4DV7M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv7M02
4DV3M 4YY3M 3OTOM 3A45A 1L1TA 3SAVA 5ITXE 4DR4M 3U6QA 1KFVA 3U6MA 1N32M 1L2BA 4JI5M 5ITTA 4LF6M 5ITXA 3SAUA 2UXCM 4JI4M 1L2DA 1EE8A 4G4NA 4LF8M 1N36M 1Z5AA 1XC8A 3U6EA 4JI6M 5LMUM 3A42A 4DV2M 4X65M 3JAMS 4LF7M 1N33M 4G4QA 5IWAM 3JR5A 4DUYM 4JI1M 1PJJA 1XNRM 1Q3CA 3GQ4A 2UUBM 2XZUA 4B3SM 1N34M 3VK8A 4B3MM 4CISA 1Q39A 3T1YM 4KHPM 1HNWM 3GPYA 4JI0M 4DV4M 3U6SA 3U6DA 2UU9M 4LFCM 2E5LM 4GKJM 3W0FA 3A46A 1XNQM 4JV5M 5ITRA 1IBLM 4DUZM 1TDZA 2HKJA 4K0KM 2ZM6M 3J80S 3GPUA 2OQ4A 3TWMA 4X64M 4NXNM 4NRVA 3TWKA 1PJIA 1HR0M 1L2CA 3T1HM 3VK7A 3SASA 4MB7A 1J5EM 4DV5M 4DR2M 4LF9M 4B3RM 5FLXS 4PDGA 4GKKM 3TWLA 3GQ3A 3U6LA 4X62M 1L1ZA 3GP1A 1XMQM 4JI8M 4DV1M 4B3TM 2EA0A 2ZBKB 4DR3M 3GPPA 4DV0M 2F5NA 2F5OA 1HNXM 1NNJA 4LF4M 4G4OA 1R2YA 3SBJA 1PM5A 2VQEM 2UUAM 4NXMM 1IBMM 4DR6M 3JR4A 1Z5BA 5A2QS 1I94M 1IBKM 3GO8A 4LF5M 1K3WA 4JYAM 4ITQA 2UUCM 4DR7M 3DOAA 4AQYM 3GPXA 1Q3BA 4PCZA 4NRWA 4OX9M 3SARA 3U6OA 4LFAM 1Z59A 3U6PA 4X66M 4JI3M 4DV7M 4PD2A 4DR1M 4JI2M 1Z5CA 1K82A 2F5PA 5IT9S 4PDIA 3SATA 1R2ZA 2F4VM 1TDHA 2HHHM 5ITYA 2F5SA 5LMNM 4YHHM 2XZFA 1HNZM 1XMOM 5ITUA 2UXDM 2OPFA 3U6CA 4LFBM 1K3XA 1MU5A 3C58A 4G4RA 3J7AS 3J81S 3GQ5A 4DV6M 1MX0A 3SAWA 4JI7M 1FJGM 2UXBM 2F5QA 2VQFM 4DR5M 5ITQA 5BR8M 2Q2EB
chains in the Genus database with same CATH superfamily
4F1IA 2FH0A 4YY3M 3OTOM 4DV3M 1IQPA 3RGSA 3U6QA 2J7NA 1QYRA 2DZNB 4JXJA 4RF0A 5ITTA 1IXSA 1T3TA 3SAUA 1L2DA 1EE8A 4LF8M 4P17A 3GRVA 1IN6A 2B3TA 4AW4A 2L2DA 5EQTA 2JZ0A 2K47A 3AL0C 2LHGA 2QZ4A 3B89A 4ZPXA 2R65A 2G5GX 1C7YA 1R6BX 5DNYA 1IY1A 2DWNA 4WURA 1CUKA 2W82A 1A5TA 4IBEA 2LTUA 1TH3A 3WHKA 3M7GA 2HWJA 3ZQJA 4AG5A 3KOZE 3RFWA 1IN7A 1YLAA 2QQ8A 1OFHA 3T1YM 2LBCA 3F92A 3HY5A 4CHTB 2R44A 2YNMD 3GLIB 3U6DA 1ORYB 2UU9M 4LFCM 3AOEC 2DXIA 4KO8A 3GLFE 2KA6B 4AKIA 4OW0A 3D8BA 2XLJA 1DGBA 4JV5M 2FS1A 5ITRA 1IBLM 1AUAA 4LCBA 5JI3E 1TDZA 1ZV1A 4MH0E 2LHCA 3KDSE 3ZCBB 4IJFA 3B7ZA 4K0KM 2DVWB 3RE8A 2DAKA 2CHGA 3GPUA 3UJNA 3ZC7B 3GLIE 3UK6A 5KQ8A 1DGGA 4NRVA 2R0IA 1PJIA 1L2CA 4W5WA 3T1HM 3SASA 3LMMA 1J5EM 1R5LA 3GLIA 4X62M 2QCUA 1XMQM 1OAOC 3H4JA 1DGFA 2O01F 3TPZA 4LGMA 2EA0A 3U61A 4B3TM 3I04M 3LQRA 2Y0QA 2F5NA 3E9SA 2JNHA 4FVMA 3TL4X 4AG6A 2AHMA 4LF4M 2XF3A 1R2YA 1PM5A 4L15A 4GIPA 2VQEM 4G6ZA 4LG2A 4NXMM 4LY6A 1IBMM 5EP3A 4DR6M 1Z5BA 1I94M 1UFZA 1VEJA 3GO8A 4TUWA 1K3WA 1TR8A 3FTEA 2DKLA 4OX9M 3T38A 3E4RA 1L8QA 4R3DA 1TH4A 1WXQA 3VDPA 1Z5CA 3SATA 2KHHA 2R18A 2F4VM 5C18A 2ZTCA 2L09A 2WZJA 3EIHA 5LMNM 2O25A 1TF0B 2EO2A 3E46A 2DHRA 4P16A 2K9DA 1S3SA 1NVMA 1WJ7A 5F3WA 4F2LA 3NBXX 3FRHA 3GRRA 2JY6B 5ITUA 4QNMA 1ZMVA 2UXDM 2KNZA 1K3XA 1W5SA 2RRUA 4G4RA 2BWEA 2K0BX 1OAIA 2X4AA 1T43A 3KVWA 4DV6M 4JI7M 2WSCF 3W0LB 2L7IA 3NBIA 4BBAA 4GHLA 3IG8A 1G41A 3SHFA 4GEWA 3KXEC 4B08A 4UN2B 3GLHB 2Q2EB 3GRUA 1W5TA 1XXHB 1GL6A 2VF7A 4GC9A 3TQSA 1KFVA 2LVPC 4IBBA 5KPZA 3U6MA 4JI5M 3FD9A 5KQDA 4LF6M 4IBGA 3KS8A 2Z4RA 4GC5A 1IXRC 1JR3D 3J2PB 2DWMA 3IHPA 5E26A 1Z5AA 2G3QA 3GLHE 3HU1A 3ZH9B 5L8RF 1XC8A 3MK6A 1YSYA 4IIWA 1QZEA 4FWHA 1NV9A 3W67A 3GLHA 1D2NA 4LRTA 1N33M 3U60B 1TH2A 1XXHA 4BB9A 4R71A 4L78A 1SG9A 3AOGA 1OJLA 1AIPC 1OFIA 2CUZA 2X49A 2R45A 4LJ7A 1GVNA 4JI1M 1E9RA 1IY0A 3SHGB 1Q3CA 3MJ5A 3BXWA 1J7KA 3HZJA 4Z8XA 3FUVA 1BVSA 2MROB 1ZQ9A 1D0MA 3DFZA 3M6AA 3U6SA 5IREB 1OIZA 3QAUA 4LZZA 4S12A 1NY5A 1MJGM 3HKPA 3HU3A 3A46A 5DYIA 3K1JA 3B7QA 3U60A 2L6OA 1DV0A 1FNNA 4WP2A 3AJIB 2HKJA 3FYCA 3KOWE 2JY8A 3J27B 1XB2B 2K6BA 3LW5F 4REZA 5FTNA 4Y28F 3J80S 2ZM6M 1IFYA 1F4IA 2CE7A 4KT0F 4X64M 1QUSA 2JWSA 3GLFB 4L8RC 1QAOA 1NJGA 3TWKA 2OOBA 4QOSA 1G71A 3QWLA 4LF9M 3VFDA 4GKKM 2VDBB 1WR1B 4DBGB 4QOZC 1QQWA 4DV1M 2ZBKB 3GPPA 3K8ZA 1OQYA 2BNKA 4LZJA 3SBJA 2RGHA 3I4YA 4FCWA 1D0KA 4M0WA 1HJPA 5FTKA 2KZSA 3U61B 2LWXA 2Y0TA 3JR4A 1JR3E 4MGYE 5A2QS 4OVZB 2JZ1A 4ITQA 3GLFA 3SMPA 4I81A 4AQYM 4AKGA 3LVVA 