  2L55 A;  1WFQ A;  3CAM A;  3HGB A;  2OWO A;  4LF6 Q;  1XPU A;  3S16 B;  5BR8 M;  1F2Z A;  1PLF A;  3S2H B;  4LJZ C;  1D1I A;  5KGU A;  4DNT B;  3GO5 A;  1FD7 D;  5EXX A;  1SDF A;  5M5Y B;  2RHS B;  4GEW A;  1WGN A;  2SDF A;  2TMP A;  1Y1W B;  4B3R Q;  3GRV A;  1GKI A;  1WHC A;  3FUT A;  2F0O A;  1Q12 A;  2E74 C;  4HEO A;  2NVY B;  4BBR G;  1J6Q A;  4LF5 Q;  3MA2 B;  4JI6 L;  4AQY M;  4H0L C;  5CV8 A;  3BS1 A;  3AFQ A;  4ME3 A;  2F0J A;  1L2D A;  3PNV A;  1G8P A;  1V1O A;  1DGH B;  5ITR A;  2C5C A;  3AFH A;  2JY5 A;  4A3F B;  3G71 A;  2RRU A;  3OSO A;  4KV6 A;  5EPJ A;  2R62 A;  5EBD A;  1TH2 A;  1EYA A;  2MUY A;  4DK3 C;  4IQZ A;  2AQ2 B;  4F88 A;  3GLI E;  5EAY A;  3RNU A;  4Z8X A;  3NBH B;  4GIP A;  5CYU A;  1R4Q B;  3BYT B;  3I51 A;  2XSZ A;  5GQO A;  4X3K A;  1O7Z A;  3A56 A;  4YCU A;  4DR3 M;  1NTG A;  1XNQ L;  4O1N A;  2HCB A;  3I2Z A;  1VQO A;  3GPY A;  4JCV E;  2R7Z B;  1PM5 A;  1YLA A;  3CCV A;  1D7Q A;  2DWL A;  3S1M H;  3SGI A;  2VB2 X;  5IZ7 D;  3HGI A;  3RZO B;  3I55 A;  5ELD A;  2LWX A;  3K6O A;  3GLI B;  1CHQ D;  2B63 H;  5JJI A;  1Y1W H;  2Y21 A;  3OW7 A;  5K5P A;  1Y8O B;  4H7B A;  2A73 B;  4DR7 Q;  2C9C A;  4DR3 L;  2B2T C;  3NP8 A;  2Z9H A;  1RD9 D;  4KHP Q;  1IY1 A;  4KHP M;  3HOZ H;  2DJG C;  4ABN A;  4J15 A;  1HT1 E;  4APV A;  1N75 A;  1G2S A;  4A4I A;  3G7L A;  4ITQ A;  1EQR A;  3CCJ A;  2XSZ D;  1QWY A;  3J81 E;  1EZ6 A;  3GLI A;  2F5O A;  1ESR A;  4XK8 F;  4I7A A;  4NP5 A;  4A3G G;  3FUV A;  3R93 A;  1ZEQ X;  2KCN A;  4LFB Q;  2PMZ B;  5A2Q L;  2Z6K C;  3W1B A;  2UXB Q;  1TT2 A;  3GRU A;  1EYG A;  1LTA D;  4WRD A;  3Q8X A;  4HJ7 A;  2RDG A;  2B3G A;  3A7L A;  2LXJ A;  4F7X A;  1SAP A;  1IN7 A;  4YHH M;  5EPK A;  4DV0 Q;  4TSS A;  3OTO Q;  2ZXP A;  1NY4 A;  1BVS A;  1X3F A;  4QUF A;  2E2H H;  1HNW Q;  4E6I A;  2QGQ A;  2BA0 A;  4GNX B;  4F87 A;  4FXD A;  4B7F A;  4C3I G;  3GTK B;  1FNV A;  3JAM E;  3HHZ A;  1B2T A;  4K8J A;  1EOV A;  4BS9 A;  5C6A A;  5I9P A;  2Y20 A;  3GQ3 A;  4RCN A;  3TZU A;  4JBJ A;  4X64 M;  4DV1 Q;  4NXN Q;  4II7 A;  4LF5 M;  5C18 A;  1A0I A;  3STB C;  3FEW X;  2C5R A;  4AQY Q;  2WZJ A;  1PA6 A;  2J7N A;  1KAA A;  3ND8 A;  3NTK A;  3M85 A;  2O5J C;  4RCO A;  3K7A B;  5JEA J;  2K4K A;  5I2Y A;  3RE8 A;  1S5F D;  4XYQ A;  1VQJ A;  2W82 A;  1PYW D;  1BF4 A;  3C3L A;  3A42 A;  5DEH A;  1SNM A;  4DV7 Q;  1D2B A;  4OWT B;  3KLS X;  3U6P A;  2DWZ B;  4HJ5 A;  2HUG A;  4OW0 A;  1ZYR D;  4A3G H;  2R7D A;  1ENF A;  4G4O A;  2NWG A;  4DV6 M;  5FTK A;  5J3B A;  4K6D A;  3DEP A;  5IP9 H;  2D7G A;  3FKE A;  4IBG A;  1XTC D;  2JA6 B;  3J7A F;  2Y0S E;  2CV2 A;  1N33 Q;  4OO1 G;  2BA1 A;  1I4R A;  1L1T A;  4JV5 L;  1PZK D;  2PQE A;  4B3S Q;  1Q1B A;  2JZ1 A;  2V1C C;  1EIY B;  1TXY A;  4G4K A;  2NVX B;  3N52 A;  5CC4 A;  1HCZ A;  4FVM A;  1CSQ A;  3NUC A;  4DK1 A;  2VF8 A;  4IOC A;  4HR7 B;  4DR2 M;  1CQF A;  5BR8 Q;  3J7Y W;  4RFB A;  1HNW L;  5LL6 S;  1WXQ A;  1I6V C;  4QY7 A;  4ZYS A;  1GHJ A;  5KEE A;  4H13 C;  2KA7 A;  4V0B A;  4A3E G;  1DZ1 A;  1BCP F;  5JAV A;  4JV5 M;  4DR6 Q;  3U6L A;  2ZXO A;  4FO2 A;  4JI7 L;  2CWP A;  4LJ6 A;  4EIW A;  1X3E A;  2I5M X;  2KW0 A;  3QO2 A;  4KJN A;  1HR0 L;  4GC9 A;  2MFI A;  1QUS A;  1EY5 A;  4DV4 M;  3FTC A;  3NWT A;  4TVA B;  4DAY A;  3OWF A;  1N9W A;  4DR1 L;  2VUM G;  2ZXR A;  4FD2 A;  1S4Z A;  3U58 A;  3S16 H;  3H91 A;  4Y7N H;  2R6G A;  4KD4 A;  3QWL A;  3ZCB B;  4BBS B;  2R6F A;  1L1O C;  3Q0A A;  4C3I B;  4PG3 A;  2I07 B;  1SMX A;  4QMG A;  1VQF A;  4CIS A;  4NB3 A;  3JAM S;  4Z9C B;  3HKZ G;  1PJT A;  4UAI A;  4FF2 A;  3WDN A;  2WSC F;  2DY7 A;  2IL8 A;  5J39 A;  4DR5 M;  1KNA A;  4GOP A;  2ES2 A;  1IW7 D;  1Q7Y C;  2YR0 A;  3LCV B;  1RTO A;  2UUA L;  2ZAO A;  2K0B X;  4DR4 M;  3I72 A;  1DO0 A;  2QIL A;  4IUT A;  4UPA A;  2D9U A;  3LWE A;  4OX9 Q;  3J81 S;  3JR4 A;  2HQL A;  4IUU A;  3L25 A;  4RGT A;  4WJ4 A;  2H1R A;  4FYD A;  1X6O A;  4HMJ A;  2Q2E B;  2Z8Y M;  3H15 A;  2E2I B;  5G3L D;  1TY0 A;  4IUV A;  5J1Z A;  3KF8 B;  1ONL A;  3DMU A;  1A63 A;  2CV1 A;  2JXM B;  2JA6 G;  4A76 A;  3UZU A;  1EFI D;  1IBK M;  3L27 A;  3AJI B;  1VQC A;  2UUA M;  3RLO A;  5M3F B;  4A93 H;  3FYC A;  1OXV A;  2HT1 A;  3EIE A;  2IPK D;  2G3Q A;  3CPF A;  2YYZ A;  3KYH C;  4NSR A;  1O7L A;  1YNN C;  4A3I G;  3PO3 G;  1IYV A;  4OL7 A;  1PHJ A;  1YNN D;  4D81 A;  3T6P A;  2R92 H;  4CGY B;  1EIJ A;  4WJ3 M;  2EYL A;  2L2D A;  3HU3 A;  4P75 A;  3G48 A;  5GKN A;  5M3M B;  1WGL A;  