4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna replication/isomerase
molecule keywords DNA TOPOISOMERASE 3-ALPHA
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CHTB 3NBIA 4CGYB
chains in the Genus database with same CATH superfamily
4A3JB 1PFMA 1SNOA 3E9HA 3E5SA 4DBGB 3I90A 4PMBA 4QMGA 4W5WA 2K75A 1HR0M 5HURA 4RGOS 2KHSA 2KCMA 4AKGA 2C99A 3GTPB 3I73A 1NV9A 4FWHA 3LCUA 1HT1E 4YCVA 3UE0A 4HMJA 4GHAA 1PJJA 4M8AA 5ITRA 1K8OA 5LMNL 1PH2A 2B2VC 1E32A 1XNQM 4PZ8A 3GP1A 5E4WC 2Z8YM 1TS2A 2DAMA 2KOLA 3HG9A 5C4HA 2C9CA 2A6ED 1V1PA 1RCVD 3A56A 3H0GG 1OXTA 5ELCA 2CHGA 1QJOA 1OXVA 3SMPA 3LGJA 1Q8KA 1HQCA 4JYAM 1KFVA 4AZFA 1S5DD 4MGKE 3K8ZA 5KQ8A 3KP1E 1E0BA 3PUYA 1IKMA 1A2UA 3K92A 2GN5A 2C5CA 4MNOA 1K0SA 1B2TA 4DR7L 1G71A 2AQ2B 1PFNA 3AKZA 1OXSC 2L4EA 2PZUA 3Q23A 3QG1A 3S1QH 4JYAQ 1TGUA 5A35A 5KQDA 3MAQA 1ASZA 2CQAA 3NWSA 1B4OA 4LFCQ 3RN5A 1S4ZA 3JAMi 1N8RC 3BVZA 3QIAA 2JE6I 5IWAL 1JQJC 2G5DA 2XN9C 1EY6A 3ONAB 4C3IH 4X62Q 3L7ZC 3EIHA 4GNXC 3Q8DA 3NTKA 1T43A 1PTOH 4JI8L 5BN5A 5HGQA 2RBMA 4OL7A 5ELOA 5JEAJ 1IBMQ 1NSNS 2UXDM 4JOIC 2H1RA 1OTRA 2FXQA 4X66Q 1X32A 4HJ8A 1XNQL 1HR0Q 1WD1A 4A93H 3KW6A 1QUSA 2GQFA 2QP9X 2IJ0A 2YFQA 1N36L 2XFSA 4FWDA 1YUBA 3FEWX 2HAKA 1MI2A 1YEZA 4GOPA 5I6WA 2E2JB 2K32A 4OELB 4LFAQ 2EJSA 1P16A 2KA6B 2JY7A 2J7ZA 2UUAL 1HZCA 4DAVA 1K0RA 1VMPA 4LJZC 1NSFA 4MN3A 4BBSH 3V96A 4FO2A 4XT1B 3CMAA 5DEHA 2IPKD 4G6ZA 3VDUA 5C4XB 3OW2A 2Z6BA 1VQ7A 2RHSB 1LTMA 4HL4A 3WHKA 3NPPA 3CCEA 3UDGA 2YTXA 1NY5A 3FKIG 5CBEE 3NBIA 2BOSA 2Z9HA 1ZQ9A 3SC3A 3I04M 1ONLA 3PSIA 4GN4B 4UP8A 5C4JH 1A2TA 3QYEA 3PGZA 2KCCA 2KZSA 1DOKA 1TVXA 4MZ9A 2OOBA 1KAAA 2F5QA 3D31A 1WIVA 2DJGC 3CPWA 3Q0AA 2N78A 4FP5D 3FP9A 4X3TA 2O5IC 2EZVA 3G71A 4EQPA 2IX3A 1DM0B 1XTDA 2ZJPA 4DV7L 2JXNA 2PI2A 1M4VA 3SK8A 1Z5BA 1SLJA 2L9HA 2DHRA 4OXPA 4ME5A 1YHQA 2JA5G 1TWHB 4LGYA 3GP7A 4DUYM 3AB9A 4JPBW 1CSPA 3R93A 1N33Q 3UDFA 1K83B 2MROB 4P17A 2JA5B 2LBCA 4A3GH 4PDGA 1SYFA 1B3AA 1KLUD 1HH2P 3VR2A 1X3GA 1FNNA 3Q8GA 3J80i 4KT0F 3H3VH 4CJ0B 3KOWE 4DR6L 3KSJA 1LTLA 3GLFE 4K0KM 3M4QA 3TL4X 3ICEA 3UI2A 1HHVA 1TS4A 3U5ZA 1AE2A 1VQHA 3I01M 3HGBA 5TSSA 1I5FA 3SK6A 1SJHD 1TU2B 3CHBD 1A63A 1PMRA 1J5EQ 1PDQA 1TS5A 3KF6B 3HOZG 4FCVA 2Z8LA 1FD7D 5IGDA 1RD9D 4GKKQ 1VEKA 3BVMA 4I4LA 2C35B 3CCLA 3S1NH 3I91A 2R45A 3SXHA 3KF8A 1HNZM 5KO3A 5C3EB 1TWCB 1PZJD 2KRKA 2E5LQ 4JI4Q 2EY1A 1HJPA 4KHVA 1OKSA 2UUCM 4RNAA 1VDDA 3C2PA 5IGBA 3CGWA 2B2YA 3BOSA 5DNFA 3OOCA 4B3RM 2RSOA 4JI7L 4LRSA 3RZDH 2JXMB 1XJVA 1SROA 4ZKBB 2R4EA 3UJNA 1NY6A 2F3VA 1TH3A 1AP0A 5CV8A 2VQEL 1CT1D 3TDQA 5EAYA 1R9TH 2Y21A 5FTLA 3L27A 2Z3XA 5LMNW 1KHIA 2QHOB 3FRHA 4MGYE 2CKZB 3GLHB 3H4JA 5BR8Q 1PM5A 1D0MA 5DM63 3HKZE 4HJ9A 2K6AA 4OONA 2YNMD 3NENA 3B7ZA 3HOUG 3OPOA 1D0LA 1EFUB 1EZ6A 3DLLA 1YHBA 4BY7G 1TWHH 3AQQA 3DA1A 4P75A 3IG8A 1L1OB 1JR3A 2HHHL 2UUCQ 3OTOQ 3VDYA 3J7AF 3L0OA 2DHYA 1Y69U 1HZ9A 1CZGA 4WJ3M 2K6BA 1XMOL 1SXJC 2WAQB 5E4XA 1O7ZA 5G3LD 4L4UA 5ITYA 2Z4IA 2UUAQ 1Y8NB 2SNSA 3J7AV 2OF1A 4DR1M 5C44B 3KS4A 1AE3A 3JR4A 3FTFA 1TF0B 2NZOA 4RMFA 3T1YL 1HNXL 3PQIA 5EJCA 2UXBL 1WD0A 1LTID 3CD6A 1O80A 1IYVA 1SYBA 2QPAA 1Q3LA 2DY7A 1LM0A 2F0KA 4DR4L 2Y0TA 4R9WA 1W2BA 3JR5A 2VQFQ 4K5VA 2TMPA 2HL7A 3F8TA 3N52A 4IPHA 3T56B 4IQZA 2BWBA 3KOJA 2QDBA 3U6DA 2WKCA 3GDEA 3NXWA 4UHVA 1X9NA 2VS1A 4RCOA 3RZOH 1JORA 1EL0A 3A7LA 1WGNA 3DWAA 1PRTC 2EKFA 4HN7A 1EYGA 2OWOA 3S9WA 5J3BA 4TRDA 2EYMA 1GKIA 3OTOM 4LUVA 1OTCA 5JPNC 2K5QA 5KGUA 3ZQJA 1JB0F 1TR8A 4JK1C 4A3DG 1N32M 3KJPA 1SNPA 2ZAOA 1FJGL 3WWVA 3SATA 4LF5L 4IPCA 4CJ1B 5COYA 4KLKA 4C3IG 3G6JB 2WFWA 1DD2A 3D0FA 4PV1C 4LFCL 2A73B 2QF7A 4YHHL 1HZBA 2Y0SB 1IY0A 3CMEA 2CP8A 4IBGA 1SJED 4L78A 1NCVA 1YIJA 1ESRA 1P3QQ 3GTJH 2PW7A 4BY1H 1V33A 3HJSA 1L2BA 2KXEA 2JSOA 5JEAH 1C48A 3PV0A 1HA5A 3S1QB 2K1BA 4AYBB 3EJIA 5T1IA 4YHHQ 4X66L 1V43A 3HOVH 3CC2A 4IFDJ 4ANRA 1QVCA 3FDTA 2LTUA 1ENFA 2KENA 4RHRA 3K1JA 3QAUA 2L5TA 1YHAA 5E1FA 1K9MC 4R4IA 3VYSA 2EJGC 3KS8A 3JC66 4HIDA 4DPGA 2FS1A 2DKLA 3CW2C 4X65Q 1GJXA 2EPBA 5AFWA 1N32L 5JJIA 1KDBA 3K9OA 3TP7A 4FW9A 3HOZH 2Y20A 3A42A 4LJAA 2ID0A 1PRTB 3I55A 2CFOA 4QNMA 1A15A 3THGA 4JYAL 3AL0C 1F2LA 2NTTA 2F3IA 1CHQD 4DUZM 2A68D 4DR5Q 1Y1WH 1E94E 3IECA 4MGZE 1NNJA 4JI4M 1YBYA 2F0OA 1H9KA 4B3TL 1LABA 4F87A 3S2DH 3S1MB 2D9UA 4KKSA 3HHWA 5ITQA 3GLIE 4LMQD 3ULJA 2N88A 2PMZE 4QL5A 4LJ7A 3J7YW 1SAPA 4BS9A 2JQOA 1STAA 1RTOA 2EE1A 2F4VL 2DZNB 1E9SA 2B2WC 1ILPA 3OHXC 1JWSD 3E9IA 4G4QA 2QBYA 3HJ8A 2J0TD 1PH1A 3DMUA 5EBDA 2MO1A 3UZUA 4GN3B 2JYOA 4BB9A 1QUTA 1D5XC 4BXXG 4LF4M 1QAOA 2FHTA 4K5XA 4GKJQ 4DV1L 1WHCA 3AOGA 1QCBD 4N8X1 4ME3A 4AIMA 1UFZA 2F0VA 4TSSA 2MNAA 2L7HA 3GD7A 2A74C 1TWAH 1PRTF 4QB4A 2ZM6Q 2RDFA 5H37D 4Z9CB 1WI5A 3LNNA 3H0GB 1PV4A 3P7JA 5CMDA 2RKSA 1LV9A 4RGTA 5M3MB 3FE3A 5KYLA 1YVCA 4AW4A 1B70B 2QDLA 1BNZA 3NQIA 4ID6A 4A3EB 2L11A 4LWCA 2Z6KA 5FOBB 1O7IA 1Y14B 3RN2A 3QB3A 3K58A 4OX9L 2JA8G 2VQEM 1AUAA 5KNBA 2R7FA 1QNUA 3U6MA 4IJLA 3I7FA 4IJEA 2KVMA 3J80E 1DXMA 2LHCA 2NN6I 3CCJA 3OWFA 4O42A 4D80A 2PMZB 2DWMA 3U4ZA 4A3GB 2QW7A 3A46A 1VQAA 4GC5A 4FCWA 4ZUJA 3C58A 4FXDA 2KHJA 4ZUIA 4BWGB 2J4XA 2MJ8A 5C5LA 1EQQA 4DV6L 4AKIA 4HJ7A 1XWEA 4BBRH 3SVMA 3ULPA 1Q1BA 2IT1A 4FNFA 4IURA 1WTWA 4M9XA 1DGFA 2CEAA 4OVZA 3GPXA 2EYFA 3AOEC 5LMNM 1DOMA 1I4GA 2L15A 1IXZA 1NHGC 3M3YH 3M85A 5GKNA 1PFBA 4DV2L 1G6ZA 2EY5A 3PF5A 3U4VA 3BZCA 5IP9G 5EP3A 1BBUA 5KRUA 3GTMB 2R46A 5CV5A 4B3SL 1AEXA 2H5XA 2JA6B 2HQEA 3K5LA 5M5XH 2B2TC 4II7A 3FUVA 2WB1G 4HIKA 2KNZA 4CKEA 4UPAA 3J81L 4DV0M 2MP1A 2GVBA 2XGTA 1BUVT 4ZKCB 3I2ZA 3IL8A 4OEMB 2WIIB 1VQMA 5NUCA 1QZHA 2JY5A 3M9BA 3W1GA 4NP5A 1IBKM 2MUYA 1F4IA 5IP7H 3GLIA 3L29A 3TPZA 4C3JH 1R9TB 2N49A 3H15A 3RE8A 2E2DC 4FYDA 4A3EG 2YU9B 4NB3A 1FYCA 2NVYH 1LT3D 2JA8B 5DFLA 3SASA 2L55A 1I94L 4N9PA 1QZGA 4IUNA 2K4KA 1TQOA 4PD2A 4PMCA 1JJ2A 4AI6A 2HHHQ 4KKUA 1QZMA 3HRZC 3Q8XA 1JOKA 1N9WA 5IT9c 1EOVA 3V05A 2JA7H 4JI1Q 4M0WA 4K0KQ 1LUZA 5E3FA 1Q02A 1IW7D 3AFHA 5J22A 3P1HA 1W3SA 1JB7A 5I9PA 1X3QA 3IG5A 2FJ2A 2ES2A 1PRBA 1CM9A 1Y1WB 1VQEA 1TY2A 3S2DB 4HAEA 2E75C 1F2MA 1NO1A 1JMCA 3PO3B 2IWHA 3KFUA 3GO8A 3T53B 1CZWA 1A3VA 2VXWA 3PIOA 4FD2A 1U5KA 3ZCBB 2BE5C 4NMZA 5HY6A 2D0OA 4DR3Q 5ISRA 1H9JA 3PO3G 3RZOB 1V8QA 2PZWA 3ZH9B 4NSOB 1QUQB 4GN5A 1Z5CA 1CI3M 3GV3A 4EVOA 2APLA 4IBEA 3P75A 4KY7A 3CTWB 3MA2B 2M5ZA 4UY8C 4AG5A 3K59A 5ITXE 1E2VA 1PRTD 4R4CA 3RGPA 4HTHA 3ULLA 1NY4A 2R92G 1ML0D 4JI6Q 1IBLL 3NBHA 1PJTA 2F5NA 1II3A 1UUPA 2OQ0A 3F1ZA 4MTNA 4QY7A 2VF8A 2KCTA 4F88A 4NKLA 3H09A 2VB2X 3MXNB 2DNAA 1FGBD 4X6AH 5M3FG 3KLSA 4LJ8A 4KJOA 3BDOA 1L1OC 2NVQH 2K50A 3F2BA 4POFA 1CKMA 2LSSA 1GM5A 1JCKB 3J7A5 2DAGA 4LG2A 1YJWA 1IHZA 3DOAA 4JBMA 1SBBB 1QVRA 2B3TA 3RGSA 1XXGA 3TS2A 1XXHA 2WB1E 1EQTA 2CWAA 3FPPA 5C3XA 4LF8L 2QSFX 1R2YA 2EA0A 1K3WA 5FLMG 4LFAM 3L2PA 5EXTA 1OXXK 4NXMQ 4ZYSA 2LVOC 4A93B 5K36H 4GLVB 5C1BA 4XDXA 1L0XB 3ZJYC 2ZT9C 2L7IA 3K5OA 3QJYA 2I0QA 5H1SE 5K36G 1EIYB 1QVFA 4RG1A 4IJFA 4L6V6 3I4OA 2ZJQA 1E24A 1PYBA 3G7LA 3GTJB 4PMWA 3LWEA 1R4QB 1KNAA 2B2UC 4K6LA 1SE8A 4YIJA 3GPPA 3KBXA 1IY1A 1CA6A 1PH4A 2KHIA 1EYCA 3PMFA 1VQ1A 1I94M 2WAQE 1PJQA 3CKIB 3FHWA 2F0DA 3CQZH 4JVZA 2LWXA 4V190 3GLFB 2K04A 1QWYA 1MJGM 3MXUA 1B50A 4L5SA 4YWMA 4LJ6A 2B2WA 2JZ1A 3KDFA 5D14A 5IOCA 3CF6E 3GPUA 4IOCA 3TN2A 4LF4Q 3CC7A 3S16B 4IUUA 2QCUA 2X4AA 5CR3A 1XMQL 2OPFA 3L3OC 5EGTA 1ZAEA 2R18A 1YLAA 5FTMA 1VQBA 1YJ9A 2MGWA 5M5XB 3VKGA 4NW2A 2NTSA 4JI3L 4A3JH 5CV6A 4LFAL 4KD3A 2YTYA 2FFKB 3A98B 4K0KL 1O7LA 3MXNA 2AWNA 4IUVA 1GL6A 2CV0A 1BCPC 4A4IA 4FF2A 1YJNA 4LF8M 2E2HH 2MO0A 3U6CA 1V1PB 4B7GA 4IBDA 3HOYB 3AU7A 3J81j 3B9PA 5JPMC 3RNUA 1I94Q 2NVYB 1P8LA 3I4YA 4B3SM 3PO2G 2NVQB 4JI2M 1KAWA 4A3IG 4HJ5A 2K01A 5IT9E 1VQ6A 1SMYD 3VR6A 1D5MC 4CDCC 5FTKA 3HJQA 2K52A 4GMQA 5BR8L 5LMUQ 1Q81C 3DM3A 2I7PA 1K73C 5EP2A 1SNDA 4EQNA 2MR9A 2OEOA 2ZXOA 4JI1L 3TMEA 1XMOQ 3W67A 2XLJA 3S15B 2RF4A 3TEHB 1E1OA 3WHLA 4J15A 2QEXA 3F2DA 2VDBB 2IHEA 4DXGA 4A3IH 2F0FA 5GAHC 1M1KC 2JA5H 2PNHA 2UXBQ 1FNVA 2JUJA 4AH6A 1UEAB 2PCFB 1EZ8A 1AZQA 2VF7A 2Z6KC 3SHGB 3PIP3 1HNWQ 2Y0SG 2D5DA 2JA2A 3GV6A 3CF0A 5EP4A 4NL4H 1YE9A 1BQQT 1ENCA 3CAMA 2R7DA 4H7BA 2BE5D 3T13A 1QDTA 1SE3A 4CDFC 4F2LA 2MHVA 2A5YB 3URYA 5E7NA 4NXNQ 1Z5AA 2L09A 2JN4A 3T1YQ 1HNXQ 1E3PA 4HJAA 5CGKA 3FYCA 3MXPA 1D1KA 1RIPA 5I2YA 2PQEA 4LF8Q 1FNUA 1AN8A 1UE5A 1ZYRD 4UN2B 4A3MB 1WGLA 2XSCA 3R8BA 5L37A 5A2QE 4ZLTF 3JAML 5AJ3L 5L8RF 2K47A 4HEDA 3OMCA 4PT5A 3NWLA 1I4XA 1IN4A 1XNRM 3HKZG 3M6AA 1R4PB 5KYIA 5C6AA 3BU2A 2EYLA 2BH2A 1QYRA 2K5WA 2PI2E 2XWJB 3QOJA 3DWQA 2C98A 1VDZA 4PG3A 1X6OA 2OTLA 2FH0A 2RKOA 1G4AE 1RKNA 1PXUA 1JE4A 2VZAA 5FK9C 4FCTA 5EJWA 2A19A 1VEGA 2UXCM 5JEAG 4JI2L 4DV6Q 1W6JA 2BA1A 5EXPA 2RQXA 1FJGQ 4IPGA 5EBCA 3EIEA 3PFIA 4OW0A 4X3UA 2RHQB 3NTHA 4FDBA 4L8JA 2LFNA 3KLSX 3ZC7B 1KIXA 4OHJA 2UUAM 1JICA 3KSXA 1H9MA 3WOFA 4CJ2C 1W6KA 4RWSC 4H44C 4A3FG 2HCBA 2N35A 2R65A 2AMCB 2CV2A 5BN4A 3CCRA 3CCQA 4IBCA 2A6EC 2EY6A 3NQTA 4IBJA 1HTPA 1XB2B 4EIWA 1V9PA 1CKNA 1STHA 4DGZA 4GEWA 4C3JB 2R93H 1IM2A 3MC0B 5CYUA 4DR1L 1SFOB 5EXSA 1JQYD 2O5RA 5M3FH 1JJGA 4LRTA 5CBAE 1IKLA 4MB7A 3CQZB 3HOXG 1KQSA 1MJCA 1I50H 2A5HA 1MHWC 5J1ZA 4LF9L 2Q8TA 2ERCA 1IW7C 2TSSA 2B39A 3DZDA 1SXTA 4TVAB 4ZRZA 3RFWA 1AFPA 1SXJA 4H0LC 2NUCA 1XTCD 4NRVA 2LS01 2A69D 1RTNA 4IIWA 3QOLA 1SXJE 4L5RC 1STEA 5IYBH 2LXJA 1OFIA 2WZJA 3HP3A 3GRVA 5A2QL 2VUMG 3GTKB 4LFBQ 1GHKA 1YZ6A 3U58A 3TRZA 1BR9A 3U6QA 4FXGC 4IFDG 1LO5D 1A0IA 2E5LM 1VQGA 1HUMA 3VR5A 4CBVA 1K8AC 2EJFC 3VR4A 2ZBKB 4K14A 3NHHA 4JOIA 3KLRA 1ZMVA 3GRYA 1WTRA 4BA2I 3VLFB 4X62L 4DR4Q 1VQ9A 4X65M 4GLXA 4YCUA 4P16A 3HY5A 1MSHA 2HIVA 2R6GA 1WVLA 1K3RA 3T4AC 4LJ9A 1LLRD 3KFUG 1PVOA 4L15A 2IX0A 2EUCA 3S1NB 1X65A 2K0BX 3R3OA 5IYDH 3RR5A 4D81A 4DV1Q 5IREB 3I4MG 1PTOF 5IYBG 1UAPA 4GKKM 5ELDA 2OQ4A 3ITPA 3HS0C 3K7UC 4JI7M 2B63H 3P20A 1IXSA 2MQHA 2Z7JA 2F4IA 5LMUM 1IBMM 1S3OA 2EKKA 4DXFA 1NJIC 1R4GA 3ERQA 4HMIA 1WTPA 1NBWA 3HOXB 3GTGH 3GQ5A 1GUOA 1B7YB 4CJ6A 4CDEC 2R44A 1DGBA 1A3UA 3PCOB 2DN8A 4M9ZA 4CHTB 3S24A 2M60A 1SE4A 3U60B 1Z7TA 3CU7A 2LVNC 4IPDA 2EO2A 4OX9M 1VQ8A 1WFQA 1AIPC 3OYYA 3SK5A 1X37A 4B3TM 1I3QH 2LXEA 1WJJA 3L28A 2LNHC 2LXKA 2UU9Q 4ITQA 4L5QA 2WKDA 2HCCA 2V1UA 4DKAC 4C3IB 3J80S 3HKSA 3HGIA 5ELBA 5IWAM 1K3BC 4LGMA 1STGA 1DZ1A 3M0EA 5CV7A 5IODA 2DI0A 1PTOB 4DV7M 1EYAA 2KCNA 4R8NA 1G291 2A1AA 2EXDA 3S16H 4AQYM 4S3SA 5ITTA 5EPLA 1NUCA 1PYSB 2DWLA 2KA7A 1IY2A 4OO1I 1VQFA 4DFAA 3SR1A 2B8FA 3HHZA 2K5DA 1QOHA 1EY8A 1G8ZD 1LT6D 2L12A 3U6PA 3K0XA 4GLAC 2L4FA 3MEHA 1ICWA 4F7XA 3T38A 4DV5L 3J7BA 3NSWA 5C44G 2XF3A 2CH4A 1KDCA 5D65A 1VQ5A 3HOYH 4G4OA 1I4RA 3KP0E 1TWAB 4GKKL 1C1KA 2D2CC 3SHLA 2N55A 4G3OA 2VL6A 2XSZD 3J7ZC 1RU3A 3J81i 3A7AB 1I4PA 2R62A 1JOOA 5M3MH 2NYZD 2OOAA 1IXSB 1SMYC 4ZQ3A 1TWGB 3R8FA 3U6OA 2MPMA 2UXDL 1MU5A 1D1IA 2PQAB 1BBXC 1XPUA 1BO0A 1NJGA 2RDGA 2R93B 3W0FA 4DAPA 3GTQH 5F3WA 2OT2A 4DV0L 1UEBA 1UM8A 4P73A 3IFDA 3A55A 3LCVB 4I65A 5M3FB 1CKNB 2Q2HA 2KDLA 3I56A 1CFMA 2YR0A 2W82A 1M90C 3NUCA 3PIO3 4K2KA 1K3XA 4PNYA 2F0WA 1OFHA 4G57A 4DV4M 2K14A 1XXHB 1X3FA 3TS0A 5EQTA 2G8LA 3SMSA 3JAMc 4JI3M 3C3EA 3GLGE 4LZZA 1E2WA 1TWFH 3STBC 4A3DB 1ILQA 1L1OA 4A3IB 2K28A 5IGCA 4NC6A 1QB5D 5M5WH 4KHPQ 3VK8A 1R5LA 3MVVA 4A3CH 2I46A 4RKBA 3HOVB 1VQIA 4WP2A 3NTIA 2X6LA 3VDPA 5FLXE 2JWSA 1TTEA 3K6OA 3QWNA 4DR3L 3AOEA 1A8VA 