4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna replication/isomerase
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CHTB 4CGYB 3NBIA
chains in the Genus database with same CATH superfamily
4IFDG 1J7KA 3HHXA 5ELCA 3I4NB 1TY2A 2Q2EB 2ZM6M 3T1YL 2B63H 3Q8DA 1N34Q 3HOWG 4B7FA 4XYQA 4LAAA 4GOPA 2ERCA 1JORA 3J80i 3HOVB 5M5XB 5EBCA 2CW0C 3UDXA 1N33M 4LJ6A 3PUVA 4GZYC 3GLHA 2JUJA 2LBCA 4S3SA 1B4OA 4LFAM 2MP1A 4GOPB 1NJGA 1J09A 3KSJA 1S40A 4RNAA 1K0RA 2Q8IB 2CFOA 1JQJC 3FYDA 1XTCD 3T1HM 3HOZH 4A3DG 5JEAG 3J81j 4DR5M 1STGA 4IBIA 5JJKA 1Z7TA 2ASBA 2WKCA 4MN3A 2B2WC 2XGTA 3I91A 1VMCA 5C3XA 3GTMH 3BU2A 2VF8A 2C99A 2LVNC 1D5ZC 1TXYA 1QUTA 3HGBA 4CDDC 2I0QA 3RZOB 1A0IA 1FJGL 3FUUA 1WJ7A 1GUSA 4RKUF 3Q6SA 4Z8XA 1VQNA 2E5LL 2XIWA 3VYUA 1FNVA 1XPRA 3VLFB 2K1BA 1N77A 2FOIC 1VQGA 4IPDA 3CC7A 4C2MB 4HEOA 2ZXRA 1CSPA 3F2CA 1VQ9A 4LFCL 2EY1A 1TWFB 1I50B 1Z5BA 2I46A 3ILKA 2R92G 1NY5A 1E2VA 4GLXA 3HKZB 4JBJA 3CF5A 1PV4A 5EJWA 5KPRA 1H9MA 2N8NA 5E6JA 5K36H 4L5QA 3FHWA 3LCVB 2PPBC 3J81E 1LTAD 1JQYD 3H4MA 4XK8F 2JN4A 3HZXA 4DR2M 4AG5A 2B3GA 1PH1A 4Y52H 4ALPA 3A56A 1UFZA 1JJCB 4PZ6A 4DR6L 1E24A 1SLJA 1SXJA 3MHBA 4RGOS 1HCZA 1JE5A 3S1RH 4LJ7A 1RIPA 2UXCQ 1L2BA 4ID6A 3RN2A 4L5TA 4TKOB 2NYZD 2Q2HA 1HZ9A 3ZCBB 3Q24A 2HIVA 2OO9A 3I8ZA 4XIGS 3E9SA 1NO1A 1CTMA 2HUGA 4DUZM 1QZGA 1HFNA 1MHWC 4G7OC 5EPKA 1PA6A 1DJRD 2EY5A 1LTID 5C44H 4HJ7A 1PH3A 2DZNB 1LACA 5IT9E 4DR3L 1B8AA 4IBBA 2ZTEA 1A5TA 4G4NA 2UUAQ 4AIMA 1D8LA 2UUCL 4IBFA 4FYDA 1V1QA 2UUBM 3THGA 3JAMc 3TP7A 2WB1B 1AN8A 4A3FB 4Z9CB 4WW0A 2JA5G 1YJWA 4JI5Q 1ZKOA 2D62A 1QUQA 2ZXOA 1O7ZA 2HCCA 1SYCA 4B3TL 3FUXA 1JMCA 4DV1Q 4IBJA 2OEOA 5IIFA 3GTKB 3LWUA 4UN2B 1STBA 3NPPA 2NZHA 2JA8B 3HGIA 4KT0F 3M7GA 5JPMC 5M5XH 1PH6A 3MFYA 1K82A 3C1FA 4LFBM 5EXTA 3PUYA 3G6EA 1Z47A 1BBUA 5I6YA 2X49A 5LMUM 1L1OA 3JAMS 2DNAA 1CZWA 4A3EH 1BBWA 1HZAA 3BYTB 4PQXA 4ZCKA 3DM3A 1GOZA 1TS3A 1EEID 4N8X1 2UXDL 1O80A 4LRTA 2MNAA 3KSXA 1L1OB 1Y1VB 2CV2A 2A1AA 1J8IA 2GVAA 1IN4A 3UZUA 2DY7A 1JR3A 1JE4A 1QCBD 4R4OA 2HDMA 2GA4B 5LMNQ 1N36L 4LG2A 1BXTA 4R8NA 1Y1WB 3D8BA 4KY5A 1KD1C 4QNMA 4DXFA 5EP2A 1PRBA 3U4ZA 4B3RL 1PLFA 1N34M 2NZOA 2DHRA 3A5ZB 5ELOA 4OL7A 4I81A 3ERQA 4C2MH 1SNQA 1MJEA 3CHBD 3M85A 2R93B 3M4YA 1D1IA 3STBD 4DK1A 3KOZE 1TWFH 2WZJA 2Q2IA 5FO9B 1WTQA 5BR8Q 1HJPA 4OU7A 1HTLD 5KQDA 4PD2A 3EBEA 2D5DA 3I90A 3H3VC 1SSOA 4K0KL 4ZYSA 3SK6A 3WHLA 1Z9FA 2LXEA 4RAUC 3A54A 2WKDA 3I4LA 2JEAI 1VQ1A 1T3TA 3GLGE 3PIPA 1VDZA 4KY6A 1NR2A 1CM9A 2G8LA 2JZ1A 2L6OA 1QANA 3GRRA 1QAQA 3EN2A 4UP7A 2WP8J 1UE1A 3U50C 4N8FA 2R44A 2E74C 4DFAA 3MHVC 3T1YQ 3J2PB 2B39A 1WD0A 3TP5A 4IUNA 4E6IA 1B7YB 3F92A 1HQMC 4R9WA 5FLXS 3BDCA 2VZAA 3I4OA 1SR3A 3AEVA 4G6ZA 1QE6A 4WURA 4LGYA 2HCBA 1EQVA 3UJNA 3L7ZC 4JCVE 2L12A 4AQYQ 1TDZA 4A3FH 1IM2A 3E6ZX 5C0XG 1JR0D 1QVRA 1A6XA 2PMZB 3O13A 1EOVA 3SC3A 2DHYA 4KN4C 5M3MB 2CHVA 1QB5D 1K9MC 3OYYA 5DAUA 4X66L 4O42A 2OCEA 4PT5A 4FXDA 1F2ZA 2A68C 2K5WA 3K81C 1VQ5A 5HY6A 1CT1D 4C3JG 1EWIA 5KIXA 4V0BA 2FINB 2UXCM 1DOKA 1IN6A 2KCTA 4IUPA 4KHPL 1SMXA 3S16B 5JVG3 2E5LQ 1WVLA 2EZVA 4KJOA 1ENFA 3I4MG 1ILQA 1U9RA 5C3EB 4LZJA 3GLFE 3TZUA 1GUNA 2E2HH 2R3ZA 5C4XG 4LFCQ 5IREB 3GTJB 2L5TA 4UP9A 3PO2G 4K5VA 1Z6TA 3VR3A 1U0LA 5IGDA 2WINB 2NVTB 2UUAM 3MTSA 1SROA 3P75A 3RMHA 4YWMA 2CCZA 5LL6S 2BJVA 4DR4M 2UXBL 3TSSA 1IY1A 2N35A 3OPOA 4GNXC 5FKAC 3HU2A 2RHSB 3AQQA 2R7ZB 4B3SM 2H4OA 4DV1M 3NUCA 4LK1C 4X65M 2EKFA 1SYEA 5GROA 1OTCA 2RSOA 4DR6Q 1XMOM 5IGEA 3K7AB 4CKCA 3FRHA 3NBHA 3HRZC 5C4HA 3FUVA 2DNCA 3PSIA 2ES2A 2EQSA 3DA1A 5BPVA 5JVH3 5L8RF 3BOSA 1BUVT 2C9OA 2Q8RE 3BZDB 4IBCA 4O0AA 3R93A 5FTLA 4LF4L 2XZFA 4KLKA 5H1SE 4WJWA 2JWSA 4ZUJA 3K7UC 4DNIA 2Y0TA 4QIWB 4JI2M 2EYPA 3HOWB 3FTDA 3FPUB 3OSOA 2XF3A 4EQ5A 2EOTA 3KJPA 1N32L 1IQPA 3J80E 2VQFL 5LMNM 2UUCQ 4JI6L 3TS0A 4JV5L 2AUJD 4EX5A 3HEJA 4BXXG 3ERSX 2NVYB 4JBMA 5DYIA 3I51A 2EY2A 3R3OA 2N55A 3J7AS 4BA2I 3PVSA 4RCOA 3H94A 1GD7A 3V96A 5DM63 2BWEA 3FEWX 2KJXA 3PNVA 5GADC 4B3TQ 4BWGB 1A2UA 4XXEA 2L11A 2M2LA 4RGTA 1BR9A 1QYRA 2R46A 3SHGB 1ET6A 4A3DB 4EGVA 1N9WA 4OIKA 4MM3B 3SASA 5M5YB 2Z6KC 4F1IA 3IAYA 4M9ZA 4C3IH 1HTPA 4LJAA 1D0MA 4RFBA 2JA6H 3QAUA 1B3AA 1EQTA 4IJEA 4HEDA 5EP1A 2UXDQ 2DJFC 2K01A 4PMCA 2B3TA 1EOTA 3WOEA 2JA7H 3KW6A 2UU9L 2HD3A 2BH2A 3D8LA 1B9MA 2YV5A 2GN5A 4JI4L 1N36Q 5KNDA 2DGYA 4FXKC 4RG1A 3WDNA 1ENAA 5DNYA 1KLUD 3VR2A 2KUMA 3DLLA 1TWCB 2KXEA 4TUWA 3N6RA 3NK9A 1EIGA 1W6KA 2F1MA 4LMQD 3S16H 4B3RQ 2R92B 1PH9A 4A3KH 1TGUA 3EROA 1EE8A 1PTOH 3FDTA 3PMFA 4KK7A 3MJ5A 3Q23A 5C3EH 4FCVA 1GABA 3GQ3A 3NTHA 3GTJH 1EY4A 1PH5A 3N52A 1FVIA 2NVTH 3J81c 3HOXH 2A5YB 3I73A 5EPLA 2IW3A 4K0KQ 4DPGA 3K2LA 2OOAA 4L8JA 3MA2B 1IYUA 3A55A 1HR0L 5CR3A 5GAGC 1BQQT 2O5RA 2Z7JA 1VQCA 1KNEA 2Z4HA 1D6EC 1LT5D 2BDOA 3NHHA 1HH2P 2NTTA 3M6AA 4FDBA 3K7AH 3H0GG 4JVZA 2VNUD 1SE2A 3J81S 1FJGM 1SNPA 4BBRG 1Q82C 4B7GA 3TEHB 5IODA 2EYHA 4PDIA 1K28A 5IT9c 2XSZD 5EJCA 1K8OA 4NKLA 3GTLB 2JA5B 3SYLA 2I7NA 3I04M 5I6WA 5E1FA 4IBKA 1EFWA 4ODGA 5IZ7D 1DV0A 4A3GG 1X56A 2M60A 4NW2A 2O25A 4LFCM 3E21A 4ZLTF 5CC4A 3HS0C 2F4IA 1WOCA 4DR1L 3EA6A 1I6VC 3S1MB 3UK6A 1CQVA 1HXYD 3KVWA 1IXRA 5C4ZA 3KFUG 5IYBG 3FE3A 4QHTA 2EPBA 2MUYA 1KQSA 2GVBA 2A69D 1WTWA 2NVYH 3RUZA 3OIQA 3E0JA 4REZA 5IT9S 1B1ZA 2RRUA 2V1CC 2CW0D 1PJSA 3FYCA 1RTNA 1HNXQ 1V1OA 2KA7A 1WCMG 4X66Q 4LF7L 2VW9A 1KRSA 4M9XA 3RE8A 1VEJA 1YHBA 2JJQA 1E1TA 2F0SA 2XFTA 3IFDA 4K2KA 3UDGA 2DZLA 2C96A 4UDUC 1JOOA 2YFQA 2B2UA 3L9AX 4OWTB 4KHPQ 2QW7A 1AH9A 2XZUA 2F0UA 1ASYA 1OJLA 4I65A 2RVLA 3TREA 3IFTA 3D6WA 1G3IA 2AMCB 3I72A 1AIPC 3K8ZA 2CRUA 1JCKB 2JY6B 1ICFB 4AG6A 2K9DA 1Z6HA 3IKJA 1BNZA 4DR3M 1WD1A 3CTWB 2XNAC 3R2IA 2JE6I 2UUCM 3M7NA 1MD2D 2Q8TA 5FLMG 4UY8C 2ALYB 3ER0A 4Q0FA 4AKHA 2RGOA 4BY7G 3W0LB 2PZUA 1PYBA 2SEBD 4ZKBB 2AQ1B 1NR4A 3TP8A 3H4JA 2BE5C 4B3TM 1NSNS 2YYZA 4GN3B 1ONLA 3TMEA 2A6EC 3EIVA 1YJNA 1KRTA 2CH4W 3CCVA 1OKSA 1XNQQ 3I2ZA 2Z0SA 4I7ZC 1M4VA 5EQ0A 4IBDA 4P73A 4YY3M 4ZKCB 1Q8IA 4NSRA 1J5EL 2KEBA 1Q3CA 2KNAA 1HFGA 4D82A 4H44C 3K92A 4M1UB 1XJVA 1EU3A 2PNRC 3C1EA 1D2NA 4LF4Q 1TWAH 3ULLA 4XQJA 3A42A 1EUJA 4GKJL 2UXDM 1A63A 1F9SA 5K5PA 2HL7A 1PGYA 4IUUA 3PV0A 1OXXK 1Z5CA 5FLXE 1EZ6A 2LXKA 2K5VA 1QAMA 2XRSD 2L55A 4MZ9A 1N32Q 2PQAB 3F2DA 4JN6A 1N36M 2VQFQ 4JI6Q 4JV5Q 2CKZB 3KOWE 3K5MA 1WTPA 4EVOA 3CC4A 4CJ6A 1F9PA 3AOEC 3EJIA 3FMCA 3B7NA 2LY7A 2EKKA 2FJ2A 1HUMA 2FFKB 1OQYA 2L7IA 4B3RM 1ENCA 1EYAA 2A6HD 1JOQA 2RGHA 5ELEA 3DXJC 3GQ5A 2JY7A 1S5FD 1TVXA 2B29A 5CV4A 5A2QS 4WFN3 4APVA 4A3MB 3HOYB 1C4QA 3MVVA 1C1KA 1VMPA 3T53B 1HNZL 2KBNA 2L7HA 5FJ8H 5GQOA 5CBAE 1PFNA 4OONA 4K0KM 1VQOA 3CW2C 4L6V6 5C18A 3PIOA 4ZQ3A 3E46A 5EXPA 3DEPA 3K80C 5IYCH 2FH0A 3BYYB 3D3RA 3BZKA 4A3IH 3LMMA 5FO8B 4R4TA 2UU9Q 2ZBKB 3DWQA 3ND9A 2RKOA 2BDNA 3I4MB 2N88A 1W6JA 4NPSA 2CEAA 2AUKA 2R61A 4DKAC 4JI4Q 2HHHL 5C4XB 1AEXA 2LH0A 3PO2B 2CHQA 3ULJA 4EQPA 4IFDJ 2KA6B 4GEWA 1JJGA 5JOBA 3HOUB 2M9VA 3MZ5A 2CQAA 5ELBA 1V33A 1Y8OB 2L0CA 1W2BA 3I4VA 5F2DA 2Z9HA 1X37A 1BOSA 3FTCA 2L15A 3IG8A 5EXSA 4JI3L 5KEEA 1X9NA 1CI3M 1II3A 4QJFA 2WSEF 3L29A 5EXXA 7CATA 2K04A 2F4VL 2ZAMA 3U6PA 2R4JA 2K0BX 2JA9A 3S14H 1WGNA 1NMGA 4LF6L 3AU7A 4HL4A 4KV6A 3V2TA 5M3FH 1VQKA 1XMQQ 4IJLA 4M0WA 4JOIA 5EPJA 1Y14B 1W5SA 2Y20A 2ZTDA 1I4QA 1KLGD 2OQKA 3SHLA 3DUZA 2K5NA 4IN3A 1Z5AA 4JG2A 3C3LA 3VR6A 5BR8L 2PYKA 1WTVA 4X66M 1RL2A 1IN7A 4RHSA 2CE7A 3WOFA 1UE7A 4ITQA 3CCMA 1VQBA 3KXEC 2F0DA 5IWAL 1X6OA 4P72A 5L37A 2JY8A 4RMFA 1H95A 4MNOA 1E32A 3ZC7B 4KHPM 1I4HA 3PO3G 1U4LA 3SYKA 1LTRD 1U4PA 1YNND 2F0HA 4A3BH 3J80c 3SARA 3OHXC 3QG1A 1NY4A 3C58A 4GH9A 4BY1G 2L09A 1FGBD 1I4XA 1GL7A 4IQZA 4YCVA 4DR1Q 4UAIA 5C1BA 3A7LA 3D6CA 1TKWB 3K5OA 4NSOB 2AKWB 1HNWM 3NP8A 1K0SA 4RA8A 1QZEA 1QG7A 4GITA 3QOLA 4KI0A 2R18A 2UXBM 3LW5F 1BVSA 4DK3C 4CJ1B 1STEA 4I5SA 5G3LD 2D0PA 2B2TC 2LVAA 2Z8YM 1X3QA 1VQEA 2R4EA 3J80S 1R5LA 4A3JH 1L1TA 3TPZA 2MPMA 2QZ4A 4LF7Q 2DXIA 1YNJC 1YBYA 4KD3A 4JBKA 4GIPA 5EGTA 1NTGA 4AQYL 4Y7NB 4CHTB 1RTOA 1SN8A 5HURA 1B50A 3K9OA 4A3MH 3HOYH 3KBXA 4DAVA 4ME5A 1IN8A 1U4RA 2OOBA 4GN4B 5AJ3L 2C98A 4S12A 4X3TA 3AMUA 4OXPA 4YWKA 1B53A 1YUBA 1IZ6A 4LF4M 2ID0A 4KKSA 1VQHA 3G4SA 4WJ4A 2A68D 3VK7A 2NVQB 1X3GA 1HUNA 1EU4A 1O7YA 1RCVD 1DXMA 1Q7YC 1V9PA 4QMGA 4A93G 2QDBA 5IP9G 1N32M 2ZJQA 4JV5M 2VQFM 2J7NA 4JI6M 2JEBI 5I4DA 1W5TA 3J7BA 3MEFA 4OGQC 4DK0A 4DV0L 4KJNA 3PO2H 4G3OA 1L2CA 1FNUA 1SAPA 1STYA 2F3WA 2RA4A 5D3DA 4PDGA 3HOUH 2G5DA 3CF6E 1FL0A 4RKBA 5JPNC 3W68A 4X62M 1VQJA 3QIAA 5C4JB 1BDOA 3G6JB 2XLJA 2K5HA 4OELB 1RDPD 2IWHA 3VYTA 2PW7A 2RSNA 1YIJA 1M1KC 3RGSA 1GL6A 2X4AA 1J6QA 4IUVA 1J5EQ 5J3BA 2ATWA 1NHGC 3RLNA 3UE0A 3S2DB 2B2YC 3KYHC 3PGZA 1WTRA 3K58A 4LF9L 1LTTD 1BKBA 3HFZB 4GS3A 5ELDA 5IOCA 2FMMA 1SYBA 4BBRB 1TH3A 4GKJQ 4EIWA 3CRLC 5I9OA 2KNZA 5DNFA 4AKGA 3BBZA 2UU9M 1LYLA 5KGUA 4LF8L 3QYBA 1P8LA 2F0EA 1KIXA 4IO9A 4AW4A 1EFID 2AHMA 2F0FA 2R62A 1E9RA 3SAUA 4OO1G 3M4PA 2J7OA 1B3QA 1O7LA 4BBAA 2ICEC 1XYIA 3GQ4A 3ZJYC 4DXGA 5ITUA 4AYBE 1QDRA 1GUOA 2SDFA 1WCMB 2PI2E 3I4NH 3IL8A 1LV7A 3U6QA 4DV6L 3A0JA 1HNZQ 1E2WA 2E75C 3ND8A 3GTOB 3NE5B 1GJXA 4IOAA 1DD2A 3F1ZA 1V34A 2KDLA 3HOVH 2AQ3B 2WACA 2N78A 2DAKA 4GOPC 1ASZA 2OTLA 4F2LA 3PUZA 4P71A 1YI2A 1HR0M 2ZJRA 3S1NB 4NRWA 3PUXA 4YIJA 3NSWA 1T6OA 1AW7A 2QHOB 3MXNB 2HHHQ 2JK8A 1VQ8A 4FF4A 3S15B 4GKKL 1P3QQ 5KQ8A 2H1EA 1UWVA 4A3CG 1E7ZA 1DYQA 4G7ZC 1SBBB 4AYBG 3J7AV 4BLCA 1IBML 1EIJA 4JI3Q 3PCOB 4R4IA 2RQXA 4LF5L 1IW7C 4KMUC 1LUZA 4BY7B 4DV4L 3TP6A 2F4VQ 3RZOH 1ESRA 1EWHA 4P17A 1IHZA 3UDFA 2K32A 3G71A 3S17B 2QCUA 1PFMA 4LF6Q 4DR1M 4N9TA 4JI0L 4ABNA 5T1IA 4IZ8A 1YSYA 3JAML 3NENA 3OW7A 4GC9A 2DKLA 3U6LA 5C0XJ 4X64L 1QWYA 1R2YA 3HHYA 3HY5A 1PJIA 1NV8A 4KD4A 4F7XA 2I7PA 1MGSA 1I50H 1OXUA 2EYFA 4X6AH 1ZYRC 3B89A 4GNXA 1PJJA 1BO0A 3KOJA 1AP0A 5C4JH 5JI3E 5HGQA 1R2ZA 2QGQA 5T1GA 2RDFA 4DF7A 3CCRA 5IWAQ 2EIFA 3GTPB 5E26A 3EVQA 4K6LA 1MKHA 1IKLA 1VQDA 2JP7A 4WRDA 4GNXB 2NN6H 3T4AC 5FLXc 3OWEB 3S2DH 3L27A 1LTLA 4IOCA 5I9PA 4JI8L 3E4RA 2VUMB 2OT2A 2X6GA 5CV8A 2PNHA 1SXJC 5A2QE 4G57A 1FNNA 1DOLA 3CRKC 3OTOL 2MR9A 2WAQE 1QZHA 3CPFA 1AZPA 1JWMD 4J1MA 2A74C 3H3VH 1KNAA 2HWJA 3CMAA 1F9RA 1NNJA 1K8GA 5IYBH 3CXCA 1BCPC 1U5KA 1JT8A 3C9PA 1H9KA 4DUYQ 1I5FA 1LM0A 4NRVA 2E2JB 1S3SA 3FKIG 2GNOA 5M5WB 4NXML 3MK6A 1G8PA 3CCQA 3CD6A 3KBGA 1N78A 3B7ZA 3OIPA 1UAPA 4CKBA 5KO3A 2XSCA 4IURA 1LO5D 1HNXL 1XXHA 3U4VA 5AJ3Q 1J5EM 2KVMA 2B63G 1OAOC 3GTKH 2LVOC 3SMPA 3GTOH 2JA8H 2WAQG 1A62A 1EIFA 2V1UA 3VR4A 4GKJM 2VY3A 4OVZA 3VDUA 5C5LA 4UP8A 1XXHB 5FLXL 4JYAQ 4HMJA 3BVGA 2R65A 1GHJA 1DO0A 1ZMVA 1TDHA 3V76A 2NUCA 4WORA 3UE1A 2HIXA 1VEGA 3U6CA 3GLIA 1L1OC 4XT3B 4DV0Q 4NOOB 1GM5A 3S1QB 3J7ZC 1OAIA 4OVZB 4GHLA 1SMYC 3HOZG 1Y1VH 2EXZA 4A4IA 1CFMA 4L5SA 3D4WA 5ITXA 1VQLA 3W2DA 3M4OB 3GLIB 5CV9A 4BY7H 2RCFA 2IX0A 1G6ZA 3AFQA 1F2MA 4JI5M 1Y1WH 2KCCA 1B2TA 4JI7L 1I4RA 3U5ZA 3SATA 1AE2A 1OFIA 2DY8A 2D7HA 4C3HG 1HNZM 3DFZA 4JBWA 2BE5D 4HR7B 1TF0B 2A19A 4LF9Q 2VQEQ 4LJ9A 1XNQL 2A6ED 4CGYB 1EWCA 4KHZA 4PCZA 5KPTA 3U5ZB 4UHVA 2ZM6L 2R93H 4GHAA 1SEBD 1LT4D 3KUPA 3OMCA 1S3OA 3HJSA 3U61A 3A46A 1B44D 4LF8Q 2F0OA 4P16A 5ELFA 2K6BA 4LY6A 3AKZA 4HAEA 4FWGA 2ZJPA 5K36G 4W5WA 5EKKA 1XPUA 1KFVA 2APLA 3U61B 1I3QB 2Y0SE 1F9QA 4JI3M 1QOHA 3R8FA 1ZEQX 3DOAA 4A3LH 1MU5A 2KHHA 2DAMA 4IPHA 4L78A 4DBGB 3WWVA 3QYEA 3FKEA 5IGGA 3MAQA 2VUMH 1KAAA 