3KSJA

The alkanesulfonate-binding protein ssua from xabthomonas axonopodis pv. citri bound to mes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
AEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
molecule keywords Nitrate transport protein
total genus 94
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA02
4IY6A 3S9EA 1DPPA 1N7WA 2F97A 2RF1A 2ZYKA 3OELA 2DXRA 3TTNA 3FVGA 4ND9A 2IA4A 3C9HA 1Q1KA 2RC9A 2ZNUA 1FW0A 1N0TA 2H9BA 3MPLA 1R9QA 4XXUA 3VVFA 4GL0A 2CMOA 3PV0E 3H7MA 1A99A 2FYIA 4KI0E 4Q0CA 4EF1A 2I4CA 2G93A 3UGWA 1ZLQA 3OOAA 3OSQA 2VP1A 4UACA 2DOJA 2VD3A 3GBBA 4MBPA 4GXSB 1NNTA 4F22A 3T22A 1H45A 3FXUA 3MVWA 3KFMA 3T66A 1XVXA 3TDJA 4RY1A 2WKYA 3K0VA 2FA7A 2XX8A 4PQJA 3QAXA 5I57B 1R6ZA 3N5LA 2QL3A 4ZDMA 3VE1B 3KJTA 4GQOA 3SEVA 3MUQA 3O9PA 3TAJA 2ZYOA 4GL8A 3UK4A 5I59B 4Q5TA 4QSDA 4G68B 1S50A 1URGA 3FVKA 3CI8A 2PBWA 4Q8RA 3IAZA 1GTKA 2QMWA 5EHMA 3K1PA 2VHAA 3N6UA 4R2BA 3FGSA 3V83A 2REGA 2XX7A 4HW8A 3Q28A 2XXPA 5CM6A 3WAEA 2PX1A 4OWDA 3MBPA 1II5A 4G68C 3CG1A 2F6GA 3UIFA 2OLBA 3QK6A 1B7UA 1POY1 1ZBMA 4RJZA 4ZECA 3HPIA 1N3WA 3KGCA 2CZLA 4G8MA 2XXWA 1MY2A 4N07A 3D4CA 1Y20A 4DXUA 1Y3QA 4KFQA 1US5A 5TPAB 3R7XA 5AA4B 2OJTA 4GRKA 5I2KB 4ZEKA 3PUYE 4F29A 3IOTA 1NL5A 2UXAA 2AL4A 4RXLA 3TCGA 5HBCA 4KHZE 1MM6A 1N76A 1GGGA 3C34A 3IJOB 4C1UA 4EDPA 3HCQA 3HHFA 4NF6A 5LOMA 3S9LC 5CMCA 4EQBA 4KYDA 3MW0A 3FV2A 4MF3A 3MZ1A 1Z7NE 2PVUA 3V89B 2V3QA 3KG2A 3FATA 2Z8EA 2ZYMA 4OZ9A 3N94A 3SDFA 2V3TA 3RPWA 1QUIA 4N6PA 4QHQA 3CFLA 1B51A 1PBQA 1JW1A 1SD3A 4MLQA 3TQWA 1B32A 5FHOA 1LAFE 3E13X 4JB7A 5ICTA 4DZ1A 3O6IA 1B58A 1D9VA 1QULA 2GHBA 3KOSA 1FTJA 1SW4A 2DYXA 2O69A 3C32A 1XOCA 2X26A 3HO7A 3O6GA 4IO5A 1MXYA 4F1VA 2RINA 4R9FA 1LFHA 1VSOA 1EZ9A 1OLCA 1URSA 1TXFA 3QIMA 3VV5A 3S9MC 1A54A 4GXAA 3O29A 4QSCA 3S4UA 4JSOA 1WVJA 2PT1A 3M3FA 1JEVA 4ISUA 4G8NA 3HSTA 4POXA 3RN8A 1N3XA 4IO6A 2R71A 2D21A 3G3GA 3ILTB 1FTKA 4JBZA 3MVZA 1SVXB 4LUBA 4YAHX 1QW0A 4QFPA 4GOTA 1POTA 3U72A 5AA1A 3C4MA 4C1TA 3M3KA 1MY4A 1B1HA 4OTEA 2DQVA 4K3FA 3TPAA 2Q2CA 4OQOA 3MP8A 2QMXA 2Z8FA 4XKNA 2NWJA 3T96B 3W15C 1UTBB 2DE4A 1DTZA 2PYYA 2XD2A 3Q26A 4DCXA 5JTYB 5B7DA 3PPPA 3BBRA 1MPDA 4O3BA 4F18A 3M8UA 2A5TB 4IO2A 5KDTB 3BKIB 1B3HA 1ZIUA 2GFEA 1ZKBA 2E1SA 4I62A 2DWJA 3QUJA 1DOTA 4NF8B 4RK9A 2DWIA 4O3CA 3THIA 3TKDA 3VVEA 1OVBA 4KQPA 2I48A 4Z0IA 2H99A 3H6WA 2O68A 1JW5A 4H1XA 5B70A 1PEBA 3RUMA 1QKBA 4RPOA 3P7IA 1R1NA 4BDNA 1I6AA 5KZTA 3TUSA 3CVGA 4DCYA 1VFDA 2X7PA 4LZ5A 2AL5A 4GD5A 5DYHA 1MS7A 3LSFB 2Q89A 4TQUQ 4JSDA 3O66A 3K6WA 1FQDA 5I58B 2DVZA 5CI5A 1Q35A 1M5DA 3OEMA 4HTGA 5CBRA 5CC2A 1FCKA 1O64A 1A7LA 3GZGA 3UORA 3VVDA 2O7UA 4DXBA 5ELVA 2GRVA 1D3KA 1OVTA 3UA8A 3VFJA 1GVCA 1M5BA 2ZNTA 1MH4A 4OYVA 1IQ7A 3OENA 4BDLA 1MXVA 1MY3A 3K4UA 1I6BA 2NUVA 4XKPA 4EUOA 2OWTA 3T9UA 4ZEDA 3PPOA 1NKXA 1L5TA 1B3EA 4F19A 4ELQA 5FTIA 1FQEA 1QUKA 1Y1MA 5CRYA 3IOWA 3GXAA 4POWA 1B5IA 3RQTA 1DTGA 4NF5B 2I3WA 1MY0A 3B6WA 5FTHA 4WXJA 3PPNA 1LBBA 1NNFA 1TFAA 4FEBA 4NF4A 1IXGA 4PFYA 4U1ZA 4ZZAA 1ANFA 3RNNA 2LAOA 1XHYA 5K2YA 2Y84A 3B7DA 4H65A 5EYFA 1EU8A 4PETA 3FVNA 1B3GA 1LAXA 2AIXA 5TP9A 3TFLA 3IX1A 4THIA 2Z23A 1LAHE 4ZEBA 2ESNA 3DELB 4HCYA 5ITOA 1UTHA 4ESXA 5K2XA 1ZMGA 3MZ9A 3SERA 2ONKE 1LFGA 3KBRA 4PFTA 3E9XA 4NE4A 3K01A 5KCJB 3LUYA 4DIGA 2D5WA 5L9OA 1IEJA 3O6HA 3PD9A 5FHMA 1VFEA 1N04A 2ONRA 1Y3PA 4NEDA 4KYEA 1SYIA 1SI1A 1SW5A 3AXFA 4BLAA 3ZSFA 1LB9A 3FVOA 1USYH 3U93A 3EQ1A 5I56B 3K6VA 2IEEA 2I49A 2OK2A 1XVYA 4FEDA 1Y1ZA 3SKPA 3V5AA 2ZNSA 5H8QA 2DP8A 2I4BA 4OENA 4XTCQ 3CRBA 4U1OA 3FUZA 5H8FB 4YMAA 3M3LA 5F7VA 1S7YA 2OWSA 1MXWA 4LZ7A 4AQ4A 1SI0A 1EZOA 4F3PA 4G2ZA 2Y7KA 1MG1A 3KSJA 2PMSA 1JVXA 1M5FA 1M5CA 3IOUA 3IB0A 4MH5A 3QSLA 3DM0A 1B0LA 1F9BA 3QUFA 3FD3A 3R26A 4X1BA 3KOTA 1NNPA 5H8SA 2B65A 2Y7WA 4EQ7A 3PD8A 2YPNA 3IO4A 4U2RA 3RGYA 2XXVA 1TFDA 1LBCA 2O7IA 4YZZA 4ELRA 3HV1A 1LGBC 4JXIA 1T0KA 5BWJA 1AMFA 1MXZA 2OBGA 4R6YA 4OXVA 4IO4A 1LB8A 2YLNA 4R75A 3PMVA 4YU0A 4C0RA 3K2DA 4BDMA 2G29A 1JVYA 3K6UA 4N13A 1B7HA 1ATGA 1ZJLA 2UVGA 4L17A 3G7WA 4FE8A 1JW4A 1CE2A 1P1UA 3EHUA 4X1DA 1A40A 4R6HA 4ECFA 3MJNA 4KR5A 4WEDA 3GLBA 5AA2D 1B0HA 2HEUA 3C33A 1OQHA 4BDQA 4ZS9A 2P0SA 4DE8A 4FJPA 3G3KA 3O2AA 3G3FA 5H8NA 3S2VA 4NWDA 3W9WA 3ZS6A 4M1VA 2ANJA 3FJMA 4QRZA 1QUJA 1N7XA 4H8IA 5CMKA 1WODA 5DEXB 5A5XA 1SW2A 3H03A 3Q27A 3W9VA 4OFOA 4AB6A 2I58A 4LZ8A 4FIMA 4PP0A 4RPNA 5AA3A 1KWHA 2OCUA 3FIRA 4NTLA 4OFLA 4YKJA 3TTKA 4Z7EA 4X9TA 3HHGA 4ELPA 3RT8A 3PU5A 3K6XA 3VLWA 3ECRA 1OIBA 2DXYA 4EQ9A 3CFZA 2R6GE 2Y7IA 3G3JA 1NH8A 4PFUA 4R6KA 1B40A 4NMYA 5TPAA 4LP2B 2A5TA 2AYSA 2ZXTA 2HFBA 1H43A 1Y4CA 2F36A 2KLFA 3N26A 4GIZA 3T9VA 1P99A 1A8EA 3S9NC 3C36A 1MPCA 1Z7ME 1Y3NA 2DWAA 2VGQA 3B6TA 3MZBA 4QSEA 3PUXE 1BTJA 3PMXA 4UA8A 1H76A 5AA4A 4PE5B 4ELOA 4IGTA 5I2KA 3MAMA 4ZEIA 2RC7A 1UTHB 2XXQA 3CR9A 1B4ZA 1B5HA 3DP6A 1HSLA 4P0IA 4QFNA 4XIGQ 2YJPA 5JEIA 1B7ZA 2UVJA 4NF6B 4I1DA 4R72A 3I3VA 1TWYA 2PT2A 5DVIA 3LSLA 3MP1A 5FHNA 2ALUA 4R73A 3O97A 5I59A 2XD3A 1TT1A 1H44A 1YPNA 2DE3A 4PFWA 2I0BA 2UYFA 1NNKA 3IO6A 4LATA 2B3BA 2GH9A 4GWOA 4RA1A 2O51A 4YICA 2P2AA 1MDQA 1MY1A 4YB6A 3LSXA 2I6EA 3JYRA 4QF9A 1LCTA 4P11A 3OMBA 3O28A 4TLLB 1FTOA 1EH3A 3SEYA 1BP5A 2W7YA 4DLDA 4YKKA 2XXUA 2NVUB 4FATA 1MQGA 2QS1A 5DVFA 4MFIA 1FTMA 1MH3A 3B6QA 2X7QA 4NWCA 4GFRA 3D4GA 1MRPA 1PDAA 2RCBA 1QJMA 4G8HA 1B52A 5DT6A 3IB1A 4R9GA 2QPQA 2REJA 3RLFE 4QFLA 5DVJA 3N6TA 3OD7A 1SDXA 4NF4B 4IY5A 5H8HA 3KEIA 5J1DA 3IL1B 5IAIA 3CG3A 3GBAA 5ITPA 3C31A 3MP6A 3U92A 4OESA 2RC8A 3LC8A 3FASA 1UQWA 1UIVA 2QS2A 1B6HA 3C35A 4YB7A 4F2QA 3USDA 1QKAA 1J1NA 2XX9A 4TLMB 3TQLA 5JTYA 3DP8A 3FZVA 3I5OA 2V3UA 3JZJA 4IO7A 5JK4A 2V93A 3QXMA 4E0XA 5I2NB 3EF7A 2O1LA 3MWBA 3OXNA 4FAJA 1I6QA 2Q2AA 4IO3A 5ISUA 3TTLA 4QFOA 5AA2A 1FQCA 1I69A 3KN7A 1P1OA 2Z22A 1FQFA 4U23A 4U21A 3ONMA 5EHSA 4DDDA 4F31B 1B46A 2F7CA 5IKBA 2ZMBA 1MQHA 1D4NA 1P1WA 3V8XB 1P1QA 2HZLA 2ABHA 2VOZA 4IB2A 1RYXA 2HAVA 2H4IA 3KN8A 2DWHA 4FORA 4DXCA 3TMGA 1IXHA 4XKQA 3H06B 1AL3A 1AOVA 3MPKA 1GR2A 3E4RA 1MPBA 1NMUA 2O6AA 3A3UA 1PC3A 2H5YA 4G4PA 3PGFA 4YKIA 3SEWA 4EXKA 4OHNA 1EZPA 1BKAA 3H4ZA 2XXTA 3IOVA 4OEVA 5DTBA 1LFIA 3QYTA 4X48A 1HSEA 3VDFA 3RTWB 3OO9A 3VXCA 2XXIA 1IZ1A 3KJ7A 3K00A 4RNSA 2ONSA 3DLNA 1PBPA 1NH7A 4WKMA 1URDA 1LLSA 4JWXA 5I58A 1O7TA 2UVHA 4ZZEA 1XT8A 4OEUA 3T9XB 1IXIA 1SBPA 4XKRA 3RY3A 1JETA 3T93B 3TZAA 1FTLA 4KCDA 1UTBA 3Q29A 1UIUA 2F5XA 2F6PA 3A09A 3CSBA 4H5FA 1YAEA 3OO7A 1IIWA 1PB8A 3KSXA 4H5GA 4FECA 4LQ5A 4WEPA 3H6VA 4Q30B 1RKMA 4YKPA 5HPQA 1MDP1 2Z8DA 4OFJA 4EF2A 2B3FA 3RT6B 3BFTA 4G77A 4JDFA 4H8JA 1AIVA 1O63A 1B5JA 4HS7A 3T9HB 3JV9A 1SYHA 2Q9TA 2F8DA 2QS3A 4LA9A 1MXXA 2XXHA 4H0WA 4RYAA 3I6VA 2O1MA 3H6TA 4TOZA 1IITA 2V84A 1S9TA 4NF8A 4I8CA 4U22A 3LBSA 2D3IA 2F35A 2VD2A 5H8NB 3TTMA 3ZKKA 3VLUA 2DVCA 4HCWA 3L6GA 3TODA 1DPEA 3G3IA 3ODBA 4F2OA 5TP9B 2Y7PA 5DEXA 3G3HA 1PB7A 4GLIA 3TTRA 2DS9A 3FV1A 3WAFA 3IR1A 5BUUA 3PUZE 4LQ2A 4H67A 1ELJA 5I57A 3CIJA 2HQ0A 3FJGA 1R9LA 2F7AA 1FQAA 2H98A 2DE2A 3TELA 4JWOA 5ICQA 5KCJA 1MQJA 3ILUB 1PB9A 3L6HA 3VLVA 2GHAA 3OSRA 1CB6A 4F1UA 4G68A 4BDRA 2A5SA 3TEPA 2Q88A 1YCJA 3LSWA 5L9SA 4KD5A 1SW1A 4RK2A 4OERA 2NOOA 3UN6A 4F3SA 2F7BA 4U4XA 3EHSA 2NXOA 2HAUA 1B2HA 1IUDA 2THIA 2I0CA 3OO6A 3CSGA 1QVSA 5H8HB 4F39A 5HM4B 4NF5A 4F3BA 3U94A 1FQBA 3BFUA 3EN3A 3IORA 3R6UA 1DSNA 1Y9UA 1YTVA 3TCHA 4F3GA 1H3DA 2V25A 3F11A 1B9JA 4OETA 2XXXA 4MLVA 3K1MA 1M5EA 1SQYA 4I9DA 5AE4A 3ZKLA 5H8FA 3SEUA 2Q8JA 3SEXA 2I3VA 1BIYA 2RKMA 1XC1A 2HZKA 4R2FA 2XHDA 1IXCA 2QSXA 5L9MA 5CMBA 4KYSA 2Y7RA 1DMBA 1D9YA 2R9JA 4M4GA 1GV8A 2HCAA 3IB2A 3MC2A 3CFXA 5CBSA 4YMBA 1JNFA 1N84A 2H25A 3PMWA 3PPQA 3PPRA 4KPTA 3FXRA 2BJJX 5CMMA 5L8DA 3U8QA 1JQFA 3LR1A 2ZYNA 3IK6B 4QFKA 4ZE8A 4BDOA 4GF8A 3H3GA 3OEKA 4H6DA 4O3AA 3FJ7A 1B3LA 1P1NA 2FNCA 2M8CA 2QS4A 4LONB 3EPEA 3KN3A 1BLFA 5KDTA 1OLAA 4OVJA 4AB5A 5I56A 1Y4TA 2F78A 3MVXA 4IGRA 1LAGE 1XS5A 2HXWA 4KCCA 1MM7A 3OO8A 5F1QA 1RYOA 1A55A 1MXUA 2QJEA 3FXQA 4EXLA 1US4A 1ZTYA 3KZGA 3UP9A 1OMPA 5H8QB 3E3KA 2F34A 4ONYA 4U4SA 1HSJA 1NFTA 3IJXB 4LVQA 5A5XB 1USYE 3VXBA 2QRYA 1B4HA 1AH5A 1LCFA 2UVIA 3MVYA 2UYEA 1LSTA 3K1NA 1B3FA 1A8FA 2O84X 4YB5A 3SETA 3Q25A 3U1OA 1WDNA 4GVOA 4ZEFA 1VE4A 1ZU0A 4ZE9A 2XXYA 3DP4A 3H6UA 3PUVE 3RTFB 5M2VA 5I84A 2E0SA 1B05A 1MQIA 1MQDA 1OQGA 2RCAA 2XXRA 3MQ9A 3PUWE 4OMBA 4E0WA 2OZZA 1VR5A 3K02A 4F1YA 3A3CA 4R74A 5TU0A 5I2NA 1B1XA 4P0GA 3TYHA 2DSFA 2P1SA 5AA2B 4JWYA 3EHTA 1JEUA 3HN0A 4ESWA 3TCFA 3SESA
chains in the Genus database with same CATH superfamily
4IY6A 3S9EA 1HQYE 1YLAA 2ZYKA 5EQTA 4JI0M 1EYIA 3H4JA 2IA4A 5KQDA 2RC9A 2ZNUA 1FW0A 3GYYA 3MPLA 1OIZA 1R9QA 4XXUA 3QYBA 1NV4A 3E78A 4KI0E 4CJ6A 4EF1A 3UGWA 1ZLQA 4UACA 1NNTA 3TDJA 1F4IA 5C18A 2XLJA 1VEGA 2OOBA 3QAXA 4G6ZA 3N5LA 2QL3A 2CEAA 5EQ9A 4ZDMA 3VE1B 4GQOA 3TAJA 1YXIA 2ZYOA 3UK4A 4K0KM 2Q8MA 4GRIA 5EYGA 2PBWA 4Q8RA 3IAZA 1GTKA 5EHMA 5ET8A 2XWOA 3N6UA 3FGSA 4R2BA 4LF9M 2XXPA 3WAEA 2PX1A 4O8MA 1KZ8A 2F6GA 3QK6A 4RJZA 1OTRA 3AL0C 1QUSA 4G8MA 4UN2B 1PGYA 1Y20A 5IZ1A 2LXEA 1Y3QA 1US5A 3PUYE 2V4CA 2AL4A 1IMCA 2XF3A 4RXLA 1JB0F 2R46A 5HBCA 4KHZE 4PDIA 3GLGB 2B4LA 3HHFA 2Y20A 3FV2A 1NJFA 4MF3A 1ZAEA 2CHVA 3I51A 3V89B 3FATA 1IMEA 2Z8EA 1QGXA 5GKNA 3SDFA 3PNYA 2JY7A 3RPWA 3DZDA 3NOHA 2LBCA 4AQYM 4G4NA 3E13X 4OVRA 3OTOM 2KRKA 1OFHA 4DZ1A 3SAUA 3KOSA 3C32A 4B7GA 2HHMA 3C3EA 1URSA 1TXFA 1NV8A 1Z5AA 3E9SA 3O29A 4Q7JA 2JY5A 5I7IA 3C58A 4OVPA 1T43A 4JSOA 2XZUA 4G8NA 1NNJA 4POXA 3SBJA 2R71A 4LGYA 3G3GA 4B3TM 4PC9A 4GOTA 3QYEA 1B1HA 2DZNB 2QMXA 4XKNA 2NWJA 3W15C 2DE4A 1NUYA 4GEWA 2A5TB 1E9SA 2WX9A 4AS5A 4E0WA 4I62A 2DWIA 3THIA 1OVBA 3C3DA 3JR4A 2H99A 1IN5A 5EQAA 3GLGE 3HFUA 3TUSA 4MNIA 1I6AA 3CVGA 4DCYA 2DAEA 2X7PA 2QVRA 5DYHA 1MS7A 2Q89A 4TQUQ 1OAIA 3AV0A 1IY1A 3K6WA 5CI5A 3FXBA 4HTGA 5CC2A 3RGSA 3L2AA 5IT9S 3VVDA 4DXBA 5ELVA 2GRVA 2D7HA 1D3KA 1QUTA 4BDLA 5DYGA 3K4UA 1HNWM 3M7GA 3LCUA 4ZEDA 3MJ5A 1NKXA 2JWSA 4N6KA 2QPAA 5ITRA 5CRYA 3IOWA 4POWA 5FTHA 1TDHA 4L8RC 1TFAA 3RPLB 1IXGA 4PFYA 1ANFA 3K2LA 2EJSA 2KHHA 2LAOA 3T38A 4L16A 5K2YA 2NQ8C 3B7DA 3RYDA 2FBPA 1EU8A 3LV0A 4GIPA 4PETA 3FVNA 1LAXA 4THIA 1LAHE 4ZEBA 5ITOA 4QOSA 1EIJA 3MZ9A 2ONKE 1NUXA 3KBRA 3K01A 4GWYA 3UJNA 5L9OA 2VDBB 3O6HA 3T1BA 4NEDA 1SW5A 4MMPA 3BIGA 4DR4M 1R7RA 2OPFA 4X65M 2OK2A 1Y1ZA 3SKPA 3V5AA 2F5OA 2ZNSA 5F7VA 1GKIA 1MXWA 1FJGM 4F3PA 2EKFA 3HX3A 2Y7KA 3KSJA 2MGWA 4M9XA 5FTKA 2R0IA 1VG5A 2L7HA 2F5SA 3PD8A 4N4UA 2ZZWA 1FJ9A 4ELRA 1AMFA 2OBGA 7CATA 4DR2M 4IO4A 4R75A 3SHFA 4N13A 2UVGA 2X8AA 3LCVB 4FE8A 3EHUA 2RGHA 4WEDA 4BDQA 1OQHA 4HE1A 4XF5A 4DE8A 4FJPA 3O2AA 3KS4A 1VDLA 4FCVA 3EKIA 4H8IA 5CMKA 1WODA 5A5XA 1SW2A 3Q27A 2I58A 4RPNA 5DYIA 3FIRA 4NTLA 1SXJC 5EQ7A 4MAGA 1NI9A 4R6KA 4FBPA 5TPAA 2A5TA 2AYSA 4LJ8A 2B3TA 1Y4CA 3HHZA 2KLFA 3T9VA 4ZPXA 2B4MA 3C36A 4P16A 1A5TA 2DWAA 2VGQA 3MZBA 1NHGC 3PUXE 1BTJA 4FD2A 5ITTA 4ZEIA 1N75A 1UTHB 5IWAM 3CR9A 1IN4A 4DR5M 4XIGQ 1TH2A 2OQ4A 2UVJA 3FD9A 3I3VA 3FUVA 4R73A 4L15A 1NHWC 1YPNA 2R8TA 2HWJA 2PCRA 2B3BA 2GH9A 4GWOA 3RGPA 3CF0A 3LSXA 3JYRA 3HZJA 4P11A 4GHAA 1EH3A 2W7YA 4YKKA 2NVUB 2QS1A 1MH3A 3SYKA 1RDZA 3F92A 2P5TA 1L1TA 4NOOB 1FPJA 2RCBA 4G8HA 4R9GA 3RLFE 1DCUA 1SDXA 3TPZA 4IY5A 4LJ5A 1QAMA 5J1DA 4MJOA 4JI5M 2P3NA 2F5NA 1NNUC 2R45A 3FTCA 1VEKA 4MHFA 2XX9A 4P1EA 4TLMB 3DP8A 3JZJA 4IO7A 2V3UA 1SXJB 2L5VA 5I2NB 3GQ3A 3EF7A 3THGA 2C9OA 3MWBA 3TTLA 1FQCA 3KN7A 1INPA 5EHSA 4DDDA 4WW0A 3B7NA 3L26A 2RGOA 3KOZE 1K3XA 4IB2A 1NSFA 1TH3A 2KDLA 1YYZA 4G4PA 1PC3A 4EXKA 3VDPA 3CF6E 4LG2A 1FPFA 3DOAA 4QHSA 1EZPA 3IOVA 4OEVA 3VDFA 1LBVA 4JVCA 2XXIA 5EQ8A 4RNSA 2ONSA 1HNXM 4WKMA 1H6UA 4ANRA 1Q9DA 4OEUA 3RFWA 1L8QA 2LVQD 4LUBA 3TQSA 4H5FA 3CSBA 4NAPA 1YAEA 1IIWA 4OU7A 3U5ZB 5HPQA 2Z8DA 4OFJA 2B3FA 1J09A 3RT6B 1V34A 1VQ1A 