4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna replication/isomerase
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CGYB 4CHTB 3NBIA
chains in the Genus database with same CATH superfamily
2GN5A 1YNJD 3S16B 5C4XH 2K05A 1MSGA 2UUAQ 3QJYA 4C3HB 4CDEC 3D31A 3GTJH 5I2YA 2OXPA 2OTLA 5E1FA 2R93G 2LMCB 4A3JB 4BA2I 1BDOA 1VQ4A 2PQAA 5CV6A 2KHIA 1K8OA 1LO5D 2MR9A 5EP1A 1JJCB 4JN6A 2EJFC 1W6JA 2KW0A 2JA6H 5L8RF 2BJWA 1JOQA 4Z8XA 5J3BA 4B3TQ 3M3YH 1Q12A 1IXRC 4A3JH 1DOLA 3S24A 1PYSB 1VQ1A 2UXCM 3B7ZA 3UK6A 3JAMi 4C56C 3P7JA 4DKAC 2PI2A 3HG9A 3K81C 1ZQ9A 3IAYA 3OTOL 2F1MA 2RHQB 2ZM6M 3K5MA 1BXTA 1CT1D 4RNAA 1S5DD 1IBLL 4A3GG 2ZXOA 4Q5VA 4DXFA 2I46A 3HOVG 2E2IH 5EP2A 1UNSA 2E76C 4ME5A 4P71A 2L12A 2OQ0A 4IBBA 1MJGM 4C2MH 4JI2M 1F2YA 4HIOA 4IBEA 1K9MC 1UE7A 5C4JH 1PH8A 2I7PA 2RHSB 4HJ7A 2MP1A 4RA8A 1DGFA 4LFCL 4GNXB 2Q2EB 2FS1A 1LTRD 2WACA 2A19A 1PRTC 4JI5Q 3I4MB 1TY0A 3T1HM 2WB1E 4JI3Q 1OXVA 3U4VA 1CQFA 2WKCA 1PH7A 3RZOH 1LYLA 3GO8A 4NSOB 1UFZA 3NBHB 3R8FA 4F8MA 2MGSA 4ILWA 2LBCA 4LK1C 1XNRQ 4ZK9B 4GNXA 4L63B 1VQ9A 1FL0A 3J7AF 2FINB 3F2CA 3THGA 3FTCA 5IP7G 4X65M 1IBKM 1K73C 3CC7A 1XXHB 1ET9A 2K75A 2RVLA 3A42A 3KUPA 4KY7A 1PRBA 1O7ZA 3RUZA 3SEBA 1IL8A 3G7LA 4B3RL 1Y1VG 3NBHA 2EXDA 4LG2A 3CHBD 5IYCH 1XTDA 3CKIB 3H4MA 2JXMB 2NQ8C 3GTKB 1Z9FA 2UXDL 1H95A 3RGPA 2YNMD 5M3MB 2MFIA 4FWGA 5C6AA 3AFHA 3E9IA 4NDXA 4HR7B 4HCSA 3KFUA 4G3OA 4LMQD 4ME3A 2VF7A 2R46A 4LFAL 1WGNA 3UDGA 2VQFL 1S72A 3STBC 1G8ZD 5T1GA 1VQGA 3CGWA 1EQRA 3TL4X 2KRUA 1TDHA 1YBYA 4R1JA 2NYZD 3GRYA 4LJ8A 3BZCA 3NTIA 1Y1WG 1XMOQ 1EY6A 2GVAA 2K4KA 5ITXE 2SEBD 5EQTA 5F2DA 2O5JC 3TZUA 2R7DA 3K7UC 3C1FA 2PZWA 1I4QA 1SNMA 5JEAJ 5KGUA 2LFNA 1K83B 4IFDG 2QGQA 4QIWE 1XNQQ 4BBRH 4PZ6A 2UUCL 2UXBL 3L2PA 3MAQA 1MGSA 5CYUA 1SFOH 1HA6A 3G4SA 1G6PA 3H0GH 4B3MM 4XQJA 4BBSH 1XMOM 3NBXX 3HJQA 1RF2D 2F0LA 3U6MA 1R4GA 3VK7A 2CWAA 1TXYA 3I4LA 1XNQM 1AH9A 4X66Q 4GLAC 4JW0A 1CSPA 1Q3BA 1R7RA 3MXGA 4P2CB 3PIOA 1G3IA 3CMAA 3HKZB 3Q6SA 4R4QA 4KT0F 2LSSA 2I5LX 4FF1A 3C3DA 4IQZA 2DY8A 2E2DC 2L15A 2E5LL 1LT5D 4QQBX 4QF4A 3T38A 5IWAQ 1G2TA 2CUZA 1GKIA 1HFGA 4AQYL 4X66M 3OYYA 1JT8A 4A3MB 4JK1C 4G7OC 2CHQA 1R4QB 1OAOC 2DNCA 2CWBA 1TWCH 3FUXA 5FTKA 4GKKL 3PO3G 1DJRD 2Q2HA 3C2PA 2NVQH 2K50A 2B3TA 4I5SA 3GDEA 5LMUQ 3G6EA 2QBYB 3HZJA 1CZGA 3FKIH 3RN5A 2K47A 1Q90A 4JI1Q 1TS4A 2HD3A 1VQFA 5ELNA 4FF2A 2XGNA 4XQQA 4OEMB 5A2QE 3F2DA 1S5ED 4FXDA 1F2MA 4A3DB 4FCTA 2O4XA 3CC2A 5FK9C 4FDBA 3MWYW 4E6IA 4JBKA 4RAUC 4BWGB 1QQWA 1D6EC 1B1ZA 4ANRA 3HWSA 1Y14B 3GP1A 1MU5A 1IN7A 3ILKA 4I65A 4BY1H 1N33L 2E8GA 1GXDC 1YNJC 5M5WH 1IY1A 1Y8OB 3K5LA 4WURA 1H9SA 2N88A 3T16A 1YJWA 4F2LA 3E46A 4PDIA 2WKDA 1I5FA 4KY6A 4B7HA 4DR3M 3TQSA 2XZUA 5I4DA 2I07B 3HOYB 3U9OA 2QILA 3PF4A 1GO3E 1NR2A 3FUTA 4YY3L 1F9SA 2FHTA 1K82A 3HFZB 3L3OC 1F2LA 4K8IA 1KTKA 4P17A 1K0SA 3B9PA 3A7AB 2MHVA 2F4IA 5KNDA 1RD9D 4YCWA 1SN8A 3K0XA 2L7IA 4NB3A 4WRDA 1WTVA 4IOAA 3H15A 1ZEQX 3I01M 2DWZB 2UUBQ 3GTMH 3MHVC 2B2TC 4X3UA 4IUUA 1N36L 3TPZA 1SR3A 4TVAB 2WP8J 2VQEL 3HOWB 3GRRA 4JI0M 1SE3A 5IP9G 2XWJB 2R7ZG 2DNAA 4KK7A 1JJGA 1EY5A 4GOPB 4WW0A 4Z9CB 1ILPA 1ZMWA 1PRTB 2VB2X 1JR3A 1QDTA 4I8OA 3OWFA 2KA7A 1QDRA 4NC6A 3S15B 2Z4IA 1DZ1A 1SNQA 3K6OA 4A3CH 1JR0D 3MFGA 4YHHM 4V0BA 2NUCA 2RDGA 3VYRA 4A93G 3A7LA 4IJHA 4GOPA 1VMPA 3NQIA 2IHEA 5KPTA 4TQUS 3U61B 3KF6B 3S2HB 1PH2A 3E4RA 4M9XA 2F5NA 1HZBA 1HQCA 3IRBA 2E2JB 3J81j 2NVTB 2AQ1B 5EXTA 1QVRA 3OTOQ 4Y28F 4HEDA 2B29A 1W2BA 1IBLQ 1AE3A 1EQVA 1LTBD 3RD4A 4AIMA 1TQOA 3HKPA 3P20A 4NW2A 1B9MA 3JAMS 5M5YH 4DV0M 1A0IA 1HZ9A 2PCFB 3FTEA 3S2HH 2OTJA 3ULJA 1YVCA 4QMGA 5C3XA 1WTQA 4BY7G 1SMYD 1GUGA 4NSRA 2ZXRA 3J80i 1WTOA 2R93B 1XHBA 1GHKA 1QUTA 1CTMA 3AQQA 3FUWA 4B3SQ 1GL6A 4DV4M 5EKKA 4DV6L 3GQ3A 2OPFA 2A6HD 3LCVB 4WJ3M 4IOCA 1HZAA 3DWAA 1I3QB 3K9OA 1HNZL 1NY4A 4LFCQ 4FF3A 2DAEA 3MK6A 1EEFD 2JA8G 5JJZA 2VS1A 1WJ7A 4C3IH 3M9BA 5FLXL 3Q8DA 3FKEA 1KAAA 3AOEC 3FRPB 4DV7M 3R9XB 4GC5A 3M7NA 1EFWA 3K1JA 3M7GA 3ULPA 4B3SM 2JJQA 3MHBA 4MIUA 1F4IA 4DR6L 3U5ZB 3JR4A 2BDOA 2KUMA 1TWAB 3S2DH 4DR7L 4A3GB 3E5SA 3EIVA 5BPVA 3HOVB 1RL2A 5ELBA 1AP0A 1VQNA 4AKGA 3M4OB 4HTHA 5T1IA 2PI2E 4MH0E 3IFDA 4JI7L 3VK8A 3TQYA 4A3EH 4A3FB 1UUPA 2DHRA 1YIJA 4A3KB 1J7KA 1EL0A 3U5ZA 4X64L 3J80L 2QNJA 4DV1L 3R2IA 2UXDQ 2CFOA 5IT9E 1LTID 1Z5CA 1ZMVA 2LHGA 1ET6A 5C4XG 4JV5L 4AKHA 3L0OA 4NXML 1A3UA 5E3FA 4RKLA 4XT1B 2KHJA 2OWOA 5EPLA 3CF0A 4LFAQ 1ZAEA 4HMJA 2VQFQ 4IUQA 3Q22A 1QNKA 2GNOA 3DWQA 4P75A 5ELOA 1QZEA 1GUSA 5IYDH 1F9QA 1BUVT 4FD2A 1IQPA 4C3HG 1H9KA 1V8QA 3K57A 1B2TA 1TH3A 2K04A 1EY7A 2DAGA 1J6QA 4AG5A 4A3JG 1PZJD 1TH4A 1F2ZA 1Y1VB 2UUCQ 2UXBQ 4MM3B 1LT4D 1VQOA 1S5CD 4RCOA 3CC4A 1WTWA 4AYBG 1SMXA 4PMWA 3S1QH 3I04M 5LMNW 5DAUA 2D2CC 1QILA 1PH4A 1PH6A 1HFNA 3PSIA 3PIP3 1SYEA 2QDLA 4LJZC 1TT2A 2K5VA 5EXXA 1HR0W 1PTOB 1UWVA 2J7ZA 1Q46A 4DAVA 3TSSA 3GLHA 1WR1B 2F0IA 2OOAA 4B7FA 1VF5C 1EIGA 1FR3A 3ZC7B 2IX0A 2AWNA 3KVWA 1OXXK 1SXTA 3AJIB 2DAMA 4RF0A 4GKJM 1DYQA 4HEOA 2E74C 1XTCD 1VQ7A 2Q2UA 2GQFA 3SYLA 2E5LQ 3HP3A 4H02A 1L2BA 4XK8F 1NAPA 4G4KA 1IBMM 2L4EA 4L5RC 4JI4Q 2DJFC 4JI6M 1STNA 7CATA 1NUCA 2G8LA 1GUOA 4P73A 2K6BA 1VEGA 1SNDA 4CKEA 1WD1A 4QUFA 1ENCA 1E9RA 4HSVA 3HOXB 2LVPC 3BYYB 4QCLA 3PCOB 3OW2A 3SASA 1SE8A 5HURA 5LMNL 1H9JA 2VW9A 4JI4M 2IX3A 2Q2IA 2EKKA 5IYCG 1E1OA 1WYDA 1HR0L 1NMFA 1AIPC 1NTGA 1N32L 2HHHL 1EZ6A 3A5ZB 3KF8B 4IALA 3CTWB 1X65A 3CU7A 3X3NA 3D4DA 1RDPD 1PRTF 1TWFH 4JOIA 2L1BA 4CISA 2KHHA 4XQNA 2F3WA 3ER0A 3KJPA 4NXNL 1N33Q 2KECA 3C46A 5JJLA 1YLAA 3S14B 1KAWA 1M90C 3KLSX 1D7QA 4FXGC 3PO3B 3K58A 5CV7A 1QOHA 3TN2A 1EIHA 3BJUA 3TE6A 4YY3Q 4LF6M 2ZANA 5E7NA 4L16A 2NTTA 5M5XH 3X3MA 2OQKA 1LT3D 3M0EA 3JC66 4DAPA 3T1YL 1XWEA 3VDUA 2DXIA 3A74A 3SHLA 1O78A 2JY8A 3GLIA 4BBRG 5ITUA 2CQOA 1HJPA 1CKNB 4OIJA 1T5XD 1HXYD 4F7XA 5KIXA 1QG7A 3VDPA 4YY3M 1WJJA 4GITA 1PJQA 3IHPA 3H6MA 4L6V6 3OHXC 5C5LA 2UU9M 3WOEA 4BBSG 2WINB 1PJTA 3DEPA 3FDTA 5EQ0A 1IFYA 1GKHA 2APLA 1JE4A 2VQEQ 1OAIA 1I4XA 4ZYSA 2I5HA 2HUGA 4DR2M 1STGA 1VQIA 2B2UA 3KLWA 4C1NK 3VKHA 1PH9A 3RLNA 4XYQA 4LJ6A 4CIZA 1SMYC 1CZWA 1EOVA 4OWTB 1LTAD 2V4DA 4DV5M 3Q0AA 1QB5D 1AFPA 3RN2A 3CW2C 2A6HC 4U673 2ICIA 1JR3D 3HU2A 3FVQA 4HLQA 2CCZA 4IJEA 1L1OB 1DGSA 3I90A 1C9OA 2HT1A 3QO2A 3HKZG 3TP6A 5C18A 2YV5A 1HTPA 3TDQA 5IGCA 5C0XI 2ID0A 1L0WA 1RTOA 1BOSA 1Q8IA 2E2HB 3ONAB 4R8NA 2Z4RA 4C3JH 4A3MG 1L1OA 2C9OA 3U6LA 1GVPA 1P8LA 2B2WA 1NJIC 1FJGM 2R7ZB 1D0LA 1Q3CA 1C48A 3NE5B 5JVG3 3GTOB 4K0KM 4IBJA 3NWLA 5FLXc 2PPBC 1KYIA 2HQEA 3BZDB 2F0SA 1VCIA 2JEAI 1CKMA 1STHA 4DV6Q 1GUTA 4DAYA 3DMUA 4KKTA 1HNZQ 1OJLA 1DXMA 4L8JA 3LNNA 2EDGA 4MB7A 1NBWA 4PG3A 4BY1G 4A93B 4HIKA 3NELA 1IM2A 5M9OA 4L78A 3GTLB 2G5DA 2JZ0A 2CV1A 1YE9A 2CHGA 3D4WA 2CRUA 2C5RA 1H6UA 4ZUIA 5J39A 2XF3A 3KDSE 1ORYB 3K59A 4G4NA 1TR8A 4DR7Q 1X37A 1PFMA 5KYLA 3ZQJA 1SJED 4LRTA 2HQLA 4JC0A 4DV3L 3MTSA 3Q24A 2AQ2B 4BY7B 1RU3A 3I8ZA 4JI7Q 2F03A 4CDDC 3K2LA 5BR8L 4L8RC 2PW7A 3GTGB 3CF5A 4X64Q 2JP1A 2X49A 3K8AA 4DV1Q 2KNVA 4K6DA 1G91A 3CF6E 3CF2A 5IZ7D 2XFSA 2KOLA 3I4NH 2F0FA 3A45A 4NXMQ 1MJCA 2JA8B 1VEKA 1GUWA 1HRJA 3OPOA 2EJGC 1HT2E 1Y8NB 2NVXB 3AOGA 1ZV1A 4C1NI 1SAPA 3JAME 4BBAA 1RKNA 4QHTA 3GRUA 3ZH9B 2K0BX 1VQBA 1LACA 2QHOB 2I7NA 1PDQA 1RODA 2J5YA 1RTNA 2K7VA 4IZ8A 1MN3A 3PGZA 3VYSA 4DUYL 4L5SA 2VUMB 3KJOA 4LAAA 2RA4A 3CAMA 4IUPA 2F3IA 2JQOA 3OOCA 1R9TH 2LHCA 1TGUA 2DN8A 2AQ3B 1E94E 2Y21A 4PDGA 2L55A 4FP5D 2V1CA 2Q8IB 3ZJYC 3PUXA 3VKGA 4JI8L 4PMCA 3W1BA 3FRHA 3F2UA 4NRVA 2M5ZA 4PV1C 4LF5L 3GTQB 1E2WA 1RCVD 1XPRA 3GLGA 1WOCA 3K92A 4LNQA 1K28A 4G4QA 5FJ8H 5J22A 2R61A 2N35A 2V1UA 1VQ6A 2QA4A 5FOBB 3GTJB 2TSSA 2F0GA 2QKIC 4K5XA 2BOSA 1SE2A 2PZTA 1E0BA 2EYFA 4WORA 1GOZA 3BBZA 2ES2A 1Y69U 1IHZA 2LTUA 4OU7A 2A5YB 1FD7D 3SMSA 3T4AC 4OELB 4D82A 2JA6B 2VF8A 2VZAA 1UAPA 2K14A 4C3IG 2KEDA 3BDOA 1HNWL 3M3YB 3CQZH 4LJAA 1AW7A 1A6XA 4U68A 3SVMA 5GAGC 2N8NA 1S3SA 2AUKA 4M0WA 2SNSA 4AYBB 1KDAA 1YHQA 2JYOA 2RSNA 1LUZA 2KDLA 3NBIA 1I4HA 2UUAM 2EY6A 3B74A 5FO8B 2JUJA 2R65A 3HRZC 1YITA 3DXJC 1N77A 2E2IB 4B7GA 1I94L 1SEBD 1WIVA 1PZID 5IT9S 1I4PA 2ZAOA 1FGBD 3SK6A 1IW7D 3OWEB 5LMNQ 1VQPA 3J7YW 3B6YA 2KJXA 5KYIA 4A3EG 3J7BA 1L0XB 4C2MB 2ZT9C 5ELCA 2XZFA 4K8JA 1HR0Q 5C4JB 1QYRA 1N32Q 2R62A 4B3TM 1XWIA 3OSOA 3ZCBB 2JA5H 3GLHE 2K03A 3T13A 1TS3A 4A3FG 4NXNQ 4XYOA 5ELFA 4A3KG 4LZJA 3RZOB 3V96A 2J7OA 2PO4A 3EJIA 2X6GA 2O5RA 2OOBA 5IYDG 4EIWA 1PFBA 1RIPA 4TKOB 1NMGA 1PM5A 4IBKA 2CH4W 3M4PA 1SG9A 1QNUA 3T1YQ 2ZJPA 2MGWA 1D2BA 2EYPA 1CSQA 3K9PA 2XIWA 1KNEA 1Z6TA 1X32A 2YFQA 1FNWA 4OHJA 2WIIB 4I4LA 1SXJB 2Y20A 2KCCA 3SHFA 4JI5M 1ZKOA 1B7YB 1WD0A 3HOZH 2WSFF 3IKJA 2Y0TA 4JI3M 5KO3A 3BVZA 3NTKA 2RF4A 4LF4Q 4D80A 4NRWA 1GJTA 1V1PA 3M4QA 3UE0A 5I9OA 3J7ZC 2EO2A 2Q8RE 3HHXA 1XNRM 3KOZE 3EA6A 4LZZA 1TWHH 4H44C 1SXJA 4CDCC 2WV6D 1YJ9A 4EQOA 4KV6A 3VA7A 1XPUA 1XXHA 1Q86C 5GQOA 2K5WA 2IWHA 3S1NH 4LF4M 4KKUA 1VQMA 2ASBA 2F0PA 4A3BH 1CKOA 4R4IA 2W82A 3FE3A 3L27A 4DF7A 2HCIA 3M6AA 2J4XA 1J5EL 1KDCA 5D14A 2D0OA 2F0VA 3J81L 4BBRB 3HGIA 1TS5A 2RKOA 4ZKBB 1DGBA 4DR4Q 1BO0A 2CHVA 1SFOB 4JYAL 5TSSA 2L2DA 2I0QA 3U9SA 3H0GB 4BBSB 4MGKE 1PH1A 3PF5A 3IG5A 1XMQL 3SMPA 4IFDJ 1Q39A 3GLIE 2ZXPA 1E2VA 2F5QA 2BCOA 1D5ZC 3EROA 3ZYYX 4HMIA 4DR4M 1KSFX 1X56A 4MGYE 1JICA 4QNRA 3I4YA 3AMUA 2Z4SA 5FTMA 2L9HA 3PNYA 3HOXG 4OWXB 2R0IA 5GAEC 5A35A 2FJ2A 3MZ5A 2XEPA 5AJ3L 2MJ8A 1BR9A 2EY2A 3K5NA 3LWEA 2VDBB 3FTDA 3D8LA 1VQ8A 3F92A 1EE8A 5M3FH 2O01F 1HA5A 2EJMA 1NO1A 1TWCB 2N3SA 3KLRA 2ZJRA 2BWEA 2L11A 4Q7JA 2HIXA 2PMZB 1SNCA 2NVQB 2V6ZM 1SRUA 1PZKD 3QG1A 4I7ZC 4A3IH 1B53A 2QQ8A 1D5MC 4LF7L 2Z4HA 3FKIB 4MGIE 2K1BA 3BVGA 1NE3A 2FXQA 3NUCA 1KXLA 1CQVA 5IGFA 4DV3Q 5BR8Q 3PIPA 4ID6A 5IWAM 5C3EH 1DV0A 5DYGA 3C3LA 4LUVA 1T9HA 2F0JA 2JA2A 2F4VL 1A2UA 1JQJC 4MTKA 4CDFC 4BY1B 4KI0A 3PO2H 1QAMA 2EYHA 2B8FA 2LY7A 4DR1Q 5M5WB 3I55A 1L2FA 4G57A 4JG2A 1ESRA 4K2KA 3MFYA 4DV2L 1FNVA 2JZ1A 3KDFB 5LMUM 2DY7A 2QBYA 1A63A 1QZHA 3U60B 5J1ZA 4JI1M 3GQBA 4FWDA 1U4RA 4DUYQ 1GLNA 4DR1M 5C0XH 3GLFB 1G51A 3GD7A 2EIFA 4J1MA 1VQLA 4H7BA 3LVWA 3J80E 1X6OA 3K7AH 1E22A 2EY1A 4GRIA 3EIEA 2RQXA 3HOUH 4JI8Q 4RH6A 4DR5L 4YWMA 3TREA 2LWXA 1FYCA 3VYUA 2VXWA 4LF5Q 4LFBL 3GTMB 5KQ8A 1DM0B 1VDLA 3UMMA 4DUYM 1STBA 1ZXTA 2ZAMA 1BCPD 3GLFA 3AB9A 4ZRZA 1EIJA 1LT6D 3H94A 1I4WA 3FTFA 2N78A 2ERCA 1A15A 1IXRA 4QL5A 1HZCA 1LTMA 3KSXA 4IPCA 1ICWA 5DM73 4R7GA 1IW7C 2JK8A 2NZOA 3LGJA 1L2CA 4M9ZA 2F0OA 2XLJA 4HJ8A 4LWCA 4O2DA 2LKVA 4A3VB 1KQSA 4ODGA 1HNWQ 2A5HA 4RKUF 2K5QA 3MXNB 1A3TA 1II3A 3CCLA 4X3KA 2UUBM 2EYOA 5DNFA 4B08A 3NENA 3MEHA 1N34L 1MKHA 3DOAA 2D0PA 3I70A 2KCTA 1TWGH 5JOBA 2JA7B 1SSOA 1HNWM 2IJ0A 4RG1A 1I94Q 2ZTDA 4MNOA 5M5YB 3MJ5A 4OONA 2Z9HA 3MA2B 4IO9A 3B89A 1F77A 2K28A 3QWNA 2F0KA 1V34A 3PNVA 1ESFA 1U0LA 3F2BA 1JJ2A 3GLGE 2DVWB 2ICEC 3C58A 1QCBD 3DHQA 2GVBA 3E9HA 3VYTA 2DJGC 1A62A 4OVZB 2J0TD 3HKSA 2JA7H 3W3AA 1LV9A 4JBJA 4OXPA 3I4NG 4DK1A 1PVOA 3U61A 3KF6A 3FYCA 4C3IB 1UE5A 5IGGA 4X62L 1TDZA 1EFID 1PH5A 1YUBA 4IUVA 3W1GA 3OMGA 1IKMA 1L0YB 1PYWD 2CVRA 3OTOM 1GL7A 3RLFA 4OVZA 4PMBA 3I91A 1WTRA 1IBLM 4NKLA 1HNXL 1TU2B 2K52A 3E21A 1I4GA 3S2DB 1OXSC 3QOLA 5CV8A 5EAYA 2AWOA 2B2UC 3LWUA 2FNAA 4LRSA 4CKBA 3LQQA 3KYHC 2QCUA 2OCEA 4A3EB 2O5IC 1S4ZA 2KVMA 4X6AH 1EY9A 3HHYA 2FFKB 2QW7A 2QEXA 1KIXA 1IYJB 2YU9H 2R92H 4LFCM 2O2LD 3GV6A 4KJNA 5GAHC 