2G9DA 3LNNA 1DGGA 2CWAA 2XWJB 2D2CC 5AFWA 4HJ5A 4LF6M 1VQ7A 4DV6Q 3M0EA 4GRIA 1MBYA 2RF4A 1V43A 3D8GA 3CF0A 5JJLA 4DNRB 5CMDA 5KNBA 2CUZA 3B6YA 1VF7A 5BR8M 5C44G 1XC8A 3CCLA 4LUZA 1XNRL 2IY5B 1ILPA 2Y0SG 1O78A 5NUCA 1OXSC 4GKKQ 1SYDA 3GLHE 1S5CD 3RZDB 1MIUA 4JW0A 2JYOA 3MXPA 4R4CA 4A93B 3HHWA 5M3MH 4B9XA 2K33A 1MJGM 1IKMA 4HJAA 1CKOA 4XQNA 1CZGA 2OQ0A 3RN5A 1IBMQ 3K0YA 4X3UA 4LF5Q 4MTKA 2P5TA 4DV4Q 1HR0W 4IFDI 1EIYB 1X3EA 2HQLA 1R4GA 3KF6B 1HQYE 2E76C 1PHJA 4FWHA 1PTOC 4JI0Q 1NUCA 1PRTC 1EY8A 3SAVA 4RF1A 3T1YM 4A3EG 3KLSX 1WYDA 4L5RC 3JR5A 5GAEC 3W0FA 2KHSA 1LV9A 2YU9B 2K03A 1A3TA 2QILA 2SNSA 4X64Q 3K5LA 3ZQJA 1KSFX 2KECA 8CATA 3S1QH 4LRSA 3T56B 4IBGA 2NBFA 3E0EA 2L1BA 1PYWD 4FWDA 3TDQA 1A3VA 2QKIC 3ZH9B 1XMQL 2O4XA 2XWBB 1JB3A 3HKZE 4XTCS 1G8ZD 4ULLA 4AQYM 5IYDH 3F2UA 1YHQA 1STNA 3W3AA 2XRQD 1H6UA 1QJOA 1I4GA 4TSSA 2L2DA 1EZ8A 2R7ZH 3HX3A 3VFDA 4GN5A 1G4AE 4Z6YA 1GO5A 2DAEA 5FSWA 4NL4H 4RWSC 4DV2L 2R6FA 4JI8Q 2LHGA 2AHOB 3DM1A 1N75A 3FP9A 3DWPA 1H9SB 2J4XA 3TQSA 1SXJE 3OTOQ 2E5LM 3Q0AA 1XB2B 4BBSG 1LTMA 1Q1BA 1VQ4A 5I2YA 4IFDH 2J5YA 3FTEA 3C2PA 4IUQA 5ITRA 3HKZG 3T6PA 1IBKL 3U6SA 5LMUL 5EQTA 3HOWH 1EYGA 4JK1C 4R3DA 4G4RA 1I3QH 1VS0A 1YVCA 1PH4A 4HSVA 5C3WA 2WB1E 1R9TB 3PF4A 2G5GX 4MGIE 4F8MA 1S5DD 2ZTCA 5EP3A 4WP2A 4NXMQ 4RH6A 3CCEA 2R0IA 2R6GA 3NXWA 1E9SA 1X3PA 4IJHA 3NQTA 4AH6A 5HGTA 3J81L 3JC66 4PV1C 1VQMA 3Q8GA 1E2ZA 1LTSD 5E3FA 1QVFA 1NVMA 1YZ6A 2EYLA 4Q5VA 3D4DA 4DR6M 4LF9M 2AWNA 4A3DH 1TWGB 2QENA 5JEAH 1YNJD 3E9HA 1X32A 1NY6A 3KDSE 5M5YH 2EYJA 2VB3X 2EJSA 3MFGA 1Q3LA 3FUTA 2R7DA 1YEZA 3BG3A 4EQOA 4LF8M 4NXNL 5C6AA 4K6DA 4JI1L 5G3LF 2C35B 3RZDH 4HIDA 1TH4A 1MSHA 3AFHA 3QR8A 5IT9L 2QP9X 4M9SA 2G3QA 3U6DA 2K5DA 5IE8A 1G91A 3IECA 3S2HB 3GPUA 1A3UA 1F4IA 4M0DA 5D3IB 3HJ8A 1G41A 1JR3E 1E22A 1QNUA 1TWCH 3R2TA 4JI7Q 4DV6M 2QDLA 3IHPA 1EQQA 2KEEA 2ZANA 1GVPA 3SXHA 3CCSA 2R92H 1IBLL 3L25A 1M8AA 1SE8A 3RFWA 4KY7A 3FD9A 5FTJA 3TWLA 1LT6D 4I7AA 2FE8A 3W67A 1DGBA 2QCPX 2ZM6Q 1HQCA 1T5EA 1V8QA 2Y0QA 1E1OA 1L2DA 3DHQA 2N3SA 4HJ8A 4Y28F 4EQNA 4I8OA 2X8AA 1FD7D 4GKKM 2PQAA 1UEAB 5IGCA 4NP5A 2TMPA 2B2VA 2MH8A 2CH4A 1NJFA 1HRJA 5KYIA 5LL6X 2VDBB 5JI2E 2OF1A 2XSZA 3GLGA 4LF5M 5EP4A 1ZMUA 2ICIA 1EY9A 4HN7A 3R8BA 4OX9L 1Q39A 3EIEA 2EA0A 1K3XA 4OO1H 5E7NA 4U68A 4X3KA 1OO9B 4R8IA 4MGKE 4JI0M 4IPCA 3PIP3 3BDOA 1BBXC 3GLGB 1JICA 3FKIB 2F5PA 1P16A 3GTLH 1QVGA 2JA5H 2JY5A 4X64M 3PUWA 1CQFA 2B8GA 3L28A 1Q1EA 2B63B 2DWLA 5LMNW 1AFPA 2L4EA 2QNJA 2BH8A 3S1MH 4CJ0B 1XNRQ 2CQOA 5J39A 4K2LA 1UNSA 5A35A 4L16A 1F2LA 4C3JB 1R9TH 3SAWA 1V92A 3VK8A 1FYCA 4KN7C 1IXRC 1X3FA 4X3SA 1K83B 1KABA 3TWMA 2F0PA 3KJOA 3HKPA 4KLNA 2RBMA 2DN8A 5DM73 1RJTA 2JQOA 3HOZB 2B2WA 2F0QA 4A75A 4JI8M 2L4FA 1PZJD 1ESFA 1AZQA 2CHGA 4B3SL 5E4XA 3BXWA 2CFMA 1VQPA 1TWHB 1VCIA 2Z3XA 4C3IG 4QGUA 1IY0A 3A74A 3GTMB 1XMOL 1SNCA 2PW5A 4PNYA 1TQOA 3A5UA 2JA6G 4KKUA 1IW7D 4C3HB 1SE4A 3GLFA 2YQZA 5D65A 3L2PA 3VDPA 1E94E 2G9HD 2JA7G 1PDQA 5C0XI 2TSSA 1IFYA 2JNHA 5EKLA 3S2HH 3CGWA 4NXMM 2Z1CA 4V190 3NTKA 3GLFB 5JEAJ 1MJCA 1HNXM 3I4YA 3UMMA 3I55A 2UUBQ 2HDLA 2BCOA 1B70B 1OXTA 3L0OA 1Y8NB 4A3KG 1ET9A 3KLWA 1ZYRD 1R4PB 2MROB 1B9NA 4DV2Q 1QDTA 2K52A 5C3EG 4LUVA 1WGLA 4DA2A 3ONAB 1YITA 2NQ8C 3Q8XA 2LVQD 5TSSA 3CKIB 3HOXG 4B3ML 4PG3A 4L15A 1NHWC 3GPPA 3KS8A 3A7AB 3LX0A 3S1RB 2BOSA 3TZDA 5CBEE 4QIWE 1DM0B 3ZYYX 1YJ9A 1IBKQ 5LMUQ 2JP1A 3QWLA 4K5WA 1CKNB 4IJFA 3GD7A 3OMGA 2QA4A 1SXJD 1NNUC 2Z6BA 3KS4A 2K05A 1XTDA 1Q3BA 2J7ZA 1JC7A 1EY5A 1JOKA 5C44B 3QJYA 4JI7M 1KDBA 1OIPA 3LQRA 2FMCA 4OWXB 4RCNA 4H7BA 3VYSA 2A73B 4IALA 1T9HA 3MWYW 4DUYL 1IL8A 4DV3L 5C0XH 1BCPD 2PCFB 1SFOB 4QCLA 3LQQA 1XNQM 1U4MA 4DAPA 1KL9A 2A69C 1K8MA 1Y69U 3J7AF 1QZMA 2VB2X 1HT2E 2MGSA 2F0IA 4C3JH 1WHCA 1C7YA 4D81A 1XWIA 1SRUA 3TN2A 4JI1Q 3CMEA 4NXNQ 1HA6A 1OFHA 3GV6A 2CHBD 2LS01 2YTXA 4POFA 3BDLA 5F3WA 4CDCC 1K83H 4A3EB 1Q8KA 4LW1A 2O01F 3TWKA 1YHAA 4FF2A 4JYAL 3GRYA 2D0OA 4P2CB 3CPWA 2F0NA 3J80L 3I4MH 4FO2A 1I94L 1AE3A 5C4XH 3GLHB 4PMWA 1IYVA 2KHJA 1NAPA 4K14A 1E3PA 4TVAB 4ZAIA 4GLAC 3T16A 1T5XD 1X65A 2HCIA 1GKIA 2KOLA 4HCEA 4M8AA 4RKLA 1TWHH 1SMYD 3L3OC 1IBLQ 2CP8A 2KCMA 1GLNA 3NWSA 4KODA 3BVMA 4FCTA 1NNXA 4XT1B 3HKSA 4DV7L 3C3EA 2LWXA 1A15A 4C3HH 4H02A 3H09A 1JR3D 5JJZA 4J6HA 4K5XA 3SHFA 1XNRM 5IGBA 1CSQA 3WHKA 3ICEA 2AQ2B 2RKSA 4DK6C 2KZSA 2F5QA 3H0GB 1TY0A 1EY6A 2VQEL 2A5HA 3A8JE 3CF2A 2RCNA 3VA7A 1UUPA 5IP7G 4JOIC 5ITYA 1SNDA 3URYA 1Q90A 3GTGB 1A8VA 3FPPA 2XEPA 4OW0A 4KTAA 2C5RA 3CC2A 3KFUA 4BBSB 3SK8A 1F2YA 2CV1A 4JI4M 4A3GB 1QUSA 4MH0E 4GLVB 2CWPA 2WFWA 2X6LA 4HMIA 4OX9Q 1H9JA 1QVCA 1VEKA 4MGHA 1V1PA 3SEBA 5IGFA 2QF7A 4FD2A 1NBWA 3U58A 1I4WA 4C1NK 4BXXH 3I7FA 4QY7A 4F87A 1VQAA 2JXMB 2XTIA 1PH7A 1NSFA 2FHTA 1V1PB 1TR8A 2HKJA 3J27B 1LABA 2I5MX 4WJ3M 3KLSA 1SXJB 1XMQM 2DENA 1KXLA 5FTMA 4AZFA 5ITTA 1GVNA 2A6HC 3NWLA 3MXNA 1EFUB 2FNAA 1UEBA 1C9OA 1C8CA 1OTRA 2CWBA 1A2TA 1XX8A 5IY0A 2Z8LA 1DO2A 4R4QA 2DWZB 3FUWA 1SE3A 2NN6I 4IUTA 1BCPB 4F88A 1TT2A 4XYOA 4LJ8A 1GKHA 2Q2TA 1SFOH 2VF7A 4DR4Q 4DV2M 3HG9A 2E2IB 2WSCF 4Y7NH 2Z4RA 4ILWA 3SR1A 3SDZA 4CDEC 2QBYA 4B3SQ 1RHPA 1HT1E 1GUGA 2V6ZM 2I5HA 4LWCA 3LVVA 4X65Q 4RGMA 2NVXB 1XMOQ 3JAMi 5JAVA 5FJ8G 1CUKA 1STAA 1KC8C 1L2FA 1HZCA 1QUQB 2VL6A 1ZXTA 3H3VI 1NV9A 4YY3L 1IBKM 4MB7A 2QBYB 1KYIA 5IYCG 4R71A 4PMBA 4FCWA 1I6HB 1K3BC 2ZAOA 2NB0A 3NTIA 1T43A 2NVQH 4A3IG 1TU2B 3K57A 3TL4X 1EQRA 1FNWA 2CVRA 1PTOD 5FTKA 4ZPXA 1PRTD 2F5OA 1OXVA 3J7A5 2C5CA 2E2HB 1JWSD 4JI2Q 1UE5A 3CP0A 3GPYA 3NBIA 2Q2UA 4G4KA 3G7LA 1R6BX 2HT1A 3GTQB 5FOBB 4LF7M 3GDEA 4LJ4A 3SK5A 1TS4A 2F5SA 4LJZC 2LKVA 3FTFA 4DR7L 4FF3A 3AFPA 4KKTA 5M3FG 2AWOA 3E9IA 4NB3A 4ZRZA 3CQZB 4B3MQ 4ANRA 2LNHC 4NXNM 3H0GH 3S24A 4QQBX 4JI1M 2R45A 4FVMA 1UE6A 1XXGA 4BBRH 1D2BA 4RF0A 5H37D 1KDCA 3GTGH 2VIIA 5DEHA 2IJ0A 4UPAA 2O5IC 4JC0A 3DWAA 4BBSH 2F0JA 3NBXX 1IN5A 3UGJA 1X55A 2XH9A 1AUAA 4HTHA 4OWWB 4A3GH 1DZ1A 1NCVA 3OOCA 4L6TB 4LZZA 3I3CA 3VKHA 2MJ8A 1YNNC 2MQHA 3AL0C 4MHEA 4II7A 4CJ2C 3G48A 1G6PA 4U673 3U9OA 1IBLM 2EYOA 4A3BG 4DV3Q 3M9BA 4NMZA 2Z4IA 3SE0A 2GQFA 3SMSA 1L0XB 3U6MA 4FNFA 1IL2A 1BF4A 1PH8A 4YHHL 1HA5A 1SYGA 1WCMH 1DGFA 1TS2A 1WJJA 4QOZC 2F0WA 4YCWA 3M4QA 1EIHA 2Z6KA 3TS2A 1YNXA 3A8IE 1QAOA 2ENBA 5ELNA 3P1HA 3NELA 3CCUA 2I5LX 4C3IB 1VDLA 3D4RA 3K9PA 1RODA 4IIWA 3PQIA 4NDXA 3S1NH 4A3JG 4DAMA 3GRUA 1S5ED 4CIZA 4PZ7A 2JA6B 1S5BD 1I94Q 2M00A 3PIO3 3S15H 1DGHA 2K47A 4OX9M 5J1ZA 2IL8A 2E2IH 1R7RA 2YTVA 3MC0B 2JA7B 4A3MG 3HOYG 5BN3A 1ZQ9A 1PYSB 2WV6D 3HP3A 3A8KE 2QQ8A 4TQUS 1ML0D 2EE1A 4GMQA 1MI2A 2F0LA 5FLMH 1CA6A 2NVXH 4DNTB 1DGHB 5CV6A 4CISA 2EJMA 3X3MA 1PH2A 4DV7Q 1SYFA 1FJGQ 4DV5L 2HQEA 1I6HH 3S17H 3PNYA 2X69A 1L8QA 2R7FA 1F77A 3NWTA 1YE9A 3E3XA 4A3KB 2FXQA 1PTOB 1PRTB 4N9PA 2O2LD 1G59A 2KRUA 1FGUA 1PFSA 3GQBA 2A8VA 3KP1E 5FK9C 3SK4A 3VYRA 3T13A 2PZWA 3RLOA 1EYDA 3PO3B 3U9SA 3SGIA 1S72A 2ZT9C 3HOUG 4A3VB 3HOXB 1HNWL 3GTQH 3HZJA 1G291 2XFSA 4IPGA 1GJTA 2P5ZX 3SBJA 1I4PA 3FVQA 3IG5A 2HHHM 5C5MA 3RR5A 4BY1B 1N33L 1DCZA 3TBIB 3PF5A 3GTPH 4A76A 1TIID 4LFAL 2SOBA 4HIKA 2DUDA 3I01M 2LSSA 2N49A 3Q22A 4OEMB 2Z4SA 3CQZH 1D7QA 3KF8A 2DAIA 3W1GA 3T51B 2F4VM 3T1HL 3HHZA 2E2DC 1JJ2A 3RLFA 2LVPC 2KEDA 4HCSA 4DR5L 2K28A 1HPCA 3IRBA 2LTUA 1R4QB 5KNCA 2DI0A 2CV0A 3GRVA 3T15A 1WTOA 1ICWA 4P75A 1Q86C 3KF8B 3MEHA 4IBEA 2EO2A 5CYUA 3CAMA 3NBHB 4P74A 1JWUD 3AOGA 4R7GA 3GPXA 1KTKA 3HU1A 3VDYA 4DR3Q 3HWSA 3W1BA 3GO8A 2KNVA 2V1CA 1CHPD 4HIMA 3VA5A 3QOJA 2YNMD 2EY6A 3B9PA 4NC6A 1FR3A 4H0LC 5COYA 2OQ4A 2E2JH 1N8RC 5M5WH 3UDIA 1ORYB 5IWAM 1XWEA 2K75A 2YR0A 3KF6A 2J0TD 5D14A 4CKEA 3I4NG 3PFIA 4X62L 2NZ1D 2KZUA 1S4ZA 2H5XA 2LMCB 2F0GA 2VXWA 1G2TA 4O2DA 4B3MM 1KDAA 1W3SA 2V4DA 1LLRD 2DAGA 1KHIA 1PZID 3FRPB 5CORA 1LTBD 3HOVG 4R1JA 4YY3Q 2OXPA 4LCBA 2MJ5B 1RF2D 4YWLA 2FS1A 2DNEA 4Q7JA 4FXGC 4DR2L 3JR4A 4LGMA 4K8IA 2K14A 4FW9A 1ZMWA 3AV0A 1SJHD 4LJ5A 1TS5A 2I07B 2KQ3A 3SVMA 3EQLC 3E5SA 4QB4A 1PZKD 4B9WA 3NEMA 3VKGA 3ITPA 2BJWA 1SJED 2YTYA 4DAYA 4L63B 2DWNA 2IX3A 3RD4A 4HIOA 3AJIB 1DGSA 4DUYM 3M4OH 4DV3M 4DUZL 5BN4A 1PVOA 5E4WC 4DR7Q 4JPBW 4DAYB 1VQFA 4I4LA 3KDFA 4ME3A 1WIVA 4D80A 4J15A 4PZ8A 2VS1A 1H9SA 2UUBL 1GXDC 3STBC 2E8GA 2FFJA 1KAWA 1O7IA 2K6AA 5GKNA 4POGA 1HQRD 2M5ZA 4KHVA 3K5NA 2F0MA 1NE3A 1J9OA 3KDFB 4QUCA 4YCUA 3PO3H 2IHEA 4B08A 3T38A 2K7VA 2MHVA 2XN9C 2MO0A 3GO5A 1HHVA 4JYAM 5DYGA 2NTSA 2RDHA 3K59A 1EY0A 1TWAB 4QNRA 1I94M 4MGYE 3KOYE 2JSOA 3X3NA 4BY1H 4G4QA 4DV0M 4H13C 4LFBL 3BVZA 4BB9A 3H15A 3QB3A 4QHSA 3K8AA 2D7EA 3L26A 1QQWA 1X54A 3AOEA 3TRZA 3FRIA 2LXJA 1M90C 2LFNA 3H91A 3J81i 3B74A 2NN6G 4OHJA 1EYCA 3H6MA 4TRDA 5ITQA 3LWEA 2O5JC 2F0KA 4DV7M 5ISRA 4QL5A 4CBVA 1D5MC 5KPZA 2BWBA 4YHHQ 3U60A 2QEJC 1VQ6A 3SFZA 1MN3A 1E0BA 5EKIA 2PI2A 2EXDA 4CDFC 1Y8GA 1VDDA 1JB0F 4RGNA 3HU3A 3K6OA 4XQQA 3CU7A 3F2BA 2VQEM 1K73C 5CV5A 2OTJA 1VQIA 4AYBB 3U60B 5GAHC 4LUOA 2W82A 1N34L 5EBDA 3AYHB 1RU3A 2EYMA 3AB9A 5I2XA 3JAME 3MMPA 2MGWA 1YLAA 1HZBA 5EAYA 2DVWB 2WB1G 4A3FG 3EIHA 4OO1I 4L8RC 4A3IB 2F03A 4A93H 5FO7B 1PJTA 4RHRA 5IP9H 1Q46A 3KP0E 3K1JA 1BCPF 2JXNA 3R9XB 2IHFA 2JA8G 3U6OA 1C0AA 1PFBA 1Y8PB 4DV5Q 4K8JA 4L4UA 1LTGD 4XGIA 4ZUIA 2RDGA 4AI6A 2PQEA 3GP7A 1EL0A 1MSGA 2YU9H 2EDGA 3L2AA 3S14B 4HSPA 1C48A 4JXJA 1VF5C 1XHBA 4HLQA 4BS9A 5M3FB 5JJIA 4QF4A 3QWNA 1SNMA 1SNOA 2PO4A 2JZ0A 1Y1VG 3TQYA 3S9WA 1K8AC 3ULPA 1HNWQ 2EJGC 3M3YB 3C46A 2RHQB 1DONA 2F0VA 1STHA 4G7HC 1WTXA 1CHQD 1H9RA 1PMRA 3B7QA 2WIIB 5IP7H 5FTNA 2UXBQ 2D9UA 1N33Q 1VG5A 4AKIA 3A45A 2XGNA 4FP5D 1Y1WG 2KHIA 4XDXA 1OIZA 2IPKD 2PZTA 4LFAQ 4BA1I 4J8QA 1EY7A 1CA5A 2K5QA 5DFLA 4ZK9B 1IBMM 3DEOA 4C56C 5KYLA 2EJFC 4DV4M 2JA2A 3T1HQ 3GV3A 2KW0A 1GJSA 1TTEA 4XBOA 4LNQA 4DR5Q 2F0TA 2R93G 3W5OA 1TH2A 3GP1A 2EUCA 4A3BB 1D0KA 1G2SA 1GHKA 2EVBA 5DLQE 1GUWA 2F5NA 2UXCL 2WSFF 1Z59A 2MFIA 3J7YW 2H1RA 4GC5A 2D7GA 1PXUA 1IXZA 1ZV1A 2B2TA 1D0LA 2WAQB 4KO8A 3D0FA 2KRKA 4A3LG 2PMZE 2KCNA 3OWFA 1L1ZA 4MGZE 4DR7M 2VUMG 3RGPA 2BA1A 1RD9D 3LGJA 3BS1A 1PM5A 2OPFA 4A3JB 2UUAL 4X62Q 3F8TA 1L0YB 3P7JA 2MO1A 3OW2A 2K4KA 2C9CA 1SG9A 2L9HA 1IY2A 4MTNA 1CK1A 1Q12A 4HJ9A 4DR4L 3DMUA 4MIUA 3DZDA 3C3DA 4JI5L 5BN5A 4A3CH 2LHCA 1TWGH 3BZCA 1XXHE 4DU9A 5LHY1 5M9OA 5J22A 1NJIC 3A98B 4DV1L 1NMFA 2KENA 5A2QL 1MX0A 3I56A 4DR2Q 2XVSA 4X65L 4QOSA 3OTOM 2HAKA 2F3IA 3TE6A 1QILA 3U6EA 2B2UC 1G51A 5KRUA 2SNMA 4DN4M 1Q02A 5M3MG 3RNUA 4B7HA 3GLIE 1SXTA 2Y21A 1D1KA 2L4NA 1L0WA 1WFQA 3KK7A 4DUZQ 3P20A 2IX1A 3NQIA 1ZAEA 4JI2L 1IYJB 2ZXPA 2IT1A 4YHHM 5ITXE 1CKMA 3KLRA 4FF1A 3LCUA 2BA0A 1GO3E 5LMNL 4OIJA 2QSFX 3KOXE 1QNKA 1XPOA 3EFXD 2QPAA 1IXSA 2NWGA 2B8FA 1G71A 3I70A 3LVWA 2B2YA 3MXGA 3K0XA 1PTOF 3M3YH 1PRTF 1RKNA 1PJQA 1CKNA 4C1NI 1JB7A 1IXSB 2BNKA 5CGKA 1D5XC 3HJQA 1SDFA 3UI2A 4LFBQ 1WI5A 5IYDG 1GUTA 1WR1B 1WXQA 3CCJA 2DWMA 1HR0Q 2DJGC 3MXUA 1DOMA 2F3VA 2R7ZG 2B2VC 2OWOA 3PXGA 1Q81C 1UM8A 2DZOB 5CV7A 4DV5M 1WTHA 1LT3D 1EEFD 3QO2A 2F52A 1TR5A 3VR5A 4O1NA 4DGZA 2Y0SB 3BJUA 2QEXA 3D31A 3FKIH 1K3RA 2K50A 3V05A 4QUFA 1K3WA 4G4OA
chains in the Genus database with same CATH topology