4LCBA 5EP4A 4JDFA 4QOZC 4PAFA 1D0LA 1NV6A 2Q9TA 4RYAA 4H46A 2W82A 4NXMM 1IITA 2V84A 1S9TA 3KW6A 2WBDA 4X04A 4PD2A 3TTMA 3ZKKA 3VLUA 2DVCA 4HCWA 2DHYA 3G3IA 4F2OA 2Y7PA 5DEXA 2GNOA 3WAFA 4PF8A 1G4AE 5BUUA 4LQ2A 1ELJA 2Q74A 3CIJA 2QVUA 1PB9A 1FJ6A 3PNVA 1IFYA 4LJ4A 3OSRA 1QYRA 1YCJA 4KD5A 1SW1A 1PM5A 1G59A 3UN6A 2F7BA 4U4XA 2QBYB 4JYAM 2QENA 2THIA 5ITQA 1N33M 4X62M 4F39A 5HM4B 2DZOB 4NF5A 3U94A 4R71A 2D7EA 4B08A 2JY8A 3F11A 3KDSE 4MLVA 5AE4A 4BBAA 2DVWB 3ZKLA 2Q8JA 3U61A 2F5QA 1FRPA 3GLFB 4LJ9A 4LJ7A 4AKHA 2LNHC 1IXCA 1PJSA 5CMBA 1GV8A 3IB2A 1FSAA 5CBSA 3PPQA 3PPRA 5CMMA 1PJTA 4DV0M 5L8DA 4ZE8A 4QFKA 2ZYNA 2Y5KA 5ITYA 3H3GA 2XWIA 4KXPA 3FJ7A 4G3OA 2M8CA 1WIVA 2J5YA 4CGYB 1FPBA 3EPEA 3KN3A 5KDTA 2OX3A 4IGRA 2CHGA 2ZTCA 2KEBA 3FXQA 4EXLA 1SXJD 4ONYA 3IJXB 3T1YM 2L2DA 3VXBA 1B4HA 2UYEA 4YB5A 3SETA 2O84X 3Q25A 2O5RA 5FTJA 4N8YA 4ZEFA 1ZU0A 4ZE9A 2V6ZM 2XZFA 3H6UA 4XK8F 3PUVE 1B05A 1OQGA 5EXTA 5F3WA 5DW8A 2ZBKB 3PUWE 1VR5A 3D8LA 3K02A 4DI3D 5I2NA 2KQZA 4P0GA 2P1SA 4LJAA 2ERCA 4IIWA 5ITUA 2MJ5B 2CV2A 1NV3A 3OELA 2DXRA 3HU3A 3TTNA 4AKIA 1XMQM 2H9BA 4GL0A 3H7MA 2FYIA 1YUBA 1HNZM 4HE2A 4OVQA 1QAOA 1AWBA 1WHCA 4JI7M 2VP1A 2X4AA 3SYLA 4MBPA 4F22A 3T22A 3M6AA 3MVWA 4M9SA 1XVXA 4JI1M 1DGHA 3SZPA 3B74A 2XX8A 1R6BX 1R6ZA 1DO0A 2QZ4A 4L78A 4MGKE 1GL7A 2MR9A 5E26A 4GL8A 4JV5M 1Q02A 3GQ5A 2PFZA 3U6SA 4I40A 1NV0A 2HL7A 2REGA 2XX7A 4HW8A 2DAIA 2ZZXA 4OWDA 1C7YA 1IXZA 1IMBA 3HPIA 4O7MA 2XXWA 1MY2A 3D4CA 4PF6A 1FPLA 4KFQA 2CZIA 2OJTA 4GRKA 4ZEKA 2UXAA 3S9LC 5LOMA 4EDPA 4NF6A 4W5WA 4KYDA 4IBFA 3MW0A 1XI6A 1Z7NE 3KG2A 2JZ1A 4GC9A 2ZYMA 2R62A 4I3YA 5ET6A 3N94A 2V3TA 1QUIA 2FVZA 4N6PA 4PGNA 3FYDA 3CFLA 1PBQA 1K82A 3TQWA 1MJGM 5ICTA 4I81A 1QULA 2UXCM 4QXDA 1FTJA 2FH0A 2DYXA 2O69A 4IO5A 1XOCA 2QCUA 2R18A 3S9MC 1A54A 2XXKA 4XFEA 4GXAA 3U60A 2DDKA 5FTLA 2PT1A 4ISUA 3I4YA 3DFZA 2FIXA 2D21A 3J7BA 1FTKA 4LY6A 4JBZA 1POTA 1EYKA 1YZ0A 3M3KA 3TWLA 1MY4A 2DQVA 3TPAA 2Q2CA 1N77A 2Z8FA 1UTBB 2XD2A 3Q26A 4DCXA 3BBRA 1MPDA 5KDTB 4JVIA 1B3HA 2GFEA 1ZKBA 2E1SA 4RK9A 2DWJA 3QUJA 4NF8B 4O3CA 2I48A 4P56A 4Z0IA 2N35A 3H6WA 5B70A 1QKBA 3WHKA 4BDNA 2UUBM 2XFSA 4LZ5A 2DWMA 3W67A 4LZJA 4GD5A 4DR1M 4O94A 5A2QS 1LV7A 4IBIA 1T6OA 1KYIA 5I58B 2APLA 3V76A 1M5DA 4N81A 5CBRA 1S3SA 1FCKA 1A7LA 1W5SA 4KHPM 2O7UA 2Y0TA 1IMDA 1M5BA 2ZNTA 4OYVA 2XSZD 3OENA 1J5EM 1MXVA 1DO2A 4XKPA 2JJKA 5BR8M 4EUOA 2OWTA 3PPOA 1HQCA 5KO3A 5IZZA 1FQEA 4LF7M 1DTGA 4I5SA 2GQFA 3B6WA 3K92A 1LBBA 1NNFA 1PJQA 1NV7A 4NF4A 4B3RM 3KOXE 5KPRA 3TFLA 3IX1A 4D80A 2Z23A 2ESNA 3GLFA 3DELB 4HCYA 1UTHA 4DI4B 2O01F 3AKZA 5K2XA 1IXSA 2DWZB 4PFTA 3MYUA 4TUWA 1IEJA 3PD9A 4NC6A 5FHMA 2CEYA 2ONRA 1Y3PA 3IG5A 1Q3BA 3CF2A 4KYEA 1R2ZA 1SYIA 3A42A 3HKPA 4DV6M 4NRVA 1MU5A 3ZSFA 1LB9A 2KW0A 1N34M 2XEPA 1USYH 3K6VA 3GLIA 2I49A 2CE7A 2R6FA 4FEDA 5EXSA 1LBWA 3HU1A 2I4BA 4XTCQ 3CRBA 3E46A 3FUZA 5H8FB 1S7YA 2OWSA 2CWBA 1SI0A 2QQ8A 3AJIB 3BBZA 3PVSA 3HHWA 4G2ZA 1Z5CA 3FTFA 1NNPA 4JI3M 2Y7WA 1IQPA 4GHLA 1TFDA 2O7IA 3DA1A 2WZJA 4L6V6 4R6YA 4OXVA 4C0RA 3QMFA 3K2DA 2G29A 3W68A 1B7HA 1QZEA 1JR3E 4L17A 2JZ0A 1JW4A 1P1UA 2HHHM 4X1DA 1A40A 4ECFA 3GLBA 5AA2D 2HEUA 3C33A 1DBZA 2P0SA 5H8NA 1ZMUA 4NWDA 4M1VA 4QRZA 1N7XA 3T1HM 3W0LB 1G3IA 3D1RA 3H03A 4FIMA 5E6JA 1KWHA 2OCUA 3TTKA 2Z7JA 4X9TA 4ELPA 3PU5A 3ECRA 1OIBA 3A45A 4PFUA 3SFZA 4NMYA 1NV1A 4LP2B 2ZXTA 3N26A 3M0EA 2KXEA 4PBQA 4BLCA 1A8EA 1TDZA 1MPCA 1Y3NA 5ET5A 5AA4A 1H76A 1DV0A 4IGTA 2RC7A 2L4EA 2XXQA 3TWKA 3ZH9B 4QFNA 4I1DA 2VPNA 5FHNA 5I59A 3O97A 1ZV1A 3J7AS 1H44A 2DE3A 4GWSA 3IO6A 4YICA 4JI8M 1N32M 1NNKA 4LATA 2O51A 2K9DA 2P2AA 1MDQA 2O25A 2I6EA 2G5GX 2KR0A 2XXUA 1MQGA 1D9QA 3B6QA 1RDYA 2X7QA 1CNQA 2WYKA 3D4GA 1D2NA 2FS1A 1L2BA 2QPQA 4QFLA 2QBYA 4NF4B 1W5TA 5H8HA 2UXDM 1NV9A 1IBKM 3C31A 5ITPA 1FPDA 3U92A 1UIVA 1B6HA 1G0IA 4YB7A 3D8BA 3USDA 4FW9A 1QKAA 2Z4RA 4P47A 1XC8A 3FZVA 2HPGA 3CHGA 3UK6A 2V93A 2O1LA 4IO3A 4LFBM 5AA2A 1P1OA 3ONMA 2BJVA 4F31B 1KSFX 1BK4A 2HZLA 5ITXA 1RYXA 2H4IA 2HAVA 3TMGA 1AOVA 1AL3A 2QP9X 3E4RA 2O6AA 4OVSA 3SEWA 4YKIA 3PGFA 1FBCA 3H4ZA 5F24A 1G0HA 5DTBA 1L1ZA 4X48A 4DR3M 3OO9A 1IZ1A 4OANA 3DLNA 1PBPA 1URDA 2VF7A 2UVHA 4ZZEA 1IXIA 3RY3A 4LFAM 2DWLA 1NO1A 3Q29A 3OO7A 1LEVA 3BFTA 4G77A 2KNVA 4H8JA 1O63A 1B5JA 3FUUA 3T9HB 3SARA 3JV9A 1SYHA 1ZQ9A 3IFAA 2DWNA 1MXXA 2XXHA 4H0WA 3T15A 2O1MA 1K9ZA 4GX4A 1Q39A 1KFVA 2YQZA 4U22A 2F35A 2VD2A 5H8NB 2KZUA 2R65A 3ODBA 1G8PA 2EA0A 5TP9B 4JVDA 2OOAA 4GLIA 3PUZE 1FBHA 3A29A 2HQ0A 3TELA 1R9LA 2H98A 2DE2A 4JWOA 3L6HA 3GLHE 4DUZM 3UMMA 4L4UA 2Q88A 3LSWA 3FKEA 3HU2A 4RK2A 4OERA 4F3SA 1FBPA 2HAUA 2NXOA 4AS4A 1UFZA 1QVSA 1OIPA 1FQBA 3R6UA 4HXVA 1GO5A 4OETA 3K1MA 1M5EA 4I9DA 1YSYA 4IR8A 2I3VA 2JP7A 3B7ZA 1EE8A 2HZKA 1D0KA 3ROJA 2Y7RA 1D9YA 3JAMS 3MC2A 4YMBA 1JNFA 4IBBA 4KPTA 2K0BX 3U8QA 1JQFA 3IK6B 4GF8A 5IZ7D 4O3AA 1B3LA 1QDTA 3LVVA 4LONB 1BLFA 3LQQA 1OLAA 4OVJA 3U6PA 2Z3XA 1Y4TA 4I4LA 1LAGE 4KCCA 4F29A 1MM7A 2KNZA 5F1QA 1A55A 1SPIA 1GL6A 2BJWA 1US4A 2J7NA 2F34A 4RF1A 1USYE 2QRYA 1LCFA 2L09A 1WDNA 4KLNA 2XXYA 3DP4A 4PBHA 2LVOC 2ZZVA 3RTFB 2RCAA 3MQ9A 2XXRA 4PTKA 2OZZA 3FE3A 1B1XA 2XFTA 4ESWA 3ZCBB 5IZ3A 1DPPA 3TWMA 1N7WA 1G71A 2F97A 4LF6M 2RF1A 3C9HA 3TCGA 4IBDA 1N0TA 1MX0A 4M0DA 3VVFA 2CMOA 3PV0E 4JI2M 1A99A 1TR8A 3FRHA 2G93A 2VD3A 4G61A 2EKKA 3KOWE 2CHQA 4GXSB 1H45A 5I5PA 2UU9M 4RY1A 3K0VA 2FA7A 3RE8A 4PQJA 3FRIA 3KJTA 3SEVA 2C9CA 3MUQA 3O9PA 4P17A 2YFQA 5I59B 2ZAOA 4Q5TA 4G68B 1S50A 1URGA 2YNMD 3K1PA 2VHAA 1D0MA 4WURA 5LTCA 3V83A 1CUKA 5CM6A 4G68C 3UIFA 2OLBA 1B7UA 1POY1 1ZBMA 3FUTA 4ZECA 5T3JA 5EP1A 3KGCA 2CZLA 1UM8A 4P3LA 3R7XA 5TPAB 2BNKA 4I8OA 3U61B 3IOTA 2AHMA 4LZZA 1JR3D 1P3QQ 1N76A 4C1UA 3KP1E 1GGGA 3AOGA 5CMCA 5EJCA 4QBAA 3MZ1A 2V3QA 4Z8XA 1VDWA 4OZ9A 1GABA 5BPVA 4MGZE 1B51A 1SD3A 1B32A 1LAFE 4JB7A 4DV1M 3O6IA 1D9VA 3O6GA 3HO7A 2R4JA 2CV0A 4R9FA 3AOEC 3U6MA 1LFHA 4LRSA 4X64M 5I3SA 3QIMA 3VV5A 3ILKA 4N17A 2LWXA 2ZANA 2WEFA 4QSCA 2Z8YM 3S4UA 4PE3A 2DAMA 3U6OA 1JEVA 3HSTA 4IO6A 3ILTB 3MVZA 1SVXB 1PRBA 3EIEA 4QFPA 1DGBA 3U72A 1T3TA 4A3VB 3GO8A 3MP8A 4GBVA 2PYYA 1DTZA 5B7DA 5JTYB 3PPPA 4F18A 4JN6A 1ZIUA 3A46A 2F5PA 1DOTA 3VVEA 3TKDA 4GX3A 1QZMA 2O68A 1JW5A 3B8BA 3RUMA 1DGFA 2I7NA 1R1NA 1VFDA 2BWEA 3HWSA 4AW4A 3LSFB 4JSDA 3O66A 1FQDA 2KRUA 1Q35A 3OEMA 1XHBA 3GZGA 2YR0A 1OVTA 3T0JA 1OKSA 2CUZA 3VFJA 1GVCA 3W0FA 1IQ7A 4LJ6A 3VLFB 1DK4A 3QAUA 3KFUG 4PDDA 1B3EA 4IBEA 4F19A 4IBJA 5KPTA 3RQTA 4JXJA 3I04M 3PPNA 4NL4H 4YHHM 3RNNA 4XEQA 2Y84A 5EYFA 1B3GA 4GWXA 2AIXA 2WBBA 4M9ZA 1ZMGA 3SERA 1XXHE 5KCJB 4AI6A 4DIGA 2D5WA 4GH9A 1N04A 4II7A 3LUZA 4AG6A 2VIIA 1FPKA 4BLAA 1NY6A 3SMPA 5I56B 3EQ1A 2LHGA 4LRTA 2IEEA 4AZFA 1XVYA 3GPUA 4IBGA 5H8QA 2DP8A 4LF5M 3MK6A 4YMAA 3ISPA 3GRUA 3B50A 5ET7A 2Y21A 1C1KA 3UGJA 4OVZA 1MG1A 2PMSA 3L28A 1JVXA 1TTEA 1M5CA 4MH5A 1IBMM 3IB0A 3DM0A 1B0LA 2FE8A 5FTMA 3KOTA 5H8SA 2DAGA 2YPNA 1LBCA 3EIHA 1LGBC 4I3EA 5BWJA 1NJGA 4QNRA 1XNRM 3PMVA 4UABA 4BDMA 1JVYA 2I7PA 3HHYA 2F3DA 1ZJLA 4RKUF 4PAIA 4ZS9A 3W9WA 3FJMA 5DEXB 1FBDA 4MX6A 3W9VA 4OVTA 4M0WA 1HR0M 5DNYA 4AB6A 4PP0A 5AA3A 3B9PA 4OFLA 2M60A 4YKJA 1RDXA 3K9PA 4Z7EA 2BJIA 3HHGA 3RT8A 3VLWA 1IY0A 4Y28F 2DXYA 4EQ9A 2Y7IA 3G3JA 1NH8A 4HLQA 3MMPA 4BB9A 1XMOM 3Q8XA 1H43A 3ZC7B 2F36A 4GIZA 1XNQM 3NWLA 1P99A 1IN6A 1X37A 1Z7ME 3B6TA 4RF0A 3R9XB 3PMXA 2DXIA 3BOSA 1DGGA 4ELOA 1I94M 3FUWA 1B4ZA 4P0IA 2YJPA 1NVMA 1TWYA 4CISA 3LSLA 3MP1A 4N6DA 1TT1A 3TL4X 3H4MA 2I0BA 2UYFA 5DVIA 1IM2A 2ZM6M 4RA1A 2RRUA 2JY6B 1MY1A 4YB6A 4D81A 3T93B 4TLLB 3OMBA 3O28A 4DLDA 1FTOA 1PJJA 5DVFA 3FYCA 3SHGB 2HXRA 1FPIA 1QJMA 3IB1A 3BIHA 2REJA 3N6TA 3OD7A 3RPLA 3VKGA 3KBZA 4OESA 2RC8A 3FASA 4AG5A 4NSRA 2CZHA 1E94E 4F2QA 3TQLA 1VDDA 1IBLM 3I5OA 5JTYA 4H45A 3B89A 3OXNA 4HEOA 4GMQA 1I6QA 2K6BA 2E5LM 2Z22A 2D7GA 5EP2A 2G8LA 1VEJA 1FQFA 4U21A 4U23A 5IKBA 2F7CA 2ZMBA 1MQHA 4GWUA 3V8XB 2VOZA 3HGIA 2DWHA 4FORA 4DXCA 1IXHA 4DV3M 1FPEA 4XKQA 1FPGA 1GR2A 5J16A 4FWHA 4DBGB 1E9RA 2H5YA 2XXTA 4IBCA 3GPXA 3CTWB 3QYTA 4P9KA 2CFOA 3KJ7A 3K00A 2C96A 1SG9A 1LLSA 4JWXA 1NY5A 1O7TA 1XT8A 3AOEA 4AKGA 3T9XB 1SBPA 2P3VA 4XKRA 5FBPA 4CHTB 1JETA 3TZAA 1FTLA 2Z4SA 1UTBA 4KCDA 3GLHA 1UIUA 2F6PA 3A09A 2CEXA 4H5GA 3KSXA 3NBIA 4LQ5A 4WEPA 3H6VA 4YKPA 2DHRA 1RKMA 1MDP1 4GKJM 4EF2A 4X8RA 1AIVA 4IJFA 3LVWA 4Z6YA 2QS3A 4LA9A 1EFUB 4OW0A 4QHTA 1K3WA 3H6TA 4TOZA 4NF8A 2PFYA 4PFRA 1DPEA 3L27A 3G3HA 3K9OA 4H67A 2KA6B 2F7AA 5KCJA 1L2DA 1TH4A 1MQJA 3ILUB 3VLVA 2GHAA 4DV5M 3KXEC 4F1UA 4G68A 3TEPA 1I4WA 2QVVA 4ITQA 3PTYA 2JNHA 3PXGA 2NOOA 3EHSA 4N91A 1B2HA 3OO6A 3CSGA 5H8HB 4F3BA 1XB2B 1YTVA 1Y9UA 3E21A 2DENA 3TCHA 4F3GA 1H3DA 3U60B 2XXXA 3BXWA 4GITA 1SQYA 4DV4M 1WJ7A 3A98B 5C1BA 3SEXA 3KC1A 3SEUA 1BIYA 2RKMA 4JI6M 4OVZB 4FWGA 5L9MA 5FTNA 2R9JA 3Q8GA 3CFXA 2H25A 2BJJX 3LR1A 3VDUA 4BDOA 3OEKA 1P1NA 2QS4A 1IXSB 1Y8GA 3KVWA 3GLIB 4NX1A 4HE0A 1MXUA 2QJEA 2JUJA 1ZTYA 3KZGA 1OMPA 3GRRA 3CGWA 1NFTA 5A5XB 4PDHA 2DI0A 5IM2A 3MVYA 3U1OA 1A8FA 4XBOA 2FHYA 1SXJE 1IXRC 1VE4A 4GC5A 4HL4A 4N15A 4NGUA 1OAOC 3KOYE 4NRWA 2C99A 3FTDA 5IGAA 1IN8A 3A3CA 4R74A 5TU0A 1JEUA 3HN0A 3TCFA 3SESA 3FVGA 4ND9A 4XGIA 5H37D 1Q1KA 4Q0CA 2I4CA 2XWVA 3OOAA 3OSQA 2DOJA 3GBBA 4PCZA 3FXUA 3KFMA 3T66A 1GJSA 3SATA 2WKYA 5I57B 2OO9A 1R5LA 1QANA 4QSDA 1LBYA 3FVKA 3CI8A 3VFDA 4GWWA 2QMWA 2GQ1A 1GVNA 3Q28A 1ZMWA 3MBPA 3U5ZA 1II5A 2L6OA 3CG1A 4DUYM 3C9PA 4EIWA 1N3WA 4N07A 4DXUA 5AA4B 2WSFF 5I2KB 1NL5A 4P1LA 3GPPA 1MM6A 3C34A 3IJOB 3HCQA 3E79A 3MSTA 4EQBA 2M5ZA 1OQYA 1FBEA 2PVUA 4GKKM 2A5YB 2FFJA 1V92A 4QHQA 2VF8A 1JW1A 2DKLA 4MLQA 5FHOA 2K47A 1B58A 2GHBA 1SW4A 2X26A 4PGPA 1MXYA 1YE9A 4F1VA 4F1IA 4PT5A 3VKHA 2RINA 1TGUA 4PCDA 1VSOA 1EZ9A 1OLCA 1FBFA 5LDZA 2C98A 5EP3A 1EYJA 5JI2E 3GPYA 4LF8M 4LF4M 4LGMA 1WVJA 2MROB 3R8FA 3M3FA 3SMSA 3RN8A 4R3DA 1N3XA 3KC0A 5A5LA 1JQJC 4YAHX 1QW0A 4C1TA 3QWLA 1IMFA 5AA1A 3C4MA 1N36M 4OTEA 5IZ3B 4K3FA 4OQOA 3U6DA 1NUWA 4NN3A 3T96B 2MKZA 4MGYE 4MNPA 4KT0F 4O3BA 5KPZA 4IO2A 4B7FA 3BKIB 4OX9M 2XA5A 4KQPA 4H1XA 1PEBA 3SASA 4RPOA 5KZTA 3P7IA 1TF0B 4MGIE 4GX6A 2AL5A 1OJLA 2DVZA 1O64A 1LBXA 4B7HA 1XXHA 3UORA 2VQFM 4G4RA 3FUXA 3J27B 1ORYB 3UA8A 1MH4A 3HY5A 1MY3A 1JP4A 3KP0E 1I6BA 4O7IA 1R2YA 2NUVA 3GP1A 2FIEA 3T9UA 1L5TA 4F2LA 4ELQA 1V33A 1IY2A 1WR1B 1LBZA 3GLIE 5FTIA 4MH0E 1QUKA 1Y1MA 3GXAA 1B5IA 1IMAA 4NF5B 3GLGA 2I3WA 1MY0A 4WXJA 4U1ZA 4FEBA 4ZZAA 3MHVC 3SAVA 3U6LA 1XHYA 8CATA 4MIJA 4H65A 2H5XA 5TP9A 4PDGA 3U65A 4WP2A 4REZA 4ESXA 2R4EA 3VK8A 1LFGA 2X49A 3E9XA 4NE4A 3LUYA 3K1JA 5IREB 1AUAA 4CIZA 1VFEA 2LVPC 4NHBA 1J7KA 1SI1A 3AXFA 5KQ8A 3B7QA 3FTEA 3FVOA 3U93A 1Q3CA 1Z6TA 1JR3A 2DAKA 4DR6M 3GRYA 4OENA 4U1OA 3M3LA 4LZ7A 4AQ4A 2G3QA 4FCTA 1M5FA 3IOUA 3GLFE 3QSLA 1F9BA 3QUFA 3FD3A 3R26A 2OWZA 1LTMA 4X1BA 2B65A 4EQ7A 3IO4A 3I01M 4U2RA 3IG8A 4MGHA 3RGYA 2XXVA 4YZZA 2WSCF 2Y0QA 3HV1A 4JXIA 3AFHA 1T0KA 4MB7A 1MXZA 2Q2EB 2XGNA 1LB8A 2YLNA 4YU0A 4FWDA 1K9YA 3K6UA 1ATGA 3G7WA 1CE2A 1PJIA 4R6HA 3MJNA 4KR5A 1B0HA 2MH8A 4NQ8A 3G3KA 4B3MM 3G3FA 3S2VA 3ZS6A 4NF0A 2ANJA 1QUJA 1WXQA 3L25A 4OFOA 4LZ8A 2WSEF 3U6CA 3K6XA 3GRVA 4GBWA 4MEVA 2QNJA 3CFZA 2R6GE 5DFLA 3GQ4A 3SC3A 1B40A 2HFBA 2LVAA 3GLHB 3J80S 2H1RA 3S9NC 4QSEA 4PAKA 5EXPA 4UA8A 4P8BA 2F4VM 4PE5B 5I2KA 3MAMA 4MM3B 3PFIA 4N8GA 3J81S 1B5HA 3DP6A 1L2CA 1HSLA 5JEIA 1B7ZA 2WYPA 4NF6B 4R72A 2UUAM 2PT2A 5FSWA 2ALUA 2VT5A 2XD3A 2XH9A 2CP8A 4PFWA 2DZLA 2L4FA 4S12A 2ZAMA 4JI4M 3HJQA 4DV2M 5EYHA 4QF9A 3SEYA 3U6QA 1LCTA 1EZOA 2CZKA 2BWBA 1BP5A 4FATA 2QHOB 5ESYA 4MFIA 1FTMA 4NWCA 4GFRA 1PDAA 1MRPA 5DT6A 1R4GA 1B52A 2HKJA 3WHLA 4NSOB 5DVJA 4QNMA 3KEIA 4GWZA 3IL1B 5IAIA 3CG3A 2KNAA 3GBAA 3MP6A 1NV5A 1WGLA 2J7OA 3LC8A 5JI3E 1UQWA 2QS2A 4PFBA 3C35A 4G4QA 1IN7A 4X66M 1J1NA 3ZQJA 2V1UA 1QVRA 5JK4A 3QXMA 4E0XA 2QFLA 4FAJA 1RU3A 2Q2AA 2CV1A 2XWKA 3LQRA 4QFOA 3UZUA 1I69A 2VPOA 4OA4A 1B46A 2UXBM 4G4OA 2EO2A 1D4NA 1P1QA 1P1WA 2ABHA 4MCOA 2VQEM 3KN8A 3H06B 3MPKA 3A3UA 1MPBA 1NMUA 2F3BA 4B3SM 1G41A 4OHNA 1BKAA 1QAQA 1FTAA 1KA1A 1XXHB 1LFIA 1XWIA 1HSEA 4PFIA 3RTWB 3VXCA 1FNNA 1NH7A 1OFIA 5I58A 3LMMA 5EXXA 3HJ8A 1BVSA 1QDRA 3J2PB 2RKOA 2HCBA 1GJTA 4FCWA 4DV7M 2F5XA 3HJSA 1PB8A 4FECA 4Q30B 4FVMA 2UUCM 3T6PA 2ZTDA 2DNAA 5ITXE 1KA0A 2L7IA 4YY3M 3KS8A 4HS7A 5LMNM 1NUZA 2F8DA 2LTUA 1WGNA 3I6VA 1FBGA 4I8CA 3LBSA 4DR7M 2D3IA 4NG7A 3K8ZA 4IJEA 3L6GA 3TODA 3IFCA 1ZMVA 2C5RA 1DGHB 1PB7A 3TTRA 2DS9A 3FV1A 3IR1A 1HT1E 2QSFX 5I57A 3FJGA 4KO8A 1FQAA 5ICQA 2CRUA 1CB6A 4BDRA 3IECA 2FOIC 2A5SA 2KZSA 5L9SA 3JR5A 4LFCM 1IUDA 2I0CA 2EUCA 2LH0A 4IBKA 3HHXA 3BFUA 3EN3A 3IORA 1HT2E 1DSNA 3IHPA 3U6EA 2V25A 1B9JA 5H8FA 3VK7A 1Z59A 1SXJA 2JA2A 1XC1A 2V1CA 3L29A 4R2FA 2XHDA 2QSXA 2LHCA 1E32A 4R7GA 4KYSA 1DMBA 4M4GA 2HCAA 1N84A 3PMWA 3LW5F 3FXRA 2R44A 2Y5LA 2FNAA 4H6DA 4NXNM 2FNCA 2JXNA 4KODA 4D82A 5L8RF 1N78A 1NV2A 4AB5A 5I56A 3I4VA 2F78A 3MVXA 4RNAA 2HXWA 3SAWA 1XS5A 3TE6A 5ISUA 3OO8A 1RYOA 1MN3A 1GLNA 3UP9A 5H8QB 3E3KA 2XSZA 1AIPC 4U4SA 1HSJA 1QQWA 4LVQA 2LVNC 1AH5A 2UVIA 1LSTA 3K1NA 1HJPA 1B3FA 4LN5A 4GVOA 3NBXX 3FBPA 1Z5BA 2HAKA 5LMUM 5M2VA 4MNCA 2E0SA 5I84A 1MQIA 1MQDA 5FLXS 4OMBA 4F1YA 3TYHA 2DSFA 5AA2B 4JWYA 3EHTA 3M8UA
