4DV7M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv7M02
1L2DA 1Z5BA 4LF8M 3GQ5A 3A45A 2XZFA 4X62M 4DUYM 2F5OA 4ITQA 4AQYM 1L1ZA 4LFAM 3U6OA 4JI3M 1K82A 4X64M 3TWMA 1N36M 3W0FA 3A42A 4GKKM 1XC8A 4DR4M 4X65M 1MX0A 2F4VM 2E5LM 3J81S 4JI5M 4DV5M 5FLXS 4DR7M 3GQ4A 3J80S 3U6QA 1Q3CA 4LF9M 4MB7A 3DOAA 4DV4M 2EA0A 5ITUA 3SAVA 2ZM6M 2UUAM 4NXMM 4JI0M 1EE8A 1Z5CA 3VK7A 1PM5A 4LF6M 1XMOM 4DUZM 3VK8A 4LF4M 4JI6M 3U6MA 1K3XA 4G4OA 5ITQA 1HNWM 1L2BA 5LMUM 4JI1M 1K3WA 2UUBM 5ITTA 3J7AS 4DV7M 3C58A 2F5NA 3GPYA 4JI8M 1Z59A 4JI7M 4B3MM 4DV6M 3GO8A 3U6DA 1I94M 2F5SA 3U6EA 5ITRA 3GP1A 1XNRM 4YHHM 1J5EM 4NRWA 2VQFM 3SAUA 1IBLM 4DV2M 3JR5A 1N33M 1NNJA 4PD2A 4DR3M 3U6SA 4OX9M 1N32M 3T1HM 1Q39A 2OQ4A 4LF7M 5A2QS 4DR6M 1HNZM 4LFCM 1R2ZA 3JAMS 3GPXA 1IBMM 2OPFA 2UXBM 3SASA 4K0KM 3U6CA 4B3RM 2XZUA 4LF5M 2F5QA 3TWKA 3SATA 1Z5AA 2VQEM 2HHHM 1XNQM 3SBJA 1KFVA 3GPPA 2UUCM 1PJIA 1HR0M 4G4NA 2HKJA 4DV0M 1PJJA 1HNXM 1R2YA 3JR4A 3SAWA 4DR5M 1Q3BA 3GQ3A 3T1YM 3SARA 1XMQM 4YY3M 1TDHA 4PDGA 5ITYA 4DR1M 4DV3M 2ZBKB 4JYAM 2UXDM 4GKJM 2UU9M 3A46A 4G4RA 1IBKM 3OTOM 4DV1M 5ITXE 1L2CA 4JV5M 4DR2M 3U6LA 4CISA 1FJGM 1MU5A 4LFBM 2Q2EB 4PDIA 4B3TM 4KHPM 1TDZA 2UXCM 4X66M 5ITXA 4PCZA 5LMNM 3TWLA 4NXNM 4JI2M 3GPUA 4NRVA 5BR8M 4G4QA 1N34M 2F5PA 4B3SM 4JI4M 3U6PA 5IT9S 1L1TA 5IWAM
chains in the Genus database with same CATH superfamily
2LHCA 4NOOB 1G41A 1VEKA 4L6V6 4KO8A 3SYLA 3A45A 2XLJA 2MGWA 4LF8M 1OFIA 2C98A 3Q8GA 4X62M 4DUYM 8CATA 1T43A 2LWXA 4AQYM 2JZ1A 4ITQA 1DV0A 3HX3A 1QAOA 2XF3A 3B7QA 5EXXA 2K9DA 3AV0A 4FWHA 3FTEA 2ZTCA 2L7IA 3W0FA 2DAKA 2QBYB 1MJGM 4B7FA 2X8AA 2QSFX 3QAUA 1XC8A 2LHGA 4W5WA 1IN8A 3KOXE 3FYDA 4B7HA 2DAGA 3IG5A 4OW0A 2HL7A 4WURA 2E5LM 3R8FA 4MGYE 2Y20A 2QBYA 2JWSA 2R44A 4PT5A 2HCBA 4G4OA 2HWJA 1JQJC 2VDBB 4DV4M 2I7PA 2JY8A 2UUAM 2CHGA 4FCWA 4GH9A 2C9OA 4NXMM 5EJCA 1W5TA 3E4RA 1CUKA 4GHAA 2LVAA 4DUZM 3R9XB 3K9PA 1OKSA 1RU3A 3HKPA 4JI1M 1N75A 1R5LA 2F5NA 5EXTA 2Z7JA 3LVVA 3GPYA 5FTMA 4JI8M 3HJ8A 1IFYA 1IXSB 1Z59A 4JI7M 4A3VB 3HHWA 5KO3A 3CGWA 3F92A 4DV6M 4AG6A 3U6DA 4AW4A 3GP1A 4YHHM 3DZDA 3PNYA 1E94E 3UGJA 4RNAA 3JR5A 1GJSA 1W5SA 3GRVA 1IXSA 1OJLA 3VDPA 2V1UA 1N33M 4OX9M 2VF7A 1UM8A 1X37A 2DI0A 3VLFB 1IXRC 1N77A 1HT1E 3I01M 1HT2E 4L8RC 1DGFA 2QCUA 2RKOA 4TUWA 1IXZA 1Y8GA 1YE9A 1IBMM 1SXJD 1LV7A 2LH0A 4IBBA 4L16A 2QENA 4OVZA 4RF1A 3L26A 3U6CA 2QNJA 2XZUA 4GEWA 1DO2A 1TF0B 2FOIC 1Z5AA 1TGUA 2VQEM 2H5XA 3SBJA 1KFVA 3LCUA 3M6AA 2Y21A 3DFZA 3PXGA 2UUCM 1Z6TA 2CHQA 3K9OA 3SHGB 2HKJA 4DV0M 1IQPA 4QNRA 1G59A 3AL0C 1R2YA 3SARA 3T1YM 4R71A 1IM2A 2YNMD 2R45A 2XFTA 2OOAA 2XFSA 5ITYA 4DV3M 1KSFX 1EIJA 3WHKA 4B08A 3RFWA 3D8BA 2JA2A 4BB9A 3A46A 1IBKM 3FE3A 2EO2A 4DV1M 4R3DA 1L2CA 3KSXA 1NNUC 2YR0A 2JY5A 3THGA 1NSFA 1QVRA 3RGPA 3B89A 4B3TM 1G4AE 2R62A 1GO5A 4NL4H 3E9SA 3CTWB 1SXJB 4NXNM 1OIZA 4JI2M 1WGLA 4NRVA 2VIIA 2DAMA 5IT9S 3KOZE 1SXJE 1L2DA 1PJQA 2KXEA 3C3DA 2ZAMA 4I4LA 3ZQJA 1MN3A 3NBXX 2CUZA 2DKLA 4LJ6A 3U6PA 3I4YA 5F3WA 2D7HA 1SXJA 1L1ZA 4LY6A 4IBDA 5DYIA 2DNAA 1GL6A 2ZANA 1F4IA 1WGNA 2YQZA 4IBCA 1T6OA 3TWMA 1N36M 2K0BX 3FRIA 4GKKM 4F1IA 1ZAEA 1ZMUA 1BVSA 4D82A 3HWSA 3SHFA 4CGYB 4UN2B 3K92A 3ILKA 1K3XA 1IN5A 2DENA 3I4VA 2WSFF 5FLXS 3GLFB 3KP1E 3T15A 3U5ZB 3J80S 3T38A 4QHSA 3U6QA 1DGHB 2JXNA 2O5RA 3GLFE 2B3TA 4MGIE 4B7GA 4D81A 1GLNA 2EA0A 3LMMA 4XBOA 3L25A 3H4MA 4JI0M 1EE8A 2V1CA 4FD2A 4AG5A 1XMOM 3GLFA 3FRHA 3VK8A 2J5YA 4LF4M 3U5ZA 4JI6M 3HJQA 4MGHA 2LVNC 2CE7A 1DGHA 3L29A 4G6ZA 4MM3B 3HHXA 1GVNA 4EIWA 1NO1A 2L4FA 3LVWA 2O25A 1NVMA 4HL4A 5ITTA 4IBKA 1WIVA 1K3WA 3J2PB 1VG5A 3C58A 1OFHA 3I51A 4IJEA 3EIEA 5EQTA 1E32A 4B3MM 2RRUA 4IBIA 3SFZA 3CF6E 2LVQD 2F5SA 3U6EA 4L4UA 5ITRA 2L7HA 3GLIB 3KVWA 1R4GA 3FTCA 3LCVB 2VQFM 3B74A 1ZV1A 4KODA 4WW0A 5L8RF 1IBLM 4NC6A 4RKUF 3GLIE 2BWEA 1IN4A 2XGNA 1GL7A 3E46A 1AUAA 5KPRA 3MK6A 2VF8A 3KOYE 1OQYA 3T1HM 1J09A 4LF7M 5A2QS 4QNMA 