3KSJA

The alkanesulfonate-binding protein ssua from xabthomonas axonopodis pv. citri bound to mes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
b'AEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
molecule tags Transport protein
source organism Xanthomonas axonopodis pv. citri
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
total genus 94
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA02
1O7TA 2AYSA 4QRZA 2Y7KA 2HQ0A 3SEUA 4XKQA 1US4A 4P11A 3TAJA 3LSLA 4JWYA 4IO6A 2GFEA 1B0HA 4DXUA 1N7WA 4WKMA 3EF7A 4ZEIA 1MRPA 3CVGA 3O6IA 1AOVA 3C4MA 2DWHA 4OETA 1FW0A 3FXUA 4GXAA 4H6DA 4IB2A 5FHMA 5FHNA 3ZSFA 2RCAA 5I59B 4BLAA 2OCUA 2XHDA 2RCBA 3K1MA 4BDMA 5FTHA 2UVHA 4G8NA 4KCDA 2H98A 4MH5A 3RTWB 4KD5A 3TKDA 1IEJA 1VR5A 4OFJA 3TCGA 1SW1A 5K2YA 1P1QA 3N6TA 4R74A 1JVXA 4LA9A 3R7XA 2F8DA 1A40A 1MXWA 1PEBA 1LSTA 1UIVA 4H5GA 4N6PA 1UTHB 1MDQA 1Y20A 2A5SA 1URSA 2QMWA 3ECRA 3IB1A 2ONKE 4H8IA 3CFXA 1DSNA 3HN0A 1AH5A 2XXUA 4O3CA 1JW5A 4JSDA 1OLAA 4YMBA 5BWJA 1SD3A 1QUKA 1RYOA 1LFIA 1B4ZA 4X1BA 1NFTA 4Q5TA 1R9QA 3RPWA 3O6GA 1UTHA 1JEUA 2KLFA 1OVBA 3HPIA 4QHQA 4X48A 2F7BA 1MPDA 3H06B 3VV5A 2ZYNA 4NE4A 4PFWA 2VD2A 2O7IA 1RYXA 4NWCA 3M3FA 2DXYA 1S50A 5HBCA 4DCXA 2QS3A 5CM6A 1MH4A 3OMBA 2O6AA 4GFRA 4YB7A 3TCFA 3SEWA 1GGGA 3VXCA 1LCTA 4BDOA 4FATA 1UQWA 5H8FA 3T9VA 1CB6A 2V93A 2XXWA 3O97A 4IO4A 1LAGE 1B6HA 2OJTA 2XXHA 3N5LA 4IO3A 4QFPA 3ZKKA 1FTKA 1Y4TA 1B1XA 3C34A 2I3VA 3MZBA 4ZEBA 5TPAB 3VVDA 4F39A 4Q8RA 5DVIA 4YMAA 1NNTA 2B65A 3PUVE 2BJJX 1NKXA 1LBCA 3TTLA 3PMWA 4JB7A 3V83A 1JW4A 3IB2A 5JTYB 4MLQA 3PPPA 1IIWA 3CRBA 2ZMBA 3H6WA 5ICQA 1R9LA 3TZAA 1XT8A 1IQ7A 4FORA 2F78A 4GD5A 1YPNA 3C31A 3QUFA 4X1DA 2D21A 5F7VA 2Y7WA 1LAFE 4H1XA 3MPLA 5I57B 2LAOA 3H7MA 5TP9B 5AA3A 2O1LA 1B9JA 2HCAA 2QS1A 3GBAA 3H03A 1MPCA 1PBQA 2OWTA 4IGTA 4JSOA 4OFLA 3THIA 2X7PA 4EF1A 5M2VA 5DTBA 3I5OA 2GHAA 3WAEA 3ILUB 3R26A 2Q8JA 4R6HA 3S2VA 4K3FA 4OMBA 2Z8DA 1PDAA 2UVJA 4U2RA 1MXYA 3B6WA 4YU0A 5B7DA 5L9SA 3MVXA 3VE1B 1ZBMA 2NXOA 5I59A 2DSFA 4KHZE 1OQHA 3MAMA 4YKJA 3KZGA 2PVUA 1SYIA 4ONYA 2F7AA 4XXUA 2UXAA 2VP1A 5CMBA 4YKPA 2Y7IA 4E0XA 2O7UA 1MDP1 4POXA 1SW2A 2XXYA 4RXLA 3N26A 4XKRA 1OLCA 2AL5A 3MVYA 2I6EA 4DZ1A 3FJMA 4ELOA 4U1ZA 3IOTA 3G3KA 3FD3A 3KN8A 2QL3A 4TLMB 4U23A 5JK4A 1FQAA 3U72A 2ZNSA 2O69A 2REJA 5I2KB 1B3EA 2F7CA 1NL5A 2XXXA 3RT6B 5J1DA 2DYXA 3TMGA 4RPOA 2NOOA 4G77A 2F34A 3O6HA 3TUSA 4R73A 4U1OA 4YZZA 1ZJLA 2ZNTA 4OZ9A 1EH3A 5H8QA 5H8SA 5L9MA 3FJ7A 3B6QA 3U92A 5ITPA 1N7XA 3U8QA 4YKIA 3ODBA 3U1OA 2R6GE 3TTMA 1A8FA 3QSLA 1QULA 5I2NB 1EU8A 2VD3A 1MQHA 1SDXA 1BIYA 1XC1A 2XX7A 2Y7RA 1QKBA 4WEDA 5L8DA 3K1PA 3SKPA 2QRYA 1QJMA 1MXXA 2V84A 4TLLB 1JVYA 2DE4A 4F3GA 3USDA 1DTZA 1NMUA 3PMVA 4RJZA 1GVCA 2ABHA 4DDDA 1TWYA 3CSGA 2ZYOA 2DVCA 3IX1A 3LBSA 1POY1 3EHSA 3Q25A 3VVEA 4EXKA 4ZECA 3I6VA 4XTCQ 3JYRA 1NNPA 1IZ1A 2F6PA 2QSXA 4KYDA 4P0GA 3SEYA 1N3WA 4QFOA 2P2AA 1LLSA 3E9XA 4U4SA 1B3FA 1BTJA 1ZU0A 4PE5B 2F6GA 4C1TA 4NF6B 5LOMA 3K6WA 4ZE8A 2I48A 4WXJA 4GL0A 4U4XA 2FA7A 3OO6A 5CBSA 2IA4A 3PPRA 1SW4A 1MQGA 3W15C 3WAFA 4F1UA 3G3HA 1VSOA 3OEKA 4NMYA 4QSEA 2XXVA 2XX8A 4KR5A 1NH7A 1POTA 3M8UA 1Y3QA 1B3LA 3MP6A 2QMXA 3HHFA 1P1OA 5A5XA 2ONSA 1JW1A 2I0CA 1N3XA 3FVOA 1FQDA 4DIGA 4F18A 4OXVA 1MY3A 2AIXA 1QKAA 2AL4A 3O28A 3IOUA 3PUXE 4KYSA 3CR9A 1MM6A 2I3WA 1WDNA 2QJEA 2X26A 2XXTA 3FGSA 3FXQA 2RF1A 4FIMA 3T22A 5AA2A 1NNKA 3RUMA 2RC8A 4LONB 4BDNA 3Q28A 3O2AA 4R9FA 3KFMA 4R2BA 2V3TA 3UIFA 5I2KA 4X9TA 4F1YA 1SI0A 4GL8A 4F29A 4THIA 1UTBA 1WVJA 2Q9TA 3TTNA 4Z0IA 5DVJA 2H9BA 3SETA 5B70A 2G93A 2OLBA 1FTMA 3G3JA 3G7WA 4QFLA 4JBZA 1MQDA 2Q88A 3IO4A 3MBPA 3PUWE 2DWAA 4L17A 1BLFA 1IXHA 2Y84A 3TODA 1IXGA 1D3KA 4OYVA 4ESXA 3KJ7A 3FASA 3K0VA 2PX1A 5F1QA 3HO7A 4FECA 4GIZA 2E1SA 3ONMA 3K6VA 5EHSA 4P0IA 4GRKA 1FQBA 3IOVA 2Z8FA 3HHGA 3PPOA 4OFOA 5KDTA 1JETA 3TDJA 3FJGA 3T9UA 1UIUA 4OEVA 1ANFA 4G4PA 1LB9A 3FATA 2H5YA 4N13A 1FTJA 3MP1A 3PPQA 4AQ4A 3GZGA 3MVWA 2QS2A 5TP9A 4BDLA 3IB0A 5IKBA 2UVIA 4H8JA 3CG3A 4NWDA 1SBPA 3MWBA 1R1NA 3H4ZA 4QSDA 4R6YA 4TOZA 4F22A 4F2QA 4RA1A 1TFAA 1MY0A 2DE3A 4IO5A 4R9GA 1KWHA 4AB6A 1QUJA 3K00A 4FE8A 3QK6A 2Y7PA 2NVUB 2ALUA 1UTBB 1M5EA 1FCKA 4KI0E 4JDFA 4PETA 3A3UA 4IO2A 1FQEA 3OO7A 4YAHX 1LBBA 1B32A 3ZKLA 1L5TA 1OVTA 1GV8A 3TQLA 3TYHA 4HW8A 3K1NA 2G29A 5AA2B 1DMBA 2PBWA 4F3PA 3O66A 5I2NA 2YJPA 1B05A 3DP8A 5TU0A 3V89B 1PB8A 4FEBA 4QFKA 3K02A 1SVXB 2ONRA 5FTIA 3LSFB 1MY1A 1O64A 2DXRA 2PT1A 3IORA 1B3HA 1H76A 3PD8A 2NWJA 3T66A 1D9YA 3IL1B 1O63A 5DYHA 3MZ9A 4PFUA 3VVFA 3GBBA 1B7UA 2Q2AA 2UVGA 2THIA 3DP6A 1FTOA 4NF4B 2ESNA 4I62A 1P99A 1VFDA 2Q89A 3KN3A 4QF9A 3FVKA 4LZ7A 3C33A 1LAXA 4OENA 1GTKA 1MPBA 3T96B 1B5JA 2F97A 2HXWA 5EHMA 3MC2A 5CMCA 2O1MA 4OTEA 4DCYA 3QAXA 3IR1A 1M5CA 3EHTA 3PGFA 1DPEA 4RNSA 1HSEA 1DTGA 1Y1ZA 3OXNA 4ZZAA 3CSBA 2P0SA 4LQ5A 1OQGA 3DLNA 2O84X 3UGWA 1YAEA 5JEIA 1OIBA 1US5A 3FVNA 1WODA 4RPNA 4ZS9A 5CMKA 2RINA 2I58A 4NEDA 4XKNA 4OESA 5BUUA 3OD7A 4R2FA 2OZZA 4ND9A 3G3FA 2HZKA 1MY4A 4OHNA 1VE4A 4ZEDA 1P1WA 1D4NA 3EN3A 1B51A 2GH9A 1Q35A 2I4BA 4GWOA 3MVZA 3MPKA 3C35A 4NF5A 1N84A 3UA8A 4KCCA 4G8MA 2ANJA 4FEDA 4C1UA 1B46A 4PP0A 1Y1MA 2O68A 4ISUA 4JWOA 4M4GA 1FTLA 4OWDA 5DEXA 1USYH 1XS5A 3KJTA 5CMMA 3UORA 2V3UA 4KPTA 4KYEA 4LZ5A 5ITOA 4G68B 4C0RA 4I9DA 3H6UA 3D4CA 1H43A 1MS7A 2X7QA 3K6XA 2REGA 2A5TA 3PD9A 5HM4B 1N0TA 3N94A 3G3GA 1LCFA 1LFGA 2I4CA 5JTYA 3JV9A 3E4RA 2OK2A 3H6TA 1PBPA 4NF4A 4N07A 4WEPA 4NF8B 3PUZE 4RYAA 4ELRA 1HSJA 3KEIA 4JWXA 4ZDMA 1P1NA 1B7HA 1JQFA 3BFUA 4NTLA 2Z23A 1SI1A 2RKMA 3CI8A 5TPAA 1B1HA 3QIMA 1URGA 3H6VA 3HV1A 4ELQA 4BDQA 1MQIA 1I69A 3TELA 2YLNA 4BDRA 3UN6A 4FAJA 3C32A 3G3IA 1ZKBA 2B3BA 2XD3A 3P7IA 3S9EA 3UK4A 3ILTB 4NF5B 4E0WA 1Y3NA 1B52A 4JXIA 4ZZEA 4EXLA 3KSJA 4MFIA 3QYTA 4QFNA 1URDA 3FXRA 3OO8A 3SEXA 3L6HA 1LFHA 1MH3A 2OWSA 1I6QA 1Y9UA 2YPNA 3LR1A 1B58A 1EZ9A 3PV0E 4H65A 1BP5A 4KFQA 4ELPA 4LQ2A 3IAZA 3GLBA 1YCJA 3CIJA 3ZS6A 2F5XA 3K01A 4EF2A 4EUOA 4IY5A 2FNCA 4GF8A 1XOCA 2QPQA 4PQJA 3MJNA 4R75A 4I1DA 3Q26A 2XX9A 3T93B 3VLUA 2CMOA 4IGRA 1ZMGA 2F36A 3QXMA 4PFYA 3MZ1A 3N6UA 3PU5A 4MBPA 4ZEFA 1BKAA 5EYFA 1B5HA 1LAHE 3W9WA 3LC8A 4F2OA 1MG1A 3JZJA 5ISUA 1H44A 1PC3A 2UYFA 2I0BA 3GXAA 3CFLA 3IJXB 2UYEA 3O9PA 3TCHA 3EPEA 4F3BA 2R71A 1PB9A 5H8NA 2M8CA 1B0LA 1N04A 5K2XA 3SDFA 3TFLA 4DLDA 2ZYKA 5KCJA 4XKPA 4YICA 1IUDA 5HPQA 1B4HA 4EQBA 1QW0A 3A3CA 3H3GA 4M1VA 2W7YA 1II5A 2PMSA 2XXRA 1ZTYA 3FZVA 1B5IA 3BFTA 3IJOB 3KOSA 5H8FB 1S9TA 1H3DA 3AXFA 1XVYA 2DWIA 1MY2A 2DS9A 1M5FA 4F1VA 1AL3A 5I56A 3A09A 2I49A 5I84A 2HAUA 3HSTA 5CRYA 4DE8A 3RGYA 2H4IA 3S9NC 3SEVA 3B7DA 3OELA 4EDPA 3U93A 2HEUA 3CG1A 2Z22A 4G8HA 3VLWA 5AA4B 1F9BA 1Z7NE 3KGCA 1P1UA 4F3SA 1RKMA 4H67A 3RTFB 3MW0A 1MM7A 5CI5A 1I6AA 3DELB 2DWJA 3K2DA 3SESA 1A54A 2HZLA 3Q29A 3S9MC 4EQ9A 4F19A 3VXBA 1NNFA 3MUQA 1FQCA 1XVXA 1J1NA 1VFEA 3OSQA 4ESWA 1M5DA 5I58A 5IAIA 1B40A 3FV2A 2VOZA 3L6GA 4ECFA 2P1SA 4G2ZA 1A8EA 5AA2D 1B7ZA 5ELVA 3RQTA 1LGBC 3S9LC 2NUVA 1ATGA 5H8NB 4GOTA 3PPNA 1T0KA 1M5BA 1OMPA 5KDTB 1I6BA 5H8HA 1DPPA 1TXFA 3EHUA 3V8XB 1IITA 4LZ8A 4R6KA 3MQ9A 3VLVA 1XHYA 2D5WA 4H5FA 4LUBA 4AB5A 1A55A 3HCQA 4XIGQ 3OO9A 4NF6A 1AMFA 3T9XB 1A99A 4GLIA 3TEPA 1D9VA 5AA1A 1B2HA 3IO6A 3UP9A 3KBRA 5DVFA 1IXIA 2B3FA 3KG2A 4YB5A 1ZLQA 1MXUA 5CBRA 2O51A 1JNFA 4R72A 4EQ7A 1SYHA 3BKIB 2ZNUA 4OVJA 3U94A 1FQFA 4IY6A 3Q27A 4GXSB 3FIRA 5AA4A 2E0SA 3TTRA 3MP8A 3IK6B 2RC9A 4Z7EA 1SQYA 3E13X 3W9VA 4ZE9A 1LB8A 2FYIA 2H99A 3TQWA 1A7LA 2DQVA 2RC7A 2DP8A 2IEEA 3E3KA 2DOJA 2XXPA 3DP4A 3RT8A 5I56B 4KQPA 3QUJA 2DE2A 2R9JA 2XXIA 1MXVA 2DVZA 3FV1A 4TQUQ 1JEVA 4YB6A 3LUYA 5FHOA 1PB7A 1R6ZA 2V3QA 4I8CA 1ELJA 5A5XB 4ZEKA 3OOAA 1MQJA 1EZOA 5I58B 5KCJB 3K4UA 5H8QB 1N76A 4HCYA 4LVQA 4RK9A 3C9HA 1DOTA 3LSXA 3V5AA 3BBRA 5ICTA 2QS4A 3PUYE 3D4GA 1HSLA 4PFTA 1AIVA 1EZPA 1SW5A 3F11A 2V25A 3KN7A 1QUIA 2Q2CA 4RY1A 4OEUA 3K6UA 3R6UA 3CFZA 3OENA 1IXCA 2XXQA 4Q30B 3B6TA 4DXCA 3RN8A 3KSXA 4LP2B 3I3VA 3O29A 3SERA 4G68A 3RNNA 1USYE 5KZTA 2F35A 1QVSA 1TT1A 4LATA 5DEXB 3FUZA 2GRVA 4UA8A 4U21A 3EQ1A 1ZIUA 1H45A 3RLFE 2CZLA 4GQOA 2WKYA 4FJPA 2PT2A 5CC2A 3FVGA 3VFJA 2HFBA 5AE4A 1B3GA 3LSWA 3PMXA 5H8HB 3TPAA 3T9HB 4H0WA 2OBGA 2ZXTA 2XD2A 1GR2A 4UACA 4O3BA 4OERA 4HCWA 3OSRA 2PYYA 3IOWA 4G68C 4IO7A 3TTKA 3VDFA 2GHBA 1Y3PA 4MLVA 5I57A 3C36A 2VGQA 1NH8A 4HS7A 4MF3A 4Q0CA 3OEMA 1Q1KA 4RK2A 4YKKA 1Z7ME 1S7YA 2Z8EA 1CE2A 3RY3A 4POWA 4U22A 3M3LA 4O3AA 4GVOA 4OQOA 3KOTA 2VHAA 4HTGA 5DT6A 4DXBA 4QSCA 2HAVA 2ZYMA 4NF8A 1YTVA 1Y4CA 1MXZA 1TFDA 3M3KA 3DM0A 3S4UA 5L9OA 2H25A 2A5TB 2D3IA 4F31B
chains in the Genus database with same CATH superfamily
1IQPA 3JAMS 1US4A 4JWYA 1B0HA 5DW8A 3LUZA 3EF7A 3SAUA 3CVGA 4GWSA 1Q3CA 2DHRA 4KCDA 4KD5A 1IEJA 5K2YA 5LDZA 3SEVA 4LA9A 3HHYA 2F8DA 1UIVA 1MXWA 3CF2A 3GRYA 5IM2A 1MDQA 3IB1A 3ECRA 5KZTA 4B3SM 1AH5A 1JW5A 4JSDA 1UFZA 4Q5TA 2HXRA 1UTHA 3LMMA 4D81A 1MPDA 4KHPM 3U6OA 1OAOC 2ZYNA 4IIWA 1RYXA 4NWCA 1NSFA 1S50A 4PDDA 2O6AA 3FRHA 1LCTA 2WYPA 1UQWA 3T9VA 1CB6A 3C34A 1B1XA 3MZBA 1CUKA 1R5LA 5ITUA 2B65A 2BJJX 1GJTA 5ET8A 1ZMUA 2KXEA 3GPYA 2ZAMA 3CRBA 1FPDA 1ZAEA 1XT8A 3TZAA 4LJ8A 1IQ7A 2F78A 3C31A 5F7VA 2UU9M 1XNRM 3DZDA 3H7MA 5TP9B 3A45A 3OTOM 2HCAA 3H03A 1PJIA 4IGTA 4JSOA 2X7PA 2GHAA 3ILUB 1RDXA 5B7DA 3SASA 2NXOA 2KR0A 4KHZE 3GQ3A 4AS5A 5F3WA 1IXSA 1KYIA 1SYIA 5CMBA 2Y7IA 4PGPA 3SFZA 4FVMA 3FJMA 3FD3A 2UUCM 1J5EM 4MNPA 1IBKM 2F5SA 1B3EA 1NL5A 2DENA 5J1DA 2DYXA 4PCDA 3NBXX 4RPOA 3FXBA 4G77A 3A29A 5H37D 4JI2M 4U1OA 5H8SA 1YXIA 1N7XA 5IREB 4OVSA 3QSLA 5I2NB 2UXBM 2Y7RA 4WEDA 3SKPA 3J7AS 4TLLB 3FD9A 4I40A 1FTAA 4LFBM 3CSGA 4JI1M 1FPBA 4XTCQ 4IBKA 3JYRA 2I7PA 4U4SA 2R44A 1G4AE 1KZ8A 4U4XA 2FA7A 3OO6A 2LH0A 2R4JA 3L29A 3LCVB 3A46A 5CBSA 2F5OA 3WAFA 4F1UA 4QSEA 3UJNA 4NMYA 1NUZA 4KR5A 3GLFE 1POTA 5LTCA 1Y3QA 1B3LA 3HHFA 2AHMA 3FVOA 3L26A 1MY3A 2AIXA 3O28A 1IBLM 2J5YA 1MM6A 3T22A 5EXSA 2XXTA 3FXQA 1N33M 4LONB 1VDDA 3O2AA 4R9FA 4R2BA 2L4FA 1SI0A 4GL8A 4F29A 1FPFA 2H9BA 3SETA 4B3TM 1WIVA 1K3WA 4JBZA 4PFIA 1MQDA 2DWAA 1OKSA 2Z8YM 3E9SA 1C7YA 5F1QA 3HO7A 2JA2A 3T1YM 4CGYB 1G0HA 3TWLA 1UIUA 4OEVA 4TUWA 2D7HA 1Q3BA 3M6AA 3GZGA 5TP9A 4BDLA 3KC1A 3MWBA 4RA1A 3KW6A 1FJ6A 1KWHA 3NOHA 2NVUB 2Y7PA 2P3NA 2XF3A 1L1TA 1P3QQ 1BK4A 1M5EA 4LFCM 4X04A 2DWLA 1B32A 5AA2B 3K1JA 1IN8A 3K1NA 1VEKA 4F3PA 3C3EA 2YJPA 4GKKM 5FTMA 3DP8A 4XF5A 2M60A 1SVXB 2XWVA 3LSFB 2KNVA 3IORA 1D9YA 2F3BA 2DZNB 4PFUA 3GBBA 1PJSA 3IFCA 4OW0A 3GQ5A 2FH0A 1FTOA 1IMDA 4I62A 4X66M 4OENA 3C33A 4GWWA 2Y0TA 4G3OA 3HWSA 1L2BA 2CEYA 3E21A 1VEJA 3MC2A 3H4JA 4OTEA 2DXIA 2LHGA 2FS1A 1HNWM 5ESYA 2MH8A 3U6CA 4O7IA 4XKNA 4NEDA 1HR0M 2I7NA 3G3FA 2HZKA 3GLIA 4OHNA 1VE4A 4ZEDA 3T6PA 1L2CA 3AOEC 2I4BA 2O25A 3U61A 4DR7M 1Q35A 3MPKA 3UA8A 2UXDM 5GKNA 1B46A 3FUWA 3GLHB 4ISUA 5FTHA 4KYEA 4LF6M 3H6UA 5KQDA 3D4CA 5ITXA 2REGA 1AWBA 2L5VA 4I81A 2QENA 3JV9A 3E4RA 4NF4A 4ZDMA 1AIPC 1B7HA 1JQFA 2Y5KA 2Z23A 1SI1A 5TPAA 1B1HA 5EP3A 3H6VA 4BDQA 1NY5A 2VPOA 1ZMWA 2Z7JA 4BDRA 3UN6A 3C32A 3G3IA 4DR5M 2KRUA 3ILTB 4EXLA 4MNIA 2O5RA 4QOZC 2OWSA 1Y9UA 1QGXA 3LR1A 4H65A 1B58A 4GX4A 1I94M 3TE6A 3CIJA 2F5XA 2ZZWA 2DZOB 4XFEA 4R75A 3VLUA 2XX9A 4PFYA 3MZ1A 3HU2A 1TDHA 1WHCA 2UUAM 2OWZA 3JZJA 5ISUA 1H44A 2I0BA 4AZFA 2MKZA 3TCHA 4F3BA 1LBWA 1B0LA 5ITQA 2XZUA 4XKPA 2LWXA 1IUDA 1QW0A 3A3CA 4M1VA 3RN8A 1DO0A 1ZTYA 3FUXA 1B5IA 5H8FB 1DGHB 3A09A 5EQ7A 4DE8A 2CRUA 4H46A 4MX6A 2QZ4A 2H4IA 1ZQ9A 4EIWA 4CISA 3U93A 4I3EA 1N77A 1LTMA 4B7HA 4G4RA 4NHBA 1OIPA 3M0EA 3DELB 4MNCA 1A54A 1LBZA 4EQ9A 4HL4A 3VXBA 1J1NA 1OTRA 4ESWA 1IFYA 3GRVA 3FKEA 3L6GA 1EE8A 2DHYA 2QQ8A 4LF7M 1FRPA 3S9LC 4NX1A 1ATGA 1M5BA 1OMPA 5KDTB 1I6BA 1DPPA 3GLGA 4DV7M 3EHUA 2QFLA 2JY7A 3MQ9A 2XXKA 4LUBA 4BB9A 4GITA 2WSEF 5AA1A 3KBRA 2D7GA 2MJ5B 4CJ6A 1J09A 1EYJA 2O51A 3BKIB 