3KSJA

The alkanesulfonate-binding protein ssua from xabthomonas axonopodis pv. citri bound to mes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
AEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
molecule keywords Nitrate transport protein
total genus 94
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA02
3E3KA 4TOZA 1N7WA 2O51A 3H6VA 4LQ5A 5A5XA 3TTRA 5EHSA 5KCJA 1FTLA 4GOTA 2ONKE 2DS9A 2QSXA 4POXA 1B46A 4IO6A 4QFNA 3LSXA 1GV8A 2HEUA 1WVJA 3M3KA 3MVYA 3SEYA 4GXSB 3TQLA 4YKIA 4BDQA 2P0SA 5I2KA 4NF6B 4OENA 5ISUA 3KSJA 2F7CA 2Y7WA 3ZKKA 3VLUA 2PMSA 2DQVA 4RXLA 3MP6A 1LB9A 1JEUA 1I6BA 3BFUA 1F9BA 1LAGE 1LSTA 3OD7A 5TU0A 4BDNA 4H5GA 4ESWA 2XX7A 3IOUA 1FTJA 3IJXB 4JXIA 4UA8A 1BP5A 4BDLA 5AA2D 1UTBB 4GIZA 5EHMA 3UA8A 4F1YA 1WODA 4H8JA 2P2AA 1LCFA 3K1PA 1SW4A 2DWAA 3DM0A 5DTBA 1H76A 3CSGA 2FYIA 2I6EA 1O63A 3K6WA 3CI8A 3E9XA 2I58A 3OO6A 3TZAA 3A3UA 1LBBA 1TFAA 3U92A 1MQGA 5CMCA 4U4SA 1LFIA 4O3BA 2PBWA 2Q9TA 1OVTA 3S2VA 4C1TA 2XXUA 3FZVA 4GXAA 1YPNA 2RC9A 3TPAA 5H8NA 2NXOA 5TP9A 3FATA 2RINA 1USYE 4QFOA 3HCQA 3MAMA 2O7IA 2Y7RA 4G8MA 4MFIA 4U4XA 1AH5A 2QRYA 1Y1MA 2F78A 3PPQA 1YAEA 1MPCA 1LAXA 4OXVA 4OEUA 4X1BA 2D3IA 4P0IA 3SETA 3TCGA 2I0CA 3O6GA 1DTZA 1FQCA 2QMXA 3V89B 1BIYA 2UYEA 1FQDA 2DE2A 4HTGA 2F34A 2F6PA 4WEPA 1MM7A 2OBGA 4DCYA 2F6GA 1P1UA 1OVBA 5I57B 1DTGA 4QFPA 5TPAB 1AIVA 3A3CA 2RF1A 3KN8A 4F22A 3O97A 3PGFA 2GHAA 4OWDA 2UVGA 1S7YA 5TPAA 2ABHA 3ONMA 1VSOA 1DOTA 2ANJA 4G77A 5IAIA 4LVQA 1URSA 2OWTA 1MXVA 2A5SA 3G3KA 2H4IA 1IUDA 1P99A 2XHDA 3C31A 4NF4B 4OERA 4H67A 2F8DA 1ATGA 2OWSA 1SD3A 1D4NA 1SBPA 2F97A 3RTWB 1P1OA 1SI0A 3OO7A 2O7UA 4IO4A 1LBCA 4O3AA 3FV2A 1QUIA 3FV1A 1SDXA 2B65A 3KN3A 3ODBA 1RYOA 3RT6B 3KJTA 1B32A 4R9FA 3USDA 3GBAA 3G3HA 1IIWA 2DVCA 4LQ2A 1QJMA 4LZ5A 3KFMA 1Y20A 3VFJA 4YB7A 2YPNA 5I58B 1B5JA 1HSEA 3I5OA 3QUJA 3LBSA 4FIMA 4OESA 4WKMA 3T9XB 4ISUA 3VXBA 1B1HA 1ANFA 1MH4A 1B0LA 1RKMA 2H9BA 4F18A 4DIGA 3OOAA 5KDTB 1XVXA 5CM6A 3V83A 5CMBA 4EXLA 1QUJA 1UTHA 3EHTA 3SEWA 1GVCA 3S9LC 4NF5A 2HXWA 4FEBA 4GVOA 4HCYA 1B2HA 4IO2A 1GGGA 4XKPA 5FTHA 5H8QB 3RY3A 3W15C 2V3TA 1VR5A 1XVYA 2D5WA 2PYYA 3IB2A 3K1NA 3KN7A 1B0HA 2O69A 4EQ9A 4P0GA 1GTKA 4PQJA 1MY1A 3ZKLA 3H6UA 3FXRA 1AMFA 1NNPA 2Y84A 4IO5A 1A8FA 3U94A 4WXJA 4X9TA 1QUKA 4IO7A 1QKAA 1D9YA 4ZZAA 1Y1ZA 3OEKA 3SKPA 5A5XB 1NNFA 4F19A 3PPRA 1IXHA 1MXUA 1B4ZA 1LGBC 2QJEA 3KOSA 1H45A 1SW2A 3LSFB 5CC2A 3TUSA 3MZ1A 2UYFA 4GF8A 2REGA 4N07A 3HV1A 2XXQA 3IORA 4QFLA 4EQBA 4ESXA 1I69A 1MH3A 5H8HB 2YLNA 2HAVA 4KCCA 3Q26A 1MQIA 1D9VA 3N5LA 4QFKA 3BFTA 1ZJLA 3C32A 3G3GA 3O29A 4QRZA 4RY1A 4U1ZA 5CRYA 3TKDA 4XKNA 4XTCQ 5I56A 2QS2A 4I62A 2QS3A 1UIUA 2DWJA 3BKIB 1FQAA 5CI5A 5H8QA 3TTNA 3UN6A 4EF1A 5CBSA 4WEDA 3IO6A 1N7XA 4ZEBA 2REJA 3N6UA 3K6XA 1A54A 3CVGA 3K6VA 2Q8JA 5AA2B 1N76A 2DE4A 3B6WA 4GWOA 5KDTA 3HHGA 3UK4A 1Y3NA 3T96B 2FA7A 3SEVA 4NMYA 5H8FA 2DE3A 3JYRA 2RCBA 2IA4A 5CMMA 1CB6A 4I9DA 4IY6A 1M5CA 4YMAA 1H44A 1MPBA 3F11A 4M4GA 1N3WA 1NH8A 1POY1 1LB8A 1S9TA 4JWYA 4R73A 1XT8A 4PE5B 4IB2A 3IJOB 2NOOA 3V5AA 5JK4A 2DVZA 1ZTYA 4DLDA 1FTMA 2V3QA 5I2NB 1B58A 1ZMGA 2CMOA 2O1LA 1BKAA 1IXIA 1XOCA 2O68A 1TXFA 3L6HA 5ITPA 2PT2A 4KYSA 5BUUA 5DVIA 4KD5A 5B7DA 5DVFA 3H4ZA 5F1QA 3U72A 1XS5A 3IK6B 4G8HA 5BWJA 5AA4A 4QF9A 3H6TA 1Y3PA 4THIA 1M5DA 4ZZEA 3FVGA 4JBZA 4KI0E 3C34A 4ELQA 4ELRA 5HBCA 2OK2A 3KOTA 1B3HA 1DSNA 4ZEFA 2A5TB 1UQWA 3CG1A 4EXKA 3MW0A 3FASA 4H8IA 5DEXA 4NF6A 1JW5A 4NF8B 4FATA 5I2KB 3PPPA 2ZYOA 4G2ZA 1PEBA 4G8NA 2Q89A 2AYSA 4GRKA 3SESA 3I6VA 1M5BA 3K01A 3HPIA 5FHOA 3TTLA 5JEIA 4DE8A 2QMWA 3LUYA 3E4RA 2Q88A 3W9WA 2ZNSA 3E13X 4OTEA 4OZ9A 4QSCA 4PFYA 4QSDA 3AXFA 3PMWA 4JB7A 3RT8A 3RN8A 5TP9B 4YU0A 3H3GA 3DP4A 4QSEA 2XD2A 4XKQA 1SW1A 5FHMA 4EQ7A 2ZYNA 3EQ1A 1WDNA 2B3FA 2ZYKA 3ECRA 3TDJA 4E0XA 3CRBA 1A8EA 2Z23A 3CFZA 3PD8A 4I8CA 3TYHA 3VLWA 3OXNA 4DCXA 1DPPA 2HAUA 3G3JA 3OMBA 5DVJA 3UP9A 1OQHA 3HHFA 1NMUA 2THIA 3O2AA 1B52A 3TCHA 3V8XB 3MPLA 3EPEA 1TWYA 3RLFE 3PUWE 1US5A 2Y7KA 4MH5A 2E1SA 2RC8A 5I57A 1JVXA 1PDAA 1H43A 1MXZA 3KZGA 3P7IA 4JDFA 4F1VA 4IGRA 2Q2AA 3PMXA 1VFEA 4U21A 4E0WA 4NTLA 3TELA 3K0VA 3M3LA 2P1SA 2LAOA 4KYDA 3DELB 4ZECA 3B6QA 1MPDA 1QVSA 3TEPA 1MXXA 2X7PA 3R6UA 3GBBA 3PD9A 3MP8A 1SQYA 2FNCA 4JWOA 3FUZA 1ZU0A 1R6ZA 1EZ9A 3PMVA 1MS7A 2H25A 1ZKBA 3PPOA 2UVJA 1O64A 2A5TA 3N26A 1A99A 4KFQA 4X48A 3VV5A 4RNSA 2OLBA 1R9LA 5CMKA 4FE8A 2I0BA 5ITOA 4YKKA 3TMGA 3IOVA 2GRVA 2ZXTA 4F3GA 2GHBA 4G4PA 2I4CA 3G3IA 4ONYA 5AA4B 3PUVE 4F3PA 5ICTA 3I3VA 2I3WA 3IB1A 1MXWA 3SEUA 1B3EA 1MM6A 5B70A 5L8DA 1ZLQA 1FQBA 3Q28A 1YTVA 4U2RA 2QPQA 3KG2A 4EUOA 2V3UA 4JWXA 4RA1A 4F3BA 3UORA 3DP8A 5FTIA 1B51A 1P1NA 4OFOA 1ZIUA 3ILTB 3PUZE 4UACA 3MBPA 3OSQA 3FXQA 4HW8A 1LAHE 3LC8A 2XXTA 1IXCA 3OO8A 4R9GA 1B40A 1GR2A 2CZLA 2GFEA 3RGYA 3RQTA 4LATA 1NNKA 1PB8A 1Z7NE 3CG3A 3CIJA 4KPTA 2G29A 4GL8A 1FQEA 3VLVA 5DYHA 5I56B 4LP2B 2E0SA 3MVWA 2O6AA 3IOTA 2UVIA 3DLNA 1JW4A 4N13A 2AL5A 1L5TA 4HCWA 2UVHA 3MVZA 4MLVA 4R75A 4XKRA 3CFXA 3OO9A 1LFGA 4Q30B 4RK2A 3IL1B 1Q1KA 4OVJA 4POWA 1N0TA 4Q0CA 4YAHX 1OMPA 3C4MA 1MQHA 4ND9A 5I84A 4DXBA 1A55A 1SYIA 2KLFA 3D4GA 4H5FA 5J1DA 4OQOA 1OLCA 1MQDA 3T66A 4H0WA 2DWIA 4HS7A 3ZS6A 1O7TA 4AB6A 2UXAA 2I3VA 1D3KA 4MF3A 1PBPA 1PBQA 2AIXA 2ZYMA 3LSLA 5L9MA 2F36A 2ZNUA 4FORA 1SW5A 1URDA 3MC2A 4C0RA 2XXVA 2F5XA 3IB0A 4F2QA 4KQPA 2HZKA 1NNTA 1ZBMA 2RC7A 2HCAA 4F1UA 4ZDMA 1JEVA 3C9HA 4BDMA 2X7QA 3O66A 3TCFA 1MY0A 1VE4A 3EHSA 4M1VA 1FQFA 4F31B 2W7YA 1B6HA 4LONB 2NWJA 4XIGQ 1POTA 2RKMA 3THIA 1PB9A 3G3FA 2NUVA 1B7UA 5H8FB 1Y3QA 2ESNA 3FJGA 4KYEA 5EYFA 1N04A 1A7LA 2ZMBA 4F29A 1FCKA 3N94A 4OETA 4R6YA 2F7BA 3U1OA 2HFBA 3VDFA 3MP1A 2XXRA 4FECA 3QAXA 1P1WA 3HSTA 3QK6A 4GQOA 1LLSA 3OEMA 4X1DA 3PUXE 3DP6A 1LAFE 3EF7A 3IX1A 1B7ZA 3OELA 3Q27A 3VXCA 2BJJX 2DP8A 5ELVA 2PT1A 1TT1A 3BBRA 3MPKA 1USYH 1SI1A 4OFLA 4DDDA 5I59A 3PV0E 2O1MA 1FTOA 4Z7EA 1Q35A 5K2XA 2QL3A 4KHZE 3VE1B 1MQJA 4IY5A 4EDPA 2H5YA 1OQGA 3L6GA 2XXIA 2QS1A 5HPQA 1MXYA 3QUFA 3LR1A 3C36A 3MQ9A 3OENA 1QW0A 1II5A 1MY2A 4JSOA 1EH3A 5H8NB 5JTYA 3MVXA 2IEEA 4PFTA 4DZ1A 4RYAA 1ELJA 2PX1A 2VGQA 4H1XA 1BTJA 3K02A 4NF4A 4NF8A 1H3DA 4TQUQ 1IZ1A 4U22A 3TFLA 1XHYA 4AQ4A 1N84A 1Y4TA 3U8QA 3HN0A 1EZOA 3VVFA 3MJNA 1B1XA 2Y7IA 3CFLA 4FJPA 4R6HA 3W9VA 1Z7ME 3WAFA 1BLFA 4R6KA 1NH7A 1AOVA 1JVYA 1M5EA 1NFTA 2VD3A 3KEIA 1MG1A 3O28A 2DXRA 4ZEIA 1UTBA 3FGSA 4AB5A 4LUBA 3FVNA 4YMBA 3IR1A 3TQWA 5I58A 5ICQA 3T9UA 3S9MC 1CE2A 4DXCA 3KJ7A 1XC1A 4C1UA 5I2NA 4PP0A 1Y9UA 2YJPA 1R1NA 3SDFA 3RUMA 2R9JA 1VFDA 3TTKA 2XXWA 2DXYA 4H65A 3S4UA 3OSRA 4KCDA 4U23A 1EZPA 1IEJA 1JW1A 4N6PA 2Z8FA 2DOJA 3RTFB 1B4HA 1IXGA 3R26A 1B3GA 5JTYB 1RYXA 5AA1A 3FVKA 4U1OA 4GFRA 3SEXA 5AA3A 3PUYE 4KR5A 2H98A 3M3FA 4P11A 2I4BA 1UIVA 3LSWA 2OCUA 4RPOA 3MZBA 1LFHA 3HO7A 2NVUB 3O6HA 2Q2CA 1MY4A 3K2DA 1MDQA 1R9QA 4GLIA 3T93B 4RJZA 5AE4A 3C35A 5KZTA 4K3FA 2HZLA 3IO4A 3QYTA 4R72A 4ELPA 5AA2A 2H99A 5I59B 1JETA 3S9EA 4ZEDA 1N3XA 3H6WA 4RPNA 2XXXA 4FAJA 1A40A 1US4A 2O84X 3PPNA 4ZE9A 1B7HA 5HM4B 1B9JA 1P1QA 2XD3A 3EN3A 4OYVA 3A09A 1HSLA 2GH9A 3MWBA 2ALUA 3EHUA 3FVOA 4IO3A 1NL5A 4JSDA 2QS4A 4NEDA 4QHQA 5FHNA 3TAJA 1LCTA 4LA9A 3QSLA 3O6IA 1EU8A 4TLMB 1T0KA 2XX9A 3S9NC 1S50A 2DSFA 3FJMA 3RNNA 2Z8EA 3H7MA 3H06B 3KSXA 2XXHA 2V25A 3PU5A 1J1NA 1B5IA 4YB6A 3FIRA 4YKPA 4GL0A 2ONSA 4GD5A 5F7VA 5M2VA 2DWHA 2Z22A 3GLBA 3JV9A 4I1DA 3QXMA 4YB5A 5DEXB 3FJ7A 3UGWA 4F39A 4G68A 1AL3A 1MRPA 3M8UA 4TLLB 4R74A 2ZNTA 3TODA 2D21A 1PB7A 2OZZA 4LZ7A 2XXPA 3GXAA 4ZS9A 4Z0IA 4BLAA 5CBRA 2V93A 1B3LA 1FTKA 4PFWA 5DT6A 1IITA 4FEDA 2WKYA 4OHNA 3K4UA 1DMBA 2I49A 4BDRA 5L9SA 3CSBA 4NF5B 5L9OA 1SYHA 3KBRA 2VD2A 1UTHB 3VVEA 2Z8DA 2ONRA 4OFJA 2DYXA 3QIMA 4OEVA 3WAEA 2G93A 3H03A 4F2OA 3B7DA 3B6TA 4NWCA 3C33A 4XXUA 3TTMA 4MLQA 4EF2A 4F3SA 1DPEA 2XX8A 5IKBA 2VP1A 4OMBA 3K00A 1QKBA 2XXYA 1Y4CA 4G68B 4O3CA 4ELOA 1TFDA 2X26A 5KCJB 3R7XA 4G68C 1I6QA 4R2BA 1NKXA 2VHAA 2AL4A 3GZGA 4LZ8A 4ZEKA 3T9VA 4RK9A 3UIFA 3K1MA 4YZZA 1M5FA 4DXUA 1MY3A 3KGCA 3D4CA 1B3FA 3RPWA 3IAZA 4YICA 3K6UA 4PETA 1KWHA 2F7AA 4BDOA 4NWDA 1YCJA 1JNFA 1OLAA 2I48A 2VOZA 2Y7PA 2HQ0A 2F35A 3FD3A 5LOMA 3G7WA 3MUQA 1URGA 3CR9A 1IQ7A 3Q29A 1QULA 3O9PA 4ECFA 1HSJA 5H8SA 3JZJA 1B5HA 4Q5TA 3U93A 4L17A 2RCAA 4MBPA 3N6TA 1JQFA 5K2YA 4Q8RA 4ZE8A 3SERA 4NE4A 2M8CA 2R6GE 2OJTA 3T22A 1MDP1 2B3BA 1OIBA 1FW0A 5H8HA 4YKJA 3VVDA 3MZ9A 3IOWA 3ZSFA 2PVUA 4IGTA 3Q25A 1PC3A 2V84A 3ILUB 4PFUA 2R71A 1I6AA 4R2FA 3FXUA 3T9HB 1B05A 4H6DA 1SVXB
chains in the Genus database with same CATH superfamily
3NBIA 1TDHA 1N7WA 1JQJC 2O51A 4LQ5A 5A5XA 4GHAA 1IN4A 1VG5A 4HE0A 3U60A 3LSXA 3M3KA 3SEYA 5I2KA 4NF6B 2FIXA 4G4QA 2HHHM 2Y7WA 4S12A 1JEUA 1LAGE 4FBPA 1QZMA 4H5GA 4PF8A 2M5ZA 4BDLA 1BP5A 1UTBB 1UFZA 5EHMA 3AV0A 1G0HA 1SW4A 1CUKA 4NN3A 2FYIA 3K6WA 3TZAA 3KOXE 4GBVA 1TFAA 1VQ1A 2PBWA 4C1TA 1E94E 4JXJA 3GLGB 3TPAA 3UZUA 4I5SA 1TDZA 4QFOA 3MAMA 4LF7M 4U4XA 2F78A 1YAEA 4F2LA 4ZPXA 2D3IA 1PGYA 2CZKA 3TCGA 2I0CA 4IBGA 3O6GA 1BIYA 2UYEA 1FQDA 3M7GA 1HNXM 4HTGA 4ANRA 4DCYA 4WEPA 2OBGA 1NHGC 1T43A 1P1UA 2H5XA 1PJSA 3PGFA 3LMMA 4OWDA 3U6CA 1VSOA 4JI0M 1URSA 4BBAA 3J7BA 2Z8YM 4PDHA 2XHDA 1IUDA 4NF4B 3C31A 2VF8A 2OWSA 2F97A 3RTWB 1P1OA 3OO7A 3BBZA 4DR5M 3E79A 1RYOA 3RT6B 4R9FA 3GBAA 4LQ2A 1IIWA 2DVCA 1NV8A 4DV7M 1Y20A 1NI9A 1QUTA 4GX3A 3QUJA 1XHBA 1IN7A 1VEJA 3E9SA 3SEWA 4GVOA 4FEBA 4O7MA 1GGGA 1LBZA 3W15C 1XVYA 2Q74A 4NSRA 3FXRA 1NNPA 2Y84A 1A8FA 2LVPC 3HX3A 1NNFA 4X65M 1LGBC 1SW2A 4GF8A 2UYFA 2REGA 4RF1A 4LGMA 1I69A 4LF9M 5H8HB 4KCCA 2P3VA 3HJQA 1ZQ9A 3N5LA 5CRYA 1HR0M 4U1ZA 4I62A 2J7NA 4OANA 2DWJA 2UXCM 3AFHA 3HWSA 1LEVA 5CI5A 3TTNA 1V92A 1N7XA 4NL4H 4R7GA 5AA2B 2G5GX 4OVZA 2DE4A 1Y3NA 1PJTA 4HE1A 5CMMA 1L1ZA 4IY6A 3A29A 3Q8XA 1S9TA 1N3WA 1LB8A 1XT8A 4PE5B 3IJOB 4O8MA 5JK4A 1NNUC 3FBPA 4DLDA 4LY6A 1FTMA 1LBXA 1B58A 5C18A 2C9OA 4KYSA 2M60A 1VDDA 2LNHC 3TWLA 4G8HA 2RRUA 5E26A 2PFZA 4KI0E 1B3HA 2XFSA 3RYDA 2L7HA 2A5TB 1UQWA 4NF6A 1JW5A 4NF8B 4FATA 3L26A 4GRKA 2JZ0A 2WZJA 1M5BA 3IFCA 5EQTA 4LFBM 2FVZA 4FD2A 3SC3A 3E4RA 3HFUA 3LUYA 2Q2EB 2V1CA 2ZNSA 1GKIA 3RT8A 3U5ZB 4YU0A 1KZ8A 3DP4A 4XKQA 2QZ4A 2KEBA 2ZYNA 4DI3D 2DAEA 3EQ1A 4E0XA 3GLFA 3TQSA 2HAKA 3PD8A 3CFZA 4DCXA 5DVJA 2HAUA 2WBDA 3MPLA 4JI7M 3PUWE 2Y7KA 2E1SA 3L28A 1PDAA 3GPPA 1MXZA 4F1VA 4XBOA 4DR7M 4IGRA 4E0WA 4NTLA 3K0VA 1N78A 2P1SA 1FNNA 3FUTA 1QVSA 4D82A 3GBBA 1HNWM 3PMVA 2H25A 3N26A 1A99A 4X48A 4RNSA 2OLBA 5DYIA 1DCUA 4GBWA 5CMKA 2I0BA 4GWWA 4N91A 1FPGA 4XGIA 4F3GA 3PUVE 2MROB 2KR0A 3IB1A 2LH0A 2DKLA 2L6OA 1ZLQA 1YYZA 1FQBA 2WEFA 2QPQA 2C5RA 4F3BA 3UORA 1B51A 1TGUA 1GO5A 1P1NA 4MNCA 3PUZE 3MBPA 3OSQA 3FXQA 2JY7A 5EXPA 1G0IA 2D7HA 1GR2A 4YY3M 3KW6A 3MYUA 2JA2A 4QXDA 3HY5A 3CG3A 2G29A 3VLVA 5I56B 2O6AA 2QSFX 4WP2A 2AL5A 3GPXA 5L8RF 1DV0A 3CFXA 3MK6A 4Q30B 2RKOA 1Q1KA 2WYKA 4LJ8A 1GABA 1LBYA 2EJSA 3C4MA 2CV1A 4OQOA 4H0WA 2DWIA 1O7TA 1XXHE 2UXAA 3C9PA 2I3VA 4MF3A 3LSLA 3RPLA 5ITUA 2R8TA 4C0RA 2F5QA 1EYKA 3FTFA 4F1UA 3C9HA 4YHHM 5EQ7A 3TCFA 2HKJA 1MY0A 2VIIA 2W7YA 4LONB 2QP9X 2NWJA 4LRTA 1PB9A 3G3FA 5H8FB 4PFIA 4N8YA 1A7LA 4A3VB 2F7BA 1FBGA 4G3OA 3B7ZA 2J7OA 3DP6A 5F24A 3Q27A 2FBPA 1IY1A 4LFAM 1USYH 1D9QA 5I59A 3DZDA 2BJVA 4Z7EA 5K2XA 2QL3A 4KHZE 1MQJA 4EDPA 1OQGA 2Q8MA 2XXIA 3QUFA 1N36M 1QW0A 3L29A 1EH3A 1RDZA 5JTYA 2IEEA 2ZTCA 3JR4A 4OA4A 5ITQA 4U22A 3BOSA 1EZOA 5DFLA 1IBLM 2AHMA 5EXSA 3U8QA 1Q39A 2CHQA 2BJIA 2DZNB 3VVFA 3CFLA 5ITXA 3J2PB 3WAFA 1VEKA 3WHLA 1EFUB 3HU1A 1JVYA 1OKSA 2DI0A 3KEIA 3O28A 4ZEIA 4YMBA 2XLJA 3TQWA 4DXCA 4C1UA 2DWMA 1Y9UA 2YJPA 3TTKA 1VFDA 3OSRA 3THGA 1IEJA 3PFIA 3RTFB 3GLGA 1XB2B 1FJGM 1B4HA 1IXGA 2DOJA 3R26A 5AA1A 3FVKA 4U1OA 1DGBA 2R65A 4NRVA 4RPOA 3K2DA 3T93B 2RGHA 2R62A 3QYTA 4P47A 4ELPA 5I59B 1JETA 3U61A 4RPNA 5IZZA 3KP1E 3LCUA 