2DAIA 3GLIA 4DR6M 4HLQA 1IN7A 2L4EA 3MMPA 1ZMWA 2DHRA 4I8OA 2D7GA 3UJNA 1HNZM 2Z4RA 3PFIA 1NY6A 3QYBA 3I04M 4REZA 3JAMS 2BJVA 1ZMVA 4GIPA 4CIZA 1G71A 3U61B 2DVWB 5H37D 3V76A 4KT0F 4WP2A 1TH4A 3KP0E 4Z8XA 1G3IA 2HHHM 2EUCA 4LZJA 2DZOB 5FTLA 2X49A 3QYEA 4S12A 1PJIA 5FTJA 5KQDA 3U61A 4M0WA 4G4NA 3HY5A 4QOSA 1V34A 3FUWA 5E6JA 1QUSA 2GQFA 5EXPA 1TTEA 1TDHA 2EKFA 4PDGA 1XMQM 4AKIA 4DR1M 2FNAA 1D0LA 1ORYB 2MJ5B 3FUXA 2UXDM 1L8QA 3KDSE 3KS4A 2CV2A 2JZ0A 4JV5M 4DR2M 1DGBA 4CISA 4GMQA 1OAIA 1KYIA 4ANRA 2JY7A 1J7KA 4LCBA 4LZZA 1XWIA 3B9PA 4PDIA 1TH2A 1L2BA 4KHPM 2CFOA 2RGOA 4LJ8A 3TWLA 4B3SM 2F5PA 1N78A 1QZMA 1QDRA 3GRYA 2CRUA 2HAKA 4NSOB 1Z5BA 5EP3A 2XEPA 3TQSA 4KLNA 1VQ1A 5IREB 2CP8A 4BLCA 1ZQ9A 2DHYA 2R0IA 5KQ8A 4QOZC 4MH0E 2CV1A 4LFAM 3U6OA 3AJIB 2AHMA 4I81A 4D80A 1K82A 4X64M 1Q02A 2EKKA 3L27A 1QZEA 2FH0A 1C1KA 2Z4SA 1NY5A 2LVPC 2KRKA 3HHZA 4DR4M 1SG9A 2R4JA 5EP4A 3ZH9B 3CF0A 2KEBA 3KOWE 4P17A 4XK8F 2K6BA 5JI2E 3GRRA 5DFLA 3J81S 4JI5M 4DV5M 1XHBA 4GRIA 3VKGA 1XXHB 2G5GX 4MGZE 4GHLA 2OOBA 3GQ4A 4NSRA 5EXSA 4LF9M 1XXHE 3LQQA 3VFDA 3SAVA 3VDUA 4GC5A 4L78A 1Z5CA 3KS8A 2L2DA 2Z8YM 4LF6M 1XXHA 4M9ZA 4FWDA 4P16A 4Y28F 4LG2A 4IBJA 3KSJA 4IJFA 2UUBM 4FCTA 4IBEA 2BWBA 3J7AS 5JI3E 1G8PA 3AOGA 1UFZA 4LRSA 1EFUB 4M0DA 2DWMA 1YLAA 2R46A 2XH9A 3K8ZA 3TL4X 2KW0A 4IBGA 4L15A 2JUJA 1FNNA 3HJSA 5LMUM 2DWLA 2DWNA 1XNRM 3FUVA 4LGMA 3SC3A 1XB2B 2KDLA 1J5EM 2QQ8A 4NRWA 2ZTDA 4AKGA 1DO0A 2QP9X 4LJAA 4DV2M 2QPAA 4LRTA 4PD2A 2WSCF 3U6SA 1I4WA 3GLGB 3HGIA 1V33A 3GLGE 1IY2A 1HJPA 1PGYA 1VEJA 1R6BX 2LTUA 2V6ZM 1GKIA 4IBFA 2JY6B 1TH3A 1R2ZA 4OU7A 3UK6A 3GLGA 2OPFA 2UXBM 2KRUA 3UZUA 4K0KM 4B3RM 3EIHA 4JXJA 2ERCA 2F5QA 3SATA 4LF5M 1IY1A 3NBIA 5C1BA 4Q7JA 5FTKA 4CJ6A 2KNVA 3LQRA 3FTFA 2N35A 3AKZA 2DAEA 1LTMA 2KNAA 3IHPA 3QWLA 1HNXM 1AIPC 3UMMA 3JR4A 3SAWA 1YSYA 1Q3BA 3L28A 3GQ3A 2M60A 5FSWA 4DR5M 4F2LA 2C5RA 4YY3M 3VKHA 2O01F 3W68A 5DYGA 3KW6A 5E26A 1IN6A 2R6FA 4LJ4A 1P3QQ 4GKJM 2MH8A 4AI6A 4G4RA 1T3TA 1YUBA 2WSEF 3J7BA 5ITXE 1HQYE 2KZUA 3U6LA 1QDTA 2YFQA 1MU5A 4LJ5A 3RE8A 2Q2EB 2W82A 3LW5F 5KPTA 1QQWA 1WR1B 3PVSA 4LJ9A 2FFJA 4X66M 3AFHA 5ITXA 4PCZA 5LMNM 1D0KA 1NV8A 3GPUA 4G4QA 1N34M 1JB0F 2C9CA 3FUTA 3B7ZA 1L1TA 1VEGA 3BBZA 3W67A 3MHVC 3GQ5A 4II7A 4Z6YA 2XZFA 1HNWM 2L09A 2NQ8C 3GRUA 1NHWC 5DNYA 2F5OA 2G8LA 3C3EA 3HU3A 2CEAA 3L2AA 3Q8XA 1QYRA 4JI3M 3FD9A 5EP1A 4AZFA 3K2LA 3B7NA 1C7YA 3A42A 4FCVA 2A5YB 1QAMA 1WXQA 1JR3D 4M9XA 2GNOA 1TR8A 2XSZD 2G3QA 1MX0A 2ZAOA 4X65M 2F4VM 1OAOC 1V92A 2BJWA 2KHHA 2RGHA 4ZPXA 3FUUA 4DR7M 1D2NA 1NJGA 3D8LA 1Q3CA 1WJ7A 4MB7A 3DOAA 2H1RA 2JNHA 1NV9A 2DXIA 2APLA 1NJFA 1PJTA 2CHVA 3J27B 4IIWA 4LJ7A 5ITUA 2ZM6M 3MJ5A 1NHGC 2KA6B 3VK7A 1PM5A 2MR9A 3M0EA 3SYKA 2DZNB 4BBAA 1QANA 3U6MA 3GLHB 5ITQA 2MROB 3M7GA 3TPZA 3HHYA 1QUTA 3GLHE 4FWGA 5BPVA 3KFUG 2LVOC 2WZJA 4DV7M 3U60B 2X4AA 3AOEA 1E9RA 2R4EA 1GABA 4G3OA 1QAQA 4GITA 5GKNA 3GLHA 1PRBA 3FKEA 4I5SA 5EP2A 3ZCBB 3GO8A 1I94M 3WHLA 3BXWA 2KZSA 4M9SA 1JR3E 2Y0TA 4JN6A 3K1JA 3U60A 3AOEC 1DGGA 4MGKE 3SAUA 1S3SA 2FS1A 4DBGB 1NNJA 5FTNA 4DR3M 1R7RA 2LXEA 1JR3A 2Z3XA 1N32M 2C96A 1Q39A 2OQ4A 3IECA 2R18A 2XSZA 3PNVA 7CATA 4LGYA 4HEOA 3E21A 2LBCA 4XGIA 2CV0A 2QHOB 3HZJA 3RGSA 4AKHA 3GPXA 3SASA 2JP7A 3FYCA 3TE6A 1OIPA 3H4JA 3TWKA 1VDDA 1A5TA 3SMSA 1XNQM 3T6PA 2FE8A 1H6UA 3HU1A 4FW9A 3GPPA 1OTRA 1HR0M 1GJTA 3SMPA 2KNZA 2R65A 1PJJA 2L6OA 2J7OA 4CHTB 4LFCM 2D7EA 2CWBA 3BOSA 4R7GA 5KPZA 2C99A 2M5ZA 1WHCA 1HQCA 2EJSA 3HU2A 2ZBKB 4JYAM 2K47A 4RF0A 2DZLA 2OO9A 1SXJC 2UU9M 3OTOM 3ZC7B 4OVZB 2Y0QA 1FJGM 3DA1A 2BNKA 2DWZB 4LFBM 3A98B 4FVMA 5C18A 3W0LB 1TDZA 2J7NA 2UXCM 3IG8A 1IY0A 1D0MA 2I7NA 2P5TA 1VDLA 2QZ4A 3C9PA 3FTDA 4QHTA 3KXEC 5BR8M 5IZ7D 3NWLA 3CF2A 2LNHC 1PJSA 4GC9A 4JI4M 1E9SA 5IWAM
chains in the Genus database with same CATH topology