4LRSA 3EIEA 4I4LA 1GL7A 3C3DA 1VEGA 3SARA 2X8AA 4NOOB 4LFAM 3U6PA 4QNRA 4G3OA 4X66M 2QENA 4JI3M 3HJ8A 4HL4A 4MM3B 3I4VA 2CV0A 4FCTA 2J7OA 4CJ6A 3AV0A 3CGWA 2F5PA 2C9OA 4IBKA 2CHVA 2C9CA 1R2ZA 1H6UA 4IBCA 4IBIA 4Z6YA 1VDDA 5ITYA 2HHHM 1QAQA 2F5SA 3LVWA 3KP0E 2XSZA 4YHHM 1GLNA 1Q02A 2A5YB 1R7RA 4OVZA 3CF0A 2QP9X 2JY5A 2FFJA 2CV2A 2C98A 3Q8XA 2I7PA 5FSWA 3U6CA 4LFBM 1V34A 4MGZE 3R8FA 3J7AS 2YR0A 3GQ5A 1PJTA 3B9PA 3L29A 1MX0A 2JUJA 2ZAOA 4GITA 3KOYE 2P5TA 2VQFM 2DWZB 4PT5A 1MN3A 2R6FA 5EJCA 1VG5A 3AKZA 3J7BA 3SFZA 2XEPA 1PRBA 1T6OA 3A45A 2Z8YM 3T6PA 1L1TA 3SAVA 2N35A 3DZDA 3HHYA 1IXZA 1C1KA 2DNAA 1N32M 1G3IA 1SXJC 2KRKA 3VLFB 2D7GA 1L2BA 2MJ5B 3BOSA 3KFUG 4RNAA 2LNHC 3PVSA 2VIIA 4G4NA 1N36M 2WSFF 4M9SA 1NO1A 4HEOA 2RGOA 3U6EA 2CFOA 4MGIE 2Y20A 2FE8A 5LMUM 2LVOC 2OO9A 2GQFA 2XFTA 3HHWA 4AKHA 3A42A 3AOEA 1HQYE 4LF7M 1XHBA 2ZANA 2KW0A 1E9SA 2QNJA 4GMQA 4EIWA 5IWAM 4G4QA 2CRUA 2BJVA 3FUUA 3A98B 4IBFA 4DUYM 1QANA 4RF1A 5EXPA 1XNRM 3GQ4A 2HL7A 2DHYA 2H1RA 2LVAA 2XZUA 3HHZA 4GHAA 2QHOB 3VK8A 2QPAA 3VKHA 1Q39A 3SMSA 4B7GA 2M5ZA 3FTCA 3GLGB 2BWBA 3GPYA 4GH9A 4NSRA 3SYKA 5KPTA 1KYIA 3K92A 3FUWA 2LVNC 2OOAA 3HGIA 2KRUA 5FTJA 2HAKA 1DO2A 1NJFA 4DUZM 4KLNA 3QYBA 1WGLA 4L4UA 4AZFA 3UMMA 3L25A 2C99A 8CATA 1LTMA 2KZUA 3GLGE 3AFHA 1RU3A 5BPVA 3NWLA 2DWLA 2WSEF 1E32A 1GKIA 5JI2E 1HR0M 3GLGA 3VK7A 2R4EA 4MB7A 4KODA 1OKSA 5H37D 2QBYB 4FW9A 4IBDA 1PGYA 4NC6A 5EXTA 3TWLA 3CF6E 3C9PA 3GQ3A 3GP1A 3U6LA 1JB0F 4JI8M 1WIVA 2EUCA 2XGNA 3KW6A 2V6ZM 4DR3M 4DV0M 4LJ8A 2F5OA 1HNXM 1NHGC 2DI0A 1KSFX 4XGIA 2KNAA 4QHTA 1HT2E 2LXEA 3PNVA 4ANRA 7CATA 2UUAM 1VEKA 2JA2A 5EXXA 1IN4A 4BLCA 4RKUF 1DO0A 4XK8F 1IBKM 2O5RA 4LJAA 4JYAM 2UUCM 2FOIC 3HJSA 1QDTA 4DR7M 1QUTA 3CTWB 1G4AE 1Q3BA 1YE9A 4CGYB 4PCZA 3T15A 4NRWA 1N75A 2ZAMA 1TTEA 3DA1A 3GRYA 5IZ7D 2QBYA 4FCVA 4MGKE 3PXGA 1IN8A 2ERCA 1N78A 4DR1M 1K82A 3C3EA 5GKNA 4PDIA 4NSOB 2KNVA 2R4JA 2JY7A 4QHSA 1WHCA 3MHVC 2MH8A 3FTDA 4I5SA 4R7GA 1HNZM 4B7HA 2Y21A 2I7NA 3KP1E 1TGUA 2OPFA 2NQ8C 2DENA 3KSJA 3J81S 3SC3A 1X37A 2EKKA 1FJGM 2KXEA 3H4MA 3ILKA 3FKEA 2UXBM 2F5QA 3I51A 1JR3A 2EJSA 4DR5M 5ITQA 5BR8M 2XH9A 2C96A 1PJSA 2DZOB 5ITXE 4DR4M 1R4GA 2H5XA 2CV1A 3B74A 2J5YA 5C1BA 5EP2A 2EKFA 1GJTA 2MR9A 5ITXA 2V1UA 3FUTA 2UXCM 3K2LA 4JI4M 5EP1A 4HLQA 1UM8A 1V33A 1D0LA 2RKOA 2DAMA 2GNOA 3THGA 2YQZA 3U5ZB 4JI6M 3KS4A 2R46A 2CWBA 4DV2M 2R62A 4X65M 3JAMS 1HQCA 3FUXA 1VQ1A 5DFLA 4L6V6 3JR5A 2V1CA 1I4WA 3QYEA 2XFSA 3RGPA 1QVRA 2LH0A 2DAGA 1NV8A 4M9ZA 1PJJA 4CIZA 1YUBA 2DZLA 4LGYA 1QAMA 2UUBM 3PNYA 3WHLA 4B3SM 1N34M 3FTFA 3LQQA 4B3MM 5FTMA 1DGHB 1E94E 1WGNA 2ZTDA 1SXJD 4CISA 4KHPM 4MGHA 1HNWM 4JI0M 3VDUA 4DV4M 2Z7JA 2CEAA 3I01M 2FNAA 2E5LM 3U5ZA 4GKJM 3W0FA 2VF8A 1OTRA 5EXSA 1XNQM 3LCUA 3MMPA 3TE6A 4IJEA 1J09A 1ZMUA 4M9XA 1GJSA 3IG5A 3M0EA 4D80A 2D7HA 3B7NA 3K9OA 3PFIA 4B7FA 2OQ4A 3KOXE 4WW0A 2DAIA 3HJQA 5DYGA 3TWMA 4XBOA 4NXNM 1DGHA 4AI6A 3IECA 4I8OA 1QDRA 2BJWA 1ZMWA 4D82A 4B3RM 2LVQD 3E21A 3UZUA 3UGJA 4DV5M 5FLXS 2HCBA 2KDLA 3KSXA 4PDGA 4DR2M 2JP7A 1L1ZA 2CHQA 4II7A 1N77A 3HU2A 2CP8A 4LJ4A 1GO5A 1LV7A 1NNJA 4G4OA 2YFQA 3D8LA 4OU7A 2L4FA 2QSFX 5FTLA 1XWIA 2Z3XA 4JN6A 1EIJA 4LF5M 4LJ6A 3W68A 4FD2A 4L16A 3K9PA 4NL4H 3DOAA 1JQJC 1P3QQ 4Q7JA 2Z4SA 3GPXA 3VKGA 3HHXA 4D81A 4GRIA 1SXJB 3CF2A 3L27A 3U6OA 3SYLA 1Z59A 2M60A 2KEBA 3BBZA 1IY2A 5KO3A 5EP4A 4DV7M 4PD2A 1HT1E 2G8LA 4JI2M 4FWDA 5IT9S 2L7HA 1VDLA 2JXNA 1TDHA 2MGWA 4M0DA 1Y8GA 1Z6TA 3Q8GA 1PJQA 3L2AA 1V92A 1ZAEA 2XZFA 5KPRA 3L28A 4FWGA 1SXJE 1IN5A 4A3VB 1NSFA 1OIPA 1XMOM 1G8PA 4IBJA 1EFUB 1XXHE 3FYDA 2DAEA 4LJ5A 1IXSB 4LJ9A 1NHWC 2D7EA 1NY6A 1SXJA 3FE3A 1MU5A 3FRIA 3C58A 3V76A 2L4EA 3R9XB 1GABA 3L26A 3SAWA 1NNUC 2APLA 2C5RA 3HWSA 1G59A 1IM2A 3HX3A 2XSZD 3LCVB 1QZMA 5E6JA
chains in the Genus database with same CATH topology