1O7I A;  3DWA A;  3KBX A;  3D0F A;  1LT5 D;  1TWC H;  3L2A A;  4JI3 Q;  3P75 A;  4DR5 Q;  1IXR C;  2OQ4 A;  1SE8 A;  4P17 A;  3D6C A;  1K8O A;  5C4Z A;  5LMU Q;  1HUN A;  5JEA H;  3MFY A;  1N36 Q;  4NXM Q;  4RKB A;  3KS4 A;  3MXU A;  4FWG A;  4OWW B;  5C0X J;  3I4L A;  4MGH A;  5JI2 E;  2ZTD A;  2J0T D;  3OHX C;  2DAE A;  4LRT A;  2DEN A;  1IW7 C;  2BDO A;  4IUQ A;  4IUN A;  4ME5 A;  4BBR B;  4RGN A;  3CGW A;  5HGQ A;  4JG2 A;  1VQD A;  4X65 M;  4N9P A;  1HNX L;  1X3G A;  5EXT A;  2CEA A;  3SMS A;  2JY6 B;  3S1Q H;  1LLR D;  4L5S A;  4S12 A;  4DN4 M;  2CHV A;  4R9W A;  2EA0 A;  1J7K A;  1ICW A;  5KYL A;  3E6Z X;  1NVM A;  2EJF C;  1B9M A;  2B2U C;  5E26 A;  3GPP A;  1FNU A;  5C1B A;  3I04 M;  1X55 A;  5JI3 E;  4A75 A;  4IPG A;  1CTM A;  1PH9 A;  4X62 M;  3MEH A;  4CDD C;  2LXE A;  1IN6 A;  2L7H A;  2Z0S A;  2KHI A;  1HTP A;  2MJ8 A;  3GQB A;  4R1J A;  2AHO B;  1J9O A;  1OAO C;  1S3S A;  5L8R F;  1F2M A;  5C5L A;  2F03 A;  1ILP A;  5DYG A;  2ZM6 M;  3A74 A;  5HGT A;  4K0K L;  4DK0 A;  1JE5 A;  2Y0S G;  2OCE A;  5C4H A;  4B3S L;  1FR3 A;  1GD7 A;  2X8A A;  2OEO A;  1NNU C;  5JJZ A;  2VQF M;  2HCI A;  5IIF A;  3S14 B;  1SXJ C;  5I6W A;  4PNY A;  4AQY L;  4QNR A;  4I65 A;  1W6K A;  3CMA A;  3T1H Q;  1EFW A;  4FW9 A;  3GQ5 A;  1NE3 A;  1V34 A;  5TSS A;  3P20 A;  2Z7J A;  1VQB A;  2F0N A;  1TF0 B;  4RF0 A;  1E7Z A;  2LMC B;  2F3I A;  2F3V A;  3I4Y A;  2JA5 H;  4OU7 A;  5E3F A;  2L09 A;  2FFK B;  2I7P A;  2A6E D;  1NJG A;  3K0X A;  2CE7 A;  2Y0T A;  3PFI A;  4LF4 Q;  1LV7 A;  3ONA B;  4B3T Q;  2FE8 A;  3B7Q A;  3ZQJ A;  3EA6 A;  3BZC A;  4JI5 L;  4REZ A;  2ID0 A;  3KSX A;  3MZ5 A;  4NKL A;  1Q39 A;  3S17 B;  3HOY G;  3FKI B;  2UXC L;  2K6B A;  1AZQ A;  3BG3 A;  3AU7 A;  3H94 A;  5A2Q S;  4N9T A;  1WJ7 A;  1RCV D;  3CRK C;  2J7O A;  1TY2 A;  2F4V Q;  3Q8G A;  2IHF A;  1K8M A;  3SBJ A;  3K8Z A;  1OFI A;  3DXJ C;  3TS0 A;  3PXG A;  4OEL B;  2ZTC A;  2Z3X A;  1NY5 A;  2F0K A;  1NUC A;  3M7N A;  4RKU F;  1JQJ C;  2EIF A;  2JA2 A;  3RGS A;  3TWL A;  1SE4 A;  4LF7 M;  2ICE C;  5NUC A;  4HJ9 A;  2LVO C;  1RL2 A;  2JQO A;  3FD9 A;  2Q2I A;  1PH8 A;  3ULL A;  3U6O A;  5D14 A;  2GVA A;  1R5L A;  2HKJ A;  4IPD A;  2AHM A;  1E0B A;  4K0K Q;  1ENC A;  2B2W A;  1W2B A;  4MHE A;  3VK7 A;  4L5Q A;  3K0Y A;  2R46 A;  1SXJ E;  1WJJ A;  3FPP A;  4LUZ A;  1H9K A;  2Y0S B;  2VB3 X;  3WOF A;  4C3J H;  3HFZ B;  3M7G A;  2N3S A;  3IFT A;  4R3D A;  4BBR H;  5C3E B;  1B70 B;  3M4Q A;  1GL7 A;  1EY9 A;  1KRS A;  2TSS A;  3S17 H;  1IXR A;  4LFC M;  1SYE A;  1VEJ A;  3BDO A;  1SFO B;  3FUX A;  1AP0 A;  5IYC G;  4KK7 A;  1Q02 A;  4LK1 C;  1EZ8 A;  3J7A V;  2FJ2 A;  3HHY A;  2K14 A;  3K81 C;  3TWM A;  2BDN A;  3CRL C;  3CC7 A;  3GTQ H;  1OIP A;  2KNA A;  3S2D H;  1VQ4 A;  1XYI A;  1XNR M;  3FUU A;  1RKN A;  1VCI A;  1STA A;  2Q8R E;  3L9A X;  2KHH A;  4X62 Q;  1ICF B;  5ITY A;  1TWA B;  5IT9 L;  2DI0 A;  2JZ0 A;  1HZ9 A;  2R7F A;  3MHB A;  5I4D A;  2VQF Q;  4DV7 M;  4JI4 Q;  2A5H A;  2WFW A;  3Q23 A;  4CJ2 C;  3KOY E;  3FUW A;  1DOL A;  4IPC A;  3RUZ A;  1HT2 E;  5JJK A;  4Y28 F;  3FTE A;  1ET6 A;  2BE5 D;  2QKI C;  3HS0 C;  4GIT A;  5FLX c;  3M4O H;  4L16 A;  3AKZ A;  1H95 A;  1IY2 A;  1KD1 C;  2MQH A;  3SK4 A;  1BXT A;  2FOI C;  4FWH A;  4BY7 G;  4GKK Q;  1GOZ A;  1JR3 D;  1ZMV A;  4NDX A;  2EUC A;  1N8R C;  3J7A S;  1IY0 A;  1IBM M;  4K2K A;  3SHL A;  2YQZ A;  3UJN A;  1D1K A;  3BVM A;  3SFZ A;  3CF2 A;  1BKB A;  2JEB I;  4UY8 C;  4GLX A;  2H5X A;  1GUN A;  2PI2 A;  2LVQ D;  1SXJ A;  4RGM A;  5COR A;  2CVR A;  4PV1 C;  4DR6 M;  4C2M H;  4A3J B;  4JV5 Q;  4CDE C;  4A93 G;  4DNI A;  3OMG A;  1F2L A;  1F77 A;  5IYC H;  1K3X A;  1GUT A;  3CCQ A;  1VQM A;  2CHQ A;  4HED A;  3PUZ A;  4JXJ A;  1SG9 A;  4P71 A;  3FE3 A;  4LF9 L;  3CXC A;  2F0H A;  2LBC A;  2YTX A;  4C3H G;  5BR8 L;  1MN3 A;  2QF7 A;  1C1K A;  1O7Y A;  4A3L H;  1F9Q A;  3K8A A;  1SE2 A;  2F0U A;  1W3S A;  1VQH A;  1LTM A;  1WTP A;  1LAC A;  1QAN A;  1GKH A;  2PYK A;  2DWM A;  1WTR A;  4BY1 B;  5EKK A;  1TGU A;  2EYF A;  2EXZ A;  2B29 A;  2EY5 A;  1WCM H;  2RKO A;  1QIL A;  3TQS A;  1ZYR C;  5C0X G;  3HOU G;  1JOK A;  3JAM i;  1JIC A;  4X62 L;  2F0D A;  2CH4 A;  3KJO A;  4JC0 A;  4PD2 A;  5IGD A;  3I8Z A;  3TRE A;  1A5T A;  2Z4R A;  1PFM A;  4JBW A;  4DNR B;  5FLX L;  4RF1 A;  4LGY A;  1CA5 A;  2G8L A;  2LVA A;  1JOO A;  1YNJ D;  3E0J A;  3PGZ A;  4DV1 L;  1B44 D;  4GN4 B;  3I4M H;  4U68 A;  1PFB A;  5EP1 A;  3GO8 A;  