3ILKA 1EYJA 2XD3A 3QAUA 3A09A 3MHVC 1HSLA 4MCOA 4AS5A 4QHQA 1S3SA 4KHPM 2RGOA 1OFIA 1Z5BA 3FJMA 3RNNA 1I4WA 3PU5A 2V25A 3EKIA 4PT5A 1B5IA 2R46A 2ONSA 5DEXB 3E21A 4F39A 1AL3A 3TODA 2D21A 4GIPA 3GXAA 5CBRA 1DGHB 2ZTDA 4PDDA 4OHNA 1NNJA 2I49A 5ITYA 5L9SA 4WURA 4NF5B 5L9OA 4GKJM 4G6ZA 2Z8DA 3DA1A 1X37A 3H03A 4F2OA 3B6TA 3K00A 2OX3A 4G68B 4O3CA 2CE7A 4L15A 1TFDA 4MJOA 2R45A 4G68C 5HPQA 4DV3M 4BB9A 4AS4A 3UIFA 3K9OA 3T15A 3I04M 2KQZA 1OTRA 4DXUA 5EP3A 4YICA 4N8GA 2F7AA 4NWDA 1YCJA 1JNFA 1OLAA 4AKHA 3MJ5A 1NY5A 2VQEM 4B3MM 4Q5TA 4LJ4A 2RCAA 2B4LA 4MBPA 4MH0E 4I81A 1HJPA 3B7NA 2KNVA 2M8CA 3KS8A 2B3BA 5H8HA 1FJ9A 4IGTA 1PC3A 2V84A 2LVQD 1I6AA 5I56A 1B05A 2ONRA 1MX0A 4MHFA 3LQQA 1FTLA 4GOTA 3KFUG 2QSXA 4XK8F 1B46A 3L25A 3AKZA 4GXSB 1G3IA 4YKIA 3SATA 3ZKKA 1OIPA 2QNJA 4L4UA 1I6BA 3BFUA 3OD7A 2XX7A 3IOUA 3IJXB 3GLGE 4P56A 2L2DA 3UA8A 1WODA 4NSOB 3IECA 3DM0A 3HZJA 1H76A 3CSGA 2I6EA 2XWOA 1SG9A 3CI8A 1XC8A 5CMCA 4U4SA 4JV5M 4GX6A 3HHYA 1D0MA 2P5TA 1YPNA 3VDUA 5H8NA 3NWLA 3SBJA 1NHWC 2O7IA 3PPQA 4X1BA 4OEUA 4G4RA 2ZAMA 2QMXA 2HL7A 3V89B 1QAQA 1AWBA 2LHCA 2F6PA 4LF4M 5I57B 1Z5CA 1EYIA 4DV1M 3A3CA 2E5LM 5DW8A 2X49A 1S7YA 5TPAA 5FLXS 2XSZA 3JR5A 1PJIA 2ANJA 1DOTA 5FTLA 5DNYA 2A5SA 3G3KA 2H4IA 4DBGB 4OERA 3J7AS 2F8DA 1ATGA 2Y21A 1SBPA 4B3RM 2FFJA 2YNMD 2OOAA 1FBCA 1QUIA 1SDXA 3KN3A 2FH0A 5KQ8A 2J5YA 1K82A 1FSAA 4MEVA 2LWXA 1ZMWA 5C1BA 4GRIA 4B3SM 1B5JA 3I5OA 4FIMA 3A45A 4WKMA 4ISUA 1ANFA 1RKMA 4DUYM 3OOAA 5CM6A 2FS1A 3GLIB 4EXLA 4NF5A 2HXWA 4EQ7A 2QCUA 1TTEA 2B3TA 2PYYA 2UU9M 3T6PA 4G4NA 4PQJA 1J5EM 4PAIA 3LV0A 3ZKLA 4GX4A 3GLHA 1YLAA 3HGIA 1D9YA 2H1RA 1Y1ZA 3SKPA 4F19A 3PPRA 5CC2A 1H45A 4N07A 3IORA 4QFLA 1WHCA 2YLNA 1MQIA 1ZJLA 4QRZA 1N33M 5A5LA 5IZ1A 5H8QA 4NG7A 3IO6A 1NJGA 4ZEBA 3LUZA 2Q8JA 1A54A 1K9YA 3B6WA 4GWOA 4HE2A 3UK4A 2LTUA 3U6OA 4H45A 3T96B 2CEAA 3JYRA 2RCBA 4IBJA 4I9DA 1DO0A 1H44A 3TPZA 3F11A 4PBQA 4R73A 1D0KA 3V5AA 3FTEA 1ZTYA 1SXJC 3PXGA 5I2NB 1ZMGA 2CMOA 2O1LA 1IXIA 3L6HA 2QENA 2WX9A 2NQ8C 3E46A 2PT2A 4L6V6 3UMMA 2PCRA 5DVFA 3H4ZA 1FTAA 1XS5A 2X4AA 1QUSA 3W67A 4THIA 3SYKA 1ZMVA 3FE3A 3C34A 4ELRA 4REZA 2DDKA 2OK2A 4GEWA 3SMPA 5DEXA 3FASA 2F3BA 5ET5A 3PPPA 1H6UA 3U5ZA 4O94A 1PEBA 2Q89A 1RDXA 4LJ9A 1IY2A 3I6VA 4H46A 5FHOA 1FPKA 3KOYE 2QMWA 3EIHA 3E13X 4OZ9A 4PF6A 2LVOC 3B7QA 3RN8A 5H8NB 5FHMA 3H3GA 2XD2A 1LBVA 4DR6M 2ZYKA 2B3FA 2Y20A 3ECRA 2HPGA 2Z23A 1R6BX 4JI4M 5H37D 3GLIE 1GJSA 4DUZM 3HHFA 1B52A 3TCHA 4LF8M 4FWGA 2RC8A 4QOZC 1AIPC 1JVXA 1H43A 3P7IA 3PMXA 4U21A 5EQ8A 3LCVB 3U6PA 5J16A 3B6QA 4MB7A 2A5YB 1MPDA 2JXNA 1MXXA 4GWYA 3PD9A 1ZU0A 4M0DA 2KDLA 1ZKBA 4NX1A 2UVJA 4ITQA 3B8BA 4K0KM 3T1YM 4IJEA 2GRVA 5ICTA 2JY5A 4ONYA 2WSEF 3I3VA 3VFDA 4FCVA 2FIEA 4P9KA 3VKHA 3KG2A 5I3SA 2V3UA 4JWXA 3GLFB 2KHHA 4OFOA 2W82A 3CF2A 1PRBA 4I40A 1IMAA 1LAHE 2UUBM 1OIZA 4PTKA 2APLA 2GFEA 1PB8A 4Z8XA 4LP2B 3IOTA 4N13A 1L5TA 2K9DA 1NV7A 4HCWA 1J7KA 4R75A 4RK2A 1LFGA 4JN6A 2JUJA 5I84A 1A55A 1SYIA 3KC1A 3D4GA 1OLCA 1MQDA 1R4GA 5FTKA 4AB6A 2F5OA 2WSCF 1NJFA 2X8AA 3FTCA 4X66M 1PBQA 5L9MA 2ZNUA 4NHBA 5ITXE 4FORA 1SW5A 3MC2A 2D7EA 3IB0A 4KQPA 2HCAA 3B50A 4BDMA 2EKKA 3FYDA 3U6QA 3HU2A 4F31B 3EHSA 1FQFA 3KP0E 1POTA 1R5LA 1NO1A 2CZIA 5LMUM 3A42A 5EYFA 2EKFA 4PFRA 2ZMBA 5A2QS 1FCKA 4OVZB 3N94A 4OETA 4X62M 4R6YA 3TE6A 1FBHA 2XXRA 4FECA 4X1DA 3QK6A 3OEMA 2EO2A 3IX1A 1B7ZA 5EQ9A 3U6SA 2PT1A 1TT1A 4IR8A 3HU3A 1IXSA 2ZAOA 1IXZA 4IY5A 2QS1A 4DV4M 3OENA 4B7FA 4CHTB 1II5A 1MY2A 4MMPA 3MVXA 2ERCA 4PFTA 4DZ1A 4GWXA 5LMNM 1ELJA 4NAPA 2YR0A 1NV9A 2DZLA 1IZ1A 1FBFA 3I4YA 4OU7A 1B1XA 4FJPA 4R6HA 3W9VA 4R3DA 1T3TA 4IBDA 4GWUA 2VD3A 4HLQA 3C3DA 3SFZA 1MG1A 2EUCA 2G3QA 4AB5A 1TR8A 5I58A 5ICQA 3GQ4A 2XEPA 4IBEA 3S9MC 3C58A 1XC1A 1FPJA 5LTCA 1QGXA 4Z6YA 2OWZA 4GWZA 2DXYA 2CEXA 3S4UA 4BLCA 4KCDA 3T1BA 4MGKE 4U23A 4N6PA 5JTYB 1TF0B 4KR5A 2Y5KA 4PC9A 1UIVA 2BWBA 3TWMA 2NVUB 1Z5AA 1MY4A 1R9QA 4GLIA 3RPLB 5T3JA 2HZLA 3ROJA 4R72A 3S9EA 2KA6B 3H6WA 2ZM6M 2O84X 5HM4B 4B7HA 1B7HA 1IXRC 4PGPA 4NEDA 3EHUA 3B9PA 2QS4A 4OX9M 2DHRA 3FRIA 4LA9A 2OPFA 3QSLA 2OQ4A 3U60B 3B74A 2Z8EA 1GL7A 1XI6A 3TWKA 4JI1M 1F4IA 4N6KA 3FIRA 1KYIA 1IMEA 5M2VA 2DWHA 2Z22A 4I1DA 4OVSA 3FJ7A 3ZH9B 4TLLB 3RGSA 2ZNTA 3PVSA 2OZZA 2V93A 4DR4M 4I3EA 1G41A 1VDWA 2WKYA 2JWSA 3KBRA 2CRUA 2KRKA 2DYXA 3QIMA 3WHKA 2G93A 1AUAA 4NWCA 3TTMA 2OO9A 4B3TM 1DPEA 2XX8A 3F92A 5KCJB 1NKXA 3GZGA 4ZEKA 4R71A 4RK9A 3K1MA 2C99A 4YZZA 1M5FA 4WW0A 1TH3A 3VK7A 3CTWB 2XZUA 4HXVA 5ITRA 1KWHA 2I48A 2VOZA 2Y7PA 2F35A 4P1EA 1Q9DA 5LOMA 4L8RC 1URGA 4JI2M 1UM8A 1WIVA 1HSJA 2QVVA 1SPIA 1Z6TA 3N6TA 4Q8RA 4ZE8A 1JR3A 3BIHA 4NE4A 3SERA 3T22A 1MDP1 1FW0A 3MZ9A 3IOWA 3ISPA 4PFUA 4II7A 4R2FA 3T9HB 4H6DA 4YMAA 3E3KA 3H6VA 3RFWA 1QVRA 4PCZA 3TTRA 1FPLA 4MGHA 2ONKE 3K2LA 2DS9A 4POXA 2BNKA 4IO6A 4QFNA 1GV8A 2HEUA 2CP8A 1WVJA 3MVYA 2DAIA 1XXHA 2ZBKB 4BDQA 1NV4A 4OENA 3IHPA 2F7CA 1N34M 4RXLA 3MP6A 3U6EA 1F9BA 5TU0A 4ESWA 4BDNA 1FTJA 5AA2D 4GIZA 1W5TA 4F1YA 1HQCA 4AW4A 2KNZA 4AI6A 3HHXA 2DWAA 2VT5A 3K1PA 5DTBA 3E9XA 3U92A 3A3UA 1LBBA 1MQGA 1LFIA 4O3BA 3S2VA 1OVTA 4FCWA 4GXAA 2ZZWA 2NXOA 2QPAA 4Q7JA 2RINA 3HCQA 2C98A 1QANA 3K8ZA 1IBMM 2Y7RA 4G8MA 1AH5A 2QRYA 5L8DA 1BVSA 3FRHA 1LAXA 2FHYA 1MJGM 4M9ZA 1LTMA 1DTZA 2V4CA 2BJWA 1MM7A 1GVNA 2F5SA 2F6GA 4PFBA 1DTGA 1AIVA 2VPNA 3KN8A 4F22A 3O97A 2GHAA 2UVGA 3ONMA 1GL6A 2DVWB 4G77A 3K92A 1QZEA 3W0LB 4LVQA 5IAIA 2OWTA 4H67A 3CHGA 3K9PA 3J80S 1HT2E 3PNYA 4IO4A 2O7UA 1LBCA 1PJQA 4IBKA 4RKUF 3FV2A 3GPUA 2B65A 1MN3A 2F5PA 4FW9A 3HHWA 3USDA 4NXMM 3G3HA 1QJMA 4LZ5A 3KFMA 3VFJA 4YB7A 2YPNA 1HSEA 3LBSA 3FXBA 1B1HA 1MH4A 5KDTB 1B0LA 4F18A 1IY0A 1QUJA 3S9LC 4DI4B 4XKPA 4HCYA 1B2HA 2JNHA 2R4JA 3PNVA 1YUBA 1JB0F 5H8QB 2V3TA 4I8OA 4LF5M 2D5WA 3IB2A 3MSTA 2JY6B 4EQ9A 3J81S 4P0GA 1GTKA 2DXIA 3H6UA 4NGUA 3DOAA 3HHZA 4IO5A 4IO7A 4LFCM 1QKAA 4UABA 4ZZAA 3QMFA 1IXHA 2QJEA 4NOOB 3GO8A 3GP1A 1B4ZA 1RDYA 3KOSA 3LSFB 4N81A 4UN2B 4P1LA 2XXQA 4ESXA 3IG8A 1MH3A 5KQDA 2HAVA 2VF7A 2JJKA 3Q26A 1D9VA 3FTDA 3C32A 4RY1A 1DGGA 3TKDA 3GRUA 4XKNA 3FUXA 1ZMUA 2QS2A 1UIUA 3BKIB 2L5VA 1FQAA 1Z59A 3UN6A 4WEDA 3CVGA 3UK6A 1NV2A 1XNQM 3SARA 2DZOB 2O01F 4IBIA 2FA7A 3SEVA 2DWZB 4NMYA 2DE3A 5H8FA 2OOBA 1WGNA 2IA4A 1CB6A 4OVTA 3FD9A 4M4GA 2LHGA 5ITTA 1G4AE 4M9SA 2YQZA 2UXBM 2V3QA 4PDGA 1XOCA 1TXFA 5BUUA 3AOEC 2R6FA 5B7DA 5EYHA 5F1QA 4LJAA 1IN6A 5BWJA 1RU3A 4QF9A 3H6TA 4MNPA 1Y3PA 4ZZEA 1NV5A 1IN8A 3T1HM 3FVGA 4JBZA 4ELQA 5HBCA 5EYGA 1IMFA 2KZSA 1J09A 3CG1A 3MW0A 3D1RA 5I2KB 3SESA 2AYSA 2HXRA 4NXNM 3RGPA 3HPIA 3K01A 1ZAEA 4OTEA 4QSDA 3PMWA 1OFHA 4JI3M 2XGNA 1FPDA 1WDNA 4N4UA 4GH9A 1A8EA 4W5WA 4GC9A 3KVWA 4I8CA 3OXNA 1NUYA 1NV3A 3G3JA 3UP9A 1NMUA 2THIA 3V8XB 1TWYA 3RLFE 1YE9A 3JAMS 2QBYA 2VPOA 5ET8A 2Q2AA 4IIWA 1VFEA 3M3LA 2LAOA 3I01M 4PDIA 2DENA 1R7RA 1VDLA 3TEPA 2X7PA 3R6UA 1KSFX 1SQYA 2FNCA 2XA5A 2MH8A 3FUZA 2CWBA 5IZ3A 1EZ9A 3SHGB 3PPOA 3KDSE 2WYPA 4JVCA 3VV5A 1R9LA 4FE8A 3TMGA 5IWAM 2ZXTA 2GHBA 4G4PA 2I4CA 4F3PA 2I3WA 3AL0C 4GKKM 3SEUA 1FBDA 3KOWE 1B3EA 1MM6A 3Q28A 3R9XB 4RA1A 1C7YA 2Z3XA 3ILTB 4UACA 2DAMA 4HW8A 3LC8A 2XXTA 1JR3E 3RQTA 3I51A 4LATA 1NNKA 4M0WA 5IREB 2XWKA 3MVWA 2D7GA 2CEYA 1Q3BA 1YXIA 4FVMA 2UVHA 4MLVA 3BXWA 1LBWA 4OVJA 1N0TA 4Q0CA 4YAHX 1OMPA 2KLFA 4H5FA 1L2DA 4IBCA 3M0EA 2P3NA 1PBPA 2AIXA 2ZYMA 2F36A 1N75A 5FTJA 1URDA 4IJFA 2XXVA 2F5XA 2MR9A 5KPZA 2RC7A 7CATA 3GQ3A 2X7QA 3O66A 1TH2A 1XMOM 3OTOM 4QNRA 1VE4A 2WBBA 3A98B 3NBXX 2R4EA 4XIGQ 2NUVA 1B7UA 2R0IA 3FJGA 1YZ0A 5IM2A 1DK4A 1IFYA 2XWVA 1P1WA 3HSTA 1LLSA 2CHVA 3SHFA 3C3EA 3OELA 3VXCA 2BJJX 1D0LA 2CHGA 5ELVA 2DNAA 1SI1A 4DDDA 1PM5A 1NV6A 5I7IA 1FTOA 2DAGA 3T0JA 1Q35A 3VE1B 5EJCA 2H5YA 3L6GA 3LR1A 3C36A 1NUZA 2CFOA 4I4LA 4JSOA 3GRRA 1D2NA 1BTJA 4TQUQ 4NF4A 4NF8A 3TFLA 1G59A 4N6DA 4F3SA 1XHYA 3HN0A 3U65A 2Y7IA 1CNQA 1NUXA 1Z7ME 4R6KA 1NH7A 3RE8A 1NFTA 3L27A 2I7PA 1UTBA 3EIEA 3FVNA 3H4MA 2DAKA 4MGYE 4D80A 3T9UA 1SXJA 3A46A 4LN5A 1FJ6A 3UGJA 3KJ7A 5I2NA 1R1NA 3RUMA 2R9JA 4LJ5A 4NRWA 2XXWA 4H65A 5IT9S 2KW0A 4LF6M 1EZPA 1JW1A 2Z8FA 1B3GA 1K9ZA 4B7GA 4GFRA 4MGIE 2H98A 3MZBA 3HO7A 4L78A 2Q2CA 1KFVA 5KZTA 4RJZA 5AA2A 4XEQA 2H99A 2XWIA 4GITA 4ZEDA 1WGLA 2XXXA 4FAJA 1A40A 4ZE9A 3PPNA 3QYBA 3FUVA 4LGYA 1IMCA 4OYVA 2GH9A 3MWBA 2ALUA 4IO3A 5FTNA 1NL5A 4JSDA 5FHNA 3TAJA 1LCTA 4TLMB 3O6IA 2XX9A 3S9NC 4JVIA 4F1IA 3H7MA 3H06B 3KSXA 4P16A 2MGWA 3HJSA 5F7VA 4GD5A 3SDFA 1Q02A 3GLBA 3JV9A 3QXMA 3UGWA 1MRPA 4TUWA 4R74A 2XXPA 1I94M 3NOHA 4BLAA 2HWJA 1B3LA 1FTKA 1IITA 1DO2A 4DV2M 5ESYA 1WR1B 3E78A 1L2CA 3CSBA 2VD2A 1OAOC 1Q3CA 3VVEA 4LG2A 4OFJA 4OEVA 2N35A 4XXUA 4DR3M 4MLQA 4OVPA 4EF2A 2VP1A 1QKBA 2XXYA 1K3WA 3R7XA 4R2BA 1I6QA 2VHAA 2AL4A 4LZ8A 5LDZA 4AQYM 3LVWA 4GC5A 4XFEA 4CISA 3BIGA 1MY3A 2QHOB 1IN5A 4JI5M 1B3FA 4PBHA 3LW5F 4PETA 4BDOA 3PTYA 3FD3A 1MU5A 4N17A 2Y0QA 1R2YA 3MUQA 3CR9A 1IQ7A 1FBEA 3JZJA 1B5HA 5H8SA 3VLFB 2LBCA 1LV7A 1JQFA 5K2YA 4QHSA 3DFZA 1OAIA 3HJ8A 4YKJA 3VVDA 3GRVA 1E32A 2LVNC 3ZSFA 2PVUA 1HNZM 4HEOA 1B9JA 5EP1A 3FXUA 4H1XA 2LXEA 4TOZA 5KO3A 1XMQM 2V1UA 1JR3D 5BR8M 5EHSA 5KCJA 2F5NA 2L09A 4AZFA 1IM2A 3CGWA 3TQLA 5ISUA 3MMPA 2P0SA 4OVQA 3KSJA 2JY8A 2VDBB 3VLUA 2PMSA 2DQVA 4PGNA 1LB9A 1L1TA 1LSTA 1QAMA 4JXIA 4UA8A 2QBYB 4MNIA 2LVAA 5I5PA 2VQFM 3VKGA 2P2AA 1LCFA 4H8JA 2ZANA 1KA1A 3Q8GA 4B08A 3VK8A 1O63A 2ZZVA 2I58A 3OO6A 2Q9TA 1NV0A 2XXUA 3FZVA 2Z4SA 5EP2A 2RC9A 5TP9A 3FATA 4PAKA 4JI6M 1IQPA 1USYE 3VDPA 2K47A 4MFIA 5EP4A 1Y1MA 4OXVA 1MPCA 4P0IA 3SETA 1L8QA 1FQCA 1P3QQ 2DE2A 2UXDM 5KPRA 2F34A 1OVBA 5TPAB 4QFPA 2RF1A 4QNMA 4KLNA 2ABHA 1IMDA 1MXVA 1P99A 4CIZA 1W5SA 2B4MA 4LCBA 1SD3A 1D4NA 1XWIA 1SI0A 2C9CA 4PAFA 1IMBA 2XF3A 4O3AA 1FPIA 3FV1A 3ODBA 2V6ZM 3KJTA 1B32A 2QVRA 1L2BA 4JI8M 3SAUA 4P17A 1V34A 4OESA 3T9XB 3VXBA 4LJ7A 1OJLA 2MKZA 2H9BA 1FPEA 3GRYA 2PFYA 4DIGA 1XVXA 3V83A 5CMBA 1UTHA 3EHTA 2Z4RA 1GVCA 4IO2A 5FTHA 5F3WA 3RY3A 1VR5A 4IBFA 1QQWA 3KXEC 3K1NA 2O5RA 3KN7A 1B0HA 1XNRM 2O69A 1VEGA 4NQ8A 3SASA 4FWDA 3GQ5A 1MY1A 3T38A 1EE8A 5BPVA 1AMFA 3U94A 4WXJA 4X9TA 4DV6M 1QUKA 2FOIC 3KOZE 3OEKA 5A5XB 4PD2A 4LZZA 1MXUA 3GYYA 3TUSA 1INPA 4X04A 3MZ1A 3HV1A 4EQBA 2Y5LA 3B89A 1IXSB 3LQRA 4QFKA 3BFTA 3G3GA 3O29A 2HHMA 4XTCQ 2QS3A 5CBSA 4EF1A 2DWNA 2REJA 3K6XA 3K6VA 4RF0A 3N6UA 1N76A 5KDTA 3HHGA 5FBPA 1N32M 2I7NA 1M5CA 1MPBA 4Y28F 1NH8A 1POY1 4JWYA 2GQFA 2UUCM 4IB2A 1E9RA 2NOOA 2JP7A 3QWLA 2DVZA 3TL4X 4LRSA 2EA0A 1BKAA 2O68A 1TH4A 5ITPA 3AOGA 1PJJA 1R2ZA 5DVIA 4KD5A 2O25A 3U72A 5FTMA 2ZZXA 3IK6B 4PE3A 2R18A 5AA4A 1M5DA 1HT1E 2DHYA 3KOTA 4KT0F 2HCBA 1NY6A 1DSNA 4ZEFA 4EXKA 4XF5A 4H8IA 3U6LA 2ZYOA 3IG5A 4G2ZA 4G8NA 1G8PA 5JEIA 3TTLA 4DE8A 4MAGA 2Q88A 4I3YA 3W9WA 2GNOA 4QSCA 4PFYA 3AXFA 4KO8A 4JB7A 4PCDA 5TP9B 4QSEA 1SW1A 4MIJA 5FSWA 3TDJA 3CRBA 3FKEA 1ORYB 3H4JA 3TYHA 3VLWA 3D8LA 1DPPA 3OMBA 2L7IA 5JI2E 1OQHA 3O2AA 4DR1M 3EPEA 2K0BX 3GLHE 1US5A 4LJ6A 2KRUA 4MH5A 5I57A 1NUWA 3W68A 4JDFA 3KZGA 4IBBA 3TELA 2C96A 4KYDA 3DELB 4ZECA 4DR2M 1WJ7A 3SMSA 4JWOA 3MP8A 1R6ZA 3W0FA 3ZQJA 2CV0A 3L2AA 1MS7A 1O64A 2A5TA 4KFQA 3D8BA 5ITOA 4YKKA 4AG5A 3IOVA 3G3IA 4DV5M 5AA4B 5EQAA 2FE8A 1KA0A 1MXWA 3UJNA 5EXTA 5B70A 4U2RA 4N15A 1YTVA 2QQ8A 4EUOA 3M6AA 1QYRA 2YFQA 3DP8A 5FTIA 2DWLA 1ZIUA 2WSFF 1XXHB 5JI3E 1IXCA 3OO8A 4R9GA 1B40A 2CZLA 3RGYA 2F4VM 1Z7NE 4M9XA 3CIJA 4KPTA 3HKPA 2L4FA 4GL8A 3AJIB 1FQEA 5DYHA 1OQYA 2E0SA 2QFLA 2UVIA 3DLNA 3GLHB 1JW4A 4FWHA 3MVZA 4XKRA 3OO9A 3IL1B 4GHLA 4POWA 2Y0TA 1MQHA 4ND9A 4DXBA 5J1DA 3T66A 3ZS6A 4HS7A 1GLNA 1IBKM 4GWSA 4HL4A 1D3KA 4DV0M 1SXJD 3GLFE 4NC6A 3I4VA 5IZ7D 1FPFA 4F2QA 2HZKA 1WXQA 1NNTA 1ZBMA 4ZDMA 1JEVA 4CGYB 4M1VA 1B6HA 3THIA 2RKMA 3SAVA 1GJTA 2XXKA 1Y3QA 2ESNA 4KYEA 1N04A 2Z7JA 4D81A 4F29A 1SXJB 3U1OA 2HFBA 3VDFA 2XFTA 3MP1A 3QAXA 4OW0A 1DBZA 4GQOA 3PUXE 4EIWA 1LAFE 3EF7A 3CF0A 1YSYA 2DP8A 2CV2A 3MPKA 3BBRA 4OFLA 1NV1A 3PV0E 2O1MA 4QBAA 3R8FA 4QOSA 1QAOA 1MXYA 3MQ9A 1QDRA 1C1KA 4AG6A 4MM3B 4RYAA 1DGFA 2PX1A 2VGQA 2CZHA 1NVMA 2QVUA 1E9SA 3K02A 1H3DA 4AQ4A 4JYAM 1Y4TA 1N84A 3MJNA 3K1JA 5ET7A 1BLFA 2R44A 3V76A 4MX6A 1M5EA 3U6MA 2XZFA 2DXRA 4G4OA 2XH9A 2UUAM 3FGSA 4LUBA 3FUUA 4G61A 3IR1A 1CE2A 5DYGA 4PP0A 1FRPA 5IZ3B 3SZPA 3KC0A 3SEXA 2KNAA 3CF6E 4MGZE 1RYXA 5AA3A 3U6DA 3PUYE 1QDTA 3M3FA 4JVDA 4P3LA 2I4BA 4P11A 3LSWA 2OCUA 1LFHA 1G71A 1JP4A 3O6HA 1MDQA 5AE4A 3C35A 4K3FA 3IO4A 3FUWA 2L4EA 1N3XA 3LVVA 1US4A 4NF0A 3FYCA 1P1QA 4QHTA 8CATA 3EN3A 4GMQA 4P8BA 3FVOA 1T6OA 1T0KA 3SAWA 1BK4A 3KBZA 1N77A 1EU8A 2JZ1A 1S50A 2DSFA 2KZUA 1A5TA 2XXHA 1J1NA 1HQYE 4YB6A 4YKPA 4GL0A 4YB5A 3ZCBB 1Y8GA 4G68A 3M8UA 5E6JA 1NSFA 5IGAA 3J27B 3GPYA 1PB7A 2GQ1A 2CUZA 3KS4A 4LZ7A 4ZS9A 4Z0IA 1V33A 4CJ6A 4KODA 2K6BA 3SYLA 4PFWA 5DT6A 5EXXA 4FEDA 3K4UA 4KXPA 1DMBA 4BDRA 2G8LA 1SYHA 1UTHB 3GLIA 4OVRA 1DGHA 3WAEA 4X64M 3B7DA 3C33A 5IKBA 3QYEA 4OMBA 1FPBA 1Y4CA 4ELOA 4X8RA 4FCTA 2X26A 1EIJA 3ZC7B 2F3DA 3T9VA 5GKNA 5I58B 2FNAA 4LZJA 5KPTA 3KGCA 3D4CA 3RPWA 2BWEA 3IAZA 3K6UA 2HQ0A 1ZV1A 1K3XA 3G7WA 3Q29A 4ECFA 2KXEA 1QULA 3O9PA 4O7IA 3AOEA 3U93A 4L17A 2MJ5B 4AKGA 2XSZD 4RNAA 1SXJE 3IFAA 3U61B 2R6GE 2OJTA 5ET6A 1OIBA 4L16A 3Q25A 1FBPA 3ILUB 2R71A 1AOVA 4AKIA 1SVXB