4DV3M 4YY3M 3OTOM 1IQPA 3RGSA 3U6QA 2J7NA 1QYRA 2DZNB 4JXJA 4RF0A 5ITTA 1T3TA 3SAUA 1L2DA 1EE8A 4LF8M 3GRVA 1IN6A 4AW4A 5EQTA 2K47A 3AL0C 2QZ4A 4ZPXA 2R65A 2G5GX 1R6BX 5DNYA 1IY1A 2DWNA 4WURA 2W82A 4IBEA 1TH3A 3WHKA 3M7GA 4AG5A 3KOZE 3RFWA 1IN7A 3T1YM 1OFHA 4CHTB 2YNMD 3GLIB 3U6DA 1ORYB 2UU9M 4LFCM 3AOEC 2DXIA 4KO8A 2KA6B 4AKIA 4OW0A 3D8BA 2XLJA 1DGBA 4JV5M 5ITRA 1IBLM 4LCBA 5JI3E 1TDZA 4MH0E 3KDSE 3ZCBB 4IJFA 4K0KM 2DVWB 3RE8A 2CHGA 3GPUA 3UJNA 3ZC7B 3UK6A 5KQ8A 1DGGA 4NRVA 1PJIA 1L2CA 4W5WA 3T1HM 3SASA 3LMMA 1J5EM 3GLIA 4X62M 2QCUA 1XMQM 1DGFA 3TPZA 4B3TM 4LGMA 2EA0A 3U61A 3LQRA 2Y0QA 2F5NA 3E9SA 4FVMA 3TL4X 4AG6A 4LF4M 2AHMA 2XF3A 1R2YA 1PM5A 4L15A 4GIPA 2VQEM 4G6ZA 4LG2A 4NXMM 4LY6A 1IBMM 5EP3A 4DR6M 1Z5BA 1I94M 3GO8A 4TUWA 1K3WA 3FTEA 4OX9M 3T38A 3E4RA 1L8QA 4R3DA 1TH4A 1WXQA 3VDPA 1Z5CA 3SATA 2R18A 2F4VM 5C18A 2L09A 3EIHA 5LMNM 2EO2A 2DHRA 4P16A 1S3SA 1NVMA 5F3WA 3GRRA 5ITUA 4QNMA 2UXDM 1K3XA 1W5SA 4G4RA 2X4AA 3KVWA 4DV6M 4JI7M 3W0LB 2L7IA 3NBIA 4BBAA 4GHLA 3IG8A 1G41A 3SHFA 3KXEC 4B08A 3GLHB 2Q2EB 3GRUA 1W5TA 1XXHB 1GL6A 4GC9A 3TQSA 1KFVA 3U6MA 4IBBA 5KPZA 4JI5M 3FD9A 5KQDA 4LF6M 4IBGA 3KS8A 2Z4RA 4GC5A 1IXRC 1JR3D 3J2PB 2DWMA 5E26A 1Z5AA 3HU1A 3ZH9B 1XC8A 3MK6A 1YSYA 4IIWA 4FWHA 3GLHA 1D2NA 4LRTA 1N33M 3U60B 1TH2A 1XXHA 4BB9A 4L78A 3AOGA 1OJLA 2X49A 1OFIA 2CUZA 2R45A 4LJ7A 1GVNA 4JI1M 1E9RA 1IY0A 3SHGB 1Q3CA 3MJ5A 4Z8XA 1J7KA 3FUVA 1ZQ9A 3DFZA 3M6AA 3U6SA 5IREB 3QAUA 4LZZA 4S12A 1NY5A 3HKPA 3HU3A 3A46A 5DYIA 3K1JA 3U60A 2L6OA 1FNNA 3AJIB 2HKJA 3FYCA 3KOWE 4REZA 3J27B 2ZM6M 3J80S 5FTNA 2CE7A 3GLFB 4X64M 4L8RC 1QAOA 1NJGA 3TWKA 4QOSA 3QWLA 4LF9M 3VFDA 4GKKM 4QOZC 1QQWA 4DV1M 2ZBKB 3GPPA 3K8ZA 2BNKA 4LZJA 3SBJA 2RGHA 3I4YA 4FCWA 4M0WA 5FTKA 2KZSA 3U61B 2LWXA 2Y0TA 3JR4A 4MGYE 5A2QS 4OVZB 4ITQA 3GLFA 3SMPA 4I81A 4AQYM 4AKGA 3LVVA 4LRSA 3EIEA 4I4LA 1GL7A 3SARA 2X8AA 4NOOB 4LFAM 3U6PA 4QNRA 4X66M 2QENA 4JI3M 3HJ8A 4HL4A 4MM3B 3I4VA 2CV0A 4FCTA 2J7OA 3AV0A 2F5PA 2C9OA 4IBKA 2CHVA 2C9CA 1R2ZA 1H6UA 4IBCA 4IBIA 4Z6YA 1VDDA 5ITYA 2HHHM 1QAQA 2F5SA 3LVWA 3KP0E 2XSZA 4YHHM 1GLNA 2A5YB 1R7RA 4OVZA 3CF0A 2QP9X 2FFJA 2CV2A 2C98A 3Q8XA 2I7PA 5FSWA 3U6CA 4LFBM 4MGZE 3R8FA 3J7AS 2YR0A 3GQ5A 3B9PA 3L29A 1MX0A 2ZAOA 4GITA 3KOYE 2P5TA 2VQFM 2DWZB 4PT5A 5EJCA 3AKZA 3J7BA 3SFZA 2XEPA 3A45A 1L1TA 3SAVA 3DZDA 3HHYA 1IXZA 1C1KA 1N32M 1G3IA 1SXJC 2KRKA 3VLFB 2D7GA 1L2BA 3BOSA 3KFUG 4RNAA 2LNHC 3PVSA 2VIIA 4G4NA 1N36M 4M9SA 2RGOA 3U6EA 2CFOA 4MGIE 2Y20A 2FE8A 5LMUM 3HHWA 2XFTA 4AKHA 3A42A 3AOEA 1HQYE 4LF7M 1XHBA 2ZANA 2KW0A 1E9SA 4GMQA 4EIWA 5IWAM 4G4QA 2BJVA 3FUUA 3A98B 4IBFA 4DUYM 1QANA 4RF1A 5EXPA 1XNRM 3GQ4A 2HL7A 4GHAA 2H1RA 3VKHA 2XZUA 3HHZA 3VK8A 2QPAA 1Q39A 3SMSA 4B7GA 2M5ZA 3FTCA 3GLGB 3GPYA 4GH9A 4NSRA 3SYKA 5KPTA 1KYIA 3K92A 3FUWA 3HGIA 2KRUA 5FTJA 1DO2A 1NJFA 4DUZM 4KLNA 3UMMA 4L4UA 4AZFA 3L25A 2C99A 8CATA 2KZUA 3AFHA 5BPVA 3NWLA 2DWLA 1E32A 1GKIA 5JI2E 1HR0M 3GLGA 3VK7A 2R4EA 4MB7A 4KODA 5H37D 2QBYB 4FW9A 4IBDA 3TWLA 5EXTA 3GQ3A 3U6LA 3CF6E 3GP1A 4JI8M 2EUCA 2XGNA 3KW6A 2V6ZM 4DR3M 4DV0M 4LJ8A 2F5OA 1HNXM 1NHGC 1KSFX 4XGIA 4QHTA 1HT2E 2LXEA 3PNVA 7CATA 2UUAM 2JA2A 5EXXA 1IN4A 4BLCA 1DO0A 1IBKM 2O5RA 4LJAA 4JYAM 2UUCM 2FOIC 3HJSA 4DR7M 3CTWB 1G4AE 1Q3BA 1YE9A 4CGYB 4PCZA 3T15A 4NRWA 1N75A 2ZAMA 2QBYA 3DA1A 3GRYA 5IZ7D 4FCVA 4MGKE 3PXGA 1IN8A 2ERCA 1N78A 4DR1M 1K82A 5GKNA 4PDIA 4NSOB 2R4JA 4QHSA 3MHVC 3FTDA 4I5SA 4R7GA 1HNZM 4B7HA 2Y21A 2I7NA 3KP1E 1TGUA 2OPFA 2NQ8C 3KSJA 3J81S 3SC3A 1X37A 1FJGM 2KXEA 3H4MA 3ILKA 3FKEA 2UXBM 2F5QA 3I51A 1JR3A 4DR5M 5ITQA 5BR8M 2XH9A 2C96A 2DZOB 5ITXE 4DR4M 2CV1A 5C1BA 5EP2A 5ITXA 2V1UA 3FUTA 2UXCM 3K2LA 4JI4M 5EP1A 4HLQA 1UM8A 2RKOA 3THGA 2YQZA 3U5ZB 4JI6M 3KS4A 2R46A 4DV2M 2R62A 4X65M 3JAMS 3FUXA 1HQCA 3JR5A 2V1CA 1I4WA 2XFSA 3RGPA 1QVRA 2LH0A 4M9ZA 1PJJA 1YUBA 4LGYA 1QAMA 2UUBM 3PNYA 3WHLA 4B3SM 1N34M 3FTFA 3LQQA 4B3MM 5FTMA 1DGHB 1E94E 4CISA 4KHPM 1SXJD 4MGHA 1HNWM 4JI0M 3VDUA 