4CGYB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
215
structure length
205
Chain Sequence
b'NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna replication/isomerase
total genus 54
structure length 205
sequence length 215
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4cgyB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cgyB02
4CGYB 4CHTB 3NBIA
chains in the Genus database with same CATH superfamily
2FINB 3HOWG 3CRKC 1DGFA 2R44A 3FDTA 5KQ8A 2AWOA 1K0RA 3WOEA 4JI7L 3I01M 4X65Q 2HHHL 2R7ZG 1CI3M 2ID0A 2EJSA 2RDGA 3KLSX 1WCMB 4M8AA 5M9OA 4ZAIA 3U9SA 4IBKA 2XZUA 1TWAB 2HIVA 1HR0W 1TVXA 3PIOA 3J7BA 4DUYQ 2YU9H 5C4XG 2F0NA 3J80i 1LTRD 1EU3A 4X3UA 4XQQA 4B3ML 4PMWA 4LY6A 1IKLA 2NZOA 5C3WA 1PH1A 1IN5A 5LHY1 4F8MA 1AW7A 4L8JA 1EY6A 2L2DA 1N33L 3J81j 1XYIA 3M3YH 2RDHA 1B4OA 2BH8A 3TWMA 4X66L 4A3IB 4GEWA 3ZH9B 3SXHA 3GTQH 4AYBE 2UUAL 2NVTH 3I73A 3SC3A 1JE4A 3S1QH 4TSSA 1E0BA 3PFIA 1C9OA 4IPDA 4FF3A 3HOVB 1T6OA 1JR3E 4NRWA 3HOXH 4DR1Q 4RNAA 1U0LA 1SYBA 4AW4A 2QBYA 4OWWB 2AHOB 1D1IA 2RF4A 3VYUA 3D6WA 5IYCG 3J27B 2JA7G 3GTLH 2GA4B 2LKVA 2V6ZM 2ES2A 4CIZA 2IL8A 2KNVA 4A3CG 3H0GH 1HR0L 1YBYA 4ODGA 4WORA 3EROA 4GHAA 3C1EA 3S15H 4A3EH 4RGTA 5FJ8G 5C4JB 2LFNA 3LVWA 4ZUIA 1VDDA 1D0KA 1BF4A 5DYIA 1CTMA 2DWMA 4JI8L 2R4JA 1WIVA 1AE3A 3SYKA 4LAAA 1I6HB 2JY5A 2K7VA 2OTJA 1E1TA 3LVVA 4PV1C 3J80E 4HSVA 2K28A 4X3SA 1SE4A 4B9XA 2D2CC 4IBJA 2C98A 2EKFA 4DR4M 2M00A 4QNRA 1SYEA 3P1HA 3PV0A 3U6LA 3U58A 3EN2A 2DAGA 2R92H 3STBD 4X62M 3F2UA 4WJWA 1PH3A 3J7A5 1UE7A 2VQEL 4LF6L 4OU7A 3TL4X 4UP8A 3VYSA 2K1BA 2GVAA 3GPXA 2DZOB 1EY9A 3O13A 1PJSA 4XIGS 2EE1A 1BVSA 3AMUA 1KL9A 4KO8A 5JEAH 4MH0E 2VY3A 3S1RH 2UU9Q 2ZTCA 4JVZA 4AQYQ 3HRZC 1DYQA 2D62A 1TWCB 4N9TA 1QVRA 4ZCKA 3KOZE 3CCVA 1X3FA 2L1BA 1CKNB 1B7YB 2F0LA 4R4IA 1V92A 5HGQA 1ZAEA 4IUVA 4NOOB 2VQFQ 3L25A 2EJGC 4QJFA 3I4OA 3PO2G 3U6MA 2VDBB 1M4VA 5C3XA 1ZKOA 3GPUA 2LBCA 2JA5B 4FCWA 2K5WA 3BU2A 4BB9A 2AUKA 5BN5A 5A35A 3E21A 1H9SB 1NBWA 2R0IA 3KBXA 1JR3D 3TWLA 4PZ8A 2BE5C 1IKMA 1Q7YC 4DXFA 2JK8A 2MGWA 3GLIE 1HPCA 4DNRB 4DR6L 4IFDH 1D2NA 1K83B 3NEMA 3RLFA 2L4FA 1WTRA 3TP5A 3T1YL 1Y8PB 5D3IB 2F0TA 1M8AA 1A0IA 5KQDA 3URYA 3V2TA 5IYBH 1PTOD 2F3WA 5T1IA 1U5KA 4IO9A 3RZOB 1TWHB 1A15A 1GL6A 5IWAQ 2PI2A 4CDCC 1CA5A 2C5CA 4IN3A 1XXHB 5EJCA 2Y0QA 2DJFC 5E26A 1G41A 2MH8A 1EQRA 2RDFA 2NN6I 1MJGM 1XPUA 4FP5D 1JMCA 4LF5L 2J0TD 3K81C 4UHVA 3S14H 2VIIA 3JAMc 1AH9A 3GRVA 4JYAM 2QF7A 3U60B 1SRUA 2EOTA 2KCNA 4DR5M 3KJPA 4OO1G 4R9WA 2B2UA 1Y1WG 5DM63 1V33A 2EYOA 1N75A 3UDIA 2UUBL 5FLXL 4L63B 1Q39A 1WTWA 2ICEC 4HSPA 2E8GA 2AMCB 3CC7A 5BPVA 1R9TH 2HDMA 2PQEA 2KRUA 1EIGA 1CZGA 4JI2M 1BQQT 1Y1VB 1HNXQ 1YI2A 3HOYG 4O1NA 5LMUL 5GKNA 1QWYA 4NXNQ 4LF4Q 2A68D 4DV0Q 5A2QL 1VQ8A 2JEAI 1R2YA 2DZLA 1XNQQ 3HKSA 2LSSA 3NWSA 3NWLA 1EUJA 3I4MG 1CHQD 4GRIA 1QAQA 3S17B 3A7AB 1ZQ9A 2FMCA 1FD7D 3GTGH 2VXWA 5M3MB 2KHHA 1VQ7A 2GNOA 3AOEA 2F5PA 4GKKM 3T38A 2LVPC 2NBFA 5IGFA 1KRTA 3I72A 3PXGA 2EJMA 2HCIA 4C3HB 5FO8B 3GTPH 4L78A 3AFPA 1Q3LA 3DUZA 1XHBA 1WI5A 1MBYA 1ZV1A 2JYOA 1CM9A 2E5LM 3OWFA 1RDPD 4OELB 2KZSA 1X32A 4A3GB 1H95A 2DUDA 1PH2A 1FL0A 1HFNA 5IYDH 5CORA 3J81c 2LS01 3PUZA 2JY6B 3LWUA 4P71A 1RIPA 1TXYA 2K5QA 2CV1A 5C3EH 2OXPA 4JI4Q 1IYVA 2G9HD 4Q0FA 4N9PA 2BH2A 5C4HA 4L6V6 1OAIA 1HNZQ 2JEBI 5EP4A 4CKCA 4DV1M 4HN7A 1FNVA 2AQ1B 1JWUD 2LTUA 4LRTA 1FNNA 4IBFA 5E1FA 3C58A 1A3VA 2WSFF 3C9PA 2L12A 5CV7A 4UAIA 2FE8A 1KLGD 1WCMG 3D8GA 1ILPA 2YNMD 2IT1A 5EP1A 2E76C 3LQQA 3B7NA 2LY7A 3HKZB 1QZMA 4IBIA 1PFNA 1XMOQ 3NENA 1SXJA 1EQQA 4JBWA 1Q90A 2L7HA 4DR4L 1SYDA 5C0XG 4LFAQ 1V1PB 4IUNA 5IGGA 5DEHA 1X55A 3SR1A 2SDFA 2BA0A 4DV3Q 4DR6M 3H3VI 4QIWB 4GZYC 1N9WA 1MHWC 1QUQB 4G4QA 2PZWA 3K80C 4A3IG 1XMQM 5EAYA 3F8TA 4YHHQ 1Q46A 5G3LD 2PZUA 4LFCL 4LK1C 1LTTD 3N52A 3V96A 3SAWA 5KPTA 2Z6KA 3V05A 3Q8DA 3R2TA 3A56A 1K3RA 5DYGA 5IP7G 3HOVG 3HOZB 4U673 2EUCA 2V4DA 3EIEA 2A6HD 1XNRL 1PTOF 4HIDA 3R8BA 4XK8F 3KS8A 3PGZA 4HEDA 1S5BD 4BBSH 4IPCA 2WAQE 2F0FA 3L2AA 1VS0A 2DXIA 2CRUA 2WACA 1OFIA 5BR8Q 4HIOA 1B53A 4OX9L 1B9NA 2WB1E 4QHSA 4RF1A 2JZ0A 3HX3A 3RLNA 3HOUB 1HUNA 4R3DA 4F1IA 2OOBA 1KFVA 1IBKM 4AKGA 4DV6Q 4K0KQ 5KYLA 1B3AA 1PLFA 1II3A 3UI2A 3LWEA 2MROB 1ICFB 1TT2A 3B7QA 1PZJD 2RHSB 4B3TM 1XJVA 3HHZA 4L5RC 4DV7Q 5CR3A 1EOTA 1B1ZA 1K28A 4KHPQ 4N8FA 2KBNA 1SJHD 3G4SA 4GLVB 3X3NA 3MAQA 3AV0A 2CW0D 4H7BA 2QEXA 3B89A 3BDLA 4D80A 3U6CA 3C3EA 1Q3CA 3A8IE 3FRPB 5I2XA 3S2HB 1KAWA 5CBAE 3GLFA 3A55A 4WFN3 4IOCA 1U4LA 2NVYH 4BXXG 3HWSA 1EIJA 5M5YH 3AOEC 4JI6M 2XRSD 4GN5A 1FJGQ 3BS1A 2VS1A 1K3BC 5KO3A 2B2YA 2NVXB 2O5IC 4DR5L 2RKOA 2HIXA 3T1HM 3EVQA 4DR2M 3KBGA 4BBRH 1PJQA 1IL8A 4CBVA 1AZPA 1A2UA 1X3PA 1VQBA 1Y8GA 2YTXA 3GD7A 1NY4A 3I4NG 2F3IA 4RCOA 4K5WA 5J1ZA 2JA5G 3SEBA 3KF8B 3A45A 2DGYA 5C1BA 5FLXE 4DA2A 3Q8GA 1IXSB 2XWBB 5CV9A 2JWSA 4K2LA 1ENCA 1D0LA 4OHJA 5FOBB 2DZNB 1O7LA 3CQZB 4NSOB 3KOWE 3U61B 2ZXRA 2CUZA 1JC7A 1S5DD 2R93H 4Q5VA 3NP8A 4AYBB 2UUCM 2I46A 3RN5A 1MI2A 3ICEA 2Z4RA 1B2TA 1VCIA 1E32A 4GC9A 2UXDM 3UE0A 1E7ZA 2K50A 5I2YA 5A2QE 2XLJA 1EEFD 2JSOA 1QNUA 3PIP3 2IJ0A 1R2ZA 1LTLA 4KY6A 4GLXA 4CJ0B 1L1ZA 4X62Q 5C4XH 3E0EA 2H1EA 1I3QB 4RHSA 3RMHA 4ZQ3A 2ERCA 3BBZA 1KDBA 1RTNA 1Z47A 3DWQA 1R4QB 3M9BA 5ELEA 5KNDA 1I6VC 4B7FA 1OFHA 1Y8NB 2DENA 3HS0C 5KNBA 3TS2A 5C6AA 1NNUC 4Z9CB 2RSNA 3T6PA 2Z6KC 3SE0A 5KEEA 2Y0SE 4FDBA 4JW0A 5ITXA 1I4GA 1JOKA 5C44B 1R7RA 1WGLA 4MB7A 1Y1VG 4LJ4A 4JI7M 1NTGA 4M1UB 2HHHM 2E74C 2PQAB 3RZDB 1S40A 2ZJRA 3UGJA 3E46A 1N32L 2JQOA 4A3KH 4JI3Q 5HURA 1R6BX 3B74A 2NB0A 3MZ5A 4CKEA 1K82A 3H3VC 3AFQA 4A3CH 2X49A 4B3MM 3L3OC 4UDUC 3CC2A 1Z5AA 4PD2A 2B2WA 3MXPA 2CE7A 1NO1A 1N33M 1HT1E 2R46A 3FRIA 2E2JB 4DR3L 5M3MG 1H6UA 1IBML 2E2HB 2B2VA 4XXEA 4PDGA 3PIO3 4LF9L 4IFDI 2Q2IA 2UXCL 5IT9S 5D14A 2CWAA 4C3HG 4NP5A 1C7YA 3IFDA 4IUPA 2F4VL 4A4IA 1DO2A 1GL7A 4FO2A 4PZ6A 1CKNA 3TS0A 1XWIA 1PH8A 2HT1A 3CKIB 3MJ5A 1WD0A 1XMQL 1N34L 3S1NH 1JQJC 3SAUA 3ER0A 3K58A 2B3GA 4A3GG 3M4OB 2KCTA 3CCMA 4H0LC 4P75A 4IJLA 1AE2A 2AQ2B 1HQYE 4XBOA 3R2IA 1H9SA 1EZ6A 4CDDC 4IUUA 1EYAA 2R61A 3GLIB 3E3XA 3I3CA 2I7PA 4DK0A 5LMNQ 4ZRZA 3S1MB 2RKSA 3L2PA 1J6QA 2YTVA 4GKJM 5DAUA 3L28A 5JAVA 5I9OA 2E2IH 4FXDA 1AN8A 3QR8A 3E9SA 4TKOB 1QUTA 1FVIA 1PH4A 3E9IA 3VR2A 4E6IA 1SYFA 4JI2Q 3I4LA 5AJ3L 1D2BA 2CH4A 2EQSA 3QO2A 3WWVA 2Q2HA 1OIZA 4K5VA 4YCUA 4B3TL 1NV8A 1WHCA 2B3TA 1E2ZA 1OXVA 1XXHA 3BVZA 3DEPA 4ZK9B 2J7NA 2K01A 2I07B 3T56B 1BXTA 1LTID 1ASYA 3QWLA 4P73A 2NVQH 3LNNA 3HKZG 2VQEM 4X65L 4LF6M 3FE3A 1O80A 1YNJD 1OJLA 4D82A 3U60A 1CKMA 3P75A 4JBJA 1XWEA 4ILWA 4GKKQ 1G8ZD 1HH2P 3M7NA 1K3XA 4LZZA 5EPLA 3PUYA 5FTMA 2RCNA 4JI6L 4Z8XA 1IY1A 1V1QA 1IN4A 3JAML 2JNHA 5NUCA 2FJ2A 1SYGA 1BCPD 2CKZB 1J9OA 3HOZG 1GABA 2JUJA 5IREB 2NTSA 1IL2A 2DWNA 3T1HL 4A3DB 3NTHA 2HAKA 2XSZD 2BA1A 3J80S 2UXBQ 5JI3E 2IX0A 3I90A 1N36M 3NK9A 2JY8A 4DR7Q 1TKWB 3F2BA 3GPYA 3K0XA 2DAIA 1EE8A 4G7ZC 4DR1L 2B8GA 3CHBD 4M9SA 3HFZB 3Q24A 3FYCA 2OT2A 2F3VA 4OVZB 1LYLA 5FSWA 1F2LA 2JE6I 3HOUG 4NL4H 4AG6A 3T53B 2X6LA 1ENFA 3GQ5A 1CK1A 1QDTA 2YFQA 2D7EA 4RCNA 3VR6A 3CPFA 1C1KA 3PIPA 4R1JA 2ASBA 4A3BB 3HOYH 2EY1A 1XB2B 2K47A 1NSNS 5HY6A 1R5LA 1TWFB 1U9RA 4YCVA 4BWGB 3ZYYX 1U4RA 4ULLA 5C5LA 2FHTA 1B3QA 4A3JH 3OSOA 2C35B 1W2BA 3PNYA 1KDCA 3I4MH 2B2WC 5GROA 1UEBA 1TY2A 3ND9A 3ULJA 2HCCA 2QHOB 3N6RA 1DJRD 2JA8B 1PRTD 2VUMB 2KEEA 3GLFB 1I50B 4Y7NH 2M60A 4G4NA 1SNMA 1L1OB 1QQWA 3D0FA 4KJNA 1PFBA 4R4TA 2RCFA 3SK6A 2K03A 4EQNA 4WJ3M 3J81L 3M0EA 3AB9A 2F0MA 5EPKA 4LUVA 3SVMA 2IHEA 5ELFA 1EQVA 5LMUM 4R8NA 1V34A 2O4XA 2XTIA 1IN6A 3CC4A 4ZKCB 3FUTA 3SHFA 4L16A 3K7UC 3T51B 1PM5A 3SARA 1KIXA 1NY6A 3GO8A 3J7AS 1WTHA 2IY5B 4MGHA 2B63B 1IBKQ 1VMCA 2L11A 4GLAC 2F0PA 2YU9B 1A2TA 3FUWA 2JA9A 1V1PA 2G3QA 3QYEA 3AL0C 1PDQA 4GIPA 1LTSD 3U50C 4AYBG 4A3MH 2JJQA 1QUQA 1V8QA 4B9WA 1BNZA 1DCZA 5D65A 1GJTA 5M3FB 5EKLA 1Q02A 3AOGA 1PZKD 3IG5A 1VQHA 1K73C 2NVTB 3OTOQ 1LUZA 3D31A 3ULPA 3CF0A 3LGJA 1WCMH 4NDXA 4N8X1 4JI5M 1I4PA 1PFMA 3A8KE 5CV5A 2IX3A 2PMZE 2LHCA 3NXWA 1T3TA 5FTJA 1TWAH 4DV2Q 3S2DB 1VQ6A 2ZBKB 4HEOA 5EXPA 1Q12A 4R4CA 5IWAL 1C8CA 3HOXB 1A3UA 2WB1B 2ZANA 4HLQA 4LUOA 5EBDA 5IGDA 4ZPXA 4DUZL 5IT9c 3GTLB 3ZCBB 1MX0A 4F87A 2K5HA 4DR2Q 1XPRA 1G8PA 2NUCA 3TSSA 3W2DA 4A3IH 3HZXA 4DV5Q 3S15B 1VQDA 4II7A 1FGBD 3FP9A 4A3EB 1O7ZA 2A8VA 1JICA 4QUCA 4GKJL 3JAMi 4JBKA 5C44G 3KSXA 3KLSA 1H9RA 1L2FA 2I7NA 3KOYE 3PCOB 2L55A 3LCVB 3SK5A 1IBLL 2I5HA 2NN6G 2PI2E 3C3LA 4BY1B 3L27A 1BCPF 3I56A 4DK3C 1BKBA 3G6EA 4B7GA 1AP0A 4Y28F 1HZ9A 4AI6A 1BR9A 2WV6D 2R92B 1UE1A 3VDYA 3T13A 1SFOH 1OKSA 1ZYRC 2UUCQ 1Z5BA 1F77A 1YVCA 2MPMA 2RGHA 2Q2EB 4DK6C 2BCOA 3MHBA 4IIWA 4IALA 1F9PA 4QUFA 1EY5A 1EIHA 1EIYB 1ML0D 4LFCM 1I6HH 1WTVA 4QQBX 1EQTA 1GKIA 5ELBA 2DJGC 4K5XA 2QW7A 2QA4A 1EFID 1SLJA 3ERQA 3OHXC 2KHSA 1HA6A 1XNRM 4RF0A 2PO4A 2I5LX 3CW2C 3L9AX 5I9PA 4DKAC 1SMYD 2N78A 4DV4Q 1C0AA 1IW7C 3KF8A 1SBBB 4PT5A 3I4NB 4HTHA 1NNJA 2KOLA 1BDOA 1DZ1A 1V43A 4BXXH 1IXSA 3M85A 2KZUA 5ELNA 5CYUA 4OX9M 4HMJA 4LF8M 2HCBA 2QP9X 4GN3B 1N36L 3WOFA 3CCLA 5EQ0A 1LM0A 4JI1L 3JAME 3ZC7B 4LFBM 1OXXK 4POGA 3U61A 4BBAA 5ITRA 2R62A 2DAEA 3U9OA 5GAEC 1MJEA 4KN7C 1PYSB 4JI7Q 3R3OA 2XWJB 4GITA 1PRTF 2HHHQ 1NR4A 3HHXA 1TWGH 4ME3A 2ATWA 4JI4L 3J81i 4QF4A 2EJFC 4NXMQ 4KD4A 1HNZL 5JI2E 2CV0A 2SEBD 1STNA 4G4RA 1E24A 2IX1A 1DONA 4B3MQ 1Q3BA 3P20A 3IAYA 3AEVA 1F9RA 2CHBD 3SFZA 3BJUA 2BWEA 2B39A 3MC0B 5ITQA 1N33Q 5EXTA 2YYZA 4L5SA 2JN4A 3CF2A 1K83H 1RU3A 2WSCF 2EXZA 3PUWA 4X66Q 5J39A 3JC66 2UUAQ 1WR1B 4ME5A 1GUSA 1KQSA 2Y0SB 1D7QA 3DM3A 4KV6A 1EYCA 1KHIA 4LFAL 2HWJA 3HHWA 1SNDA 5JVH3 1ONLA 2ZT9C 3E5SA 3GTJH 1IXZA 5IP9G 4JI0Q 4YCWA 4EQPA 2VW9A 1VQKA 3TREA 4IUTA 1RHPA 4LF7M 4A3DG 2PQAA 1CHPD 2BOSA 2KENA 4B3RQ 1TIID 3OYYA 3LW5F 5FLMH 3CCEA 2CHGA 1CT1D 1HR0Q 1D5MC 4C3IB 3M4PA 1G71A 1V1OA 1UWVA 5EXSA 1HZAA 4YY3Q 2K05A 2YR0A 4B08A 4RFBA 3J81E 4JI8Q 1KRSA 1SXJE 2KCMA 2WIIB 1E3PA 2JZ1A 2ZJQA 1C4QA 1EL0A 5DNFA 3KW6A 4X3KA 1KSFX 2EA0A 3DFZA 1TF0B 4P16A 4KKTA 4EVOA 1Y1VH 2Y20A 3NELA 4IUQA 4A3BG 4BY7B 1HRJA 3GTPB 3FMCA 2ENBA 4KTAA 4LGMA 1AIPC 3RR5A 4L8RC 1A62A 1I5FA 3NPPA 4NKLA 4JV5Q 1BBUA 3J2PB 3JR5A 1OAOC 4LF6Q 1RF2D 2PPBC 3U5ZB 3RN2A 1UE5A 2TSSA 4JI5L 4FXGC 3GLIA 1NMGA 4M0DA 5FLXS 2N3SA 2JA8G 4QGUA 5M3MH 1NUCA 1NMFA 2VUMG 1VG5A 5JJZA 2DNAA 3A98B 4EX5A 2K75A 2C5RA 3STBC 2OWOA 2ZM6M 1C48A 4LNQA 5C3EB 2D7HA 3K5MA 4GMQA 3EIVA 2I5MX 5H1SE 1DGHB 1LLRD 1RL2A 5J22A 1AUAA 1A63A 5JJKA 2VB3X 1B50A 1TDZA 1EYDA 4DXGA 5A2QS 3S9WA 4K2KA 2L15A 2RGOA 1N32M 2F0JA 4A3GH 4CKBA 3KF6B 1S72A 2KNAA 3CTWB 4OL7A 5COYA 1X3QA 3GLHE 1SAPA 3S16B 4L4UA 2EO2A 4LCBA 3IHPA 1WYDA 4WP2A 3KOJA 4H44C 1SNCA 4KK7A 3EA6A 1I94Q 2Z3XA 2B63G 4LJ8A 3T1YQ 4J6HA 1ESRA 5TSSA 3D8LA 4RAUC 1SDFA 4DR3M 1W6JA 4HJ7A 1IBMM 3U6DA 3DOAA 4LF9M 3D4WA 2UXCM 4DNTB 4Z6YA 5K5PA 1BBXC 3FKIH 2F4VM 1Z6TA 1SNQA 2D0OA 1NV9A 1R4PB 4MTKA 5C0XJ 2C9CA 5M3FG 3TRZA 3K59A 1SXJD 1J5EL 1N34M 3CXCA 4LF5Q 1I4RA 3D8BA 3Q22A 3VR4A 3MFYA 3TP7A 2EVBA 5GADC 1ZMUA 1JWSD 4BA2I 2AHMA 1PTOC 1DGBA 1QVCA 1XTDA 1LT6D 3H15A 3HOXG 1ASZA 2EY2A 1LTGD 3HJSA 4DF7A 2WB1G 4C3JH 2UUBQ 1LTAD 4BBSB 2VL6A 1HNWM 5KNCA 1G6ZA 1X6OA 2QCUA 2VZAA 2JA6H 3PO3B 1VQEA 4RHRA 2D0PA 1CSQA 4B3SQ 4OVZA 1HXYD 4V190 3LCUA 3FTEA 5DNYA 1HA5A 1FGUA 2IHFA 4I65A 4RKBA 3W3AA 4LF8L 4MZ9A 1MSGA 4A3EG 1UUPA 4LFBL 2FS1A 1O7YA 4FF1A 3QAUA 3FTFA 4P2CB 