4NOOB 1G41A 3SYLA 4LF8M 4KO8A 2XLJA 3A45A 1OFIA 2C98A 4X62M 4DUYM 4ITQA 2LWXA 4AQYM 1QAOA 2XF3A 5EXXA 3AV0A 4FWHA 3FTEA 2L7IA 3W0FA 2QBYB 4B7FA 2X8AA 3QAUA 1XC8A 4W5WA 1IN8A 3KOXE 3FYDA 4B7HA 3IG5A 4OW0A 2HL7A 4WURA 2E5LM 3R8FA 4MGYE 2Y20A 2QBYA 4PT5A 2HCBA 1JQJC 4DV4M 2I7PA 2UUAM 2CHGA 4FCWA 4GH9A 2C9OA 4NXMM 5EJCA 1W5TA 3E4RA 4GHAA 4DUZM 3R9XB 3HKPA 4JI1M 1N75A 2F5NA 5EXTA 2Z7JA 3LVVA 3GPYA 5FTMA 4JI8M 3HJ8A 1IXSB 1Z59A 4JI7M 4A3VB 3HHWA 5KO3A 4DV6M 4AG6A 3U6DA 4AW4A 3GP1A 4YHHM 3DZDA 3PNYA 1E94E 3UGJA 4RNAA 3JR5A 1W5SA 3GRVA 1OJLA 3VDPA 2V1UA 1N33M 4OX9M 1UM8A 1X37A 3VLFB 1IXRC 1N77A 1HT1E 1HT2E 4L8RC 1DGFA 2QCUA 2RKOA 4TUWA 1IXZA 1YE9A 1IBMM 1SXJD 1LV7A 2LH0A 4IBBA 4L16A 2QENA 4OVZA 4RF1A 3L26A 3U6CA 2XZUA 1DO2A 2FOIC 1Z5AA 1TGUA 2VQEM 3SBJA 1KFVA 3M6AA 2UUCM 2Y21A 3DFZA 3PXGA 1Z6TA 2CHQA 3SHGB 2HKJA 4DV0M 1IQPA 4QNRA 1G59A 3AL0C 1R2YA 3SARA 3T1YM 1IM2A 2YNMD 2R45A 2XFTA 5ITYA 2XFSA 4DV3M 1KSFX 3WHKA 4B08A 3RFWA 3D8BA 2JA2A 4BB9A 3A46A 1IBKM 2EO2A 4DV1M 4R3DA 1L2CA 3KSXA 1NNUC 2YR0A 3THGA 1NSFA 1QVRA 3RGPA 4B3TM 1G4AE 2R62A 4NL4H 3E9SA 3CTWB 1SXJB 4NXNM 4JI2M 4NRVA 2VIIA 5IT9S 3KOZE 1SXJE 1L2DA 2KXEA 2ZAMA 4I4LA 2CUZA 4LJ6A 3U6PA 3I4YA 5F3WA 2D7HA 1SXJA 1L1ZA 4LY6A 4IBDA 5DYIA 1GL6A 2ZANA 2YQZA 4IBCA 3TWMA 1N36M 4GKKM 1ZAEA 4D82A 3HWSA 3SHFA 4CGYB 3K92A 3ILKA 1IN5A 3I4VA 5FLXS 3GLFB 3KP1E 3T15A 3U5ZB 3J80S 3T38A 4QHSA 3U6QA 1DGHB 2O5RA 4MGIE 4B7GA 4D81A 1GLNA 2EA0A 3LMMA 4XBOA 3L25A 3H4MA 4JI0M 1EE8A 2V1CA 4FD2A 4AG5A 1XMOM 3GLFA 3VK8A 4LF4M 3U5ZA 4JI6M 3HJQA 4MGHA 4G4OA 2CE7A 1DGHA 3L29A 4G6ZA 4MM3B 3HHXA 1GVNA 4EIWA 5LMUM 3LVWA 1K3WA 1K3XA 1NVMA 4HL4A 5ITTA 4IBKA 3J2PB 3C58A 1OFHA 3I51A 4IJEA 3EIEA 5EQTA 1E32A 4B3MM 4IBIA 3SFZA 3CF6E 2F5SA 3U6EA 4L4UA 5ITRA 2L7HA 3GLIB 3KVWA 2VQFM 3FTCA 1IBLM 4KODA 4WW0A 1IN4A 2XGNA 1GL7A 5KPRA 3MK6A 3KOYE 3T1HM 1J09A 4LF7M 5A2QS 4QNMA 3GLIA 4DR6M 4HLQA 1IN7A 4I8OA 2DHRA 1HNZM 2D7GA 3UJNA 2Z4RA 3PFIA 1NY6A 4REZA 8CATA 5FSWA 3JAMS 2BJVA 4LFCM 4GIPA 3U61B 2DVWB 5H37D 1TH4A 3KP0E 4Z8XA 1G3IA 2HHHM 2EUCA 4LZJA 2DZOB 5FTLA 2X49A 4S12A 1PJIA 5FTJA 5KQDA 3U61A 4M0WA 4G4NA 4QOSA 5E6JA 3FUWA 5EXPA 1XMQM 1TDHA 4PDGA 4AKIA 4DR1M 2FNAA 1ORYB 3FUXA 2UXDM 1L8QA 3KDSE 3KS4A 2CV2A 4JV5M 4DR2M 1DGBA 4CISA 4GMQA 1KYIA 1J7KA 4LCBA 4LZZA 1XWIA 3B9PA 4PDIA 1TH2A 1L2BA 4KHPM 2CFOA 2RGOA 4LJ8A 3TWLA 4B3SM 2F5PA 1N78A 1QZMA 3GRYA 4NSOB 1Z5BA 5EP3A 2XEPA 3TQSA 4KLNA 5IREB 4BLCA 1ZQ9A 5KQ8A 4QOZC 4MH0E 2CV1A 4LFAM 3U6OA 3AJIB 2AHMA 4I81A 4D80A 1K82A 4X64M 3L27A 1C1KA 2Z4SA 1NY5A 2KRKA 3HHZA 4DR4M 2R4JA 5EP4A 3ZH9B 3CF0A 2KEBA 3KOWE 5JI2E 3J81S 3GRRA 4JI5M 4DV5M 1XHBA 4GRIA 3VKGA 1XXHB 2G5GX 4MGZE 4GHLA 3GQ4A 4NSRA 5EXSA 4LF9M 3LQQA 3VFDA 3SAVA 3VDUA 4GC5A 4L78A 1Z5CA 3KS8A 4LF6M 1XXHA 4M9ZA 4FWDA 4P16A 4LG2A 4IBJA 3KSJA 4IJFA 2UUBM 4FCTA 4IBEA 3J7AS 5JI3E 1G8PA 3AOGA 4LRSA 4M0DA 2DWMA 2XH9A 2R46A 3K8ZA 3TL4X 2KW0A 4IBGA 4L15A 1FNNA 3HJSA 2DWLA 2DWNA 1XNRM 3FUVA 4LGMA 3SC3A 1J5EM 4NRWA 4AKGA 1DO0A 2QP9X 4LJAA 4DV2M 2QPAA 4LRTA 4PD2A 3U6SA 1I4WA 3GLGB 3HGIA 1IY2A 1R6BX 2V6ZM 1GKIA 4IBFA 1TH3A 1R2ZA 4OU7A 3UK6A 3GLGA 2OPFA 2UXBM 2KRUA 3UZUA 4K0KM 4B3RM 3EIHA 4JXJA 2ERCA 2F5QA 3SATA 4LF5M 1IY1A 3NBIA 5C1BA 5FTKA 3LQRA 3FTFA 3AKZA 3QWLA 1HNXM 3UMMA 3JR4A 3SAWA 1YSYA 1Q3BA 3L28A 3GQ3A 2M60A 4DR5M 2C5RA 4YY3M 3VKHA 5DYGA 3KW6A 5E26A 1IN6A 4LJ4A 4GKJM 4AI6A 4G4RA 1T3TA 1YUBA 3J7BA 5ITXE 1HQYE 2KZUA 3U6LA 2YFQA 1MU5A 4LJ5A 3RE8A 2Q2EB 2W82A 5KPTA 1QQWA 3PVSA 4LJ9A 2FFJA 4X66M 3AFHA 5ITXA 4PCZA 5LMNM 3GPUA 4G4QA 1N34M 2C9CA 3FUTA 1L1TA 3MHVC 3GQ5A 4II7A 4Z6YA 2XZFA 1HNWM 2L09A 2NQ8C 3GRUA 1NHWC 5DNYA 2F5OA 2G8LA 3HU3A 2CEAA 3L2AA 3Q8XA 1QYRA 4JI3M 3FD9A 5EP1A 4AZFA 3K2LA 3A42A 4FCVA 2A5YB 1QAMA 1WXQA 1JR3D 4M9XA 2XSZD 4X65M 1MX0A 2ZAOA 2F4VM 2BJWA 2RGHA 4ZPXA 3FUUA 4DR7M 1D2NA 1NJGA 3D8LA 1Q3CA 4MB7A 3DOAA 2H1RA 2DXIA 1NJFA 2CHVA 4IIWA 3J27B 4LJ7A 5ITUA 2ZM6M 3MJ5A 1NHGC 2KA6B 3VK7A 1PM5A 3M0EA 3SYKA 2DZNB 