4DV4M 2Z7JA 2CEAA 2FNAA 2E5LM 3U5ZA 4GKJM 3W0FA 5EXSA 1XNQM 3TE6A 4IJEA 1J09A 4M9XA 3IG5A 3M0EA 4D80A 2D7HA 3PFIA 4B7FA 2OQ4A 3KOXE 4WW0A 3HJQA 5DYGA 3TWMA 4XBOA 4NXNM 1DGHA 4AI6A 4I8OA 2BJWA 4D82A 4B3RM 4DV5M 3UZUA 4DR2M 3UGJA 5FLXS 2HCBA 4PDGA 3KSXA 1L1ZA 2CHQA 4II7A 1N77A 3HU2A 4LJ4A 1LV7A 1NNJA 4G4OA 2YFQA 3D8LA 4OU7A 5FTLA 1XWIA 2Z3XA 4JN6A 4LF5M 4LJ6A 4FD2A 4L16A 4NL4H 3DOAA 1JQJC 3GPXA 2Z4SA 3VKGA 3HHXA 4D81A 4GRIA 3L27A 1SXJB 3CF2A 3U6OA 3SYLA 1Z59A 2M60A 2KEBA 5KO3A 1IY2A 4DV7M 5EP4A 4PD2A 1HT1E 2G8LA 4JI2M 4FWDA 5IT9S 2L7HA 1TDHA 4M0DA 1Z6TA 3L2AA 1ZAEA 2XZFA 5KPRA 3L28A 4FWGA 1SXJE 1IN5A 4A3VB 1NSFA 1XMOM 1G8PA 4IBJA 3FYDA 4LJ5A 1IXSB 4LJ9A 1NHWC 2D7EA 1NY6A 1SXJA 3R9XB 1MU5A 3C58A 3L26A 3SAWA 1NNUC 2C5RA 3HWSA 1G59A 1IM2A 2XSZD 1QZMA 5E6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 M;  4YY3 M;  3OTO M;  3A45 A;  1L1T A;  3SAV A;  5ITX E;  4DR4 M;  3U6Q A;  1KFV A;  3U6M A;  1N32 M;  1L2B A;  4JI5 M;  5ITT A;  4LF6 M;  5ITX A;  3SAU A;  2UXC M;  4JI4 M;  1L2D A;  1EE8 A;  4G4N A;  4LF8 M;  1N36 M;  1Z5A A;  1XC8 A;  3U6E A;  4JI6 M;  5LMU M;  3A42 A;  4DV2 M;  4X65 M;  3JAM S;  4LF7 M;  1N33 M;  4G4Q A;  5IWA M;  3JR5 A;  4DUY M;  4JI1 M;  1PJJ A;  1XNR M;  1Q3C A;  3GQ4 A;  2UUB M;  2XZU A;  4B3S M;  1N34 M;  3VK8 A;  4B3M M;  4CIS A;  1Q39 A;  3T1Y M;  4KHP M;  1HNW M;  3GPY A;  4JI0 M;  4DV4 M;  3U6S A;  3U6D A;  2UU9 M;  4LFC M;  2E5L M;  4GKJ M;  3W0F A;  3A46 A;  1XNQ M;  4JV5 M;  5ITR A;  1IBL M;  4DUZ M;  1TDZ A;  2HKJ A;  4K0K M;  2ZM6 M;  3J80 S;  3GPU A;  2OQ4 A;  3TWM A;  4X64 M;  4NXN M;  4NRV A;  3TWK A;  1PJI A;  1HR0 M;  1L2C A;  3T1H M;  3VK7 A;  3SAS A;  4MB7 A;  1J5E M;  4DV5 M;  4DR2 M;  4LF9 M;  4B3R M;  5FLX S;  4PDG A;  4GKK M;  3TWL A;  3GQ3 A;  3U6L A;  4X62 M;  1L1Z A;  3GP1 A;  1XMQ M;  4JI8 M;  4DV1 M;  4B3T M;  2EA0 A;  2ZBK B;  4DR3 M;  3GPP A;  4DV0 M;  2F5N A;  2F5O A;  1HNX M;  1NNJ A;  4LF4 M;  4G4O A;  1R2Y A;  3SBJ A;  1PM5 A;  2VQE M;  2UUA M;  4NXM M;  1IBM M;  4DR6 M;  3JR4 A;  1Z5B A;  5A2Q S;  1I94 M;  1IBK M;  3GO8 A;  4LF5 M;  1K3W A;  4JYA M;  4ITQ A;  2UUC M;  4DR7 M;  3DOA A;  4AQY M;  3GPX A;  1Q3B A;  4PCZ A;  4NRW A;  4OX9 M;  3SAR A;  3U6O A;  4LFA M;  1Z59 A;  3U6P A;  4X66 M;  4JI3 M;  4DV7 M;  4PD2 A;  4DR1 M;  4JI2 M;  1Z5C A;  1K82 A;  2F5P A;  5IT9 S;  4PDI A;  3SAT A;  1R2Z A;  2F4V M;  1TDH A;  2HHH M;  5ITY A;  2F5S A;  5LMN M;  4YHH M;  2XZF A;  1HNZ M;  1XMO M;  5ITU A;  2UXD M;  2OPF A;  3U6C A;  4LFB M;  1K3X A;  1MU5 A;  3C58 A;  4G4R A;  3J7A S;  3J81 S;  3GQ5 A;  4DV6 M;  1MX0 A;  3SAW A;  4JI7 M;  1FJG M;  2UXB M;  2F5Q A;  2VQF M;  4DR5 M;  5ITQ A;  5BR8 M;  2Q2E B; 
#chains in the Genus database with same CATH topology
 4F1I A;  2FH0 A;  4YY3 M;  3OTO M;  4DV3 M;  1IQP A;  3RGS A;  3U6Q A;  2J7N A;  1QYR A;  2DZN B;  4JXJ A;  4RF0 A;  5ITT A;  1IXS A;  1T3T A;  3SAU A;  1L2D A;  1EE8 A;  4LF8 M;  4P17 A;  3GRV A;  1IN6 A;  2B3T A;  4AW4 A;  2L2D A;  5EQT A;  2JZ0 A;  2K47 A;  3AL0 C;  2LHG A;  2QZ4 A;  3B89 A;  4ZPX A;  2R65 A;  2G5G X;  1C7Y A;  1R6B X;  5DNY A;  1IY1 A;  2DWN A;  4WUR A;  1CUK A;  2W82 A;  1A5T A;  4IBE A;  2LTU A;  1TH3 A;  3WHK A;  3M7G A;  2HWJ A;  3ZQJ A;  4AG5 A;  3KOZ E;  3RFW A;  1IN7 A;  1YLA A;  2QQ8 A;  1OFH A;  3T1Y M;  2LBC A;  3F92 A;  3HY5 A;  4CHT B;  2R44 A;  2YNM D;  3GLI B;  3U6D A;  1ORY B;  2UU9 M;  4LFC M;  3AOE C;  2DXI A;  4KO8 A;  3GLF E;  2KA6 B;  4AKI A;  4OW0 A;  3D8B A;  2XLJ A;  1DGB A;  4JV5 M;  2FS1 A;  5ITR A;  1IBL M;  1AUA A;  4LCB A;  5JI3 E;  1TDZ A;  1ZV1 A;  4MH0 E;  2LHC A;  3KDS E;  3ZCB B;  4IJF A;  3B7Z A;  4K0K M;  2DVW B;  3RE8 A;  2DAK A;  2CHG A;  3GPU A;  3UJN A;  3ZC7 B;  3GLI E;  3UK6 A;  5KQ8 A;  1DGG A;  4NRV A;  2R0I A;  1PJI A;  1L2C A;  4W5W A;  3T1H M;  3SAS A;  3LMM A;  