2B63H 2VUMG 5C1BA 3HGBA 2WAQG 2Z0SA 1Q7YC 5FJ8G 3WDNA 2B3GA 4J6HA 4AYBE 2C99A 2XWBB 1NR4A 4L4UA 1DD2A 4B3RQ 3FMCA 1CHPD 2H4OA 3KW6A 5ISRA 2CH4A 3J81c 4LY6A 5A2QL 1E3PA 3RFWA 4M0DA 3UJNA 1SYCA 1GJXA 4BB9A 4XTCS 3P1HA 2B2WC 3G48A 5CR3A 4EQ5A 1B50A 4RF1A 2C35B 4B3RM 2EYJA 2F0MA 4FCVA 1EU4A 2X69A 1SYGA 1J5EQ 4GHLA 5KNCA 2BA0A 1YI2A 2CHBD 5EPKA 2F0TA 5KPZA 2UXDM 8CATA 4A3LH 3A5UA 4GLVB 3S1QB 4JYAQ 2WZJA 2AHOB 2R7FA 1YEZA 4LJ7A 2NTSA 2JA6G 1LTTD 5EXSA 3W68A 4KHZA 5DYIA 3R8BA 1XMQQ 2XSZA 1C7YA 2A73B 3PQIA 4O1NA 5CMDA 1TH2A 4LFAM 4DUZL 5H37D 5G3LD 2VQFM 2KQ3A 1XYIA 2IY5B 3WWVA 1EY4A 2MUYA 3AKZA 1B8AA 3W67A 4LJ5A 2JN4A 1E1TA 3GV3A 4S3SA 4JYAM 1ICFB 2SDFA 4K2LA 4KTAA 4GEWA 1YNXA 1M4VA 1T3TA 5AJ3Q 2JA5G 3SE0A 3MVVA 3HEJA 1JCKB 4H0LC 3K0YA 2H5XA 2UUCM 2UXBM 2NZHA 3SAWA 3ERQA 1D2NA 1A5TA 1SXJE 1O80A 2PNRC 3SBJA 2QEJC 1D5XC 2VL6A 4II7A 3CPFA 4K6LA 3LW5F 1XXHE 4DNTB 2YQZA 1QJOA 4JCVE 4LF8L 4KHPL 3CP0A 3EBEA 2QSFX 4IPDA 4HJ9A 2B8GA 5GROA 4D81A 4IN3A 1B9NA 1S40A 3TP8A 1BVSA 3AFPA 2MNAA 1NJFA 2NBFA 4LF7Q 1AE2A 1NNXA 2CWPA 4AQYQ 1QZMA 3I56A 1KDBA 1PFSA 5ITYA 3KBGA 3EVQA 4CJ0B 2OQ4A 4GKKQ 5HGQA 4WJWA 5ITQA 3TS0A 3AEVA 3T51B 4UPAA 4QOZC 2E5LM 2LVNC 1O7LA 5LL6X 3E6ZX 3SYKA 3J7AV 4DPGA 2AHMA 1PA6A 1J8IA 4AQYM 1TWFB 2JWSA 3WHLA 3F1ZA 5IGDA 1IZ6A 1EWCA 2HCBA 1BCPC 4R4OA 3H4JA 4AW4A 1PMRA 4GKKM 1V43A 1WCMH 1C0AA 4H13C 2UXCL 3A98B 2MO1A 2RGOA 4QHSA 2NZ1D 2OT2A 4DGZA 4OL7A 3I72A 5EKLA 4DV2Q 2DZNB 4LF9L 3A55A 1WVLA 5EGTA 4P72A 5M5XB 4NPSA 2ZM6L 1Y1WH 3R93A 2B2TA 1NJGA 3NSWA 5ELDA 1VMCA 3T15A 1NNUC 3J2PB 1N78A 3NQTA 4QUCA 1OIPA 4F88A 4IFDH 5C44H 5JEAH 3KF8A 4XT3B 3PXGA 1VQEA 3GP7A 4JI2L 1VQCA 4EVOA 4DR5Q 2LH0A 4LFBQ 1OO9B 1QVGA 3AV0A 3NHHA 4L5QA 3H3VI 1N33M 4LGMA 1EWIA 3V76A 2R45A 3Q8GA 1CI3M 3HKZE 3T1HL 1B3AA 3VR6A 2XVSA 2PMZE 1JORA 1K3WA 3UI2A 4JVZA 1O7IA 1DOKA 4M1UB 4NMZA 2HIVA 1G8PA 2R6GA 2Z6KA 2NN6I 3H0GG 2F52A 3NWSA 3ULLA 4YWKA 2E75C 1N36Q 4ZQ3A 5FTLA 2MH8A 4IPHA 4OX9L 4X65L 2PQEA 1IBKL 1CKNA 3S1RH 1IXSB 1KL9A 5I2XA 5KPRA 5M3FG 3U6PA 1AN8A 2RKSA 3H09A 4K5VA 4W5WA 3KP0E 4A75A 3JR5A 5CC4A 4GLXA 1I50H 1VDZA 3QYBA 4R3DA 3M4YA 1N36M 4CBVA 1QVFA 3HHWA 1L1TA 2VQEM 1N34Q 5IYBH 1M1KC 4CKCA 2AKWB 4C3JB 4QGUA 1K3RA 5CBAE 1ML0D 2EYMA 4KN7C 4XGIA 1NSNS 2VB3X 1B4OA 3N6RA 3AOEA 5FLXS 4B9WA 1DGHB 1DCZA 5CGKA 2DI0A 1CHQD 1R2YA 2FOIC 3V2TA 4FCWA 3GLFE 5C3EG 1PRTD 3I4OA 1GVNA 2KA6B 2DAIA 2NVYH 3IECA 3FKIG 2XN9C 4Q0FA 3QR8A 4DK3C 4FW9A 1Q02A 5EXPA 4ZCKA 1JB0F 3PO2G 3J7AS 4X62Q 3A0JA 5K36H 2XFTA 4GNXC 1SYBA 1UM8A 3EN2A 5BN3A 2PZUA 4AZFA 1STAA 1YHAA 4B3ML 1HNXQ 1XMOL 3J80S 1V92A 3CMEA 1SE4A 1ENAA 4JBWA 2LXKA 2CE7A 1KFVA 5C0XG 1TS2A 3LVVA 2F0UA 2M2LA 3ND8A 2DHYA 4IPGA 1Q3LA 2Z1CA 4FF4A 1XNQL 2BJVA 1SYDA 4GZYC 1IN6A 4DV6M 2KCMA 3HOUG 5FSWA 4DR6Q 1HNZM 1MJEA 3DWPA 1KLGD 4PQXA 3FHWA 5EBCA 3TS2A 2L6OA 1T6OA 5NUCA 1S5BD 1X3EA 3I4NB 3MMPA 4QY7A 4X66L 4UN2B 1J9OA 3U4ZA 4PT5A 1STEA 3TWKA 3HS0C 4KODA 4DR6M 3EQLC 2EA0A 4KKSA 1PJIA 5C3WA 2N55A 2PYKA 4DR7M 2L0CA 4JV5Q 1GABA 3KOYE 4M8AA 3SXHA 3H3VC 3E0JA 2EE1A 4JI7M 1R9TB 3QB3A 4R4CA 2Z8LA 3QYEA 4X64M 2Y0SG 3KK7A 4N9TA 4DV1M 1L2DA 1MBYA 4GN5A 1XXGA 4MZ9A 5IODA 4JV5M 5IOCA 4NXMM 4LW1A 4WFN3 1V33A 4YWLA 4B9XA 4A3CG 2WAQB 4KLKA 1LTGD 4UP8A 2A6ED 4HCEA 1Y8GA 3FRIA 4DUZQ 3IL8A 4J15A 4DFAA 4AG6A 3FEWX 1TIID 2YR0A 1VS0A 2RCFA 4KD3A 4KN4C 4N9PA 1X3FA 1V9PA 2EUCA 3NK9A 1Z5BA 3Q23A 4DR3L 2O25A 1BCPB 3ICEA 1UEBA 1R6BX 2JA7G 4HN7A 2B2YA 2ALYB 2M60A 1VQJA 4JBMA 1H9RA 3S1MH 4OGQC 2HCCA 3ITPA 4MTNA 2CP8A 3CQZB 3U6SA 1EIFA 2B2VA 1KRSA 1ILQA 1AEXA 4M9SA 3O13A 3J7A5 1PFNA 4LF8Q 4IBGA 1PLFA 2A8VA 4KHPQ 2OO9A 1JE5A 5FTJA 1VQKA 1WTPA 4R4TA 4XIGS 3WOFA 4JI0L 3KBXA 3MC0B 5GKNA 2KXEA 1PTOD 2PNHA 4POFA 1WHCA 3OIQA 1KABA 2L7HA 4YCUA 3ND9A 2R92G 3L28A 2ZBKB 1ASYA 2BH8A 4EGVA 2F0EA 3PUWA 2Q8TA 2B63G 2R4EA 2RBMA 2JA5B 2G9HD 4R9WA 4YHHL 3SHGB 1M8AA 3S17H 4LJ9A 3GO5A 1TF0B 3U6EA 2NWGA 3HZXA 5K5PA 1C4QA 1OXUA 1E7ZA 1VQHA 2UXCQ 2EQSA 2HHHQ 1D0KA 4CGYB 1B3QA 4LF9Q 1HCZA 1JWMD 5DLQE 3VDYA 3S16H 4KJOA 2ZM6Q 2Z6BA 4C3HH 1R5LA 5LMNM 1NY5A 1ZMUA 3IG8A 4DV0L 2EZVA 2FE8A 1HR0M 3PV0A 1G6ZA 1N32M 4A3LG 2AMCB 3HJSA 2HHHM 3T56B 2XRSD 3HJ8A 4LF9M 4JI2Q 1ONLA 3VR2A 4DV4L 2A74C 4HJAA 4ABNA 3HOZB 1PH3A 3CD6A 5KEEA 3QAUA 3J81i 2K32A 3D8GA 1HHVA 4NXNM 4AH6A 3T1HQ 2JXNA 2CV2A 5IT9c 3T53B 3AYHB 4DV7L 1U4LA 4KMUC 1EZ8A 3HY5A 3D8BA 1TWHB 4B3SL 1W5SA 3KOWE 1IN5A 5I9PA 2D62A 3VLFB 2K5DA 3T1YM 3EFXD 3DZDA 1MD2D 3S1NB 4A3BB 4GOPC 4OIKA 1TKWB 4OX9Q 3BZKA 4FNFA 2ZTCA 4XBOA 2NB0A 4X65Q 2DZOB 4FWHA 4PNYA 1IBKQ 5CV4A 1MIUA 5CORA 4O42A 1JOKA 1D0MA 1KLUD 1EY0A 2C98A 3CRLC 1OIZA 1DO0A 1F9PA 4I81A 2C96A 5EKIA 1X55A 2K01A 3JAML 3VR4A 5C4ZA 4I7AA 2D7EA 4OX9M 3I4MH 3GPUA 3NTHA 5JI3E 4IJFA 3DFZA 4WJ4A 3T6PA 1DOMA 3HX3A 1U4PA 3L26A 2KCNA 1IN8A 1SNPA 2R18A 4OO1H 3UDIA 1QWYA 1QUSA 4IFDI 1W3SA 4RCNA 3KP1E 4P16A 3I73A 2MQHA 3SFZA 2DAKA 3BVMA 1Z47A 3CCEA 1MI2A 5JI2E 3H91A 1H9MA 2BWBA 3U6CA 3PFIA 5EJWA 1WCMG 5M3FB 1QZGA 2WB1G 2AUJD 2F0WA 3GTKH 1K8GA 5BN5A 1TR5A 1S3OA 1QANA 1C1KA 1GUNA 3R3OA 5M3MH 5HGTA 4A3IB 4B3MQ 4G4OA 2KENA 3CCQA 2Q2TA 2RCNA 2XGTA 5IE8A 3FYDA 2L4NA 1NV9A 1GM5A 4XDXA 2WSCF 2BDNA 4BXXH 2P5ZX 3HHZA 1CA6A 1VF7A 5C44G 5CBEE 3H3VH 2Z7JA 5JEAG 2QF7A 2HKJA 3MXUA 4IBCA 1SJHD 3GPPA 4DNRB 1HUMA 3F8TA 3TP7A 5C3EB 5F3WA 2J7NA 3DA1A 4GKJL 2IT1A 1U9RA 3W5OA 4BS9A 1I6VC 2QZ4A 2NN6H 2CW0D 1KNAA 3RMHA 3J27B 1YHBA 2X6LA 1SYFA 1K83H 3DM1A 3I2ZA 1K8AC 3PO2B 2DWLA 1NY6A 1BCPF 2A6EC 1FNUA 3E0EA 3A46A 1IBML 2KZUA 1IKLA 1CK1A 5FLMH 3SAUA 4JI6L 2JY5A 1YZ6A 5FLXE 4UAIA 2KEEA 1BQQT 4DK6C 2OEOA 2DUDA 1DO2A 1Z5AA 4DV3M 5KQDA 1V1OA 2YTXA 5BR8M 2I5MX 2MO0A 2LVQD 1BF4A 3K7AB 1IYVA 4JI4L 1PJJA 1QUQB 4OWWB 1NSFA 1TVXA 3SR1A 3HOUB 1FVIA 1EYDA 1K3BC 4RGMA 4PD2A 3PUVA 1JWUD 1XX8A 3UDXA 2XRQD 5IYBG 3KS8A 3Q8XA 4L6TB 1PJSA 2CV0A 4L5TA 4HJ5A 4A3MH 5I6WA 2MJ5B 2F0NA 1QUQA 2BA1A 3KDFA 1SNOA 2JSOA 3D3RA 4ZLTF 1VDDA 1XJVA 1SDFA 1HUNA 1H9SB 3U60A 5CV5A 4DR3Q 1PTOC 2MPMA 4UHVA 4LF6L 1G59A 3QIAA 4C3JG 1LV7A 3LMMA 1KRTA 4REZA 5ITTA 4L15A 4IJLA 2A1AA 2VIIA 1STYA 4X3SA 5K36G 2CKZB 2D9UA 4JI8M 3TP5A 4A3DH 4LF5M 2Y0SB 4WP2A 2H1RA 3SARA 4HIDA 2UU9L 4AKIA 1EU3A 3GQ5A 1TWGB 2RSOA 4GN3B 1P3QQ 5D3DA 4X3TA 5E4WC 2GA4B 4JI0Q 2DGYA 1E9SA 4GIPA 3OIPA 4DXGA 4DR2L 3ERSX 5CV9A 4GC9A 1HQMC 3HOYH 4LUOA 3GPXA 3PUZA 4EX5A 2DNEA 4POGA 3D4RA 4BLCA 4JOIC 2IX1A 5AFWA 4DV5L 5KRUA 1WXQA 3TRZA 3VA5A 1NV8A 2HDLA 3MXNA 4ZPXA 1BBXC 4PCZA 1HH2P 4UDUC 4YHHQ 3RE8A 1X3QA 1GO5A 4GMQA 4BA1I 3FP9A 2BE5D 2WAQE 5LL6S 3CCSA 1K8MA 3KXEC 2DWNA 1Z7TA 5EP4A 1UE1A 4TUWA 5IY0A 2IW3A 3RLOA 3HOWH 1I94M 1WGLA 3PUYA 1EY8A 2YYZA 3BU2A 4A76A 1OKSA 1EOTA 2B39A 1E24A 1JMCA 1N9WA 2F0HA 4DV0Q 4GS3A 3L2AA 1FJGL 1RHPA 2Z6KC 4FXKC 4K0KL 2YU9B 2D5DA 3SC3A 1EUJA 2L5TA 2EVBA 2R92B 3GQ4A 2VNUD 4HL4A 3FPUB 1T5EA 3S15H 2B63B 4ZKCB 4DV4Q 1G291 3U6OA 5E6JA 2JEBI 2K33A 4CJ1B 2MROB 1OQYA 3BDLA 5EPJA 5C4HA 4UP7A 1O7YA 3BYTB 2LXJA 5G3LF 3CCMA 4DV7Q 3I51A 4OW0A 2QDBA 1PGYA 2E2JH 2SOBA 3J81S 1LABA 2NVTH 5JJKA 3BDCA 3W0LB 1EEID 3KLSA 4P74A 1QVCA 1TY2A 4FO2A 3K8ZA 2EPBA 1EYAA 4A4IA 3A8JE 5C5MA 5DNYA 1CUKA 3BS1A 2K9DA 1B44D 4DU9A 3JAMc 5FO9B 1UE6A 3LX0A 2XNAC 2HL7A 2R93H 4ZAIA 3E9SA 3SATA 1F9RA 1EQQA 3NPPA 4O0AA 3S9WA 1FNNA 3D0FA 1TTEA 2KNAA 1I3QH 5L37A 3RNUA 1Q8KA 1YNND 2WSEF 5FTNA 1L1OC 1VQAA 3QOJA 1G4AE 2LS01 4KD4A 3UDFA 1JC7A 1X3GA 4MGZE 1SXJD 1ZYRD 4MHEA 4DAMA 3A54A 2FH0A 5I6YA 2XTIA 2SNMA 3E3XA 1OTCA 1Q1EA 2QP9X 3U50C 3NWTA 1DONA 2XH9A 1TWAH 2KHSA 1QE6A 4A3GH 3SK8A 2A69D 2KBNA 2K6AA 2DZLA 3HOVH 2HWJA 5H1SE 5EBDA 3CCRA 3M4OH 1J5EM 3HU3A 3TMEA 1GHJA 2OF1A 3VFDA 5IGBA 4A3FH 2CW0C 1KC8C 1ASZA 4A3KH 2F5SA 2F5OA 3SK5A 1MSHA 1EYGA 1EQTA 1XMQM 1IL2A 4G6ZA 3L29A 3W0FA 3PIO3 2G5GX 3SGIA 3QWLA 1A8VA 1KHIA 2M00A 1Q81C 1K3XA 1LTLA 1Y8PB 1Z59A 4QB4A 5COYA 2WFWA 1VQDA 2LVOC 2TMPA 3U6DA 5HY6A 1GJSA 3GLHB 1EYCA 2M9VA 3OMCA 4KO8A 3TEHB 3C3EA 4UY8C 4RGTA 2DKLA 3CXCA 4GKJQ 4FYDA 4LCBA 4RFBA 5IP7H 1N8RC 1BNZA 4RHRA 4G7ZC 3KOXE 3B7QA 5DM63 1QAOA 2EXZA 3CPWA 2IL8A 1IBMQ 1Y1VH 1A2TA 4AI6A 1WCMB 1OXTA 3GTPB 2F3VA 2FFJA 2N49A 2WB1B 1XPOA 3AU7A 2JA9A 4JI6Q 4G7HC 3A56A 3HOZG 5E26A 1IY2A 4Z6YA 4GH9A 2F0QA 2QCPX 4TSSA 3MXPA 4LF7M 1Q82C 2ZJQA 1Y1WB 2UUAL 2F4VQ 1BBWA 1PTOH 1A3VA 5DFLA 1GD7A 2EYLA 5DEHA 4OO1I 1CA5A 1G41A 4KY5A 4XXEA 2V1CC 5C44B 1T43A 3GTPH 4JPBW 3KS4A 3EIHA 5JPMC 2RGHA 3AFQA 4MGHA 1X3PA 3C9PA 4A3BG 4RGNA 2B2YC 2JY7A 2F4VM 1PXUA 3DUZA 3MEFA 3I4MG 4EQNA 2LNHC 4B3TL 1XB2B 4JXJA 2A68D 1G2SA 1MHWC 3DEOA 2B2VC 1V1QA 4NP5A 5D65A 3UE1A 3IFTA 4LUZA 1WI5A 4RHSA 2Y0QA 2HDMA 4DV2M 1JB3A 1IN4A 3PMFA 1NHGC 1X9NA 3FUUA 1CM9A 1OFHA 3URYA 4OO1G 3GRVA 3TWLA 1D1IA 2D7GA 3HOXH 4CHTB 2EJSA 4K14A 4LF6Q 1MX0A 1C8CA 5EP3A 1HT1E 2C9CA 4R8IA 3KFUG 4ALPA 3V05A 3S1RB 3FPPA 2KEBA 1JQYD 2KRKA 5FKAC 4DR5M 4FVMA 3GLIB 4NOOB 4LFBM 1I50B 2BH2A 4F87A 3DM3A 5M3MG 4QIWB 2LVAA 2BE5C 2IPKD 1SLJA 5IT9L 1R2ZA 4K5WA 1G71A 4JI5L 2UU9Q 3TZDA 1KD1C 4UP9A 5KNBA 4JI3L 1BBUA 4EQPA 1L1ZA 2F5PA 2YTYA 5ITXA 3FD9A 4BXXG 2DWMA 2ATWA 4YIJA 2JY6B 4IBDA 3S14H 1E2ZA 4DR2Q 5D3IB 1XNRL 1Q1BA 4HIMA 2FMCA 3PO3H 5JJIA 4LGYA 1WTXA 2D7HA 2R4JA 2RDFA 2G9DA 4A3IG 1D1KA 1B70B 2NVYB 1HTLD 1LM0A 1IXSA 2R44A 4DN4M 5IREB 4DV5Q 2NN6G 4LF4L 5ITRA 2Z8YM 1OFIA 2QPAA 2QENA 4RGOS 5EJCA 5FO7B 1OTRA 1I4RA 1CFMA 3OW7A 5JAVA 1NVMA 4N8X1 1QAQA 1VG5A 2L4FA 3FUVA 5FLMG 1JB7A 1AUAA 2L09A 3UZUA 4IUTA 2EKFA 2JP7A 3VR3A 4J8QA 4QNMA 1N34M 2JNHA 3N52A 3NEMA 3I3CA 3L25A 3U58A 4IBFA 1LLRD 4TRDA 1DGHA 3LCUA 4F1IA 5IIFA 1W5TA 1FJGQ 4DR4L 4R71A 4APVA 1IY0A 2FMMA 3L9AX 2P5TA 3HU1A 4K0KQ 4IBIA 4ULLA 4MN3A 4Y52H 4QOSA 2VY3A 5C0XJ 4NL4H 5A2QS 3L7ZC 1PYBA 4DAYB 2BNKA 2Y0SE 4X62M 3D6WA 2HAKA 3TBIB 5GADC 1EIYB 1YNNC 2R3ZA 1SXJC 1ZYRC 3RR5A 1SBBB 4CJ6A 2LXEA 1HNXM 1P16A 3KSJA 1ENFA 1UEAB 1IYUA 1N75A 3SAVA 2E2HH 3STBD 5IP9H 3TWMA 1EWHA 4N8FA 5ELEA 4DA2A 3BXWA 2R7ZH 1D8LA 3NXWA 1JR3E 2A69C 5JPNC 3GTOH 4DNIA 3P75A 1JWSD 1YJNA 1U5KA 5E4XA 4A3DG 3CCJA 4IIWA 4Y7NB 3B7NA 4ITQA 2DENA 4LJ4A 2JE6I 4KLNA 1LTSD 1E32A 5LHY1 4HAEA 3RZDB 1J09A 3CCUA 1U4MA 5IWAL 3SDZA 1X54A 1IXZA 3J80c 1Z6HA 3C1EA 4A93H 2PW5A 3WHKA 1FGUA 5BN4A 4GN4B 1AZPA 3GPYA 4Y7NH 2CFMA 3GTLH 5IGEA 1R4PB 1HQYE 3HOYG 2XSCA 2CEAA 1PHJA 4S12A 3RZDH 3CRKC 1VEJA 2IHFA 1VQ5A 1PTOF 3K80C 5LMUL 2K5NA 2X8AA 1BKBA 1NHWC 1HPCA 3A8IE 3AL0C 3W2DA 4JI1L 4RMFA 4IUNA 3S1MB 1XC8A 4RWSC 1YSYA 2Z3XA 4G4RA 3KOJA 3SK4A 4DR1L 4HSPA 3CCVA 3VR5A 4BY7H 4CJ2C 2KZSA 2ENBA 1JOOA 3G6JB 3G71A 2XSZD 1K0RA 2RRUA 3M85A 3GTGH 1DGGA 4ZUJA 2KNZA 4GHAA 1HQRD 2ZTEA 1NNJA 3HOWG 1WFQA 1L8QA 3RGSA 4DUZM 3NP8A 4QJFA 2JA8H 3I7FA 1NCVA 3J81E 3GLGB 3R2TA 2YTVA 1EFUB 3DLLA 4DBGB 2EY5A 3K5OA 3BOSA 4PZ7A 2NVXH 3U6QA 1WTHA 3PVSA 1I6HB 4V190 2EOTA 1SROA 2X4AA 2C5CA 2VUMH 4PZ8A 4DK0A 1V1PB 1W6KA 1PV4A 5C4XB 3A8KE 3BG3A 4KHVA 3S17B 1S5FD 2K5HA 4YCVA 4RKBA 1I6HH 2A68C 5JVH3 4LF8M 4KHPM 1RJTA 3UGJA 2CQAA 2R6FA 1AZQA 3GTQH 2H1EA 2PQAB 2RDHA 2UUBL 3D6CA 4IURA 3LQRA 2F0DA 2G3QA 3I4VA
chains in the Genus database with same CATH topology