2KNAA 4OWTB 1LT4D 2CHVA 1PZID 3GTMH 4QIWB 4M9SA 4GKJL 2JZ0A 2ICEC 3UE1A 3GQ3A 4IUQA 2QGQA 3KUPA 4I7ZC 2ZM6M 3E0JA 3M4YA 2SNMA 2NBFA 1TY0A 3I51A 1NNXA 1SNMA 1VQOA 2BDNA 2NB0A 4AG6A 2HD3A 1JWUD 4KTAA 4X3SA 3X3MA 1AW7A 4NDXA 4D82A 1QAMA 4IBIA 3KYHC 1J09A 2J5YA 5JJZA 4ZK9B 1KLGD 2Z0SA 5IYCH 1C9OA 4EQ5A 4M1UB 4A3KG 2UU9L 3M4PA 2YU9H 3HWSA 3ND8A 1STBA 5ELFA 4LF7M 2VUMH 3BBZA 4JI0Q 3NP8A 1SEBD 4NOOB 4HSPA 4R71A 2CRUA 3HX3A 3A8JE 3D6CA 3X3NA 1QDRA 2DJFC 4DV4L 1CQFA 3T1HL 1HTLD 3U9SA 1B9MA 4XGIA 2EYPA 4GHLA 2KJXA 4LF5Q 1EOTA 2F0QA 5JVG3 4ALPA 1IFYA 3EVQA 1JR0D 2VQFL 1OIZA 4QHTA 2F0PA 2LMCB 2HT1A 4F1IA 3HFZB 3CCSA 4MTKA 4L6TB 2EVBA 3U60A 1EQRA 1WOCA 2V6ZM 1H9RA 2EY2A 4J1MA 4KKTA 3GTOH 3H0GH 1IN5A 1CSQA 2RCFA 4DV5Q 2RRUA 1SR3A 1RF2D 5C0XG 5E6JA 4DV2M 2K9DA 4XYOA 4GITA 4O0AA 3D4RA 1BXTA 4A3EH 1S5FD 1IL8A 3TQSA 1Z59A 2EYJA 4JC0A 5IGEA 5GAEC 1TH4A 5C4ZA 4XXEA 3S14B 3H6MA 3U9OA 4JI0M 1JJCB 2I5MX 1WR1B 1Y1VH 5M3MG 4KV6A 2FNAA 4C3HG 4YY3M 1S3SA 2BH8A 3CCMA 3FKIB 1TH2A 3L2AA 1OJLA 1VMCA 3C1EA 5LMNQ 3S1MH 3HHYA 3M7NA 1QZEA 2HWJA 3DM1A 1XXHE 1DV0A 1UE1A 2O2LD 3B6YA 1RL2A 1NHWC 3TP5A 1IN6A 1ASYA 1WCMG 4L16A 1HQYE 1TDZA 2D7GA 1I4QA 2PPBC 3OIQA 3RLOA 3H3VI 3CRKC 4Y28F 4KD4A 3U50C 3KDFB 2UU9M 1WCMH 4LF9Q 4MGIE 3AFQA 4JV5L 4JI5Q 2L1BA 3BVGA 1M8AA 1TWGH 1QVGA 3GRUA 3A54A 3MXGA 7CATA 3J81E 3IAYA 5ITXA 1MD2D 3L25A 3CPFA 1NE3A 4LF9M 1SYGA 2A69C 3W68A 5HGTA 5IWAQ 2JA6H 3RLNA 5DM73 3GLHE 1B53A 3OIPA 1G2TA 3VK7A 3FMCA 3I70A 1Q82C 3M7GA 1ZMUA 1BKBA 1IBKL 2JNHA 2K03A 2SOBA 3SDZA 5KEEA 1H9SA 2VIIA 5GQOA 1PH3A 2AWOA 4JCVE 1GUTA 2VQFM 4BLCA 4CISA 3RUZA 1H6UA 3VYRA 4FF4A 1X3EA 2BA0A 2XRQD 3STBD 3OTOL 3G48A 1UE6A 3MHVC 2XFTA 2JA6G 1LTSD 2OXPA 4DV3Q 1Q8IA 3MWYW 3CCUA 2B63B 1DJRD 2E2IB 4DK0A 3KXEC 2KEDA 3T6PA 5FLXL 1N77A 1IBKQ 4QUCA 4B9WA 1UWVA 3D8LA 4E6IA 3I4NB 3MZ5A 3LVWA 3LMMA 1Q3CA 5BR8M 1J6QA 1QNKA 4B08A 3PF4A 1J9OA 2ZXPA 1PFSA 5G3LF 4ULLA 1EIFA 1N75A 4DA2A 2A6HC 3IKJA 2L2DA 2R92H 5DYGA 3SFZA 1OQYA 2JP1A 3OW7A 3FRPB 5C18A 1NTGA 2JA7B 2VB3X 5FTJA 3A5UA 3E21A 4BBAA 4DNTB 2NZ1D 4DR2L 2XSZA 1E9RA 3J81S 2NVXH 2R7ZH 2UXBM 4L63B 4UAIA 1F9SA 3NE5B 2IX1A 4KHZA 2JY8A 3QR8A 4OIKA 2XRSD 2E8GA 3F2UA 4A3BH 5IYCG 1TDHA 1PH7A 1J7KA 2F1MA 3GQBA 3E9SA 2Q8RE 4CKBA 2HUGA 4IBFA 1KL9A 1Q1EA 4EGVA 4M0DA 3VFDA 3D8BA 3EIVA 3SARA 1YNJD 2AHOB 2JK8A 5I2XA 1KRTA 4QJFA 4JV5M 2VUMB 1GHJA 1I4HA 3CCVA 4DV2Q 1WTVA 3K5MA 3A8IE 3TZUA 2F5PA 5LL6X 2R4JA 1DONA 2JY6B 2NWGA 4EQOA 1AH9A 3J7AS 5KIXA 1RDPD 5T1GA 5M5YH 4B3SQ 1IXRA 1F2YA 3MEFA 4B3MM 4JI8Q 3S15H 1YITA 3NEMA 3GTPH 5K5PA 2KUMA 3IRBA 1EWIA 5ITUA 4BY1G 3DEOA 4B3TQ 4S12A 1H95A 1YNXA 2K05A 1L0YB 4QGUA 2Q2TA 3D6WA 4H02A 4UP9A 1VQKA 3G6EA 3QYBA 2EDGA 3KLWA 4HEOA 4K6DA 3VKHA 2F0HA 3LQRA 3K57A 4AQYL 4C1NK 4IFDI 3FUTA 3TE6A 2Q8IB 3D4WA 4B7HA 4CDDC 4FVMA 2I5LX 3GTQB 1XWIA 4A3KH 1BCPF 4JBKA 2UXCL 4DNIA 1SN8A 1XMQM 1R2ZA 1FVIA 2B8GA 3RLFA 3CC4A 4A3DH 4GZYC 2OTJA 2PNRC 3U5ZB 2HCIA 2DAEA 2V1CA 2PZTA 1LTRD 4JI7Q 2KQ3A 4Y7NH 1KSFX 1E7ZA 2AQ3B 2OCEA 4LZJA 1EY0A 4JI3Q 3C46A 3G4SA 1DYQA 3VYTA 1ET6A 4JI8M 4A3MH 1C0AA 4POGA 1EE8A 3VR3A 1G2SA 3UMMA 1B44D 3U6EA 4G7HC 1EIHA 1I6VC 2WV6D 1A62A 2XZUA 1SNQA 2UXDQ 3D3RA 5EKIA 2R0IA 2RCNA 3K5NA 4JI5M 4JV5Q 3DFZA 4G4KA 4A3BB 1T9HA 4DR5M 3WOEA 3K7AB 2FE8A 4NXMM 3Q6SA 1CTMA 5C0XI 1GJSA 4GRIA 1A3TA 1C7YA 2WSEF 1TWCH 5D3IB 5LL6S 2Q2EB 3W3AA 5LHY1 1HR0W 2UUCL 4A3BG 4BBRB 4K5WA 2RSNA 3MFGA 4LF6L 4GOPC 4WJ4A 3SGIA 3KF6A 4Q0FA 2E2JH 2KBNA 1HNWL 1KABA 1K82A 2ZM6L 1OAOC 1TS3A 1JOQA 4QOZC 4G7OC 3GLHA 4CKCA 5GAGC 1T3TA 2F0NA 3V76A 1B8AA 5A2QS 1SE2A 4TKOB 1FL0A 1ICFB 5J39A 2BWEA 1L2CA 1VEJA 3J2PB 4IBKA 4KLNA 4LNQA 4A3MG 4A75A 3VYUA 1NJFA 2KEBA 1H9SB 3EBEA 1G41A 1SFOH 1WTOA 2ENBA 1ET9A 1L2DA 4IALA 4LF5M 4A3GG 1D8LA 4MIUA 1L8QA 3TP6A 5DAUA 4DR3M 2ZANA 1LTBD 1LTGD 1L1ZA 4QHSA 2F3WA 3K0YA 2R93G 2QQ8A 1JE5A 4DV7Q 1NNUC 2ICIA 2DWZB 2N8NA 1EUJA 4IN3A 4HLQA 1NR4A 1E22A 1MKHA 3HOYG 2B2UA 1AZPA 4HCSA 3S1RH 3FTDA 3B89A 4REZA 4JI6M 1CK1A 2R61A 5IZ7D 1X54A 4LFCM 3S14H 2NVXB 1D0KA 3GTOB 1GABA 5C0XH 4KK7A 3J27B 3KOXE 4I8OA 4G4NA 4LK1C 2AUKA 2K5HA 4R4TA 4FWGA 2ZAMA 2N3SA 1EEID 3E0EA 3PO2B 1Y1VB 1FJGM 2EJMA 2BJVA 2F5OA 4JI2Q 3QWLA 1GUGA 1G6PA 4X62M 1L1TA 3PXGA 2V1CC 1VQLA 1ORYB 1IN7A 1I4WA 2K5VA 3BDLA 2DNCA 1JR3E 1Q90A 4DR6Q 2R3ZA 2WB1B 1SG9A 2AUJD 1A6XA 3EFXD 2HKJA 1K83H 2O5JC 3PUVA 5CC4A 1PH8A 1IYJB 1EY4A 4UDUC 1MJEA 3AYHB 1SYEA 2DGYA 3D8GA 1EU3A 1IN8A 4R4OA 3AMUA 1X56A 2D7EA 2WACA 1GUSA 2F0SA 1R7RA 3UGJA 3EN2A 1G91A 2CQOA 3HZXA 5BPVA 5FO7B 4RA8A 2UXCQ 3K81C 1HZAA 2RDHA 1U4RA 3PO3H 4DR1Q 3HU3A 2PO4A 1XMQQ 5DYIA 5IGGA 2C96A 2F03A 4JI1M 1GXDC 5FTNA 3SYLA 1T5EA 4RKLA 2JA7G 2LH0A 1HRJA 4QUFA 4OWXB 4YY3Q 4XQNA 2XWBB 1KYIA 4JI5L 4HIOA 1SYCA 1W5TA 1Y8GA 2K7VA 2F52A 4O1NA 2KRUA 4H13C 2BDOA 4DU9A 1HFGA 1SYDA 1T5XD 1U4LA 2F0UA 4DF7A 1PJSA 3ERSX 3MMPA 4NSRA 3A5ZB 4DV0Q 4FXKC 3SAUA 4CGYB 4A3CG 4YY3L 2QILA 3C9PA 4DR2M 2DNEA 1MGSA 4RCNA 4AKHA 1KTKA 4KY5A 5KNCA 3NBXX 4A3KB 1HNWM 4A3VB 4KN4C 4Q7JA 1NMGA 5IP7G 4MH0E 3TWLA 1RODA 3C3DA 3GO5A 5ELEA 1QG7A 3B7NA 2IL8A 4TUWA 3FPUB 1YSYA 2L0CA 4I5SA 1IBLQ 1Q3BA 2VW9A 5FSWA 2IW3A 3LVVA 2B63G 1IQPA 3C1FA 1E2ZA 2QA4A 2NN6G 2Y0QA 4DV5M 2DWNA 5FO9B 4OU7A 4DR4M 2E2IH 4KN7C 1Z6TA 1VCIA 2G9HD 2EIFA 3KJOA 4GNXA 3HOZB 4U673 4JBJA 3DHQA 1SXJB 2LKVA 1LTAD 4RF0A 3TZDA 5JJLA 4X64M 3HOWG 2HDLA 4JBWA 2R7ZB 1TR5A 3K7AH 4DV3M 1JB3A 5C3EG 4DR2Q 1D2NA 3W1BA 4RFBA 3GLGA 2KZUA 1CUKA 1DCZA 1MN3A 1EYDA 1GKHA 1U9RA 1WYDA 3ZYYX 1QAQA 4N9TA 5EPJA 4Q5VA 3FRIA 4BA1I 3B7QA 5GADC 4XQJA 3SEBA 1EY9A 1O78A 4C2MH 2I7NA 2IHFA 4HR7B 4OWWB 2KHHA 2EYHA 1IL2A 2EQSA 5FJ8G 1VQNA 3GPYA 2QZ4A 3NBHB 3AV0A 1YNJC 3M4OB 3TBIB 1XHBA 2B2TA 3BYYB 4Z8XA 1PTOD 4R1JA 4TQUS 1LV7A 3MK6A 4RGNA 4I7AA 5ELNA 4LJ4A 5JI2E 2A6HD 3E4RA 2GNOA 1N78A 1YNNC 1Y1WG 2CH4W 1ZYRC 3H3VC 3T15A 4DUYQ 5FLXS 5FJ8H 3I3CA 4GKJM 1OIPA 1GD7A 3LX0A 1DGGA 1WTXA 3BJUA 1V1QA 2VY3A 3DEPA 4A3FH 1XNRQ 4BY7B 3Q22A 2CW0D 3E3XA 3MJ5A 1TKWB 1CQVA 2ZTEA 4LUOA 1XX8A 1S5ED 3S1RB 2WAQG 3A0JA 2ALYB 3DUZA 1MBYA 1HFNA 3LW5F 4C3HH 3EA6A 4EX5A 4QCLA 1QQWA 2C5RA 1HCZA 1CHPD 3MFYA 5M5WB 2DENA 2AKWB 2L4NA 4QIWE 4K2LA 2O01F 3HOUB 4DR5L 3AFPA 2FFJA 1RHPA 1U0LA 4LY6A 4BXXH 2EOTA 4IO9A 2PYKA 2F0MA 4C56C 3UK6A 5FLXc 4OVZB 1VG5A 4DUZQ 4V0BA 2BCOA 4XYQA 1Y8OB 2GVAA 3HOWB 3HHXA 2QNJA 2EXZA 2J7NA 2G3QA 3HU1A 3GLFA 3H4MA 4LCBA 1KRSA 1DGHA 4LF4L 2UUBQ 4JW0A 2NQ8C 1TIID 4C3JG 3TWMA 1WTHA 2HIXA 3AEVA 2DAIA 3AJIB 4KODA 2G5GX 5JJKA 2A68C 3T51B 5LMUL 3I4MH 1ZXTA 3JAME 3I4NG 4DN4M 3BS1A 1VQDA 2YQZA 5EKKA 3W0LB 1JR3D 2KW0A 2UUBL 1Q39A 1XMOM 1DOLA 4HIMA 1K28A 5FKAC 3PIPA 2QCPX 1FGUA 2NZHA 4RHSA 4RF1A 1V92A 3I72A 1G59A 4WJWA 3U6SA 2XTIA 5D3DA 1EIJA 3NK9A 4P71A 4DAMA 2CWBA 4WURA 2X69A 1PHJA 2XIWA 1D7QA 1ENAA 1LACA 3DXJC 2IY5B 1BF4A 5FO8B 2WINB 4JXJA 2M9VA 3U61A 1G8PA 3SAVA 1EQVA 3SE0A 3HEJA 1Y1VG 1TT2A 3SAWA 2F0IA 4OIJA 4YHHM 4MGHA 5F2DA 1SDFA 4R8IA 3O13A 1VQPA 4I81A 4L8RC 2F0TA 1O7YA 2DZOB 5IT9S 1EIGA 2WSCF 2Z4HA 1QANA 1HT2E 2XEPA 3CF5A 4LF6M 3KOYE 5M9OA 4FF3A 3BXWA 1D6EC 3PNVA 3DWPA 3LQQA 2A8VA 4A3LH 5C5MA 2I07B 5CV4A 3KK7A 4P72A 2FINB 2Q2UA 3SK4A 2M2LA 3GRRA 3UDIA 4KMUC 2F0JA 3J80L 3HOXH 2JEAI 3FVQA 3GTGB 2MH8A 1BBWA 1E1TA 1KDAA 5DNYA 2VNUD 1NV8A 2QENA 2E74C 1SNCA 2MFIA 5JOBA 4JI6L 4AYBG 2E2HB 2OQKA 5GROA 4BY1B 4RH6A 3RD4A 3CXCA 3HOUH 1ZMWA 1B9NA 3PUXA 5KPRA 4PDIA 4IBBA 3GTLB 2ZTCA 3NWTA 4RAUC 1S5CD 2P5ZX 4DR6M 3ILKA 4YWLA 4OGQC 1I6HB 2DZLA 4X64L 1N34Q 1R6BX 1PJIA 4A3JG 3PO2H 4DV1M 1IZ6A 4WORA 1PA6A 1W5SA 4U68A 4Y52H 1L0WA 3HKPA 3WDNA 5I9OA 3IFTA 4QQBX 3KOZE 4XTCS 3TREA 3Q24A 1KNEA 4F8MA 4G4RA 5I4DA 2H1EA 3S17H 2XZFA 3D4DA 5CORA 4KY6A 4P74A 1EY5A 1LYLA 3W2DA 1PLFA 2LVPC 1EU4A 2CHBD 4LFBL 2AHMA 1Z9FA 1N33L 2O25A 2JA9A 3FUUA 1VF7A 2R6FA 1YNND 2NVTH 3J81c 3R2TA 3H91A 1EWCA 1Y8PB 5JAVA 2KEEA 2BNKA 3U6LA 4KI0A 2E76C 1PGYA 4DUZL 1YI2A 1DO0A 1BCPB 3KF8B 4PZ7A 3L26A 1EEFD 4ABNA 1S72A 3GTKH 2D62A 2XVSA 1J5EL 1F77A 4A3FB 4BY7H 5EQ0A 1QE6A 3B74A 2YYZA 4BBRG 1Q46A 5I6YA 1F2ZA 3K9PA 2QEJC 4GIPA 3ER0A 5CV9A 4NXNM 4LW1A 5EPKA 2K33A 1XPRA 2Z1CA 4DNRB 5E26A 3T1HM 3TSSA 2E5LL 3I4VA 1QUQA 2HDMA 4L5TA 4C3HB 2JJQA 2NN6H 2DVWB 1CKOA 3EROA 3A45A 4XIGS 3SYKA 2HQLA 4WW0A 5IT9L 3UDXA 4QNRA 4OO1G 4R3DA 4AQYQ 3FKEA 4DR7Q 1G3IA 5DLQE 3CF2A 4GNXB 3HOWH 4ODGA 2BJWA 2OO9A 1B1ZA 4IUTA 1PYWD 4FF1A 3F2CA 1A5TA 3OWEB 5EP1A 2Q2IA 4O2DA 4DK3C 1K8GA 1XYIA 1TWFB 2P5TA 2ZXRA 4UP7A 1QILA 2KECA 3BYTB 3SBJA 4GOPB 1PZKD 1G51A 4DAYB 2ATWA 2DAKA 4ZCKA 2F5SA 1C8CA 3V2TA 1IBML 4KJNA 3FUWA 4X65L 2CFMA 3HKZB 3N6RA 4LAAA 3R2IA 2LY7A 4IOAA 2B2YC 3FYDA 4CIZA 3EQLC 1N33M 4DK6C 3BDCA 1WTQA 2X49A 4XT3B 5C0XJ 3S17B 2CCZA 5C4XG 2JP7A 1ZEQX 3I8ZA 4A3LG 1N36Q 1VF5C 1STNA 4P2CB 3T16A 1OO9B 1I3QB 1XNQQ 1HR0L 3FD9A 1D5ZC 3FKIH 2MGSA 1OXUA 3K2LA 4DV6M 2XH9A 2DY8A 3M3YB 1KXLA 1BVSA 3K80C 3M4OH 5M5YB 3J80c 1LT5D 5IGFA 8CATA 3KDSE 1UNSA 3L9AX 3TQYA 4DV3L 2FOIC 1C4QA 3U61B 1N36M 5IYDG 4OX9Q 4K8JA 2RGHA 2QBYB 3OSOA 2Y0SE 3A8KE 3PVSA 2MJ5B 1HXYD 5C4XH 4BBSG 3K8AA 3IHPA 2Z4SA 4C2MB 2V4DA 1JWMD 1N34L 3T1YM 1HNXM 1NMFA 2R7ZG 4NXNL 3RMHA 3W5OA 1WCMB 2LVQD 2PQAA 1CA5A 1XNRL 2M00A 1S40A 4BBSB 4KHPL 4XQQA 1JT8A 4LF7L 5C4JB 1XPOA 1Q7YC 3BZKA 4DUYL 4KO8A 5KPZA 4IUPA 5JVH3 2CVRA 2RA4A 4IZ8A 5BN3A 5IP9H 1GVNA 5AJ3Q 4IFDH 3KBGA 1VQCA 2JEBI 3S2HB 1GL7A 4JN6A 1F9PA 2O4XA 3T1HQ 4DV4Q 1ESFA 1D2BA 3BZDB 2L6OA 2JA8H 1I6HH 1X55A 1BDOA 4NRWA 4J8QA 3F92A 4MM3B 5C3WA 2F0EA 2WSFF 4NXML 4B3RL 1HA6A 3A74A 4OO1H 1F9RA 1EFID 1PTOC 2H4OA 1PH9A 5IY0A 5IIFA 4DAYA 1MX0A 1B3QA 1DO2A 1IBLM 1HPCA 1K8MA 3PUZA 2GA4B 4ILWA 1EWHA 4PZ6A 3NELA 3GQ4A 3TP8A 4X66M 5EKLA 4WFN3 1NAPA 3I4MB 1HNZL 1F9QA 4JI0L 1VQ4A 2UUBM 1VQJA 2R92B 1GUWA 3JAMS 1GOZA 2CW0C 5FLMH 4QF4A 1X3PA 1FR3A 1STYA 2Z4RA 2DUDA 2RVLA 2F4VM 4JI4L 3FTEA 1DGSA 1V1OA 4GS3A 1EY7A 4LJ5A 2CV1A 2PW5A 2CE7A 2F0GA 1HNZQ 1GO5A 4N8FA 3QO2A 4G7ZC 5IE8A 1ZV1A 4HSVA 2B29A 4LUZA 1N34M 3GLGB 2DXIA 1BCPD 1UE7A 4R4QA 1L2FA 1SRUA 1N32Q 1HUNA 4K8IA 2RGOA 4NPSA 1EFWA 3VA7A 1NVMA 1IYUA 5EXXA 1SSOA 3LWUA 2I5HA 2VQEQ 3BG3A 1GJTA 2D7HA 5C3EH 5JI3E 5KPTA 4X3KA 2CUZA 3PUWA 2J7OA 4IJHA 4PQXA 2FMCA 2LHGA 1Z6HA 4ZAIA 3E6ZX 1S5BD 2HHHM 1KC8C 3C3LA 2CWPA 2SEBD 1Z47A 3SHFA 3OMGA 2QKIC 4B3ML 2LVAA 3H94A 3VA5A 4A93G 4DK1A 2XNAC 1OAIA 2F4VQ 2YV5A 3HZJA 4GH9A 1T6OA 4A76A 3KVWA 1SXJD 2ASBA 3S2HH 2ZJRA 1Q86C 4RGMA 2X8AA 3HOVG 1DGHB 1HQMC 4C1NI 1XC8A 1GO3E 4J6HA 1FNWA 4B3MQ 4KHPM 1MIUA 3I4NH 3RZDB 3GLIB 1WXQA 4DR7M 3HU2A 1I50B 1U4PA 1ZKOA 1RJTA 2X6GA 2D0PA 2WP8J 4RKUF 4XK8F 2EYOA 1PH6A 4PCZA 4APVA 1VS0A 1BOSA 2B3GA 1JC7A 1GVPA 4LF6Q 1GUNA 4GC9A 3R9XB 3E46A 3CP0A 1TXYA 4XBOA 2C9OA 4X64Q 4B7FA 1WJ7A 3GTLH 2AQ1B 1J8IA 4MHEA 2CHQA 2XGNA 5C44H 2YTVA 1KD1C 4Y7NB 3TWKA 2KNVA 2FMMA 4WRDA 4R7GA 4LFBM 3CRLC 1LTTD 2K5NA 1NR2A 1SMXA 1HQRD 4YCWA 2F0LA 1IXRC 4Z6YA 3MTSA 4QOSA 4YWKA 4B9XA 2B2VA 2NVTB 2SDFA 4AYBE 3FTCA 1U4MA 1V34A 4B3RQ 5KNDA 3I4LA 4ZPXA 1J5EM 3MHBA 3PNYA 1VDLA 3FUXA 2G9DA 3ND9A 4JG2A 1PH5A 2ZTDA 4LF7Q 1Q12A 1MSGA 1GLNA 4HCEA
chains in the Genus database with same CATH topology