1J5E M;  1R5L A;  3GLI A;  4X62 M;  2QCU A;  1XMQ M;  1OAO C;  3H4J A;  1DGF A;  2O01 F;  3TPZ A;  4LGM A;  2EA0 A;  3U61 A;  4B3T M;  3I04 M;  3LQR A;  2Y0Q A;  2F5N A;  3E9S A;  2JNH A;  4FVM A;  3TL4 X;  4AG6 A;  2AHM A;  4LF4 M;  2XF3 A;  1R2Y A;  1PM5 A;  4L15 A;  4GIP A;  2VQE M;  4G6Z A;  4LG2 A;  4NXM M;  4LY6 A;  1IBM M;  5EP3 A;  4DR6 M;  1Z5B A;  1I94 M;  1UFZ A;  1VEJ A;  3GO8 A;  4TUW A;  1K3W A;  1TR8 A;  3FTE A;  2DKL A;  4OX9 M;  3T38 A;  3E4R A;  1L8Q A;  4R3D A;  1TH4 A;  1WXQ A;  3VDP A;  1Z5C A;  3SAT A;  2KHH A;  2R18 A;  2F4V M;  5C18 A;  2ZTC A;  2L09 A;  2WZJ A;  3EIH A;  5LMN M;  2O25 A;  1TF0 B;  2EO2 A;  3E46 A;  2DHR A;  4P16 A;  2K9D A;  1S3S A;  1NVM A;  1WJ7 A;  5F3W A;  4F2L A;  3NBX X;  3FRH A;  3GRR A;  2JY6 B;  5ITU A;  4QNM A;  1ZMV A;  2UXD M;  2KNZ A;  1K3X A;  1W5S A;  2RRU A;  4G4R A;  2BWE A;  2K0B X;  1OAI A;  2X4A A;  1T43 A;  3KVW A;  4DV6 M;  4JI7 M;  2WSC F;  3W0L B;  2L7I A;  3NBI A;  4BBA A;  4GHL A;  3IG8 A;  1G41 A;  3SHF A;  4GEW A;  3KXE C;  4B08 A;  4UN2 B;  3GLH B;  2Q2E B;  3GRU A;  1W5T A;  1XXH B;  1GL6 A;  2VF7 A;  4GC9 A;  3TQS A;  1KFV A;  2LVP C;  4IBB A;  5KPZ A;  3U6M A;  4JI5 M;  3FD9 A;  5KQD A;  4LF6 M;  4IBG A;  3KS8 A;  2Z4R A;  4GC5 A;  1IXR C;  1JR3 D;  3J2P B;  2DWM A;  3IHP A;  5E26 A;  1Z5A A;  2G3Q A;  3GLH E;  3HU1 A;  3ZH9 B;  5L8R F;  1XC8 A;  3MK6 A;  1YSY A;  4IIW A;  1QZE A;  4FWH A;  1NV9 A;  3W67 A;  3GLH A;  1D2N A;  4LRT A;  1N33 M;  3U60 B;  1TH2 A;  1XXH A;  4BB9 A;  4R71 A;  4L78 A;  1SG9 A;  3AOG A;  1OJL A;  1AIP C;  1OFI A;  2CUZ A;  2X49 A;  2R45 A;  4LJ7 A;  1GVN A;  4JI1 M;  1E9R A;  1IY0 A;  3SHG B;  1Q3C A;  3MJ5 A;  3BXW A;  1J7K A;  3HZJ A;  4Z8X A;  3FUV A;  1BVS A;  2MRO B;  1ZQ9 A;  1D0M A;  3DFZ A;  3M6A A;  3U6S A;  5IRE B;  1OIZ A;  3QAU A;  4LZZ A;  4S12 A;  1NY5 A;  1MJG M;  3HKP A;  3HU3 A;  3A46 A;  5DYI A;  3K1J A;  3B7Q A;  3U60 A;  2L6O A;  1DV0 A;  1FNN A;  4WP2 A;  3AJI B;  2HKJ A;  3FYC A;  3KOW E;  2JY8 A;  3J27 B;  1XB2 B;  2K6B A;  3LW5 F;  4REZ A;  5FTN A;  4Y28 F;  3J80 S;  2ZM6 M;  1IFY A;  1F4I A;  2CE7 A;  4KT0 F;  4X64 M;  1QUS A;  2JWS A;  3GLF B;  4L8R C;  1QAO A;  1NJG A;  3TWK A;  2OOB A;  4QOS A;  1G71 A;  3QWL A;  4LF9 M;  3VFD A;  4GKK M;  2VDB B;  1WR1 B;  4DBG B;  4QOZ C;  1QQW A;  4DV1 M;  2ZBK B;  3GPP A;  3K8Z A;  1OQY A;  2BNK A;  4LZJ A;  3SBJ A;  2RGH A;  3I4Y A;  4FCW A;  1D0K A;  4M0W A;  1HJP A;  5FTK A;  2KZS A;  3U61 B;  2LWX A;  2Y0T A;  3JR4 A;  1JR3 E;  4MGY E;  5A2Q S;  4OVZ B;  2JZ1 A;  4ITQ A;  3GLF A;  3SMP A;  4I81 A;  4AQY M;  4AKG A;  3LVV A;  4LRS A;  3EIE A;  4I4L A;  1GL7 A;  3C3D A;  1VEG A;  3SAR A;  2X8A A;  4NOO B;  4LFA M;  3U6P A;  4QNR A;  4G3O A;  4X66 M;  2QEN A;  4JI3 M;  3HJ8 A;  4HL4 A;  4MM3 B;  3I4V A;  2CV0 A;  4FCT A;  2J7O A;  4CJ6 A;  3AV0 A;  3CGW A;  2F5P A;  2C9O A;  4IBK A;  2CHV A;  2C9C A;  1R2Z A;  1H6U A;  4IBC A;  4IBI A;  4Z6Y A;  1VDD A;  5ITY A;  2HHH M;  1QAQ A;  2F5S A;  3LVW A;  3KP0 E;  2XSZ A;  4YHH M;  1GLN A;  1Q02 A;  2A5Y B;  1R7R A;  4OVZ A;  3CF0 A;  2QP9 X;  2JY5 A;  2FFJ A;  2CV2 A;  2C98 A;  3Q8X A;  2I7P A;  5FSW A;  3U6C A;  4LFB M;  1V34 A;  4MGZ E;  3R8F A;  3J7A S;  2YR0 A;  3GQ5 A;  1PJT A;  3B9P A;  3L29 A;  1MX0 A;  2JUJ A;  2ZAO A;  4GIT A;  3KOY E;  2P5T A;  2VQF M;  2DWZ B;  4PT5 A;  1MN3 A;  2R6F A;  5EJC A;  1VG5 A;  3AKZ A;  3J7B A;  3SFZ A;  2XEP A;  1PRB A;  1T6O A;  3A45 A;  2Z8Y M;  3T6P A;  1L1T A;  3SAV A;  2N35 A;  3DZD A;  3HHY A;  1IXZ A;  1C1K A;  2DNA A;  1N32 M;  1G3I A;  1SXJ C;  2KRK A;  3VLF B;  2D7G A;  1L2B A;  2MJ5 B;  3BOS A;  3KFU G;  4RNA A;  2LNH C;  3PVS A;  2VII A;  4G4N A;  1N36 M;  2WSF F;  4M9S A;  1NO1 A;  4HEO A;  2RGO A;  3U6E A;  2CFO A;  4MGI E;  2Y20 A;  2FE8 A;  5LMU M;  2LVO C;  2OO9 A;  2GQF