chains in the Genus database with same CATH topology
4IY6A 3S9EA 1HQYE 2ZYKA 5EQTA 4JI0M 2IA4A 5KQDA 2ZNUA 2RC9A 1FW0A 3MPLA 4XXUA 1R9QA 4KI0E 4EF1A 3UGWA 1ZLQA 4UACA 1NNTA 3TDJA 5C18A 2XLJA 3QAXA 4G6ZA 3N5LA 2QL3A 2CEAA 4ZDMA 3VE1B 4GQOA 3TAJA 2ZYOA 3UK4A 4K0KM 4GRIA 4Q8RA 2PBWA 3IAZA 1GTKA 5EHMA 3N6UA 4R2BA 3FGSA 4LF9M 2XXPA 3WAEA 2PX1A 2F6GA 3QK6A 4RJZA 3AL0C 4G8MA 1Y20A 2LXEA 1Y3QA 1US5A 3PUYE 2AL4A 2XF3A 4RXLA 2R46A 5HBCA 4KHZE 4PDIA 3GLGB 3HHFA 2Y20A 3FV2A 1NJFA 4MF3A 1ZAEA 2CHVA 3I51A 3V89B 3FATA 2Z8EA 5GKNA 3SDFA 3PNYA 3RPWA 3DZDA 4AQYM 4G4NA 3E13X 3OTOM 2KRKA 1OFHA 4DZ1A 3SAUA 3KOSA 3C32A 4B7GA 1URSA 1TXFA 1Z5AA 3E9SA 3O29A 3C58A 4JSOA 2XZUA 4G8NA 1NNJA 4POXA 3SBJA 2R71A 4LGYA 3G3GA 4B3TM 4GOTA 1B1HA 2DZNB 2QMXA 4XKNA 2NWJA 3W15C 2DE4A 2A5TB 1E9SA 4E0WA 4I62A 2DWIA 3THIA 1OVBA 3JR4A 2H99A 1IN5A 3TUSA 1I6AA 3CVGA 4DCYA 2X7PA 5DYHA 1MS7A 2Q89A 4TQUQ 3AV0A 1IY1A 3K6WA 5CI5A 4HTGA 5CC2A 3RGSA 3L2AA 5IT9S 3VVDA 4DXBA 5ELVA 2GRVA 2D7HA 1D3KA 4BDLA 5DYGA 3K4UA 1HNWM 3M7GA 4ZEDA 3MJ5A 1NKXA 2QPAA 5ITRA 5CRYA 3IOWA 4POWA 5FTHA 1TDHA 4L8RC 1TFAA 1IXGA 4PFYA 1ANFA 3K2LA 2LAOA 3T38A 4L16A 5K2YA 2NQ8C 3B7DA 1EU8A 4GIPA 4PETA 3FVNA 1LAXA 4THIA 1LAHE 4ZEBA 5ITOA 4QOSA 3MZ9A 2ONKE 3KBRA 3K01A 3UJNA 5L9OA 3O6HA 4NEDA 1SW5A 4DR4M 1R7RA 2OPFA 4X65M 2OK2A 1Y1ZA 3SKPA 3V5AA 2F5OA 2ZNSA 5F7VA 1GKIA 1MXWA 1FJGM 4F3PA 2Y7KA 3KSJA 4M9XA 5FTKA 2L7HA 2F5SA 3PD8A 4ELRA 1AMFA 2OBGA 7CATA 4DR2M 4IO4A 4R75A 3SHFA 4N13A 2UVGA 2X8AA 4FE8A 3EHUA 2RGHA 4WEDA 4BDQA 1OQHA 4DE8A 4FJPA 3O2AA 3KS4A 4FCVA 4H8IA 5CMKA 1WODA 5A5XA 1SW2A 3Q27A 2I58A 4RPNA 5DYIA 3FIRA 4NTLA 1SXJC 4R6KA 5TPAA 2A5TA 2AYSA 4LJ8A 1Y4CA 3HHZA 2KLFA 3T9VA 4ZPXA 3C36A 4P16A 2DWAA 2VGQA 3MZBA 1NHGC 3PUXE 1BTJA 4FD2A 5ITTA 4ZEIA 1N75A 1UTHB 5IWAM 3CR9A 1IN4A 4DR5M 4XIGQ 1TH2A 2OQ4A 2UVJA 3FD9A 3I3VA 3FUVA 4R73A 4L15A 1NHWC 1YPNA 2B3BA 2GH9A 4GWOA 3RGPA 3CF0A 3LSXA 3JYRA 4P11A 4GHAA 1EH3A 2W7YA 4YKKA 2NVUB 2QS1A 1MH3A 3SYKA 2P5TA 1L1TA 4NOOB 4G8HA 2RCBA 4R9GA 3RLFE 1SDXA 3TPZA 4IY5A 4LJ5A 1QAMA 5J1DA 4JI5M 2F5NA 1NNUC 2R45A 3FTCA 2XX9A 4TLMB 3DP8A 3JZJA 4IO7A 2V3UA 1SXJB 5I2NB 3GQ3A 3EF7A 3THGA 2C9OA 3MWBA 3TTLA 1FQCA 3KN7A 5EHSA 4DDDA 4WW0A 3L26A 2RGOA 3KOZE 1K3XA 4IB2A 1NSFA 1TH3A 4G4PA 1PC3A 4EXKA 3VDPA 3CF6E 4LG2A 3DOAA 4QHSA 1EZPA 3IOVA 4OEVA 3VDFA 2XXIA 4RNSA 2ONSA 1HNXM 4WKMA 1H6UA 4OEUA 3RFWA 1L8QA 4LUBA 3TQSA 4H5FA 3CSBA 1YAEA 1IIWA 4OU7A 3U5ZB 5HPQA 2Z8DA 4OFJA 2B3FA 1J09A 3RT6B 4LCBA 5EP4A 4JDFA 4QOZC 2Q9TA 4RYAA 2W82A 4NXMM 1IITA 2V84A 1S9TA 3KW6A 4PD2A 3TTMA 3ZKKA 3VLUA 2DVCA 4HCWA 3G3IA 4F2OA 2Y7PA 5DEXA 3WAFA 1G4AE 5BUUA 4LQ2A 1ELJA 3CIJA 1PB9A 3PNVA 3OSRA 4LJ4A 1QYRA 1YCJA 4KD5A 1SW1A 1PM5A 1G59A 3UN6A 2F7BA 4U4XA 2QBYB 2THIA 4JYAM 2QENA 5ITQA 1N33M 4X62M 4F39A 5HM4B 2DZOB 4NF5A 3U94A 2D7EA 4B08A 3F11A 3KDSE 4MLVA 5AE4A 4BBAA 2DVWB 3ZKLA 2Q8JA 3U61A 2F5QA 3GLFB 4LJ9A 4LJ7A 4AKHA 2LNHC 1IXCA 5CMBA 1GV8A 3IB2A 5CBSA 3PPQA 3PPRA 5CMMA 4DV0M 5L8DA 4ZE8A 4QFKA 2ZYNA 5ITYA 3H3GA 3FJ7A 2M8CA 4CGYB 3EPEA 3KN3A 5KDTA 4IGRA 2CHGA 3FXQA 2KEBA 4EXLA 1SXJD 4ONYA 3IJXB 3T1YM 3VXBA 1B4HA 2UYEA 4YB5A 3SETA 2O84X 3Q25A 2O5RA 5FTJA 4ZEFA 1ZU0A 4ZE9A 2V6ZM 2XZFA 3H6UA 3PUVE 1B05A 1OQGA 5EXTA 5F3WA 2ZBKB 3PUWE 1VR5A 3D8LA 3K02A 5I2NA 4P0GA 2P1SA 4LJAA 2ERCA 4IIWA 5ITUA 2CV2A 3OELA 2DXRA 3HU3A 3TTNA 4AKIA 1XMQM 2H9BA 4GL0A 3H7MA 2FYIA 1YUBA 1HNZM 1QAOA 2VP1A 4JI7M 4MBPA 2X4AA 3SYLA 4F22A 3T22A 3M6AA 3MVWA 4M9SA 1XVXA 4JI1M 1DGHA 2XX8A 1R6BX 1R6ZA 1DO0A 2QZ4A 4L78A 4MGKE 1GL7A 5E26A 4GL8A 4JV5M 3GQ5A 3U6SA 2HL7A 2REGA 2XX7A 4HW8A 4OWDA 1IXZA 3HPIA 2XXWA 1MY2A 3D4CA 4KFQA 2OJTA 4GRKA 4ZEKA 2UXAA 3S9LC 5LOMA 4EDPA 4NF6A 4W5WA 4KYDA 4IBFA 3MW0A 1Z7NE 3KG2A 4GC9A 2ZYMA 2R62A 3N94A 2V3TA 1QUIA 4N6PA 3FYDA 3CFLA 1PBQA 1K82A 3TQWA 5ICTA 4I81A 1QULA 2UXCM 1FTJA 2O69A 2DYXA 4IO5A 1XOCA 2QCUA 2R18A 3S9MC 1A54A 4GXAA 3U60A 5FTLA 2PT1A 4ISUA 3I4YA 3DFZA 2D21A 3J7BA 1FTKA 4LY6A 4JBZA 1POTA 3M3KA 3TWLA 1MY4A 2DQVA 3TPAA 2Q2CA 1N77A 2Z8FA 1UTBB 2XD2A 3Q26A 4DCXA 3BBRA 1MPDA 5KDTB 1B3HA 2GFEA 1ZKBA 2E1SA 4RK9A 2DWJA 3QUJA 4NF8B 4O3CA 2I48A 4Z0IA 3H6WA 5B70A 1QKBA 3WHKA 4BDNA 2UUBM 2XFSA 4LZ5A 2DWMA 4LZJA 4GD5A 4DR1M 5A2QS 1LV7A 4IBIA 1KYIA 5I58B 5CBRA 1M5DA 1S3SA 1FCKA 1A7LA 1W5SA 4KHPM 2O7UA 2Y0TA 1M5BA 2ZNTA 4OYVA 2XSZD 3OENA 1J5EM 1MXVA 1DO2A 4XKPA 5BR8M 4EUOA 2OWTA 3PPOA 1HQCA 5KO3A 1FQEA 4LF7M 1DTGA 4I5SA 3B6WA 3K92A 1LBBA 1NNFA 4NF4A 4B3RM 3KOXE 5KPRA 3TFLA 3IX1A 4D80A 2Z23A 2ESNA 3GLFA 3DELB 4HCYA 1UTHA 3AKZA 5K2XA 2DWZB 4PFTA 4TUWA 1IEJA 3PD9A 5FHMA 2ONRA 1Y3PA 3IG5A 1Q3BA 3CF2A 4KYEA 1R2ZA 1SYIA 3A42A 3HKPA 4DV6M 4NRVA 1MU5A 3ZSFA 1LB9A 2KW0A 1N34M 2XEPA 1USYH 3K6VA 3GLIA 2I49A 2CE7A 4FEDA 5EXSA 3HU1A 2I4BA 4XTCQ 3CRBA 3FUZA 5H8FB 1S7YA 2OWSA 1SI0A 3AJIB 3PVSA 3HHWA 4G2ZA 1Z5CA 3FTFA 1NNPA 4JI3M 2Y7WA 1IQPA 4GHLA 1TFDA 2O7IA 3DA1A 4R6YA 4OXVA 4C0RA 3K2DA 2G29A 1B7HA 4L17A 1JW4A 1P1UA 2HHHM 4X1DA 1A40A 4ECFA 3GLBA 5AA2D 2HEUA 3C33A 2P0SA 5H8NA 4NWDA 4M1VA 4QRZA 1N7XA 3T1HM 3W0LB 1G3IA 3H03A 4FIMA 5E6JA 1KWHA 2OCUA 3TTKA 2Z7JA 4X9TA 4ELPA 3PU5A 3ECRA 1OIBA 3A45A 4PFUA 3SFZA 4NMYA 4LP2B 2ZXTA 3N26A 3M0EA 2KXEA 4BLCA 1A8EA 1TDZA 1MPCA 1Y3NA 5AA4A 1H76A 4IGTA 2RC7A 2XXQA 3TWKA 3ZH9B 4QFNA 4I1DA 5FHNA 5I59A 3O97A 3J7AS 1H44A 2DE3A 3IO6A 4YICA 4JI8M 1N32M 1NNKA 4LATA 2O51A 2P2AA 1MDQA 2I6EA 2G5GX 2XXUA 1MQGA 3B6QA 2X7QA 3D4GA 1D2NA 1L2BA 2QPQA 4QFLA 2QBYA 4NF4B 1W5TA 5H8HA 2UXDM 5ITPA 1IBKM 3C31A 3U92A 1UIVA 1B6HA 4YB7A 3D8BA 3USDA 4FW9A 1QKAA 2Z4RA 1XC8A 3FZVA 3UK6A 2V93A 2O1LA 4IO3A 4LFBM 5AA2A 1P1OA 3ONMA 2BJVA 4F31B 1KSFX 2HZLA 5ITXA 1RYXA 2H4IA 2HAVA 3TMGA 1AOVA 1AL3A 2QP9X 3E4RA 2O6AA 3SEWA 4YKIA 3PGFA 3H4ZA 5DTBA 1L1ZA 4X48A 4DR3M 3OO9A 1IZ1A 3DLNA 1PBPA 1URDA 2UVHA 4ZZEA 1IXIA 3RY3A 4LFAM 2DWLA 3Q29A 3OO7A 3BFTA 4G77A 4H8JA 1O63A 1B5JA 3FUUA 3T9HB 3SARA 3JV9A 1SYHA 1ZQ9A 2DWNA 1MXXA 2XXHA 4H0WA 3T15A 2O1MA 1Q39A 1KFVA 2YQZA 4U22A 2F35A 2VD2A 5H8NB 2KZUA 2R65A 3ODBA 1G8PA 2EA0A 5TP9B 4GLIA 3PUZE 2HQ0A 3TELA 1R9LA 2H98A 2DE2A 4JWOA 3L6HA 4DUZM 3UMMA 4L4UA 2Q88A 3LSWA 3FKEA 3HU2A 4RK2A 4OERA 4F3SA 2NXOA 2HAUA 1QVSA 1FQBA 3R6UA 4OETA 3K1MA 1M5EA 4I9DA 1YSYA 2I3VA 1EE8A 2HZKA 2Y7RA 1D9YA 3JAMS 3MC2A 4YMBA 1JNFA 4IBBA 4KPTA 3U8QA 1JQFA 3IK6B 4GF8A 5IZ7D 4O3AA 1B3LA 3LVVA 4LONB 1BLFA 3LQQA 1OLAA 4OVJA 3U6PA 2Z3XA 1Y4TA 4I4LA 1LAGE 4KCCA 4F29A 1MM7A 5F1QA 1A55A 1GL6A 2BJWA 1US4A 2J7NA 2F34A 4RF1A 1USYE 2QRYA 1LCFA 2L09A 1WDNA 4KLNA 2XXYA 3DP4A 3RTFB 2RCAA 3MQ9A 2XXRA 2OZZA 1B1XA 2XFTA 4ESWA 3ZCBB 1DPPA 3TWMA 1N7WA 2F97A 4LF6M 2RF1A 3C9HA 3TCGA 4IBDA 1N0TA 1MX0A 4M0DA 3VVFA 2CMOA 3PV0E 4JI2M 1A99A 2G93A 2VD3A 3KOWE 2CHQA 4GXSB 1H45A 2UU9M 4RY1A 3K0VA 2FA7A 3RE8A 4PQJA 3KJTA 3SEVA 2C9CA 3MUQA 3O9PA 2YFQA 5I59B 2ZAOA 4Q5TA 4G68B 1S50A 1URGA 2YNMD 3K1PA 2VHAA 4WURA 3V83A 5CM6A 4G68C 3UIFA 2OLBA 1B7UA 1POY1 1ZBMA 3FUTA 4ZECA 5EP1A 3KGCA 2CZLA 1UM8A 3R7XA 5TPAB 2BNKA 4I8OA 3U61B 3IOTA 2AHMA 4LZZA 1JR3D 1N76A 4C1UA 3KP1E 1GGGA 3AOGA 5CMCA 5EJCA 3MZ1A 2V3QA 4Z8XA 4OZ9A 5BPVA 4MGZE 1B51A 1SD3A 1B32A 1LAFE 4JB7A 4DV1M 3O6IA 1D9VA 3O6GA 3HO7A 2R4JA 2CV0A 4R9FA 3AOEC 3U6MA 1LFHA 4LRSA 4X64M 3QIMA 3VV5A 3ILKA 2LWXA 2ZANA 4QSCA 3S4UA 1JEVA 3U6OA 3HSTA 4IO6A 3ILTB 3MVZA 1SVXB 3EIEA 4QFPA 1DGBA 3U72A 1T3TA 4A3VB 3GO8A 3MP8A 2PYYA 1DTZA 5B7DA 5JTYB 3PPPA 4F18A 4JN6A 1ZIUA 3A46A 2F5PA 1DOTA 3VVEA 3TKDA 1QZMA 2O68A 1JW5A 3RUMA 1DGFA 2I7NA 1R1NA 1VFDA 3HWSA 4AW4A 3LSFB 4JSDA 3O66A 1FQDA 2KRUA 1Q35A 3OEMA 1XHBA 3GZGA 2YR0A 1OVTA 3VFJA 2CUZA 1GVCA 3W0FA 1IQ7A 4LJ6A 3VLFB 3QAUA 3KFUG 1B3EA 4IBEA 4F19A 4IBJA 5KPTA 3RQTA 4JXJA 3PPNA 4NL4H 4YHHM 3RNNA 2Y84A 5EYFA 1B3GA 2AIXA 4M9ZA 1ZMGA 3SERA 5KCJB 4AI6A 4DIGA 2D5WA 4GH9A 1N04A 4II7A 4AG6A 2VIIA 4BLAA 1NY6A 3SMPA 5I56B 3EQ1A 4LRTA 2IEEA 4AZFA 1XVYA 3GPUA 4IBGA 5H8QA 2DP8A 4LF5M 3MK6A 4YMAA 3GRUA 2Y21A 1C1KA 3UGJA 4OVZA 1MG1A 2PMSA 3L28A 1JVXA 1M5CA 4MH5A 1IBMM 3IB0A 3DM0A 1B0LA 2FE8A 5FTMA 3KOTA 5H8SA 2YPNA 1LBCA 3EIHA 1LGBC 5BWJA 1NJGA 4QNRA 1XNRM 3PMVA 4BDMA 1JVYA 2I7PA 3HHYA 1ZJLA 4ZS9A 3W9WA 3FJMA 5DEXB 3W9VA 4M0WA 1HR0M 5DNYA 4AB6A 4PP0A 5AA3A 3B9PA 4OFLA 2M60A 4YKJA 4Z7EA 3HHGA 3RT8A 3VLWA 1IY0A 2DXYA 4EQ9A 2Y7IA 3G3JA 1NH8A 4HLQA 4BB9A 1XMOM 3Q8XA 1H43A 3ZC7B 2F36A 4GIZA 1XNQM 3NWLA 1P99A 1IN6A 1X37A 1Z7ME 3B6TA 4RF0A 3R9XB 3PMXA 2DXIA 3BOSA 1DGGA 4ELOA 1I94M 3FUWA 1B4ZA 4P0IA 2YJPA 1NVMA 1TWYA 4CISA 3LSLA 3MP1A 1TT1A 3TL4X 2UYFA 3H4MA 2I0BA 5DVIA 1IM2A 2ZM6M 4RA1A 1MY1A 4YB6A 4D81A 3T93B 4TLLB 3OMBA 3O28A 4DLDA 1FTOA 1PJJA 5DVFA 3FYCA 3SHGB 1QJMA 3IB1A 2REJA 3N6TA 3OD7A 3VKGA 4OESA 2RC8A 3FASA 4AG5A 4NSRA 1E94E 4F2QA 3TQLA 1VDDA 1IBLM 3I5OA 5JTYA 3OXNA 4GMQA 1I6QA 2E5LM 2Z22A 2D7GA 5EP2A 2G8LA 1FQFA 4U21A 4U23A 5IKBA 2F7CA 2ZMBA 1MQHA 3V8XB 2VOZA 3HGIA 2DWHA 4FORA 4DXCA 1IXHA 4DV3M 4XKQA 1GR2A 4FWHA 1E9RA 2H5YA 2XXTA 4IBCA 3GPXA 3CTWB 3QYTA 2CFOA 3KJ7A 3K00A 2C96A 1LLSA 4JWXA 1NY5A 1O7TA 1XT8A 3AOEA 4AKGA 3T9XB 1SBPA 4XKRA 4CHTB 1JETA 3TZAA 1FTLA 2Z4SA 1UTBA 4KCDA 3GLHA 1UIUA 2F6PA 3A09A 4H5GA 3KSXA 3NBIA 4LQ5A 4WEPA 3H6VA 4YKPA 2DHRA 1RKMA 1MDP1 4GKJM 4EF2A 1AIVA 4IJFA 3LVWA 4Z6YA 2QS3A 4LA9A 4OW0A 4QHTA 1K3WA 3H6TA 4TOZA 4NF8A 1DPEA 3L27A 3G3HA 4H67A 2KA6B 2F7AA 5KCJA 1L2DA 1TH4A 1MQJA 3ILUB 3VLVA 2GHAA 4DV5M 3KXEC 4F1UA 4G68A 3TEPA 1I4WA 4ITQA 3PXGA 2NOOA 3EHSA 1B2HA 3OO6A 3CSGA 5H8HB 4F3BA 1Y9UA 1YTVA 3TCHA 4F3GA 1H3DA 3U60B 2XXXA 4GITA 1SQYA 4DV4M 3A98B 3SEUA 5C1BA 3SEXA 1BIYA 2RKMA 4JI6M 4OVZB 4FWGA 5L9MA 5FTNA 2R9JA 3CFXA 2H25A 2BJJX 3LR1A 3VDUA 4BDOA 3OEKA 1P1NA 2QS4A 1IXSB 3KVWA 3GLIB 1MXUA 2QJEA 1ZTYA 3KZGA 1OMPA 3GRRA 1NFTA 5A5XB 3MVYA 3U1OA 1A8FA 4XBOA 1SXJE 1IXRC 1VE4A 4GC5A 4HL4A 3KOYE 4NRWA 2C99A 3FTDA 1IN8A 3A3CA 4R74A 5TU0A 1JEUA 3HN0A 3TCFA 3SESA 3FVGA 4ND9A 4XGIA 5H37D 1Q1KA 4Q0CA 2I4CA 3OOAA 3OSQA 2DOJA 3GBBA 4PCZA 3FXUA 3KFMA 3T66A 3SATA 2WKYA 5I57B 1QANA 4QSDA 3FVKA 3CI8A 3VFDA 2QMWA 1GVNA 3Q28A 3MBPA 3U5ZA 1II5A 2L6OA 3CG1A 4DUYM 4EIWA 1N3WA 4N07A 4DXUA 5AA4B 5I2KB 1NL5A 3GPPA 1MM6A 3C34A 3IJOB 3HCQA 4EQBA 2M5ZA 2PVUA 4GKKM 2A5YB 2FFJA 4QHQA 1JW1A 4MLQA 5FHOA 2K47A 1B58A 2GHBA 1SW4A 2X26A 1MXYA 1YE9A 4F1VA 4PT5A 3VKHA 2RINA 1TGUA 1VSOA 1EZ9A 1OLCA 2C98A 5EP3A 5JI2E 3GPYA 4LF8M 4LF4M 4LGMA 1WVJA 3R8FA 3M3FA 3SMSA 3RN8A 4R3DA 1N3XA 1JQJC 4YAHX 1QW0A 4C1TA 3QWLA 5AA1A 3C4MA 1N36M 4OTEA 4K3FA 4OQOA 3U6DA 