4C1NK 1YHAA 4K6DA 3CCJA 2ZJPA 5LMUQ 3GLGE 2OCEA 3GQ3A 3K57A 3TDQA 4MN3A 2MJ8A 1PJTA 3UMMA 1RJTA 2N55A 3T4AC 1GUWA 4I81A 2HUGA 2A6ED 1LT4D 2F0OA 2K32A 5C5MA 3HY5A 4BY1G 1L0XB 3GTOH 2LXEA 4X65M 2OOAA 2RQXA 4GC5A 2PNRC 3THGA 3NTIA 1WOCA 4JI3L 2R92G 3HOUH 3L29A 4CGYB 4FNFA 3C3DA 5F2DA 1MIUA 2Z7JA 2LVNC 2FMMA 4DUYM 1DOKA 2A68C 1SN8A 1YE9A 3VK7A 1L1OA 4A3LG 2D5DA 4NSRA 3A7LA 3NTKA 1STHA 5JEAG 3GP1A 2QILA 4NB3A 1YNXA 4KLNA 4X3TA 1Z59A 3C46A 2GQFA 1UE6A 1DV0A 4FYDA 1YHBA 4BA1I 3AQQA 3RLOA 3RGPA 1F4IA 1F2MA 3FUVA 2B2TA 3TQSA 4JOIA 3OW7A 3BXWA 3K1JA 1Z7TA 5KPZA 4LF7L 1UM8A 1RD9D 1IYJB 1AEXA 4DR1M 5M5XH 3SAVA 2K5NA 2K5VA 2X6GA 2Z4HA 3GPPA 3BZDB 3GTMB 2DY7A 2IWHA 3I70A 3UK6A 2NVXH 5D3DA 1W6KA 2KJXA 4IJFA 4MHEA 4IFDG 1EY8A 4CDFC 4TUWA 2DAMA 2MO1A 4DFAA 3NUCA 1QZHA 1VEJA 2R93B 2JY7A 3C1FA 1NE3A 3DWPA 5GQOA 2C99A 3HOWH 3ONAB 3J7YW 2EYPA 3CPWA 2KECA 4K8JA 3W1BA 5M5WH 1YNND 3E4RA 1CFMA 4NW2A 3HKPA 2R7ZH 4DR4Q 4MTNA 3M4YA 4KMUC 4R8IA 5IIFA 2B63H 1GUOA 4ALPA 2QCPX 1PH5A 1EYGA 5L8RF 2K9DA 3CCUA 2O2LD 1WJJA 1PTOB 2F52A 5C18A 3NSWA 1FYCA 3KXEC 2V1CA 4YWLA 4CDEC 1F2ZA 1LTMA 1XTCD 3EJIA 1OTCA 4LFCQ 4CHTB 1WFQA 2Y0SG 4GOPC 2TMPA 5ELDA 1NR2A 3IL8A 3RD4A 1STEA 1TY0A 3PSIA 1WTXA 1XNRQ 4LJ7A 4AQYM 3SASA 4L5TA 1JORA 4QHTA 3H4JA 1STAA 3K8AA 5IT9L 2ZM6L 2PCFB 3SATA 4MGKE 4LJ6A 2F0QA 4APVA 1YSYA 5EBCA 1S5CD 5CV8A 4QB4A 3PUVA 4OX9Q 3A8JE 4WW0A 1G2SA 4A3KB 4C3IG 1PH7A 4ANRA 4LGYA 3CP0A 4I8OA 1K8AC 5IYCH 3K7AB 2JA7H 3MHVC 3IKJA 2A6HC 1M90C 4DR7L 1SE8A 2MQHA 1WTPA 2A69D 1J09A 3OMCA 4FW9A 2LNHC 3OMGA 5FJ8H 3WHKA 3KP1E 5FO7B 2JXNA 2Q2UA 4Q7JA 2V1UA 3AYHB 4P74A 5C44H 3UDXA 3K5LA 2X8AA 3AJIB 4BY7G 4PCZA 1RKNA 1WTQA 4IBEA 2F4IA 2K0BX 2QKIC 1NJFA 1GVNA 4G3OA 2R3ZA 1Q8KA 4HIKA 2DAKA 3OIPA 3FUUA 1EFWA 4FCVA 2YV5A 1L2BA 5IWAM 4JK1C 4JPBW 2R7FA 1X54A 4TVAB 1Q86C 2BDOA 2EY5A 1QUSA 3MWYW 5JPNC 4K8IA 1DOMA 2EYMA 1DOLA 4DUZM 4JYAQ 3W68A 5EP3A 5ITUA 2BWBA 1Z6HA 2N49A 3FVQA 4DR5Q 4GH9A 1L1OC 2JXMB 5IYDG 2E2HH 2CW0C 1L0WA 1LV7A 5J3BA 5K36G 1HTPA 2DHYA 1SEBD 2LMCB 4GN4B 1F9QA 2EYJA 3PF5A 3FPUB 1HNWL 4RH6A 1VQLA 4QY7A 1TH3A 5C3EG 2XH9A 4I7AA 3R9XB 2CQAA 3SMPA 1PV4A 1EY7A 1LABA 1SR3A 1QCBD 2B2TC 2LXKA 4XGIA 5ELCA 4NRVA 4JOIC 2RBMA 2G5DA 2ZXOA 1PA6A 1IBLM 1RODA 3PO2H 4A93B 4W5WA 5FKAC 4X64L 2F0GA 1GLNA 2KHIA 5EGTA 3I8ZA 1IHZA 4WJ4A 3QIAA 3CF6E 3NQTA 4DBGB 2JA2A 3NBXX 1X37A 4DV0M 4IZ8A 4O0AA 5KYIA 2JP1A 4HJ5A 1ICWA 2QGQA 3HGBA 3BOSA 4LJAA 3UE1A 3K0YA 2CQOA 1OXTA 2F0HA 1TQOA 2L0CA 3KOXE 5CC4A 3VYRA 3UDGA 1SYCA 4AKHA 3M7GA 1QYRA 4DUYL 4POFA 5KGUA 1DM0B 4PMCA 3J7ZC 1WD1A 4GOPB 1YJNA 1HT2E 3MTSA 4ZLTF 3WHLA 1A8VA 1OO9B 4LG2A 1WGNA 2XN9C 4A3FB 2E5LQ 2APLA 5DFLA 1X3GA 3QJYA 3GTKH 5ELOA 1CQFA 1L1TA 1IN7A 4IBGA 2AUJD 4V0BA 1WVLA 3BDOA 2D7GA 4BBSG 4L15A 4JI1M 2V1CC 3PO3G 3H4MA 5EPJA 4G4OA 2NZ1D 3HKZE 2IPKD 4C1NI 2NWGA 4OO1H 3I91A 1QZGA 2F5SA 1Y1WH 1YZ6A 2EIFA 3GRUA 3CD6A 1KAAA 4HIMA 4A76A 3FRHA 3Q6SA 4QIWE 1UFZA 1NVMA 4JI4M 2L4EA 1UNSA 1OXSC 2EYFA 2SOBA 4DV1Q 2EZVA 1N32Q 4A75A 1HNZM 3A0JA 4OEMB 1P3QQ 1ESFA 1ILQA 2GN5A 1DD2A 3ZJYC 1GD7A 1QVGA 4HJ8A 4FWGA 2N88A 2LHGA 4C2MB 1YLAA 2XFTA 3U5ZA 2M9VA 2J5YA 5E4WC 3BYYB 1G3IA 4PNYA 1U4PA 3SDZA 4A3JB 2P5TA 4LF9Q 2F1MA 2UXCQ 1Y14B 1STGA 3H09A 3QG1A 3H3VH 3HU2A 4O42A 1TTEA 1CKOA 1D1KA 3MFGA 2F4VQ 4PQXA 4DR6Q 2O01F 1F9SA 4LFAM 1J7KA 2K4KA 3AU7A 3TEHB 5CMDA 1XMQQ 4NC6A 1N34Q 2LVQD 1E22A 4A3BH 4K6LA 1DGHA 4NMZA 3KP0E 1G59A 3TWKA 4KKUA 1VQOA 4DGZA 4DAYB 1V9PA 3GLHB 3BZKA 4OONA 2UU9L 3KUPA 5CV4A 3KF6A 4AQYL 3RFWA 1ET6A 1HTLD 1BOSA 3SHGB 4GNXC 4EIWA 2H1RA 1VQAA 2BE5D 1QAMA 1F2YA 2WP8J 2JA8H 3LQRA 4OWXB 1EWHA 4KHZA 1QDRA 4DV4L 5IZ7D 1I50H 2DNCA 2PNHA 2VQFL 1L8QA 1GJXA 3U4VA 4DAMA 3FPPA 5AJ3Q 4QOSA 3MXNB 5IT9E 1TR8A 1L2CA 2A73B 3RGSA 1I4XA 2FFJA 1BUVT 4KLKA 1GKHA 4R4OA 2R93G 3OWEB 4UY8C 4B3TQ 4A3MB 3TZUA 1ENAA 2Z9HA 1QILA 4LMQD 4QMGA 2WSEF 3M3YB 2F0WA 5DM73 3QOJA 4KD3A 2KNZA 3HJ8A 4JC0A 4KJOA 4OGQC 4XYQA 4DV7M 3GTQB 3W0FA 2H5XA 4KHPM 1JR0D 1UEAB 1VQJA 2R18A 2D9UA 2QZ4A 2RVLA 3S1QB 4NXML 1Y8OB 2WAQB 4QL5A 1IY2A 2MGSA 5C4ZA 1S5FD 3DWAA 4UN2B 1PJIA 4JI6Q 5C0XH 3TZDA 1PH9A 2XRQD 1EWCA 2F03A 2M2LA 1BO0A 3J81S 1NJIC 2XZFA 1YNJC 3GLGB 2VF7A 2PW5A 3H0GB 1FJGM 3VYTA 5M3FH 3T1HQ 3JR4A 2QDLA 3BYTB 3A74A 4IBCA 2E75C 1QJOA 2RSOA 3D3RA 4YIJA 1D6EC 1D8LA 2K33A 4XTCS 1YHQA 1EZ8A 2K04A 1QG7A 1E94E 4JXJA 2A19A 5IP7H 1QOHA 4OIJA 3CF5A 4HJAA 3HOVH 4NPSA 1GHJA 2NYZD 2ZTDA 4JI0L 2K52A 3S2DH 1G6PA 5IGCA 3FTCA 2Q8IB 3A5UA 4M9ZA 4A3KG 4MGYE 1BCPC 5FTLA 1E1OA 1NSFA 3FUXA 4B3RL 1A6XA 1HNXL 2H4OA 1SSOA 2F0IA 3ERSX 2A1AA 4FF2A 3VKHA 1VEKA 4DPGA 3Q0AA 3MXGA 3GRRA 3AKZA 1SFOB 4NXNL 4LF4L 4IPHA 4DV0L 2KA6B 2ZTEA 4YY3L 5C4JH 1XNQL 1MKHA 5ITYA 3G7LA 4OXPA 2UXDQ 1PGYA 2DHRA 1J5EM 1EFUB 2RA4A 1HQRD 1TS2A 4RGMA 2EPBA 3GQBA 3MEHA 4RG1A 3S1RB 1OTRA 1IZ6A 2DNEA 4F7XA 2AQ3B 4BY1H 1DO0A 2MNAA 2WKDA 2MUYA 1IQPA 1W3SA 1GUNA 2SNMA 3UZUA 4LJ5A 5EKIA 2R65A 3K5OA 3RNUA 4JV5L 4RKUF 2R4EA 1X9NA 5EP2A 3LMMA 1MD2D 3PMFA 4A3LH 4GNXB 4RKLA 5BN4A 3PF4A 2KDLA 1PHJA 2CWPA 2VB2X 4ABNA 1LV9A 4RA8A 3G71A 1E2WA 1TWCH 1B70B 1PRTC 2F0KA 1JOOA 4UP7A 5L37A 4DAVA 5F3WA 1TWGB 2FH0A 2RHQB 1GJSA 1KDAA 5EKKA 3J80c 1JR3A 4A93G 3I4NH 1D5XC 2CHQA 1VEGA 4PMBA 1Q82C 2JA5H 4HCSA 2L7IA 3K9OA 2G9DA 4LWCA 3J7AV 4JI3M 1X65A 2QPAA 2K5DA 3TMEA 4ITQA 4CJ1B 3GV6A 3OIQA 3W67A 4ZUJA 1SE3A 2FOIC 4EQOA 3MK6A 1YUBA 4AZFA 4IPGA 3G48A 3SHLA 3S14B 1I94L 3K2LA 1H9KA 1EIFA 5FO9B 4CJ2C 4XT1B 2KRKA 1HUMA 2W82A 1OQYA 1XMOL 4FVMA 4BLCA 2DN8A 5JPMC 1VQCA 3M4QA 1EEID 1NNXA 3GTJB 1QZEA 2QNJA 1FNWA 1TWHH 3RZOH 4J15A 2EDGA 2J7OA 1R4GA 3W5OA 4DV3L 4QOZC 1VQ4A 4A3FG 1R9TB 2QQ8A 1TS3A 3TP6A 3T16A 4DUZQ 1VQMA 4YHHL 4YWMA 2CH4W 3NBHB 1K8GA 2XIWA 4CISA 5ITTA 3HG9A 1BCPB 1Q1EA 5T1GA 4AG5A 4GKJQ 4OW0A 5IY0A 2NQ8C 4M9XA 1CUKA 5LMNM 1S3OA 2BDNA 1XXGA 1S3SA 3VFDA 1FR3A 3U6QA 1H9JA 2K6BA 3S24A 3D4RA 4B3SL 3DHQA 4IJHA 4MGZE 4K14A 5BR8L 1HZBA 2G8LA 1IBLQ 3GTGB 4DN4M 1KNEA 1S4ZA 4DNIA 3I04M 4K0KL 4DV6L 1GVPA 4FCTA 3IECA 2J4XA 2F0EA 3TP8A 4LRSA 4PZ7A 4C3IH 1ZXTA 5GAHC 3DLLA 3NBIA 5IODA 3R8FA 3I7FA 1YJWA 2VQEQ 4A3JG 4A3VB 4DV7L 1TDHA 3DXJC 3UDFA 4KHPL 4DU9A 1JJGA 3SK4A 3S17H 1IXRA 5JJIA 2A5YB 1ZEQX 2F5QA 4FD2A 3KVWA 2VNUD 4I4LA 1GOZA 1VQPA 2XEPA 2ZAOA 5FTKA 1VQ5A 3H91A 4KI0A 1B44D 4BY7H 1LTBD 2Z1CA 4C3HH 5IGBA 1IN8A 1NJGA 2DY8A 4R7GA 2K14A 1WJ7A 2KUMA 3GRYA 4QNMA 1FJGL 2EYHA 4WRDA 1ORYB 3F1ZA 3Q8XA 1N36Q 1LACA 1PRTB 4IBDA 4JI1Q 2UXBM 2HL7A 2ZXPA 2F0DA 1B9MA 3F2DA 2LWXA 4KHVA 1G4AE 4DR7M 5BN3A 3VDUA 5K36H 1QAOA 1PFSA 1SMYC 3EQLC 2FXQA 1AFPA 3E6ZX 1CA6A 3HU1A 4OO1I 1VF7A 2O5JC 3GLFE 2OEOA 3OW2A 5HGTA 1VDLA 2HDLA 2R45A 3VLFB 4A3MG 4FXKC 1E9RA 5KPRA 3FKIB 4C56C 2CCZA 3MVVA 3R93A 4KT0F 1VQFA 1DXMA 4GOPA 2OO9A 3KLRA 1W5SA 2KEDA 4B7HA 5EXXA 3S16H 4FWHA 4EQ5A 3AFHA 2KXEA 2M5ZA 2QDBA 1XC8A 1VDZA 1JB3A 3I4YA 4HL4A 1PH6A 1JT8A 3B9PA 1BBWA 2WAQG 3BDCA 3I2ZA 1A5TA 3FYDA 1EY4A 5FK9C 5EJWA 2CHVA 2LH0A 4C3JB 2PYKA 2OPFA 2JA6B 2Q2TA 4X62L 2N35A 4QCLA 1TR5A 1VMPA 4S3SA 3H0GG 3PVSA 1WXQA 3QYBA 4DAPA 4M0WA 2SNSA 3MMPA 3TPZA 2LXJA 3IG8A 4H13C 3P7JA 3HOZH 4X64M 5IE8A 2CEAA 4I5SA 2F5OA 1JJ2A 4I7ZC 1L2DA 3PQIA 4H02A 2K6AA 2WINB 4XQNA 3RE8A 2MO0A 3PO3H 2KCCA 3GTOB 2QBYB 2B2UC 4G7OC 3I4VA 3F2CA 2EY6A 2L09A 1OXUA 1EU4A 3A5ZB 1KYIA 1G291 1P16A 2CWBA 4IQZA 3FHWA 3CCRA 2NVYB 4UPAA 5LL6S 1IFYA 1K9MC 2N8NA 2NTTA 1TH2A 4KY7A 5LMNW 3GQ4A 1GO5A 2JP7A 1SNOA 2MP1A 1MN3A 2L9HA 2F0SA 5I6WA 2DI0A 2G5GX 1AZQA 4IJEA 3SMSA 1VQGA 3VR3A 1SG9A 3KSJA 2ZAMA 3GLHA 1CSPA 1KLUD 1ZMWA 2XSCA 5AFWA 4DAYA 2OTLA 1JQYD 4JI5Q 5JEAJ 4WURA 1RTOA 4BBRB 2IW3A 2XFSA 3OTOM 3KDFA 3KYHC 5ITXE 2I0QA 3KLWA 2XGTA 1KNAA 2J7ZA 1IXRC 4DV2M 3S2HH 3TQYA 3MA2B 4LJ9A 5M5XB 3FTDA 3CMAA 1IYUA 1PXUA 1SE2A 4KKSA 3VA5A 3SGIA 2R6FA 3MXNA 4XDXA 4JYAL 3KFUG 5C0XI 2MFIA 3HU3A 3MXUA 1Z5CA 4HMIA 2A74C 4RGNA 4DV5M 3ZQJA 1QE6A 3A46A 1CQVA 3BVGA 1GUTA 1HZCA 5LMNL 2L6OA 1JOQA 3SYLA 3L0OA 1J8IA 3HOWB 1NCVA 1GO3E 4IFDJ 3HHYA 1GUGA 3BG3A 5M5YB 2BJWA 5IYBG 1K8OA 2PMZB 2DKLA 3TE6A 3NWTA 3VA7A 1G91A 5M5WB 4JI2L 2WKCA 2EXDA 4IBBA 3U4ZA 2R7ZB 3GTMH 2EYLA 4R71A 1Z9FA 3G6JB 4L5QA 2Q8RE 1HQMC 2O25A 2HD3A 3QB3A 1SMXA 2DWZB 3A54A 1JB0F 3PUXA 5C4XB 2LVOC 3CQZH 1VQ1A 1LT3D 5E6JA 3K6OA 4GHLA 1VQ9A 3L7ZC 2FNAA 2Z4SA 4F88A 5IOCA 1J5EQ 1PYWD 3GLGA 1HQCA 2MJ5B 4RMFA 4G4KA 2C96A 2PW7A 1GXDC 1PZID 2XGNA 1CZWA 1A3TA 2LVAA 3DMUA 3IFTA 3J7AF 4GKKL 2UU9M 1S5ED 3BZCA 4G57A 4FF4A 1P8LA 4MNOA 4JN6A 2CV2A 1JJCB 3NE5B 1IY0A 3DZDA 4D81A 4L6TB 5JJLA 1SXJC 5FLMG 1I3QH 4DV4M 1E9SA 1PTOH 5FLXc 2VQFM 2QENA 3MEFA 2E5LL 4LF8Q 4MM3B 1QANA 2Z8YM 1XXHE 2Z6BA 4J1MA 4RGOS 3W1GA 2DVWB 1PMRA 5ISRA 1YIJA 5EQTA 1T9HA 4LFBQ 2UXBL 2JA7B 5CGKA 2KEBA 3Q23A 4REZA 2ALYB 3UJNA 2FFKB 3VK8A 2X4AA 1STBA 3OOCA 4KN4C 1W5TA 3ULLA 1JB7A 1NAPA 1MJCA 1X56A 4J8QA 1JE5A 3K8ZA 3CU7A 2C9OA 1QB5D 3EFXD 1O7IA 1LT5D 4PDIA 3IRBA 1YJ9A 4G6ZA 3TBIB 2CFOA 4XQJA 2BJVA 1XPOA 4HCEA 3RZDH 2XVSA 4DV1L 1TS4A 3VDPA 5G3LF 3HGIA 4NXMM 5E4XA 2VF8A 2NN6H 1FNUA 1NHGC 3K7AH 1VQNA 1MGSA 3K5NA 3S1NB 3ND8A 1I4WA 3KS4A 3U6PA 4HAEA 3M6AA 2F0VA 2P5ZX 2A6EC 4X6AH 3ITPA 1PVOA 4GNXA 5JVG3 4BS9A 5IGEA 2E2JH 1YEZA 4PG3A 1HCZA 4X66M 2F0UA 3KFUA 4AH6A 1DGSA 3RUZA 1K3WA 2UUAM 1ET9A 3H6MA 1TU2B 2R6GA 2A5HA 2EKKA 1PRBA 1B8AA 3CCSA 4P72A 2E2IB 3SK8A 5DLQE 4LF7Q 3U6OA 4JI0M 2KQ3A 4GS3A 3BVMA 1YITA 1HFGA 2PZTA 1KD1C 1L0YB 1GM5A 1K8MA 4OWTB 3M4OH 3PO2B 2B8FA 5JOBA 4KODA 4B3RM 1I4HA 3HZJA 1HNXM 2YQZA 4LZJA 4P17A 1HR0M 3HJQA 4ID6A 3GV3A 3HEJA 5GAGC 3TN2A 4KY5A 2B2YC 3J80L 3KK7A 4NXNM 2F5NA 4LF4M 4LUZA 2NVQB 2O5RA 4ZYSA 3CAMA 3S1MH 4YY3M 2OQKA 3FKEA 1XNQM 7CATA 4O2DA 3X3MA 4JI8M 1D5ZC 4U68A 4MIUA 1K0SA 5LL6X 3FKIG 3H94A 1IBKL 1QVFA 3DM1A 3FEWX 1U4MA 5CBEE 1GHKA 4DK1A 4A93H 1DGGA 3OPOA 1JWMD 3EBEA 4G7HC 2L4NA 3U6SA 3VKGA 2XNAC 3F92A 1IM2A 3I51A 1LO5D 2HKJA 4IOAA 3V76A 3GO5A 3L26A 4HR7B 1HHVA 3CRLC 4HJ9A 3GTKB 4JV5M 1NHWC 2KHJA 5I6YA 4S12A 3NBHA 1RCVD 2MHVA 1YNNC 3OTOL 4C3JG 1KABA 4YWKA 2GVBA 4R4QA 3E0JA 1T5EA 1MU5A 1SXJB 2JA6G 3PNVA 1ZMVA 4DV2L 2E2DC 1NY5A 1VQIA 4Y52H 2Z0SA 2CVRA 2ZM6Q 2CP8A 4MGIE 1KTKA 2QSFX 2XSZA 2NZHA 1Y1WB 2XF3A 4UP9A 3WDNA 4F2LA 2Y0TA 4AKIA 3I55A 5CV6A 2DWLA 2HQLA 2Y21A 5IP9H 2BNKA 1EWIA 2MR9A 1KXLA 2WZJA 4ZKBB 3CCQA 4A3FH 1SROA 3NHHA 4RWSC 3EIHA 4DR2L 1Q81C 4JBMA 1G2TA 4A3DH 1D0MA 2YTYA 3DEOA 4DV5L 1JCKB 1VF5C 4TQUS 1SNPA 2KVMA 2ICIA 1H9MA 5E7NA 3QWNA 3HOYB 2WFWA 4JG2A 1QNKA 1ZYRD 1N78A 1G51A 3VR5A 4AIMA 2R7DA 3K9PA 2B29A 2HQEA 4DR3Q 1X3EA 2X69A 1EY0A 1IBMQ 3D6CA 1I94M 2Q8TA 3I4MB 3T1YM 4XT3B 5E3FA 1T5XD 1STYA 2OQ0A 1XMOM 4LJZC 1M1KC 1XX8A 2CFMA 3JAMS 1Q1BA 1Y69U 1SXTA 4IURA 4CJ6A 2RRUA 2KA7A 3A42A 3GDEA 4Y7NB 1Q8IA 1KC8C 4DV3M 2Z8LA 2UUCL 1I4QA 3T15A 1EOVA 2A69C 4TRDA 3C2PA 3K92A 1IW7D 2UXDL 1HJPA 3DA1A 3D4DA 1TWFH 4C2MH 4BBRG 4XYOA 2L5TA 1PJJA 4YHHM 3FD9A 1TS5A 8CATA 2AWNA 3B6YA 4EGVA 4LF5M 5KIXA 3LX0A 2KW0A 1PYBA 3KDFB 3ILKA 5H37D 2QEJC 3NQIA 5FTNA 1T43A 3CGWA 5I4DA 1HNWQ 1OIPA 4LW1A 1TGUA 1E2VA 2OQ4A 3SBJA 1N77A 2UUBM 2B2VC 3CMEA 1SJED 2VUMH 3W0LB 3E9HA 3HP3A 4FWDA 1TH4A 4JCVE 2OF1A 4OIKA 3U6EA 4B3SM 5KRUA 1O78A 3KJOA 3B7ZA 5BR8M 3QOLA 1MSHA 1N8RC 2Z4IA 3GP7A 1WTOA 4X64Q 2AKWB 3KDSE 4K0KM 1UAPA 4DV6M
chains in the Genus database with same CATH topology