4OVJA 4DR6M 3NWLA 3FIRA 4GRIA 2P3VA 3MP8A 4Z7EA 1MX0A 4WP2A 1FSAA 2H99A 5IZ7D 3E3KA 1EIJA 3B8BA 3UK6A 4MH0E 3MSTA 2DNAA 4YB6A 4PF6A 5FHOA 4AKGA 1NI9A 1PB7A 1R6ZA 5A5XB 4MCOA 3OOAA 1EZOA 5KCJB 3K4UA 3LSXA 1DV0A 4NOOB 4PFTA 1HSLA 4JI3M 5A5LA 1EZPA 1SW5A 4RY1A 4OEUA 3R8FA 3KC0A 3OENA 2XXQA 3B9PA 4LP2B 2VF8A 1Z6TA 3GLFB 3FE3A 1NV3A 1TT1A 2L09A 1RU3A 1H45A 3KVWA 3IHPA 4LFAM 1KA0A 3U6QA 2PT2A 4IBIA 2Q74A 3FVGA 3SMSA 2HFBA 3LSWA 5DFLA 4MEVA 3T9HB 3CF0A 4H0WA 2XD2A 4KLNA 4KT0F 4HCWA 3VDFA 2PYYA 3IOWA 3DOAA 3C36A 2VGQA 1NH8A 4HS7A 5DYIA 2XWIA 5K2XA 3RY3A 4POWA 2CWBA 4U22A 1G71A 3M3LA 1GKIA 4MGHA 1JQJC 1NHGC 2EKFA 2E5LM 2FBPA 3S4UA 3VDPA 5JI3E 1O7TA 1QUSA 4QRZA 4G61A 3J80S 1N36M 1N75A 3TAJA 4N8GA 2GFEA 4DXUA 4WKMA 3T0JA 1V92A 4LGMA 4ZEIA 2XFTA 4OVQA 4GC9A 3FXUA 4MMPA 3GLIB 3HFUA 5FHNA 2OCUA 2XHDA 3K1MA 2JZ1A 2UVHA 4G8NA 3RTWB 3TKDA 1GL7A 4JVCA 1P1QA 1JVXA 3R7XA 1A40A 3L28A 2R62A 4H8IA 3VK8A 3CFXA 3HN0A 2XXUA 1NNJA 3T1BA 1OLAA 5BWJA 5FTJA 1NUYA 1LFIA 1B4ZA 3RPWA 3AOGA 1OVBA 2F7BA 3H06B 4REZA 5IGAA 4PFWA 2VD2A 2O7IA 4LG2A 3K9PA 4MM3B 2VQEM 1LV7A 2DXYA 5CM6A 4GFRA 2R4EA 4PE3A 4YB7A 3SEWA 1GGGA 1E9RA 4GIPA 3O97A 4IO3A 1LAGE 1B6HA 1SXJA 3N5LA 4QFPA 3ZKKA 1FTKA 2I3VA 4ZEBA 4YMAA 1NKXA 3FYDA 3PMWA 4JB7A 3IB2A 3KOWE 1D2NA 4MLQA 3KP1E 1R9LA 4GD5A 2Y7WA 1LAFE 2R6FA 3MPLA 4H1XA 2X49A 5AA3A 2O1LA 4PBHA 2QS1A 3THIA 5DTBA 3R9XB 2CEAA 3R26A 3RE8A 4OMBA 4FWGA 2UVJA 4U2RA 4DR2M 3HU3A 2ZBKB 3MVXA 3VE1B 3MAMA 4ONYA 4XXUA 1GLNA 5KQ8A 1HNXM 1FPEA 2VP1A 5KPZA 4POXA 4DV2M 2XXYA 4RXLA 4XKRA 2I6EA 1YZ0A 3CGWA 3G3KA 2BJIA 2JY5A 5JK4A 2ZNSA 2REJA 5I2KB 2F7CA 2DAKA 1XMQM 3TMGA 2NOOA 2RGHA 2ZNTA 2GQFA 3GP1A 4O7MA 3B6QA 2ZZVA 3HKPA 3U8QA 4PTKA 4QHTA 3ODBA 3U1OA 3FRIA 1EU8A 1SDXA 1BIYA 4GHLA 2QRYA 1JVYA 3USDA 1DTZA 2ABHA 1TWYA 4B08A 3UMMA 2ZYOA 4M9ZA 1EFUB 4L8RC 4P0GA 4OVZA 1NV2A 2F6PA 4PFRA 3KDSE 2LNHC 1ZU0A 4PE5B 2F6GA 2H1RA 4NF6B 4X62M 4ZE8A 2ZTDA 3GLGE 4GL0A 1QZEA 3BOSA 1XMOM 2PFZA 2FOIC 1SW4A 1MQGA 3W15C 3G3HA 1K9ZA 4NSOB 3OEKA 4PGNA 4MGIE 3RPLA 5A5XA 3LV0A 3D1RA 4F18A 4OXVA 3FUVA 2LVPC 3GQ4A 3IOUA 3PUXE 4KYSA 3CR9A 2X26A 1WDNA 2QBYA 4FIMA 4DUZM 3RUMA 4ITQA 2Y21A 4BDNA 2XWOA 4WURA 3KFMA 4LF8M 1FPKA 2WX9A 1UTBA 3J81S 2Q9TA 3W67A 3MYUA 1SXJB 2EKKA 2YFQA 4LJ4A 1K3XA 4F2LA 1FTMA 3GRRA 2FHYA 4L17A 5IZZA 1IXHA 2Y84A 3TODA 1R6BX 4ESXA 3KJ7A 2M5ZA 2E1SA 3ONMA 3BIGA 4P0IA 1FQBA 3HHXA 1RDZA 4QNRA 3HHGA 3D8LA 3TDJA 3T9UA 4MHFA 3K8ZA 1FNNA 4DR3M 4K0KM 3FATA 1FTJA 3MP1A 1SXJD 2QS2A 2N35A 3CG3A 4QSDA 1R1NA 4TOZA 2MR9A 1JP4A 4AB6A 3K00A 2CE7A 3QK6A 4XGIA 4PDGA 2ALUA 1UTBB 1E9SA 1FCKA 4KI0E 4JDFA 1YYZA 3OO7A 1LBBA 1IMEA 2XLJA 1OVTA 4HW8A 4QXDA 1GL6A 3PNVA 2PBWA 4QBAA 5I2NA 4EQ7A 2ONRA 1A5TA 4UABA 3PD8A 2NWJA 3T66A 1R2YA 1O63A 4JVIA 3VVFA 1B7UA 2QHOB 2UVGA 3L25A 3DP6A 4NQ8A 2VF7A 4IBGA 1VFDA 1NJGA 1BVSA 1FBHA 4DI4B 4QF9A 4LZ7A 1MPBA 3MHVC 3T96B 2F97A 1NV0A 2PFYA 2V6ZM 1M5CA 1MN3A 1DTGA 1Y1ZA 4IR8A 4ZZAA 4JI6M 2P0SA 4LQ5A 5FBPA 2O84X 1YAEA 3H4MA 3FVNA 5CMKA 1WODA 4G4OA 2I58A 3CF6E 5BUUA 4R2FA 4N8YA 2OZZA 4ND9A 4O8MA 4A3VB 1GABA 5IT9S 1I4WA 4PAKA 2GH9A 4GWOA 1WGLA 4FEDA 4OU7A 4PP0A 4M4GA 4OWDA 4HE0A 5EQ8A 2Z3XA 4HE1A 1USYH 2V3UA 1H43A 1MS7A 3PD9A 3G3GA 2I4CA 1YE9A 4IBBA 3GLIE 4N07A 4NF8B 1HSJA 4JWXA 1C1KA 4N17A 3CI8A 1TH4A 2PCRA 1URGA 4ELQA 2FIXA 1ZKBA 2XD3A 3J2PB 4KODA 3UK4A 4E0WA 2HHMA 4ZZEA 4PBQA 2DZLA 3QYTA 3VKHA 5ET5A 1IN4A 2YPNA 1I6QA 4L15A 3SMPA 3RGPA 2RRUA 4PAIA 3GLBA 1YCJA 3ZS6A 4EF2A 3K01A 1J7KA 4IY5A 4PF8A 5DYGA 4GF8A 1XOCA 4PQJA 3MJNA 4I1DA 3Q26A 2XFSA 3QAUA 2L4EA 2KNAA 4LZZA 3PU5A 4ZEFA 5EYFA 1MG1A 1NY6A 3IJXB 3GXAA 4OVRA 2F5QA 3O9PA 2APLA 5EYGA 5H8NA 1N04A 2ZYKA 1B4HA 4EQBA 1HT1E 3H3GA 4NRWA 2JY8A 2W7YA 1II5A 2PMSA 5AE4A 2A5YB 3E46A 1S9TA 1XVYA 1MY2A 2DS9A 3B74A 4NSRA 2FNAA 2HAUA 3RGYA 3OELA 2ERCA 2R0IA 1Z7NE 3KGCA 5IZ3B 4F3SA 4H67A 3MW0A 3RGSA 4X64M 4CIZA 3Q29A 1MJGM 1PJQA 4DV3M 4F19A 3MUQA 1VFEA 2FIEA 5IAIA 3SARA 4OX9M 4P16A 1NUWA 3FV2A 3QYBA 5ELVA 3RQTA 4GOTA 3DA1A 3PPNA 1T0KA 2KZUA 5H8HA 1DGGA 1IITA 4DV0M 1QVRA 2DVWB 2H5XA 1TR8A 5EQAA 2Y0QA 4XIGQ 3OO9A 4NF6A 3U60A 4GLIA 4I3YA 1PJJA 4N6DA 1GO5A 3SATA 2DI0A 4YB5A 3K2LA 1SYHA 2ZNUA 3U94A 3PFIA 1DCUA 3M7GA 5AA4A 5EXPA 3TTRA 3IK6B 3PNYA 3W9VA 2DQVA 2RC7A 3RT8A 2XXPA 3QUJA 2DE2A 2OOBA 2R9JA 4LN5A 3LQQA 3D8BA 2DVZA 3FV1A 5DNYA 3QYEA 4LGYA 3SAWA 1N76A 2Y20A 1N32M 4RK9A 1TGUA 1DOTA 1G8PA 1QDTA 3D4GA 3K9OA 3KN7A 2J7OA 1UM8A 4Q30B 3CFZA 3SERA 3CHGA 1USYE 2F35A 1NO1A 2DKLA 4GC5A 2HL7A 3U61B 4GQOA 2C9OA 4FJPA 5CC2A 2KA6B 1B3GA 3PMXA 5H8HB 1XI6A 4I5SA 2OBGA 1GR2A 4G6ZA 4UACA 4OERA 4P56A 1XNQM 4G68C 3C9PA 1GJSA 2CZKA 1Y3PA 4PC9A 4DUYM 5I57A 1TDZA 5BR8M 4MF3A 4Q0CA 4RK2A 4YKKA 1S7YA 4O3AA 4GVOA 3KOTA 3HJ8A 4DXBA 5IWAM 5E26A 5I7IA 2JJKA 4QSCA 2ZYMA 4DR4M 3FTCA 5KPRA 1Y4CA 1MXZA 2R18A 1FPIA 3M3KA 2H25A 1OQGA 2D3IA 3FJGA 4F31B 2ZANA 2Y7KA 3SEUA 4XKQA 4X8RA 3LSLA 4IO6A 1IXSB 4IJEA 1D0MA 1N7WA 5IZ1A 4F1IA 2XH9A 3FBPA 1AOVA 3C4MA 4OETA 2L2DA 1FW0A 1ZV1A 4IB2A 3HY5A 3ZSFA 2RCAA 5I59B 2RCBA 2JXNA 5FLXS 1VR5A 3PVSA 4OFJA 4N15A 3I04M 1TF0B 3N6TA 4R74A 4LF5M 2GNOA 1LSTA 4H5GA 2CV1A 1UTHB 2QMWA 1FBEA 2A5SA 3SYKA 2ONKE 4O3CA 3T38A 3I4YA 1SD3A 2ZAOA 1QUKA 2V4CA 1NFTA 1R9QA 4QHQA 1JEUA 4DV4M 2KLFA 4X48A 2QPAA 3VK7A 4MGKE 3VV5A 1K82A 5EQ9A 2LXEA 4NE4A 4PAFA 3EIEA 3RYDA 2QSFX 2CHGA 4N6KA 2QS3A 1MH4A 3OMBA 3VXCA 3WHLA 4BDOA 4FATA 4IO4A 4HLQA 5ET7A 2XXHA 2BJWA 4F39A 4Q8RA 4N4UA 4XK8F 3PUVE 2HWJA 1QDRA 2KNZA 3TTLA 3V83A 1FPJA 1QZMA 3B89A 1VQ1A 3H6WA 2ZMBA 4UN2B 3KOZE 4X1DA 1YPNA 3KOXE 3QUFA 1WR1B 2DWNA 3QMFA 4HXVA 5I57B 1B9JA 1MPCA 2J7NA 2OWTA 3GYYA 5M2VA 3I5OA 3WAEA 1VG5A 2XGNA 4R6HA 1FBCA 2HAKA 2Z8DA 1PDAA 4YU0A 3B6WA 5L9SA 1ZBMA 1EYKA 4YKJA 2PVUA 4YKPA 4P17A 2G3QA 3N26A 3MVYA 4DZ1A 2QL3A 4TLMB 4U23A 4NXMM 1FQAA 3U72A 2O69A 1XXHB 3GO8A 3RT6B 4LF4M 1Q02A 2F34A 3O6HA 4YZZA 1ZJLA 2R45A 4OZ9A 1EH3A 5H8QA 3FJ7A 4R7GA 4YKIA 2R6GE 3TTMA 1A8FA 1QULA 2BJVA 4P9KA 2WSFF 2XX7A 5L8DA 4Z8XA 1MXXA 2V84A 1IY1A 1NMUA 3PMVA 4RJZA 1HT2E 3IECA 3GPUA 4B7FA 4ZECA 2DVCA 3IX1A 4GBWA 1POY1 4BBAA 4EXKA 1NNPA 1IZ1A 4KYDA 3SEYA 1S3SA 2DAGA 1LLSA 1DGBA 3E9XA 1B3FA 5LOMA 4RKUF 3K6WA 4WXJA 2ZTCA 2XZFA 1D0LA 4NXNM 4KXPA 3ZC7B 4JVDA 3C3DA 3IFAA 4DBGB 1VSOA 1SG9A 3M8UA 2EO2A 2QMXA 2I0CA 1N3XA 4DIGA 3L27A 1PRBA 2QJEA 1DO2A 4R71A 2B4MA 2RF1A 3FGSA 5AA2A 2CZHA 1NNKA 2K6BA 1OQYA 3VDUA 3UIFA 5I2KA 2JWSA 4THIA 1WVJA 3FUUA 1NV7A 4AI6A 2UXCM 4GEWA 2OLBA 2Q88A 3MBPA 3U6SA 2VIIA 1NNUC 1W5TA 2O01F 1BLFA 1D3KA 2KW0A 4JI5M 3FASA 1DGFA 2PX1A 3K0VA 1H6UA 3A98B 4FECA 1D0KA 4JXJA 3TL4X 1JR3D 4GIZA 1ORYB 3IOVA 2D7EA 3PPOA 2VPNA 4OFOA 5KDTA 1ANFA 2Z4RA 2H5YA 4N13A 4AQ4A 3MVWA 4W5WA 5IKBA 4NWDA 4R6YA 3KXEC 1XWIA 1TFAA 1MY0A 4R9GA 1QUJA 4FE8A 4RF0A 3Q8XA 3U6DA 1QAQA 3A3UA 4PDIA 4IO2A 4YAHX 4M9XA 1FBGA 4OVPA 3ZKLA 2KDLA 3TYHA 1L1ZA 1DMBA 3U5ZB 3O66A 1INPA 1B05A 5TU0A 1PB8A 4FEBA 4NN3A 4QFKA 5FTIA 2DXRA 1B3HA 4GWXA 1NV8A 5ITYA 2B4LA 3IL1B 5DYHA 1X37A 2ESNA 1OIZA 4LJAA 3NBIA 1V33A 1LAXA 4GWYA 4AW4A 2LBCA 3TPZA 2BNKA 1T6OA 4S12A 3W0LB 2O1MA 4DCYA 3QAXA 4MB7A 2C5RA 3EHTA 3B7NA 1DPEA 4LRSA 2EA0A 5EP1A 3I51A 3DLNA 5JEIA 1US5A 4GKJM 4RPNA 1TTEA 4MGZE 4OESA 3OD7A 1JR3A 1D4NA 1YLAA 5ITTA 5ET6A 3MVZA 4B7GA 3C35A 2YQZA 4KCCA 2ANJA 4C1UA 1WGNA 1Y1MA 2WZJA 3U6EA 1FTLA 3KJTA 5CMMA 5ITOA 4C0RA 1GVNA 1PM5A 2G8LA 2OK2A 3H6TA 4WEPA 4ELRA 3KEIA 1HJPA 4NTLA 2NQ8C 3BFUA 1IN6A 2FVZA 2RKMA 3QIMA 3FUTA 3HV1A 1MQIA 3TELA 3KP0E 3FTFA 3P7IA 3S9EA 3KSJA 3Q8GA 4MFIA 1IY0A 3FXRA 3OO8A 2KHHA 4R3DA 2KQZA 4QFNA 3SEXA 1LFHA 4JYAM 1WJ7A 4EUOA 3T1HM 2FNCA 4IBJA 3FYCA 3VKGA 1NV5A 3MJ5A 2CMOA 4IGRA 2G5GX 2F36A 3N6UA 4MBPA 4AKIA 3QWLA 1BKAA 3HHZA 4LCBA 4YHHM 1B5HA 1LAHE 3LC8A 1PC3A 2UYFA 4OANA 3CFLA 2UYEA 4AKHA 3EPEA 5BPVA 2CV0A 4ANRA 3SDFA 3BBZA 3ROJA 3AFHA 5KCJA 1L5TA 3IJOB 4DV1M 3KOSA 4JI0M 3BFTA 3AXFA 4L16A 1M5FA 4F1VA 2I49A 1FPGA 5I84A 3HSTA 5CRYA 1Z5BA 2VDBB 1LEVA 2QCUA 1N78A 2HEUA 3T15A 2Z22A 1RKMA 3RTFB 1NV9A 5J16A 3E79A 1MM7A 4PCZA 4RNAA 1I6AA 3K2DA 3LVWA 3SESA 3AL0C 3S9MC 1NNFA 5I58A 3OSQA 2L6OA 1M5DA 4N91A 4PDHA 5E6JA 4ECFA 1Z5AA 1A8EA 1B7ZA 2NUVA 5H8NB 3L2AA 2LVAA 2LTUA 3GRUA 3MK6A 2ZM6M 1NUXA 3V8XB 3VLVA 2XEPA 4R6KA 2R65A 2D5WA 4H5FA 2K9DA 3HJSA 1A55A 3HCQA 1L8QA 4GX3A 2VQFM 1A99A 3TEPA 3IO6A 1Q9DA 5DVFA 2B3FA 3SYLA 1G41A 1FBDA 5CBRA 5EJCA 4PFBA 1FQFA 4IY6A 4GXSB 2E0SA 2B3TA 4P1LA 2JZ0A 2RC9A 4ZE9A 3TWMA 1LB8A 2FYIA 2MROB 1R2ZA 1A7LA 2Y5LA 4IBDA 3FTDA 2DP8A 5I56B 2DOJA 3DP4A 4KQPA 2XXIA 1JEVA 3EIHA 4I8CA 1ELJA 4ZEKA 2JY6B 7CATA 5H8QB 5LMNM 3HJQA 4FWHA 2JUJA 3C9HA 3V5AA 3BBRA 3PUYE 1AIVA 1LBXA 2V25A 1QUIA 2Q2CA 4CHTB 4P3LA 3K6UA 3U6MA 1HQCA 4DV6M 1IXCA 3KSXA 3I3VA 1VEGA 4G68A 4LJ6A 4O94A 4H45A 3BIHA 5DEXB 1QVSA 4UA8A 5KPTA 4U21A 3EQ1A 2CZLA 2CHVA 2WKYA 4D82A 2LHCA 3LVVA 5T3JA 3UZUA 1TH3A 3HHWA 3TPAA 2DWMA 1DBZA 2JNHA 1OAIA 3PTYA 1DK4A 4O3BA 3E78A 3KOYE 4MLVA 1Q1KA 1IN5A 1CE2A 4OQOA 4P8BA 1XC8A 4B3MM 2OX3A 2EJSA 2HAVA 5IZ3A 1LBYA 1TFDA 4HE2A 1OLCA 4JWOA 1LBVA 1G0IA 2AYSA 2HQ0A 1L2DA 2JP7A 4P11A 5L8RF 1MRPA 3O6IA 3U5ZA 4YY3M 3KFUG 2DWHA 4X65M 4H6DA 4GXAA 5FHMA 2HCBA 5FTNA 4BLAA 4BDMA 5F24A 5FTKA 2H98A 4MH5A 4LF9M 1IBMM 3SC3A 1RDYA 3TCGA 1SW1A 3GPPA 1PEBA 3HX3A 1IXRC 2KZSA 4N6PA 1Z59A 1Y20A 3IG5A 4M0WA 1URSA 5I58B 4YMBA 1DSNA 5LMUM 4GX6A 1RYOA 4GHAA 4X1BA 4L4UA 3O6GA 3ZCBB 3HPIA 1FPLA 3U65A 2L7HA 1Q39A 1AUAA 3V76A 4NF0A 1JB0F 4GMQA 4JV5M 3M3FA 5HBCA 4DCXA 4IJFA 3TCFA 5H8FA 2V93A 2XXWA 4JI7M 2OJTA 5EYHA 1Y4TA 5TPAB 3VVDA 5DVIA 1NNTA 1LBCA 4FCTA 4MGYE 1JW4A 4Q7JA 1XHBA 2OO9A 2QVRA 5JTYB 3ILKA 3PPPA 1IIWA 5ICQA 2CV2A 4FORA 4AG6A 4FCWA 2D21A 2HPGA 4II7A 2LAOA 2OOAA 4LJ5A 3GBAA 3RFWA 4EF1A 1PBQA 4OFLA 4N81A 2Q8JA 3S2VA 4K3FA 1QAMA 1IXZA 1MXYA 5I59A 2DSFA 1OQHA 3KZGA 2F7AA 2UXAA 4HEOA 2CHQA 2O7UA 1MDP1 1SW2A 1T43A 2AL5A 4ELOA 2HKJA 4U1ZA 1QAOA 3IOTA 3KN8A 3TWKA 1N34M 4AS4A 1SPIA 2FFJA 2XXXA 3TUSA 4R73A 2DAEA 5L9MA 4I8OA 3U92A 5ITPA 2XSZD 2FE8A 1MQHA 2VD3A 1XC1A 1QKBA 3K1PA 2HHHM 1QJMA 4XBOA 2DE4A 3SBJA 4F3GA 2L7IA 4FCVA 2ZZXA 1GVCA 4DDDA 4LJ9A 3HZJA 1FJ9A 3LBSA 3EHSA 3Q25A 3VVEA 2F5NA 4PT5A 3I6VA 2QSXA 3KS4A 1QQWA 1N3WA 4QFOA 3THGA 2P2AA 4E0XA 1BTJA 3ZH9B 4C1TA 2YNMD 4QHSA 4KO8A 2I48A 1SXJE 3MMPA 2MGWA 4RF1A 2IA4A 3PPRA 4MIJA 3VLFB 2XXVA 2XX8A 4WW0A 1NH7A 1IM2A 3MP6A 1P1OA 2ONSA 4LZJA 1JW1A 1FQDA 1IMAA 4L78A 4OA4A 1QKAA 2AL4A 1F4IA 3B50A 4LY6A 2WBBA 2I3WA 1TH2A 3B7ZA 2RC8A 3Q28A 1NV6A 2V3TA 4X9TA 4F1YA 4IBCA 3KBZA 2F5PA 3TTNA 4Z0IA 3PXGA 5DVJA 5I5PA 2DAMA 5B70A 2G93A 4B3RM 3G3JA 3G7WA 4QFLA 1XXHE 3B7QA 5C18A 1HNZM 3IO4A 3PUWE 4P1EA 2RGOA 1NHWC 1IXGA 4OYVA 2BWBA 1VDWA 3K6VA 3GLHE 5EHSA 4GRKA 2Z8FA 4QOSA 4DV5M 1JETA 2WBDA 4G4PA 4NL4H 1LB9A 4DI3D 3PPQA 5EP4A 3AKZA 3IB0A 3KS8A 2UVIA 4H8JA 1KA1A 1SBPA 4F22A 3H4ZA 4F2QA 2F3DA 2DE3A 4IO5A 5FTLA 4MJOA 4PETA 1FQEA 2R8TA 2LVNC 1GV8A 3C58A 3TQLA 2KEBA 2G29A 3TQSA 4Z6YA 1CNQA 2QVUA 3V89B 1V34A 3JR4A 4NG7A 3K02A 3EKIA 1MY1A 1O64A 2PT1A 1H76A 1D9QA 5ITRA 4NGUA 3MZ9A 3RPLB 2Q2AA 2YR0A 2THIA 4NF4B 2XWKA 1P99A 2R46A 4AQYM 2QNJA 1OJLA 2Q89A 3KN3A 3FVKA 1GTKA 1B5JA 2HXWA 1IN7A 5EHMA 1YUBA 5CMCA 3JR5A 3IR1A 1NV1A 3PGFA 4RNSA 1HSEA 5FSWA 3OXNA 4OVZB 3CSBA 4L6V6 3U6PA 3IG8A 3UGWA 1OIBA 4ZS9A 3J7BA 2RINA 5C1BA 4D80A 1MY4A 1OFHA 1P1WA 3EN3A 1PJTA 1R4GA 1B51A 3SHGB 3ISPA 4OVTA 1QYRA 4NF5A 1N84A 1PGYA 4G8MA 2O68A 5DEXA 4AG5A 2Z4SA 2Q2EB 3UORA 5AA2D 1XS5A 2CZIA 4KPTA 4LZ5A 4G68B 4I9DA 2X7QA 3K6XA 2A5TA 5HM4B 1N0TA 3N94A 1LCFA 1LFGA 5JTYA 1ZMVA 1PBPA 1JR3E 3PUZE 4RYAA 4GWZA 3A42A 2CEXA 2CP8A 1G59A 8CATA 2OQ4A 1EYIA 1P1NA 4JI8M 5EXTA 1IMBA 4IBFA 1I69A 4I4LA 2YLNA 4FAJA 2B3BA 1NV4A 4NF5B 3HGIA 3FTEA 1Y3NA 1B52A 4JXIA 2K47A 5A2QS 2GQ1A 1URDA 2QVVA 3CTWB 3L6HA 3WHKA 2C98A 1MH3A 3PV0E 1EZ9A 4KFQA 3GPXA 4ELPA 1BP5A 4LQ2A 3IAZA 2CUZA 1WXQA 4NAPA 2DDKA 1W5SA 5EQTA 2C96A 4QNMA 1OFIA 2UUBM 2QPQA 3GLFA 3T93B 1NJFA 2V1UA 1ZMGA 3QXMA 1E94E 4FWDA 3W9WA 4F2OA 3LW5F 3GLGB 3SZPA 5I3SA 4M9SA 2WEFA 2R71A 3J27B 1PB9A 2M8CA 3TFLA 4NRVA 4DLDA 1K9YA 4YICA 2CFOA 5HPQA 1IMCA 2LVQD 1QANA 2XSZA 2XXRA 3FZVA 1H3DA 2DWIA 5JI2E 5I56A 4P47A 1AL3A 3S9NC 4FW9A 1FBPA 3B7DA 4EDPA 1Y8GA 1IY2A 1SXJC 3ZQJA 3CG1A 4G8HA 1E32A 2C99A 1F9BA 3VLWA 5AA4B 1P1UA 1XB2B 5CI5A 2EUCA 5KO3A 2DWJA 2HZLA 3SHFA 1VDLA 4DR1M 1FQCA 1XVXA 1B40A 1FJGM 2VOZA 2P1SA 4G2ZA 2DAIA 4XEQA 3HU1A 4BLCA 1LGBC 4MAGA 3I4VA 1HQYE 4JN6A 2WYKA 3BXWA 1TXFA 4LZ8A 4LRTA 3F92A 2K0BX 1XHYA 1FBFA 3AV0A 1AMFA 3T9XB 1D9VA 1B2HA 3UP9A 1IXIA 3KG2A 1ZLQA 1YSYA 1MXUA 1JNFA 4R72A 1NVMA 1IMFA 4G4QA 4Y28F 4JI4M 3Q27A 2DWZB 2X4AA 2P5TA 1SQYA 2F4VM 2VT5A 3E13X 2QBYB 4FBPA 3TQWA 1QUTA 3U6LA 1DGHA 2IEEA 5EXXA 4GBVA 3K92A 2OPFA 4FD2A 1MXVA 4TQUQ 3LUYA 2V3QA 3W0FA 1MQJA 3I01M 2KRKA 4M0DA 1MU5A 4HCYA 4LVQA 2Q8MA 2WSCF 5ICTA 2QS4A 1T3TA 3F11A 4ZPXA 1KFVA 1XXHA 3AOEA 4GWUA 3R6UA 2X8AA 4DXCA 3B6TA 3O29A 3AJIB 3RNNA 1Z5CA 3GLHA 4LATA 3U60B 3DFZA 3FUZA 2W82A 2GRVA 1ZIUA 3RLFE 1KSFX 3VFDA 4PD2A 2RKOA 3SAVA 1G3IA 3VFJA 2C9CA 4GH9A 2ZXTA 4NC6A 5ITXE 3LCUA 4G4NA 3OSRA 3TTKA 4IO7A 2GHBA 2V1CA 4AB5A 3OEMA 1Z7ME 5EP2A 4IBEA 3UGJA 2Z8EA 2LVOC 2QP9X 3W68A 1R7RA 2VHAA 4HTGA 5DT6A 3LQRA 2BWEA 4NF8A 1YTVA 2XA5A 4LJ7A 3DM0A 5L9OA 2A5TB