1YNJD 3S16B 2K05A 1MSGA 3QJYA 4C3HB 3D31A 5I2YA 2OXPA 5E1FA 2LMCB 4A3JB 4BA2I 1BDOA 5CV6A 1K8OA 1LO5D 5EP1A 4JN6A 2EJFC 1W6JA 2KW0A 2BJWA 1JOQA 4Z8XA 1Q12A 1IXRC 1DOLA 2UXCM 3UK6A 4C56C 3P7JA 3HG9A 1ZQ9A 3IAYA 2F1MA 2ZM6M 3K5MA 1BXTA 1CT1D 4RNAA 1S5DD 2ZXOA 4Q5VA 4DXFA 2I46A 5EP2A 1UNSA 2E76C 4ME5A 2L12A 4IBBA 4JI2M 1F2YA 4IBEA 2I7PA 2MP1A 4RA8A 1DGFA 2Q2EB 1LTRD 2WACA 1PRTC 3I4MB 1TY0A 3T1HM 1OXVA 1CQFA 2WKCA 3GO8A 4NSOB 3R8FA 4F8MA 2MGSA 4ILWA 4LK1C 4ZK9B 4L63B 3J7AF 2FINB 3THGA 3FTCA 4X65M 1IBKM 1XXHB 1ET9A 2RVLA 3KUPA 3A42A 4KY7A 1O7ZA 3RUZA 3SEBA 1IL8A 3G7LA 3NBHA 4LG2A 3CHBD 3CKIB 3H4MA 2JXMB 2NQ8C 3GTKB 3RGPA 2YNMD 5M3MB 4FWGA 5C6AA 3AFHA 4NDXA 4HR7B 4HCSA 4LMQD 2R46A 1G8ZD 5T1GA 3TL4X 2KRUA 1TDHA 2NYZD 3GRYA 4LJ8A 3NTIA 1EY6A 5ITXE 2SEBD 5EQTA 5F2DA 2O5JC 3TZUA 3C1FA 2PZWA 1I4QA 1SNMA 5JEAJ 5KGUA 2LFNA 1K83B 4IFDG 3MAQA 1MGSA 5CYUA 1HA6A 4B3MM 4XQJA 1XMOM 3HJQA 1RF2D 2F0LA 3U6MA 3VK7A 3I4LA 1XNQM 1Q3BA 1R7RA 3MXGA 4P2CB 1G3IA 3HKZB 3Q6SA 4FF1A 4IQZA 2DY8A 2E2DC 1LT5D 4QF4A 3T38A 1G2TA 2CUZA 1GKIA 1HFGA 4X66M 4A3MB 4JK1C 4G7OC 2CHQA 1R4QB 2DNCA 3FUXA 5FTKA 1DJRD 3C2PA 4I5SA 2QBYB 1CZGA 2K47A 1Q90A 1TS4A 4FF2A 2XGNA 4XQQA 5A2QE 1S5ED 4FXDA 1F2MA 4A3DB 4FCTA 2O4XA 5FK9C 3MWYW 4E6IA 4RAUC 4BWGB 1QQWA 1D6EC 1B1ZA 3HWSA 3GP1A 1MU5A 1IN7A 3ILKA 4I65A 1GXDC 1YNJC 1IY1A 1Y8OB 3K5LA 4WURA 1H9SA 2N88A 3T16A 4PDIA 2WKDA 4KY6A 4B7HA 4DR3M 3TQSA 2XZUA 5I4DA 2I07B 3HOYB 3U9OA 2QILA 1NR2A 3FUTA 1F9SA 2FHTA 1K82A 3L3OC 1F2LA 4K8IA 1KTKA 3B9PA 3A7AB 2MHVA 2F4IA 5KNDA 1RD9D 2L7IA 4WRDA 1WTVA 1ZEQX 2DWZB 3MHVC 2B2TC 4X3UA 4IUUA 3TPZA 3HOWB 2WP8J 3GRRA 4JI0M 1SE3A 2XWJB 4KK7A 1EY5A 4WW0A 4Z9CB 1ILPA 1PRTB 2VB2X 1JR3A 4I8OA 3OWFA 2KA7A 3S15B 2Z4IA 1DZ1A 1SNQA 3K6OA 1JR0D 3MFGA 4YHHM 4V0BA 2NUCA 2RDGA 3VYRA 3A7LA 1VMPA 3NQIA 5KPTA 4TQUS 3U61B 3S2HB 3E4RA 4M9XA 2F5NA 1HQCA 2E2JB 2NVTB 2AQ1B 5EXTA 1QVRA 4HEDA 1EQVA 1LTBD 3RD4A 1TQOA 3HKPA 3P20A 4NW2A 3JAMS 1B9MA 4DV0M 2PCFB 3FTEA 4QMGA 5C3XA 1WTQA 2R93B 1SMYD 1GUGA 4NSRA 2ZXRA 1WTOA 1GHKA 1XHBA 1CTMA 3FUWA 1GL6A 4DV4M 5EKKA 3GQ3A 2OPFA 2A6HD 3DWAA 1I3QB 4FF3A 3MK6A 1EEFD 5JJZA 5FLXL 3FKEA 1KAAA 3AOEC 3FRPB 4DV7M 3R9XB 4GC5A 3M7NA 3K1JA 3M7GA 4B3SM 3MHBA 4MIUA 3U5ZB 3JR4A 2BDOA 2KUMA 1TWAB 4A3GB 3E5SA 5BPVA 3HOVB 5ELBA 1AP0A 4AKGA 3M4OB 4HTHA 5T1IA 4MH0E 3IFDA 3VK8A 4A3FB 1UUPA 2DHRA 4A3KB 1J7KA 1EL0A 3U5ZA 3J80L 3R2IA 2CFOA 5IT9E 1LTID 1Z5CA 1ET6A 4AKHA 1A3UA 5E3FA 4RKLA 4XT1B 5EPLA 3CF0A 1ZAEA 4HMJA 4IUQA 3Q22A 1QNKA 3DWQA 1GUSA 1F9QA 1BUVT 4FD2A 1IQPA 4C3HG 1H9KA 1V8QA 3K57A 1B2TA 1TH3A 2K04A 1EY7A 4AG5A 1PZJD 1TH4A 1F2ZA 1Y1VB 4MM3B 1LT4D 1S5CD 4RCOA 1WTWA 4PMWA 5DAUA 2D2CC 1QILA 1HFNA 3PIP3 1SYEA 4LJZC 1TT2A 5EXXA 1PTOB 2J7ZA 4DAVA 3TSSA 3GLHA 2F0IA 4B7FA 1VF5C 1EIGA 1FR3A 3ZC7B 2IX0A 2AWNA 3KVWA 1SXTA 1OXXK 3AJIB 4RF0A 4GKJM 1DYQA 2E74C 1XTCD 3SYLA 3HP3A 1L2BA 1NAPA 4G4KA 1IBMM 4JI6M 1STNA 7CATA 1NUCA 2G8LA 1GUOA 1SNDA 4CKEA 1WD1A 4QUFA 1ENCA 1E9RA 4HSVA 3HOXB 3BYYB 4QCLA 3SASA 5HURA 1H9JA 4JI4M 2IX3A 1EZ6A 4IALA 3CTWB 3CU7A 3X3NA 3D4DA 1RDPD 1PRTF 2L1BA 4CISA 4XQNA 2F3WA 2KECA 3C46A 3S14B 3KLSX 4FXGC 3PO3B 3K58A 5CV7A 1QOHA 3TN2A 1EIHA 3TE6A 4LF6M 2ZANA 4L16A 2NTTA 3X3MA 1LT3D 3M0EA 4DAPA 1XWEA 3VDUA 2DXIA 3SHLA 1O78A 3GLIA 5ITUA 4OIJA 1T5XD 1HXYD 4F7XA 5KIXA 1QG7A 3VDPA 4YY3M 4GITA 3OHXC 3H6MA 5C5LA 3WOEA 2UU9M 2WINB 3DEPA 3FDTA 5EQ0A 1JE4A 4ZYSA 1I4XA 2HUGA 4DR2M 1STGA 2B2UA 4C1NK 3VKHA 4XYQA 4LJ6A 1SMYC 1CZWA 1LTAD 2V4DA 4DV5M 3Q0AA 1QB5D 1AFPA 2A6HC 4U673 2ICIA 1JR3D 3HU2A 3FVQA 4HLQA 4IJEA 3I90A 3QO2A 3TP6A 5C18A 1HTPA 3TDQA 5IGCA 5C0XI 2ID0A 1RTOA 1BOSA 1Q8IA 2E2HB 3ONAB 4R8NA 2Z4RA 2C9OA 3U6LA 2B2WA 2R7ZB 1FJGM 1Q3CA 1C48A 3NE5B 5JVG3 3GTOB 4K0KM 4IBJA 3NWLA 2PPBC 1KYIA 2HQEA 3BZDB 2F0SA 1VCIA 2JEAI 1STHA 1GUTA 4DAYA 3DMUA 4KKTA 1OJLA 1DXMA 4L8JA 3LNNA 2EDGA 4MB7A 4A93B 1IM2A 5M9OA 4L78A 3GTLB 2CV1A 1YE9A 2CHGA 3D4WA 2C5RA 5J39A 1H6UA 4ZUIA 2XF3A 3KDSE 1ORYB 3K59A 4G4NA 1X37A 1PFMA 5KYLA 1SJED 4LRTA 3MTSA 3Q24A 2AQ2B 4BY7B 3I8ZA 2F03A 3K2LA 4L8RC 2PW7A 3GTGB 2JP1A 2X49A 4K6DA 1G91A 3CF6E 3CF2A 5IZ7D 2XFSA 2KOLA 2JA8B 2F0FA 3A45A 1GUWA 1HRJA 3OPOA 2EJGC 1HT2E 1Y8NB 2NVXB 3AOGA 4C1NI 1SAPA 3JAME 4BBAA 1RKNA 4QHTA 3GRUA 3ZH9B 1LACA 2I7NA 1PDQA 1RODA 1RTNA 2K7VA 4IZ8A 2VUMB 3VYSA 4LAAA 2RA4A 4IUPA 3OOCA 1TGUA 2DN8A 2AQ3B 1E94E 2Y21A 4PDGA 2L55A 4FP5D 2V1CA 2Q8IB 3PUXA 3VKGA 4PMCA 3GTQB 3F2UA 4NRVA 2M5ZA 4PV1C 1E2WA 1RCVD 3GLGA 3K92A 4G4QA 5J22A 2R61A 2V1UA 5FOBB 3GTJB 2TSSA 2F0GA 2QKIC 4K5XA 2BOSA 1SE2A 2PZTA 1E0BA 2EYFA 4WORA 1GOZA 1Y69U 1IHZA 4OU7A 2A5YB 1FD7D 3SMSA 3T4AC 4D82A 2JA6B 1UAPA 4C3IG 2KEDA 3BDOA 3M3YB 4LJAA 1AW7A 1A6XA 4U68A 3SVMA 1S3SA 2AUKA 4M0WA 2SNSA 4AYBB 1KDAA 2JYOA 2RSNA 3NBIA 1I4HA 2UUAM 2EY6A 5FO8B 2R65A 3HRZC 3DXJC 1N77A 2E2IB 4B7GA 1SEBD 1PZID 5IT9S 1I4PA 2ZAOA 1FGBD 3SK6A 1IW7D 3OWEB 3J7YW 5KYIA 2KJXA 3J7BA 1L0XB 4C2MB 2ZT9C 5ELCA 2XZFA 4K8JA 5C4JB 1QYRA 2R62A 4B3TM 1XWIA 3OSOA 3ZCBB 2K03A 3T13A 1TS3A 4XYOA 5ELFA 4LZJA 3RZOB 3V96A 2J7OA 2PO4A 3EJIA 2X6GA 2O5RA 4EIWA 1PFBA 4TKOB 1PM5A 4IBKA 1QNUA 1D2BA 2EYPA 2XIWA 1KNEA 1Z6TA 1X32A 2YFQA 1FNWA 4OHJA 2WIIB 4I4LA 1SXJB 2Y20A 2KCCA 3SHFA 4JI5M 1ZKOA 1WD0A 3IKJA 2Y0TA 4JI3M 5KO3A 3BVZA 3NTKA 4D80A 4NRWA 5I9OA 2EO2A 2Q8RE 3HHXA 1XNRM 3KOZE 3EA6A 4LZZA 4H44C 1SXJA 2WV6D 4EQOA 4KV6A 3VA7A 1XXHA 2IWHA 2K5WA 4LF4M 4KKUA 2F0PA 2W82A 3L27A 4DF7A 2HCIA 3M6AA 2J4XA 1KDCA 5D14A 2F0VA 3J81L 4BBRB 3HGIA 1TS5A 2RKOA 4ZKBB 1DGBA 1BO0A 2CHVA 1SFOB 5TSSA 3U9SA 3H0GB 4BBSB 4MGKE 3IG5A 3SMPA 4IFDJ 1Q39A 2ZXPA 1E2VA 2F5QA 2BCOA 1D5ZC 3EROA 3ZYYX 4HMIA 4DR4M 1KSFX 4MGYE 1JICA 4QNRA 3I4YA 3AMUA 2Z4SA 5FTMA 2L9HA 3PNYA 5A35A 2FJ2A 3MZ5A 2XEPA 2MJ8A 1BR9A 2EY2A 3K5NA 3LWEA 3FTDA 3D8LA 1EE8A 1HA5A 2EJMA 1TWCB 3KLRA 2L11A 2PMZB 1SNCA 2NVQB 2V6ZM 3QG1A 1PZKD 4I7ZC 1B53A 1D5MC 2Z4HA 3FKIB 4MGIE 2K1BA 3BVGA 3NUCA 1CQVA 5IGFA 4ID6A 5IWAM 5DYGA 3C3LA 2F0JA 2JA2A 1A2UA 1JQJC 4BY1B 4KI0A 1QAMA 2EYHA 2B8FA 2LY7A 5M5WB 4G57A 1ESRA 4K2KA 3MFYA 1FNVA 5LMUM 2DY7A 2QBYA 3U60B 5J1ZA 4JI1M 3GQBA 4FWDA 1U4RA 1GLNA 4DR1M 5C0XH 3GLFB 3GD7A 4J1MA 4H7BA 3LVWA 3J80E 2EY1A 4GRIA 3EIEA 2RQXA 4RH6A 2LWXA 1FYCA 3VYUA 2VXWA 3GTMB 5KQ8A 1DM0B 3UMMA 4DUYM 1STBA 1ZXTA 2ZAMA 1BCPD 3GLFA 3AB9A 4ZRZA 3H94A 1LT6D 1I4WA 3FTFA 2ERCA 1A15A 3KSXA 1ICWA 5DM73 4R7GA 1IW7C 1L2CA 4M9ZA 2F0OA 2XLJA 2LKVA 4A3VB 4ODGA 2A5HA 2K5QA 1A3TA 1II3A 4X3KA 2UUBM 2EYOA 5DNFA 4B08A 3MEHA 3DOAA 3I70A 5JOBA 2JA7B 1SSOA 1HNWM 2IJ0A 5M5YB 3MJ5A 3MA2B 1F77A 2K28A 3QWNA 2F0KA 3PNVA 1ESFA 2DVWB 2ICEC 3C58A 1QCBD 3DHQA 3VYTA 4OVZB 2J0TD 3W3AA 1LV9A 4DK1A 3U61A 3FYCA 4C3IB 5IGGA 1TDZA 1EFID 1YUBA 4IUVA 3OMGA 1IKMA 1L0YB 1PYWD 2CVRA 3OTOM 1GL7A 3RLFA 4OVZA 4PMBA 3I91A 1WTRA 1IBLM 4NKLA 1TU2B 1I4GA 3S2DB 1OXSC 3QOLA 5CV8A 2AWOA 2B2UC 3LWUA 2FNAA 4LRSA 4CKBA 3LQQA 2QCUA 4A3EB 2O5IC 1S4ZA 2KVMA 1EY9A 3HHYA 2FFKB 4LFCM 2O2LD 3GV6A 4KJNA 5C1BA 3HGBA 3WDNA 4J6HA 2C99A 2XWBB 1NR4A 4L4UA 1DD2A 3FMCA 1CHPD 2H4OA 3KW6A 5ISRA 4LY6A 5A2QL 3RFWA 4M0DA 3UJNA 1SYCA 1GJXA 4BB9A 4XTCS 3P1HA 2B2WC 5CR3A 1B50A 4RF1A 4B3RM 2EYJA 2F0MA 4FCVA 1EU4A 2X69A 1SYGA 4GHLA 5KNCA 2BA0A 2CHBD 5EPKA 2F0TA 5KPZA 2UXDM 8CATA 3S1QB 4LJ7A 2NTSA 1LTTD 5EXSA 4KHZA 5DYIA 3R8BA 2XSZA 2A73B 4O1NA 5CMDA 1TH2A 4LFAM 5H37D 5G3LD 2VQFM 2KQ3A 1XYIA 1EY4A 2MUYA 3AKZA 4LJ5A 3GV3A 4S3SA 4JYAM 2SDFA 4K2LA 4KTAA 1M4VA 1T3TA 3SE0A 3MVVA 3HEJA 1JCKB 4H0LC 3K0YA 2UUCM 2UXBM 3ERQA 3SAWA 1D2NA 1SXJE 1O80A 2PNRC 2QEJC 3SBJA 1D5XC 4II7A 4K6LA 4DNTB 2YQZA 1QJOA 2B8GA 4D81A 4IN3A 1B9NA 3TP8A 1NJFA 2NBFA 1QZMA 1KDBA 5ITYA 3KBGA 3EVQA 4CJ0B 2OQ4A 4WJWA 5ITQA 3T51B 4QOZC 2E5LM 1O7LA 5LL6X 3E6ZX 3SYKA 3J7AV 2AHMA 1J8IA 4AQYM 1TWFB 3WHLA 5IGDA 1EWCA 2HCBA 1BCPC 4AW4A 1PMRA 1V43A 4GKKM 4H13C 3A98B 2OT2A 2RGOA 4QHSA 2NZ1D 4DGZA 4OL7A 3I72A 5EKLA 2DZNB 3A55A 1WVLA 5EGTA 5M5XB 3R93A 2B2TA 1NJGA 3NSWA 5ELDA 1VMCA 3T15A 1NNUC 3J2PB 1N78A 3NQTA 4QUCA 4F88A 4IFDH 5JEAH 3KF8A 4XT3B 3PXGA 3GP7A 4EVOA 2LH0A 1OO9B 3AV0A 3NHHA 1N33M 4LGMA 2R45A 1CI3M 1B3AA 3VR6A 2XVSA 1JORA 1K3WA 3UI2A 1DOKA 4M1UB 4NMZA 1G8PA 2R6GA 2NN6I 3NWSA 2E75C 4ZQ3A 5FTLA 2PQEA 1IXSB 5I2XA 5KPRA 3U6PA 1AN8A 2RKSA 3H09A 4K5VA 4W5WA 3KP0E 3JR5A 5CC4A 1VDZA 4R3DA 3M4YA 1N36M 4CBVA 3HHWA 1L1TA 2VQEM 4CKCA 4C3JB 5CBAE 1ML0D 2EYMA 4KN7C 4XGIA 1NSNS 2VB3X 1B4OA 3N6RA 3AOEA 5FLXS 4B9WA 1DGHB 1DCZA 5CGKA 1CHQD 1R2YA 2FOIC 3V2TA 4FCWA 1PRTD 1GVNA 2KA6B 2XN9C 4Q0FA 4FW9A 5EXPA 3J7AS 5K36H 2XFTA 1SYBA 1UM8A 5BN3A 2PZUA 4AZFA 1STAA 3J80S 1SE4A 1ENAA 4JBWA 2CE7A 1KFVA 5C0XG 1TS2A 3LVVA 2F0UA 2M2LA 3ND8A 4FF4A 1Q3LA 2Z1CA 2BJVA 1SYDA 4GZYC 1IN6A 4DV6M 5FSWA 1HNZM 3DWPA 1KLGD 4PQXA 5EBCA 2L6OA 5NUCA 1S5BD 3I4NB 1J9OA 4PT5A 1STEA 3TWKA 3HS0C 4KODA 4DR6M 3EQLC 2EA0A 4KKSA 1PJIA 5C3WA 2N55A 2PYKA 4DR7M 2L0CA 3H3VC 3KOYE 4M8AA 3SXHA 3E0JA 2EE1A 4JI7M 1R9TB 3QB3A 2Z8LA 4X64M 3KK7A 4N9TA 4DV1M 1L2DA 1MBYA 1XXGA 5IODA 4JV5M 5IOCA 4NXMM 4WFN3 4B9XA 2WAQB 1LTGD 2A6ED 4HCEA 3IL8A 4DFAA 4AG6A 3FEWX 1TIID 2YR0A 4KD3A 4KN4C 4N9PA 2EUCA 3NK9A 1Z5BA 3Q23A 1BCPB 1R6BX 4HN7A 2B2YA 2M60A 1H9RA 4OGQC 2HCCA 3ITPA 3CQZB 3U6SA 2B2VA 1ILQA 1AEXA 4M9SA 3O13A 1PFNA 4IBGA 1PLFA 5FTJA 1WTPA 4XIGS 3WOFA 3KBXA 3MC0B 5GKNA 2KXEA 1PTOD 3OIQA 1KABA 2L7HA 3ND9A 3L28A 2ZBKB 4EGVA 2F0EA 3PUWA 2Q8TA 2R4EA 2RBMA 2JA5B 2G9HD 4R9WA 3SHGB 1M8AA 4LJ9A 3GO5A 3U6EA 2NWGA 3HZXA 5K5PA 1C4QA 1OXUA 4CGYB 1HCZA 1JWMD 4KJOA 5LMNM 1NY5A 3IG8A 2EZVA 2FE8A 1HR0M 3PV0A 1G6ZA 1N32M 3HJSA 2HHHM 3T56B 2XRSD 3HJ8A 4LF9M 1ONLA 3VR2A 2A74C 4ABNA 3HOZB 5KEEA 3QAUA 1HHVA 2K32A 3D8GA 4NXNM 2CV2A 3T53B 1U4LA 4KMUC 1EZ8A 3D8BA 1TWHB 1W5SA 3KOWE 1IN5A 5I9PA 2D62A 3VLFB 2K5DA 3T1YM 3EFXD 3DZDA 1MD2D 3S1NB 4A3BB 4OIKA 1TKWB 4FNFA 4XBOA 2NB0A 2DZOB 4FWHA 4PNYA 5CV4A 5CORA 4O42A 1JOKA 1KLUD 1EY0A 2C98A 3CRLC 1DO0A 1F9PA 4I81A 2C96A 5EKIA 2K01A 3JAML 3VR4A 5C4ZA 2D7EA 4OX9M 3GPUA 3NTHA 5JI3E 4IJFA 3DFZA 1DOMA 1U4PA 3L26A 2KCNA 1IN8A 1SNPA 2R18A 4OO1H 1QWYA 4IFDI 4RCNA 3KP1E 4P16A 3I73A 3SFZA 3BVMA 1Z47A 1MI2A 5JI2E 3H91A 1H9MA 3U6CA 3PFIA 5EJWA 5M3FB 2AUJD 2F0WA 5BN5A 1TR5A 1QANA 1C1KA 1GUNA 3R3OA 5HGTA 4A3IB 4G4OA 3FYDA 2L4NA 4XDXA 2BDNA 3HHZA 1CA6A 1VF7A 5CBEE 2Z7JA 5JEAG 2QF7A 2HKJA 3MXUA 4IBCA 1SJHD 3GPPA 4DNRB 1HUMA 3TP7A 5C3EB 5F3WA 2J7NA 3DA1A 2IT1A 1U9RA 4BS9A 1I6VC 2QZ4A 2NN6H 2CW0D 1KNAA 3RMHA 3J27B 2X6LA 1SYFA 3DM1A 3PO2B 2DWLA 1NY6A 1BCPF 2A6EC 1FNUA 3A46A 2KZUA 1IKLA 1CK1A 3SAUA 5FLXE 4UAIA 2KEEA 1BQQT 2OEOA 1DO2A 1Z5AA 4DV3M 5KQDA 1V1OA 5BR8M 1BF4A 3K7AB 1IYVA 1PJJA 1NSFA 1TVXA 3SR1A 3HOUB 1EYDA 4RGMA 4PD2A 3PUVA 1JWUD 1XX8A 2XRQD 3KS8A 3Q8XA 4L6TB 2CV0A 5I6WA 2F0NA 2BA1A 1SNOA 2JSOA 3D3RA 4ZLTF 1VDDA 1SDFA 1HUNA 1H9SB 3U60A 5CV5A 1PTOC 2MPMA 1G59A 3QIAA 4C3JG 1LV7A 3LMMA 4REZA 5ITTA 4L15A 2VIIA 1STYA 4X3SA 5K36G 2D9UA 4JI8M 3TP5A 4LF5M 2Y0SB 2H1RA 3SARA 4AKIA 1EU3A 3GQ5A 1TWGB 2RSOA 5D3DA 4X3TA 5E4WC 2GA4B 1E9SA 4GIPA 3OIPA 4DXGA 5CV9A 4GC9A 1HQMC 3GPXA 3PUZA 2DNEA 3D4RA 4BLCA 2IX1A 5AFWA 5KRUA 1WXQA 3VA5A 2HDLA 3MXNA 4ZPXA 1BBXC 4PCZA 4UDUC 3RE8A 1X3QA 4GMQA 4BA1I 2BE5D 5LL6S 1K8MA 3KXEC 2DWNA 1Z7TA 5EP4A 4TUWA 2IW3A 1I94M 3PUYA 1EY8A 2YYZA 1EOTA 2B39A 2F0HA 3L2AA 1RHPA 4FXKC 2YU9B 2D5DA 3SC3A 2L5TA 2EVBA 2R92B 3GQ4A 2VNUD 4HL4A 3FPUB 1T5EA 2B63B 4ZKCB 1G291 3U6OA 5E6JA 2JEBI 2K33A 4CJ1B 3BDLA 5EPJA 5C4HA 1O7YA 3BYTB 5G3LF 3I51A 4OW0A 2QDBA 2SOBA 3J81S 1LABA 3BDCA 3W0LB 1EEID 3KLSA 4FO2A 1TY2A 3K8ZA 2EPBA 1EYAA 3A8JE 5C5MA 5DNYA 3BS1A 1B44D 4DU9A 5FO9B 3LX0A 2XNAC 2HL7A 4ZAIA 3E9SA 3SATA 1F9RA 3NPPA 3S9WA 