2FINB 3CRKC 1DGFA 3FDTA 5KQ8A 2AWOA 3WOEA 1CI3M 2ID0A 2RDGA 3KLSX 1WCMB 4M8AA 5M9OA 4ZAIA 3U9SA 4IBKA 2XZUA 1TWAB 1TVXA 3J7BA 2F0NA 1LTRD 1EU3A 4X3UA 4XQQA 4PMWA 4LY6A 1IKLA 5C3WA 1IN5A 5LHY1 4F8MA 1AW7A 4L8JA 1EY6A 1XYIA 2RDHA 1B4OA 3TWMA 4A3IB 3ZH9B 3SXHA 3I73A 3SC3A 1JE4A 4TSSA 1E0BA 3PFIA 4FF3A 3HOVB 4NRWA 4RNAA 1SYBA 4AW4A 2QBYA 1D1IA 3VYUA 3D6WA 3J27B 2GA4B 2LKVA 2V6ZM 2IL8A 4ODGA 4WORA 3EROA 4GHAA 3C1EA 4RGTA 5C4JB 2LFNA 3LVWA 4ZUIA 1VDDA 1BF4A 5DYIA 1CTMA 2DWMA 2R4JA 3SYKA 4LAAA 1I6HB 2K7VA 3LVVA 4PV1C 3J80E 4HSVA 2K28A 4X3SA 1SE4A 4B9XA 2D2CC 4IBJA 2C98A 4DR4M 2M00A 4QNRA 1SYEA 3P1HA 3PV0A 3U6LA 4X62M 3F2UA 4WJWA 4OU7A 3TL4X 3VYSA 2K1BA 3GPXA 2DZOB 1EY9A 3O13A 4XIGS 3AMUA 2EE1A 4KO8A 5JEAH 4MH0E 3HRZC 1DYQA 2D62A 1TWCB 4N9TA 1QVRA 3KOZE 2L1BA 2F0LA 1ZAEA 4IUVA 4NOOB 3L25A 2EJGC 3U6MA 1M4VA 5C3XA 1ZKOA 3GPUA 2JA5B 4FCWA 2K5WA 4BB9A 2AUKA 5BN5A 5A35A 1H9SB 3KBXA 1JR3D 3TWLA 2BE5C 1IKMA 4DXFA 1HPCA 4DNRB 4IFDH 1D2NA 1K83B 3RLFA 1WTRA 3TP5A 1Y8PB 5D3IB 2F0TA 1M8AA 5KQDA 3URYA 3V2TA 1PTOD 2F3WA 5T1IA 3RZOB 1TWHB 1A15A 1GL6A 1CA5A 2C5CA 4IN3A 1XXHB 5EJCA 2Y0QA 5E26A 1G41A 2RDFA 2NN6I 4FP5D 2J0TD 2VIIA 3GRVA 4JYAM 2QF7A 3U60B 2EOTA 2KCNA 4DR5M 4OO1G 4R9WA 2B2UA 5DM63 2EYOA 1N75A 5FLXL 4L63B 1Q39A 1WTWA 2ICEC 4HSPA 5BPVA 2HDMA 2PQEA 2KRUA 1EIGA 1CZGA 4JI2M 1BQQT 1Y1VB 4O1NA 5GKNA 1QWYA 2A68D 5A2QL 2JEAI 1R2YA 3NWSA 3NWLA 1CHQD 4GRIA 1QAQA 3S17B 3A7AB 1ZQ9A 2FMCA 1FD7D 2VXWA 5M3MB 3AOEA 2F5PA 4GKKM 3T38A 2NBFA 5IGFA 3I72A 3PXGA 2EJMA 2HCIA 4C3HB 5FO8B 4L78A 1Q3LA 3DUZA 1XHBA 1MBYA 2JYOA 1CM9A 2E5LM 3OWFA 1RDPD 2KZSA 1X32A 4A3GB 1HFNA 5CORA 2LS01 3PUZA 3LWUA 2K5QA 2CV1A 2OXPA 1IYVA 2G9HD 4Q0FA 4N9PA 5C4HA 2JEBI 5EP4A 4CKCA 4DV1M 4HN7A 1FNVA 2AQ1B 1JWUD 4LRTA 1FNNA 4IBFA 5E1FA 3C58A 1A3VA 2L12A 5CV7A 4UAIA 2FE8A 1KLGD 3D8GA 1ILPA 2YNMD 2IT1A 5EP1A 2E76C 3LQQA 2LY7A 3HKZB 1QZMA 4IBIA 1PFNA 1SXJA 4JBWA 1Q90A 2L7HA 1SYDA 5C0XG 1V1PB 4IUNA 5IGGA 5DEHA 3SR1A 2SDFA 2BA0A 4DR6M 4GZYC 4QIWB 4G4QA 2PZWA 1XMQM 5G3LD 2PZUA 4LK1C 1LTTD 3N52A 3V96A 3SAWA 5KPTA 3V05A 3R2TA 3A56A 5DYGA 3HOZB 4U673 2EUCA 2V4DA 3EIEA 2A6HD 1PTOF 3R8BA 3KS8A 4HEDA 1S5BD 2F0FA 3L2AA 2DXIA 2WACA 1OFIA 1B53A 1B9NA 4QHSA 4RF1A 3HOUB 1HUNA 4R3DA 1IBKM 1KFVA 4AKGA 5KYLA 1B3AA 1PLFA 1II3A 3UI2A 3LWEA 1TT2A 1PZJD 4B3TM 3HHZA 5CR3A 1EOTA 1B1ZA 1SJHD 3X3NA 3MAQA 3AV0A 2CW0D 4H7BA 3BDLA 4D80A 3U6CA 1Q3CA 3A8IE 3FRPB 5I2XA 3S2HB 5CBAE 3GLFA 3A55A 4WFN3 1U4LA 3HWSA 3AOEC 4JI6M 2XRSD 3BS1A 5KO3A 2B2YA 2NVXB 2O5IC 2RKOA 3T1HM 3EVQA 4DR2M 3KBGA 1IL8A 4CBVA 1AZPA 1A2UA 1X3PA 3GD7A 4RCOA 4K5WA 5J1ZA 3SEBA 3A45A 5C1BA 5FLXE 4DA2A 1IXSB 2XWBB 5CV9A 4K2LA 1ENCA 4OHJA 5FOBB 2DZNB 1O7LA 3CQZB 4NSOB 3KOWE 3U61B 2ZXRA 2CUZA 1JC7A 1S5DD 4Q5VA 3NP8A 4AYBB 2UUCM 2I46A 1MI2A 1B2TA 2Z4RA 1VCIA 1E32A 4GC9A 2UXDM 5I2YA 5A2QE 2XLJA 1EEFD 2JSOA 1QNUA 3PIP3 2IJ0A 1R2ZA 4KY6A 4CJ0B 1L1ZA 2H1EA 1I3QB 4RHSA 3RMHA 4ZQ3A 2ERCA 1KDBA 1RTNA 1Z47A 3DWQA 1R4QB 5ELEA 5KNDA 1I6VC 4B7FA 1OFHA 1Y8NB 3HS0C 5KNBA 5C6AA 1NNUC 4Z9CB 2RSNA 5KEEA 3SE0A 5ITXA 1I4GA 1JOKA 5C44B 1R7RA 4MB7A 4LJ4A 4JI7M 4M1UB 2HHHM 2E74C 3RZDB 3UGJA 5HURA 1R6BX 2NB0A 3MZ5A 4CKEA 1K82A 3H3VC 2X49A 4B3MM 3L3OC 4UDUC 1Z5AA 4PD2A 2B2WA 3MXPA 2CE7A 1N33M 1HT1E 2R46A 2E2JB 1H6UA 2E2HB 2B2VA 4XXEA 4PDGA 3PIO3 4IFDI 5IT9S 5D14A 4C3HG 4NP5A 3IFDA 4IUPA 1DO2A 1GL7A 4FO2A 1XWIA 3CKIB 3MJ5A 1WD0A 1JQJC 3SAUA 3K58A 3M4OB 4H0LC 2AQ2B 1HQYE 4XBOA 3R2IA 1H9SA 1EZ6A 4IUUA 1EYAA 2R61A 3GLIB 3I3CA 2I7PA 4DK0A 4ZRZA 3S1MB 2RKSA 4GKJM 5DAUA 3L28A 5JAVA 5I9OA 4FXDA 1AN8A 3E9SA 4TKOB 4E6IA 3VR2A 1SYFA 3I4LA 1D2BA 3QO2A 4K5VA 1OXVA 1E2ZA 3DEPA 4ZK9B 1XXHA 3BVZA 2J7NA 2K01A 2I07B 3T56B 1BXTA 1LTID 3QWLA 3LNNA 2VQEM 4LF6M 1O80A 1YNJD 1OJLA 4D82A 3U60A 3P75A 1XWEA 4ILWA 1G8ZD 3M7NA 1K3XA 4LZZA 5EPLA 3PUYA 5FTMA 4Z8XA 1IY1A 3JAML 1IN4A 5NUCA 2FJ2A 1SYGA 1BCPD 1J9OA 2NTSA 5IREB 2DWNA 4A3DB 3NTHA 2XSZD 2BA1A 3J80S 5JI3E 2IX0A 3I90A 1N36M 3NK9A 1TKWB 3GPYA 1EE8A 4G7ZC 2B8GA 3CHBD 4M9SA 3Q24A 3FYCA 2OT2A 2F3VA 4OVZB 2JE6I 5FSWA 1F2LA 4NL4H 4AG6A 3T53B 2X6LA 1ENFA 3GQ5A 1CK1A 2YFQA 2D7EA 4RCNA 3VR6A 1C1KA 4A3BB 2EY1A 2K47A 1NSNS 1TWFB 1U9RA 4BWGB 3ZYYX 1U4RA 4ULLA 5C5LA 2FHTA 3OSOA 3PNYA 1KDCA 2B2WC 3ND9A 1TY2A 2HCCA 3N6RA 1DJRD 2JA8B 1PRTD 2VUMB 2KEEA 3GLFB 1I50B 2M60A 4G4NA 1SNMA 1QQWA 4KJNA 1PFBA 3SK6A 2K03A 4EQNA 3J81L 3M0EA 3AB9A 2F0MA 5EPKA 3SVMA 5ELFA 1EQVA 5LMUM 4R8NA 2O4XA 1IN6A 4ZKCB 3FUTA 3SHFA 4L16A 3T51B 1PM5A 3SARA 1NY6A 3GO8A 3J7AS 4MGHA 2B63B 1VMCA 2L11A 2F0PA 2YU9B 1A2TA 3FUWA 1V1PA 3AL0C 1PDQA 4GIPA 1LTSD 1V8QA 4B9WA 1BNZA 1DCZA 5D65A 5M3FB 5EKLA 3AOGA 1PZKD 3IG5A 2NVTB 3D31A 3CF0A 5CV5A 4NDXA 4JI5M 1I4PA 1PFMA 3A8KE 2IX3A 3NXWA 1T3TA 5FTJA 3S2DB 2ZBKB 1C8CA 5EXPA 1Q12A 3HOXB 1A3UA 2WB1B 2ZANA 4HLQA 5EBDA 5IGDA 4ZPXA 3GTLB 3ZCBB 1MX0A 4F87A 1G8PA 2NUCA 3TSSA 3W2DA 3HZXA 3S15B 4II7A 1FGBD 4A3EB 1O7ZA 1JICA 4QUCA 3KSXA 3KLSA 1H9RA 2I7NA 3KOYE 2L55A 3SK5A 2NN6G 3C3LA 4BY1B 3L27A 1BCPF 4B7GA 1AP0A 4AI6A 1BR9A 2WV6D 2R92B 3T13A 1ZYRC 1Z5BA 1F77A 2MPMA 2RGHA 2Q2EB 2BCOA 3MHBA 4IIWA 4IALA 1F9PA 4QUFA 1EY5A 1EIHA 1ML0D 4LFCM 1WTVA 1EQTA 1GKIA 5ELBA 4K5XA 1EFID 3ERQA 3OHXC 2KHSA 1HA6A 1XNRM 4RF0A 2PO4A 3L9AX 5I9PA 1SMYD 1IW7C 3KF8A 1SBBB 4PT5A 3I4NB 4HTHA 1NNJA 2KOLA 1BDOA 1DZ1A 1V43A 3M85A 2KZUA 5CYUA 4OX9M 4HMJA 4LF8M 2HCBA 2QP9X 3WOFA 5EQ0A 3JAME 3ZC7B 4LFBM 1OXXK 3U61A 4BBAA 5ITRA 2R62A 3U9OA 4KN7C 3R3OA 2XWJB 4GITA 1PRTF 1NR4A 3HHXA 4QF4A 2EJFC 4KD4A 5JI2E 2CV0A 2SEBD 1STNA 4G4RA 2IX1A 1DONA 1Q3BA 3P20A 3IAYA 1F9RA 2CHBD 3SFZA 2B39A 3MC0B 5ITQA 5EXTA 2YYZA 3CF2A 2EXZA 3PUWA 5J39A 4ME5A 1GUSA 2Y0SB 4KV6A 1EYCA 3HHWA 1SNDA 5JVH3 1ONLA 2ZT9C 3E5SA 1IXZA 4EQPA 4IUTA 1RHPA 4LF7M 1CHPD 2BOSA 1TIID 2CHGA 1CT1D 1D5MC 4C3IB 1V1OA 5EXSA 2K05A 2YR0A 4B08A 4RFBA 3J81E 1SXJE 2WIIB 1C4QA 1EL0A 5DNFA 3KW6A 4X3KA 1KSFX 2EA0A 3DFZA 4P16A 4KKTA 4EVOA 2Y20A 4IUQA 4BY7B 1HRJA 3GTPB 3FMCA 2ENBA 4KTAA 4LGMA 4L8RC 4NKLA 3NPPA 3J2PB 3JR5A 1RF2D 2PPBC 3U5ZB 2TSSA 4FXGC 3GLIA 4M0DA 5FLXS 1NUCA 5JJZA 3A98B 2C5RA 2ZM6M 1C48A 5C3EB 2D7HA 3K5MA 4GMQA 1DGHB 1LLRD 5J22A 2VB3X 1B50A 1TDZA 1EYDA 4DXGA 5A2QS 3S9WA 4K2KA 2RGOA 1N32M 2F0JA 4CKBA 3CTWB 4OL7A 5COYA 1X3QA 1SAPA 3S16B 4L4UA 2EO2A 4LCBA 4H44C 1SNCA 4KK7A 3EA6A 2Z3XA 4LJ8A 4J6HA 1ESRA 5TSSA 3D8LA 4RAUC 1SDFA 4DR3M 1W6JA 1IBMM 3U6DA 3DOAA 4LF9M 3D4WA 2UXCM 4DNTB 4Z6YA 5K5PA 1BBXC 2F4VM 1Z6TA 1SNQA 1R4PB 5C0XJ 2C9CA 3K59A 1SXJD 1N34M 1I4RA 3D8BA 3Q22A 3VR4A 3MFYA 3TP7A 2EVBA 1JWSD 4BA2I 2AHMA 1PTOC 1DGBA 1LT6D 2EY2A 1LTGD 3HJSA 4DF7A 1LTAD 4BBSB 1HNWM 5KNCA 1G6ZA 2QCUA 3PO3B 4RHRA 4OVZA 1HXYD 4V190 5DNYA 3FTEA 1HA5A 4I65A 4RKBA 3W3AA 1MSGA 1UUPA 1O7YA 4FF1A 3QAUA 3FTFA 4P2CB 4C1NK 4K6DA 3GQ3A 3K57A 3TDQA 4MN3A 2MJ8A 3UMMA 1RJTA 2N55A 3T4AC 1GUWA 4I81A 2HUGA 2A6ED 1LT4D 2F0OA 2K32A 5C5MA 1L0XB 2LXEA 4X65M 2RQXA 4GC5A 2PNRC 3THGA 3NTIA 3L29A 4CGYB 4FNFA 5F2DA 2Z7JA 2FMMA 4DUYM 1DOKA 2A68C 1YE9A 3VK7A 2D5DA 4NSRA 3A7LA 3NTKA 1STHA 5JEAG 3GP1A 2QILA 4KLNA 4X3TA 1Z59A 3C46A 4FYDA 4BA1I 3RGPA 1F2MA 3FUVA 2B2TA 3TQSA 3OW7A 3K1JA 1Z7TA 5KPZA 1UM8A 1RD9D 1AEXA 4DR1M 3SAVA 2X6GA 2Z4HA 3GPPA 3BZDB 3GTMB 2DY7A 2IWHA 3I70A 3UK6A 5D3DA 1W6KA 2KJXA 4IJFA 4MHEA 4IFDG 1EY8A 4TUWA 4DFAA 3NUCA 2R93B 3C1FA 3DWPA 2C99A 3ONAB 3J7YW 2EYPA 2KECA 4K8JA 1YNND 3E4RA 1CFMA 4NW2A 3HKPA 3M4YA 4KMUC 4R8IA 5IIFA 1GUOA 2QCPX 2O2LD 1PTOB 5C18A 3NSWA 1FYCA 3KXEC 2V1CA 1F2ZA 3EJIA 1XTCD 4CHTB 2TMPA 5ELDA 1NR2A 3IL8A 3RD4A 1STEA 1TY0A 1WTXA 4LJ7A 4AQYM 3SASA 1JORA 4QHTA 1STAA 5IT9L 2PCFB 3SATA 4MGKE 4LJ6A 2F0QA 1YSYA 5EBCA 1S5CD 5CV8A 4QB4A 3PUVA 3A8JE 4WW0A 1G2SA 4A3KB 4C3IG 4LGYA 4I8OA 3K7AB 3MHVC 3IKJA 2A6HC 1WTPA 2A69D 1J09A 3OMCA 4FW9A 2LNHC 3OMGA 3WHKA 3KP1E 5FO7B 2V1UA 3K5LA 2X8AA 3AJIB 4PCZA 1RKNA 1WTQA 4IBEA 2F4IA 2QKIC 2R3ZA 1NJFA 1GVNA 3OIPA 3FUUA 4FCVA 1L2BA 5IWAM 4JK1C 2BDOA 2EY5A 5JPNC 3MWYW 4K8IA 1DOMA 2EYMA 1DOLA 4DUZM 5ITUA 5EP3A 3FVQA 1Z6HA 4GH9A 2JXMB 2CW0C 1LV7A 5K36G 1HTPA 1SEBD 2LMCB 1F9QA 2EYJA 3FPUB 4RH6A 1TH3A 2XH9A 3R9XB 2CQAA 3SMPA 1EY7A 1LABA 1QCBD 2B2TC 4XGIA 5ELCA 4NRVA 2RBMA 2ZXOA 1IBLM 1RODA 4A93B 4W5WA 5FKAC 2F0GA 1GLNA 5EGTA 3I8ZA 1IHZA 3QIAA 3CF6E 3NQTA 2JA2A 1X37A 4DV0M 4IZ8A 5KYIA 2JP1A 1ICWA 3HGBA 3BOSA 4LJAA 3K0YA 1OXTA 2F0HA 1TQOA 2L0CA 3KOXE 5CC4A 3VYRA 1SYCA 4AKHA 3M7GA 1QYRA 5KGUA 1DM0B 4PMCA 1WD1A 1HT2E 3MTSA 4ZLTF 3WHLA 2XN9C 1OO9B 4LG2A 4A3FB 3QJYA 1CQFA 1L1TA 1IN7A 4IBGA 2AUJD 4V0BA 1WVLA 3BDOA 2D7GA 4L15A 4JI1M 3H4MA 5EPJA 4G4OA 2NZ1D 2IPKD 4C1NI 2NWGA 4OO1H 3I91A 2F5SA 3GRUA 1KAAA 3Q6SA 1NVMA 4JI4M 1UNSA 2EYFA 1OXSC 2SOBA 2EZVA 1HNZM 1ESFA 1ILQA 1DD2A 4FWGA 2N88A 4C2MB 2XFTA 3U5ZA 2M9VA 5E4WC 3BYYB 1G3IA 4PNYA 1U4PA 3SDZA 4A3JB 2P5TA 2F1MA 1STGA 3H09A 3QG1A 3HU2A 4O42A 1D1KA 3MFGA 4PQXA 1F9SA 4LFAM 1J7KA 3AU7A 5CMDA 4K6LA 1DGHA 4NMZA 3KP0E 1G59A 3TWKA 4KKUA 4DGZA 3GLHB 3KUPA 5CV4A 3RFWA 1ET6A 1HTLD 1BOSA 3SHGB 4EIWA 2H1RA 2BE5D 1QAMA 1F2YA 2WP8J 3LQRA 1EWHA 4KHZA 5IZ7D 2DNCA 1L8QA 1GJXA 3FPPA 4QOSA 5IT9E 1L2CA 2A73B 3RGSA 2FFJA 1I4XA 1BUVT 3OWEB 4A3MB 3TZUA 1ENAA 1QILA 4LMQD 4QMGA 3M3YB 2F0WA 5DM73 3QOJA 4KD3A 3HJ8A 4OGQC 4KJOA 4XYQA 4DV7M 3GTQB 3W0FA 4KHPM 1JR0D 1UEAB 2D9UA 2RVLA 2R18A 3S1QB 2QZ4A 1Y8OB 2WAQB 1IY2A 2MGSA 5C4ZA 1S5FD 3DWAA 1PJIA 5C0XH 3TZDA 2XRQD 1EWCA 2F03A 2M2LA 1BO0A 3J81S 2XZFA 1YNJC 3GLGB 2PW5A 3H0GB 1FJGM 3VYTA 3JR4A 3BYTB 4IBCA 2E75C 1QJOA 2RSOA 3D3RA 4YIJA 1D6EC 2K33A 4XTCS 1EZ8A 2K04A 1QG7A 1E94E 4JXJA 1QOHA 4OIJA 1GHJA 2NYZD 5IGCA 3FTCA 2Q8IB 4M9ZA 4MGYE 1BCPC 5FTLA 1NSFA 3FUXA 1A6XA 2H4OA 1SSOA 2F0IA 4FF2A 3VKHA 3Q0AA 3MXGA 3GRRA 3AKZA 1SFOB 2KA6B 5ITYA 3G7LA 2DHRA 1J5EM 2RA4A 1HQRD 1TS2A 4RGMA 2EPBA 3GQBA 3MEHA 3S1RB 2DNEA 4F7XA 2AQ3B 1DO0A 2WKDA 2MUYA 1IQPA 1GUNA 2SNMA 3UZUA 4LJ5A 5EKIA 2R65A 3K5OA 2R4EA 5EP2A 3LMMA 1MD2D 3PMFA 4RKLA 5BN4A 2VB2X 4ABNA 1LV9A 4RA8A 1E2WA 1PRTC 2F0KA 1JOOA 4DAVA 5F3WA 1TWGB 5EKKA 1KDAA 1JR3A 1D5XC 2CHQA 4PMBA 4HCSA 2L7IA 2G9DA 3J7AV 4JI3M 2QPAA 2K5DA 3TMEA 4ITQA 4CJ1B 3GV6A 3OIQA 4ZUJA 1SE3A 2FOIC 4EQOA 3MK6A 1YUBA 4AZFA 3SHLA 3S14B 3K2LA 1H9KA 5FO9B 4CJ2C 4XT1B 2KRKA 1HUMA 2W82A 4FVMA 4BLCA 2DN8A 5JPMC 1EEID 3GTJB 1FNWA 2EDGA 2J7OA 4QOZC 1R9TB 1TS3A 3TP6A 3T16A 2XIWA 4CISA 5ITTA 3HG9A 1BCPB 1Q1EA 5T1GA 4AG5A 4OW0A 2NQ8C 4M9XA 5LMNM 2BDNA 1XXGA 1S3SA 3VFDA 1FR3A 3U6QA 1H9JA 3D4RA 3DHQA 4MGZE 4K14A 2G8LA 3GTGB 4DN4M 1KNEA 1S4ZA 4FCTA 2J4XA 2F0EA 3TP8A 4LRSA 1ZXTA 3NBIA 5IODA 3R8FA 4A3VB 1TDHA 3DXJC 4DU9A 3SK4A 2A5YB 1ZEQX 2F5QA 4FD2A 3KVWA 2VNUD 4I4LA 1GOZA 2XEPA 2ZAOA 5FTKA 3H91A 4KI0A 1B44D 1LTBD 2Z1CA 5IGBA 1IN8A 1NJGA 2DY8A 4R7GA 2KUMA 3GRYA 4QNMA 2EYHA 4WRDA 1ORYB 3Q8XA 1LACA 1PRTB 4IBDA 2UXBM 2HL7A 2ZXPA 2F0DA 1B9MA 2LWXA 4KHVA 1G4AE 4DR7M 5BN3A 3VDUA 5K36H 1QAOA 1SMYC 3EQLC 1AFPA 3E6ZX 1CA6A 3HU1A 4OO1I 1VF7A 2O5JC 2OEOA 5HGTA 2HDLA 2R45A 3VLFB 4FXKC 1E9RA 5KPRA 3FKIB 4C56C 3MVVA 3R93A 1DXMA 3KLRA 1W5SA 2KEDA 4B7HA 5EXXA 4FWHA 3AFHA 2KXEA 2M5ZA 2QDBA 1XC8A 1VDZA 1JB3A 3I4YA 4HL4A 3B9PA 3BDCA 3FYDA 1EY4A 5FK9C 5EJWA 2CHVA 2LH0A 4C3JB 2PYKA 2OPFA 2JA6B 4QCLA 1TR5A 1VMPA 4S3SA 3PVSA 1WXQA 4DAPA 4M0WA 2SNSA 3TPZA 3IG8A 4H13C 3P7JA 4X64M 2CEAA 4I5SA 2F5OA 4I7ZC 1L2DA 2K6AA 2WINB 4XQNA 3RE8A 2KCCA 3GTOB 2QBYB 2B2UC 4G7OC 3I4VA 2EY6A 2L09A 1OXUA 1EU4A 1KYIA 1G291 4IQZA 2NVYB 5LL6S 2NTTA 1TH2A 4KY7A 5M5YB 3GQ4A 2MP1A 1SNOA 5I6WA 2L9HA 2F0SA 2G5GX 1AZQA 4IJEA 