4BBAA 1QANA 3U6MA 3GLHB 5ITQA 3M7GA 3TPZA 3HHYA 5BPVA 4FWGA 3KFUG 4DV7M 3U60B 2X4AA 3AOEA 1E9RA 2R4EA 1QAQA 4GITA 5GKNA 3GLHA 3FKEA 5EP2A 4I5SA 3ZCBB 3GO8A 1I94M 3WHLA 2KZSA 4M9SA 2Y0TA 4JN6A 3K1JA 3U60A 3AOEC 1DGGA 4MGKE 3SAUA 1S3SA 1NNJA 5FTNA 4DR3M 1R7RA 2LXEA 1JR3A 2Z3XA 1N32M 2C96A 1Q39A 2OQ4A 2R18A 2XSZA 3PNVA 7CATA 4LGYA 4XGIA 2CV0A 3RGSA 4AKHA 3GPXA 3SASA 3FYCA 3TE6A 3TWKA 1VDDA 3SMSA 1XNQM 2FE8A 1H6UA 3HU1A 4FW9A 3GPPA 1HR0M 3SMPA 2R65A 1PJJA 2L6OA 2J7OA 4CHTB 2D7EA 3BOSA 4R7GA 5KPZA 2C99A 2M5ZA 1HQCA 3HU2A 2ZBKB 4JYAM 2K47A 4RF0A 1SXJC 2UU9M 3OTOM 3ZC7B 4OVZB 2Y0QA 1FJGM 3DA1A 2BNKA 2DWZB 4LFBM 3A98B 4FVMA 5C18A 3W0LB 1TDZA 2J7NA 2UXCM 3IG8A 1IY0A 2I7NA 2QZ4A 2P5TA 4QHTA 3FTDA 3KXEC 5BR8M 5IZ7D 3NWLA 3CF2A 2LNHC 4GC9A 4JI4M 1E9SA 5IWAM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2D A;  1Z5B A;  4LF8 M;  3GQ5 A;  3A45 A;  2XZF A;  4X62 M;  4DUY M;  2F5O A;  4ITQ A;  4AQY M;  1L1Z A;  4LFA M;  3U6O A;  4JI3 M;  1K82 A;  4X64 M;  3TWM A;  1N36 M;  3W0F A;  3A42 A;  4GKK M;  1XC8 A;  4DR4 M;  4X65 M;  1MX0 A;  2F4V M;  2E5L M;  3J81 S;  4JI5 M;  4DV5 M;  5FLX S;  4DR7 M;  3GQ4 A;  3J80 S;  3U6Q A;  1Q3C A;  4LF9 M;  4MB7 A;  3DOA A;  4DV4 M;  2EA0 A;  5ITU A;  3SAV A;  2ZM6 M;  2UUA M;  4NXM M;  4JI0 M;  1EE8 A;  1Z5C A;  3VK7 A;  1PM5 A;  4LF6 M;  1XMO M;  4DUZ M;  3VK8 A;  4LF4 M;  4JI6 M;  3U6M A;  1K3X A;  4G4O A;  5ITQ A;  1HNW M;  1L2B A;  5LMU M;  4JI1 M;  1K3W A;  2UUB M;  5ITT A;  3J7A S;  4DV7 M;  3C58 A;  2F5N A;  3GPY A;  4JI8 M;  1Z59 A;  4JI7 M;  4B3M M;  4DV6 M;  3GO8 A;  3U6D A;  1I94 M;  2F5S A;  3U6E A;  5ITR A;  3GP1 A;  1XNR M;  4YHH M;  1J5E M;  4NRW A;  2VQF M;  3SAU A;  1IBL M;  4DV2 M;  3JR5 A;  1N33 M;  1NNJ A;  4PD2 A;  4DR3 M;  3U6S A;  4OX9 M;  1N32 M;  3T1H M;  1Q39 A;  2OQ4 A;  4LF7 M;  5A2Q S;  4DR6 M;  1HNZ M;  4LFC M;  1R2Z A;  3JAM S;  3GPX A;  1IBM M;  2OPF A;  2UXB M;  3SAS A;  4K0K M;  3U6C A;  4B3R M;  2XZU A;  4LF5 M;  2F5Q A;  3TWK A;  3SAT A;  1Z5A A;  2VQE M;  2HHH M;  1XNQ M;  3SBJ A;  1KFV A;  3GPP A;  2UUC M;  1PJI A;  1HR0 M;  4G4N A;  2HKJ A;  4DV0 M;  1PJJ A;  1HNX M;  1R2Y A;  3JR4 A;  3SAW A;  4DR5 M;  1Q3B A;  3GQ3 A;  3T1Y M;  3SAR A;  1XMQ M;  4YY3 M;  1TDH A;  4PDG A;  5ITY A;  4DR1 M;  4DV3 M;  2ZBK B;  4JYA M;  2UXD M;  4GKJ M;  2UU9 M;  3A46 A;  4G4R A;  1IBK M;  3OTO M;  4DV1 M;  5ITX E;  1L2C A;  4JV5 M;  4DR2 M;  3U6L A;  4CIS A;  1FJG M;  1MU5 A;  4LFB M;  2Q2E B;  4PDI A;  4B3T M;  4KHP M;  1TDZ A;  2UXC M;  4X66 M;  5ITX A;  4PCZ A;  5LMN M;  3TWL A;  4NXN M;  4JI2 M;  3GPU A;  4NRV A;  5BR8 M;  4G4Q A;  1N34 M;  2F5P A;  4B3S M;  4JI4 M;  3U6P A;  5IT9 S;  1L1T A;  5IWA M; 
#chains in the Genus database with same CATH topology
 2LHC A;  4NOO B;  1G41 A;  1VEK A;  4L6V 6;  4KO8 A;  3SYL A;  3A45 A;  2XLJ A;  2MGW A;  4LF8 M;  1OFI A;  2C98 A;  3Q8G A;  4X62 M;  4DUY M;  8CAT A;  1T43 A;  2LWX A;  4AQY M;  2JZ1 A;  4ITQ A;  1DV0 A;  3HX3 A;  1QAO A;  2XF3 A;  3B7Q A;  5EXX A;  2K9D A;  3AV0 A;  4FWH A;  3FTE A;  2ZTC A;  2L7I A;  3W0F A;  2DAK A;  2QBY B;  1MJG M;  4B7F A;  2X8A A;  2QSF X;  3QAU A;  1XC8 A;  2LHG A;  4W5W A;  1IN8 A;  3KOX E;  3FYD A;  4B7H A;  2DAG A;  3IG5 A;  4OW0 A;  2HL7 A;  4WUR A;  2E5L M;  3R8F A;  4MGY E;  2Y20 A;  2QBY A;  2JWS A;  2R44 A;  4PT5 A;  2HCB A;  4G4O A;  2HWJ A;  1JQJ C;  2VDB B;  4DV4 M;  2I7P A;  2JY8 A;  2UUA M;  2CHG A;  4FCW A;  4GH9 A;  2C9O A;  4NXM M;  5EJC A;  1W5T A;  3E4R A;  1CUK A;  4GHA A;  2LVA A;  4DUZ M;  3R9X B;  3K9P A;  1OKS A;  1RU3 A;  3HKP A;  4JI1 M;  1N75 A;  1R5L A;  2F5N A;  5EXT A;  2Z7J A;  3LVV A;  3GPY A;  5FTM A;  4JI8 M;  3HJ8 A;  1IFY A;  1IXS B;  1Z59 A;  4JI7 M;  4A3V B;  3HHW A;  5KO3 A;  3CGW A;  3F92 A;  4DV6 M;  4AG6 A;  3U6D A;  4AW4 A;  3GP1 A;  4YHH M;  3DZD A;  3PNY A;  