chains in the Genus database with same CATH topology
3NBIA 1TDHA 1N7WA 1JQJC 2O51A 4LQ5A 5A5XA 4GHAA 1IN4A 3U60A 3LSXA 3M3KA 3SEYA 5I2KA 4NF6B 4G4QA 2HHHM 2Y7WA 4S12A 1JEUA 1LAGE 1QZMA 4H5GA 2M5ZA 4BDLA 1BP5A 1UTBB 5EHMA 3AV0A 1SW4A 2FYIA 3K6WA 3TZAA 3KOXE 1TFAA 2PBWA 4C1TA 1E94E 4JXJA 3GLGB 3TPAA 3UZUA 4I5SA 1TDZA 4QFOA 3MAMA 4LF7M 4U4XA 2F78A 1YAEA 4ZPXA 2D3IA 3TCGA 2I0CA 4IBGA 3O6GA 1BIYA 2UYEA 1FQDA 3M7GA 1HNXM 4HTGA 4DCYA 4WEPA 2OBGA 1NHGC 1P1UA 3PGFA 3LMMA 4OWDA 3U6CA 1VSOA 4JI0M 1URSA 4BBAA 3J7BA 2XHDA 1IUDA 4NF4B 3C31A 2OWSA 2F97A 3RTWB 1P1OA 3OO7A 4DR5M 1RYOA 3RT6B 4R9FA 3GBAA 4LQ2A 1IIWA 2DVCA 4DV7M 1Y20A 3QUJA 1XHBA 1IN7A 3E9SA 3SEWA 4GVOA 4FEBA 1GGGA 3W15C 1XVYA 4NSRA 3FXRA 1NNPA 2Y84A 1A8FA 1NNFA 4X65M 1LGBC 1SW2A 4GF8A 2UYFA 2REGA 4RF1A 4LGMA 1I69A 4LF9M 5H8HB 4KCCA 3HJQA 1ZQ9A 3N5LA 5CRYA 1HR0M 4U1ZA 4I62A 2J7NA 2DWJA 2UXCM 3AFHA 3HWSA 5CI5A 3TTNA 1N7XA 4NL4H 4R7GA 5AA2B 2G5GX 4OVZA 2DE4A 1Y3NA 5CMMA 1L1ZA 4IY6A 3Q8XA 1N3WA 1S9TA 1LB8A 1XT8A 4PE5B 3IJOB 5JK4A 1NNUC 4DLDA 4LY6A 1FTMA 1B58A 5C18A 2C9OA 4KYSA 2M60A 1VDDA 2LNHC 3TWLA 4G8HA 5E26A 4KI0E 1B3HA 2XFSA 2L7HA 2A5TB 1UQWA 4NF6A 1JW5A 4NF8B 4FATA 3L26A 4GRKA 1M5BA 5EQTA 4LFBM 4FD2A 3SC3A 3E4RA 3LUYA 2Q2EB 2V1CA 2ZNSA 1GKIA 3RT8A 3U5ZB 4YU0A 3DP4A 4XKQA 2QZ4A 2KEBA 2ZYNA 3EQ1A 4E0XA 3GLFA 3TQSA 3PD8A 3CFZA 4DCXA 5DVJA 2HAUA 3MPLA 4JI7M 3PUWE 2Y7KA 2E1SA 3L28A 1PDAA 3GPPA 1MXZA 4F1VA 4XBOA 4DR7M 4IGRA 4E0WA 4NTLA 3K0VA 1N78A 2P1SA 1FNNA 3FUTA 1QVSA 4D82A 3GBBA 1HNWM 3PMVA 2H25A 3N26A 1A99A 4X48A 4RNSA 2OLBA 5DYIA 5CMKA 2I0BA 4XGIA 4F3GA 3PUVE 3IB1A 2LH0A 2L6OA 1ZLQA 1FQBA 2QPQA 2C5RA 4F3BA 3UORA 1B51A 1TGUA 1P1NA 3PUZE 3MBPA 3OSQA 3FXQA 5EXPA 2D7HA 1GR2A 4YY3M 3KW6A 2JA2A 3CG3A 2G29A 3VLVA 5I56B 2O6AA 2AL5A 3GPXA 3CFXA 3MK6A 4Q30B 2RKOA 1Q1KA 4LJ8A 3C4MA 2CV1A 4OQOA 4H0WA 2DWIA 1O7TA 2UXAA 2I3VA 4MF3A 3LSLA 5ITUA 4C0RA 2F5QA 3FTFA 4F1UA 3C9HA 4YHHM 3TCFA 2HKJA 1MY0A 2VIIA 2W7YA 4LONB 2QP9X 2NWJA 4LRTA 1PB9A 3G3FA 5H8FB 1A7LA 4A3VB 2F7BA 2J7OA 3DP6A 3Q27A 1IY1A 4LFAM 1USYH 5I59A 3DZDA 2BJVA 4Z7EA 5K2XA 2QL3A 4KHZE 1MQJA 4EDPA 1OQGA 2XXIA 3QUFA 1N36M 1QW0A 3L29A 1EH3A 5JTYA 2IEEA 3JR4A 5ITQA 4U22A 3BOSA 1EZOA 1IBLM 2AHMA 5EXSA 3U8QA 1Q39A 2CHQA 3VVFA 2DZNB 3CFLA 5ITXA 3J2PB 3WAFA 3WHLA 3HU1A 1JVYA 3KEIA 3O28A 4ZEIA 4YMBA 2XLJA 3TQWA 4DXCA 4C1UA 2DWMA 1Y9UA 2YJPA 3TTKA 1VFDA 3OSRA 3THGA 1IEJA 3PFIA 3RTFB 3GLGA 1FJGM 1B4HA 1IXGA 2DOJA 3R26A 5AA1A 3FVKA 4U1OA 1DGBA 2R65A 4NRVA 4RPOA 3K2DA 3T93B 2RGHA 2R62A 3QYTA 4ELPA 5I59B 1JETA 3U61A 4RPNA 3KP1E 3ILKA 2XD3A 3QAUA 3A09A 3MHVC 1HSLA 4QHQA 1S3SA 4KHPM 2RGOA 1OFIA 1Z5BA 3FJMA 3RNNA 1I4WA 3PU5A 2V25A 4PT5A 1B5IA 2R46A 2ONSA 5DEXB 4F39A 1AL3A 3TODA 2D21A 4GIPA 3GXAA 5CBRA 1DGHB 4OHNA 1NNJA 2I49A 5ITYA 5L9SA 4WURA 4NF5B 5L9OA 4GKJM 4G6ZA 2Z8DA 3DA1A 1X37A 3H03A 4F2OA 3B6TA 3K00A 4G68B 4O3CA 2CE7A 4L15A 1TFDA 2R45A 4G68C 5HPQA 4DV3M 4BB9A 3UIFA 3T15A 4DXUA 5EP3A 4YICA 2F7AA 4NWDA 1YCJA 1JNFA 1OLAA 4AKHA 3MJ5A 1NY5A 2VQEM 4B3MM 4Q5TA 4LJ4A 2RCAA 4MBPA 4MH0E 4I81A 2M8CA 3KS8A 2B3BA 5H8HA 4IGTA 1PC3A 2V84A 1I6AA 5I56A 1B05A 2ONRA 1MX0A 3LQQA 1FTLA 4GOTA 3KFUG 2QSXA 1B46A 3L25A 3AKZA 4GXSB 1G3IA 4YKIA 3SATA 3ZKKA 4L4UA 1I6BA 3BFUA 3OD7A 2XX7A 3IOUA 3IJXB 3UA8A 1WODA 4NSOB 3DM0A 1H76A 3CSGA 2I6EA 3CI8A 1XC8A 5CMCA 4U4SA 4JV5M 3HHYA 2P5TA 1YPNA 3VDUA 5H8NA 3NWLA 3SBJA 1NHWC 2O7IA 3PPQA 4X1BA 4OEUA 4G4RA 2ZAMA 2QMXA 2HL7A 3V89B 1QAQA 2F6PA 4LF4M 5I57B 1Z5CA 4DV1M 3A3CA 2E5LM 2X49A 1S7YA 5TPAA 5FLXS 2XSZA 3JR5A 1PJIA 2ANJA 1DOTA 5FTLA 5DNYA 2A5SA 3G3KA 2H4IA 4OERA 3J7AS 2F8DA 1ATGA 2Y21A 1SBPA 4B3RM 2FFJA 2YNMD 1QUIA 1SDXA 3KN3A 5KQ8A 1K82A 2LWXA 5C1BA 4B3SM 4GRIA 1B5JA 4WKMA 3I5OA 4FIMA 3A45A 5I58B 4ISUA 1ANFA 1RKMA 4DUYM 3OOAA 5CM6A 3GLIB 4EXLA 4NF5A 2HXWA 4EQ7A 2QCUA 2PYYA 2UU9M 4G4NA 4PQJA 1J5EM 3ZKLA 3GLHA 3HGIA 1D9YA 2H1RA 1Y1ZA 3SKPA 4F19A 3PPRA 5CC2A 1H45A 4N07A 3IORA 4QFLA 2YLNA 1MQIA 1ZJLA 4QRZA 1N33M 5H8QA 3IO6A 1NJGA 4ZEBA 2Q8JA 1A54A 3B6WA 4GWOA 3UK4A 3U6OA 3T96B 2CEAA 3JYRA 2RCBA 4IBJA 4I9DA 1DO0A 1H44A 3TPZA 3F11A 4R73A 3V5AA 3FTEA 1ZTYA 1SXJC 3PXGA 5I2NB 1ZMGA 2CMOA 2O1LA 1IXIA 3L6HA 2QENA 2NQ8C 2PT2A 3UMMA 5DVFA 3H4ZA 1XS5A 2X4AA 4THIA 3SYKA 3C34A 4ELRA 4REZA 2OK2A 3SMPA 5DEXA 3FASA 3PPPA 1H6UA 3U5ZA 1PEBA 2Q89A 4LJ9A 1IY2A 3I6VA 5FHOA 3KOYE 2QMWA 3EIHA 3E13X 4OZ9A 3RN8A 5H8NB 5FHMA 3H3GA 2XD2A 4DR6M 2ZYKA 2B3FA 2Y20A 3ECRA 2Z23A 1R6BX 4JI4M 5H37D 4DUZM 3HHFA 1B52A 3TCHA 4LF8M 2RC8A 4FWGA 4QOZC 1JVXA 3P7IA 1H43A 3PMXA 4U21A 3U6PA 3B6QA 4MB7A 2A5YB 1MPDA 1MXXA 3PD9A 1ZU0A 4M0DA 1ZKBA 2UVJA 4ITQA 4K0KM 3T1YM 4IJEA 2GRVA 5ICTA 4ONYA 3I3VA 3VFDA 4FCVA 3VKHA 3KG2A 2V3UA 4JWXA 3GLFB 4OFOA 2W82A 3CF2A 1LAHE 2UUBM 2GFEA 1PB8A 4Z8XA 4LP2B 3IOTA 4N13A 1L5TA 4HCWA 1J7KA 4R75A 4RK2A 1LFGA 4JN6A 5I84A 1A55A 1SYIA 3D4GA 1OLCA 1MQDA 5FTKA 4AB6A 2F5OA 1NJFA 2X8AA 3FTCA 4X66M 1PBQA 5L9MA 2ZNUA 5ITXE 4FORA 1SW5A 3MC2A 2D7EA 3IB0A 4KQPA 2HCAA 4BDMA 3FYDA 3U6QA 3HU2A 4F31B 3EHSA 1FQFA 3KP0E 1POTA 5LMUM 3A42A 5EYFA 2ZMBA 5A2QS 1FCKA 4OVZB 3N94A 4OETA 4X62M 4R6YA 3TE6A 2XXRA 4FECA 4X1DA 3QK6A 3OEMA 2EO2A 3IX1A 1B7ZA 3U6SA 2PT1A 1TT1A 3HU3A 2ZAOA 1IXZA 4IY5A 2QS1A 4DV4M 3OENA 4B7FA 4CHTB 1II5A 1MY2A 3MVXA 2ERCA 4PFTA 4DZ1A 5LMNM 1ELJA 2YR0A 1IZ1A 3I4YA 4OU7A 1B1XA 4FJPA 4R6HA 3W9VA 4R3DA 1T3TA 4IBDA 2VD3A 4HLQA 3SFZA 1MG1A 2EUCA 4AB5A 5I58A 5ICQA 3GQ4A 2XEPA 4IBEA 3S9MC 3C58A 1XC1A 4Z6YA 2DXYA 3S4UA 4BLCA 4KCDA 4MGKE 4U23A 4N6PA 5JTYB 4KR5A 1UIVA 3TWMA 2NVUB 1Z5AA 1MY4A 1R9QA 4GLIA 2HZLA 4R72A 3S9EA 2KA6B 3H6WA 2ZM6M 2O84X 5HM4B 4B7HA 1B7HA 1IXRC 4NEDA 3EHUA 3B9PA 2QS4A 4OX9M 2DHRA 4LA9A 2OPFA 3QSLA 2OQ4A 3U60B 2Z8EA 1GL7A 3TWKA 4JI1M 3FIRA 1KYIA 5M2VA 2DWHA 2Z22A 4I1DA 3FJ7A 3ZH9B 4TLLB 3RGSA 2ZNTA 3PVSA 2OZZA 2V93A 4DR4M 1G41A 2WKYA 3KBRA 2KRKA 2DYXA 3QIMA 3WHKA 2G93A 4NWCA 3TTMA 4B3TM 1DPEA 2XX8A 5KCJB 1NKXA 3GZGA 4ZEKA 4RK9A 3K1MA 2C99A 4YZZA 1M5FA 4WW0A 1TH3A 3VK7A 3CTWB 2XZUA 5ITRA 1KWHA 2I48A 2VOZA 2Y7PA 2F35A 5LOMA 4L8RC 4JI2M 1URGA 1UM8A 1HSJA 1Z6TA 3N6TA 4Q8RA 4ZE8A 1JR3A 3SERA 4NE4A 3T22A 1MDP1 1FW0A 3MZ9A 3IOWA 4PFUA 4II7A 4R2FA 3T9HB 4H6DA 4YMAA 3E3KA 3H6VA 3RFWA 1QVRA 4PCZA 3TTRA 4MGHA 2ONKE 3K2LA 2DS9A 4POXA 2BNKA 4IO6A 4QFNA 1GV8A 2HEUA 1WVJA 3MVYA 1XXHA 2ZBKB 4BDQA 4OENA 2F7CA 1N34M 4RXLA 3MP6A 3U6EA 1F9BA 5TU0A 4ESWA 4BDNA 1FTJA 5AA2D 4GIZA 1W5TA 4F1YA 1HQCA 4AW4A 4AI6A 3K1PA 3HHXA 2DWAA 5DTBA 3E9XA 3U92A 3A3UA 1LBBA 1MQGA 1LFIA 4O3BA 3S2VA 1OVTA 4FCWA 4GXAA 2NXOA 2QPAA 2RINA 3HCQA 2C98A 1QANA 3K8ZA 1IBMM 2Y7RA 4G8MA 1AH5A 2QRYA 5L8DA 1LAXA 4M9ZA 1DTZA 2BJWA 1MM7A 1GVNA 2F5SA 2F6GA 1DTGA 1AIVA 3KN8A 4F22A 3O97A 2GHAA 2UVGA 3ONMA 1GL6A 2DVWB 4G77A 3K92A 3W0LB 4LVQA 5IAIA 2OWTA 4H67A 3J80S 1HT2E 3PNYA 4IO4A 2O7UA 1LBCA 4IBKA 3FV2A 3GPUA 2B65A 2F5PA 4FW9A 3HHWA 3USDA 4NXMM 3G3HA 1QJMA 4LZ5A 3KFMA 3VFJA 4YB7A 2YPNA 1HSEA 3LBSA 1B1HA 1MH4A 5KDTB 1B0LA 4F18A 1IY0A 1QUJA 3S9LC 4XKPA 4HCYA 1B2HA 2R4JA 3PNVA 1YUBA 5H8QB 2V3TA 4I8OA 4LF5M 2D5WA 3IB2A 4EQ9A 3J81S 4P0GA 1GTKA 2DXIA 3H6UA 3DOAA 3HHZA 4IO5A 4IO7A 4LFCM 1QKAA 4ZZAA 1IXHA 2QJEA 4NOOB 3GO8A 3GP1A 1B4ZA 3KOSA 3LSFB 2XXQA 4ESXA 3IG8A 1MH3A 5KQDA 2HAVA 3Q26A 1D9VA 3FTDA 3C32A 4RY1A 1DGGA 3TKDA 3GRUA 4XKNA 3FUXA 2QS2A 1UIUA 3BKIB 1FQAA 1Z59A 3UN6A 4WEDA 3CVGA 3UK6A 1XNQM 3SARA 2DZOB 4IBIA 2FA7A 3SEVA 2DWZB 4NMYA 2DE3A 5H8FA 2IA4A 1CB6A 3FD9A 4M4GA 5ITTA 1G4AE 4M9SA 2YQZA 2UXBM 2V3QA 4PDGA 1XOCA 1TXFA 5BUUA 3AOEC 5B7DA 5F1QA 4LJAA 1IN6A 5BWJA 4QF9A 3H6TA 1Y3PA 4ZZEA 1IN8A 3T1HM 3FVGA 4JBZA 4ELQA 5HBCA 2KZSA 1J09A 3CG1A 3MW0A 5I2KB 3SESA 2AYSA 4NXNM 3RGPA 3HPIA 3K01A 1ZAEA 4OTEA 4QSDA 3PMWA 1OFHA 4JI3M 2XGNA 1WDNA 4GH9A 1A8EA 4W5WA 4GC9A 3KVWA 4I8CA 3OXNA 3UP9A 3G3JA 1NMUA 2THIA 3V8XB 1TWYA 3RLFE 1YE9A 3JAMS 2QBYA 2Q2AA 4IIWA 1VFEA 3M3LA 2LAOA 4PDIA 1R7RA 3TEPA 2X7PA 3R6UA 1KSFX 1SQYA 2FNCA 3FUZA 1EZ9A 3SHGB 3PPOA 3KDSE 3VV5A 1R9LA 4FE8A 3TMGA 5IWAM 2ZXTA 2GHBA 4G4PA 2I4CA 4F3PA 2I3WA 3AL0C 4GKKM 3SEUA 3KOWE 1B3EA 1MM6A 3Q28A 3R9XB 4RA1A 2Z3XA 3ILTB 4UACA 4HW8A 3LC8A 2XXTA 3RQTA 3I51A 4LATA 1NNKA 4M0WA 5IREB 3MVWA 2D7GA 1Q3BA 4FVMA 2UVHA 4MLVA 4OVJA 1N0TA 4Q0CA 4YAHX 1OMPA 2KLFA 4H5FA 1L2DA 4IBCA 3M0EA 1PBPA 2AIXA 2ZYMA 2F36A 1N75A 5FTJA 1URDA 4IJFA 2XXVA 2F5XA 5KPZA 2RC7A 7CATA 3GQ3A 2X7QA 3O66A 1TH2A 1XMOM 3OTOM 4QNRA 1VE4A 3A98B 2R4EA 4XIGQ 2NUVA 1B7UA 3FJGA 1P1WA 3HSTA 1LLSA 2CHVA 3SHFA 3OELA 3VXCA 2BJJX 2CHGA 5ELVA 1SI1A 4DDDA 1PM5A 1FTOA 1Q35A 3VE1B 5EJCA 2H5YA 3L6GA 3LR1A 3C36A 2CFOA 4I4LA 4JSOA 3GRRA 1D2NA 1BTJA 4TQUQ 4NF4A 4NF8A 3TFLA 1G59A 4F3SA 1XHYA 3HN0A 2Y7IA 1Z7ME 4R6KA 1NH7A 3RE8A 1NFTA 3L27A 2I7PA 1UTBA 3EIEA 3FVNA 3H4MA 4D80A 4MGYE 3T9UA 1SXJA 3A46A 3KJ7A 3UGJA 5I2NA 1R1NA 3RUMA 2R9JA 4LJ5A 4NRWA 2XXWA 4H65A 5IT9S 2KW0A 4LF6M 1EZPA 1JW1A 2Z8FA 1B3GA 4B7GA 4GFRA 4MGIE 2H98A 3MZBA 3HO7A 4L78A 2Q2CA 1KFVA 5KZTA 4RJZA 5AA2A 2H99A 4GITA 4ZEDA 2XXXA 4FAJA 1A40A 4ZE9A 3PPNA 3FUVA 4LGYA 4OYVA 2GH9A 3MWBA 2ALUA 4IO3A 5FTNA 1NL5A 4JSDA 5FHNA 3TAJA 1LCTA 4TLMB 3O6IA 2XX9A 3S9NC 3H7MA 3H06B 3KSXA 4P16A 3HJSA 5F7VA 4GD5A 3SDFA 3GLBA 3JV9A 3QXMA 3UGWA 1MRPA 4TUWA 4R74A 2XXPA 1I94M 4BLAA 1B3LA 1FTKA 1IITA 1DO2A 4DV2M 1L2CA 3CSBA 2VD2A 3VVEA 1Q3CA 4LG2A 4OFJA 4OEVA 4XXUA 4DR3M 4MLQA 4EF2A 2VP1A 1QKBA 2XXYA 1K3WA 3R7XA 4R2BA 1I6QA 2VHAA 2AL4A 4LZ8A 4AQYM 3LVWA 4GC5A 4CISA 1MY3A 1IN5A 4JI5M 1B3FA 4BDOA 4PETA 3FD3A 1MU5A 2Y0QA 1R2YA 3MUQA 3CR9A 1IQ7A 5H8SA 3JZJA 1B5HA 3VLFB 1LV7A 1JQFA 5K2YA 4QHSA 3DFZA 3HJ8A 4YKJA 3VVDA 3GRVA 1E32A 3ZSFA 2PVUA 1HNZM 1B9JA 3FXUA 5EP1A 4H1XA 2LXEA 4TOZA 5KO3A 1XMQM 2V1UA 1JR3D 5BR8M 5EHSA 5KCJA 2F5NA 2L09A 4AZFA 1IM2A 3TQLA 5ISUA 2P0SA 3KSJA 3VLUA 2PMSA 2DQVA 1LB9A 1L1TA 1LSTA 1QAMA 4JXIA 4UA8A 2QBYB 2VQFM 3VKGA 2P2AA 1LCFA 4H8JA 2ZANA 4B08A 3VK8A 1O63A 2I58A 3OO6A 2Q9TA 2XXUA 3FZVA 2Z4SA 5EP2A 2RC9A 5TP9A 3FATA 4JI6M 1IQPA 1USYE 3VDPA 2K47A 4MFIA 5EP4A 1Y1MA 4OXVA 1MPCA 4P0IA 3SETA 1L8QA 1FQCA 2DE2A 2UXDM 5KPRA 2F34A 1OVBA 5TPAB 4QFPA 2RF1A 4QNMA 4KLNA 2ABHA 1MXVA 1P99A 1W5SA 4LCBA 1SD3A 1D4NA 1XWIA 1SI0A 2C9CA 2XF3A 4O3AA 3FV1A 3ODBA 2V6ZM 3KJTA 1B32A 1L2BA 4JI8M 3SAUA 4OESA 3T9XB 3VXBA 4LJ7A 1OJLA 2H9BA 3GRYA 4DIGA 1XVXA 3V83A 5CMBA 1UTHA 3EHTA 2Z4RA 1GVCA 4IO2A 5FTHA 5F3WA 3RY3A 1VR5A 4IBFA 1QQWA 3KXEC 3K1NA 2O5RA 3KN7A 1B0HA 1XNRM 2O69A 3SASA 4FWDA 3GQ5A 1MY1A 3T38A 1EE8A 5BPVA 1AMFA 