4IFDG 1J7KA 3HHXA 5ELCA 3I4NB 1TY2A 2Q2EB 2ZM6M 4B7FA 4XYQA 4LAAA 2ERCA 1JORA 3HOVB 5M5XB 5EBCA 2CW0C 1N33M 4LJ6A 3PUVA 4GZYC 3GLHA 4S3SA 1B4OA 4LFAM 2MP1A 1NJGA 1J09A 3KSJA 4RNAA 2Q8IB 2CFOA 1JQJC 3FYDA 1XTCD 3T1HM 5JEAG 4DR5M 1STGA 4IBIA 1Z7TA 2WKCA 4MN3A 2B2WC 3I91A 1VMCA 5C3XA 1D5ZC 2C99A 3RZOB 3HGBA 3FUUA 1GUSA 3Q6SA 4Z8XA 2XIWA 3VYUA 1FNVA 3VLFB 2K1BA 1N77A 2FOIC 4C2MB 2ZXRA 2EY1A 1TWFB 1I50B 1Z5BA 2I46A 3ILKA 1NY5A 1E2VA 3HKZB 5EJWA 5KPRA 1H9MA 5E6JA 5K36H 2PPBC 3J81E 1LTAD 1JQYD 3H4MA 3HZXA 4DR2M 4AG5A 3A56A 1SXJA 3MHBA 4RGOS 1HCZA 4LJ7A 1L2BA 4ID6A 4TKOB 2NYZD 3ZCBB 3Q24A 3I8ZA 4XIGS 3E9SA 1CTMA 2HUGA 4DUZM 1HFNA 4G7OC 5EPKA 1DJRD 2EY5A 1LTID 2DZNB 1LACA 5IT9E 4IBBA 4G4NA 4IBFA 4FYDA 2UUBM 3THGA 3TP7A 2WB1B 1AN8A 4A3FB 4Z9CB 4WW0A 1ZKOA 2D62A 2ZXOA 1O7ZA 2HCCA 1SYCA 3FUXA 4IBJA 2OEOA 5IIFA 3GTKB 3LWUA 1STBA 3NPPA 2JA8B 3HGIA 3M7GA 5JPMC 3MFYA 1K82A 3C1FA 4LFBM 5EXTA 3PUYA 1Z47A 5I6YA 2X49A 5LMUM 3JAMS 1CZWA 3BYTB 4PQXA 1GOZA 1TS3A 1EEID 1O80A 4LRTA 3KSXA 1Y1VB 2CV2A 1J8IA 1IN4A 3UZUA 2DY7A 1JR3A 1JE4A 1QCBD 2HDMA 2GA4B 4LG2A 1BXTA 4R8NA 1Y1WB 3D8BA 4KY5A 4QNMA 4DXFA 5EP2A 1PLFA 1N34M 2DHRA 4OL7A 4I81A 3ERQA 1SNQA 3CHBD 3M85A 2R93B 3M4YA 1D1IA 4DK1A 3KOZE 1WTQA 5FO9B 4OU7A 1HTLD 5KQDA 4PD2A 3I90A 2D5DA 3H3VC 1SSOA 4ZYSA 3SK6A 3WHLA 4RAUC 2LXEA 3A54A 2WKDA 3I4LA 2JEAI 1T3TA 1VDZA 4KY6A 1NR2A 1CM9A 2G8LA 2L6OA 3GRRA 1QANA 1QAQA 2WP8J 2E74C 4DFAA 3MHVC 3J2PB 2B39A 1WD0A 3TP5A 4IUNA 4E6IA 4R9WA 1HQMC 5FLXS 3BDCA 4G6ZA 1QE6A 4WURA 4LGYA 2HCBA 1EQVA 3UJNA 3L7ZC 2L12A 1TDZA 1IM2A 3E6ZX 5C0XG 1JR0D 1QVRA 1A6XA 2PMZB 3O13A 4KN4C 3SC3A 5M3MB 2CHVA 1QB5D 5DAUA 4O42A 4PT5A 4FXDA 1F2ZA 2A68C 2K5WA 1CT1D 4C3JG 5KIXA 4V0BA 2FINB 2UXCM 1DOKA 1IN6A 4IUPA 3S16B 5JVG3 1WVLA 2EZVA 4KJOA 1ENFA 1ILQA 1U9RA 5C3EB 4LZJA 3TZUA 1GUNA 2R3ZA 5IREB 3GTJB 2L5TA 4K5VA 1Z6TA 3VR3A 5IGDA 2WINB 2NVTB 2UUAM 3MTSA 3P75A 3RMHA 5LL6S 2BJVA 4DR4M 3TSSA 1IY1A 3OPOA 5FKAC 3HU2A 2R7ZB 4B3SM 2H4OA 4DV1M 3NUCA 4LK1C 4X65M 1SYEA 2RSOA 1XMOM 5IGEA 3K7AB 4CKCA 3NBHA 3HRZC 5C4HA 3FUVA 2DNCA 3DA1A 5BPVA 5JVH3 3BOSA 1BUVT 2C9OA 2Q8RE 3BZDB 4IBCA 3R93A 5FTLA 2XZFA 4WJWA 4ZUJA 2Y0TA 4QIWB 4JI2M 2EYPA 3HOWB 3FTDA 3FPUB 3OSOA 2XF3A 2EOTA 1IQPA 3J80E 5LMNM 2AUJD 3HEJA 2NVYB 5DYIA 3I51A 2EY2A 3R3OA 2N55A 3J7AS 4BA2I 3PVSA 4RCOA 3H94A 3V96A 5DM63 3FEWX 2KJXA 3PNVA 4BWGB 1A2UA 4XXEA 2L11A 2M2LA 4RGTA 1BR9A 1QYRA 2R46A 3SHGB 1ET6A 4A3DB 4EGVA 4OIKA 4MM3B 3SASA 5M5YB 3IAYA 4M9ZA 1HTPA 4LJAA 4RFBA 3QAUA 1B3AA 1EQTA 4IJEA 4HEDA 5EP1A 2K01A 4PMCA 1EOTA 3WOEA 3KW6A 3D8LA 1B9MA 5KNDA 4FXKC 3WDNA 1ENAA 5DNYA 1KLUD 3VR2A 2KUMA 1TWCB 2KXEA 4TUWA 3N6RA 3NK9A 1EIGA 1W6KA 2F1MA 4LMQD 2R92B 1TGUA 3EROA 1EE8A 1PTOH 3FDTA 3PMFA 4KK7A 3MJ5A 3Q23A 4FCVA 3GQ3A 3NTHA 1EY4A 3N52A 2A5YB 3I73A 5EPLA 2IW3A 3K2LA 4L8JA 3MA2B 1IYUA 3A55A 5CR3A 1BQQT 2O5RA 2Z7JA 1KNEA 2Z4HA 1D6EC 1LT5D 2BDOA 3NHHA 2NTTA 3M6AA 2VNUD 1SE2A 3J81S 1FJGM 1SNPA 4B7GA 5IODA 2EYHA 4PDIA 2XSZD 5EJCA 1K8OA 4NKLA 3GTLB 2JA5B 3SYLA 2I7NA 5I6WA 5E1FA 4IBKA 4ODGA 5IZ7D 2M60A 4NW2A 4LFCM 5CC4A 4ZLTF 3HS0C 2F4IA 3EA6A 1I6VC 3S1MB 3UK6A 1CQVA 1HXYD 3KVWA 5C4ZA 3KFUG 4QHTA 2EPBA 2MUYA 2A69D 1WTWA 3RUZA 3OIQA 3E0JA 4REZA 5IT9S 1B1ZA 2CW0D 3FYCA 1RTNA 1V1OA 2KA7A 4M9XA 3RE8A 2F0SA 2XFTA 3IFDA 4K2KA 2C96A 4UDUC 1JOOA 2YFQA 2B2UA 3L9AX 2XZUA 2F0UA 1OJLA 4I65A 2RVLA 3IFTA 3D6WA 1G3IA 3I72A 3K8ZA 1JCKB 4AG6A 1Z6HA 3IKJA 1BNZA 4DR3M 1WD1A 3CTWB 2XNAC 3R2IA 2JE6I 2UUCM 3M7NA 1MD2D 2Q8TA 4Q0FA 4AKHA 2RGOA 3W0LB 2PZUA 4ZKBB 2SEBD 2AQ1B 1NR4A 3TP8A 2BE5C 4B3TM 1NSNS 2YYZA 1ONLA 3TMEA 2A6EC 4I7ZC 1M4VA 5EQ0A 4IBDA 4YY3M 4ZKCB 1Q8IA 4NSRA 2KEBA 1Q3CA 1HFGA 4D82A 4H44C 3K92A 4M1UB 1EU3A 2PNRC 3C1EA 1D2NA 4XQJA 3A42A 2UXDM 1F9SA 5K5PA 2HL7A 4IUUA 3PV0A 1OXXK 1Z5CA 5FLXE 1EZ6A 2XRSD 1QAMA 2L55A 4JN6A 1N36M 3KOWE 3K5MA 1WTPA 4EVOA 1F9PA 3AOEC 3EJIA 3FMCA 2LY7A 2FJ2A 1HUMA 2FFKB 2L7IA 4B3RM 1ENCA 1EYAA 2A6HD 1JOQA 2RGHA 5ELEA 3DXJC 3GQ5A 1S5FD 1TVXA 5CV4A 5A2QS 4WFN3 4A3MB 3HOYB 1C4QA 3MVVA 1C1KA 1VMPA 3T53B 2L7HA 5CBAE 1PFNA 4K0KM 5C18A 4ZQ3A 5EXPA 3DEPA 3BYYB 3D3RA 3LMMA 5FO8B 2ZBKB 3DWQA 3ND9A 2RKOA 2BDNA 3I4MB 2N88A 1W6JA 2CEAA 2AUKA 2R61A 5C4XB 1AEXA 2LH0A 3PO2B 2CHQA 4IFDJ 4EQPA 2KA6B 5JOBA 3HOUB 2M9VA 3MZ5A 2CQAA 5ELBA 1Y8OB 2L0CA 3I4VA 5F2DA 1X37A 1BOSA 3FTCA 3IG8A 5EXSA 5KEEA 1CI3M 1II3A 3L29A 5EXXA 7CATA 2K04A 2ZAMA 3U6PA 2R4JA 3AU7A 4HL4A 4KV6A 3V2TA 4M0WA 5EPJA 1W5SA 2Y20A 1I4QA 1KLGD 3SHLA 3DUZA 4IN3A 1Z5AA 3C3LA 3VR6A 2PYKA 1WTVA 4X66M 1IN7A 4RHSA 2CE7A 3WOFA 4ITQA 3KXEC 2F0DA 1E32A 3ZC7B 4KHPM 1I4HA 1U4LA 3SYKA 1LTRD 1U4PA 1YNND 2F0HA 3SARA 3OHXC 3QG1A 3C58A 4GH9A 2L09A 1FGBD 1I4XA 1GL7A 4IQZA 4UAIA 5C1BA 3A7LA 3D6CA 1TKWB 3K5OA 4NSOB 1HNWM 3NP8A 4RA8A 1QG7A 4GITA 3QOLA 4KI0A 2R18A 2UXBM 4CJ1B 1STEA 4I5SA 5G3LD 2B2TC 1X3QA 2R4EA 3J80S 1L1TA 3TPZA 2MPMA 2QZ4A 2DXIA 1YNJC 4KD3A 4GIPA 5EGTA 4Y7NB 4CHTB 1RTOA 5HURA 1B50A 3KBXA 4DAVA 4ME5A 1IN8A 1U4RA 2C98A 4S12A 4X3TA 3AMUA 1B53A 1YUBA 4LF4M 2ID0A 4KKSA 2A68D 3VK7A 2NVQB 1HUNA 1EU4A 1O7YA 1RCVD 1DXMA 4QMGA 2QDBA 1N32M 4JV5M 2VQFM 2J7NA 4JI6M 2JEBI 5I4DA 1W5TA 3J7BA 4OGQC 4DK0A 4KJNA 1L2CA 1FNUA 1SAPA 1STYA 2F3WA 2RA4A 5D3DA 4PDGA 3CF6E 4RKBA 5JPNC 4X62M 3QIAA 5C4JB 1BDOA 3G6JB 2XLJA 1RDPD 2IWHA 3VYTA 2PW7A 2RSNA 3RGSA 1GL6A 2X4AA 4IUVA 1NHGC 3S2DB 2B2YC 1WTRA 3K58A 1LTTD 5ELDA 5IOCA 2FMMA 1SYBA 4BBRB 1TH3A 4EIWA 3CRLC 5I9OA 5DNFA 4AKGA 2UU9M 5KGUA 2F0EA 4AW4A 1EFID 2AHMA 2F0FA 2R62A 1E9RA 3SAUA 4OO1G 2J7OA 1O7LA 4BBAA 2ICEC 1XYIA 3GQ4A 4DXGA 5ITUA 1GUOA 2SDFA 1WCMB 3IL8A 1LV7A 3U6QA 1E2WA 2E75C 3ND8A 3GTOB 3NE5B 1GJXA 1DD2A 2AQ3B 2WACA 3PUZA 1HR0M 3S1NB 4NRWA 3PUXA 4YIJA 3NSWA 1AW7A 3S15B 4FF4A 5KQ8A 2H1EA 1DYQA 4G7ZC 1SBBB 3J7AV 4BLCA 2RQXA 1IW7C 4KMUC 4BY7B 3TP6A 1ESRA 1EWHA 1IHZA 2K32A 3S17B 2QCUA 1PFMA 4DR1M 4N9TA 4ABNA 5T1IA 4IZ8A 1YSYA 3JAML 3OW7A 4GC9A 3U6LA 5C0XJ 1QWYA 1R2YA 3HHYA 1PJIA 4KD4A 4F7XA 2EYFA 2I7PA 1MGSA 1OXUA 1ZYRC 1PJJA 1BO0A 1AP0A 5JI3E 1R2ZA 5T1GA 2RDFA 4DF7A 3GTPB 5E26A 3EVQA 4K6LA 1IKLA 4WRDA 2NN6H 3T4AC 3OWEB 3L27A 5I9PA 3E4RA 2VUMB 2OT2A 2X6GA 5CV8A 1SXJC 5A2QE 4G57A 1FNNA 1DOLA 3CRKC 1AZPA 1JWMD 4J1MA 2A74C 1KNAA 1F9RA 1NNJA 1BCPC 1H9KA 4NRVA 2E2JB 1S3SA 5M5WB 3MK6A 1G8PA 3KBGA 1N78A 3OIPA 1UAPA 4CKBA 5KO3A 2XSCA 4IURA 1LO5D 1XXHA 1J5EM 2KVMA 3SMPA 2V1UA 3VR4A 4GKJM 4OVZA 3VDUA 5C5LA 1XXHB 5FLXL 4HMJA 3BVGA 2R65A 1GHJA 1DO0A 1TDHA 2NUCA 4WORA 3U6CA 3GLIA 4XT3B 3S1QB 4NOOB 4OVZB 4GHLA 1SMYC 2EXZA 1CFMA 3D4WA 5ITXA 3W2DA 3M4OB 3GLIB 5CV9A 2IX0A 1G6ZA 1F2MA 4JI5M 2KCCA 1B2TA 1I4RA 3U5ZA 3SATA 1OFIA 2DY8A 2D7HA 4C3HG 1HNZM 3DFZA 4JBWA 2BE5D 4HR7B 4LJ9A 2A6ED 4CGYB 1EWCA 4KHZA 4PCZA 5KPTA 3U5ZB 4GHAA 1SEBD 1LT4D 3KUPA 3OMCA 3HJSA 3U61A 3A46A 1B44D 2F0OA 4P16A 5ELFA 4LY6A 3AKZA 4HAEA 4FWGA 5K36G 4W5WA 5EKKA 1KFVA 1I3QB 3U61B 1F9QA 4JI3M 1QOHA 3R8FA 1ZEQX 3DOAA 1MU5A 4L78A 3FKEA 5IGGA 3MAQA 1KAAA 2G9DA 3LNNA 1DGGA 2XWJB 2D2CC 5AFWA 4LF6M 3M0EA 4GRIA 1MBYA 1V43A 3D8GA 3CF0A 4DNRB 5CMDA 5KNBA 2CUZA 1VF7A 5BR8M 1XC8A 1ILPA 5NUCA 1O78A 1OXSC 1SYDA 1S5CD 3RZDB 2JYOA 3MXPA 4A93B 3HHWA 4B9XA 2K33A 1IKMA 4XQNA 1CZGA 3K0YA 4X3UA 2P5TA 4IFDI 1HQYE 2E76C 4FWHA 1PTOC 1NUCA 1PRTC 1EY8A 3SAVA 4RF1A 3T1YM 3KLSX 3JR5A 3W0FA 2KHSA 1LV9A 2YU9B 2K03A 1A3TA 2QILA 2SNSA 3K5LA 1KSFX 2KECA 8CATA 4LRSA 3T56B 4IBGA 2NBFA 2L1BA 1PYWD 4FWDA 3TDQA 1A3VA 2QKIC 3ZH9B 2O4XA 2XWBB 1JB3A 4XTCS 1G8ZD 4ULLA 4AQYM 3F2UA 1STNA 3W3AA 2XRQD 1H6UA 1QJOA 1I4GA 4TSSA 1EZ8A 3VFDA 1G4AE 4Z6YA 5FSWA 4NL4H 4RWSC 3DM1A 1N75A 3DWPA 1H9SB 2J4XA 3TQSA 1SXJE 2E5LM 3Q0AA 1Q1BA 5I2YA 4IFDH 3FTEA 3C2PA 4IUQA 5ITRA 3U6SA 5EQTA 4JK1C 4R3DA 4G4RA 4HSVA 5C3WA 1R9TB 2G5GX 4MGIE 4F8MA 1S5DD 5EP3A 4RH6A 2R6GA 3NXWA 1E9SA 1X3PA 5HGTA 3NQTA 3J81L 4PV1C 1LTSD 1E2ZA 5E3FA 1NVMA 2EYLA 4Q5VA 3D4DA 4DR6M 4LF9M 2AWNA 1TWGB 2QENA 5JEAH 1YNJD 1X32A 1NY6A 3KDSE 2EYJA 2VB3X 3MFGA 1Q3LA 3FUTA 3BG3A 4EQOA 4LF8M 5C6AA 4K6DA 5G3LF 1TH4A 1MSHA 3AFHA 5IT9L 2QP9X 4M9SA 3U6DA 2K5DA 1G91A 3S2HB 3GPUA 1A3UA 4M0DA 5D3IB 3HJ8A 1G41A 1QNUA 3R2TA 4DV6M 2KEEA 2ZANA 3SXHA 3L25A 1M8AA 3RFWA 4KY7A 3FD9A 5FTJA 3TWLA 1LT6D 2FE8A 1DGBA 2QCPX 1HQCA 1T5EA 1V8QA 2Y0QA 1L2DA 3DHQA 4EQNA 4I8OA 2X8AA 1FD7D 4GKKM 1UEAB 5IGCA 4NP5A 2TMPA 2B2VA 1NJFA 1HRJA 5KYIA 5LL6X 5JI2E 2OF1A 2XSZA 3GLGA 4LF5M 5EP4A 2ICIA 1EY9A 4HN7A 3R8BA 1Q39A 3EIEA 2EA0A 1K3XA 4OO1H 4U68A 4X3KA 1OO9B 4R8IA 4MGKE 4JI0M 3PIP3 3BDOA 1BBXC 3GLGB 1JICA 3FKIB 2F5PA 4X64M 3PUWA 1CQFA 2B8GA 3L28A 1Q1EA 2B63B 2DWLA 1AFPA 4CJ0B 5J39A 4K2LA 1UNSA 5A35A 4L16A 1F2LA 4C3JB 3SAWA 1FYCA 3VK8A 4KN7C 1IXRC 4X3SA 1K83B 1KABA 3TWMA 2F0PA 3HKPA 4KLNA 2RBMA 2DN8A 5DM73 1RJTA 3HOZB 2B2WA 2F0QA 4JI8M 1PZJD 1ESFA 1AZQA 2CHGA 5E4XA 1TWHB 1VCIA 2Z3XA 4C3IG 3GTMB 1IY0A 1SNCA 2PW5A 4PNYA 1TQOA 4KKUA 1IW7D 4C3HB 1SE4A 3GLFA 2YQZA 5D65A 3VDPA 1E94E 2G9HD 1PDQA 5C0XI 2TSSA 5EKLA 4NXMM 2Z1CA 4V190 3NTKA 3GLFB 5JEAJ 1HNXM 3I4YA 3UMMA 2HDLA 2BCOA 1OXTA 1Y8NB 1ET9A 1ZYRD 1R4PB 1B9NA 4DA2A 3ONAB 2NQ8C 3Q8XA 5TSSA 3CKIB 4L15A 1NHWC 3GPPA 3KS8A 3A7AB 3LX0A 3S1RB 2BOSA 3TZDA 5CBEE 1DM0B 3ZYYX 2JP1A 3QWLA 4K5WA 4IJFA 3GD7A 3OMGA 1SXJD 1NNUC 3KS4A 2K05A 1Q3BA 2J7ZA 1JC7A 1EY5A 1JOKA 5C44B 3QJYA 4JI7M 1KDBA 3LQRA 2FMCA 4RCNA 4H7BA 3VYSA 2A73B 4IALA 3MWYW 1IL8A 1SFOB 5C0XH 1BCPD 2PCFB 4QCLA 3LQQA 1XNQM 1U4MA 4DAPA 2A69C 1K8MA 1Y69U 3J7AF 1QZMA 2VB2X 1HT2E 2MGSA 2F0IA 4D81A 1XWIA 3TN2A 1HA6A 1OFHA 3GV6A 2CHBD 2LS01 3BDLA 5F3WA 4A3EB 4FF2A 3TWKA 3GRYA 4P2CB 2F0NA 3J80L 4FO2A 3GLHB 4PMWA 1IYVA 1NAPA 4K14A 4ZAIA 3T16A 1T5XD 2HCIA 1GKIA 2KOLA 4HCEA 4M8AA 4RKLA 1SMYD 3L3OC 1GLNA 3NWSA 4KODA 3BVMA 4FCTA 4XT1B 2LWXA 1A15A 3H09A 1JR3D 5JJZA 4J6HA 4K5XA 3SHFA 1XNRM 5IGBA 3WHKA 2AQ2B 2RKSA 2KZSA 2F5QA 3H0GB 1TY0A 1EY6A 2A5HA 3A8JE 3CF2A 3VA7A 1UUPA 5ITYA 1SNDA 3URYA 1Q90A 3GTGB 3FPPA 4KTAA 2XEPA 4OW0A 2C5RA 4BBSB 3SK8A 1F2YA 2CV1A 4JI4M 4A3GB 4MH0E 4HMIA 2X6LA 1H9JA 4MGHA 1V1PA 3SEBA 5IGFA 2QF7A 4FD2A 1I4WA 4C1NK 4F87A 2JXMB 1NSFA 2FHTA 1V1PB 2HKJA 3J27B 1LABA 3KLSA 1SXJB 1XMQM 5FTMA 4AZFA 5ITTA 1GVNA 2A6HC 3NWLA 3MXNA 2FNAA 1C8CA 1A2TA 1XX8A 2Z8LA 1DO2A 2DWZB 3FUWA 1SE3A 2NN6I 4IUTA 1BCPB 4F88A 1TT2A 4XYOA 4LJ8A 4DV2M 3HG9A 2E2IB 2Z4RA 4ILWA 3SR1A 3SDZA 2QBYA 1RHPA 1HT1E 1GUGA 2V6ZM 3LVVA 4RGMA 2NVXB 5JAVA 1STAA 1ZXTA 1IBKM 4MB7A 2QBYB 1KYIA 1I6HB 4PMBA 4FCWA 2NB0A 2ZAOA 3NTIA 1TU2B 3K57A 3TL4X 2CVRA 1FNWA 1PTOD 5FTKA 4ZPXA 1PRTD 2F5OA 1OXVA 2E2HB 2C5CA 1JWSD 3GPYA 3NBIA 4G4KA 3G7LA 1R6BX 3GTQB 5FOBB 4LF7M 4LJ4A 3SK5A 1TS4A 2F5SA 4LJZC 2LKVA 3FTFA 4FF3A 4KKTA 2AWOA 4ZRZA 3CQZB 2LNHC 4NXNM 4JI1M 2R45A 4FVMA 1XXGA 1D2BA 4RF0A 5H37D 1KDCA 2VIIA 5DEHA 2IJ0A 2O5IC 3DWAA 2F0JA 1IN5A 3UGJA 2XH9A 4HTHA 1DZ1A 1NCVA 3OOCA 4L6TB 4LZZA 3I3CA 3VKHA 2MJ8A 1YNNC 3AL0C 4MHEA 4II7A 4CJ2C 4U673 3U9OA 1IBLM 2EYOA 4NMZA 2Z4IA 3SE0A 3SMSA 1L0XB 3U6MA 4FNFA 1BF4A 1HA5A 1SYGA 1DGFA 1TS2A 4QOZC 2F0WA 1EIHA 3A8IE 1QAOA 2ENBA 3P1HA 4C3IB 3D4RA 1RODA 4IIWA 4NDXA 3GRUA 1S5ED 2JA6B 1S5BD 2M00A 3PIO3 1DGHA 2K47A 4OX9M 5J1ZA 2IL8A 1R7RA 3MC0B 2JA7B 5BN3A 1ZQ9A 2WV6D 3HP3A 3A8KE 4TQUS 1ML0D 2EE1A 4GMQA 1MI2A 2F0LA 1CA6A 4DNTB 1DGHB 5CV6A 4CISA 2EJMA 3X3MA 1SYFA 2HQEA 3PNYA 2X69A 1L8QA 1F77A 3NWTA 1YE9A 4A3KB 1PTOB 1PRTB 4N9PA 2O2LD 1G59A 2KRUA 3GQBA 3KP1E 5FK9C 3SK4A 3VYRA 3T13A 2PZWA 1EYDA 3PO3B 3U9SA 2ZT9C 4A3VB 3HOXB 1G291 2XFSA 3SBJA 1I4PA 3FVQA 3IG5A 2HHHM 5C5MA 4BY1B 1DCZA 3TBIB 1TIID 2SOBA 3Q22A 2Z4SA 3KF8A 3T51B 2F4VM 3HHZA 2E2DC 3RLFA 2KEDA 4HCSA 2K28A 1HPCA 1R4QB 5KNCA 2CV0A 3GRVA 3T15A 1WTOA 1ICWA 3MEHA 