1FNNA 1YNND 5FTNA 3QOJA 4KD4A 1G4AE 2LS01 1JC7A 4MHEA 4MGZE 1SXJD 1ZYRD 3A54A 5I6YA 2SNMA 1Q1EA 2QP9X 3NWTA 1DONA 2XH9A 2KHSA 1QE6A 3SK8A 2A69D 2K6AA 5EBDA 1J5EM 3HU3A 3TMEA 1GHJA 2OF1A 3VFDA 5IGBA 2CW0C 2F5SA 2F5OA 3SK5A 1MSHA 1EQTA 1XMQM 4G6ZA 3L29A 3W0FA 3PIO3 2G5GX 3QWLA 2M00A 1K3XA 1Y8PB 1Z59A 4QB4A 5COYA 2TMPA 3U6DA 3GLHB 1EYCA 2M9VA 3OMCA 4KO8A 4RGTA 4FYDA 4LCBA 4RFBA 1BNZA 4RHRA 4G7ZC 3KOXE 5DM63 1QAOA 2EXZA 2IL8A 1A2TA 4AI6A 1WCMB 1OXTA 3GTPB 2F3VA 2FFJA 2WB1B 3AU7A 4G7HC 3A56A 5E26A 1IY2A 2F0QA 4GH9A 4Z6YA 2QCPX 4TSSA 3MXPA 4LF7M 1Y1WB 1PTOH 1A3VA 5DEHA 4OO1I 2EYLA 1CA5A 1G41A 4KY5A 4XXEA 5C44B 3KS4A 3EIHA 5JPMC 2RGHA 4MGHA 1X3PA 4RGNA 2B2YC 2F4VM 1PXUA 3DUZA 4EQNA 2LNHC 4JXJA 2A68D 1G2SA 3DEOA 2B2VC 5D65A 4NP5A 3IFTA 4RHSA 2Y0QA 2HDMA 4DV2M 1JB3A 1IN4A 3PMFA 1NHGC 3FUUA 1CM9A 1OFHA 3URYA 4OO1G 3GRVA 3TWLA 1D1IA 2D7GA 4CHTB 4K14A 1MX0A 1C8CA 5EP3A 1HT1E 2C9CA 4R8IA 3KFUG 3V05A 3S1RB 3FPPA 2KEBA 1JQYD 2KRKA 5FKAC 4DR5M 4FVMA 3GLIB 4NOOB 4LFBM 1I50B 4F87A 4QIWB 2BE5C 2IPKD 5IT9L 1R2ZA 4K5WA 3TZDA 5KNBA 4EQPA 1L1ZA 2F5PA 5ITXA 3FD9A 2DWMA 4YIJA 4IBDA 1E2ZA 5D3IB 1Q1BA 2FMCA 4LGYA 1WTXA 2D7HA 2R4JA 2RDFA 2G9DA 1D1KA 2NVYB 1HTLD 4DN4M 5IREB 2NN6G 5ITRA 1OFIA 2QPAA 2QENA 4RGOS 5EJCA 5FO7B 1I4RA 1CFMA 3OW7A 5JAVA 1NVMA 1QAQA 3FUVA 2L09A 3UZUA 4IUTA 3VR3A 4J8QA 4QNMA 1N34M 3N52A 3I3CA 3L25A 4IBFA 1LLRD 4TRDA 1DGHA 5IIFA 1W5TA 1IY0A 2FMMA 3L9AX 2P5TA 3HU1A 4IBIA 4ULLA 4MN3A 4QOSA 5C0XJ 4NL4H 5A2QS 3L7ZC 2BNKA 3D6WA 4X62M 3TBIB 1YNNC 2R3ZA 1SXJC 1ZYRC 1SBBB 2LXEA 1HNXM 3KSJA 1ENFA 1UEAB 1IYUA 1N75A 3SAVA 3TWMA 1EWHA 5ELEA 4DA2A 3NXWA 2A69C 5JPNC 3P75A 1JWSD 5E4XA 4IIWA 4Y7NB 4ITQA 4LJ4A 2JE6I 4KLNA 1LTSD 1E32A 5LHY1 4HAEA 3RZDB 1J09A 1U4MA 3SDZA 1IXZA 1Z6HA 3C1EA 2PW5A 3WHKA 5BN4A 1AZPA 3GPYA 5IGEA 1R4PB 1HQYE 2XSCA 2CEAA 4S12A 3CRKC 1PTOF 2X8AA 1NHWC 1HPCA 3A8IE 3AL0C 3W2DA 4IUNA 3S1MB 1XC8A 4RWSC 1YSYA 2Z3XA 4G4RA 3SK4A 4HSPA 3VR5A 4CJ2C 2KZSA 2ENBA 1JOOA 3G6JB 2XSZD 3M85A 1DGGA 4ZUJA 4GHAA 1HQRD 1NNJA 3NP8A 1L8QA 3RGSA 4DUZM 3J81E 1NCVA 3GLGB 3R2TA 2EY5A 3K5OA 3BOSA 3U6QA 3PVSA 1I6HB 4V190 2EOTA 2X4AA 2C5CA 4DK0A 1V1PB 1W6KA 5C4XB 3A8KE 3BG3A 4KHVA 3S17B 1S5FD 4RKBA 2A68C 5JVH3 4LF8M 4KHPM 1RJTA 3UGJA 2CQAA 1AZQA 2H1EA 2RDHA 3D6CA 4IURA 3LQRA 2F0DA 3I4VA 1V1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGY B;  4CHT B;  3NBI A; 
#chains in the Genus database with same CATH topology
 2GN5 A;  1YNJ D;  3S16 B;  5C4X H;  2K05 A;  1MSG A;  2UUA Q;  3QJY A;  4C3H B;  4CDE C;  3D31 A;  3GTJ H;  5I2Y A;  2OXP A;  2OTL A;  5E1F A;  2R93 G;  2LMC B;  4A3J B;  4BA2 I;  1BDO A;  1VQ4 A;  2PQA A;  5CV6 A;  2KHI A;  1K8O A;  1LO5 D;  2MR9 A;  5EP1 A;  1JJC B;  4JN6 A;  2EJF C;  1W6J A;  2KW0 A;  2JA6 H;  5L8R F;  2BJW A;  1JOQ A;  4Z8X A;  5J3B A;  4B3T Q;  3M3Y H;  1Q12 A;  1IXR C;  4A3J H;  1DOL A;  3S24 A;  1PYS B;  1VQ1 A;  2UXC M;  3B7Z A;  3UK6 A;  3JAM i;  4C56 C;  3P7J A;  4DKA C;  2PI2 A;  3HG9 A;  3K81 C;  1ZQ9 A;  3IAY A;  3OTO L;  2F1M A;  2RHQ B;  2ZM6 M;  3K5M A;  1BXT A;  1CT1 D;  4RNA A;  1S5D D;  1IBL L;  4A3G G;  2ZXO A;  4Q5V A;  4DXF A;  2I46 A;  3HOV G;  2E2I H;  5EP2 A;  1UNS A;  2E76 C;  4ME5 A;  4P71 A;  2L12 A;  2OQ0 A;  4IBB A;  1MJG M;  4C2M H;  4JI2 M;  1F2Y A;  4HIO A;  4IBE A;  1K9M C;  1UE7 A;  5C4J H;  1PH8 A;  2I7P A;  2RHS B;  4HJ7 A;  2MP1 A;  4RA8 A;  1DGF A;  4LFC L;  4GNX B;  2Q2E B;  2FS1 A;  1LTR D;  2WAC A;  2A19 A;  1PRT C;  4JI5 Q;  3I4M B;  1TY0 A;  3T1H M;  2WB1 E;  4JI3 Q;  1OXV A;  3U4V A;  1CQF A;  2WKC A;  1PH7 A;  3RZO H;  1LYL A;  3GO8 A;  4NSO B;  1UFZ A;  3NBH B;  3R8F A;  4F8M A;  2MGS A;  4ILW A;  2LBC A;  4LK1 C;  1XNR Q;  4ZK9 B;  4GNX A;  4L63 B;  1VQ9 A;  1FL0 A;  3J7A F;  2FIN B;  3F2C A;  3THG A;  3FTC A;  5IP7 G;  4X65 M;  1IBK M;  1K73 C;  3CC7 A;  1XXH B;  1ET9 A;  2K75 A;  2RVL A;  3A42 A;  3KUP A;  4KY7 A;  1PRB A;  1O7Z A;  3RUZ A;  3SEB A;  1IL8 A;  3G7L A;  4B3R L;  1Y1V G;  3NBH A;  2EXD A;  4LG2 A;  3CHB D;  5IYC H;  1XTD A;  3CKI B;  3H4M A;  2JXM B;  2NQ8 C;  3GTK B;  1Z9F A;  2UXD L;  1H95 A;  3RGP A;  2YNM D;  5M3M B;  2MFI A;  4FWG A;  5C6A A;  3AFH A;  3E9I A;  4NDX A;  4HR7 B;  4HCS A;  3KFU A;  4G3O A;  4LMQ D;  4ME3 A;  2VF7 A;  2R46 A;  4LFA L;  1WGN A;  3UDG A;  2VQF L;  1S72 A;  3STB C;  1G8Z D;  5T1G A;  1VQG A;  3CGW A;  1EQR A;  3TL4 X;  2KRU A;  1TDH A;  1YBY A;  4R1J A;  2NYZ D;  3GRY A;  4LJ8 A;  3BZC A;  3NTI A;  1Y1W G;  1XMO Q;  1EY6 A;  2GVA A;  2K4K A;  5ITX E;  2SEB D;  5EQT A;  5F2D A;  2O5J C;  3TZU A;  2R7D A;  3K7U C;  3C1F A;  2PZW A;  1I4Q A;  1SNM A;  5JEA J;  5KGU A;  2LFN A;  1K83 B;  4IFD G;  2QGQ A;  4QIW E;  1XNQ Q;  4BBR H;  4PZ6 A;  2UUC L;  2UXB L;  3L2P A;  3MAQ A;  1MGS A;  5CYU A;  1SFO H;  1HA6 A;  3G4S A;  1G6P A;  3H0G H;  4B3M M;  4XQJ A;  4BBS H;  1XMO M;  3NBX X;  3HJQ A;  1RF2 D;  2F0L A;  3U6M A;  1R4G A;  3VK7 A;  2CWA A;  1TXY A;  3I4L A;  1XNQ M;  1AH9 A;  4X66 Q;  4GLA C;  4JW0 A;  1CSP A;  1Q3B A;  1R7R A;  3MXG A;  4P2C B;  3PIO A;  1G3I A;  3CMA A;  3HKZ B;  3Q6S A;  4R4Q A;  4KT0 F;  2LSS A;  2I5L X;  4FF1 A;  3C3D A;  4IQZ A;  2DY8 A;  2E2D C;  2L15 A;  2E5L L;  1LT5 D;  4QQB X;  4QF4 A;  3T38 A;  5IWA Q;  1G2T A;  2CUZ A;  1GKI A;  1HFG A;  4AQY L;  4X66 M;  3OYY A;  1JT8 A;  4A3M B;  4JK1 C;  4G7O C;  2CHQ A;  1R4Q B;  1OAO C;  2DNC A;  2CWB A;  1TWC H;  3FUX A;  5FTK A;  4GKK L;  3PO3 G;  1DJR D;  2Q2H A;  3C2P A;  2NVQ H;  2K50 A;  2B3T A;  4I5S A;  3GDE A;  5LMU Q;  3G6E A;  2QBY B;  3HZJ A;  1CZG A;  3FKI H;  3RN5 A;  2K47 A;  1Q90 A;  4JI1 Q;  1TS4 A;  2HD3 A;  1VQF A;  5ELN A;  4FF2 A;  2XGN A;  4XQQ A;  4OEM B;  5A2Q E;  3F2D A;  1S5E D;  4FXD A;  1F2M A;  4A3D B;  4FCT A;  2O4X A;  3CC2 A;  5FK9 C;  4FDB A;  3MWY W;  4E6I A;  4JBK A;  4RAU C;  4BWG B;  1QQW A;  1D6E C;  1B1Z A;  4ANR A;  3HWS A;  1Y14 B;  3GP1 A;  1MU5 A;  1IN7 A;  3ILK A;  4I65 A;  4BY1 H;  1N33 L;  2E8G A;  1GXD C;  1YNJ C;  5M5W H;  1IY1 A;  1Y8O B;  3K5L A;  4WUR A;  1H9S A;  2N88 A;  3T16 A;  1YJW A;  4F2L A;  3E46 A;  4PDI A;  2WKD A;  1I5F A;  4KY6 A;  4B7H A;  4DR3 M;  3TQS A;  2XZU A;  5I4D A;  2I07 B;  3HOY B;  3U9O A;  2QIL A;  3PF4 A;  1GO3 E;  1NR2 A;  3FUT A;  4YY3 L;  1F9S A;  2FHT A;  1K82 A;  3HFZ B;  3L3O C;  1F2L A;  4K8I A;  1KTK A;  4P17 A;  1K0S A;  3B9P A;  3A7A B;  2MHV A;  2F4I A;  5KND A;  1RD9 D;  4YCW A;  1SN8 A;  3K0X A;  2L7I A;  4NB3 A;  4WRD A;  1WTV A;  4IOA A;  3H15 A;  1ZEQ X;  3I01 M;  2DWZ B;  2UUB Q;  3GTM H;  3MHV C;  2B2T C;  4X3U A;  4IUU A;  1N36 L;  3TPZ A;  1SR3 A;  4TVA B;  2WP8 J;  2VQE L;  3HOW B;  3GRR A;  4JI0 M;  1SE3 A;  5IP9 G;  2XWJ B;  2R7Z G;  2DNA A;  4KK7 A;  1JJG A;  1EY5 A;  4GOP B;  4WW0 A;  4Z9C B;  1ILP A;  1ZMW A;  1PRT B;  2VB2 X;  1JR3 A;  1QDT A;  4I8O A;  3OWF A;  2KA7 A;  1QDR A;  4NC6 A;  3S15 B;  2Z4I A;  1DZ1 A;  1SNQ A;  3K6O A;  4A3C H;  1JR0 D;  3MFG A;  4YHH M;  4V0B A;  2NUC A;  2RDG A;  3VYR A;  4A93 G;  3A7L A;  4IJH A;  4GOP A;  1VMP A;  3NQI A;  2IHE A;  5KPT A;  4TQU S;  3U61 B;  3KF6 B;  3S2H B;  1PH2 A;  3E4R A;  4M9X A;  2F5N A;  1HZB A;  1HQC A;  3IRB A;  2E2J B;  3J81 j;  2NVT B;  2AQ1 B;  5EXT A;  1QVR A;  3OTO Q;  4Y28 F;  4HED A;  2B29 A;  1W2B A;  1IBL Q;  1AE3 A;  1EQV A;  1LTB D;  3RD4 A;  4AIM A;  1TQO A;  3HKP A;  3P20 A;  4NW2 A;  1B9M A;  3JAM S;  5M5Y H;  4DV0 M;  1A0I A;  1HZ9 A;  2PCF B;  3FTE A;  3S2H H;  2OTJ A;  3ULJ A;  1YVC A;  4QMG A;  5C3X A;  1WTQ A;  4BY7 G;  1SMY D;  1GUG A;  4NSR A;  2ZXR A;  3J80 i;  1WTO A;  2R93 B;  1XHB A;  1GHK A;  1QUT A;  1CTM A;  3AQQ A;  3FUW A;  4B3S Q;  1GL6 A;  4DV4 M;  5EKK A;  4DV6 L;  3GQ3 A;  2OPF A;  2A6H D;  3LCV B;  4WJ3 M;  4IOC A;  1HZA A;  3DWA A;  1I3Q B;  3K9O A;  1HNZ L;  1NY4 A;  4LFC Q;  4FF3 A;  2DAE A;  3MK6 A;  1EEF D;  2JA8 G;  5JJZ A;  2VS1 A;  1WJ7 A;  4C3I H;  3M9B A;  5FLX L;  3Q8D A;  3FKE A;  1KAA A;  3AOE C;  3FRP B;  4DV7 M;  3R9X B;  4GC5 A;  3M7N A;  1EFW A;  3K1J A;  3M7G A;  3ULP A;  4B3S M;  2JJQ A;  3MHB A;  4MIU A;  1F4I A;  4DR6 L;  3U5Z B;  3JR4 A;  2BDO A;  2KUM A;  1TWA B;  3S2D H;  4DR7 L;  4A3G B;  3E5S A;  3EIV A;  5BPV A;  3HOV B;  1RL2 A;  5ELB A;  1AP0 A;  1VQN A;  4AKG A;  3M4O B;  4HTH A;  5T1I A;  2PI2 E;  4MH0 E;  3IFD A;  4JI7 L;  3VK8 A;  3TQY A;  4A3E H;  4A3F B;  1UUP A;  2DHR A;  1YIJ A;  4A3K B;  1J7K A;  1EL0 A;  3U5Z A;  4X64 L;  3J80 L;  2QNJ A;  4DV1 L;  3R2I A;  2UXD Q;  2CFO A;  5IT9 E;  1LTI D;  1Z5C A;  1ZMV A;  2LHG A;  1ET6 A;  5C4X G;  4JV5 L;  4AKH A;  3L0O A;  4NXM L;  1A3U A;  5E3F A;  4RKL A;  4XT1 B;  2KHJ A;  2OWO A;  5EPL A;  3CF0 A;  4LFA Q;  1ZAE A;  4HMJ A;  2VQF Q;  4IUQ A;  3Q22 A;  1QNK A;  2GNO A;  3DWQ A;  4P75 A;  5ELO A;  1QZE A;  1GUS A;  5IYD H;  1F9Q A;  1BUV T;  4FD2 A;  1IQP A;  4C3H G;  1H9K A;  1V8Q A;  3K57 A;  1B2T A;  1TH3 A;  2K04 A;  1EY7 A;  2DAG A;  1J6Q A;  4AG5 A;  4A3J G;  1PZJ D;  1TH4 A;  1F2Z A;  1Y1V B;  2UUC Q;  2UXB Q;  4MM3 B;  1LT4 D;  1VQO A;  1S5C D;  4RCO A;  3CC4 A;  1WTW A;  4AYB G;  1SMX A;  4PMW A;  3S1Q H;  3I04 M;  5LMN W;  5DAU A;  2D2C C;  1QIL A;  1PH4 A;  1PH6 A;  1HFN A;  3PSI A;  3PIP 3;  1SYE A;  2QDL A;  4LJZ C;  1TT2 A;  2K5V A;  5EXX A;  1HR0 W;  1PTO B;  1UWV A;  2J7Z A;  1Q46 A;  4DAV A;  3TSS A;  3GLH A;  1WR1 B;  2F0I A;  2OOA A;  4B7F A;  1VF5 C;  1EIG A;  1FR3 A;  3ZC7 B;  2IX0 A;  2AWN A;  3KVW A;  1OXX K;  1SXT A;  3AJI B;  2DAM A;  4RF0 A;  4GKJ M;  1DYQ A;  4HEO A;  2E74 C;  1XTC D;  1VQ7 A;  2Q2U A;  2GQF A;  3SYL A;  2E5L Q;  3HP3 A;  4H02 A;  1L2B A;  4XK8 F;  1NAP A;  4G4K A;  1IBM M;  2L4E A;  4L5R C;  4JI4 Q;  2DJF C;  4JI6 M;  1STN A;  7CAT A;  1NUC A;  2G8L A;  1GUO A;  4P73 A;  2K6B A;  1VEG A;  1SND A;  4CKE A;  1WD1 A;  4QUF A;  1ENC A;  1E9R A;  4HSV A;  3HOX B;  2LVP C;  3BYY B;  4QCL A;  3PCO B;  3OW2 A;  3SAS A;  1SE8 A;  5HUR A;  5LMN L;  1H9J A;  2VW9 A;  4JI4 M;  2IX3 A;  2Q2I A;  2EKK A;  5IYC G;  1E1O A;  1WYD A;  1HR0 L;  1NMF A;  1AIP C;  1NTG A;  1N32 L;  2HHH L;  1EZ6 A;  3A5Z B;  3KF8 B;  4IAL A;  3CTW B;  1X65 A;  3CU7 A;  3X3N A;  3D4D A;  1RDP D;  1PRT F;  1TWF H;  4JOI A;  2L1B A;  4CIS A;  2KHH A;  4XQN A;  2F3W A;  3ER0 A;  3KJP A;  4NXN L;  1N33 Q;  2KEC A;  3C46 A;  5JJL A;  1YLA A;  3S14 B;  1KAW A;  1M90 C;  3KLS X;  1D7Q A;  4FXG C;  3PO3 B;  3K58 A;  5CV7 A;  1QOH A;  3TN2 A;  1EIH A;  3BJU A;  3TE6 A;  4YY3 Q;  4LF6 M;  2ZAN A;  5E7N A;  4L16 A;  2NTT A;  5M5X H;  3X3M A;  2OQK A;  1LT3 D;  3M0E A;  3JC6 6;  4DAP A;  3T1Y L;  1XWE A;  3VDU A;  2DXI A;  3A74 A;  3SHL A;  1O78 A;  2JY8 A;  3GLI A;  4BBR G;  5ITU A;  2CQO A;  1HJP A;  1CKN B;  4OIJ A;  1T5X D;  1HXY D;  4F7X A;  5KIX A;  1QG7 A;  3VDP A;  4YY3 M;  1WJJ A;  4GIT A;  1PJQ A;  3IHP A;  3H6M A;  4L6V 6;  3OHX C;  5C5L A;  2UU9 M;  3WOE A;  4BBS G;  2WIN B;  1PJT A;  3DEP A;  3FDT A;  5EQ0 A;  1IFY A;  1GKH A;  2APL A;  1JE4 A;  2VQE Q;  1OAI A;  1I4X A;  4ZYS A;  2I5H A;  2HUG A;  4DR2 M;  1STG A;  1VQI A;  2B2U A;  3KLW A;  4C1N K;  3VKH A;  1PH9 A;  3RLN A;  4XYQ A;  4LJ6 A;  4CIZ A;  1SMY C;  1CZW A;  1EOV A;  4OWT B;  1LTA D;  