4A3JB 1PFMA 1SNOA 3I90A 3E5SA 4PMBA 4QMGA 4W5WA 1HR0M 5HURA 4RGOS 2KHSA 4AKGA 2C99A 3GTPB 3I73A 4FWHA 1HT1E 4HMJA 4GHAA 1PJJA 4M8AA 5ITRA 1K8OA 2B2VC 1E32A 1XNQM 3GP1A 5E4WC 1TS2A 5C4HA 3HG9A 2KOLA 2C9CA 2A6ED 1V1PA 1RCVD 3A56A 5ELCA 1OXTA 2CHGA 1QJOA 1OXVA 3SMPA 1HQCA 4JYAM 1KFVA 4AZFA 1S5DD 4MGKE 3K8ZA 5KQ8A 3KP1E 1E0BA 3PUYA 1IKMA 1A2UA 3K92A 2C5CA 1B2TA 2AQ2B 1PFNA 3AKZA 1OXSC 2PZUA 3Q23A 3QG1A 1TGUA 5A35A 5KQDA 3MAQA 2CQAA 3NWSA 1B4OA 1S4ZA 3BVZA 3QIAA 2JE6I 1JQJC 2XN9C 3ONAB 1EY6A 3L7ZC 3EIHA 3NTKA 1PTOH 5BN5A 2RBMA 4OL7A 5JEAJ 1NSNS 2UXDM 2H1RA 1X32A 1WD1A 3KW6A 2QP9X 2IJ0A 2YFQA 2XFSA 4FWDA 1YUBA 3FEWX 1MI2A 5I6WA 2E2JB 2K32A 2KA6B 2J7ZA 4DAVA 1VMPA 4LJZC 1NSFA 4MN3A 3V96A 4FO2A 4XT1B 5DEHA 2IPKD 4G6ZA 3VDUA 5C4XB 4HL4A 3WHKA 3NPPA 1NY5A 5CBEE 3NBIA 2BOSA 1ZQ9A 3SC3A 1ONLA 1A2TA 2KCCA 2KZSA 1DOKA 1TVXA 1KAAA 2F5QA 3D31A 3Q0AA 4FP5D 4X3TA 2O5IC 2EZVA 4EQPA 2IX3A 1DM0B 1M4VA 3SK8A 1Z5BA 2L9HA 2DHRA 4ME5A 1TWHB 4LGYA 3GP7A 4DUYM 3AB9A 3R93A 1K83B 2JA5B 4PDGA 1SYFA 1B3AA 1KLUD 3VR2A 1FNNA 4CJ0B 3KOWE 3KSJA 4K0KM 3TL4X 3UI2A 1HHVA 1TS4A 3U5ZA 3HGBA 5TSSA 3SK6A 1SJHD 1TU2B 3CHBD 1PMRA 1PDQA 1TS5A 4FCVA 2Z8LA 1FD7D 5IGDA 1RD9D 3BVMA 4I4LA 3I91A 2R45A 3SXHA 3KF8A 1HNZM 5KO3A 5C3EB 1TWCB 1PZJD 2KRKA 2EY1A 4KHVA 2UUCM 4RNAA 1VDDA 3C2PA 5IGBA 2B2YA 3BOSA 5DNFA 3OOCA 4B3RM 2RSOA 4LRSA 2JXMB 4ZKBB 2R4EA 3UJNA 1NY6A 2F3VA 1TH3A 1AP0A 5CV8A 1CT1D 3TDQA 2Y21A 5FTLA 3L27A 2Z3XA 4MGYE 3GLHB 1PM5A 5DM63 2K6AA 2YNMD 3OPOA 1EZ6A 3DA1A 3IG8A 1JR3A 3J7AF 1Y69U 1CZGA 1SXJC 2WAQB 5E4XA 1O7ZA 5G3LD 4L4UA 5ITYA 2Z4IA 3J7AV 1Y8NB 2SNSA 2OF1A 4DR1M 5C44B 3KS4A 3JR4A 3FTFA 5EJCA 1WD0A 1LTID 1IYVA 1O80A 1SYBA 2QPAA 1Q3LA 2DY7A 2F0KA 2Y0TA 4R9WA 3JR5A 4K5VA 2TMPA 2HL7A 3N52A 3T56B 4IQZA 2QDBA 3U6DA 2WKCA 3NXWA 4RCOA 1JORA 1EL0A 3A7LA 3DWAA 1PRTC 4HN7A 3S9WA 4TRDA 2EYMA 1GKIA 3OTOM 5JPNC 2K5QA 5KGUA 4JK1C 1N32M 1SNPA 2ZAOA 3SATA 4CJ1B 5COYA 4C3IG 3G6JB 1DD2A 4PV1C 2A73B 2QF7A 2Y0SB 1IY0A 4IBGA 1SJED 4L78A 1NCVA 1ESRA 2PW7A 3HJSA 1L2BA 2KXEA 2JSOA 5JEAH 1C48A 3PV0A 1HA5A 3S1QB 2K1BA 4AYBB 3EJIA 5T1IA 1V43A 4IFDJ 3FDTA 1ENFA 4RHRA 3K1JA 3QAUA 2L5TA 5E1FA 3VYSA 2EJGC 3KS8A 1GJXA 2EPBA 5AFWA 1KDBA 3TP7A 4FW9A 2Y20A 3A42A 4LJAA 2ID0A 1PRTB 2CFOA 4QNMA 1A15A 3THGA 3AL0C 1F2LA 2NTTA 1CHQD 4DUZM 2A68D 1E94E 4MGZE 1NNJA 4JI4M 3S1MB 1B50A 2F0OA 1H9KA 1LABA 4F87A 2D9UA 4KKSA 3HHWA 5ITQA 4LMQD 2N88A 4LJ7A 3J7YW 1SAPA 4BS9A 1STAA 1RTOA 2EE1A 2DZNB 1E9SA 2B2WC 1ILPA 3OHXC 1JWSD 4G4QA 2QBYA 3HJ8A 2J0TD 3DMUA 5EBDA 3UZUA 2JYOA 4BB9A 1D5XC 4LF4M 1QAOA 2FHTA 4K5XA 3AOGA 1QCBD 2F0VA 4TSSA 2L7HA 3GD7A 2A74C 4QB4A 1PRTF 2RDFA 5H37D 4Z9CB 3LNNA 3H0GB 3P7JA 5CMDA 2RKSA 1LV9A 4RGTA 5M3MB 5KYLA 4AW4A 1BNZA 3NQIA 4ID6A 4A3EB 2L11A 5FOBB 3QB3A 3K58A 2VQEM 5KNBA 3U6MA 1QNUA 4IJEA 2KVMA 3J80E 1DXMA 2NN6I 3OWFA 4O42A 4D80A 2PMZB 2DWMA 4A3GB 3A46A 4ZUJA 4GC5A 4FCWA 3C58A 4FXDA 4ZUIA 4BWGB 2J4XA 2MJ8A 5C5LA 4AKIA 1XWEA 3SVMA 1Q1BA 2IT1A 4FNFA 4IURA 1WTWA 4M9XA 1DGFA 2CEAA 4OVZA 3GPXA 2EYFA 3AOEC 5LMNM 1DOMA 1I4GA 1IXZA 1NHGC 3M85A 5GKNA 1PFBA 1G6ZA 2EY5A 5EP3A 5KRUA 3GTMB 2R46A 5CV5A 1AEXA 2JA6B 2HQEA 3K5LA 2B2TC 4II7A 3FUVA 4CKEA 3J81L 4DV0M 2MP1A 4ZKCB 1BUVT 3IL8A 2WIIB 5NUCA 4NP5A 1IBKM 2MUYA 3GLIA 3L29A 3TPZA 1R9TB 4FYDA 3RE8A 2E2DC 2YU9B 1FYCA 1LT3D 2JA8B 3SASA 2L55A 4N9PA 4IUNA 1TQOA 4PD2A 4PMCA 4AI6A 4KKUA 1QZMA 3HRZC 3Q8XA 1JOKA 3V05A 4M0WA 5E3FA 1IW7D 3AFHA 5J22A 3P1HA 5I9PA 1X3QA 3IG5A 2FJ2A 1CM9A 1Y1WB 1TY2A 3S2DB 4HAEA 2E75C 1F2MA 3PO3B 2IWHA 3GO8A 3T53B 1CZWA 1A3VA 2VXWA 4FD2A 3ZCBB 2BE5C 4NMZA 5ISRA 1H9JA 3RZOB 1V8QA 2PZWA 3ZH9B 4NSOB 1Z5CA 1CI3M 3GV3A 4EVOA 3P75A 4IBEA 4KY7A 3CTWB 3MA2B 2M5ZA 4AG5A 3K59A 5ITXE 1E2VA 1PRTD 3RGPA 4HTHA 1ML0D 3NBHA 2F5NA 1UUPA 1II3A 2E2HB 4F88A 4NKLA 3H09A 2VB2X 1FGBD 3KLSA 4LJ8A 4KJOA 3BDOA 1JCKB 4LG2A 1IHZA 3DOAA 1SBBB 1QVRA 3RGSA 1XXGA 1XXHA 1EQTA 3FPPA 5C3XA 1R2YA 2EA0A 1K3WA 4LFAM 5EXTA 1OXXK 5K36H 4ZYSA 4A93B 4XDXA 5C1BA 1L0XB 2ZT9C 2L7IA 3K5OA 3QJYA 5K36G 4IJFA 3G7LA 3GTJB 4PMWA 3LWEA 1R4QB 1KNAA 2B2UC 4K6LA 4YIJA 3GPPA 3KBXA 1IY1A 1CA6A 1EYCA 3PMFA 1I94M 3CKIB 2F0DA 2LWXA 4V190 3GLFB 2K04A 1QWYA 3MXUA 4LJ6A 2B2WA 5IOCA 5D14A 3CF6E 3GPUA 3TN2A 3S16B 4IUUA 2QCUA 2X4AA 5CR3A 2OPFA 3L3OC 5EGTA 1ZAEA 2R18A 5FTMA 5M5XB 3VKGA 4NW2A 2NTSA 5CV6A 4KD3A 2FFKB 3A98B 1O7LA 3MXNA 2AWNA 4IUVA 1GL6A 2CV0A 1BCPC 4FF2A 4LF8M 3U6CA 1V1PB 4B7GA 4IBDA 3HOYB 3AU7A 3B9PA 5JPMC 2NVYB 3I4YA 4B3SM 2NVQB 4JI2M 2K01A 5IT9E 1SMYD 3VR6A 1D5MC 5FTKA 3HJQA 4GMQA 2I7PA 5EP2A 1SNDA 4EQNA 2OEOA 2ZXOA 3TMEA 2XLJA 3S15B 3WHLA 4DXGA 2F0FA 1FNVA 1UEAB 2PCFB 1EZ8A 1AZQA 3SHGB 3PIP3 2D5DA 2JA2A 3GV6A 3CF0A 5EP4A 4NL4H 1YE9A 1BQQT 1ENCA 4H7BA 2BE5D 3T13A 1SE3A 2MHVA 2A5YB 3URYA 1Z5AA 2L09A 5CGKA 3FYCA 3MXPA 1D1KA 5I2YA 2PQEA 1FNUA 1AN8A 1ZYRD 4A3MB 2XSCA 3R8BA 5A2QE 4ZLTF 3JAML 2K47A 4HEDA 3OMCA 4PT5A 3NWLA 1I4XA 1IN4A 1XNRM 3M6AA 1R4PB 5KYIA 5C6AA 2EYLA 1QYRA 2K5WA 2XWJB 3QOJA 3DWQA 2C98A 1VDZA 2RKOA 1G4AE 1RKNA 1PXUA 1JE4A 5FK9C 4FCTA 5EJWA 2UXCM 5JEAG 1W6JA 2BA1A 5EXPA 2RQXA 5EBCA 3EIEA 3PFIA 4OW0A 4X3UA 3NTHA 4L8JA 2LFNA 3KLSX 3ZC7B 4OHJA 2UUAM 1JICA 3KSXA 1H9MA 3WOFA 4CJ2C 1W6KA 4RWSC 4H44C 2HCBA 2R65A 2CV2A 5BN4A 4IBCA 2A6EC 2EY6A 3NQTA 4IBJA 1HTPA 4EIWA 1STHA 4DGZA 4C3JB 1IM2A 3MC0B 5CYUA 1SFOB 5EXSA 1JQYD 2O5RA 4LRTA 5CBAE 1IKLA 4MB7A 3CQZB 2A5HA 5J1ZA 2Q8TA 2ERCA 1IW7C 2TSSA 2B39A 3DZDA 1SXTA 4ZRZA 3RFWA 1AFPA 1SXJA 4H0LC 2NUCA 1XTCD 4NRVA 2LS01 2A69D 1RTNA 4IIWA 3QOLA 1SXJE 1STEA 1OFIA 5A2QL 3HP3A 3GRVA 3GTKB 1GHKA 1BR9A 3U6QA 4FXGC 4IFDG 1LO5D 2E5LM 4CBVA 1HUMA 3VR5A 2EJFC 3VR4A 2ZBKB 4K14A 3NHHA 3KLRA 3GRYA 1WTRA 4BA2I 3VLFB 4X65M 4P16A 1WVLA 1MSHA 2R6GA 3T4AC 4LJ9A 1LLRD 3KFUG 4L15A 2IX0A 2EUCA 3S1NB 3R3OA 4D81A 5IREB 1PTOF 1UAPA 4GKKM 5ELDA 2OQ4A 3ITPA 3HS0C 4JI7M 3P20A 2Z7JA 2F4IA 5LMUM 1IBMM 4DXFA 3ERQA 4HMIA 1WTPA 3HOXB 3GQ5A 1GUOA 1DGBA 1A3UA 2DN8A 4M9ZA 4CHTB 1SE4A 2M60A 3U60B 1Z7TA 3CU7A 2EO2A 4OX9M 3SK5A 1X37A 4B3TM 2LXEA 3L28A 2LNHC 4ITQA 2WKDA 2HCCA 2V1UA 4C3IB 3J80S 5ELBA 3HGIA 5IWAM 4LGMA 1STGA 1DZ1A 3M0EA 5CV7A 5IODA 1PTOB 4DV7M 1EYAA 2KCNA 4R8NA 1G291 4AQYM 4S3SA 5ITTA 5EPLA 1NUCA 2DWLA 2KA7A 1IY2A 4OO1I 4DFAA 3SR1A 2B8FA 3HHZA 2K5DA 1QOHA 1EY8A 1G8ZD 1LT6D 2L12A 3U6PA 3MEHA 1ICWA 4F7XA 3T38A 3J7BA 3NSWA 2XF3A 1KDCA 5D65A 4G4OA 1I4RA 3KP0E 1TWAB 1C1KA 2D2CC 3SHLA 2N55A 2XSZD 3A7AB 1I4PA 2R62A 1JOOA 2NYZD 1IXSB 1SMYC 4ZQ3A 1TWGB 3R8FA 3U6OA 2MPMA 1MU5A 1D1IA 1BBXC 1BO0A 1NJGA 2RDGA 2R93B 3W0FA 4DAPA 5F3WA 2OT2A 1UM8A 3IFDA 3A55A 5M3FB 4I65A 1CFMA 2W82A 2YR0A 3NUCA 3PIO3 4K2KA 1K3XA 4PNYA 2F0WA 1OFHA 4G57A 4DV4M 1XXHB 5EQTA 2G8LA 3SMSA 4JI3M 4LZZA 1E2WA 4A3DB 1ILQA 4A3IB 2K28A 5IGCA 1QB5D 3VK8A 3MVVA 2I46A 4RKBA 3HOVB 3NTIA 2X6LA 3VDPA 5FLXE 3K6OA 3QWNA 3AOEA 1LT4D 2CHVA 1PZID 4QIWB 4M9SA 2ICEC 3GQ3A 4IUQA 3KUPA 4I7ZC 2ZM6M 3E0JA 3M4YA 2SNMA 2NBFA 1TY0A 3I51A 1SNMA 2BDNA 2NB0A 4AG6A 1JWUD 4KTAA 4X3SA 3X3MA 1AW7A 4NDXA 4D82A 1QAMA 4IBIA 1J09A 5JJZA 4ZK9B 1KLGD 4M1UB 3HWSA 3ND8A 1STBA 5ELFA 4LF7M 3NP8A 1SEBD 4NOOB 4HSPA 3D6CA 3A8JE 3X3NA 1CQFA 1HTLD 3U9SA 1B9MA 4XGIA 2EYPA 4GHLA 2KJXA 1EOTA 2F0QA 5JVG3 3EVQA 1JR0D 4QHTA 2F0PA 2LMCB 4L6TB 2EVBA 3U60A 2EY2A 4J1MA 2V6ZM 1H9RA 4KKTA 1IN5A 1RF2D 5C0XG 5E6JA 4DV2M 4XYOA 4GITA 3D4RA 1BXTA 1S5FD 1IL8A 3TQSA 1Z59A 2EYJA 5IGEA 1TH4A 5C4ZA 4XXEA 3S14B 3H6MA 3U9OA 4JI0M 4KV6A 2FNAA 4C3HG 4YY3M 1S3SA 3FKIB 1TH2A 3L2AA 1OJLA 1VMCA 3C1EA 3HHYA 3M7NA 3DM1A 2O2LD 1NHWC 3TP5A 1IN6A 4L16A 1HQYE 1TDZA 2D7GA 1I4QA 2PPBC 3OIQA 3CRKC 4KD4A 2UU9M 4MGIE 2L1BA 3BVGA 1M8AA 3GRUA 3A54A 3MXGA 7CATA 3J81E 3IAYA 5ITXA 1MD2D 3L25A 1SYGA 4LF9M 2A69C 5HGTA 5DM73 1B53A 3OIPA 1G2TA 3VK7A 3FMCA 3I70A 3M7GA 2K03A 2SOBA 5KEEA 3SDZA 1H9SA 2VIIA 2AWOA 1GUTA 2VQFM 4BLCA 4CISA 3RUZA 1H6UA 3VYRA 4FF4A 2BA0A 2XRQD 3MHVC 2XFTA 1LTSD 2OXPA 1Q8IA 3MWYW 2B63B 2E2IB 1DJRD 4DK0A 3KXEC 2KEDA 5FLXL 1N77A 4QUCA 4B9WA 3I4NB 3D8LA 4E6IA 3MZ5A 3LVWA 3LMMA 1Q3CA 5BR8M 1QNKA 4B08A 1J9OA 2ZXPA 5G3LF 4ULLA 1N75A 4DA2A 2A6HC 3IKJA 5DYGA 3SFZA 2JP1A 3OW7A 3FRPB 5C18A 2JA7B 2VB3X 5FTJA 4BBAA 4DNTB 2NZ1D 2XSZA 1E9RA 3J81S 2UXBM 4L63B 4UAIA 1F9SA 3NE5B 2IX1A 4KHZA 4OIKA 2XRSD 3F2UA 1TDHA 1J7KA 2F1MA 3GQBA 3E9SA 2Q8RE 4CKBA 2HUGA 4IBFA 1Q1EA 4EGVA 4M0DA 3VFDA 3D8BA 3SARA 1YNJD 5I2XA 4JV5M 2VUMB 1GHJA 1I4HA 1WTVA 3K5MA 3A8IE 3TZUA 2F5PA 5LL6X 2R4JA 1DONA 2NWGA 4EQOA 3J7AS 5KIXA 1RDPD 5T1GA 1F2YA 4B3MM 5K5PA 2KUMA 5ITUA 3DEOA 4S12A 2K05A 1L0YB 3D6WA 2EDGA 4K6DA 3VKHA 2F0HA 3LQRA 3K57A 4C1NK 4IFDI 3FUTA 3TE6A 2Q8IB 3D4WA 4B7HA 4FVMA 3GTQB 1XWIA 1BCPF 1XMQM 1R2ZA 2B8GA 3RLFA 4GZYC 2PNRC 3U5ZB 2HCIA 2V1CA 2PZTA 1LTRD 2KQ3A 1KSFX 2AQ3B 4LZJA 1EY0A 3C46A 1DYQA 3VYTA 1ET6A 4JI8M 1EE8A 3VR3A 1G2SA 3UMMA 1B44D 3U6EA 4G7HC 1EIHA 1I6VC 2WV6D 2XZUA 1SNQA 3D3RA 5EKIA 3K5NA 4JI5M 3DFZA 4G4KA 4A3BB 4DR5M 3WOEA 3K7AB 2FE8A 4NXMM 3Q6SA 1CTMA 5C0XI 4GRIA 1A3TA 5LL6S 5D3IB 2Q2EB 3W3AA 5LHY1 4BBRB 4K5WA 2RSNA 3MFGA 4Q0FA 1KABA 1K82A 1JOQA 1TS3A 4QOZC 4G7OC 3GLHA 4CKCA 1T3TA 2F0NA 5A2QS 1SE2A 4TKOB 5J39A 1L2CA 3J2PB 4IBKA 4KLNA 3VYUA 1NJFA 2KEBA 1H9SB 1G41A 1WTOA 2ENBA 1ET9A 1L2DA 4IALA 4LF5M 4MIUA 1L8QA 3TP6A 5DAUA 4DR3M 2ZANA 1LTBD 1LTGD 1L1ZA 4QHSA 2F3WA 3K0YA 1NNUC 2ICIA 2DWZB 4IN3A 4HLQA 1NR4A 2B2UA 1AZPA 4HCSA 3FTDA 4REZA 4JI6M 1CK1A 2R61A 5IZ7D 4LFCM 2NVXB 3GTOB 5C0XH 4KK7A 3J27B 3KOXE 4I8OA 4G4NA 4LK1C 2AUKA 4FWGA 2ZAMA 1EEID 3PO2B 1Y1VB 1FJGM 2EJMA 2BJVA 2F5OA 3QWLA 1GUGA 4X62M 1L1TA 3PXGA 1ORYB 1IN7A 1I4WA 3BDLA 2DNCA 1Q90A 2R3ZA 2WB1B 2AUJD 1A6XA 3EFXD 2HKJA 2O5JC 3PUVA 5CC4A 1EY4A 4UDUC 1SYEA 3D8GA 1EU3A 1IN8A 3AMUA 2D7EA 2WACA 1GUSA 2F0SA 1R7RA 3UGJA 1G91A 3HZXA 5BPVA 5FO7B 4RA8A 2RDHA 1U4RA 3HU3A 2PO4A 5DYIA 5IGGA 2C96A 2F03A 4JI1M 1GXDC 5FTNA 3SYLA 1T5EA 4RKLA 2LH0A 1HRJA 4QUFA 4XQNA 2XWBB 1KYIA 1SYCA 1W5TA 2K7VA 4O1NA 2KRUA 4H13C 2BDOA 4DU9A 1HFGA 1SYDA 1T5XD 2F0UA 1U4LA 4DF7A 4NSRA 4FXKC 3SAUA 4CGYB 2QILA 4DR2M 2DNEA 1MGSA 4RCNA 4AKHA 1KTKA 4KY5A 5KNCA 4A3KB 1HNWM 4A3VB 4KN4C 4MH0E 3TWLA 1RODA 3GO5A 5ELEA 2IL8A 1QG7A 4TUWA 3FPUB 1YSYA 2L0CA 4I5SA 1Q3BA 5FSWA 2IW3A 3LVVA 1IQPA 3C1FA 1E2ZA 2NN6G 2Y0QA 4DV5M 2DWNA 5FO9B 4OU7A 4DR4M 4KN7C 1Z6TA 1VCIA 2G9HD 3HOZB 4U673 3DHQA 1SXJB 2LKVA 1LTAD 4RF0A 3TZDA 4X64M 2HDLA 4JBWA 2R7ZB 1TR5A 4DV3M 1JB3A 1D2NA 4RFBA 3GLGA 2KZUA 1DCZA 1EYDA 3ZYYX 1U9RA 1QAQA 4N9TA 5EPJA 4Q5VA 4BA1I 4XQJA 3SEBA 1EY9A 1O78A 2I7NA 4HR7B 2EYHA 3GPYA 2QZ4A 3AV0A 1YNJC 3M4OB 3TBIB 1XHBA 2B2TA 3BYYB 4Z8XA 1PTOD 4TQUS 1LV7A 3MK6A 4RGNA 4LJ4A 5JI2E 2A6HD 3E4RA 1N78A 1YNNC 1ZYRC 3H3VC 3T15A 5FLXS 3I3CA 4GKJM 3LX0A 1DGGA 1WTXA 3DEPA 4BY7B 3Q22A 2CW0D 3MJ5A 1TKWB 1CQVA 1XX8A 1S5ED 3S1RB 3DUZA 1MBYA 1HFNA 4QCLA 3EA6A 1QQWA 2C5RA 1HCZA 1CHPD 3MFYA 5M5WB 2L4NA 4K2LA 3HOUB 2FFJA 1RHPA 4LY6A 2EOTA 2PYKA 2F0MA 4C56C 3UK6A 4OVZB 4V0BA 2BCOA 4XYQA 1Y8OB 3HOWB 3HHXA 2EXZA 2J7NA 3HU1A 3GLFA 3H4MA 4LCBA 1DGHA 2NQ8C 1TIID 4C3JG 3TWMA 3AJIB 4KODA 2G5GX 2A68C 3T51B 1ZXTA 3JAME 4DN4M 3BS1A 2YQZA 5EKKA 3W0LB 1JR3D 2KW0A 1Q39A 1XMOM 1DOLA 5FKAC 2QCPX 4RHSA 4RF1A 3I72A 1G59A 4WJWA 3U6SA 5D3DA 3NK9A 4WURA 2X69A 2XIWA 1ENAA 1LACA 3DXJC 1BF4A 5FO8B 2WINB 4JXJA 2M9VA 3U61A 1G8PA 3SAVA 1EQVA 3SE0A 3HEJA 1TT2A 3SAWA 2F0IA 4OIJA 4YHHM 4MGHA 5F2DA 1SDFA 4R8IA 3O13A 4I81A 4L8RC 2F0TA 1O7YA 2DZOB 5IT9S 1EIGA 2Z4HA 1QANA 1HT2E 2XEPA 4LF6M 3KOYE 5M9OA 4FF3A 1D6EC 3PNVA 3DWPA 3LQQA 5C5MA 2I07B 5CV4A 3KK7A 2FINB 3SK4A 2M2LA 3GRRA 4KMUC 2F0JA 3J80L 2JEAI 3GTGB 3FVQA 1KDAA 5DNYA 2VNUD 2QENA 2E74C 1SNCA 