3U94A 4WXJA 4X9TA 4DV6M 1QUKA 2FOIC 3KOZE 3OEKA 5A5XB 4PD2A 4LZZA 1MXUA 3TUSA 3MZ1A 3HV1A 4EQBA 1IXSB 3LQRA 4QFKA 3BFTA 3G3GA 3O29A 4XTCQ 2QS3A 5CBSA 4EF1A 2DWNA 2REJA 3K6XA 3K6VA 4RF0A 3N6UA 1N76A 5KDTA 3HHGA 1N32M 2I7NA 1M5CA 1MPBA 1NH8A 1POY1 4JWYA 2UUCM 4IB2A 1E9RA 2NOOA 3QWLA 2DVZA 3TL4X 4LRSA 2EA0A 1BKAA 2O68A 1TH4A 5ITPA 3AOGA 1PJJA 1R2ZA 5DVIA 4KD5A 3U72A 5FTMA 3IK6B 2R18A 5AA4A 1M5DA 1HT1E 3KOTA 2HCBA 1NY6A 1DSNA 4ZEFA 4EXKA 4H8IA 3U6LA 2ZYOA 3IG5A 4G2ZA 4G8NA 1G8PA 5JEIA 3TTLA 4DE8A 2Q88A 3W9WA 4QSCA 4PFYA 3AXFA 4KO8A 4JB7A 5TP9B 4QSEA 1SW1A 5FSWA 3TDJA 3CRBA 3FKEA 1ORYB 3TYHA 3VLWA 3D8LA 1DPPA 3OMBA 2L7IA 5JI2E 1OQHA 3O2AA 4DR1M 3EPEA 4MH5A 1US5A 4LJ6A 2KRUA 5I57A 4JDFA 3KZGA 4IBBA 3TELA 2C96A 4KYDA 3DELB 4ZECA 4DR2M 3SMSA 4JWOA 3MP8A 1R6ZA 3W0FA 2CV0A 3L2AA 1MS7A 1O64A 2A5TA 4KFQA 3D8BA 5ITOA 4YKKA 4AG5A 3IOVA 3G3IA 4DV5M 5AA4B 2FE8A 1MXWA 3UJNA 5EXTA 5B70A 4U2RA 1YTVA 4EUOA 3M6AA 1QYRA 2YFQA 3DP8A 5FTIA 2DWLA 1ZIUA 1XXHB 5JI3E 1IXCA 3OO8A 4R9GA 1B40A 2CZLA 3RGYA 2F4VM 1Z7NE 4M9XA 3CIJA 4KPTA 3HKPA 4GL8A 3AJIB 1FQEA 5DYHA 2E0SA 2UVIA 3DLNA 3GLHB 1JW4A 4FWHA 3MVZA 4XKRA 3OO9A 3IL1B 4GHLA 4POWA 2Y0TA 1MQHA 4ND9A 4DXBA 5J1DA 3T66A 3ZS6A 4HS7A 1GLNA 1IBKM 4HL4A 1D3KA 4DV0M 1SXJD 3I4VA 5IZ7D 4F2QA 2HZKA 1WXQA 1NNTA 1ZBMA 4ZDMA 1JEVA 4CGYB 4M1VA 1B6HA 3THIA 2RKMA 3SAVA 1Y3QA 2ESNA 4KYEA 1N04A 2Z7JA 4D81A 4F29A 1SXJB 3U1OA 2HFBA 3VDFA 2XFTA 3MP1A 3QAXA 4OW0A 4GQOA 3PUXE 4EIWA 1LAFE 3EF7A 3CF0A 1YSYA 2DP8A 2CV2A 3MPKA 3BBRA 4OFLA 3PV0E 2O1MA 3R8FA 4QOSA 1QAOA 1MXYA 3MQ9A 1C1KA 4AG6A 4MM3B 4RYAA 1DGFA 2PX1A 2VGQA 1NVMA 3K02A 1E9SA 1H3DA 4AQ4A 4JYAM 1N84A 1Y4TA 3MJNA 3K1JA 1BLFA 1M5EA 3U6MA 2XZFA 2DXRA 4G4OA 2XH9A 2UUAM 3FGSA 4LUBA 3FUUA 3IR1A 1CE2A 5DYGA 4PP0A 3SEXA 3CF6E 1RYXA 4MGZE 5AA3A 3U6DA 3PUYE 3M3FA 4P11A 2I4BA 3LSWA 2OCUA 1LFHA 3O6HA 1MDQA 5AE4A 3C35A 4K3FA 3IO4A 3FUWA 1N3XA 3LVVA 1US4A 3FYCA 1P1QA 4QHTA 8CATA 3EN3A 4GMQA 3FVOA 1T0KA 3SAWA 1N77A 1EU8A 1S50A 2DSFA 2KZUA 2XXHA 1J1NA 1HQYE 4YB6A 4YKPA 4GL0A 4YB5A 3ZCBB 4G68A 3M8UA 5E6JA 1NSFA 3J27B 3GPYA 1PB7A 2CUZA 3KS4A 4LZ7A 4ZS9A 4Z0IA 4KODA 4PFWA 3SYLA 5DT6A 5EXXA 4FEDA 3K4UA 1DMBA 4BDRA 2G8LA 1SYHA 1UTHB 3GLIA 1DGHA 3WAEA 4X64M 3B7DA 3C33A 5IKBA 4OMBA 1Y4CA 4ELOA 4FCTA 2X26A 3ZC7B 3T9VA 5GKNA 2FNAA 4LZJA 5KPTA 3KGCA 3D4CA 3RPWA 3IAZA 3K6UA 2HQ0A 1K3XA 3G7WA 3Q29A 4ECFA 2KXEA 1QULA 3O9PA 3AOEA 3U93A 4L17A 4AKGA 2XSZD 4RNAA 1SXJE 3U61B 2R6GE 2OJTA 1OIBA 4L16A 3Q25A 3ILUB 2R71A 1AOVA 4AKIA 1SVXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E3K A;  4TOZ A;  1N7W A;  2O51 A;  3H6V A;  4LQ5 A;  5A5X A;  3TTR A;  5EHS A;  5KCJ A;  1FTL A;  4GOT A;  2ONK E;  2DS9 A;  2QSX A;  4POX A;  1B46 A;  4IO6 A;  4QFN A;  3LSX A;  1GV8 A;  2HEU A;  1WVJ A;  3M3K A;  3MVY A;  3SEY A;  4GXS B;  3TQL A;  4YKI A;  4BDQ A;  2P0S A;  5I2K A;  4NF6 B;  4OEN A;  5ISU A;  3KSJ A;  2F7C A;  2Y7W A;  3ZKK A;  3VLU A;  2PMS A;  2DQV A;  4RXL A;  3MP6 A;  1LB9 A;  1JEU A;  1I6B A;  3BFU A;  1F9B A;  1LAG E;  1LST A;  3OD7 A;  5TU0 A;  4BDN A;  4H5G A;  4ESW A;  2XX7 A;  3IOU A;  1FTJ A;  3IJX B;  4JXI A;  4UA8 A;  1BP5 A;  4BDL A;  5AA2 D;  1UTB B;  4GIZ A;  5EHM A;  3UA8 A;  4F1Y A;  1WOD A;  4H8J A;  2P2A A;  1LCF A;  3K1P A;  1SW4 A;  2DWA A;  3DM0 A;  5DTB A;  1H76 A;  3CSG A;  2FYI A;  2I6E A;  1O63 A;  3K6W A;  3CI8 A;  3E9X A;  2I58 A;  3OO6 A;  3TZA A;  3A3U A;  1LBB A;  1TFA A;  3U92 A;  1MQG A;  5CMC A;  4U4S A;  1LFI A;  4O3B A;  2PBW A;  2Q9T A;  1OVT A;  3S2V A;  4C1T A;  2XXU A;  3FZV A;  4GXA A;  1YPN A;  2RC9 A;  3TPA A;  5H8N A;  2NXO A;  5TP9 A;  3FAT A;  2RIN A;  1USY E;  4QFO A;  3HCQ A;  3MAM A;  2O7I A;  2Y7R A;  4G8M A;  4MFI A;  4U4X A;  1AH5 A;  2QRY A;  1Y1M A;  2F78 A;  3PPQ A;  1YAE A;  1MPC A;  1LAX A;  4OXV A;  4OEU A;  4X1B A;  2D3I A;  4P0I A;  3SET A;  3TCG A;  2I0C A;  3O6G A;  1DTZ A;  1FQC A;  2QMX A;  3V89 B;  1BIY A;  2UYE A;  1FQD A;  2DE2 A;  4HTG A;  2F34 A;  2F6P A;  4WEP A;  1MM7 A;  2OBG A;  4DCY A;  2F6G A;  1P1U A;  1OVB A;  5I57 B;  1DTG A;  4QFP A;  5TPA B;  1AIV A;  3A3C A;  2RF1 A;  3KN8 A;  4F22 A;  3O97 A;  3PGF A;  2GHA A;  4OWD A;  2UVG A;  1S7Y A;  5TPA A;  2ABH A;  3ONM A;  1VSO A;  1DOT A;  2ANJ A;  4G77 A;  5IAI A;  4LVQ A;  1URS A;  2OWT A;  1MXV A;  2A5S A;  3G3K A;  2H4I A;  1IUD A;  1P99 A;  2XHD A;  3C31 A;  4NF4 B;  4OER A;  4H67 A;  2F8D A;  1ATG A;  2OWS A;  1SD3 A;  1D4N A;  1SBP A;  2F97 A;  3RTW B;  1P1O A;  1SI0 A;  3OO7 A;  2O7U A;  4IO4 A;  1LBC A;  4O3A A;  3FV2 A;  1QUI A;  3FV1 A;  1SDX A;  2B65 A;  3KN3 A;  3ODB A;  1RYO A;  3RT6 B;  3KJT A;  1B32 A;  4R9F A;  3USD A;  3GBA A;  3G3H A;  1IIW A;  2DVC A;  4LQ2 A;  1QJM A;  4LZ5 A;  3KFM A;  1Y20 A;  3VFJ A;  4YB7 A;  2YPN A;  5I58 B;  1B5J A;  1HSE A;  3I5O A;  3QUJ A;  3LBS A;  4FIM A;  4OES A;  4WKM A;  3T9X B;  4ISU A;  3VXB A;  1B1H A;  1ANF A;  1MH4 A;  1B0L A;  1RKM A;  2H9B A;  4F18 A;  4DIG A;  3OOA A;  5KDT B;  1XVX A;  5CM6 A;  3V83 A;  5CMB A;  4EXL A;  1QUJ A;  1UTH A;  3EHT A;  3SEW A;  1GVC A;  3S9L C;  4NF5 A;  2HXW A;  4FEB A;  4GVO A;  4HCY A;  1B2H A;  4IO2 A;  1GGG A;  4XKP A;  5FTH A;  5H8Q B;  3RY3 A;  3W15 C;  2V3T A;  1VR5 A;  1XVY A;  2D5W A;  2PYY A;  3IB2 A;  3K1N A;  3KN7 A;  1B0H A;  2O69 A;  4EQ9 A;  4P0G A;  1GTK A;  4PQJ A;  1MY1 A;  3ZKL A;  3H6U A;  3FXR A;  1AMF A;  1NNP A;  2Y84 A;  4IO5 A;  1A8F A;  3U94 A;  4WXJ A;  4X9T A;  1QUK A;  4IO7 A;  1QKA A;  1D9Y A;  4ZZA A;  1Y1Z A;  3OEK A;  3SKP A;  5A5X B;  1NNF A;  4F19 A;  3PPR A;  1IXH A;  1MXU A;  1B4Z A;  1LGB C;  2QJE A;  3KOS A;  1H45 A;  1SW2 A;  3LSF B;  5CC2 A;  3TUS A;  3MZ1 A;  2UYF A;  4GF8 A;  2REG A;  4N07 A;  3HV1 A;  2XXQ A;  3IOR A;  4QFL A;  4EQB A;  4ESX A;  1I69 A;  1MH3 A;  5H8H B;  2YLN A;  2HAV A;  4KCC A;  3Q26 A;  1MQI A;  1D9V A;  3N5L A;  4QFK A;  3BFT A;  1ZJL A;  3C32 A;  3G3G A;  3O29 A;  4QRZ A;  4RY1 A;  4U1Z A;  5CRY A;  3TKD A;  4XKN A;  4XTC Q;  5I56 A;  2QS2 A;  4I62 A;  2QS3 A;  1UIU A;  2DWJ A;  3BKI B;  1FQA A;  5CI5 A;  5H8Q A;  3TTN A;  3UN6 A;  4EF1 A;  5CBS A;  4WED A;  3IO6 A;  1N7X A;  4ZEB A;  2REJ A;  3N6U A;  3K6X A;  1A54 A;  3CVG A;  3K6V A;  2Q8J A;  5AA2 B;  1N76 A;  2DE4 A;  3B6W A;  4GWO A;  5KDT A;  3HHG A;  3UK4 A;  1Y3N A;  3T96 B;  2FA7 A;  3SEV A;  4NMY A;  5H8F A;  2DE3 A;  3JYR A;  2RCB A;  2IA4 A;  5CMM A;  1CB6 A;  4I9D A;  4IY6 A;  1M5C A;  4YMA A;  1H44 A;  1MPB A;  3F11 A;  4M4G A;  1N3W A;  1NH8 A;  1POY 1;  1LB8 A;  1S9T A;  4JWY A;  4R73 A;  1XT8 A;  4PE5 B;  4IB2 A;  3IJO B;  2NOO A;  3V5A A;  5JK4 A;  2DVZ A;  1ZTY A;  4DLD A;  1FTM A;  2V3Q A;  5I2N B;  1B58 A;  1ZMG A;  2CMO A;  2O1L A;  1BKA A;  1IXI A;  1XOC A;  2O68 A;  1TXF A;  3L6H A;  5ITP A;  2PT2 A;  4KYS A;  5BUU A;  5DVI A;  4KD5 A;  5B7D A;  5DVF A;  3H4Z A;  5F1Q A;  3U72 A;  1XS5 A;  3IK6 B;  4G8H A;  5BWJ A;  5AA4 A;  4QF9 A;  3H6T A;  1Y3P A;  4THI A;  1M5D A;  4ZZE A;  3FVG A;  4JBZ A;  4KI0 E;  3C34 A;  4ELQ A;  4ELR A;  5HBC A;  2OK2 A;  3KOT A;  1B3H A;  1DSN A;  4ZEF A;  2A5T B;  1UQW A;  3CG1 A;  4EXK A;  3MW0 A;  3FAS A;  4H8I A;  5DEX A;  4NF6 A;  1JW5 A;  4NF8 B;  4FAT A;  5I2K B;  3PPP A;  2ZYO A;  4G2Z A;  1PEB A;  4G8N A;  2Q89 A;  2AYS A;  4GRK A;  3SES A;  3I6V A;  1M5B A;  3K01 A;  3HPI A;  5FHO A;  3TTL A;  5JEI A;  4DE8 A;  2QMW A;  3LUY A;  3E4R A;  2Q88 A;  3W9W A;  2ZNS A;  3E13 X;  4OTE A;  4OZ9 A;  4QSC A;  4PFY A;  4QSD A;  3AXF A;  3PMW A;  4JB7 A;  3RT8 A;  3RN8 A;  5TP9 B;  4YU0 A;  3H3G A;  3DP4 A;  4QSE A;  2XD2 A;  4XKQ A;  1SW1 A;  5FHM A;  4EQ7 A;  2ZYN A;  3EQ1 A;  1WDN A;  2B3F A;  2ZYK A;  3ECR A;  3TDJ A;  4E0X A;  3CRB A;  1A8E A;  2Z23 A;  3CFZ A;  3PD8 A;  4I8C A;  3TYH A;  3VLW A;  3OXN A;  4DCX A;  1DPP A;  2HAU A;  3G3J A;  3OMB A;  5DVJ A;  3UP9 A;  1OQH A;  3HHF A;  1NMU A;  2THI A;  3O2A A;  1B52 A;  3TCH A;  3V8X B;  3MPL A;  3EPE A;  1TWY A;  3RLF E;  3PUW E;  1US5 A;  2Y7K A;  4MH5 A;  2E1S A;  2RC8 A;  5I57 A;  1JVX A;  1PDA A;  1H43 A;  1MXZ A;  3KZG A;  3P7I A;  4JDF A;  4F1V A;  4IGR A;  2Q2A A;  3PMX A;  1VFE A;  4U21 A;  4E0W A;  4NTL A;  3TEL A;  3K0V A;  3M3L A;  2P1S A;  2LAO A;  4KYD A;  3DEL B;  4ZEC A;  3B6Q A;  1MPD A;  1QVS A;  3TEP A;  1MXX A;  2X7P A;  3R6U A;  3GBB A;  3PD9 A;  3MP8 A;  1SQY A;  2FNC A;  4JWO A;  3FUZ A;  1ZU0 A;  1R6Z A;  1EZ9 A;  3PMV A;  1MS7 A;  2H25 A;  1ZKB A;  3PPO A;  2UVJ A;  1O64 A;  2A5T A;  3N26 A;  1A99 A;  4KFQ A;  4X48 A;  3VV5 A;  4RNS A;  2OLB A;  1R9L A;  5CMK A;  4FE8 A;  2I0B A;  5ITO A;  4YKK A;  3TMG A;  3IOV A;  2GRV A;  2ZXT A;  4F3G A;  2GHB A;  4G4P A;  2I4C A;  3G3I A;  4ONY A;  5AA4 B;  3PUV E;  4F3P A;  5ICT A;  3I3V A;  2I3W A;  3IB1 A;  1MXW A;  3SEU A;  1B3E A;  1MM6 A;  5B70 A;  5L8D A;  1ZLQ A;  1FQB A;  3Q28 A;  1YTV A;  4U2R A;  2QPQ A;  3KG2 A;  4EUO A;  2V3U A;  4JWX A;  4RA1 A;  4F3B A;  3UOR A;  3DP8 A;  5FTI A;  1B51 A;  1P1N A;  4OFO A;  1ZIU A;  3ILT B;  3PUZ E;  4UAC A;  3MBP A;  3OSQ A;  3FXQ A;  4HW8 A;  1LAH E;  3LC8 A;  2XXT A;  1IXC A;  3OO8 A;  4R9G A;  1B40 A;  1GR2 A;  2CZL A;  2GFE A;  3RGY A;  3RQT A;  4LAT A;  1NNK A;  1PB8 A;  1Z7N E;  3CG3 A;  3CIJ A;  4KPT A;  2G29 A;  4GL8 A;  1FQE A;  3VLV A;  5DYH A;  5I56 B;  4LP2 B;  2E0S A;  3MVW A;  2O6A A;  3IOT A;  2UVI A;  3DLN A;  1JW4 A;  4N13 A;  2AL5 A;  1L5T A;  4HCW A;  2UVH A;  3MVZ A;  4MLV A;  4R75 A;  4XKR A;  3CFX A;  3OO9 A;  1LFG A;  4Q30 B;  4RK2 A;  3IL1 B;  1Q1K A;  4OVJ A;  4POW A;  1N0T A;  4Q0C A;  4YAH X;  1OMP A;  3C4M A;  1MQH A;  4ND9 A;  5I84 A;  4DXB A;  1A55 A;  1SYI A;  2KLF A;  3D4G A;  4H5F A;  5J1D A;  4OQO A;  1OLC A;  1MQD A;  3T66 A;  4H0W A;  2DWI A;  4HS7 A;  3ZS6 A;  1O7T A;  4AB6 A;  2UXA A;  2I3V A;  1D3K A;  4MF3 A;  1PBP A;  1PBQ A;  2AIX A;  2ZYM A;  3LSL A;  5L9M A;  2F36 A;  2ZNU A;  4FOR A;  1SW5 A;  1URD A;  3MC2 A;  4C0R A;  2XXV A;  2F5X A;  3IB0 A;  4F2Q A;  4KQP A;  2HZK A;  1NNT A;  1ZBM A;  2RC7 A;  2HCA A;  4F1U A;  4ZDM A;  1JEV A;  3C9H A;  4BDM A;  2X7Q A;  3O66 A;  3TCF A;  1MY0 A;  1VE4 A;  3EHS A;  4M1V A;  1FQF A;  4F31 B;  2W7Y A;  1B6H A;  4LON B;  2NWJ A;  4XIG Q;  1POT A;  2RKM A;  3THI A;  1PB9 A;  3G3F A;  2NUV A;  1B7U A;  5H8F B;  1Y3Q A;  2ESN A;  3FJG A;  4KYE A;  5EYF A;  1N04 A;  1A7L A;  2ZMB A;  4F29 A;  1FCK A;  3N94 A;  4OET A;  4R6Y A;  2F7B A;  3U1O A;  2HFB A;  3VDF A;  3MP1 A;  2XXR A;  4FEC A;  3QAX A;  1P1W A;  3HST A;  3QK6 A;  4GQO A;  1LLS A;  3OEM A;  4X1D A;  3PUX E;  3DP6 A;  1LAF E;  3EF7 A;  3IX1 A;  1B7Z A;  3OEL A;  3Q27 A;  3VXC A;  2BJJ X;  2DP8 A;  5ELV A;  2PT1 A;  1TT1 A;  3BBR A;  3MPK A;  1USY H;  1SI1 A;  4OFL A;  4DDD A;  5I59 A;  3PV0 E;  2O1M A;  1FTO A;  4Z7E A;  1Q35 A;  5K2X A;  2QL3 A;  4KHZ E;  3VE1 B;  1MQJ A;  4IY5 A;  4EDP A;  2H5Y A;  1OQG A;  3L6G A;  2XXI A;  2QS1 A;  5HPQ A;  1MXY A;  3QUF A;  3LR1 A;  3C36 A;  3MQ9 A;  3OEN A;  1QW0 A;  1II5 A;  1MY2 A;  4JSO A;  1EH3 A;  5H8N B;  5JTY A;  3MVX A;  2IEE A;  4PFT A;  4DZ1 A;  4RYA A;  1ELJ A;  2PX1 A;  2VGQ A;  4H1X A;  1BTJ A;  3K02 A;  4NF4 A;  4NF8 A;  1H3D A;  4TQU Q;  1IZ1 A;  4U22 A;  3TFL A;  1XHY A;  4AQ4 A;  1N84 A;  1Y4T A;  3U8Q A;  3HN0 A;  1EZO A;  3VVF A;  3MJN A;  1B1X A;  2Y7I A;  3CFL A;  4FJP A;  4R6H A;  3W9V A;  1Z7M E;  3WAF A;  1BLF A;  4R6K A;  1NH7 A;  1AOV A;  1JVY A;  1M5E A;  1NFT A;  2VD3 A;  3KEI A;  1MG1 A;  3O28 A;  2DXR A;  4ZEI A;  1UTB A;  3FGS A;  4AB5 A;  4LUB A;  3FVN A;  4YMB A;  3IR1 A;  3TQW A;  5I58 A;  5ICQ A;  3T9U A;  3S9M C;  1CE2 A;  4DXC A;  