2V4D A;  4DV5 M;  3Q0A A;  1QB5 D;  1AFP A;  3RN2 A;  3CW2 C;  2A6H C;  4U67 3;  2ICI A;  1JR3 D;  3HU2 A;  3FVQ A;  4HLQ A;  2CCZ A;  4IJE A;  1L1O B;  1DGS A;  3I90 A;  1C9O A;  2HT1 A;  3QO2 A;  3HKZ G;  3TP6 A;  5C18 A;  2YV5 A;  1HTP A;  3TDQ A;  5IGC A;  5C0X I;  2ID0 A;  1L0W A;  1RTO A;  1BOS A;  1Q8I A;  2E2H B;  3ONA B;  4R8N A;  2Z4R A;  4C3J H;  4A3M G;  1L1O A;  2C9O A;  3U6L A;  1GVP A;  1P8L A;  2B2W A;  1NJI C;  1FJG M;  2R7Z B;  1D0L A;  1Q3C A;  1C48 A;  3NE5 B;  5JVG 3;  3GTO B;  4K0K M;  4IBJ A;  3NWL A;  5FLX c;  2PPB C;  1KYI A;  2HQE A;  3BZD B;  2F0S A;  1VCI A;  2JEA I;  1CKM A;  1STH A;  4DV6 Q;  1GUT A;  4DAY A;  3DMU A;  4KKT A;  1HNZ Q;  1OJL A;  1DXM A;  4L8J A;  3LNN A;  2EDG A;  4MB7 A;  1NBW A;  4PG3 A;  4BY1 G;  4A93 B;  4HIK A;  3NEL A;  1IM2 A;  5M9O A;  4L78 A;  3GTL B;  2G5D A;  2JZ0 A;  2CV1 A;  1YE9 A;  2CHG A;  3D4W A;  2CRU A;  2C5R A;  1H6U A;  4ZUI A;  5J39 A;  2XF3 A;  3KDS E;  1ORY B;  3K59 A;  4G4N A;  1TR8 A;  4DR7 Q;  1X37 A;  1PFM A;  5KYL A;  3ZQJ A;  1SJE D;  4LRT A;  2HQL A;  4JC0 A;  4DV3 L;  3MTS A;  3Q24 A;  2AQ2 B;  4BY7 B;  1RU3 A;  3I8Z A;  4JI7 Q;  2F03 A;  4CDD C;  3K2L A;  5BR8 L;  4L8R C;  2PW7 A;  3GTG B;  3CF5 A;  4X64 Q;  2JP1 A;  2X49 A;  3K8A A;  4DV1 Q;  2KNV A;  4K6D A;  1G91 A;  3CF6 E;  3CF2 A;  5IZ7 D;  2XFS A;  2KOL A;  3I4N H;  2F0F A;  3A45 A;  4NXM Q;  1MJC A;  2JA8 B;  1VEK A;  1GUW A;  1HRJ A;  3OPO A;  2EJG C;  1HT2 E;  1Y8N B;  2NVX B;  3AOG A;  1ZV1 A;  4C1N I;  1SAP A;  3JAM E;  4BBA A;  1RKN A;  4QHT A;  3GRU A;  3ZH9 B;  2K0B X;  1VQB A;  1LAC A;  2QHO B;  2I7N A;  1PDQ A;  1ROD A;  2J5Y A;  1RTN A;  2K7V A;  4IZ8 A;  1MN3 A;  3PGZ A;  3VYS A;  4DUY L;  4L5S A;  2VUM B;  3KJO A;  4LAA A;  2RA4 A;  3CAM A;  4IUP A;  2F3I A;  2JQO A;  3OOC A;  1R9T H;  2LHC A;  1TGU A;  2DN8 A;  2AQ3 B;  1E94 E;  2Y21 A;  4PDG A;  2L55 A;  4FP5 D;  2V1C A;  2Q8I B;  3ZJY C;  3PUX A;  3VKG A;  4JI8 L;  4PMC A;  3W1B A;  3FRH A;  3F2U A;  4NRV A;  2M5Z A;  4PV1 C;  4LF5 L;  3GTQ B;  1E2W A;  1RCV D;  1XPR A;  3GLG A;  1WOC A;  3K92 A;  4LNQ A;  1K28 A;  4G4Q A;  5FJ8 H;  5J22 A;  2R61 A;  2N35 A;  2V1U A;  1VQ6 A;  2QA4 A;  5FOB B;  3GTJ B;  2TSS A;  2F0G A;  2QKI C;  4K5X A;  2BOS A;  1SE2 A;  2PZT A;  1E0B A;  2EYF A;  4WOR A;  1GOZ A;  3BBZ A;  2ES2 A;  1Y69 U;  1IHZ A;  2LTU A;  4OU7 A;  2A5Y B;  1FD7 D;  3SMS A;  3T4A C;  4OEL B;  4D82 A;  2JA6 B;  2VF8 A;  2VZA A;  1UAP A;  2K14 A;  4C3I G;  2KED A;  3BDO A;  1HNW L;  3M3Y B;  3CQZ H;  4LJA A;  1AW7 A;  1A6X A;  4U68 A;  3SVM A;  5GAG C;  2N8N A;  1S3S A;  2AUK A;  4M0W A;  2SNS A;  4AYB B;  1KDA A;  1YHQ A;  2JYO A;  2RSN A;  1LUZ A;  2KDL A;  3NBI A;  1I4H A;  2UUA M;  2EY6 A;  3B74 A;  5FO8 B;  2JUJ A;  2R65 A;  3HRZ C;  1YIT A;  3DXJ C;  1N77 A;  2E2I B;  4B7G A;  1I94 L;  1SEB D;  1WIV A;  1PZI D;  5IT9 S;  1I4P A;  2ZAO A;  1FGB D;  3SK6 A;  1IW7 D;  3OWE B;  5LMN Q;  1VQP A;  3J7Y W;  3B6Y A;  2KJX A;  5KYI A;  4A3E G;  3J7B A;  1L0X B;  4C2M B;  2ZT9 C;  5ELC A;  2XZF A;  4K8J A;  1HR0 Q;  5C4J B;  1QYR A;  1N32 Q;  2R62 A;  4B3T M;  1XWI A;  3OSO A;  3ZCB B;  2JA5 H;  3GLH E;  2K03 A;  3T13 A;  1TS3 A;  4A3F G;  4NXN Q;  4XYO A;  5ELF A;  4A3K G;  4LZJ A;  3RZO B;  3V96 A;  2J7O A;  2PO4 A;  3EJI A;  2X6G A;  2O5R A;  2OOB A;  5IYD G;  4EIW A;  1PFB A;  1RIP A;  4TKO B;  1NMG A;  1PM5 A;  4IBK A;  2CH4 W;  3M4P A;  1SG9 A;  1QNU A;  3T1Y Q;  2ZJP A;  2MGW A;  1D2B A;  2EYP A;  1CSQ A;  3K9P A;  2XIW A;  1KNE A;  1Z6T A;  1X32 A;  2YFQ A;  1FNW A;  4OHJ A;  2WII B;  4I4L A;  1SXJ B;  2Y20 A;  2KCC A;  3SHF A;  4JI5 M;  1ZKO A;  1B7Y B;  1WD0 A;  3HOZ H;  2WSF F;  3IKJ A;  2Y0T A;  4JI3 M;  5KO3 A;  3BVZ A;  3NTK A;  2RF4 A;  4LF4 Q;  4D80 A;  4NRW A;  1GJT A;  1V1P A;  3M4Q A;  3UE0 A;  5I9O A;  3J7Z C;  2EO2 A;  2Q8R E;  3HHX A;  1XNR M;  3KOZ E;  3EA6 A;  4LZZ A;  1TWH H;  4H44 C;  1SXJ A;  4CDC C;  2WV6 D;  1YJ9 A;  4EQO A;  4KV6 A;  3VA7 A;  1XPU A;  1XXH A;  1Q86 C;  5GQO A;  2K5W A;  2IWH A;  3S1N H;  4LF4 M;  4KKU A;  1VQM A;  2ASB A;  2F0P A;  4A3B H;  1CKO A;  4R4I A;  2W82 A;  3FE3 A;  3L27 A;  4DF7 A;  2HCI A;  3M6A A;  2J4X A;  1J5E L;  1KDC A;  5D14 A;  2D0O A;  2F0V A;  3J81 L;  4BBR B;  3HGI A;  1TS5 A;  2RKO A;  4ZKB B;  1DGB A;  4DR4 Q;  1BO0 A;  2CHV A;  1SFO B;  4JYA L;  5TSS A;  2L2D A;  2I0Q A;  3U9S A;  3H0G B;  4BBS B;  4MGK E;  1PH1 A;  3PF5 A;  3IG5 A;  1XMQ L;  3SMP A;  4IFD J;  1Q39 A;  3GLI E;  2ZXP A;  1E2V A;  2F5Q A;  2BCO A;  1D5Z C;  3ERO A;  3ZYY X;  4HMI A;  4DR4 M;  1KSF X;  1X56 A;  4MGY E;  1JIC A;  4QNR A;  3I4Y A;  3AMU A;  2Z4S A;  5FTM A;  2L9H A;  3PNY A;  3HOX G;  4OWX B;  2R0I A;  5GAE C;  5A35 A;  2FJ2 A;  3MZ5 A;  2XEP A;  5AJ3 L;  2MJ8 A;  1BR9 A;  2EY2 A;  3K5N A;  3LWE A;  2VDB B;  3FTD A;  3D8L A;  1VQ8 A;  3F92 A;  1EE8 A;  5M3F H;  2O01 F;  1HA5 A;  2EJM A;  1NO1 A;  1TWC B;  2N3S A;  3KLR A;  2ZJR A;  2BWE A;  2L11 A;  4Q7J A;  2HIX A;  2PMZ B;  1SNC A;  2NVQ B;  2V6Z M;  1SRU A;  1PZK D;  3QG1 A;  4I7Z C;  4A3I H;  1B53 A;  2QQ8 A;  1D5M C;  4LF7 L;  2Z4H A;  3FKI B;  4MGI E;  2K1B A;  3BVG A;  1NE3 A;  2FXQ A;  3NUC A;  1KXL A;  1CQV A;  5IGF A;  4DV3 Q;  5BR8 Q;  3PIP A;  4ID6 A;  5IWA M;  5C3E H;  1DV0 A;  5DYG A;  3C3L A;  4LUV A;  1T9H A;  2F0J A;  2JA2 A;  2F4V L;  1A2U A;  1JQJ C;  4MTK A;  4CDF C;  4BY1 B;  4KI0 A;  3PO2 H;  1QAM A;  2EYH A;  2B8F A;  2LY7 A;  4DR1 Q;  5M5W B;  3I55 A;  1L2F A;  4G57 A;  4JG2 A;  1ESR A;  4K2K A;  3MFY A;  4DV2 L;  1FNV A;  2JZ1 A;  3KDF B;  5LMU M;  2DY7 A;  2QBY A;  1A63 A;  1QZH A;  3U60 B;  5J1Z A;  4JI1 M;  3GQB A;  4FWD A;  1U4R A;  4DUY Q;  1GLN A;  4DR1 M;  5C0X H;  3GLF B;  1G51 A;  3GD7 A;  2EIF A;  4J1M A;  1VQL A;  4H7B A;  3LVW A;  3J80 E;  1X6O A;  3K7A H;  1E22 A;  2EY1 A;  4GRI A;  3EIE A;  2RQX A;  3HOU H;  4JI8 Q;  4RH6 A;  4DR5 L;  4YWM A;  3TRE A;  2LWX A;  1FYC A;  3VYU A;  2VXW A;  4LF5 Q;  4LFB L;  3GTM B;  5KQ8 A;  1DM0 B;  1VDL A;  3UMM A;  4DUY M;  1STB A;  1ZXT A;  2ZAM A;  1BCP D;  3GLF A;  3AB9 A;  4ZRZ A;  1EIJ A;  1LT6 D;  3H94 A;  1I4W A;  3FTF A;  2N78 A;  2ERC A;  1A15 A;  1IXR A;  4QL5 A;  1HZC A;  1LTM A;  3KSX A;  4IPC A;  1ICW A;  5DM7 3;  4R7G A;  1IW7 C;  2JK8 A;  2NZO A;  3LGJ A;  1L2C A;  4M9Z A;  2F0O A;  2XLJ A;  4HJ8 A;  4LWC A;  4O2D A;  2LKV A;  4A3V B;  1KQS A;  4ODG A;  1HNW Q;  2A5H A;  4RKU F;  2K5Q A;  3MXN B;  1A3T A;  1II3 A;  3CCL A;  4X3K A;  2UUB M;  2EYO A;  5DNF A;  4B08 A;  3NEN A;  3MEH A;  1N34 L;  1MKH A;  3DOA A;  2D0P A;  3I70 A;  2KCT A;  1TWG H;  5JOB A;  2JA7 B;  1SSO A;  1HNW M;  2IJ0 A;  4RG1 A;  1I94 Q;  2ZTD A;  4MNO A;  5M5Y B;  3MJ5 A;  4OON A;  2Z9H A;  3MA2 B;  4IO9 A;  3B89 A;  1F77 A;  2K28 A;  3QWN A;  2F0K A;  1V34 A;  3PNV A;  1ESF A;  1U0L A;  3F2B A;  1JJ2 A;  3GLG E;  2DVW B;  2ICE C;  3C58 A;  1QCB D;  3DHQ A;  2GVB A;  3E9H A;  3VYT A;  2DJG C;  1A62 A;  4OVZ B;  2J0T D;  3HKS A;  2JA7 H;  3W3A A;  1LV9 A;  4JBJ A;  4OXP A;  3I4N G;  4DK1 A;  1PVO A;  3U61 A;  3KF6 A;  3FYC A;  4C3I B;  1UE5 A;  5IGG A;  4X62 L;  1TDZ A;  1EFI D;  1PH5 A;  1YUB A;  4IUV A;  3W1G A;  3OMG A;  1IKM A;  1L0Y B;  1PYW D;  2CVR A;  3OTO M;  1GL7 A;  3RLF A;  4OVZ A;  4PMB A;  3I91 A;  1WTR A;  1IBL M;  4NKL A;  1HNX L;  1TU2 B;  2K52 A;  3E21 A;  1I4G A;  3S2D B;  1OXS C;  3QOL A;  5CV8 A;  5EAY A;  2AWO A;  2B2U C;  3LWU A;  2FNA A;  4LRS A;  4CKB A;  3LQQ A;  3KYH C;  2QCU A;  2OCE A;  4A3E B;  2O5I C;  1S4Z A;  2KVM A;  4X6A H;  1EY9 A;  3HHY A;  2FFK B;  2QW7 A;  2QEX A;  1KIX A;  1IYJ B;  2YU9 H;  2R92 H;  4LFC M;  2O2L D;  3GV6 A;  4KJN A;  5GAH C;  2B63 H;  2VUM G;  5C1B A;  3HGB A;  2WAQ G;  2Z0S A;  1Q7Y C;  5FJ8 G;  3WDN A;  2B3G A;  4J6H A;  4AYB E;  2C99 A;  2XWB B;  1NR4 A;  4L4U A;  1DD2 A;  4B3R Q;  3FMC A;  1CHP D;  2H4O A;  3KW6 A;  5ISR A;  2CH4 A;  3J81 c;  4LY6 A;  5A2Q L;  1E3P A;  3RFW A;  4M0D A;  3UJN A;  1SYC A;  1GJX A;  4BB9 A;  4XTC S;  3P1H A;  2B2W C;  3G48 A;  5CR3 A;  4EQ5 A;  1B50 A;  4RF1 A;  2C35 B;  4B3R M;  2EYJ A;  2F0M A;  4FCV A;  1EU4 A;  2X69 A;  1SYG A;  1J5E Q;  4GHL A;  5KNC A;  2BA0 A;  1YI2 A;  2CHB D;  5EPK A;  2F0T A;  5KPZ A;  2UXD M;  8CAT A;  4A3L H;  3A5U A;  4GLV B;  3S1Q B;  4JYA Q;  2WZJ A;  2AHO B;  2R7F A;  1YEZ A;  4LJ7 A;  2NTS A;  2JA6 G;  1LTT D;  5EXS A;  3W68 A;  4KHZ A;  5DYI A;  3R8B A;  1XMQ Q;  2XSZ A;  1C7Y A;  2A73 B;  3PQI A;  4O1N A;  5CMD A;  1TH2 A;  4LFA M;  4DUZ L;  5H37 D;  5G3L D;  2VQF M;  2KQ3 A;  1XYI A;  2IY5 B;  3WWV A;  1EY4 A;  2MUY A;  3AKZ A;  1B8A A;  3W67 A;  4LJ5 A;  2JN4 A;  1E1T A;  3GV3 A;  4S3S A;  4JYA M;  1ICF B;  2SDF A;  4K2L A;  4KTA A;  4GEW A;  1YNX A;  1M4V A;  1T3T A;  5AJ3 Q;  2JA5 G;  3SE0 A;  3MVV A;  3HEJ A;  1JCK B;  4H0L C;  3K0Y A;  2H5X A;  2UUC M;  2UXB M;  2NZH A;  3SAW A;  3ERQ A;  1D2N A;  1A5T A;  1SXJ E;  1O80 A;  2PNR C;  3SBJ A;  2QEJ C;  1D5X C;  2VL6 A;  4II7 A;  3CPF A;  4K6L A;  3LW5 F;  1XXH E;  4DNT B;  2YQZ A;  1QJO A;  4JCV E;  4LF8 L;  4KHP L;  3CP0 A;  3EBE A;  2QSF X;  4IPD A;  4HJ9 A;  2B8G A;  5GRO A;  4D81 A;  4IN3 A;  1B9N A;  1S40 A;  3TP8 A;  1BVS A;  3AFP A;  2MNA A;  1NJF A;  2NBF A;  4LF7 Q;  1AE2 A;  1NNX A;  2CWP A;  4AQY Q;  1QZM A;  3I56 A;  1KDB A;  1PFS A;  5ITY A;  3KBG A;  3EVQ A;  4CJ0 B;  2OQ4 A;  4GKK Q;  5HGQ A;  4WJW A;  5ITQ A;  3TS0 A;  3AEV A;  3T51 B;  4UPA A;  4QOZ C;  2E5L M;  2LVN C;  1O7L A;  5LL6 X;  3E6Z X;  3SYK A;  3J7A V;  4DPG A;  2AHM A;  1PA6 A;  1J8I A;  4AQY M;  1TWF B;  2JWS A;  3WHL A;  3F1Z A;  5IGD A;  1IZ6 A;  1EWC A;  2HCB A;  1BCP C;  4R4O A;  3H4J A;  4AW4 A;  1PMR A;  4GKK M;  1V43 A;  1WCM H;  1C0A A;  4H13 C;  2UXC L;  3A98 B;  2MO1 A;  2RGO A;  4QHS A;  2NZ1 D;  2OT2 A;  4DGZ A;  4OL7 A;  3I72 A;  5EKL A;  4DV2 Q;  2DZN B;  4LF9 L;  3A55 A;  1WVL A;  5EGT A;  4P72 A;  5M5X B;  4NPS A;  2ZM6 L;  1Y1W H;  3R93 A;  2B2T A;  1NJG A;  3NSW A;  5ELD A;  1VMC A;  3T15 A;  1NNU C;  3J2P B;  1N78 A;  3NQT A;  4QUC A;  1OIP A;  4F88 A;  4IFD H;  5C44 H;  5JEA H;  3KF8 A;  4XT3 B;  3PXG A;  1VQE A;  3GP7 A;  4JI2 L;  1VQC A;  4EVO A;  4DR5 Q;  2LH0 A;  4LFB Q;  1OO9 B;  1QVG A;  3AV0 A;  3NHH A;  4L5Q A;  3H3V I;  1N33 M;  4LGM A;  1EWI A;  3V76 A;  2R45 A;  3Q8G A;  1CI3 M;  3HKZ E;  3T1H L;  1B3A A;  3VR6 A;  2XVS A;  2PMZ E;  1JOR A;  1K3W A;  3UI2 A;  4JVZ A;  1O7I A;  1DOK A;  4M1U B;  4NMZ A;  2HIV A;  1G8P A;  2R6G A;  2Z6K A;  2NN6 I;  3H0G G;  2F52 A;  3NWS A;  3ULL A;  4YWK A;  2E75 C;  1N36 Q;  4ZQ3 A;  5FTL A;  2MH8 A;  4IPH A;  4OX9 L;  4X65 L;  2PQE A;  1IBK L;  1CKN A;  3S1R H;  1IXS B;  1KL9 A;  5I2X A;  5KPR A;  5M3F G;  3U6P A;  1AN8 A;  2RKS A;  3H09 A;  4K5V A;  4W5W A;  3KP0 E;  4A75 A;  3JR5 A;  5CC4 A;  4GLX A;  1I50 H;  1VDZ A;  3QYB A;  4R3D A;  3M4Y A;  1N36 M;  4CBV A;  1QVF A;  3HHW A;  1L1T A;  2VQE M;  1N34 Q;  5IYB H;  1M1K C;  4CKC A;  2AKW B;  4C3J B;  4QGU A;  1K3R A;  5CBA E;  1ML0 D;  2EYM A;  4KN7 C;  4XGI A;  1NSN S;  2VB3 X;  1B4O A;  3N6R A;  3AOE A;  5FLX S;  4B9W A;  1DGH B;  1DCZ A;  5CGK A;  2DI0 A;  