5JOBA 4BY1B 4RH6A 3RD4A 1B9NA 3PUXA 5KPRA 4PDIA 4IBBA 3GTLB 3NWTA 4RAUC 1S5CD 4DR6M 3ILKA 1I6HB 4OGQC 1R6BX 1PJIA 4DV1M 4WORA 1W5SA 4U68A 3HKPA 3WDNA 5I9OA 3IFTA 3KOZE 4XTCS 3Q24A 1KNEA 4F8MA 4G4RA 5I4DA 2H1EA 2XZFA 3D4DA 5CORA 4KY6A 1EY5A 3W2DA 1PLFA 1EU4A 2CHBD 2AHMA 3FUUA 1VF7A 1YNND 3R2TA 3H91A 1EWCA 1Y8PB 5JAVA 2KEEA 2BNKA 3U6LA 4KI0A 2E76C 1DO0A 1BCPB 3L26A 1EEFD 4ABNA 2D62A 2XVSA 1F77A 4A3FB 5EQ0A 1QE6A 2YYZA 5I6YA 1F2ZA 2QEJC 4GIPA 5CV9A 4NXNM 5EPKA 2K33A 2Z1CA 4DNRB 5E26A 3T1HM 3TSSA 3I4VA 2HDMA 4C3HB 2NN6H 2DVWB 3EROA 4XIGS 3A45A 3SYKA 4WW0A 5IT9L 4OO1G 4QNRA 4R3DA 3FKEA 1G3IA 3CF2A 4ODGA 2BJWA 1B1ZA 4IUTA 1PYWD 4FF1A 3OWEB 5EP1A 1XYIA 1TWFB 2P5TA 2ZXRA 1QILA 2KECA 3BYTB 3SBJA 1PZKD 2F5SA 1C8CA 3V2TA 4KJNA 3FUWA 3HKZB 3N6RA 4LAAA 3R2IA 2LY7A 2B2YC 3FYDA 3EQLC 1N33M 3BDCA 1WTQA 2X49A 4XT3B 5C0XJ 3S17B 1ZEQX 3I8ZA 1VF5C 1STNA 4P2CB 3T16A 1OO9B 1I3QB 3FD9A 1D5ZC 2MGSA 1OXUA 3K2LA 4DV6M 2XH9A 2DY8A 3M3YB 5M5YB 1LT5D 5IGFA 8CATA 3KDSE 1UNSA 3L9AX 2FOIC 1N36M 3U61B 1C4QA 4K8JA 2RGHA 2QBYB 3OSOA 3A8KE 3PVSA 1HXYD 2Z4SA 4C2MB 2V4DA 1JWMD 3T1YM 1HNXM 3RMHA 1WCMB 1CA5A 2M00A 4BBSB 4XQQA 5C4JB 4KO8A 5KPZA 4IUPA 5JVH3 2CVRA 2RA4A 4IZ8A 5BN3A 1GVNA 4IFDH 3KBGA 2JEBI 3S2HB 1GL7A 4JN6A 1F9PA 2O4XA 1ESFA 1D2BA 3BZDB 2L6OA 1BDOA 4NRWA 4J8QA 5C3WA 4MM3B 2F0EA 1HA6A 4OO1H 1F9RA 1EFID 1PTOC 2H4OA 5IIFA 4DAYA 1MX0A 1DO2A 1IBLM 1HPCA 1K8MA 3PUZA 2GA4B 4ILWA 1EWHA 3GQ4A 3TP8A 4X66M 5EKLA 4WFN3 1NAPA 3I4MB 1F9QA 1GUWA 2UUBM 2R92B 3JAMS 1GOZA 2CW0C 4QF4A 1X3PA 1FR3A 1STYA 2Z4RA 2RVLA 2F4VM 3FTEA 1V1OA 1EY7A 4LJ5A 2CV1A 2PW5A 2CE7A 2F0GA 3QO2A 4G7ZC 4HSVA 1N34M 3GLGB 2DXIA 1BCPD 1HUNA 4K8IA 2RGOA 3VA7A 1NVMA 1IYUA 5EXXA 1SSOA 3LWUA 3BG3A 2D7HA 5JI3E 5KPTA 4X3KA 2CUZA 3PUWA 2J7OA 4PQXA 4ZAIA 2FMCA 1Z6HA 3E6ZX 1S5BD 2HHHM 3C3LA 2SEBD 1Z47A 3SHFA 3OMGA 2QKIC 3H94A 3VA5A 4DK1A 2XNAC 4GH9A 3KVWA 1SXJD 4RGMA 2X8AA 1DGHB 1HQMC 4C1NI 1XC8A 4J6HA 1FNWA 4KHPM 3RZDB 3GLIB 1WXQA 4DR7M 3HU2A 1I50B 1U4PA 1ZKOA 1RJTA 2X6GA 2WP8J 2EYOA 4PCZA 1BOSA 1JC7A 1GUNA 4GC9A 3R9XB 4XBOA 2C9OA 4B7FA 2AQ1B 1J8IA 4MHEA 2CHQA 2XGNA 4Y7NB 3TWKA 2FMMA 4WRDA 4R7GA 4LFBM 3CRLC 1LTTD 1NR2A 1HQRD 2F0LA 1IXRC 4Z6YA 3MTSA 4QOSA 4B9XA 2B2VA 2NVTB 2SDFA 3FTCA 1U4MA 5KNDA 3I4LA 4ZPXA 1J5EM 3MHBA 3PNYA 2G9DA 3FUXA 3ND9A 1Q12A 1MSGA 1GLNA 4HCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHT B;  3NBI A;  4CGY B; 
#chains in the Genus database with same CATH topology
 4A3J B;  1PFM A;  1SNO A;  3E9H A;  3E5S A;  4DBG B;  3I90 A;  4PMB A;  4QMG A;  4W5W A;  2K75 A;  1HR0 M;  5HUR A;  4RGO S;  2KHS A;  2KCM A;  4AKG A;  2C99 A;  3GTP B;  3I73 A;  1NV9 A;  4FWH A;  3LCU A;  1HT1 E;  4YCV A;  3UE0 A;  4HMJ A;  4GHA A;  1PJJ A;  4M8A A;  5ITR A;  1K8O A;  5LMN L;  1PH2 A;  2B2V C;  1E32 A;  1XNQ M;  4PZ8 A;  3GP1 A;  5E4W C;  2Z8Y M;  1TS2 A;  2DAM A;  2KOL A;  3HG9 A;  5C4H A;  2C9C A;  2A6E D;  1V1P A;  1RCV D;  3A56 A;  3H0G G;  1OXT A;  5ELC A;  2CHG A;  1QJO A;  1OXV A;  3SMP A;  3LGJ A;  1Q8K A;  1HQC A;  4JYA M;  1KFV A;  4AZF A;  1S5D D;  4MGK E;  3K8Z A;  5KQ8 A;  3KP1 E;  1E0B A;  3PUY A;  1IKM A;  1A2U A;  3K92 A;  2GN5 A;  2C5C A;  4MNO A;  1K0S A;  1B2T A;  4DR7 L;  1G71 A;  2AQ2 B;  1PFN A;  3AKZ A;  1OXS C;  2L4E A;  2PZU A;  3Q23 A;  3QG1 A;  3S1Q H;  4JYA Q;  1TGU A;  5A35 A;  5KQD A;  3MAQ A;  1ASZ A;  2CQA A;  3NWS A;  1B4O A;  4LFC Q;  3RN5 A;  1S4Z A;  3JAM i;  1N8R C;  3BVZ A;  3QIA A;  2JE6 I;  5IWA L;  1JQJ C;  2G5D A;  2XN9 C;  1EY6 A;  3ONA B;  4C3I H;  4X62 Q;  3L7Z C;  3EIH A;  4GNX C;  3Q8D A;  3NTK A;  1T43 A;  1PTO H;  4JI8 L;  5BN5 A;  5HGQ A;  2RBM A;  4OL7 A;  5ELO A;  5JEA J;  1IBM Q;  1NSN S;  2UXD M;  4JOI C;  2H1R A;  1OTR A;  2FXQ A;  4X66 Q;  1X32 A;  4HJ8 A;  1XNQ L;  1HR0 Q;  1WD1 A;  4A93 H;  3KW6 A;  1QUS A;  2GQF A;  2QP9 X;  2IJ0 A;  2YFQ A;  1N36 L;  2XFS A;  4FWD A;  1YUB A;  3FEW X;  2HAK A;  1MI2 A;  1YEZ A;  4GOP A;  5I6W A;  2E2J B;  2K32 A;  4OEL B;  4LFA Q;  2EJS A;  1P16 A;  2KA6 B;  2JY7 A;  2J7Z A;  2UUA L;  1HZC A;  4DAV A;  1K0R A;  1VMP A;  4LJZ C;  1NSF A;  4MN3 A;  4BBS H;  3V96 A;  4FO2 A;  4XT1 B;  3CMA A;  5DEH A;  2IPK D;  4G6Z A;  3VDU A;  5C4X B;  3OW2 A;  2Z6B A;  1VQ7 A;  2RHS B;  1LTM A;  4HL4 A;  3WHK A;  3NPP A;  3CCE A;  3UDG A;  2YTX A;  1NY5 A;  3FKI G;  5CBE E;  3NBI A;  2BOS A;  2Z9H A;  1ZQ9 A;  3SC3 A;  3I04 M;  1ONL A;  3PSI A;  4GN4 B;  4UP8 A;  5C4J H;  1A2T A;  3QYE A;  3PGZ A;  2KCC A;  2KZS A;  1DOK A;  1TVX A;  4MZ9 A;  2OOB A;  1KAA A;  2F5Q A;  3D31 A;  1WIV A;  2DJG C;  3CPW A;  3Q0A A;  2N78 A;  4FP5 D;  3FP9 A;  4X3T A;  2O5I C;  2EZV A;  3G71 A;  4EQP A;  2IX3 A;  1DM0 B;  1XTD A;  2ZJP A;  4DV7 L;  2JXN A;  2PI2 A;  1M4V A;  3SK8 A;  1Z5B A;  1SLJ A;  2L9H A;  2DHR A;  4OXP A;  4ME5 A;  1YHQ A;  2JA5 G;  1TWH B;  4LGY A;  3GP7 A;  4DUY M;  3AB9 A;  4JPB W;  1CSP A;  3R93 A;  1N33 Q;  3UDF A;  1K83 B;  2MRO B;  4P17 A;  2JA5 B;  2LBC A;  4A3G H;  4PDG A;  1SYF A;  1B3A A;  1KLU D;  1HH2 P;  3VR2 A;  1X3G A;  1FNN A;  3Q8G A;  3J80 i;  4KT0 F;  3H3V H;  4CJ0 B;  3KOW E;  4DR6 L;  3KSJ A;  1LTL A;  3GLF E;  4K0K M;  3M4Q A;  3TL4 X;  3ICE A;  3UI2 A;  1HHV A;  1TS4 A;  3U5Z A;  1AE2 A;  1VQH A;  3I01 M;  3HGB A;  5TSS A;  1I5F A;  3SK6 A;  1SJH D;  1TU2 B;  3CHB D;  1A63 A;  1PMR A;  1J5E Q;  1PDQ A;  1TS5 A;  3KF6 B;  3HOZ G;  4FCV A;  2Z8L A;  1FD7 D;  5IGD A;  1RD9 D;  4GKK Q;  1VEK A;  3BVM A;  4I4L A;  2C35 B;  3CCL A;  3S1N H;  3I91 A;  2R45 A;  3SXH A;  3KF8 A;  1HNZ M;  5KO3 A;  5C3E B;  1TWC B;  1PZJ D;  2KRK A;  2E5L Q;  4JI4 Q;  2EY1 A;  1HJP A;  4KHV A;  1OKS A;  2UUC M;  4RNA A;  1VDD A;  3C2P A;  5IGB A;  3CGW A;  2B2Y A;  3BOS A;  5DNF A;  3OOC A;  4B3R M;  2RSO A;  4JI7 L;  4LRS A;  3RZD H;  2JXM B;  1XJV A;  1SRO A;  4ZKB B;  2R4E A;  3UJN A;  1NY6 A;  2F3V A;  1TH3 A;  1AP0 A;  5CV8 A;  2VQE L;  1CT1 D;  3TDQ A;  5EAY A;  1R9T H;  2Y21 A;  5FTL A;  3L27 A;  2Z3X A;  5LMN W;  1KHI A;  2QHO B;  3FRH A;  4MGY E;  2CKZ B;  3GLH B;  3H4J A;  5BR8 Q;  1PM5 A;  1D0M A;  5DM6 3;  3HKZ E;  4HJ9 A;  2K6A A;  4OON A;  2YNM D;  3NEN A;  3B7Z A;  3HOU G;  3OPO A;  1D0L A;  1EFU B;  1EZ6 A;  3DLL A;  1YHB A;  4BY7 G;  1TWH H;  3AQQ A;  3DA1 A;  4P75 A;  3IG8 A;  1L1O B;  1JR3 A;  2HHH L;  2UUC Q;  3OTO Q;  3VDY A;  3J7A F;  3L0O A;  2DHY A;  1Y69 U;  1HZ9 A;  1CZG A;  4WJ3 M;  2K6B A;  1XMO L;  1SXJ C;  2WAQ B;  5E4X A;  1O7Z A;  5G3L D;  4L4U A;  5ITY A;  2Z4I A;  2UUA Q;  1Y8N B;  2SNS A;  3J7A V;  2OF1 A;  4DR1 M;  5C44 B;  3KS4 A;  1AE3 A;  3JR4 A;  3FTF A;  1TF0 B;  2NZO A;  4RMF A;  3T1Y L;  1HNX L;  3PQI A;  5EJC A;  2UXB L;  1WD0 A;  1LTI D;  3CD6 A;  1O80 A;  1IYV A;  1SYB A;  2QPA A;  1Q3L A;  2DY7 A;  1LM0 A;  2F0K A;  4DR4 L;  2Y0T A;  4R9W A;  1W2B A;  3JR5 A;  2VQF Q;  4K5V A;  2TMP A;  2HL7 A;  3F8T A;  3N52 A;  4IPH A;  3T56 B;  4IQZ A;  2BWB A;  3KOJ A;  2QDB A;  3U6D A;  2WKC A;  3GDE A;  3NXW A;  4UHV A;  1X9N A;  2VS1 A;  4RCO A;  3RZO H;  1JOR A;  1EL0 A;  3A7L A;  1WGN A;  3DWA A;  1PRT C;  2EKF A;  4HN7 A;  1EYG A;  2OWO A;  3S9W A;  5J3B A;  4TRD A;  2EYM A;  1GKI A;  3OTO M;  4LUV A;  1OTC A;  5JPN C;  2K5Q A;  5KGU A;  3ZQJ A;  1JB0 F;  1TR8 A;  4JK1 C;  4A3D G;  1N32 M;  3KJP A;  1SNP A;  2ZAO A;  1FJG L;  3WWV A;  3SAT A;  4LF5 L;  4IPC A;  4CJ1 B;  5COY A;  4KLK A;  4C3I G;  3G6J B;  2WFW A;  1DD2 A;  3D0F A;  4PV1 C;  4LFC L;  2A73 B;  2QF7 A;  4YHH L;  1HZB A;  2Y0S B;  1IY0 A;  3CME A;  2CP8 A;  4IBG A;  1SJE D;  4L78 A;  1NCV A;  1YIJ A;  1ESR A;  1P3Q Q;  3GTJ H;  2PW7 A;  4BY1 H;  1V33 A;  3HJS A;  1L2B A;  2KXE A;  2JSO A;  5JEA H;  1C48 A;  3PV0 A;  1HA5 A;  3S1Q B;  2K1B A;  4AYB B;  3EJI A;  5T1I A;  4YHH Q;  4X66 L;  1V43 A;  3HOV H;  3CC2 A;  4IFD J;  4ANR A;  1QVC A;  3FDT A;  2LTU A;  1ENF A;  2KEN A;  4RHR A;  3K1J A;  3QAU A;  2L5T A;  1YHA A;  5E1F A;  1K9M C;  4R4I A;  3VYS A;  2EJG C;  3KS8 A;  3JC6 6;  4HID A;  4DPG A;  2FS1 A;  2DKL A;  3CW2 C;  4X65 Q;  1GJX A;  2EPB A;  5AFW A;  1N32 L;  5JJI A;  1KDB A;  3K9O A;  3TP7 A;  4FW9 A;  3HOZ H;  2Y20 A;  3A42 A;  4LJA A;  2ID0 A;  1PRT B;  3I55 A;  2CFO A;  4QNM A;  1A15 A;  3THG A;  4JYA L;  3AL0 C;  1F2L A;  2NTT A;  2F3I A;  1CHQ D;  4DUZ M;  2A68 D;  4DR5 Q;  1Y1W H;  1E94 E;  3IEC A;  4MGZ E;  1NNJ A;  4JI4 M;  1YBY A;  2F0O A;  1H9K A;  4B3T L;  1LAB A;  4F87 A;  3S2D H;  3S1M B;  2D9U A;  4KKS A;  3HHW A;  5ITQ A;  3GLI E;  4LMQ D;  3ULJ A;  2N88 A;  2PMZ E;  4QL5 A;  4LJ7 A;  3J7Y W;  1SAP A;  4BS9 A;  2JQO A;  1STA A;  1RTO A;  2EE1 A;  2F4V L;  2DZN B;  1E9S A;  2B2W C;  1ILP A;  3OHX C;  1JWS D;  3E9I A;  4G4Q A;  2QBY A;  3HJ8 A;  2J0T D;  1PH1 A;  3DMU A;  5EBD A;  2MO1 A;  3UZU A;  4GN3 B;  2JYO A;  4BB9 A;  1QUT A;  1D5X C;  4BXX G;  4LF4 M;  1QAO A;  2FHT A;  4K5X A;  4GKJ Q;  4DV1 L;  1WHC A;  3AOG A;  1QCB D;  4N8X 1;  4ME3 A;  4AIM A;  1UFZ A;  2F0V A;  4TSS A;  2MNA A;  2L7H A;  3GD7 A;  2A74 C;  1TWA H;  1PRT F;  4QB4 A;  2ZM6 Q;  2RDF A;  5H37 D;  4Z9C B;  1WI5 A;  3LNN A;  3H0G B;  1PV4 A;  3P7J A;  5CMD A;  2RKS A;  1LV9 A;  4RGT A;  5M3M B;  3FE3 A;  5KYL A;  1YVC A;  4AW4 A;  1B70 B;  2QDL A;  1BNZ A;  3NQI A;  4ID6 A;  4A3E B;  2L11 A;  4LWC A;  2Z6K A;  5FOB B;  1O7I A;  1Y14 B;  3RN2 A;  3QB3 A;  3K58 A;  4OX9 L;  2JA8 G;  2VQE M;  1AUA A;  5KNB A;  2R7F A;  1QNU A;  3U6M A;  4IJL A;  3I7F A;  4IJE A;  2KVM A;  3J80 E;  1DXM A;  2LHC A;  2NN6 I;  3CCJ A;  3OWF A;  4O42 A;  4D80 A;  2PMZ B;  2DWM A;  3U4Z A;  4A3G B;  2QW7 A;  3A46 A;  1VQA A;  4GC5 A;  4FCW A;  4ZUJ A;  3C58 A;  4FXD A;  2KHJ A;  4ZUI A;  4BWG B;  2J4X A;  2MJ8 A;  5C5L A;  1EQQ A;  4DV6 L;  4AKI A;  4HJ7 A;  1XWE A;  4BBR H;  3SVM A;  3ULP A;  1Q1B A;  2IT1 A;  4FNF A;  4IUR A;  1WTW A;  4M9X A;  1DGF A;  2CEA A;  4OVZ A;  3GPX A;  2EYF A;  3AOE C;  5LMN M;  1DOM A;  1I4G A;  2L15 A;  1IXZ A;  1NHG C;  3M3Y H;  3M85 A;  5GKN A;  1PFB A;  4DV2 L;  1G6Z A;  2EY5 A;  3PF5 A;  3U4V A;  3BZC A;  5IP9 G;  5EP3 A;  1BBU A;  5KRU A;  3GTM B;  2R46 A;  5CV5 A;  4B3S L;  1AEX A;  2H5X A;  2JA6 B;  2HQE A;  3K5L A;  5M5X H;  2B2T C;  4II7 A;  3FUV A;  2WB1 G;  4HIK A;  2KNZ A;  4CKE A;  4UPA A;  3J81 L;  4DV0 M;  2MP1 A;  2GVB A;  2XGT A;  1BUV T;  4ZKC B;  3I2Z A;  3IL8 A;  4OEM B;  2WII B;  1VQM A;  5NUC A;  1QZH A;  2JY5 A;  3M9B A;  3W1G A;  4NP5 A;  1IBK M;  2MUY A;  1F4I A;  5IP7 H;  3GLI A;  3L29 A;  3TPZ A;  4C3J H;  1R9T B;  2N49 A;  3H15 A;  3RE8 A;  2E2D C;  4FYD A;  4A3E G;  2YU9 B;  4NB3 A;  1FYC A;  2NVY H;  1LT3 D;  2JA8 B;  5DFL A;  3SAS A;  2L55 A;  1I94 L;  4N9P A;  1QZG A;  4IUN A;  2K4K A;  1TQO A;  4PD2 A;  4PMC A;  1JJ2 A;  4AI6 A;  2HHH Q;  4KKU A;  1QZM A;  3HRZ C;  3Q8X A;  1JOK A;  1N9W A;  5IT9 c;  1EOV A;  3V05 A;  2JA7 H;  4JI1 Q;  4M0W A;  4K0K Q;  1LUZ A;  5E3F A;  1Q02 A;  1IW7 D;  3AFH A;  5J22 A;  3P1H A;  1W3S A;  1JB7 A;  5I9P A;  1X3Q A;  3IG5 A;  2FJ2 A;  2ES2 A;  1PRB A;  1CM9 A;  1Y1W B;  1VQE A;  1TY2 A;  3S2D B;  4HAE A;  2E75 C;  1F2M A;  1NO1 A;  1JMC A;  3PO3 B;  2IWH A;  3KFU A;  3GO8 A;  3T53 B;  1CZW A;  1A3V A;  2VXW A;  3PIO A;  4FD2 