1E94 E;  3UGJ A;  4RNA A;  3JR5 A;  1GJS A;  1W5S A;  3GRV A;  1IXS A;  1OJL A;  3VDP A;  2V1U A;  1N33 M;  4OX9 M;  2VF7 A;  1UM8 A;  1X37 A;  2DI0 A;  3VLF B;  1IXR C;  1N77 A;  1HT1 E;  3I01 M;  1HT2 E;  4L8R C;  1DGF A;  2QCU A;  2RKO A;  4TUW A;  1IXZ A;  1Y8G A;  1YE9 A;  1IBM M;  1SXJ D;  1LV7 A;  2LH0 A;  4IBB A;  4L16 A;  2QEN A;  4OVZ A;  4RF1 A;  3L26 A;  3U6C A;  2QNJ A;  2XZU A;  4GEW A;  1DO2 A;  1TF0 B;  2FOI C;  1Z5A A;  1TGU A;  2VQE M;  2H5X A;  3SBJ A;  1KFV A;  3LCU A;  3M6A A;  2Y21 A;  3DFZ A;  3PXG A;  2UUC M;  1Z6T A;  2CHQ A;  3K9O A;  3SHG B;  2HKJ A;  4DV0 M;  1IQP A;  4QNR A;  1G59 A;  3AL0 C;  1R2Y A;  3SAR A;  3T1Y M;  4R71 A;  1IM2 A;  2YNM D;  2R45 A;  2XFT A;  2OOA A;  2XFS A;  5ITY A;  4DV3 M;  1KSF X;  1EIJ A;  3WHK A;  4B08 A;  3RFW A;  3D8B A;  2JA2 A;  4BB9 A;  3A46 A;  1IBK M;  3FE3 A;  2EO2 A;  4DV1 M;  4R3D A;  1L2C A;  3KSX A;  1NNU C;  2YR0 A;  2JY5 A;  3THG A;  1NSF A;  1QVR A;  3RGP A;  3B89 A;  4B3T M;  1G4A E;  2R62 A;  1GO5 A;  4NL4 H;  3E9S A;  3CTW B;  1SXJ B;  4NXN M;  1OIZ A;  4JI2 M;  1WGL A;  4NRV A;  2VII A;  2DAM A;  5IT9 S;  3KOZ E;  1SXJ E;  1L2D A;  1PJQ A;  2KXE A;  3C3D A;  2ZAM A;  4I4L A;  3ZQJ A;  1MN3 A;  3NBX X;  2CUZ A;  2DKL A;  4LJ6 A;  3U6P A;  3I4Y A;  5F3W A;  2D7H A;  1SXJ A;  1L1Z A;  4LY6 A;  4IBD A;  5DYI A;  2DNA A;  1GL6 A;  2ZAN A;  1F4I A;  1WGN A;  2YQZ A;  4IBC A;  1T6O A;  3TWM A;  1N36 M;  2K0B X;  3FRI A;  4GKK M;  4F1I A;  1ZAE A;  1ZMU A;  1BVS A;  4D82 A;  3HWS A;  3SHF A;  4CGY B;  4UN2 B;  3K92 A;  3ILK A;  1K3X A;  1IN5 A;  2DEN A;  3I4V A;  2WSF F;  5FLX S;  3GLF B;  3KP1 E;  3T15 A;  3U5Z B;  3J80 S;  3T38 A;  4QHS A;  3U6Q A;  1DGH B;  2JXN A;  2O5R A;  3GLF E;  2B3T A;  4MGI E;  4B7G A;  4D81 A;  1GLN A;  2EA0 A;  3LMM A;  4XBO A;  3L25 A;  3H4M A;  4JI0 M;  1EE8 A;  2V1C A;  4FD2 A;  4AG5 A;  1XMO M;  3GLF A;  3FRH A;  3VK8 A;  2J5Y A;  4LF4 M;  3U5Z A;  4JI6 M;  3HJQ A;  4MGH A;  2LVN C;  2CE7 A;  1DGH A;  3L29 A;  4G6Z A;  4MM3 B;  3HHX A;  1GVN A;  4EIW A;  1NO1 A;  2L4F A;  3LVW A;  2O25 A;  1NVM A;  4HL4 A;  5ITT A;  4IBK A;  1WIV A;  1K3W A;  3J2P B;  1VG5 A;  3C58 A;  1OFH A;  3I51 A;  4IJE A;  3EIE A;  5EQT A;  1E32 A;  4B3M M;  2RRU A;  4IBI A;  3SFZ A;  3CF6 E;  2LVQ D;  2F5S A;  3U6E A;  4L4U A;  5ITR A;  2L7H A;  3GLI B;  3KVW A;  1R4G A;  3FTC A;  3LCV B;  2VQF M;  3B74 A;  1ZV1 A;  4KOD A;  4WW0 A;  5L8R F;  1IBL M;  4NC6 A;  4RKU F;  3GLI E;  2BWE A;  1IN4 A;  2XGN A;  1GL7 A;  3E46 A;  1AUA A;  5KPR A;  3MK6 A;  2VF8 A;  3KOY E;  1OQY A;  3T1H M;  1J09 A;  4LF7 M;  5A2Q S;  4QNM A;  2DAI A;  3GLI A;  4DR6 M;  4HLQ A;  1IN7 A;  2L4E A;  3MMP A;  1ZMW A;  2DHR A;  4I8O A;  2D7G A;  3UJN A;  1HNZ M;  2Z4R A;  3PFI A;  1NY6 A;  3QYB A;  3I04 M;  4REZ A;  3JAM S;  2BJV A;  1ZMV A;  4GIP A;  4CIZ A;  1G71 A;  3U61 B;  2DVW B;  5H37 D;  3V76 A;  4KT0 F;  4WP2 A;  1TH4 A;  3KP0 E;  4Z8X A;  1G3I A;  2HHH M;  2EUC A;  4LZJ A;  2DZO B;  5FTL A;  2X49 A;  3QYE A;  4S12 A;  1PJI A;  5FTJ A;  5KQD A;  3U61 A;  4M0W A;  4G4N A;  3HY5 A;  4QOS A;  1V34 A;  3FUW A;  5E6J A;  1QUS A;  2GQF A;  5EXP A;  1TTE A;  1TDH A;  2EKF A;  4PDG A;  1XMQ M;  4AKI A;  4DR1 M;  2FNA A;  1D0L A;  1ORY B;  2MJ5 B;  3FUX A;  2UXD M;  1L8Q A;  3KDS E;  3KS4 A;  2CV2 A;  2JZ0 A;  4JV5 M;  4DR2 M;  1DGB A;  4CIS A;  4GMQ A;  1OAI A;  1KYI A;  4ANR A;  2JY7 A;  1J7K A;  4LCB A;  4LZZ A;  1XWI A;  3B9P A;  4PDI A;  1TH2 A;  1L2B A;  4KHP M;  2CFO A;  2RGO A;  4LJ8 A;  3TWL A;  4B3S M;  2F5P A;  1N78 A;  1QZM A;  1QDR A;  3GRY A;  2CRU A;  2HAK A;  4NSO B;  1Z5B A;  5EP3 A;  2XEP A;  3TQS A;  4KLN A;  1VQ1 A;  5IRE B;  2CP8 A;  4BLC A;  1ZQ9 A;  2DHY A;  2R0I A;  5KQ8 A;  4QOZ C;  4MH0 E;  2CV1 A;  4LFA M;  3U6O A;  3AJI B;  2AHM A;  4I81 A;  4D80 A;  1K82 A;  4X64 