1CHQ D;  1R2Y A;  2FOI C;  3V2T A;  4FCW A;  3GLF E;  5C3E G;  1PRT D;  3I4O A;  1GVN A;  2KA6 B;  2DAI A;  2NVY H;  3IEC A;  3FKI G;  2XN9 C;  4Q0F A;  3QR8 A;  4DK3 C;  4FW9 A;  1Q02 A;  5EXP A;  4ZCK A;  1JB0 F;  3PO2 G;  3J7A S;  4X62 Q;  3A0J A;  5K36 H;  2XFT A;  4GNX C;  1SYB A;  1UM8 A;  3EN2 A;  5BN3 A;  2PZU A;  4AZF A;  1STA A;  1YHA A;  4B3M L;  1HNX Q;  1XMO L;  3J80 S;  1V92 A;  3CME A;  1SE4 A;  1ENA A;  4JBW A;  2LXK A;  2CE7 A;  1KFV A;  5C0X G;  1TS2 A;  3LVV A;  2F0U A;  2M2L A;  3ND8 A;  2DHY A;  4IPG A;  1Q3L A;  2Z1C A;  4FF4 A;  1XNQ L;  2BJV A;  1SYD A;  4GZY C;  1IN6 A;  4DV6 M;  2KCM A;  3HOU G;  5FSW A;  4DR6 Q;  1HNZ M;  1MJE A;  3DWP A;  1KLG D;  4PQX A;  3FHW A;  5EBC A;  3TS2 A;  2L6O A;  1T6O A;  5NUC A;  1S5B D;  1X3E A;  3I4N B;  3MMP A;  4QY7 A;  4X66 L;  4UN2 B;  1J9O A;  3U4Z A;  4PT5 A;  1STE A;  3TWK A;  3HS0 C;  4KOD A;  4DR6 M;  3EQL C;  2EA0 A;  4KKS A;  1PJI A;  5C3W A;  2N55 A;  2PYK A;  4DR7 M;  2L0C A;  4JV5 Q;  1GAB A;  3KOY E;  4M8A A;  3SXH A;  3H3V C;  3E0J A;  2EE1 A;  4JI7 M;  1R9T B;  3QB3 A;  4R4C A;  2Z8L A;  3QYE A;  4X64 M;  2Y0S G;  3KK7 A;  4N9T A;  4DV1 M;  1L2D A;  1MBY A;  4GN5 A;  1XXG A;  4MZ9 A;  5IOD A;  4JV5 M;  5IOC A;  4NXM M;  4LW1 A;  4WFN 3;  1V33 A;  4YWL A;  4B9X A;  4A3C G;  2WAQ B;  4KLK A;  1LTG D;  4UP8 A;  2A6E D;  4HCE A;  1Y8G A;  3FRI A;  4DUZ Q;  3IL8 A;  4J15 A;  4DFA A;  4AG6 A;  3FEW X;  1TII D;  2YR0 A;  1VS0 A;  2RCF A;  4KD3 A;  4KN4 C;  4N9P A;  1X3F A;  1V9P A;  2EUC A;  3NK9 A;  1Z5B A;  3Q23 A;  4DR3 L;  2O25 A;  1BCP B;  3ICE A;  1UEB A;  1R6B X;  2JA7 G;  4HN7 A;  2B2Y A;  2ALY B;  2M60 A;  1VQJ A;  4JBM A;  1H9R A;  3S1M H;  4OGQ C;  2HCC A;  3ITP A;  4MTN A;  2CP8 A;  3CQZ B;  3U6S A;  1EIF A;  2B2V A;  1KRS A;  1ILQ A;  1AEX A;  4M9S A;  3O13 A;  3J7A 5;  1PFN A;  4LF8 Q;  4IBG A;  1PLF A;  2A8V A;  4KHP Q;  2OO9 A;  1JE5 A;  5FTJ A;  1VQK A;  1WTP A;  4R4T A;  4XIG S;  3WOF A;  4JI0 L;  3KBX A;  3MC0 B;  5GKN A;  2KXE A;  1PTO D;  2PNH A;  4POF A;  1WHC A;  3OIQ A;  1KAB A;  2L7H A;  4YCU A;  3ND9 A;  2R92 G;  3L28 A;  2ZBK B;  1ASY A;  2BH8 A;  4EGV A;  2F0E A;  3PUW A;  2Q8T A;  2B63 G;  2R4E A;  2RBM A;  2JA5 B;  2G9H D;  4R9W A;  4YHH L;  3SHG B;  1M8A A;  3S17 H;  4LJ9 A;  3GO5 A;  1TF0 B;  3U6E A;  2NWG A;  3HZX A;  5K5P A;  1C4Q A;  1OXU A;  1E7Z A;  1VQH A;  2UXC Q;  2EQS A;  2HHH Q;  1D0K A;  4CGY B;  1B3Q A;  4LF9 Q;  1HCZ A;  1JWM D;  5DLQ E;  3VDY A;  3S16 H;  4KJO A;  2ZM6 Q;  2Z6B A;  4C3H H;  1R5L A;  5LMN M;  1NY5 A;  1ZMU A;  3IG8 A;  4DV0 L;  2EZV A;  2FE8 A;  1HR0 M;  3PV0 A;  1G6Z A;  1N32 M;  4A3L G;  2AMC B;  3HJS A;  2HHH M;  3T56 B;  2XRS D;  3HJ8 A;  4LF9 M;  4JI2 Q;  1ONL A;  3VR2 A;  4DV4 L;  2A74 C;  4HJA A;  4ABN A;  3HOZ B;  1PH3 A;  3CD6 A;  5KEE A;  3QAU A;  3J81 i;  2K32 A;  3D8G A;  1HHV A;  4NXN M;  4AH6 A;  3T1H Q;  2JXN A;  2CV2 A;  5IT9 c;  3T53 B;  3AYH B;  4DV7 L;  1U4L A;  4KMU C;  1EZ8 A;  3HY5 A;  3D8B A;  1TWH B;  4B3S L;  1W5S A;  3KOW E;  1IN5 A;  5I9P A;  2D62 A;  3VLF B;  2K5D A;  3T1Y M;  3EFX D;  3DZD A;  1MD2 D;  3S1N B;  4A3B B;  4GOP C;  4OIK A;  1TKW B;  4OX9 Q;  3BZK A;  4FNF A;  2ZTC A;  4XBO A;  2NB0 A;  4X65 Q;  2DZO B;  4FWH A;  4PNY A;  1IBK Q;  5CV4 A;  1MIU A;  5COR A;  4O42 A;  1JOK A;  1D0M A;  1KLU D;  1EY0 A;  2C98 A;  3CRL C;  1OIZ A;  1DO0 A;  1F9P A;  4I81 A;  2C96 A;  5EKI A;  1X55 A;  2K01 A;  3JAM L;  3VR4 A;  5C4Z A;  4I7A A;  2D7E A;  4OX9 M;  3I4M H;  3GPU A;  3NTH A;  5JI3 E;  4IJF A;  3DFZ A;  4WJ4 A;  3T6P A;  1DOM A;  3HX3 A;  1U4P A;  3L26 A;  2KCN A;  1IN8 A;  1SNP A;  2R18 A;  4OO1 H;  3UDI A;  1QWY A;  1QUS A;  4IFD I;  1W3S A;  4RCN A;  3KP1 E;  4P16 A;  3I73 A;  2MQH A;  3SFZ A;  2DAK A;  3BVM A;  1Z47 A;  3CCE A;  1MI2 A;  5JI2 E;  3H91 A;  1H9M A;  2BWB A;  3U6C A;  3PFI A;  5EJW A;  1WCM G;  5M3F B;  1QZG A;  2WB1 G;  2AUJ D;  2F0W A;  3GTK H;  1K8G A;  5BN5 A;  1TR5 A;  1S3O A;  1QAN A;  1C1K A;  1GUN A;  3R3O A;  5M3M H;  5HGT A;  4A3I B;  4B3M Q;  4G4O A;  2KEN A;  3CCQ A;  2Q2T A;  2RCN A;  2XGT A;  5IE8 A;  3FYD A;  2L4N A;  1NV9 A;  1GM5 A;  4XDX A;  2WSC F;  2BDN A;  4BXX H;  2P5Z X;  3HHZ A;  1CA6 A;  1VF7 A;  5C44 G;  5CBE E;  3H3V H;  2Z7J A;  5JEA G;  2QF7 A;  2HKJ A;  3MXU A;  4IBC A;  1SJH D;  3GPP A;  4DNR B;  1HUM A;  3F8T A;  3TP7 A;  5C3E B;  5F3W A;  2J7N A;  3DA1 A;  4GKJ L;  2IT1 A;  1U9R A;  3W5O A;  4BS9 A;  1I6V C;  2QZ4 A;  2NN6 H;  2CW0 D;  1KNA A;  3RMH A;  3J27 B;  1YHB A;  2X6L A;  1SYF A;  1K83 H;  3DM1 A;  3I2Z A;  1K8A C;  3PO2 B;  2DWL A;  1NY6 A;  1BCP F;  2A6E C;  1FNU A;  3E0E A;  3A46 A;  1IBM L;  2KZU A;  1IKL A;  1CK1 A;  5FLM H;  3SAU A;  4JI6 L;  2JY5 A;  1YZ6 A;  5FLX E;  4UAI A;  2KEE A;  1BQQ T;  4DK6 C;  2OEO A;  2DUD A;  1DO2 A;  1Z5A A;  4DV3 M;  5KQD A;  1V1O A;  2YTX A;  5BR8 M;  2I5M X;  2MO0 A;  2LVQ D;  1BF4 A;  3K7A B;  1IYV A;  4JI4 L;  1PJJ A;  1QUQ B;  4OWW B;  1NSF A;  1TVX A;  3SR1 A;  3HOU B;  1FVI A;  1EYD A;  1K3B C;  4RGM A;  4PD2 A;  3PUV A;  1JWU D;  1XX8 A;  3UDX A;  2XRQ D;  5IYB G;  3KS8 A;  3Q8X A;  4L6T B;  1PJS A;  2CV0 A;  4L5T A;  4HJ5 A;  4A3M H;  5I6W A;  2MJ5 B;  2F0N A;  1QUQ A;  2BA1 A;  3KDF A;  1SNO A;  2JSO A;  3D3R A;  4ZLT F;  1VDD A;  1XJV A;  1SDF A;  1HUN A;  1H9S B;  3U60 A;  5CV5 A;  4DR3 Q;  1PTO C;  2MPM A;  4UHV A;  4LF6 L;  1G59 A;  3QIA A;  4C3J G;  1LV7 A;  3LMM A;  1KRT A;  4REZ A;  5ITT A;  4L15 A;  4IJL A;  2A1A A;  2VII A;  1STY A;  4X3S A;  5K36 G;  2CKZ B;  2D9U A;  4JI8 M;  3TP5 A;  4A3D H;  4LF5 M;  2Y0S B;  4WP2 A;  2H1R A;  3SAR A;  4HID A;  2UU9 L;  4AKI A;  1EU3 A;  3GQ5 A;  1TWG B;  2RSO A;  4GN3 B;  1P3Q Q;  5D3D A;  4X3T A;  5E4W C;  2GA4 B;  4JI0 Q;  2DGY A;  1E9S A;  4GIP A;  3OIP A;  4DXG A;  4DR2 L;  3ERS X;  5CV9 A;  4GC9 A;  1HQM C;  3HOY H;  4LUO A;  3GPX A;  3PUZ A;  4EX5 A;  2DNE A;  4POG A;  3D4R A;  4BLC A;  4JOI C;  2IX1 A;  5AFW A;  4DV5 L;  5KRU A;  1WXQ A;  3TRZ A;  3VA5 A;  1NV8 A;  2HDL A;  3MXN A;  4ZPX A;  1BBX C;  4PCZ A;  1HH2 P;  4UDU C;  4YHH Q;  3RE8 A;  1X3Q A;  1GO5 A;  4GMQ A;  4BA1 I;  3FP9 A;  2BE5 D;  2WAQ E;  5LL6 S;  3CCS A;  1K8M A;  3KXE C;  2DWN A;  1Z7T A;  5EP4 A;  1UE1 A;  4TUW A;  5IY0 A;  2IW3 A;  3RLO A;  3HOW H;  1I94 M;  1WGL A;  3PUY A;  1EY8 A;  2YYZ A;  3BU2 A;  4A76 A;  1OKS A;  1EOT A;  2B39 A;  1E24 A;  1JMC A;  1N9W A;  2F0H A;  4DV0 Q;  4GS3 A;  3L2A A;  1FJG L;  1RHP A;  2Z6K C;  4FXK C;  4K0K L;  2YU9 B;  2D5D A;  3SC3 A;  1EUJ A;  2L5T A;  2EVB A;  2R92 B;  3GQ4 A;  2VNU D;  4HL4 A;  3FPU B;  1T5E A;  3S15 H;  2B63 B;  4ZKC B;  4DV4 Q;  1G29 1;  3U6O A;  5E6J A;  2JEB I;  2K33 A;  4CJ1 B;  2MRO B;  1OQY A;  3BDL A;  5EPJ A;  5C4H A;  4UP7 A;  1O7Y A;  3BYT B;  2LXJ A;  5G3L F;  3CCM A;  4DV7 Q;  3I51 A;  4OW0 A;  2QDB A;  1PGY A;  2E2J H;  2SOB A;  3J81 S;  1LAB A;  2NVT H;  5JJK A;  3BDC A;  3W0L B;  1EEI D;  3KLS A;  4P74 A;  1QVC A;  1TY2 A;  4FO2 A;  3K8Z A;  2EPB A;  1EYA A;  4A4I A;  3A8J E;  5C5M A;  5DNY A;  1CUK A;  3BS1 A;  2K9D A;  1B44 D;  4DU9 A;  3JAM c;  5FO9 B;  1UE6 A;  3LX0 A;  2XNA C;  2HL7 A;  2R93 H;  4ZAI A;  3E9S A;  3SAT A;  1F9R A;  1EQQ A;  3NPP A;  4O0A A;  3S9W A;  1FNN A;  3D0F A;  1TTE A;  2KNA A;  1I3Q H;  5L37 A;  3RNU A;  1Q8K A;  1YNN D;  2WSE F;  5FTN A;  1L1O C;  1VQA A;  3QOJ A;  1G4A E;  2LS0 1;  4KD4 A;  3UDF A;  1JC7 A;  1X3G A;  4MGZ E;  1SXJ D;  1ZYR D;  4MHE A;  4DAM A;  3A54 A;  2FH0 A;  5I6Y A;  2XTI A;  2SNM A;  3E3X A;  1OTC A;  1Q1E A;  2QP9 X;  3U50 C;  3NWT A;  1DON A;  2XH9 A;  1TWA H;  2KHS A;  1QE6 A;  4A3G H;  3SK8 A;  2A69 D;  2KBN A;  2K6A A;  2DZL A;  3HOV H;  2HWJ A;  5H1S E;  5EBD A;  3CCR A;  3M4O H;  1J5E M;  3HU3 A;  3TME A;  1GHJ A;  2OF1 A;  3VFD A;  5IGB A;  4A3F H;  2CW0 C;  1KC8 C;  1ASZ A;  4A3K H;  2F5S A;  2F5O A;  3SK5 A;  1MSH A;  1EYG A;  1EQT A;  1XMQ M;  1IL2 A;  4G6Z A;  3L29 A;  3W0F A;  3PIO 3;  2G5G X;  3SGI A;  3QWL A;  1A8V A;  1KHI A;  2M00 A;  1Q81 C;  1K3X A;  1LTL A;  1Y8P B;  1Z59 A;  4QB4 A;  5COY A;  2WFW A;  1VQD A;  2LVO C;  2TMP A;  3U6D A;  5HY6 A;  1GJS A;  3GLH B;  1EYC A;  2M9V A;  3OMC A;  4KO8 A;  3TEH B;  3C3E A;  4UY8 C;  4RGT A;  2DKL A;  3CXC A;  4GKJ Q;  4FYD A;  4LCB A;  4RFB A;  5IP7 H;  1N8R C;  1BNZ A;  4RHR A;  4G7Z C;  3KOX E;  3B7Q A;  5DM6 3;  1QAO A;  2EXZ A;  3CPW A;  2IL8 A;  1IBM Q;  1Y1V H;  1A2T A;  4AI6 A;  1WCM B;  1OXT A;  3GTP B;  2F3V A;  2FFJ A;  2N49 A;  2WB1 B;  1XPO A;  3AU7 A;  2JA9 A;  4JI6 Q;  4G7H C;  3A56 A;  3HOZ G;  5E26 A;  1IY2 A;  4Z6Y A;  4GH9 A;  2F0Q A;  2QCP X;  4TSS A;  3MXP A;  4LF7 M;  1Q82 C;  2ZJQ A;  1Y1W B;  2UUA L;  2F4V Q;  1BBW A;  1PTO H;  1A3V A;  5DFL A;  1GD7 A;  2EYL A;  5DEH A;  4OO1 I;  1CA5 A;  1G41 A;  4KY5 A;  4XXE A;  2V1C C;  5C44 B;  1T43 A;  3GTP H;  4JPB W;  3KS4 A;  3EIH A;  5JPM C;  2RGH A;  3AFQ A;  4MGH A;  1X3P A;  3C9P A;  4A3B G;  4RGN A;  2B2Y C;  2JY7 A;  2F4V M;  1PXU A;  3DUZ A;  3MEF A;  3I4M G;  4EQN A;  2LNH C;  4B3T L;  1XB2 B;  4JXJ A;  2A68 D;  1G2S A;  1MHW C;  3DEO A;  2B2V C;  1V1Q A;  4NP5 A;  5D65 A;  3UE1 A;  3IFT A;  4LUZ A;  1WI5 A;  4RHS A;  2Y0Q A;  2HDM A;  4DV2 M;  1JB3 A;  1IN4 A;  3PMF A;  1NHG C;  1X9N A;  3FUU A;  1CM9 A;  1OFH A;  3URY A;  4OO1 G;  3GRV A;  3TWL A;  1D1I A;  2D7G A;  3HOX H;  4CHT B;  2EJS A;  4K14 A;  4LF6 Q;  1MX0 A;  1C8C A;  5EP3 A;  1HT1 E;  2C9C A;  4R8I A;  3KFU G;  4ALP A;  3V05 A;  3S1R B;  3FPP A;  2KEB A;  1JQY D;  2KRK A;  5FKA C;  4DR5 M;  4FVM A;  3GLI B;  4NOO B;  4LFB M;  1I50 B;  2BH2 A;  4F87 A;  3DM3 A;  5M3M G;  4QIW B;  2LVA A;  2BE5 C;  2IPK D;  1SLJ A;  5IT9 L;  1R2Z A;  4K5W A;  1G71 A;  4JI5 L;  2UU9 Q;  3TZD A;  1KD1 C;  4UP9 A;  5KNB A;  4JI3 L;  1BBU A;  4EQP A;  1L1Z A;  2F5P A;  2YTY A;  5ITX A;  3FD9 A;  4BXX G;  2DWM A;  2ATW A;  4YIJ A;  2JY6 B;  4IBD A;  3S14 H;  1E2Z A;  4DR2 Q;  5D3I B;  1XNR L;  1Q1B A;  4HIM A;  2FMC A;  3PO3 H;  5JJI A;  4LGY A;  1WTX A;  2D7H A;  2R4J A;  2RDF A;  2G9D A;  4A3I G;  1D1K A;  1B70 B;  2NVY B;  1HTL D;  1LM0 A;  1IXS A;  2R44 A;  4DN4 M;  5IRE B;  4DV5 Q;  2NN6 G;  4LF4 L;  5ITR A;  2Z8Y M;  1OFI A;  2QPA A;  2QEN A;  4RGO S;  5EJC A;  5FO7 B;  1OTR A;  1I4R A;  1CFM A;  3OW7 A;  5JAV A;  1NVM A;  4N8X 1;  1QAQ A;  1VG5 A;  2L4F A;  3FUV A;  5FLM G;  1JB7 A;  1AUA A;  2L09 A;  3UZU A;  4IUT A;  2EKF A;  2JP7 A;  3VR3 A;  4J8Q A;  4QNM A;  1N34 M;  2JNH A;  3N52 A;  3NEM A;  3I3C A;  3L25 A;  3U58 A;  4IBF A;  1LLR D;  4TRD A;  1DGH A;  3LCU A;  4F1I A;  5IIF A;  1W5T A;  1FJG Q;  4DR4 L;  4R71 A;  4APV A;  1IY0 A;  2FMM A;  3L9A X;  2P5T A;  3HU1 A;  4K0K Q;  4IBI A;  4ULL A;  4MN3 A;  4Y52 H;  4QOS A;  2VY3 A;  5C0X J;  4NL4 H;  5A2Q S;  3L7Z C;  1PYB A;  4DAY B;  2BNK A;  2Y0S E;  4X62 M;  3D6W A;  2HAK A;  3TBI B;  5GAD C;  1EIY B;  1YNN C;  2R3Z A;  1SXJ C;  1ZYR C;  3RR5 A;  1SBB B;  4CJ6 A;  2LXE A;  1HNX M;  1P16 A;  3KSJ A;  1ENF A;  1UEA B;  1IYU A;  1N75 A;  3SAV A;  2E2H H;  3STB D;  5IP9 H;  3TWM A;  1EWH A;  4N8F A;  5ELE A;  4DA2 A;  3BXW A;  2R7Z H;  1D8L A;  3NXW A;  1JR3 E;  2A69 C;  5JPN C;  3GTO H;  4DNI A;  3P75 A;  1JWS D;  1YJN A;  1U5K A;  5E4X A;  4A3D G;  3CCJ A;  4IIW A;  4Y7N B;  3B7N A;  4ITQ A;  2DEN A;  4LJ4 A;  2JE6 I;  4KLN A;  1LTS D;  1E32 A;  5LHY 1;  4HAE A;  3RZD B;  1J09 A;  3CCU A;  1U4M A;  5IWA L;  3SDZ A;  1X54 A;  1IXZ A;  3J80 c;  1Z6H A;  3C1E A;  4A93 H;  2PW5 A;  3WHK A;  1FGU A;  5BN4 A;  4GN4 B;  1AZP A;  3GPY A;  4Y7N H;  2CFM A;  3GTL H;  5IGE A;  1R4P B;  1HQY E;  3HOY G;  2XSC A;  2CEA A;  1PHJ A;  4S12 A;  3RZD H;  3CRK C;  1VEJ A;  2IHF A;  1VQ5 A;  1PTO F;  3K80 C;  5LMU L;  2K5N A;  2X8A A;  1BKB A;  1NHW C;  1HPC A;  3A8I E;  3AL0 C;  3W2D A;  4JI1 L;  4RMF A;  4IUN A;  3S1M B;  1XC8 A;  4RWS C;  1YSY A;  2Z3X A;  4G4R A;  3KOJ A;  3SK4 A;  4DR1 L;  4HSP A;  3CCV A;  3VR5 A;  4BY7 H;  4CJ2 C;  2KZS A;  2ENB A;  1JOO A;  3G6J B;  3G71 A;  2XSZ D;  1K0R A;  2RRU A;  3M85 A;  3GTG H;  1DGG A;  4ZUJ A;  2KNZ A;  4GHA A;  1HQR D;  2ZTE A;  1NNJ A;  3HOW G;  1WFQ A;  1L8Q A;  3RGS A;  4DUZ M;  3NP8 A;  4QJF A;  2JA8 H;  3I7F A;  1NCV A;  3J81 E;  3GLG B;  3R2T A;  2YTV A;  1EFU B;  3DLL A;  4DBG B;  2EY5 A;  3K5O A;  3BOS A;  4PZ7 A;  2NVX H;  3U6Q A;  1WTH A;  3PVS A;  1I6H B;  4V19 0;  2EOT A;  1SRO A;  2X4A A;  2C5C A;  2VUM H;  4PZ8 A;  4DK0 A;  1V1P B;  1W6K A;  1PV4 A;  5C4X B;  3A8K E;  3BG3 A;  4KHV A;  3S17 B;  1S5F D;  2K5H A;  4YCV A;  4RKB A;  1I6H H;  2A68 C;  5JVH 3;  4LF8 M;  4KHP M;  1RJT A;  3UGJ A;  2CQA A;  2R6F A;  1AZQ A;  3GTQ H;  2H1E A;  2PQA B;  2RDH A;  2UUB L;  3D6C A;  4IUR A;  3LQR A;  2F0D A;  2G3Q A;  3I4V A; 