chains in the Genus database with same CATH topology
1IQPA 3JAMS 1US4A 4JWYA 1B0HA 3EF7A 3SAUA 3CVGA 1Q3CA 2DHRA 4KCDA 4KD5A 1IEJA 5K2YA 3SEVA 4LA9A 3HHYA 2F8DA 1UIVA 1MXWA 3CF2A 3GRYA 1MDQA 3IB1A 3ECRA 5KZTA 4B3SM 1AH5A 1JW5A 4JSDA 4Q5TA 1UTHA 3LMMA 4D81A 1MPDA 4KHPM 3U6OA 2ZYNA 4IIWA 1RYXA 4NWCA 1NSFA 1S50A 2O6AA 1LCTA 1UQWA 3T9VA 1CB6A 3C34A 1B1XA 3MZBA 5ITUA 2B65A 2BJJX 2KXEA 3GPYA 2ZAMA 3CRBA 3TZAA 1ZAEA 1XT8A 4LJ8A 1IQ7A 2F78A 3C31A 5F7VA 2UU9M 1XNRM 3DZDA 3H7MA 5TP9B 3A45A 3OTOM 2HCAA 3H03A 1PJIA 4IGTA 4JSOA 2X7PA 2GHAA 3ILUB 5B7DA 3SASA 2NXOA 4KHZE 3GQ3A 5F3WA 1KYIA 1SYIA 5CMBA 2Y7IA 3SFZA 4FVMA 3FJMA 3FD3A 2UUCM 1J5EM 1IBKM 2F5SA 1B3EA 1NL5A 5J1DA 2DYXA 4RPOA 4G77A 5H37D 4JI2M 4U1OA 5H8SA 1N7XA 5IREB 3QSLA 5I2NB 2UXBM 2Y7RA 4WEDA 3SKPA 3J7AS 4TLLB 3FD9A 4LFBM 3CSGA 4JI1M 4XTCQ 4IBKA 3JYRA 2I7PA 4U4SA 1G4AE 4U4XA 2FA7A 3OO6A 2LH0A 2R4JA 3L29A 3A46A 5CBSA 2F5OA 3WAFA 4F1UA 4QSEA 3UJNA 4NMYA 4KR5A 1POTA 1Y3QA 1B3LA 3HHFA 2AHMA 3FVOA 3L26A 1MY3A 2AIXA 3O28A 1IBLM 1MM6A 3T22A 5EXSA 2XXTA 3FXQA 1N33M 4LONB 1VDDA 3O2AA 4R9FA 4R2BA 1SI0A 4GL8A 4F29A 2H9BA 3SETA 4B3TM 1K3WA 4JBZA 1MQDA 2DWAA 3E9SA 5F1QA 3HO7A 2JA2A 3T1YM 4CGYB 3TWLA 1UIUA 4OEVA 4TUWA 2D7HA 1Q3BA 3M6AA 3GZGA 5TP9A 4BDLA 3MWBA 4RA1A 3KW6A 1KWHA 2NVUB 2Y7PA 2XF3A 1L1TA 1M5EA 4LFCM 2DWLA 1B32A 5AA2B 3K1JA 1IN8A 3K1NA 4F3PA 2YJPA 4GKKM 5FTMA 3DP8A 2M60A 1SVXB 3LSFB 3IORA 1D9YA 2DZNB 4PFUA 3GBBA 4OW0A 3GQ5A 1FTOA 4I62A 4X66M 4OENA 3C33A 2Y0TA 3HWSA 1L2BA 3MC2A 4OTEA 2DXIA 1HNWM 3U6CA 4XKNA 4NEDA 1HR0M 2I7NA 3G3FA 2HZKA 3GLIA 4OHNA 1VE4A 4ZEDA 1L2CA 3AOEC 2I4BA 3U61A 1Q35A 4DR7M 3UA8A 3MPKA 2UXDM 5GKNA 1B46A 3FUWA 3GLHB 4ISUA 5FTHA 4KYEA 4LF6M 3H6UA 5KQDA 3D4CA 5ITXA 2REGA 4I81A 2QENA 3JV9A 3E4RA 4NF4A 4ZDMA 1B7HA 1JQFA 2Z23A 1SI1A 5TPAA 1B1HA 5EP3A 3H6VA 4BDQA 1NY5A 2Z7JA 4BDRA 3UN6A 3C32A 3G3IA 4DR5M 2KRUA 3ILTB 4EXLA 2O5RA 4QOZC 2OWSA 1Y9UA 3LR1A 4H65A 1B58A 1I94M 3TE6A 3CIJA 2F5XA 2DZOB 4R75A 3VLUA 2XX9A 4PFYA 3MZ1A 3HU2A 1TDHA 2UUAM 3JZJA 5ISUA 1H44A 2I0BA 4AZFA 3TCHA 4F3BA 1B0LA 5ITQA 2XZUA 4XKPA 2LWXA 1IUDA 1QW0A 3A3CA 4M1VA 3RN8A 1DO0A 1ZTYA 3FUXA 1B5IA 5H8FB 1DGHB 3A09A 4DE8A 2QZ4A 2H4IA 1ZQ9A 4EIWA 4CISA 3U93A 1N77A 4B7HA 4G4RA 3M0EA 3DELB 1A54A 4EQ9A 4HL4A 3VXBA 1J1NA 4ESWA 3GRVA 3FKEA 3L6GA 1EE8A 4LF7M 3S9LC 1ATGA 1M5BA 1OMPA 5KDTB 1I6BA 1DPPA 3GLGA 4DV7M 3EHUA 3MQ9A 4LUBA 4BB9A 4GITA 5AA1A 3KBRA 2D7GA 2O51A 1J09A 3BKIB 4OVJA 4DR6M 3NWLA 3FIRA 4GRIA 3MP8A 4Z7EA 1MX0A 2H99A 5IZ7D 3E3KA 3UK6A 4MH0E 4YB6A 5FHOA 4AKGA 1PB7A 1R6ZA 5A5XB 3OOAA 1EZOA 5KCJB 3K4UA 3LSXA 4NOOB 4PFTA 1HSLA 4JI3M 1EZPA 1SW5A 4RY1A 4OEUA 3R8FA 3OENA 2XXQA 3B9PA 4LP2B 1Z6TA 3GLFB 1TT1A 2L09A 1H45A 3KVWA 4LFAM 3U6QA 2PT2A 4IBIA 3FVGA 3SMSA 2HFBA 3LSWA 3T9HB 3CF0A 4H0WA 2XD2A 4KLNA 4HCWA 3VDFA 2PYYA 3IOWA 3DOAA 3C36A 2VGQA 1NH8A 4HS7A 5DYIA 5K2XA 3RY3A 4POWA 4U22A 3M3LA 1GKIA 4MGHA 1JQJC 1NHGC 2E5LM 3S4UA 3VDPA 5JI3E 1O7TA 4QRZA 3J80S 1N36M 1N75A 3TAJA 2GFEA 4DXUA 4WKMA 4LGMA 4ZEIA 2XFTA 4GC9A 3FXUA 3GLIB 5FHNA 2OCUA 2XHDA 3K1MA 2UVHA 4G8NA 3RTWB 3TKDA 1GL7A 1P1QA 1JVXA 3R7XA 1A40A 3L28A 2R62A 4H8IA 3VK8A 3CFXA 3HN0A 2XXUA 1NNJA 1OLAA 5BWJA 5FTJA 1LFIA 1B4ZA 3RPWA 3AOGA 1OVBA 2F7BA 3H06B 4REZA 4PFWA 2VD2A 2O7IA 4LG2A 4MM3B 2VQEM 1LV7A 2DXYA 5CM6A 4GFRA 2R4EA 4YB7A 3SEWA 1GGGA 1E9RA 4GIPA 3O97A 4IO3A 1LAGE 1B6HA 1SXJA 3N5LA 4QFPA 3ZKKA 1FTKA 2I3VA 4ZEBA 4YMAA 1NKXA 3FYDA 3PMWA 4JB7A 3IB2A 3KOWE 1D2NA 4MLQA 3KP1E 1R9LA 4GD5A 2Y7WA 1LAFE 4H1XA 3MPLA 2X49A 5AA3A 2O1LA 2QS1A 3THIA 5DTBA 3R9XB 2CEAA 3R26A 3RE8A 4OMBA 4FWGA 2UVJA 4U2RA 4DR2M 3HU3A 2ZBKB 3MVXA 3VE1B 3MAMA 4ONYA 4XXUA 1GLNA 5KQ8A 1HNXM 2VP1A 5KPZA 4POXA 4DV2M 2XXYA 4RXLA 4XKRA 2I6EA 3G3KA 5JK4A 2ZNSA 2REJA 5I2KB 2F7CA 1XMQM 3TMGA 2NOOA 2RGHA 2ZNTA 3GP1A 3B6QA 3HKPA 3U8QA 4QHTA 3ODBA 3U1OA 1EU8A 1SDXA 1BIYA 4GHLA 2QRYA 1JVYA 3USDA 1DTZA 2ABHA 1TWYA 4B08A 3UMMA 2ZYOA 4M9ZA 4L8RC 4P0GA 4OVZA 2F6PA 3KDSE 2LNHC 1ZU0A 4PE5B 2F6GA 2H1RA 4NF6B 4X62M 4ZE8A 4GL0A 3BOSA 1XMOM 2FOIC 1SW4A 1MQGA 3W15C 3G3HA 4NSOB 3OEKA 4MGIE 5A5XA 4F18A 4OXVA 3FUVA 3GQ4A 3IOUA 3PUXE 4KYSA 3CR9A 2X26A 1WDNA 2QBYA 4FIMA 4DUZM 3RUMA 4ITQA 2Y21A 4BDNA 4WURA 3KFMA 4LF8M 1UTBA 3J81S 2Q9TA 1SXJB 2YFQA 4LJ4A 1FTMA 1K3XA 3GRRA 4L17A 1IXHA 2Y84A 3TODA 1R6BX 4ESXA 3KJ7A 2M5ZA 2E1SA 3ONMA 4P0IA 1FQBA 3HHXA 4QNRA 3HHGA 3D8LA 3TDJA 3T9UA 3K8ZA 1FNNA 4DR3M 4K0KM 3FATA 1FTJA 3MP1A 1SXJD 2QS2A 3CG3A 4QSDA 1R1NA 4TOZA 4AB6A 3K00A 2CE7A 3QK6A 4XGIA 2ALUA 4PDGA 1E9SA 1UTBB 1FCKA 4KI0E 4JDFA 3OO7A 1LBBA 2XLJA 1OVTA 4HW8A 1GL6A 3PNVA 2PBWA 5I2NA 4EQ7A 2ONRA 3T66A 3PD8A 2NWJA 1R2YA 1O63A 3VVFA 1B7UA 2UVGA 3L25A 3DP6A 4IBGA 1VFDA 1NJGA 4QF9A 4LZ7A 1MPBA 3MHVC 3T96B 2F97A 2V6ZM 1M5CA 1DTGA 1Y1ZA 4ZZAA 4JI6M 2P0SA 4LQ5A 2O84X 1YAEA 3H4MA 3FVNA 5CMKA 1WODA 4G4OA 2I58A 3CF6E 5BUUA 4R2FA 2OZZA 4ND9A 4A3VB 5IT9S 1I4WA 2GH9A 4GWOA 4FEDA 4OU7A 4PP0A 4M4GA 4OWDA 2Z3XA 1USYH 2V3UA 1H43A 1MS7A 3PD9A 3G3GA 2I4CA 1YE9A 4IBBA 4N07A 4NF8B 1HSJA 4JWXA 1C1KA 3CI8A 1TH4A 1URGA 4ELQA 1ZKBA 2XD3A 3J2PB 4KODA 3UK4A 4E0WA 4ZZEA 3QYTA 3VKHA 1IN4A 2YPNA 1I6QA 4L15A 3SMPA 3RGPA 3GLBA 1YCJA 3ZS6A 4EF2A 3K01A 1J7KA 4IY5A 5DYGA 4GF8A 1XOCA 4PQJA 3MJNA 4I1DA 3Q26A 2XFSA 3QAUA 4ZEFA 4LZZA 3PU5A 5EYFA 1MG1A 1NY6A 3IJXB 3GXAA 2F5QA 3O9PA 5H8NA 1N04A 2ZYKA 1B4HA 4EQBA 1HT1E 3H3GA 4NRWA 2W7YA 2PMSA 1II5A 5AE4A 2A5YB 1S9TA 1XVYA 1MY2A 2DS9A 4NSRA 2HAUA 2FNAA 3RGYA 3OELA 2ERCA 1Z7NE 3KGCA 4F3SA 4H67A 3MW0A 3RGSA 4X64M 3Q29A 4DV3M 4F19A 3MUQA 1VFEA 5IAIA 3SARA 4OX9M 3FV2A 4P16A 5ELVA 3RQTA 4GOTA 3DA1A 3PPNA 1T0KA 2KZUA 5H8HA 1DGGA 1IITA 4DV0M 1QVRA 2DVWB 2Y0QA 4XIGQ 3OO9A 4NF6A 3U60A 4GLIA 1PJJA 3SATA 4YB5A 3K2LA 1SYHA 2ZNUA 3U94A 3PFIA 3M7GA 5AA4A 5EXPA 3TTRA 3IK6B 3PNYA 3W9VA 2DQVA 2RC7A 3RT8A 2XXPA 3QUJA 2DE2A 2R9JA 3LQQA 3FV1A 3D8BA 2DVZA 5DNYA 4LGYA 3SAWA 1N76A 2Y20A 1N32M 4RK9A 1TGUA 1DOTA 1G8PA 3D4GA 3KN7A 2J7OA 1UM8A 4Q30B 3CFZA 3SERA 1USYE 2F35A 4GC5A 2HL7A 3U61B 4GQOA 2C9OA 4FJPA 5CC2A 2KA6B 1B3GA 3PMXA 5H8HB 4I5SA 2OBGA 1GR2A 4G6ZA 4UACA 4OERA 1XNQM 4G68C 1Y3PA 4DUYM 5I57A 1TDZA 5BR8M 4MF3A 4Q0CA 4RK2A 4YKKA 1S7YA 4O3AA 4GVOA 3KOTA 3HJ8A 4DXBA 5IWAM 5E26A 4QSCA 2ZYMA 4DR4M 3FTCA 5KPRA 1Y4CA 1MXZA 2R18A 3M3KA 2H25A 3FJGA 2D3IA 1OQGA 4F31B 2ZANA 2Y7KA 3SEUA 4XKQA 3LSLA 4IO6A 1IXSB 4IJEA 1N7WA 2XH9A 1AOVA 3C4MA 4OETA 1FW0A 4IB2A 3ZSFA 2RCAA 5I59B 2RCBA 5FLXS 1VR5A 3PVSA 4OFJA 3N6TA 4R74A 4LF5M 1LSTA 4H5GA 2CV1A 1UTHB 2QMWA 2A5SA 3SYKA 2ONKE 4O3CA 3T38A 3I4YA 1SD3A 2ZAOA 1QUKA 1NFTA 1R9QA 4QHQA 1JEUA 4DV4M 2KLFA 4X48A 2QPAA 3VK7A 4MGKE 3VV5A 1K82A 2LXEA 4NE4A 3EIEA 2CHGA 2QS3A 1MH4A 3OMBA 3VXCA 3WHLA 4BDOA 4FATA 4IO4A 4HLQA 2XXHA 2BJWA 4F39A 4Q8RA 3PUVE 3TTLA 3V83A 1QZMA 3H6WA 2ZMBA 3KOZE 4X1DA 1YPNA 3KOXE 3QUFA 2DWNA 5I57B 1B9JA 1MPCA 2J7NA 2OWTA 5M2VA 3I5OA 3WAEA 2XGNA 4R6HA 2Z8DA 1PDAA 4YU0A 3B6WA 5L9SA 1ZBMA 4YKJA 2PVUA 4YKPA 3N26A 3MVYA 4DZ1A 2QL3A 4TLMB 4U23A 4NXMM 1FQAA 3U72A 2O69A 1XXHB 3GO8A 3RT6B 4LF4M 2F34A 3O6HA 4YZZA 1ZJLA 2R45A 4OZ9A 1EH3A 5H8QA 3FJ7A 4R7GA 4YKIA 2R6GE 3TTMA 1A8FA 1QULA 2BJVA 2XX7A 5L8DA 4Z8XA 1MXXA 2V84A 1IY1A 1NMUA 3PMVA 4RJZA 1HT2E 3GPUA 4B7FA 4ZECA 2DVCA 3IX1A 1POY1 4BBAA 4EXKA 1NNPA 1IZ1A 4KYDA 3SEYA 1S3SA 1LLSA 1DGBA 3E9XA 1B3FA 5LOMA 3K6WA 4WXJA 2XZFA 4NXNM 3ZC7B 1VSOA 3M8UA 2EO2A 2QMXA 2I0CA 1N3XA 4DIGA 3L27A 2QJEA 1DO2A 3FGSA 2RF1A 5AA2A 1NNKA 3VDUA 3UIFA 5I2KA 4THIA 1WVJA 3FUUA 4AI6A 2UXCM 2OLBA 2Q88A 3MBPA 3U6SA 2VIIA 1NNUC 1W5TA 1BLFA 1D3KA 2KW0A 4JI5M 3FASA 1DGFA 2PX1A 3K0VA 1H6UA 3A98B 4FECA 4JXJA 3TL4X 4GIZA 1JR3D 1ORYB 3IOVA 2D7EA 3PPOA 4OFOA 5KDTA 1ANFA 2Z4RA 2H5YA 4N13A 4AQ4A 3MVWA 4W5WA 5IKBA 4NWDA 4R6YA 3KXEC 1XWIA 1TFAA 1MY0A 4R9GA 1QUJA 4FE8A 4RF0A 3Q8XA 3U6DA 1QAQA 3A3UA 4PDIA 4IO2A 4YAHX 4M9XA 3ZKLA 3TYHA 1L1ZA 1DMBA 3U5ZB 3O66A 1B05A 5TU0A 1PB8A 4FEBA 4QFKA 5FTIA 2DXRA 1B3HA 5ITYA 3IL1B 5DYHA 1X37A 2ESNA 4LJAA 3NBIA 1LAXA 4AW4A 3TPZA 2BNKA 4S12A 3W0LB 2O1MA 4DCYA 3QAXA 4MB7A 2C5RA 3EHTA 1DPEA 4LRSA 2EA0A 5EP1A 3I51A 3DLNA 5JEIA 1US5A 4GKJM 4RPNA 4MGZE 4OESA 3OD7A 1JR3A 1D4NA 5ITTA 3MVZA 4B7GA 3C35A 2YQZA 4KCCA 2ANJA 4C1UA 1Y1MA 3U6EA 1FTLA 3KJTA 5CMMA 5ITOA 4C0RA 1GVNA 1PM5A 2G8LA 2OK2A 3H6TA 4WEPA 4ELRA 3KEIA 4NTLA 2NQ8C 3BFUA 1IN6A 2RKMA 3QIMA 3FUTA 3HV1A 1MQIA 3TELA 3KP0E 3FTFA 3P7IA 3S9EA 3KSJA 4MFIA 1IY0A 3FXRA 3OO8A 4R3DA 4QFNA 3SEXA 1LFHA 4JYAM 4EUOA 3T1HM 2FNCA 4IBJA 3FYCA 3VKGA 3MJ5A 2CMOA 4IGRA 2G5GX 2F36A 3N6UA 4MBPA 4AKIA 3QWLA 1BKAA 3HHZA 4LCBA 4YHHM 1B5HA 1LAHE 3LC8A 1PC3A 2UYFA 3CFLA 2UYEA 4AKHA 3EPEA 5BPVA 2CV0A 3SDFA 3AFHA 5KCJA 1L5TA 3IJOB 4DV1M 3KOSA 3BFTA 4JI0M 3AXFA 4L16A 1M5FA 4F1VA 2I49A 5I84A 3HSTA 5CRYA 1Z5BA 2QCUA 1N78A 2HEUA 3T15A 2Z22A 1RKMA 3RTFB 1MM7A 4PCZA 4RNAA 1I6AA 3K2DA 3LVWA 3SESA 3AL0C 3S9MC 1NNFA 5I58A 3OSQA 2L6OA 1M5DA 4ECFA 5E6JA 1Z5AA 1A8EA 1B7ZA 2NUVA 5H8NB 3L2AA 3GRUA 3MK6A 2ZM6M 3V8XB 3VLVA 2XEPA 4R6KA 2R65A 2D5WA 4H5FA 3HJSA 1A55A 3HCQA 1L8QA 2VQFM 1A99A 3TEPA 3IO6A 5DVFA 2B3FA 3SYLA 1G41A 5CBRA 5EJCA 1FQFA 4IY6A 4GXSB 2E0SA 2RC9A 4ZE9A 3TWMA 1LB8A 2FYIA 1R2ZA 1A7LA 4IBDA 3FTDA 2DP8A 5I56B 2DOJA 3DP4A 4KQPA 2XXIA 1JEVA 3EIHA 4I8CA 1ELJA 4ZEKA 7CATA 5H8QB 5LMNM 3HJQA 4FWHA 3C9HA 3V5AA 3BBRA 3PUYE 1AIVA 2V25A 1QUIA 2Q2CA 4CHTB 3K6UA 3U6MA 1HQCA 4DV6M 1IXCA 3KSXA 3I3VA 4G68A 4LJ6A 5DEXB 1QVSA 4UA8A 5KPTA 4U21A 3EQ1A 2CZLA 2CHVA 2WKYA 4D82A 3LVVA 3UZUA 1TH3A 3HHWA 3TPAA 2DWMA 4O3BA 3KOYE 4MLVA 1Q1KA 1IN5A 1CE2A 4OQOA 1XC8A 4B3MM 2HAVA 1TFDA 1OLCA 4JWOA 2AYSA 2HQ0A 1L2DA 4P11A 1MRPA 3O6IA 3U5ZA 4YY3M 3KFUG 2DWHA 4X65M 4H6DA 4GXAA 5FHMA 2HCBA 5FTNA 4BLAA 4BDMA 5FTKA 2H98A 4MH5A 4LF9M 1IBMM 3SC3A 3TCGA 1SW1A 3GPPA 1PEBA 1IXRC 2KZSA 4N6PA 1Z59A 1Y20A 3IG5A 4M0WA 1URSA 5I58B 4YMBA 1DSNA 5LMUM 1RYOA 4GHAA 4X1BA 4L4UA 3O6GA 3ZCBB 3HPIA 2L7HA 1Q39A 4GMQA 4JV5M 3M3FA 5HBCA 4DCXA 4IJFA 3TCFA 5H8FA 2V93A 2XXWA 4JI7M 2OJTA 1Y4TA 5TPAB 3VVDA 5DVIA 1NNTA 1LBCA 4FCTA 4MGYE 1JW4A 1XHBA 5JTYB 3ILKA 3PPPA 1IIWA 5ICQA 2CV2A 4FORA 4AG6A 4FCWA 2D21A 4II7A 2LAOA 4LJ5A 3GBAA 3RFWA 4EF1A 1PBQA 4OFLA 2Q8JA 3S2VA 4K3FA 1QAMA 1IXZA 1MXYA 5I59A 2DSFA 1OQHA 3KZGA 2F7AA 2UXAA 2CHQA 2O7UA 1MDP1 1SW2A 2AL5A 4ELOA 2HKJA 4U1ZA 1QAOA 3IOTA 3KN8A 3TWKA 1N34M 2FFJA 2XXXA 3TUSA 4R73A 5L9MA 4I8OA 3U92A 5ITPA 2XSZD 2FE8A 1MQHA 2VD3A 1XC1A 1QKBA 