3KJ7 A;  1XC1 A;  4C1U A;  5I2N A;  4PP0 A;  1Y9U A;  2YJP A;  1R1N A;  3SDF A;  3RUM A;  2R9J A;  1VFD A;  3TTK A;  2XXW A;  2DXY A;  4H65 A;  3S4U A;  3OSR A;  4KCD A;  4U23 A;  1EZP A;  1IEJ A;  1JW1 A;  4N6P A;  2Z8F A;  2DOJ A;  3RTF B;  1B4H A;  1IXG A;  3R26 A;  1B3G A;  5JTY B;  1RYX A;  5AA1 A;  3FVK A;  4U1O A;  4GFR A;  3SEX A;  5AA3 A;  3PUY E;  4KR5 A;  2H98 A;  3M3F A;  4P11 A;  2I4B A;  1UIV A;  3LSW A;  2OCU A;  4RPO A;  3MZB A;  1LFH A;  3HO7 A;  2NVU B;  3O6H A;  2Q2C A;  1MY4 A;  3K2D A;  1MDQ A;  1R9Q A;  4GLI A;  3T93 B;  4RJZ A;  5AE4 A;  3C35 A;  5KZT A;  4K3F A;  2HZL A;  3IO4 A;  3QYT A;  4R72 A;  4ELP A;  5AA2 A;  2H99 A;  5I59 B;  1JET A;  3S9E A;  4ZED A;  1N3X A;  3H6W A;  4RPN A;  2XXX A;  4FAJ A;  1A40 A;  1US4 A;  2O84 X;  3PPN A;  4ZE9 A;  1B7H A;  5HM4 B;  1B9J A;  1P1Q A;  2XD3 A;  3EN3 A;  4OYV A;  3A09 A;  1HSL A;  2GH9 A;  3MWB A;  2ALU A;  3EHU A;  3FVO A;  4IO3 A;  1NL5 A;  4JSD A;  2QS4 A;  4NED A;  4QHQ A;  5FHN A;  3TAJ A;  1LCT A;  4LA9 A;  3QSL A;  3O6I A;  1EU8 A;  4TLM B;  1T0K A;  2XX9 A;  3S9N C;  1S50 A;  2DSF A;  3FJM A;  3RNN A;  2Z8E A;  3H7M A;  3H06 B;  3KSX A;  2XXH A;  2V25 A;  3PU5 A;  1J1N A;  1B5I A;  4YB6 A;  3FIR A;  4YKP A;  4GL0 A;  2ONS A;  4GD5 A;  5F7V A;  5M2V A;  2DWH A;  2Z22 A;  3GLB A;  3JV9 A;  4I1D A;  3QXM A;  4YB5 A;  5DEX B;  3FJ7 A;  3UGW A;  4F39 A;  4G68 A;  1AL3 A;  1MRP A;  3M8U A;  4TLL B;  4R74 A;  2ZNT A;  3TOD A;  2D21 A;  1PB7 A;  2OZZ A;  4LZ7 A;  2XXP A;  3GXA A;  4ZS9 A;  4Z0I A;  4BLA A;  5CBR A;  2V93 A;  1B3L A;  1FTK A;  4PFW A;  5DT6 A;  1IIT A;  4FED A;  2WKY A;  4OHN A;  3K4U A;  1DMB A;  2I49 A;  4BDR A;  5L9S A;  3CSB A;  4NF5 B;  5L9O A;  1SYH A;  3KBR A;  2VD2 A;  1UTH B;  3VVE A;  2Z8D A;  2ONR A;  4OFJ A;  2DYX A;  3QIM A;  4OEV A;  3WAE A;  2G93 A;  3H03 A;  4F2O A;  3B7D A;  3B6T A;  4NWC A;  3C33 A;  4XXU A;  3TTM A;  4MLQ A;  4EF2 A;  4F3S A;  1DPE A;  2XX8 A;  5IKB A;  2VP1 A;  4OMB A;  3K00 A;  1QKB A;  2XXY A;  1Y4C A;  4G68 B;  4O3C A;  4ELO A;  1TFD A;  2X26 A;  5KCJ B;  3R7X A;  4G68 C;  1I6Q A;  4R2B A;  1NKX A;  2VHA A;  2AL4 A;  3GZG A;  4LZ8 A;  4ZEK A;  3T9V A;  4RK9 A;  3UIF A;  3K1M A;  4YZZ A;  1M5F A;  4DXU A;  1MY3 A;  3KGC A;  3D4C A;  1B3F A;  3RPW A;  3IAZ A;  4YIC A;  3K6U A;  4PET A;  1KWH A;  2F7A A;  4BDO A;  4NWD A;  1YCJ A;  1JNF A;  1OLA A;  2I48 A;  2VOZ A;  2Y7P A;  2HQ0 A;  2F35 A;  3FD3 A;  5LOM A;  3G7W A;  3MUQ A;  1URG A;  3CR9 A;  1IQ7 A;  3Q29 A;  1QUL A;  3O9P A;  4ECF A;  1HSJ A;  5H8S A;  3JZJ A;  1B5H A;  4Q5T A;  3U93 A;  4L17 A;  2RCA A;  4MBP A;  3N6T A;  1JQF A;  5K2Y A;  4Q8R A;  4ZE8 A;  3SER A;  4NE4 A;  2M8C A;  2R6G E;  2OJT A;  3T22 A;  1MDP 1;  2B3B A;  1OIB A;  1FW0 A;  5H8H A;  4YKJ A;  3VVD A;  3MZ9 A;  3IOW A;  3ZSF A;  2PVU A;  4IGT A;  3Q25 A;  1PC3 A;  2V84 A;  3ILU B;  4PFU A;  2R71 A;  1I6A A;  4R2F A;  3FXU A;  3T9H B;  1B05 A;  4H6D A;  1SVX B; 
#chains in the Genus database with same CATH topology
 3NBI A;  1TDH A;  1N7W A;  1JQJ C;  2O51 A;  4LQ5 A;  5A5X A;  4GHA A;  1IN4 A;  1VG5 A;  4HE0 A;  3U60 A;  3LSX A;  3M3K A;  3SEY A;  5I2K A;  4NF6 B;  2FIX A;  4G4Q A;  2HHH M;  2Y7W A;  4S12 A;  1JEU A;  1LAG E;  4FBP A;  1QZM A;  4H5G A;  4PF8 A;  2M5Z A;  4BDL A;  1BP5 A;  1UTB B;  1UFZ A;  5EHM A;  3AV0 A;  1G0H A;  1SW4 A;  1CUK A;  4NN3 A;  2FYI A;  3K6W A;  3TZA A;  3KOX E;  4GBV A;  1TFA A;  1VQ1 A;  2PBW A;  4C1T A;  1E94 E;  4JXJ A;  3GLG B;  3TPA A;  3UZU A;  4I5S A;  1TDZ A;  4QFO A;  3MAM A;  4LF7 M;  4U4X A;  2F78 A;  1YAE A;  4F2L A;  4ZPX A;  2D3I A;  1PGY A;  2CZK A;  3TCG A;  2I0C A;  4IBG A;  3O6G A;  1BIY A;  2UYE A;  1FQD A;  3M7G A;  1HNX M;  4HTG A;  4ANR A;  4DCY A;  4WEP A;  2OBG A;  1NHG C;  1T43 A;  1P1U A;  2H5X A;  1PJS A;  3PGF A;  3LMM A;  4OWD A;  3U6C A;  1VSO A;  4JI0 M;  1URS A;  4BBA A;  3J7B A;  2Z8Y M;  4PDH A;  2XHD A;  1IUD A;  4NF4 B;  3C31 A;  2VF8 A;  2OWS A;  2F97 A;  3RTW B;  1P1O A;  3OO7 A;  3BBZ A;  4DR5 M;  3E79 A;  1RYO A;  3RT6 B;  4R9F A;  3GBA A;  4LQ2 A;  1IIW A;  2DVC A;  1NV8 A;  4DV7 M;  1Y20 A;  1NI9 A;  1QUT A;  4GX3 A;  3QUJ A;  1XHB A;  1IN7 A;  1VEJ A;  3E9S A;  3SEW A;  4GVO A;  4FEB A;  4O7M A;  1GGG A;  1LBZ A;  3W15 C;  1XVY A;  2Q74 A;  4NSR A;  3FXR A;  1NNP A;  2Y84 A;  1A8F A;  2LVP C;  3HX3 A;  1NNF A;  4X65 M;  1LGB C;  1SW2 A;  4GF8 A;  2UYF A;  2REG A;  4RF1 A;  4LGM A;  1I69 A;  4LF9 M;  5H8H B;  4KCC A;  2P3V A;  3HJQ A;  1ZQ9 A;  3N5L A;  5CRY A;  1HR0 M;  4U1Z A;  4I62 A;  2J7N A;  4OAN A;  2DWJ A;  2UXC M;  3AFH A;  3HWS A;  1LEV A;  5CI5 A;  3TTN A;  1V92 A;  1N7X A;  4NL4 H;  4R7G A;  5AA2 B;  2G5G X;  4OVZ A;  2DE4 A;  1Y3N A;  1PJT A;  4HE1 A;  5CMM A;  1L1Z A;  4IY6 A;  3A29 A;  3Q8X A;  1S9T A;  1N3W A;  1LB8 A;  1XT8 A;  4PE5 B;  3IJO B;  4O8M A;  5JK4 A;  1NNU C;  3FBP A;  4DLD A;  4LY6 A;  1FTM A;  1LBX A;  1B58 A;  5C18 A;  2C9O A;  4KYS A;  2M60 A;  1VDD A;  2LNH C;  3TWL A;  4G8H A;  2RRU A;  5E26 A;  2PFZ A;  4KI0 E;  1B3H A;  2XFS A;  3RYD A;  2L7H A;  2A5T B;  1UQW A;  4NF6 A;  1JW5 A;  4NF8 B;  4FAT A;  3L26 A;  4GRK A;  2JZ0 A;  2WZJ A;  1M5B A;  3IFC A;  5EQT A;  4LFB M;  2FVZ A;  4FD2 A;  3SC3 A;  3E4R A;  3HFU A;  3LUY A;  2Q2E B;  2V1C A;  2ZNS A;  1GKI A;  3RT8 A;  3U5Z B;  4YU0 A;  1KZ8 A;  3DP4 A;  4XKQ A;  2QZ4 A;  2KEB A;  2ZYN A;  4DI3 D;  2DAE A;  3EQ1 A;  4E0X A;  3GLF A;  3TQS A;  2HAK A;  3PD8 A;  3CFZ A;  4DCX A;  5DVJ A;  2HAU A;  2WBD A;  3MPL A;  4JI7 M;  3PUW E;  2Y7K A;  2E1S A;  3L28 A;  1PDA A;  3GPP A;  1MXZ A;  4F1V A;  4XBO A;  4DR7 M;  4IGR A;  4E0W A;  4NTL A;  3K0V A;  1N78 A;  2P1S A;  1FNN A;  3FUT A;  1QVS A;  4D82 A;  3GBB A;  1HNW M;  3PMV A;  2H25 A;  3N26 A;  1A99 A;  4X48 A;  4RNS A;  2OLB A;  5DYI A;  1DCU A;  4GBW A;  5CMK A;  2I0B A;  4GWW A;  4N91 A;  1FPG A;  4XGI A;  4F3G A;  3PUV E;  2MRO B;  2KR0 A;  3IB1 A;  2LH0 A;  2DKL A;  2L6O A;  1ZLQ A;  1YYZ A;  1FQB A;  2WEF A;  2QPQ A;  2C5R A;  4F3B A;  3UOR A;  1B51 A;  1TGU A;  1GO5 A;  1P1N A;  4MNC A;  3PUZ E;  3MBP A;  3OSQ A;  3FXQ A;  2JY7 A;  5EXP A;  1G0I A;  2D7H A;  1GR2 A;  4YY3 M;  3KW6 A;  3MYU A;  2JA2 A;  4QXD A;  3HY5 A;  3CG3 A;  2G29 A;  3VLV A;  5I56 B;  2O6A A;  2QSF X;  4WP2 A;  2AL5 A;  3GPX A;  5L8R F;  1DV0 A;  3CFX A;  3MK6 A;  4Q30 B;  2RKO A;  1Q1K A;  2WYK A;  4LJ8 A;  1GAB A;  1LBY A;  2EJS A;  3C4M A;  2CV1 A;  4OQO A;  4H0W A;  2DWI A;  1O7T A;  1XXH E;  2UXA A;  3C9P A;  2I3V A;  4MF3 A;  3LSL A;  3RPL A;  5ITU A;  2R8T A;  4C0R A;  2F5Q A;  1EYK A;  3FTF A;  4F1U A;  3C9H A;  4YHH M;  5EQ7 A;  3TCF A;  2HKJ A;  1MY0 A;  2VII A;  2W7Y A;  4LON B;  2QP9 X;  2NWJ A;  4LRT A;  1PB9 A;  3G3F A;  5H8F B;  4PFI A;  4N8Y A;  1A7L A;  4A3V B;  2F7B A;  1FBG A;  4G3O A;  3B7Z A;  2J7O A;  3DP6 A;  5F24 A;  3Q27 A;  2FBP A;  1IY1 A;  4LFA M;  1USY H;  1D9Q A;  5I59 A;  3DZD A;  2BJV A;  4Z7E A;  5K2X A;  2QL3 A;  4KHZ E;  1MQJ A;  4EDP A;  1OQG A;  2Q8M A;  2XXI A;  3QUF A;  1N36 M;  1QW0 A;  3L29 A;  1EH3 A;  1RDZ A;  5JTY A;  2IEE A;  2ZTC A;  3JR4 A;  4OA4 A;  5ITQ A;  4U22 A;  3BOS A;  1EZO A;  5DFL A;  1IBL M;  2AHM A;  5EXS A;  3U8Q A;  1Q39 A;  2CHQ A;  2BJI A;  2DZN B;  3VVF A;  3CFL A;  5ITX A;  3J2P B;  3WAF A;  1VEK A;  3WHL A;  1EFU B;  3HU1 A;  1JVY A;  1OKS A;  2DI0 A;  3KEI A;  3O28 A;  4ZEI A;  4YMB A;  2XLJ A;  3TQW A;  4DXC A;  4C1U A;  2DWM A;  1Y9U A;  2YJP A;  3TTK A;  1VFD A;  3OSR A;  3THG A;  1IEJ A;  3PFI A;  3RTF B;  3GLG A;  1XB2 B;  1FJG M;  1B4H A;  1IXG A;  2DOJ A;  3R26 A;  5AA1 A;  3FVK A;  4U1O A;  1DGB A;  2R65 A;  4NRV A;  4RPO A;  3K2D A;  3T93 B;  2RGH A;  2R62 A;  3QYT A;  4P47 A;  4ELP A;  5I59 B;  1JET A;  3U61 A;  4RPN A;  5IZZ A;  3KP1 E;  3LCU A;  3ILK A;  1EYJ A;  2XD3 A;  3QAU A;  3A09 A;  3MHV C;  1HSL A;  4MCO A;  4AS5 A;  4QHQ A;  1S3S A;  4KHP M;  2RGO A;  1OFI A;  1Z5B A;  3FJM A;  3RNN A;  1I4W A;  3PU5 A;  2V25 A;  3EKI A;  4PT5 A;  1B5I A;  2R46 A;  2ONS A;  5DEX B;  3E21 A;  4F39 A;  1AL3 A;  3TOD A;  2D21 A;  4GIP A;  3GXA A;  5CBR A;  1DGH B;  2ZTD A;  4PDD A;  4OHN A;  1NNJ A;  2I49 A;  5ITY A;  5L9S A;  4WUR A;  4NF5 B;  5L9O A;  4GKJ M;  4G6Z A;  2Z8D A;  3DA1 A;  1X37 A;  3H03 A;  4F2O A;  3B6T A;  3K00 A;  2OX3 A;  4G68 B;  4O3C A;  2CE7 A;  4L15 A;  1TFD A;  4MJO A;  2R45 A;  4G68 C;  5HPQ A;  4DV3 M;  4BB9 A;  4AS4 A;  3UIF A;  3K9O A;  3T15 A;  3I04 M;  2KQZ A;  1OTR A;  4DXU A;  5EP3 A;  4YIC A;  4N8G A;  2F7A A;  4NWD A;  1YCJ A;  1JNF A;  1OLA A;  4AKH A;  3MJ5 A;  1NY5 A;  2VQE M;  4B3M M;  4Q5T A;  4LJ4 A;  2RCA A;  2B4L A;  4MBP A;  4MH0 E;  4I81 A;  1HJP A;  3B7N A;  2KNV A;  2M8C A;  3KS8 A;  2B3B A;  5H8H A;  1FJ9 A;  4IGT A;  1PC3 A;  2V84 A;  2LVQ D;  1I6A A;  5I56 A;  1B05 A;  2ONR A;  1MX0 A;  4MHF A;  3LQQ A;  1FTL A;  4GOT A;  3KFU G;  2QSX A;  4XK8 F;  1B46 A;  3L25 A;  3AKZ A;  4GXS B;  1G3I A;  4YKI A;  3SAT A;  3ZKK A;  1OIP A;  2QNJ A;  4L4U A;  1I6B A;  3BFU A;  3OD7 A;  2XX7 A;  3IOU A;  3IJX B;  3GLG E;  4P56 A;  2L2D A;  3UA8 A;  1WOD A;  4NSO B;  3IEC A;  3DM0 A;  3HZJ A;  1H76 A;  3CSG A;  2I6E A;  2XWO A;  1SG9 A;  3CI8 A;  1XC8 A;  5CMC A;  4U4S A;  4JV5 M;  4GX6 A;  3HHY A;  1D0M A;  2P5T A;  1YPN A;  3VDU A;  5H8N A;  3NWL A;  3SBJ A;  1NHW C;  2O7I A;  3PPQ A;  4X1B A;  4OEU A;  4G4R A;  2ZAM A;  2QMX A;  2HL7 A;  3V89 B;  1QAQ A;  1AWB A;  2LHC A;  2F6P A;  4LF4 M;  5I57 B;  1Z5C A;  1EYI A;  4DV1 M;  3A3C A;  2E5L M;  5DW8 A;  2X49 A;  1S7Y A;  5TPA A;  5FLX S;  2XSZ A;  3JR5 A;  1PJI A;  2ANJ A;  1DOT A;  5FTL A;  5DNY A;  2A5S A;  3G3K A;  2H4I A;  4DBG B;  4OER A;  3J7A S;  2F8D A;  1ATG A;  2Y21 A;  1SBP A;  4B3R M;  2FFJ A;  2YNM D;  2OOA A;  1FBC A;  1QUI A;  1SDX A;  3KN3 A;  2FH0 A;  5KQ8 A;  2J5Y A;  1K82 A;  1FSA A;  4MEV A;  2LWX A;  1ZMW A;  5C1B A;  4GRI A;  4B3S M;  1B5J A;  3I5O A;  4FIM A;  3A45 A;  4WKM A;  4ISU A;  1ANF A;  1RKM A;  4DUY M;  3OOA A;  5CM6 A;  2FS1 A;  3GLI B;  4EXL A;  4NF5 A;  2HXW A;  4EQ7 A;  2QCU A;  1TTE A;  2B3T A;  2PYY A;  2UU9 M;  3T6P A;  4G4N A;  4PQJ A;  1J5E M;  4PAI A;  3LV0 A;  3ZKL A;  4GX4 A;  3GLH A;  1YLA A;  3HGI A;  1D9Y A;  2H1R A;  1Y1Z A;  3SKP A;  4F19 A;  3PPR A;  5CC2 A;  1H45 A;  4N07 A;  3IOR A;  4QFL A;  1WHC A;  2YLN A;  1MQI A;  1ZJL A;  4QRZ A;  1N33 M;  5A5L A;  5IZ1 A;  5H8Q A;  4NG7 A;  3IO6 A;  1NJG A;  4ZEB A;  3LUZ A;  2Q8J A;  1A54 A;  1K9Y A;  3B6W A;  4GWO A;  4HE2 A;  3UK4 A;  2LTU A;  3U6O A;  4H45 A;  3T96 B;  2CEA A;  3JYR A;  2RCB A;  4IBJ A;  4I9D A;  1DO0 A;  1H44 A;  3TPZ A;  3F11 A;  4PBQ A;  4R73 A;  1D0K A;  3V5A A;  3FTE A;  1ZTY A;  1SXJ C;  3PXG A;  5I2N B;  1ZMG A;  2CMO A;  2O1L A;  1IXI A;  3L6H A;  2QEN A;  2WX9 A;  2NQ8 C;  3E46 A;  2PT2 A;  4L6V 6;  3UMM A;  2PCR A;  5DVF A;  3H4Z A;  1FTA A;  1XS5 A;  2X4A A;  1QUS A;  3W67 A;  4THI A;  3SYK A;  1ZMV A;  3FE3 A;  3C34 A;  4ELR A;  4REZ A;  2DDK A;  2OK2 A;  4GEW A;  3SMP A;  5DEX A;  3FAS A;  2F3B A;  5ET5 A;  3PPP A;  1H6U A;  3U5Z A;  4O94 A;  1PEB A;  2Q89 A;  1RDX A;  4LJ9 A;  1IY2 A;  3I6V A;  4H46 A;  5FHO A;  1FPK A;  3KOY E;  2QMW A;  3EIH A;  3E13 X;  4OZ9 A;  4PF6 A;  2LVO C;  3B7Q A;  3RN8 A;  5H8N B;  5FHM A;  3H3G A;  2XD2 A;  1LBV A;  4DR6 M;  2ZYK A;  2B3F A;  2Y20 A;  3ECR A;  2HPG A;  2Z23 A;  1R6B X;  4JI4 M;  5H37 D;  3GLI E;  1GJS A;  4DUZ M;  3HHF A;  1B52 A;  3TCH A;  4LF8 M;  4FWG A;  2RC8 A;  4QOZ C;  1AIP C;  1JVX A;  1H43 A;  3P7I A;  3PMX A;  4U21 A;  5EQ8 A;  3LCV B;  3U6P A;  5J16 