M;  1Q02 A;  2EKK A;  3L27 A;  1QZE A;  2FH0 A;  1C1K A;  2Z4S A;  1NY5 A;  2LVP C;  2KRK A;  3HHZ A;  4DR4 M;  1SG9 A;  2R4J A;  5EP4 A;  3ZH9 B;  3CF0 A;  2KEB A;  3KOW E;  4P17 A;  4XK8 F;  2K6B A;  5JI2 E;  3GRR A;  5DFL A;  3J81 S;  4JI5 M;  4DV5 M;  1XHB A;  4GRI A;  3VKG A;  1XXH B;  2G5G X;  4MGZ E;  4GHL A;  2OOB A;  3GQ4 A;  4NSR A;  5EXS A;  4LF9 M;  1XXH E;  3LQQ A;  3VFD A;  3SAV A;  3VDU A;  4GC5 A;  4L78 A;  1Z5C A;  3KS8 A;  2L2D A;  2Z8Y M;  4LF6 M;  1XXH A;  4M9Z A;  4FWD A;  4P16 A;  4Y28 F;  4LG2 A;  4IBJ A;  3KSJ A;  4IJF A;  2UUB M;  4FCT A;  4IBE A;  2BWB A;  3J7A S;  5JI3 E;  1G8P A;  3AOG A;  1UFZ A;  4LRS A;  1EFU B;  4M0D A;  2DWM A;  1YLA A;  2R46 A;  2XH9 A;  3K8Z A;  3TL4 X;  2KW0 A;  4IBG A;  4L15 A;  2JUJ A;  1FNN A;  3HJS A;  5LMU M;  2DWL A;  2DWN A;  1XNR M;  3FUV A;  4LGM A;  3SC3 A;  1XB2 B;  2KDL A;  1J5E M;  2QQ8 A;  4NRW A;  2ZTD A;  4AKG A;  1DO0 A;  2QP9 X;  4LJA A;  4DV2 M;  2QPA A;  4LRT A;  4PD2 A;  2WSC F;  3U6S A;  1I4W A;  3GLG B;  3HGI A;  1V33 A;  3GLG E;  1IY2 A;  1HJP A;  1PGY A;  1VEJ A;  1R6B X;  2LTU A;  2V6Z M;  1GKI A;  4IBF A;  2JY6 B;  1TH3 A;  1R2Z A;  4OU7 A;  3UK6 A;  3GLG A;  2OPF A;  2UXB M;  2KRU A;  3UZU A;  4K0K M;  4B3R M;  3EIH A;  4JXJ A;  2ERC A;  2F5Q A;  3SAT A;  4LF5 M;  1IY1 A;  3NBI A;  5C1B A;  4Q7J A;  5FTK A;  4CJ6 A;  2KNV A;  3LQR A;  3FTF A;  2N35 A;  3AKZ A;  2DAE A;  1LTM A;  2KNA A;  3IHP A;  3QWL A;  1HNX M;  1AIP C;  3UMM A;  3JR4 A;  3SAW A;  1YSY A;  1Q3B A;  3L28 A;  3GQ3 A;  2M60 A;  5FSW A;  4DR5 M;  4F2L A;  2C5R A;  4YY3 M;  3VKH A;  2O01 F;  3W68 A;  5DYG A;  3KW6 A;  5E26 A;  1IN6 A;  2R6F A;  4LJ4 A;  1P3Q Q;  4GKJ M;  2MH8 A;  4AI6 A;  4G4R A;  1T3T A;  1YUB A;  2WSE F;  3J7B A;  5ITX E;  1HQY E;  2KZU A;  3U6L A;  1QDT A;  2YFQ A;  1MU5 A;  4LJ5 A;  3RE8 A;  2Q2E B;  2W82 A;  3LW5 F;  5KPT A;  1QQW A;  1WR1 B;  3PVS A;  4LJ9 A;  2FFJ A;  4X66 M;  3AFH A;  5ITX A;  4PCZ A;  5LMN M;  1D0K A;  1NV8 A;  3GPU A;  4G4Q A;  1N34 M;  1JB0 F;  2C9C A;  3FUT A;  3B7Z A;  1L1T A;  1VEG A;  3BBZ A;  3W67 A;  3MHV C;  3GQ5 A;  4II7 A;  4Z6Y A;  2XZF A;  1HNW M;  2L09 A;  2NQ8 C;  3GRU A;  1NHW C;  5DNY A;  2F5O A;  2G8L A;  3C3E A;  3HU3 A;  2CEA A;  3L2A A;  3Q8X A;  1QYR A;  4JI3 M;  3FD9 A;  5EP1 A;  4AZF A;  3K2L A;  3B7N A;  1C7Y A;  3A42 A;  4FCV A;  2A5Y B;  1QAM A;  1WXQ A;  1JR3 D;  4M9X A;  2GNO A;  1TR8 A;  2XSZ D;  2G3Q A;  1MX0 A;  2ZAO A;  4X65 M;  2F4V M;  1OAO C;  1V92 A;  2BJW A;  2KHH A;  2RGH A;  4ZPX A;  3FUU A;  4DR7 M;  1D2N A;  1NJG A;  3D8L A;  1Q3C A;  1WJ7 A;  4MB7 A;  3DOA A;  2H1R A;  2JNH A;  1NV9 A;  2DXI A;  2APL A;  1NJF A;  1PJT A;  2CHV A;  3J27 B;  4IIW A;  4LJ7 A;  5ITU A;  2ZM6 M;  3MJ5 A;  1NHG C;  2KA6 B;  3VK7 A;  1PM5 A;  2MR9 A;  3M0E A;  3SYK A;  2DZN B;  4BBA A;  1QAN A;  3U6M A;  3GLH B;  5ITQ A;  2MRO B;  3M7G A;  3TPZ A;  3HHY A;  1QUT A;  3GLH E;  4FWG A;  5BPV A;  3KFU G;  2LVO C;  2WZJ A;  4DV7 M;  3U60 B;  2X4A A;  3AOE A;  1E9R A;  2R4E A;  1GAB A;  4G3O A;  1QAQ A;  4GIT A;  5GKN A;  3GLH A;  1PRB A;  3FKE A;  4I5S A;  5EP2 A;  3ZCB B;  3GO8 A;  1I94 M;  3WHL A;  3BXW A;  2KZS A;  4M9S A;  1JR3 E;  2Y0T A;  4JN6 A;  3K1J A;  3U60 A;  3AOE C;  1DGG A;  4MGK E;  3SAU A;  1S3S A;  2FS1 A;  4DBG B;  1NNJ A;  5FTN A;  4DR3 M;  1R7R A;  2LXE A;  1JR3 A;  2Z3X A;  1N32 M;  2C96 A;  1Q39 A;  2OQ4 A;  3IEC A;  2R18 A;  2XSZ A;  3PNV A;  7CAT A;  4LGY A;  4HEO A;  3E21 A;  2LBC A;  4XGI A;  2CV0 A;  2QHO B;  3HZJ A;  3RGS A;  4AKH A;  3GPX A;  3SAS A;  2JP7 A;  3FYC A;  3TE6 A;  1OIP A;  3H4J A;  3TWK A;  1VDD A;  1A5T A;  3SMS A;  1XNQ M;  3T6P A;  2FE8 A;  1H6U A;  3HU1 A;  4FW9 A;  3GPP A;  1OTR A;  1HR0 M;  1GJT A;  3SMP A;  2KNZ A;  2R65 A;  1PJJ A;  2L6O A;  2J7O A;  4CHT B;  4LFC M;  2D7E A;  2CWB A;  3BOS A;  4R7G A;  5KPZ A;  2C99 A;  2M5Z A;  1WHC A;  1HQC A;  2EJS A;  3HU2 A;  2ZBK B;  4JYA M;  2K47 A;  4RF0 A;  2DZL A;  2OO9 A;  1SXJ C;  2UU9 M;  3OTO M;  3ZC7 B;  4OVZ B;  2Y0Q A;  1FJG M;  3DA1 A;  2BNK A;  2DWZ B;  4LFB M;  3A98 B;  4FVM A;  5C18 A;  3W0L B;  1TDZ A;  2J7N A;  2UXC M;  3IG8 A;  1IY0 A;  1D0M A;  2I7N A;  2P5T A;  1VDL A;  2QZ4 A;  3C9P A;  3FTD A;  4QHT A;  3KXE C;  5BR8 M;  5IZ7 D;  3NWL A;  3CF2 A;  2LNH C;  1PJS A;  4GC9 A;  4JI4 M;  1E9S A;  5IWA M; 
