3KSJA

The alkanesulfonate-binding protein ssua from xabthomonas axonopodis pv. citri bound to mes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
b'AEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
total genus 94
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA02
1ZKBA 2P2AA 1FQBA 2HZLA 2HXWA 4ZZAA 4OERA 3H6VA 5CBRA 4PE5B 1YTVA 4QSEA 2IA4A 5IAIA 2VD3A 2ZMBA 1WODA 1B1XA 2V25A 5H8SA 3G3HA 3SEXA 3Q28A 1B5HA 3WAEA 1A8FA 3KSXA 3L6HA 1MXUA 3U72A 5L8DA 5FTHA 1CB6A 3QYTA 3UIFA 3SEUA 3BFTA 2W7YA 1T0KA 4DZ1A 1RYOA 1XS5A 3E4RA 1FCKA 3MAMA 4DXUA 3KN8A 2GRVA 4NF5A 3EPEA 1MXYA 5HM4B 4KQPA 1B3HA 5CMBA 2H99A 2V3TA 1UTBA 5CRYA 2YPNA 3UORA 2QS4A 4N6PA 1MQJA 1P99A 2QMWA 4MLVA 3T22A 1R1NA 1NNFA 4G68B 4BDNA 3SEWA 3U8QA 1QW0A 3SETA 4ZE9A 3ZKLA 1DMBA 3R7XA 4BDOA 3KGCA 4OENA 3ODBA 3KSJA 5H8NB 4GVOA 3EHSA 4JSDA 3HPIA 4X1BA 4TQUQ 5L9OA 4RA1A 4OFJA 4R74A 4DLDA 1POTA 3ZKKA 3MVXA 2OK2A 4H5GA 3KJTA 4IY5A 4BDMA 1SW4A 4Q5TA 3KEIA 3DM0A 4WXJA 2QS2A 2DOJA 3H6WA 4ESWA 4N07A 1N04A 2UYEA 4OZ9A 3IORA 2Y7WA 4YU0A 4H65A 3WAFA 3PU5A 1LLSA 2Z22A 4R75A 3ZS6A 1GVCA 4Q30B 3PUWE 4U2RA 1QUIA 3I5OA 1I6AA 1IXHA 4NF6A 3LUYA 1MY2A 3VLUA 3K6UA 2R9JA 4XKRA 1B7UA 1M5EA 3PGFA 3Q27A 5KCJA 3CR9A 4FIMA 1RKMA 1ZLQA 2M8CA 1LFIA 4KCDA 1M5FA 5TPAB 1ZMGA 4EXKA 3EN3A 3O66A 3T9VA 2VD2A 3TELA 1SQYA 1FQCA 4YZZA 1URSA 3PD8A 4JWXA 4DXCA 3OO8A 4U22A 1LB9A 4QF9A 5JEIA 2XXYA 1MXVA 4IB2A 2XD2A 3GLBA 3B7DA 5CMMA 1QULA 4LVQA 1FTMA 2HAUA 1Y1ZA 3S4UA 4XKPA 3UN6A 1Y20A 4P11A 4ZDMA 3IB0A 1JEUA 4EXLA 1AOVA 3TAJA 1Y1MA 5FHNA 2ONSA 5H8HA 2PT1A 3MPKA 1H44A 1EH3A 2VHAA 3FV1A 1IITA 4I9DA 3FZVA 5AA2A 2D5WA 5HPQA 1LFHA 4C1TA 4G4PA 5JTYB 4IO5A 5I2KB 2Z8FA 4XKQA 4G68C 5CMCA 3R26A 5DVJA 2HEUA 4OTEA 4POWA 2PX1A 2DWIA 5K2XA 3MZ9A 2DE2A 4ZE8A 5BUUA 2Q2AA 1MM7A 2F78A 2V3QA 1OVTA 3SEVA 1VFEA 4YAHX 4I8CA 