3K1PA 2HHHM 1QJMA 4XBOA 2DE4A 3SBJA 4F3GA 2L7IA 4FCVA 1GVCA 4DDDA 4LJ9A 3LBSA 3EHSA 3Q25A 3VVEA 2F5NA 4PT5A 3I6VA 2QSXA 3KS4A 1QQWA 1N3WA 4QFOA 2P2AA 3THGA 4E0XA 1BTJA 3ZH9B 4C1TA 2YNMD 4QHSA 4KO8A 2I48A 1SXJE 4RF1A 2IA4A 3PPRA 3VLFB 2XXVA 2XX8A 4WW0A 1NH7A 1IM2A 3MP6A 1P1OA 2ONSA 4LZJA 1JW1A 1FQDA 4L78A 1QKAA 2AL4A 4LY6A 2I3WA 1TH2A 2RC8A 3Q28A 2V3TA 4X9TA 4F1YA 4IBCA 2F5PA 3TTNA 4Z0IA 3PXGA 5DVJA 5B70A 2G93A 4B3RM 3G3JA 3G7WA 4QFLA 3IO4A 5C18A 1HNZM 3PUWE 2RGOA 1NHWC 1IXGA 4OYVA 3K6VA 5EHSA 4GRKA 2Z8FA 4QOSA 4DV5M 1JETA 4G4PA 4NL4H 1LB9A 3PPQA 5EP4A 3AKZA 3IB0A 3KS8A 2UVIA 4H8JA 1SBPA 4F22A 3H4ZA 4F2QA 2DE3A 4IO5A 5FTLA 4PETA 1FQEA 1GV8A 3C58A 3TQLA 2KEBA 2G29A 3TQSA 4Z6YA 3V89B 3JR4A 3K02A 1MY1A 1O64A 2PT1A 1H76A 5ITRA 3MZ9A 2Q2AA 2YR0A 2THIA 4NF4B 1P99A 2R46A 4AQYM 1OJLA 2Q89A 3KN3A 3FVKA 1GTKA 1B5JA 2HXWA 1IN7A 5EHMA 1YUBA 5CMCA 3JR5A 3IR1A 3PGFA 4RNSA 1HSEA 5FSWA 3OXNA 4OVZB 3CSBA 3U6PA 3IG8A 3UGWA 1OIBA 4ZS9A 3J7BA 2RINA 5C1BA 4D80A 1MY4A 1OFHA 1P1WA 3EN3A 1B51A 3SHGB 1QYRA 4NF5A 1N84A 4G8MA 2O68A 5DEXA 4AG5A 2Z4SA 2Q2EB 3UORA 5AA2D 1XS5A 4KPTA 4LZ5A 4G68B 4I9DA 2X7QA 3K6XA 2A5TA 5HM4B 1N0TA 3N94A 1LCFA 1LFGA 5JTYA 1PBPA 3PUZE 4RYAA 3A42A 1G59A 8CATA 2OQ4A 1P1NA 4JI8M 5EXTA 4IBFA 1I69A 4I4LA 2YLNA 4FAJA 2B3BA 4NF5B 3HGIA 3FTEA 1Y3NA 1B52A 4JXIA 2K47A 5A2QS 1URDA 3CTWB 3L6HA 3WHKA 2C98A 1MH3A 3PV0E 1EZ9A 4KFQA 3GPXA 4ELPA 1BP5A 4LQ2A 3IAZA 2CUZA 1WXQA 1W5SA 5EQTA 2C96A 4QNMA 1OFIA 2UUBM 2QPQA 3GLFA 3T93B 1NJFA 2V1UA 1ZMGA 3QXMA 1E94E 4FWDA 3W9WA 4F2OA 3GLGB 4M9SA 2R71A 3J27B 1PB9A 2M8CA 3TFLA 4NRVA 4DLDA 4YICA 2CFOA 5HPQA 3FZVA 1QANA 2XXRA 2XSZA 1H3DA 2DWIA 5JI2E 5I56A 1AL3A 3S9NC 4FW9A 3B7DA 4EDPA 1IY2A 3VLWA 1SXJC 3CG1A 4G8HA 1E32A 2C99A 1F9BA 5AA4B 1P1UA 5CI5A 2EUCA 5KO3A 2DWJA 2HZLA 3SHFA 4DR1M 1FQCA 1XVXA 1B40A 1FJGM 2VOZA 2P1SA 4G2ZA 3HU1A 4BLCA 1LGBC 3I4VA 1HQYE 4JN6A 1TXFA 4LZ8A 4LRTA 1XHYA 3AV0A 1AMFA 3T9XB 1D9VA 1B2HA 3UP9A 1IXIA 3KG2A 1ZLQA 1YSYA 1MXUA 1JNFA 4R72A 1NVMA 4G4QA 4JI4M 3Q27A 2DWZB 2X4AA 2P5TA 1SQYA 2F4VM 3E13X 2QBYB 3TQWA 3U6LA 1DGHA 2IEEA 5EXXA 3K92A 2OPFA 4FD2A 1MXVA 4TQUQ 3LUYA 2V3QA 3W0FA 1MQJA 2KRKA 4M0DA 1MU5A 4HCYA 4LVQA 5ICTA 2QS4A 1T3TA 3F11A 4ZPXA 1KFVA 1XXHA 3AOEA 3R6UA 2X8AA 4DXCA 3B6TA 3O29A 3AJIB 3RNNA 1Z5CA 3GLHA 4LATA 3U60B 3DFZA 3FUZA 2W82A 2GRVA 1ZIUA 3RLFE 1KSFX 3VFDA 4PD2A 2RKOA 3SAVA 1G3IA 3VFJA 2C9CA 4GH9A 2ZXTA 5ITXE 4G4NA 3OSRA 3TTKA 4IO7A 2GHBA 2V1CA 4AB5A 3OEMA 1Z7ME 5EP2A 4IBEA 3UGJA 2Z8EA 2QP9X 1R7RA 2VHAA 4HTGA 5DT6A 3LQRA 4NF8A 1YTVA 4LJ7A 3DM0A 5L9OA 2A5TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7T A;  2AYS A;  4QRZ A;  2Y7K A;  2HQ0 A;  3SEU A;  4XKQ A;  1US4 A;  4P11 A;  3TAJ A;  3LSL A;  4JWY A;  4IO6 A;  2GFE A;  1B0H A;  4DXU A;  1N7W A;  4WKM A;  3EF7 A;  4ZEI A;  1MRP A;  3CVG A;  3O6I A;  1AOV A;  3C4M A;  2DWH A;  4OET A;  1FW0 A;  3FXU A;  4GXA A;  4H6D A;  4IB2 A;  5FHM A;  5FHN A;  3ZSF A;  2RCA A;  5I59 B;  4BLA A;  2OCU A;  2XHD A;  2RCB A;  3K1M A;  4BDM A;  5FTH A;  2UVH A;  4G8N A;  4KCD A;  2H98 A;  4MH5 A;  3RTW B;  4KD5 A;  3TKD A;  1IEJ A;  1VR5 A;  4OFJ A;  3TCG A;  1SW1 A;  5K2Y A;  1P1Q A;  3N6T A;  4R74 A;  1JVX A;  4LA9 A;  3R7X A;  2F8D A;  1A40 A;  1MXW A;  1PEB A;  1LST A;  1UIV A;  4H5G A;  4N6P A;  1UTH B;  1MDQ A;  1Y20 A;  2A5S A;  1URS A;  2QMW A;  3ECR A;  3IB1 A;  2ONK E;  4H8I A;  3CFX A;  1DSN A;  3HN0 A;  1AH5 A;  2XXU A;  4O3C A;  1JW5 A;  4JSD A;  1OLA A;  4YMB A;  5BWJ A;  1SD3 A;  1QUK A;  1RYO A;  1LFI A;  1B4Z A;  4X1B A;  1NFT A;  4Q5T A;  1R9Q A;  3RPW A;  3O6G A;  1UTH A;  1JEU A;  2KLF A;  1OVB A;  3HPI A;  4QHQ A;  4X48 A;  2F7B A;  1MPD A;  3H06 B;  3VV5 A;  2ZYN A;  4NE4 A;  4PFW A;  2VD2 A;  2O7I A;  1RYX A;  4NWC A;  3M3F A;  2DXY A;  1S50 A;  5HBC A;  4DCX A;  2QS3 A;  5CM6 A;  1MH4 A;  3OMB A;  2O6A A;  4GFR A;  4YB7 A;  3TCF A;  3SEW A;  1GGG A;  3VXC A;  1LCT A;  4BDO A;  4FAT A;  1UQW A;  5H8F A;  3T9V A;  1CB6 A;  2V93 A;  2XXW A;  3O97 A;  4IO4 A;  1LAG E;  1B6H A;  2OJT A;  2XXH A;  3N5L A;  4IO3 A;  4QFP A;  3ZKK A;  1FTK A;  1Y4T A;  1B1X A;  3C34 A;  2I3V A;  3MZB A;  4ZEB A;  5TPA B;  3VVD A;  4F39 A;  4Q8R A;  5DVI A;  4YMA A;  1NNT A;  2B65 A;  3PUV E;  2BJJ X;  1NKX A;  1LBC A;  3TTL A;  3PMW A;  4JB7 A;  3V83 A;  1JW4 A;  3IB2 A;  5JTY B;  4MLQ A;  3PPP A;  1IIW A;  3CRB A;  2ZMB A;  3H6W A;  5ICQ A;  1R9L A;  3TZA A;  1XT8 A;  1IQ7 A;  4FOR A;  2F78 A;  4GD5 A;  1YPN A;  3C31 A;  3QUF A;  4X1D A;  2D21 A;  5F7V A;  2Y7W A;  1LAF E;  4H1X A;  3MPL A;  5I57 B;  2LAO A;  3H7M A;  5TP9 B;  5AA3 A;  2O1L A;  1B9J A;  2HCA A;  2QS1 A;  3GBA A;  3H03 A;  1MPC A;  1PBQ A;  2OWT A;  4IGT A;  4JSO A;  4OFL A;  3THI A;  2X7P A;  4EF1 A;  5M2V A;  5DTB A;  3I5O A;  2GHA A;  3WAE A;  3ILU B;  3R26 A;  2Q8J A;  4R6H A;  3S2V A;  4K3F A;  4OMB A;  2Z8D A;  1PDA A;  2UVJ A;  4U2R A;  1MXY A;  3B6W A;  4YU0 A;  5B7D A;  5L9S A;  3MVX A;  3VE1 B;  1ZBM A;  2NXO A;  5I59 A;  2DSF A;  4KHZ E;  1OQH A;  3MAM A;  4YKJ A;  3KZG A;  2PVU A;  1SYI A;  4ONY A;  2F7A A;  4XXU A;  2UXA A;  2VP1 A;  5CMB A;  4YKP A;  2Y7I A;  4E0X A;  2O7U A;  1MDP 1;  4POX A;  1SW2 A;  2XXY A;  4RXL A;  3N26 A;  4XKR A;  1OLC A;  2AL5 A;  3MVY A;  2I6E A;  4DZ1 A;  3FJM A;  4ELO A;  4U1Z A;  3IOT A;  3G3K A;  3FD3 A;  3KN8 A;  2QL3 A;  4TLM B;  4U23 A;  5JK4 A;  1FQA A;  3U72 A;  2ZNS A;  2O69 A;  2REJ A;  5I2K B;  1B3E A;  2F7C A;  1NL5 A;  2XXX A;  3RT6 B;  5J1D A;  2DYX A;  3TMG A;  4RPO A;  2NOO A;  4G77 A;  2F34 A;  3O6H A;  3TUS A;  4R73 A;  4U1O A;  4YZZ A;  1ZJL A;  2ZNT A;  4OZ9 A;  1EH3 A;  5H8Q A;  5H8S A;  5L9M A;  3FJ7 A;  3B6Q A;  3U92 A;  5ITP A;  1N7X A;  3U8Q A;  4YKI A;  3ODB A;  3U1O A;  2R6G E;  3TTM A;  1A8F A;  3QSL A;  1QUL A;  5I2N B;  1EU8 A;  2VD3 A;  1MQH A;  1SDX A;  1BIY A;  1XC1 A;  2XX7 A;  2Y7R A;  1QKB A;  4WED A;  5L8D A;  3K1P A;  3SKP A;  2QRY A;  1QJM A;  1MXX A;  2V84 A;  4TLL B;  1JVY A;  2DE4 A;  4F3G A;  3USD A;  1DTZ A;  1NMU A;  3PMV A;  4RJZ A;  1GVC A;  2ABH A;  4DDD A;  1TWY A;  3CSG A;  2ZYO A;  2DVC A;  3IX1 A;  3LBS A;  1POY 1;  3EHS A;  3Q25 A;  3VVE A;  4EXK A;  4ZEC A;  3I6V A;  4XTC Q;  3JYR A;  1NNP A;  1IZ1 A;  2F6P A;  2QSX A;  4KYD A;  4P0G A;  3SEY A;  1N3W A;  4QFO A;  2P2A A;  1LLS A;  3E9X A;  4U4S A;  1B3F A;  1BTJ A;  1ZU0 A;  4PE5 B;  2F6G A;  4C1T A;  4NF6 B;  5LOM A;  3K6W A;  4ZE8 A;  2I48 A;  4WXJ A;  4GL0 A;  4U4X A;  2FA7 A;  3OO6 A;  5CBS A;  2IA4 A;  3PPR A;  1SW4 A;  1MQG A;  3W15 C;  3WAF A;  4F1U A;  3G3H A;  1VSO A;  3OEK A;  4NMY A;  4QSE A;  2XXV A;  2XX8 A;  4KR5 A;  1NH7 A;  1POT A;  3M8U A;  1Y3Q A;  1B3L A;  3MP6 A;  2QMX A;  3HHF A;  1P1O A;  5A5X A;  2ONS A;  1JW1 A;  2I0C A;  1N3X A;  3FVO A;  1FQD A;  4DIG A;  4F18 A;  4OXV A;  1MY3 A;  2AIX A;  1QKA A;  2AL4 A;  3O28 A;  3IOU A;  3PUX E;  4KYS A;  3CR9 A;  1MM6 A;  2I3W A;  1WDN A;  2QJE A;  2X26 A;  2XXT A;  3FGS A;  3FXQ A;  2RF1 A;  4FIM A;  3T22 A;  5AA2 A;  1NNK A;  3RUM A;  2RC8 A;  4LON B;  4BDN A;  3Q28 A;  3O2A A;  4R9F A;  3KFM A;  4R2B A;  2V3T A;  3UIF A;  5I2K A;  4X9T A;  4F1Y A;  1SI0 A;  4GL8 A;  4F29 A;  4THI A;  1UTB A;  1WVJ A;  2Q9T A;  3TTN A;  4Z0I A;  5DVJ A;  2H9B A;  3SET A;  5B70 A;  2G93 A;  2OLB A;  1FTM A;  3G3J A;  3G7W A;  4QFL A;  4JBZ A;  1MQD A;  2Q88 A;  3IO4 A;  3MBP A;  3PUW E;  2DWA A;  4L17 A;  1BLF A;  1IXH A;  2Y84 A;  3TOD A;  1IXG A;  1D3K A;  4OYV A;  4ESX A;  3KJ7 A;  3FAS A;  3K0V A;  2PX1 A;  5F1Q A;  3HO7 A;  4FEC A;  4GIZ A;  2E1S A;  3ONM A;  3K6V A;  5EHS A;  4P0I A;  4GRK A;  1FQB A;  3IOV A;  2Z8F A;  3HHG A;  3PPO A;  4OFO A;  5KDT A;  1JET A;  3TDJ A;  3FJG A;  3T9U A;  1UIU A;  4OEV A;  1ANF A;  4G4P A;  1LB9 A;  3FAT A;  2H5Y A;  4N13 A;  1FTJ A;  3MP1 A;  3PPQ A;  4AQ4 A;  3GZG A;  3MVW A;  2QS2 A;  5TP9 A;  4BDL A;  3IB0 A;  5IKB A;  2UVI A;  4H8J A;  3CG3 A;  4NWD A;  1SBP A;  3MWB A;  1R1N A;  3H4Z A;  4QSD A;  4R6Y A;  4TOZ A;  4F22 A;  4F2Q A;  4RA1 A;  1TFA A;  1MY0 A;  2DE3 A;  4IO5 A;  4R9G A;  1KWH A;  4AB6 A;  1QUJ A;  3K00 A;  4FE8 A;  3QK6 A;  2Y7P A;  2NVU B;  2ALU A;  1UTB B;  1M5E A;  1FCK A;  4KI0 E;  4JDF A;  4PET A;  3A3U A;  4IO2 A;  1FQE A;  3OO7 A;  4YAH X;  1LBB A;  1B32 A;  3ZKL A;  1L5T A;  1OVT A;  1GV8 A;  3TQL A;  3TYH A;  4HW8 A;  3K1N A;  2G29 A;  5AA2 B;  1DMB A;  2PBW A;  4F3P A;  3O66 A;  5I2N A;  2YJP A;  1B05 A;  3DP8 A;  5TU0 A;  3V89 B;  1PB8 A;  4FEB A;  4QFK A;  3K02 A;  1SVX B;  2ONR A;  5FTI A;  3LSF B;  1MY1 A;  1O64 A;  2DXR A;  2PT1 A;  3IOR A;  1B3H A;  1H76 A;  3PD8 A;  2NWJ A;  3T66 A;  1D9Y A;  3IL1 B;  1O63 A;  5DYH A;  3MZ9 A;  4PFU A;  3VVF A;  3GBB A;  1B7U A;  2Q2A A;  2UVG A;  2THI A;  3DP6 A;  1FTO A;  4NF4 B;  2ESN A;  4I62 A;  1P99 A;  1VFD A;  2Q89 A;  3KN3 A;  4QF9 A;  3FVK A;  4LZ7 A;  3C33 A;  1LAX A;  4OEN A;  1GTK A;  1MPB A;  3T96 B;  1B5J A;  2F97 A;  2HXW A;  5EHM A;  3MC2 A;  5CMC A;  2O1M A;  4OTE A;  4DCY A;  3QAX A;  3IR1 A;  1M5C A;  3EHT A;  3PGF A;  1DPE A;  4RNS A;  1HSE A;  1DTG A;  1Y1Z A;  3OXN A;  4ZZA A;  3CSB A;  2P0S A;  4LQ5 A;  1OQG A;  3DLN A;  2O84 X;  3UGW A;  1YAE A;  5JEI A;  1OIB A;  1US5 A;  3FVN A;  1WOD A;  4RPN A;  4ZS9 A;  5CMK A;  2RIN A;  2I58 A;  4NED A;  4XKN A;  4OES A;  5BUU A;  3OD7 A;  4R2F A;  2OZZ A;  4ND9 A;  3G3F A;  2HZK A;  1MY4 A;  4OHN A;  1VE4 A;  4ZED A;  1P1W A;  1D4N A;  3EN3 A;  1B51 A;  2GH9 A;  1Q35 A;  2I4B A;  4GWO A;  3MVZ A;  3MPK A;  3C35 A;  4NF5 A;  1N84 A;  3UA8 A;  4KCC A;  4G8M A;  2ANJ A;  4FED A;  4C1U A;  1B46 A;  4PP0 A;  1Y1M A;  2O68 A;  4ISU A;  4JWO A;  4M4G A;  1FTL A;  4OWD A;  5DEX A;  1USY H;  1XS5 A;  3KJT A;  5CMM A;  3UOR A;  2V3U A;  4KPT A;  4KYE A;  4LZ5 A;  5ITO A;  4G68 B;  4C0R A;  4I9D A;  3H6U A;  3D4C A;  1H43 A;  1MS7 A;  2X7Q A;  3K6X A;  2REG A;  2A5T A;  3PD9 A;  5HM4 B;  1N0T A;  3N94 A;  3G3G A;  1LCF A;  1LFG A;  2I4C A;  5JTY A;  3JV9 A;  3E4R A;  2OK2 A;  3H6T A;  1PBP A;  4NF4 A;  4N07 A;  4WEP A;  4NF8 B;  3PUZ E;  4RYA A;  4ELR A;  1HSJ A;  3KEI A;  4JWX A;  4ZDM A;  1P1N A;  1B7H A;  1JQF A;  3BFU A;  4NTL A;  2Z23 A;  1SI1 A;  2RKM A;  3CI8 A;  5TPA A;  1B1H A;  3QIM A;  1URG A;  3H6V A;  3HV1 A;  4ELQ A;  4BDQ A;  1MQI A;  1I69 A;  3TEL A;  2YLN A;  4BDR A;  3UN6 A;  4FAJ A;  3C32 A;  3G3I A;  1ZKB A;  2B3B A;  2XD3 A;  3P7I A;  3S9E A;  3UK4 A;  3ILT B;  4NF5 B;  4E0W A;  1Y3N A;  1B52 A;  4JXI A;  4ZZE A;  4EXL A;  3KSJ A;  4MFI A;  3QYT A;  4QFN A;  1URD A;  3FXR A;  3OO8 A;  3SEX A;  3L6H A;  1LFH A;  1MH3 A;  2OWS A;  1I6Q A;  1Y9U A;  2YPN A;  3LR1 A;  1B58 A;  1EZ9 A;  3PV0 E;  4H65 A;  1BP5 A;  4KFQ A;  4ELP A;  4LQ2 A;  3IAZ A;  3GLB A;  1YCJ A;  3CIJ A;  3ZS6 A;  2F5X A;  3K01 A;  4EF2 A;  4EUO A;  4IY5 A;  2FNC A;  4GF8 A;  1XOC A;  2QPQ A;  4PQJ A;  3MJN A;  4R75 A;  4I1D A;  3Q26 A;  2XX9 A;  3T93 B;  3VLU A;  2CMO A;  4IGR A;  1ZMG A;  2F36 A;  3QXM A;  4PFY A;  3MZ1 A;  3N6U A;  3PU5 A;  4MBP A;  4ZEF A;  1BKA A;  5EYF A;  1B5H A;  1LAH E;  3W9W A;  3LC8 A;  4F2O A;  1MG1 A;  3JZJ A;  5ISU A;  1H44 A;  1PC3 A;  2UYF A;  2I0B A;  3GXA A;  3CFL A;  3IJX B;  2UYE A;  3O9P A;  3TCH A;  3EPE A;  4F3B A;  2R71 A;  1PB9 A;  5H8N A;  2M8C A;  1B0L A;  1N04 A;  5K2X A;  3SDF A;  3TFL A;  4DLD A;  2ZYK A;  5KCJ A;  4XKP A;  4YIC A;  1IUD A;  5HPQ A;  1B4H A;  4EQB A;  1QW0 A;  3A3C A;  3H3G A;  4M1V A;  2W7Y A;  1II5 A;  2PMS A;  2XXR A;  1ZTY A;  3FZV A;  1B5I A;  3BFT A;  3IJO B;  3KOS A;  5H8F B;  1S9T A;  1H3D A;  3AXF A;  1XVY A;  2DWI A;  1MY2 A;  2DS9 A;  1M5F A;  