#chains in the Genus database with same CATH homology
 4NOO B;  1G41 A;  3SYL A;  4LF8 M;  4KO8 A;  2XLJ A;  3A45 A;  1OFI A;  2C98 A;  4X62 M;  4DUY M;  4ITQ A;  2LWX A;  4AQY M;  1QAO A;  2XF3 A;  5EXX A;  3AV0 A;  4FWH A;  3FTE A;  2L7I A;  3W0F A;  2QBY B;  4B7F A;  2X8A A;  3QAU A;  1XC8 A;  4W5W A;  1IN8 A;  3KOX E;  3FYD A;  4B7H A;  3IG5 A;  4OW0 A;  2HL7 A;  4WUR A;  2E5L M;  3R8F A;  4MGY E;  2Y20 A;  2QBY A;  4PT5 A;  2HCB A;  1JQJ C;  4DV4 M;  2I7P A;  2UUA M;  2CHG A;  4FCW A;  4GH9 A;  2C9O A;  4NXM M;  5EJC A;  1W5T A;  3E4R A;  4GHA A;  4DUZ M;  3R9X B;  3HKP A;  4JI1 M;  1N75 A;  2F5N A;  5EXT A;  2Z7J A;  3LVV A;  3GPY A;  5FTM A;  4JI8 M;  3HJ8 A;  1IXS B;  1Z59 A;  4JI7 M;  4A3V B;  3HHW A;  5KO3 A;  4DV6 M;  4AG6 A;  3U6D A;  4AW4 A;  3GP1 A;  4YHH M;  3DZD A;  3PNY A;  1E94 E;  3UGJ A;  4RNA A;  3JR5 A;  1W5S A;  3GRV A;  1OJL A;  3VDP A;  2V1U A;  1N33 M;  4OX9 M;  1UM8 A;  1X37 A;  3VLF B;  1IXR C;  1N77 A;  1HT1 E;  1HT2 E;  4L8R C;  1DGF A;  2QCU A;  2RKO A;  4TUW A;  1IXZ A;  1YE9 A;  1IBM M;  1SXJ D;  1LV7 A;  2LH0 A;  4IBB A;  4L16 A;  2QEN A;  4OVZ A;  4RF1 A;  3L26 A;  3U6C A;  2XZU A;  1DO2 A;  2FOI C;  1Z5A A;  1TGU A;  2VQE M;  3SBJ A;  1KFV A;  3M6A A;  2UUC M;  2Y21 A;  3DFZ A;  3PXG A;  1Z6T A;  2CHQ A;  3SHG B;  2HKJ A;  4DV0 M;  1IQP A;  4QNR A;  1G59 A;  3AL0 C;  1R2Y A;  3SAR A;  3T1Y M;  1IM2 A;  2YNM D;  2R45 A;  2XFT A;  5ITY A;  2XFS A;  4DV3 M;  1KSF X;  3WHK A;  4B08 A;  3RFW A;  3D8B A;  2JA2 A;  4BB9 A;  3A46 A;  1IBK M;  2EO2 A;  4DV1 M;  4R3D A;  1L2C A;  3KSX A;  1NNU C;  2YR0 A;  3THG A;  1NSF A;  1QVR A;  3RGP A;  4B3T M;  1G4A E;  2R62 A;  4NL4 H;  3E9S A;  3CTW B;  1SXJ B;  4NXN M;  4JI2 M;  4NRV A;  2VII A;  5IT9 S;  3KOZ E;  1SXJ E;  1L2D A;  2KXE A;  2ZAM A;  4I4L A;  2CUZ A;  4LJ6 A;  3U6P A;  3I4Y A;  5F3W A;  2D7H A;  1SXJ A;  1L1Z A;  4LY6 A;  4IBD A;  5DYI A;  1GL6 A;  2ZAN A;  2YQZ A;  4IBC A;  3TWM A;  1N36 M;  4GKK M;  1ZAE A;  4D82 A;  3HWS A;  3SHF A;  4CGY B;  3K92 A;  3ILK A;  1IN5 A;  3I4V A;  5FLX S;  3GLF B;  3KP1 E;  3T15 A;  3U5Z B;  3J80 S;  3T38 A;  4QHS A;  3U6Q A;  1DGH B;  2O5R A;  4MGI E;  4B7G A;  4D81 A;  1GLN A;  2EA0 A;  3LMM A;  4XBO A;  3L25 A;  3H4M A;  4JI0 M;  1EE8 A;  2V1C A;  4FD2 A;  4AG5 A;  1XMO M;  3GLF A;  3VK8 A;  4LF4 M;  3U5Z A;  4JI6 M;  3HJQ A;  4MGH A;  4G4O A;  2CE7 A;  1DGH A;  3L29 A;  4G6Z A;  4MM3 B;  3HHX A;  1GVN A;  4EIW A;  5LMU M;  3LVW A;  1K3W A;  1K3X A;  1NVM A;  4HL4 A;  5ITT A;  4IBK A;  3J2P B;  3C58 A;  1OFH A;  3I51 A;  4IJE A;  3EIE A;  5EQT A;  1E32 A;  4B3M M;  4IBI A;  3SFZ A;  3CF6 E;  2F5S A;  3U6E A;  4L4U A;  5ITR A;  2L7H A;  3GLI B;  3KVW A;  2VQF M;  3FTC A;  1IBL M;  4KOD A;  4WW0 A;  1IN4 A;  2XGN A;  1GL7 A;  5KPR A;  3MK6 A;  3KOY E;  3T1H M;  1J09 A;  4LF7 M;  5A2Q S;  4QNM A;  3GLI A;  4DR6 M;  4HLQ A;  1IN7 A;  4I8O A;  2DHR A;  1HNZ M;  2D7G A;  3UJN A;  2Z4R A;  3PFI A;  1NY6 A;  4REZ A;  8CAT A;  5FSW A;  3JAM S;  2BJV A;  4LFC M;  4GIP A;  3U61 B;  2DVW B;  5H37 D;  1TH4 A;  3KP0 E;  4Z8X A;  1G3I A;  2HHH M;  2EUC A;  4LZJ A;  2DZO B;  5FTL A;  2X49 A;  4S12 A;  1PJI A;  5FTJ A;  5KQD A;  3U61 A;  4M0W A;  4G4N A;  4QOS A;  5E6J A;  3FUW A;  5EXP A;  1XMQ M;  1TDH A;  4PDG A;  4AKI A;  4DR1 M;  2FNA A;  1ORY