3SMSA 3VR3A 4DAYA 3KSJA 2ZAMA 3GLHA 1KLUD 2XSCA 5AFWA 1JQYD 5JEAJ 4WURA 1RTOA 4BBRB 2IW3A 2XFSA 3OTOM 5ITXE 1KNAA 2J7ZA 1IXRC 4DV2M 3MA2B 4LJ9A 5M5XB 3FTDA 1IYUA 1PXUA 1SE2A 4KKSA 3VA5A 3MXNA 4XDXA 3KFUG 5C0XI 3HU3A 3MXUA 1Z5CA 4HMIA 2A74C 4RGNA 4DV5M 1QE6A 3A46A 1CQVA 3BVGA 1GUTA 2L6OA 1JOQA 3SYLA 1J8IA 3HOWB 1NCVA 4IFDJ 3HHYA 1GUGA 3BG3A 2BJWA 1K8OA 2PMZB 3TE6A 3NWTA 3VA7A 1G91A 5M5WB 2WKCA 4IBBA 2R7ZB 2EYLA 3G6JB 2Q8RE 1HQMC 3QB3A 2DWZB 3A54A 3PUXA 5C4XB 1LT3D 5E6JA 3K6OA 4GHLA 3L7ZC 2FNAA 2Z4SA 4F88A 5IOCA 1PYWD 3GLGA 1HQCA 4G4KA 2C96A 2PW7A 1GXDC 1PZID 2XGNA 1CZWA 1A3TA 3DMUA 3IFTA 3J7AF 2UU9M 1S5ED 4G57A 4FF4A 4JN6A 2CV2A 3NE5B 1IY0A 3DZDA 4D81A 4L6TB 1SXJC 4DV4M 1E9SA 1PTOH 2VQFM 2QENA 4MM3B 1QANA 4RGOS 4J1MA 2DVWB 1PMRA 5ISRA 5EQTA 2JA7B 5CGKA 2KEBA 3Q23A 4REZA 2FFKB 3UJNA 3VK8A 2X4AA 1STBA 3OOCA 4KN4C 1W5TA 1NAPA 4J8QA 3K8ZA 3CU7A 2C9OA 1QB5D 3EFXD 1LT5D 4PDIA 4G6ZA 3TBIB 2CFOA 4XQJA 2BJVA 4HCEA 2XVSA 1TS4A 3VDPA 5G3LF 3HGIA 4NXMM 5E4XA 2NN6H 1FNUA 1NHGC 1MGSA 3K5NA 3S1NB 3ND8A 1I4WA 3KS4A 3U6PA 4HAEA 3M6AA 2F0VA 2A6EC 3ITPA 5JVG3 4BS9A 5IGEA 1HCZA 4X66M 2F0UA 3RUZA 1K3WA 2UUAM 1ET9A 3H6MA 1TU2B 2R6GA 2A5HA 2E2IB 3SK8A 3U6OA 4JI0M 2KQ3A 3BVMA 1HFGA 2PZTA 1L0YB 1K8MA 3PO2B 2B8FA 5JOBA 4KODA 4B3RM 1I4HA 1HNXM 2YQZA 4LZJA 1HR0M 3HJQA 4ID6A 3GV3A 3HEJA 3TN2A 4KY5A 2B2YC 3J80L 3KK7A 4NXNM 2F5NA 4LF4M 2NVQB 2O5RA 4ZYSA 4YY3M 3FKEA 1XNQM 7CATA 3X3MA 4JI8M 1D5ZC 4U68A 4MIUA 5LL6X 3H94A 3DM1A 3FEWX 1U4MA 5CBEE 1GHKA 4DK1A 1DGGA 3OPOA 1JWMD 4G7HC 2L4NA 3U6SA 3VKGA 2XNAC 1LO5D 1IM2A 3I51A 2HKJA 3GO5A 3L26A 4HR7B 1HHVA 3CRLC 3GTKB 4JV5M 1NHWC 5I6YA 4S12A 3NBHA 1RCVD 2MHVA 1YNNC 4C3JG 1KABA 3E0JA 1T5EA 1MU5A 1SXJB 3PNVA 2E2DC 1NY5A 2CVRA 1Y1WB 4MGIE 1KTKA 2XSZA 2XF3A 3WDNA 2Y0TA 4AKIA 5CV6A 2DWLA 2Y21A 2BNKA 4ZKBB 3NHHA 4RWSC 3EIHA 1G2TA 3DEOA 1JCKB 1VF5C 4TQUS 1SNPA 2KVMA 2ICIA 1H9MA 3QWNA 3HOYB 1QNKA 1ZYRD 1N78A 3VR5A 2HQEA 2X69A 1EY0A 3D6CA 1I94M 2Q8TA 3I4MB 3T1YM 4XT3B 5E3FA 1T5XD 1STYA 4LJZC 1XMOM 1XX8A 3JAMS 1Q1BA 1Y69U 1SXTA 4IURA 2KA7A 4Y7NB 3A42A 1Q8IA 4DV3M 2Z8LA 1I4QA 3T15A 2A69C 4TRDA 3C2PA 3K92A 1IW7D 3D4DA 3DA1A 4XYOA 2L5TA 1PJJA 4YHHM 3FD9A 1TS5A 8CATA 2AWNA 4EGVA 4LF5M 5KIXA 3LX0A 2KW0A 3ILKA 5H37D 2QEJC 3NQIA 5FTNA 5I4DA 1TGUA 1E2VA 2OQ4A 3SBJA 1N77A 2UUBM 2B2VC 1SJED 3W0LB 3HP3A 4FWDA 1TH4A 2OF1A 4OIKA 3U6EA 4B3SM 5KRUA 1O78A 5BR8M 3QOLA 1MSHA 2Z4IA 3GP7A 1WTOA 3KDSE 4K0KM 1UAPA 4DV6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGY B;  4CHT B;  3NBI A; 
#chains in the Genus database with same CATH topology
 2FIN B;  3HOW G;  3CRK C;  1DGF A;  2R44 A;  3FDT A;  5KQ8 A;  2AWO A;  1K0R A;  3WOE A;  4JI7 L;  3I01 M;  4X65 Q;  2HHH L;  2R7Z G;  1CI3 M;  2ID0 A;  2EJS A;  2RDG A;  3KLS X;  1WCM B;  4M8A A;  5M9O A;  4ZAI A;  3U9S A;  4IBK A;  2XZU A;  1TWA B;  2HIV A;  1HR0 W;  1TVX A;  3PIO A;  3J7B A;  4DUY Q;  2YU9 H;  5C4X G;  2F0N A;  3J80 i;  1LTR D;  1EU3 A;  4X3U A;  4XQQ A;  4B3M L;  4PMW A;  4LY6 A;  1IKL A;  2NZO A;  5C3W A;  1PH1 A;  1IN5 A;  5LHY 1;  4F8M A;  1AW7 A;  4L8J A;  1EY6 A;  2L2D A;  1N33 L;  3J81 j;  1XYI A;  3M3Y H;  2RDH A;  1B4O A;  2BH8 A;  3TWM A;  4X66 L;  4A3I B;  4GEW A;  3ZH9 B;  3SXH A;  3GTQ H;  4AYB E;  2UUA L;  2NVT H;  3I73 A;  3SC3 A;  1JE4 A;  3S1Q H;  4TSS A;  1E0B A;  3PFI A;  1C9O A;  4IPD A;  4FF3 A;  3HOV B;  1T6O A;  1JR3 E;  4NRW A;  3HOX H;  4DR1 Q;  4RNA A;  1U0L A;  1SYB A;  4AW4 A;  2QBY A;  4OWW B;  2AHO B;  1D1I A;  2RF4 A;  3VYU A;  3D6W A;  5IYC G;  3J27 B;  2JA7 G;  3GTL H;  2GA4 B;  2LKV A;  2V6Z M;  2ES2 A;  4CIZ A;  2IL8 A;  2KNV A;  4A3C G;  3H0G H;  1HR0 L;  1YBY A;  4ODG A;  4WOR A;  3ERO A;  4GHA A;  3C1E A;  3S15 H;  4A3E H;  4RGT A;  5FJ8 G;  5C4J B;  2LFN A;  3LVW A;  4ZUI A;  1VDD A;  1D0K A;  1BF4 A;  5DYI A;  1CTM A;  2DWM A;  4JI8 L;  2R4J A;  1WIV A;  1AE3 A;  3SYK A;  4LAA A;  1I6H B;  2JY5 A;  2K7V A;  2OTJ A;  1E1T A;  3LVV A;  4PV1 C;  3J80 E;  4HSV A;  2K28 A;  4X3S A;  1SE4 A;  4B9X A;  2D2C C;  4IBJ A;  2C98 A;  2EKF A;  4DR4 M;  2M00 A;  4QNR A;  1SYE A;  3P1H A;  3PV0 A;  3U6L A;  3U58 A;  3EN2 A;  2DAG A;  2R92 H;  3STB D;  4X62 M;  3F2U A;  4WJW A;  1PH3 A;  3J7A 5;  1UE7 A;  2VQE L;  4LF6 L;  4OU7 A;  3TL4 X;  4UP8 A;  3VYS A;  2K1B A;  2GVA A;  3GPX A;  2DZO B;  1EY9 A;  3O13 A;  1PJS A;  4XIG S;  2EE1 A;  1BVS A;  3AMU A;  1KL9 A;  4KO8 A;  5JEA H;  4MH0 E;  2VY3 A;  3S1R H;  2UU9 Q;  2ZTC A;  4JVZ A;  4AQY Q;  3HRZ C;  1DYQ A;  2D62 A;  1TWC B;  4N9T A;  1QVR A;  4ZCK A;  3KOZ E;  3CCV A;  1X3F A;  2L1B A;  1CKN B;  1B7Y B;  2F0L A;  4R4I A;  1V92 A;  5HGQ A;  1ZAE A;  4IUV A;  4NOO B;  2VQF Q;  3L25 A;  2EJG C;  4QJF A;  3I4O A;  3PO2 G;  3U6M A;  2VDB B;  1M4V A;  5C3X A;  1ZKO A;  3GPU A;  2LBC A;  2JA5 B;  4FCW A;  2K5W A;  3BU2 A;  4BB9 A;  2AUK A;  5BN5 A;  5A35 A;  3E21 A;  1H9S B;  1NBW A;  2R0I A;  3KBX A;  1JR3 D;  3TWL A;  4PZ8 A;  2BE5 C;  1IKM A;  1Q7Y C;  4DXF A;  2JK8 A;  2MGW A;  3GLI E;  1HPC A;  4DNR B;  4DR6 L;  4IFD H;  1D2N A;  1K83 B;  3NEM A;  3RLF A;  2L4F A;  1WTR A;  3TP5 A;  3T1Y L;  1Y8P B;  5D3I B;  2F0T A;  1M8A A;  1A0I A;  5KQD A;  3URY A;  3V2T A;  5IYB H;  1PTO D;  2F3W A;  5T1I A;  1U5K A;  4IO9 A;  3RZO B;  1TWH B;  1A15 A;  1GL6 A;  5IWA Q;  2PI2 A;  4CDC C;  1CA5 A;  2C5C A;  4IN3 A;  1XXH B;  5EJC A;  2Y0Q A;  2DJF C;  5E26 A;  1G41 A;  2MH8 A;  1EQR A;  2RDF A;  2NN6 I;  1MJG M;  1XPU A;  4FP5 D;  1JMC A;  4LF5 L;  2J0T D;  3K81 C;  4UHV A;  3S14 H;  2VII A;  3JAM c;  1AH9 A;  3GRV A;  4JYA M;  2QF7 A;  3U60 B;  1SRU A;  2EOT A;  2KCN A;  4DR5 M;  3KJP A;  4OO1 G;  4R9W A;  2B2U A;  1Y1W G;  5DM6 3;  1V33 A;  2EYO A;  1N75 A;  3UDI A;  2UUB L;  5FLX L;  4L63 B;  1Q39 A;  1WTW A;  2ICE C;  4HSP A;  2E8G A;  2AMC B;  3CC7 A;  5BPV A;  1R9T H;  2HDM A;  2PQE A;  2KRU A;  1EIG A;  1CZG A;  4JI2 M;  1BQQ T;  1Y1V B;  1HNX Q;  1YI2 A;  3HOY G;  4O1N A;  5LMU L;  5GKN A;  1QWY A;  4NXN Q;  4LF4 Q;  2A68 D;  4DV0 Q;  5A2Q L;  1VQ8 A;  2JEA I;  1R2Y A;  2DZL A;  1XNQ Q;  3HKS A;  2LSS A;  3NWS A;  3NWL A;  1EUJ A;  3I4M G;  1CHQ D;  4GRI A;  1QAQ A;  3S17 B;  3A7A B;  1ZQ9 A;  2FMC A;  1FD7 D;  3GTG H;  2VXW A;  5M3M B;  2KHH A;  1VQ7 A;  2GNO A;  3AOE A;  2F5P A;  4GKK M;  3T38 A;  2LVP C;  2NBF A;  5IGF A;  1KRT A;  3I72 A;  3PXG A;  2EJM A;  2HCI A;  4C3H B;  5FO8 B;  3GTP H;  4L78 A;  3AFP A;  1Q3L A;  3DUZ A;  1XHB A;  1WI5 A;  1MBY A;  1ZV1 A;  2JYO A;  1CM9 A;  2E5L M;  3OWF A;  1RDP D;  4OEL B;  2KZS A;  1X32 A;  4A3G B;  1H95 A;  2DUD A;  1PH2 A;  1FL0 A;  1HFN A;  5IYD H;  5COR A;  3J81 c;  2LS0 1;  3PUZ A;  2JY6 B;  3LWU A;  4P71 A;  1RIP A;  1TXY A;  2K5Q A;  2CV1 A;  5C3E H;  2OXP A;  4JI4 Q;  1IYV A;  2G9H D;  4Q0F A;  4N9P A;  2BH2 A;  5C4H A;  4L6V 6;  1OAI A;  1HNZ Q;  2JEB I;  5EP4 A;  4CKC A;  4DV1 M;  4HN7 A;  1FNV A;  2AQ1 B;  1JWU D;  2LTU A;  4LRT A;  1FNN A;  4IBF A;  5E1F A;  3C58 A;  1A3V A;  2WSF F;  3C9P A;  2L12 A;  5CV7 A;  4UAI A;  2FE8 A;  1KLG D;  1WCM G;  3D8G A;  1ILP A;  2YNM D;  2IT1 A;  5EP1 A;  2E76 C;  3LQQ A;  3B7N A;  2LY7 A;  3HKZ B;  1QZM A;  4IBI A;  1PFN A;  1XMO Q;  3NEN A;  1SXJ A;  1EQQ A;  4JBW A;  1Q90 A;  2L7H A;  4DR4 L;  1SYD A;  5C0X G;  4LFA Q;  1V1P B;  4IUN A;  5IGG A;  5DEH A;  1X55 A;  3SR1 A;  2SDF A;  2BA0 A;  4DV3 Q;  4DR6 M;  3H3V I;  4QIW B;  4GZY C;  1N9W A;  1MHW C;  1QUQ B;  4G4Q A;  2PZW A;  3K80 C;  4A3I G;  1XMQ M;  5EAY A;  3F8T A;  4YHH Q;  1Q46 A;  5G3L D;  2PZU A;  4LFC L;  4LK1 C;  1LTT D;  3N52 A;  3V96 A;  3SAW A;  5KPT A;  2Z6K A;  3V05 A;  3Q8D A;  3R2T A;  3A56 A;  1K3R A;  5DYG A;  5IP7 G;  3HOV G;  3HOZ B;  4U67 3;  2EUC A;  2V4D A;  3EIE A;  2A6H D;  1XNR L;  1PTO F;  4HID A;  3R8B A;  4XK8 F;  3KS8 A;  3PGZ A;  4HED A;  1S5B D;  4BBS H;  4IPC A;  2WAQ E;  2F0F A;  3L2A A;  1VS0 A;  2DXI A;  2CRU A;  2WAC A;  1OFI A;  5BR8 Q;  4HIO A;  1B53 A;  4OX9 L;  1B9N A;  2WB1 E;  4QHS A;  4RF1 A;  2JZ0 A;  3HX3 A;  3RLN A;  3HOU B;  1HUN A;  4R3D A;  4F1I A;  2OOB A;  1KFV A;  1IBK M;  4AKG A;  4DV6 Q;  4K0K Q;  5KYL A;  1B3A A;  1PLF A;  1II3 A;  3UI2 A;  3LWE A;  2MRO B;  1ICF B;  1TT2 A;  3B7Q A;  1PZJ D;  2RHS B;  4B3T M;  1XJV A;  3HHZ A;  4L5R C;  4DV7 Q;  5CR3 A;  1EOT A;  1B1Z A;  1K28 A;  4KHP Q;  4N8F A;  2KBN A;  1SJH D;  3G4S A;  4GLV B;  3X3N A;  3MAQ A;  3AV0 A;  2CW0 D;  4H7B A;  2QEX A;  3B89 A;  3BDL A;  4D80 A;  3U6C A;  3C3E A;  1Q3C A;  3A8I E;  3FRP B;  5I2X A;  3S2H B;  1KAW A;  5CBA E;  3GLF A;  3A55 A;  4WFN 3;  4IOC A;  1U4L A;  2NVY H;  4BXX G;  3HWS A;  1EIJ A;  5M5Y H;  3AOE C;  4JI6 M;  2XRS D;  4GN5 A;  1FJG Q;  3BS1 A;  2VS1 A;  1K3B C;  5KO3 A;  2B2Y A;  2NVX B;  2O5I C;  4DR5 L;  2RKO A;  2HIX A;  3T1H M;  3EVQ A;  4DR2 M;  3KBG A;  4BBR H;  1PJQ A;  1IL8 A;  4CBV A;  1AZP A;  1A2U A;  1X3P A;  1VQB A;  1Y8G A;  2YTX A;  3GD7 A;  1NY4 A;  3I4N G;  2F3I A;  4RCO A;  4K5W A;  5J1Z A;  2JA5 G;  3SEB A;  3KF8 B;  3A45 A;  2DGY A;  5C1B A;  5FLX E;  4DA2 A;  3Q8G A;  1IXS B;  2XWB B;  5CV9 A;  2JWS A;  4K2L A;  1ENC A;  1D0L A;  4OHJ A;  5FOB B;  2DZN B;  1O7L A;  3CQZ B;  4NSO B;  3KOW E;  3U61 B;  2ZXR A;  2CUZ A;  1JC7 A;  1S5D D;  2R93 H;  4Q5V A;  3NP8 A;  4AYB B;  2UUC M;  2I46 A;  3RN5 A;  1MI2 A;  3ICE A;  2Z4R A;  1B2T A;  1VCI A;  1E32 A;  4GC9 A;  2UXD M;  3UE0 A;  1E7Z A;  2K50 A;  5I2Y A;  5A2Q E;  2XLJ A;  1EEF D;  2JSO A;  1QNU A;  3PIP 3;  2IJ0 A;  1R2Z A;  1LTL A;  4KY6 A;  4GLX A;  4CJ0 B;  1L1Z A;  4X62 Q;  5C4X H;  3E0E A;  2H1E A;  1I3Q B;  4RHS A;  3RMH A;  4ZQ3 A;  2ERC A;  3BBZ A;  1KDB A;  1RTN A;  1Z47 A;  3DWQ A;  1R4Q B;  3M9B A;  5ELE A;  5KND A;  1I6V C;  4B7F A;  1OFH A;  1Y8N B;  2DEN A;  3HS0 C;  5KNB A;  3TS2 A;  5C6A A;  1NNU C;  4Z9C B;  2RSN A;  3T6P A;  2Z6K C;  3SE0 A;  5KEE A;  2Y0S E;  4FDB A;  4JW0 A;  5ITX A;  1I4G A;  1JOK A;  5C44 B;  1R7R A;  1WGL A;  4MB7 A;  1Y1V G;  4LJ4 A;  4JI7 M;  1NTG A;  4M1U B;  2HHH M;  2E74 C;  2PQA B;  3RZD B;  1S40 A;  2ZJR A;  3UGJ A;  3E46 A;  1N32 L;  2JQO A;  4A3K H;  4JI3 Q;  5HUR A;  1R6B X;  3B74 A;  2NB0 A;  3MZ5 A;  4CKE A;  1K82 A;  3H3V C;  3AFQ A;  4A3C H;  2X49 A;  4B3M M;  3L3O C;  4UDU C;  3CC2 A;  1Z5A A;  4PD2 A;  2B2W A;  3MXP A;  2CE7 A;  1NO1 A;  1N33 M;  1HT1 E;  2R46 A;  3FRI A;  2E2J B;  4DR3 L;  5M3M G;  1H6U A;  1IBM L;  2E2H B;  2B2V A;  4XXE A;  4PDG A;  3PIO 3;  4LF9 L;  4IFD I;  2Q2I A;  2UXC L;  5IT9 S;  5D14 A;  2CWA A;  4C3H G;  4NP5 A;  1C7Y A;  3IFD A;  4IUP A;  2F4V L;  4A4I A;  1DO2 A;  1GL7 A;  4FO2 A;  4PZ6 A;  1CKN A;  3TS0 A;  1XWI A;  1PH8 A;  2HT1 A;  3CKI B;  3MJ5 A;  1WD0 A;  1XMQ L;  1N34 L;  3S1N H;  1JQJ C;  3SAU A;  3ER0 A;  3K58 A;  2B3G A;  4A3G G;  3M4O B;  2KCT A;  3CCM A;  4H0L C;  4P75 A;  4IJL A;  1AE2 A;  2AQ2 B;  1HQY E;  4XBO A;  3R2I A;  1H9S A;  1EZ6 A;  4CDD C;  4IUU A;  1EYA A;  2R61 A;  3GLI B;  3E3X A;  3I3C A;  2I7P A;  4DK0 A;  5LMN Q;  4ZRZ A;  3S1M B;  2RKS A;  3L2P A;  1J6Q A;  2YTV A;  4GKJ M;  5DAU A;  3L28 A;  5JAV A;  5I9O A;  2E2I H;  4FXD A;  1AN8 A;  3QR8 A;  3E9S A;  4TKO B;  1QUT A;  1FVI A;  1PH4 A;  3E9I A;  3VR2 A;  4E6I A;  1SYF A;  4JI2 