A;  3B6Q A;  4MB7 A;  2A5Y B;  1MPD A;  2JXN A;  1MXX A;  4GWY A;  3PD9 A;  1ZU0 A;  4M0D A;  2KDL A;  1ZKB A;  4NX1 A;  2UVJ A;  4ITQ A;  3B8B A;  4K0K M;  3T1Y M;  4IJE A;  2GRV A;  5ICT A;  2JY5 A;  4ONY A;  2WSE F;  3I3V A;  3VFD A;  4FCV A;  2FIE A;  4P9K A;  3VKH A;  3KG2 A;  5I3S A;  2V3U A;  4JWX A;  3GLF B;  2KHH A;  4OFO A;  2W82 A;  3CF2 A;  1PRB A;  4I40 A;  1IMA A;  1LAH E;  2UUB M;  1OIZ A;  4PTK A;  2APL A;  2GFE A;  1PB8 A;  4Z8X A;  4LP2 B;  3IOT A;  4N13 A;  1L5T A;  2K9D A;  1NV7 A;  4HCW A;  1J7K A;  4R75 A;  4RK2 A;  1LFG A;  4JN6 A;  2JUJ A;  5I84 A;  1A55 A;  1SYI A;  3KC1 A;  3D4G A;  1OLC A;  1MQD A;  1R4G A;  5FTK A;  4AB6 A;  2F5O A;  2WSC F;  1NJF A;  2X8A A;  3FTC A;  4X66 M;  1PBQ A;  5L9M A;  2ZNU A;  4NHB A;  5ITX E;  4FOR A;  1SW5 A;  3MC2 A;  2D7E A;  3IB0 A;  4KQP A;  2HCA A;  3B50 A;  4BDM A;  2EKK A;  3FYD A;  3U6Q A;  3HU2 A;  4F31 B;  3EHS A;  1FQF A;  3KP0 E;  1POT A;  1R5L A;  1NO1 A;  2CZI A;  5LMU M;  3A42 A;  5EYF A;  2EKF A;  4PFR A;  2ZMB A;  5A2Q S;  1FCK A;  4OVZ B;  3N94 A;  4OET A;  4X62 M;  4R6Y A;  3TE6 A;  1FBH A;  2XXR A;  4FEC A;  4X1D A;  3QK6 A;  3OEM A;  2EO2 A;  3IX1 A;  1B7Z A;  5EQ9 A;  3U6S A;  2PT1 A;  1TT1 A;  4IR8 A;  3HU3 A;  1IXS A;  2ZAO A;  1IXZ A;  4IY5 A;  2QS1 A;  4DV4 M;  3OEN A;  4B7F A;  4CHT B;  1II5 A;  1MY2 A;  4MMP A;  3MVX A;  2ERC A;  4PFT A;  4DZ1 A;  4GWX A;  5LMN M;  1ELJ A;  4NAP A;  2YR0 A;  1NV9 A;  2DZL A;  1IZ1 A;  1FBF A;  3I4Y A;  4OU7 A;  1B1X A;  4FJP A;  4R6H A;  3W9V A;  4R3D A;  1T3T A;  4IBD A;  4GWU A;  2VD3 A;  4HLQ A;  3C3D A;  3SFZ A;  1MG1 A;  2EUC A;  2G3Q A;  4AB5 A;  1TR8 A;  5I58 A;  5ICQ A;  3GQ4 A;  2XEP A;  4IBE A;  3S9M C;  3C58 A;  1XC1 A;  1FPJ A;  5LTC A;  1QGX A;  4Z6Y A;  2OWZ A;  4GWZ A;  2DXY A;  2CEX A;  3S4U A;  4BLC A;  4KCD A;  3T1B A;  4MGK E;  4U23 A;  4N6P A;  5JTY B;  1TF0 B;  4KR5 A;  2Y5K A;  4PC9 A;  1UIV A;  2BWB A;  3TWM A;  2NVU B;  1Z5A A;  1MY4 A;  1R9Q A;  4GLI A;  3RPL B;  5T3J A;  2HZL A;  3ROJ A;  4R72 A;  3S9E A;  2KA6 B;  3H6W A;  2ZM6 M;  2O84 X;  5HM4 B;  4B7H A;  1B7H A;  1IXR C;  4PGP A;  4NED A;  3EHU A;  3B9P A;  2QS4 A;  4OX9 M;  2DHR A;  3FRI A;  4LA9 A;  2OPF A;  3QSL A;  2OQ4 A;  3U60 B;  3B74 A;  2Z8E A;  1GL7 A;  1XI6 A;  3TWK A;  4JI1 M;  1F4I A;  4N6K A;  3FIR A;  1KYI A;  1IME A;  5M2V A;  2DWH A;  2Z22 A;  4I1D A;  4OVS A;  3FJ7 A;  3ZH9 B;  4TLL B;  3RGS A;  2ZNT A;  3PVS A;  2OZZ A;  2V93 A;  4DR4 M;  4I3E A;  1G41 A;  1VDW A;  2WKY A;  2JWS A;  3KBR A;  2CRU A;  2KRK A;  2DYX A;  3QIM A;  3WHK A;  2G93 A;  1AUA A;  4NWC A;  3TTM A;  2OO9 A;  4B3T M;  1DPE A;  2XX8 A;  3F92 A;  5KCJ B;  1NKX A;  3GZG A;  4ZEK A;  4R71 A;  4RK9 A;  3K1M A;  2C99 A;  4YZZ A;  1M5F A;  4WW0 A;  1TH3 A;  3VK7 A;  3CTW B;  2XZU A;  4HXV A;  5ITR A;  1KWH A;  2I48 A;  2VOZ A;  2Y7P A;  2F35 A;  4P1E A;  1Q9D A;  5LOM A;  4L8R C;  1URG A;  4JI2 M;  1UM8 A;  1WIV A;  1HSJ A;  2QVV A;  1SPI A;  1Z6T A;  3N6T A;  4Q8R A;  4ZE8 A;  1JR3 A;  3BIH A;  4NE4 A;  3SER A;  3T22 A;  1MDP 1;  1FW0 A;  3MZ9 A;  3IOW A;  3ISP A;  4PFU A;  4II7 A;  4R2F A;  3T9H B;  4H6D A;  4YMA A;  3E3K A;  3H6V A;  3RFW A;  1QVR A;  4PCZ A;  3TTR A;  1FPL A;  4MGH A;  2ONK E;  3K2L A;  2DS9 A;  4POX A;  2BNK A;  4IO6 A;  4QFN A;  1GV8 A;  2HEU A;  2CP8 A;  1WVJ A;  3MVY A;  2DAI A;  1XXH A;  2ZBK B;  4BDQ A;  1NV4 A;  4OEN A;  3IHP A;  2F7C A;  1N34 M;  4RXL A;  3MP6 A;  3U6E A;  1F9B A;  5TU0 A;  4ESW A;  4BDN A;  1FTJ A;  5AA2 D;  4GIZ A;  1W5T A;  4F1Y A;  1HQC A;  4AW4 A;  2KNZ A;  4AI6 A;  3HHX A;  2DWA A;  2VT5 A;  3K1P A;  5DTB A;  3E9X A;  3U92 A;  3A3U A;  1LBB A;  1MQG A;  1LFI A;  4O3B A;  3S2V A;  1OVT A;  4FCW A;  4GXA A;  2ZZW A;  2NXO A;  2QPA A;  4Q7J A;  2RIN A;  3HCQ A;  2C98 A;  1QAN A;  3K8Z A;  1IBM M;  2Y7R A;  4G8M A;  1AH5 A;  2QRY A;  5L8D A;  1BVS A;  3FRH A;  1LAX A;  2FHY A;  1MJG M;  4M9Z A;  1LTM A;  1DTZ A;  2V4C A;  2BJW A;  1MM7 A;  1GVN A;  2F5S A;  2F6G A;  4PFB A;  1DTG A;  1AIV A;  2VPN A;  3KN8 A;  4F22 A;  3O97 A;  2GHA A;  2UVG A;  3ONM A;  1GL6 A;  2DVW B;  4G77 A;  3K92 A;  1QZE A;  3W0L B;  4LVQ A;  5IAI A;  2OWT A;  4H67 A;  3CHG A;  3K9P A;  3J80 S;  1HT2 E;  3PNY A;  4IO4 A;  2O7U A;  1LBC A;  1PJQ A;  4IBK A;  4RKU F;  3FV2 A;  3GPU A;  2B65 A;  1MN3 A;  2F5P A;  4FW9 A;  3HHW A;  3USD A;  4NXM M;  3G3H A;  1QJM A;  4LZ5 A;  3KFM A;  3VFJ A;  4YB7 A;  2YPN A;  1HSE A;  3LBS A;  3FXB A;  1B1H A;  1MH4 A;  5KDT B;  1B0L A;  4F18 A;  1IY0 A;  1QUJ A;  3S9L C;  4DI4 B;  4XKP A;  4HCY A;  1B2H A;  2JNH A;  2R4J A;  3PNV A;  1YUB A;  1JB0 F;  5H8Q B;  2V3T A;  4I8O A;  4LF5 M;  2D5W A;  3IB2 A;  3MST A;  2JY6 B;  4EQ9 A;  3J81 S;  4P0G A;  1GTK A;  2DXI A;  3H6U A;  4NGU A;  3DOA A;  3HHZ A;  4IO5 A;  4IO7 A;  4LFC M;  1QKA A;  4UAB A;  4ZZA A;  3QMF A;  1IXH A;  2QJE A;  4NOO B;  3GO8 A;  3GP1 A;  1B4Z A;  1RDY A;  3KOS A;  3LSF B;  4N81 A;  4UN2 B;  4P1L A;  2XXQ A;  4ESX A;  3IG8 A;  1MH3 A;  5KQD A;  2HAV A;  2VF7 A;  2JJK A;  3Q26 A;  1D9V A;  3FTD A;  3C32 A;  4RY1 A;  1DGG A;  3TKD A;  3GRU A;  4XKN A;  3FUX A;  1ZMU A;  2QS2 A;  1UIU A;  3BKI B;  2L5V A;  1FQA A;  1Z59 A;  3UN6 A;  4WED A;  3CVG A;  3UK6 A;  1NV2 A;  1XNQ M;  3SAR A;  2DZO B;  2O01 F;  4IBI A;  2FA7 A;  3SEV A;  2DWZ B;  4NMY A;  2DE3 A;  5H8F A;  2OOB A;  1WGN A;  2IA4 A;  1CB6 A;  4OVT A;  3FD9 A;  4M4G A;  2LHG A;  5ITT A;  1G4A E;  4M9S A;  2YQZ A;  2UXB M;  2V3Q A;  4PDG A;  1XOC A;  1TXF A;  5BUU A;  3AOE C;  2R6F A;  5B7D A;  5EYH A;  5F1Q A;  4LJA A;  1IN6 A;  5BWJ A;  1RU3 A;  4QF9 A;  3H6T A;  4MNP A;  1Y3P A;  4ZZE A;  1NV5 A;  1IN8 A;  3T1H M;  3FVG A;  4JBZ A;  4ELQ A;  5HBC A;  5EYG A;  1IMF A;  2KZS A;  1J09 A;  3CG1 A;  3MW0 A;  3D1R A;  5I2K B;  3SES A;  2AYS A;  2HXR A;  4NXN M;  3RGP A;  3HPI A;  3K01 A;  1ZAE A;  4OTE A;  4QSD A;  3PMW A;  1OFH A;  4JI3 M;  2XGN A;  1FPD A;  1WDN A;  4N4U A;  4GH9 A;  1A8E A;  4W5W A;  4GC9 A;  3KVW A;  4I8C A;  3OXN A;  1NUY A;  1NV3 A;  3G3J A;  3UP9 A;  1NMU A;  2THI A;  3V8X B;  1TWY A;  3RLF E;  1YE9 A;  3JAM S;  2QBY A;  2VPO A;  5ET8 A;  2Q2A A;  4IIW A;  1VFE A;  3M3L A;  2LAO A;  3I01 M;  4PDI A;  2DEN A;  1R7R A;  1VDL A;  3TEP A;  2X7P A;  3R6U A;  1KSF X;  1SQY A;  2FNC A;  2XA5 A;  2MH8 A;  3FUZ A;  2CWB A;  5IZ3 A;  1EZ9 A;  3SHG B;  3PPO A;  3KDS E;  2WYP A;  4JVC A;  3VV5 A;  1R9L A;  4FE8 A;  3TMG A;  5IWA M;  2ZXT A;  2GHB A;  4G4P A;  2I4C A;  4F3P A;  2I3W A;  3AL0 C;  4GKK M;  3SEU A;  1FBD A;  3KOW E;  1B3E A;  1MM6 A;  3Q28 A;  3R9X B;  4RA1 A;  1C7Y A;  2Z3X A;  3ILT B;  4UAC A;  2DAM A;  4HW8 A;  3LC8 A;  2XXT A;  1JR3 E;  3RQT A;  3I51 A;  4LAT A;  1NNK A;  4M0W A;  5IRE B;  2XWK A;  3MVW A;  2D7G A;  2CEY A;  1Q3B A;  1YXI A;  4FVM A;  2UVH A;  4MLV A;  3BXW A;  1LBW A;  4OVJ A;  1N0T A;  4Q0C A;  4YAH X;  1OMP A;  2KLF A;  4H5F A;  1L2D A;  4IBC A;  3M0E A;  2P3N A;  1PBP A;  2AIX A;  2ZYM A;  2F36 A;  1N75 A;  5FTJ A;  1URD A;  4IJF A;  2XXV A;  2F5X A;  2MR9 A;  5KPZ A;  2RC7 A;  7CAT A;  3GQ3 A;  2X7Q A;  3O66 A;  1TH2 A;  1XMO M;  3OTO M;  4QNR A;  1VE4 A;  2WBB A;  3A98 B;  3NBX X;  2R4E A;  4XIG Q;  2NUV A;  1B7U A;  2R0I A;  3FJG A;  1YZ0 A;  5IM2 A;  1DK4 A;  1IFY A;  2XWV A;  1P1W A;  3HST A;  1LLS A;  2CHV A;  3SHF A;  3C3E A;  3OEL A;  3VXC A;  2BJJ X;  1D0L A;  2CHG A;  5ELV A;  2DNA A;  1SI1 A;  4DDD A;  1PM5 A;  1NV6 A;  5I7I A;  1FTO A;  2DAG A;  3T0J A;  1Q35 A;  3VE1 B;  5EJC A;  2H5Y A;  3L6G A;  3LR1 A;  3C36 A;  1NUZ A;  2CFO A;  4I4L A;  4JSO A;  3GRR A;  1D2N A;  1BTJ A;  4TQU Q;  4NF4 A;  4NF8 A;  3TFL A;  1G59 A;  4N6D A;  4F3S A;  1XHY A;  3HN0 A;  3U65 A;  2Y7I A;  1CNQ A;  1NUX A;  1Z7M E;  4R6K A;  1NH7 A;  3RE8 A;  1NFT A;  3L27 A;  2I7P A;  1UTB A;  3EIE A;  3FVN A;  3H4M A;  2DAK A;  4MGY E;  4D80 A;  3T9U A;  1SXJ A;  3A46 A;  4LN5 A;  1FJ6 A;  3UGJ A;  3KJ7 A;  5I2N A;  1R1N A;  3RUM A;  2R9J A;  4LJ5 A;  4NRW A;  2XXW A;  4H65 A;  5IT9 S;  2KW0 A;  4LF6 M;  1EZP A;  1JW1 A;  2Z8F A;  1B3G A;  1K9Z A;  4B7G A;  4GFR A;  4MGI E;  2H98 A;  3MZB A;  3HO7 A;  4L78 A;  2Q2C A;  1KFV A;  5KZT A;  4RJZ A;  5AA2 A;  4XEQ A;  2H99 A;  2XWI A;  4GIT A;  4ZED A;  1WGL A;  2XXX A;  4FAJ A;  1A40 A;  4ZE9 A;  3PPN A;  3QYB A;  3FUV A;  4LGY A;  1IMC A;  4OYV A;  2GH9 A;  3MWB A;  2ALU A;  4IO3 A;  5FTN A;  1NL5 A;  4JSD A;  5FHN A;  3TAJ A;  1LCT A;  4TLM B;  3O6I A;  2XX9 A;  3S9N C;  4JVI A;  4F1I A;  3H7M A;  3H06 B;  3KSX A;  4P16 A;  2MGW A;  3HJS A;  5F7V A;  4GD5 A;  3SDF A;  1Q02 A;  3GLB A;  3JV9 A;  3QXM A;  3UGW A;  1MRP A;  4TUW A;  4R74 A;  2XXP A;  1I94 M;  3NOH A;  4BLA A;  2HWJ A;  1B3L A;  1FTK A;  1IIT A;  1DO2 A;  4DV2 M;  5ESY A;  1WR1 B;  3E78 A;  1L2C A;  3CSB A;  2VD2 A;  1OAO C;  1Q3C A;  3VVE A;  4LG2 A;  4OFJ A;  4OEV A;  2N35 A;  4XXU A;  4DR3 M;  4MLQ A;  4OVP A;  4EF2 A;  2VP1 A;  1QKB A;  2XXY A;  1K3W A;  3R7X A;  4R2B A;  1I6Q A;  2VHA A;  2AL4 A;  4LZ8 A;  5LDZ A;  4AQY M;  3LVW A;  4GC5 A;  4XFE A;  4CIS A;  3BIG A;  1MY3 A;  2QHO B;  1IN5 A;  4JI5 M;  1B3F A;  4PBH A;  3LW5 F;  4PET A;  4BDO A;  3PTY A;  3FD3 A;  1MU5 A;  4N17 A;  2Y0Q A;  1R2Y A;  3MUQ A;  3CR9 A;  1IQ7 A;  1FBE A;  3JZJ A;  1B5H A;  5H8S A;  3VLF B;  2LBC A;  1LV7 A;  1JQF A;  5K2Y A;  4QHS A;  3DFZ A;  1OAI A;  3HJ8 A;  4YKJ A;  3VVD A;  3GRV A;  1E32 A;  2LVN C;  3ZSF A;  2PVU A;  1HNZ M;  4HEO A;  1B9J A;  5EP1 A;  3FXU A;  4H1X A;  2LXE A;  4TOZ A;  5KO3 A;  1XMQ M;  2V1U A;  1JR3 D;  5BR8 M;  5EHS A;  5KCJ A;  2F5N A;  2L09 A;  4AZF A;  1IM2 A;  3CGW A;  3TQL A;  5ISU A;  3MMP A;  2P0S A;  4OVQ A;  3KSJ A;  2JY8 A;  2VDB B;  3VLU A;  2PMS A;  2DQV A;  4PGN A;  1LB9 A;  1L1T A;  1LST A;  1QAM A;  4JXI A;  4UA8 A;  2QBY B;  4MNI A;  2LVA A;  5I5P A;  2VQF M;  3VKG A;  2P2A A;  1LCF A;  4H8J A;  2ZAN A;  1KA1 A;  3Q8G A;  4B08 A;  3VK8 A;  1O63 A;  2ZZV A;  2I58 A;  3OO6 A;  2Q9T A;  1NV0 A;  2XXU A;  3FZV A;  2Z4S A;  5EP2 A;  2RC9 A;  5TP9 A;  3FAT A;  4PAK A;  4JI6 M;  1IQP A;  1USY E;  3VDP A;  2K47 A;  4MFI A;  5EP4 A;  1Y1M A;  4OXV A;  1MPC A;  4P0I A;  3SET A;  1L8Q A;  1FQC A;  1P3Q Q;  2DE2 A;  2UXD M;  5KPR A;  2F34 A;  1OVB A;  5TPA B;  4QFP A;  2RF1 A;  4QNM A;  4KLN A;  2ABH A;  1IMD A;  1MXV A;  1P99 A;  4CIZ A;  1W5S A;  2B4M A;  4LCB A;  1SD3 A;  1D4N A;  1XWI A;  1SI0 A;  2C9C A;  4PAF A;  1IMB A;  2XF3 A;  4O3A A;  1FPI A;  3FV1 A;  3ODB A;  2V6Z M;  3KJT A;  1B32 A;  2QVR A;  1L2B A;  4JI8 M;  3SAU A;  4P17 A;  1V34 A;  4OES A;  3T9X B;  3VXB A;  4LJ7 A;  1OJL A;  2MKZ A;  2H9B A;  1FPE A;  3GRY A;  2PFY A;  4DIG A;  1XVX A;  3V83 A;  5CMB A;  1UTH A;  3EHT A;  2Z4R A;  1GVC A;  4IO2 A;  5FTH A;  5F3W A;  3RY3 A;  1VR5 A;  4IBF A;  1QQW A;  3KXE C;  3K1N A;  2O5R A;  3KN7 A;  1B0H A;  1XNR M;  2O69 A;  1VEG A;  4NQ8 A;  3SAS A;  4FWD A;  3GQ5 A;  1MY1 A;  3T38 A;  1EE8 A;  5BPV A;  1AMF A;  3U94 A;  4WXJ A;  4X9T A;  4DV6 M;  1QUK A;  2FOI C;  3KOZ E;  3OEK A;  5A5X B;  4PD2 A;  4LZZ A;  1MXU A;  3GYY A;  3TUS A;  1INP A;  4X04 A;  3MZ1 A;  3HV1 A;  4EQB A;  2Y5L A;  3B89 A;  1IXS B;  3LQR A;  4QFK A;  3BFT A;  3G3G A;  3O29 A;  2HHM A;  4XTC Q;  2QS3 A;  5CBS A;  4EF1 A;  2DWN A;  2REJ A;  3K6X A;  3K6V A;  4RF0 A;  3N6U A;  1N76 A;  5KDT A;  3HHG A;  5FBP A;  1N32 M;  2I7N A;  1M5C A;  1MPB A;  4Y28 F;  1NH8 A;  1POY 1;  4JWY A;  2GQF A;  2UUC M;  4IB2 A;  1E9R A;  2NOO A;  2JP7 A;  3QWL A;  2DVZ A;  3TL4 X;  4LRS A;  2EA0 A;  1BKA A;  2O68 A;  1TH4 A;  5ITP A;  3AOG A;  