B;  3FUX A;  2UXD M;  1L8Q A;  3KDS E;  3KS4 A;  2CV2 A;  4JV5 M;  4DR2 M;  1DGB A;  4CIS A;  4GMQ A;  1KYI A;  1J7K A;  4LCB A;  4LZZ A;  1XWI A;  3B9P A;  4PDI A;  1TH2 A;  1L2B A;  4KHP M;  2CFO A;  2RGO A;  4LJ8 A;  3TWL A;  4B3S M;  2F5P A;  1N78 A;  1QZM A;  3GRY A;  4NSO B;  1Z5B A;  5EP3 A;  2XEP A;  3TQS A;  4KLN A;  5IRE B;  4BLC A;  1ZQ9 A;  5KQ8 A;  4QOZ C;  4MH0 E;  2CV1 A;  4LFA M;  3U6O A;  3AJI B;  2AHM A;  4I81 A;  4D80 A;  1K82 A;  4X64 M;  3L27 A;  1C1K A;  2Z4S A;  1NY5 A;  2KRK A;  3HHZ A;  4DR4 M;  2R4J A;  5EP4 A;  3ZH9 B;  3CF0 A;  2KEB A;  3KOW E;  5JI2 E;  3J81 S;  3GRR A;  4JI5 M;  4DV5 M;  1XHB A;  4GRI A;  3VKG A;  1XXH B;  2G5G X;  4MGZ E;  4GHL A;  3GQ4 A;  4NSR A;  5EXS A;  4LF9 M;  3LQQ A;  3VFD A;  3SAV A;  3VDU A;  4GC5 A;  4L78 A;  1Z5C A;  3KS8 A;  4LF6 M;  1XXH A;  4M9Z A;  4FWD A;  4P16 A;  4LG2 A;  4IBJ A;  3KSJ A;  4IJF A;  2UUB M;  4FCT A;  4IBE A;  3J7A S;  5JI3 E;  1G8P A;  3AOG A;  4LRS A;  4M0D A;  2DWM A;  2XH9 A;  2R46 A;  3K8Z A;  3TL4 X;  2KW0 A;  4IBG A;  4L15 A;  1FNN A;  3HJS A;  2DWL A;  2DWN A;  1XNR M;  3FUV A;  4LGM A;  3SC3 A;  1J5E M;  4NRW A;  4AKG A;  1DO0 A;  2QP9 X;  4LJA A;  4DV2 M;  2QPA A;  4LRT A;  4PD2 A;  3U6S A;  1I4W A;  3GLG B;  3HGI A;  1IY2 A;  1R6B X;  2V6Z M;  1GKI A;  4IBF A;  1TH3 A;  1R2Z A;  4OU7 A;  3UK6 A;  3GLG A;  2OPF A;  2UXB M;  2KRU A;  3UZU A;  4K0K M;  4B3R M;  3EIH A;  4JXJ A;  2ERC A;  2F5Q A;  3SAT A;  4LF5 M;  1IY1 A;  3NBI A;  5C1B A;  5FTK A;  3LQR A;  3FTF A;  3AKZ A;  3QWL A;  1HNX M;  3UMM A;  3JR4 A;  3SAW A;  1YSY A;  1Q3B A;  3L28 A;  3GQ3 A;  2M60 A;  4DR5 M;  2C5R A;  4YY3 M;  3VKH A;  5DYG A;  3KW6 A;  5E26 A;  1IN6 A;  4LJ4 A;  4GKJ M;  4AI6 A;  4G4R A;  1T3T A;  1YUB A;  3J7B A;  5ITX E;  1HQY E;  2KZU A;  3U6L A;  2YFQ A;  1MU5 A;  4LJ5 A;  3RE8 A;  2Q2E B;  2W82 A;  5KPT A;  1QQW A;  3PVS A;  4LJ9 A;  2FFJ A;  4X66 M;  3AFH A;  5ITX A;  4PCZ A;  5LMN M;  3GPU A;  4G4Q A;  1N34 M;  2C9C A;  3FUT A;  1L1T A;  3MHV C;  3GQ5 A;  4II7 A;  4Z6Y A;  2XZF A;  1HNW M;  2L09 A;  2NQ8 C;  3GRU A;  1NHW C;  5DNY A;  2F5O A;  2G8L A;  3HU3 A;  2CEA A;  3L2A A;  3Q8X A;  1QYR A;  4JI3 M;  3FD9 A;  5EP1 A;  4AZF A;  3K2L A;  3A42 A;  4FCV A;  2A5Y B;  1QAM A;  1WXQ A;  1JR3 D;  4M9X A;  2XSZ D;  4X65 M;  1MX0 A;  2ZAO A;  2F4V M;  2BJW A;  2RGH A;  4ZPX A;  3FUU A;  4DR7 M;  1D2N A;  1NJG A;  3D8L A;  1Q3C A;  4MB7 A;  3DOA A;  2H1R A;  2DXI A;  1NJF A;  2CHV A;  4IIW A;  3J27 B;  4LJ7 A;  5ITU A;  2ZM6 M;  3MJ5 A;  1NHG C;  2KA6 B;  3VK7 A;  1PM5 A;  3M0E A;  3SYK A;  2DZN B;  4BBA A;  1QAN A;  3U6M A;  3GLH B;  5ITQ A;  3M7G A;  3TPZ A;  3HHY A;  5BPV A;  4FWG A;  3KFU G;  4DV7 M;  3U60 B;  2X4A A;  3AOE A;  1E9R A;  2R4E A;  1QAQ A;  4GIT A;  5GKN A;  3GLH A;  3FKE A;  5EP2 A;  4I5S A;  3ZCB B;  3GO8 A;  1I94 M;  3WHL A;  2KZS A;  4M9S A;  2Y0T A;  4JN6 A;  3K1J A;  3U60 A;  3AOE C;  1DGG A;  4MGK E;  3SAU A;  1S3S A;  1NNJ A;  5FTN A;  4DR3 M;  1R7R A;  2LXE A;  1JR3 A;  2Z3X A;  1N32 M;  2C96 A;  1Q39 A;  2OQ4 A;  2R18 A;  2XSZ A;  3PNV A;  7CAT A;  4LGY A;  4XGI A;  2CV0 A;  3RGS A;  4AKH A;  3GPX A;  3SAS A;  3FYC A;  3TE6 A;  3TWK A;  1VDD A;  3SMS A;  1XNQ M;  2FE8 A;  1H6U A;  3HU1 A;  4FW9 A;  3GPP A;  1HR0 M;  3SMP A;  2R65 A;  1PJJ A;  2L6O A;  2J7O A;  4CHT B;  2D7E A;  3BOS A;  4R7G A;  5KPZ A;  2C99 A;  2M5Z A;  1HQC A;  3HU2 A;  2ZBK B;  4JYA M;  2K47 A;  4RF0 A;  1SXJ C;  2UU9 M;  3OTO M;  3ZC7 B;  4OVZ B;  2Y0Q A;  1FJG M;  3DA1 A;  2BNK A;  2DWZ B;  4LFB M;  3A98 B;  4FVM A;  5C18 A;  3W0L B;  1TDZ A;  2J7N A;  2UXC M;  3IG8 A;  1IY0 A;  2I7N A;  2QZ4 A;  2P5T A;  4QHT A;  3FTD A;  3KXE C;  5BR8 M;  5IZ7 D;  3NWL A;  3CF2 A;  2LNH C;  4GC9 A;  4JI4 M;  1E9S A;  5IWA M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...