4IBEA 2EO2A 5CYUA 1JWUD 3AOGA 4R7GA 3GPXA 1KTKA 3HU1A 3HWSA 3GO8A 2V1CA 1CHPD 3VA5A 3QOJA 2YNMD 2EY6A 3B9PA 1FR3A 4H0LC 5COYA 2OQ4A 1ORYB 5IWAM 1XWEA 2YR0A 2J0TD 5D14A 4CKEA 3PFIA 2NZ1D 2KZUA 1S4ZA 2LMCB 2F0GA 2VXWA 1G2TA 4B3MM 1KDAA 2V4DA 1LLRD 5CORA 1PZID 3FRPB 1LTBD 2OXPA 4LCBA 1RF2D 2DNEA 4FXGC 3JR4A 4LGMA 4K8IA 4FW9A 3AV0A 1SJHD 4LJ5A 1TS5A 2I07B 2KQ3A 3SVMA 3EQLC 3E5SA 4QB4A 1PZKD 4B9WA 3VKGA 3ITPA 2BJWA 1SJED 4DAYA 4L63B 2DWNA 2IX3A 3RD4A 3AJIB 4DUYM 4DV3M 5BN4A 5E4WC 4I4LA 4D80A 1H9SA 1GXDC 2FFJA 2K6AA 5GKNA 1HQRD 2M5ZA 4KHVA 3K5NA 2F0MA 1J9OA 4QUCA 4B08A 3T38A 2K7VA 2MHVA 2XN9C 3GO5A 1HHVA 4JYAM 5DYGA 2NTSA 2RDHA 3K59A 1EY0A 1TWAB 4QNRA 1I94M 4MGYE 3KOYE 2JSOA 3X3NA 4G4QA 4DV0M 4H13C 3BVZA 4BB9A 3QB3A 4QHSA 2D7EA 3L26A 1QQWA 3AOEA 2LFNA 3H91A 2NN6G 4OHJA 1EYCA 3H6MA 4TRDA 5ITQA 3LWEA 2O5JC 2F0KA 4DV7M 5ISRA 4CBVA 1D5MC 5KPZA 3U60A 2QEJC 3SFZA 1E0BA 5EKIA 1VDDA 4RGNA 3HU3A 3K6OA 4XQQA 3CU7A 2VQEM 5CV5A 4AYBB 3U60B 2W82A 5EBDA 3AB9A 2EYMA 5I2XA 3JAME 2DVWB 3EIHA 4OO1I 4L8RC 4A3IB 2F03A 5FO7B 4RHRA 3KP0E 3K1JA 1BCPF 3R9XB 3U6OA 1PFBA 1Y8PB 4K8JA 4L4UA 1LTGD 4XGIA 4ZUIA 2RDGA 4AI6A 2PQEA 3GP7A 1EL0A 1MSGA 2EDGA 3L2AA 3S14B 4HSPA 1C48A 4JXJA 1VF5C 1XHBA 4HLQA 4BS9A 5M3FB 4QF4A 3QWNA 1SNMA 1SNOA 2PO4A 3S9WA 2EJGC 3M3YB 3C46A 1DONA 2F0VA 1STHA 4G7HC 1WTXA 1CHQD 1H9RA 1PMRA 2WIIB 5FTNA 2D9UA 4AKIA 3A45A 2XGNA 4FP5D 4XDXA 2IPKD 2PZTA 4BA1I 4J8QA 1EY7A 1CA5A 2K5QA 4ZK9B 1IBMM 3DEOA 4C56C 5KYLA 2EJFC 4DV4M 2JA2A 3GV3A 2KW0A 4XBOA 2F0TA 1TH2A 3GP1A 2EUCA 4A3BB 1G2SA 1GHKA 2EVBA 1GUWA 2F5NA 1Z59A 3J7YW 2H1RA 4GC5A 2D7GA 1PXUA 1IXZA 2B2TA 2WAQB 4KO8A 2KRKA 2KCNA 3OWFA 1L1ZA 4MGZE 4DR7M 3RGPA 2BA1A 1RD9D 4A3JB 3BS1A 1PM5A 2OPFA 1L0YB 3P7JA 2C9CA 2L9HA 1IY2A 1CK1A 1Q12A 3DMUA 4MIUA 3DZDA 5BN5A 5J22A 4DU9A 5LHY1 5M9OA 3A98B 5A2QL 1MX0A 2XVSA 4QOSA 3OTOM 3TE6A 1QILA 3U6EA 2B2UC 5KRUA 2SNMA 4DN4M 4B7HA 1SXTA 2Y21A 1D1KA 2L4NA 2IX1A 3KK7A 3P20A 3NQIA 1ZAEA 2ZXPA 2IT1A 4YHHM 5ITXE 3KLRA 4FF1A 2BA0A 4OIJA 1QNKA 3KOXE 3EFXD 2QPAA 2NWGA 2B8FA 3I70A 3LVWA 2B2YA 3MXGA 1PTOF 1PRTF 1RKNA 4C1NI 1IXSB 2BNKA 5CGKA 1D5XC 3HJQA 1SDFA 3UI2A 1GUTA 1WXQA 2DWMA 3MXUA 1DOMA 2F3VA 2B2VC 3PXGA 1UM8A 2DZOB 5CV7A 4DV5M 1LT3D 1EEFD 3QO2A 1TR5A 3VR5A 4O1NA 4DGZA 2Y0SB 3D31A 4QUFA 3V05A 1K3WA 4G4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHT B;  4CGY B;  3NBI A; 
#chains in the Genus database with same CATH topology
 4IFD G;  1J7K A;  3HHX A;  5ELC A;  3I4N B;  1TY2 A;  2Q2E B;  2ZM6 M;  3T1Y L;  2B63 H;  3Q8D A;  1N34 Q;  3HOW G;  4B7F A;  4XYQ A;  4LAA A;  4GOP A;  2ERC A;  1JOR A;  3J80 i;  3HOV B;  5M5X B;  5EBC A;  2CW0 C;  3UDX A;  1N33 M;  4LJ6 A;  3PUV A;  4GZY C;  3GLH A;  2JUJ A;  2LBC A;  4S3S A;  1B4O A;  4LFA M;  2MP1 A;  4GOP B;  1NJG A;  1J09 A;  3KSJ A;  1S40 A;  4RNA A;  1K0R A;  2Q8I B;  2CFO A;  1JQJ C;  3FYD A;  1XTC D;  3T1H M;  3HOZ H;  4A3D G;  5JEA G;  3J81 j;  4DR5 M;  1STG A;  4IBI A;  5JJK A;  1Z7T A;  2ASB A;  2WKC A;  4MN3 A;  2B2W C;  2XGT A;  3I91 A;  1VMC A;  5C3X A;  3GTM H;  3BU2 A;  2VF8 A;  2C99 A;  2LVN C;  1D5Z C;  1TXY A;  1QUT A;  3HGB A;  4CDD C;  2I0Q A;  3RZO B;  1A0I A;  1FJG L;  3FUU A;  1WJ7 A;  1GUS A;  4RKU F;  3Q6S A;  4Z8X A;  1VQN A;  2E5L L;  2XIW A;  3VYU A;  1FNV A;  1XPR A;  3VLF B;  2K1B A;  1N77 A;  2FOI C;  1VQG A;  4IPD A;  3CC7 A;  4C2M B;  4HEO A;  2ZXR A;  1CSP A;  3F2C A;  1VQ9 A;  4LFC L;  2EY1 A;  1TWF B;  1I50 B;  1Z5B A;  2I46 A;  3ILK A;  2R92 G;  1NY5 A;  1E2V A;  4GLX A;  3HKZ B;  4JBJ A;  3CF5 A;  1PV4 A;  5EJW A;  5KPR A;  1H9M A;  2N8N A;  5E6J A;  5K36 H;  4L5Q A;  3FHW A;  3LCV B;  2PPB C;  3J81 E;  1LTA D;  1JQY D;  3H4M A;  4XK8 F;  2JN4 A;  3HZX A;  4DR2 M;  4AG5 A;  2B3G A;  1PH1 A;  4Y52 H;  4ALP A;  3A56 A;  1UFZ A;  1JJC B;  4PZ6 A;  4DR6 L;  1E24 A;  1SLJ A;  1SXJ A;  3MHB A;  4RGO S;  1HCZ A;  1JE5 A;  3S1R H;  4LJ7 A;  1RIP A;  2UXC Q;  1L2B A;  4ID6 A;  3RN2 A;  4L5T A;  4TKO B;  2NYZ D;  2Q2H A;  1HZ9 A;  3ZCB B;  3Q24 A;  2HIV A;  2OO9 A;  3I8Z A;  4XIG S;  3E9S A;  1NO1 A;  1CTM A;  2HUG A;  4DUZ M;  1QZG A;  1HFN A;  1MHW C;  4G7O C;  5EPK A;  1PA6 A;  1DJR D;  2EY5 A;  1LTI D;  5C44 H;  4HJ7 A;  1PH3 A;  2DZN B;  1LAC A;  5IT9 E;  4DR3 L;  1B8A A;  4IBB A;  2ZTE A;  1A5T A;  4G4N A;  2UUA Q;  4AIM A;  1D8L A;  2UUC L;  4IBF A;  4FYD A;  1V1Q A;  2UUB M;  3THG A;  3JAM c;  3TP7 A;  2WB1 B;  1AN8 A;  4A3F B;  4Z9C B;  4WW0 A;  2JA5 G;  1YJW A;  4JI5 Q;  1ZKO A;  2D62 A;  1QUQ A;  2ZXO A;  1O7Z A;  2HCC A;  1SYC A;  4B3T L;  3FUX A;  1JMC A;  4DV1 Q;  4IBJ A;  2OEO A;  5IIF A;  3GTK B;  3LWU A;  4UN2 B;  1STB A;  3NPP A;  2NZH A;  2JA8 B;  3HGI A;  4KT0 F;  3M7G A;  5JPM C;  5M5X H;  1PH6 A;  3MFY A;  1K82 A;  3C1F A;  4LFB M;  5EXT A;  3PUY A;  3G6E A;  1Z47 A;  1BBU A;  5I6Y A;  2X49 A;  5LMU M;  1L1O A;  3JAM S;  2DNA A;  1CZW A;  4A3E H;  1BBW A;  1HZA A;  3BYT B;  4PQX A;  4ZCK A;  3DM3 A;  1GOZ A;  1TS3 A;  1EEI D;  4N8X 1;  2UXD L;  1O80 A;  4LRT A;  2MNA A;  3KSX A;  1L1O B;  1Y1V B;  2CV2 A;  2A1A A;  1J8I A;  2GVA A;  1IN4 A;  3UZU A;  2DY7 A;  1JR3 A;  1JE4 A;  1QCB D;  4R4O A;  2HDM A;  2GA4 B;  5LMN Q;  1N36 L;  4LG2 A;  1BXT A;  4R8N A;  1Y1W B;  3D8B A;  4KY5 A;  1KD1 C;  4QNM A;  4DXF A;  5EP2 A;  1PRB A;  3U4Z A;  4B3R L;  1PLF A;  1N34 M;  2NZO A;  2DHR A;  3A5Z B;  5ELO A;  4OL7 A;  4I81 A;  3ERQ A;  4C2M H;  1SNQ A;  1MJE A;  3CHB D;  3M85 A;  2R93 B;  3M4Y A;  1D1I A;  3STB D;  4DK1 A;  3KOZ E;  1TWF H;  2WZJ A;  2Q2I A;  5FO9 B;  1WTQ A;  5BR8 Q;  1HJP A;  4OU7 A;  1HTL D;  5KQD A;  4PD2 A;  3EBE A;  2D5D A;  3I90 A;  3H3V C;  1SSO A;  4K0K L;  4ZYS A;  3SK6 A;  3WHL A;  1Z9F A;  2LXE A;  4RAU C;  3A54 A;  2WKD A;  3I4L A;  2JEA I;  1VQ1 A;  1T3T A;  3GLG E;  3PIP A;  1VDZ A;  4KY6 A;  1NR2 A;  1CM9 A;  2G8L A;  2JZ1 A;  2L6O A;  1QAN A;  3GRR A;  1QAQ A;  3EN2 A;  4UP7 A;  2WP8 J;  1UE1 A;  3U50 C;  4N8F A;  2R44 A;  2E74 C;  4DFA A;  3MHV C;  3T1Y Q;  3J2P B;  2B39 A;  1WD0 A;  3TP5 A;  4IUN A;  4E6I A;  1B7Y B;  3F92 A;  1HQM C;  4R9W A;  5FLX S;  3BDC A;  2VZA A;  3I4O A;  1SR3 A;  3AEV A;  4G6Z A;  1QE6 A;  4WUR A;  4LGY A;  2HCB A;  1EQV A;  3UJN A;  3L7Z C;  4JCV E;  2L12 A;  4AQY Q;  1TDZ A;  4A3F H;  1IM2 A;  3E6Z X;  5C0X G;  1JR0 D;  1QVR A;  1A6X A;  2PMZ B;  3O13 A;  1EOV A;  3SC3 A;  2DHY A;  4KN4 C;  5M3M B;  2CHV A;  1QB5 D;  1K9M C;  3OYY A;  5DAU A;  4X66 L;  4O42 A;  2OCE A;  4PT5 A;  4FXD A;  1F2Z A;  2A68 C;  2K5W A;  3K81 C;  1VQ5 A;  5HY6 A;  1CT1 D;  4C3J G;  1EWI A;  5KIX A;  4V0B A;  2FIN B;  2UXC M;  1DOK A;  1IN6 A;  2KCT A;  4IUP A;  4KHP L;  1SMX A;  3S16 B;  5JVG 3;  2E5L Q;  1WVL A;  2EZV A;  4KJO A;  1ENF A;  3I4M G;  1ILQ A;  1U9R A;  5C3E B;  4LZJ A;  3GLF E;  3TZU A;  1GUN A;  2E2H H;  2R3Z A;  5C4X G;  4LFC Q;  5IRE B;  3GTJ B;  2L5T A;  4UP9 A;  3PO2 G;  4K5V A;  1Z6T A;  3VR3 A;  1U0L A;  5IGD A;  2WIN B;  2NVT B;  2UUA M;  3MTS A;  1SRO A;  3P75 A;  3RMH A;  4YWM A;  2CCZ A;  5LL6 S;  2BJV A;  4DR4 M;  2UXB L;  3TSS A;  1IY1 A;  2N35 A;  3OPO A;  4GNX C;  5FKA C;  3HU2 A;  2RHS B;  3AQQ A;  2R7Z B;  4B3S M;  2H4O A;  4DV1 M;  3NUC A;  4LK1 C;  4X65 M;  2EKF A;  1SYE A;  5GRO A;  1OTC A;  2RSO A;  4DR6 Q;  1XMO M;  5IGE A;  3K7A B;  4CKC A;  3FRH A;  3NBH A;  3HRZ C;  5C4H A;  3FUV A;  2DNC A;  3PSI A;  2ES2 A;  2EQS A;  3DA1 A;  5BPV A;  5JVH 3;  5L8R F;  3BOS A;  1BUV T;  2C9O A;  2Q8R E;  3BZD B;  4IBC A;  4O0A A;  3R93 A;  5FTL A;  4LF4 L;  2XZF A;  4KLK A;  5H1S E;  4WJW A;  2JWS A;  4ZUJ A;  3K7U C;  4DNI A;  2Y0T A;  4QIW B;  4JI2 M;  2EYP A;  3HOW B;  3FTD A;  3FPU B;  3OSO A;  2XF3 A;  4EQ5 A;  2EOT A;  3KJP A;  1N32 L;  1IQP A;  3J80 E;  2VQF L;  5LMN M;  2UUC Q;  4JI6 L;  3TS0 A;  4JV5 L;  2AUJ D;  4EX5 A;  3HEJ A;  4BXX G;  3ERS X;  2NVY B;  4JBM A;  5DYI A;  3I51 A;  2EY2 A;  3R3O A;  2N55 A;  3J7A S;  4BA2 I;  3PVS A;  4RCO A;  3H94 A;  1GD7 A;  3V96 A;  5DM6 3;  2BWE A;  3FEW X;  2KJX A;  3PNV A;  5GAD C;  4B3T Q;  4BWG B;  1A2U A;  4XXE A;  2L11 A;  2M2L A;  4RGT A;  1BR9 A;  1QYR A;  2R46 A;  3SHG B;  1ET6 A;  4A3D B;  4EGV A;  1N9W A;  4OIK A;  4MM3 B;  3SAS A;  5M5Y B;  2Z6K C;  4F1I A;  3IAY A;  4M9Z A;  4C3I H;  1HTP A;  4LJA A;  1D0M A;  4RFB A;  2JA6 H;  3QAU A;  1B3A A;  1EQT A;  4IJE A;  4HED A;  5EP1 A;  2UXD Q;  2DJF C;  2K01 A;  4PMC A;  2B3T A;  1EOT A;  3WOE A;  2JA7 H;  3KW6 A;  2UU9 L;  2HD3 A;  2BH2 A;  3D8L A;  1B9M A;  2YV5 A;  2GN5 A;  4JI4 L;  1N36 Q;  5KND A;  2DGY A;  4FXK C;  4RG1 A;  3WDN A;  1ENA A;  5DNY A;  1KLU D;  3VR2 A;  2KUM A;  3DLL A;  1TWC B;  2KXE A;  4TUW A;  3N6R A;  3NK9 A;  1EIG A;  1W6K A;  2F1M A;  4LMQ D;  3S16 H;  4B3R Q;  2R92 B;  1PH9 A;  4A3K H;  1TGU A;  3ERO A;  1EE8 A;  1PTO H;  3FDT A;  3PMF A;  4KK7 A;  3MJ5 A;  3Q23 A;  5C3E H;  4FCV A;  1GAB A;  3GQ3 A;  3NTH A;  3GTJ H;  1EY4 A;  1PH5 A;  3N52 A;  1FVI A;  2NVT H;  3J81 c;  3HOX H;  2A5Y B;  3I73 A;  5EPL A;  2IW3 A;  4K0K Q;  4DPG A;  3K2L A;  2OOA A;  4L8J A;  3MA2 B;  1IYU A;  3A55 A;  1HR0 L;  5CR3 A;  5GAG C;  1BQQ T;  2O5R A;  2Z7J A;  1VQC A;  1KNE A;  2Z4H A;  1D6E C;  1LT5 D;  2BDO A;  3NHH A;  1HH2 P;  2NTT A;  3M6A A;  4FDB A;  3K7A H;  3H0G G;  4JVZ A;  2VNU D;  1SE2 A;  3J81 S;  1FJG M;  1SNP A;  4BBR G;  1Q82 C;  4B7G A;  3TEH B;  5IOD A;  2EYH A;  4PDI A;  1K28 A;  5IT9 c;  2XSZ D;  5EJC A;  1K8O A;  4NKL A;  3GTL B;  2JA5 B;  3SYL A;  2I7N A;  3I04 M;  5I6W A;  5E1F A;  4IBK A;  1EFW A;  4ODG A;  5IZ7 D;  1DV0 A;  4A3G G;  1X56 A;  2M60 A;  4NW2 A;  2O25 A;  4LFC M;  3E21 A;  4ZLT F;  5CC4 A;  3HS0 C;  2F4I A;  1WOC A;  4DR1 L;  3EA6 A;  1I6V C;  3S1M B;  3UK6 A;  1CQV A;  1HXY D;  3KVW A;  1IXR A;  5C4Z A;  3KFU G;  5IYB G;  3FE3 A;  4QHT A;  2EPB A;  2MUY A;  1KQS A;  2GVB A;  2A69 D;  1WTW A;  2NVY H;  3RUZ A;  3OIQ A;  3E0J A;  4REZ A;  5IT9 S;  1B1Z A;  2RRU A;  2V1C C;  2CW0 D;  1PJS A;  3FYC A;  1RTN A;  1HNX Q;  1V1O A;  2KA7 A;  1WCM G;  4X66 Q;  4LF7 L;  2VW9 A;  1KRS A;  4M9X A;  3RE8 A;  1VEJ A;  1YHB A;  2JJQ A;  1E1T A;  2F0S A;  2XFT A;  3IFD A;  4K2K A;  3UDG A;  2DZL A;  2C96 A;  4UDU C;  1JOO A;  2YFQ A;  2B2U A;  3L9A X;  4OWT B;  4KHP Q;  2QW7 A;  1AH9 A;  2XZU A;  2F0U A;  1ASY A;  1OJL A;  4I65 A;  2RVL A;  3TRE A;  3IFT A;  3D6W A;  1G3I A;  2AMC B;  3I72 A;  1AIP C;  3K8Z A;  2CRU A;  1JCK B;  2JY6 B;  1ICF B;  4AG6 A;  2K9D A;  1Z6H A;  3IKJ A;  1BNZ A;  4DR3 M;  1WD1 A;  3CTW B;  2XNA C;  3R2I A;  2JE6 I;  2UUC M;  3M7N A;  1MD2 D;  2Q8T A;  5FLM G;  4UY8 C;  2ALY B;  3ER0 A;  4Q0F A;  4AKH A;  2RGO A;  4BY7 G;  3W0L B;  2PZU A;  1PYB A;  2SEB D;  4ZKB B;  2AQ1 B;  1NR4 A;  3TP8 A;  3H4J A;  2BE5 C;  4B3T M;  1NSN S;  2YYZ A;  4GN3 B;  1ONL A;  3TME A;  2A6E C;  3EIV A;  1YJN A;  1KRT A;  2CH4 W;  3CCV A;  1OKS A;  1XNQ Q;  3I2Z A;  2Z0S A;  4I7Z C;  1M4V A;  5EQ0 A;  4IBD A;  4P73 A;  4YY3 M;  4ZKC B;  1Q8I A;  4NSR A;  1J5E L;  2KEB A;  1Q3C A;  2KNA A;  1HFG A;  4D82 A;  4H44 C;  3K92 A;  4M1U B;  1XJV A;  1EU3 A;  2PNR C;  3C1E A;  1D2N A;  4LF4 Q;  1TWA H;  3ULL A;  4XQJ A;  3A42 A;  1EUJ A;  4GKJ L;  2UXD M;  