A;  2XFT A;  3HHW A;  4AKH A;  3A42 A;  3AOE A;  1HQY E;  4LF7 M;  1XHB A;  2ZAN A;  2KW0 A;  1E9S A;  2QNJ A;  4GMQ A;  4EIW A;  5IWA M;  4G4Q A;  2CRU A;  2BJV A;  3FUU A;  3A98 B;  4IBF A;  4DUY M;  1QAN A;  4RF1 A;  5EXP A;  1XNR M;  3GQ4 A;  2HL7 A;  2DHY A;  2H1R A;  2LVA A;  2XZU A;  3HHZ A;  4GHA A;  2QHO B;  3VK8 A;  2QPA A;  3VKH A;  1Q39 A;  3SMS A;  4B7G A;  2M5Z A;  3FTC A;  3GLG B;  2BWB A;  3GPY A;  4GH9 A;  4NSR A;  3SYK A;  5KPT A;  1KYI A;  3K92 A;  3FUW A;  2LVN C;  2OOA A;  3HGI A;  2KRU A;  5FTJ A;  2HAK A;  1DO2 A;  1NJF A;  4DUZ M;  4KLN A;  3QYB A;  1WGL A;  4L4U A;  4AZF A;  3UMM A;  3L25 A;  2C99 A;  8CAT A;  1LTM A;  2KZU A;  3GLG E;  3AFH A;  1RU3 A;  5BPV A;  3NWL A;  2DWL A;  2WSE F;  1E32 A;  1GKI A;  5JI2 E;  1HR0 M;  3GLG A;  3VK7 A;  2R4E A;  4MB7 A;  4KOD A;  1OKS A;  5H37 D;  2QBY B;  4FW9 A;  4IBD A;  1PGY A;  4NC6 A;  5EXT A;  3TWL A;  3CF6 E;  3C9P A;  3GQ3 A;  3GP1 A;  3U6L A;  1JB0 F;  4JI8 M;  1WIV A;  2EUC A;  2XGN A;  3KW6 A;  2V6Z M;  4DR3 M;  4DV0 M;  4LJ8 A;  2F5O A;  1HNX M;  1NHG C;  2DI0 A;  1KSF X;  4XGI A;  2KNA A;  4QHT A;  1HT2 E;  2LXE A;  3PNV A;  4ANR A;  7CAT A;  2UUA M;  1VEK A;  2JA2 A;  5EXX A;  1IN4 A;  4BLC A;  4RKU F;  1DO0 A;  4XK8 F;  1IBK M;  2O5R A;  4LJA A;  4JYA M;  2UUC M;  2FOI C;  3HJS A;  1QDT A;  4DR7 M;  1QUT A;  3CTW B;  1G4A E;  1Q3B A;  1YE9 A;  4CGY B;  4PCZ A;  3T15 A;  4NRW A;  1N75 A;  2ZAM A;  1TTE A;  3DA1 A;  3GRY A;  5IZ7 D;  2QBY A;  4FCV A;  4MGK E;  3PXG A;  1IN8 A;  2ERC A;  1N78 A;  4DR1 M;  1K82 A;  3C3E A;  5GKN A;  4PDI A;  4NSO B;  2KNV A;  2R4J A;  2JY7 A;  4QHS A;  1WHC A;  3MHV C;  2MH8 A;  3FTD A;  4I5S A;  4R7G A;  1HNZ M;  4B7H A;  2Y21 A;  2I7N A;  3KP1 E;  1TGU A;  2OPF A;  2NQ8 C;  2DEN A;  3KSJ A;  3J81 S;  3SC3 A;  1X37 A;  2EKK A;  1FJG M;  2KXE A;  3H4M A;  3ILK A;  3FKE A;  2UXB M;  2F5Q A;  3I51 A;  1JR3 A;  2EJS A;  4DR5 M;  5ITQ A;  5BR8 M;  2XH9 A;  2C96 A;  1PJS A;  2DZO B;  5ITX E;  4DR4 M;  1R4G A;  2H5X A;  2CV1 A;  3B74 A;  2J5Y A;  5C1B A;  5EP2 A;  2EKF A;  1GJT A;  2MR9 A;  5ITX A;  2V1U A;  3FUT A;  2UXC M;  3K2L A;  4JI4 M;  5EP1 A;  4HLQ A;  1UM8 A;  1V33 A;  1D0L A;  2RKO A;  2DAM A;  2GNO A;  3THG A;  2YQZ A;  3U5Z B;  4JI6 M;  3KS4 A;  2R46 A;  2CWB A;  4DV2 M;  2R62 A;  4X65 M;  3JAM S;  1HQC A;  3FUX A;  1VQ1 A;  5DFL A;  4L6V 6;  3JR5 A;  2V1C A;  1I4W A;  3QYE A;  2XFS A;  3RGP A;  1QVR A;  2LH0 A;  2DAG A;  1NV8 A;  4M9Z A;  1PJJ A;  4CIZ A;  1YUB A;  2DZL A;  4LGY A;  1QAM A;  2UUB M;  3PNY A;  3WHL A;  4B3S M;  1N34 M;  3FTF A;  3LQQ A;  4B3M M;  5FTM A;  1DGH B;  1E94 E;  1WGN A;  2ZTD A;  1SXJ D;  4CIS A;  4KHP M;  4MGH A;  1HNW M;  4JI0 M;  3VDU A;  4DV4 M;  2Z7J A;  2CEA A;  3I01 M;  2FNA A;  2E5L M;  3U5Z A;  4GKJ M;  3W0F A;  2VF8 A;  1OTR A;  5EXS A;  1XNQ M;  3LCU A;  3MMP A;  3TE6 A;  4IJE A;  1J09 A;  1ZMU A;  4M9X A;  1GJS A;  3IG5 A;  3M0E A;  4D80 A;  2D7H A;  3B7N A;  3K9O A;  3PFI A;  4B7F A;  2OQ4 A;  3KOX E;  4WW0 A;  2DAI A;  3HJQ A;  5DYG A;  3TWM A;  4XBO A;  4NXN M;  1DGH A;  4AI6 A;  3IEC A;  4I8O A;  1QDR A;  2BJW A;  1ZMW A;  4D82 A;  4B3R M;  2LVQ D;  3E21 A;  3UZU A;  3UGJ A;  4DV5 M;  5FLX S;  2HCB A;  2KDL A;  3KSX A;  4PDG A;  4DR2 M;  2JP7 A;  1L1Z A;  2CHQ A;  4II7 A;  1N77 A;  3HU2 A;  2CP8 A;  4LJ4 A;  1GO5 A;  1LV7 A;  1NNJ A;  4G4O A;  2YFQ A;  3D8L A;  4OU7 A;  2L4F A;  2QSF X;  5FTL A;  1XWI A;  2Z3X A;  4JN6 A;  1EIJ A;  4LF5 M;  4LJ6 A;  3W68 A;  4FD2 A;  4L16 A;  3K9P A;  4NL4 H;  3DOA A;  1JQJ C;  1P3Q Q;  4Q7J A;  2Z4S A;  3GPX A;  3VKG A;  3HHX A;  4D81 A;  4GRI A;  1SXJ B;  3CF2 A;  3L27 A;  3U6O A;  3SYL A;  1Z59 A;  2M60 A;  2KEB A;  3BBZ A;  1IY2 A;  5KO3 A;  5EP4 A;  4DV7 M;  4PD2 A;  1HT1 E;  2G8L A;  4JI2 M;  4FWD A;  5IT9 S;  2L7H A;  1VDL A;  2JXN A;  1TDH A;  2MGW A;  4M0D A;  1Y8G A;  1Z6T A;  3Q8G A;  1PJQ A;  3L2A A;  1V92 A;  1ZAE A;  2XZF A;  5KPR A;  3L28 A;  4FWG A;  1SXJ E;  1IN5 A;  4A3V B;  1NSF A;  1OIP A;  1XMO M;  1G8P A;  4IBJ A;  1EFU B;  1XXH E;  3FYD A;  2DAE A;  4LJ5 A;  1IXS B;  4LJ9 A;  1NHW C;  2D7E A;  1NY6 A;  1SXJ A;  3FE3 A;  1MU5 A;  3FRI A;  3C58 A;  3V76 A;  2L4E A;  3R9X B;  1GAB A;  3L26 A;  3SAW A;  1NNU C;  2APL A;  2C5R A;  3HWS A;  1G59 A;  1IM2 A;  3HX3 A;  2XSZ D;  3LCV B;  1QZM A;  5E6J A; 