Q;  3I4L A;  5AJ3 L;  1D2B A;  2CH4 A;  2EQS A;  3QO2 A;  3WWV A;  2Q2H A;  1OIZ A;  4K5V A;  4YCU A;  4B3T L;  1NV8 A;  1WHC A;  2B3T A;  1E2Z A;  1OXV A;  1XXH A;  3BVZ A;  3DEP A;  4ZK9 B;  2J7N A;  2K01 A;  2I07 B;  3T56 B;  1BXT A;  1LTI D;  1ASY A;  3QWL A;  4P73 A;  2NVQ H;  3LNN A;  3HKZ G;  2VQE M;  4X65 L;  4LF6 M;  3FE3 A;  1O80 A;  1YNJ D;  1OJL A;  4D82 A;  3U60 A;  1CKM A;  3P75 A;  4JBJ A;  1XWE A;  4ILW A;  4GKK Q;  1G8Z D;  1HH2 P;  3M7N A;  1K3X A;  4LZZ A;  5EPL A;  3PUY A;  5FTM A;  2RCN A;  4JI6 L;  4Z8X A;  1IY1 A;  1V1Q A;  1IN4 A;  3JAM L;  2JNH A;  5NUC A;  2FJ2 A;  1SYG A;  1BCP D;  2CKZ B;  1J9O A;  3HOZ G;  1GAB A;  2JUJ A;  5IRE B;  2NTS A;  1IL2 A;  2DWN A;  3T1H L;  4A3D B;  3NTH A;  2HAK A;  2XSZ D;  2BA1 A;  3J80 S;  2UXB Q;  5JI3 E;  2IX0 A;  3I90 A;  1N36 M;  3NK9 A;  2JY8 A;  4DR7 Q;  1TKW B;  3F2B A;  3GPY A;  3K0X A;  2DAI A;  1EE8 A;  4G7Z C;  4DR1 L;  2B8G A;  3CHB D;  4M9S A;  3HFZ B;  3Q24 A;  3FYC A;  2OT2 A;  2F3V A;  4OVZ B;  1LYL A;  5FSW A;  1F2L A;  2JE6 I;  3HOU G;  4NL4 H;  4AG6 A;  3T53 B;  2X6L A;  1ENF A;  3GQ5 A;  1CK1 A;  1QDT A;  2YFQ A;  2D7E A;  4RCN A;  3VR6 A;  3CPF A;  1C1K A;  3PIP A;  4R1J A;  2ASB A;  4A3B B;  3HOY H;  2EY1 A;  1XB2 B;  2K47 A;  1NSN S;  5HY6 A;  1R5L A;  1TWF B;  1U9R A;  4YCV A;  4BWG B;  3ZYY X;  1U4R A;  4ULL A;  5C5L A;  2FHT A;  1B3Q A;  4A3J H;  3OSO A;  2C35 B;  1W2B A;  3PNY A;  1KDC A;  3I4M H;  2B2W C;  5GRO A;  1UEB A;  1TY2 A;  3ND9 A;  3ULJ A;  2HCC A;  2QHO B;  3N6R A;  1DJR D;  2JA8 B;  1PRT D;  2VUM B;  2KEE A;  3GLF B;  1I50 B;  4Y7N H;  2M60 A;  4G4N A;  1SNM A;  1L1O B;  1QQW A;  3D0F A;  4KJN A;  1PFB A;  4R4T A;  2RCF A;  3SK6 A;  2K03 A;  4EQN A;  4WJ3 M;  3J81 L;  3M0E A;  3AB9 A;  2F0M A;  5EPK A;  4LUV A;  3SVM A;  2IHE A;  5ELF A;  1EQV A;  5LMU M;  4R8N A;  1V34 A;  2O4X A;  2XTI A;  1IN6 A;  3CC4 A;  4ZKC B;  3FUT A;  3SHF A;  4L16 A;  3K7U C;  3T51 B;  1PM5 A;  3SAR A;  1KIX A;  1NY6 A;  3GO8 A;  3J7A S;  1WTH A;  2IY5 B;  4MGH A;  2B63 B;  1IBK Q;  1VMC A;  2L11 A;  4GLA C;  2F0P A;  2YU9 B;  1A2T A;  3FUW A;  2JA9 A;  1V1P A;  2G3Q A;  3QYE A;  3AL0 C;  1PDQ A;  4GIP A;  1LTS D;  3U50 C;  4AYB G;  4A3M H;  2JJQ A;  1QUQ A;  1V8Q A;  4B9W A;  1BNZ A;  1DCZ A;  5D65 A;  1GJT A;  5M3F B;  5EKL A;  1Q02 A;  3AOG A;  1PZK D;  3IG5 A;  1VQH A;  1K73 C;  2NVT B;  3OTO Q;  1LUZ A;  3D31 A;  3ULP A;  3CF0 A;  3LGJ A;  1WCM H;  4NDX A;  4N8X 1;  4JI5 M;  1I4P A;  1PFM A;  3A8K E;  5CV5 A;  2IX3 A;  2PMZ E;  2LHC A;  3NXW A;  1T3T A;  5FTJ A;  1TWA H;  4DV2 Q;  3S2D B;  1VQ6 A;  2ZBK B;  4HEO A;  5EXP A;  1Q12 A;  4R4C A;  5IWA L;  1C8C A;  3HOX B;  1A3U A;  2WB1 B;  2ZAN A;  4HLQ A;  4LUO A;  5EBD A;  5IGD A;  4ZPX A;  4DUZ L;  5IT9 c;  3GTL B;  3ZCB B;  1MX0 A;  4F87 A;  2K5H A;  4DR2 Q;  1XPR A;  1G8P A;  2NUC A;  3TSS A;  3W2D A;  4A3I H;  3HZX A;  4DV5 Q;  3S15 B;  1VQD A;  4II7 A;  1FGB D;  3FP9 A;  4A3E B;  1O7Z A;  2A8V A;  1JIC A;  4QUC A;  4GKJ L;  3JAM i;  4JBK A;  5C44 G;  3KSX A;  3KLS A;  1H9R A;  1L2F A;  2I7N A;  3KOY E;  3PCO B;  2L55 A;  3LCV B;  3SK5 A;  1IBL L;  2I5H A;  2NN6 G;  2PI2 E;  3C3L A;  4BY1 B;  3L27 A;  1BCP F;  3I56 A;  4DK3 C;  1BKB A;  3G6E A;  4B7G A;  1AP0 A;  4Y28 F;  1HZ9 A;  4AI6 A;  1BR9 A;  2WV6 D;  2R92 B;  1UE1 A;  3VDY A;  3T13 A;  1SFO H;  1OKS A;  1ZYR C;  2UUC Q;  1Z5B A;  1F77 A;  1YVC A;  2MPM A;  2RGH A;  2Q2E B;  4DK6 C;  2BCO A;  3MHB A;  4IIW A;  4IAL A;  1F9P A;  4QUF A;  1EY5 A;  1EIH A;  1EIY B;  1ML0 D;  4LFC M;  1I6H H;  1WTV A;  4QQB X;  1EQT A;  1GKI A;  5ELB A;  2DJG C;  4K5X A;  2QW7 A;  2QA4 A;  1EFI D;  1SLJ A;  3ERQ A;  3OHX C;  2KHS A;  1HA6 A;  1XNR M;  4RF0 A;  2PO4 A;  2I5L X;  3CW2 C;  3L9A X;  5I9P A;  4DKA C;  1SMY D;  2N78 A;  4DV4 Q;  1C0A A;  1IW7 C;  3KF8 A;  1SBB B;  4PT5 A;  3I4N B;  4HTH A;  1NNJ A;  2KOL A;  1BDO A;  1DZ1 A;  1V43 A;  4BXX H;  1IXS A;  3M85 A;  2KZU A;  5ELN A;  5CYU A;  4OX9 M;  4HMJ A;  4LF8 M;  2HCB A;  2QP9 X;  4GN3 B;  1N36 L;  3WOF A;  3CCL A;  5EQ0 A;  1LM0 A;  4JI1 L;  3JAM E;  3ZC7 B;  4LFB M;  1OXX K;  4POG A;  3U61 A;  4BBA A;  5ITR A;  2R62 A;  2DAE A;  3U9O A;  5GAE C;  1MJE A;  4KN7 C;  1PYS B;  4JI7 Q;  3R3O A;  2XWJ B;  4GIT A;  1PRT F;  2HHH Q;  1NR4 A;  3HHX A;  1TWG H;  4ME3 A;  2ATW A;  4JI4 L;  3J81 i;  4QF4 A;  2EJF C;  4NXM Q;  4KD4 A;  1HNZ L;  5JI2 E;  2CV0 A;  2SEB D;  1STN A;  4G4R A;  1E24 A;  2IX1 A;  1DON A;  4B3M Q;  1Q3B A;  3P20 A;  3IAY A;  3AEV A;  1F9R A;  2CHB D;  3SFZ A;  3BJU A;  2BWE A;  2B39 A;  3MC0 B;  5ITQ A;  1N33 Q;  5EXT A;  2YYZ A;  4L5S A;  2JN4 A;  3CF2 A;  1K83 H;  1RU3 A;  2WSC F;  2EXZ A;  3PUW A;  4X66 Q;  5J39 A;  3JC6 6;  2UUA Q;  1WR1 B;  4ME5 A;  1GUS A;  1KQS A;  2Y0S B;  1D7Q A;  3DM3 A;  4KV6 A;  1EYC A;  1KHI A;  4LFA L;  2HWJ A;  3HHW A;  1SND A;  5JVH 3;  1ONL A;  2ZT9 C;  3E5S A;  3GTJ H;  1IXZ A;  5IP9 G;  4JI0 Q;  4YCW A;  4EQP A;  2VW9 A;  1VQK A;  3TRE A;  4IUT A;  1RHP A;  4LF7 M;  4A3D G;  2PQA A;  1CHP D;  2BOS A;  2KEN A;  4B3R Q;  1TII D;  3OYY A;  3LW5 F;  5FLM H;  3CCE A;  2CHG A;  1CT1 D;  1HR0 Q;  1D5M C;  4C3I B;  3M4P A;  1G71 A;  1V1O A;  1UWV A;  5EXS A;  1HZA A;  4YY3 Q;  2K05 A;  2YR0 A;  4B08 A;  4RFB A;  3J81 E;  4JI8 Q;  1KRS A;  1SXJ E;  2KCM A;  2WII B;  1E3P A;  2JZ1 A;  2ZJQ A;  1C4Q A;  1EL0 A;  5DNF A;  3KW6 A;  4X3K A;  1KSF X;  2EA0 A;  3DFZ A;  1TF0 B;  4P16 A;  4KKT A;  4EVO A;  1Y1V H;  2Y20 A;  3NEL A;  4IUQ A;  4A3B G;  4BY7 B;  1HRJ A;  3GTP B;  3FMC A;  2ENB A;  4KTA A;  4LGM A;  1AIP C;  3RR5 A;  4L8R C;  1A62 A;  1I5F A;  3NPP A;  4NKL A;  4JV5 Q;  1BBU A;  3J2P B;  3JR5 A;  1OAO C;  4LF6 Q;  1RF2 D;  2PPB C;  3U5Z B;  3RN2 A;  1UE5 A;  2TSS A;  4JI5 L;  4FXG C;  3GLI A;  1NMG A;  4M0D A;  5FLX S;  2N3S A;  2JA8 G;  4QGU A;  5M3M H;  1NUC A;  1NMF A;  2VUM G;  1VG5 A;  5JJZ A;  2DNA A;  3A98 B;  4EX5 A;  2K75 A;  2C5R A;  3STB C;  2OWO A;  2ZM6 M;  1C48 A;  4LNQ A;  5C3E B;  2D7H A;  3K5M A;  4GMQ A;  3EIV A;  2I5M X;  5H1S E;  1DGH B;  1LLR D;  1RL2 A;  5J22 A;  1AUA A;  1A63 A;  5JJK A;  2VB3 X;  1B50 A;  1TDZ A;  1EYD A;  4DXG A;  5A2Q S;  3S9W A;  4K2K A;  2L15 A;  2RGO A;  1N32 M;  2F0J A;  4A3G H;  4CKB A;  3KF6 B;  1S72 A;  2KNA A;  3CTW B;  4OL7 A;  5COY A;  1X3Q A;  3GLH E;  1SAP A;  3S16 B;  4L4U A;  2EO2 A;  4LCB A;  3IHP A;  1WYD A;  4WP2 A;  3KOJ A;  4H44 C;  1SNC A;  4KK7 A;  3EA6 A;  1I94 Q;  2Z3X A;  2B63 G;  4LJ8 A;  3T1Y Q;  4J6H A;  1ESR A;  5TSS A;  3D8L A;  4RAU C;  1SDF A;  4DR3 M;  1W6J A;  4HJ7 A;  1IBM M;  3U6D A;  3DOA A;  4LF9 M;  3D4W A;  2UXC M;  4DNT B;  4Z6Y A;  5K5P A;  1BBX C;  3FKI H;  2F4V M;  1Z6T A;  1SNQ A;  2D0O A;  1NV9 A;  1R4P B;  4MTK A;  5C0X J;  2C9C A;  5M3F G;  3TRZ A;  3K59 A;  1SXJ D;  1J5E L;  1N34 M;  3CXC A;  4LF5 Q;  1I4R A;  3D8B A;  3Q22 A;  3VR4 A;  3MFY A;  3TP7 A;  2EVB A;  5GAD C;  1ZMU A;  1JWS D;  4BA2 I;  2AHM A;  1PTO C;  1DGB A;  1QVC A;  1XTD A;  1LT6 D;  3H15 A;  3HOX G;  1ASZ A;  2EY2 A;  1LTG D;  3HJS A;  4DF7 A;  2WB1 G;  4C3J H;  2UUB Q;  1LTA D;  4BBS B;  2VL6 A;  1HNW M;  5KNC A;  1G6Z A;  1X6O A;  2QCU A;  2VZA A;  2JA6 H;  3PO3 B;  1VQE A;  4RHR A;  2D0P A;  1CSQ A;  4B3S Q;  4OVZ A;  1HXY D;  4V19 0;  3LCU A;  3FTE A;  5DNY A;  1HA5 A;  1FGU A;  2IHF A;  4I65 A;  4RKB A;  3W3A A;  4LF8 L;  4MZ9 A;  1MSG A;  4A3E G;  1UUP A;  4LFB L;  2FS1 A;  1O7Y A;  4FF1 A;  3QAU A;  3FTF A;  4P2C B;  4C1N K;  1YHA A;  4K6D A;  3CCJ A;  2ZJP A;  5LMU Q;  3GLG E;  2OCE A;  3GQ3 A;  3K57 A;  3TDQ A;  4MN3 A;  2MJ8 A;  1PJT A;  3UMM A;  1RJT A;  2N55 A;  3T4A C;  1GUW A;  4I81 A;  2HUG A;  2A6E D;  1LT4 D;  2F0O A;  2K32 A;  5C5M A;  3HY5 A;  4BY1 G;  1L0X B;  3GTO H;  2LXE A;  4X65 M;  2OOA A;  2RQX A;  4GC5 A;  2PNR C;  3THG A;  3NTI A;  1WOC A;  4JI3 L;  2R92 G;  3HOU H;  3L29 A;  4CGY B;  4FNF A;  3C3D A;  5F2D A;  1MIU A;  2Z7J A;  2LVN C;  2FMM A;  4DUY M;  1DOK A;  2A68 C;  1SN8 A;  1YE9 A;  3VK7 A;  1L1O A;  4A3L G;  2D5D A;  4NSR A;  3A7L A;  3NTK A;  1STH A;  5JEA G;  3GP1 A;  2QIL A;  4NB3 A;  1YNX A;  4KLN A;  4X3T A;  1Z59 A;  3C46 A;  2GQF A;  1UE6 A;  1DV0 A;  4FYD A;  1YHB A;  4BA1 I;  3AQQ A;  3RLO A;  3RGP A;  1F4I A;  1F2M A;  3FUV A;  2B2T A;  3TQS A;  4JOI A;  3OW7 A;  3BXW A;  3K1J A;  1Z7T A;  5KPZ A;  4LF7 L;  1UM8 A;  1RD9 D;  1IYJ B;  1AEX A;  4DR1 M;  5M5X H;  3SAV A;  2K5N A;  2K5V A;  2X6G A;  2Z4H A;  3GPP A;  3BZD B;  3GTM B;  2DY7 A;  2IWH A;  3I70 A;  3UK6 A;  2NVX H;  5D3D A;  1W6K A;  2KJX A;  4IJF A;  4MHE A;  4IFD G;  1EY8 A;  4CDF C;  4TUW A;  2DAM A;  2MO1 A;  4DFA A;  3NUC A;  1QZH A;  1VEJ A;  2R93 B;  2JY7 A;  3C1F A;  1NE3 A;  3DWP A;  5GQO A;  2C99 A;  3HOW H;  3ONA B;  3J7Y W;  2EYP A;  3CPW A;  2KEC A;  4K8J A;  3W1B A;  5M5W H;  1YNN D;  3E4R A;  1CFM A;  4NW2 A;  3HKP A;  2R7Z H;  4DR4 Q;  4MTN A;  3M4Y A;  4KMU C;  4R8I A;  5IIF A;  2B63 H;  1GUO A;  4ALP A;  2QCP X;  1PH5 A;  1EYG A;  5L8R F;  2K9D A;  3CCU A;  2O2L D;  1WJJ A;  1PTO B;  2F52 A;  5C18 A;  3NSW A;  1FYC A;  3KXE C;  2V1C A;  4YWL A;  4CDE C;  1F2Z A;  1LTM A;  1XTC D;  3EJI A;  1OTC A;  4LFC Q;  4CHT B;  1WFQ A;  2Y0S G;  4GOP C;  2TMP A;  5ELD A;  1NR2 A;  3IL8 A;  3RD4 A;  1STE A;  1TY0 A;  3PSI A;  1WTX A;  1XNR Q;  4LJ7 A;  4AQY M;  3SAS A;  4L5T A;  1JOR A;  4QHT A;  3H4J A;  1STA A;  3K8A A;  5IT9 L;  2ZM6 L;  2PCF B;  3SAT A;  4MGK E;  4LJ6 A;  2F0Q A;  4APV A;  1YSY A;  5EBC A;  1S5C D;  5CV8 A;  4QB4 A;  3PUV A;  4OX9 Q;  3A8J E;  4WW0 A;  1G2S A;  4A3K B;  4C3I G;  1PH7 A;  4ANR A;  4LGY A;  3CP0 A;  4I8O A;  1K8A C;  5IYC H;  3K7A B;  2JA7 H;  3MHV C;  3IKJ A;  2A6H C;  1M90 C;  4DR7 L;  1SE8 A;  2MQH A;  1WTP A;  2A69 D;  1J09 A;  3OMC A;  4FW9 A;  2LNH C;  3OMG A;  5FJ8 H;  3WHK A;  3KP1 E;  5FO7 B;  2JXN A;  2Q2U A;  4Q7J A;  2V1U A;  3AYH B;  4P74 A;  5C44 H;  3UDX A;  3K5L A;  2X8A A;  3AJI B;  4BY7 G;  4PCZ A;  1RKN A;  1WTQ A;  4IBE A;  2F4I A;  2K0B X;  2QKI C;  1NJF A;  1GVN A;  4G3O A;  2R3Z A;  1Q8K A;  4HIK A;  2DAK A;  3OIP A;  3FUU A;  1EFW A;  4FCV A;  2YV5 A;  1L2B A;  5IWA M;  4JK1 C;  4JPB W;  2R7F A;  1X54 A;  4TVA B;  1Q86 C;  2BDO A;  2EY5 A;  1QUS A;  3MWY W;  5JPN C;  4K8I A;  1DOM A;  2EYM A;  1DOL A;  4DUZ M;  4JYA Q;  3W68 A;  5EP3 A;  5ITU A;  2BWB A;  1Z6H A;  2N49 A;  3FVQ A;  4DR5 Q;  4GH9 A;  1L1O C;  2JXM B;  5IYD G;  2E2H H;  2CW0 C;  1L0W A;  1LV7 A;  5J3B A;  5K36 G;  1HTP A;  2DHY A;  1SEB D;  2LMC B;  4GN4 B;  1F9Q A;  2EYJ A;  3PF5 A;  3FPU B;  1HNW L;  4RH6 A;  1VQL A;  4QY7 A;  1TH3 A;  5C3E G;  2XH9 A;  4I7A A;  3R9X B;  2CQA A;  3SMP A;  1PV4 A;  1EY7 A;  1LAB A;  1SR3 A;  1QCB D;  2B2T C;  2LXK A;  4XGI A;  5ELC A;  4NRV A;  4JOI C;  2RBM A;  2G5D A;  2ZXO A;  1PA6 A;  1IBL M;  1ROD A;  3PO2 H;  4A93 B;  4W5W A;  5FKA C;  4X64 L;  2F0G A;  1GLN A;  2KHI A;  5EGT A;  3I8Z A;  1IHZ A;  4WJ4 A;  3QIA A;  3CF6 E;  3NQT A;  4DBG B;  2JA2 A;  3NBX X;  1X37 A;  4DV0 M;  4IZ8 A;  4O0A A;  5KYI A;  2JP1 A;  4HJ5 A;  1ICW A;  2QGQ A;  3HGB A;  3BOS A;  4LJA A;  3UE1 A;  3K0Y A;  2CQO A;  1OXT A;  2F0H A;  1TQO A;  