#chains in the Genus database with same CATH homology
 1YNJ D;  3S16 B;  2K05 A;  1MSG A;  3QJY A;  4C3H B;  3D31 A;  5I2Y A;  2OXP A;  5E1F A;  2LMC B;  4A3J B;  4BA2 I;  1BDO A;  5CV6 A;  1K8O A;  1LO5 D;  5EP1 A;  4JN6 A;  2EJF C;  1W6J A;  2KW0 A;  2BJW A;  1JOQ A;  4Z8X A;  1Q12 A;  1IXR C;  1DOL A;  2UXC M;  3UK6 A;  4C56 C;  3P7J A;  3HG9 A;  1ZQ9 A;  3IAY A;  2F1M A;  2ZM6 M;  3K5M A;  1BXT A;  1CT1 D;  4RNA A;  1S5D D;  2ZXO A;  4Q5V A;  4DXF A;  2I46 A;  5EP2 A;  1UNS A;  2E76 C;  4ME5 A;  2L12 A;  4IBB A;  4JI2 M;  1F2Y A;  4IBE A;  2I7P A;  2MP1 A;  4RA8 A;  1DGF A;  2Q2E B;  1LTR D;  2WAC A;  1PRT C;  3I4M B;  1TY0 A;  3T1H M;  1OXV A;  1CQF A;  2WKC A;  3GO8 A;  4NSO B;  3R8F A;  4F8M A;  2MGS A;  4ILW A;  4LK1 C;  4ZK9 B;  4L63 B;  3J7A F;  2FIN B;  3THG A;  3FTC A;  4X65 M;  1IBK M;  1XXH B;  1ET9 A;  2RVL A;  3KUP A;  3A42 A;  4KY7 A;  1O7Z A;  3RUZ A;  3SEB A;  1IL8 A;  3G7L A;  3NBH A;  4LG2 A;  3CHB D;  3CKI B;  3H4M A;  2JXM B;  2NQ8 C;  3GTK B;  3RGP A;  2YNM D;  5M3M B;  4FWG A;  5C6A A;  3AFH A;  4NDX A;  4HR7 B;  4HCS A;  4LMQ D;  2R46 A;  1G8Z D;  5T1G A;  3TL4 X;  2KRU A;  1TDH A;  2NYZ D;  3GRY A;  4LJ8 A;  3NTI A;  1EY6 A;  5ITX E;  2SEB D;  5EQT A;  5F2D A;  2O5J C;  3TZU A;  3C1F A;  2PZW A;  1I4Q A;  1SNM A;  5JEA J;  5KGU A;  2LFN A;  1K83 B;  4IFD G;  3MAQ A;  1MGS A;  5CYU A;  1HA6 A;  4B3M M;  4XQJ A;  1XMO M;  3HJQ A;  1RF2 D;  2F0L A;  3U6M A;  3VK7 A;  3I4L A;  1XNQ M;  1Q3B A;  1R7R A;  3MXG A;  4P2C B;  1G3I A;  3HKZ B;  3Q6S A;  4FF1 A;  4IQZ A;  2DY8 A;  2E2D C;  1LT5 D;  4QF4 A;  3T38 A;  1G2T A;  2CUZ A;  1GKI A;  1HFG A;  4X66 M;  4A3M B;  4JK1 C;  4G7O C;  2CHQ A;  1R4Q B;  2DNC A;  3FUX A;  5FTK A;  1DJR D;  3C2P A;  4I5S A;  2QBY B;  1CZG A;  2K47 A;  1Q90 A;  1TS4 A;  4FF2 A;  2XGN A;  4XQQ A;  5A2Q E;  1S5E D;  4FXD A;  1F2M A;  4A3D B;  4FCT A;  2O4X A;  5FK9 C;  3MWY W;  4E6I A;  4RAU C;  4BWG B;  1QQW A;  1D6E C;  1B1Z A;  3HWS A;  3GP1 A;  1MU5 A;  1IN7 A;  3ILK A;  4I65 A;  1GXD C;  1YNJ C;  1IY1 A;  1Y8O B;  3K5L A;  4WUR A;  1H9S A;  2N88 A;  3T16 A;  4PDI A;  2WKD A;  4KY6 A;  4B7H A;  4DR3 M;  3TQS A;  2XZU A;  5I4D A;  2I07 B;  3HOY B;  3U9O A;  2QIL A;  1NR2 A;  3FUT A;  1F9S A;  2FHT A;  1K82 A;  3L3O C;  1F2L A;  4K8I A;  1KTK A;  3B9P A;  3A7A B;  2MHV A;  2F4I A;  5KND A;  1RD9 D;  2L7I A;  4WRD A;  1WTV A;  1ZEQ X;  2DWZ B;  3MHV C;  2B2T C;  4X3U A;  4IUU A;  3TPZ A;  3HOW B;  2WP8 J;  3GRR A;  4JI0 M;  1SE3 A;  2XWJ B;  4KK7 A;  1EY5 A;  4WW0 A;  4Z9C B;  1ILP A;  1PRT B;  2VB2 X;  1JR3 A;  4I8O A;  3OWF A;  2KA7 A;  3S15 B;  2Z4I A;  1DZ1 A;  1SNQ A;  3K6O A;  1JR0 D;  3MFG A;  4YHH M;  4V0B A;  2NUC A;  2RDG A;  3VYR A;  3A7L A;  1VMP A;  3NQI A;  5KPT A;  4TQU S;  3U61 B;  3S2H B;  3E4R A;  4M9X A;  2F5N A;  1HQC A;  2E2J B;  2NVT B;  2AQ1 B;  5EXT A;  1QVR A;  4HED A;  1EQV A;  1LTB D;  3RD4 A;  1TQO A;  3HKP A;  3P20 A;  4NW2 A;  3JAM S;  1B9M A;  4DV0 M;  2PCF B;  3FTE A;  4QMG A;  5C3X A;  1WTQ A;  2R93 B;  1SMY D;  1GUG A;  4NSR A;  2ZXR A;  1WTO A;  1GHK A;  1XHB A;  1CTM A;  3FUW A;  1GL6 A;  4DV4 M;  5EKK A;  3GQ3 A;  2OPF A;  2A6H D;  3DWA A;  1I3Q B;  4FF3 A;  3MK6 A;  1EEF D;  5JJZ A;  5FLX L;  3FKE A;  1KAA A;  3AOE C;  3FRP B;  4DV7 M;  3R9X B;  4GC5 A;  3M7N A;  3K1J A;  3M7G A;  4B3S M;  3MHB A;  4MIU A;  3U5Z B;  3JR4 A;  2BDO A;  2KUM A;  1TWA B;  4A3G B;  3E5S A;  5BPV A;  3HOV B;  5ELB A;  1AP0 A;  4AKG A;  3M4O B;  4HTH A;  5T1I A;  4MH0 E;  3IFD A;  3VK8 A;  4A3F B;  1UUP A;  2DHR A;  4A3K B;  1J7K A;  1EL0 A;  3U5Z A;  3J80 L;  3R2I A;  2CFO A;  5IT9 E;  1LTI D;  1Z5C A;  1ET6 A;  4AKH A;  1A3U A;  5E3F A;  4RKL A;  4XT1 B;  5EPL A;  3CF0 A;  1ZAE A;  4HMJ A;  4IUQ A;  3Q22 A;  1QNK A;  3DWQ A;  1GUS A;  1F9Q A;  1BUV T;  4FD2 A;  1IQP A;  4C3H G;  1H9K A;  1V8Q A;  3K57 A;  1B2T A;  1TH3 A;  2K04 A;  1EY7 A;  4AG5 A;  1PZJ D;  1TH4 A;  1F2Z A;  1Y1V B;  4MM3 B;  1LT4 D;  1S5C D;  4RCO A;  1WTW A;  4PMW A;  5DAU A;  2D2C C;  1QIL A;  1HFN A;  3PIP 3;  1SYE A;  4LJZ C;  1TT2 A;  5EXX A;  1PTO B;  2J7Z A;  4DAV A;  3TSS A;  3GLH A;  2F0I A;  4B7F A;  1VF5 C;  1EIG A;  1FR3 A;  3ZC7 B;  2IX0 A;  2AWN A;  3KVW A;  1SXT A;  1OXX K;  3AJI B;  4RF0 A;  4GKJ M;  1DYQ A;  2E74 C;  1XTC D;  3SYL A;  3HP3 A;  1L2B A;  1NAP A;  4G4K A;  1IBM M;  4JI6 M;  1STN A;  7CAT A;  1NUC A;  2G8L A;  1GUO A;  1SND A;  4CKE A;  1WD1 A;  4QUF A;  1ENC A;  1E9R A;  4HSV A;  3HOX B;  3BYY B;  4QCL A;  3SAS A;  5HUR A;  1H9J A;  4JI4 M;  2IX3 A;  1EZ6 A;  4IAL A;  3CTW B;  3CU7 A;  3X3N A;  3D4D A;  1RDP D;  1PRT F;  2L1B A;  4CIS A;  4XQN A;  2F3W A;  2KEC A;  3C46 A;  3S14 B;  3KLS X;  4FXG C;  3PO3 B;  3K58 A;  5CV7 A;  1QOH A;  3TN2 A;  1EIH A;  3TE6 A;  4LF6 M;  2ZAN A;  4L16 A;  2NTT A;  3X3M A;  1LT3 D;  3M0E A;  4DAP A;  1XWE A;  3VDU A;  2DXI A;  3SHL A;  1O78 A;  3GLI A;  5ITU A;  4OIJ A;  1T5X D;  1HXY D;  4F7X A;  5KIX A;  1QG7 A;  3VDP A;  4YY3 M;  4GIT A;  3OHX C;  3H6M A;  5C5L A;  3WOE A;  2UU9 M;  2WIN B;  3DEP A;  3FDT A;  5EQ0 A;  1JE4 A;  4ZYS A;  1I4X A;  2HUG A;  4DR2 M;  1STG A;  2B2U A;  4C1N K;  3VKH A;  4XYQ A;  4LJ6 A;  1SMY C;  1CZW A;  1LTA D;  2V4D A;  4DV5 M;  3Q0A A;  1QB5 D;  1AFP A;  2A6H C;  4U67 3;  2ICI A;  1JR3 D;  3HU2 A;  3FVQ A;  4HLQ A;  4IJE A;  3I90 A;  3QO2 A;  3TP6 A;  5C18 A;  1HTP A;  3TDQ A;  5IGC A;  5C0X I;  2ID0 A;  1RTO A;  1BOS A;  1Q8I A;  2E2H B;  3ONA B;  4R8N A;  2Z4R A;  2C9O A;  3U6L A;  2B2W A;  2R7Z B;  1FJG M;  1Q3C A;  1C48 A;  3NE5 B;  5JVG 3;  3GTO B;  4K0K M;  4IBJ A;  3NWL A;  2PPB C;  1KYI A;  2HQE A;  3BZD B;  2F0S A;  1VCI A;  2JEA I;  1STH A;  1GUT A;  4DAY A;  3DMU A;  4KKT A;  1OJL A;  1DXM A;  4L8J A;  3LNN A;  2EDG A;  4MB7 A;  4A93 B;  1IM2 A;  5M9O A;  4L78 A;  3GTL B;  2CV1 A;  1YE9 A;  2CHG A;  3D4W A;  2C5R A;  5J39 A;  1H6U A;  4ZUI A;  2XF3 A;  3KDS E;  1ORY B;  3K59 A;  4G4N A;  1X37 A;  1PFM A;  5KYL A;  1SJE D;  4LRT A;  3MTS A;  3Q24 A;  2AQ2 B;  4BY7 B;  3I8Z A;  2F03 A;  3K2L A;  4L8R C;  2PW7 A;  3GTG B;  2JP1 A;  2X49 A;  4K6D A;  1G91 A;  3CF6 E;  3CF2 A;  5IZ7 D;  2XFS A;  2KOL A;  2JA8 B;  2F0F A;  3A45 A;  1GUW A;  1HRJ A;  3OPO A;  2EJG C;  1HT2 E;  1Y8N B;  2NVX B;  3AOG A;  4C1N I;  1SAP A;  3JAM E;  4BBA A;  1RKN A;  4QHT A;  3GRU A;  3ZH9 B;  1LAC A;  2I7N A;  1PDQ A;  1ROD A;  1RTN A;  2K7V A;  4IZ8 A;  2VUM B;  3VYS A;  4LAA A;  2RA4 A;  4IUP A;  3OOC A;  1TGU A;  2DN8 A;  2AQ3 B;  1E94 E;  2Y21 A;  4PDG A;  2L55 A;  4FP5 D;  2V1C A;  2Q8I B;  3PUX A;  3VKG A;  4PMC A;  3GTQ B;  3F2U A;  4NRV A;  2M5Z A;  4PV1 C;  1E2W A;  1RCV D;  3GLG A;  3K92 A;  4G4Q A;  5J22 A;  2R61 A;  2V1U A;  5FOB B;  3GTJ B;  2TSS A;  2F0G A;  2QKI C;  4K5X A;  2BOS A;  1SE2 A;  2PZT A;  1E0B A;  2EYF A;  4WOR A;  1GOZ A;  1Y69 U;  1IHZ A;  4OU7 A;  2A5Y B;  1FD7 D;  3SMS A;  3T4A C;  4D82 A;  2JA6 B;  1UAP A;  4C3I G;  2KED A;  3BDO A;  3M3Y B;  4LJA A;  1AW7 A;  1A6X A;  4U68 A;  3SVM A;  1S3S A;  2AUK A;  4M0W A;  2SNS A;  4AYB B;  1KDA A;  2JYO A;  2RSN A;  3NBI A;  1I4H A;  2UUA M;  2EY6 A;  5FO8 B;  2R65 A;  3HRZ C;  3DXJ C;  1N77 A;  2E2I B;  4B7G A;  1SEB D;  1PZI D;  5IT9 S;  1I4P A;  2ZAO A;  1FGB D;  3SK6 A;  1IW7 D;  3OWE B;  3J7Y W;  5KYI A;  2KJX A;  3J7B A;  1L0X B;  4C2M B;  2ZT9 C;  5ELC A;  2XZF A;  4K8J A;  5C4J B;  1QYR A;  2R62 A;  4B3T M;  1XWI A;  3OSO A;  3ZCB B;  2K03 A;  3T13 A;  1TS3 A;  4XYO A;  5ELF A;  4LZJ A;  3RZO B;  3V96 A;  2J7O A;  2PO4 A;  3EJI A;  2X6G A;  2O5R A;  4EIW A;  1PFB A;  4TKO B;  1PM5 A;  4IBK A;  1QNU A;  1D2B A;  2EYP A;  2XIW A;  1KNE A;  1Z6T A;  1X32 A;  2YFQ A;  1FNW A;  4OHJ A;  2WII B;  4I4L A;  1SXJ B;  2Y20 A;  2KCC A;  3SHF A;  4JI5 M;  1ZKO A;  1WD0 A;  3IKJ A;  2Y0T A;  4JI3 M;  5KO3 A;  3BVZ A;  3NTK A;  4D80 A;  4NRW A;  5I9O A;  2EO2 A;  2Q8R E;  3HHX A;  1XNR M;  3KOZ E;  3EA6 A;  4LZZ A;  4H44 C;  1SXJ A;  2WV6 D;  4EQO A;  4KV6 A;  3VA7 A;  1XXH A;  2IWH A;  2K5W A;  4LF4 M;  4KKU A;  2F0P A;  2W82 A;  3L27 A;  4DF7 A;  2HCI A;  3M6A A;  2J4X A;  1KDC A;  5D14 A;  2F0V A;  3J81 L;  4BBR B;  3HGI A;  1TS5 A;  2RKO A;  4ZKB B;  1DGB A;  1BO0 A;  2CHV A;  1SFO B;  5TSS A;  3U9S A;  3H0G B;  4BBS B;  4MGK E;  3IG5 A;  3SMP A;  4IFD J;  1Q39 A;  2ZXP A;  1E2V A;  2F5Q A;  2BCO A;  1D5Z C;  3ERO A;  3ZYY X;  4HMI A;  4DR4 M;  1KSF X;  4MGY E;  1JIC A;  4QNR A;  3I4Y A;  3AMU A;  2Z4S A;  5FTM A;  2L9H A;  3PNY A;  5A35 A;  2FJ2 A;  3MZ5 A;  2XEP A;  2MJ8 A;  1BR9 A;  2EY2 A;  3K5N A;  3LWE A;  3FTD A;  3D8L A;  1EE8 A;  1HA5 A;  2EJM A;  1TWC B;  3KLR A;  2L11 A;  2PMZ B;  1SNC A;  2NVQ B;  2V6Z M;  3QG1 A;  1PZK D;  4I7Z C;  1B53 A;  1D5M C;  2Z4H A;  3FKI B;  4MGI E;  2K1B A;  3BVG A;  3NUC A;  1CQV A;  5IGF A;  4ID6 A;  5IWA M;  5DYG A;  3C3L A;  2F0J A;  2JA2 A;  1A2U A;  1JQJ C;  4BY1 B;  4KI0 A;  1QAM A;  2EYH A;  2B8F A;  2LY7 A;  5M5W B;  4G57 A;  1ESR A;  4K2K A;  3MFY A;  1FNV A;  5LMU M;  2DY7 A;  2QBY A;  3U60 B;  5J1Z A;  4JI1 M;  3GQB A;  4FWD A;  1U4R A;  1GLN A;  4DR1 M;  5C0X H;  3GLF B;  3GD7 A;  4J1M A;  4H7B A;  3LVW A;  3J80 E;  2EY1 A;  4GRI A;  3EIE A;  2RQX A;  4RH6 A;  2LWX A;  1FYC A;  3VYU A;  2VXW A;  3GTM B;  5KQ8 A;  1DM0 B;  3UMM A;  4DUY M;  1STB A;  1ZXT A;  2ZAM A;  1BCP D;  3GLF A;  3AB9 A;  4ZRZ A;  3H94 A;  1LT6 D;  1I4W A;  3FTF A;  2ERC A;  1A15 A;  3KSX A;  1ICW A;  5DM7 3;  4R7G A;  1IW7 C;  1L2C A;  4M9Z A;  2F0O A;  2XLJ A;  2LKV A;  4A3V