3T96B 4MGYE 4O3BA 5KPZA 4IO2A 4B7FA 3BKIB 4OX9M 4KQPA 4H1XA 1PEBA 3SASA 4RPOA 5KZTA 3P7IA 4MGIE 2AL5A 1OJLA 2DVZA 1O64A 3UORA 4B7HA 1XXHA 2VQFM 4G4RA 3FUXA 3J27B 1ORYB 3UA8A 1MH4A 1MY3A 3KP0E 1I6BA 1R2YA 2NUVA 3GP1A 3T9UA 1L5TA 4ELQA 1IY2A 5FTIA 4MH0E 1QUKA 1Y1MA 3GXAA 1B5IA 4NF5B 3GLGA 2I3WA 1MY0A 4WXJA 4U1ZA 4FEBA 4ZZAA 3MHVC 3SAVA 3U6LA 1XHYA 8CATA 4H65A 5TP9A 4PDGA 4REZA 4ESXA 2R4EA 3VK8A 1LFGA 2X49A 3E9XA 4NE4A 3LUYA 3K1JA 5IREB 1VFEA 1J7KA 1SI1A 3AXFA 5KQ8A 3FTEA 3FVOA 3U93A 1Q3CA 1Z6TA 1JR3A 4DR6M 3GRYA 4OENA 4U1OA 3M3LA 4LZ7A 4AQ4A 4FCTA 1M5FA 3IOUA 3QSLA 1F9BA 3QUFA 3FD3A 3R26A 4X1BA 2B65A 4EQ7A 3IO4A 4U2RA 3IG8A 4MGHA 3RGYA 2XXVA 4YZZA 2Y0QA 3HV1A 4JXIA 3AFHA 1T0KA 4MB7A 1MXZA 2Q2EB 2XGNA 1LB8A 2YLNA 4YU0A 4FWDA 3K6UA 1ATGA 3G7WA 1CE2A 1PJIA 4R6HA 3MJNA 4KR5A 1B0HA 3G3KA 4B3MM 3G3FA 3S2VA 3ZS6A 2ANJA 1QUJA 1WXQA 3L25A 4OFOA 4LZ8A 3U6CA 3K6XA 3GRVA 3CFZA 2R6GE 3GQ4A 3SC3A 1B40A 2HFBA 3GLHB 3J80S 2H1RA 3S9NC 4QSEA 5EXPA 4UA8A 2F4VM 4PE5B 5I2KA 3MAMA 4MM3B 3PFIA 3J81S 1B5HA 3DP6A 1L2CA 1HSLA 5JEIA 1B7ZA 4NF6B 4R72A 2UUAM 2PT2A 5FSWA 2ALUA 2XD3A 2XH9A 4PFWA 4S12A 2ZAMA 4JI4M 3HJQA 4DV2M 4QF9A 3SEYA 3U6QA 1LCTA 1EZOA 1BP5A 4FATA 4MFIA 1FTMA 4NWCA 4GFRA 1MRPA 1PDAA 5DT6A 1B52A 2HKJA 3WHLA 4NSOB 5DVJA 4QNMA 3KEIA 3IL1B 5IAIA 3CG3A 3GBAA 3MP6A 2J7OA 3LC8A 5JI3E 1UQWA 2QS2A 3C35A 4G4QA 1IN7A 4X66M 1J1NA 2V1UA 1QVRA 5JK4A 3QXMA 4E0XA 4FAJA 2Q2AA 2CV1A 3LQRA 4QFOA 3UZUA 1I69A 1B46A 2UXBM 4G4OA 2EO2A 1D4NA 1P1QA 1P1WA 2ABHA 2VQEM 3KN8A 3H06B 3MPKA 3A3UA 1MPBA 1NMUA 4B3SM 1G41A 4OHNA 1BKAA 1QAQA 1XXHB 1LFIA 1XWIA 1HSEA 3RTWB 3VXCA 1FNNA 1NH7A 1OFIA 5I58A 3LMMA 5EXXA 3HJ8A 3J2PB 2RKOA 2HCBA 4FCWA 4DV7M 2F5XA 3HJSA 1PB8A 4FECA 4Q30B 4FVMA 2UUCM 5ITXE 2L7IA 4YY3M 3KS8A 4HS7A 5LMNM 2F8DA 3I6VA 4I8CA 3LBSA 4DR7M 2D3IA 3K8ZA 4IJEA 3L6GA 3TODA 2C5RA 1DGHB 1PB7A 3TTRA 2DS9A 3FV1A 3IR1A 1HT1E 5I57A 3FJGA 4KO8A 1FQAA 5ICQA 1CB6A 4BDRA 2A5SA 2FOIC 2KZSA 5L9SA 3JR5A 4LFCM 1IUDA 2I0CA 2EUCA 2LH0A 4IBKA 3HHXA 3BFUA 3EN3A 3IORA 1HT2E 1DSNA 3U6EA 2V25A 1B9JA 5H8FA 3VK7A 1Z59A 1SXJA 2JA2A 1XC1A 2V1CA 3L29A 4R2FA 2XHDA 2QSXA 1E32A 4R7GA 4KYSA 1DMBA 4M4GA 2HCAA 1N84A 3PMWA 3FXRA 2FNAA 4H6DA 4NXNM 2FNCA 4KODA 4D82A 1N78A 4AB5A 5I56A 3I4VA 2F78A 3MVXA 4RNAA 2HXWA 3SAWA 1XS5A 3TE6A 5ISUA 3OO8A 1RYOA 1GLNA 3UP9A 5H8QB 3E3KA 2XSZA 4U4SA 1HSJA 1QQWA 4LVQA 1AH5A 2UVIA 1LSTA 3K1NA 1B3FA 4GVOA 1Z5BA 5LMUM 5M2VA 5I84A 2E0SA 1MQIA 1MQDA 5FLXS 4OMBA 4F1YA 3TYHA 2DSFA 5AA2B 4JWYA 3EHTA 3M8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IY6 A;  3S9E A;  1DPP A;  1N7W A;  2F97 A;  2RF1 A;  2ZYK A;  3OEL A;  2DXR A;  3TTN A;  3FVG A;  4ND9 A;  2IA4 A;  3C9H A;  1Q1K A;  2RC9 A;  2ZNU A;  1FW0 A;  1N0T A;  2H9B A;  3MPL A;  1R9Q A;  4XXU A;  3VVF A;  4GL0 A;  2CMO A;  3PV0 E;  3H7M A;  1A99 A;  2FYI A;  4KI0 E;  4Q0C A;  4EF1 A;  2I4C A;  2G93 A;  3UGW A;  1ZLQ A;  3OOA A;  3OSQ A;  2VP1 A;  4UAC A;  2DOJ A;  2VD3 A;  3GBB A;  4MBP A;  4GXS B;  1NNT A;  4F22 A;  3T22 A;  1H45 A;  3FXU A;  3MVW A;  3KFM A;  3T66 A;  1XVX A;  3TDJ A;  4RY1 A;  2WKY A;  3K0V A;  2FA7 A;  2XX8 A;  4PQJ A;  3QAX A;  5I57 B;  1R6Z A;  3N5L A;  2QL3 A;  4ZDM A;  3VE1 B;  3KJT A;  4GQO A;  3SEV A;  3MUQ A;  3O9P A;  3TAJ A;  2ZYO A;  4GL8 A;  3UK4 A;  5I59 B;  4Q5T A;  4QSD A;  4G68 B;  1S50 A;  1URG A;  3FVK A;  3CI8 A;  2PBW A;  4Q8R A;  3IAZ A;  1GTK A;  2QMW A;  5EHM A;  3K1P A;  2VHA A;  3N6U A;  4R2B A;  3FGS A;  3V83 A;  2REG A;  2XX7 A;  4HW8 A;  3Q28 A;  2XXP A;  5CM6 A;  3WAE A;  2PX1 A;  4OWD A;  3MBP A;  1II5 A;  4G68 C;  3CG1 A;  2F6G A;  3UIF A;  2OLB A;  3QK6 A;  1B7U A;  1POY 1;  1ZBM A;  4RJZ A;  4ZEC A;  3HPI A;  1N3W A;  3KGC A;  2CZL A;  4G8M A;  2XXW A;  1MY2 A;  4N07 A;  3D4C A;  1Y20 A;  4DXU A;  1Y3Q A;  4KFQ A;  1US5 A;  5TPA B;  3R7X A;  5AA4 B;  2OJT A;  4GRK A;  5I2K B;  4ZEK A;  3PUY E;  4F29 A;  3IOT A;  1NL5 A;  2UXA A;  2AL4 A;  4RXL A;  3TCG A;  5HBC A;  4KHZ E;  1MM6 A;  1N76 A;  1GGG A;  3C34 A;  3IJO B;  4C1U A;  4EDP A;  3HCQ A;  3HHF A;  4NF6 A;  5LOM A;  3S9L C;  5CMC A;  4EQB A;  4KYD A;  3MW0 A;  3FV2 A;  4MF3 A;  3MZ1 A;  1Z7N E;  2PVU A;  3V89 B;  2V3Q A;  3KG2 A;  3FAT A;  2Z8E A;  2ZYM A;  4OZ9 A;  3N94 A;  3SDF A;  2V3T A;  3RPW A;  1QUI A;  4N6P A;  4QHQ A;  3CFL A;  1B51 A;  1PBQ A;  1JW1 A;  1SD3 A;  4MLQ A;  3TQW A;  1B32 A;  5FHO A;  1LAF E;  3E13 X;  4JB7 A;  5ICT A;  4DZ1 A;  3O6I A;  1B58 A;  1D9V A;  1QUL A;  2GHB A;  3KOS A;  1FTJ A;  1SW4 A;  2DYX A;  2O69 A;  3C32 A;  1XOC A;  2X26 A;  3HO7 A;  3O6G A;  4IO5 A;  1MXY A;  4F1V A;  2RIN A;  4R9F A;  1LFH A;  1VSO A;  1EZ9 A;  1OLC A;  1URS A;  1TXF A;  3QIM A;  3VV5 A;  3S9M C;  1A54 A;  4GXA A;  3O29 A;  4QSC A;  3S4U A;  4JSO A;  1WVJ A;  2PT1 A;  3M3F A;  1JEV A;  4ISU A;  4G8N A;  3HST A;  4POX A;  3RN8 A;  1N3X A;  4IO6 A;  2R71 A;  2D21 A;  3G3G A;  3ILT B;  1FTK A;  4JBZ A;  3MVZ A;  1SVX B;  4LUB A;  4YAH X;  1QW0 A;  4QFP A;  4GOT A;  1POT A;  3U72 A;  5AA1 A;  3C4M A;  4C1T A;  3M3K A;  1MY4 A;  1B1H A;  4OTE A;  2DQV A;  4K3F A;  3TPA A;  2Q2C A;  4OQO A;  3MP8 A;  2QMX A;  2Z8F A;  4XKN A;  2NWJ A;  3T96 B;  3W15 C;  1UTB B;  2DE4 A;  1DTZ A;  2PYY A;  2XD2 A;  3Q26 A;  4DCX A;  5JTY B;  5B7D A;  3PPP A;  3BBR A;  1MPD A;  4O3B A;  4F18 A;  3M8U A;  2A5T B;  4IO2 A;  5KDT B;  3BKI B;  1B3H A;  1ZIU A;  2GFE A;  1ZKB A;  2E1S A;  4I62 A;  2DWJ A;  3QUJ A;  1DOT A;  4NF8 B;  4RK9 A;  2DWI A;  4O3C A;  3THI A;  3TKD A;  3VVE A;  1OVB A;  4KQP A;  2I48 A;  4Z0I A;  2H99 A;  3H6W A;  2O68 A;  1JW5 A;  4H1X A;  5B70 A;  1PEB A;  3RUM A;  1QKB A;  4RPO A;  3P7I A;  1R1N A;  4BDN A;  1I6A A;  5KZT A;  3TUS A;  3CVG A;  4DCY A;  1VFD A;  2X7P A;  4LZ5 A;  2AL5 A;  4GD5 A;  5DYH A;  1MS7 A;  3LSF B;  2Q89 A;  4TQU Q;  4JSD A;  3O66 A;  3K6W A;  1FQD A;  5I58 B;  2DVZ A;  5CI5 A;  1Q35 A;  1M5D A;  3OEM A;  4HTG A;  5CBR A;  5CC2 A;  1FCK A;  1O64 A;  1A7L A;  3GZG A;  3UOR A;  3VVD A;  2O7U A;  4DXB A;  5ELV A;  2GRV A;  1D3K A;  1OVT A;  3UA8 A;  3VFJ A;  1GVC A;  1M5B A;  2ZNT A;  1MH4 A;  4OYV A;  1IQ7 A;  3OEN A;  4BDL A;  1MXV A;  1MY3 A;  3K4U A;  1I6B A;  2NUV A;  4XKP A;  4EUO A;  2OWT A;  3T9U A;  4ZED A;  3PPO A;  1NKX A;  1L5T A;  1B3E A;  4F19 A;  4ELQ A;  5FTI A;  1FQE A;  1QUK A;  1Y1M A;  5CRY A;  3IOW A;  3GXA A;  4POW A;  1B5I A;  3RQT A;  1DTG A;  4NF5 B;  2I3W A;  1MY0 A;  3B6W A;  5FTH A;  4WXJ A;  3PPN A;  1LBB A;  1NNF A;  1TFA A;  4FEB A;  4NF4 A;  1IXG A;  4PFY A;  4U1Z A;  4ZZA A;  1ANF A;  3RNN A;  2LAO A;  1XHY A;  5K2Y A;  2Y84 A;  3B7D A;  4H65 A;  5EYF A;  1EU8 A;  4PET A;  3FVN A;  1B3G A;  1LAX A;  2AIX A;  5TP9 A;  3TFL A;  3IX1 A;  4THI A;  2Z23 A;  1LAH E;  4ZEB A;  2ESN A;  3DEL B;  4HCY A;  5ITO A;  1UTH A;  4ESX A;  5K2X A;  1ZMG A;  3MZ9 A;  3SER A;  2ONK E;  1LFG A;  3KBR A;  4PFT A;  3E9X A;  4NE4 A;  3K01 A;  5KCJ B;  3LUY A;  4DIG A;  2D5W A;  5L9O A;  1IEJ A;  3O6H A;  3PD9 A;  5FHM A;  1VFE A;  1N04 A;  2ONR A;  1Y3P A;  4NED A;  4KYE A;  1SYI A;  1SI1 A;  1SW5 A;  3AXF A;  4BLA A;  3ZSF A;  1LB9 A;  3FVO A;  1USY H;  3U93 A;  3EQ1 A;  5I56 B;  3K6V A;  2IEE A;  2I49 A;  2OK2 A;  1XVY A;  4FED A;  1Y1Z A;  3SKP A;  3V5A A;  2ZNS A;  5H8Q A;  2DP8 A;  2I4B A;  4OEN A;  4XTC Q;  3CRB A;  4U1O A;  3FUZ A;  5H8F B;  4YMA A;  3M3L A;  5F7V A;  1S7Y A;  2OWS A;  1MXW A;  4LZ7 A;  4AQ4 A;  1SI0 A;  1EZO A;  4F3P A;  4G2Z A;  2Y7K A;  1MG1 A;  3KSJ A;  2PMS A;  1JVX A;  1M5F A;  1M5C A;  3IOU A;  3IB0 A;  4MH5 A;  3QSL A;  3DM0 A;  1B0L A;  1F9B A;  3QUF A;  3FD3 A;  3R26 A;  4X1B A;  3KOT A;  1NNP A;  5H8S A;  2B65 A;  2Y7W A;  4EQ7 A;  3PD8 A;  2YPN A;  3IO4 A;  4U2R A;  3RGY A;  2XXV A;  1TFD A;  1LBC A;  2O7I A;  4YZZ A;  4ELR A;  3HV1 A;  1LGB C;  4JXI A;  1T0K A;  5BWJ A;  1AMF A;  1MXZ A;  2OBG A;  4R6Y A;  4OXV A;  4IO4 A;  1LB8 A;  2YLN A;  4R75 A;  3PMV A;  4YU0 A;  4C0R A;  3K2D A;  4BDM A;  2G29 A;  1JVY A;  3K6U A;  4N13 A;  1B7H A;  1ATG A;  1ZJL A;  2UVG A;  4L17 A;  3G7W A;  4FE8 A;  1JW4 A;  1CE2 A;  1P1U A;  3EHU A;  4X1D A;  1A40 A;  4R6H A;  4ECF A;  3MJN A;  4KR5 A;  4WED A;  3GLB A;  5AA2 D;  1B0H A;  2HEU A;  3C33 A;  1OQH A;  4BDQ A;  4ZS9 A;  2P0S A;  4DE8 A;  4FJP A;  3G3K A;  3O2A A;  3G3F A;  5H8N A;  3S2V A;  4NWD A;  3W9W A;  3ZS6 A;  4M1V A;  2ANJ A;  3FJM A;  4QRZ A;  1QUJ A;  1N7X A;  4H8I A;  5CMK A;  1WOD A;  5DEX B;  5A5X A;  1SW2 A;  3H03 A;  3Q27 A;  3W9V A;  4OFO A;  4AB6 A;  2I58 A;  4LZ8 A;  4FIM A;  4PP0 A;  4RPN A;  5AA3 A;  1KWH A;  2OCU A;  3FIR A;  4NTL A;  4OFL A;  4YKJ A;  3TTK A;  4Z7E A;  4X9T A;  3HHG A;  4ELP A;  3RT8 A;  3PU5 A;  3K6X A;  3VLW A;  3ECR A;  1OIB A;  2DXY A;  4EQ9 A;  3CFZ A;  2R6G E;  2Y7I A;  3G3J A;  1NH8 A;  4PFU A;  4R6K A;  1B40 A;  4NMY A;  5TPA A;  4LP2 B;  2A5T A;  2AYS A;  2ZXT A;  2HFB A;  1H43 A;  1Y4C A;  2F36 A;  2KLF A;  3N26 A;  4GIZ A;  3T9V A;  1P99 A;  1A8E A;  3S9N C;  3C36 A;  1MPC A;  1Z7M E;  1Y3N A;  2DWA A;  2VGQ A;  3B6T A;  3MZB A;  4QSE A;  3PUX E;  1BTJ A;  3PMX A;  4UA8 A;  1H76 A;  5AA4 A;  4PE5 B;  4ELO A;  4IGT A;  5I2K A;  3MAM A;  4ZEI A;  2RC7 A;  1UTH B;  2XXQ A;  3CR9 A;  1B4Z A;  1B5H A;  3DP6 A;  1HSL A;  4P0I A;  4QFN A;  4XIG Q;  2YJP A;  5JEI A;  1B7Z A;  2UVJ A;  4NF6 B;  4I1D A;  4R72 A;  3I3V A;  1TWY A;  2PT2 A;  5DVI A;  3LSL A;  3MP1 A;  5FHN A;  2ALU A;  4R73 A;  3O97 A;  5I59 A;  2XD3 A;  1TT1 A;  1H44 A;  1YPN A;  2DE3 A;  4PFW A;  2I0B A;  2UYF A;  1NNK A;  3IO6 A;  4LAT A;  2B3B A;  2GH9 A;  4GWO A;  4RA1 A;  2O51 A;  4YIC A;  2P2A A;  1MDQ A;  1MY1 A;  4YB6 A;  3LSX A;  2I6E A;  3JYR A;  4QF9 A;  1LCT A;  4P11 A;  3OMB A;  3O28 A;  4TLL B;  1FTO A;  1EH3 A;  3SEY A;  1BP5 A;  2W7Y A;  4DLD A;  4YKK A;  2XXU A;  2NVU B;  4FAT A;  1MQG A;  2QS1 A;  5DVF A;  4MFI A;  1FTM A;  1MH3 A;  3B6Q A;  2X7Q A;  4NWC A;  4GFR A;  3D4G A;  1MRP A;  1PDA A;  2RCB A;  1QJM A;  4G8H A;  1B52 A;  5DT6 A;  3IB1 A;  4R9G A;  2QPQ A;  2REJ A;  3RLF E;  4QFL A;  5DVJ A;  3N6T A;  3OD7 A;  1SDX A;  4NF4 B;  4IY5 A;  5H8H A;  3KEI A;  5J1D A;  3IL1 B;  5IAI A;  3CG3 A;  3GBA A;  5ITP A;  3C31 A;  3MP6 A;  3U92 A;  4OES A;  2RC8 A;  3LC8 A;  3FAS A;  1UQW A;  1UIV A;  2QS2 A;  1B6H A;  3C35 A;  4YB7 A;  4F2Q A;  3USD A;  1QKA A;  1J1N A;  2XX9 A;  4TLM B;  3TQL A;  5JTY A;  3DP8 A;  3FZV A;  3I5O A;  2V3U A;  3JZJ A;  4IO7 A;  5JK4 A;  2V93 A;  3QXM A;  4E0X A;  5I2N B;  3EF7 A;  2O1L A;  3MWB A;  3OXN A;  4FAJ A;  1I6Q A;  2Q2A A;  4IO3 A;  5ISU A;  3TTL A;  4QFO A;  5AA2 A;  1FQC A;  1I69 A;  3KN7 A;  1P1O A;  2Z22 A;  1FQF A;  4U23 A;  4U21 A;  3ONM A;  5EHS A;  4DDD A;  4F31 B;  1B46 A;  2F7C A;  5IKB A;  2ZMB A;  1MQH A;  1D4N A;  1P1W A;  3V8X B;  1P1Q A;  2HZL A;  2ABH A;  2VOZ A;  4IB2 A;  1RYX A;  2HAV A;  2H4I A;  3KN8 A;  2DWH A;  4FOR A;  4DXC A;  3TMG A;  1IXH A;  4XKQ A;  3H06 B;  1AL3 A;  1AOV A;  3MPK A;  1GR2 A;  3E4R A;  1MPB A;  1NMU A;  2O6A A;  3A3U A;  1PC3 A;  2H5Y A;  4G4P A;  3PGF A;  4YKI A;  3SEW A;  4EXK A;  4OHN A;  1EZP A;  1BKA A;  3H4Z A;  2XXT A;  3IOV A;  4OEV A;  5DTB A;  1LFI A;  3QYT A;  4X48 A;  1HSE A;  3VDF A;  3RTW B;  3OO9 A;  3VXC A;  2XXI A;  1IZ1 A;  3KJ7 A;  3K00 A;  4RNS A;  2ONS A;  3DLN A;  1PBP A;  1NH7 A;  4WKM A;  1URD A;  1LLS A;  4JWX A;  5I58 A;  1O7T A;  2UVH A;  4ZZE A;  1XT8 A;  4OEU A;  3T9X B;  1IXI A;  1SBP A;  4XKR A;  3RY3 A;  1JET A;  3T93 B;  3TZA A;  1FTL A;  4KCD A;  1UTB A;  3Q29 A;  1UIU A;  2F5X A;  2F6P A;  3A09 A;  3CSB A;  4H5F A;  1YAE A;  3OO7 A;  1IIW A;  