A;  1U5K A;  3ZCB B;  2BE5 C;  4NMZ A;  5HY6 A;  2D0O A;  4DR3 Q;  5ISR A;  1H9J A;  3PO3 G;  3RZO B;  1V8Q A;  2PZW A;  3ZH9 B;  4NSO B;  1QUQ B;  4GN5 A;  1Z5C A;  1CI3 M;  3GV3 A;  4EVO A;  2APL A;  4IBE A;  3P75 A;  4KY7 A;  3CTW B;  3MA2 B;  2M5Z A;  4UY8 C;  4AG5 A;  3K59 A;  5ITX E;  1E2V A;  1PRT D;  4R4C A;  3RGP A;  4HTH A;  3ULL A;  1NY4 A;  2R92 G;  1ML0 D;  4JI6 Q;  1IBL L;  3NBH A;  1PJT A;  2F5N A;  1II3 A;  1UUP A;  2OQ0 A;  3F1Z A;  4MTN A;  4QY7 A;  2VF8 A;  2KCT A;  4F88 A;  4NKL A;  3H09 A;  2VB2 X;  3MXN B;  2DNA A;  1FGB D;  4X6A H;  5M3F G;  3KLS A;  4LJ8 A;  4KJO A;  3BDO A;  1L1O C;  2NVQ H;  2K50 A;  3F2B A;  4POF A;  1CKM A;  2LSS A;  1GM5 A;  1JCK B;  3J7A 5;  2DAG A;  4LG2 A;  1YJW A;  1IHZ A;  3DOA A;  4JBM A;  1SBB B;  1QVR A;  2B3T A;  3RGS A;  1XXG A;  3TS2 A;  1XXH A;  2WB1 E;  1EQT A;  2CWA A;  3FPP A;  5C3X A;  4LF8 L;  2QSF X;  1R2Y A;  2EA0 A;  1K3W A;  5FLM G;  4LFA M;  3L2P A;  5EXT A;  1OXX K;  4NXM Q;  4ZYS A;  2LVO C;  4A93 B;  5K36 H;  4GLV B;  5C1B A;  4XDX A;  1L0X B;  3ZJY C;  2ZT9 C;  2L7I A;  3K5O A;  3QJY A;  2I0Q A;  5H1S E;  5K36 G;  1EIY B;  1QVF A;  4RG1 A;  4IJF A;  4L6V 6;  3I4O A;  2ZJQ A;  1E24 A;  1PYB A;  3G7L A;  3GTJ B;  4PMW A;  3LWE A;  1R4Q B;  1KNA A;  2B2U C;  4K6L A;  1SE8 A;  4YIJ A;  3GPP A;  3KBX A;  1IY1 A;  1CA6 A;  1PH4 A;  2KHI A;  1EYC A;  3PMF A;  1VQ1 A;  1I94 M;  2WAQ E;  1PJQ A;  3CKI B;  3FHW A;  2F0D A;  3CQZ H;  4JVZ A;  2LWX A;  4V19 0;  3GLF B;  2K04 A;  1QWY A;  1MJG M;  3MXU A;  1B50 A;  4L5S A;  4YWM A;  4LJ6 A;  2B2W A;  2JZ1 A;  3KDF A;  5D14 A;  5IOC A;  3CF6 E;  3GPU A;  4IOC A;  3TN2 A;  4LF4 Q;  3CC7 A;  3S16 B;  4IUU A;  2QCU A;  2X4A A;  5CR3 A;  1XMQ L;  2OPF A;  3L3O C;  5EGT A;  1ZAE A;  2R18 A;  1YLA A;  5FTM A;  1VQB A;  1YJ9 A;  2MGW A;  5M5X B;  3VKG A;  4NW2 A;  2NTS A;  4JI3 L;  4A3J H;  5CV6 A;  4LFA L;  4KD3 A;  2YTY A;  2FFK B;  3A98 B;  4K0K L;  1O7L A;  3MXN A;  2AWN A;  4IUV A;  1GL6 A;  2CV0 A;  1BCP C;  4A4I A;  4FF2 A;  1YJN A;  4LF8 M;  2E2H H;  2MO0 A;  3U6C A;  1V1P B;  4B7G A;  4IBD A;  3HOY B;  3AU7 A;  3J81 j;  3B9P A;  5JPM C;  3RNU A;  1I94 Q;  2NVY B;  1P8L A;  3I4Y A;  4B3S M;  3PO2 G;  2NVQ B;  4JI2 M;  1KAW A;  4A3I G;  4HJ5 A;  2K01 A;  5IT9 E;  1VQ6 A;  1SMY D;  3VR6 A;  1D5M C;  4CDC C;  5FTK A;  3HJQ A;  2K52 A;  4GMQ A;  5BR8 L;  5LMU Q;  1Q81 C;  3DM3 A;  2I7P A;  1K73 C;  5EP2 A;  1SND A;  4EQN A;  2MR9 A;  2OEO A;  2ZXO A;  4JI1 L;  3TME A;  1XMO Q;  3W67 A;  2XLJ A;  3S15 B;  2RF4 A;  3TEH B;  1E1O A;  3WHL A;  4J15 A;  2QEX A;  3F2D A;  2VDB B;  2IHE A;  4DXG A;  4A3I H;  2F0F A;  5GAH C;  1M1K C;  2JA5 H;  2PNH A;  2UXB Q;  1FNV A;  2JUJ A;  4AH6 A;  1UEA B;  2PCF B;  1EZ8 A;  1AZQ A;  2VF7 A;  2Z6K C;  3SHG B;  3PIP 3;  1HNW Q;  2Y0S G;  2D5D A;  2JA2 A;  3GV6 A;  3CF0 A;  5EP4 A;  4NL4 H;  1YE9 A;  1BQQ T;  1ENC A;  3CAM A;  2R7D A;  4H7B A;  2BE5 D;  3T13 A;  1QDT A;  1SE3 A;  4CDF C;  4F2L A;  2MHV A;  2A5Y B;  3URY A;  5E7N A;  4NXN Q;  1Z5A A;  2L09 A;  2JN4 A;  3T1Y Q;  1HNX Q;  1E3P A;  4HJA A;  5CGK A;  3FYC A;  3MXP A;  1D1K A;  1RIP A;  5I2Y A;  2PQE A;  4LF8 Q;  1FNU A;  1AN8 A;  1UE5 A;  1ZYR D;  4UN2 B;  4A3M B;  1WGL A;  2XSC A;  3R8B A;  5L37 A;  5A2Q E;  4ZLT F;  3JAM L;  5AJ3 L;  5L8R F;  2K47 A;  4HED A;  3OMC A;  4PT5 A;  3NWL A;  1I4X A;  1IN4 A;  1XNR M;  3HKZ G;  3M6A A;  1R4P B;  5KYI A;  5C6A A;  3BU2 A;  2EYL A;  2BH2 A;  1QYR A;  2K5W A;  2PI2 E;  2XWJ B;  3QOJ A;  3DWQ A;  2C98 A;  1VDZ A;  4PG3 A;  1X6O A;  2OTL A;  2FH0 A;  2RKO A;  1G4A E;  1RKN A;  1PXU A;  1JE4 A;  2VZA A;  5FK9 C;  4FCT A;  5EJW A;  2A19 A;  1VEG A;  2UXC M;  5JEA G;  4JI2 L;  4DV6 Q;  1W6J A;  2BA1 A;  5EXP A;  2RQX A;  1FJG Q;  4IPG A;  5EBC A;  3EIE A;  3PFI A;  4OW0 A;  4X3U A;  2RHQ B;  3NTH A;  4FDB A;  4L8J A;  2LFN A;  3KLS X;  3ZC7 B;  1KIX A;  4OHJ A;  2UUA M;  1JIC A;  3KSX A;  1H9M A;  3WOF A;  4CJ2 C;  1W6K A;  4RWS C;  4H44 C;  4A3F G;  2HCB A;  2N35 A;  2R65 A;  2AMC B;  2CV2 A;  5BN4 A;  3CCR A;  3CCQ A;  4IBC A;  2A6E C;  2EY6 A;  3NQT A;  4IBJ A;  1HTP A;  1XB2 B;  4EIW A;  1V9P A;  1CKN A;  1STH A;  4DGZ A;  4GEW A;  4C3J B;  2R93 H;  1IM2 A;  3MC0 B;  5CYU A;  4DR1 L;  1SFO B;  5EXS A;  1JQY D;  2O5R A;  5M3F H;  1JJG A;  4LRT A;  5CBA E;  1IKL A;  4MB7 A;  3CQZ B;  3HOX G;  1KQS A;  1MJC A;  1I50 H;  2A5H A;  1MHW C;  5J1Z A;  4LF9 L;  2Q8T A;  2ERC A;  1IW7 C;  2TSS A;  2B39 A;  3DZD A;  1SXT A;  4TVA B;  4ZRZ A;  3RFW A;  1AFP A;  1SXJ A;  4H0L C;  2NUC A;  1XTC D;  4NRV A;  2LS0 1;  2A69 D;  1RTN A;  4IIW A;  3QOL A;  1SXJ E;  4L5R C;  1STE A;  5IYB H;  2LXJ A;  1OFI A;  2WZJ A;  3HP3 A;  3GRV A;  5A2Q L;  2VUM G;  3GTK B;  4LFB Q;  1GHK A;  1YZ6 A;  3U58 A;  3TRZ A;  1BR9 A;  3U6Q A;  4FXG C;  4IFD G;  1LO5 D;  1A0I A;  2E5L M;  1VQG A;  1HUM A;  3VR5 A;  4CBV A;  1K8A C;  2EJF C;  3VR4 A;  2ZBK B;  4K14 A;  3NHH A;  4JOI A;  3KLR A;  1ZMV A;  3GRY A;  1WTR A;  4BA2 I;  3VLF B;  4X62 L;  4DR4 Q;  1VQ9 A;  4X65 M;  4GLX A;  4YCU A;  4P16 A;  3HY5 A;  1MSH A;  2HIV A;  2R6G A;  1WVL A;  1K3R A;  3T4A C;  4LJ9 A;  1LLR D;  3KFU G;  1PVO A;  4L15 A;  2IX0 A;  2EUC A;  3S1N B;  1X65 A;  2K0B X;  3R3O A;  5IYD H;  3RR5 A;  4D81 A;  4DV1 Q;  5IRE B;  3I4M G;  1PTO F;  5IYB G;  1UAP A;  4GKK M;  5ELD A;  2OQ4 A;  3ITP A;  3HS0 C;  3K7U C;  4JI7 M;  2B63 H;  3P20 A;  1IXS A;  2MQH A;  2Z7J A;  2F4I A;  5LMU M;  1IBM M;  1S3O A;  2EKK A;  4DXF A;  1NJI C;  1R4G A;  3ERQ A;  4HMI A;  1WTP A;  1NBW A;  3HOX B;  3GTG H;  3GQ5 A;  1GUO A;  1B7Y B;  4CJ6 A;  4CDE C;  2R44 A;  1DGB A;  1A3U A;  3PCO B;  2DN8 A;  4M9Z A;  4CHT B;  3S24 A;  2M60 A;  1SE4 A;  3U60 B;  1Z7T A;  3CU7 A;  2LVN C;  4IPD A;  2EO2 A;  4OX9 M;  1VQ8 A;  1WFQ A;  1AIP C;  3OYY A;  3SK5 A;  1X37 A;  4B3T M;  1I3Q H;  2LXE A;  1WJJ A;  3L28 A;  2LNH C;  2LXK A;  2UU9 Q;  4ITQ A;  4L5Q A;  2WKD A;  2HCC A;  2V1U A;  4DKA C;  4C3I B;  3J80 S;  3HKS A;  3HGI A;  5ELB A;  5IWA M;  1K3B C;  4LGM A;  1STG A;  1DZ1 A;  3M0E A;  5CV7 A;  5IOD A;  2DI0 A;  1PTO B;  4DV7 M;  1EYA A;  2KCN A;  4R8N A;  1G29 1;  2A1A A;  2EXD A;  3S16 H;  4AQY M;  4S3S A;  5ITT A;  5EPL A;  1NUC A;  1PYS B;  2DWL A;  2KA7 A;  1IY2 A;  4OO1 I;  1VQF A;  4DFA A;  3SR1 A;  2B8F A;  3HHZ A;  2K5D A;  1QOH A;  1EY8 A;  1G8Z D;  1LT6 D;  2L12 A;  3U6P A;  3K0X A;  4GLA C;  2L4F A;  3MEH A;  1ICW A;  4F7X A;  3T38 A;  4DV5 L;  3J7B A;  3NSW A;  5C44 G;  2XF3 A;  2CH4 A;  1KDC A;  5D65 A;  1VQ5 A;  3HOY H;  4G4O A;  1I4R A;  3KP0 E;  1TWA B;  4GKK L;  1C1K A;  2D2C C;  3SHL A;  2N55 A;  4G3O A;  2VL6 A;  2XSZ D;  3J7Z C;  1RU3 A;  3J81 i;  3A7A B;  1I4P A;  2R62 A;  1JOO A;  5M3M H;  2NYZ D;  2OOA A;  1IXS B;  1SMY C;  4ZQ3 A;  1TWG B;  3R8F A;  3U6O A;  2MPM A;  2UXD L;  1MU5 A;  1D1I A;  2PQA B;  1BBX C;  1XPU A;  1BO0 A;  1NJG A;  2RDG A;  2R93 B;  3W0F A;  4DAP A;  3GTQ H;  5F3W A;  2OT2 A;  4DV0 L;  1UEB A;  1UM8 A;  4P73 A;  3IFD A;  3A55 A;  3LCV B;  4I65 A;  5M3F B;  1CKN B;  2Q2H A;  2KDL A;  3I56 A;  1CFM A;  2YR0 A;  2W82 A;  1M90 C;  3NUC A;  3PIO 3;  4K2K A;  1K3X A;  4PNY A;  2F0W A;  1OFH A;  4G57 A;  4DV4 M;  2K14 A;  1XXH B;  1X3F A;  3TS0 A;  5EQT A;  2G8L A;  3SMS A;  3JAM c;  4JI3 M;  3C3E A;  3GLG E;  4LZZ A;  1E2W A;  1TWF H;  3STB C;  4A3D B;  1ILQ A;  1L1O A;  4A3I B;  2K28 A;  5IGC A;  4NC6 A;  1QB5 D;  5M5W H;  4KHP Q;  3VK8 A;  1R5L A;  3MVV A;  4A3C H;  2I46 A;  4RKB A;  3HOV B;  1VQI A;  4WP2 A;  3NTI A;  2X6L A;  3VDP A;  5FLX E;  2JWS A;  1TTE A;  3K6O A;  3QWN A;  4DR3 L;  3AOE A;  1A8V A;  2KNA A;  4OWT B;  1LT4 D;  2CHV A;  1PZI D;  3GTM H;  4QIW B;  4M9S A;  4GKJ L;  2JZ0 A;  2ICE C;  3UE1 A;  3GQ3 A;  4IUQ A;  2QGQ A;  3KUP A;  4I7Z C;  2ZM6 M;  3E0J A;  3M4Y A;  2SNM A;  2NBF A;  1TY0 A;  3I51 A;  1NNX A;  1SNM A;  1VQO A;  2BDN A;  2NB0 A;  4AG6 A;  2HD3 A;  1JWU D;  4KTA A;  4X3S A;  3X3M A;  1AW7 A;  4NDX A;  4D82 A;  1QAM A;  4IBI A;  3KYH C;  1J09 A;  2J5Y A;  5JJZ A;  4ZK9 B;  1KLG D;  2Z0S A;  5IYC H;  1C9O A;  4EQ5 A;  4M1U B;  4A3K G;  2UU9 L;  3M4P A;  2YU9 H;  3HWS A;  3ND8 A;  1STB A;  5ELF A;  4LF7 M;  2VUM H;  3BBZ A;  4JI0 Q;  3NP8 A;  1SEB D;  4NOO B;  4HSP A;  4R71 A;  2CRU A;  3HX3 A;  3A8J E;  3D6C A;  3X3N A;  1QDR A;  2DJF C;  4DV4 L;  1CQF A;  3T1H L;  1HTL D;  3U9S A;  1B9M A;  4XGI A;  2EYP A;  4GHL A;  2KJX A;  4LF5 Q;  1EOT A;  2F0Q A;  5JVG 3;  4ALP A;  1IFY A;  3EVQ A;  1JR0 D;  2VQF L;  1OIZ A;  4QHT A;  2F0P A;  2LMC B;  2HT1 A;  4F1I A;  3HFZ B;  3CCS A;  4MTK A;  4L6T B;  2EVB A;  3U60 A;  1EQR A;  1WOC A;  2V6Z M;  1H9R A;  2EY2 A;  4J1M A;  4KKT A;  3GTO H;  3H0G H;  1IN5 A;  1CSQ A;  2RCF A;  4DV5 Q;  2RRU A;  1SR3 A;  1RF2 D;  5C0X G;  5E6J A;  4DV2 M;  2K9D A;  4XYO A;  4GIT A;  4O0A A;  3D4R A;  1BXT A;  4A3E H;  1S5F D;  1IL8 A;  3TQS A;  1Z59 A;  2EYJ A;  4JC0 A;  5IGE A;  5GAE C;  1TH4 A;  5C4Z A;  4XXE A;  3S14 B;  3H6M A;  3U9O A;  4JI0 M;  1JJC B;  2I5M X;  1WR1 B;  1Y1V H;  5M3M G;  4KV6 A;  2FNA A;  4C3H G;  4YY3 M;  1S3S A;  2BH8 A;  3CCM A;  3FKI B;  1TH2 A;  3L2A A;  1OJL A;  1VMC A;  3C1E A;  5LMN Q;  3S1M H;  3HHY A;  3M7N A;  1QZE A;  2HWJ A;  3DM1 A;  1XXH E;  1DV0 A;  1UE1 A;  2O2L D;  3B6Y A;  1RL2 A;  1NHW C;  3TP5 A;  1IN6 A;  1ASY A;  1WCM G;  4L16 A;  1HQY E;  1TDZ A;  2D7G A;  1I4Q A;  2PPB C;  3OIQ A;  3RLO A;  3H3V I;  3CRK C;  4Y28 F;  4KD4 A;  3U50 C;  3KDF B;  2UU9 M;  1WCM H;  4LF9 Q;  4MGI E;  3AFQ A;  4JV5 L;  4JI5 Q;  2L1B A;  3BVG A;  1M8A A;  1TWG H;  1QVG A;  3GRU A;  3A54 A;  3MXG A;  7CAT A;  3J81 E;  3IAY A;  5ITX A;  1MD2 D;  3L25 A;  3CPF A;  1NE3 A;  4LF9 M;  1SYG A;  2A69 C;  3W68 A;  5HGT A;  5IWA Q;  2JA6 H;  3RLN A;  5DM7 3;  3GLH E;  1B53 A;  3OIP A;  1G2T A;  3VK7 A;  3FMC A;  3I70 A;  1Q82 C;  3M7G A;  1ZMU A;  1BKB A;  1IBK L;  2JNH A;  2K03 A;  2SOB A;  3SDZ A;  5KEE A;  1H9S A;  2VII A;  5GQO A;  1PH3 A;  2AWO A;  4JCV E;  1GUT A;  2VQF M;  4BLC A;  4CIS A;  3RUZ A;  1H6U A;  3VYR A;  4FF4 A;  1X3E A;  2BA0 A;  2XRQ D;  3STB D;  3OTO L;  3G48 A;  1UE6 A;  3MHV C;  2XFT A;  2JA6 G;  1LTS D;  2OXP A;  4DV3 Q;  1Q8I A;  3MWY W;  3CCU A;  2B63 B;  1DJR D;  2E2I B;  4DK0 A;  3KXE C;  2KED A;  3T6P A;  5FLX L;  1N77 A;  1IBK Q;  4QUC A;  4B9W A;  1UWV A;  3D8L A;  4E6I A;  3I4N B;  3MZ5 A;  3LVW A;  3LMM A;  1Q3C A;  5BR8 M;  1J6Q A;  1QNK A;  4B08 A;  3PF4 A;  1J9O A;  2ZXP A;  1PFS A;  5G3L F;  4ULL A;  1EIF A;  1N75 A;  4DA2 A;  2A6H C;  3IKJ A;  2L2D A;  2R92 H;  5DYG A;  3SFZ A;  1OQY A;  2JP1 A;  3OW7 A;  3FRP B;  5C18 A;  1NTG A;  2JA7 B;  2VB3 X;  5FTJ A;  3A5U A;  3E21 A;  4BBA A;  4DNT B;  2NZ1 D;  4DR2 L;  2XSZ A;  1E9R A;  3J81 S;  2NVX H;  2R7Z H;  2UXB M;  4L63 B;  4UAI A;  1F9S A;  3NE5 B;  2IX1 A;  4KHZ A;  2JY8 A;  3QR8 A;  4OIK A;  2XRS D;  2E8G A;  3F2U A;  4A3B H;  5IYC G;  1TDH A;  1PH7 A;  1J7K A;  2F1M A;  3GQB A;  3E9S A;  2Q8R E;  4CKB A;  2HUG A;  4IBF A;  1KL9 A;  1Q1E A;  4EGV A;  4M0D A;  3VFD A;  3D8B A;  3EIV A;  3SAR A;  1YNJ D;  2AHO B;  2JK8 A;  5I2X A;  1KRT A;  4QJF A;  4JV5 