2L0C A;  3KOX E;  5CC4 A;  3VYR A;  3UDG A;  1SYC A;  4AKH A;  3M7G A;  1QYR A;  4DUY L;  4POF A;  5KGU A;  1DM0 B;  4PMC A;  3J7Z C;  1WD1 A;  4GOP B;  1YJN A;  1HT2 E;  3MTS A;  4ZLT F;  3WHL A;  1A8V A;  1OO9 B;  4LG2 A;  1WGN A;  2XN9 C;  4A3F B;  2E5L Q;  2APL A;  5DFL A;  1X3G A;  3QJY A;  3GTK H;  5ELO A;  1CQF A;  1L1T A;  1IN7 A;  4IBG A;  2AUJ D;  4V0B A;  1WVL A;  3BDO A;  2D7G A;  4BBS G;  4L15 A;  4JI1 M;  2V1C C;  3PO3 G;  3H4M A;  5EPJ A;  4G4O A;  2NZ1 D;  3HKZ E;  2IPK D;  4C1N I;  2NWG A;  4OO1 H;  3I91 A;  1QZG A;  2F5S A;  1Y1W H;  1YZ6 A;  2EIF A;  3GRU A;  3CD6 A;  1KAA A;  4HIM A;  4A76 A;  3FRH A;  3Q6S A;  4QIW E;  1UFZ A;  1NVM A;  4JI4 M;  2L4E A;  1UNS A;  1OXS C;  2EYF A;  2SOB A;  4DV1 Q;  2EZV A;  1N32 Q;  4A75 A;  1HNZ M;  3A0J A;  4OEM B;  1P3Q Q;  1ESF A;  1ILQ A;  2GN5 A;  1DD2 A;  3ZJY C;  1GD7 A;  1QVG A;  4HJ8 A;  4FWG A;  2N88 A;  2LHG A;  4C2M B;  1YLA A;  2XFT A;  3U5Z A;  2M9V A;  2J5Y A;  5E4W C;  3BYY B;  1G3I A;  4PNY A;  1U4P A;  3SDZ A;  4A3J B;  2P5T A;  4LF9 Q;  2F1M A;  2UXC Q;  1Y14 B;  1STG A;  3H09 A;  3QG1 A;  3H3V H;  3HU2 A;  4O42 A;  1TTE A;  1CKO A;  1D1K A;  3MFG A;  2F4V Q;  4PQX A;  4DR6 Q;  2O01 F;  1F9S A;  4LFA M;  1J7K A;  2K4K A;  3AU7 A;  3TEH B;  5CMD A;  1XMQ Q;  4NC6 A;  1N34 Q;  2LVQ D;  1E22 A;  4A3B H;  4K6L A;  1DGH A;  4NMZ A;  3KP0 E;  1G59 A;  3TWK A;  4KKU A;  1VQO A;  4DGZ A;  4DAY B;  1V9P A;  3GLH B;  3BZK A;  4OON A;  2UU9 L;  3KUP A;  5CV4 A;  3KF6 A;  4AQY L;  3RFW A;  1ET6 A;  1HTL D;  1BOS A;  3SHG B;  4GNX C;  4EIW A;  2H1R A;  1VQA A;  2BE5 D;  1QAM A;  1F2Y A;  2WP8 J;  2JA8 H;  3LQR A;  4OWX B;  1EWH A;  4KHZ A;  1QDR A;  4DV4 L;  5IZ7 D;  1I50 H;  2DNC A;  2PNH A;  2VQF L;  1L8Q A;  1GJX A;  3U4V A;  4DAM A;  3FPP A;  5AJ3 Q;  4QOS A;  3MXN B;  5IT9 E;  1TR8 A;  1L2C A;  2A73 B;  3RGS A;  1I4X A;  2FFJ A;  1BUV T;  4KLK A;  1GKH A;  4R4O A;  2R93 G;  3OWE B;  4UY8 C;  4B3T Q;  4A3M B;  3TZU A;  1ENA A;  2Z9H A;  1QIL A;  4LMQ D;  4QMG A;  2WSE F;  3M3Y B;  2F0W A;  5DM7 3;  3QOJ A;  4KD3 A;  2KNZ A;  3HJ8 A;  4JC0 A;  4KJO A;  4OGQ C;  4XYQ A;  4DV7 M;  3GTQ B;  3W0F A;  2H5X A;  4KHP M;  1JR0 D;  1UEA B;  1VQJ A;  2R18 A;  2D9U A;  2QZ4 A;  2RVL A;  3S1Q B;  4NXM L;  1Y8O B;  2WAQ B;  4QL5 A;  1IY2 A;  2MGS A;  5C4Z A;  1S5F D;  3DWA A;  4UN2 B;  1PJI A;  4JI6 Q;  5C0X H;  3TZD A;  1PH9 A;  2XRQ D;  1EWC A;  2F03 A;  2M2L A;  1BO0 A;  3J81 S;  1NJI C;  2XZF A;  1YNJ C;  3GLG B;  2VF7 A;  2PW5 A;  3H0G B;  1FJG M;  3VYT A;  5M3F H;  3T1H Q;  3JR4 A;  2QDL A;  3BYT B;  3A74 A;  4IBC A;  2E75 C;  1QJO A;  2RSO A;  3D3R A;  4YIJ A;  1D6E C;  1D8L A;  2K33 A;  4XTC S;  1YHQ A;  1EZ8 A;  2K04 A;  1QG7 A;  1E94 E;  4JXJ A;  2A19 A;  5IP7 H;  1QOH A;  4OIJ A;  3CF5 A;  4HJA A;  3HOV H;  4NPS A;  1GHJ A;  2NYZ D;  2ZTD A;  4JI0 L;  2K52 A;  3S2D H;  1G6P A;  5IGC A;  3FTC A;  2Q8I B;  3A5U A;  4M9Z A;  4A3K G;  4MGY E;  1BCP C;  5FTL A;  1E1O A;  1NSF A;  3FUX A;  4B3R L;  1A6X A;  1HNX L;  2H4O A;  1SSO A;  2F0I A;  3ERS X;  2A1A A;  4FF2 A;  3VKH A;  1VEK A;  4DPG A;  3Q0A A;  3MXG A;  3GRR A;  3AKZ A;  1SFO B;  4NXN L;  4LF4 L;  4IPH A;  4DV0 L;  2KA6 B;  2ZTE A;  4YY3 L;  5C4J H;  1XNQ L;  1MKH A;  5ITY A;  3G7L A;  4OXP A;  2UXD Q;  1PGY A;  2DHR A;  1J5E M;  1EFU B;  2RA4 A;  1HQR D;  1TS2 A;  4RGM A;  2EPB A;  3GQB A;  3MEH A;  4RG1 A;  3S1R B;  1OTR A;  1IZ6 A;  2DNE A;  4F7X A;  2AQ3 B;  4BY1 H;  1DO0 A;  2MNA A;  2WKD A;  2MUY A;  1IQP A;  1W3S A;  1GUN A;  2SNM A;  3UZU A;  4LJ5 A;  5EKI A;  2R65 A;  3K5O A;  3RNU A;  4JV5 L;  4RKU F;  2R4E A;  1X9N A;  5EP2 A;  3LMM A;  1MD2 D;  3PMF A;  4A3L H;  4GNX B;  4RKL A;  5BN4 A;  3PF4 A;  2KDL A;  1PHJ A;  2CWP A;  2VB2 X;  4ABN A;  1LV9 A;  4RA8 A;  3G71 A;  1E2W A;  1TWC H;  1B70 B;  1PRT C;  2F0K A;  1JOO A;  4UP7 A;  5L37 A;  4DAV A;  5F3W A;  1TWG B;  2FH0 A;  2RHQ B;  1GJS A;  1KDA A;  5EKK A;  3J80 c;  1JR3 A;  4A93 G;  3I4N H;  1D5X C;  2CHQ A;  1VEG A;  4PMB A;  1Q82 C;  2JA5 H;  4HCS A;  2L7I A;  3K9O A;  2G9D A;  4LWC A;  3J7A V;  4JI3 M;  1X65 A;  2QPA A;  2K5D A;  3TME A;  4ITQ A;  4CJ1 B;  3GV6 A;  3OIQ A;  3W67 A;  4ZUJ A;  1SE3 A;  2FOI C;  4EQO A;  3MK6 A;  1YUB A;  4AZF A;  4IPG A;  3G48 A;  3SHL A;  3S14 B;  1I94 L;  3K2L A;  1H9K A;  1EIF A;  5FO9 B;  4CJ2 C;  4XT1 B;  2KRK A;  1HUM A;  2W82 A;  1OQY A;  1XMO L;  4FVM A;  4BLC A;  2DN8 A;  5JPM C;  1VQC A;  3M4Q A;  1EEI D;  1NNX A;  3GTJ B;  1QZE A;  2QNJ A;  1FNW A;  1TWH H;  3RZO H;  4J15 A;  2EDG A;  2J7O A;  1R4G A;  3W5O A;  4DV3 L;  4QOZ C;  1VQ4 A;  4A3F G;  1R9T B;  2QQ8 A;  1TS3 A;  3TP6 A;  3T16 A;  4DUZ Q;  1VQM A;  4YHH L;  4YWM A;  2CH4 W;  3NBH B;  1K8G A;  2XIW A;  4CIS A;  5ITT A;  3HG9 A;  1BCP B;  1Q1E A;  5T1G A;  4AG5 A;  4GKJ Q;  4OW0 A;  5IY0 A;  2NQ8 C;  4M9X A;  1CUK A;  5LMN M;  1S3O A;  2BDN A;  1XXG A;  1S3S A;  3VFD A;  1FR3 A;  3U6Q A;  1H9J A;  2K6B A;  3S24 A;  3D4R A;  4B3S L;  3DHQ A;  4IJH A;  4MGZ E;  4K14 A;  5BR8 L;  1HZB A;  2G8L A;  1IBL Q;  3GTG B;  4DN4 M;  1KNE A;  1S4Z A;  4DNI A;  3I04 M;  4K0K L;  4DV6 L;  1GVP A;  4FCT A;  3IEC A;  2J4X A;  2F0E A;  3TP8 A;  4LRS A;  4PZ7 A;  4C3I H;  1ZXT A;  5GAH C;  3DLL A;  3NBI A;  5IOD A;  3R8F A;  3I7F A;  1YJW A;  2VQE Q;  4A3J G;  4A3V B;  4DV7 L;  1TDH A;  3DXJ C;  3UDF A;  4KHP L;  4DU9 A;  1JJG A;  3SK4 A;  3S17 H;  1IXR A;  5JJI A;  2A5Y B;  1ZEQ X;  2F5Q A;  4FD2 A;  3KVW A;  2VNU D;  4I4L A;  1GOZ A;  1VQP A;  2XEP A;  2ZAO A;  5FTK A;  1VQ5 A;  3H91 A;  4KI0 A;  1B44 D;  4BY7 H;  1LTB D;  2Z1C A;  4C3H H;  5IGB A;  1IN8 A;  1NJG A;  2DY8 A;  4R7G A;  2K14 A;  1WJ7 A;  2KUM A;  3GRY A;  4QNM A;  1FJG L;  2EYH A;  4WRD A;  1ORY B;  3F1Z A;  3Q8X A;  1N36 Q;  1LAC A;  1PRT B;  4IBD A;  4JI1 Q;  2UXB M;  2HL7 A;  2ZXP A;  2F0D A;  1B9M A;  3F2D A;  2LWX A;  4KHV A;  1G4A E;  4DR7 M;  5BN3 A;  3VDU A;  5K36 H;  1QAO A;  1PFS A;  1SMY C;  3EQL C;  2FXQ A;  1AFP A;  3E6Z X;  1CA6 A;  3HU1 A;  4OO1 I;  1VF7 A;  2O5J C;  3GLF E;  2OEO A;  3OW2 A;  5HGT A;  1VDL A;  2HDL A;  2R45 A;  3VLF B;  4A3M G;  4FXK C;  1E9R A;  5KPR A;  3FKI B;  4C56 C;  2CCZ A;  3MVV A;  3R93 A;  4KT0 F;  1VQF A;  1DXM A;  4GOP A;  2OO9 A;  3KLR A;  1W5S A;  2KED A;  4B7H A;  5EXX A;  3S16 H;  4FWH A;  4EQ5 A;  3AFH A;  2KXE A;  2M5Z A;  2QDB A;  1XC8 A;  1VDZ A;  1JB3 A;  3I4Y A;  4HL4 A;  1PH6 A;  1JT8 A;  3B9P A;  1BBW A;  2WAQ G;  3BDC A;  3I2Z A;  1A5T A;  3FYD A;  1EY4 A;  5FK9 C;  5EJW A;  2CHV A;  2LH0 A;  4C3J B;  2PYK A;  2OPF A;  2JA6 B;  2Q2T A;  4X62 L;  2N35 A;  4QCL A;  1TR5 A;  1VMP A;  4S3S A;  3H0G G;  3PVS A;  1WXQ A;  3QYB A;  4DAP A;  4M0W A;  2SNS A;  3MMP A;  3TPZ A;  2LXJ A;  3IG8 A;  4H13 C;  3P7J A;  3HOZ H;  4X64 M;  5IE8 A;  2CEA A;  4I5S A;  2F5O A;  1JJ2 A;  4I7Z C;  1L2D A;  3PQI A;  4H02 A;  2K6A A;  2WIN B;  4XQN A;  3RE8 A;  2MO0 A;  3PO3 H;  2KCC A;  3GTO B;  2QBY B;  2B2U C;  4G7O C;  3I4V A;  3F2C A;  2EY6 A;  2L09 A;  1OXU A;  1EU4 A;  3A5Z B;  1KYI A;  1G29 1;  1P16 A;  2CWB A;  4IQZ A;  3FHW A;  3CCR A;  2NVY B;  4UPA A;  5LL6 S;  1IFY A;  1K9M C;  2N8N A;  2NTT A;  1TH2 A;  4KY7 A;  5LMN W;  3GQ4 A;  1GO5 A;  2JP7 A;  1SNO A;  2MP1 A;  1MN3 A;  2L9H A;  2F0S A;  5I6W A;  2DI0 A;  2G5G X;  1AZQ A;  4IJE A;  3SMS A;  1VQG A;  3VR3 A;  1SG9 A;  3KSJ A;  2ZAM A;  3GLH A;  1CSP A;  1KLU D;  1ZMW A;  2XSC A;  5AFW A;  4DAY A;  2OTL A;  1JQY D;  4JI5 Q;  5JEA J;  4WUR A;  1RTO A;  4BBR B;  2IW3 A;  2XFS A;  3OTO M;  3KDF A;  3KYH C;  5ITX E;  2I0Q A;  3KLW A;  2XGT A;  1KNA A;  2J7Z A;  1IXR C;  4DV2 M;  3S2H H;  3TQY A;  3MA2 B;  4LJ9 A;  5M5X B;  3FTD A;  3CMA A;  1IYU A;  1PXU A;  1SE2 A;  4KKS A;  3VA5 A;  3SGI A;  2R6F A;  3MXN A;  4XDX A;  4JYA L;  3KFU G;  5C0X I;  2MFI A;  3HU3 A;  3MXU A;  1Z5C A;  4HMI A;  2A74 C;  4RGN A;  4DV5 M;  3ZQJ A;  1QE6 A;  3A46 A;  1CQV A;  3BVG A;  1GUT A;  1HZC A;  5LMN L;  2L6O A;  1JOQ A;  3SYL A;  3L0O A;  1J8I A;  3HOW B;  1NCV A;  1GO3 E;  4IFD J;  3HHY A;  1GUG A;  3BG3 A;  5M5Y B;  2BJW A;  5IYB G;  1K8O A;  2PMZ B;  2DKL A;  3TE6 A;  3NWT A;  3VA7 A;  1G91 A;  5M5W B;  4JI2 L;  2WKC A;  2EXD A;  4IBB A;  3U4Z A;  2R7Z B;  3GTM H;  2EYL A;  4R71 A;  1Z9F A;  3G6J B;  4L5Q A;  2Q8R E;  1HQM C;  2O25 A;  2HD3 A;  3QB3 A;  1SMX A;  2DWZ B;  3A54 A;  1JB0 F;  3PUX A;  5C4X B;  2LVO C;  3CQZ H;  1VQ1 A;  1LT3 D;  5E6J A;  3K6O A;  4GHL A;  1VQ9 A;  3L7Z C;  2FNA A;  2Z4S A;  4F88 A;  5IOC A;  1J5E Q;  1PYW D;  3GLG A;  1HQC A;  2MJ5 B;  4RMF A;  4G4K A;  2C96 A;  2PW7 A;  1GXD C;  1PZI D;  2XGN A;  1CZW A;  1A3T A;  2LVA A;  3DMU A;  3IFT A;  3J7A F;  4GKK L;  2UU9 M;  1S5E D;  3BZC A;  4G57 A;  4FF4 A;  1P8L A;  4MNO A;  4JN6 A;  2CV2 A;  1JJC B;  3NE5 B;  1IY0 A;  3DZD A;  4D81 A;  4L6T B;  5JJL A;  1SXJ C;  5FLM G;  1I3Q H;  4DV4 M;  1E9S A;  1PTO H;  5FLX c;  2VQF M;  2QEN A;  3MEF A;  2E5L L;  4LF8 Q;  4MM3 B;  1QAN A;  2Z8Y M;  1XXH E;  2Z6B A;  4J1M A;  4RGO S;  3W1G A;  2DVW B;  1PMR A;  5ISR A;  1YIJ A;  5EQT A;  1T9H A;  4LFB Q;  2UXB L;  2JA7 B;  5CGK A;  2KEB A;  3Q23 A;  4REZ A;  2ALY B;  3UJN A;  2FFK B;  3VK8 A;  2X4A A;  1STB A;  3OOC A;  4KN4 C;  1W5T A;  3ULL A;  1JB7 A;  1NAP A;  1MJC A;  1X56 A;  4J8Q A;  1JE5 A;  3K8Z A;  3CU7 A;  2C9O A;  1QB5 D;  3EFX D;  1O7I A;  1LT5 D;  4PDI A;  3IRB A;  1YJ9 A;  4G6Z A;  3TBI B;  2CFO A;  4XQJ A;  2BJV A;  1XPO A;  4HCE A;  3RZD H;  2XVS A;  4DV1 L;  1TS4 A;  3VDP A;  5G3L F;  3HGI A;  4NXM M;  5E4X A;  2VF8 A;  2NN6 H;  1FNU A;  1NHG C;  3K7A H;  1VQN A;  1MGS A;  3K5N A;  3S1N B;  3ND8 A;  1I4W A;  3KS4 A;  3U6P A;  4HAE A;  3M6A A;  2F0V A;  2P5Z X;  2A6E C;  4X6A H;  3ITP A;  1PVO A;  4GNX A;  5JVG 3;  4BS9 A;  5IGE A;  2E2J H;  1YEZ A;  4PG3 A;  1HCZ A;  4X66 M;  2F0U A;  3KFU A;  4AH6 A;  1DGS A;  3RUZ A;  1K3W A;  2UUA M;  1ET9 A;  3H6M A;  1TU2 B;  2R6G A;  2A5H A;  2EKK A;  1PRB A;  1B8A A;  3CCS A;  4P72 A;  2E2I B;  3SK8 A;  5DLQ E;  4LF7 Q;  3U6O A;  4JI0 M;  2KQ3 A;  4GS3 A;  3BVM A;  1YIT A;  1HFG A;  2PZT A;  1KD1 C;  1L0Y B;  1GM5 A;  1K8M A;  4OWT B;  3M4O H;  3PO2 B;  2B8F A;  5JOB A;  4KOD A;  4B3R M;  1I4H A;  3HZJ A;  1HNX M;  2YQZ A;  4LZJ A;  4P17 A;  1HR0 M;  3HJQ A;  4ID6 A;  3GV3 A;  3HEJ A;  5GAG C;  3TN2 A;  4KY5 A;  2B2Y C;  3J80 L;  3KK7 A;  4NXN M;  2F5N A;  4LF4 M;  4LUZ A;  2NVQ B;  2O5R A;  4ZYS A;  3CAM A;  3S1M H;  4YY3 M;  2OQK A;  3FKE A;  1XNQ M;  7CAT A;  4O2D A;  3X3M A;  4JI8 M;  1D5Z C;  4U68 A;  4MIU A;  1K0S A;  5LL6 X;  3FKI G;  3H94 A;  1IBK L;  1QVF A;  3DM1 A;  3FEW X;  1U4M A;  5CBE E;  1GHK A;  4DK1 A;  4A93 H;  1DGG A;  3OPO A;  1JWM D;  3EBE A;  4G7H C;  2L4N A;  3U6S A;  3VKG A;  2XNA C;  3F92 A;  1IM2 A;  3I51 A;  1LO5 D;  2HKJ A;  4IOA A;  3V76 A;  3GO5 A;  3L26 A;  4HR7 B;  1HHV A;  3CRL C;  4HJ9 A;  3GTK B;  4JV5 M;  1NHW C;  2KHJ A;  5I6Y A;  4S12 A;  3NBH A;  1RCV D;  2MHV A;  1YNN C;  3OTO L;  4C3J G;  1KAB A;  4YWK A;  2GVB A;  4R4Q A;  3E0J A;  1T5E A;  1MU5 A;  1SXJ B;  2JA6 G;  3PNV A;  1ZMV A;  4DV2 L;  2E2D C;  1NY5 A;  1VQI A;  4Y52 H;  2Z0S A;  2CVR A;  2ZM6 Q;  2CP8 A;  4MGI E;  1KTK A;  2QSF X;  2XSZ A;  2NZH A;  1Y1W B;  2XF3 A;  4UP9 A;  3WDN A;  4F2L A;  2Y0T A;  4AKI A;  3I55 A;  5CV6 A;  2DWL A;  2HQL A;  2Y21 A;  5IP9 H;  2BNK A;  1EWI A;  2MR9 A;  1KXL A;  2WZJ A;  4ZKB B;  3CCQ A;  4A3F H;  1SRO A;  3NHH A;  4RWS C;  3EIH A;  4DR2 L;  1Q81 C;  4JBM A;  1G2T A;  4A3D H;  1D0M A;  2YTY A;  3DEO A;  4DV5 L;  1JCK B;  1VF5 C;  4TQU S;  1SNP A;  2KVM A;  2ICI A;  1H9M A;  5E7N A;  3QWN A;  3HOY B;  2WFW A;  4JG2 A;  1QNK A;  1ZYR D;  1N78 A;  1G51 A;  3VR5 A;  4AIM A;  2R7D A;  3K9P A;  2B29 A;  2HQE A;  4DR3 Q;  1X3E A;  2X69 A;  1EY0 A;  1IBM Q;  3D6C A;  1I94 M;  2Q8T A;  3I4M B;  3T1Y M;  4XT3 B;  5E3F A;  1T5X D;  1STY A;  2OQ0 A;  1XMO M;  4LJZ C;  1M1K C;  1XX8 A;  2CFM A;  3JAM S;  1Q1B A;  1Y69 U;  1SXT A;  4IUR A;  4CJ6 A;  2RRU A;  2KA7 A;  3A42 A;  3GDE A;  4Y7N B;  1Q8I A;  1KC8 C;  4DV3 M;  2Z8L A;  2UUC L;  1I4Q A;  3T15 A;  1EOV A;  2A69 C;  4TRD A;  3C2P A;  3K92 A;  1IW7 D;  2UXD L;  1HJP A;  3DA1 A;  3D4D A;  1TWF H;  4C2M H;  4BBR G;  4XYO A;  2L5T A;  1PJJ A;  4YHH M;  3FD9 A;  1TS5 A;  8CAT A;  2AWN A;  3B6Y A;  4EGV A;  4LF5 M;  5KIX A;  3LX0 A;  2KW0 A;  1PYB A;  3KDF B;  3ILK A;  5H37 D;  2QEJ C;  3NQI A;  5FTN A;  1T43 A;  3CGW A;  5I4D A;  1HNW Q;  1OIP A;  4LW1 A;  1TGU A;  1E2V A;  2OQ4 A;  3SBJ A;  1N77 A;  2UUB M;  2B2V C;  3CME A;  1SJE D;  2VUM H;  3W0L B;  3E9H A;  3HP3 A;  4FWD A;  1TH4 A;  4JCV E;  2OF1 A;  4OIK A;  3U6E A;  4B3S M;  5KRU A;  1O78 A;  3KJO A;  3B7Z A;  5BR8 M;  3QOL A;  1MSH A;  1N8R C;  2Z4I A;  3GP7 A;  1WTO A;  4X64 Q;  2AKW B;  3KDS E;  4K0K M;  1UAP A;  4DV6 M; 