1PB8 A;  3KSX A;  4H5G A;  4FEC A;  4LQ5 A;  4WEP A;  3H6V A;  4Q30 B;  1RKM A;  4YKP A;  5HPQ A;  1MDP 1;  2Z8D A;  4OFJ A;  4EF2 A;  2B3F A;  3RT6 B;  3BFT A;  4G77 A;  4JDF A;  4H8J A;  1AIV A;  1O63 A;  1B5J A;  4HS7 A;  3T9H B;  3JV9 A;  1SYH A;  2Q9T A;  2F8D A;  2QS3 A;  4LA9 A;  1MXX A;  2XXH A;  4H0W A;  4RYA A;  3I6V A;  2O1M A;  3H6T A;  4TOZ A;  1IIT A;  2V84 A;  1S9T A;  4NF8 A;  4I8C A;  4U22 A;  3LBS A;  2D3I A;  2F35 A;  2VD2 A;  5H8N B;  3TTM A;  3ZKK A;  3VLU A;  2DVC A;  4HCW A;  3L6G A;  3TOD A;  1DPE A;  3G3I A;  3ODB A;  4F2O A;  5TP9 B;  2Y7P A;  5DEX A;  3G3H A;  1PB7 A;  4GLI A;  3TTR A;  2DS9 A;  3FV1 A;  3WAF A;  3IR1 A;  5BUU A;  3PUZ E;  4LQ2 A;  4H67 A;  1ELJ A;  5I57 A;  3CIJ A;  2HQ0 A;  3FJG A;  1R9L A;  2F7A A;  1FQA A;  2H98 A;  2DE2 A;  3TEL A;  4JWO A;  5ICQ A;  5KCJ A;  1MQJ A;  3ILU B;  1PB9 A;  3L6H A;  3VLV A;  2GHA A;  3OSR A;  1CB6 A;  4F1U A;  4G68 A;  4BDR A;  2A5S A;  3TEP A;  2Q88 A;  1YCJ A;  3LSW A;  5L9S A;  4KD5 A;  1SW1 A;  4RK2 A;  4OER A;  2NOO A;  3UN6 A;  4F3S A;  2F7B A;  4U4X A;  3EHS A;  2NXO A;  2HAU A;  1B2H A;  1IUD A;  2THI A;  2I0C A;  3OO6 A;  3CSG A;  1QVS A;  5H8H B;  4F39 A;  5HM4 B;  4NF5 A;  4F3B A;  3U94 A;  1FQB A;  3BFU A;  3EN3 A;  3IOR A;  3R6U A;  1DSN A;  1Y9U A;  1YTV A;  3TCH A;  4F3G A;  1H3D A;  2V25 A;  3F11 A;  1B9J A;  4OET A;  2XXX A;  4MLV A;  3K1M A;  1M5E A;  1SQY A;  4I9D A;  5AE4 A;  3ZKL A;  5H8F A;  3SEU A;  2Q8J A;  3SEX A;  2I3V A;  1BIY A;  2RKM A;  1XC1 A;  2HZK A;  4R2F A;  2XHD A;  1IXC A;  2QSX A;  5L9M A;  5CMB A;  4KYS A;  2Y7R A;  1DMB A;  1D9Y A;  2R9J A;  4M4G A;  1GV8 A;  2HCA A;  3IB2 A;  3MC2 A;  3CFX A;  5CBS A;  4YMB A;  1JNF A;  1N84 A;  2H25 A;  3PMW A;  3PPQ A;  3PPR A;  4KPT A;  3FXR A;  2BJJ X;  5CMM A;  5L8D A;  3U8Q A;  1JQF A;  3LR1 A;  2ZYN A;  3IK6 B;  4QFK A;  4ZE8 A;  4BDO A;  4GF8 A;  3H3G A;  3OEK A;  4H6D A;  4O3A A;  3FJ7 A;  1B3L A;  1P1N A;  2FNC A;  2M8C A;  2QS4 A;  4LON B;  3EPE A;  3KN3 A;  1BLF A;  5KDT A;  1OLA A;  4OVJ A;  4AB5 A;  5I56 A;  1Y4T A;  2F78 A;  3MVX A;  4IGR A;  1LAG E;  1XS5 A;  2HXW A;  4KCC A;  1MM7 A;  3OO8 A;  5F1Q A;  1RYO A;  1A55 A;  1MXU A;  2QJE A;  3FXQ A;  4EXL A;  1US4 A;  1ZTY A;  3KZG A;  3UP9 A;  1OMP A;  5H8Q B;  3E3K A;  2F34 A;  4ONY A;  4U4S A;  1HSJ A;  1NFT A;  3IJX B;  4LVQ A;  5A5X B;  1USY E;  3VXB A;  2QRY A;  1B4H A;  1AH5 A;  1LCF A;  2UVI A;  3MVY A;  2UYE A;  1LST A;  3K1N A;  1B3F A;  1A8F A;  2O84 X;  4YB5 A;  3SET A;  3Q25 A;  3U1O A;  1WDN A;  4GVO A;  4ZEF A;  1VE4 A;  1ZU0 A;  4ZE9 A;  2XXY A;  3DP4 A;  3H6U A;  3PUV E;  3RTF B;  5M2V A;  5I84 A;  2E0S A;  1B05 A;  1MQI A;  1MQD A;  1OQG A;  2RCA A;  2XXR A;  3MQ9 A;  3PUW E;  4OMB A;  4E0W A;  2OZZ A;  1VR5 A;  3K02 A;  4F1Y A;  3A3C A;  4R74 A;  5TU0 A;  5I2N A;  1B1X A;  4P0G A;  3TYH A;  2DSF A;  2P1S A;  5AA2 B;  4JWY A;  3EHT A;  1JEU A;  3HN0 A;  4ESW A;  3TCF A;  3SES A; 
#chains in the Genus database with same CATH topology
 4IY6 A;  3S9E A;  1HQY E;  1YLA A;  2ZYK A;  5EQT A;  4JI0 M;  1EYI A;  3H4J A;  2IA4 A;  5KQD A;  2RC9 A;  2ZNU A;  1FW0 A;  3GYY A;  3MPL A;  1OIZ A;  1R9Q A;  4XXU A;  3QYB A;  1NV4 A;  3E78 A;  4KI0 E;  4CJ6 A;  4EF1 A;  3UGW A;  1ZLQ A;  4UAC A;  1NNT A;  3TDJ A;  1F4I A;  5C18 A;  2XLJ A;  1VEG A;  2OOB A;  3QAX A;  4G6Z A;  3N5L A;  2QL3 A;  2CEA A;  5EQ9 A;  4ZDM A;  3VE1 B;  4GQO A;  3TAJ A;  1YXI A;  2ZYO A;  3UK4 A;  4K0K M;  2Q8M A;  4GRI A;  5EYG A;  2PBW A;  4Q8R A;  3IAZ A;  1GTK A;  5EHM A;  5ET8 A;  2XWO A;  3N6U A;  3FGS A;  4R2B A;  4LF9 M;  2XXP A;  3WAE A;  2PX1 A;  4O8M A;  1KZ8 A;  2F6G A;  3QK6 A;  4RJZ A;  1OTR A;  3AL0 C;  1QUS A;  4G8M A;  4UN2 B;  1PGY A;  1Y20 A;  5IZ1 A;  2LXE A;  1Y3Q A;  1US5 A;  3PUY E;  2V4C A;  2AL4 A;  1IMC A;  2XF3 A;  4RXL A;  1JB0 F;  2R46 A;  5HBC A;  4KHZ E;  4PDI A;  3GLG B;  2B4L A;  3HHF A;  2Y20 A;  3FV2 A;  1NJF A;  4MF3 A;  1ZAE A;  2CHV A;  3I51 A;  3V89 B;  3FAT A;  1IME A;  2Z8E A;  1QGX A;  5GKN A;  3SDF A;  3PNY A;  2JY7 A;  3RPW A;  3DZD A;  3NOH A;  2LBC A;  4AQY M;  4G4N A;  3E13 X;  4OVR A;  3OTO M;  2KRK A;  1OFH A;  4DZ1 A;  3SAU A;  3KOS A;  3C32 A;  4B7G A;  2HHM A;  3C3E A;  1URS A;  1TXF A;  1NV8 A;  1Z5A A;  3E9S A;  3O29 A;  4Q7J A;  2JY5 A;  5I7I A;  3C58 A;  4OVP A;  1T43 A;  4JSO A;  2XZU A;  4G8N A;  1NNJ A;  4POX A;  3SBJ A;  2R71 A;  4LGY A;  3G3G A;  4B3T M;  4PC9 A;  4GOT A;  3QYE A;  1B1H A;  2DZN B;  2QMX A;  4XKN A;  2NWJ A;  3W15 C;  2DE4 A;  1NUY A;  4GEW A;  2A5T B;  1E9S A;  2WX9 A;  4AS5 A;  4E0W A;  4I62 A;  2DWI A;  3THI A;  1OVB A;  3C3D A;  3JR4 A;  2H99 A;  1IN5 A;  5EQA A;  3GLG E;  3HFU A;  3TUS A;  4MNI A;  1I6A A;  3CVG A;  4DCY A;  2DAE A;  2X7P A;  2QVR A;  5DYH A;  1MS7 A;  2Q89 A;  4TQU Q;  1OAI A;  3AV0 A;  1IY1 A;  3K6W A;  5CI5 A;  3FXB A;  4HTG A;  5CC2 A;  3RGS A;  3L2A A;  5IT9 S;  3VVD A;  4DXB A;  5ELV A;  2GRV A;  2D7H A;  1D3K A;  1QUT A;  4BDL A;  5DYG A;  3K4U A;  1HNW M;  3M7G A;  3LCU A;  4ZED A;  3MJ5 A;  1NKX A;  2JWS A;  4N6K A;  2QPA A;  5ITR A;  5CRY A;  3IOW A;  4POW A;  5FTH A;  1TDH A;  4L8R C;  1TFA A;  3RPL B;  1IXG A;  4PFY A;  1ANF A;  3K2L A;  2EJS A;  2KHH A;  2LAO A;  3T38 A;  4L16 A;  5K2Y A;  2NQ8 C;  3B7D A;  3RYD A;  2FBP A;  1EU8 A;  3LV0 A;  4GIP A;  4PET A;  3FVN A;  1LAX A;  4THI A;  1LAH E;  4ZEB A;  5ITO A;  4QOS A;  1EIJ A;  3MZ9 A;  2ONK E;  1NUX A;  3KBR A;  3K01 A;  4GWY A;  3UJN A;  5L9O A;  2VDB B;  3O6H A;  3T1B A;  4NED A;  1SW5 A;  4MMP A;  3BIG A;  4DR4 M;  1R7R A;  2OPF A;  4X65 M;  2OK2 A;  1Y1Z A;  3SKP A;  3V5A A;  2F5O A;  2ZNS A;  5F7V A;  1GKI A;  1MXW A;  1FJG M;  4F3P A;  2EKF A;  3HX3 A;  2Y7K A;  3KSJ A;  2MGW A;  4M9X A;  5FTK A;  2R0I A;  1VG5 A;  2L7H A;  2F5S A;  3PD8 A;  4N4U A;  2ZZW A;  1FJ9 A;  4ELR A;  1AMF A;  2OBG A;  7CAT A;  4DR2 M;  4IO4 A;  4R75 A;  3SHF A;  4N13 A;  2UVG A;  2X8A A;  3LCV B;  4FE8 A;  3EHU A;  2RGH A;  4WED A;  4BDQ A;  1OQH A;  4HE1 A;  4XF5 A;  4DE8 A;  4FJP A;  3O2A A;  3KS4 A;  1VDL A;  4FCV A;  3EKI A;  4H8I A;  5CMK A;  1WOD A;  5A5X A;  1SW2 A;  3Q27 A;  2I58 A;  4RPN A;  5DYI A;  3FIR A;  4NTL A;  1SXJ C;  5EQ7 A;  4MAG A;  1NI9 A;  4R6K A;  4FBP A;  5TPA A;  2A5T A;  2AYS A;  4LJ8 A;  2B3T A;  1Y4C A;  3HHZ A;  2KLF A;  3T9V A;  4ZPX A;  2B4M A;  3C36 A;  4P16 A;  1A5T A;  2DWA A;  2VGQ A;  3MZB A;  1NHG C;  3PUX E;  1BTJ A;  4FD2 A;  5ITT A;  4ZEI A;  1N75 A;  1UTH B;  5IWA M;  3CR9 A;  1IN4 A;  4DR5 M;  4XIG Q;  1TH2 A;  2OQ4 A;  2UVJ A;  3FD9 A;  3I3V A;  3FUV A;  4R73 A;  4L15 A;  1NHW C;  1YPN A;  2R8T A;  2HWJ A;  2PCR A;  2B3B A;  2GH9 A;  4GWO A;  3RGP A;  3CF0 A;  3LSX A;  3JYR A;  3HZJ A;  4P11 A;  4GHA A;  1EH3 A;  2W7Y A;  4YKK A;  2NVU B;  2QS1 A;  1MH3 A;  3SYK A;  1RDZ A;  3F92 A;  2P5T A;  1L1T A;  4NOO B;  1FPJ A;  2RCB A;  4G8H A;  4R9G A;  3RLF E;  1DCU A;  1SDX A;  3TPZ A;  4IY5 A;  4LJ5 A;  1QAM A;  5J1D A;  4MJO A;  4JI5 M;  2P3N A;  2F5N A;  1NNU C;  2R45 A;  3FTC A;  1VEK A;  4MHF A;  2XX9 A;  4P1E A;  4TLM B;  3DP8 A;  3JZJ A;  4IO7 A;  2V3U A;  1SXJ B;  2L5V A;  5I2N B;  3GQ3 A;  3EF7 A;  3THG A;  2C9O A;  3MWB A;  3TTL A;  1FQC A;  3KN7 A;  1INP A;  5EHS A;  4DDD A;  4WW0 A;  3B7N A;  3L26 A;  2RGO A;  3KOZ E;  1K3X A;  4IB2 A;  1NSF A;  1TH3 A;  2KDL A;  1YYZ A;  4G4P A;  1PC3 A;  4EXK A;  3VDP A;  3CF6 E;  4LG2 A;  1FPF A;  3DOA A;  4QHS A;  1EZP A;  3IOV A;  4OEV A;  3VDF A;  1LBV A;  4JVC A;  2XXI A;  5EQ8 A;  4RNS A;  2ONS A;  1HNX M;  4WKM A;  1H6U A;  4ANR A;  1Q9D A;  4OEU A;  3RFW A;  1L8Q A;  2LVQ D;  4LUB A;  3TQS A;  4H5F A;  3CSB A;  4NAP A;  1YAE A;  1IIW A;  4OU7 A;  3U5Z B;  5HPQ A;  2Z8D A;  4OFJ A;  2B3F A;  1J09 A;  3RT6 B;  1V34 A;  1VQ1 A;  4LCB A;  5EP4 A;  4JDF A;  4QOZ C;  4PAF A;  1D0L A;  1NV6 A;  2Q9T A;  4RYA A;  4H46 A;  2W82 A;  4NXM M;  1IIT A;  2V84 A;  1S9T A;  3KW6 A;  2WBD A;  4X04 A;  4PD2 A;  3TTM A;  3ZKK A;  3VLU A;  2DVC A;  4HCW A;  2DHY A;  3G3I A;  4F2O A;  2Y7P A;  5DEX A;  2GNO A;  3WAF A;  4PF8 A;  1G4A E;  5BUU A;  4LQ2 A;  1ELJ A;  2Q74 A;  3CIJ A;  2QVU A;  1PB9 A;  1FJ6 A;  3PNV A;  1IFY A;  4LJ4 A;  3OSR A;  1QYR A;  1YCJ A;  4KD5 A;  1SW1 A;  1PM5 A;  1G59 A;  3UN6 A;  2F7B A;  4U4X A;  2QBY B;  4JYA M;  2QEN A;  2THI A;  5ITQ A;  1N33 M;  4X62 M;  4F39 A;  5HM4 B;  2DZO B;  4NF5 A;  3U94 A;  4R71 A;  2D7E A;  4B08 A;  2JY8 A;  3F11 A;  3KDS E;  4MLV A;  5AE4 A;  4BBA A;  2DVW B;  3ZKL A;  2Q8J A;  3U61 A;  2F5Q A;  1FRP A;  3GLF B;  4LJ9 A;  4LJ7 A;  4AKH A;  2LNH C;  1IXC A;  1PJS A;  5CMB A;  1GV8 A;  3IB2 A;  1FSA A;  5CBS A;  3PPQ A;  3PPR A;  5CMM A;  1PJT A;  4DV0 M;  5L8D A;  4ZE8 A;  4QFK A;  2ZYN A;  2Y5K A;  5ITY A;  3H3G A;  2XWI A;  4KXP A;  3FJ7 A;  4G3O A;  2M8C A;  1WIV A;  2J5Y A;  4CGY B;  1FPB A;  3EPE A;  3KN3 A;  5KDT A;  2OX3 A;  4IGR A;  2CHG A;  2ZTC A;  2KEB A;  3FXQ A;  4EXL A;  1SXJ D;  4ONY A;  3IJX B;  3T1Y M;  2L2D A;  3VXB A;  1B4H A;  2UYE A;  4YB5 A;  3SET A;  2O84 X;  3Q25 A;  2O5R A;  5FTJ A;  4N8Y A;  4ZEF A;  1ZU0 A;  4ZE9 A;  2V6Z M;  2XZF A;  3H6U A;  4XK8 F;  3PUV E;  1B05 A;  1OQG A;  5EXT A;  5F3W A;  5DW8 A;  2ZBK B;  3PUW E;  1VR5 A;  3D8L A;  3K02 A;  4DI3 D;  5I2N A;  2KQZ A;  4P0G A;  2P1S A;  4LJA A;  2ERC A;  4IIW A;  5ITU A;  2MJ5 B;  2CV2 A;  1NV3 A;  3OEL A;  2DXR A;  3HU3 A;  3TTN A;  4AKI A;  1XMQ M;  2H9B A;  4GL0 A;  3H7M A;  2FYI A;  1YUB A;  1HNZ M;  4HE2 A;  4OVQ A;  1QAO A;  1AWB A;  1WHC A;  4JI7 M;  2VP1 A;  2X4A A;  3SYL A;  4MBP A;  4F22 A;  3T22 A;  3M6A A;  3MVW A;  4M9S A;  1XVX A;  4JI1 M;  1DGH A;  3SZP A;  3B74 A;  2XX8 A;  1R6B X;  1R6Z A;  1DO0 A;  2QZ4 A;  4L78 A;  4MGK E;  1GL7 A;  2MR9 A;  5E26 A;  4GL8 A;  4JV5 M;  1Q02 A;  3GQ5 A;  2PFZ A;  3U6S A;  4I40 A;  1NV0 A;  2HL7 A;  2REG A;  2XX7 A;  4HW8 A;  2DAI A;  2ZZX A;  4OWD A;  1C7Y A;  1IXZ A;  1IMB A;  3HPI A;  4O7M A;  2XXW A;  1MY2 A;  3D4C A;  4PF6 A;  1FPL A;  4KFQ A;  2CZI A;  2OJT A;  4GRK A;  4ZEK A;  2UXA A;  3S9L C;  5LOM A;  4EDP A;  4NF6 A;  4W5W A;  4KYD A;  4IBF A;  3MW0 A;  1XI6 A;  1Z7N E;  3KG2 A;  2JZ1 A;  4GC9 A;  2ZYM A;  2R62 A;  4I3Y A;  5ET6 A;  3N94 A;  2V3T A;  1QUI A;  2FVZ A;  4N6P A;  4PGN A;  3FYD A;  3CFL A;  1PBQ A;  1K82 A;  3TQW A;  1MJG M;  5ICT A;  4I81 A;  1QUL A;  2UXC M;  4QXD A;  1FTJ A;  2FH0 A;  2DYX A;  2O69 A;  4IO5 A;  1XOC A;  2QCU A;  2R18 A;  3S9M C;  1A54 A;  2XXK A;  4XFE A;  4GXA A;  3U60 A;  2DDK A;  5FTL A;  2PT1 A;  4ISU A;  3I4Y A;  3DFZ A;  2FIX A;  2D21 A;  3J7B A;  1FTK A;  4LY6 A;  4JBZ A;  1POT A;  1EYK A;  1YZ0 A;  3M3K A;  3TWL A;  1MY4 A;  2DQV A;  3TPA A;  2Q2C A;  1N77 A;  2Z8F A;  1UTB B;  2XD2 A;  3Q26 A;  4DCX A;  3BBR A;  1MPD A;  5KDT B;  4JVI A;  1B3H A;  2GFE A;  1ZKB A;  2E1S A;  4RK9 A;  2DWJ A;  3QUJ A;  4NF8 B;  4O3C A;  2I48 A;  4P56 A;  4Z0I A;  2N35 A;  3H6W A;  5B70 A;  1QKB A;  3WHK A;  4BDN A;  2UUB M;  2XFS A;  4LZ5 A;  2DWM A;  3W67 A;  4LZJ A;  4GD5 A;  4DR1 M;  4O94 A;  5A2Q S;  1LV7 A;  4IBI A;  1T6O A;  1KYI A;  5I58 B;  2APL A;  3V76 A;  1M5D A;  4N81 A;  5CBR A;  1S3S A;  1FCK A;  1A7L A;  1W5S A;  4KHP M;  2O7U A;  2Y0T A;  1IMD A;  1M5B A;  2ZNT A;  4OYV A;  2XSZ D;  3OEN A;  1J5E M;  1MXV A;  1DO2 A;  4XKP A;  2JJK A;  5BR8 M;  4EUO A;  2OWT A;  3PPO A;  1HQC A;  5KO3 A;  5IZZ A;  1FQE A;  4LF7 M;  1DTG A;  4I5S A;  2GQF A;  3B6W A;  3K92 A;  1LBB A;  1NNF A;  1PJQ A;  1NV7 A;  4NF4 A;  4B3R M;  3KOX E;  5KPR A;  3TFL A;  3IX1 A;  4D80 A;  2Z23 A;  2ESN