#chains in the Genus database with same CATH homology
 4DV3 M;  4YY3 M;  3OTO M;  1IQP A;  3RGS A;  3U6Q A;  2J7N A;  1QYR A;  2DZN B;  4JXJ A;  4RF0 A;  5ITT A;  1T3T A;  3SAU A;  1L2D A;  1EE8 A;  4LF8 M;  3GRV A;  1IN6 A;  4AW4 A;  5EQT A;  2K47 A;  3AL0 C;  2QZ4 A;  4ZPX A;  2R65 A;  2G5G X;  1R6B X;  5DNY A;  1IY1 A;  2DWN A;  4WUR A;  2W82 A;  4IBE A;  1TH3 A;  3WHK A;  3M7G A;  4AG5 A;  3KOZ E;  3RFW A;  1IN7 A;  3T1Y M;  1OFH A;  4CHT B;  2YNM D;  3GLI B;  3U6D A;  1ORY B;  2UU9 M;  4LFC M;  3AOE C;  2DXI A;  4KO8 A;  2KA6 B;  4AKI A;  4OW0 A;  3D8B A;  2XLJ A;  1DGB A;  4JV5 M;  5ITR A;  1IBL M;  4LCB A;  5JI3 E;  1TDZ A;  4MH0 E;  3KDS E;  3ZCB B;  4IJF A;  4K0K M;  2DVW B;  3RE8 A;  2CHG A;  3GPU A;  3UJN A;  3ZC7 B;  3UK6 A;  5KQ8 A;  1DGG A;  4NRV A;  1PJI A;  1L2C A;  4W5W A;  3T1H M;  3SAS A;  3LMM A;  1J5E M;  3GLI A;  4X62 M;  2QCU A;  1XMQ M;  1DGF A;  3TPZ A;  4B3T M;  4LGM A;  2EA0 A;  3U61 A;  3LQR A;  2Y0Q A;  2F5N A;  3E9S A;  4FVM A;  3TL4 X;  4AG6 A;  4LF4 M;  2AHM A;  2XF3 A;  1R2Y A;  1PM5 A;  4L15 A;  4GIP A;  2VQE M;  4G6Z A;  4LG2 A;  4NXM M;  4LY6 A;  1IBM M;  5EP3 A;  4DR6 M;  1Z5B A;  1I94 M;  3GO8 A;  4TUW A;  1K3W A;  3FTE A;  4OX9 M;  3T38 A;  3E4R A;  1L8Q A;  4R3D A;  1TH4 A;  1WXQ A;  3VDP A;  1Z5C A;  3SAT A;  2R18 A;  2F4V M;  5C18 A;  2L09 A;  3EIH A;  5LMN M;  2EO2 A;  2DHR A;  4P16 A;  1S3S A;  1NVM A;  5F3W A;  3GRR A;  5ITU A;  4QNM A;  2UXD M;  1K3X A;  1W5S A;  4G4R A;  2X4A A;  3KVW A;  4DV6 M;  4JI7 M;  3W0L B;  2L7I A;  3NBI A;  4BBA A;  4GHL A;  3IG8 A;  1G41 A;  3SHF A;  3KXE C;  4B08 A;  3GLH B;  2Q2E B;  3GRU A;  1W5T A;  1XXH B;  1GL6 A;  4GC9 A;  3TQS A;  1KFV A;  3U6M A;  4IBB A;  5KPZ A;  4JI5 M;  3FD9 A;  5KQD A;  4LF6 M;  4IBG A;  3KS8 A;  2Z4R A;  4GC5 A;  1IXR C;  1JR3 D;  3J2P B;  2DWM A;  5E26 A;  1Z5A A;  3HU1 A;  3ZH9 B;  1XC8 A;  3MK6 A;  1YSY A;  4IIW A;  4FWH A;  3GLH A;  1D2N A;  4LRT A;  1N33 M;  3U60 B;  1TH2 A;  1XXH A;  4BB9 A;  4L78 A;  3AOG A;  1OJL A;  2X49 A;  1OFI A;  2CUZ A;  2R45 A;  4LJ7 A;  1GVN A;  4JI1 M;  1E9R A;  1IY0 A;  3SHG B;  1Q3C A;  3MJ5 A;  4Z8X A;  1J7K A;  3FUV A;  1ZQ9 A;  3DFZ A;  3M6A A;  3U6S A;  5IRE B;  3QAU A;  4LZZ A;  4S12 A;  1NY5 A;  3HKP A;  3HU3 A;  3A46 A;  5DYI A;  3K1J A;  3U60 A;  2L6O A;  1FNN A;  3AJI B;  2HKJ A;  3FYC A;  3KOW E;  4REZ A;  3J27 B;  2ZM6 M;  3J80 S;  5FTN A;  2CE7 A;  3GLF B;  4X64 M;  4L8R C;  1QAO A;  1NJG A;  3TWK A;  4QOS A;  3QWL A;  4LF9 M;  3VFD A;  4GKK M;  4QOZ C;  1QQW A;  4DV1 M;  2ZBK B;  3GPP A;  3K8Z A;  2BNK A;  4LZJ A;  3SBJ A;  2RGH A;  3I4Y A;  4FCW A;  4M0W A;  5FTK A;  2KZS A;  3U61 B;  2LWX A;  2Y0T A;  3JR4 A;  4MGY E;  5A2Q S;  4OVZ B;  4ITQ A;  3GLF A;  3SMP A;  4I81 A;  4AQY M;  4AKG A;  3LVV A;  4LRS A;  3EIE A;  4I4L A;  1GL7 A;  3SAR A;  2X8A A;  4NOO B;  4LFA M;  3U6P A;  4QNR A;  4X66 M;  2QEN A;  4JI3 M;  3HJ8 A;  4HL4 A;  4MM3 B;  3I4V A;  2CV0 A;  4FCT A;  2J7O A;  3AV0 A;  2F5P A;  2C9O A;  4IBK A;  2CHV A;  2C9C A;  1R2Z A;  1H6U A;  4IBC A;  4IBI A;  4Z6Y A;  1VDD A;  5ITY A;  2HHH M;  1QAQ A;  2F5S A;  3LVW A;  3KP0 E;  2XSZ A;  4YHH M;  1GLN A;  2A5Y B;  1R7R A;  4OVZ A;  3CF0 A;  2QP9 X;  2FFJ A;  2CV2 A;  2C98 A;  3Q8X A;  2I7P A;  5FSW A;  3U6C A;  4LFB M;  4MGZ E;  3R8F A;  3J7A