1PJJ A;  1R2Z A;  5DVI A;  4KD5 A;  2O25 A;  3U72 A;  5FTM A;  2ZZX A;  3IK6 B;  4PE3 A;  2R18 A;  5AA4 A;  1M5D A;  1HT1 E;  2DHY A;  3KOT A;  4KT0 F;  2HCB A;  1NY6 A;  1DSN A;  4ZEF A;  4EXK A;  4XF5 A;  4H8I A;  3U6L A;  2ZYO A;  3IG5 A;  4G2Z A;  4G8N A;  1G8P A;  5JEI A;  3TTL A;  4DE8 A;  4MAG A;  2Q88 A;  4I3Y A;  3W9W A;  2GNO A;  4QSC A;  4PFY A;  3AXF A;  4KO8 A;  4JB7 A;  4PCD A;  5TP9 B;  4QSE A;  1SW1 A;  4MIJ A;  5FSW A;  3TDJ A;  3CRB A;  3FKE A;  1ORY B;  3H4J A;  3TYH A;  3VLW A;  3D8L A;  1DPP A;  3OMB A;  2L7I A;  5JI2 E;  1OQH A;  3O2A A;  4DR1 M;  3EPE A;  2K0B X;  3GLH E;  1US5 A;  4LJ6 A;  2KRU A;  4MH5 A;  5I57 A;  1NUW A;  3W68 A;  4JDF A;  3KZG A;  4IBB A;  3TEL A;  2C96 A;  4KYD A;  3DEL B;  4ZEC A;  4DR2 M;  1WJ7 A;  3SMS A;  4JWO A;  3MP8 A;  1R6Z A;  3W0F A;  3ZQJ A;  2CV0 A;  3L2A A;  1MS7 A;  1O64 A;  2A5T A;  4KFQ A;  3D8B A;  5ITO A;  4YKK A;  4AG5 A;  3IOV A;  3G3I A;  4DV5 M;  5AA4 B;  5EQA A;  2FE8 A;  1KA0 A;  1MXW A;  3UJN A;  5EXT A;  5B70 A;  4U2R A;  4N15 A;  1YTV A;  2QQ8 A;  4EUO A;  3M6A A;  1QYR A;  2YFQ A;  3DP8 A;  5FTI A;  2DWL A;  1ZIU A;  2WSF F;  1XXH B;  5JI3 E;  1IXC A;  3OO8 A;  4R9G A;  1B40 A;  2CZL A;  3RGY A;  2F4V M;  1Z7N E;  4M9X A;  3CIJ A;  4KPT A;  3HKP A;  2L4F A;  4GL8 A;  3AJI B;  1FQE A;  5DYH A;  1OQY A;  2E0S A;  2QFL A;  2UVI A;  3DLN A;  3GLH B;  1JW4 A;  4FWH A;  3MVZ A;  4XKR A;  3OO9 A;  3IL1 B;  4GHL A;  4POW A;  2Y0T A;  1MQH A;  4ND9 A;  4DXB A;  5J1D A;  3T66 A;  3ZS6 A;  4HS7 A;  1GLN A;  1IBK M;  4GWS A;  4HL4 A;  1D3K A;  4DV0 M;  1SXJ D;  3GLF E;  4NC6 A;  3I4V A;  5IZ7 D;  1FPF A;  4F2Q A;  2HZK A;  1WXQ A;  1NNT A;  1ZBM A;  4ZDM A;  1JEV A;  4CGY B;  4M1V A;  1B6H A;  3THI A;  2RKM A;  3SAV A;  1GJT A;  2XXK A;  1Y3Q A;  2ESN A;  4KYE A;  1N04 A;  2Z7J A;  4D81 A;  4F29 A;  1SXJ B;  3U1O A;  2HFB A;  3VDF A;  2XFT A;  3MP1 A;  3QAX A;  4OW0 A;  1DBZ A;  4GQO A;  3PUX E;  4EIW A;  1LAF E;  3EF7 A;  3CF0 A;  1YSY A;  2DP8 A;  2CV2 A;  3MPK A;  3BBR A;  4OFL A;  1NV1 A;  3PV0 E;  2O1M A;  4QBA A;  3R8F A;  4QOS A;  1QAO A;  1MXY A;  3MQ9 A;  1QDR A;  1C1K A;  4AG6 A;  4MM3 B;  4RYA A;  1DGF A;  2PX1 A;  2VGQ A;  2CZH A;  1NVM A;  2QVU A;  1E9S A;  3K02 A;  1H3D A;  4AQ4 A;  4JYA M;  1Y4T A;  1N84 A;  3MJN A;  3K1J A;  5ET7 A;  1BLF A;  2R44 A;  3V76 A;  4MX6 A;  1M5E A;  3U6M A;  2XZF A;  2DXR A;  4G4O A;  2XH9 A;  2UUA M;  3FGS A;  4LUB A;  3FUU A;  4G61 A;  3IR1 A;  1CE2 A;  5DYG A;  4PP0 A;  1FRP A;  5IZ3 B;  3SZP A;  3KC0 A;  3SEX A;  2KNA A;  3CF6 E;  4MGZ E;  1RYX A;  5AA3 A;  3U6D A;  3PUY E;  1QDT A;  3M3F A;  4JVD A;  4P3L A;  2I4B A;  4P11 A;  3LSW A;  2OCU A;  1LFH A;  1G71 A;  1JP4 A;  3O6H A;  1MDQ A;  5AE4 A;  3C35 A;  4K3F A;  3IO4 A;  3FUW A;  2L4E A;  1N3X A;  3LVV A;  1US4 A;  4NF0 A;  3FYC A;  1P1Q A;  4QHT A;  8CAT A;  3EN3 A;  4GMQ A;  4P8B A;  3FVO A;  1T6O A;  1T0K A;  3SAW A;  1BK4 A;  3KBZ A;  1N77 A;  1EU8 A;  2JZ1 A;  1S50 A;  2DSF A;  2KZU A;  1A5T A;  2XXH A;  1J1N A;  1HQY E;  4YB6 A;  4YKP A;  4GL0 A;  4YB5 A;  3ZCB B;  1Y8G A;  4G68 A;  3M8U A;  5E6J A;  1NSF A;  5IGA A;  3J27 B;  3GPY A;  1PB7 A;  2GQ1 A;  2CUZ A;  3KS4 A;  4LZ7 A;  4ZS9 A;  4Z0I A;  1V33 A;  4CJ6 A;  4KOD A;  2K6B A;  3SYL A;  4PFW A;  5DT6 A;  5EXX A;  4FED A;  3K4U A;  4KXP A;  1DMB A;  4BDR A;  2G8L A;  1SYH A;  1UTH B;  3GLI A;  4OVR A;  1DGH A;  3WAE A;  4X64 M;  3B7D A;  3C33 A;  5IKB A;  3QYE A;  4OMB A;  1FPB A;  1Y4C A;  4ELO A;  4X8R A;  4FCT A;  2X26 A;  1EIJ A;  3ZC7 B;  2F3D A;  3T9V A;  5GKN A;  5I58 B;  2FNA A;  4LZJ A;  5KPT A;  3KGC A;  3D4C A;  3RPW A;  2BWE A;  3IAZ A;  3K6U A;  2HQ0 A;  1ZV1 A;  1K3X A;  3G7W A;  3Q29 A;  4ECF A;  2KXE A;  1QUL A;  3O9P A;  4O7I A;  3AOE A;  3U93 A;  4L17 A;  2MJ5 B;  4AKG A;  2XSZ D;  4RNA A;  1SXJ E;  3IFA A;  3U61 B;  2R6G E;  2OJT A;  5ET6 A;  1OIB A;  4L16 A;  3Q25 A;  1FBP A;  3ILU B;  2R71 A;  1AOV A;  4AKI A;  1SVX B; 
#chains in the Genus database with same CATH homology
 3NBI A;  1TDH A;  1N7W A;  1JQJ C;  2O51 A;  4LQ5 A;  5A5X A;  4GHA A;  1IN4 A;  3U60 A;  3LSX A;  3M3K A;  3SEY A;  5I2K A;  4NF6 B;  4G4Q A;  2HHH M;  2Y7W A;  4S12 A;  1JEU A;  1LAG E;  1QZM A;  4H5G A;  2M5Z A;  4BDL A;  1BP5 A;  1UTB B;  5EHM A;  3AV0 A;  1SW4 A;  2FYI A;  3K6W A;  3TZA A;  3KOX E;  1TFA A;  2PBW A;  4C1T A;  1E94 E;  4JXJ A;  3GLG B;  3TPA A;  3UZU A;  4I5S A;  1TDZ A;  4QFO A;  3MAM A;  4LF7 M;  4U4X A;  2F78 A;  1YAE A;  4ZPX A;  2D3I A;  3TCG A;  2I0C A;  4IBG A;  3O6G A;  1BIY A;  2UYE A;  1FQD A;  3M7G A;  1HNX M;  4HTG A;  4DCY A;  4WEP A;  2OBG A;  1NHG C;  1P1U A;  3PGF A;  3LMM A;  4OWD A;  3U6C A;  1VSO A;  4JI0 M;  1URS A;  4BBA A;  3J7B A;  2XHD A;  1IUD A;  4NF4 B;  3C31 A;  2OWS A;  2F97 A;  3RTW B;  1P1O A;  3OO7 A;  4DR5 M;  1RYO A;  3RT6 B;  4R9F A;  3GBA A;  4LQ2 A;  1IIW A;  2DVC A;  4DV7 M;  1Y20 A;  3QUJ A;  1XHB A;  1IN7 A;  3E9S A;  3SEW A;  4GVO A;  4FEB A;  1GGG A;  3W15 C;  1XVY A;  4NSR A;  3FXR A;  1NNP A;  2Y84 A;  1A8F A;  1NNF A;  4X65 M;  1LGB C;  1SW2 A;  4GF8 A;  2UYF A;  2REG A;  4RF1 A;  4LGM A;  1I69 A;  4LF9 M;  5H8H B;  4KCC A;  3HJQ A;  1ZQ9 A;  3N5L A;  5CRY A;  1HR0 M;  4U1Z A;  4I62 A;  2J7N A;  2DWJ A;  2UXC M;  3AFH A;  3HWS A;  5CI5 A;  3TTN A;  1N7X A;  4NL4 H;  4R7G A;  5AA2 B;  2G5G X;  4OVZ A;  2DE4 A;  1Y3N A;  5CMM A;  1L1Z A;  4IY6 A;  3Q8X A;  1N3W A;  1S9T A;  1LB8 A;  1XT8 A;  4PE5 B;  3IJO B;  5JK4 A;  1NNU C;  4DLD A;  4LY6 A;  1FTM A;  1B58 A;  5C18 A;  2C9O A;  4KYS A;  2M60 A;  1VDD A;  2LNH C;  3TWL A;  4G8H A;  5E26 A;  4KI0 E;  1B3H A;  2XFS A;  2L7H A;  2A5T B;  1UQW A;  4NF6 A;  1JW5 A;  4NF8 B;  4FAT A;  3L26 A;  4GRK A;  1M5B A;  5EQT A;  4LFB M;  4FD2 A;  3SC3 A;  3E4R A;  3LUY A;  2Q2E B;  2V1C A;  2ZNS A;  1GKI A;  3RT8 A;  3U5Z B;  4YU0 A;  3DP4 A;  4XKQ A;  2QZ4 A;  2KEB A;  2ZYN A;  3EQ1 A;  4E0X A;  3GLF A;  3TQS A;  3PD8 A;  3CFZ A;  4DCX A;  5DVJ A;  2HAU A;  3MPL A;  4JI7 M;  3PUW E;  2Y7K A;  2E1S A;  3L28 A;  1PDA A;  3GPP A;  1MXZ A;  4F1V A;  4XBO A;  4DR7 M;  4IGR A;  4E0W A;  4NTL A;  3K0V A;  1N78 A;  2P1S A;  1FNN A;  3FUT A;  1QVS A;  4D82 A;  3GBB A;  1HNW M;  3PMV A;  2H25 A;  3N26 A;  1A99 A;  4X48 A;  4RNS A;  2OLB A;  5DYI A;  5CMK A;  2I0B A;  4XGI A;  4F3G A;  3PUV E;  3IB1 A;  2LH0 A;  2L6O A;  1ZLQ A;  1FQB A;  2QPQ A;  2C5R A;  4F3B A;  3UOR A;  1B51 A;  1TGU A;  1P1N A;  3PUZ E;  3MBP A;  3OSQ A;  3FXQ A;  5EXP A;  2D7H A;  1GR2 A;  4YY3 M;  3KW6 A;  2JA2 A;  3CG3 A;  2G29 A;  3VLV A;  5I56 B;  2O6A A;  2AL5 A;  3GPX A;  3CFX A;  3MK6 A;  4Q30 B;  2RKO A;  1Q1K A;  4LJ8 A;  3C4M A;  2CV1 A;  4OQO A;  4H0W A;  2DWI A;  1O7T A;  2UXA A;  2I3V A;  4MF3 A;  3LSL A;  5ITU A;  4C0R A;  2F5Q A;  3FTF A;  4F1U A;  3C9H A;  4YHH M;  3TCF A;  2HKJ A;  1MY0 A;  2VII A;  2W7Y A;  4LON B;  2QP9 X;  2NWJ A;  4LRT A;  1PB9 A;  3G3F A;  5H8F B;  1A7L A;  4A3V B;  2F7B A;  2J7O A;  3DP6 A;  3Q27 A;  1IY1 A;  4LFA M;  1USY H;  5I59 A;  3DZD A;  2BJV A;  4Z7E A;  5K2X A;  2QL3 A;  4KHZ E;  1MQJ A;  4EDP A;  1OQG A;  2XXI A;  3QUF A;  1N36 M;  1QW0 A;  3L29 A;  1EH3 A;  5JTY A;  2IEE A;  3JR4 A;  5ITQ A;  4U22 A;  3BOS A;  1EZO A;  1IBL M;  2AHM A;  5EXS A;  3U8Q A;  1Q39 A;  2CHQ A;  3VVF A;  2DZN B;  3CFL A;  5ITX A;  3J2P B;  3WAF A;  3WHL A;  3HU1 A;  1JVY A;  3KEI A;  3O28 A;  4ZEI A;  4YMB A;  2XLJ A;  3TQW A;  4DXC A;  4C1U A;  2DWM A;  1Y9U A;  2YJP A;  3TTK A;  1VFD A;  3OSR A;  3THG A;  1IEJ A;  3PFI A;  3RTF B;  3GLG A;  1FJG M;  1B4H A;  1IXG A;  2DOJ A;  3R26 A;  5AA1 A;  3FVK A;  4U1O A;  1DGB A;  2R65 A;  4NRV A;  4RPO A;  3K2D A;  3T93 B;  2RGH A;  2R62 A;  3QYT A;  4ELP A;  5I59 B;  1JET A;  3U61 A;  4RPN A;  3KP1 E;  3ILK A;  2XD3 A;  3QAU A;  3A09 A;  3MHV C;  1HSL A;  4QHQ A;  1S3S A;  4KHP M;  2RGO A;  1OFI A;  1Z5B A;  3FJM A;  3RNN A;  1I4W A;  3PU5 A;  2V25 A;  4PT5 A;  1B5I A;  2R46 A;  2ONS A;  5DEX B;  4F39 A;  1AL3 A;  3TOD A;  2D21 A;  4GIP A;  3GXA A;  5CBR A;  1DGH B;  4OHN A;  1NNJ A;  2I49 A;  5ITY A;  5L9S A;  4WUR A;  4NF5 B;  5L9O A;  4GKJ M;  4G6Z A;  2Z8D A;  3DA1 A;  1X37 A;  3H03 A;  4F2O A;  3B6T A;  3K00 A;  4G68 B;  4O3C A;  2CE7 A;  4L15 A;  1TFD A;  2R45 A;  4G68 C;  5HPQ A;  4DV3 M;  4BB9 A;  3UIF A;  3T15 A;  4DXU A;  5EP3 A;  4YIC A;  2F7A A;  4NWD A;  1YCJ A;  1JNF A;  1OLA A;  4AKH A;  3MJ5 A;  1NY5 A;  2VQE M;  4B3M M;  4Q5T A;  4LJ4 A;  2RCA A;  4MBP A;  4MH0 E;  4I81 A;  2M8C A;  3KS8 A;  2B3B A;  5H8H A;  4IGT A;  1PC3 A;  2V84 A;  1I6A A;  5I56 A;  1B05 A;  2ONR A;  1MX0 A;  3LQQ A;  1FTL A;  4GOT A;  3KFU G;  2QSX A;  1B46 A;  3L25 A;  3AKZ A;  4GXS B;  1G3I A;  4YKI A;  3SAT A;  3ZKK A;  4L4U A;  1I6B A;  3BFU A;  3OD7 A;  2XX7 A;  3IOU A;  3IJX B;  3UA8 A;  1WOD A;  4NSO B;  3DM0 A;  1H76 A;  3CSG A;  2I6E A;  3CI8 A;  1XC8 A;  5CMC A;  4U4S A;  4JV5 M;  3HHY A;  2P5T A;  1YPN A;  3VDU A;  5H8N A;  3NWL A;  3SBJ A;  1NHW C;  2O7I A;  3PPQ A;  4X1B A;  4OEU A;  4G4R A;  2ZAM A;  2QMX A;  2HL7 A;  3V89 B;  1QAQ A;  2F6P A;  4LF4 M;  5I57 B;  1Z5C A;  4DV1 M;  3A3C A;  2E5L M;  2X49 A;  1S7Y A;  5TPA A;  5FLX S;  2XSZ A;  3JR5 A;  1PJI A;  2ANJ A;  1DOT A;  5FTL A;  5DNY A;  2A5S A;  3G3K A;  2H4I A;  4OER A;  3J7A S;  2F8D A;  1ATG A;  2Y21 A;  1SBP A;  4B3R M;  2FFJ A;  2YNM D;  1QUI A;  1SDX A;  3KN3 A;  5KQ8 A;  1K82 A;  2LWX A;  5C1B A;  4B3S M;  4GRI A;  1B5J A;  4WKM A;  3I5O A;  4FIM A;  3A45 A;  5I58 B;  4ISU A;  1ANF A;  1RKM A;  4DUY M;  3OOA A;  5CM6 A;  3GLI B;  4EXL A;  4NF5 A;  2HXW A;  4EQ7 A;  2QCU A;  2PYY A;  2UU9 M;  4G4N A;  4PQJ A;  1J5E M;  3ZKL A;  3GLH A;  3HGI A;  1D9Y A;  2H1R A;  1Y1Z A;  3SKP A;  4F19 A;  3PPR A;  5CC2 A;  1H45 A;  4N07 A;  3IOR A;  4QFL A;  2YLN A;  1MQI A;  1ZJL A;  4QRZ A;  1N33 M;  5H8Q A;  3IO6 A;  1NJG A;  4ZEB A;  2Q8J A;  1A54 A;  3B6W A;  4GWO A;  3UK4 A;  3U6O A;  3T96 B;  2CEA A;  3JYR A;  2RCB A;  4IBJ A;  4I9D A;  1DO0 A;  1H44 A;  3TPZ A;  3F11 A;  4R73 A;  3V5A A;  3FTE A;  1ZTY A;  1SXJ C;  3PXG A;  5I2N B;  1ZMG A;  2CMO A;  2O1L A;  1IXI A;  3L6H A;  2QEN A;  2NQ8 C;  2PT2 A;  3UMM A;  5DVF A;  3H4Z A;  1XS5 A;  2X4A A;  4THI A;  3SYK A;  3C34 A;  4ELR A;  4REZ A;  2OK2 A;  3SMP A;  5DEX A;  3FAS A;  3PPP A;  1H6U A;  3U5Z A;  1PEB A;  2Q89 A;  4LJ9 A;  1IY2 A;  3I6V A;  5FHO A;  3KOY E;  2QMW A;  3EIH A;  3E13 X;  4OZ9 A;  3RN8 A;  5H8N B;  5FHM A;  3H3G A;  2XD2 A;  4DR6 M;  2ZYK A;  2B3F A;  2Y20 A;  3ECR A;  2Z23 A;  1R6B X;  4JI4 M;  5H37 D;  4DUZ M;  3HHF A;  1B52 A;  3TCH A;  4LF8 M;  2RC8 A;  4FWG A;  4QOZ C;  1JVX A;  3P7I A;  1H43 A;  3PMX A;  4U21 A;  3U6P A;  3B6Q A;  4MB7 A;  2A5Y B;  1MPD A;  1MXX A;  3PD9 A;  1ZU0 A;  4M0D A;  1ZKB A;  2UVJ A;  4ITQ A;  4K0K M;  3T1Y M;  4IJE A;  2GRV A;  5ICT A;  4ONY A;  3I3V A;  3VFD A;  4FCV A;  3VKH A;  3KG2 A;  2V3U A;  4JWX A;  3GLF B;  4OFO A;  2W82 A;  3CF2 A;  1LAH E;  2UUB M;  2GFE A;  1PB8 A;  4Z8X A;  4LP2 B;  3IOT A;  4N13 A;  1L5T A;  4HCW A;  1J7K A;  4R75 A;  4RK2 A;  1LFG A;  4JN6 A;  5I84 A;  1A55 A;  1SYI A;  3D4G A;  1OLC A;  1MQD A;  5FTK A;  4AB6 A;  2F5O A;  1NJF A;  2X8A A;  3FTC A;  4X66 M;  1PBQ A;  5L9M A;  2ZNU A;  5ITX E;  4FOR A;  1SW5 A;  3MC2 A;  2D7E A;  3IB0 A;  4KQP A;  2HCA A;  4BDM A;  3FYD A;  3U6Q A;  3HU2 A;  4F31 B;  3EHS A;  1FQF A;  3KP0 E;  1POT A;  5LMU M;  3A42 A;  5EYF A;  2ZMB A;  5A2Q S;  1FCK A;  4OVZ B;  3N94 A;  4OET A;  4X62 M;  4R6Y A;  3TE6 A;  2XXR A;  4FEC A;  4X1D A;  3QK6 A;  