1A63 A;  1F9S A;  5K5P A;  2HL7 A;  1PGY A;  4IUU A;  3PV0 A;  1OXX K;  1Z5C A;  5FLX E;  1EZ6 A;  2LXK A;  2K5V A;  1QAM A;  2XRS D;  2L55 A;  4MZ9 A;  1N32 Q;  2PQA B;  3F2D A;  4JN6 A;  1N36 M;  2VQF Q;  4JI6 Q;  4JV5 Q;  2CKZ B;  3KOW E;  3K5M A;  1WTP A;  4EVO A;  3CC4 A;  4CJ6 A;  1F9P A;  3AOE C;  3EJI A;  3FMC A;  3B7N A;  2LY7 A;  2EKK A;  2FJ2 A;  1HUM A;  2FFK B;  1OQY A;  2L7I A;  4B3R M;  1ENC A;  1EYA A;  2A6H D;  1JOQ A;  2RGH A;  5ELE A;  3DXJ C;  3GQ5 A;  2JY7 A;  1S5F D;  1TVX A;  2B29 A;  5CV4 A;  5A2Q S;  4WFN 3;  4APV A;  4A3M B;  3HOY B;  1C4Q A;  3MVV A;  1C1K A;  1VMP A;  3T53 B;  1HNZ L;  2KBN A;  2L7H A;  5FJ8 H;  5GQO A;  5CBA E;  1PFN A;  4OON A;  4K0K M;  1VQO A;  3CW2 C;  4L6V 6;  5C18 A;  3PIO A;  4ZQ3 A;  3E46 A;  5EXP A;  3DEP A;  3K80 C;  5IYC H;  2FH0 A;  3BYY B;  3D3R A;  3BZK A;  4A3I H;  3LMM A;  5FO8 B;  4R4T A;  2UU9 Q;  2ZBK B;  3DWQ A;  3ND9 A;  2RKO A;  2BDN A;  3I4M B;  2N88 A;  1W6J A;  4NPS A;  2CEA A;  2AUK A;  2R61 A;  4DKA C;  4JI4 Q;  2HHH L;  5C4X B;  1AEX A;  2LH0 A;  3PO2 B;  2CHQ A;  3ULJ A;  4EQP A;  4IFD J;  2KA6 B;  4GEW A;  1JJG A;  5JOB A;  3HOU B;  2M9V A;  3MZ5 A;  2CQA A;  5ELB A;  1V33 A;  1Y8O B;  2L0C A;  1W2B A;  3I4V A;  5F2D A;  2Z9H A;  1X37 A;  1BOS A;  3FTC A;  2L15 A;  3IG8 A;  5EXS A;  4JI3 L;  5KEE A;  1X9N A;  1CI3 M;  1II3 A;  4QJF A;  2WSE F;  3L29 A;  5EXX A;  7CAT A;  2K04 A;  2F4V L;  2ZAM A;  3U6P A;  2R4J A;  2K0B X;  2JA9 A;  3S14 H;  1WGN A;  1NMG A;  4LF6 L;  3AU7 A;  4HL4 A;  4KV6 A;  3V2T A;  5M3F H;  1VQK A;  1XMQ Q;  4IJL A;  4M0W A;  4JOI A;  5EPJ A;  1Y14 B;  1W5S A;  2Y20 A;  2ZTD A;  1I4Q A;  1KLG D;  2OQK A;  3SHL A;  3DUZ A;  2K5N A;  4IN3 A;  1Z5A A;  4JG2 A;  3C3L A;  3VR6 A;  5BR8 L;  2PYK A;  1WTV A;  4X66 M;  1RL2 A;  1IN7 A;  4RHS A;  2CE7 A;  3WOF A;  1UE7 A;  4ITQ A;  3CCM A;  1VQB A;  3KXE C;  2F0D A;  5IWA L;  1X6O A;  4P72 A;  5L37 A;  2JY8 A;  4RMF A;  1H95 A;  4MNO A;  1E32 A;  3ZC7 B;  4KHP M;  1I4H A;  3PO3 G;  1U4L A;  3SYK A;  1LTR D;  1U4P A;  1YNN D;  2F0H A;  4A3B H;  3J80 c;  3SAR A;  3OHX C;  3QG1 A;  1NY4 A;  3C58 A;  4GH9 A;  4BY1 G;  2L09 A;  1FGB D;  1I4X A;  1GL7 A;  4IQZ A;  4YCV A;  4DR1 Q;  4UAI A;  5C1B A;  3A7L A;  3D6C A;  1TKW B;  3K5O A;  4NSO B;  2AKW B;  1HNW M;  3NP8 A;  1K0S A;  4RA8 A;  1QZE A;  1QG7 A;  4GIT A;  3QOL A;  4KI0 A;  2R18 A;  2UXB M;  3LW5 F;  1BVS A;  4DK3 C;  4CJ1 B;  1STE A;  4I5S A;  5G3L D;  2D0P A;  2B2T C;  2LVA A;  2Z8Y M;  1X3Q A;  1VQE A;  2R4E A;  3J80 S;  1R5L A;  4A3J H;  1L1T A;  3TPZ A;  2MPM A;  2QZ4 A;  4LF7 Q;  2DXI A;  1YNJ C;  1YBY A;  4KD3 A;  4JBK A;  4GIP A;  5EGT A;  1NTG A;  4AQY L;  4Y7N B;  4CHT B;  1RTO A;  1SN8 A;  5HUR A;  1B50 A;  3K9O A;  4A3M H;  3HOY H;  3KBX A;  4DAV A;  4ME5 A;  1IN8 A;  1U4R A;  2OOB A;  4GN4 B;  5AJ3 L;  2C98 A;  4S12 A;  4X3T A;  3AMU A;  4OXP A;  4YWK A;  1B53 A;  1YUB A;  1IZ6 A;  4LF4 M;  2ID0 A;  4KKS A;  1VQH A;  3G4S A;  4WJ4 A;  2A68 D;  3VK7 A;  2NVQ B;  1X3G A;  1HUN A;  1EU4 A;  1O7Y A;  1RCV D;  1DXM A;  1Q7Y C;  1V9P A;  4QMG A;  4A93 G;  2QDB A;  5IP9 G;  1N32 M;  2ZJQ A;  4JV5 M;  2VQF M;  2J7N A;  4JI6 M;  2JEB I;  5I4D A;  1W5T A;  3J7B A;  3MEF A;  4OGQ C;  4DK0 A;  4DV0 L;  4KJN A;  3PO2 H;  4G3O A;  1L2C A;  1FNU A;  1SAP A;  1STY A;  2F3W A;  2RA4 A;  5D3D A;  4PDG A;  3HOU H;  2G5D A;  3CF6 E;  1FL0 A;  4RKB A;  5JPN C;  3W68 A;  4X62 M;  1VQJ A;  3QIA A;  5C4J B;  1BDO A;  3G6J B;  2XLJ A;  2K5H A;  4OEL B;  1RDP D;  2IWH A;  3VYT A;  2PW7 A;  2RSN A;  1YIJ A;  1M1K C;  3RGS A;  1GL6 A;  2X4A A;  1J6Q A;  4IUV A;  1J5E Q;  5J3B A;  2ATW A;  1NHG C;  3RLN A;  3UE0 A;  3S2D B;  2B2Y C;  3KYH C;  3PGZ A;  1WTR A;  3K58 A;  4LF9 L;  1LTT D;  1BKB A;  3HFZ B;  4GS3 A;  5ELD A;  5IOC A;  2FMM A;  1SYB A;  4BBR B;  1TH3 A;  4GKJ Q;  4EIW A;  3CRL C;  5I9O A;  2KNZ A;  5DNF A;  4AKG A;  3BBZ A;  2UU9 M;  1LYL A;  5KGU A;  4LF8 L;  3QYB A;  1P8L A;  2F0E A;  1KIX A;  4IO9 A;  4AW4 A;  1EFI D;  2AHM A;  2F0F A;  2R62 A;  1E9R A;  3SAU A;  4OO1 G;  3M4P A;  2J7O A;  1B3Q A;  1O7L A;  4BBA A;  2ICE C;  1XYI A;  3GQ4 A;  3ZJY C;  4DXG A;  5ITU A;  4AYB E;  1QDR A;  1GUO A;  2SDF A;  1WCM B;  2PI2 E;  3I4N H;  3IL8 A;  1LV7 A;  3U6Q A;  4DV6 L;  3A0J A;  1HNZ Q;  1E2W A;  2E75 C;  3ND8 A;  3GTO B;  3NE5 B;  1GJX A;  4IOA A;  1DD2 A;  3F1Z A;  1V34 A;  2KDL A;  3HOV H;  2AQ3 B;  2WAC A;  2N78 A;  2DAK A;  4GOP C;  1ASZ A;  2OTL A;  4F2L A;  3PUZ A;  4P71 A;  1YI2 A;  1HR0 M;  2ZJR A;  3S1N B;  4NRW A;  3PUX A;  4YIJ A;  3NSW A;  1T6O A;  1AW7 A;  2QHO B;  3MXN B;  2HHH Q;  2JK8 A;  1VQ8 A;  4FF4 A;  3S15 B;  4GKK L;  1P3Q Q;  5KQ8 A;  2H1E A;  1UWV A;  4A3C G;  1E7Z A;  1DYQ A;  4G7Z C;  1SBB B;  4AYB G;  3J7A V;  4BLC A;  1IBM L;  1EIJ A;  4JI3 Q;  3PCO B;  4R4I A;  2RQX A;  4LF5 L;  1IW7 C;  4KMU C;  1LUZ A;  4BY7 B;  4DV4 L;  3TP6 A;  2F4V Q;  3RZO H;  1ESR A;  1EWH A;  4P17 A;  1IHZ A;  3UDF A;  2K32 A;  3G71 A;  3S17 B;  2QCU A;  1PFM A;  4LF6 Q;  4DR1 M;  4N9T A;  4JI0 L;  4ABN A;  5T1I A;  4IZ8 A;  1YSY A;  3JAM L;  3NEN A;  3OW7 A;  4GC9 A;  2DKL A;  3U6L A;  5C0X J;  4X64 L;  1QWY A;  1R2Y A;  3HHY A;  3HY5 A;  1PJI A;  1NV8 A;  4KD4 A;  4F7X A;  2I7P A;  1MGS A;  1I50 H;  1OXU A;  2EYF A;  4X6A H;  1ZYR C;  3B89 A;  4GNX A;  1PJJ A;  1BO0 A;  3KOJ A;  1AP0 A;  5C4J H;  5JI3 E;  5HGQ A;  1R2Z A;  2QGQ A;  5T1G A;  2RDF A;  4DF7 A;  3CCR A;  5IWA Q;  2EIF A;  3GTP B;  5E26 A;  3EVQ A;  4K6L A;  1MKH A;  1IKL A;  1VQD A;  2JP7 A;  4WRD A;  4GNX B;  2NN6 H;  3T4A C;  5FLX c;  3OWE B;  3S2D H;  3L27 A;  1LTL A;  4IOC A;  5I9P A;  4JI8 L;  3E4R A;  2VUM B;  2OT2 A;  2X6G A;  5CV8 A;  2PNH A;  1SXJ C;  5A2Q E;  4G57 A;  1FNN A;  1DOL A;  3CRK C;  3OTO L;  2MR9 A;  2WAQ E;  1QZH A;  3CPF A;  1AZP A;  1JWM D;  4J1M A;  2A74 C;  3H3V H;  1KNA A;  2HWJ A;  3CMA A;  1F9R A;  1NNJ A;  1K8G A;  5IYB H;  3CXC A;  1BCP C;  1U5K A;  1JT8 A;  3C9P A;  1H9K A;  4DUY Q;  1I5F A;  1LM0 A;  4NRV A;  2E2J B;  1S3S A;  3FKI G;  2GNO A;  5M5W B;  4NXM L;  3MK6 A;  1G8P A;  3CCQ A;  3CD6 A;  3KBG A;  1N78 A;  3B7Z A;  3OIP A;  1UAP A;  4CKB A;  5KO3 A;  2XSC A;  4IUR A;  1LO5 D;  1HNX L;  1XXH A;  3U4V A;  5AJ3 Q;  1J5E M;  2KVM A;  2B63 G;  1OAO C;  3GTK H;  2LVO C;  3SMP A;  3GTO H;  2JA8 H;  2WAQ G;  1A62 A;  1EIF A;  2V1U A;  3VR4 A;  4GKJ M;  2VY3 A;  4OVZ A;  3VDU A;  5C5L A;  4UP8 A;  1XXH B;  5FLX L;  4JYA Q;  4HMJ A;  3BVG A;  2R65 A;  1GHJ A;  1DO0 A;  1ZMV A;  1TDH A;  3V76 A;  2NUC A;  4WOR A;  3UE1 A;  2HIX A;  1VEG A;  3U6C A;  3GLI A;  1L1O C;  4XT3 B;  4DV0 Q;  4NOO B;  1GM5 A;  3S1Q B;  3J7Z C;  1OAI A;  4OVZ B;  4GHL A;  1SMY C;  3HOZ G;  1Y1V H;  2EXZ A;  4A4I A;  1CFM A;  4L5S A;  3D4W A;  5ITX A;  1VQL A;  3W2D A;  3M4O B;  3GLI B;  5CV9 A;  4BY7 H;  2RCF A;  2IX0 A;  1G6Z A;  3AFQ A;  1F2M A;  4JI5 M;  1Y1W H;  2KCC A;  1B2T A;  4JI7 L;  1I4R A;  3U5Z A;  3SAT A;  1AE2 A;  1OFI A;  2DY8 A;  2D7H A;  4C3H G;  1HNZ M;  3DFZ A;  4JBW A;  2BE5 D;  4HR7 B;  1TF0 B;  2A19 A;  4LF9 Q;  2VQE Q;  4LJ9 A;  1XNQ L;  2A6E D;  4CGY B;  1EWC A;  4KHZ A;  4PCZ A;  5KPT A;  3U5Z B;  4UHV A;  2ZM6 L;  2R93 H;  4GHA A;  1SEB D;  1LT4 D;  3KUP A;  3OMC A;  1S3O A;  3HJS A;  3U61 A;  3A46 A;  1B44 D;  4LF8 Q;  2F0O A;  4P16 A;  5ELF A;  2K6B A;  4LY6 A;  3AKZ A;  4HAE A;  4FWG A;  2ZJP A;  5K36 G;  4W5W A;  5EKK A;  1XPU A;  1KFV A;  2APL A;  3U61 B;  1I3Q B;  2Y0S E;  1F9Q A;  4JI3 M;  1QOH A;  3R8F A;  1ZEQ X;  3DOA A;  4A3L H;  1MU5 A;  2KHH A;  2DAM A;  4IPH A;  4L78 A;  4DBG B;  3WWV A;  3QYE A;  3FKE A;  5IGG A;  3MAQ A;  2VUM H;  1KAA A;  2G9D A;  3LNN A;  1DGG A;  2CWA A;  2XWJ B;  2D2C C;  5AFW A;  4HJ5 A;  4LF6 M;  1VQ7 A;  4DV6 Q;  3M0E A;  4GRI A;  1MBY A;  2RF4 A;  1V43 A;  3D8G A;  3CF0 A;  5JJL A;  4DNR B;  5CMD A;  5KNB A;  2CUZ A;  3B6Y A;  1VF7 A;  5BR8 M;  5C44 G;  1XC8 A;  3CCL A;  4LUZ A;  1XNR L;  2IY5 B;  1ILP A;  2Y0S G;  1O78 A;  5NUC A;  1OXS C;  4GKK Q;  1SYD A;  3GLH E;  1S5C D;  3RZD B;  1MIU A;  4JW0 A;  2JYO A;  3MXP A;  4R4C A;  4A93 B;  3HHW A;  5M3M H;  4B9X A;  2K33 A;  1MJG M;  1IKM A;  4HJA A;  1CKO A;  4XQN A;  1CZG A;  2OQ0 A;  3RN5 A;  1IBM Q;  3K0Y A;  4X3U A;  4LF5 Q;  4MTK A;  2P5T A;  4DV4 Q;  1HR0 W;  4IFD I;  1EIY B;  1X3E A;  2HQL A;  1R4G A;  3KF6 B;  1HQY E;  2E76 C;  1PHJ A;  4FWH A;  1PTO C;  4JI0 Q;  1NUC A;  1PRT C;  1EY8 A;  3SAV A;  4RF1 A;  3T1Y M;  4A3E G;  3KLS X;  1WYD A;  4L5R C;  3JR5 A;  5GAE C;  3W0F A;  2KHS A;  1LV9 A;  2YU9 B;  2K03 A;  1A3T A;  2QIL A;  2SNS A;  4X64 Q;  3K5L A;  3ZQJ A;  1KSF X;  2KEC A;  8CAT A;  3S1Q H;  4LRS A;  3T56 B;  4IBG A;  2NBF A;  3E0E A;  2L1B A;  1PYW D;  4FWD A;  3TDQ A;  1A3V A;  2QKI C;  3ZH9 B;  1XMQ L;  2O4X A;  2XWB B;  1JB3 A;  3HKZ E;  4XTC S;  1G8Z D;  4ULL A;  4AQY M;  5IYD H;  3F2U A;  1YHQ A;  1STN A;  3W3A A;  2XRQ D;  1H6U A;  1QJO A;  1I4G A;  4TSS A;  2L2D A;  1EZ8 A;  2R7Z H;  3HX3 A;  3VFD A;  4GN5 A;  1G4A E;  4Z6Y A;  1GO5 A;  2DAE A;  5FSW A;  4NL4 H;  4RWS C;  4DV2 L;  2R6F A;  4JI8 Q;  2LHG A;  2AHO B;  3DM1 A;  1N75 A;  3FP9 A;  3DWP A;  1H9S B;  2J4X A;  3TQS A;  1SXJ E;  3OTO Q;  2E5L M;  3Q0A A;  1XB2 B;  4BBS G;  1LTM A;  1Q1B A;  1VQ4 A;  5I2Y A;  4IFD H;  2J5Y A;  3FTE A;  3C2P A;  4IUQ A;  5ITR A;  3HKZ G;  3T6P A;  1IBK L;  3U6S A;  5LMU L;  5EQT A;  3HOW H;  1EYG A;  4JK1 C;  4R3D A;  4G4R A;  1I3Q H;  1VS0 A;  1YVC A;  1PH4 A;  4HSV A;  5C3W A;  2WB1 E;  1R9T B;  3PF4 A;  2G5G X;  4MGI E;  4F8M A;  1S5D D;  2ZTC A;  5EP3 A;  4WP2 A;  4NXM Q;  4RH6 A;  3CCE A;  2R0I A;  2R6G A;  3NXW A;  1E9S A;  1X3P A;  4IJH A;  3NQT A;  4AH6 A;  5HGT A;  3J81 L;  3JC6 6;  4PV1 C;  1VQM A;  3Q8G A;  1E2Z A;  1LTS D;  5E3F A;  1QVF A;  1NVM A;  1YZ6 A;  2EYL A;  4Q5V A;  3D4D A;  4DR6 M;  4LF9 M;  2AWN A;  4A3D H;  1TWG B;  2QEN A;  5JEA H;  1YNJ D;  3E9H A;  1X32 A;  1NY6 A;  3KDS E;  5M5Y H;  2EYJ A;  2VB3 X;  2EJS A;  3MFG A;  1Q3L A;  3FUT A;  2R7D A;  1YEZ A;  3BG3 A;  4EQO A;  4LF8 M;  4NXN L;  5C6A A;  4K6D A;  4JI1 L;  5G3L F;  2C35 B;  3RZD H;  4HID A;  1TH4 A;  1MSH A;  3AFH A;  3QR8 A;  5IT9 L;  2QP9 X;  4M9S A;  2G3Q A;  3U6D A;  2K5D A;  5IE8 A;  1G91 A;  3IEC A;  3S2H B;  3GPU A;  1A3U A;  1F4I A;  4M0D A;  5D3I B;  3HJ8 A;  1G41 A;  1JR3 E;  1E22 A;  1QNU A;  1TWC H;  3R2T A;  4JI7 Q;  4DV6 M;  2QDL A;  3IHP A;  1EQQ A;  2KEE A;  2ZAN A;  1GVP A;  3SXH A;  3CCS A;  2R92 H;  1IBL L;  3L25 A;  1M8A A;  1SE8 A;  3RFW A;  4KY7 A;  3FD9 A;  5FTJ A;  3TWL A;  1LT6 D;  4I7A A;  2FE8 A;  3W67 A;  1DGB A;  2QCP X;  2ZM6 Q;  1HQC A;  1T5E A;  1V8Q A;  2Y0Q A;  1E1O A;  1L2D A;  3DHQ A;  2N3S A;  4HJ8 A;  4Y28 F;  4EQN A;  4I8O A;  2X8A A;  1FD7 D;  4GKK M;  2PQA A;  1UEA B;  5IGC A;  4NP5 A;  2TMP A;  2B2V A;  2MH8 A;  2CH4 A;  1NJF A;  1HRJ A;  5KYI A;  5LL6 X;  2VDB B;  5JI2 E;  2OF1 A;  2XSZ A;  3GLG A;  4LF5 M;  5EP4 A;  1ZMU A;  2ICI A;  1EY9 A;  4HN7 A;  3R8B A;  4OX9 L;  1Q39 A;  3EIE A;  2EA0 A;  1K3X A;  4OO1 H;  5E7N A;  4U68 A;  4X3K A;  1OO9 B;  4R8I A;  4MGK E;  4JI0 M;  