3C2P A;  4B3T M;  1M90 C;  3V96 A;  2D62 A;  2RKS A;  4EGV A;  2B2Y A;  1PH3 A;  3BOS A;  4JI5 Q;  1SEB D;  2YU9 H;  3MFG A;  3KW6 A;  1K83 H;  1JJG A;  1Q1E A;  4UN2 B;  2QW7 A;  5K36 H;  1WCM G;  3C46 A;  4ILW A;  1OTC A;  3GRY A;  1OQY A;  1QUT A;  3P7J A;  4LJ4 A;  3NEN A;  3J80 c;  2OXP A;  3C1E A;  4JI8 M;  4IJH A;  1QZH A;  2PMZ E;  2B63 B;  1HNZ M;  3HOW B;  1NR2 A;  3AOE C;  4P74 A;  1VQI A;  4RWS C;  4QOZ C;  5KQD A;  1Q8I A;  2OQK A;  2E2J H;  3GTO H;  3KFU A;  4K5X A;  5IT9 S;  3KFU G;  4RA8 A;  1WTW A;  5IP9 G;  4B9X A;  2R44 A;  4NXM M;  3QB3 A;  5GAH C;  4B7G A;  3C58 A;  2K6A A;  2VDB B;  1E3P A;  3A54 A;  3RZO H;  3CF6 E;  1ROD A;  2ENB A;  3U6S A;  1F4I A;  3QOJ A;  3M0E A;  4JI8 L;  4C3J B;  3DUZ A;  5C44 G;  2FHT A;  4DV5 M;  2NZH A;  2MJ5 B;  1JJ2 A;  3ZH9 B;  4DA2 A;  4A3V B;  1C4Q A;  1PH5 A;  4GLA C;  1D0L A;  1KXL A;  3DM3 A;  4HTH A;  2N49 A;  3EIH A;  2L1B A;  3J81 j;  3R2I A;  4CJ0 B;  1NY6 A;  2FMM A;  1G41 A;  2KZU A;  2K50 A;  1YJW A;  1HPC A;  2LKV A;  4AG6 A;  2H4O A;  4G3O A;  4GKJ Q;  3EBE A;  3HU2 A;  3PQI A;  3DA1 A;  3X3M A;  3TBI B;  2XZU A;  3W3A A;  1A3U A;  4MM3 B;  3E3X A;  2FFJ A;  4IBJ A;  1HNX Q;  5EJC A;  2QBY A;  1ENA A;  3LGJ A;  4LF8 L;  2PW5 A;  4M9X A;  5CBA E;  3J81 c;  3T1H L;  1HXY D;  4RMF A;  4BBA A;  3E9S A;  2ZT9 C;  2ASB A;  1DON A;  5EBC A;  1FJG M;  3HZJ A;  5FSW A;  4X66 Q;  4HJA A;  1SFO H;  3GP1 A;  3CTW B;  4B3M M;  5M3F H;  1EY8 A;  2V4D A;  2OOB A;  1U0L A;  2K04 A;  1M1K C;  2Z4H A;  3NWL A;  1WCM B;  3V2T A;  3K7A H;  1E9S A;  4DV3 M;  2O5I C;  3NEL A;  3SAT A;  2XZF A;  2LHG A;  3UDI A;  3CD6 A;  3VYR A;  1G71 A;  3F2C A;  3BYY B;  1FJG L;  2LFN A;  4DBG B;  4GKK M;  4FCT A;  2WB1 B;  3PUW A;  1AE2 A;  1WTH A;  2VQF L;  2R92 G;  3U50 C;  3KOX E;  1OIZ A;  4JI2 L;  1L1O A;  1R9T H;  4B3R L;  1DD2 A;  3J80 S;  2QNJ A;  1I4P A;  1BBW A;  5IWA M;  1C7Y A;  5FLM G;  2DJF C;  1XXH B;  2NN6 G;  2UXD Q;  2JY7 A;  3E21 A;  2D7E A;  1CI3 M;  2KEB A;  3RMH A;  2PCF B;  3LW5 F;  2A68 C;  4BWG B;  1PH4 A;  2HAK A;  1K3B C;  3VLF B;  4MB7 A;  4LF4 L;  3HP3 A;  3U61 A;  1HA5 A;  3K5M A;  3TE6 A;  4GKK L;  3CF0 A;  1YE9 A;  4U67 3;  2CFO A;  5FTN A;  4EX5 A;  4GS3 A;  4KY6 A;  2KZS A;  4B7H A;  3U6D A;  3H0G B;  4G7H C;  4ZK9 B;  3J27 B;  3T53 B;  1KLG D;  2JEA I;  4JK1 C;  1HZB A;  4X3U A;  2CV0 A;  2UXC M;  5BN4 A;  4NL4 H;  2K05 A;  2KED A;  3KVW A;  3MXN A;  1N34 L;  4O0A A;  2LY7 A;  4JI7 M;  2HDL A;  1VMP A;  4MNO A;  4GZY C;  1XMO Q;  5H37 D;  2N55 A;  2PZT A;  3R8B A;  4IBE A;  3GTO B;  2E2J B;  1EY6 A;  4GMQ A;  1AUA A;  4K5W A;  4LFA M;  1R2Z A;  1MJG M;  1CFM A;  4LGM A;  1LTR D;  1TU2 B;  2L0C A;  5IYB H;  4KY5 A;  5CV7 A;  3O13 A;  2QEJ C;  3U6M A;  2KHS A;  1MJC A;  5LMU L;  3BJU A;  5EKL A;  5I6Y A;  3U4V A;  4CJ1 B;  4YHH L;  3N6R A;  2DZN B;  4NRV A;  1SE3 A;  1AZP A;  5M3F G;  1JCK B;  1L2F A;  2Q8I B;  1Q81 C;  2YFQ A;  4ALP A;  4QB4 A;  1VQ9 A;  2E5L L;  4A3B B;  1DGH A;  4AYB E;  4HIM A;  3TSS A;  4L8R C;  3PUX A;  2WAQ B;  1B4O A;  3E9I A;  4CDC C;  5FTJ A;  4D82 A;  1FL0 A;  2I46 A;  3H0G H;  1IL2 A;  3D4R A;  2HIV A;  3E0E A;  2JJQ A;  3J80 i;  1N33 M;  4DR7 L;  3KSJ A;  2UUB L;  1HH2 P;  8CAT A;  2EJS A;  1HQY E;  1QCB D;  1F9S A;  1J8I A;  3OMC A;  3HRZ C;  4G7Z C;  3CCE A;  1TR8 A;  1JWS D;  1F9R A;  4A3L G;  2ATW A;  5IYD H;  2RDH A;  3GLF B;  2F5S A;  3IKJ A;  4F2L A;  1YBY A;  1Z6H A;  5C0X I;  5IYD G;  1L0W A;  3KXE C;  3AEV A;  1KTK A;  1PRT B;  2E2I H;  1AW7 A;  4GHL A;  4JI1 M;  2F5P A;  1TWH H;  4KHV A;  2Y0Q A;  1SYF A;  3LQQ A;  1UEA B;  2V1C A;  4IUP A;  1QOH A;  2JXN A;  4MGK E;  1TWC B;  3TPZ A;  3ZC7 B;  1G2T A;  2YTY A;  1ZXT A;  1VDZ A;  1C8C A;  1Y1V B;  1JT8 A;  5C4X G;  3J2P B;  2E75 C;  2DWN A;  3UGJ A;  4PZ6 A;  3Q6S A;  3H09 A;  3LNN A;  2UU9 M;  2RHQ B;  4X3S A;  1C0A A;  2VNU D;  1MI2 A;  3KOJ A;  4ZUI A;  3JC6 6;  3K9O A;  1K82 A;  1D5M C;  4OHJ A;  2F4V L;  4QF4 A;  3MTS A;  2GQF A;  4DAM A;  3W67 A;  4GRI A;  1JWU D;  3I56 A;  4MTK A;  1PRT C;  2PNR C;  1CM9 A;  1G51 A;  5LMN L;  4IOA A;  4RG1 A;  3GD7 A;  2DZO B;  1G3I A;  2JK8 A;  2KXE A;  1R7R A;  2BOS A;  3M4P A;  2ZM6 Q;  2NVQ B;  3BXW A;  2K03 A;  3VR2 A;  2FXQ A;  2SOB A;  2Z8L A;  1KYI A;  4C1N K;  1YUB A;  2DUD A;  3KF6 A;  3RZD B;  3KJP A;  1TS2 A;  3V76 A;  4DV2 M;  1KQS A;  1GHK A;  4I4L A;  4GHA A;  3K7U C;  1TWA H;  3E4R A;  3NQI A;  3HHX A;  2JA5 G;  4K6L A;  3VA7 A;  