B;  4ODG A;  2A5H A;  2K5Q A;  1A3T A;  1II3 A;  4X3K A;  2UUB M;  2EYO A;  5DNF A;  4B08 A;  3MEH A;  3DOA A;  3I70 A;  5JOB A;  2JA7 B;  1SSO A;  1HNW M;  2IJ0 A;  5M5Y B;  3MJ5 A;  3MA2 B;  1F77 A;  2K28 A;  3QWN A;  2F0K A;  3PNV A;  1ESF A;  2DVW B;  2ICE C;  3C58 A;  1QCB D;  3DHQ A;  3VYT A;  4OVZ B;  2J0T D;  3W3A A;  1LV9 A;  4DK1 A;  3U61 A;  3FYC A;  4C3I B;  5IGG A;  1TDZ A;  1EFI D;  1YUB A;  4IUV A;  3OMG A;  1IKM A;  1L0Y B;  1PYW D;  2CVR A;  3OTO M;  1GL7 A;  3RLF A;  4OVZ A;  4PMB A;  3I91 A;  1WTR A;  1IBL M;  4NKL A;  1TU2 B;  1I4G A;  3S2D B;  1OXS C;  3QOL A;  5CV8 A;  2AWO A;  2B2U C;  3LWU A;  2FNA A;  4LRS A;  4CKB A;  3LQQ A;  2QCU A;  4A3E B;  2O5I C;  1S4Z A;  2KVM A;  1EY9 A;  3HHY A;  2FFK B;  4LFC M;  2O2L D;  3GV6 A;  4KJN A;  5C1B A;  3HGB A;  3WDN A;  4J6H A;  2C99 A;  2XWB B;  1NR4 A;  4L4U A;  1DD2 A;  3FMC A;  1CHP D;  2H4O A;  3KW6 A;  5ISR A;  4LY6 A;  5A2Q L;  3RFW A;  4M0D A;  3UJN A;  1SYC A;  1GJX A;  4BB9 A;  4XTC S;  3P1H A;  2B2W C;  5CR3 A;  1B50 A;  4RF1 A;  4B3R M;  2EYJ A;  2F0M A;  4FCV A;  1EU4 A;  2X69 A;  1SYG A;  4GHL A;  5KNC A;  2BA0 A;  2CHB D;  5EPK A;  2F0T A;  5KPZ A;  2UXD M;  8CAT A;  3S1Q B;  4LJ7 A;  2NTS A;  1LTT D;  5EXS A;  4KHZ A;  5DYI A;  3R8B A;  2XSZ A;  2A73 B;  4O1N A;  5CMD A;  1TH2 A;  4LFA M;  5H37 D;  5G3L D;  2VQF M;  2KQ3 A;  1XYI A;  1EY4 A;  2MUY A;  3AKZ A;  4LJ5 A;  3GV3 A;  4S3S A;  4JYA M;  2SDF A;  4K2L A;  4KTA A;  1M4V A;  1T3T A;  3SE0 A;  3MVV A;  3HEJ A;  1JCK B;  4H0L C;  3K0Y A;  2UUC M;  2UXB M;  3ERQ A;  3SAW A;  1D2N A;  1SXJ E;  1O80 A;  2PNR C;  2QEJ C;  3SBJ A;  1D5X C;  4II7 A;  4K6L A;  4DNT B;  2YQZ A;  1QJO A;  2B8G A;  4D81 A;  4IN3 A;  1B9N A;  3TP8 A;  1NJF A;  2NBF A;  1QZM A;  1KDB A;  5ITY A;  3KBG A;  3EVQ A;  4CJ0 B;  2OQ4 A;  4WJW A;  5ITQ A;  3T51 B;  4QOZ C;  2E5L M;  1O7L A;  5LL6 X;  3E6Z X;  3SYK A;  3J7A V;  2AHM A;  1J8I A;  4AQY M;  1TWF B;  3WHL A;  5IGD A;  1EWC A;  2HCB A;  1BCP C;  4AW4 A;  1PMR A;  1V43 A;  4GKK M;  4H13 C;  3A98 B;  2OT2 A;  2RGO A;  4QHS A;  2NZ1 D;  4DGZ A;  4OL7 A;  3I72 A;  5EKL A;  2DZN B;  3A55 A;  1WVL A;  5EGT A;  5M5X B;  3R93 A;  2B2T A;  1NJG A;  3NSW A;  5ELD A;  1VMC A;  3T15 A;  1NNU C;  3J2P B;  1N78 A;  3NQT A;  4QUC A;  4F88 A;  4IFD H;  5JEA H;  3KF8 A;  4XT3 B;  3PXG A;  3GP7 A;  4EVO A;  2LH0 A;  1OO9 B;  3AV0 A;  3NHH A;  1N33 M;  4LGM A;  2R45 A;  1CI3 M;  1B3A A;  3VR6 A;  2XVS A;  1JOR A;  1K3W A;  3UI2 A;  1DOK A;  4M1U B;  4NMZ A;  1G8P A;  2R6G A;  2NN6 I;  3NWS A;  2E75 C;  4ZQ3 A;  5FTL A;  2PQE A;  1IXS B;  5I2X A;  5KPR A;  3U6P A;  1AN8 A;  2RKS A;  3H09 A;  4K5V A;  4W5W A;  3KP0 E;  3JR5 A;  5CC4 A;  1VDZ A;  4R3D A;  3M4Y A;  1N36 M;  4CBV A;  3HHW A;  1L1T A;  2VQE M;  4CKC A;  4C3J B;  5CBA E;  1ML0 D;  2EYM A;  4KN7 C;  4XGI A;  1NSN S;  2VB3 X;  1B4O A;  3N6R A;  3AOE A;  5FLX S;  4B9W A;  1DGH B;  1DCZ A;  5CGK A;  1CHQ D;  1R2Y A;  2FOI C;  3V2T A;  4FCW A;  1PRT D;  1GVN A;  2KA6 B;  2XN9 C;  4Q0F A;  4FW9 A;  5EXP A;  3J7A S;  5K36 H;  2XFT A;  1SYB A;  1UM8 A;  5BN3 A;  2PZU A;  4AZF A;  1STA A;  3J80 S;  1SE4 A;  1ENA A;  4JBW A;  2CE7 A;  1KFV A;  5C0X G;  1TS2 A;  3LVV A;  2F0U A;  2M2L A;  3ND8 A;  4FF4 A;  1Q3L A;  2Z1C A;  2BJV A;  1SYD A;  4GZY C;  1IN6 A;  4DV6 M;  5FSW A;  1HNZ M;  3DWP A;  1KLG D;  4PQX A;  5EBC A;  2L6O A;  5NUC A;  1S5B D;  3I4N B;  1J9O A;  4PT5 A;  1STE A;  3TWK A;  3HS0 C;  4KOD A;  4DR6 M;  3EQL C;  2EA0 A;  4KKS A;  1PJI A;  5C3W A;  2N55 A;  2PYK A;  4DR7 M;  2L0C A;  3H3V C;  3KOY E;  4M8A A;  3SXH A;  3E0J A;  2EE1 A;  4JI7 M;  1R9T B;  3QB3 A;  2Z8L A;  4X64 M;  3KK7 A;  4N9T A;  4DV1 M;  1L2D A;  1MBY A;  1XXG A;  5IOD A;  4JV5 M;  5IOC A;  4NXM M;  4WFN 3;  4B9X A;  2WAQ B;  1LTG D;  2A6E D;  4HCE A;  3IL8 A;  4DFA A;  4AG6 A;  3FEW X;  1TII D;  2YR0 A;  4KD3 A;  4KN4 C;  4N9P A;  2EUC A;  3NK9 A;  1Z5B A;  3Q23 A;  1BCP B;  1R6B X;  4HN7 A;  2B2Y A;  2M60 A;  1H9R A;  4OGQ C;  2HCC A;  3ITP A;  3CQZ B;  3U6S A;  2B2V A;  1ILQ A;  1AEX A;  4M9S A;  3O13 A;  1PFN A;  4IBG A;  1PLF A;  5FTJ A;  1WTP A;  4XIG S;  3WOF A;  3KBX A;  3MC0 B;  5GKN A;  2KXE A;  1PTO D;  3OIQ A;  1KAB A;  2L7H A;  3ND9 A;  3L28 A;  2ZBK B;  4EGV A;  2F0E A;  3PUW A;  2Q8T A;  2R4E A;  2RBM A;  2JA5 B;  2G9H D;  4R9W A;  3SHG B;  1M8A A;  4LJ9 A;  3GO5 A;  3U6E A;  2NWG A;  3HZX A;  5K5P A;  1C4Q A;  1OXU A;  4CGY B;  1HCZ A;  1JWM D;  4KJO A;  5LMN M;  1NY5 A;  3IG8 A;  2EZV A;  2FE8 A;  1HR0 M;  3PV0 A;  1G6Z A;  1N32 M;  3HJS A;  2HHH M;  3T56 B;  2XRS D;  3HJ8 A;  4LF9 M;  1ONL A;  3VR2 A;  2A74 C;  4ABN A;  3HOZ B;  5KEE A;  3QAU A;  1HHV A;  2K32 A;  3D8G A;  4NXN M;  2CV2 A;  3T53 B;  1U4L A;  4KMU C;  1EZ8 A;  3D8B A;  1TWH B;  1W5S A;  3KOW E;  1IN5 A;  5I9P A;  2D62 A;  3VLF B;  2K5D A;  3T1Y M;  3EFX D;  3DZD A;  1MD2 D;  3S1N B;  4A3B B;  4OIK A;  1TKW B;  4FNF A;  4XBO A;  2NB0 A;  2DZO B;  4FWH A;  4PNY A;  5CV4 A;  5COR A;  4O42 A;  1JOK A;  1KLU D;  1EY0 A;  2C98 A;  3CRL C;  1DO0 A;  1F9P A;  4I81 A;  2C96 A;  5EKI A;  2K01 A;  3JAM L;  3VR4 A;  5C4Z A;  2D7E A;  4OX9 M;  3GPU A;  3NTH A;  5JI3 E;  4IJF A;  3DFZ A;  1DOM A;  1U4P A;  3L26 A;  2KCN A;  1IN8 A;  1SNP A;  2R18 A;  4OO1 H;  1QWY A;  4IFD I;  4RCN A;  3KP1 E;  4P16 A;  3I73 A;  3SFZ A;  3BVM A;  1Z47 A;  1MI2 A;  5JI2 E;  3H91 A;  1H9M A;  3U6C A;  3PFI A;  5EJW A;  5M3F B;  2AUJ D;  2F0W A;  5BN5 A;  1TR5 A;  1QAN A;  1C1K A;  1GUN A;  3R3O A;  5HGT A;  4A3I B;  4G4O A;  3FYD A;  2L4N A;  4XDX A;  2BDN A;  3HHZ A;  1CA6 A;  1VF7 A;  5CBE E;  2Z7J A;  5JEA G;  2QF7 A;  2HKJ A;  3MXU A;  4IBC A;  1SJH D;  3GPP A;  4DNR B;  1HUM A;  3TP7 A;  5C3E B;  5F3W A;  2J7N A;  3DA1 A;  2IT1 A;  1U9R A;  4BS9 A;  1I6V C;  2QZ4 A;  2NN6 H;  2CW0 D;  1KNA A;  3RMH A;  3J27 B;  2X6L A;  1SYF A;  3DM1 A;  3PO2 B;  2DWL A;  1NY6 A;  1BCP F;  2A6E C;  1FNU A;  3A46 A;  2KZU A;  1IKL A;  1CK1 A;  3SAU A;  5FLX E;  4UAI A;  2KEE A;  1BQQ T;  2OEO A;  1DO2 A;  1Z5A A;  4DV3 M;  5KQD A;  1V1O A;  5BR8 M;  1BF4 A;  3K7A B;  1IYV A;  1PJJ A;  1NSF A;  1TVX A;  3SR1 A;  3HOU B;  1EYD A;  4RGM A;  4PD2 A;  3PUV A;  1JWU D;  1XX8 A;  2XRQ D;  3KS8 A;  3Q8X A;  4L6T B;  2CV0 A;  5I6W A;  2F0N A;  2BA1 A;  1SNO A;  2JSO A;  3D3R A;  4ZLT F;  1VDD A;  1SDF A;  1HUN A;  1H9S B;  3U60 A;  5CV5 A;  1PTO C;  2MPM A;  1G59 A;  3QIA A;  4C3J G;  1LV7 A;  3LMM A;  4REZ A;  5ITT A;  4L15 A;  2VII A;  1STY A;  4X3S A;  5K36 G;  2D9U A;  4JI8 M;  3TP5 A;  4LF5 M;  2Y0S B;  2H1R A;  3SAR A;  4AKI A;  1EU3 A;  3GQ5 A;  1TWG B;  2RSO A;  5D3D A;  4X3T A;  5E4W C;  2GA4 B;  1E9S A;  4GIP A;  3OIP A;  4DXG A;  5CV9 A;  4GC9 A;  1HQM C;  3GPX A;  3PUZ A;  2DNE A;  3D4R A;  4BLC A;  2IX1 A;  5AFW A;  5KRU A;  1WXQ A;  3VA5 A;  2HDL A;  3MXN A;  4ZPX A;  1BBX C;  4PCZ A;  4UDU C;  3RE8 A;  1X3Q A;  4GMQ A;  4BA1 I;  2BE5 D;  5LL6 S;  1K8M A;  3KXE C;  2DWN A;  1Z7T A;  5EP4 A;  4TUW A;  2IW3 A;  1I94 M;  3PUY A;  1EY8 A;  2YYZ A;  1EOT A;  2B39 A;  2F0H A;  3L2A A;  1RHP A;  4FXK C;  2YU9 B;  2D5D A;  3SC3 A;  2L5T A;  2EVB A;  2R92 B;  3GQ4 A;  2VNU D;  4HL4 A;  3FPU B;  1T5E A;  2B63 B;  4ZKC B;  1G29 1;  3U6O A;  5E6J A;  2JEB I;  2K33 A;  4CJ1 B;  3BDL A;  5EPJ A;  5C4H A;  1O7Y A;  3BYT B;  5G3L F;  3I51 A;  4OW0 A;  2QDB A;  2SOB A;  3J81 S;  1LAB A;  3BDC A;  3W0L B;  1EEI D;  3KLS A;  4FO2 A;  1TY2 A;  3K8Z A;  2EPB A;  1EYA A;  3A8J E;  5C5M A;  5DNY A;  3BS1 A;  1B44 D;  4DU9 A;  5FO9 B;  3LX0 A;  2XNA C;  2HL7 A;  4ZAI A;  3E9S A;  3SAT A;  1F9R A;  3NPP A;  3S9W A;  1FNN A;  1YNN D;  5FTN A;  3QOJ A;  4KD4 A;  1G4A E;  2LS0 1;  1JC7 A;  4MHE A;  4MGZ E;  1SXJ D;  1ZYR D;  3A54 A;  5I6Y A;  2SNM A;  1Q1E A;  2QP9 X;  3NWT A;  1DON A;  2XH9 A;  2KHS A;  1QE6 A;  3SK8 A;  2A69 D;  2K6A A;  5EBD A;  1J5E M;  3HU3 A;  3TME A;  1GHJ A;  2OF1 A;  3VFD A;  5IGB A;  2CW0 C;  2F5S A;  2F5O A;  3SK5 A;  1MSH A;  1EQT A;  1XMQ M;  4G6Z A;  3L29 A;  3W0F A;  3PIO 3;  2G5G X;  3QWL A;  2M00 A;  1K3X A;  1Y8P B;  1Z59 A;  4QB4 A;  5COY A;  2TMP A;  3U6D A;  3GLH B;  1EYC A;  2M9V A;  3OMC A;  4KO8 A;  4RGT A;  4FYD A;  4LCB A;  4RFB A;  1BNZ A;  4RHR A;  4G7Z C;  3KOX E;  5DM6 3;  1QAO A;  2EXZ A;  2IL8 A;  1A2T A;  4AI6 A;  1WCM B;  1OXT A;  3GTP B;  2F3V A;  2FFJ A;  2WB1 B;  3AU7 A;  4G7H C;  3A56 A;  5E26 A;  1IY2 A;  2F0Q A;  4GH9 A;  4Z6Y A;  2QCP X;  4TSS A;  3MXP A;  4LF7 M;  1Y1W B;  1PTO H;  1A3V A;  5DEH A;  4OO1 I;  2EYL A;  1CA5 A;  1G41 A;  4KY5 A;  4XXE A;  5C44 B;  3KS4 A;  3EIH A;  5JPM C;  2RGH A;  4MGH A;  1X3P A;  4RGN A;  2B2Y C;  2F4V M;  1PXU A;  3DUZ A;  4EQN A;  2LNH C;  4JXJ A;  2A68 D;  1G2S A;  3DEO A;  2B2V C;  5D65 A;  4NP5 A;  3IFT A;  4RHS A;  2Y0Q A;  2HDM A;  4DV2 M;  1JB3 A;  1IN4 A;  3PMF A;  1NHG C;  3FUU A;  1CM9 A;  1OFH A;  3URY A;  4OO1 G;  3GRV A;  3TWL A;  1D1I A;  2D7G A;  4CHT B;  4K14 A;  1MX0 A;  1C8C A;  5EP3 A;  1HT1 E;  2C9C A;  4R8I A;  3KFU G;  3V05 A;  3S1R B;  3FPP A;  2KEB A;  1JQY D;  2KRK A;  5FKA C;  4DR5 M;  4FVM A;  3GLI B;  4NOO B;  4LFB M;  1I50 B;  4F87 A;  4QIW B;  2BE5 C;  2IPK D;  5IT9 L;  1R2Z A;  4K5W A;  3TZD A;  5KNB A;  4EQP A;  1L1Z A;  2F5P A;  5ITX A;  3FD9 A;  2DWM A;  4YIJ A;  4IBD A;  1E2Z A;  5D3I B;  1Q1B A;  2FMC A;  4LGY A;  1WTX A;  2D7H A;  2R4J A;  2RDF A;  2G9D A;  1D1K A;  2NVY B;  1HTL D;  4DN4 M;  5IRE B;  2NN6 G;  5ITR A;  1OFI A;  2QPA A;  2QEN A;  4RGO S;  5EJC A;  5FO7 B;  1I4R A;  1CFM A;  3OW7 A;  5JAV A;  1NVM A;  1QAQ A;  3FUV A;  2L09 A;  3UZU A;  4IUT A;  3VR3 A;  4J8Q A;  4QNM A;  1N34 M;  3N52 A;  3I3C A;  3L25 A;  4IBF A;  1LLR D;  4TRD A;  1DGH A;  5IIF A;  1W5T A;  1IY0 A;  2FMM A;  3L9A X;  2P5T A;  3HU1 A;  4IBI A;  4ULL A;  4MN3 A;  4QOS A;  5C0X J;  4NL4 H;  5A2Q S;  3L7Z C;  2BNK A;  3D6W A;  4X62 M;  3TBI B;  1YNN C;  2R3Z A;  1SXJ C;  1ZYR C;  1SBB B;  2LXE A;  1HNX M;  3KSJ A;  1ENF A;  1UEA B;  1IYU A;  1N75 A;  3SAV A;  3TWM A;  1EWH A;  5ELE A;  4DA2 A;  3NXW A;  2A69 C;  5JPN C;  3P75 A;  1JWS D;  5E4X A;  4IIW A;  4Y7N B;  4ITQ A;  4LJ4 A;  2JE6 I;  4KLN A;  1LTS D;  1E32 A;  5LHY 1;  4HAE A;  3RZD B;  1J09 A;  1U4M A;  3SDZ A;  1IXZ A;  1Z6H A;  3C1E A;  2PW5 A;  3WHK A;  5BN4 A;  1AZP A;  3GPY A;  5IGE A;  1R4P B;  1HQY E;  2XSC A;  2CEA A;  4S12 A;  3CRK C;  1PTO F;  2X8A A;  1NHW C;  1HPC A;  3A8I E;  3AL0 C;  3W2D A;  4IUN A;  3S1M B;  1XC8 A;  4RWS C;  1YSY A;  2Z3X A;  4G4R A;  3SK4 A;  4HSP A;  3VR5 A;  4CJ2 C;  2KZS A;  2ENB A;  1JOO A;  3G6J B;  2XSZ D;  3M85 A;  1DGG A;  4ZUJ A;  4GHA A;  1HQR D;  1NNJ A;  3NP8 A;  1L8Q A;  3RGS A;  4DUZ M;  3J81 E;  1NCV A;  3GLG B;  3R2T A;  2EY5 A;  3K5O A;  3BOS A;  3U6Q A;  3PVS A;  1I6H B;  4V19 0;  2EOT A;  2X4A A;  2C5C A;  4DK0 A;  1V1P B;  1W6K A;  5C4X B;  3A8K E;  3BG3 A;  4KHV A;  3S17 B;  1S5F D;  4RKB A;  2A68 C;  5JVH 3;  4LF8 M;  4KHP M;  1RJT A;  3UGJ A;  2CQA A;  1AZQ A;  2H1E A;  2RDH A;  3D6C A;  4IUR A;  3LQR A;  2F0D A;  3I4V A;  1V1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...