#chains in the Genus database with same CATH homology
 2FIN B;  3CRK C;  1DGF A;  3FDT A;  5KQ8 A;  2AWO A;  3WOE A;  1CI3 M;  2ID0 A;  2RDG A;  3KLS X;  1WCM B;  4M8A A;  5M9O A;  4ZAI A;  3U9S A;  4IBK A;  2XZU A;  1TWA B;  1TVX A;  3J7B A;  2F0N A;  1LTR D;  1EU3 A;  4X3U A;  4XQQ A;  4PMW A;  4LY6 A;  1IKL A;  5C3W A;  1IN5 A;  5LHY 1;  4F8M A;  1AW7 A;  4L8J A;  1EY6 A;  1XYI A;  2RDH A;  1B4O A;  3TWM A;  4A3I B;  3ZH9 B;  3SXH A;  3I73 A;  3SC3 A;  1JE4 A;  4TSS A;  1E0B A;  3PFI A;  4FF3 A;  3HOV B;  4NRW A;  4RNA A;  1SYB A;  4AW4 A;  2QBY A;  1D1I A;  3VYU A;  3D6W A;  3J27 B;  2GA4 B;  2LKV A;  2V6Z M;  2IL8 A;  4ODG A;  4WOR A;  3ERO A;  4GHA A;  3C1E A;  4RGT A;  5C4J B;  2LFN A;  3LVW A;  4ZUI A;  1VDD A;  1BF4 A;  5DYI A;  1CTM A;  2DWM A;  2R4J A;  3SYK A;  4LAA A;  1I6H B;  2K7V A;  3LVV A;  4PV1 C;  3J80 E;  4HSV A;  2K28 A;  4X3S A;  1SE4 A;  4B9X A;  2D2C C;  4IBJ A;  2C98 A;  4DR4 M;  2M00 A;  4QNR A;  1SYE A;  3P1H A;  3PV0 A;  3U6L A;  4X62 M;  3F2U A;  4WJW A;  4OU7 A;  3TL4 X;  3VYS A;  2K1B A;  3GPX A;  2DZO B;  1EY9 A;  3O13 A;  4XIG S;  3AMU A;  2EE1 A;  4KO8 A;  5JEA H;  4MH0 E;  3HRZ C;  1DYQ A;  2D62 A;  1TWC B;  4N9T A;  1QVR A;  3KOZ E;  2L1B A;  2F0L A;  1ZAE A;  4IUV A;  4NOO B;  3L25 A;  2EJG C;  3U6M A;  1M4V A;  5C3X A;  1ZKO A;  3GPU A;  2JA5 B;  4FCW A;  2K5W A;  4BB9 A;  2AUK A;  5BN5 A;  5A35 A;  1H9S B;  3KBX A;  1JR3 D;  3TWL A;  2BE5 C;  1IKM A;  4DXF A;  1HPC A;  4DNR B;  4IFD H;  1D2N A;  1K83 B;  3RLF A;  1WTR A;  3TP5 A;  1Y8P B;  5D3I B;  2F0T A;  1M8A A;  5KQD A;  3URY A;  3V2T A;  1PTO D;  2F3W A;  5T1I A;  3RZO B;  1TWH B;  1A15 A;  1GL6 A;  1CA5 A;  2C5C A;  4IN3 A;  1XXH B;  5EJC A;  2Y0Q A;  5E26 A;  1G41 A;  2RDF A;  2NN6 I;  4FP5 D;  2J0T D;  2VII A;  3GRV A;  4JYA M;  2QF7 A;  3U60 B;  2EOT A;  2KCN A;  4DR5 M;  4OO1 G;  4R9W A;  2B2U A;  5DM6 3;  2EYO A;  1N75 A;  5FLX L;  4L63 B;  1Q39 A;  1WTW A;  2ICE C;  4HSP A;  5BPV A;  2HDM A;  2PQE A;  2KRU A;  1EIG A;  1CZG A;  4JI2 M;  1BQQ T;  1Y1V B;  4O1N A;  5GKN A;  1QWY A;  2A68 D;  5A2Q L;  2JEA I;  1R2Y A;  3NWS A;  3NWL A;  1CHQ D;  4GRI A;  1QAQ A;  3S17 B;  3A7A B;  1ZQ9 A;  2FMC A;  1FD7 D;  2VXW A;  5M3M B;  3AOE A;  2F5P A;  4GKK M;  3T38 A;  2NBF A;  5IGF A;  3I72 A;  3PXG A;  2EJM A;  2HCI A;  4C3H B;  5FO8 B;  4L78 A;  1Q3L A;  3DUZ A;  1XHB A;  1MBY A;  2JYO A;  1CM9 A;  2E5L M;  3OWF A;  1RDP D;  2KZS A;  1X32 A;  4A3G B;  1HFN A;  5COR A;  2LS0 1;  3PUZ A;  3LWU A;  2K5Q A;  2CV1 A;  2OXP A;  1IYV A;  2G9H D;  4Q0F A;  4N9P A;  5C4H A;  2JEB I;  5EP4 A;  4CKC A;  4DV1 M;  4HN7 A;  1FNV A;  2AQ1 B;  1JWU D;  4LRT A;  1FNN A;  4IBF A;  5E1F A;  3C58 A;  1A3V A;  2L12 A;  5CV7 A;  4UAI A;  2FE8 A;  1KLG D;  3D8G A;  1ILP A;  2YNM D;  2IT1 A;  5EP1 A;  2E76 C;  3LQQ A;  2LY7 A;  3HKZ B;  1QZM A;  4IBI A;  1PFN A;  1SXJ A;  4JBW A;  1Q90 A;  2L7H A;  1SYD A;  5C0X G;  1V1P B;  4IUN A;  5IGG A;  5DEH A;  3SR1 A;  2SDF A;  2BA0 A;  4DR6 M;  4GZY C;  4QIW B;  4G4Q A;  2PZW A;  1XMQ M;  5G3L D;  2PZU A;  4LK1 C;  1LTT D;  3N52 A;  3V96 A;  3SAW A;  5KPT A;  3V05 A;  3R2T A;  3A56 A;  5DYG A;  3HOZ B;  4U67 3;  2EUC A;  2V4D A;  3EIE A;  2A6H D;  1PTO F;  3R8B A;  3KS8 A;  4HED A;  1S5B D;  2F0F A;  3L2A A;  2DXI A;  2WAC A;  1OFI A;  1B53 A;  1B9N A;  4QHS A;  4RF1 A;  3HOU B;  1HUN A;  4R3D A;  1IBK M;  1KFV A;  4AKG A;  5KYL A;  1B3A A;  1PLF A;  1II3 A;  3UI2 A;  3LWE A;  1TT2 A;  1PZJ D;  4B3T M;  3HHZ A;  5CR3 A;  1EOT A;  1B1Z A;  1SJH D;  3X3N A;  3MAQ A;  3AV0 A;  2CW0 D;  4H7B A;  3BDL A;  4D80 A;  3U6C A;  1Q3C A;  3A8I E;  3FRP B;  5I2X A;  3S2H B;  5CBA E;  3GLF A;  3A55 A;  4WFN 3;  1U4L A;  3HWS A;  3AOE C;  4JI6 M;  2XRS D;  3BS1 A;  5KO3 A;  2B2Y A;  2NVX B;  2O5I C;  2RKO A;  3T1H M;  3EVQ A;  4DR2 M;  3KBG A;  1IL8 A;  4CBV A;  1AZP A;  1A2U A;  1X3P A;  3GD7 A;  4RCO A;  4K5W A;  5J1Z A;  3SEB A;  3A45 A;  5C1B A;  5FLX E;  4DA2 A;  1IXS B;  2XWB B;  5CV9 A;  4K2L A;  1ENC A;  4OHJ A;  5FOB B;  2DZN B;  1O7L A;  3CQZ B;  4NSO B;  3KOW E;  3U61 B;  2ZXR A;  2CUZ A;  1JC7 A;  1S5D D;  4Q5V A;  3NP8 A;  4AYB B;  2UUC M;  2I46 A;  1MI2 A;  1B2T A;  2Z4R A;  1VCI A;  1E32 A;  4GC9 A;  2UXD M;  5I2Y A;  5A2Q E;  2XLJ A;  1EEF D;  2JSO A;  1QNU A;  3PIP 3;  2IJ0 A;  1R2Z A;  4KY6 A;  4CJ0 B;  1L1Z A;  2H1E A;  1I3Q B;  4RHS A;  3RMH A;  4ZQ3 A;  2ERC A;  1KDB A;  1RTN A;  1Z47 A;  3DWQ A;  1R4Q B;  5ELE A;  5KND A;  1I6V C;  4B7F A;  1OFH A;  1Y8N B;  3HS0 C;  5KNB A;  5C6A A;  1NNU C;  4Z9C B;  2RSN A;  5KEE A;  3SE0 A;  5ITX A;  1I4G A;  1JOK A;  5C44 B;  1R7R A;  4MB7 A;  4LJ4 A;  4JI7 M;  4M1U B;  2HHH M;  2E74 C;  3RZD B;  3UGJ A;  5HUR A;  1R6B X;  2NB0 A;  3MZ5 A;  4CKE A;  1K82 A;  3H3V C;  2X49 A;  4B3M M;  3L3O C;  4UDU C;  1Z5A A;  4PD2 A;  2B2W A;  3MXP A;  2CE7 A;  1N33 M;  1HT1 E;  2R46 A;  2E2J B;  1H6U A;  2E2H B;  2B2V A;  4XXE A;  4PDG A;  3PIO 3;  4IFD I;  5IT9 S;  5D14 A;  4C3H G;  4NP5 A;  3IFD A;  4IUP A;  1DO2 A;  1GL7 A;  4FO2 A;  1XWI A;  3CKI B;  3MJ5 A;  1WD0 A;  1JQJ C;  3SAU A;  3K58 A;  3M4O B;  4H0L C;  2AQ2 B;  1HQY E;  4XBO A;  3R2I A;  1H9S A;  1EZ6 A;  4IUU A;  1EYA A;  2R61 A;  3GLI B;  3I3C A;  2I7P A;  4DK0 A;  4ZRZ A;  3S1M B;  2RKS A;  4GKJ M;  5DAU A;  3L28 A;  5JAV A;  5I9O A;  4FXD A;  1AN8 A;  3E9S A;  4TKO B;  4E6I A;  3VR2 A;  1SYF A;  3I4L A;  1D2B A;  3QO2 A;  4K5V A;  1OXV A;  1E2Z A;  3DEP A;  4ZK9 B;  1XXH A;  3BVZ A;  2J7N A;  2K01 A;  2I07 B;  3T56 B;  1BXT A;  1LTI D;  3QWL A;  3LNN A;  2VQE M;  4LF6 M;  1O80 A;  1YNJ D;  1OJL A;  4D82 A;  3U60 A;  3P75 A;  1XWE A;  4ILW A;  1G8Z D;  3M7N A;  1K3X A;  4LZZ A;  5EPL A;  3PUY A;  5FTM A;  4Z8X A;  1IY1 A;  3JAM L;  1IN4 A;  5NUC A;  2FJ2 A;  1SYG A;  1BCP D;  1J9O A;  2NTS A;  5IRE B;  2DWN A;  4A3D B;  3NTH A;  2XSZ D;  2BA1 A;  3J80 S;  5JI3 E;  2IX0 A;  3I90 A;  1N36 M;  3NK9 A;  1TKW B;  3GPY A;  1EE8 A;  4G7Z C;  2B8G A;  3CHB D;  4M9S A;  3Q24 A;  3FYC A;  2OT2 A;  2F3V A;  4OVZ B;  2JE6 I;  5FSW A;  1F2L A;  4NL4 H;  4AG6 A;  3T53 B;  2X6L A;  1ENF A;  3GQ5 A;  1CK1 A;  2YFQ A;  2D7E A;  4RCN A;  3VR6 A;  1C1K A;  4A3B B;  2EY1 A;  2K47 A;  1NSN S;  1TWF B;  1U9R A;  4BWG B;  3ZYY X;  1U4R A;  4ULL A;  5C5L A;  2FHT A;  3OSO A;  3PNY A;  1KDC A;  2B2W C;  3ND9 A;  1TY2 A;  2HCC A;  3N6R A;  1DJR D;  2JA8 B;  1PRT D;  2VUM B;  2KEE A;  3GLF B;  1I50 B;  2M60 A;  4G4N A;  1SNM A;  1QQW A;  4KJN A;  1PFB A;  3SK6 A;  2K03 A;  4EQN A;  3J81 L;  3M0E A;  3AB9 A;  2F0M A;  5EPK A;  3SVM A;  5ELF A;  1EQV A;  5LMU M;  4R8N A;  2O4X A;  1IN6 A;  4ZKC B;  3FUT A;  3SHF A;  4L16 A;  3T51 B;  1PM5 A;  3SAR A;  1NY6 A;  3GO8 A;  3J7A S;  4MGH A;  2B63 B;  1VMC A;  2L11 A;  2F0P A;  2YU9 B;  1A2T A;  3FUW A;  1V1P A;  3AL0 C;  1PDQ A;  4GIP A;  1LTS D;  1V8Q A;  4B9W A;  1BNZ A;  1DCZ A;  5D65 A;  5M3F B;  5EKL A;  3AOG A;  1PZK D;  3IG5 A;  2NVT B;  3D31 A;  3CF0 A;  5CV5 A;  4NDX A;  4JI5 M;  1I4P A;  1PFM A;  3A8K E;  2IX3 A;  3NXW A;  1T3T A;  5FTJ A;  3S2D B;  2ZBK B;  1C8C A;  5EXP A;  1Q12 A;  3HOX B;  1A3U A;  2WB1 B;  2ZAN A;  4HLQ A;  5EBD A;  5IGD A;  4ZPX A;  3GTL B;  3ZCB B;  1MX0 A;  4F87 A;  1G8P A;  2NUC A;  3TSS A;  3W2D A;  3HZX A;  3S15 B;  4II7 A;  1FGB D;  4A3E B;  1O7Z A;  1JIC A;  4QUC A;  3KSX A;  3KLS A;  1H9R A;  2I7N A;  3KOY E;  2L55 A;  3SK5 A;  2NN6 G;  3C3L A;  4BY1 B;  3L27 A;  1BCP F;  4B7G A;  1AP0 A;  4AI6 A;  1BR9 A;  2WV6 D;  2R92 B;  3T13 A;  1ZYR C;  1Z5B A;  1F77 A;  2MPM A;  2RGH A;  2Q2E B;  2BCO A;  3MHB A;  4IIW A;  4IAL A;  1F9P A;  4QUF A;  1EY5 A;  1EIH A;  1ML0 D;  4LFC M;  1WTV A;  1EQT A;  1GKI A;  5ELB A;  4K5X A;  1EFI D;  3ERQ A;  3OHX C;  2KHS A;  1HA6 A;  1XNR M;  4RF0 A;  2PO4 A;  3L9A X;  5I9P A;  1SMY D;  1IW7 C;  3KF8 A;  1SBB B;  4PT5 A;  3I4N B;  4HTH A;  1NNJ A;  2KOL A;  1BDO A;  1DZ1 A;  1V43 A;  3M85 A;  2KZU A;  5CYU A;  4OX9 M;  4HMJ A;  4LF8 M;  2HCB A;  2QP9 X;  3WOF A;  5EQ0 A;  3JAM E;  3ZC7 B;  4LFB M;  1OXX K;  3U61 A;  4BBA A;  5ITR A;  2R62 A;  3U9O A;  4KN7 C;  3R3O A;  2XWJ B;  4GIT A;  1PRT F;  1NR4 A;  3HHX A;  4QF4 A;  2EJF C;  4KD4 A;  5JI2 E;  2CV0 A;  2SEB D;  1STN A;  4G4R A;  2IX1 A;  1DON A;  1Q3B A;  3P20 A;  3IAY A;  1F9R A;  2CHB D;  3SFZ A;  2B39 A;  3MC0 B;  5ITQ A;  5EXT A;  2YYZ A;  3CF2 A;  2EXZ A;  3PUW A;  5J39 A;  4ME5 A;  1GUS A;  2Y0S B;  4KV6 A;  1EYC A;  3HHW A;  1SND A;  5JVH 3;  1ONL A;  2ZT9 C;  3E5S A;  1IXZ A;  4EQP A;  4IUT A;  1RHP A;  4LF7 M;  1CHP D;  2BOS A;  1TII D;  2CHG A;  1CT1 D;  1D5M C;  4C3I B;  1V1O A;  5EXS A;  2K05 A;  2YR0 A;  4B08 A;  4RFB A;  3J81 E;  1SXJ E;  2WII B;  1C4Q A;  1EL0 A;  5DNF A;  3KW6 A;  4X3K A;  1KSF X;  2EA0 A;  3DFZ A;  4P16 A;  4KKT A;  4EVO A;  2Y20 A;  4IUQ A;  4BY7 B;  1HRJ A;  3GTP B;  3FMC A;  2ENB A;  4KTA A;  4LGM A;  4L8R C;  4NKL A;  3NPP A;  3J2P B;  3JR5 A;  1RF2 D;  2PPB C;  3U5Z B;  2TSS A;  4FXG C;  3GLI A;  4M0D A;  5FLX S;  1NUC A;  5JJZ A;  3A98 B;  2C5R A;  2ZM6 M;  1C48 A;  5C3E B;  2D7H A;  3K5M A;  4GMQ A;  1DGH B;  1LLR D;  5J22 A;  2VB3 X;  1B50 A;  1TDZ A;  1EYD A;  4DXG A;  5A2Q S;  3S9W A;  4K2K A;  2RGO A;  1N32 M;  2F0J A;  4CKB A;  3CTW B;  4OL7 A;  5COY A;  1X3Q A;  1SAP A;  3S16 B;  4L4U A;  2EO2 A;  4LCB A;  4H44 C;  1SNC A;  4KK7 A;  3EA6 A;  2Z3X A;  4LJ8 A;  4J6H A;  1ESR A;  5TSS A;  3D8L A;  4RAU C;  1SDF A;  4DR3 M;  1W6J A;  1IBM M;  3U6D A;  3DOA A;  4LF9 