4IPC A;  3PIP 3;  3BDO A;  1BBX C;  3GLG B;  1JIC A;  3FKI B;  2F5P A;  1P16 A;  3GTL H;  1QVG A;  2JA5 H;  2JY5 A;  4X64 M;  3PUW A;  1CQF A;  2B8G A;  3L28 A;  1Q1E A;  2B63 B;  2DWL A;  5LMN W;  1AFP A;  2L4E A;  2QNJ A;  2BH8 A;  3S1M H;  4CJ0 B;  1XNR Q;  2CQO A;  5J39 A;  4K2L A;  1UNS A;  5A35 A;  4L16 A;  1F2L A;  4C3J B;  1R9T H;  3SAW A;  1V92 A;  3VK8 A;  1FYC A;  4KN7 C;  1IXR C;  1X3F A;  4X3S A;  1K83 B;  1KAB A;  3TWM A;  2F0P A;  3KJO A;  3HKP A;  4KLN A;  2RBM A;  2DN8 A;  5DM7 3;  1RJT A;  2JQO A;  3HOZ B;  2B2W A;  2F0Q A;  4A75 A;  4JI8 M;  2L4F A;  1PZJ D;  1ESF A;  1AZQ A;  2CHG A;  4B3S L;  5E4X A;  3BXW A;  2CFM A;  1VQP A;  1TWH B;  1VCI A;  2Z3X A;  4C3I G;  4QGU A;  1IY0 A;  3A74 A;  3GTM B;  1XMO L;  1SNC A;  2PW5 A;  4PNY A;  1TQO A;  3A5U A;  2JA6 G;  4KKU A;  1IW7 D;  4C3H B;  1SE4 A;  3GLF A;  2YQZ A;  5D65 A;  3L2P A;  3VDP A;  1E94 E;  2G9H D;  2JA7 G;  1PDQ A;  5C0X I;  2TSS A;  1IFY A;  2JNH A;  5EKL A;  3S2H H;  3CGW A;  4NXM M;  2Z1C A;  4V19 0;  3NTK A;  3GLF B;  5JEA J;  1MJC A;  1HNX M;  3I4Y A;  3UMM A;  3I55 A;  2UUB Q;  2HDL A;  2BCO A;  1B70 B;  1OXT A;  3L0O A;  1Y8N B;  4A3K G;  1ET9 A;  3KLW A;  1ZYR D;  1R4P B;  2MRO B;  1B9N A;  4DV2 Q;  1QDT A;  2K52 A;  5C3E G;  4LUV A;  1WGL A;  4DA2 A;  3ONA B;  1YIT A;  2NQ8 C;  3Q8X A;  2LVQ D;  5TSS A;  3CKI B;  3HOX G;  4B3M L;  4PG3 A;  4L15 A;  1NHW C;  3GPP A;  3KS8 A;  3A7A B;  3LX0 A;  3S1R B;  2BOS A;  3TZD A;  5CBE E;  4QIW E;  1DM0 B;  3ZYY X;  1YJ9 A;  1IBK Q;  5LMU Q;  2JP1 A;  3QWL A;  4K5W A;  1CKN B;  4IJF A;  3GD7 A;  3OMG A;  2QA4 A;  1SXJ D;  1NNU C;  2Z6B A;  3KS4 A;  2K05 A;  1XTD A;  1Q3B A;  2J7Z A;  1JC7 A;  1EY5 A;  1JOK A;  5C44 B;  3QJY A;  4JI7 M;  1KDB A;  1OIP A;  3LQR A;  2FMC A;  4OWX B;  4RCN A;  4H7B A;  3VYS A;  2A73 B;  4IAL A;  1T9H A;  3MWY W;  4DUY L;  1IL8 A;  4DV3 L;  5C0X H;  1BCP D;  2PCF B;  1SFO B;  4QCL A;  3LQQ A;  1XNQ M;  1U4M A;  4DAP A;  1KL9 A;  2A69 C;  1K8M A;  1Y69 U;  3J7A F;  1QZM A;  2VB2 X;  1HT2 E;  2MGS A;  2F0I A;  4C3J H;  1WHC A;  1C7Y A;  4D81 A;  1XWI A;  1SRU A;  3TN2 A;  4JI1 Q;  3CME A;  4NXN Q;  1HA6 A;  1OFH A;  3GV6 A;  2CHB D;  2LS0 1;  2YTX A;  4POF A;  3BDL A;  5F3W A;  4CDC C;  1K83 H;  4A3E B;  1Q8K A;  4LW1 A;  2O01 F;  3TWK A;  1YHA A;  4FF2 A;  4JYA L;  3GRY A;  2D0O A;  4P2C B;  3CPW A;  2F0N A;  3J80 L;  3I4M H;  4FO2 A;  1I94 L;  1AE3 A;  5C4X H;  3GLH B;  4PMW A;  1IYV A;  2KHJ A;  1NAP A;  4K14 A;  1E3P A;  4TVA B;  4ZAI A;  4GLA C;  3T16 A;  1T5X D;  1X65 A;  2HCI A;  1GKI A;  2KOL A;  4HCE A;  4M8A A;  4RKL A;  1TWH H;  1SMY D;  3L3O C;  1IBL Q;  2CP8 A;  2KCM A;  1GLN A;  3NWS A;  4KOD A;  3BVM A;  4FCT A;  1NNX A;  4XT1 B;  3HKS A;  4DV7 L;  3C3E A;  2LWX A;  1A15 A;  4C3H H;  4H02 A;  3H09 A;  1JR3 D;  5JJZ A;  4J6H A;  4K5X A;  3SHF A;  1XNR M;  5IGB A;  1CSQ A;  3WHK A;  3ICE A;  2AQ2 B;  2RKS A;  4DK6 C;  2KZS A;  2F5Q A;  3H0G B;  1TY0 A;  1EY6 A;  2VQE L;  2A5H A;  3A8J E;  3CF2 A;  2RCN A;  3VA7 A;  1UUP A;  5IP7 G;  4JOI C;  5ITY A;  1SND A;  3URY A;  1Q90 A;  3GTG B;  1A8V A;  3FPP A;  2XEP A;  4OW0 A;  4KTA A;  2C5R A;  3CC2 A;  3KFU A;  4BBS B;  3SK8 A;  1F2Y A;  2CV1 A;  4JI4 M;  4A3G B;  1QUS A;  4MH0 E;  4GLV B;  2CWP A;  2WFW A;  2X6L A;  4HMI A;  4OX9 Q;  1H9J A;  1QVC A;  1VEK A;  4MGH A;  1V1P A;  3SEB A;  5IGF A;  2QF7 A;  4FD2 A;  1NBW A;  3U58 A;  1I4W A;  4C1N K;  4BXX H;  3I7F A;  4QY7 A;  4F87 A;  1VQA A;  2JXM B;  2XTI A;  1PH7 A;  1NSF A;  2FHT A;  1V1P B;  1TR8 A;  2HKJ A;  3J27 B;  1LAB A;  2I5M X;  4WJ3 M;  3KLS A;  1SXJ B;  1XMQ M;  2DEN A;  1KXL A;  5FTM A;  4AZF A;  5ITT A;  1GVN A;  2A6H C;  3NWL A;  3MXN A;  1EFU B;  2FNA A;  1UEB A;  1C9O A;  1C8C A;  1OTR A;  2CWB A;  1A2T A;  1XX8 A;  5IY0 A;  2Z8L A;  1DO2 A;  4R4Q A;  2DWZ B;  3FUW A;  1SE3 A;  2NN6 I;  4IUT A;  1BCP B;  4F88 A;  1TT2 A;  4XYO A;  4LJ8 A;  1GKH A;  2Q2T A;  1SFO H;  2VF7 A;  4DR4 Q;  4DV2 M;  3HG9 A;  2E2I B;  2WSC F;  4Y7N H;  2Z4R A;  4ILW A;  3SR1 A;  3SDZ A;  4CDE C;  2QBY A;  4B3S Q;  1RHP A;  1HT1 E;  1GUG A;  2V6Z M;  2I5H A;  4LWC A;  3LVV A;  4X65 Q;  4RGM A;  2NVX B;  1XMO Q;  3JAM i;  5JAV A;  5FJ8 G;  1CUK A;  1STA A;  1KC8 C;  1L2F A;  1HZC A;  1QUQ B;  2VL6 A;  1ZXT A;  3H3V I;  1NV9 A;  4YY3 L;  1IBK M;  4MB7 A;  2QBY B;  1KYI A;  5IYC G;  4R71 A;  4PMB A;  4FCW A;  1I6H B;  1K3B C;  2ZAO A;  2NB0 A;  3NTI A;  1T43 A;  2NVQ H;  4A3I G;  1TU2 B;  3K57 A;  3TL4 X;  1EQR A;  1FNW A;  2CVR A;  1PTO D;  5FTK A;  4ZPX A;  1PRT D;  2F5O A;  1OXV A;  3J7A 5;  2C5C A;  2E2H B;  1JWS D;  4JI2 Q;  1UE5 A;  3CP0 A;  3GPY A;  3NBI A;  2Q2U A;  4G4K A;  3G7L A;  1R6B X;  2HT1 A;  3GTQ B;  5FOB B;  4LF7 M;  3GDE A;  4LJ4 A;  3SK5 A;  1TS4 A;  2F5S A;  4LJZ C;  2LKV A;  3FTF A;  4DR7 L;  4FF3 A;  3AFP A;  4KKT A;  5M3F G;  2AWO A;  3E9I A;  4NB3 A;  4ZRZ A;  3CQZ B;  4B3M Q;  4ANR A;  2LNH C;  4NXN M;  3H0G H;  3S24 A;  4QQB X;  4JI1 M;  2R45 A;  4FVM A;  1UE6 A;  1XXG A;  4BBR H;  1D2B A;  4RF0 A;  5H37 D;  1KDC A;  3GTG H;  2VII A;  5DEH A;  2IJ0 A;  4UPA A;  2O5I C;  4JC0 A;  3DWA A;  4BBS H;  2F0J A;  3NBX X;  1IN5 A;  3UGJ A;  1X55 A;  2XH9 A;  1AUA A;  4HTH A;  4OWW B;  4A3G H;  1DZ1 A;  1NCV A;  3OOC A;  4L6T B;  4LZZ A;  3I3C A;  3VKH A;  2MJ8 A;  1YNN C;  2MQH A;  3AL0 C;  4MHE A;  4II7 A;  4CJ2 C;  3G48 A;  1G6P A;  4U67 3;  3U9O A;  1IBL M;  2EYO A;  4A3B G;  4DV3 Q;  3M9B A;  4NMZ A;  2Z4I A;  3SE0 A;  2GQF A;  3SMS A;  1L0X B;  3U6M A;  4FNF A;  1IL2 A;  1BF4 A;  1PH8 A;  4YHH L;  1HA5 A;  1SYG A;  1WCM H;  1DGF A;  1TS2 A;  1WJJ A;  4QOZ C;  2F0W A;  4YCW A;  3M4Q A;  1EIH A;  2Z6K A;  3TS2 A;  1YNX A;  3A8I E;  1QAO A;  2ENB A;  5ELN A;  3P1H A;  3NEL A;  3CCU A;  2I5L X;  4C3I B;  1VDL A;  3D4R A;  3K9P A;  1ROD A;  4IIW A;  3PQI A;  4NDX A;  3S1N H;  4A3J G;  4DAM A;  3GRU A;  1S5E D;  4CIZ A;  4PZ7 A;  2JA6 B;  1S5B D;  1I94 Q;  2M00 A;  3PIO 3;  3S15 H;  1DGH A;  2K47 A;  4OX9 M;  5J1Z A;  2IL8 A;  2E2I H;  1R7R A;  2YTV A;  3MC0 B;  2JA7 B;  4A3M G;  3HOY G;  5BN3 A;  1ZQ9 A;  1PYS B;  2WV6 D;  3HP3 A;  3A8K E;  2QQ8 A;  4TQU S;  1ML0 D;  2EE1 A;  4GMQ A;  1MI2 A;  2F0L A;  5FLM H;  1CA6 A;  2NVX H;  4DNT B;  1DGH B;  5CV6 A;  4CIS A;  2EJM A;  3X3M A;  1PH2 A;  4DV7 Q;  1SYF A;  1FJG Q;  4DV5 L;  2HQE A;  1I6H H;  3S17 H;  3PNY A;  2X69 A;  1L8Q A;  2R7F A;  1F77 A;  3NWT A;  1YE9 A;  3E3X A;  4A3K B;  2FXQ A;  1PTO B;  1PRT B;  4N9P A;  2O2L D;  1G59 A;  2KRU A;  1FGU A;  1PFS A;  3GQB A;  2A8V A;  3KP1 E;  5FK9 C;  3SK4 A;  3VYR A;  3T13 A;  2PZW A;  3RLO A;  1EYD A;  3PO3 B;  3U9S A;  3SGI A;  1S72 A;  2ZT9 C;  3HOU G;  4A3V B;  3HOX B;  1HNW L;  3GTQ H;  3HZJ A;  1G29 1;  2XFS A;  4IPG A;  1GJT A;  2P5Z X;  3SBJ A;  1I4P A;  3FVQ A;  3IG5 A;  2HHH M;  5C5M A;  3RR5 A;  4BY1 B;  1N33 L;  1DCZ A;  3TBI B;  3PF5 A;  3GTP H;  4A76 A;  1TII D;  4LFA L;  2SOB A;  4HIK A;  2DUD A;  3I01 M;  2LSS A;  2N49 A;  3Q22 A;  4OEM B;  2Z4S A;  3CQZ H;  1D7Q A;  3KF8 A;  2DAI A;  3W1G A;  3T51 B;  2F4V M;  3T1H L;  3HHZ A;  2E2D C;  1JJ2 A;  3RLF A;  2LVP C;  2KED A;  4HCS A;  4DR5 L;  2K28 A;  1HPC A;  3IRB A;  2LTU A;  1R4Q B;  5KNC A;  2DI0 A;  2CV0 A;  3GRV A;  3T15 A;  1WTO A;  1ICW A;  4P75 A;  1Q86 C;  3KF8 B;  3MEH A;  4IBE A;  2EO2 A;  5CYU A;  3CAM A;  3NBH B;  4P74 A;  1JWU D;  3AOG A;  4R7G A;  3GPX A;  1KTK A;  3HU1 A;  3VDY A;  4DR3 Q;  3HWS A;  3W1B A;  3GO8 A;  2KNV A;  2V1C A;  1CHP D;  4HIM A;  3VA5 A;  3QOJ A;  2YNM D;  2EY6 A;  3B9P A;  4NC6 A;  1FR3 A;  4H0L C;  5COY A;  2OQ4 A;  2E2J H;  1N8R C;  5M5W H;  3UDI A;  1ORY B;  5IWA M;  1XWE A;  2K75 A;  2YR0 A;  3KF6 A;  2J0T D;  5D14 A;  4CKE A;  3I4N G;  3PFI A;  4X62 L;  2NZ1 D;  2KZU A;  1S4Z A;  2H5X A;  2LMC B;  2F0G A;  2VXW A;  1G2T A;  4O2D A;  4B3M M;  1KDA A;  1W3S A;  2V4D A;  1LLR D;  2DAG A;  1KHI A;  1PZI D;  3FRP B;  5COR A;  1LTB D;  3HOV G;  4R1J A;  4YY3 Q;  2OXP A;  4LCB A;  2MJ5 B;  1RF2 D;  4YWL A;  2FS1 A;  2DNE A;  4Q7J A;  4FXG C;  4DR2 L;  3JR4 A;  4LGM A;  4K8I A;  2K14 A;  4FW9 A;  1ZMW A;  3AV0 A;  1SJH D;  4LJ5 A;  1TS5 A;  2I07 B;  2KQ3 A;  3SVM A;  3EQL C;  3E5S A;  4QB4 A;  1PZK D;  4B9W A;  3NEM A;  3VKG A;  3ITP A;  2BJW A;  1SJE D;  2YTY A;  4DAY A;  4L63 B;  2DWN A;  2IX3 A;  3RD4 A;  4HIO A;  3AJI B;  1DGS A;  4DUY M;  3M4O H;  4DV3 M;  4DUZ L;  5BN4 A;  1PVO A;  5E4W C;  4DR7 Q;  4JPB W;  4DAY B;  1VQF A;  4I4L A;  3KDF A;  4ME3 A;  1WIV A;  4D80 A;  4J15 A;  4PZ8 A;  2VS1 A;  1H9S A;  2UUB L;  1GXD C;  3STB C;  2E8G A;  2FFJ A;  1KAW A;  1O7I A;  2K6A A;  5GKN A;  4POG A;  1HQR D;  2M5Z A;  4KHV A;  3K5N A;  2F0M A;  1NE3 A;  1J9O A;  3KDF B;  4QUC A;  4YCU A;  3PO3 H;  2IHE A;  4B08 A;  3T38 A;  2K7V A;  2MHV A;  2XN9 C;  2MO0 A;  3GO5 A;  1HHV A;  4JYA M;  5DYG A;  2NTS A;  2RDH A;  3K59 A;  1EY0 A;  1TWA B;  4QNR A;  1I94 M;  4MGY E;  3KOY E;  2JSO A;  3X3N A;  4BY1 H;  4G4Q A;  4DV0 M;  4H13 C;  4LFB L;  3BVZ A;  4BB9 A;  3H15 A;  3QB3 A;  4QHS A;  3K8A A;  2D7E A;  3L26 A;  1QQW A;  1X54 A;  3AOE A;  3TRZ A;  3FRI A;  2LXJ A;  1M90 C;  2LFN A;  3H91 A;  3J81 i;  3B74 A;  2NN6 G;  4OHJ A;  1EYC A;  3H6M A;  4TRD A;  5ITQ A;  3LWE A;  2O5J C;  2F0K A;  4DV7 M;  5ISR A;  4QL5 A;  4CBV A;  1D5M C;  5KPZ A;  2BWB A;  4YHH Q;  3U60 A;  2QEJ C;  1VQ6 A;  3SFZ A;  1MN3 A;  1E0B A;  5EKI A;  2PI2 A;  2EXD A;  4CDF C;  1Y8G A;  1VDD A;  1JB0 F;  4RGN A;  3HU3 A;  3K6O A;  4XQQ A;  3CU7 A;  3F2B A;  2VQE M;  1K73 C;  5CV5 A;  2OTJ A;  1VQI A;  4AYB B;  3U60 B;  5GAH C;  4LUO A;  2W82 A;  1N34 L;  5EBD A;  3AYH B;  1RU3 A;  2EYM A;  3AB9 A;  5I2X A;  3JAM E;  3MMP A;  2MGW A;  1YLA A;  1HZB A;  5EAY A;  2DVW B;  2WB1 G;  4A3F G;  3EIH A;  4OO1 I;  4L8R C;  4A3I B;  2F03 A;  4A93 H;  5FO7 B;  1PJT A;  4RHR A;  5IP9 H;  1Q46 A;  3KP0 E;  3K1J A;  1BCP F;  2JXN A;  3R9X B;  2IHF A;  2JA8 G;  3U6O A;  1C0A A;  1PFB A;  1Y8P B;  4DV5 Q;  4K8J A;  4L4U A;  1LTG D;  4XGI A;  4ZUI A;  2RDG A;  4AI6 A;  2PQE A;  3GP7 A;  1EL0 A;  1MSG A;  2YU9 H;  2EDG A;  3L2A A;  3S14 B;  4HSP A;  1C48 A;  4JXJ A;  1VF5 C;  1XHB A;  4HLQ A;  4BS9 A;  5M3F B;  5JJI A;  4QF4 A;  3QWN A;  1SNM A;  1SNO A;  2PO4 A;  2JZ0 A;  1Y1V G;  3TQY A;  3S9W A;  1K8A C;  3ULP A;  1HNW Q;  2EJG C;  3M3Y B;  3C46 A;  2RHQ B;  1DON A;  2F0V A;  1STH A;  4G7H C;  1WTX A;  1CHQ D;  1H9R A;  1PMR A;  3B7Q A;  2WII B;  5IP7 H;  5FTN A;  2UXB Q;  2D9U A;  1N33 Q;  1VG5 A;  4AKI A;  3A45 A;  2XGN A;  4FP5 D;  1Y1W G;  2KHI A;  4XDX A;  1OIZ A;  2IPK D;  2PZT A;  4LFA Q;  4BA1 I;  4J8Q A;  1EY7 A;  1CA5 A;  2K5Q A;  5DFL A;  4ZK9 B;  1IBM M;  3DEO A;  4C56 C;  5KYL A;  2EJF C;  4DV4 M;  2JA2 A;  3T1H Q;  3GV3 A;  2KW0 A;  1GJS A;  1TTE A;  4XBO A;  4LNQ A;  4DR5 Q;  2F0T A;  2R93 G;  3W5O A;  1TH2 A;  3GP1 A;  2EUC A;  4A3B B;  1D0K A;  1G2S A;  1GHK A;  2EVB A;  5DLQ E;  1GUW A;  2F5N A;  2UXC L;  2WSF F;  1Z59 A;  2MFI A;  3J7Y W;  2H1R A;  4GC5 A;  2D7G A;  1PXU A;  1IXZ A;  1ZV1 A;  2B2T A;  1D0L A;  2WAQ B;  4KO8 A;  3D0F A;  2KRK A;  4A3L G;  2PMZ E;  2KCN A;  3OWF A;  1L1Z A;  4MGZ E;  4DR7 M;  2VUM G;  3RGP A;  2BA1 A;  1RD9 D;  3LGJ A;  3BS1 A;  1PM5 A;  2OPF A;  4A3J B;  2UUA L;  4X62 Q;  3F8T A;  1L0Y B;  3P7J A;  2MO1 A;  3OW2 A;  2K4K A;  2C9C A;  1SG9 A;  2L9H A;  1IY2 A;  4MTN A;  1CK1 A;  1Q12 A;  4HJ9 A;  4DR4 L;  3DMU A;  4MIU A;  3DZD A;  3C3D A;  4JI5 L;  5BN5 A;  4A3C H;  2LHC A;  1TWG H;  3BZC A;  1XXH E;  4DU9 A;  5LHY 1;  5M9O A;  5J22 A;  1NJI C;  3A98 B;  4DV1 L;  1NMF A;  2KEN A;  5A2Q L;  1MX0 A;  3I56 A;  4DR2 Q;  2XVS A;  4X65 L;  4QOS A;  3OTO M;  2HAK A;  2F3I A;  3TE6 A;  1QIL A;  3U6E A;  2B2U C;  1G51 A;  5KRU A;  2SNM A;  4DN4 M;  1Q02 A;  5M3M G;  3RNU A;  4B7H A;  3GLI E;  1SXT A;  2Y21 A;  1D1K A;  2L4N A;  1L0W A;  1WFQ A;  3KK7 A;  4DUZ Q;  3P20 A;  2IX1 A;  3NQI A;  1ZAE A;  4JI2 L;  1IYJ B;  2ZXP A;  2IT1 A;  4YHH M;  5ITX E;  1CKM A;  3KLR A;  4FF1 A;  3LCU A;  2BA0 A;  1GO3 E;  5LMN L;  4OIJ A;  2QSF X;  3KOX E;  1QNK A;  1XPO A;  3EFX D;  2QPA A;  1IXS A;  2NWG A;  2B8F A;  1G71 A;  3I70 A;  3LVW A;  2B2Y A;  3MXG A;  3K0X A;  1PTO F;  3M3Y H;  1PRT F;  1RKN A;  1PJQ A;  1CKN A;  4C1N I;  1JB7 A;  1IXS B;  2BNK A;  5CGK A;  1D5X C;  3HJQ A;  1SDF A;  3UI2 A;  4LFB Q;  1WI5 A;  5IYD G;  1GUT A;  1WR1 B;  1WXQ A;  3CCJ A;  2DWM A;  1HR0 Q;  2DJG C;  3MXU A;  1DOM A;  2F3V A;  2R7Z G;  2B2V C;  2OWO A;  3PXG A;  1Q81 C;  1UM8 A;  2DZO B;  5CV7 A;  4DV5 M;  1WTH A;  1LT3 D;  1EEF D;  3QO2 A;  2F52 A;  1TR5 A;  3VR5 A;  4O1N A;  4DGZ A;  2Y0S B;  3BJU A;  2QEX A;  3D31 A;  3FKI H;  1K3R A;  2K50 A;  3V05 A;  4QUF A;  1K3W A;  4G4O A; 