2EKF A;  2F0G A;  3E9H A;  3DZD A;  3EQL C;  5M5Y H;  1B3Q A;  1UE7 A;  1XC8 A;  2WAQ G;  2RBM A;  5HY6 A;  3D31 A;  2QHO B;  4I5S A;  2B39 A;  3F2D A;  3QG1 A;  2QA4 A;  4A3M G;  4EQO A;  4B3M L;  3GLF E;  4K8I A;  1CZW A;  4RNA A;  3R8F A;  4AG5 A;  1UM8 A;  2LTU A;  3NK9 A;  4ZAI A;  4YWL A;  1U4L A;  4HSV A;  5A2Q E;  5FTL A;  4B9W A;  3KLW A;  4DV3 L;  1CA6 A;  5FLM H;  1A3V A;  2J5Y A;  5DYI A;  2MO0 A;  4XQN A;  1MJE A;  5ELF A;  1TDZ A;  2I5L X;  1U4R A;  2MPM A;  3HOW G;  3C1F A;  1PJI A;  3AMU A;  1NV8 A;  1PTO B;  1HZC A;  1LT3 D;  1QQW A;  2CWB A;  4MZ9 A;  2WB1 E;  4A3E B;  3RD4 A;  4ODG A;  5GAG C;  5DM6 3;  4BA2 I;  5G3L F;  2O4X A;  3MWY W;  5CV6 A;  2MRO B;  3LVW A;  3OIP A;  4WFN 3;  4YY3 L;  3AOE A;  4MIU A;  1X54 A;  4DR1 Q;  3GQ4 A;  3S1N B;  2KJX A;  3S1M B;  1X37 A;  2IY5 B;  1J09 A;  1N36 M;  5ITX E;  3CW2 C;  1TVX A;  1QDR A;  4HIO A;  1IN5 A;  2Q2H A;  1SXT A;  3L29 A;  4R4I A;  3L28 A;  2R7Z G;  1Y14 B;  2WAC A;  1EY4 A;  1I3Q B;  4H44 C;  3QAU A;  4TRD A;  4X66 L;  2RF4 A;  3ULP A;  4AYB G;  4LJ7 A;  1LTT D;  3VYT A;  1O78 A;  3I91 A;  1PH2 A;  3QYB A;  4OIK A;  1KLU D;  5E6J A;  2AQ1 B;  2M2L A;  3T13 A;  3GPU A;  1YHB A;  2PQA A;  3AYH B;  3K59 A;  4A3M H;  1XWE A;  2NN6 I;  4HID A;  3K2L A;  4WP2 A;  2HHH M;  3KLR A;  5C44 B;  4FF3 A;  3PO2 G;  3T16 A;  1GO3 E;  4Q5V A;  2NYZ D;  2L7I A;  3SAU A;  1OTR A;  2UUC M;  2JA5 B;  2NVT B;  1HUM A;  2BH2 A;  3DOA A;  1DOK A;  3U9S A;  4I8O A;  2PPB C;  3AL0 C;  2EJM A;  2F0F A;  2O2L D;  4DUY Q;  3EVQ A;  3SHG B;  3PNY A;  1PGY A;  4IBF A;  2X6G A;  1TWG H;  1IBL L;  3H3V H;  1STY A;  1ZV1 A;  1J5E Q;  2BWB A;  2CUZ A;  2C9O A;  1BCP D;  3KP0 E;  2D0O A;  2K5H A;  2WV6 D;  3MXG A;  5KNC A;  3A5U A;  1Y8P B;  4JBM A;  1TII D;  2IHE A; 
#chains in the Genus database with same CATH homology
 5KO3 A;  2R4E A;  1QAO A;  1V8Q A;  1CHP D;  4L6T B;  3T1Y M;  2CHB D;  2R92 B;  3MHV C;  2A74 C;  3PIP 3;  3FYD A;  4BB9 A;  3T1H M;  1G59 A;  1I4X A;  2B8F A;  2UUB M;  4IBK A;  2RGO A;  1X3Q A;  4TUW A;  2XEP A;  4V19 0;  1LTG D;  1EWH A;  1I4Q A;  4A93 B;  3TME A;  1Z47 A;  5C3X A;  2DVW B;  1CZG A;  2QDB A;  2EE1 A;  2NUC A;  1FYC A;  1JC7 A;  2EYM A;  2XNA C;  2XRS D;  1Q90 A;  1E32 A;  3S15 B;  1A3T A;  4J1M A;  1VMC A;  1WVL A;  2QCP X;  5BN5 A;  1OJL A;  1L2B A;  3NBH A;  3HOU B;  2WIN B;  3FTF A;  2K7V A;  3AB9 A;  4XXE A;  3TZD A;  5KQ8 A;  4LJ5 A;  3ITP A;  5HUR A;  4HLQ A;  4LF9 M;  3K5O A;  3DHQ A;  1WD0 A;  3UMM A;  3NTH A;  4A3K B;  2NZ1 D;  4RKL A;  2K5W A;  3AV0 A;  4NXN M;  5ITU A;  2F0L A;  5LMN M;  1SBB B;  4J8Q A;  3FMC A;  3HJ8 A;  1YNJ C;  3RLF A;  3HKP A;  1BUV T;  2OPF A;  3TWK A;  2KUM A;  1WTX A;  1FNN A;  3H4M A;  3SYL A;  1D2N A;  4PCZ A;  3A98 B;  4XQQ A;  1IL8 A;  2KVM A;  3LWU A;  4I7Z C;  1QVR A;  5LMU M;  1PFN A;  2BJV A;  2NN6 H;  2QPA A;  2R3Z A;  4LG2 A;  4LFB M;  1H9R A;  5F2D A;  1IHZ A;  4PQX A;  2NBF A;  4JI3 M;  1DXM A;  1E2Z A;  1HR0 M;  2A6E C;  4O42 A;  3PIO 3;  1D5Z C;  4JI6 M;  1QNU A;  5E4W C;  3K5L A;  4DAV A;  4AKH A;  2K01 A;  3A7A B;  3D4W A;  1HA6 A;  2EVB A;  3D3R A;  4JN6 A;  1Y8N B;  1JWM D;  3HWS A;  1DM0 B;  1M8A A;  1JR0 D;  1V1P A;  2XVS A;  3R2T A;  1BCP B;  3SVM A;  3KK7 A;  3RFW A;  4LY6 A;  1NNJ A;  1IKL A;  2Z4S A;  1B9N A;  1SJE D;  4KN7 C;  1B50 A;  3VR5 A;  1H9S A;  5C5M A;  3GLH B;  2HDM A;  4MGY E;  1MSG A;  2EZV A;  1SMY C;  1QB5 D;  5IOD A;  1DYQ A;  1MX0 A;  4FWD A;  1EYC A;  1K83 B;  2BJW A;  4GC5 A;  3VKG A;  4K2L A;  3E5S A;  3DWQ A;  3OPO A;  1PTO D;  3PVS A;  3HKZ B;  4CBV A;  2MP1 A;  4G6Z A;  2B2V A;  2UXD M;  1EQT A;  2WKC A;  1H9S B;  4DF7 A;  5JOB A;  1GLN A;  1HNX M;  1C48 A;  1ML0 D;  4L4U A;  1BQQ T;  4LJ9 A;  3VDP A;  5J22 A;  1ILQ A;  4DGZ A;  1N77 A;  1B1Z A;  3MXP A;  5ELC A;  3ND9 A;  2F0E A;  2EOT A;  2RSO A;  1Q3L A;  1XWI A;  1RHP A;  1T5X D;  2P5T A;  5D3D A;  1GVN A;  1NHW C;  3BDL A;  3G6J B;  1XXG A;  1OXU A;  2EPB A;  1PJJ A;  4D80 A;  4M0D A;  5M9O A;  4RH6 A;  4Z6Y A;  3SK8 A;  2RA4 A;  2OF1 A;  3GLH A;  4HAE A;  2L5T A;  4FCV A;  4LRS A;  3NE5 B;  4IBB A;  1U9R A;  4JYA M;  4P2C B;  5IGB A;  2D5D A;  4PDG A;  3NWS A;  2EYO A;  2YNM D;  4IIW A;  1EQV A;  2LNH C;  2JA7 B;  3LX0 A;  4NW2 A;  5COY A;  4LF6 M;  1RJT A;  4FF4 A;  4LZZ A;  5ELB A;  1LO5 D;  1Y69 U;  1E9R A;  4KN4 C;  1EU3 A;  2EDG A;  4BLC A;  2E2D C;  2EY6 A;  1W5S A;  4PT5 A;  3QWN A;  5DM7 3;  1SNC A;  4L63 B;  2I7N