M;  3D4W A;  2UXC M;  4DNT B;  4Z6Y A;  5K5P A;  1BBX C;  2F4V M;  1Z6T A;  1SNQ A;  1R4P B;  5C0X J;  2C9C A;  3K59 A;  1SXJ D;  1N34 M;  1I4R A;  3D8B A;  3Q22 A;  3VR4 A;  3MFY A;  3TP7 A;  2EVB A;  1JWS D;  4BA2 I;  2AHM A;  1PTO C;  1DGB A;  1LT6 D;  2EY2 A;  1LTG D;  3HJS A;  4DF7 A;  1LTA D;  4BBS B;  1HNW M;  5KNC A;  1G6Z A;  2QCU A;  3PO3 B;  4RHR A;  4OVZ A;  1HXY D;  4V19 0;  5DNY A;  3FTE A;  1HA5 A;  4I65 A;  4RKB A;  3W3A A;  1MSG A;  1UUP A;  1O7Y A;  4FF1 A;  3QAU A;  3FTF A;  4P2C B;  4C1N K;  4K6D A;  3GQ3 A;  3K57 A;  3TDQ A;  4MN3 A;  2MJ8 A;  3UMM A;  1RJT A;  2N55 A;  3T4A C;  1GUW A;  4I81 A;  2HUG A;  2A6E D;  1LT4 D;  2F0O A;  2K32 A;  5C5M A;  1L0X B;  2LXE A;  4X65 M;  2RQX A;  4GC5 A;  2PNR C;  3THG A;  3NTI A;  3L29 A;  4CGY B;  4FNF A;  5F2D A;  2Z7J A;  2FMM A;  4DUY M;  1DOK A;  2A68 C;  1YE9 A;  3VK7 A;  2D5D A;  4NSR A;  3A7L A;  3NTK A;  1STH A;  5JEA G;  3GP1 A;  2QIL A;  4KLN A;  4X3T A;  1Z59 A;  3C46 A;  4FYD A;  4BA1 I;  3RGP A;  1F2M A;  3FUV A;  2B2T A;  3TQS A;  3OW7 A;  3K1J A;  1Z7T A;  5KPZ A;  1UM8 A;  1RD9 D;  1AEX A;  4DR1 M;  3SAV A;  2X6G A;  2Z4H A;  3GPP A;  3BZD B;  3GTM B;  2DY7 A;  2IWH A;  3I70 A;  3UK6 A;  5D3D A;  1W6K A;  2KJX A;  4IJF A;  4MHE A;  4IFD G;  1EY8 A;  4TUW A;  4DFA A;  3NUC A;  2R93 B;  3C1F A;  3DWP A;  2C99 A;  3ONA B;  3J7Y W;  2EYP A;  2KEC A;  4K8J A;  1YNN D;  3E4R A;  1CFM A;  4NW2 A;  3HKP A;  3M4Y A;  4KMU C;  4R8I A;  5IIF A;  1GUO A;  2QCP X;  2O2L D;  1PTO B;  5C18 A;  3NSW A;  1FYC A;  3KXE C;  2V1C A;  1F2Z A;  3EJI A;  1XTC D;  4CHT B;  2TMP A;  5ELD A;  1NR2 A;  3IL8 A;  3RD4 A;  1STE A;  1TY0 A;  1WTX A;  4LJ7 A;  4AQY M;  3SAS A;  1JOR A;  4QHT A;  1STA A;  5IT9 L;  2PCF B;  3SAT A;  4MGK E;  4LJ6 A;  2F0Q A;  1YSY A;  5EBC A;  1S5C D;  5CV8 A;  4QB4 A;  3PUV A;  3A8J E;  4WW0 A;  1G2S A;  4A3K B;  4C3I G;  4LGY A;  4I8O A;  3K7A B;  3MHV C;  3IKJ A;  2A6H C;  1WTP A;  2A69 D;  1J09 A;  3OMC A;  4FW9 A;  2LNH C;  3OMG A;  3WHK A;  3KP1 E;  5FO7 B;  2V1U A;  3K5L A;  2X8A A;  3AJI B;  4PCZ A;  1RKN A;  1WTQ A;  4IBE A;  2F4I A;  2QKI C;  2R3Z A;  1NJF A;  1GVN A;  3OIP A;  3FUU A;  4FCV A;  1L2B A;  5IWA M;  4JK1 C;  2BDO A;  2EY5 A;  5JPN C;  3MWY W;  4K8I A;  1DOM A;  2EYM A;  1DOL A;  4DUZ M;  5ITU A;  5EP3 A;  3FVQ A;  1Z6H A;  4GH9 A;  2JXM B;  2CW0 C;  1LV7 A;  5K36 G;  1HTP A;  1SEB D;  2LMC B;  1F9Q A;  2EYJ A;  3FPU B;  4RH6 A;  1TH3 A;  2XH9 A;  3R9X B;  2CQA A;  3SMP A;  1EY7 A;  1LAB A;  1QCB D;  2B2T C;  4XGI A;  5ELC A;  4NRV A;  2RBM A;  2ZXO A;  1IBL M;  1ROD A;  4A93 B;  4W5W A;  5FKA C;  2F0G A;  1GLN A;  5EGT A;  3I8Z A;  1IHZ A;  3QIA A;  3CF6 E;  3NQT A;  2JA2 A;  1X37 A;  4DV0 M;  4IZ8 A;  5KYI A;  2JP1 A;  1ICW A;  3HGB A;  3BOS A;  4LJA A;  3K0Y A;  1OXT A;  2F0H A;  1TQO A;  2L0C A;  3KOX E;  5CC4 A;  3VYR A;  1SYC A;  4AKH A;  3M7G A;  1QYR A;  5KGU A;  1DM0 B;  4PMC A;  1WD1 A;  1HT2 E;  3MTS A;  4ZLT F;  3WHL A;  2XN9 C;  1OO9 B;  4LG2 A;  4A3F B;  3QJY A;  1CQF A;  1L1T A;  1IN7 A;  4IBG A;  2AUJ D;  4V0B A;  1WVL A;  3BDO A;  2D7G A;  4L15 A;  4JI1 M;  3H4M A;  5EPJ A;  4G4O A;  2NZ1 D;  2IPK D;  4C1N I;  2NWG A;  4OO1 H;  3I91 A;  2F5S A;  3GRU A;  1KAA A;  3Q6S A;  1NVM A;  4JI4 M;  1UNS A;  2EYF A;  1OXS C;  2SOB A;  2EZV A;  1HNZ M;  1ESF A;  1ILQ A;  1DD2 A;  4FWG A;  2N88 A;  4C2M B;  2XFT A;  3U5Z A;  2M9V A;  5E4W C;  3BYY B;  1G3I A;  4PNY A;  1U4P A;  3SDZ A;  4A3J B;  2P5T A;  2F1M A;  1STG A;  3H09 A;  3QG1 A;  3HU2 A;  4O42 A;  1D1K A;  3MFG A;  4PQX A;  1F9S A;  4LFA M;  1J7K A;  3AU7 A;  5CMD A;  4K6L A;  1DGH A;  4NMZ A;  3KP0 E;  1G59 A;  3TWK A;  4KKU A;  4DGZ A;  3GLH B;  3KUP A;  5CV4 A;  3RFW A;  1ET6 A;  1HTL D;  1BOS A;  3SHG B;  4EIW A;  2H1R A;  2BE5 D;  1QAM A;  1F2Y A;  2WP8 J;  3LQR A;  1EWH A;  4KHZ A;  5IZ7 D;  2DNC A;  1L8Q A;  1GJX A;  3FPP A;  4QOS A;  5IT9 E;  1L2C A;  2A73 B;  3RGS A;  2FFJ A;  1I4X A;  1BUV T;  3OWE B;  4A3M B;  3TZU A;  1ENA A;  1QIL A;  4LMQ D;  4QMG A;  3M3Y B;  2F0W A;  5DM7 3;  3QOJ A;  4KD3 A;  3HJ8 A;  4OGQ C;  4KJO A;  4XYQ A;  4DV7 M;  3GTQ B;  3W0F A;  4KHP M;  1JR0 D;  1UEA B;  2D9U A;  2RVL A;  2R18 A;  3S1Q B;  2QZ4 A;  1Y8O B;  2WAQ B;  1IY2 A;  2MGS A;  5C4Z A;  1S5F D;  3DWA A;  1PJI A;  5C0X H;  3TZD A;  2XRQ D;  1EWC A;  2F03 A;  2M2L A;  1BO0 A;  3J81 S;  2XZF A;  1YNJ C;  3GLG B;  2PW5 A;  3H0G B;  1FJG M;  3VYT A;  3JR4 A;  3BYT B;  4IBC A;  2E75 C;  1QJO A;  2RSO A;  3D3R A;  4YIJ A;  1D6E C;  2K33 A;  4XTC S;  1EZ8 A;  2K04 A;  1QG7 A;  1E94 E;  4JXJ A;  1QOH A;  4OIJ A;  1GHJ A;  2NYZ D;  5IGC A;  3FTC A;  2Q8I B;  4M9Z A;  4MGY E;  1BCP C;  5FTL A;  1NSF A;  3FUX A;  1A6X A;  2H4O A;  1SSO A;  2F0I A;  4FF2 A;  3VKH A;  3Q0A A;  3MXG A;  3GRR A;  3AKZ A;  1SFO B;  2KA6 B;  5ITY A;  3G7L A;  2DHR A;  1J5E M;  2RA4 A;  1HQR D;  1TS2 A;  4RGM A;  2EPB A;  3GQB A;  3MEH A;  3S1R B;  2DNE A;  4F7X A;  2AQ3 B;  1DO0 A;  2WKD A;  2MUY A;  1IQP A;  1GUN A;  2SNM A;  3UZU A;  4LJ5 A;  5EKI A;  2R65 A;  3K5O A;  2R4E A;  5EP2 A;  3LMM A;  1MD2 D;  3PMF A;  4RKL A;  5BN4 A;  2VB2 X;  4ABN A;  1LV9 A;  4RA8 A;  1E2W A;  1PRT C;  2F0K A;  1JOO A;  4DAV A;  5F3W A;  1TWG B;  5EKK A;  1KDA A;  1JR3 A;  1D5X C;  2CHQ A;  4PMB A;  4HCS A;  2L7I A;  2G9D A;  3J7A V;  4JI3 M;  2QPA A;  2K5D A;  3TME A;  4ITQ A;  4CJ1 B;  3GV6 A;  3OIQ A;  4ZUJ A;  1SE3 A;  2FOI C;  4EQO A;  3MK6 A;  1YUB A;  4AZF A;  3SHL A;  3S14 B;  3K2L A;  1H9K A;  5FO9 B;  4CJ2 C;  4XT1 B;  2KRK A;  1HUM A;  2W82 A;  4FVM A;  4BLC A;  2DN8 A;  5JPM C;  1EEI D;  3GTJ B;  1FNW A;  2EDG A;  2J7O A;  4QOZ C;  1R9T B;  1TS3 A;  3TP6 A;  3T16 A;  2XIW A;  4CIS A;  5ITT A;  3HG9 A;  1BCP B;  1Q1E A;  5T1G A;  4AG5 A;  4OW0 A;  2NQ8 C;  4M9X A;  5LMN M;  2BDN A;  1XXG A;  1S3S A;  3VFD A;  1FR3 A;  3U6Q A;  1H9J A;  3D4R A;  3DHQ A;  4MGZ E;  4K14 A;  2G8L A;  3GTG B;  4DN4 M;  1KNE A;  1S4Z A;  4FCT A;  2J4X A;  2F0E A;  3TP8 A;  4LRS A;  1ZXT A;  3NBI A;  5IOD A;  3R8F A;  4A3V B;  1TDH A;  3DXJ C;  4DU9 A;  3SK4 A;  2A5Y B;  1ZEQ X;  2F5Q A;  4FD2 A;  3KVW A;  2VNU D;  4I4L A;  1GOZ A;  2XEP A;  2ZAO A;  5FTK A;  3H91 A;  4KI0 A;  1B44 D;  1LTB D;  2Z1C A;  5IGB A;  1IN8 A;  1NJG A;  2DY8 A;  4R7G A;  2KUM A;  3GRY A;  4QNM A;  2EYH A;  4WRD A;  1ORY B;  3Q8X A;  1LAC A;  1PRT B;  4IBD A;  2UXB M;  2HL7 A;  2ZXP A;  2F0D A;  1B9M A;  2LWX A;  4KHV A;  1G4A E;  4DR7 M;  5BN3 A;  3VDU A;  5K36 H;  1QAO A;  1SMY C;  3EQL C;  1AFP A;  3E6Z X;  1CA6 A;  3HU1 A;  4OO1 I;  1VF7 A;  2O5J C;  2OEO A;  5HGT A;  2HDL A;  2R45 A;  3VLF B;  4FXK C;  1E9R A;  5KPR A;  3FKI B;  4C56 C;  3MVV A;  3R93 A;  1DXM A;  3KLR A;  1W5S A;  2KED A;  4B7H A;  5EXX A;  4FWH A;  3AFH A;  2KXE A;  2M5Z A;  2QDB A;  1XC8 A;  1VDZ A;  1JB3 A;  3I4Y A;  4HL4 A;  3B9P A;  3BDC A;  3FYD A;  1EY4 A;  5FK9 C;  5EJW A;  2CHV A;  2LH0 A;  4C3J B;  2PYK A;  2OPF A;  2JA6 B;  4QCL A;  1TR5 A;  1VMP A;  4S3S A;  3PVS A;  1WXQ A;  4DAP A;  4M0W A;  2SNS A;  3TPZ A;  3IG8 A;  4H13 C;  3P7J A;  4X64 M;  2CEA A;  4I5S A;  2F5O A;  4I7Z C;  1L2D A;  2K6A A;  2WIN B;  4XQN A;  3RE8 A;  2KCC A;  3GTO B;  2QBY B;  2B2U C;  4G7O C;  3I4V A;  2EY6 A;  2L09 A;  1OXU A;  1EU4 A;  1KYI A;  1G29 1;  4IQZ A;  2NVY B;  5LL6 S;  2NTT A;  1TH2 A;  4KY7 A;  5M5Y B;  3GQ4 A;  2MP1 A;  1SNO A;  5I6W A;  2L9H A;  2F0S A;  2G5G X;  1AZQ A;  4IJE A;  3SMS A;  3VR3 A;  4DAY A;  3KSJ A;  2ZAM A;  3GLH A;  1KLU D;  2XSC A;  5AFW A;  1JQY D;  5JEA J;  4WUR A;  1RTO A;  4BBR B;  2IW3 A;  2XFS A;  3OTO M;  5ITX E;  1KNA A;  2J7Z A;  1IXR C;  4DV2 M;  3MA2 B;  4LJ9 A;  5M5X B;  3FTD A;  1IYU A;  1PXU A;  1SE2 A;  4KKS A;  3VA5 A;  3MXN A;  4XDX A;  3KFU G;  5C0X I;  3HU3 A;  3MXU A;  1Z5C A;  4HMI A;  2A74 C;  4RGN A;  4DV5 M;  1QE6 A;  3A46 A;  1CQV A;  3BVG A;  1GUT A;  2L6O A;  1JOQ A;  3SYL A;  1J8I A;  3HOW B;  1NCV A;  4IFD J;  3HHY A;  1GUG A;  3BG3 A;  2BJW A;  1K8O A;  2PMZ B;  3TE6 A;  3NWT A;  3VA7 A;  1G91 A;  5M5W B;  2WKC A;  4IBB A;  2R7Z B;  2EYL A;  3G6J B;  2Q8R E;  1HQM C;  3QB3 A;  2DWZ B;  3A54 A;  3PUX A;  5C4X B;  1LT3 D;  5E6J A;  3K6O A;  4GHL A;  3L7Z C;  2FNA A;  2Z4S A;  4F88 A;  5IOC A;  1PYW D;  3GLG A;  1HQC A;  4G4K A;  2C96 A;  2PW7 A;  1GXD C;  1PZI D;  2XGN A;  1CZW A;  1A3T A;  3DMU A;  3IFT A;  3J7A F;  2UU9 M;  1S5E D;  4G57 A;  4FF4 A;  4JN6 A;  2CV2 A;  3NE5 B;  1IY0 A;  3DZD A;  4D81 A;  4L6T B;  1SXJ C;  4DV4 M;  1E9S A;  1PTO H;  2VQF M;  2QEN A;  4MM3 B;  1QAN A;  4RGO S;  4J1M A;  2DVW B;  1PMR A;  5ISR A;  5EQT A;  2JA7 B;  5CGK A;  2KEB A;  3Q23 A;  4REZ A;  2FFK B;  3UJN A;  3VK8 A;  2X4A A;  1STB A;  3OOC A;  4KN4 C;  1W5T A;  1NAP A;  4J8Q A;  3K8Z A;  3CU7 A;  2C9O A;  1QB5 D;  3EFX D;  1LT5 D;  4PDI A;  4G6Z A;  3TBI B;  2CFO A;  4XQJ A;  2BJV A;  4HCE A;  2XVS A;  1TS4 A;  3VDP A;  5G3L F;  3HGI A;  4NXM M;  5E4X A;  2NN6 H;  1FNU A;  1NHG C;  1MGS A;  3K5N A;  3S1N B;  3ND8 A;  1I4W A;  3KS4 A;  3U6P A;  4HAE A;  3M6A A;  2F0V A;  2A6E C;  3ITP A;  5JVG 3;  4BS9 A;  5IGE A;  1HCZ A;  4X66 M;  2F0U A;  3RUZ A;  1K3W A;  2UUA M;  1ET9 A;  3H6M A;  1TU2 B;  2R6G A;  2A5H A;  2E2I B;  3SK8 A;  3U6O A;  4JI0 M;  2KQ3 A;  3BVM A;  1HFG A;  2PZT A;  1L0Y B;  1K8M A;  3PO2 B;  2B8F A;  5JOB A;  4KOD A;  4B3R M;  1I4H A;  1HNX M;  2YQZ A;  4LZJ A;  1HR0 M;  3HJQ A;  4ID6 A;  3GV3 A;  3HEJ A;  3TN2 A;  4KY5 A;  2B2Y C;  3J80 L;  3KK7 A;  4NXN M;  2F5N A;  4LF4 M;  2NVQ B;  2O5R A;  4ZYS A;  4YY3 M;  3FKE A;  1XNQ M;  7CAT A;  3X3M A;  4JI8 M;  1D5Z C;  4U68 A;  4MIU A;  5LL6 X;  3H94 A;  3DM1 A;  3FEW X;  1U4M A;  5CBE E;  1GHK A;  4DK1 A;  1DGG A;  3OPO A;  1JWM D;  4G7H C;  2L4N A;  3U6S A;  3VKG A;  2XNA C;  1LO5 D;  1IM2 A;  3I51 A;  2HKJ A;  3GO5 A;  3L26 A;  4HR7 B;  1HHV A;  3CRL C;  3GTK B;  4JV5 M;  1NHW C;  5I6Y A;  4S12 A;  3NBH A;  1RCV D;  2MHV A;  1YNN C;  4C3J G;  1KAB A;  3E0J A;  1T5E A;  1MU5 A;  1SXJ B;  3PNV A;  2E2D C;  1NY5 A;  2CVR A;  1Y1W B;  4MGI E;  1KTK A;  2XSZ A;  2XF3 A;  3WDN A;  2Y0T A;  4AKI A;  5CV6 A;  2DWL A;  2Y21 A;  2BNK A;  4ZKB B;  3NHH A;  4RWS C;  3EIH A;  1G2T A;  3DEO A;  1JCK B;  1VF5 C;  4TQU S;  1SNP A;  2KVM A;  2ICI A;  1H9M A;  3QWN A;  3HOY B;  1QNK A;  1ZYR D;  1N78 A;  3VR5 A;  2HQE A;  2X69 A;  1EY0 A;  3D6C A;  1I94 M;  2Q8T A;  3I4M B;  3T1Y M;  4XT3 B;  5E3F A;  1T5X D;  1STY A;  4LJZ C;  1XMO M;  1XX8 A;  3JAM S;  1Q1B A;  1Y69 U;  1SXT A;  4IUR A;  2KA7 A;  4Y7N B;  3A42 A;  1Q8I A;  4DV3 M;  2Z8L A;  1I4Q A;  3T15 A;  2A69 C;  4TRD A;  3C2P A;  3K92 A;  1IW7 D;  3D4D A;  3DA1 A;  4XYO A;  2L5T A;  1PJJ A;  4YHH M;  3FD9 A;  1TS5 A;  8CAT A;  2AWN A;  4EGV A;  4LF5 M;  5KIX A;  3LX0 A;  2KW0 A;  3ILK A;  5H37 D;  2QEJ C;  3NQI A;  5FTN A;  5I4D A;  1TGU A;  1E2V A;  2OQ4 A;  3SBJ A;  1N77 A;  2UUB M;  2B2V C;  1SJE D;  3W0L B;  3HP3 A;  4FWD A;  1TH4 A;  2OF1 A;  4OIK A;  3U6E A;  4B3S M;  5KRU A;  1O78 A;  5BR8 M;  3QOL A;  1MSH A;  2Z4I A;  3GP7 A;  1WTO A;  3KDS E;  4K0K M;  1UAP A;  4DV6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...