A;  3GLF A;  3DEL B;  4HCY A;  1UTH A;  4DI4 B;  2O01 F;  3AKZ A;  5K2X A;  1IXS A;  2DWZ B;  4PFT A;  3MYU A;  4TUW A;  1IEJ A;  3PD9 A;  4NC6 A;  5FHM A;  2CEY A;  2ONR A;  1Y3P A;  3IG5 A;  1Q3B A;  3CF2 A;  4KYE A;  1R2Z A;  1SYI A;  3A42 A;  3HKP A;  4DV6 M;  4NRV A;  1MU5 A;  3ZSF A;  1LB9 A;  2KW0 A;  1N34 M;  2XEP A;  1USY H;  3K6V A;  3GLI A;  2I49 A;  2CE7 A;  2R6F A;  4FED A;  5EXS A;  1LBW A;  3HU1 A;  2I4B A;  4XTC Q;  3CRB A;  3E46 A;  3FUZ A;  5H8F B;  1S7Y A;  2OWS A;  2CWB A;  1SI0 A;  2QQ8 A;  3AJI B;  3BBZ A;  3PVS A;  3HHW A;  4G2Z A;  1Z5C A;  3FTF A;  1NNP A;  4JI3 M;  2Y7W A;  1IQP A;  4GHL A;  1TFD A;  2O7I A;  3DA1 A;  2WZJ A;  4L6V 6;  4R6Y A;  4OXV A;  4C0R A;  3QMF A;  3K2D A;  2G29 A;  3W68 A;  1B7H A;  1QZE A;  1JR3 E;  4L17 A;  2JZ0 A;  1JW4 A;  1P1U A;  2HHH M;  4X1D A;  1A40 A;  4ECF A;  3GLB A;  5AA2 D;  2HEU A;  3C33 A;  1DBZ A;  2P0S A;  5H8N A;  1ZMU A;  4NWD A;  4M1V A;  4QRZ A;  1N7X A;  3T1H M;  3W0L B;  1G3I A;  3D1R A;  3H03 A;  4FIM A;  5E6J A;  1KWH A;  2OCU A;  3TTK A;  2Z7J A;  4X9T A;  4ELP A;  3PU5 A;  3ECR A;  1OIB A;  3A45 A;  4PFU A;  3SFZ A;  4NMY A;  1NV1 A;  4LP2 B;  2ZXT A;  3N26 A;  3M0E A;  2KXE A;  4PBQ A;  4BLC A;  1A8E A;  1TDZ A;  1MPC A;  1Y3N A;  5ET5 A;  5AA4 A;  1H76 A;  1DV0 A;  4IGT A;  2RC7 A;  2L4E A;  2XXQ A;  3TWK A;  3ZH9 B;  4QFN A;  4I1D A;  2VPN A;  5FHN A;  5I59 A;  3O97 A;  1ZV1 A;  3J7A S;  1H44 A;  2DE3 A;  4GWS A;  3IO6 A;  4YIC A;  4JI8 M;  1N32 M;  1NNK A;  4LAT A;  2O51 A;  2K9D A;  2P2A A;  1MDQ A;  2O25 A;  2I6E A;  2G5G X;  2KR0 A;  2XXU A;  1MQG A;  1D9Q A;  3B6Q A;  1RDY A;  2X7Q A;  1CNQ A;  2WYK A;  3D4G A;  1D2N A;  2FS1 A;  1L2B A;  2QPQ A;  4QFL A;  2QBY A;  4NF4 B;  1W5T A;  5H8H A;  2UXD M;  1NV9 A;  1IBK M;  3C31 A;  5ITP A;  1FPD A;  3U92 A;  1UIV A;  1B6H A;  1G0I A;  4YB7 A;  3D8B A;  3USD A;  4FW9 A;  1QKA A;  2Z4R A;  4P47 A;  1XC8 A;  3FZV A;  2HPG A;  3CHG A;  3UK6 A;  2V93 A;  2O1L A;  4IO3 A;  4LFB M;  5AA2 A;  1P1O A;  3ONM A;  2BJV A;  4F31 B;  1KSF X;  1BK4 A;  2HZL A;  5ITX A;  1RYX A;  2H4I A;  2HAV A;  3TMG A;  1AOV A;  1AL3 A;  2QP9 X;  3E4R A;  2O6A A;  4OVS A;  3SEW A;  4YKI A;  3PGF A;  1FBC A;  3H4Z A;  5F24 A;  1G0H A;  5DTB A;  1L1Z A;  4X48 A;  4DR3 M;  3OO9 A;  1IZ1 A;  4OAN A;  3DLN A;  1PBP A;  1URD A;  2VF7 A;  2UVH A;  4ZZE A;  1IXI A;  3RY3 A;  4LFA M;  2DWL A;  1NO1 A;  3Q29 A;  3OO7 A;  1LEV A;  3BFT A;  4G77 A;  2KNV A;  4H8J A;  1O63 A;  1B5J A;  3FUU A;  3T9H B;  3SAR A;  3JV9 A;  1SYH A;  1ZQ9 A;  3IFA A;  2DWN A;  1MXX A;  2XXH A;  4H0W A;  3T15 A;  2O1M A;  1K9Z A;  4GX4 A;  1Q39 A;  1KFV A;  2YQZ A;  4U22 A;  2F35 A;  2VD2 A;  5H8N B;  2KZU A;  2R65 A;  3ODB A;  1G8P A;  2EA0 A;  5TP9 B;  4JVD A;  2OOA A;  4GLI A;  3PUZ E;  1FBH A;  3A29 A;  2HQ0 A;  3TEL A;  1R9L A;  2H98 A;  2DE2 A;  4JWO A;  3L6H A;  3GLH E;  4DUZ M;  3UMM A;  4L4U A;  2Q88 A;  3LSW A;  3FKE A;  3HU2 A;  4RK2 A;  4OER A;  4F3S A;  1FBP A;  2HAU A;  2NXO A;  4AS4 A;  1UFZ A;  1QVS A;  1OIP A;  1FQB A;  3R6U A;  4HXV A;  1GO5 A;  4OET A;  3K1M A;  1M5E A;  4I9D A;  1YSY A;  4IR8 A;  2I3V A;  2JP7 A;  3B7Z A;  1EE8 A;  2HZK A;  1D0K A;  3ROJ A;  2Y7R A;  1D9Y A;  3JAM S;  3MC2 A;  4YMB A;  1JNF A;  4IBB A;  4KPT A;  2K0B X;  3U8Q A;  1JQF A;  3IK6 B;  4GF8 A;  5IZ7 D;  4O3A A;  1B3L A;  1QDT A;  3LVV A;  4LON B;  1BLF A;  3LQQ A;  1OLA A;  4OVJ A;  3U6P A;  2Z3X A;  1Y4T A;  4I4L A;  1LAG E;  4KCC A;  4F29 A;  1MM7 A;  2KNZ A;  5F1Q A;  1A55 A;  1SPI A;  1GL6 A;  2BJW A;  1US4 A;  2J7N A;  2F34 A;  4RF1 A;  1USY E;  2QRY A;  1LCF A;  2L09 A;  1WDN A;  4KLN A;  2XXY A;  3DP4 A;  4PBH A;  2LVO C;  2ZZV A;  3RTF B;  2RCA A;  3MQ9 A;  2XXR A;  4PTK A;  2OZZ A;  3FE3 A;  1B1X A;  2XFT A;  4ESW A;  3ZCB B;  5IZ3 A;  1DPP A;  3TWM A;  1N7W A;  1G71 A;  2F97 A;  4LF6 M;  2RF1 A;  3C9H A;  3TCG A;  4IBD A;  1N0T A;  1MX0 A;  4M0D A;  3VVF A;  2CMO A;  3PV0 E;  4JI2 M;  1A99 A;  1TR8 A;  3FRH A;  2G93 A;  2VD3 A;  4G61 A;  2EKK A;  3KOW E;  2CHQ A;  4GXS B;  1H45 A;  5I5P A;  2UU9 M;  4RY1 A;  3K0V A;  2FA7 A;  3RE8 A;  4PQJ A;  3FRI A;  3KJT A;  3SEV A;  2C9C A;  3MUQ A;  3O9P A;  4P17 A;  2YFQ A;  5I59 B;  2ZAO A;  4Q5T A;  4G68 B;  1S50 A;  1URG A;  2YNM D;  3K1P A;  2VHA A;  1D0M A;  4WUR A;  5LTC A;  3V83 A;  1CUK A;  5CM6 A;  4G68 C;  3UIF A;  2OLB A;  1B7U A;  1POY 1;  1ZBM A;  3FUT A;  4ZEC A;  5T3J A;  5EP1 A;  3KGC A;  2CZL A;  1UM8 A;  4P3L A;  3R7X A;  5TPA B;  2BNK A;  4I8O A;  3U61 B;  3IOT A;  2AHM A;  4LZZ A;  1JR3 D;  1P3Q Q;  1N76 A;  4C1U A;  3KP1 E;  1GGG A;  3AOG A;  5CMC A;  5EJC A;  4QBA A;  3MZ1 A;  2V3Q A;  4Z8X A;  1VDW A;  4OZ9 A;  1GAB A;  5BPV A;  4MGZ E;  1B51 A;  1SD3 A;  1B32 A;  1LAF E;  4JB7 A;  4DV1 M;  3O6I A;  1D9V A;  3O6G A;  3HO7 A;  2R4J A;  2CV0 A;  4R9F A;  3AOE C;  3U6M A;  1LFH A;  4LRS A;  4X64 M;  5I3S A;  3QIM A;  3VV5 A;  3ILK A;  4N17 A;  2LWX A;  2ZAN A;  2WEF A;  4QSC A;  2Z8Y M;  3S4U A;  4PE3 A;  2DAM A;  3U6O A;  1JEV A;  3HST A;  4IO6 A;  3ILT B;  3MVZ A;  1SVX B;  1PRB A;  3EIE A;  4QFP A;  1DGB A;  3U72 A;  1T3T A;  4A3V B;  3GO8 A;  3MP8 A;  4GBV A;  2PYY A;  1DTZ A;  5B7D A;  5JTY B;  3PPP A;  4F18 A;  4JN6 A;  1ZIU A;  3A46 A;  2F5P A;  1DOT A;  3VVE A;  3TKD A;  4GX3 A;  1QZM A;  2O68 A;  1JW5 A;  3B8B A;  3RUM A;  1DGF A;  2I7N A;  1R1N A;  1VFD A;  2BWE A;  3HWS A;  4AW4 A;  3LSF B;  4JSD A;  3O66 A;  1FQD A;  2KRU A;  1Q35 A;  3OEM A;  1XHB A;  3GZG A;  2YR0 A;  1OVT A;  3T0J A;  1OKS A;  2CUZ A;  3VFJ A;  1GVC A;  3W0F A;  1IQ7 A;  4LJ6 A;  3VLF B;  1DK4 A;  3QAU A;  3KFU G;  4PDD A;  1B3E A;  4IBE A;  4F19 A;  4IBJ A;  5KPT A;  3RQT A;  4JXJ A;  3I04 M;  3PPN A;  4NL4 H;  4YHH M;  3RNN A;  4XEQ A;  2Y84 A;  5EYF A;  1B3G A;  4GWX A;  2AIX A;  2WBB A;  4M9Z A;  1ZMG A;  3SER A;  1XXH E;  5KCJ B;  4AI6 A;  4DIG A;  2D5W A;  4GH9 A;  1N04 A;  4II7 A;  3LUZ A;  4AG6 A;  2VII A;  1FPK A;  4BLA A;  1NY6 A;  3SMP A;  5I56 B;  3EQ1 A;  2LHG A;  4LRT A;  2IEE A;  4AZF A;  1XVY A;  3GPU A;  4IBG A;  5H8Q A;  2DP8 A;  4LF5 M;  3MK6 A;  4YMA A;  3ISP A;  3GRU A;  3B50 A;  5ET7 A;  2Y21 A;  1C1K A;  3UGJ A;  4OVZ A;  1MG1 A;  2PMS A;  3L28 A;  1JVX A;  1TTE A;  1M5C A;  4MH5 A;  1IBM M;  3IB0 A;  3DM0 A;  1B0L A;  2FE8 A;  5FTM A;  3KOT A;  5H8S A;  2DAG A;  2YPN A;  1LBC A;  3EIH A;  1LGB C;  4I3E A;  5BWJ A;  1NJG A;  4QNR A;  1XNR M;  3PMV A;  4UAB A;  4BDM A;  1JVY A;  2I7P A;  3HHY A;  2F3D A;  1ZJL A;  4RKU F;  4PAI A;  4ZS9 A;  3W9W A;  3FJM A;  5DEX B;  1FBD A;  4MX6 A;  3W9V A;  4OVT A;  4M0W A;  1HR0 M;  5DNY A;  4AB6 A;  4PP0 A;  5AA3 A;  3B9P A;  4OFL A;  2M60 A;  4YKJ A;  1RDX A;  3K9P A;  4Z7E A;  2BJI A;  3HHG A;  3RT8 A;  3VLW A;  1IY0 A;  4Y28 F;  2DXY A;  4EQ9 A;  2Y7I A;  3G3J A;  1NH8 A;  4HLQ A;  3MMP A;  4BB9 A;  1XMO M;  3Q8X A;  1H43 A;  3ZC7 B;  2F36 A;  4GIZ A;  1XNQ M;  3NWL A;  1P99 A;  1IN6 A;  1X37 A;  1Z7M E;  3B6T A;  4RF0 A;  3R9X B;  3PMX A;  2DXI A;  3BOS A;  1DGG A;  4ELO A;  1I94 M;  3FUW A;  1B4Z A;  4P0I A;  2YJP A;  1NVM A;  1TWY A;  4CIS A;  3LSL A;  3MP1 A;  4N6D A;  1TT1 A;  3TL4 X;  3H4M A;  2I0B A;  2UYF A;  5DVI A;  1IM2 A;  2ZM6 M;  4RA1 A;  2RRU A;  2JY6 B;  1MY1 A;  4YB6 A;  4D81 A;  3T93 B;  4TLL B;  3OMB A;  3O28 A;  4DLD A;  1FTO A;  1PJJ A;  5DVF A;  3FYC A;  3SHG B;  2HXR A;  1FPI A;  1QJM A;  3IB1 A;  3BIH A;  2REJ A;  3N6T A;  3OD7 A;  3RPL A;  3VKG A;  3KBZ A;  4OES A;  2RC8 A;  3FAS A;  4AG5 A;  4NSR A;  2CZH A;  1E94 E;  4F2Q A;  3TQL A;  1VDD A;  1IBL M;  3I5O A;  5JTY A;  4H45 A;  3B89 A;  3OXN A;  4HEO A;  4GMQ A;  1I6Q A;  2K6B A;  2E5L M;  2Z22 A;  2D7G A;  5EP2 A;  2G8L A;  1VEJ A;  1FQF A;  4U21 A;  4U23 A;  5IKB A;  2F7C A;  2ZMB A;  1MQH A;  4GWU A;  3V8X B;  2VOZ A;  3HGI A;  2DWH A;  4FOR A;  4DXC A;  1IXH A;  4DV3 M;  1FPE A;  4XKQ A;  1FPG A;  1GR2 A;  5J16 A;  4FWH A;  4DBG B;  1E9R A;  2H5Y A;  2XXT A;  4IBC A;  3GPX A;  3CTW B;  3QYT A;  4P9K A;  2CFO A;  3KJ7 A;  3K00 A;  2C96 A;  1SG9 A;  1LLS A;  4JWX A;  1NY5 A;  1O7T A;  1XT8 A;  3AOE A;  4AKG A;  3T9X B;  1SBP A;  2P3V A;  4XKR A;  5FBP A;  4CHT B;  1JET A;  3TZA A;  1FTL A;  2Z4S A;  1UTB A;  4KCD A;  3GLH A;  1UIU A;  2F6P A;  3A09 A;  2CEX A;  4H5G A;  3KSX A;  3NBI A;  4LQ5 A;  4WEP A;  3H6V A;  4YKP A;  2DHR A;  1RKM A;  1MDP 1;  4GKJ M;  4EF2 A;  4X8R A;  1AIV A;  4IJF A;  3LVW A;  4Z6Y A;  2QS3 A;  4LA9 A;  1EFU B;  4OW0 A;  4QHT A;  1K3W A;  3H6T A;  4TOZ A;  4NF8 A;  2PFY A;  4PFR A;  1DPE A;  3L27 A;  3G3H A;  3K9O A;  4H67 A;  2KA6 B;  2F7A A;  5KCJ A;  1L2D A;  1TH4 A;  1MQJ A;  3ILU B;  3VLV A;  2GHA A;  4DV5 M;  3KXE C;  4F1U A;  4G68 A;  3TEP A;  1I4W A;  2QVV A;  4ITQ A;  3PTY A;  2JNH A;  3PXG A;  2NOO A;  3EHS A;  4N91 A;  1B2H A;  3OO6 A;  3CSG A;  5H8H B;  4F3B A;  1XB2 B;  1YTV A;  1Y9U A;  3E21 A;  2DEN A;  3TCH A;  4F3G A;  1H3D A;  3U60 B;  2XXX A;  3BXW A;  4GIT A;  1SQY A;  4DV4 M;  1WJ7 A;  3A98 B;  5C1B A;  3SEX A;  3KC1 A;  3SEU A;  1BIY A;  2RKM A;  4JI6 M;  4OVZ B;  4FWG A;  5L9M A;  5FTN A;  2R9J A;  3Q8G A;  3CFX A;  2H25 A;  2BJJ X;  3LR1 A;  3VDU A;  4BDO A;  3OEK A;  1P1N A;  2QS4 A;  1IXS B;  1Y8G A;  3KVW A;  3GLI B;  4NX1 A;  4HE0 A;  1MXU A;  2QJE A;  2JUJ A;  1ZTY A;  3KZG A;  1OMP A;  3GRR A;  3CGW A;  1NFT A;  5A5X B;  4PDH A;  2DI0 A;  5IM2 A;  3MVY A;  3U1O A;  1A8F A;  4XBO A;  2FHY A;  1SXJ E;  1IXR C;  1VE4 A;  4GC5 A;  4HL4 A;  4N15 A;  4NGU A;  1OAO C;  3KOY E;  4NRW A;  2C99 A;  3FTD A;  5IGA A;  1IN8 A;  3A3C A;  4R74 A;  5TU0 A;  1JEU A;  3HN0 A;  3TCF A;  3SES A;  3FVG A;  4ND9 A;  4XGI A;  5H37 D;  1Q1K A;  4Q0C A;  2I4C A;  2XWV A;  3OOA A;  3OSQ A;  2DOJ A;  3GBB A;  4PCZ A;  3FXU A;  3KFM A;  3T66 A;  1GJS A;  3SAT A;  2WKY A;  5I57 B;  2OO9 A;  1R5L A;  1QAN A;  4QSD A;  1LBY A;  3FVK A;  3CI8 A;  3VFD A;  4GWW A;  2QMW A;  2GQ1 A;  1GVN A;  3Q28 A;  1ZMW A;  3MBP A;  3U5Z A;  1II5 A;  2L6O A;  3CG1 A;  4DUY M;  3C9P A;  4EIW A;  1N3W A;  4N07 A;  4DXU A;  5AA4 B;  2WSF F;  5I2K B;  1NL5 A;  4P1L A;  3GPP A;  1MM6 A;  3C34 A;  3IJO B;  3HCQ A;  3E79 A;  3MST A;  4EQB A;  2M5Z A;  1OQY A;  1FBE A;  2PVU A;  4GKK M;  2A5Y B;  2FFJ A;  1V92 A;  4QHQ A;  2VF8 A;  1JW1 A;  2DKL A;  4MLQ A;  5FHO A;  2K47 A;  1B58 A;  2GHB A;  1SW4 A;  2X26 A;  4PGP A;  1MXY A;  1YE9 A;  4F1V A;  4F1I A;  4PT5 A;  3VKH A;  2RIN A;  1TGU A;  4PCD A;  1VSO A;  1EZ9 A;  1OLC A;  1FBF A;  5LDZ A;  2C98 A;  5EP3 A;  1EYJ A;  5JI2 E;  3GPY A;  4LF8 M;  4LF4 M;  4LGM A;  1WVJ A;  2MRO B;  3R8F A;  3M3F A;  3SMS A;  3RN8 A;  4R3D A;  1N3X A;  3KC0 A;  5A5L A;  1JQJ C;  4YAH X;  1QW0 A;  4C1T A;  3QWL A;  1IMF A;  5AA1 A;  3C4M A;  1N36 M;  4OTE A;  5IZ3 B;  4K3F A;  4OQO A;  3U6D A;  1NUW A;  4NN3 A;  3T96 B;  2MKZ A;  4MGY E;  4MNP A;  4KT0 F;  4O3B A;  5KPZ A;  4IO2 A;  4B7F A;  3BKI B;  4OX9 M;  2XA5 A;  4KQP A;  4H1X A;  1PEB A;  3SAS A;  4RPO A;  5KZT A;  3P7I A;  1TF0 B;  4MGI E;  4GX6 A;  2AL5 A;  1OJL A;  2DVZ A;  1O64 A;  1LBX A;  4B7H A;  1XXH A;  3UOR A;  2VQF M;  4G4R A;  3FUX A;  3J27 B;  1ORY B;  3UA8 A;  1MH4 A;  3HY5 A;  1MY3 A;  1JP4 A;  3KP0 E;  1I6B A;  4O7I A;  1R2Y A;  2NUV A;  3GP1 A;  2FIE A;  3T9U A;  1L5T A;  4F2L A;  4ELQ A;  1V33 A;  1IY2 A;  1WR1 B;  1LBZ A;  3GLI E;  5FTI A;  4MH0 E;  1QUK A;  1Y1M A;  3GXA A;  1B5I A;  1IMA A;  4NF5 B;  3GLG A;  2I3W A;  1MY0 A;  4WXJ A;  4U1Z A;  4FEB A;  4ZZA A;  3MHV C;  3SAV A;  3U6L A;  1XHY A;  8CAT A;  4MIJ A;  4H65 A;  2H5X A;  5TP9 A;  4PDG A;  