4F1V A;  1AL3 A;  5I56 A;  3A09 A;  2I49 A;  5I84 A;  2HAU A;  3HST A;  5CRY A;  4DE8 A;  3RGY A;  2H4I A;  3S9N C;  3SEV A;  3B7D A;  3OEL A;  4EDP A;  3U93 A;  2HEU A;  3CG1 A;  2Z22 A;  4G8H A;  3VLW A;  5AA4 B;  1F9B A;  1Z7N E;  3KGC A;  1P1U A;  4F3S A;  1RKM A;  4H67 A;  3RTF B;  3MW0 A;  1MM7 A;  5CI5 A;  1I6A A;  3DEL B;  2DWJ A;  3K2D A;  3SES A;  1A54 A;  2HZL A;  3Q29 A;  3S9M C;  4EQ9 A;  4F19 A;  3VXB A;  1NNF A;  3MUQ A;  1FQC A;  1XVX A;  1J1N A;  1VFE A;  3OSQ A;  4ESW A;  1M5D A;  5I58 A;  5IAI A;  1B40 A;  3FV2 A;  2VOZ A;  3L6G A;  4ECF A;  2P1S A;  4G2Z A;  1A8E A;  5AA2 D;  1B7Z A;  5ELV A;  3RQT A;  1LGB C;  3S9L C;  2NUV A;  1ATG A;  5H8N B;  4GOT A;  3PPN A;  1T0K A;  1M5B A;  1OMP A;  5KDT B;  1I6B A;  5H8H A;  1DPP A;  1TXF A;  3EHU A;  3V8X B;  1IIT A;  4LZ8 A;  4R6K A;  3MQ9 A;  3VLV A;  1XHY A;  2D5W A;  4H5F A;  4LUB A;  4AB5 A;  1A55 A;  3HCQ A;  4XIG Q;  3OO9 A;  4NF6 A;  1AMF A;  3T9X B;  1A99 A;  4GLI A;  3TEP A;  1D9V A;  5AA1 A;  1B2H A;  3IO6 A;  3UP9 A;  3KBR A;  5DVF A;  1IXI A;  2B3F A;  3KG2 A;  4YB5 A;  1ZLQ A;  1MXU A;  5CBR A;  2O51 A;  1JNF A;  4R72 A;  4EQ7 A;  1SYH A;  3BKI B;  2ZNU A;  4OVJ A;  3U94 A;  1FQF A;  4IY6 A;  3Q27 A;  4GXS B;  3FIR A;  5AA4 A;  2E0S A;  3TTR A;  3MP8 A;  3IK6 B;  2RC9 A;  4Z7E A;  1SQY A;  3E13 X;  3W9V A;  4ZE9 A;  1LB8 A;  2FYI A;  2H99 A;  3TQW A;  1A7L A;  2DQV A;  2RC7 A;  2DP8 A;  2IEE A;  3E3K A;  2DOJ A;  2XXP A;  3DP4 A;  3RT8 A;  5I56 B;  4KQP A;  3QUJ A;  2DE2 A;  2R9J A;  2XXI A;  1MXV A;  2DVZ A;  3FV1 A;  4TQU Q;  1JEV A;  4YB6 A;  3LUY A;  5FHO A;  1PB7 A;  1R6Z A;  2V3Q A;  4I8C A;  1ELJ A;  5A5X B;  4ZEK A;  3OOA A;  1MQJ A;  1EZO A;  5I58 B;  5KCJ B;  3K4U A;  5H8Q B;  1N76 A;  4HCY A;  4LVQ A;  4RK9 A;  3C9H A;  1DOT A;  3LSX A;  3V5A A;  3BBR A;  5ICT A;  2QS4 A;  3PUY E;  3D4G A;  1HSL A;  4PFT A;  1AIV A;  1EZP A;  1SW5 A;  3F11 A;  2V25 A;  3KN7 A;  1QUI A;  2Q2C A;  4RY1 A;  4OEU A;  3K6U A;  3R6U A;  3CFZ A;  3OEN A;  1IXC A;  2XXQ A;  4Q30 B;  3B6T A;  4DXC A;  3RN8 A;  3KSX A;  4LP2 B;  3I3V A;  3O29 A;  3SER A;  4G68 A;  3RNN A;  1USY E;  5KZT A;  2F35 A;  1QVS A;  1TT1 A;  4LAT A;  5DEX B;  3FUZ A;  2GRV A;  4UA8 A;  4U21 A;  3EQ1 A;  1ZIU A;  1H45 A;  3RLF E;  2CZL A;  4GQO A;  2WKY A;  4FJP A;  2PT2 A;  5CC2 A;  3FVG A;  3VFJ A;  2HFB A;  5AE4 A;  1B3G A;  3LSW A;  3PMX A;  5H8H B;  3TPA A;  3T9H B;  4H0W A;  2OBG A;  2ZXT A;  2XD2 A;  1GR2 A;  4UAC A;  4O3B A;  4OER A;  4HCW A;  3OSR A;  2PYY A;  3IOW A;  4G68 C;  4IO7 A;  3TTK A;  3VDF A;  2GHB A;  1Y3P A;  4MLV A;  5I57 A;  3C36 A;  2VGQ A;  1NH8 A;  4HS7 A;  4MF3 A;  4Q0C A;  3OEM A;  1Q1K A;  4RK2 A;  4YKK A;  1Z7M E;  1S7Y A;  2Z8E A;  1CE2 A;  3RY3 A;  4POW A;  4U22 A;  3M3L A;  4O3A A;  4GVO A;  4OQO A;  3KOT A;  2VHA A;  4HTG A;  5DT6 A;  4DXB A;  4QSC A;  2HAV A;  2ZYM A;  4NF8 A;  1YTV A;  1Y4C A;  1MXZ A;  1TFD A;  3M3K A;  3DM0 A;  3S4U A;  5L9O A;  2H25 A;  2A5T B;  2D3I A;  4F31 B; 
#chains in the Genus database with same CATH topology
 1IQP A;  3JAM S;  1US4 A;  4JWY A;  1B0H A;  5DW8 A;  3LUZ A;  3EF7 A;  3SAU A;  3CVG A;  4GWS A;  1Q3C A;  2DHR A;  4KCD A;  4KD5 A;  1IEJ A;  5K2Y A;  5LDZ A;  3SEV A;  4LA9 A;  3HHY A;  2F8D A;  1UIV A;  1MXW A;  3CF2 A;  3GRY A;  5IM2 A;  1MDQ A;  3IB1 A;  3ECR A;  5KZT A;  4B3S M;  1AH5 A;  1JW5 A;  4JSD A;  1UFZ A;  4Q5T A;  2HXR A;  1UTH A;  3LMM A;  4D81 A;  1MPD A;  4KHP M;  3U6O A;  1OAO C;  2ZYN A;  4IIW A;  1RYX A;  4NWC A;  1NSF A;  1S50 A;  4PDD A;  2O6A A;  3FRH A;  1LCT A;  2WYP A;  1UQW A;  3T9V A;  1CB6 A;  3C34 A;  1B1X A;  3MZB A;  1CUK A;  1R5L A;  5ITU A;  2B65 A;  2BJJ X;  1GJT A;  5ET8 A;  1ZMU A;  2KXE A;  3GPY A;  2ZAM A;  3CRB A;  1FPD A;  1ZAE A;  1XT8 A;  3TZA A;  4LJ8 A;  1IQ7 A;  2F78 A;  3C31 A;  5F7V A;  2UU9 M;  1XNR M;  3DZD A;  3H7M A;  5TP9 B;  3A45 A;  3OTO M;  2HCA A;  3H03 A;  1PJI A;  4IGT A;  4JSO A;  2X7P A;  2GHA A;  3ILU B;  1RDX A;  5B7D A;  3SAS A;  2NXO A;  2KR0 A;  4KHZ E;  3GQ3 A;  4AS5 A;  5F3W A;  1IXS A;  1KYI A;  1SYI A;  5CMB A;  2Y7I A;  4PGP A;  3SFZ A;  4FVM A;  3FJM A;  3FD3 A;  2UUC M;  1J5E M;  4MNP A;  1IBK M;  2F5S A;  1B3E A;  1NL5 A;  2DEN A;  5J1D A;  2DYX A;  4PCD A;  3NBX X;  4RPO A;  3FXB A;  4G77 A;  3A29 A;  5H37 D;  4JI2 M;  4U1O A;  5H8S A;  1YXI A;  1N7X A;  5IRE B;  4OVS A;  3QSL A;  5I2N B;  2UXB M;  2Y7R A;  4WED A;  3SKP A;  3J7A S;  4TLL B;  3FD9 A;  4I40 A;  1FTA A;  4LFB M;  3CSG A;  4JI1 M;  1FPB A;  4XTC Q;  4IBK A;  3JYR A;  2I7P A;  4U4S A;  2R44 A;  1G4A E;  1KZ8 A;  4U4X A;  2FA7 A;  3OO6 A;  2LH0 A;  2R4J A;  3L29 A;  3LCV B;  3A46 A;  5CBS A;  2F5O A;  3WAF A;  4F1U A;  4QSE A;  3UJN A;  4NMY A;  1NUZ A;  4KR5 A;  3GLF E;  1POT A;  5LTC A;  1Y3Q A;  1B3L A;  3HHF A;  2AHM A;  3FVO A;  3L26 A;  1MY3 A;  2AIX A;  3O28 A;  1IBL M;  2J5Y A;  1MM6 A;  3T22 A;  5EXS A;  2XXT A;  3FXQ A;  1N33 M;  4LON B;  1VDD A;  3O2A A;  4R9F A;  4R2B A;  2L4F A;  1SI0 A;  4GL8 A;  4F29 A;  1FPF A;  2H9B A;  3SET A;  4B3T M;  1WIV A;  1K3W A;  4JBZ A;  4PFI A;  1MQD A;  2DWA A;  1OKS A;  2Z8Y M;  3E9S A;  1C7Y A;  5F1Q A;  3HO7 A;  2JA2 A;  3T1Y M;  4CGY B;  1G0H A;  3TWL A;  1UIU A;  4OEV A;  4TUW A;  2D7H A;  1Q3B A;  3M6A A;  3GZG A;  5TP9 A;  4BDL A;  3KC1 A;  3MWB A;  4RA1 A;  3KW6 A;  1FJ6 A;  1KWH A;  3NOH A;  2NVU B;  2Y7P A;  2P3N A;  2XF3 A;  1L1T A;  1P3Q Q;  1BK4 A;  1M5E A;  4LFC M;  4X04 A;  2DWL A;  1B32 A;  5AA2 B;  3K1J A;  1IN8 A;  3K1N A;  1VEK A;  4F3P A;  3C3E A;  2YJP A;  4GKK M;  5FTM A;  3DP8 A;  4XF5 A;  2M60 A;  1SVX B;  2XWV A;  3LSF B;  2KNV A;  3IOR A;  1D9Y A;  2F3B A;  2DZN B;  4PFU A;  3GBB A;  1PJS A;  3IFC A;  4OW0 A;  3GQ5 A;  2FH0 A;  1FTO A;  1IMD A;  4I62 A;  4X66 M;  4OEN A;  3C33 A;  4GWW A;  2Y0T A;  4G3O A;  3HWS A;  1L2B A;  2CEY A;  3E21 A;  1VEJ A;  3MC2 A;  3H4J A;  4OTE A;  2DXI A;  2LHG A;  2FS1 A;  1HNW M;  5ESY A;  2MH8 A;  3U6C A;  4O7I A;  4XKN A;  4NED A;  1HR0 M;  2I7N A;  3G3F A;  2HZK A;  3GLI A;  4OHN A;  1VE4 A;  4ZED A;  3T6P A;  1L2C A;  3AOE C;  2I4B A;  2O25 A;  3U61 A;  4DR7 M;  1Q35 A;  3MPK A;  3UA8 A;  2UXD M;  5GKN A;  1B46 A;  3FUW A;  3GLH B;  4ISU A;  5FTH A;  4KYE A;  4LF6 M;  3H6U A;  5KQD A;  3D4C A;  5ITX A;  2REG A;  1AWB A;  2L5V A;  4I81 A;  2QEN A;  3JV9 A;  3E4R A;  4NF4 A;  4ZDM A;  1AIP C;  1B7H A;  1JQF A;  2Y5K A;  2Z23 A;  1SI1 A;  5TPA A;  1B1H A;  5EP3 A;  3H6V A;  4BDQ A;  1NY5 A;  2VPO A;  1ZMW A;  2Z7J A;  4BDR A;  3UN6 A;  3C32 A;  3G3I A;  4DR5 M;  2KRU A;  3ILT B;  4EXL A;  4MNI A;  2O5R A;  4QOZ C;  2OWS A;  1Y9U A;  1QGX A;  3LR1 A;  4H65 A;  1B58 A;  4GX4 A;  1I94 M;  3TE6 A;  3CIJ A;  2F5X A;  2ZZW A;  2DZO B;  4XFE A;  4R75 A;  3VLU A;  2XX9 A;  4PFY A;  3MZ1 A;  3HU2 A;  1TDH A;  1WHC A;  2UUA M;  2OWZ A;  3JZJ A;  5ISU A;  1H44 A;  2I0B A;  4AZF A;  2MKZ A;  3TCH A;  4F3B A;  1LBW A;  1B0L A;  5ITQ A;  2XZU A;  4XKP A;  2LWX A;  1IUD A;  1QW0 A;  3A3C A;  4M1V A;  3RN8 A;  1DO0 A;  1ZTY A;  3FUX A;  1B5I A;  5H8F B;  1DGH B;  3A09 A;  5EQ7 A;  4DE8 A;  2CRU A;  4H46 A;  4MX6 A;  2QZ4 A;  2H4I A;  1ZQ9 A;  4EIW A;  4CIS A;  3U93 A;  4I3E A;  1N77 A;  1LTM A;  4B7H A;  4G4R A;  4NHB A;  1OIP A;  3M0E A;  3DEL B;  4MNC A;  1A54 A;  1LBZ A;  4EQ9 A;  4HL4 A;  3VXB A;  1J1N A;  1OTR A;  4ESW A;  1IFY A;  3GRV A;  3FKE A;  3L6G A;  1EE8 A;  2DHY A;  2QQ8 A;  4LF7 M;  1FRP A;  3S9L C;  4NX1 A;  1ATG A;  1M5B A;  1OMP A;  5KDT B;  1I6B A;  1DPP A;  3GLG A;  4DV7 M;  3EHU A;  2QFL A;  2JY7 A;  3MQ9 A;  2XXK A;  4LUB A;  4BB9 A;  4GIT A;  2WSE F;  5AA1 A;  3KBR A;  2D7G A;  2MJ5 B;  4CJ6 A;  1J09 A;  1EYJ A;  2O51 A;  3BKI B;  4OVJ A;  4DR6 M;  3NWL A;  3FIR A;  4GRI A;  2P3V A;  3MP8 A;  4Z7E A;  1MX0 A;  4WP2 A;  1FSA A;  2H99 A;  5IZ7 D;  3E3K A;  1EIJ A;  3B8B A;  3UK6 A;  4MH0 E;  3MST A;  2DNA A;  4YB6 A;  4PF6 A;  5FHO A;  4AKG A;  1NI9 A;  1PB7 A;  1R6Z A;  5A5X B;  4MCO A;  3OOA A;  1EZO A;  5KCJ B;  3K4U A;  3LSX A;  1DV0 A;  4NOO B;  4PFT A;  1HSL A;  4JI3 M;  5A5L A;  1EZP A;  1SW5 A;  4RY1 A;  4OEU A;  3R8F A;  3KC0 A;  3OEN A;  2XXQ A;  3B9P A;  4LP2 B;  2VF8 A;  1Z6T A;  3GLF B;  3FE3 A;  1NV3 A;  1TT1 A;  2L09 A;  1RU3 A;  1H45 A;  3KVW A;  3IHP A;  4LFA M;  1KA0 A;  3U6Q A;  2PT2 A;  4IBI A;  2Q74 A;  3FVG A;  3SMS A;  2HFB A;  3LSW A;  5DFL A;  4MEV A;  3T9H B;  3CF0 A;  4H0W A;  2XD2 A;  4KLN A;  4KT0 F;  4HCW A;  3VDF A;  2PYY A;  3IOW A;  3DOA A;  3C36 A;  2VGQ A;  1NH8 A;  4HS7 A;  5DYI A;  2XWI A;  5K2X A;  3RY3 A;  4POW A;  2CWB A;  4U22 A;  1G71 A;  3M3L A;  1GKI A;  4MGH A;  1JQJ C;  1NHG C;  2EKF A;  2E5L M;  2FBP A;  3S4U A;  3VDP A;  5JI3 E;  1O7T A;  1QUS A;  4QRZ A;  4G61 A;  3J80 S;  1N36 M;  1N75 A;  3TAJ A;  4N8G A;  2GFE A;  4DXU A;  4WKM A;  3T0J A;  1V92 A;  4LGM A;  4ZEI A;  2XFT A;  4OVQ A;  4GC9 A;  3FXU A;  4MMP A;  3GLI B;  3HFU A;  5FHN A;  2OCU A;  2XHD A;  3K1M A;  2JZ1 A;  2UVH A;  4G8N A;  3RTW B;  3TKD A;  1GL7 A;  4JVC A;  1P1Q A;  1JVX A;  3R7X A;  1A40 A;  3L28 A;  2R62 A;  4H8I A;  3VK8 A;  3CFX A;  3HN0 A;  2XXU A;  1NNJ A;  3T1B A;  1OLA A;  5BWJ A;  5FTJ A;  1NUY A;  1LFI A;  1B4Z A;  3RPW A;  3AOG A;  1OVB A;  2F7B A;  3H06 B;  4REZ A;  5IGA A;  4PFW A;  2VD2 A;  2O7I A;  4LG2 A;  3K9P A;  4MM3 B;  2VQE M;  1LV7 A;  2DXY A;  5CM6 A;  4GFR A;  2R4E A;  4PE3 A;  4YB7 A;  3SEW A;  1GGG A;  1E9R A;  4GIP A;  3O97 A;  4IO3 A;  1LAG E;  1B6H A;  1SXJ A;  3N5L A;  4QFP A;  3ZKK A;  1FTK A;  2I3V A;  4ZEB A;  4YMA A;  1NKX A;  3FYD A;  3PMW A;  4JB7 A;  3IB2 A;  3KOW E;  1D2N A;  4MLQ A;  3KP1 E;  1R9L A;  4GD5 A;  2Y7W A;  1LAF E;  2R6F A;  3MPL A;  4H1X A;  2X49 A;  5AA3 A;  2O1L A;  4PBH A;  2QS1 A;  3THI A;  5DTB A;  3R9X B;  2CEA A;  3R26 A;  3RE8 A;  4OMB A;  4FWG A;  2UVJ A;  4U2R A;  4DR2 M;  3HU3 A;  2ZBK B;  3MVX A;  3VE1 B;  3MAM A;  4ONY A;  4XXU A;  1GLN A;  5KQ8 A;  1HNX M;  1FPE A;  2VP1 A;  5KPZ A;  4POX A;  4DV2 M;  2XXY A;  4RXL A;  4XKR A;  2I6E A;  1YZ0 A;  3CGW A;  3G3K A;  2BJI A;  2JY5 A;  5JK4 A;  2ZNS A;  2REJ A;  5I2K B;  2F7C A;  2DAK A;  1XMQ M;  3TMG A;  2NOO A;  2RGH A;  2ZNT A;  2GQF A;  3GP1 A;  4O7M A;  3B6Q A;  2ZZV A;  3HKP A;  3U8Q A;  4PTK A;  4QHT A;  3ODB A;  3U1O A;  3FRI A;  1EU8 A;  1SDX A;  1BIY A;  4GHL A;  2QRY A;  1JVY A;  3USD A;  1DTZ A;  2ABH A;  1TWY A;  4B08 A;  3UMM A;  2ZYO A;  4M9Z A;  1EFU B;  4L8R C;  4P0G A;  4OVZ A;  1NV2 A;  2F6P A;  4PFR A;  3KDS E;  2LNH C;  1ZU0 A;  4PE5 B;  2F6G A;  2H1R A;  4NF6 B;  4X62 M;  4ZE8 A;  2ZTD A;  3GLG E;  4GL0 A;  1QZE A;  3BOS A;  1XMO M;  2PFZ A;  2FOI C;  1SW4 A;  1MQG A;  3W15 C;  3G3H A;  1K9Z A;  4NSO B;  3OEK A;  4PGN A;  4MGI E;  3RPL A;  5A5X A;  3LV0 A;  3D1R A;  4F18 A;  4OXV A;  3FUV A;  2LVP C;  3GQ4 A;  3IOU A;  3PUX E;  4KYS A;  3CR9 A;  2X26 A;  1WDN A;  2QBY A;  4FIM A;  4DUZ M;  3RUM A;  4ITQ A;  2Y21 A;  4BDN A;  2XWO A;  4WUR A;  3KFM A;  4LF8 M;  1FPK A;  2WX9 A;  1UTB A;  3J81 S;  2Q9T A;  3W67 A;  3MYU A;  1SXJ B;  2EKK A;  2YFQ A;  4LJ4 A;  1K3X A;  4F2L A;  1FTM A;  3GRR A;  2FHY A;  4L17 A;  5IZZ A;  1IXH A;  2Y84 A;  3TOD A;  1R6B X;  4ESX A;  3KJ7 A;  2M5Z A;  2E1S A;  3ONM A;  3BIG A;  4P0I A;  1FQB A;  3HHX A;  1RDZ A;  4QNR A;  3HHG A;  3D8L A;  3TDJ A;  3T9U A;  4MHF A;  3K8Z A;  1FNN A;  4DR3 M;  4K0K M;  3FAT A;  1FTJ A;  3MP1 A;  1SXJ D;  2QS2 A;  2N35 A;  3CG3 A;  4QSD A;  1R1N A;  4TOZ A;  2MR9 A;  1JP4 A;  4AB6 A;  3K00 A;  2CE7 A;  3QK6 A;  4XGI A;  4PDG A;  2ALU A;  1UTB B;  1E9S A;  1FCK