A;  3URY A;  4XGI A;  5JVG 3;  3UK6 A;  3FDT A;  2Z1C A;  3D8G A;  1GUG A;  4EQP A;  4LJ8 A;  2F0W A;  1B3A A;  3A55 A;  4ZLT F;  2RSN A;  1XNQ M;  1STG A;  4TQU S;  1K3W A;  3K1J A;  1N34 M;  5DNY A;  4XT1 B;  3NPP A;  5T1I A;  4LCB A;  1KAB A;  3VR3 A;  4FNF A;  3VDU A;  1NSF A;  2JSO A;  3NBI A;  1PDQ A;  3MJ5 A;  3SC3 A;  2FIN B;  2DNC A;  4X66 M;  2Z4I A;  2PO4 A;  2XFS A;  2AWN A;  4K5V A;  2M00 A;  3SK5 A;  4R8N A;  4B08 A;  5ITT A;  2XGN A;  1BBX C;  2RDF A;  3PO2 B;  1F2Y A;  1Z6T A;  4QNM A;  1EY7 A;  3QJY A;  2IX1 A;  3GTJ B;  1LTI D;  3GTP B;  3SAR A;  5KND A;  2XSC A;  3Q22 A;  4P16 A;  1X32 A;  1OFH A;  4RAU C;  3IFD A;  4KKT A;  2IWH A;  1ET9 A;  2F0T A;  4AI6 A;  4XBO A;  2YU9 B;  5C4X B;  1NR4 A;  5IGC A;  1NHG C;  4DR7 M;  2EY2 A;  1MBY A;  3HOY B;  2M5Z A;  4KJO A;  2R4J A;  1VF5 C;  2FMC A;  1XX8 A;  4IFD J;  5FO7 B;  4KOD A;  3D8B A;  4CHT B;  2R45 A;  3GLG A;  5EP2 A;  1I6H B;  5EP4 A;  2H1E A;  1XHB A;  2C99 A;  2R65 A;  2K5D A;  2F4I A;  2ERC A;  1QG7 A;  2VUM B;  3I3C A;  3U6E A;  5FKA C;  1EYD A;  3D6W A;  3WHK A;  4DXF A;  3V05 A;  3SAS A;  1T5E A;  4C3J G;  4JI5 M;  2F5N A;  2JE6 I;  4ZQ3 A;  1D6E C;  5KIX A;  4OVZ B;  4C1N I;  1ORY B;  1U4P A;  4ZRZ A;  3TP5 A;  3SAW A;  2G9H D;  5C3W A;  4IAL A;  2EYP A;  2KEE A;  3P1H A;  2D2C C;  4W5W A;  1Z5B A;  1JB3 A;  3QIA A;  3HOZ B;  5IGE A;  3KOZ E;  2LS0 1;  1BR9 A;  3SYK A;  2B2W C;  3EJI A;  4A3I B;  3PO3 B;  4K14 A;  3JAM L;  3VYU A;  1WTO A;  3TP8 A;  3K92 A;  4Y7N B;  4IFD H;  1G8Z D;  4XDX A;  2O5R A;  4EQN A;  2JP1 A;  3U60 B;  4AKG A;  3U6Q A;  1CK1 A;  3D4D A;  1OXT A;  4EVO A;  3J80 E;  1UNS A;  3L3O C;  1LT6 D;  5FLX E;  1O80 A;  3T4A C;  4QUC A;  3VK8 A;  2B8G A;  4DV1 M;  3WHL A;  2L4N A;  2L11 A;  3DWP A;  1SNP A;  4KKU A;  2ZBK B;  2HQE A;  4OO1 H;  2A6H C;  3OWE B;  3L26 A;  4AYB B;  4WUR A;  1A6X A;  1SSO A;  5FOB B;  3I4V A;  2XWB B;  4HL4 A;  1G4A E;  4B3S M;  2RGH A;  2IX0 A;  2K32 A;  3M6A A;  4DXG A;  1L1Z A;  4M9Z A;  1IM2 A;  1R9T B;  1SYG A;  1ESF A;  4F8M A;  4G57 A;  3GTQ B;  2PW7 A;  4AZF A;  1SJH D;  5EKI A;  4ZUJ A;  4IBI A;  2IT1 A;  1JQY D;  2KRU A;  4L8J A;  3W2D A;  1XMQ M;  3SAV A;  1IN8 A;  1IQP A;  1E2V A;  1PXU A;  3GV3 A;  4G4R A;  3K57 A;  4FCW A;  2VXW A;  5M5X B;  3M4Y A;  1W6J A;  5JPN C;  1XMO M;  4QOS A;  2L9H A;  1LV9 A;  5I2X A;  2F0P A;  2WKD A;  2F1M A;  3U9O A;  3NQT A;  1HFN A;  1AN8 A;  1VF7 A;  5EJW A;  1KFV A;  4DU9 A;  1IN4 A;  3DFZ A;  4AW4 A;  1G6Z A;  2A5Y B;  3RGP A;  3NXW A;  1N78 A;  5CBE E;  2GA4 B;  4XYO A;  2DY8 A;  1ZKO A;  2RQX A;  5JEA G;  2HL7 A;  1UUP A;  1BNZ A;  1KDA A;  2PZW A;  3T38 A;  1PTO H;  2WII B;  5ELE A;  3BZD B;  5CV9 A;  3EFX D;  3J81 L;  1MU5 A;  2AUK A;  3DEO A;  4WOR A;  5FO9 B;  1I4H A;  3MAQ A;  5KYI A;  4ZKB B;  2X4A A;  3I4N B;  2X49 A;  3FRP B;  3HHW A;  3KBG A;  4DFA A;  4IFD I;  4QHS A;  1SMY D;  3TP6 A;  4OX9 M;  4ULL A;  3HOX B;  3KOW E;  1R2Y A;  1H9M A;  2EJG C;  3HZX A;  3CKI B;  5CMD A;  2KEC A;  2NQ8 C;  4ZKC B;  4CKB A;  3GLG B;  2K5Q A;  4R8I A;  3KDS E;  3CHB D;  1EIG A;  4J6H A;  4G7O C;  5A35 A;  4OVZ A;  1A2U A;  3KUP A;  1WD1 A;  4IZ8 A;  1D5X C;  5KRU A;  3F2U A;  2B2V C;  3SMP A;  5KPZ A;  2EYH A;  1F9P A;  5F3W A;  4MGI E;  1IXS B;  2J7Z A;  4NSO B;  2V6Z M;  1L2C A;  2CW0 C;  3H3V C;  3PUY A;  3J7B A;  2DN8 A;  4KLN A;  1TH4 A;  1NAP A;  2DNE A;  3HOV B;  5T1G A;  1EU4 A;  4IFD G;  4FXK C;  3IG5 A;  3ILK A;  3B9P A;  2VQE M;  1LTS D;  2F0M A;  1E2W A;  1QYR A;  3W0L B;  4CKE A;  2M60 A;  5IGF A;  3SR1 A;  4IJE A;  1VDD A;  1IXZ A;  1JOR A;  5KNB A;  3R9X B;  3OOC A;  2EY1 A;  2KCC A;  4WW0 A;  4PMC A;  4GKJ M;  1YSY A;  2XH9 A;  1CQV A;  5LL6 X;  1R4P B;  1Z59 A;  3WOE A;  1TH3 A;  3IAY A;  1B53 A;  2F0Q A;  1PTO C;  1QJO A;  1SXJ D;  4ZPX A;  2K28 A;  2N88 A;  2R61 A;  2SEB D;  1PZJ D;  1BCP C;  1DGF A;  2R18 A;  3NSW A;  4LF8 M;  1NSN S;  3VKH A;  2G5G X;  1TWF B;  1H9J A;  1I4G A;  4Q0F A;  5D3I B;  3TDQ A;  5EPL A;  3SHF A;  3GRR A;  3KLS A;  2JYO A;  2IW3 A;  4G4Q A;  2DXI A;  4M0W A;  4L15 A;  3QOL A;  3X3N A;  4PDI A;  1S5B D;  3NTI A;  1BDO A;  3CU7 A;  4FXG C;  4C2M B;  1HQM C;  4QHT A;  3GTM B;  3S1R B;  3A8J E;  3KP1 E;  1MGS A;  1I4W A;  5BPV A;  2NB0 A;  3PMF A;  3SEB A;  4DV0 M;  3UI2 A;  1MSH A;  3AOG A;  1AEX A;  1DCZ A;  3A46 A;  2QEN A;  4LJA A;  1II3 A;  3NHH A;  4LZJ A;  3MVV A;  5LHY 1;  1TS4 A;  4S3S A;  3PUV A;  3Q24 A;  4XTC S;  1PTO F;  