3U65 A;  4WP2 A;  4REZ A;  4ESX A;  2R4E A;  3VK8 A;  1LFG A;  2X49 A;  3E9X A;  4NE4 A;  3LUY A;  3K1J A;  5IRE B;  1AUA A;  4CIZ A;  1VFE A;  2LVP C;  4NHB A;  1J7K A;  1SI1 A;  3AXF A;  5KQ8 A;  3B7Q A;  3FTE A;  3FVO A;  3U93 A;  1Q3C A;  1Z6T A;  1JR3 A;  2DAK A;  4DR6 M;  3GRY A;  4OEN A;  4U1O A;  3M3L A;  4LZ7 A;  4AQ4 A;  2G3Q A;  4FCT A;  1M5F A;  3IOU A;  3GLF E;  3QSL A;  1F9B A;  3QUF A;  3FD3 A;  3R26 A;  2OWZ A;  1LTM A;  4X1B A;  2B65 A;  4EQ7 A;  3IO4 A;  3I01 M;  4U2R A;  3IG8 A;  4MGH A;  3RGY A;  2XXV A;  4YZZ A;  2WSC F;  2Y0Q A;  3HV1 A;  4JXI A;  3AFH A;  1T0K A;  4MB7 A;  1MXZ A;  2Q2E B;  2XGN A;  1LB8 A;  2YLN A;  4YU0 A;  4FWD A;  1K9Y A;  3K6U A;  1ATG A;  3G7W A;  1CE2 A;  1PJI A;  4R6H A;  3MJN A;  4KR5 A;  1B0H A;  2MH8 A;  4NQ8 A;  3G3K A;  4B3M M;  3G3F A;  3S2V A;  3ZS6 A;  4NF0 A;  2ANJ A;  1QUJ A;  1WXQ A;  3L25 A;  4OFO A;  4LZ8 A;  2WSE F;  3U6C A;  3K6X A;  3GRV A;  4GBW A;  4MEV A;  2QNJ A;  3CFZ A;  2R6G E;  5DFL A;  3GQ4 A;  3SC3 A;  1B40 A;  2HFB A;  2LVA A;  3GLH B;  3J80 S;  2H1R A;  3S9N C;  4QSE A;  4PAK A;  5EXP A;  4UA8 A;  4P8B A;  2F4V M;  4PE5 B;  5I2K A;  3MAM A;  4MM3 B;  3PFI A;  4N8G A;  3J81 S;  1B5H A;  3DP6 A;  1L2C A;  1HSL A;  5JEI A;  1B7Z A;  2WYP A;  4NF6 B;  4R72 A;  2UUA M;  2PT2 A;  5FSW A;  2ALU A;  2VT5 A;  2XD3 A;  2XH9 A;  2CP8 A;  4PFW A;  2DZL A;  2L4F A;  4S12 A;  2ZAM A;  4JI4 M;  3HJQ A;  4DV2 M;  5EYH A;  4QF9 A;  3SEY A;  3U6Q A;  1LCT A;  1EZO A;  2CZK A;  2BWB A;  1BP5 A;  4FAT A;  2QHO B;  5ESY A;  4MFI A;  1FTM A;  4NWC A;  4GFR A;  1PDA A;  1MRP A;  5DT6 A;  1R4G A;  1B52 A;  2HKJ A;  3WHL A;  4NSO B;  5DVJ A;  4QNM A;  3KEI A;  4GWZ A;  3IL1 B;  5IAI A;  3CG3 A;  2KNA A;  3GBA A;  3MP6 A;  1NV5 A;  1WGL A;  2J7O A;  3LC8 A;  5JI3 E;  1UQW A;  2QS2 A;  4PFB A;  3C35 A;  4G4Q A;  1IN7 A;  4X66 M;  1J1N A;  3ZQJ A;  2V1U A;  1QVR A;  5JK4 A;  3QXM A;  4E0X A;  2QFL A;  4FAJ A;  1RU3 A;  2Q2A A;  2CV1 A;  2XWK A;  3LQR A;  4QFO A;  3UZU A;  1I69 A;  2VPO A;  4OA4 A;  1B46 A;  2UXB M;  4G4O A;  2EO2 A;  1D4N A;  1P1Q A;  1P1W A;  2ABH A;  4MCO A;  2VQE M;  3KN8 A;  3H06 B;  3MPK A;  3A3U A;  1MPB A;  1NMU A;  2F3B A;  4B3S M;  1G41 A;  4OHN A;  1BKA A;  1QAQ A;  1FTA A;  1KA1 A;  1XXH B;  1LFI A;  1XWI A;  1HSE A;  4PFI A;  3RTW B;  3VXC A;  1FNN A;  1NH7 A;  1OFI A;  5I58 A;  3LMM A;  5EXX A;  3HJ8 A;  1BVS A;  1QDR A;  3J2P B;  2RKO A;  2HCB A;  1GJT A;  4FCW A;  4DV7 M;  2F5X A;  3HJS A;  1PB8 A;  4FEC A;  4Q30 B;  4FVM A;  2UUC M;  3T6P A;  2ZTD A;  2DNA A;  5ITX E;  1KA0 A;  2L7I A;  4YY3 M;  3KS8 A;  4HS7 A;  5LMN M;  1NUZ A;  2F8D A;  2LTU A;  1WGN A;  3I6V A;  1FBG A;  4I8C A;  3LBS A;  4DR7 M;  2D3I A;  4NG7 A;  3K8Z A;  4IJE A;  3L6G A;  3TOD A;  3IFC A;  1ZMV A;  2C5R A;  1DGH B;  1PB7 A;  3TTR A;  2DS9 A;  3FV1 A;  3IR1 A;  1HT1 E;  2QSF X;  5I57 A;  3FJG A;  4KO8 A;  1FQA A;  5ICQ A;  2CRU A;  1CB6 A;  4BDR A;  3IEC A;  2FOI C;  2A5S A;  2KZS A;  5L9S A;  3JR5 A;  4LFC M;  1IUD A;  2I0C A;  2EUC A;  2LH0 A;  4IBK A;  3HHX A;  3BFU A;  3EN3 A;  3IOR A;  1HT2 E;  1DSN A;  3IHP A;  3U6E A;  2V25 A;  1B9J A;  5H8F A;  3VK7 A;  1Z59 A;  1SXJ A;  2JA2 A;  1XC1 A;  2V1C A;  3L29 A;  4R2F A;  2XHD A;  2QSX A;  2LHC A;  1E32 A;  4R7G A;  4KYS A;  1DMB A;  4M4G A;  2HCA A;  1N84 A;  3PMW A;  3LW5 F;  3FXR A;  2R44 A;  2Y5L A;  2FNA A;  4H6D A;  4NXN M;  2FNC A;  2JXN A;  4KOD A;  4D82 A;  5L8R F;  1N78 A;  1NV2 A;  4AB5 A;  5I56 A;  3I4V A;  2F78 A;  3MVX A;  4RNA A;  2HXW A;  3SAW A;  1XS5 A;  3TE6 A;  5ISU A;  3OO8 A;  1RYO A;  1MN3 A;  1GLN A;  3UP9 A;  5H8Q B;  3E3K A;  2XSZ A;  1AIP C;  4U4S A;  1HSJ A;  1QQW A;  4LVQ A;  2LVN C;  1AH5 A;  2UVI A;  1LST A;  3K1N A;  1HJP A;  1B3F A;  4LN5 A;  4GVO A;  3NBX X;  3FBP A;  1Z5B A;  2HAK A;  5LMU M;  5M2V A;  4MNC A;  2E0S A;  5I84 A;  1MQI A;  1MQD A;  5FLX S;  4OMB A;  4F1Y A;  3TYH A;  2DSF A;  5AA2 B;  4JWY A;  3EHT A;  3M8U A; 
#chains in the Genus database with same CATH homology
 4IY6 A;  3S9E A;  1HQY E;  2ZYK A;  5EQT A;  4JI0 M;  2IA4 A;  5KQD A;  2ZNU A;  2RC9 A;  1FW0 A;  3MPL A;  4XXU A;  1R9Q A;  4KI0 E;  4EF1 A;  3UGW A;  1ZLQ A;  4UAC A;  1NNT A;  3TDJ A;  5C18 A;  2XLJ A;  3QAX A;  4G6Z A;  3N5L A;  2QL3 A;  2CEA A;  4ZDM A;  3VE1 B;  4GQO A;  3TAJ A;  2ZYO A;  3UK4 A;  4K0K M;  4GRI A;  4Q8R A;  2PBW A;  3IAZ A;  1GTK A;  5EHM A;  3N6U A;  4R2B A;  3FGS A;  4LF9 M;  2XXP A;  3WAE A;  2PX1 A;  2F6G A;  3QK6 A;  4RJZ A;  3AL0 C;  4G8M A;  1Y20 A;  2LXE A;  1Y3Q A;  1US5 A;  3PUY E;  2AL4 A;  2XF3 A;  4RXL A;  2R46 A;  5HBC A;  4KHZ E;  4PDI A;  3GLG B;  3HHF A;  2Y20 A;  3FV2 A;  1NJF A;  4MF3 A;  1ZAE A;  2CHV A;  3I51 A;  3V89 B;  3FAT A;  2Z8E A;  5GKN A;  3SDF A;  3PNY A;  3RPW A;  3DZD A;  4AQY M;  4G4N A;  3E13 X;  3OTO M;  2KRK A;  1OFH A;  4DZ1 A;  3SAU A;  3KOS A;  3C32 A;  4B7G A;  1URS A;  1TXF A;  1Z5A A;  3E9S A;  3O29 A;  3C58 A;  4JSO A;  2XZU A;  4G8N A;  1NNJ A;  4POX A;  3SBJ A;  2R71 A;  4LGY A;  3G3G A;  4B3T M;  4GOT A;  1B1H A;  2DZN B;  2QMX A;  4XKN A;  2NWJ A;  3W15 C;  2DE4 A;  2A5T B;  1E9S A;  4E0W A;  4I62 A;  2DWI A;  3THI A;  1OVB A;  3JR4 A;  2H99 A;  1IN5 A;  3TUS A;  1I6A A;  3CVG A;  4DCY A;  2X7P A;  5DYH A;  1MS7 A;  2Q89 A;  4TQU Q;  3AV0 A;  1IY1 A;  3K6W A;  5CI5 A;  4HTG A;  5CC2 A;  3RGS A;  3L2A A;  5IT9 S;  3VVD A;  4DXB A;  5ELV A;  2GRV A;  2D7H A;  1D3K A;  4BDL A;  5DYG A;  3K4U A;  1HNW M;  3M7G A;  4ZED A;  3MJ5 A;  1NKX A;  2QPA A;  5ITR A;  5CRY A;  3IOW A;  4POW A;  5FTH A;  1TDH A;  4L8R C;  1TFA A;  1IXG A;  4PFY A;  1ANF A;  3K2L A;  2LAO A;  3T38 A;  4L16 A;  5K2Y A;  2NQ8 C;  3B7D A;  1EU8 A;  4GIP A;  4PET A;  3FVN A;  1LAX A;  4THI A;  1LAH E;  4ZEB A;  5ITO A;  4QOS A;  3MZ9 A;  2ONK E;  3KBR A;  3K01 A;  3UJN A;  5L9O A;  3O6H A;  4NED A;  1SW5 A;  4DR4 M;  1R7R A;  2OPF A;  4X65 M;  2OK2 A;  1Y1Z A;  3SKP A;  3V5A A;  2F5O A;  2ZNS A;  5F7V A;  1GKI A;  1MXW A;  1FJG M;  4F3P A;  2Y7K A;  3KSJ A;  4M9X A;  5FTK A;  2L7H A;  2F5S A;  3PD8 A;  4ELR A;  1AMF A;  2OBG A;  7CAT A;  4DR2 M;  4IO4 A;  4R75 A;  3SHF A;  4N13 A;  2UVG A;  2X8A A;  4FE8 A;  3EHU A;  2RGH A;  4WED A;  4BDQ A;  1OQH A;  4DE8 A;  4FJP A;  3O2A A;  3KS4 A;  4FCV A;  4H8I A;  5CMK A;  1WOD A;  5A5X A;  1SW2 A;  3Q27 A;  2I58 A;  4RPN A;  5DYI A;  3FIR A;  4NTL A;  1SXJ C;  4R6K A;  5TPA A;  2A5T A;  2AYS A;  4LJ8 A;  1Y4C A;  3HHZ A;  2KLF A;  3T9V A;  4ZPX A;  3C36 A;  4P16 A;  2DWA A;  2VGQ A;  3MZB A;  1NHG C;  3PUX E;  1BTJ A;  4FD2 A;  5ITT A;  4ZEI A;  1N75 A;  1UTH B;  5IWA M;  3CR9 A;  1IN4 A;  4DR5 M;  4XIG Q;  1TH2 A;  2OQ4 A;  2UVJ A;  3FD9 A;  3I3V A;  3FUV A;  4R73 A;  4L15 A;  1NHW C;  1YPN A;  2B3B A;  2GH9 A;  4GWO A;  3RGP A;  3CF0 A;  3LSX A;  3JYR A;  4P11 A;  4GHA A;  1EH3 A;  2W7Y A;  4YKK A;  2NVU B;  2QS1 A;  1MH3 A;  3SYK A;  2P5T A;  1L1T A;  4NOO B;  4G8H A;  2RCB A;  4R9G A;  3RLF E;  1SDX A;  3TPZ A;  4IY5 A;  4LJ5 A;  1QAM A;  5J1D A;  4JI5 M;  2F5N A;  1NNU C;  2R45 A;  3FTC A;  2XX9 A;  4TLM B;  3DP8 A;  3JZJ A;  4IO7 A;  2V3U A;  1SXJ B;  5I2N B;  3GQ3 A;  3EF7 A;  3THG A;  2C9O A;  3MWB A;  3TTL A;  1FQC A;  3KN7 A;  5EHS A;  4DDD A;  4WW0 A;  3L26 A;  2RGO A;  3KOZ E;  1K3X A;  4IB2 A;  1NSF A;  1TH3 A;  4G4P A;  1PC3 A;  4EXK A;  3VDP A;  3CF6 E;  4LG2 A;  3DOA A;  4QHS A;  1EZP A;  3IOV A;  4OEV A;  3VDF A;  2XXI A;  4RNS A;  2ONS A;  1HNX M;  4WKM A;  1H6U A;  4OEU A;  3RFW A;  1L8Q A;  4LUB A;  3TQS A;  4H5F A;  3CSB A;  1YAE A;  1IIW A;  4OU7 A;  3U5Z B;  5HPQ A;  2Z8D A;  4OFJ A;  2B3F A;  1J09 A;  3RT6 B;  4LCB A;  5EP4 A;  4JDF A;  4QOZ C;  2Q9T A;  4RYA A;  2W82 A;  4NXM M;  1IIT A;  2V84 A;  1S9T A;  3KW6 A;  4PD2 A;  3TTM A;  3ZKK A;  3VLU A;  2DVC A;  4HCW A;  3G3I A;  4F2O A;  2Y7P A;  5DEX A;  3WAF A;  1G4A E;  5BUU A;  4LQ2 A;  1ELJ A;  3CIJ A;  1PB9 A;  3PNV A;  3OSR A;  4LJ4 A;  1QYR A;  1YCJ A;  4KD5 A;  1SW1 A;  1PM5 A;  1G59 A;  3UN6 A;  2F7B A;  4U4X A;  2QBY B;  2THI A;  4JYA M;  2QEN A;  5ITQ A;  1N33 M;  4X62 M;  4F39 A;  5HM4 B;  2DZO B;  4NF5 A;  3U94 A;  2D7E A;  4B08 A;  3F11 A;  3KDS E;  4MLV A;  5AE4 A;  4BBA A;  2DVW B;  3ZKL A;  2Q8J A;  3U61 A;  2F5Q A;  3GLF B;  4LJ9 A;  4LJ7 A;  4AKH A;  2LNH C;  1IXC A;  5CMB A;  1GV8 A;  3IB2 A;  5CBS A;  3PPQ A;  3PPR A;  5CMM A;  4DV0 M;  5L8D A;  4ZE8 A;  4QFK A;  2ZYN A;  5ITY A;  3H3G A;  3FJ7 A;  2M8C A;  4CGY B;  3EPE A;  3KN3 A;  5KDT A;  4IGR A;  2CHG A;  3FXQ A;  2KEB A;  4EXL A;  1SXJ D;  4ONY A;  3IJX B;  3T1Y M;  3VXB A;  1B4H A;  2UYE A;  4YB5 A;  3SET A;  2O84 X;  3Q25 A;  2O5R A;  5FTJ A;  4ZEF A;  1ZU0 A;  4ZE9 A;  2V6Z M;  2XZF A;  3H6U A;  3PUV E;  1B05 A;  1OQG A;  5EXT A;  5F3W A;  2ZBK B;  3PUW E;  1VR5 A;  3D8L A;  3K02 A;  5I2N A;  4P0G A;  2P1S A;  4LJA A;  2ERC A;  4IIW A;  5ITU A;  2CV2 A;  3OEL A;  2DXR A;  3HU3 A;  3TTN A;  4AKI A;  1XMQ M;  2H9B A;  4GL0 A;  3H7M A;  2FYI A;  1YUB A;  1HNZ M;  1QAO A;  2VP1 A;  4JI7 M;  4MBP A;  2X4A A;  3SYL A;  4F22 A;  3T22 A;  3M6A A;  3MVW A;  4M9S A;  1XVX A;  4JI1 M;  1DGH A;  2XX8 A;  1R6B X;  1R6Z A;  1DO0 A;  2QZ4 A;  4L78 A;  4MGK E;  1GL7 A;  5E26 A;  4GL8 A;  4JV5 M;  3GQ5 A;  3U6S A;  2HL7 A;  2REG A;  2XX7 A;  4HW8 A;  4OWD A;  1IXZ A;  3HPI A;  2XXW A;  1MY2 A;  3D4C A;  4KFQ A;  2OJT A;  4GRK A;  4ZEK A;  2UXA A;  3S9L C;  5LOM A;  4EDP A;  4NF6 A;  4W5W A;  4KYD A;  4IBF A;  3MW0 A;  1Z7N E;  3KG2 A;  4GC9 A;  2ZYM A;  2R62 A;  3N94 A;  2V3T A;  1QUI A;  4N6P A;  3FYD A;  3CFL A;  1PBQ A;  1K82 A;  3TQW A;  5ICT A;  4I81 A;  1QUL A;  2UXC M;  1FTJ A;  2O69 A;  2DYX A;  4IO5 A;  1XOC A;  2QCU A;  2R18 A;  3S9M C;  1A54 A;  4GXA A;  3U60 A;  5FTL A;  2PT1 A;  4ISU A;  3I4Y A;  3DFZ A;  2D21 A;  3J7B A;  1FTK A;  4LY6 A;  4JBZ A;  1POT A;  3M3K A;  3TWL A;  1MY4 A;  2DQV A;  3TPA A;  2Q2C A;  1N77 A;  2Z8F A;  1UTB B;  2XD2 A;  3Q26 A;  4DCX A;  3BBR A;  1MPD A;  5KDT B;  1B3H A;  2GFE A;  1ZKB A;  2E1S A;  4RK9 A;  2DWJ A;  3QUJ A;  4NF8 B;  4O3C A;  2I48 A;  4Z0I A;  3H6W A;  5B70 A;  1QKB A;  3WHK A;  4BDN A;  2UUB M;  2XFS A;  4LZ5 A;  2DWM A;  4LZJ A;  4GD5 A;  4DR1 M;  5A2Q S;  1LV7 A;  4IBI A;  1KYI A;  5I58 B;  5CBR A;  1M5D A;  1S3S A;  1FCK A;  1A7L A;  1W5S A;  4KHP M;  2O7U A;  2Y0T A;  1M5B A;  2ZNT A;  4OYV A;  2XSZ D;  3OEN A;  1J5E M;  1MXV A;  1DO2 A;  4XKP A;  5BR8 M;  4EUO A;  2OWT A;  3PPO A;  1HQC A;  5KO3 A;  1FQE A;  4LF7 M;  1DTG A;  4I5S A;  3B6W A;  3K92 A;  1LBB A;  1NNF A;  4NF4 A;  4B3R M;  3KOX E;  5KPR A;  3TFL A;  3IX1 A;  4D80 A;  2Z23 A;  2ESN A;  3GLF A;  3DEL B;  4HCY A;  1UTH A;  3AKZ A;  5K2X A;  2DWZ B;  4PFT A;  4TUW A;  1IEJ A;  3PD9 A;  5FHM A;  2ONR A;  1Y3P A;  3IG5 A;  1Q3B A;  3CF2 A;  4KYE A;  1R2Z A;  1SYI A;  3A42 A;  3HKP A;  4DV6 M;  4NRV A;  1MU5 A;  3ZSF A;  1LB9 A;  2KW0 A;  1N34 M;  2XEP A;  1USY H;  3K6V A;  3GLI A;  2I49 A;  2CE7 A;  4FED A;  5EXS A;  3HU1 A;  2I4B A;  4XTC Q;  3CRB A;  3FUZ A;  5H8F B;  1S7Y A;  2OWS A;  1SI0 A;  3AJI B;  3PVS A;  3HHW A;  4G2Z A;  1Z5C A;  3FTF A;  1NNP A;  4JI3 M;  2Y7W A;  1IQP A;  4GHL A;  1TFD A;  2O7I A;  3DA1 A;  4R6Y A;  4OXV A;  4C0R A;  3K2D A;  2G29 A;  1B7H A;  4L17 A;  1JW4 A;  1P1U A;  2HHH M;  4X1D A;  1A40 A;  4ECF A;  3GLB A;  5AA2 D;  2HEU A;  3C33 A;  2P0S A;  5H8N A;  4NWD A;  4M1V A;  4QRZ A;  1N7X A;  3T1H M;  3W0L B;  1G3I A;  3H03 A;  4FIM A;  5E6J A;  1KWH A;  2OCU A;  3TTK A;  2Z7J A;  4X9T A;  4ELP A;  3PU5 A;  3ECR A;  1OIB A;  3A45 A;  