A;  4KI0 E;  4JDF A;  1YYZ A;  3OO7 A;  1LBB A;  1IME A;  2XLJ A;  1OVT A;  4HW8 A;  4QXD A;  1GL6 A;  3PNV A;  2PBW A;  4QBA A;  5I2N A;  4EQ7 A;  2ONR A;  1A5T A;  4UAB A;  3PD8 A;  2NWJ A;  3T66 A;  1R2Y A;  1O63 A;  4JVI A;  3VVF A;  1B7U A;  2QHO B;  2UVG A;  3L25 A;  3DP6 A;  4NQ8 A;  2VF7 A;  4IBG A;  1VFD A;  1NJG A;  1BVS A;  1FBH A;  4DI4 B;  4QF9 A;  4LZ7 A;  1MPB A;  3MHV C;  3T96 B;  2F97 A;  1NV0 A;  2PFY A;  2V6Z M;  1M5C A;  1MN3 A;  1DTG A;  1Y1Z A;  4IR8 A;  4ZZA A;  4JI6 M;  2P0S A;  4LQ5 A;  5FBP A;  2O84 X;  1YAE A;  3H4M A;  3FVN A;  5CMK A;  1WOD A;  4G4O A;  2I58 A;  3CF6 E;  5BUU A;  4R2F A;  4N8Y A;  2OZZ A;  4ND9 A;  4O8M A;  4A3V B;  1GAB A;  5IT9 S;  1I4W A;  4PAK A;  2GH9 A;  4GWO A;  1WGL A;  4FED A;  4OU7 A;  4PP0 A;  4M4G A;  4OWD A;  4HE0 A;  5EQ8 A;  2Z3X A;  4HE1 A;  1USY H;  2V3U A;  1H43 A;  1MS7 A;  3PD9 A;  3G3G A;  2I4C A;  1YE9 A;  4IBB A;  3GLI E;  4N07 A;  4NF8 B;  1HSJ A;  4JWX A;  1C1K A;  4N17 A;  3CI8 A;  1TH4 A;  2PCR A;  1URG A;  4ELQ A;  2FIX A;  1ZKB A;  2XD3 A;  3J2P B;  4KOD A;  3UK4 A;  4E0W A;  2HHM A;  4ZZE A;  4PBQ A;  2DZL A;  3QYT A;  3VKH A;  5ET5 A;  1IN4 A;  2YPN A;  1I6Q A;  4L15 A;  3SMP A;  3RGP A;  2RRU A;  4PAI A;  3GLB A;  1YCJ A;  3ZS6 A;  4EF2 A;  3K01 A;  1J7K A;  4IY5 A;  4PF8 A;  5DYG A;  4GF8 A;  1XOC A;  4PQJ A;  3MJN A;  4I1D A;  3Q26 A;  2XFS A;  3QAU A;  2L4E A;  2KNA A;  4LZZ A;  3PU5 A;  4ZEF A;  5EYF A;  1MG1 A;  1NY6 A;  3IJX B;  3GXA A;  4OVR A;  2F5Q A;  3O9P A;  2APL A;  5EYG A;  5H8N A;  1N04 A;  2ZYK A;  1B4H A;  4EQB A;  1HT1 E;  3H3G A;  4NRW A;  2JY8 A;  2W7Y A;  1II5 A;  2PMS A;  5AE4 A;  2A5Y B;  3E46 A;  1S9T A;  1XVY A;  1MY2 A;  2DS9 A;  3B74 A;  4NSR A;  2FNA A;  2HAU A;  3RGY A;  3OEL A;  2ERC A;  2R0I A;  1Z7N E;  3KGC A;  5IZ3 B;  4F3S A;  4H67 A;  3MW0 A;  3RGS A;  4X64 M;  4CIZ A;  3Q29 A;  1MJG M;  1PJQ A;  4DV3 M;  4F19 A;  3MUQ A;  1VFE A;  2FIE A;  5IAI A;  3SAR A;  4OX9 M;  4P16 A;  1NUW A;  3FV2 A;  3QYB A;  5ELV A;  3RQT A;  4GOT A;  3DA1 A;  3PPN A;  1T0K A;  2KZU A;  5H8H A;  1DGG A;  1IIT A;  4DV0 M;  1QVR A;  2DVW B;  2H5X A;  1TR8 A;  5EQA A;  2Y0Q A;  4XIG Q;  3OO9 A;  4NF6 A;  3U60 A;  4GLI A;  4I3Y A;  1PJJ A;  4N6D A;  1GO5 A;  3SAT A;  2DI0 A;  4YB5 A;  3K2L A;  1SYH A;  2ZNU A;  3U94 A;  3PFI A;  1DCU A;  3M7G A;  5AA4 A;  5EXP A;  3TTR A;  3IK6 B;  3PNY A;  3W9V A;  2DQV A;  2RC7 A;  3RT8 A;  2XXP A;  3QUJ A;  2DE2 A;  2OOB A;  2R9J A;  4LN5 A;  3LQQ A;  3D8B A;  2DVZ A;  3FV1 A;  5DNY A;  3QYE A;  4LGY A;  3SAW A;  1N76 A;  2Y20 A;  1N32 M;  4RK9 A;  1TGU A;  1DOT A;  1G8P A;  1QDT A;  3D4G A;  3K9O A;  3KN7 A;  2J7O A;  1UM8 A;  4Q30 B;  3CFZ A;  3SER A;  3CHG A;  1USY E;  2F35 A;  1NO1 A;  2DKL A;  4GC5 A;  2HL7 A;  3U61 B;  4GQO A;  2C9O A;  4FJP A;  5CC2 A;  2KA6 B;  1B3G A;  3PMX A;  5H8H B;  1XI6 A;  4I5S A;  2OBG A;  1GR2 A;  4G6Z A;  4UAC A;  4OER A;  4P56 A;  1XNQ M;  4G68 C;  3C9P A;  1GJS A;  2CZK A;  1Y3P A;  4PC9 A;  4DUY M;  5I57 A;  1TDZ A;  5BR8 M;  4MF3 A;  4Q0C A;  4RK2 A;  4YKK A;  1S7Y A;  4O3A A;  4GVO A;  3KOT A;  3HJ8 A;  4DXB A;  5IWA M;  5E26 A;  5I7I A;  2JJK A;  4QSC A;  2ZYM A;  4DR4 M;  3FTC A;  5KPR A;  1Y4C A;  1MXZ A;  2R18 A;  1FPI A;  3M3K A;  2H25 A;  1OQG A;  2D3I A;  3FJG A;  4F31 B;  2ZAN A;  2Y7K A;  3SEU A;  4XKQ A;  4X8R A;  3LSL A;  4IO6 A;  1IXS B;  4IJE A;  1D0M A;  1N7W A;  5IZ1 A;  4F1I A;  2XH9 A;  3FBP A;  1AOV A;  3C4M A;  4OET A;  2L2D A;  1FW0 A;  1ZV1 A;  4IB2 A;  3HY5 A;  3ZSF A;  2RCA A;  5I59 B;  2RCB A;  2JXN A;  5FLX S;  1VR5 A;  3PVS A;  4OFJ A;  4N15 A;  3I04 M;  1TF0 B;  3N6T A;  4R74 A;  4LF5 M;  2GNO A;  1LST A;  4H5G A;  2CV1 A;  1UTH B;  2QMW A;  1FBE A;  2A5S A;  3SYK A;  2ONK E;  4O3C A;  3T38 A;  3I4Y A;  1SD3 A;  2ZAO A;  1QUK A;  2V4C A;  1NFT A;  1R9Q A;  4QHQ A;  1JEU A;  4DV4 M;  2KLF A;  4X48 A;  2QPA A;  3VK7 A;  4MGK E;  3VV5 A;  1K82 A;  5EQ9 A;  2LXE A;  4NE4 A;  4PAF A;  3EIE A;  3RYD A;  2QSF X;  2CHG A;  4N6K A;  2QS3 A;  1MH4 A;  3OMB A;  3VXC A;  3WHL A;  4BDO A;  4FAT A;  4IO4 A;  4HLQ A;  5ET7 A;  2XXH A;  2BJW A;  4F39 A;  4Q8R A;  4N4U A;  4XK8 F;  3PUV E;  2HWJ A;  1QDR A;  2KNZ A;  3TTL A;  3V83 A;  1FPJ A;  1QZM A;  3B89 A;  1VQ1 A;  3H6W A;  2ZMB A;  4UN2 B;  3KOZ E;  4X1D A;  1YPN A;  3KOX E;  3QUF A;  1WR1 B;  2DWN A;  3QMF A;  4HXV A;  5I57 B;  1B9J A;  1MPC A;  2J7N A;  2OWT A;  3GYY A;  5M2V A;  3I5O A;  3WAE A;  1VG5 A;  2XGN A;  4R6H A;  1FBC A;  2HAK A;  2Z8D A;  1PDA A;  4YU0 A;  3B6W A;  5L9S A;  1ZBM A;  1EYK A;  4YKJ A;  2PVU A;  4YKP A;  4P17 A;  2G3Q A;  3N26 A;  3MVY A;  4DZ1 A;  2QL3 A;  4TLM B;  4U23 A;  4NXM M;  1FQA A;  3U72 A;  2O69 A;  1XXH B;  3GO8 A;  3RT6 B;  4LF4 M;  1Q02 A;  2F34 A;  3O6H A;  4YZZ A;  1ZJL A;  2R45 A;  4OZ9 A;  1EH3 A;  5H8Q A;  3FJ7 A;  4R7G A;  4YKI A;  2R6G E;  3TTM A;  1A8F A;  1QUL A;  2BJV A;  4P9K A;  2WSF F;  2XX7 A;  5L8D A;  4Z8X A;  1MXX A;  2V84 A;  1IY1 A;  1NMU A;  3PMV A;  4RJZ A;  1HT2 E;  3IEC A;  3GPU A;  4B7F A;  4ZEC A;  2DVC A;  3IX1 A;  4GBW A;  1POY 1;  4BBA A;  4EXK A;  1NNP A;  1IZ1 A;  4KYD A;  3SEY A;  1S3S A;  2DAG A;  1LLS A;  1DGB A;  3E9X A;  1B3F A;  5LOM A;  4RKU F;  3K6W A;  4WXJ A;  2ZTC A;  2XZF A;  1D0L A;  4NXN M;  4KXP A;  3ZC7 B;  4JVD A;  3C3D A;  3IFA A;  4DBG B;  1VSO A;  1SG9 A;  3M8U A;  2EO2 A;  2QMX A;  2I0C A;  1N3X A;  4DIG A;  3L27 A;  1PRB A;  2QJE A;  1DO2 A;  4R71 A;  2B4M A;  2RF1 A;  3FGS A;  5AA2 A;  2CZH A;  1NNK A;  2K6B A;  1OQY A;  3VDU A;  3UIF A;  5I2K A;  2JWS A;  4THI A;  1WVJ A;  3FUU A;  1NV7 A;  4AI6 A;  2UXC M;  4GEW A;  2OLB A;  2Q88 A;  3MBP A;  3U6S A;  2VII A;  1NNU C;  1W5T A;  2O01 F;  1BLF A;  1D3K A;  2KW0 A;  4JI5 M;  3FAS A;  1DGF A;  2PX1 A;  3K0V A;  1H6U A;  3A98 B;  4FEC A;  1D0K A;  4JXJ A;  3TL4 X;  1JR3 D;  4GIZ A;  1ORY B;  3IOV A;  2D7E A;  3PPO A;  2VPN A;  4OFO A;  5KDT A;  1ANF A;  2Z4R A;  2H5Y A;  4N13 A;  4AQ4 A;  3MVW A;  4W5W A;  5IKB A;  4NWD A;  4R6Y A;  3KXE C;  1XWI A;  1TFA A;  1MY0 A;  4R9G A;  1QUJ A;  4FE8 A;  4RF0 A;  3Q8X A;  3U6D A;  1QAQ A;  3A3U A;  4PDI A;  4IO2 A;  4YAH X;  4M9X A;  1FBG A;  4OVP A;  3ZKL A;  2KDL A;  3TYH A;  1L1Z A;  1DMB A;  3U5Z B;  3O66 A;  1INP A;  1B05 A;  5TU0 A;  1PB8 A;  4FEB A;  4NN3 A;  4QFK A;  5FTI A;  2DXR A;  1B3H A;  4GWX A;  1NV8 A;  5ITY A;  2B4L A;  3IL1 B;  5DYH A;  1X37 A;  2ESN A;  1OIZ A;  4LJA A;  3NBI A;  1V33 A;  1LAX A;  4GWY A;  4AW4 A;  2LBC A;  3TPZ A;  2BNK A;  1T6O A;  4S12 A;  3W0L B;  2O1M A;  4DCY A;  3QAX A;  4MB7 A;  2C5R A;  3EHT A;  3B7N A;  1DPE A;  4LRS A;  2EA0 A;  5EP1 A;  3I51 A;  3DLN A;  5JEI A;  1US5 A;  4GKJ M;  4RPN A;  1TTE A;  4MGZ E;  4OES A;  3OD7 A;  1JR3 A;  1D4N A;  1YLA A;  5ITT A;  5ET6 A;  3MVZ A;  4B7G A;  3C35 A;  2YQZ A;  4KCC A;  2ANJ A;  4C1U A;  1WGN A;  1Y1M A;  2WZJ A;  3U6E A;  1FTL A;  3KJT A;  5CMM A;  5ITO A;  4C0R A;  1GVN A;  1PM5 A;  2G8L A;  2OK2 A;  3H6T A;  4WEP A;  4ELR A;  3KEI A;  1HJP A;  4NTL A;  2NQ8 C;  3BFU A;  1IN6 A;  2FVZ A;  2RKM A;  3QIM A;  3FUT A;  3HV1 A;  1MQI A;  3TEL A;  3KP0 E;  3FTF A;  3P7I A;  3S9E A;  3KSJ A;  3Q8G A;  4MFI A;  1IY0 A;  3FXR A;  3OO8 A;  2KHH A;  4R3D A;  2KQZ A;  4QFN A;  3SEX A;  1LFH A;  4JYA M;  1WJ7 A;  4EUO A;  3T1H M;  2FNC A;  4IBJ A;  3FYC A;  3VKG A;  1NV5 A;  3MJ5 A;  2CMO A;  4IGR A;  2G5G X;  2F36 A;  3N6U A;  4MBP A;  4AKI A;  3QWL A;  1BKA A;  3HHZ A;  4LCB A;  4YHH M;  1B5H A;  1LAH E;  3LC8 A;  1PC3 A;  2UYF A;  4OAN A;  3CFL A;  2UYE A;  4AKH A;  3EPE A;  5BPV A;  2CV0 A;  4ANR A;  3SDF A;  3BBZ A;  3ROJ A;  3AFH A;  5KCJ A;  1L5T A;  3IJO B;  4DV1 M;  3KOS A;  4JI0 M;  3BFT A;  3AXF A;  4L16 A;  1M5F A;  4F1V A;  2I49 A;  1FPG A;  5I84 A;  3HST A;  5CRY A;  1Z5B A;  2VDB B;  1LEV A;  2QCU A;  1N78 A;  2HEU A;  3T15 A;  2Z22 A;  1RKM A;  3RTF B;  1NV9 A;  5J16 A;  3E79 A;  1MM7 A;  4PCZ A;  4RNA A;  1I6A A;  3K2D A;  3LVW A;  3SES A;  3AL0 C;  3S9M C;  1NNF A;  5I58 A;  3OSQ A;  2L6O A;  1M5D A;  4N91 A;  4PDH A;  5E6J A;  4ECF A;  1Z5A A;  1A8E A;  1B7Z A;  2NUV A;  5H8N B;  3L2A A;  2LVA A;  2LTU A;  3GRU A;  3MK6 A;  2ZM6 M;  1NUX A;  3V8X B;  3VLV A;  2XEP A;  4R6K A;  2R65 A;  2D5W A;  4H5F A;  2K9D A;  3HJS A;  1A55 A;  3HCQ A;  1L8Q A;  4GX3 A;  2VQF M;  1A99 A;  3TEP A;  3IO6 A;  1Q9D A;  5DVF A;  2B3F A;  3SYL A;  1G41 A;  1FBD A;  5CBR A;  5EJC A;  4PFB A;  1FQF A;  4IY6 A;  4GXS B;  2E0S A;  2B3T A;  4P1L A;  2JZ0 A;  2RC9 A;  4ZE9 A;  3TWM A;  1LB8 A;  2FYI A;  2MRO B;  1R2Z A;  1A7L A;  2Y5L A;  4IBD A;  3FTD A;  2DP8 A;  5I56 B;  2DOJ A;  3DP4 A;  4KQP A;  2XXI A;  1JEV A;  3EIH A;  4I8C A;  1ELJ A;  4ZEK A;  2JY6 B;  7CAT A;  5H8Q B;  5LMN M;  3HJQ A;  4FWH A;  2JUJ A;  3C9H A;  3V5A A;  3BBR A;  3PUY E;  1AIV A;  1LBX A;  2V25 A;  1QUI A;  2Q2C A;  4CHT B;  4P3L A;  3K6U A;  3U6M A;  1HQC A;  4DV6 M;  1IXC A;  3KSX A;  3I3V A;  1VEG A;  4G68 A;  4LJ6 A;  4O94 A;  4H45 A;  3BIH A;  5DEX B;  1QVS A;  4UA8 A;  5KPT A;  4U21 A;  3EQ1 A;  2CZL A;  2CHV A;  2WKY A;  4D82 A;  2LHC A;  3LVV A;  5T3J A;  3UZU A;  1TH3 A;  3HHW A;  3TPA A;  2DWM A;  1DBZ A;  2JNH A;  1OAI A;  3PTY A;  1DK4 A;  4O3B A;  3E78 A;  3KOY E;  4MLV A;  1Q1K A;  1IN5 A;  1CE2 A;  4OQO A;  4P8B A;  1XC8 A;  4B3M M;  2OX3 A;  2EJS A;  2HAV A;  5IZ3 A;  1LBY A;  1TFD A;  4HE2 A;  1OLC A;  4JWO A;  1LBV A;  1G0I A;  2AYS A;  2HQ0 A;  1L2D A;  2JP7 A;  4P11 A;  5L8R F;  1MRP A;  3O6I A;  3U5Z A;  4YY3 M;  3KFU G;  2DWH A;  4X65 M;  4H6D A;  4GXA A;  5FHM A;  2HCB A;  5FTN A;  4BLA A;  4BDM A;  5F24 A;  5FTK A;  2H98 A;  4MH5 A;  4LF9 M;  1IBM M;  3SC3 A;  1RDY A;  3TCG A;  1SW1 A;  3GPP A;  1PEB A;  3HX3 A;  1IXR C;  2KZS A;  4N6P A;  1Z59 A;  1Y20 A;  3IG5 A;  4M0W A;  1URS A;  5I58 B;  4YMB A;  1DSN A;  5LMU M;  4GX6 A;  1RYO A;  4GHA A;  4X1B A;  4L4U A;  3O6G A;  3ZCB B;  3HPI A;  1FPL A;  3U65 A;  2L7H A;  1Q39 A;  1AUA A;  3V76 A;  4NF0 A;  1JB0 F;  4GMQ A;  4JV5 M;  3M3F A;  5HBC A;  4DCX A;  4IJF A;  3TCF A;  5H8F A;  2V93 A;  2XXW A;  4JI7 M;  2OJT A;  5EYH A;  1Y4T A;  5TPA B;  3VVD A;  5DVI A;  1NNT A;  1LBC A;  4FCT A;  4MGY E;  1JW4 A;  4Q7J A;  1XHB A;  2OO9 A;  2QVR A;  5JTY B;  3ILK A;  3PPP A;  1IIW A;  5ICQ A;  2CV2 A;  4FOR A;  4AG6 A;  4FCW A;  2D21 A;  2HPG A;  4II7 A;  2LAO A;  2OOA A;  4LJ5 A;  3GBA A;  3RFW A;  4EF1 A;  1PBQ A;  4OFL A;  4N81 A;  2Q8J A;  3S2V A;  4K3F A;  1QAM A;  1IXZ A;  1MXY A;  5I59 A;  2DSF A;  1OQH A;  3KZG A;  2F7A A;  2UXA A;  4HEO A;  2CHQ A;  2O7U A;  1MDP 1;  1SW2 A;  1T43 A;  2AL5 A;  4ELO A;  2HKJ A;  4U1Z A;  1QAO A;  3IOT A;  3KN8 A;  3TWK A;  1N34 M;  4AS4 A;  1SPI A;  2FFJ A;  2XXX A;  3TUS A;  4R73 A;  2DAE A;  5L9M A;  4I8O A;  3U92 A;  5ITP A;  2XSZ D;  2FE8 A;  1MQH A;  2VD3 A;  1XC1 A;  1QKB A;  3K1P A;  2HHH M;  1QJM A;  4XBO A;  2DE4 A;  3SBJ A;  4F3G A;  2L7I A;  4FCV A;  2ZZX A;  1GVC A;  4DDD A;  4LJ9 A;  3HZJ A;  1FJ9 A;  3LBS A;  3EHS A;  3Q25 A;  3VVE A;  2F5N A;  4PT5 A;  3I6V A;  2QSX A;  3KS4 A;  1QQW A;  1N3W A;  4QFO A;  3THG A;  2P2A A;  4E0X A;  1BTJ A;  3ZH9 B;  4C1T A;  2YNM D;  4QHS A;  4KO8 A;  2I48 A;  1SXJ E;  3MMP A;  2MGW A;  4RF1 A;  2IA4 A;  3PPR A;  4MIJ A;  3VLF B;  2XXV A;  2XX8 A;  4WW0 A;  1NH7 A;  1IM2 A;  3MP6 A;  1P1O A;  2ONS A;  4LZJ A;  1JW1 A;  1FQD A;  1IMA A;  4L78 A;  4OA4 A;  1QKA A;  2AL4 A;  1F4I A;  3B50 A;  4LY6 A;  2WBB A;  2I3W A;  1TH2 A;  3B7Z A;  2RC8 A;  3Q28 A;  1NV6 A;  2V3T A;  4X9T A;  4F1Y A;  4IBC A;  3KBZ A;  2F5P A;  3TTN