3SK6 A;  3T56 B;  1STB A;  5DNF A;  2C96 A;  4PMB A;  3H6M A;  2C98 A;  3VR6 A;  2IX3 A;  2KOL A;  1FNW A;  3ERQ A;  1STH A;  2WP8 J;  2A69 D;  1LT4 D;  4UDU C;  2PZU A;  1EE8 A;  4XT3 B;  3OTO M;  2MHV A;  1QAM A;  7CAT A;  1HNW M;  2EYJ A;  4LMQ D;  3A8I E;  1GL6 A;  2SNM A;  1GJX A;  3GV6 A;  3MK6 A;  4X3T A;  4JI4 M;  1FGB D;  3S9W A;  3HJS A;  2E5L M;  1TS5 A;  1HFG A;  4NRW A;  1OXX K;  5AFW A;  4RGO S;  4KD3 A;  3GTL B;  1JE4 A;  4K0K M;  1Q3C A;  1PZI D;  3GP7 A;  2VII A;  1T3T A;  5ITX A;  2E2H B;  1PRT D;  1RTN A;  3VA5 A;  4KHZ A;  1S5E D;  2L12 A;  4XIG S;  1XXH A;  1BOS A;  1TQO A;  2K47 A;  2CHG A;  1NCV A;  4IN3 A;  2V1U A;  3U5Z A;  2BNK A;  3A45 A;  1ZAE A;  3U61 B;  1L0X B;  2ZAM A;  3MC0 B;  4HCE A;  5EXS A;  3BDC A;  1STN A;  4B3R M;  3HEJ A;  3S1Q B;  1U4M A;  2BE5 C;  3R3O A;  1J5E M;  4FF1 A;  4I81 A;  3PV0 A;  4AKI A;  1S5C D;  1PRT F;  1WTQ A;  1UAP A;  2L6O A;  1SNQ A;  2XN9 C;  4LF4 M;  3LVV A;  4DUY M;  1SNO A;  3LQR A;  1S5D D;  2AWO A;  2F0V A;  3S2D B;  1EY0 A;  5IOC A;  4A3G B;  1G29 1;  2KRK A;  1TKW B;  2ICI A;  2KA6 B;  3HU1 A;  3KS8 A;  3TN2 A;  1GXD C;  1TDH A;  2D7H A;  1TS3 A;  4C56 C;  2F0I A;  5JVH 3;  2DHR A;  5DAU A;  4YY3 M;  4QIW B;  3SE0 A;  3THG A;  3TP7 A;  4IUR A;  4G4N A;  4A3M B;  1KSF X;  1PMR A;  1V43 A;  2E76 C;  2CW0 D;  1KDC A;  2Q8T A;  1EOT A;  1IKM A;  1RF2 D;  1TR5 A;  3M4O B;  5CR3 A;  3DM1 A;  5E4X A;  2K33 A;  1DO2 A;  1X3P A;  2J4X A;  1LAB A;  4KY7 A;  5M5W B;  1HHV A;  1TWG B;  2ZAN A;  1BO0 A;  1L8Q A;  1JOQ A;  2B2Y C;  3I90 A;  3T15 A;  4FP5 D;  4L78 A;  4M8A A;  2XRQ D;  4C3H B;  2HCC A;  4CKC A;  1SND A;  4HN7 A;  4JI2 M;  4OGQ C;  2FNA A;  2QZ4 A;  3SXH A;  2LH0 A;  3K58 A;  5FO8 B;  5EP3 A;  1HQR D;  1IBL M;  5I9O A;  1N32 M;  1QE6 A;  1Z7T A;  3U5Z B;  3VR4 A;  2R93 B;  2F5Q A;  4JI0 M;  1CT1 D;  4LAA A;  1IYU A;  3I4M B;  2IJ0 A;  1TWH B;  4KMU C;  1LTB D;  4R7G A;  3VFD A;  2M9V A;  4M1U B;  1E94 E;  1A2T A;  1EL0 A;  2UXB M;  4ID6 A;  1WTV A;  2K1B A;  2MGS A;  4HMI A;  2AUJ D;  3U60 A;  2A68 D;  2AQ3 B;  1NJF A;  4M9S A;  1GUW A;  1EIH A;  1I94 M;  4WJW A;  5EXP A;  2B2U A;  4NOO B;  1Z5A A;  1SXJ B;  5IRE B;  2G9D A;  3L7Z C;  4RHR A;  1SYD A;  1QZM A;  4XQJ A;  4IBC A;  5ISR A;  3JR5 A;  3GLF A;  3BVG A;  2KQ3 A;  3ZYY X;  3IL8 A;  1R6B X;  1V1P B;  3W0F A;  5ITQ A;  5K36 G;  5C4J B;  1ZQ9 A;  4IBD A;  4DR1 M;  3LMM A;  2F3W A;  3A8K E;  1HTL D;  1EEF D;  5KPT A;  4KI0 A;  1G91 A;  2QCU A;  1GUS A;  2F0S A;  1MD2 D;  2JA8 B;  2QP9 X;  2XFT A;  5E1F A;  1H6U A;  1KDB A;  3HG9 A;  3BVZ A;  4HCS A;  5D65 A;  3KF8 A;  3HJQ A;  3J80 L;  4MGZ E;  2CQA A;  4KKS A;  1SYB A;  3U6C A;  1DGG A;  1HQC A;  4QCL A;  1DJR D;  1SYC A;  3FVQ A;  4KTA A;  2BCO A;  2NTS A;  2X6L A;  4TKO B;  5C0X H;  3VYS A;  3ERO A;  2B2T A;  5EGT A;  2A6H D;  5BN3 A;  1OO9 B;  4RHS A;  2OT2 A;  1EWC A;  4NMZ A;  4OO1 I;  5CGK A;  4OIJ A;  1AFP A;  3IG8 A;  4IJF A;  3I73 A;  2A69 C;  1DOM A;  5CV5 A;  5FK9 C;  3SDZ A;  5FTM A;  4HSP A;  1RDP D;  3K5N A;  1HRJ A;  1I50 B;  2F4V M;  1GUO A;  3FPU B;  5FLX S;  1JR3 A;  1M4V A;  3M3Y B;  1DGB A;  2EO2 A;  4DUZ M;  1QNK A;  2XIW A;  1A15 A;  2XWJ B;  3GPX A;  4BY7 B;  2SNS A;  1L0Y B;  4MH0 E;  1W5T A;  4A3D B;  3D8L A;  3OIQ A;  5EQ0 A;  4PMW A;  3T51 B;  4GH9 A;  3CQZ B;  4YIJ A;  5IGG A;  3FTD A;  3I70 A;  2XLJ A;  2QBY B;  2RVL A;  1Z5C A;  4BA1 I;  4DAP A;  5JPM C;  2XF3 A;  1Q3B A;  1STE A;  5KPR A;  2X69 A;  4MN3 A;  1OXS C;  3TL4 X;  3GTG B;  5EQT A;  1KNE A;  2NTT A;  4KO8 A;  1EEI D;  5IT9 E;  1QAQ A;  5CV4 A;  2L55 A;  3S16 B;  3HGB A;  3S2H B;  5BR8 M;  1F2Z A;  1PLF A;  4LJZ C;  1D1I A;  5KGU A;  4DNT B;  3GO5 A;  1FD7 D;  5EXX A;  1SDF A;  5M5Y B;  2SDF A;  2TMP A;  1Y1W B;  3GRV A;  1GKI A;  3FUT A;  2F0O A;  1Q12 A;  2E74 C;  2NVY B;  3MA2 B;  4AQY M;  4H0L C;  5CV8 A;  3BS1 A;  2F0J A;  1L2D A;  3PNV A;  1G8P A;  1V1O A;  1DGH B;  5ITR A;  2C5C A;  3AFH A;  4A3F B;  3OSO A;  4KV6 A;  5EPJ A;  2R62 A;  5EBD A;  1TH2 A;  1EYA A;  2MUY A;  4IQZ A;  2AQ2 B;  4F88 A;  4Z8X A;  4GIP A;  5CYU A;  1R4Q B;  3BYT B;  3I51 A;  2XSZ A;  4X3K A;  1O7Z A;  3A56 A;  4DR3 M;  4O1N A;  2HCB A;  3GPY A;  2R7Z B;  1PM5 A;  2DWL A;  2VB2 X;  5IZ7 D;  3HGI A;  3RZO B;  5ELD A;  2LWX A;  3K6O A;  3GLI B;  1CHQ D;  2Y21 A;  3OW7 A;  5K5P A;  1Y8O B;  4H7B A;  2A73 B;  2C9C A;  2B2T C;  3NP8 A;  1RD9 D;  1IY1 A;  4KHP M;  4ABN A;  1HT1 E;  1N75 A;  1G2S A;  