5AA2D 3VE1B 4FE8A 4KD5A 1OQHA 4NF8B 5CBSA 3RTFB 4MFIA 4LATA 1AL3A 4ESXA 1B2HA 3FJMA 4OFLA 3JV9A 1ZBMA 4QFOA 3R6UA 1VFDA 3OSRA 1GR2A 1Y9UA 2DQVA 2YLNA 4JSOA 3ILUB 3MP6A 3L6GA 4KYDA 4KI0E 3OSQA 3EHTA 2AIXA 1OVBA 5B70A 3O2AA 4DCYA 2F97A 4NEDA 3DP4A 3IJOB 3GBBA 3O28A 1BP5A 1A99A 2ESNA 4P0GA 1R6ZA 3IB1A 1YCJA 3W15C 1A7LA 2F36A 4QHQA 4UACA 4M4GA 4P0IA 1BTJA 2O84X 3QK6A 3FVNA 1XOCA 4EUOA 4DCXA 2V84A 2XX9A 3M8UA 3ZSFA 2A5TB 2NOOA 3QSLA 2F6GA 4FJPA 2GH9A 4I62A 3RPWA 1FQEA 1NH7A 3H06B 2XXWA 3FVGA 5DT6A 1II5A 3T93B 1LAFE 1B58A 4F3GA 1NH8A 3QUJA 3KOSA 1BIYA 5AA3A 3TDJA 1B52A 4UA8A 4F1UA 5EHMA 4R6KA 5AA4B 1AMFA 5TPAA 2G29A 3H03A 3TPAA 4ZZEA 4GL8A 3VXCA 3K02A 1NL5A 3EF7A 1O7TA 3MVYA 3C9HA 1MXZA 1SI1A 2AL4A 4ELPA 1P1WA 1P1QA 1ANFA 3K1PA 1ZJLA 4R6YA 4LONB 3IX1A 3O6IA 3HO7A 1IXGA 3IOWA 1MY1A 2ONKE 3HSTA 2DVZA 4OEVA 3BKIB 1N0TA 3QUFA 1N84A 1SVXB 4F31B 3VVEA 5I58B 4JWOA 3TTNA 3SKPA 3KZGA 4FEBA 3V5AA 4DE8A 3Q25A 1SYIA 1TFDA 1GV8A 4F2OA 1QKAA 2CZLA 1JW5A 4PFYA 4WEPA 2XXPA 4IO4A 5JTYA 2DS9A 2F7AA 1UIUA 1GTKA 5I2KA 4QSCA 4YMBA 5FHMA 2ZYOA 4MH5A 3TQLA 1SD3A 1D9VA 3FXUA 5DEXB 1H76A 3FVKA 4G77A 3IL1B 4LP2B 1N7WA 2RC7A 1LBCA 2B65A 3FATA 4PFUA 5ICTA 2IEEA 3TEPA 3K4UA 5L9SA 2I4CA 5LOMA 1DTGA 2ANJA 3N6TA 2P0SA 5L9MA 4NF8A 3S9LC 2HZKA 2BJJX 4THIA 4G8MA 1LGBC 1S7YA 5ITPA 1SBPA 1D9YA 1R9LA 1NKXA 4OVJA 4OEUA 3RTWB 2OWTA 1SW2A 5I56B 2DXRA 2QS3A 2DE4A 2Q2CA 3OENA 3CSBA 4ND9A 1Y4CA 5H8QB 2VOZA 1USYE 1XVYA 1VR5A 4OESA 3UK4A 4WKMA 2QJEA 1FQFA 3SEYA 1JVYA 3PUXE 4TOZA 1UTHB 3I6VA 5DVIA 4F19A 2OWSA 3FD3A 1SI0A 4ELRA 1TT1A 4BDQA 4KHZE 4GD5A 4O3AA 4NF4A 2G93A 3K6VA 4Q0CA 3G3JA 4U1ZA 1B0LA 2A5TA 4HCYA 4C1UA 4E0WA 3D4GA 4R2BA 5M2VA 4ZEFA 2Y7IA 4GIZA 2E1SA 4EDPA 5DVFA 3MPLA 1N3WA 1WVJA 3C32A 4ZEBA 4OXVA 2KLFA 2O51A 4ISUA 4PETA 1MPDA 3IOTA 2H98A 2RCAA 3VDFA 2OCUA 4EF1A 4JB7A 