M;  2VUM B;  1GHJ A;  1I4H A;  3CCV A;  4DV2 Q;  1WTV A;  3K5M A;  3A8I E;  3TZU A;  2F5P A;  5LL6 X;  2R4J A;  1DON A;  2JY6 B;  2NWG A;  4EQO A;  1AH9 A;  3J7A S;  5KIX A;  1RDP D;  5T1G A;  5M5Y H;  4B3S Q;  1IXR A;  1F2Y A;  3MEF A;  4B3M M;  4JI8 Q;  3S15 H;  1YIT A;  3NEM A;  3GTP H;  5K5P A;  2KUM A;  3IRB A;  1EWI A;  5ITU A;  4BY1 G;  3DEO A;  4B3T Q;  4S12 A;  1H95 A;  1YNX A;  2K05 A;  1L0Y B;  4QGU A;  2Q2T A;  3D6W A;  4H02 A;  4UP9 A;  1VQK A;  3G6E A;  3QYB A;  2EDG A;  3KLW A;  4HEO A;  4K6D A;  3VKH A;  2F0H A;  3LQR A;  3K57 A;  4AQY L;  4C1N K;  4IFD I;  3FUT A;  3TE6 A;  2Q8I B;  3D4W A;  4B7H A;  4CDD C;  4FVM A;  2I5L X;  3GTQ B;  1XWI A;  4A3K H;  1BCP F;  4JBK A;  2UXC L;  4DNI A;  1SN8 A;  1XMQ M;  1R2Z A;  1FVI A;  2B8G A;  3RLF A;  3CC4 A;  4A3D H;  4GZY C;  2OTJ A;  2PNR C;  3U5Z B;  2HCI A;  2DAE A;  2V1C A;  2PZT A;  1LTR D;  4JI7 Q;  2KQ3 A;  4Y7N H;  1KSF X;  1E7Z A;  2AQ3 B;  2OCE A;  4LZJ A;  1EY0 A;  4JI3 Q;  3C46 A;  3G4S A;  1DYQ A;  3VYT A;  1ET6 A;  4JI8 M;  4A3M H;  1C0A A;  4POG A;  1EE8 A;  3VR3 A;  1G2S A;  3UMM A;  1B44 D;  3U6E A;  4G7H C;  1EIH A;  1I6V C;  2WV6 D;  1A62 A;  2XZU A;  1SNQ A;  2UXD Q;  3D3R A;  5EKI A;  2R0I A;  2RCN A;  3K5N A;  4JI5 M;  4JV5 Q;  3DFZ A;  4G4K A;  4A3B B;  1T9H A;  4DR5 M;  3WOE A;  3K7A B;  2FE8 A;  4NXM M;  3Q6S A;  1CTM A;  5C0X I;  1GJS A;  4GRI A;  1A3T A;  1C7Y A;  2WSE F;  1TWC H;  5D3I B;  5LL6 S;  2Q2E B;  3W3A A;  5LHY 1;  1HR0 W;  2UUC L;  4A3B G;  4BBR B;  4K5W A;  2RSN A;  3MFG A;  4LF6 L;  4GOP C;  4WJ4 A;  3SGI A;  3KF6 A;  4Q0F A;  2E2J H;  2KBN A;  1HNW L;  1KAB A;  1K82 A;  2ZM6 L;  1OAO C;  1TS3 A;  1JOQ A;  4QOZ C;  4G7O C;  3GLH A;  4CKC A;  5GAG C;  1T3T A;  2F0N A;  3V76 A;  1B8A A;  5A2Q S;  1SE2 A;  4TKO B;  1FL0 A;  1ICF B;  5J39 A;  2BWE A;  1L2C A;  1VEJ A;  3J2P B;  4IBK A;  4KLN A;  4LNQ A;  4A3M G;  4A75 A;  3VYU A;  1NJF A;  2KEB A;  1H9S B;  3EBE A;  1G41 A;  1SFO H;  1WTO A;  2ENB A;  1ET9 A;  1L2D A;  4IAL A;  4LF5 M;  4A3G G;  1D8L A;  4MIU A;  1L8Q A;  3TP6 A;  5DAU A;  4DR3 M;  2ZAN A;  1LTB D;  1LTG D;  1L1Z A;  4QHS A;  2F3W A;  3K0Y A;  2R93 G;  2QQ8 A;  1JE5 A;  4DV7 Q;  1NNU C;  2ICI A;  2DWZ B;  2N8N A;  1EUJ A;  4IN3 A;  4HLQ A;  1NR4 A;  1E22 A;  1MKH A;  3HOY G;  2B2U A;  1AZP A;  4HCS A;  3S1R H;  3FTD A;  3B89 A;  4REZ A;  4JI6 M;  1CK1 A;  2R61 A;  5IZ7 D;  1X54 A;  4LFC M;  3S14 H;  2NVX B;  1D0K A;  3GTO B;  1GAB A;  5C0X H;  4KK7 A;  3J27 B;  3KOX E;  4I8O A;  4G4N A;  4LK1 C;  2AUK A;  2K5H A;  4R4T A;  4FWG A;  2ZAM A;  2N3S A;  1EEI D;  3E0E A;  3PO2 B;  1Y1V B;  1FJG M;  2EJM A;  2BJV A;  2F5O A;  4JI2 Q;  3QWL A;  1GUG A;  1G6P A;  4X62 M;  1L1T A;  3PXG A;  2V1C C;  1VQL A;  1ORY B;  1IN7 A;  1I4W A;  2K5V A;  3BDL A;  2DNC A;  1JR3 E;  1Q90 A;  4DR6 Q;  2R3Z A;  2WB1 B;  1SG9 A;  2AUJ D;  1A6X A;  3EFX D;  2HKJ A;  1K83 H;  2O5J C;  3PUV A;  5CC4 A;  1PH8 A;  1IYJ B;  1EY4 A;  4UDU C;  1MJE A;  3AYH B;  1SYE A;  2DGY A;  3D8G A;  1EU3 A;  1IN8 A;  4R4O A;  3AMU A;  1X56 A;  2D7E A;  2WAC A;  1GUS A;  2F0S A;  1R7R A;  3UGJ A;  3EN2 A;  1G91 A;  2CQO A;  3HZX A;  5BPV A;  5FO7 B;  4RA8 A;  2UXC Q;  3K81 C;  1HZA A;  2RDH A;  1U4R A;  3PO3 H;  4DR1 Q;  3HU3 A;  2PO4 A;  1XMQ Q;  5DYI A;  5IGG A;  2C96 A;  2F03 A;  4JI1 M;  1GXD C;  5FTN A;  3SYL A;  1T5E A;  4RKL A;  2JA7 G;  2LH0 A;  1HRJ A;  4QUF A;  4OWX B;  4YY3 Q;  4XQN A;  2XWB B;  1KYI A;  4JI5 L;  4HIO A;  1SYC A;  1W5T A;  1Y8G A;  2K7V A;  2F52 A;  4O1N A;  2KRU A;  4H13 C;  2BDO A;  4DU9 A;  1HFG A;  1SYD A;  1T5X D;  1U4L A;  2F0U A;  4DF7 A;  1PJS A;  3ERS X;  3MMP A;  4NSR A;  3A5Z B;  4DV0 Q;  4FXK C;  3SAU A;  4CGY B;  4A3C G;  4YY3 L;  2QIL A;  3C9P A;  4DR2 M;  2DNE A;  1MGS A;  4RCN A;  4AKH A;  1KTK A;  4KY5 A;  5KNC A;  3NBX X;  4A3K B;  1HNW M;  4A3V B;  4KN4 C;  4Q7J A;  1NMG A;  5IP7 G;  4MH0 E;  3TWL A;  1ROD A;  3C3D A;  3GO5 A;  5ELE A;  1QG7 A;  3B7N A;  2IL8 A;  4TUW A;  3FPU B;  1YSY A;  2L0C A;  4I5S A;  1IBL Q;  1Q3B A;  2VW9 A;  5FSW A;  2IW3 A;  3LVV A;  2B63 G;  1IQP A;  3C1F A;  1E2Z A;  2QA4 A;  2NN6 G;  2Y0Q A;  4DV5 M;  2DWN A;  5FO9 B;  4OU7 A;  4DR4 M;  2E2I H;  4KN7 C;  1Z6T A;  1VCI A;  2G9H D;  2EIF A;  3KJO A;  4GNX A;  3HOZ B;  4U67 3;  4JBJ A;  3DHQ A;  1SXJ B;  2LKV A;  1LTA D;  4RF0 A;  3TZD A;  5JJL A;  4X64 M;  3HOW G;  2HDL A;  4JBW A;  2R7Z B;  1TR5 A;  3K7A H;  4DV3 M;  1JB3 A;  5C3E G;  4DR2 Q;  1D2N A;  3W1B A;  4RFB A;  3GLG A;  2KZU A;  1CUK A;  1DCZ A;  1MN3 A;  1EYD A;  1GKH A;  1U9R A;  1WYD A;  3ZYY X;  1QAQ A;  4N9T A;  5EPJ A;  4Q5V A;  3FRI A;  4BA1 I;  3B7Q A;  5GAD C;  4XQJ A;  3SEB A;  1EY9 A;  1O78 A;  4C2M H;  2I7N A;  2IHF A;  4HR7 B;  4OWW B;  2KHH A;  2EYH A;  1IL2 A;  2EQS A;  5FJ8 G;  1VQN A;  3GPY A;  2QZ4 A;  3NBH B;  3AV0 A;  1YNJ C;  3M4O B;  3TBI B;  1XHB A;  2B2T A;  3BYY B;  4Z8X A;  1PTO D;  4R1J A;  4TQU S;  1LV7 A;  3MK6 A;  4RGN A;  4I7A A;  5ELN A;  4LJ4 A;  5JI2 E;  2A6H D;  3E4R A;  2GNO A;  1N78 A;  1YNN C;  1Y1W G;  2CH4 W;  1ZYR C;  3H3V C;  3T15 A;  4DUY Q;  5FLX S;  5FJ8 H;  3I3C A;  4GKJ M;  1OIP A;  1GD7 A;  3LX0 A;  1DGG A;  1WTX A;  3BJU A;  1V1Q A;  2VY3 A;  3DEP A;  4A3F H;  1XNR Q;  4BY7 B;  3Q22 A;  2CW0 D;  3E3X A;  3MJ5 A;  1TKW B;  1CQV A;  2ZTE A;  4LUO A;  1XX8 A;  1S5E D;  3S1R B;  2WAQ G;  3A0J A;  2ALY B;  3DUZ A;  1MBY A;  1HFN A;  3LW5 F;  4C3H H;  3EA6 A;  4EX5 A;  4QCL A;  1QQW A;  2C5R A;  1HCZ A;  1CHP D;  3MFY A;  5M5W B;  2DEN A;  2AKW B;  2L4N A;  4QIW E;  4K2L A;  2O01 F;  3HOU B;  4DR5 L;  3AFP A;  2FFJ A;  1RHP A;  1U0L A;  4LY6 A;  4BXX H;  2EOT A;  4IO9 A;  2PYK A;  2F0M A;  4C56 C;  3UK6 A;  5FLX c;  4OVZ B;  1VG5 A;  4DUZ Q;  4V0B A;  2BCO A;  4XYQ A;  1Y8O B;  2GVA A;  3HOW B;  3HHX A;  2QNJ A;  2EXZ A;  2J7N A;  2G3Q A;  3HU1 A;  3GLF A;  3H4M A;  4LCB A;  1KRS A;  1DGH A;  4LF4 L;  2UUB Q;  4JW0 A;  2NQ8 C;  1TII D;  4C3J G;  3TWM A;  1WTH A;  2HIX A;  3AEV A;  2DAI A;  3AJI B;  4KOD A;  2G5G X;  5JJK A;  2A68 C;  3T51 B;  5LMU L;  3I4M H;  1ZXT A;  3JAM E;  3I4N G;  4DN4 M;  3BS1 A;  1VQD A;  2YQZ A;  5EKK A;  3W0L B;  1JR3 D;  2KW0 A;  2UUB L;  1Q39 A;  1XMO M;  1DOL A;  4HIM A;  1K28 A;  5FKA C;  3PIP A;  2QCP X;  1FGU A;  2NZH A;  4RHS A;  4RF1 A;  1V92 A;  3I72 A;  1G59 A;  4WJW A;  3U6S A;  2XTI A;  5D3D A;  1EIJ A;  3NK9 A;  4P71 A;  4DAM A;  2CWB A;  4WUR A;  2X69 A;  1PHJ A;  2XIW A;  1D7Q A;  1ENA A;  1LAC A;  3DXJ C;  2IY5 B;  1BF4 A;  5FO8 B;  2WIN B;  4JXJ A;  2M9V A;  3U61 A;  1G8P A;  3SAV A;  1EQV A;  3SE0 A;  3HEJ A;  1Y1V G;  1TT2 A;  3SAW A;  2F0I A;  4OIJ A;  4YHH M;  4MGH A;  5F2D A;  1SDF A;  4R8I A;  3O13 A;  1VQP A;  4I81 A;  4L8R C;  2F0T A;  1O7Y A;  2DZO B;  5IT9 S;  1EIG A;  2WSC F;  2Z4H A;  1QAN A;  1HT2 E;  2XEP A;  3CF5 A;  4LF6 M;  3KOY E;  5M9O A;  4FF3 A;  3BXW A;  1D6E C;  3PNV A;  3DWP A;  3LQQ A;  2A8V A;  4A3L H;  5C5M A;  2I07 B;  5CV4 A;  3KK7 A;  4P72 A;  2FIN B;  2Q2U A;  3SK4 A;  2M2L A;  3GRR A;  3UDI A;  4KMU C;  2F0J A;  3J80 L;  3HOX H;  2JEA I;  3FVQ A;  3GTG B;  2MH8 A;  1BBW A;  1E1T A;  1KDA A;  5DNY A;  2VNU D;  1NV8 A;  2QEN A;  2E74 C;  1SNC A;  2MFI A;  5JOB A;  4JI6 L;  4AYB G;  2E2H B;  2OQK A;  5GRO A;  4BY1 B;  4RH6 A;  3RD4 A;  3CXC A;  3HOU H;  1ZMW A;  1B9N A;  3PUX A;  5KPR A;  4PDI A;  4IBB A;  3GTL B;  2ZTC A;  3NWT A;  4RAU C;  1S5C D;  2P5Z X;  4DR6 M;  3ILK A;  4YWL A;  4OGQ C;  1I6H B;  2DZL A;  4X64 L;  1N34 Q;  1R6B X;  1PJI A;  4A3J G;  3PO2 H;  4DV1 M;  1IZ6 A;  4WOR A;  1PA6 A;  1W5S A;  4U68 A;  4Y52 H;  1L0W A;  3HKP A;  3WDN A;  5I9O A;  3IFT A;  4QQB X;  3KOZ E;  4XTC S;  3TRE A;  3Q24 A;  1KNE A;  4F8M A;  4G4R A;  5I4D A;  2H1E A;  3S17 H;  2XZF A;  3D4D A;  5COR A;  4KY6 A;  4P74 A;  1EY5 A;  1LYL A;  3W2D A;  1PLF A;  2LVP C;  1EU4 A;  2CHB D;  4LFB L;  2AHM A;  1Z9F A;  1N33 L;  2O25 A;  2JA9 A;  3FUU A;  1VF7 A;  2R6F A;  1YNN D;  2NVT H;  3J81 c;  3R2T A;  3H91 A;  1EWC A;  1Y8P B;  5JAV A;  2KEE A;  2BNK A;  3U6L A;  4KI0 A;  2E76 C;  1PGY A;  4DUZ L;  1YI2 A;  1DO0 A;  1BCP B;  3KF8 B;  4PZ7 A;  3L26 A;  1EEF D;  4ABN A;  1S72 A;  3GTK H;  2D62 A;  2XVS A;  1J5E L;  1F77 A;  4A3F B;  4BY7 H;  5EQ0 A;  1QE6 A;  3B74 A;  2YYZ A;  4BBR G;  1Q46 A;  5I6Y A;  1F2Z A;  3K9P A;  2QEJ C;  4GIP A;  3ER0 A;  5CV9 A;  4NXN M;  4LW1 A;  5EPK A;  2K33 A;  1XPR A;  2Z1C A;  4DNR B;  5E26 A;  3T1H M;  3TSS A;  2E5L L;  3I4V A;  1QUQ A;  2HDM A;  4L5T A;  4C3H B;  2JJQ A;  2NN6 H;  2DVW B;  1CKO A;  3ERO A;  3A45 A;  4XIG S;  3SYK A;  2HQL A;  4WW0 A;  5IT9 L;  3UDX A;  4QNR A;  4OO1 G;  4R3D A;  4AQY Q;  3FKE A;  4DR7 Q;  1G3I A;  5DLQ E;  3CF2 A;  4GNX B;  3HOW H;  4ODG A;  2BJW A;  2OO9 A;  1B1Z A;  4IUT A;  1PYW D;  4FF1 A;  3F2C A;  1A5T A;  3OWE B;  5EP1 A;  2Q2I A;  4O2D A;  4DK3 C;  1K8G A;  1XYI A;  1TWF B;  2P5T A;  2ZXR A;  4UP7 A;  1QIL A;  2KEC A;  3BYT B;  3SBJ A;  4GOP B;  1PZK D;  1G51 A;  4DAY B;  2ATW A;  2DAK A;  4ZCK A;  2F5S A;  1C8C A;  3V2T A;  1IBM L;  4KJN A;  3FUW A;  4X65 L;  2CFM A;  3HKZ B;  3N6R A;  4LAA A;  3R2I A;  2LY7 A;  4IOA A;  2B2Y C;  3FYD A;  4CIZ A;  3EQL C;  1N33 M;  4DK6 C;  3BDC A;  1WTQ A;  2X49 A;  4XT3 B;  5C0X J;  3S17 B;  2CCZ A;  5C4X G;  2JP7 A;  1ZEQ X;  3I8Z A;  4A3L G;  1N36 Q;  1VF5 C;  1STN A;  4P2C B;  3T16 A;  1OO9 B;  1I3Q B;  1XNQ Q;  1HR0 L;  3FD9 A;  1D5Z C;  3FKI H;  2MGS A;  1OXU A;  3K2L A;  4DV6 M;  2XH9 A;  2DY8 A;  3M3Y B;  1KXL A;  1BVS A;  3K80 C;  3M4O H;  5M5Y B;  3J80 c;  1LT5 D;  5IGF A;  8CAT A;  3KDS E;  1UNS A;  3L9A X;  3TQY A;  4DV3 L;  2FOI C;  1C4Q A;  3U61 B;  1N36 M;  5IYD G;  4OX9 Q;  4K8J A;  2RGH A;  2QBY B;  3OSO A;  2Y0S E;  3A8K E;  3PVS A;  2MJ5 B;  1HXY D;  5C4X H;  4BBS G;  3K8A A;  3IHP A;  2Z4S A;  4C2M B;  2V4D A;  1JWM D;  1N34 L;  3T1Y M;  1HNX M;  1NMF A;  2R7Z G;  4NXN L;  3RMH A;  3W5O A;  1WCM B;  2LVQ D;  2PQA A;  1CA5 A;  1XNR L;  2M00 A;  1S40 A;  4BBS B;  4KHP L;  4XQQ A;  1JT8 A;  4LF7 L;  5C4J B;  1XPO A;  1Q7Y C;  3BZK A;  4DUY L;  4KO8 A;  5KPZ A;  4IUP A;  5JVH 3;  2CVR A;  2RA4 A;  4IZ8 A;  5BN3 A;  5IP9 H;  1GVN A;  5AJ3 Q;  4IFD H;  3KBG A;  1VQC A;  2JEB I;  3S2H B;  1GL7 A;  4JN6 A;  1F9P A;  2O4X A;  3T1H Q;  4DV4 Q;  1ESF A;  1D2B A;  3BZD B;  2L6O A;  2JA8 H;  1I6H H;  1X55 A;  1BDO A;  4NRW A;  4J8Q A;  3F92 A;  4MM3 B;  5C3W A;  2F0E A;  2WSF F;  4NXM L;  4B3R L;  1HA6 A;  3A74 A;  4OO1 H;  1F9R A;  1EFI D;  1PTO C;  2H4O A;  1PH9 A;  5IY0 A;  5IIF A;  4DAY A;  1MX0 A;  1B3Q A;  1DO2 A;  1IBL M;  1HPC A;  1K8M A;  3PUZ A;  2GA4 B;  4ILW A;  1EWH A;  4PZ6 A;  3NEL A;  3GQ4 A;  3TP8 A;  4X66 M;  5EKL A;  4WFN 3;  1NAP A;  3I4M B;  1HNZ L;  1F9Q A;  4JI0 L;  1VQ4 A;  2UUB M;  1VQJ A;  2R92 B;  1GUW A;  3JAM S;  1GOZ A;  2CW0 C;  5FLM H;  4QF4 A;  1X3P A;  1FR3 A;  1STY A;  2Z4R A;  2DUD A;  2RVL A;  2F4V M;  4JI4 L;  3FTE A;  1DGS A;  1V1O A;  4GS3 A;  1EY7 A;  4LJ5 A;  2CV1 A;  2PW5 A;  2CE7 A;  2F0G A;  1HNZ Q;  1GO5 A;  4N8F A;  3QO2 A;  4G7Z C;  5IE8 A;  1ZV1 A;  4HSV A;  2B29 A;  4LUZ A;  1N34 M;  3GLG B;  2DXI A;  1BCP D;  1UE7 A;  4R4Q A;  1L2F A;  1SRU A;  1N32 Q;  1HUN A;  4K8I A;  2RGO A;  4NPS A;  1EFW A;  3VA7 A;  1NVM A;  1IYU A;  5EXX A;  1SSO A;  3LWU A;  2I5H A;  2VQE Q;  3BG3 A;  1GJT A;  2D7H A;  5C3E H;  5JI3 E;  5KPT A;  4X3K A;  2CUZ A;  3PUW A;  2J7O A;  4IJH A;  4PQX A;  2FMC A;  2LHG A;  1Z6H A;  4ZAI A;  3E6Z X;  1S5B D;  2HHH M;  1KC8 C;  3C3L A;  2CWP A;  2SEB D;  1Z47 A;  3SHF A;  3OMG A;  2QKI C;  4B3M L;  2LVA A;  3H94 A;  3VA5 A;  4A93 G;  4DK1 A;  2XNA C;  1OAI A;  2F4V Q;  2YV5 A;  3HZJ A;  4GH9 A;  1T6O A;  4A76 A;  3KVW A;  1SXJ D;  2ASB A;  3S2H H;  2ZJR A;  1Q86 C;  4RGM A;  2X8A A;  3HOV G;  1DGH B;  1HQM C;  4C1N I;  1XC8 A;  1GO3 E;  4J6H A;  1FNW A;  4B3M Q;  4KHP M;  1MIU A;  3I4N H;  3RZD B;  3GLI B;  1WXQ A;  4DR7 M;  3HU2 A;  1I50 B;  1U4P A;  1ZKO A;  1RJT A;  2X6G A;  2D0P A;  2WP8 J;  4RKU F;  4XK8 F;  2EYO A;  1PH6 A;  4PCZ A;  4APV A;  1VS0 A;  1BOS A;  2B3G A;  1JC7 A;  1GVP A;  4LF6 Q;  1GUN A;  4GC9 A;  3R9X B;  3E46 A;  3CP0 A;  1TXY A;  4XBO A;  2C9O A;  4X64 Q;  4B7F A;  1WJ7 A;  3GTL H;  2AQ1 B;  1J8I A;  4MHE A;  2CHQ A;  2XGN A;  5C44 H;  2YTV A;  1KD1 C;  4Y7N B;  3TWK A;  2KNV A;  2FMM A;  4WRD A;  4R7G A;  4LFB M;  3CRL C;  1LTT D;  2K5N A;  1NR2 A;  1SMX A;  1HQR D;  4YCW A;  2F0L A;  1IXR C;  4Z6Y A;  3MTS A;  4QOS A;  4YWK A;  4B9X A;  2B2V A;  2NVT B;  2SDF A;  4AYB E;  3FTC A;  1U4M A;  1V34 A;  4B3R Q;  5KND A;  3I4L A;  4ZPX A;  1J5E M;  3MHB A;  3PNY A;  1VDL A;  3FUX A;  2G9D A;  3ND9 A;  4JG2 A;  1PH5 A;  2ZTD A;  4LF7 Q;  1Q12 A;  1MSG A;  1GLN A;  4HCE A; 