S;  2YR0 A;  3GQ5 A;  3B9P A;  3L29 A;  1MX0 A;  2ZAO A;  4GIT A;  3KOY E;  2P5T A;  2VQF M;  2DWZ B;  4PT5 A;  5EJC A;  3AKZ A;  3J7B A;  3SFZ A;  2XEP A;  3A45 A;  1L1T A;  3SAV A;  3DZD A;  3HHY A;  1IXZ A;  1C1K A;  1N32 M;  1G3I A;  1SXJ C;  2KRK A;  3VLF B;  2D7G A;  1L2B A;  3BOS A;  3KFU G;  4RNA A;  2LNH C;  3PVS A;  2VII A;  4G4N A;  1N36 M;  4M9S A;  2RGO A;  3U6E A;  2CFO A;  4MGI E;  2Y20 A;  2FE8 A;  5LMU M;  3HHW A;  2XFT A;  4AKH A;  3A42 A;  3AOE A;  1HQY E;  4LF7 M;  1XHB A;  2ZAN A;  2KW0 A;  1E9S A;  4GMQ A;  4EIW A;  5IWA M;  4G4Q A;  2BJV A;  3FUU A;  3A98 B;  4IBF A;  4DUY M;  1QAN A;  4RF1 A;  5EXP A;  1XNR M;  3GQ4 A;  2HL7 A;  4GHA A;  2H1R A;  3VKH A;  2XZU A;  3HHZ A;  3VK8 A;  2QPA A;  1Q39 A;  3SMS A;  4B7G A;  2M5Z A;  3FTC A;  3GLG B;  3GPY A;  4GH9 A;  4NSR A;  3SYK A;  5KPT A;  1KYI A;  3K92 A;  3FUW A;  3HGI A;  2KRU A;  5FTJ A;  1DO2 A;  1NJF A;  4DUZ M;  4KLN A;  3UMM A;  4L4U A;  4AZF A;  3L25 A;  2C99 A;  8CAT A;  2KZU A;  3AFH A;  5BPV A;  3NWL A;  2DWL A;  1E32 A;  1GKI A;  5JI2 E;  1HR0 M;  3GLG A;  3VK7 A;  2R4E A;  4MB7 A;  4KOD A;  5H37 D;  2QBY B;  4FW9 A;  4IBD A;  3TWL A;  5EXT A;  3GQ3 A;  3U6L A;  3CF6 E;  3GP1 A;  4JI8 M;  2EUC A;  2XGN A;  3KW6 A;  2V6Z M;  4DR3 M;  4DV0 M;  4LJ8 A;  2F5O A;  1HNX M;  1NHG C;  1KSF X;  4XGI A;  4QHT A;  1HT2 E;  2LXE A;  3PNV A;  7CAT A;  2UUA M;  2JA2 A;  5EXX A;  1IN4 A;  4BLC A;  1DO0 A;  1IBK M;  2O5R A;  4LJA A;  4JYA M;  2UUC M;  2FOI C;  3HJS A;  4DR7 M;  3CTW B;  1G4A E;  1Q3B A;  1YE9 A;  4CGY B;  4PCZ A;  3T15 A;  4NRW A;  1N75 A;  2ZAM A;  2QBY A;  3DA1 A;  3GRY A;  5IZ7 D;  4FCV A;  4MGK E;  3PXG A;  1IN8 A;  2ERC A;  1N78 A;  4DR1 M;  1K82 A;  5GKN A;  4PDI A;  4NSO B;  2R4J A;  4QHS A;  3MHV C;  3FTD A;  4I5S A;  4R7G A;  1HNZ M;  4B7H A;  2Y21 A;  2I7N A;  3KP1 E;  1TGU A;  2OPF A;  2NQ8 C;  3KSJ A;  3J81 S;  3SC3 A;  1X37 A;  1FJG M;  2KXE A;  3H4M A;  3ILK A;  3FKE A;  2UXB M;  2F5Q A;  3I51 A;  1JR3 A;  4DR5 M;  5ITQ A;  5BR8 M;  2XH9 A;  2C96 A;  2DZO B;  5ITX E;  4DR4 M;  2CV1 A;  5C1B A;  5EP2 A;  5ITX A;  2V1U A;  3FUT A;  2UXC M;  3K2L A;  4JI4 M;  5EP1 A;  4HLQ A;  1UM8 A;  2RKO A;  3THG A;  2YQZ A;  3U5Z B;  4JI6 M;  3KS4 A;  2R46 A;  4DV2 M;  2R62 A;  4X65 M;  3JAM S;  3FUX A;  1HQC A;  3JR5 A;  2V1C A;  1I4W A;  2XFS A;  3RGP A;  1QVR A;  2LH0 A;  4M9Z A;  1PJJ A;  1YUB A;  4LGY A;  1QAM A;  2UUB M;  3PNY A;  3WHL A;  4B3S M;  1N34 M;  3FTF A;  3LQQ A;  4B3M M;  5FTM A;  1DGH B;  1E94 E;  4CIS A;  4KHP M;  1SXJ D;  4MGH A;  1HNW M;  4JI0 M;  3VDU A;  4DV4 M;  2Z7J A;  2CEA A;  2FNA A;  2E5L M;  3U5Z A;  4GKJ M;  3W0F A;  5EXS A;  1XNQ M;  3TE6 A;  4IJE A;  1J09 A;  4M9X A;  3IG5 A;  3M0E A;  4D80 A;  2D7H A;  3PFI A;  4B7F A;  2OQ4 A;  3KOX E;  4WW0 A;  3HJQ A;  5DYG A;  3TWM A;  4XBO A;  4NXN M;  1DGH A;  4AI6 A;  4I8O A;  2BJW A;  4D82 A;  4B3R M;  4DV5 M;  3UZU A;  4DR2 M;  3UGJ A;  5FLX S;  2HCB A;  4PDG A;  3KSX A;  1L1Z A;  2CHQ A;  4II7 A;  1N77 A;  3HU2 A;  4LJ4 A;  1LV7 A;  1NNJ A;  4G4O A;  2YFQ A;  3D8L A;  4OU7 A;  5FTL A;  1XWI A;  2Z3X A;  4JN6 A;  4LF5 M;  4LJ6 A;  4FD2 A;  4L16 A;  4NL4 H;  3DOA A;  1JQJ C;  3GPX A;  2Z4S A;  3VKG A;  3HHX A;  4D81 A;  4GRI A;  3L27 A;  1SXJ B;  3CF2 A;  3U6O A;  3SYL A;  1Z59 A;  2M60 A;  2KEB A;  5KO3 A;  1IY2 A;  4DV7 M;  5EP4 A;  4PD2 A;  1HT1 E;  2G8L A;  4JI2 M;  4FWD A;  5IT9 S;  2L7H A;  1TDH A;  4M0D A;  1Z6T A;  3L2A A;  1ZAE A;  2XZF A;  5KPR A;  3L28 A;  4FWG A;  1SXJ E;  1IN5 A;  4A3V B;  1NSF A;  1XMO M;  1G8P A;  4IBJ A;  3FYD A;  4LJ5 A;  1IXS B;  4LJ9 A;  1NHW C;  2D7E A;  1NY6 A;  1SXJ A;  3R9X B;  1MU5 A;  3C58 A;  3L26 A;  3SAW A;  1NNU C;  2C5R A;  3HWS A;  1G59 A;  1IM2 A;  2XSZ D;  1QZM A;  5E6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...