3G7L A;  4ITQ A;  2XSZ D;  1QWY A;  3J81 E;  1EZ6 A;  3GLI A;  2F5O A;  1ESR A;  4NP5 A;  3FUV A;  3R93 A;  1ZEQ X;  2KCN A;  2PMZ B;  5A2Q L;  1TT2 A;  3GRU A;  1LTA D;  4WRD A;  3Q8X A;  2RDG A;  3A7L A;  4F7X A;  1SAP A;  1IN7 A;  4YHH M;  5EPK A;  4TSS A;  2ZXP A;  4QUF A;  4E6I A;  2BA0 A;  4F87 A;  4FXD A;  4B7F A;  4C3I G;  3GTK B;  1FNV A;  3JAM E;  3HHZ A;  1B2T A;  4K8J A;  4BS9 A;  5C6A A;  5I9P A;  2Y20 A;  3GQ3 A;  4RCN A;  3TZU A;  4X64 M;  4II7 A;  4LF5 M;  5C18 A;  3FEW X;  2C5R A;  2J7N A;  1KAA A;  3ND8 A;  3NTK A;  3M85 A;  2O5J C;  4RCO A;  3K7A B;  5JEA J;  5I2Y A;  3RE8 A;  1S5F D;  4XYQ A;  2W82 A;  1PYW D;  1BF4 A;  3C3L A;  3A42 A;  5DEH A;  1SNM A;  1D2B A;  3KLS X;  3U6P A;  2DWZ B;  2HUG A;  4OW0 A;  1ZYR D;  1ENF A;  4G4O A;  2NWG A;  4DV6 M;  5FTK A;  4K6D A;  3DEP A;  2D7G A;  3FKE A;  4IBG A;  1XTC D;  2JA6 B;  3J7A F;  2CV2 A;  4OO1 G;  2BA1 A;  1I4R A;  1L1T A;  1PZK D;  2PQE A;  1Q1B A;  2NVX B;  4G4K A;  3N52 A;  5CC4 A;  1HCZ A;  4FVM A;  3NUC A;  4DK1 A;  4HR7 B;  4DR2 M;  1CQF A;  3J7Y W;  4RFB A;  5LL6 S;  1WXQ A;  1I6V C;  4ZYS A;  1GHJ A;  5KEE A;  4H13 C;  2KA7 A;  4V0B A;  1DZ1 A;  1BCP F;  5JAV A;  4JV5 M;  3U6L A;  2ZXO A;  4FO2 A;  4LJ6 A;  4EIW A;  2KW0 A;  3QO2 A;  4KJN A;  4GC9 A;  3NWT A;  1EY5 A;  4DV4 M;  3FTC A;  4DAY A;  3OWF A;  2ZXR A;  4FD2 A;  1S4Z A;  3H91 A;  2R6G A;  4KD4 A;  3QWL A;  3ZCB B;  4BBS B;  3Q0A A;  4C3I B;  2I07 B;  4QMG A;  4CIS A;  4Z9C B;  3JAM S;  4UAI A;  4FF2 A;  3WDN A;  2DY7 A;  2IL8 A;  5J39 A;  4DR5 M;  1KNA A;  1IW7 D;  2YR0 A;  1RTO A;  2ZAO A;  4DR4 M;  3I72 A;  4IUT A;  1DO0 A;  2QIL A;  2D9U A;  3LWE A;  3J81 S;  3JR4 A;  4IUU A;  3L25 A;  4RGT A;  2H1R A;  4FYD A;  4HMJ A;  2Q2E B;  2E2I B;  5G3L D;  1TY0 A;  4IUV A;  5J1Z A;  1ONL A;  3DMU A;  2CV1 A;  2JXM B;  3UZU A;  1EFI D;  1IBK M;  3L27 A;  3AJI B;  5M3F B;  2UUA M;  3FYC A;  1OXV A;  3EIE A;  2IPK D;  2YYZ A;  4NSR A;  1YNN C;  1O7L A;  1IYV A;  4OL7 A;  1YNN D;  4D81 A;  4CGY B;  2EYL A;  3HU3 A;  5GKN A;  5M3M B;  3DWA A;  3KBX A;  1LT5 D;  3L2A A;  3P75 A;  1IXR C;  2OQ4 A;  3D6C A;  1K8O A;  5C4Z A;  1HUN A;  5JEA H;  3MFY A;  4RKB A;  3KS4 A;  3MXU A;  4FWG A;  5C0X J;  3I4L A;  4MGH A;  5JI2 E;  2J0T D;  3OHX C;  4LRT A;  1IW7 C;  2BDO A;  4IUQ A;  4IUN A;  4ME5 A;  4BBR B;  4RGN A;  4N9P A;  4X65 M;  5EXT A;  2CEA A;  3SMS A;  1LLR D;  4S12 A;  4DN4 M;  2CHV A;  4R9W A;  2EA0 A;  1J7K A;  1ICW A;  5KYL A;  3E6Z X;  1NVM A;  2EJF C;  1B9M A;  2B2U C;  5E26 A;  3GPP A;  1FNU A;  5C1B A;  5JI3 E;  1CTM A;  4X62 M;  3MEH A;  2L7H A;  1IN6 A;  2LXE A;  3GQB A;  1HTP A;  2MJ8 A;  1J9O A;  1S3S A;  1F2M A;  5C5L A;  2F03 A;  1ILP A;  5DYG A;  2ZM6 M;  5HGT A;  4DK0 A;  5C4H A;  1FR3 A;  2X8A A;  2OEO A;  1NNU C;  5JJZ A;  2VQF M;  2HCI A;  5IIF A;  3S14 B;  1SXJ C;  5I6W A;  4PNY A;  4QNR A;  4I65 A;  1W6K A;  4FW9 A;  3GQ5 A;  5TSS A;  3P20 A;  2Z7J A;  2F0N A;  4RF0 A;  2LMC B;  2F3V A;  3I4Y A;  4OU7 A;  5E3F A;  2L09 A;  2FFK B;  2I7P A;  2A6E D;  1NJG A;  2CE7 A;  2Y0T A;  3PFI A;  1LV7 A;  3ONA B;  2FE8 A;  3EA6 A;  4REZ A;  2ID0 A;  3KSX A;  3MZ5 A;  4NKL A;  1Q39 A;  3S17 B;  3FKI B;  1AZQ A;  3BG3 A;  3AU7 A;  3H94 A;  5A2Q S;  4N9T A;  1RCV D;  3CRK C;  2J7O A;  1TY2 A;  1K8M A;  3SBJ A;  3K8Z A;  1OFI A;  3DXJ C;  3PXG A;  2Z3X A;  1NY5 A;  2F0K A;  1NUC A;  3M7N A;  1JQJ C;  2JA2 A;  3RGS A;  3TWL A;  1SE4 A;  4LF7 M;  2ICE C;  5NUC A;  3FD9 A;  3U6O A;  5D14 A;  2HKJ A;  2AHM A;  1E0B A;  1ENC A;  2B2W A;  4MHE A;  3VK7 A;  3K0Y A;  2R46 A;  1SXJ E;  3FPP A;  1H9K A;  2Y0S B;  2VB3 X;  3WOF A;  3M7G A;  3IFT A;  4R3D A;  5C3E B;  1GL7 A;  1EY9 A;  2TSS A;  4LFC M;  1SYE A;  3BDO A;  1SFO B;  1AP0 A;  3FUX A;  4KK7 A;  4LK1 C;  1EZ8 A;  3J7A V;  2FJ2 A;  3HHY A;  3TWM A;  2BDN A;  3CRL C;  1XYI A;  1XNR M;  3FUU A;  1RKN A;  1VCI A;  1STA A;  2Q8R E;  3L9A X;  5ITY A;  1TWA B;  5IT9 L;  3MHB A;  5I4D A;  4DV7 M;  2A5H A;  3Q23 A;  4CJ2 C;  3KOY E;  3FUW A;  1DOL A;  3RUZ A;  1HT2 E;  3FTE A;  1ET6 A;  2BE5 D;  2QKI C;  3HS0 C;  4GIT A;  4L16 A;  3AKZ A;  1IY2 A;  3SK4 A;  1BXT A;  2FOI C;  4FWH A;  1GOZ A;  1JR3 D;  4NDX A;  2EUC A;  3J7A S;  1IY0 A;  1IBM M;  4K2K A;  3SHL A;  2YQZ A;  3UJN A;  1D1K A;  3BVM A;  3SFZ A;  3CF2 A;  2JEB I;  1GUN A;  1SXJ A;  4RGM A;  5COR A;  2CVR A;  4PV1 C;  4DR6 M;  4A3J B;  3OMG A;  1F2L A;  1F77 A;  1K3X A;  1GUT A;  2CHQ A;  4HED A;  3PUZ A;  