#chains in the Genus database with same CATH homology
 4A3J B;  1PFM A;  1SNO A;  3I90 A;  3E5S A;  4PMB A;  4QMG A;  4W5W A;  1HR0 M;  5HUR A;  4RGO S;  2KHS A;  4AKG A;  2C99 A;  3GTP B;  3I73 A;  4FWH A;  1HT1 E;  4HMJ A;  4GHA A;  1PJJ A;  4M8A A;  5ITR A;  1K8O A;  2B2V C;  1E32 A;  1XNQ M;  3GP1 A;  5E4W C;  1TS2 A;  5C4H A;  3HG9 A;  2KOL A;  2C9C A;  2A6E D;  1V1P A;  1RCV D;  3A56 A;  5ELC A;  1OXT A;  2CHG A;  1QJO A;  1OXV A;  3SMP A;  1HQC A;  4JYA M;  1KFV A;  4AZF A;  1S5D D;  4MGK E;  3K8Z A;  5KQ8 A;  3KP1 E;  1E0B A;  3PUY A;  1IKM A;  1A2U A;  3K92 A;  2C5C A;  1B2T A;  2AQ2 B;  1PFN A;  3AKZ A;  1OXS C;  2PZU A;  3Q23 A;  3QG1 A;  1TGU A;  5A35 A;  5KQD A;  3MAQ A;  2CQA A;  3NWS A;  1B4O A;  1S4Z A;  3BVZ A;  3QIA A;  2JE6 I;  1JQJ C;  2XN9 C;  3ONA B;  1EY6 A;  3L7Z C;  3EIH A;  3NTK A;  1PTO H;  5BN5 A;  2RBM A;  4OL7 A;  5JEA J;  1NSN S;  2UXD M;  2H1R A;  1X32 A;  1WD1 A;  3KW6 A;  2QP9 X;  2IJ0 A;  2YFQ A;  2XFS A;  4FWD A;  1YUB A;  3FEW X;  1MI2 A;  5I6W A;  2E2J B;  2K32 A;  2KA6 B;  2J7Z A;  4DAV A;  1VMP A;  4LJZ C;  1NSF A;  4MN3 A;  3V96 A;  4FO2 A;  4XT1 B;  5DEH A;  2IPK D;  4G6Z A;  3VDU A;  5C4X B;  4HL4 A;  3WHK A;  3NPP A;  1NY5 A;  5CBE E;  3NBI A;  2BOS A;  1ZQ9 A;  3SC3 A;  1ONL A;  1A2T A;  2KCC A;  2KZS A;  1DOK A;  1TVX A;  1KAA A;  2F5Q A;  3D31 A;  3Q0A A;  4FP5 D;  4X3T A;  2O5I C;  2EZV A;  4EQP A;  2IX3 A;  1DM0 B;  1M4V A;  3SK8 A;  1Z5B A;  2L9H A;  2DHR A;  4ME5 A;  1TWH B;  4LGY A;  3GP7 A;  4DUY M;  3AB9 A;  3R93 A;  1K83 B;  2JA5 B;  4PDG A;  1SYF A;  1B3A A;  1KLU D;  3VR2 A;  1FNN A;  4CJ0 B;  3KOW E;  3KSJ A;  4K0K M;  3TL4 X;  3UI2 A;  1HHV A;  1TS4 A;  3U5Z A;  3HGB A;  5TSS A;  3SK6 A;  1SJH D;  1TU2 B;  3CHB D;  1PMR A;  1PDQ A;  1TS5 A;  4FCV A;  2Z8L A;  1FD7 D;  5IGD A;  1RD9 D;  3BVM A;  4I4L A;  3I91 A;  2R45 A;  3SXH A;  3KF8 A;  1HNZ M;  5KO3 A;  5C3E B;  1TWC B;  1PZJ D;  2KRK A;  2EY1 A;  4KHV A;  2UUC M;  4RNA A;  1VDD A;  3C2P A;  5IGB A;  2B2Y A;  3BOS A;  5DNF A;  3OOC A;  4B3R M;  2RSO A;  4LRS A;  2JXM B;  4ZKB B;  2R4E A;  3UJN A;  1NY6 A;  2F3V A;  1TH3 A;  1AP0 A;  5CV8 A;  1CT1 D;  3TDQ A;  2Y21 A;  5FTL A;  3L27 A;  2Z3X A;  4MGY E;  3GLH B;  1PM5 A;  5DM6 3;  2K6A A;  2YNM D;  3OPO A;  1EZ6 A;  3DA1 A;  3IG8 A;  1JR3 A;  3J7A F;  1Y69 U;  1CZG A;  1SXJ C;  2WAQ B;  5E4X A;  1O7Z A;  5G3L D;  4L4U A;  5ITY A;  2Z4I A;  3J7A V;  1Y8N B;  2SNS A;  2OF1 A;  4DR1 M;  5C44 B;  3KS4 A;  3JR4 A;  3FTF A;  5EJC A;  1WD0 A;  1LTI D;  1IYV A;  1O80 A;  1SYB A;  2QPA A;  1Q3L A;  2DY7 A;  2F0K A;  2Y0T A;  4R9W A;  3JR5 A;  4K5V A;  2TMP A;  2HL7 A;  3N52 A;  3T56 B;  4IQZ A;  2QDB A;  3U6D A;  2WKC A;  3NXW A;  4RCO A;  1JOR A;  1EL0 A;  3A7L A;  3DWA A;  1PRT C;  4HN7 A;  3S9W A;  4TRD A;  2EYM A;  1GKI A;  3OTO M;  5JPN C;  2K5Q A;  5KGU A;  4JK1 C;  1N32 M;  1SNP A;  2ZAO A;  3SAT A;  4CJ1 B;  5COY A;  4C3I G;  3G6J B;  1DD2 A;  4PV1 C;  2A73 B;  2QF7 A;  2Y0S B;  1IY0 A;  4IBG A;  1SJE D;  4L78 A;  1NCV A;  1ESR A;  2PW7 A;  3HJS A;  1L2B A;  2KXE A;  2JSO A;  5JEA H;  1C48 A;  3PV0 A;  1HA5 A;  3S1Q B;  2K1B A;  4AYB B;  3EJI A;  5T1I A;  1V43 A;  4IFD J;  3FDT A;  1ENF A;  4RHR A;  3K1J A;  3QAU A;  2L5T A;  5E1F A;  3VYS A;  2EJG C;  3KS8 A;  1GJX A;  2EPB A;  5AFW A;  1KDB A;  3TP7 A;  4FW9 A;  2Y20 A;  3A42 A;  4LJA A;  2ID0 A;  1PRT B;  2CFO A;  4QNM A;  1A15 A;  3THG A;  3AL0 C;  1F2L A;  2NTT A;  1CHQ D;  4DUZ M;  2A68 D;  1E94 E;  4MGZ E;  1NNJ A;  4JI4 M;  3S1M B;  1B50 A;  2F0O A;  1H9K A;  1LAB A;  4F87 A;  2D9U A;  4KKS A;  3HHW A;  5ITQ A;  4LMQ D;  2N88 A;  4LJ7 A;  3J7Y W;  1SAP A;  4BS9 A;  1STA A;  1RTO A;  2EE1 A;  2DZN B;  1E9S A;  2B2W C;  1ILP A;  3OHX C;  1JWS D;  4G4Q A;  2QBY A;  3HJ8 A;  2J0T D;  3DMU A;  5EBD A;  3UZU A;  2JYO A;  4BB9 A;  1D5X C;  4LF4 M;  1QAO A;  2FHT A;  4K5X A;  3AOG A;  1QCB D;  2F0V A;  4TSS A;  2L7H A;  3GD7 A;  2A74 C;  4QB4 A;  1PRT F;  2RDF A;  5H37 D;  4Z9C B;  3LNN A;  3H0G B;  3P7J A;  5CMD A;  2RKS A;  1LV9 A;  4RGT A;  5M3M B;  5KYL A;  4AW4 A;  1BNZ A;  3NQI A;  4ID6 A;  4A3E B;  2L11 A;  5FOB B;  3QB3 A;  3K58 A;  2VQE M;  5KNB A;  3U6M A;  1QNU A;  4IJE A;  2KVM A;  3J80 E;  1DXM A;  2NN6 I;  3OWF A;  4O42 A;  4D80 A;  2PMZ B;  2DWM A;  4A3G B;  3A46 A;  4ZUJ A;  4GC5 A;  4FCW A;  3C58 A;  4FXD A;  4ZUI A;  4BWG B;  2J4X A;  2MJ8 A;  5C5L A;  4AKI A;  1XWE A;  3SVM A;  1Q1B A;  2IT1 A;  4FNF A;  4IUR A;  1WTW A;  4M9X A;  1DGF A;  2CEA A;  4OVZ A;  3GPX A;  2EYF A;  3AOE C;  5LMN M;  1DOM A;  1I4G A;  1IXZ A;  1NHG C;  3M85 A;  5GKN A;  1PFB A;  1G6Z A;  2EY5 A;  5EP3 A;  5KRU A;  3GTM B;  2R46 A;  5CV5 A;  1AEX A;  2JA6 B;  2HQE A;  3K5L A;  2B2T C;  4II7 A;  3FUV A;  4CKE A;  3J81 L;  4DV0 M;  2MP1 A;  4ZKC B;  1BUV T;  3IL8 A;  2WII B;  5NUC A;  4NP5 A;  1IBK M;  2MUY A;  3GLI A;  3L29 A;  3TPZ A;  1R9T B;  4FYD A;  3RE8 A;  2E2D C;  2YU9 B;  1FYC A;  1LT3 D;  2JA8 B;  3SAS A;  2L55 A;  4N9P A;  4IUN A;  1TQO A;  4PD2 A;  4PMC A;  4AI6 A;  4KKU A;  1QZM A;  3HRZ C;  3Q8X A;  1JOK A;  3V05 A;  4M0W A;  5E3F A;  1IW7 D;  3AFH A;  5J22 A;  3P1H A;  5I9P A;  1X3Q A;  3IG5 A;  2FJ2 A;  1CM9 A;  1Y1W B;  1TY2 A;  3S2D B;  4HAE A;  2E75 C;  1F2M A;  3PO3 B;  2IWH A;  3GO8 A;  3T53 B;  1CZW A;  1A3V A;  2VXW A;  4FD2 A;  3ZCB B;  2BE5 C;  4NMZ A;  5ISR A;  1H9J A;  3RZO B;  1V8Q A;  2PZW A;  3ZH9 B;  4NSO B;  1Z5C A;  1CI3 M;  3GV3 A;  4EVO A;  3P75 A;  4IBE A;  4KY7 A;  3CTW B;  3MA2 B;  2M5Z A;  4AG5 A;  3K59 A;  5ITX E;  1E2V A;  1PRT D;  3RGP A;  4HTH A;  1ML0 D;  3NBH A;  2F5N A;  1UUP A;  1II3 A;  2E2H B;  4F88 A;  4NKL A;  3H09 A;  2VB2 X;  1FGB D;  3KLS A;  4LJ8 A;  4KJO A;  3BDO A;  1JCK B;  4LG2 A;  1IHZ A;  3DOA A;  1SBB B;  1QVR A;  3RGS A;  1XXG A;  1XXH A;  1EQT A;  3FPP A;  5C3X A;  1R2Y A;  2EA0 A;  1K3W A;  4LFA M;  5EXT A;  1OXX K;  5K36 H;  4ZYS A;  4A93 B;  4XDX A;  5C1B A;  1L0X B;  2ZT9 C;  2L7I A;  3K5O A;  3QJY A;  5K36 G;  4IJF A;  3G7L A;  3GTJ B;  4PMW A;  3LWE A;  1R4Q B;  1KNA A;  2B2U C;  4K6L A;  4YIJ A;  3GPP A;  3KBX A;  1IY1 A;  1CA6 A;  1EYC A;  3PMF A;  1I94 M;  3CKI B;  2F0D A;  2LWX A;  4V19 0;  3GLF B;  2K04 A;  1QWY A;  3MXU A;  4LJ6 A;  2B2W A;  5IOC A;  5D14 A;  3CF6 E;  3GPU A;  3TN2 A;  3S16 B;  4IUU A;  2QCU A;  2X4A A;  5CR3 A;  2OPF A;  3L3O C;  5EGT A;  1ZAE A;  2R18 A;  5FTM A;  5M5X B;  3VKG A;  4NW2 A;  2NTS A;  5CV6 A;  4KD3 A;  2FFK B;  3A98 B;  1O7L A;  3MXN A;  2AWN A;  4IUV A;  1GL6 A;  2CV0 A;  1BCP C;  4FF2 A;  4LF8 M;  3U6C A;  1V1P B;  4B7G A;  4IBD A;  3HOY B;  3AU7 A;  3B9P A;  5JPM C;  2NVY B;  3I4Y A;  4B3S M;  2NVQ B;  4JI2 M;  2K01 A;  5IT9 E;  1SMY D;  3VR6 A;  1D5M C;  5FTK A;  3HJQ A;  4GMQ A;  2I7P A;  5EP2 A;  1SND A;  4EQN A;  2OEO A;  2ZXO A;  3TME A;  2XLJ A;  3S15 B;  3WHL A;  4DXG A;  2F0F A;  1FNV A;  1UEA B;  2PCF B;  1EZ8 A;  1AZQ A;  3SHG B;  3PIP 3;  2D5D A;  2JA2 A;  3GV6 A;  3CF0 A;  5EP4 A;  4NL4 H;  1YE9 A;  1BQQ T;  1ENC A;  4H7B A;  2BE5 D;  3T13 A;  1SE3 A;  2MHV A;  2A5Y B;  3URY A;  1Z5A A;  2L09 A;  5CGK A;  3FYC A;  3MXP A;  1D1K A;  5I2Y A;  2PQE A;  1FNU A;  1AN8 A;  1ZYR D;  4A3M B;  2XSC A;  3R8B A;  5A2Q E;  4ZLT F;  3JAM L;  2K47 A;  4HED A;  3OMC A;  4PT5 A;  3NWL A;  1I4X A;  1IN4 A;  1XNR M;  3M6A A;  1R4P B;  5KYI A;  5C6A A;  2EYL A;  1QYR A;  2K5W A;  2XWJ B;  3QOJ A;  3DWQ A;  2C98 A;  1VDZ A;  2RKO A;  1G4A E;  1RKN A;  1PXU A;  1JE4 A;  5FK9 C;  4FCT A;  5EJW A;  2UXC M;  5JEA G;  1W6J A;  2BA1 A;  5EXP A;  2RQX A;  5EBC A;  3EIE A;  3PFI A;  4OW0 A;  4X3U A;  3NTH A;  4L8J A;  2LFN A;  3KLS X;  3ZC7 B;  4OHJ A;  2UUA M;  1JIC A;  3KSX A;  1H9M A;  3WOF A;  4CJ2 C;  1W6K A;  4RWS C;  4H44 C;  2HCB A;  2R65 A;  2CV2 A;  5BN4 A;  4IBC A;  2A6E C;  2EY6 A;  3NQT A;  4IBJ A;  1HTP A;  4EIW A;  1STH A;  4DGZ A;  4C3J B;  1IM2 A;  3MC0 B;  5CYU A;  1SFO B;  5EXS A;  1JQY D;  2O5R A;  4LRT A;  5CBA E;  1IKL A;  4MB7 A;  3CQZ B;  2A5H A;  5J1Z A;  2Q8T A;  2ERC A;  1IW7 C;  2TSS A;  2B39 A;  3DZD A;  1SXT A;  4ZRZ A;  3RFW A;  1AFP A;  1SXJ A;  4H0L C;  2NUC A;  1XTC D;  4NRV A;  2LS0 1;  2A69 D;  1RTN A;  4IIW A;  3QOL A;  1SXJ E;  1STE A;  1OFI A;  5A2Q L;  3HP3 A;  3GRV A;  3GTK B;  1GHK A;  1BR9 A;  3U6Q A;  4FXG C;  4IFD G;  1LO5 D;  2E5L M;  4CBV A;  1HUM A;  3VR5 A;  2EJF C;  3VR4 A;  2ZBK B;  4K14 A;  3NHH A;  3KLR A;  3GRY A;  1WTR A;  4BA2 I;  3VLF B;  4X65 M;  4P16 A;  1WVL A;  1MSH A;  2R6G A;  3T4A C;  4LJ9 A;  1LLR D;  3KFU G;  4L15 A;  2IX0 A;  2EUC A;  3S1N B;  3R3O A;  4D81 A;  5IRE B;  1PTO F;  1UAP A;  4GKK M;  5ELD A;  2OQ4 A;  3ITP A;  3HS0 C;  4JI7 M;  3P20 A;  2Z7J A;  2F4I A;  5LMU M;  1IBM M;  4DXF A;  3ERQ A;  4HMI A;  1WTP A;  3HOX B;  3GQ5 A;  1GUO A;  1DGB A;  1A3U A;  2DN8 A;  4M9Z A;  4CHT B;  1SE4 A;  2M60 A;  3U60 B;  1Z7T A;  3CU7 A;  2EO2 A;  4OX9 M;  3SK5 A;  1X37 A;  4B3T M;  2LXE A;  3L28 A;  2LNH C;  4ITQ A;  2WKD A;  2HCC A;  2V1U A;  4C3I B;  3J80 S;  5ELB A;  3HGI A;  5IWA M;  4LGM A;  1STG A;  1DZ1 A;  3M0E A;  5CV7 A;  5IOD A;  1PTO B;  4DV7 M;  1EYA A;  2KCN A;  4R8N A;  1G29 1;  4AQY M;  4S3S A;  5ITT A;  5EPL A;  1NUC A;  2DWL A;  2KA7 A;  1IY2 A;  4OO1 I;  4DFA A;  3SR1 A;  2B8F A;  3HHZ A;  2K5D A;  1QOH A;  1EY8 A;  1G8Z D;  1LT6 D;  2L12 A;  3U6P A;  3MEH A;  1ICW A;  4F7X A;  3T38 A;  3J7B A;  3NSW A;  2XF3 A;  1KDC A;  5D65 A;  4G4O A;  1I4R A;  3KP0 E;  1TWA B;  1C1K A;  2D2C C;  3SHL A;  2N55 A;  