4PFU A;  3SFZ A;  4NMY A;  4LP2 B;  2ZXT A;  3N26 A;  3M0E A;  2KXE A;  4BLC A;  1A8E A;  1TDZ A;  1MPC A;  1Y3N A;  5AA4 A;  1H76 A;  4IGT A;  2RC7 A;  2XXQ A;  3TWK A;  3ZH9 B;  4QFN A;  4I1D A;  5FHN A;  5I59 A;  3O97 A;  3J7A S;  1H44 A;  2DE3 A;  3IO6 A;  4YIC A;  4JI8 M;  1N32 M;  1NNK A;  4LAT A;  2O51 A;  2P2A A;  1MDQ A;  2I6E A;  2G5G X;  2XXU A;  1MQG A;  3B6Q A;  2X7Q A;  3D4G A;  1D2N A;  1L2B A;  2QPQ A;  4QFL A;  2QBY A;  4NF4 B;  1W5T A;  5H8H A;  2UXD M;  5ITP A;  1IBK M;  3C31 A;  3U92 A;  1UIV A;  1B6H A;  4YB7 A;  3D8B A;  3USD A;  4FW9 A;  1QKA A;  2Z4R A;  1XC8 A;  3FZV A;  3UK6 A;  2V93 A;  2O1L A;  4IO3 A;  4LFB M;  5AA2 A;  1P1O A;  3ONM A;  2BJV A;  4F31 B;  1KSF X;  2HZL A;  5ITX A;  1RYX A;  2H4I A;  2HAV A;  3TMG A;  1AOV A;  1AL3 A;  2QP9 X;  3E4R A;  2O6A A;  3SEW A;  4YKI A;  3PGF A;  3H4Z A;  5DTB A;  1L1Z A;  4X48 A;  4DR3 M;  3OO9 A;  1IZ1 A;  3DLN A;  1PBP A;  1URD A;  2UVH A;  4ZZE A;  1IXI A;  3RY3 A;  4LFA M;  2DWL A;  3Q29 A;  3OO7 A;  3BFT A;  4G77 A;  4H8J A;  1O63 A;  1B5J A;  3FUU A;  3T9H B;  3SAR A;  3JV9 A;  1SYH A;  1ZQ9 A;  2DWN A;  1MXX A;  2XXH A;  4H0W A;  3T15 A;  2O1M A;  1Q39 A;  1KFV A;  2YQZ A;  4U22 A;  2F35 A;  2VD2 A;  5H8N B;  2KZU A;  2R65 A;  3ODB A;  1G8P A;  2EA0 A;  5TP9 B;  4GLI A;  3PUZ E;  2HQ0 A;  3TEL A;  1R9L A;  2H98 A;  2DE2 A;  4JWO A;  3L6H A;  4DUZ M;  3UMM A;  4L4U A;  2Q88 A;  3LSW A;  3FKE A;  3HU2 A;  4RK2 A;  4OER A;  4F3S A;  2NXO A;  2HAU A;  1QVS A;  1FQB A;  3R6U A;  4OET A;  3K1M A;  1M5E A;  4I9D A;  1YSY A;  2I3V A;  1EE8 A;  2HZK A;  2Y7R A;  1D9Y A;  3JAM S;  3MC2 A;  4YMB A;  1JNF A;  4IBB A;  4KPT A;  3U8Q A;  1JQF A;  3IK6 B;  4GF8 A;  5IZ7 D;  4O3A A;  1B3L A;  3LVV A;  4LON B;  1BLF A;  3LQQ A;  1OLA A;  4OVJ A;  3U6P A;  2Z3X A;  1Y4T A;  4I4L A;  1LAG E;  4KCC A;  4F29 A;  1MM7 A;  5F1Q A;  1A55 A;  1GL6 A;  2BJW A;  1US4 A;  2J7N A;  2F34 A;  4RF1 A;  1USY E;  2QRY A;  1LCF A;  2L09 A;  1WDN A;  4KLN A;  2XXY A;  3DP4 A;  3RTF B;  2RCA A;  3MQ9 A;  2XXR A;  2OZZ A;  1B1X A;  2XFT A;  4ESW A;  3ZCB B;  1DPP A;  3TWM A;  1N7W A;  2F97 A;  4LF6 M;  2RF1 A;  3C9H A;  3TCG A;  4IBD A;  1N0T A;  1MX0 A;  4M0D A;  3VVF A;  2CMO A;  3PV0 E;  4JI2 M;  1A99 A;  2G93 A;  2VD3 A;  3KOW E;  2CHQ A;  4GXS B;  1H45 A;  2UU9 M;  4RY1 A;  3K0V A;  2FA7 A;  3RE8 A;  4PQJ A;  3KJT A;  3SEV A;  2C9C A;  3MUQ A;  3O9P A;  2YFQ A;  5I59 B;  2ZAO A;  4Q5T A;  4G68 B;  1S50 A;  1URG A;  2YNM D;  3K1P A;  2VHA A;  4WUR A;  3V83 A;  5CM6 A;  4G68 C;  3UIF A;  2OLB A;  1B7U A;  1POY 1;  1ZBM A;  3FUT A;  4ZEC A;  5EP1 A;  3KGC A;  2CZL A;  1UM8 A;  3R7X A;  5TPA B;  2BNK A;  4I8O A;  3U61 B;  3IOT A;  2AHM A;  4LZZ A;  1JR3 D;  1N76 A;  4C1U A;  3KP1 E;  1GGG A;  3AOG A;  5CMC A;  5EJC A;  3MZ1 A;  2V3Q A;  4Z8X A;  4OZ9 A;  5BPV A;  4MGZ E;  1B51 A;  1SD3 A;  1B32 A;  1LAF E;  4JB7 A;  4DV1 M;  3O6I A;  1D9V A;  3O6G A;  3HO7 A;  2R4J A;  2CV0 A;  4R9F A;  3AOE C;  3U6M A;  1LFH A;  4LRS A;  4X64 M;  3QIM A;  3VV5 A;  3ILK A;  2LWX A;  2ZAN A;  4QSC A;  3S4U A;  1JEV A;  3U6O A;  3HST A;  4IO6 A;  3ILT B;  3MVZ A;  1SVX B;  3EIE A;  4QFP A;  1DGB A;  3U72 A;  1T3T A;  4A3V B;  3GO8 A;  3MP8 A;  2PYY A;  1DTZ A;  5B7D A;  5JTY B;  3PPP A;  4F18 A;  4JN6 A;  1ZIU A;  3A46 A;  2F5P A;  1DOT A;  3VVE A;  3TKD A;  1QZM A;  2O68 A;  1JW5 A;  3RUM A;  1DGF A;  2I7N A;  1R1N A;  1VFD A;  3HWS A;  4AW4 A;  3LSF B;  4JSD A;  3O66 A;  1FQD A;  2KRU A;  1Q35 A;  3OEM A;  1XHB A;  3GZG A;  2YR0 A;  1OVT A;  3VFJ A;  2CUZ A;  1GVC A;  3W0F A;  1IQ7 A;  4LJ6 A;  3VLF B;  3QAU A;  3KFU G;  1B3E A;  4IBE A;  4F19 A;  4IBJ A;  5KPT A;  3RQT A;  4JXJ A;  3PPN A;  4NL4 H;  4YHH M;  3RNN A;  2Y84 A;  5EYF A;  1B3G A;  2AIX A;  4M9Z A;  1ZMG A;  3SER A;  5KCJ B;  4AI6 A;  4DIG A;  2D5W A;  4GH9 A;  1N04 A;  4II7 A;  4AG6 A;  2VII A;  4BLA A;  1NY6 A;  3SMP A;  5I56 B;  3EQ1 A;  4LRT A;  2IEE A;  4AZF A;  1XVY A;  3GPU A;  4IBG A;  5H8Q A;  2DP8 A;  4LF5 M;  3MK6 A;  4YMA A;  3GRU A;  2Y21 A;  1C1K A;  3UGJ A;  4OVZ A;  1MG1 A;  2PMS A;  3L28 A;  1JVX A;  1M5C A;  4MH5 A;  1IBM M;  3IB0 A;  3DM0 A;  1B0L A;  2FE8 A;  5FTM A;  3KOT A;  5H8S A;  2YPN A;  1LBC A;  3EIH A;  1LGB C;  5BWJ A;  1NJG A;  4QNR A;  1XNR M;  3PMV A;  4BDM A;  1JVY A;  2I7P A;  3HHY A;  1ZJL A;  4ZS9 A;  3W9W A;  3FJM A;  5DEX B;  3W9V A;  4M0W A;  1HR0 M;  5DNY A;  4AB6 A;  4PP0 A;  5AA3 A;  3B9P A;  4OFL A;  2M60 A;  4YKJ A;  4Z7E A;  3HHG A;  3RT8 A;  3VLW A;  1IY0 A;  2DXY A;  4EQ9 A;  2Y7I A;  3G3J A;  1NH8 A;  4HLQ A;  4BB9 A;  1XMO M;  3Q8X A;  1H43 A;  3ZC7 B;  2F36 A;  4GIZ A;  1XNQ M;  3NWL A;  1P99 A;  1IN6 A;  1X37 A;  1Z7M E;  3B6T A;  4RF0 A;  3R9X B;  3PMX A;  2DXI A;  3BOS A;  1DGG A;  4ELO A;  1I94 M;  3FUW A;  1B4Z A;  4P0I A;  2YJP A;  1NVM A;  1TWY A;  4CIS A;  3LSL A;  3MP1 A;  1TT1 A;  3TL4 X;  2UYF A;  3H4M A;  2I0B A;  5DVI A;  1IM2 A;  2ZM6 M;  4RA1 A;  1MY1 A;  4YB6 A;  4D81 A;  3T93 B;  4TLL B;  3OMB A;  3O28 A;  4DLD A;  1FTO A;  1PJJ A;  5DVF A;  3FYC A;  3SHG B;  1QJM A;  3IB1 A;  2REJ A;  3N6T A;  3OD7 A;  3VKG A;  4OES A;  2RC8 A;  3FAS A;  4AG5 A;  4NSR A;  1E94 E;  4F2Q A;  3TQL A;  1VDD A;  1IBL M;  3I5O A;  5JTY A;  3OXN A;  4GMQ A;  1I6Q A;  2E5L M;  2Z22 A;  2D7G A;  5EP2 A;  2G8L A;  1FQF A;  4U21 A;  4U23 A;  5IKB A;  2F7C A;  2ZMB A;  1MQH A;  3V8X B;  2VOZ A;  3HGI A;  2DWH A;  4FOR A;  4DXC A;  1IXH A;  4DV3 M;  4XKQ A;  1GR2 A;  4FWH A;  1E9R A;  2H5Y A;  2XXT A;  4IBC A;  3GPX A;  3CTW B;  3QYT A;  2CFO A;  3KJ7 A;  3K00 A;  2C96 A;  1LLS A;  4JWX A;  1NY5 A;  1O7T A;  1XT8 A;  3AOE A;  4AKG A;  3T9X B;  1SBP A;  4XKR A;  4CHT B;  1JET A;  3TZA A;  1FTL A;  2Z4S A;  1UTB A;  4KCD A;  3GLH A;  1UIU A;  2F6P A;  3A09 A;  4H5G A;  3KSX A;  3NBI A;  4LQ5 A;  4WEP A;  3H6V A;  4YKP A;  2DHR A;  1RKM A;  1MDP 1;  4GKJ M;  4EF2 A;  1AIV A;  4IJF A;  3LVW A;  4Z6Y A;  2QS3 A;  4LA9 A;  4OW0 A;  4QHT A;  1K3W A;  3H6T A;  4TOZ A;  4NF8 A;  1DPE A;  3L27 A;  3G3H A;  4H67 A;  2KA6 B;  2F7A A;  5KCJ A;  1L2D A;  1TH4 A;  1MQJ A;  3ILU B;  3VLV A;  2GHA A;  4DV5 M;  3KXE C;  4F1U A;  4G68 A;  3TEP A;  1I4W A;  4ITQ A;  3PXG A;  2NOO A;  3EHS A;  1B2H A;  3OO6 A;  3CSG A;  5H8H B;  4F3B A;  1Y9U A;  1YTV A;  3TCH A;  4F3G A;  1H3D A;  3U60 B;  2XXX A;  4GIT A;  1SQY A;  4DV4 M;  3A98 B;  3SEU A;  5C1B A;  3SEX A;  1BIY A;  2RKM A;  4JI6 M;  4OVZ B;  4FWG A;  5L9M A;  5FTN A;  2R9J A;  3CFX A;  2H25 A;  2BJJ X;  3LR1 A;  3VDU A;  4BDO A;  3OEK A;  1P1N A;  2QS4 A;  1IXS B;  3KVW A;  3GLI B;  1MXU A;  2QJE A;  1ZTY A;  3KZG A;  1OMP A;  3GRR A;  1NFT A;  5A5X B;  3MVY A;  3U1O A;  1A8F A;  4XBO A;  1SXJ E;  1IXR C;  1VE4 A;  4GC5 A;  4HL4 A;  3KOY E;  4NRW A;  2C99 A;  3FTD A;  1IN8 A;  3A3C A;  4R74 A;  5TU0 A;  1JEU A;  3HN0 A;  3TCF A;  3SES A;  3FVG A;  4ND9 A;  4XGI A;  5H37 D;  1Q1K A;  4Q0C A;  2I4C A;  3OOA A;  3OSQ A;  2DOJ A;  3GBB A;  4PCZ A;  3FXU A;  3KFM A;  3T66 A;  3SAT A;  2WKY A;  5I57 B;  1QAN A;  4QSD A;  3FVK A;  3CI8 A;  3VFD A;  2QMW A;  1GVN A;  3Q28 A;  3MBP A;  3U5Z A;  1II5 A;  2L6O A;  3CG1 A;  4DUY M;  4EIW A;  1N3W A;  4N07 A;  4DXU A;  5AA4 B;  5I2K B;  1NL5 A;  3GPP A;  1MM6 A;  3C34 A;  3IJO B;  3HCQ A;  4EQB A;  2M5Z A;  2PVU A;  4GKK M;  2A5Y B;  2FFJ A;  4QHQ A;  1JW1 A;  4MLQ A;  5FHO A;  2K47 A;  1B58 A;  2GHB A;  1SW4 A;  2X26 A;  1MXY A;  1YE9 A;  4F1V A;  4PT5 A;  3VKH A;  2RIN A;  1TGU A;  1VSO A;  1EZ9 A;  1OLC A;  2C98 A;  5EP3 A;  5JI2 E;  3GPY A;  4LF8 M;  4LF4 M;  4LGM A;  1WVJ A;  3R8F A;  3M3F A;  3SMS A;  3RN8 A;  4R3D A;  1N3X A;  1JQJ C;  4YAH X;  1QW0 A;  4C1T A;  3QWL A;  5AA1 A;  3C4M A;  1N36 M;  4OTE A;  4K3F A;  4OQO A;  3U6D A;  3T96 B;  4MGY E;  4O3B A;  5KPZ A;  4IO2 A;  4B7F A;  3BKI B;  4OX9 M;  4KQP A;  4H1X A;  1PEB A;  3SAS A;  4RPO A;  5KZT A;  3P7I A;  4MGI E;  2AL5 A;  1OJL A;  2DVZ A;  1O64 A;  3UOR A;  4B7H A;  1XXH A;  2VQF M;  4G4R A;  3FUX A;  3J27 B;  1ORY B;  3UA8 A;  1MH4 A;  1MY3 A;  3KP0 E;  1I6B A;  1R2Y A;  2NUV A;  3GP1 A;  3T9U A;  1L5T A;  4ELQ A;  1IY2 A;  5FTI A;  4MH0 E;  1QUK A;  1Y1M A;  3GXA A;  1B5I A;  4NF5 B;  3GLG A;  2I3W A;  1MY0 A;  4WXJ A;  4U1Z A;  4FEB A;  4ZZA A;  3MHV C;  3SAV A;  3U6L A;  1XHY A;  8CAT A;  4H65 A;  5TP9 A;  4PDG A;  4REZ A;  4ESX A;  2R4E A;  3VK8 A;  1LFG A;  2X49 A;  3E9X A;  4NE4 A;  3LUY A;  3K1J A;  5IRE B;  1VFE A;  1J7K A;  1SI1 A;  3AXF A;  5KQ8 A;  3FTE A;  3FVO A;  3U93 A;  1Q3C A;  1Z6T A;  1JR3 A;  4DR6 M;  3GRY A;  4OEN A;  4U1O A;  3M3L A;  4LZ7 A;  4AQ4 A;  4FCT A;  1M5F A;  3IOU A;  3QSL A;  1F9B A;  3QUF A;  3FD3 A;  3R26 A;  4X1B A;  2B65 A;  4EQ7 A;  3IO4 A;  4U2R A;  3IG8 A;  4MGH A;  3RGY A;  2XXV A;  4YZZ A;  2Y0Q A;  3HV1 A;  4JXI A;  3AFH A;  1T0K A;  4MB7 A;  1MXZ A;  2Q2E B;  2XGN A;  1LB8 A;  2YLN A;  4YU0 A;  4FWD A;  3K6U A;  1ATG A;  3G7W A;  1CE2 A;  1PJI A;  4R6H A;  3MJN A;  4KR5 A;  1B0H A;  3G3K A;  4B3M M;  3G3F A;  3S2V A;  3ZS6 A;  2ANJ A;  1QUJ A;  1WXQ A;  3L25 A;  4OFO A;  4LZ8 A;  3U6C A;  3K6X A;  3GRV A;  3CFZ A;  2R6G E;  3GQ4 A;  3SC3 A;  1B40 A;  2HFB A;  3GLH B;  3J80 S;  2H1R A;  3S9N C;  4QSE A;  5EXP A;  4UA8 A;  2F4V M;  4PE5 B;  5I2K A;  3MAM A;  4MM3 B;  3PFI A;  3J81 S;  1B5H A;  3DP6 A;  1L2C A;  1HSL A;  5JEI A;  1B7Z A;  4NF6 B;  4R72 A;  2UUA M;  2PT2 A;  5FSW A;  2ALU A;  2XD3 A;  2XH9 A;  4PFW A;  4S12 A;  2ZAM A;  4JI4 M;  3HJQ A;  4DV2 M;  4QF9 A;  3SEY A;  3U6Q A;  1LCT A;  1EZO A;  1BP5 A;  4FAT A;  4MFI A;  1FTM A;  4NWC A;  4GFR A;  1MRP A;  1PDA A;  5DT6 A;  1B52 A;  2HKJ A;  3WHL A;  4NSO B;  5DVJ A;  4QNM A;  3KEI A;  3IL1 B;  5IAI A;  3CG3 A;  3GBA A;  3MP6 A;  2J7O A;  3LC8 A;  5JI3 E;  1UQW A;  2QS2 A;  3C35 A;  4G4Q A;  1IN7 A;  4X66 M;  1J1N A;  2V1U A;  1QVR A;  5JK4 A;  3QXM A;  4E0X A;  4FAJ A;  2Q2A A;  2CV1 A;  3LQR A;  4QFO A;  3UZU A;  1I69 A;  1B46 A;  2UXB M;  4G4O A;  2EO2 A;  1D4N A;  1P1Q A;  1P1W A;  2ABH A;  2VQE M;  3KN8 A;  3H06 B;  3MPK A;  3A3U A;  1MPB A;  1NMU A;  4B3S M;  1G41 A;  4OHN A;  1BKA A;  1QAQ A;  1XXH B;  1LFI A;  1XWI A;  1HSE A;  3RTW B;  3VXC A;  1FNN A;  1NH7 A;  1OFI A;  5I58 A;  3LMM A;  5EXX A;  3HJ8 A;  3J2P B;  2RKO A;  2HCB A;  4FCW A;  4DV7 M;  2F5X A;  3HJS A;  1PB8 A;  4FEC A;  4Q30 B;  4FVM A;  2UUC M;  5ITX E;  2L7I A;  4YY3 M;  3KS8 A;  4HS7 A;  5LMN M;  2F8D A;  3I6V A;  4I8C A;  3LBS A;  4DR7 M;  2D3I A;  3K8Z A;  4IJE A;  3L6G A;  3TOD A;  2C5R A;  1DGH B;  1PB7 A;  3TTR A;  2DS9 A;  3FV1 A;  3IR1 A;  1HT1 E;  5I57 A;  3FJG A;  4KO8 A;  1FQA A;  5ICQ A;  1CB6 A;  4BDR A;  2A5S A;  2FOI C;  2KZS A;  5L9S A;  3JR5 A;  4LFC M;  1IUD A;  2I0C A;  2EUC A;  2LH0 A;  4IBK A;  3HHX A;  3BFU A;  3EN3 A;  3IOR A;  1HT2 E;  1DSN A;  3U6E A;  2V25 A;  1B9J A;  5H8F A;  3VK7 A;  1Z59 A;  1SXJ A;  2JA2 A;  1XC1 A;  2V1C A;  3L29 A;  4R2F A;  2XHD A;  2QSX A;  1E32 A;  4R7G A;  4KYS A;  1DMB A;  4M4G A;  2HCA A;  1N84 A;  3PMW A;  3FXR A;  2FNA A;  4H6D A;  4NXN M;  2FNC A;  4KOD A;  4D82 A;  1N78 A;  4AB5 A;  5I56 A;  3I4V A;  2F78 A;  3MVX A;  4RNA A;  2HXW A;  3SAW A;  1XS5 A;  3TE6 A;  5ISU A;  3OO8 A;  1RYO A;  1GLN A;  3UP9 A;  5H8Q B;  3E3K A;  2XSZ A;  4U4S A;  1HSJ A;  1QQW A;  4LVQ A;  1AH5 A;  2UVI A;  1LST A;  3K1N A;  1B3F A;  4GVO A;  1Z5B A;  5LMU M;  5M2V A;  5I84 A;  2E0S A;  1MQI A;  1MQD A;  5FLX S;  4OMB A;  4F1Y A;  3TYH A;  2DSF A;  5AA2 B;  4JWY A;  3EHT A;  3M8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...