4JXJ A;  2F0H A;  4C3H G;  2QF7 A;  1C1K A;  1O7Y A;  1F9Q A;  1SE2 A;  2F0U A;  1WTP A;  1QAN A;  1LAC A;  2PYK A;  2DWM A;  1WTR A;  4BY1 B;  5EKK A;  1TGU A;  2EYF A;  2EXZ A;  2EY5 A;  2RKO A;  1QIL A;  3TQS A;  1ZYR C;  5C0X G;  1JOK A;  1JIC A;  2F0D A;  4PD2 A;  5IGD A;  3I8Z A;  2Z4R A;  1PFM A;  4JBW A;  4DNR B;  5FLX L;  4RF1 A;  4LGY A;  1CA5 A;  2G8L A;  1JOO A;  1YNJ D;  3E0J A;  1B44 D;  4U68 A;  1PFB A;  5EP1 A;  3GO8 A;  3C2P A;  4B3T M;  3V96 A;  2D62 A;  2RKS A;  4EGV A;  2B2Y A;  3BOS A;  1SEB D;  3MFG A;  3KW6 A;  1Q1E A;  5K36 H;  3C46 A;  4ILW A;  3GRY A;  3P7J A;  4LJ4 A;  2OXP A;  3C1E A;  4JI8 M;  2B63 B;  1HNZ M;  3HOW B;  1NR2 A;  3AOE C;  4RWS C;  4QOZ C;  5KQD A;  1Q8I A;  4K5X A;  5IT9 S;  3KFU G;  4RA8 A;  1WTW A;  4B9X A;  4NXM M;  3QB3 A;  4B7G A;  3C58 A;  2K6A A;  3A54 A;  3CF6 E;  1ROD A;  2ENB A;  3U6S A;  3QOJ A;  3M0E A;  4C3J B;  3DUZ A;  2FHT A;  4DV5 M;  3ZH9 B;  4DA2 A;  4A3V B;  1C4Q A;  4HTH A;  3EIH A;  2L1B A;  3R2I A;  4CJ0 B;  1NY6 A;  2FMM A;  1G41 A;  2KZU A;  1HPC A;  2LKV A;  4AG6 A;  2H4O A;  3HU2 A;  3DA1 A;  3X3M A;  3TBI B;  2XZU A;  3W3A A;  1A3U A;  4MM3 B;  2FFJ A;  4IBJ A;  5EJC A;  2QBY A;  1ENA A;  2PW5 A;  4M9X A;  5CBA E;  1HXY D;  4BBA A;  3E9S A;  2ZT9 C;  1DON A;  5EBC A;  1FJG M;  5FSW A;  3GP1 A;  3CTW B;  4B3M M;  1EY8 A;  2V4D A;  2K04 A;  2Z4H A;  3NWL A;  1WCM B;  3V2T A;  1E9S A;  4DV3 M;  2O5I C;  3SAT A;  2XZF A;  3VYR A;  3BYY B;  2LFN A;  4GKK M;  4FCT A;  2WB1 B;  3PUW A;  3KOX E;  1DD2 A;  3J80 S;  1I4P A;  5IWA M;  1XXH B;  2NN6 G;  1CI3 M;  2D7E A;  2KEB A;  3RMH A;  2PCF B;  2A68 C;  4BWG B;  3VLF B;  4MB7 A;  3HP3 A;  3U61 A;  1HA5 A;  3K5M A;  3TE6 A;  3CF0 A;  1YE9 A;  4U67 3;  2CFO A;  5FTN A;  4KY6 A;  2KZS A;  4B7H A;  3U6D A;  3H0G B;  4G7H C;  4ZK9 B;  3J27 B;  3T53 B;  1KLG D;  2JEA I;  4JK1 C;  4X3U A;  2CV0 A;  2UXC M;  5BN4 A;  4NL4 H;  2K05 A;  2KED A;  3KVW A;  3MXN A;  2LY7 A;  4JI7 M;  2HDL A;  1VMP A;  4GZY C;  5H37 D;  2N55 A;  2PZT A;  3R8B A;  4IBE A;  3GTO B;  2E2J B;  4GMQ A;  1EY6 A;  4K5W A;  4LFA M;  2L0C A;  1R2Z A;  1CFM A;  4LGM A;  1LTR D;  1TU2 B;  4KY5 A;  5CV7 A;  3O13 A;  2QEJ C;  3U6M A;  2KHS A;  5EKL A;  5I6Y A;  4CJ1 B;  3N6R A;  2DZN B;  4NRV A;  1SE3 A;  1AZP A;  1JCK B;  2Q8I B;  2YFQ A;  4QB4 A;  4A3B B;  1DGH A;  3TSS A;  4L8R C;  3PUX A;  2WAQ B;  1B4O A;  5FTJ A;  4D82 A;  2I46 A;  3D4R A;  1N33 M;  3KSJ A;  8CAT A;  1HQY E;  1QCB D;  1F9S A;  1J8I A;  3OMC A;  3HRZ C;  4G7Z C;  1JWS D;  1F9R A;  2RDH A;  3GLF B;  2F5S A;  3IKJ A;  1Z6H A;  5C0X I;  3KXE C;  1KTK A;  1PRT B;  1AW7 A;  4GHL A;  4JI1 M;  2F5P A;  4KHV A;  2Y0Q A;  1SYF A;  3LQQ A;  1UEA B;  2V1C A;  4IUP A;  1QOH A;  4MGK E;  1TWC B;  3TPZ A;  3ZC7 B;  1G2T A;  1ZXT A;  1VDZ A;  1C8C A;  1Y1V B;  3J2P B;  2E75 C;  2DWN A;  3UGJ A;  3Q6S A;  3H09 A;  3LNN A;  2UU9 M;  4X3S A;  2VNU D;  1MI2 A;  4ZUI A;  1K82 A;  1D5M C;  4OHJ A;  4QF4 A;  3MTS A;  4GRI A;  1JWU D;  1PRT C;  2PNR C;  1CM9 A;  3GD7 A;  2DZO B;  1G3I A;  2KXE A;  1R7R A;  2BOS A;  2NVQ B;  2K03 A;  3VR2 A;  2SOB A;  2Z8L A;  1KYI A;  4C1N K;  1YUB A;  3RZD B;  1TS2 A;  4DV2 M;  1GHK A;  4I4L A;  4GHA A;  3E4R A;  3NQI A;  3HHX A;  4K6L A;  3VA7 A;  2F0G A;  3DZD A;  3EQL C;  1XC8 A;  2RBM A;  3D31 A;  4I5S A;  2B39 A;  3QG1 A;  4EQO A;  4K8I A;  1CZW A;  4AG5 A;  3R8F A;  4RNA A;  1UM8 A;  3NK9 A;  4ZAI A;  1U4L A;  4HSV A;  5A2Q E;  5FTL A;  4B9W A;  1CA6 A;  1A3V A;  5DYI A;  4XQN A;  5ELF A;  1TDZ A;  1U4R A;  2MPM A;  3C1F A;  1PJI A;  3AMU A;  1PTO B;  1LT3 D;  1QQW A;  4A3E B;  3RD4 A;  4ODG A;  5DM6 3;  4BA2 I;  5G3L F;  2O4X A;  3MWY W;  5CV6 A;  3LVW A;  3OIP A;  4WFN 3;  3AOE A;  4MIU A;  3GQ4 A;  3S1N B;  2KJX A;  3S1M B;  1X37 A;  1J09 A;  1N36 M;  5ITX E;  1TVX A;  1IN5 A;  1SXT A;  3L29 A;  3L28 A;  2WAC A;  1EY4 A;  1I3Q B;  4H44 C;  3QAU A;  4TRD A;  4LJ7 A;  1LTT D;  3VYT A;  1O78 A;  3I91 A;  4OIK A;  1KLU D;  5E6J A;  2AQ1 B;  2M2L A;  3T13 A;  3GPU A;  3K59 A;  1XWE A;  2NN6 I;  3K2L A;  3KLR A;  2HHH M;  4FF3 A;  5C44 B;  3T16 A;  4Q5V A;  2NYZ D;  2L7I A;  3SAU A;  2UUC M;  2JA5 B;  2NVT B;  1HUM A;  3DOA A;  1DOK A;  3U9S A;  4I8O A;  2PPB C;  3AL0 C;  2EJM A;  2F0F A;  2O2L D;  3EVQ A;  3SHG B;  3PNY A;  4IBF A;  2X6G A;  1STY A;  2CUZ A;  3MXG A;  2C9O A;  1BCP D;  3KP0 E;  2WV6 D;  5KNC A;  1Y8P B;  1TII D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...