#chains in the Genus database with same CATH homology
 4IFD G;  1J7K A;  3HHX A;  5ELC A;  3I4N B;  1TY2 A;  2Q2E B;  2ZM6 M;  4B7F A;  4XYQ A;  4LAA A;  2ERC A;  1JOR A;  3HOV B;  5M5X B;  5EBC A;  2CW0 C;  1N33 M;  4LJ6 A;  3PUV A;  4GZY C;  3GLH A;  4S3S A;  1B4O A;  4LFA M;  2MP1 A;  1NJG A;  1J09 A;  3KSJ A;  4RNA A;  2Q8I B;  2CFO A;  1JQJ C;  3FYD A;  1XTC D;  3T1H M;  5JEA G;  4DR5 M;  1STG A;  4IBI A;  1Z7T A;  2WKC A;  4MN3 A;  2B2W C;  3I91 A;  1VMC A;  5C3X A;  1D5Z C;  2C99 A;  3RZO B;  3HGB A;  3FUU A;  1GUS A;  3Q6S A;  4Z8X A;  2XIW A;  3VYU A;  1FNV A;  3VLF B;  2K1B A;  1N77 A;  2FOI C;  4C2M B;  2ZXR A;  2EY1 A;  1TWF B;  1I50 B;  1Z5B A;  2I46 A;  3ILK A;  1NY5 A;  1E2V A;  3HKZ B;  5EJW A;  5KPR A;  1H9M A;  5E6J A;  5K36 H;  2PPB C;  3J81 E;  1LTA D;  1JQY D;  3H4M A;  3HZX A;  4DR2 M;  4AG5 A;  3A56 A;  1SXJ A;  3MHB A;  4RGO S;  1HCZ A;  4LJ7 A;  1L2B A;  4ID6 A;  4TKO B;  2NYZ D;  3ZCB B;  3Q24 A;  3I8Z A;  4XIG S;  3E9S A;  1CTM A;  2HUG A;  4DUZ M;  1HFN A;  4G7O C;  5EPK A;  1DJR D;  2EY5 A;  1LTI D;  2DZN B;  1LAC A;  5IT9 E;  4IBB A;  4G4N A;  4IBF A;  4FYD A;  2UUB M;  3THG A;  3TP7 A;  2WB1 B;  1AN8 A;  4A3F B;  4Z9C B;  4WW0 A;  1ZKO A;  2D62 A;  2ZXO A;  1O7Z A;  2HCC A;  1SYC A;  3FUX A;  4IBJ A;  2OEO A;  5IIF A;  3GTK B;  3LWU A;  1STB A;  3NPP A;  2JA8 B;  3HGI A;  3M7G A;  5JPM C;  3MFY A;  1K82 A;  3C1F A;  4LFB M;  5EXT A;  3PUY A;  1Z47 A;  5I6Y A;  2X49 A;  5LMU M;  3JAM S;  1CZW A;  3BYT B;  4PQX A;  1GOZ A;  1TS3 A;  1EEI D;  1O80 A;  4LRT A;  3KSX A;  1Y1V B;  2CV2 A;  1J8I A;  1IN4 A;  3UZU A;  2DY7 A;  1JR3 A;  1JE4 A;  1QCB D;  2HDM A;  2GA4 B;  4LG2 A;  1BXT A;  4R8N A;  1Y1W B;  3D8B A;  4KY5 A;  4QNM A;  4DXF A;  5EP2 A;  1PLF A;  1N34 M;  2DHR A;  4OL7 A;  4I81 A;  3ERQ A;  1SNQ A;  3CHB D;  3M85 A;  2R93 B;  3M4Y A;  1D1I A;  4DK1 A;  3KOZ E;  1WTQ A;  5FO9 B;  4OU7 A;  1HTL D;  5KQD A;  4PD2 A;  3I90 A;  2D5D A;  3H3V C;  1SSO A;  4ZYS A;  3SK6 A;  3WHL A;  4RAU C;  2LXE A;  3A54 A;  2WKD A;  3I4L A;  2JEA I;  1T3T A;  1VDZ A;  4KY6 A;  1NR2 A;  1CM9 A;  2G8L A;  2L6O A;  3GRR A;  1QAN A;  1QAQ A;  2WP8 J;  2E74 C;  4DFA A;  3MHV C;  3J2P B;  2B39 A;  1WD0 A;  3TP5 A;  4IUN A;  4E6I A;  4R9W A;  1HQM C;  5FLX S;  3BDC A;  4G6Z A;  1QE6 A;  4WUR A;  4LGY A;  2HCB A;  1EQV A;  3UJN A;  3L7Z C;  2L12 A;  1TDZ A;  1IM2 A;  3E6Z X;  5C0X G;  1JR0 D;  1QVR A;  1A6X A;  2PMZ B;  3O13 A;  4KN4 C;  3SC3 A;  5M3M B;  2CHV A;  1QB5 D;  5DAU A;  4O42 A;  4PT5 A;  4FXD A;  1F2Z A;  2A68 C;  2K5W A;  1CT1 D;  4C3J G;  5KIX A;  4V0B A;  2FIN B;  2UXC M;  1DOK A;  1IN6 A;  4IUP A;  3S16 B;  5JVG 3;  1WVL A;  2EZV A;  4KJO A;  1ENF A;  1ILQ A;  1U9R A;  5C3E B;  4LZJ A;  3TZU A;  1GUN A;  2R3Z A;  5IRE B;  3GTJ B;  2L5T A;  4K5V A;  1Z6T A;  3VR3 A;  5IGD A;  2WIN B;  2NVT B;  2UUA M;  3MTS A;  3P75 A;  3RMH A;  5LL6 S;  2BJV A;  4DR4 M;  3TSS A;  1IY1 A;  3OPO A;  5FKA C;  3HU2 A;  2R7Z B;  4B3S M;  2H4O A;  4DV1 M;  3NUC A;  4LK1 C;  4X65 M;  1SYE A;  2RSO A;  1XMO M;  5IGE A;  3K7A B;  4CKC A;  3NBH A;  3HRZ C;  5C4H A;  3FUV A;  2DNC A;  3DA1 A;  5BPV A;  5JVH 3;  3BOS A;  1BUV T;  2C9O A;  2Q8R E;  3BZD B;  4IBC A;  3R93 A;  5FTL A;  2XZF A;  4WJW A;  4ZUJ A;  2Y0T A;  4QIW B;  4JI2 M;  2EYP A;  3HOW B;  3FTD A;  3FPU B;  3OSO A;  2XF3 A;  2EOT A;  1IQP A;  3J80 E;  5LMN M;  2AUJ D;  3HEJ A;  2NVY B;  5DYI A;  3I51 A;  2EY2 A;  3R3O A;  2N55 A;  3J7A S;  4BA2 I;  3PVS A;  4RCO A;  3H94 A;  3V96 A;  5DM6 3;  3FEW X;  2KJX A;  3PNV A;  4BWG B;  1A2U A;  4XXE A;  2L11 A;  2M2L A;  4RGT A;  1BR9 A;  1QYR A;  2R46 A;  3SHG B;  1ET6 A;  4A3D B;  4EGV A;  4OIK A;  4MM3 B;  3SAS A;  5M5Y B;  3IAY A;  4M9Z A;  1HTP A;  4LJA A;  4RFB A;  3QAU A;  1B3A A;  1EQT A;  4IJE A;  4HED A;  5EP1 A;  2K01 A;  4PMC A;  1EOT A;  3WOE A;  3KW6 A;  3D8L A;  1B9M A;  5KND A;  4FXK C;  3WDN A;  1ENA A;  5DNY A;  1KLU D;  3VR2 A;  2KUM A;  1TWC B;  2KXE A;  4TUW A;  3N6R A;  3NK9 A;  1EIG A;  1W6K A;  2F1M A;  4LMQ D;  2R92 B;  1TGU A;  3ERO A;  1EE8 A;  1PTO H;  3FDT A;  3PMF A;  4KK7 A;  3MJ5 A;  3Q23 A;  4FCV A;  3GQ3 A;  3NTH A;  1EY4 A;  3N52 A;  2A5Y B;  3I73 A;  5EPL A;  2IW3 A;  3K2L A;  4L8J A;  3MA2 B;  1IYU A;  3A55 A;  5CR3 A;  1BQQ T;  2O5R A;  2Z7J A;  1KNE A;  2Z4H A;  1D6E C;  1LT5 D;  2BDO A;  3NHH A;  2NTT A;  3M6A A;  2VNU D;  1SE2 A;  3J81 S;  1FJG M;  1SNP A;  4B7G A;  5IOD A;  2EYH A;  4PDI A;  2XSZ D;  5EJC A;  1K8O A;  4NKL A;  3GTL B;  2JA5 B;  3SYL A;  2I7N A;  5I6W A;  5E1F A;  4IBK A;  4ODG A;  5IZ7 D;  2M60 A;  4NW2 A;  4LFC M;  5CC4 A;  4ZLT F;  3HS0 C;  2F4I A;  3EA6 A;  1I6V C;  3S1M B;  3UK6 A;  1CQV A;  1HXY D;  3KVW A;  5C4Z A;  3KFU G;  4QHT A;  2EPB A;  2MUY A;  2A69 D;  1WTW A;  3RUZ A;  3OIQ A;  3E0J A;  4REZ A;  5IT9 S;  1B1Z A;  2CW0 D;  3FYC A;  1RTN A;  1V1O A;  2KA7 A;  4M9X A;  3RE8 A;  2F0S A;  2XFT A;  3IFD A;  4K2K A;  2C96 A;  4UDU C;  1JOO A;  2YFQ A;  2B2U A;  3L9A X;  2XZU A;  2F0U A;  1OJL A;  4I65 A;  2RVL A;  3IFT A;  3D6W A;  1G3I A;  3I72 A;  3K8Z A;  1JCK B;  4AG6 A;  1Z6H A;  3IKJ A;  1BNZ A;  4DR3 M;  1WD1 A;  3CTW B;  2XNA C;  3R2I A;  2JE6 I;  2UUC M;  3M7N A;  1MD2 D;  2Q8T A;  4Q0F A;  4AKH A;  2RGO A;  3W0L B;  2PZU A;  4ZKB B;  2SEB D;  2AQ1 B;  1NR4 A;  3TP8 A;  2BE5 C;  4B3T M;  1NSN S;  2YYZ A;  1ONL A;  3TME A;  2A6E C;  4I7Z C;  1M4V A;  5EQ0 A;  4IBD A;  4YY3 M;  4ZKC B;  1Q8I A;  4NSR A;  2KEB A;  1Q3C A;  1HFG A;  4D82 A;  4H44 C;  3K92 A;  4M1U B;  1EU3 A;  2PNR C;  3C1E A;  1D2N A;  4XQJ A;  3A42 A;  2UXD M;  1F9S A;  5K5P A;  2HL7 A;  4IUU A;  3PV0 A;  1OXX K;  1Z5C A;  5FLX E;  1EZ6 A;  2XRS D;  1QAM A;  2L55 A;  4JN6 A;  1N36 M;  3KOW E;  3K5M A;  1WTP A;  4EVO A;  1F9P A;  3AOE C;  3EJI A;  3FMC A;  2LY7 A;  2FJ2 A;  1HUM A;  2FFK B;  2L7I A;  4B3R M;  1ENC A;  1EYA A;  2A6H D;  1JOQ A;  2RGH A;  5ELE A;  3DXJ C;  3GQ5 A;  1S5F D;  1TVX A;  5CV4 A;  5A2Q S;  4WFN 3;  4A3M B;  3HOY B;  1C4Q A;  3MVV A;  1C1K A;  1VMP A;  3T53 B;  2L7H A;  5CBA E;  1PFN A;  4K0K M;  5C18 A;  4ZQ3 A;  5EXP A;  3DEP A;  3BYY B;  3D3R A;  3LMM A;  5FO8 B;  2ZBK B;  3DWQ A;  3ND9 A;  2RKO A;  2BDN A;  3I4M B;  2N88 A;  1W6J A;  2CEA A;  2AUK A;  2R61 A;  5C4X B;  1AEX A;  2LH0 A;  3PO2 B;  2CHQ A;  4IFD J;  4EQP A;  2KA6 B;  5JOB A;  3HOU B;  2M9V A;  3MZ5 A;  2CQA A;  5ELB A;  1Y8O B;  2L0C A;  3I4V A;  5F2D A;  1X37 A;  1BOS A;  3FTC A;  3IG8 A;  5EXS A;  5KEE A;  1CI3 M;  1II3 A;  3L29 A;  5EXX A;  7CAT A;  2K04 A;  2ZAM A;  3U6P A;  2R4J A;  3AU7 A;  4HL4 A;  4KV6 A;  3V2T A;  4M0W A;  5EPJ A;  1W5S A;  2Y20 A;  1I4Q A;  1KLG D;  3SHL A;  3DUZ A;  4IN3 A;  1Z5A A;  3C3L A;  3VR6 A;  2PYK A;  1WTV A;  4X66 M;  1IN7 A;  4RHS A;  2CE7 A;  3WOF A;  4ITQ A;  3KXE C;  2F0D A;  1E32 A;  3ZC7 B;  4KHP M;  1I4H A;  1U4L A;  3SYK A;  1LTR D;  1U4P A;  1YNN D;  2F0H A;  3SAR A;  3OHX C;  3QG1 A;  3C58 A;  4GH9 A;  2L09 A;  1FGB D;  1I4X A;  1GL7 A;  4IQZ A;  4UAI A;  5C1B A;  3A7L A;  3D6C A;  1TKW B;  3K5O A;  4NSO B;  1HNW M;  3NP8 A;  4RA8 A;  1QG7 A;  4GIT A;  3QOL A;  4KI0 A;  2R18 A;  2UXB M;  4CJ1 B;  1STE A;  4I5S A;  5G3L D;  2B2T C;  1X3Q A;  2R4E A;  3J80 S;  1L1T A;  3TPZ A;  2MPM A;  2QZ4 A;  2DXI A;  1YNJ C;  4KD3 A;  4GIP A;  5EGT A;  4Y7N B;  4CHT B;  1RTO A;  5HUR A;  1B50 A;  3KBX A;  4DAV A;  4ME5 A;  1IN8 A;  1U4R A;  2C98 A;  4S12 A;  4X3T A;  3AMU A;  1B53 A;  1YUB A;  4LF4 M;  2ID0 A;  4KKS A;  2A68 D;  3VK7 A;  2NVQ B;  1HUN A;  1EU4 A;  1O7Y A;  1RCV D;  1DXM A;  4QMG A;  2QDB A;  1N32 M;  4JV5 M;  2VQF M;  2J7N A;  4JI6 M;  2JEB I;  5I4D A;  1W5T A;  3J7B A;  4OGQ C;  4DK0 A;  4KJN A;  1L2C A;  1FNU A;  1SAP A;  1STY A;  2F3W A;  2RA4 A;  5D3D A;  4PDG A;  3CF6 E;  4RKB A;  5JPN C;  4X62 M;  3QIA A;  5C4J B;  1BDO A;  3G6J B;  2XLJ A;  1RDP D;  2IWH A;  3VYT A;  2PW7 A;  2RSN A;  3RGS A;  1GL6 A;  2X4A A;  4IUV A;  1NHG C;  3S2D B;  2B2Y C;  1WTR A;  3K58 A;  1LTT D;  5ELD A;  5IOC A;  2FMM A;  1SYB A;  4BBR B;  1TH3 A;  4EIW A;  3CRL C;  5I9O A;  5DNF A;  4AKG A;  2UU9 M;  5KGU A;  2F0E A;  4AW4 A;  1EFI D;  2AHM A;  2F0F A;  2R62 A;  1E9R A;  3SAU A;  4OO1 G;  2J7O A;  1O7L A;  4BBA A;  2ICE C;  1XYI A;  3GQ4 A;  4DXG A;  5ITU A;  1GUO A;  2SDF A;  1WCM B;  3IL8 A;  1LV7 A;  3U6Q A;  1E2W A;  2E75 C;  3ND8 A;  3GTO B;  3NE5 B;  1GJX A;  1DD2 A;  2AQ3 B;  2WAC A;  3PUZ A;  1HR0 M;  3S1N B;  4NRW A;  3PUX A;  4YIJ A;  3NSW A;  1AW7 A;  3S15 B;  4FF4 A;  5KQ8 A;  2H1E A;  1DYQ A;  4G7Z C;  1SBB B;  3J7A V;  4BLC A;  2RQX A;  1IW7 C;  4KMU C;  4BY7 B;  3TP6 A;  1ESR A;  1EWH A;  1IHZ A;  2K32 A;  3S17 B;  2QCU A;  1PFM A;  4DR1 M;  4N9T A;  4ABN A;  5T1I A;  4IZ8 A;  1YSY A;  3JAM L;  3OW7 A;  4GC9 A;  3U6L A;  5C0X J;  1QWY A;  1R2Y A;  3HHY A;  1PJI A;  4KD4 A;  4F7X A;  2EYF A;  2I7P A;  1MGS A;  1OXU A;  1ZYR C;  1PJJ A;  1BO0 A;  1AP0 A;  5JI3 E;  1R2Z A;  5T1G A;  2RDF A;  4DF7 A;  3GTP B;  5E26 A;  3EVQ A;  4K6L A;  1IKL A;  4WRD A;  2NN6 H;  3T4A C;  3OWE B;  3L27 A;  5I9P A;  3E4R A;  2VUM B;  2OT2 A;  2X6G A;  5CV8 A;  1SXJ C;  5A2Q E;  4G57 A;  1FNN A;  1DOL A;  3CRK C;  1AZP A;  1JWM D;  4J1M A;  2A74 C;  1KNA A;  1F9R A;  1NNJ A;  1BCP C;  1H9K A;  4NRV A;  2E2J B;  1S3S A;  5M5W B;  3MK6 A;  1G8P A;  3KBG A;  1N78 A;  3OIP A;  1UAP A;  4CKB A;  5KO3 A;  2XSC A;  4IUR A;  1LO5 D;  1XXH A;  1J5E M;  2KVM A;  3SMP A;  2V1U A;  3VR4 A;  4GKJ M;  4OVZ A;  3VDU A;  5C5L A;  1XXH B;  5FLX