2XSZ D;  3A7A B;  1I4P A;  2R62 A;  1JOO A;  2NYZ D;  1IXS B;  1SMY C;  4ZQ3 A;  1TWG B;  3R8F A;  3U6O A;  2MPM A;  1MU5 A;  1D1I A;  1BBX C;  1BO0 A;  1NJG A;  2RDG A;  2R93 B;  3W0F A;  4DAP A;  5F3W A;  2OT2 A;  1UM8 A;  3IFD A;  3A55 A;  5M3F B;  4I65 A;  1CFM A;  2W82 A;  2YR0 A;  3NUC A;  3PIO 3;  4K2K A;  1K3X A;  4PNY A;  2F0W A;  1OFH A;  4G57 A;  4DV4 M;  1XXH B;  5EQT A;  2G8L A;  3SMS A;  4JI3 M;  4LZZ A;  1E2W A;  4A3D B;  1ILQ A;  4A3I B;  2K28 A;  5IGC A;  1QB5 D;  3VK8 A;  3MVV A;  2I46 A;  4RKB A;  3HOV B;  3NTI A;  2X6L A;  3VDP A;  5FLX E;  3K6O A;  3QWN A;  3AOE A;  1LT4 D;  2CHV A;  1PZI D;  4QIW B;  4M9S A;  2ICE C;  3GQ3 A;  4IUQ A;  3KUP A;  4I7Z C;  2ZM6 M;  3E0J A;  3M4Y A;  2SNM A;  2NBF A;  1TY0 A;  3I51 A;  1SNM A;  2BDN A;  2NB0 A;  4AG6 A;  1JWU D;  4KTA A;  4X3S A;  3X3M A;  1AW7 A;  4NDX A;  4D82 A;  1QAM A;  4IBI A;  1J09 A;  5JJZ A;  4ZK9 B;  1KLG D;  4M1U B;  3HWS A;  3ND8 A;  1STB A;  5ELF A;  4LF7 M;  3NP8 A;  1SEB D;  4NOO B;  4HSP A;  3D6C A;  3A8J E;  3X3N A;  1CQF A;  1HTL D;  3U9S A;  1B9M A;  4XGI A;  2EYP A;  4GHL A;  2KJX A;  1EOT A;  2F0Q A;  5JVG 3;  3EVQ A;  1JR0 D;  4QHT A;  2F0P A;  2LMC B;  4L6T B;  2EVB A;  3U60 A;  2EY2 A;  4J1M A;  2V6Z M;  1H9R A;  4KKT A;  1IN5 A;  1RF2 D;  5C0X G;  5E6J A;  4DV2 M;  4XYO A;  4GIT A;  3D4R A;  1BXT A;  1S5F D;  1IL8 A;  3TQS A;  1Z59 A;  2EYJ A;  5IGE A;  1TH4 A;  5C4Z A;  4XXE A;  3S14 B;  3H6M A;  3U9O A;  4JI0 M;  4KV6 A;  2FNA A;  4C3H G;  4YY3 M;  1S3S A;  3FKI B;  1TH2 A;  3L2A A;  1OJL A;  1VMC A;  3C1E A;  3HHY A;  3M7N A;  3DM1 A;  2O2L D;  1NHW C;  3TP5 A;  1IN6 A;  4L16 A;  1HQY E;  1TDZ A;  2D7G A;  1I4Q A;  2PPB C;  3OIQ A;  3CRK C;  4KD4 A;  2UU9 M;  4MGI E;  2L1B A;  3BVG A;  1M8A A;  3GRU A;  3A54 A;  3MXG A;  7CAT A;  3J81 E;  3IAY A;  5ITX A;  1MD2 D;  3L25 A;  1SYG A;  4LF9 M;  2A69 C;  5HGT A;  5DM7 3;  1B53 A;  3OIP A;  1G2T A;  3VK7 A;  3FMC A;  3I70 A;  3M7G A;  2K03 A;  2SOB A;  5KEE A;  3SDZ A;  1H9S A;  2VII A;  2AWO A;  1GUT A;  2VQF M;  4BLC A;  4CIS A;  3RUZ A;  1H6U A;  3VYR A;  4FF4 A;  2BA0 A;  2XRQ D;  3MHV C;  2XFT A;  1LTS D;  2OXP A;  1Q8I A;  3MWY W;  2B63 B;  2E2I B;  1DJR D;  4DK0 A;  3KXE C;  2KED A;  5FLX L;  1N77 A;  4QUC A;  4B9W A;  3I4N B;  3D8L A;  4E6I A;  3MZ5 A;  3LVW A;  3LMM A;  1Q3C A;  5BR8 M;  1QNK A;  4B08 A;  1J9O A;  2ZXP A;  5G3L F;  4ULL A;  1N75 A;  4DA2 A;  2A6H C;  3IKJ A;  5DYG A;  3SFZ A;  2JP1 A;  3OW7 A;  3FRP B;  5C18 A;  2JA7 B;  2VB3 X;  5FTJ A;  4BBA A;  4DNT B;  2NZ1 D;  2XSZ A;  1E9R A;  3J81 S;  2UXB M;  4L63 B;  4UAI A;  1F9S A;  3NE5 B;  2IX1 A;  4KHZ A;  4OIK A;  2XRS D;  3F2U A;  1TDH A;  1J7K A;  2F1M A;  3GQB A;  3E9S A;  2Q8R E;  4CKB A;  2HUG A;  4IBF A;  1Q1E A;  4EGV A;  4M0D A;  3VFD A;  3D8B A;  3SAR A;  1YNJ D;  5I2X A;  4JV5 M;  2VUM B;  1GHJ A;  1I4H A;  1WTV A;  3K5M A;  3A8I E;  3TZU A;  2F5P A;  5LL6 X;  2R4J A;  1DON A;  2NWG A;  4EQO A;  3J7A S;  5KIX A;  1RDP D;  5T1G A;  1F2Y A;  4B3M M;  5K5P A;  2KUM A;  5ITU A;  3DEO A;  4S12 A;  2K05 A;  1L0Y B;  3D6W A;  2EDG A;  4K6D A;  3VKH A;  2F0H A;  3LQR A;  3K57 A;  4C1N K;  4IFD I;  3FUT A;  3TE6 A;  2Q8I B;  3D4W A;  4B7H A;  4FVM A;  3GTQ B;  1XWI A;  1BCP F;  1XMQ M;  1R2Z A;  2B8G A;  3RLF A;  4GZY C;  2PNR C;  3U5Z B;  2HCI A;  2V1C A;  2PZT A;  1LTR D;  2KQ3 A;  1KSF X;  2AQ3 B;  4LZJ A;  1EY0 A;  3C46 A;  1DYQ A;  3VYT A;  1ET6 A;  4JI8 M;  1EE8 A;  3VR3 A;  1G2S A;  3UMM A;  1B44 D;  3U6E A;  4G7H C;  1EIH A;  1I6V C;  2WV6 D;  2XZU A;  1SNQ A;  3D3R A;  5EKI A;  3K5N A;  4JI5 M;  3DFZ A;  4G4K A;  4A3B B;  4DR5 M;  3WOE A;  3K7A B;  2FE8 A;  4NXM M;  3Q6S A;  1CTM A;  5C0X I;  4GRI A;  1A3T A;  5LL6 S;  5D3I B;  2Q2E B;  3W3A A;  5LHY 1;  4BBR B;  4K5W A;  2RSN A;  3MFG A;  4Q0F A;  1KAB A;  1K82 A;  1JOQ A;  1TS3 A;  4QOZ C;  4G7O C;  3GLH A;  4CKC A;  1T3T A;  2F0N A;  5A2Q S;  1SE2 A;  4TKO B;  5J39 A;  1L2C A;  3J2P B;  4IBK A;  4KLN A;  3VYU A;  1NJF A;  2KEB A;  1H9S B;  1G41 A;  1WTO A;  2ENB A;  1ET9 A;  1L2D A;  4IAL A;  4LF5 M;  4MIU A;  1L8Q A;  3TP6 A;  5DAU A;  4DR3 M;  2ZAN A;  1LTB D;  1LTG D;  1L1Z A;  4QHS A;  2F3W A;  3K0Y A;  1NNU C;  2ICI A;  2DWZ B;  4IN3 A;  4HLQ A;  1NR4 A;  2B2U A;  1AZP A;  4HCS A;  3FTD A;  4REZ A;  4JI6 M;  1CK1 A;  2R61 A;  5IZ7 D;  4LFC M;  2NVX B;  3GTO B;  5C0X H;  4KK7 A;  3J27 B;  3KOX E;  4I8O A;  4G4N A;  4LK1 C;  2AUK A;  4FWG A;  2ZAM A;  1EEI D;  3PO2 B;  1Y1V B;  1FJG M;  2EJM A;  2BJV A;  2F5O A;  3QWL A;  1GUG A;  4X62 M;  1L1T A;  3PXG A;  1ORY B;  1IN7 A;  1I4W A;  3BDL A;  2DNC A;  1Q90 A;  2R3Z A;  2WB1 B;  2AUJ D;  1A6X A;  3EFX D;  2HKJ A;  2O5J C;  3PUV A;  5CC4 A;  1EY4 A;  4UDU C;  1SYE A;  3D8G A;  1EU3 A;  1IN8 A;  3AMU A;  2D7E A;  2WAC A;  1GUS A;  2F0S A;  1R7R A;  3UGJ A;  1G91 A;  3HZX A;  5BPV A;  5FO7 B;  4RA8 A;  2RDH A;  1U4R A;  3HU3 A;  2PO4 A;  5DYI A;  5IGG A;  2C96 A;  2F03 A;  4JI1 M;  1GXD C;  5FTN A;  3SYL A;  1T5E A;  4RKL A;  2LH0 A;  1HRJ A;  4QUF A;  4XQN A;  2XWB B;  1KYI A;  1SYC A;  1W5T A;  2K7V A;  4O1N A;  2KRU A;  4H13 C;  2BDO A;  4DU9 A;  1HFG A;  1SYD A;  1T5X D;  2F0U A;  1U4L A;  4DF7 A;  4NSR A;  4FXK C;  3SAU A;  4CGY B;  2QIL A;  4DR2 M;  2DNE A;  1MGS A;  4RCN A;  4AKH A;  1KTK A;  4KY5 A;  5KNC A;  4A3K B;  1HNW M;  4A3V B;  4KN4 C;  4MH0 E;  3TWL A;  1ROD A;  3GO5 A;  5ELE A;  2IL8 A;  1QG7 A;  4TUW A;  3FPU B;  1YSY A;  2L0C A;  4I5S A;  1Q3B A;  5FSW A;  2IW3 A;  3LVV A;  1IQP A;  3C1F A;  1E2Z A;  2NN6 G;  2Y0Q A;  4DV5 M;  2DWN A;  5FO9 B;  4OU7 A;  4DR4 M;  4KN7 C;  1Z6T A;  1VCI A;  2G9H D;  3HOZ B;  4U67 3;  3DHQ A;  1SXJ B;  2LKV A;  1LTA D;  4RF0 A;  3TZD A;  4X64 M;  2HDL A;  4JBW A;  2R7Z B;  1TR5 A;  4DV3 M;  1JB3 A;  1D2N A;  4RFB A;  3GLG A;  2KZU A;  1DCZ A;  1EYD A;  3ZYY X;  1U9R A;  1QAQ A;  4N9T A;  5EPJ A;  4Q5V A;  4BA1 I;  4XQJ A;  3SEB A;  1EY9 A;  1O78 A;  2I7N A;  4HR7 B;  2EYH A;  3GPY A;  2QZ4 A;  3AV0 A;  1YNJ C;  3M4O B;  3TBI B;  1XHB A;  2B2T A;  3BYY B;  4Z8X A;  1PTO D;  4TQU S;  1LV7 A;  3MK6 A;  4RGN A;  4LJ4 A;  5JI2 E;  2A6H D;  3E4R A;  1N78 A;  1YNN C;  1ZYR C;  3H3V C;  3T15 A;  5FLX S;  3I3C A;  4GKJ M;  3LX0 A;  1DGG A;  1WTX A;  3DEP A;  4BY7 B;  3Q22 A;  2CW0 D;  3MJ5 A;  1TKW B;  1CQV A;  1XX8 A;  1S5E D;  3S1R B;  3DUZ A;  1MBY A;  1HFN A;  4QCL A;  3EA6 A;  1QQW A;  2C5R A;  1HCZ A;  1CHP D;  3MFY A;  5M5W B;  2L4N A;  4K2L A;  3HOU B;  2FFJ A;  1RHP A;  4LY6 A;  2EOT A;  2PYK A;  2F0M A;  4C56 C;  3UK6 A;  4OVZ B;  4V0B A;  2BCO A;  4XYQ A;  1Y8O B;  3HOW B;  3HHX A;  2EXZ A;  2J7N A;  3HU1 A;  3GLF A;  3H4M A;  4LCB A;  1DGH A;  2NQ8 C;  1TII D;  4C3J G;  3TWM A;  3AJI B;  4KOD A;  2G5G X;  2A68 C;  3T51 B;  1ZXT A;  3JAM E;  4DN4 M;  3BS1 A;  2YQZ A;  5EKK A;  3W0L B;  1JR3 D;  2KW0 A;  1Q39 A;  1XMO M;  1DOL A;  5FKA C;  2QCP X;  4RHS A;  4RF1 A;  3I72 A;  1G59 A;  4WJW A;  3U6S A;  5D3D A;  3NK9 A;  4WUR A;  2X69 A;  2XIW A;  1ENA A;  1LAC A;  3DXJ C;  1BF4 A;  5FO8 B;  2WIN B;  4JXJ A;  2M9V A;  3U61 A;  1G8P A;  3SAV A;  1EQV A;  3SE0 A;  3HEJ A;  1TT2 A;  3SAW A;  2F0I A;  4OIJ A;  4YHH M;  4MGH A;  5F2D A;  1SDF A;  4R8I A;  3O13 A;  4I81 A;  4L8R C;  2F0T A;  1O7Y A;  2DZO B;  5IT9 S;  1EIG A;  2Z4H A;  1QAN A;  1HT2 E;  2XEP A;  4LF6 M;  3KOY E;  5M9O A;  4FF3 A;  1D6E C;  3PNV A;  3DWP A;  3LQQ A;  5C5M A;  2I07 B;  5CV4 A;  3KK7 A;  2FIN B;  3SK4 A;  2M2L A;  3GRR A;  4KMU C;  2F0J A;  3J80 L;  2JEA I;  3GTG B;  3FVQ A;  1KDA A;  5DNY A;  2VNU D;  2QEN A;  2E74 C;  1SNC A;  5JOB A;  4BY1 B;  4RH6 A;  3RD4 A;  1B9N A;  3PUX A;  5KPR A;  4PDI A;  4IBB A;  3GTL B;  3NWT A;  4RAU C;  1S5C D;  4DR6 M;  3ILK A;  1I6H B;  4OGQ C;  1R6B X;  1PJI A;  4DV1 M;  4WOR A;  1W5S A;  4U68 A;  3HKP A;  3WDN A;  5I9O A;  3IFT A;  3KOZ E;  4XTC S;  3Q24 A;  1KNE A;  4F8M A;  4G4R A;  5I4D A;  2H1E A;  2XZF A;  3D4D A;  5COR A;  4KY6 A;  1EY5 A;  3W2D A;  1PLF A;  1EU4 A;  2CHB D;  2AHM A;  3FUU A;  1VF7 A;  1YNN D;  3R2T A;  3H91 A;  1EWC A;  1Y8P B;  5JAV A;  2KEE A;  2BNK A;  3U6L A;  4KI0 A;  2E76 C;  1DO0 A;  1BCP B;  3L26 A;  1EEF D;  4ABN A;  2D62 A;  2XVS A;  1F77 A;  4A3F B;  5EQ0 A;  1QE6 A;  2YYZ A;  5I6Y A;  1F2Z A;  2QEJ C;  4GIP A;  5CV9 A;  4NXN M;  5EPK A;  2K33 A;  2Z1C A;  4DNR B;  5E26 A;  3T1H M;  3TSS A;  3I4V A;  2HDM A;  4C3H B;  2NN6 H;  2DVW B;  3ERO A;  4XIG S;  3A45 A;  3SYK A;  4WW0 A;  5IT9 L;  4OO1 G;  4QNR A;  4R3D A;  3FKE A;  1G3I A;  3CF2 A;  4ODG A;  2BJW A;  1B1Z A;  4IUT A;  1PYW D;  4FF1 A;  3OWE B;  5EP1 A;  1XYI A;  1TWF B;  2P5T A;  2ZXR A;  1QIL A;  2KEC A;  3BYT B;  3SBJ A;  1PZK D;  2F5S A;  1C8C A;  3V2T A;  4KJN A;  3FUW A;  3HKZ B;  3N6R A;  4LAA A;  3R2I A;  2LY7 A;  2B2Y C;  3FYD A;  3EQL C;  1N33 M;  3BDC A;  1WTQ A;  2X49 A;  4XT3 B;  5C0X J;  3S17 B;  1ZEQ X;  3I8Z A;  1VF5 C;  1STN A;  4P2C B;  3T16 A;  1OO9 B;  1I3Q B;  3FD9 A;  1D5Z C;  2MGS A;  1OXU A;  3K2L A;  4DV6 M;  2XH9 A;  2DY8 A;  3M3Y B;  5M5Y B;  1LT5 D;  5IGF A;  8CAT A;  3KDS E;  1UNS A;  3L9A X;  2FOI C;  1N36 M;  3U61 B;  1C4Q A;  4K8J A;  2RGH A;  2QBY B;  3OSO A;  3A8K E;  3PVS A;  1HXY D;  2Z4S A;  4C2M B;  2V4D A;  1JWM D;  3T1Y M;  1HNX M;  3RMH A;  1WCM B;  1CA5 A;  2M00 A;  4BBS B;  4XQQ A;  5C4J B;  4KO8 A;  5KPZ A;  4IUP A;  5JVH 3;  2CVR A;  2RA4 A;  4IZ8 A;  5BN3 A;  1GVN A;  4IFD H;  3KBG A;  2JEB I;  3S2H B;  1GL7 A;  4JN6 A;  1F9P A;  2O4X A;  1ESF A;  1D2B A;  3BZD B;  2L6O A;  1BDO A;  4NRW A;  4J8Q A;  5C3W A;  4MM3 B;  2F0E A;  1HA6 A;  4OO1 H;  1F9R A;  1EFI D;  1PTO C;  2H4O A;  5IIF A;  4DAY A;  1MX0 A;  1DO2 A;  1IBL M;  1HPC A;  1K8M A;  3PUZ A;  2GA4 B;  4ILW A;  1EWH A;  3GQ4 A;  3TP8 A;  4X66 M;  5EKL A;  4WFN 3;  1NAP A;  3I4M B;  1F9Q A;  1GUW A;  2UUB M;  2R92 B;  3JAM S;  1GOZ A;  2CW0 C;  4QF4 A;  1X3P A;  1FR3 A;  1STY A;  2Z4R A;  2RVL A;  2F4V M;  3FTE A;  1V1O A;  1EY7 A;  4LJ5 A;  2CV1 A;  2PW5 A;  2CE7 A;  2F0G A;  3QO2 A;  4G7Z C;  4HSV A;  1N34 M;  3GLG B;  2DXI A;  1BCP D;  1HUN A;  4K8I A;  2RGO A;  3VA7 A;  1NVM A;  1IYU A;  5EXX A;  1SSO A;  3LWU A;  3BG3 A;  2D7H A;  5JI3 E;  5KPT A;  4X3K A;  2CUZ A;  3PUW A;  2J7O A;  4PQX A;  4ZAI A;  2FMC A;  1Z6H A;  3E6Z X;  1S5B D;  2HHH M;  3C3L A;  2SEB D;  1Z47 A;  3SHF A;  3OMG A;  2QKI C;  3H94 A;  3VA5 A;  4DK1 A;  2XNA C;  4GH9 A;  3KVW A;  1SXJ D;  4RGM A;  2X8A A;  1DGH B;  1HQM C;  4C1N I;  1XC8 A;  4J6H A;  1FNW A;  4KHP M;  3RZD B;  3GLI B;  1WXQ A;  4DR7 M;  3HU2 A;  1I50 B;  1U4P A;  1ZKO A;  1RJT A;  2X6G A;  2WP8 J;  2EYO A;  4PCZ A;  1BOS A;  1JC7 A;  1GUN A;  4GC9 A;  3R9X B;  4XBO A;  2C9O A;  4B7F A;  2AQ1 B;  1J8I A;  4MHE A;  2CHQ A;  2XGN A;  4Y7N B;  3TWK A;  2FMM A;  4WRD A;  4R7G A;  4LFB M;  3CRL C;  1LTT D;  1NR2 A;  1HQR D;  2F0L A;  1IXR C;  4Z6Y A;  3MTS A;  4QOS A;  4B9X A;  2B2V A;  2NVT B;  2SDF A;  3FTC A;  1U4M A;  5KND A;  3I4L A;  4ZPX A;  1J5E M;  3MHB A;  3PNY A;  2G9D A;  3FUX A;  3ND9 A;  1Q12 A;  1MSG A;  1GLN A;  4HCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...