A;  4Z0I A;  3PXG A;  5DVJ A;  5I5P A;  2DAM A;  5B70 A;  2G93 A;  4B3R M;  3G3J A;  3G7W A;  4QFL A;  1XXH E;  3B7Q A;  5C18 A;  1HNZ M;  3IO4 A;  3PUW E;  4P1E A;  2RGO A;  1NHW C;  1IXG A;  4OYV A;  2BWB A;  1VDW A;  3K6V A;  3GLH E;  5EHS A;  4GRK A;  2Z8F A;  4QOS A;  4DV5 M;  1JET A;  2WBD A;  4G4P A;  4NL4 H;  1LB9 A;  4DI3 D;  3PPQ A;  5EP4 A;  3AKZ A;  3IB0 A;  3KS8 A;  2UVI A;  4H8J A;  1KA1 A;  1SBP A;  4F22 A;  3H4Z A;  4F2Q A;  2F3D A;  2DE3 A;  4IO5 A;  5FTL A;  4MJO A;  4PET A;  1FQE A;  2R8T A;  2LVN C;  1GV8 A;  3C58 A;  3TQL A;  2KEB A;  2G29 A;  3TQS A;  4Z6Y A;  1CNQ A;  2QVU A;  3V89 B;  1V34 A;  3JR4 A;  4NG7 A;  3K02 A;  3EKI A;  1MY1 A;  1O64 A;  2PT1 A;  1H76 A;  1D9Q A;  5ITR A;  4NGU A;  3MZ9 A;  3RPL B;  2Q2A A;  2YR0 A;  2THI A;  4NF4 B;  2XWK A;  1P99 A;  2R46 A;  4AQY M;  2QNJ A;  1OJL A;  2Q89 A;  3KN3 A;  3FVK A;  1GTK A;  1B5J A;  2HXW A;  1IN7 A;  5EHM A;  1YUB A;  5CMC A;  3JR5 A;  3IR1 A;  1NV1 A;  3PGF A;  4RNS A;  1HSE A;  5FSW A;  3OXN A;  4OVZ B;  3CSB A;  4L6V 6;  3U6P A;  3IG8 A;  3UGW A;  1OIB A;  4ZS9 A;  3J7B A;  2RIN A;  5C1B A;  4D80 A;  1MY4 A;  1OFH A;  1P1W A;  3EN3 A;  1PJT A;  1R4G A;  1B51 A;  3SHG B;  3ISP A;  4OVT A;  1QYR A;  4NF5 A;  1N84 A;  1PGY A;  4G8M A;  2O68 A;  5DEX A;  4AG5 A;  2Z4S A;  2Q2E B;  3UOR A;  5AA2 D;  1XS5 A;  2CZI A;  4KPT A;  4LZ5 A;  4G68 B;  4I9D A;  2X7Q A;  3K6X A;  2A5T A;  5HM4 B;  1N0T A;  3N94 A;  1LCF A;  1LFG A;  5JTY A;  1ZMV A;  1PBP A;  1JR3 E;  3PUZ E;  4RYA A;  4GWZ A;  3A42 A;  2CEX A;  2CP8 A;  1G59 A;  8CAT A;  2OQ4 A;  1EYI A;  1P1N A;  4JI8 M;  5EXT A;  1IMB A;  4IBF A;  1I69 A;  4I4L A;  2YLN A;  4FAJ A;  2B3B A;  1NV4 A;  4NF5 B;  3HGI A;  3FTE A;  1Y3N A;  1B52 A;  4JXI A;  2K47 A;  5A2Q S;  2GQ1 A;  1URD A;  2QVV A;  3CTW B;  3L6H A;  3WHK A;  2C98 A;  1MH3 A;  3PV0 E;  1EZ9 A;  4KFQ A;  3GPX A;  4ELP A;  1BP5 A;  4LQ2 A;  3IAZ A;  2CUZ A;  1WXQ A;  4NAP A;  2DDK A;  1W5S A;  5EQT A;  2C96 A;  4QNM A;  1OFI A;  2UUB M;  2QPQ A;  3GLF A;  3T93 B;  1NJF A;  2V1U A;  1ZMG A;  3QXM A;  1E94 E;  4FWD A;  3W9W A;  4F2O A;  3LW5 F;  3GLG B;  3SZP A;  5I3S A;  4M9S A;  2WEF A;  2R71 A;  3J27 B;  1PB9 A;  2M8C A;  3TFL A;  4NRV A;  4DLD A;  1K9Y A;  4YIC A;  2CFO A;  5HPQ A;  1IMC A;  2LVQ D;  1QAN A;  2XSZ A;  2XXR A;  3FZV A;  1H3D A;  2DWI A;  5JI2 E;  5I56 A;  4P47 A;  1AL3 A;  3S9N C;  4FW9 A;  1FBP A;  3B7D A;  4EDP A;  1Y8G A;  1IY2 A;  1SXJ C;  3ZQJ A;  3CG1 A;  4G8H A;  1E32 A;  2C99 A;  1F9B A;  3VLW A;  5AA4 B;  1P1U A;  1XB2 B;  5CI5 A;  2EUC A;  5KO3 A;  2DWJ A;  2HZL A;  3SHF A;  1VDL A;  4DR1 M;  1FQC A;  1XVX A;  1B40 A;  1FJG M;  2VOZ A;  2P1S A;  4G2Z A;  2DAI A;  4XEQ A;  3HU1 A;  4BLC A;  1LGB C;  4MAG A;  3I4V A;  1HQY E;  4JN6 A;  2WYK A;  3BXW A;  1TXF A;  4LZ8 A;  4LRT A;  3F92 A;  2K0B X;  1XHY A;  1FBF A;  3AV0 A;  1AMF A;  3T9X B;  1D9V A;  1B2H A;  3UP9 A;  1IXI A;  3KG2 A;  1ZLQ A;  1YSY A;  1MXU A;  1JNF A;  4R72 A;  1NVM A;  1IMF A;  4G4Q A;  4Y28 F;  4JI4 M;  3Q27 A;  2DWZ B;  2X4A A;  2P5T A;  1SQY A;  2F4V M;  2VT5 A;  3E13 X;  2QBY B;  4FBP A;  3TQW A;  1QUT A;  3U6L A;  1DGH A;  2IEE A;  5EXX A;  4GBV A;  3K92 A;  2OPF A;  4FD2 A;  1MXV A;  4TQU Q;  3LUY A;  2V3Q A;  3W0F A;  1MQJ A;  3I01 M;  2KRK A;  4M0D A;  1MU5 A;  4HCY A;  4LVQ A;  2Q8M A;  2WSC F;  5ICT A;  2QS4 A;  1T3T A;  3F11 A;  4ZPX A;  1KFV A;  1XXH A;  3AOE A;  4GWU A;  3R6U A;  2X8A A;  4DXC A;  3B6T A;  3O29 A;  3AJI B;  3RNN A;  1Z5C A;  3GLH A;  4LAT A;  3U60 B;  3DFZ A;  3FUZ A;  2W82 A;  2GRV A;  1ZIU A;  3RLF E;  1KSF X;  3VFD A;  4PD2 A;  2RKO A;  3SAV A;  1G3I A;  3VFJ A;  2C9C A;  4GH9 A;  2ZXT A;  4NC6 A;  5ITX E;  3LCU A;  4G4N A;  3OSR A;  3TTK A;  4IO7 A;  2GHB A;  2V1C A;  4AB5 A;  3OEM A;  1Z7M E;  5EP2 A;  4IBE A;  3UGJ A;  2Z8E A;  2LVO C;  2QP9 X;  3W68 A;  1R7R A;  2VHA A;  4HTG A;  5DT6 A;  3LQR A;  2BWE A;  4NF8 A;  1YTV A;  2XA5 A;  4LJ7 A;  3DM0 A;  5L9O A;  2A5T B; 
#chains in the Genus database with same CATH homology
 1IQP A;  3JAM S;  1US4 A;  4JWY A;  1B0H A;  3EF7 A;  3SAU A;  3CVG A;  1Q3C A;  2DHR A;  4KCD A;  4KD5 A;  1IEJ A;  5K2Y A;  3SEV A;  4LA9 A;  3HHY A;  2F8D A;  1UIV A;  1MXW A;  3CF2 A;  3GRY A;  1MDQ A;  3IB1 A;  3ECR A;  5KZT A;  4B3S M;  1AH5 A;  1JW5 A;  4JSD A;  4Q5T A;  1UTH A;  3LMM A;  4D81 A;  1MPD A;  4KHP M;  3U6O A;  2ZYN A;  4IIW A;  1RYX A;  4NWC A;  1NSF A;  1S50 A;  2O6A A;  1LCT A;  1UQW A;  3T9V A;  1CB6 A;  3C34 A;  1B1X A;  3MZB A;  5ITU A;  2B65 A;  2BJJ X;  2KXE A;  3GPY A;  2ZAM A;  3CRB A;  3TZA A;  1ZAE A;  1XT8 A;  4LJ8 A;  1IQ7 A;  2F78 A;  3C31 A;  5F7V A;  2UU9 M;  1XNR M;  3DZD A;  3H7M A;  5TP9 B;  3A45 A;  3OTO M;  2HCA A;  3H03 A;  1PJI A;  4IGT A;  4JSO A;  2X7P A;  2GHA A;  3ILU B;  5B7D A;  3SAS A;  2NXO A;  4KHZ E;  3GQ3 A;  5F3W A;  1KYI A;  1SYI A;  5CMB A;  2Y7I A;  3SFZ A;  4FVM A;  3FJM A;  3FD3 A;  2UUC M;  1J5E M;  1IBK M;  2F5S A;  1B3E A;  1NL5 A;  5J1D A;  2DYX A;  4RPO A;  4G77 A;  5H37 D;  4JI2 M;  4U1O A;  5H8S A;  1N7X A;  5IRE B;  3QSL A;  5I2N B;  2UXB M;  2Y7R A;  4WED A;  3SKP A;  3J7A S;  4TLL B;  3FD9 A;  4LFB M;  3CSG A;  4JI1 M;  4XTC Q;  4IBK A;  3JYR A;  2I7P A;  4U4S A;  1G4A E;  4U4X A;  2FA7 A;  3OO6 A;  2LH0 A;  2R4J A;  3L29 A;  3A46 A;  5CBS A;  2F5O A;  3WAF A;  4F1U A;  4QSE A;  3UJN A;  4NMY A;  4KR5 A;  1POT A;  1Y3Q A;  1B3L A;  3HHF A;  2AHM A;  3FVO A;  3L26 A;  1MY3 A;  2AIX A;  3O28 A;  1IBL M;  1MM6 A;  3T22 A;  5EXS A;  2XXT A;  3FXQ A;  1N33 M;  4LON B;  1VDD A;  3O2A A;  4R9F A;  4R2B A;  1SI0 A;  4GL8 A;  4F29 A;  2H9B A;  3SET A;  4B3T M;  1K3W A;  4JBZ A;  1MQD A;  2DWA A;  3E9S A;  5F1Q A;  3HO7 A;  2JA2 A;  3T1Y M;  4CGY B;  3TWL A;  1UIU A;  4OEV A;  4TUW A;  2D7H A;  1Q3B A;  3M6A A;  3GZG A;  5TP9 A;  4BDL A;  3MWB A;  4RA1 A;  3KW6 A;  1KWH A;  2NVU B;  2Y7P A;  2XF3 A;  1L1T A;  1M5E A;  4LFC M;  2DWL A;  1B32 A;  5AA2 B;  3K1J A;  1IN8 A;  3K1N A;  4F3P A;  2YJP A;  4GKK M;  5FTM A;  3DP8 A;  2M60 A;  1SVX B;  3LSF B;  3IOR A;  1D9Y A;  2DZN B;  4PFU A;  3GBB A;  4OW0 A;  3GQ5 A;  1FTO A;  4I62 A;  4X66 M;  4OEN A;  3C33 A;  2Y0T A;  3HWS A;  1L2B A;  3MC2 A;  4OTE A;  2DXI A;  1HNW M;  3U6C A;  4XKN A;  4NED A;  1HR0 M;  2I7N A;  3G3F A;  2HZK A;  3GLI A;  4OHN A;  1VE4 A;  4ZED A;  1L2C A;  3AOE C;  2I4B A;  3U61 A;  1Q35 A;  4DR7 M;  3UA8 A;  3MPK A;  2UXD M;  5GKN A;  1B46 A;  3FUW A;  3GLH B;  4ISU A;  5FTH A;  4KYE A;  4LF6 M;  3H6U A;  5KQD A;  3D4C A;  5ITX A;  2REG A;  4I81 A;  2QEN A;  3JV9 A;  3E4R A;  4NF4 A;  4ZDM A;  1B7H A;  1JQF A;  2Z23 A;  1SI1 A;  5TPA A;  1B1H A;  5EP3 A;  3H6V A;  4BDQ A;  1NY5 A;  2Z7J A;  4BDR A;  3UN6 A;  3C32 A;  3G3I A;  4DR5 M;  2KRU A;  3ILT B;  4EXL A;  2O5R A;  4QOZ C;  2OWS A;  1Y9U A;  3LR1 A;  4H65 A;  1B58 A;  1I94 M;  3TE6 A;  3CIJ A;  2F5X A;  2DZO B;  4R75 A;  3VLU A;  2XX9 A;  4PFY A;  3MZ1 A;  3HU2 A;  1TDH A;  2UUA M;  3JZJ A;  5ISU A;  1H44 A;  2I0B A;  4AZF A;  3TCH A;  4F3B A;  1B0L A;  5ITQ A;  2XZU A;  4XKP A;  2LWX A;  1IUD A;  1QW0 A;  3A3C A;  4M1V A;  3RN8 A;  1DO0 A;  1ZTY A;  3FUX A;  1B5I A;  5H8F B;  1DGH B;  3A09 A;  4DE8 A;  2QZ4 A;  2H4I A;  1ZQ9 A;  4EIW A;  4CIS A;  3U93 A;  1N77 A;  4B7H A;  4G4R A;  3M0E A;  3DEL B;  1A54 A;  4EQ9 A;  4HL4 A;  3VXB A;  1J1N A;  4ESW A;  3GRV A;  3FKE A;  3L6G A;  1EE8 A;  4LF7 M;  3S9L C;  1ATG A;  1M5B A;  1OMP A;  5KDT B;  1I6B A;  1DPP A;  3GLG A;  4DV7 M;  3EHU A;  3MQ9 A;  4LUB A;  4BB9 A;  4GIT A;  5AA1 A;  3KBR A;  2D7G A;  2O51 A;  1J09 A;  3BKI B;  4OVJ A;  4DR6 M;  3NWL A;  3FIR A;  4GRI A;  3MP8 A;  4Z7E A;  1MX0 A;  2H99 A;  5IZ7 D;  3E3K A;  3UK6 A;  4MH0 E;  4YB6 A;  5FHO A;  4AKG A;  1PB7 A;  1R6Z A;  5A5X B;  3OOA A;  1EZO A;  5KCJ B;  3K4U A;  3LSX A;  4NOO B;  4PFT A;  1HSL A;  4JI3 M;  1EZP A;  1SW5 A;  4RY1 A;  4OEU A;  3R8F A;  3OEN A;  2XXQ A;  3B9P A;  4LP2 B;  1Z6T A;  3GLF B;  1TT1 A;  2L09 A;  1H45 A;  3KVW A;  4LFA M;  3U6Q A;  2PT2 A;  4IBI A;  3FVG A;  3SMS A;  2HFB A;  3LSW A;  3T9H B;  3CF0 A;  4H0W A;  2XD2 A;  4KLN A;  4HCW A;  3VDF A;  2PYY A;  3IOW A;  3DOA A;  3C36 A;  2VGQ A;  1NH8 A;  4HS7 A;  5DYI A;  5K2X A;  3RY3 A;  4POW A;  4U22 A;  3M3L A;  1GKI A;  4MGH A;  1JQJ C;  1NHG C;  2E5L M;  3S4U A;  3VDP A;  5JI3 E;  1O7T A;  4QRZ A;  3J80 S;  1N36 M;  1N75 A;  3TAJ A;  2GFE A;  4DXU A;  4WKM A;  4LGM A;  4ZEI A;  2XFT A;  4GC9 A;  3FXU A;  3GLI B;  5FHN A;  2OCU A;  2XHD A;  3K1M A;  2UVH A;  4G8N A;  3RTW B;  3TKD A;  1GL7 A;  1P1Q A;  1JVX A;  3R7X A;  1A40 A;  3L28 A;  2R62 A;  4H8I A;  3VK8 A;  3CFX A;  3HN0 A;  2XXU A;  1NNJ A;  1OLA A;  5BWJ A;  5FTJ A;  1LFI A;  1B4Z A;  3RPW A;  3AOG A;  1OVB A;  2F7B A;  3H06 B;  4REZ A;  4PFW A;  2VD2 A;  2O7I A;  4LG2 A;  4MM3 B;  2VQE M;  1LV7 A;  2DXY A;  5CM6 A;  4GFR A;  2R4E A;  4YB7 A;  3SEW A;  1GGG A;  1E9R A;  4GIP A;  3O97 A;  4IO3 A;  1LAG E;  1B6H A;  1SXJ A;  3N5L A;  4QFP A;  3ZKK A;  1FTK A;  2I3V A;  4ZEB A;  4YMA A;  1NKX A;  3FYD A;  3PMW A;  4JB7 A;  3IB2 A;  3KOW E;  1D2N A;  4MLQ A;  3KP1 E;  1R9L A;  4GD5 A;  2Y7W A;  1LAF E;  4H1X A;  3MPL A;  2X49 A;  5AA3 A;  2O1L A;  2QS1 A;  3THI A;  5DTB A;  3R9X B;  2CEA A;  3R26 A;  3RE8 A;  4OMB A;  4FWG A;  2UVJ A;  4U2R A;  4DR2 M;  3HU3 A;  2ZBK B;  3MVX A;  3VE1 B;  3MAM A;  4ONY A;  4XXU A;  1GLN A;  5KQ8 A;  1HNX M;  2VP1 A;  5KPZ A;  4POX A;  4DV2 M;  2XXY A;  4RXL A;  4XKR A;  2I6E A;  3G3K A;  5JK4 A;  2ZNS A;  2REJ A;  5I2K B;  2F7C A;  1XMQ M;  3TMG A;  2NOO A;  2RGH A;  2ZNT A;  3GP1 A;  3B6Q A;  3HKP A;  3U8Q A;  4QHT A;  3ODB A;  3U1O A;  1EU8 A;  1SDX A;  1BIY A;  4GHL A;  2QRY A;  1JVY A;  3USD A;  1DTZ A;  2ABH A;  1TWY A;  4B08 A;  3UMM A;  2ZYO A;  4M9Z A;  4L8R C;  4P0G A;  4OVZ A;  2F6P A;  3KDS E;  2LNH C;  1ZU0 A;  4PE5 B;  2F6G A;  2H1R A;  4NF6 B;  4X62 M;  4ZE8 A;  4GL0 A;  3BOS A;  1XMO M;  2FOI C;  1SW4 A;  1MQG A;  3W15 C;  3G3H A;  4NSO B;  3OEK A;  4MGI E;  5A5X A;  4F18 A;  4OXV A;  3FUV A;  3GQ4 A;  3IOU A;  3PUX E;  4KYS A;  3CR9 A;  2X26 A;  1WDN A;  2QBY A;  4FIM A;  4DUZ M;  3RUM A;  4ITQ A;  2Y21 A;  4BDN A;  4WUR A;  3KFM A;  4LF8 M;  1UTB A;  3J81 S;  2Q9T A;  1SXJ B;  2YFQ A;  4LJ4 A;  1FTM A;  1K3X A;  3GRR A;  4L17 A;  1IXH A;  2Y84 A;  3TOD A;  1R6B X;  4ESX A;  3KJ7 A;  2M5Z A;  2E1S A;  3ONM A;  4P0I A;  1FQB A;  3HHX A;  4QNR A;  3HHG A;  3D8L A;  3TDJ A;  3T9U A;  3K8Z A;  1FNN A;  4DR3 M;  4K0K M;  3FAT A;  1FTJ A;  3MP1 A;  1SXJ D;  2QS2 A;  3CG3 A;  4QSD A;  1R1N A;  4TOZ A;  4AB6 A;  3K00 A;  2CE7 A;  3QK6 A;  4XGI A;  2ALU A;  4PDG A;  1E9S A;  1UTB B;  1FCK A;  4KI0 E;  4JDF A;  3OO7 A;  1LBB A;  2XLJ A;  1OVT A;  4HW8 A;  1GL6 A;  3PNV A;  2PBW A;  5I2N A;  4EQ7 A;  2ONR A;  3T66 A;  3PD8 A;  2NWJ A;  1R2Y A;  1O63 A;  3VVF A;  1B7U A;  2UVG A;  3L25 A;  3DP6 A;  4IBG A;  1VFD A;  1NJG A;  4QF9 A;  4LZ7 A;  1MPB A;  3MHV C;  3T96 B;  2F97 A;  2V6Z M;  1M5C A;  1DTG A;  1Y1Z A;  4ZZA A;  4JI6 M;  2P0S A;  4LQ5 A;  2O84 X;  1YAE A;  3H4M A;  3FVN A;  5CMK A;  1WOD A;  4G4O A;  2I58 A;  3CF6 E;  5BUU A;  4R2F A;  2OZZ A;  4ND9 A;  4A3V B;  5IT9 S;  1I4W A;  2GH9 A;  4GWO A;  4FED A;  4OU7 A;  4PP0 A;  4M4G A;  4OWD A;  2Z3X A;  1USY H;  2V3U A;  1H43 A;  1MS7 A;  3PD9 A;  3G3G A;  2I4C A;  1YE9 A;  4IBB A;  4N07 A;  4NF8 B;  1HSJ A;  4JWX A;  1C1K A;  3CI8 A;  1TH4 A;  1URG A;  4ELQ A;  1ZKB A;  2XD3 A;  3J2P B;  4KOD A;  3UK4 A;  4E0W A;  4ZZE A;  3QYT A;  3VKH A;  1IN4 A;  2YPN A;  1I6Q A;  