L;  4HMJ A;  3BVG A;  2R65 A;  1GHJ A;  1DO0 A;  1TDH A;  2NUC A;  4WOR A;  3U6C A;  3GLI A;  4XT3 B;  3S1Q B;  4NOO B;  4OVZ B;  4GHL A;  1SMY C;  2EXZ A;  1CFM A;  3D4W A;  5ITX A;  3W2D A;  3M4O B;  3GLI B;  5CV9 A;  2IX0 A;  1G6Z A;  1F2M A;  4JI5 M;  2KCC A;  1B2T A;  1I4R A;  3U5Z A;  3SAT A;  1OFI A;  2DY8 A;  2D7H A;  4C3H G;  1HNZ M;  3DFZ A;  4JBW A;  2BE5 D;  4HR7 B;  4LJ9 A;  2A6E D;  4CGY B;  1EWC A;  4KHZ A;  4PCZ A;  5KPT A;  3U5Z B;  4GHA A;  1SEB D;  1LT4 D;  3KUP A;  3OMC A;  3HJS A;  3U61 A;  3A46 A;  1B44 D;  2F0O A;  4P16 A;  5ELF A;  4LY6 A;  3AKZ A;  4HAE A;  4FWG A;  5K36 G;  4W5W A;  5EKK A;  1KFV A;  1I3Q B;  3U61 B;  1F9Q A;  4JI3 M;  1QOH A;  3R8F A;  1ZEQ X;  3DOA A;  1MU5 A;  4L78 A;  3FKE A;  5IGG A;  3MAQ A;  1KAA A;  2G9D A;  3LNN A;  1DGG A;  2XWJ B;  2D2C C;  5AFW A;  4LF6 M;  3M0E A;  4GRI A;  1MBY A;  1V43 A;  3D8G A;  3CF0 A;  4DNR B;  5CMD A;  5KNB A;  2CUZ A;  1VF7 A;  5BR8 M;  1XC8 A;  1ILP A;  5NUC A;  1O78 A;  1OXS C;  1SYD A;  1S5C D;  3RZD B;  2JYO A;  3MXP A;  4A93 B;  3HHW A;  4B9X A;  2K33 A;  1IKM A;  4XQN A;  1CZG A;  3K0Y A;  4X3U A;  2P5T A;  4IFD I;  1HQY E;  2E76 C;  4FWH A;  1PTO C;  1NUC A;  1PRT C;  1EY8 A;  3SAV A;  4RF1 A;  3T1Y M;  3KLS X;  3JR5 A;  3W0F A;  2KHS A;  1LV9 A;  2YU9 B;  2K03 A;  1A3T A;  2QIL A;  2SNS A;  3K5L A;  1KSF X;  2KEC A;  8CAT A;  4LRS A;  3T56 B;  4IBG A;  2NBF A;  2L1B A;  1PYW D;  4FWD A;  3TDQ A;  1A3V A;  2QKI C;  3ZH9 B;  2O4X A;  2XWB B;  1JB3 A;  4XTC S;  1G8Z D;  4ULL A;  4AQY M;  3F2U A;  1STN A;  3W3A A;  2XRQ D;  1H6U A;  1QJO A;  1I4G A;  4TSS A;  1EZ8 A;  3VFD A;  1G4A E;  4Z6Y A;  5FSW A;  4NL4 H;  4RWS C;  3DM1 A;  1N75 A;  3DWP A;  1H9S B;  2J4X A;  3TQS A;  1SXJ E;  2E5L M;  3Q0A A;  1Q1B A;  5I2Y A;  4IFD H;  3FTE A;  3C2P A;  4IUQ A;  5ITR A;  3U6S A;  5EQT A;  4JK1 C;  4R3D A;  4G4R A;  4HSV A;  5C3W A;  1R9T B;  2G5G X;  4MGI E;  4F8M A;  1S5D D;  5EP3 A;  4RH6 A;  2R6G A;  3NXW A;  1E9S A;  1X3P A;  5HGT A;  3NQT A;  3J81 L;  4PV1 C;  1LTS D;  1E2Z A;  5E3F A;  1NVM A;  2EYL A;  4Q5V A;  3D4D A;  4DR6 M;  4LF9 M;  2AWN A;  1TWG B;  2QEN A;  5JEA H;  1YNJ D;  1X32 A;  1NY6 A;  3KDS E;  2EYJ A;  2VB3 X;  3MFG A;  1Q3L A;  3FUT A;  3BG3 A;  4EQO A;  4LF8 M;  5C6A A;  4K6D A;  5G3L F;  1TH4 A;  1MSH A;  3AFH A;  5IT9 L;  2QP9 X;  4M9S A;  3U6D A;  2K5D A;  1G91 A;  3S2H B;  3GPU A;  1A3U A;  4M0D A;  5D3I B;  3HJ8 A;  1G41 A;  1QNU A;  3R2T A;  4DV6 M;  2KEE A;  2ZAN A;  3SXH A;  3L25 A;  1M8A A;  3RFW A;  4KY7 A;  3FD9 A;  5FTJ A;  3TWL A;  1LT6 D;  2FE8 A;  1DGB A;  2QCP X;  1HQC A;  1T5E A;  1V8Q A;  2Y0Q A;  1L2D A;  3DHQ A;  4EQN A;  4I8O A;  2X8A A;  1FD7 D;  4GKK M;  1UEA B;  5IGC A;  4NP5 A;  2TMP A;  2B2V A;  1NJF A;  1HRJ A;  5KYI A;  5LL6 X;  5JI2 E;  2OF1 A;  2XSZ A;  3GLG A;  4LF5 M;  5EP4 A;  2ICI A;  1EY9 A;  4HN7 A;  3R8B A;  1Q39 A;  3EIE A;  2EA0 A;  1K3X A;  4OO1 H;  4U68 A;  4X3K A;  1OO9 B;  4R8I A;  4MGK E;  4JI0 M;  3PIP 3;  3BDO A;  1BBX C;  3GLG B;  1JIC A;  3FKI B;  2F5P A;  4X64 M;  3PUW A;  1CQF A;  2B8G A;  3L28 A;  1Q1E A;  2B63 B;  2DWL A;  1AFP A;  4CJ0 B;  5J39 A;  4K2L A;  1UNS A;  5A35 A;  4L16 A;  1F2L A;  4C3J B;  3SAW A;  1FYC A;  3VK8 A;  4KN7 C;  1IXR C;  4X3S A;  1K83 B;  1KAB A;  3TWM A;  2F0P A;  3HKP A;  4KLN A;  2RBM A;  2DN8 A;  5DM7 3;  1RJT A;  3HOZ B;  2B2W A;  2F0Q A;  4JI8 M;  1PZJ D;  1ESF A;  1AZQ A;  2CHG A;  5E4X A;  1TWH B;  1VCI A;  2Z3X A;  4C3I G;  3GTM B;  1IY0 A;  1SNC A;  2PW5 A;  4PNY A;  1TQO A;  4KKU A;  1IW7 D;  4C3H B;  1SE4 A;  3GLF A;  2YQZ A;  5D65 A;  3VDP A;  1E94 E;  2G9H D;  1PDQ A;  5C0X I;  2TSS A;  5EKL A;  4NXM M;  2Z1C A;  4V19 0;  3NTK A;  3GLF B;  5JEA J;  1HNX M;  3I4Y A;  3UMM A;  2HDL A;  2BCO A;  1OXT A;  1Y8N B;  1ET9 A;  1ZYR D;  1R4P B;  1B9N A;  4DA2 A;  3ONA B;  2NQ8 C;  3Q8X A;  5TSS A;  3CKI B;  4L15 A;  1NHW C;  3GPP A;  3KS8 A;  3A7A B;  3LX0 A;  3S1R B;  2BOS A;  3TZD A;  5CBE E;  1DM0 B;  3ZYY X;  2JP1 A;  3QWL A;  4K5W A;  4IJF A;  3GD7 A;  3OMG A;  1SXJ D;  1NNU C;  3KS4 A;  2K05 A;  1Q3B A;  2J7Z A;  1JC7 A;  1EY5 A;  1JOK A;  5C44 B;  3QJY A;  4JI7 M;  1KDB A;  3LQR A;  2FMC A;  4RCN A;  4H7B A;  3VYS A;  2A73 B;  4IAL A;  3MWY W;  1IL8 A;  1SFO B;  5C0X H;  1BCP D;  2PCF B;  4QCL A;  3LQQ A;  1XNQ M;  1U4M A;  4DAP A;  2A69 C;  1K8M A;  1Y69 U;  3J7A F;  1QZM A;  2VB2 X;  1HT2 E;  2MGS A;  2F0I A;  4D81 A;  1XWI A;  3TN2 A;  1HA6 A;  1OFH A;  3GV6 A;  2CHB D;  2LS0 1;  3BDL A;  5F3W A;  4A3E B;  4FF2 A;  3TWK A;  3GRY A;  4P2C B;  2F0N A;  3J80 L;  4FO2 A;  3GLH B;  4PMW A;  1IYV A;  1NAP A;  4K14 A;  4ZAI A;  3T16 A;  1T5X D;  2HCI A;  1GKI A;  2KOL A;  4HCE A;  4M8A A;  4RKL A;  1SMY D;  3L3O C;  1GLN A;  3NWS A;  4KOD A;  3BVM A;  4FCT A;  4XT1 B;  2LWX A;  1A15 A;  3H09 A;  1JR3 D;  5JJZ A;  4J6H A;  4K5X A;  3SHF A;  1XNR M;  5IGB A;  3WHK A;  2AQ2 B;  2RKS A;  2KZS A;  2F5Q A;  3H0G B;  1TY0 A;  1EY6 A;  2A5H A;  3A8J E;  3CF2 A;  3VA7 A;  1UUP A;  5ITY A;  1SND A;  3URY A;  1Q90 A;  3GTG B;  3FPP A;  4KTA A;  2XEP A;  4OW0 A;  2C5R A;  4BBS B;  3SK8 A;  1F2Y A;  2CV1 A;  4JI4 M;  4A3G B;  4MH0 E;  4HMI A;  2X6L A;  1H9J A;  4MGH A;  1V1P A;  3SEB A;  5IGF A;  2QF7 A;  4FD2 A;  1I4W A;  4C1N K;  4F87 A;  2JXM B;  1NSF A;  2FHT A;  1V1P B;  2HKJ A;  3J27 B;  1LAB A;  3KLS A;  1SXJ B;  1XMQ M;  5FTM A;  4AZF A;  5ITT A;  1GVN A;  2A6H C;  3NWL A;  3MXN A;  2FNA A;  1C8C A;  1A2T A;  1XX8 A;  2Z8L A;  1DO2 A;  2DWZ B;  3FUW A;  1SE3 A;  2NN6 I;  4IUT A;  1BCP B;  4F88 A;  1TT2 A;  4XYO A;  4LJ8 A;  4DV2 M;  3HG9 A;  2E2I B;  2Z4R A;  4ILW A;  3SR1 A;  3SDZ A;  2QBY A;  1RHP A;  1HT1 E;  1GUG A;  2V6Z M;  3LVV A;  4RGM A;  2NVX B;  5JAV A;  1STA A;  1ZXT A;  1IBK M;  4MB7 A;  2QBY B;  1KYI A;  1I6H B;  4PMB A;  4FCW A;  2NB0 A;  2ZAO A;  3NTI A;  1TU2 B;  3K57 A;  3TL4 X;  2CVR A;  1FNW A;  1PTO D;  5FTK A;  4ZPX A;  1PRT D;  2F5O A;  1OXV A;  2E2H B;  2C5C A;  1JWS D;  3GPY A;  3NBI A;  4G4K A;  3G7L A;  1R6B X;  3GTQ B;  5FOB B;  4LF7 M;  4LJ4 A;  3SK5 A;  1TS4 A;  2F5S A;  4LJZ C;  2LKV A;  3FTF A;  4FF3 A;  4KKT A;  2AWO A;  4ZRZ A;  3CQZ B;  2LNH C;  4NXN M;  4JI1 M;  2R45 A;  4FVM A;  1XXG A;  1D2B A;  4RF0 A;  5H37 D;  1KDC A;  2VII A;  5DEH A;  2IJ0 A;  2O5I C;  3DWA A;  2F0J A;  1IN5 A;  3UGJ A;  2XH9 A;  4HTH A;  1DZ1 A;  1NCV A;  3OOC A;  4L6T B;  4LZZ A;  3I3C A;  3VKH A;  2MJ8 A;  1YNN C;  3AL0 C;  4MHE A;  4II7 A;  4CJ2 C;  4U67 3;  3U9O A;  1IBL M;  2EYO A;  4NMZ A;  2Z4I A;  3SE0 A;  3SMS A;  1L0X B;  3U6M A;  4FNF A;  1BF4 A;  1HA5 A;  1SYG A;  1DGF A;  1TS2 A;  4QOZ C;  2F0W A;  1EIH A;  3A8I E;  1QAO A;  2ENB A;  3P1H A;  4C3I B;  3D4R A;  1ROD A;  4IIW A;  4NDX A;  3GRU A;  1S5E D;  2JA6 B;  1S5B D;  2M00 A;  3PIO 3;  1DGH A;  2K47 A;  4OX9 M;  5J1Z A;  2IL8 A;  1R7R A;  3MC0 B;  2JA7 B;  5BN3 A;  1ZQ9 A;  2WV6 D;  3HP3 A;  3A8K E;  4TQU S;  1ML0 D;  2EE1 A;  4GMQ A;  1MI2 A;  2F0L A;  1CA6 A;  4DNT B;  1DGH B;  5CV6 A;  4CIS A;  2EJM A;  3X3M A;  1SYF A;  2HQE A;  3PNY A;  2X69 A;  1L8Q A;  1F77 A;  3NWT A;  1YE9 A;  4A3K B;  1PTO B;  1PRT B;  4N9P A;  2O2L D;  1G59 A;  2KRU A;  3GQB A;  3KP1 E;  5FK9 C;  3SK4 A;  3VYR A;  3T13 A;  2PZW A;  1EYD A;  3PO3 B;  3U9S A;  2ZT9 C;  4A3V B;  3HOX B;  1G29 1;  2XFS A;  3SBJ A;  1I4P A;  3FVQ A;  3IG5 A;  2HHH M;  5C5M A;  4BY1 B;  1DCZ A;  3TBI B;  1TII D;  2SOB A;  3Q22 A;  2Z4S A;  3KF8 A;  3T51 B;  2F4V M;  3HHZ A;  2E2D C;  3RLF A;  2KED A;  4HCS A;  2K28 A;  1HPC A;  1R4Q B;  5KNC A;  2CV0 A;  3GRV A;  3T15 A;  1WTO A;  1ICW A;  3MEH A;  4IBE A;  2EO2 A;  5CYU A;  1JWU D;  3AOG A;  4R7G A;  3GPX A;  1KTK A;  3HU1 A;  3HWS A;  3GO8 A;  2V1C A;  1CHP D;  3VA5 A;  3QOJ A;  2YNM D;  2EY6 A;  3B9P A;  1FR3 A;  4H0L C;  5COY A;  2OQ4 A;  1ORY B;  5IWA M;  1XWE A;  2YR0 A;  2J0T D;  5D14 A;  4CKE A;  3PFI A;  2NZ1 D;  2KZU A;  1S4Z A;  2LMC B;  2F0G A;  2VXW A;  1G2T A;  4B3M M;  1KDA A;  2V4D A;  1LLR D;  5COR A;  1PZI D;  3FRP B;  1LTB D;  2OXP A;  4LCB A;  1RF2 D;  2DNE A;  4FXG C;  3JR4 A;  4LGM A;  4K8I A;  4FW9 A;  3AV0 A;  1SJH D;  4LJ5 A;  1TS5 A;  2I07 B;  2KQ3 A;  3SVM A;  3EQL C;  3E5S A;  4QB4 A;  1PZK D;  4B9W A;  3VKG A;  3ITP A;  2BJW A;  1SJE D;  4DAY A;  4L63 B;  2DWN A;  2IX3 A;  3RD4 A;  3AJI B;  4DUY M;  4DV3 M;  5BN4 A;  5E4W C;  4I4L A;  4D80 A;  1H9S A;  1GXD C;  2FFJ A;  2K6A A;  5GKN A;  1HQR D;  2M5Z A;  4KHV A;  3K5N A;  2F0M A;  1J9O A;  4QUC A;  4B08 A;  3T38 A;  2K7V A;  2MHV A;  2XN9 C;  3GO5 A;  1HHV A;  4JYA M;  5DYG A;  2NTS A;  2RDH A;  3K59 A;  1EY0 A;  1TWA B;  4QNR A;  1I94 M;  4MGY E;  3KOY E;  2JSO A;  3X3N A;  4G4Q A;  4DV0 M;  4H13 C;  3BVZ A;  4BB9 A;  3QB3 A;  4QHS A;  2D7E A;  3L26 A;  1QQW A;  3AOE A;  2LFN A;  3H91 A;  2NN6 G;  4OHJ A;  1EYC A;  3H6M A;  4TRD A;  5ITQ A;  3LWE A;  2O5J C;  2F0K A;  4DV7 M;  5ISR A;  4CBV A;  1D5M C;  5KPZ A;  3U60 A;  2QEJ C;  3SFZ A;  1E0B A;  5EKI A;  1VDD A;  4RGN A;  3HU3 A;  3K6O A;  4XQQ A;  3CU7 A;  2VQE M;  5CV5 A;  4AYB B;  3U60 B;  2W82 A;  5EBD A;  3AB9 A;  2EYM A;  5I2X A;  3JAM E;  2DVW B;  3EIH A;  4OO1 I;  4L8R C;  4A3I B;  2F03 A;  5FO7 B;  4RHR A;  3KP0 E;  3K1J A;  1BCP F;  3R9X B;  3U6O A;  1PFB A;  1Y8P B;  4K8J A;  4L4U A;  1LTG D;  4XGI A;  4ZUI A;  2RDG A;  4AI6 A;  2PQE A;  3GP7 A;  1EL0 A;  1MSG A;  2EDG A;  3L2A A;  3S14 B;  4HSP A;  1C48 A;  4JXJ A;  1VF5 C;  1XHB A;  4HLQ A;  4BS9 A;  5M3F B;  4QF4 A;  3QWN A;  1SNM A;  1SNO A;  2PO4 A;  3S9W A;  2EJG C;  3M3Y B;  3C46 A;  1DON A;  2F0V A;  1STH A;  4G7H C;  1WTX A;  1CHQ D;  1H9R A;  1PMR A;  2WII B;  5FTN A;  2D9U A;  4AKI A;  3A45 A;  2XGN A;  4FP5 D;  4XDX A;  2IPK D;  2PZT A;  4BA1 I;  4J8Q A;  1EY7 A;  1CA5 A;  2K5Q A;  4ZK9 B;  1IBM M;  3DEO A;  4C56 C;  5KYL A;  2EJF C;  4DV4 M;  2JA2 A;  3GV3 A;  2KW0 A;  4XBO A;  2F0T A;  1TH2 A;  3GP1 A;  2EUC A;  4A3B B;  1G2S A;  1GHK A;  2EVB A;  1GUW A;  2F5N A;  1Z59 A;  3J7Y W;  2H1R A;  4GC5 A;  2D7G A;  1PXU A;  1IXZ A;  2B2T A;  2WAQ B;  4KO8 A;  2KRK A;  2KCN A;  3OWF A;  1L1Z A;  4MGZ E;  4DR7 M;  3RGP A;  2BA1 A;  1RD9 D;  4A3J B;  3BS1 A;  1PM5 A;  2OPF A;  1L0Y B;  3P7J A;  2C9C A;  2L9H A;  1IY2 A;  1CK1 A;  1Q12 A;  3DMU A;  4MIU A;  3DZD A;  5BN5 A;  5J22 A;  4DU9 A;  5LHY 1;  5M9O A;  3A98 B;  5A2Q L;  1MX0 A;  2XVS A;  4QOS A;  3OTO M;  3TE6 A;  1QIL A;  3U6E A;  2B2U C;  5KRU A;  2SNM A;  4DN4 M;  4B7H A;  1SXT A;  2Y21 A;  1D1K A;  2L4N A;  2IX1 A;  3KK7 A;  3P20 A;  3NQI A;  1ZAE A;  2ZXP A;  2IT1 A;  4YHH M;  5ITX E;  3KLR A;  4FF1 A;  2BA0 A;  4OIJ A;  1QNK A;  3KOX E;  3EFX D;  2QPA A;  2NWG A;  2B8F A;  3I70 A;  3LVW A;  2B2Y A;  3MXG A;  1PTO F;  1PRT F;  1RKN A;  4C1N I;  1IXS B;  2BNK A;  5CGK A;  1D5X C;  3HJQ A;  1SDF A;  3UI2 A;  1GUT A;  1WXQ A;  2DWM A;  3MXU A;  1DOM A;  2F3V A;  2B2V C;  3PXG A;  1UM8 A;  2DZO B;  5CV7 A;  4DV5 M;  1LT3 D;  1EEF D;  3QO2 A;  1TR5 A;  3VR5 A;  4O1N A;  4DGZ A;  2Y0S B;  3D31 A;  4QUF A;  3V05 A;  1K3W A;  4G4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...