3OEM A;  2EO2 A;  3IX1 A;  1B7Z A;  3U6S A;  2PT1 A;  1TT1 A;  3HU3 A;  2ZAO A;  1IXZ A;  4IY5 A;  2QS1 A;  4DV4 M;  3OEN A;  4B7F A;  4CHT B;  1II5 A;  1MY2 A;  3MVX A;  2ERC A;  4PFT A;  4DZ1 A;  5LMN M;  1ELJ A;  2YR0 A;  1IZ1 A;  3I4Y A;  4OU7 A;  1B1X A;  4FJP A;  4R6H A;  3W9V A;  4R3D A;  1T3T A;  4IBD A;  2VD3 A;  4HLQ A;  3SFZ A;  1MG1 A;  2EUC A;  4AB5 A;  5I58 A;  5ICQ A;  3GQ4 A;  2XEP A;  4IBE A;  3S9M C;  3C58 A;  1XC1 A;  4Z6Y A;  2DXY A;  3S4U A;  4BLC A;  4KCD A;  4MGK E;  4U23 A;  4N6P A;  5JTY B;  4KR5 A;  1UIV A;  3TWM A;  2NVU B;  1Z5A A;  1MY4 A;  1R9Q A;  4GLI A;  2HZL A;  4R72 A;  3S9E A;  2KA6 B;  3H6W A;  2ZM6 M;  2O84 X;  5HM4 B;  4B7H A;  1B7H A;  1IXR C;  4NED A;  3EHU A;  3B9P A;  2QS4 A;  4OX9 M;  2DHR A;  4LA9 A;  2OPF A;  3QSL A;  2OQ4 A;  3U60 B;  2Z8E A;  1GL7 A;  3TWK A;  4JI1 M;  3FIR A;  1KYI A;  5M2V A;  2DWH A;  2Z22 A;  4I1D A;  3FJ7 A;  3ZH9 B;  4TLL B;  3RGS A;  2ZNT A;  3PVS A;  2OZZ A;  2V93 A;  4DR4 M;  1G41 A;  2WKY A;  3KBR A;  2KRK A;  2DYX A;  3QIM A;  3WHK A;  2G93 A;  4NWC A;  3TTM A;  4B3T M;  1DPE A;  2XX8 A;  5KCJ B;  1NKX A;  3GZG A;  4ZEK A;  4RK9 A;  3K1M A;  2C99 A;  4YZZ A;  1M5F A;  4WW0 A;  1TH3 A;  3VK7 A;  3CTW B;  2XZU A;  5ITR A;  1KWH A;  2I48 A;  2VOZ A;  2Y7P A;  2F35 A;  5LOM A;  4L8R C;  4JI2 M;  1URG A;  1UM8 A;  1HSJ A;  1Z6T A;  3N6T A;  4Q8R A;  4ZE8 A;  1JR3 A;  3SER A;  4NE4 A;  3T22 A;  1MDP 1;  1FW0 A;  3MZ9 A;  3IOW A;  4PFU A;  4II7 A;  4R2F A;  3T9H B;  4H6D A;  4YMA A;  3E3K A;  3H6V A;  3RFW A;  1QVR A;  4PCZ A;  3TTR A;  4MGH A;  2ONK E;  3K2L A;  2DS9 A;  4POX A;  2BNK A;  4IO6 A;  4QFN A;  1GV8 A;  2HEU A;  1WVJ A;  3MVY A;  1XXH A;  2ZBK B;  4BDQ A;  4OEN A;  2F7C A;  1N34 M;  4RXL A;  3MP6 A;  3U6E A;  1F9B A;  5TU0 A;  4ESW A;  4BDN A;  1FTJ A;  5AA2 D;  4GIZ A;  1W5T A;  4F1Y A;  1HQC A;  4AW4 A;  4AI6 A;  3K1P A;  3HHX A;  2DWA A;  5DTB A;  3E9X A;  3U92 A;  3A3U A;  1LBB A;  1MQG A;  1LFI A;  4O3B A;  3S2V A;  1OVT A;  4FCW A;  4GXA A;  2NXO A;  2QPA A;  2RIN A;  3HCQ A;  2C98 A;  1QAN A;  3K8Z A;  1IBM M;  2Y7R A;  4G8M A;  1AH5 A;  2QRY A;  5L8D A;  1LAX A;  4M9Z A;  1DTZ A;  2BJW A;  1MM7 A;  1GVN A;  2F5S A;  2F6G A;  1DTG A;  1AIV A;  3KN8 A;  4F22 A;  3O97 A;  2GHA A;  2UVG A;  3ONM A;  1GL6 A;  2DVW B;  4G77 A;  3K92 A;  3W0L B;  4LVQ A;  5IAI A;  2OWT A;  4H67 A;  3J80 S;  1HT2 E;  3PNY A;  4IO4 A;  2O7U A;  1LBC A;  4IBK A;  3FV2 A;  3GPU A;  2B65 A;  2F5P A;  4FW9 A;  3HHW A;  3USD A;  4NXM M;  3G3H A;  1QJM A;  4LZ5 A;  3KFM A;  3VFJ A;  4YB7 A;  2YPN A;  1HSE A;  3LBS A;  1B1H A;  1MH4 A;  5KDT B;  1B0L A;  4F18 A;  1IY0 A;  1QUJ A;  3S9L C;  4XKP A;  4HCY A;  1B2H A;  2R4J A;  3PNV A;  1YUB A;  5H8Q B;  2V3T A;  4I8O A;  4LF5 M;  2D5W A;  3IB2 A;  4EQ9 A;  3J81 S;  4P0G A;  1GTK A;  2DXI A;  3H6U A;  3DOA A;  3HHZ A;  4IO5 A;  4IO7 A;  4LFC M;  1QKA A;  4ZZA A;  1IXH A;  2QJE A;  4NOO B;  3GO8 A;  3GP1 A;  1B4Z A;  3KOS A;  3LSF B;  2XXQ A;  4ESX A;  3IG8 A;  1MH3 A;  5KQD A;  2HAV A;  3Q26 A;  1D9V A;  3FTD A;  3C32 A;  4RY1 A;  1DGG A;  3TKD A;  3GRU A;  4XKN A;  3FUX A;  2QS2 A;  1UIU A;  3BKI B;  1FQA A;  1Z59 A;  3UN6 A;  4WED A;  3CVG A;  3UK6 A;  1XNQ M;  3SAR A;  2DZO B;  4IBI A;  2FA7 A;  3SEV A;  2DWZ B;  4NMY A;  2DE3 A;  5H8F A;  2IA4 A;  1CB6 A;  3FD9 A;  4M4G A;  5ITT A;  1G4A E;  4M9S A;  2YQZ A;  2UXB M;  2V3Q A;  4PDG A;  1XOC A;  1TXF A;  5BUU A;  3AOE C;  5B7D A;  5F1Q A;  4LJA A;  1IN6 A;  5BWJ A;  4QF9 A;  3H6T A;  1Y3P A;  4ZZE A;  1IN8 A;  3T1H M;  3FVG A;  4JBZ A;  4ELQ A;  5HBC A;  2KZS A;  1J09 A;  3CG1 A;  3MW0 A;  5I2K B;  3SES A;  2AYS A;  4NXN M;  3RGP A;  3HPI A;  3K01 A;  1ZAE A;  4OTE A;  4QSD A;  3PMW A;  1OFH A;  4JI3 M;  2XGN A;  1WDN A;  4GH9 A;  1A8E A;  4W5W A;  4GC9 A;  3KVW A;  4I8C A;  3OXN A;  3UP9 A;  3G3J A;  1NMU A;  2THI A;  3V8X B;  1TWY A;  3RLF E;  1YE9 A;  3JAM S;  2QBY A;  2Q2A A;  4IIW A;  1VFE A;  3M3L A;  2LAO A;  4PDI A;  1R7R A;  3TEP A;  2X7P A;  3R6U A;  1KSF X;  1SQY A;  2FNC A;  3FUZ A;  1EZ9 A;  3SHG B;  3PPO A;  3KDS E;  3VV5 A;  1R9L A;  4FE8 A;  3TMG A;  5IWA M;  2ZXT A;  2GHB A;  4G4P A;  2I4C A;  4F3P A;  2I3W A;  3AL0 C;  4GKK M;  3SEU A;  3KOW E;  1B3E A;  1MM6 A;  3Q28 A;  3R9X B;  4RA1 A;  2Z3X A;  3ILT B;  4UAC A;  4HW8 A;  3LC8 A;  2XXT A;  3RQT A;  3I51 A;  4LAT A;  1NNK A;  4M0W A;  5IRE B;  3MVW A;  2D7G A;  1Q3B A;  4FVM A;  2UVH A;  4MLV A;  4OVJ A;  1N0T A;  4Q0C A;  4YAH X;  1OMP A;  2KLF A;  4H5F A;  1L2D A;  4IBC A;  3M0E A;  1PBP A;  2AIX A;  2ZYM A;  2F36 A;  1N75 A;  5FTJ A;  1URD A;  4IJF A;  2XXV A;  2F5X A;  5KPZ A;  2RC7 A;  7CAT A;  3GQ3 A;  2X7Q A;  3O66 A;  1TH2 A;  1XMO M;  3OTO M;  4QNR A;  1VE4 A;  3A98 B;  2R4E A;  4XIG Q;  2NUV A;  1B7U A;  3FJG A;  1P1W A;  3HST A;  1LLS A;  2CHV A;  3SHF A;  3OEL A;  3VXC A;  2BJJ X;  2CHG A;  5ELV A;  1SI1 A;  4DDD A;  1PM5 A;  1FTO A;  1Q35 A;  3VE1 B;  5EJC A;  2H5Y A;  3L6G A;  3LR1 A;  3C36 A;  2CFO A;  4I4L A;  4JSO A;  3GRR A;  1D2N A;  1BTJ A;  4TQU Q;  4NF4 A;  4NF8 A;  3TFL A;  1G59 A;  4F3S A;  1XHY A;  3HN0 A;  2Y7I A;  1Z7M E;  4R6K A;  1NH7 A;  3RE8 A;  1NFT A;  3L27 A;  2I7P A;  1UTB A;  3EIE A;  3FVN A;  3H4M A;  4D80 A;  4MGY E;  3T9U A;  1SXJ A;  3A46 A;  3KJ7 A;  3UGJ A;  5I2N A;  1R1N A;  3RUM A;  2R9J A;  4LJ5 A;  4NRW A;  2XXW A;  4H65 A;  5IT9 S;  2KW0 A;  4LF6 M;  1EZP A;  1JW1 A;  2Z8F A;  1B3G A;  4B7G A;  4GFR A;  4MGI E;  2H98 A;  3MZB A;  3HO7 A;  4L78 A;  2Q2C A;  1KFV A;  5KZT A;  4RJZ A;  5AA2 A;  2H99 A;  4GIT A;  4ZED A;  2XXX A;  4FAJ A;  1A40 A;  4ZE9 A;  3PPN A;  3FUV A;  4LGY A;  4OYV A;  2GH9 A;  3MWB A;  2ALU A;  4IO3 A;  5FTN A;  1NL5 A;  4JSD A;  5FHN A;  3TAJ A;  1LCT A;  4TLM B;  3O6I A;  2XX9 A;  3S9N C;  3H7M A;  3H06 B;  3KSX A;  4P16 A;  3HJS A;  5F7V A;  4GD5 A;  3SDF A;  3GLB A;  3JV9 A;  3QXM A;  3UGW A;  1MRP A;  4TUW A;  4R74 A;  2XXP A;  1I94 M;  4BLA A;  1B3L A;  1FTK A;  1IIT A;  1DO2 A;  4DV2 M;  1L2C A;  3CSB A;  2VD2 A;  3VVE A;  1Q3C A;  4LG2 A;  4OFJ A;  4OEV A;  4XXU A;  4DR3 M;  4MLQ A;  4EF2 A;  2VP1 A;  1QKB A;  2XXY A;  1K3W A;  3R7X A;  4R2B A;  1I6Q A;  2VHA A;  2AL4 A;  4LZ8 A;  4AQY M;  3LVW A;  4GC5 A;  4CIS A;  1MY3 A;  1IN5 A;  4JI5 M;  1B3F A;  4BDO A;  4PET A;  3FD3 A;  1MU5 A;  2Y0Q A;  1R2Y A;  3MUQ A;  3CR9 A;  1IQ7 A;  5H8S A;  3JZJ A;  1B5H A;  3VLF B;  1LV7 A;  1JQF A;  5K2Y A;  4QHS A;  3DFZ A;  3HJ8 A;  4YKJ A;  3VVD A;  3GRV A;  1E32 A;  3ZSF A;  2PVU A;  1HNZ M;  1B9J A;  3FXU A;  5EP1 A;  4H1X A;  2LXE A;  4TOZ A;  5KO3 A;  1XMQ M;  2V1U A;  1JR3 D;  5BR8 M;  5EHS A;  5KCJ A;  2F5N A;  2L09 A;  4AZF A;  1IM2 A;  3TQL A;  5ISU A;  2P0S A;  3KSJ A;  3VLU A;  2PMS A;  2DQV A;  1LB9 A;  1L1T A;  1LST A;  1QAM A;  4JXI A;  4UA8 A;  2QBY B;  2VQF M;  3VKG A;  2P2A A;  1LCF A;  4H8J A;  2ZAN A;  4B08 A;  3VK8 A;  1O63 A;  2I58 A;  3OO6 A;  2Q9T A;  2XXU A;  3FZV A;  2Z4S A;  5EP2 A;  2RC9 A;  5TP9 A;  3FAT A;  4JI6 M;  1IQP A;  1USY E;  3VDP A;  2K47 A;  4MFI A;  5EP4 A;  1Y1M A;  4OXV A;  1MPC A;  4P0I A;  3SET A;  1L8Q A;  1FQC A;  2DE2 A;  2UXD M;  5KPR A;  2F34 A;  1OVB A;  5TPA B;  4QFP A;  2RF1 A;  4QNM A;  4KLN A;  2ABH A;  1MXV A;  1P99 A;  1W5S A;  4LCB A;  1SD3 A;  1D4N A;  1XWI A;  1SI0 A;  2C9C A;  2XF3 A;  4O3A A;  3FV1 A;  3ODB A;  2V6Z M;  3KJT A;  1B32 A;  1L2B A;  4JI8 M;  3SAU A;  4OES A;  3T9X B;  3VXB A;  4LJ7 A;  1OJL A;  2H9B A;  3GRY A;  4DIG A;  1XVX A;  3V83 A;  5CMB A;  1UTH A;  3EHT A;  2Z4R A;  1GVC A;  4IO2 A;  5FTH A;  5F3W A;  3RY3 A;  1VR5 A;  4IBF A;  1QQW A;  3KXE C;  3K1N A;  2O5R A;  3KN7 A;  1B0H A;  1XNR M;  2O69 A;  3SAS A;  4FWD A;  3GQ5 A;  1MY1 A;  3T38 A;  1EE8 A;  5BPV A;  1AMF A;  3U94 A;  4WXJ A;  4X9T A;  4DV6 M;  1QUK A;  2FOI C;  3KOZ E;  3OEK A;  5A5X B;  4PD2 A;  4LZZ A;  1MXU A;  3TUS A;  3MZ1 A;  3HV1 A;  4EQB A;  1IXS B;  3LQR A;  4QFK A;  3BFT A;  3G3G A;  3O29 A;  4XTC Q;  2QS3 A;  5CBS A;  4EF1 A;  2DWN A;  2REJ A;  3K6X A;  3K6V A;  4RF0 A;  3N6U A;  1N76 A;  5KDT A;  3HHG A;  1N32 M;  2I7N A;  1M5C A;  1MPB A;  1NH8 A;  1POY 1;  4JWY A;  2UUC M;  4IB2 A;  1E9R A;  2NOO A;  3QWL A;  2DVZ A;  3TL4 X;  4LRS A;  2EA0 A;  1BKA A;  2O68 A;  1TH4 A;  5ITP A;  3AOG A;  1PJJ A;  1R2Z A;  5DVI A;  4KD5 A;  3U72 A;  5FTM A;  3IK6 B;  2R18 A;  5AA4 A;  1M5D A;  1HT1 E;  3KOT A;  2HCB A;  1NY6 A;  1DSN A;  4ZEF A;  4EXK A;  4H8I A;  3U6L A;  2ZYO A;  3IG5 A;  4G2Z A;  4G8N A;  1G8P A;  5JEI A;  3TTL A;  4DE8 A;  2Q88 A;  3W9W A;  4QSC A;  4PFY A;  3AXF A;  4KO8 A;  4JB7 A;  5TP9 B;  4QSE A;  1SW1 A;  5FSW A;  3TDJ A;  3CRB A;  3FKE A;  1ORY B;  3TYH A;  3VLW A;  3D8L A;  1DPP A;  3OMB A;  2L7I A;  5JI2 E;  1OQH A;  3O2A A;  4DR1 M;  3EPE A;  4MH5 A;  1US5 A;  4LJ6 A;  2KRU A;  5I57 A;  4JDF A;  3KZG A;  4IBB A;  3TEL A;  2C96 A;  4KYD A;  3DEL B;  4ZEC A;  4DR2 M;  3SMS A;  4JWO A;  3MP8 A;  1R6Z A;  3W0F A;  2CV0 A;  3L2A A;  1MS7 A;  1O64 A;  2A5T A;  4KFQ A;  3D8B A;  5ITO A;  4YKK A;  4AG5 A;  3IOV A;  3G3I A;  4DV5 M;  5AA4 B;  2FE8 A;  1MXW A;  3UJN A;  5EXT A;  5B70 A;  4U2R A;  1YTV A;  4EUO A;  3M6A A;  1QYR A;  2YFQ A;  3DP8 A;  5FTI A;  2DWL A;  1ZIU A;  1XXH B;  5JI3 E;  1IXC A;  3OO8 A;  4R9G A;  1B40 A;  2CZL A;  3RGY A;  2F4V M;  1Z7N E;  4M9X A;  3CIJ A;  4KPT A;  3HKP A;  4GL8 A;  3AJI B;  1FQE A;  5DYH A;  2E0S A;  2UVI A;  3DLN A;  3GLH B;  1JW4 A;  4FWH A;  3MVZ A;  4XKR A;  3OO9 A;  3IL1 B;  4GHL A;  4POW A;  2Y0T A;  1MQH A;  4ND9 A;  4DXB A;  5J1D A;  3T66 A;  3ZS6 A;  4HS7 A;  1GLN A;  1IBK M;  4HL4 A;  1D3K A;  4DV0 M;  1SXJ D;  3I4V A;  5IZ7 D;  4F2Q A;  2HZK A;  1WXQ A;  1NNT A;  1ZBM A;  4ZDM A;  1JEV A;  4CGY B;  4M1V A;  1B6H A;  3THI A;  2RKM A;  3SAV A;  1Y3Q A;  2ESN A;  4KYE A;  1N04 A;  2Z7J A;  4D81 A;  4F29 A;  1SXJ B;  3U1O A;  2HFB A;  3VDF A;  2XFT A;  3MP1 A;  3QAX A;  4OW0 A;  4GQO A;  3PUX E;  4EIW A;  1LAF E;  3EF7 A;  3CF0 A;  1YSY A;  2DP8 A;  2CV2 A;  3MPK A;  3BBR A;  4OFL A;  3PV0 E;  2O1M A;  3R8F A;  4QOS A;  1QAO A;  1MXY A;  3MQ9 A;  1C1K A;  4AG6 A;  4MM3 B;  4RYA A;  1DGF A;  2PX1 A;  2VGQ A;  1NVM A;  3K02 A;  1E9S A;  1H3D A;  4AQ4 A;  4JYA M;  1N84 A;  1Y4T A;  3MJN A;  3K1J A;  1BLF A;  1M5E A;  3U6M A;  2XZF A;  2DXR A;  4G4O A;  2XH9 A;  2UUA M;  3FGS A;  4LUB A;  3FUU A;  3IR1 A;  1CE2 A;  5DYG A;  4PP0 A;  3SEX A;  3CF6 E;  1RYX A;  4MGZ E;  5AA3 A;  3U6D A;  3PUY E;  3M3F A;  4P11 A;  2I4B A;  3LSW A;  2OCU A;  1LFH A;  3O6H A;  1MDQ A;  5AE4 A;  3C35 A;  4K3F A;  3IO4 A;  3FUW A;  1N3X A;  3LVV A;  1US4 A;  3FYC A;  1P1Q A;  4QHT A;  8CAT A;  3EN3 A;  4GMQ A;  3FVO A;  1T0K A;  3SAW A;  1N77 A;  1EU8 A;  1S50 A;  2DSF A;  2KZU A;  2XXH A;  1J1N A;  1HQY E;  4YB6 A;  4YKP A;  4GL0 A;  4YB5 A;  3ZCB B;  4G68 A;  3M8U A;  5E6J A;  1NSF A;  3J27 B;  3GPY A;  1PB7 A;  2CUZ A;  3KS4 A;  4LZ7 A;  4ZS9 A;  4Z0I A;  4KOD A;  4PFW A;  3SYL A;  5DT6 A;  5EXX A;  4FED A;  3K4U A;  1DMB A;  4BDR A;  2G8L A;  1SYH A;  1UTH B;  3GLI A;  1DGH A;  3WAE A;  4X64 M;  3B7D A;  3C33 A;  5IKB A;  4OMB A;  1Y4C A;  4ELO A;  4FCT A;  2X26 A;  3ZC7 B;  3T9V A;  5GKN A;  2FNA A;  4LZJ A;  5KPT A;  3KGC A;  3D4C A;  3RPW A;  3IAZ A;  3K6U A;  2HQ0 A;  1K3X A;  3G7W A;  3Q29 A;  4ECF A;  2KXE A;  1QUL A;  3O9P A;  3AOE A;  3U93 A;  4L17 A;  4AKG A;  2XSZ D;  4RNA A;  1SXJ E;  3U61 B;  2R6G E;  2OJT A;  1OIB A;  4L16 A;  3Q25 A;  3ILU B;  2R71 A;  1AOV A;  4AKI A;  1SVX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...