4L15 A;  3SMP A;  3RGP A;  3GLB A;  1YCJ A;  3ZS6 A;  4EF2 A;  3K01 A;  1J7K A;  4IY5 A;  5DYG A;  4GF8 A;  1XOC A;  4PQJ A;  3MJN A;  4I1D A;  3Q26 A;  2XFS A;  3QAU A;  4ZEF A;  4LZZ A;  3PU5 A;  5EYF A;  1MG1 A;  1NY6 A;  3IJX B;  3GXA A;  2F5Q A;  3O9P A;  5H8N A;  1N04 A;  2ZYK A;  1B4H A;  4EQB A;  1HT1 E;  3H3G A;  4NRW A;  2W7Y A;  2PMS A;  1II5 A;  5AE4 A;  2A5Y B;  1S9T A;  1XVY A;  1MY2 A;  2DS9 A;  4NSR A;  2HAU A;  2FNA A;  3RGY A;  3OEL A;  2ERC A;  1Z7N E;  3KGC A;  4F3S A;  4H67 A;  3MW0 A;  3RGS A;  4X64 M;  3Q29 A;  4DV3 M;  4F19 A;  3MUQ A;  1VFE A;  5IAI A;  3SAR A;  4OX9 M;  3FV2 A;  4P16 A;  5ELV A;  3RQT A;  4GOT A;  3DA1 A;  3PPN A;  1T0K A;  2KZU A;  5H8H A;  1DGG A;  1IIT A;  4DV0 M;  1QVR A;  2DVW B;  2Y0Q A;  4XIG Q;  3OO9 A;  4NF6 A;  3U60 A;  4GLI A;  1PJJ A;  3SAT A;  4YB5 A;  3K2L A;  1SYH A;  2ZNU A;  3U94 A;  3PFI A;  3M7G A;  5AA4 A;  5EXP A;  3TTR A;  3IK6 B;  3PNY A;  3W9V A;  2DQV A;  2RC7 A;  3RT8 A;  2XXP A;  3QUJ A;  2DE2 A;  2R9J A;  3LQQ A;  3FV1 A;  3D8B A;  2DVZ A;  5DNY A;  4LGY A;  3SAW A;  1N76 A;  2Y20 A;  1N32 M;  4RK9 A;  1TGU A;  1DOT A;  1G8P A;  3D4G A;  3KN7 A;  2J7O A;  1UM8 A;  4Q30 B;  3CFZ A;  3SER A;  1USY E;  2F35 A;  4GC5 A;  2HL7 A;  3U61 B;  4GQO A;  2C9O A;  4FJP A;  5CC2 A;  2KA6 B;  1B3G A;  3PMX A;  5H8H B;  4I5S A;  2OBG A;  1GR2 A;  4G6Z A;  4UAC A;  4OER A;  1XNQ M;  4G68 C;  1Y3P A;  4DUY M;  5I57 A;  1TDZ A;  5BR8 M;  4MF3 A;  4Q0C A;  4RK2 A;  4YKK A;  1S7Y A;  4O3A A;  4GVO A;  3KOT A;  3HJ8 A;  4DXB A;  5IWA M;  5E26 A;  4QSC A;  2ZYM A;  4DR4 M;  3FTC A;  5KPR A;  1Y4C A;  1MXZ A;  2R18 A;  3M3K A;  2H25 A;  3FJG A;  2D3I A;  1OQG A;  4F31 B;  2ZAN A;  2Y7K A;  3SEU A;  4XKQ A;  3LSL A;  4IO6 A;  1IXS B;  4IJE A;  1N7W A;  2XH9 A;  1AOV A;  3C4M A;  4OET A;  1FW0 A;  4IB2 A;  3ZSF A;  2RCA A;  5I59 B;  2RCB A;  5FLX S;  1VR5 A;  3PVS A;  4OFJ A;  3N6T A;  4R74 A;  4LF5 M;  1LST A;  4H5G A;  2CV1 A;  1UTH B;  2QMW A;  2A5S A;  3SYK A;  2ONK E;  4O3C A;  3T38 A;  3I4Y A;  1SD3 A;  2ZAO A;  1QUK A;  1NFT A;  1R9Q A;  4QHQ A;  1JEU A;  4DV4 M;  2KLF A;  4X48 A;  2QPA A;  3VK7 A;  4MGK E;  3VV5 A;  1K82 A;  2LXE A;  4NE4 A;  3EIE A;  2CHG A;  2QS3 A;  1MH4 A;  3OMB A;  3VXC A;  3WHL A;  4BDO A;  4FAT A;  4IO4 A;  4HLQ A;  2XXH A;  2BJW A;  4F39 A;  4Q8R A;  3PUV E;  3TTL A;  3V83 A;  1QZM A;  3H6W A;  2ZMB A;  3KOZ E;  4X1D A;  1YPN A;  3KOX E;  3QUF A;  2DWN A;  5I57 B;  1B9J A;  1MPC A;  2J7N A;  2OWT A;  5M2V A;  3I5O A;  3WAE A;  2XGN A;  4R6H A;  2Z8D A;  1PDA A;  4YU0 A;  3B6W A;  5L9S A;  1ZBM A;  4YKJ A;  2PVU A;  4YKP A;  3N26 A;  3MVY A;  4DZ1 A;  2QL3 A;  4TLM B;  4U23 A;  4NXM M;  1FQA A;  3U72 A;  2O69 A;  1XXH B;  3GO8 A;  3RT6 B;  4LF4 M;  2F34 A;  3O6H A;  4YZZ A;  1ZJL A;  2R45 A;  4OZ9 A;  1EH3 A;  5H8Q A;  3FJ7 A;  4R7G A;  4YKI A;  2R6G E;  3TTM A;  1A8F A;  1QUL A;  2BJV A;  2XX7 A;  5L8D A;  4Z8X A;  1MXX A;  2V84 A;  1IY1 A;  1NMU A;  3PMV A;  4RJZ A;  1HT2 E;  3GPU A;  4B7F A;  4ZEC A;  2DVC A;  3IX1 A;  1POY 1;  4BBA A;  4EXK A;  1NNP A;  1IZ1 A;  4KYD A;  3SEY A;  1S3S A;  1LLS A;  1DGB A;  3E9X A;  1B3F A;  5LOM A;  3K6W A;  4WXJ A;  2XZF A;  4NXN M;  3ZC7 B;  1VSO A;  3M8U A;  2EO2 A;  2QMX A;  2I0C A;  1N3X A;  4DIG A;  3L27 A;  2QJE A;  1DO2 A;  3FGS A;  2RF1 A;  5AA2 A;  1NNK A;  3VDU A;  3UIF A;  5I2K A;  4THI A;  1WVJ A;  3FUU A;  4AI6 A;  2UXC M;  2OLB A;  2Q88 A;  3MBP A;  3U6S A;  2VII A;  1NNU C;  1W5T A;  1BLF A;  1D3K A;  2KW0 A;  4JI5 M;  3FAS A;  1DGF A;  2PX1 A;  3K0V A;  1H6U A;  3A98 B;  4FEC A;  4JXJ A;  3TL4 X;  4GIZ A;  1JR3 D;  1ORY B;  3IOV A;  2D7E A;  3PPO A;  4OFO A;  5KDT A;  1ANF A;  2Z4R A;  2H5Y A;  4N13 A;  4AQ4 A;  3MVW A;  4W5W A;  5IKB A;  4NWD A;  4R6Y A;  3KXE C;  1XWI A;  1TFA A;  1MY0 A;  4R9G A;  1QUJ A;  4FE8 A;  4RF0 A;  3Q8X A;  3U6D A;  1QAQ A;  3A3U A;  4PDI A;  4IO2 A;  4YAH X;  4M9X A;  3ZKL A;  3TYH A;  1L1Z A;  1DMB A;  3U5Z B;  3O66 A;  1B05 A;  5TU0 A;  1PB8 A;  4FEB A;  4QFK A;  5FTI A;  2DXR A;  1B3H A;  5ITY A;  3IL1 B;  5DYH A;  1X37 A;  2ESN A;  4LJA A;  3NBI A;  1LAX A;  4AW4 A;  3TPZ A;  2BNK A;  4S12 A;  3W0L B;  2O1M A;  4DCY A;  3QAX A;  4MB7 A;  2C5R A;  3EHT A;  1DPE A;  4LRS A;  2EA0 A;  5EP1 A;  3I51 A;  3DLN A;  5JEI A;  1US5 A;  4GKJ M;  4RPN A;  4MGZ E;  4OES A;  3OD7 A;  1JR3 A;  1D4N A;  5ITT A;  3MVZ A;  4B7G A;  3C35 A;  2YQZ A;  4KCC A;  2ANJ A;  4C1U A;  1Y1M A;  3U6E A;  1FTL A;  3KJT A;  5CMM A;  5ITO A;  4C0R A;  1GVN A;  1PM5 A;  2G8L A;  2OK2 A;  3H6T A;  4WEP A;  4ELR A;  3KEI A;  4NTL A;  2NQ8 C;  3BFU A;  1IN6 A;  2RKM A;  3QIM A;  3FUT A;  3HV1 A;  1MQI A;  3TEL A;  3KP0 E;  3FTF A;  3P7I A;  3S9E A;  3KSJ A;  4MFI A;  1IY0 A;  3FXR A;  3OO8 A;  4R3D A;  4QFN A;  3SEX A;  1LFH A;  4JYA M;  4EUO A;  3T1H M;  2FNC A;  4IBJ A;  3FYC A;  3VKG A;  3MJ5 A;  2CMO A;  4IGR A;  2G5G X;  2F36 A;  3N6U A;  4MBP A;  4AKI A;  3QWL A;  1BKA A;  3HHZ A;  4LCB A;  4YHH M;  1B5H A;  1LAH E;  3LC8 A;  1PC3 A;  2UYF A;  3CFL A;  2UYE A;  4AKH A;  3EPE A;  5BPV A;  2CV0 A;  3SDF A;  3AFH A;  5KCJ A;  1L5T A;  3IJO B;  4DV1 M;  3KOS A;  3BFT A;  4JI0 M;  3AXF A;  4L16 A;  1M5F A;  4F1V A;  2I49 A;  5I84 A;  3HST A;  5CRY A;  1Z5B A;  2QCU A;  1N78 A;  2HEU A;  3T15 A;  2Z22 A;  1RKM A;  3RTF B;  1MM7 A;  4PCZ A;  4RNA A;  1I6A A;  3K2D A;  3LVW A;  3SES A;  3AL0 C;  3S9M C;  1NNF A;  5I58 A;  3OSQ A;  2L6O A;  1M5D A;  4ECF A;  5E6J A;  1Z5A A;  1A8E A;  1B7Z A;  2NUV A;  5H8N B;  3L2A A;  3GRU A;  3MK6 A;  2ZM6 M;  3V8X B;  3VLV A;  2XEP A;  4R6K A;  2R65 A;  2D5W A;  4H5F A;  3HJS A;  1A55 A;  3HCQ A;  1L8Q A;  2VQF M;  1A99 A;  3TEP A;  3IO6 A;  5DVF A;  2B3F A;  3SYL A;  1G41 A;  5CBR A;  5EJC A;  1FQF A;  4IY6 A;  4GXS B;  2E0S A;  2RC9 A;  4ZE9 A;  3TWM A;  1LB8 A;  2FYI A;  1R2Z A;  1A7L A;  4IBD A;  3FTD A;  2DP8 A;  5I56 B;  2DOJ A;  3DP4 A;  4KQP A;  2XXI A;  1JEV A;  3EIH A;  4I8C A;  1ELJ A;  4ZEK A;  7CAT A;  5H8Q B;  5LMN M;  3HJQ A;  4FWH A;  3C9H A;  3V5A A;  3BBR A;  3PUY E;  1AIV A;  2V25 A;  1QUI A;  2Q2C A;  4CHT B;  3K6U A;  3U6M A;  1HQC A;  4DV6 M;  1IXC A;  3KSX A;  3I3V A;  4G68 A;  4LJ6 A;  5DEX B;  1QVS A;  4UA8 A;  5KPT A;  4U21 A;  3EQ1 A;  2CZL A;  2CHV A;  2WKY A;  4D82 A;  3LVV A;  3UZU A;  1TH3 A;  3HHW A;  3TPA A;  2DWM A;  4O3B A;  3KOY E;  4MLV A;  1Q1K A;  1IN5 A;  1CE2 A;  4OQO A;  1XC8 A;  4B3M M;  2HAV A;  1TFD A;  1OLC A;  4JWO A;  2AYS A;  2HQ0 A;  1L2D A;  4P11 A;  1MRP A;  3O6I A;  3U5Z A;  4YY3 M;  3KFU G;  2DWH A;  4X65 M;  4H6D A;  4GXA A;  5FHM A;  2HCB A;  5FTN A;  4BLA A;  4BDM A;  5FTK A;  2H98 A;  4MH5 A;  4LF9 M;  1IBM M;  3SC3 A;  3TCG A;  1SW1 A;  3GPP A;  1PEB A;  1IXR C;  2KZS A;  4N6P A;  1Z59 A;  1Y20 A;  3IG5 A;  4M0W A;  1URS A;  5I58 B;  4YMB A;  1DSN A;  5LMU M;  1RYO A;  4GHA A;  4X1B A;  4L4U A;  3O6G A;  3ZCB B;  3HPI A;  2L7H A;  1Q39 A;  4GMQ A;  4JV5 M;  3M3F A;  5HBC A;  4DCX A;  4IJF A;  3TCF A;  5H8F A;  2V93 A;  2XXW A;  4JI7 M;  2OJT A;  1Y4T A;  5TPA B;  3VVD A;  5DVI A;  1NNT A;  1LBC A;  4FCT A;  4MGY E;  1JW4 A;  1XHB A;  5JTY B;  3ILK A;  3PPP A;  1IIW A;  5ICQ A;  2CV2 A;  4FOR A;  4AG6 A;  4FCW A;  2D21 A;  4II7 A;  2LAO A;  4LJ5 A;  3GBA A;  3RFW A;  4EF1 A;  1PBQ A;  4OFL A;  2Q8J A;  3S2V A;  4K3F A;  1QAM A;  1IXZ A;  1MXY A;  5I59 A;  2DSF A;  1OQH A;  3KZG A;  2F7A A;  2UXA A;  2CHQ A;  2O7U A;  1MDP 1;  1SW2 A;  2AL5 A;  4ELO A;  2HKJ A;  4U1Z A;  1QAO A;  3IOT A;  3KN8 A;  3TWK A;  1N34 M;  2FFJ A;  2XXX A;  3TUS A;  4R73 A;  5L9M A;  4I8O A;  3U92 A;  5ITP A;  2XSZ D;  2FE8 A;  1MQH A;  2VD3 A;  1XC1 A;  1QKB A;  3K1P A;  2HHH M;  1QJM A;  4XBO A;  2DE4 A;  3SBJ A;  4F3G A;  2L7I A;  4FCV A;  1GVC A;  4DDD A;  4LJ9 A;  3LBS A;  3EHS A;  3Q25 A;  3VVE A;  2F5N A;  4PT5 A;  3I6V A;  2QSX A;  3KS4 A;  1QQW A;  1N3W A;  4QFO A;  2P2A A;  3THG A;  4E0X A;  1BTJ A;  3ZH9 B;  4C1T A;  2YNM D;  4QHS A;  4KO8 A;  2I48 A;  1SXJ E;  4RF1 A;  2IA4 A;  3PPR A;  3VLF B;  2XXV A;  2XX8 A;  4WW0 A;  1NH7 A;  1IM2 A;  3MP6 A;  1P1O A;  2ONS A;  4LZJ A;  1JW1 A;  1FQD A;  4L78 A;  1QKA A;  2AL4 A;  4LY6 A;  2I3W A;  1TH2 A;  2RC8 A;  3Q28 A;  2V3T A;  4X9T A;  4F1Y A;  4IBC A;  2F5P A;  3TTN A;  4Z0I A;  3PXG A;  5DVJ A;  5B70 A;  2G93 A;  4B3R M;  3G3J A;  3G7W A;  4QFL A;  3IO4 A;  5C18 A;  1HNZ M;  3PUW E;  2RGO A;  1NHW C;  1IXG A;  4OYV A;  3K6V A;  5EHS A;  4GRK A;  2Z8F A;  4QOS A;  4DV5 M;  1JET A;  4G4P A;  4NL4 H;  1LB9 A;  3PPQ A;  5EP4 A;  3AKZ A;  3IB0 A;  3KS8 A;  2UVI A;  4H8J A;  1SBP A;  4F22 A;  3H4Z A;  4F2Q A;  2DE3 A;  4IO5 A;  5FTL A;  4PET A;  1FQE A;  1GV8 A;  3C58 A;  3TQL A;  2KEB A;  2G29 A;  3TQS A;  4Z6Y A;  3V89 B;  3JR4 A;  3K02 A;  1MY1 A;  1O64 A;  2PT1 A;  1H76 A;  5ITR A;  3MZ9 A;  2Q2A A;  2YR0 A;  2THI A;  4NF4 B;  1P99 A;  2R46 A;  4AQY M;  1OJL A;  2Q89 A;  3KN3 A;  3FVK A;  1GTK A;  1B5J A;  2HXW A;  1IN7 A;  5EHM A;  1YUB A;  5CMC A;  3JR5 A;  3IR1 A;  3PGF A;  4RNS A;  1HSE A;  5FSW A;  3OXN A;  4OVZ B;  3CSB A;  3U6P A;  3IG8 A;  3UGW A;  1OIB A;  4ZS9 A;  3J7B A;  2RIN A;  5C1B A;  4D80 A;  1MY4 A;  1OFH A;  1P1W A;  3EN3 A;  1B51 A;  3SHG B;  1QYR A;  4NF5 A;  1N84 A;  4G8M A;  2O68 A;  5DEX A;  4AG5 A;  2Z4S A;  2Q2E B;  3UOR A;  5AA2 D;  1XS5 A;  4KPT A;  4LZ5 A;  4G68 B;  4I9D A;  2X7Q A;  3K6X A;  2A5T A;  5HM4 B;  1N0T A;  3N94 A;  1LCF A;  1LFG A;  5JTY A;  1PBP A;  3PUZ E;  4RYA A;  3A42 A;  1G59 A;  8CAT A;  2OQ4 A;  1P1N A;  4JI8 M;  5EXT A;  4IBF A;  1I69 A;  4I4L A;  2YLN A;  4FAJ A;  2B3B A;  4NF5 B;  3HGI A;  3FTE A;  1Y3N A;  1B52 A;  4JXI A;  2K47 A;  5A2Q S;  1URD A;  3CTW B;  3L6H A;  3WHK A;  2C98 A;  1MH3 A;  3PV0 E;  1EZ9 A;  4KFQ A;  3GPX A;  4ELP A;  1BP5 A;  4LQ2 A;  3IAZ A;  2CUZ A;  1WXQ A;  1W5S A;  5EQT A;  2C96 A;  4QNM A;  1OFI A;  2UUB M;  2QPQ A;  3GLF A;  3T93 B;  1NJF A;  2V1U A;  1ZMG A;  3QXM A;  1E94 E;  4FWD A;  3W9W A;  4F2O A;  3GLG B;  4M9S A;  2R71 A;  3J27 B;  1PB9 A;  2M8C A;  3TFL A;  4NRV A;  4DLD A;  4YIC A;  2CFO A;  5HPQ A;  3FZV A;  1QAN A;  2XXR A;  2XSZ A;  1H3D A;  2DWI A;  5JI2 E;  5I56 A;  1AL3 A;  3S9N C;  4FW9 A;  3B7D A;  4EDP A;  1IY2 A;  3VLW A;  1SXJ C;  3CG1 A;  4G8H A;  1E32 A;  2C99 A;  1F9B A;  5AA4 B;  1P1U A;  5CI5 A;  2EUC A;  5KO3 A;  2DWJ A;  2HZL A;  3SHF A;  4DR1 M;  1FQC A;  1XVX A;  1B40 A;  1FJG M;  2VOZ A;  2P1S A;  4G2Z A;  3HU1 A;  4BLC A;  1LGB C;  3I4V A;  1HQY E;  4JN6 A;  1TXF A;  4LZ8 A;  4LRT A;  1XHY A;  3AV0 A;  1AMF A;  3T9X B;  1D9V A;  1B2H A;  3UP9 A;  1IXI A;  3KG2 A;  1ZLQ A;  1YSY A;  1MXU A;  1JNF A;  4R72 A;  1NVM A;  4G4Q A;  4JI4 M;  3Q27 A;  2DWZ B;  2X4A A;  2P5T A;  1SQY A;  2F4V M;  3E13 X;  2QBY B;  3TQW A;  3U6L A;  1DGH A;  2IEE A;  5EXX A;  3K92 A;  2OPF A;  4FD2 A;  1MXV A;  4TQU Q;  3LUY A;  2V3Q A;  3W0F A;  1MQJ A;  2KRK A;  4M0D A;  1MU5 A;  4HCY A;  4LVQ A;  5ICT A;  2QS4 A;  1T3T A;  3F11 A;  4ZPX A;  1KFV A;  1XXH A;  3AOE A;  3R6U A;  2X8A A;  4DXC A;  3B6T A;  3O29 A;  3AJI B;  3RNN A;  1Z5C A;  3GLH A;  4LAT A;  3U60 B;  3DFZ A;  3FUZ A;  2W82 A;  2GRV A;  1ZIU A;  3RLF E;  1KSF X;  3VFD A;  4PD2 A;  2RKO A;  3SAV A;  1G3I A;  3VFJ A;  2C9C A;  4GH9 A;  2ZXT A;  5ITX E;  4G4N A;  3OSR A;  3TTK A;  4IO7 A;  2GHB A;  2V1C A;  4AB5 A;  3OEM A;  1Z7M E;  5EP2 A;  4IBE A;  3UGJ A;  2Z8E A;  2QP9 X;  1R7R A;  2VHA A;  4HTG A;  5DT6 A;  3LQR A;  4NF8 A;  1YTV A;  4LJ7 A;  3DM0 A;  5L9O A;  2A5T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...