3E13X 4QFLA 3TUSA 1FTOA 4AB6A 4KFQA 3RT8A 1DTZA 2F8DA 1WDNA 3PV0E 3LSXA 3MZ1A 3IK6B 3H3GA 2I3VA 4C0RA 3LBSA 1IXCA 3IO4A 5AA1A 1QKBA 2OBGA 4HTGA 5I58A 4NWCA 3F11A 1LAGE 1M5CA 2O6AA 3T96B 3W9WA 2OJTA 3Q29A 3S2VA 4HCWA 3TTMA 1MRPA 3G3IA 1ZU0A 3H6TA 4H5FA 1I6BA 4F2QA 3B6QA 2XXIA 2RC9A 3TTLA 4H0WA 2XHDA 1URDA 5DEXA 3VLWA 3SERA 3PPQA 2Q88A 2DXYA 1HSJA 5CI5A 1D3KA 4FEDA 3B6WA 4N13A 4HW8A 3O97A 3USDA 1Y3QA 2Y7PA 3TCGA 5TU0A 1I6QA 2DYXA 2DE3A 2PVUA 5CM6A 2X7QA 1QUKA 2F6PA 1HSLA 2Q8JA 3QXMA 3IOUA 4ECFA 3TMGA 5I59B 2R6GE 2PMSA 4RPOA 2REJA 2I3WA 3M3FA 2F7BA 3IO6A 2FYIA 3FASA 2ZYMA 3C33A 3KBRA 3FUZA 5ISUA 1DSNA 3TQWA 1GGGA 4IO2A 4LA9A 1CE2A 4U4SA 1POY1 2F34A 1Z7ME 4M1VA 2CMOA 2RKMA 3GBAA 3CG3A 4G68A 4HS7A 3E9XA 2Q9TA 4YB5A 4TLMB 1B6HA 3H4ZA 3Q26A 4ELQA 1M5BA 3SESA 3U94A 3GXAA 4GXAA 3OOAA 5H8NA 2ZYNA 2ZNTA 1S9TA 2O68A 5J1DA 3IAZA 2D21A 4ZEKA 2XXQA 1B5JA 3KJ7A 1B40A 3V89B 1JNFA 2UYFA 2O1LA 4PQJA 1PBPA 4F1VA 4R6HA 3LSWA 5KZTA 3O9PA 3PUYE 3IB2A 3PMXA 3K2DA 1B51A 1UTBB 1UIVA 2I48A 2UVHA 2B3BA 4YB7A 2GFEA 3OMBA 1MY0A 1DPPA 3CVGA 4KCCA 4RPNA 1KWHA 2LAOA 1MXWA 4X1DA 2X7PA 1QVSA 3MJNA 1ZIUA 2RC8A 1A55A 2QMXA 3P7IA 4RJZA 3MVZA 2HCAA 4IGTA 3MUQA 4XKNA 2DWHA 2QS1A 2HQ0A 3JYRA 4LQ2A 3K6WA 2H9BA 1NNKA 4OQOA 4DXBA 2A5SA 1N7XA 1Y3PA 3TTKA 3DP8A 4LUBA 5F1QA 4ZECA 1EZOA 2XX8A 3T66A 4Z0IA 2VGQA 3CI8A 2XXVA 4EQ7A 2Q89A 1IQ7A 3KG2A 4H8IA 3PUVE 3UP9A 1NMUA 4QRZA 3HN0A 4KPTA 1P1OA 2RINA 3OEKA 3G7WA 4YKKA 1B9JA 1US4A 4POXA 1JW4A 2B3FA 1PEBA 3LSLA 4NF6B 2DWAA 1MS7A 4KR5A 3VVFA 4JDFA 1US5A 3S9MC 4X48A 3K0VA 3CSGA 2QPQA 2XD3A 2XXRA 3O29A 3TFLA 1RYXA 2AYSA 4PFWA 2I0CA 4NE4A 1B3LA 3CG1A 3RQTA 3MVWA 5I59A 1J1NA 5KDTB 3PPOA 1N3XA 1IEJA 1JEVA 4F22A 2ZNUA 4MF3A 3RN8A 3M3LA 4G2ZA 3TCFA 1USYH 1ATGA 5TP9B 4GQOA 1LB8A 1IZ1A 2DP8A 3CRBA 1B7ZA 3K1NA 3K6XA 3KN7A 3G3FA 3I3VA 4JBZA 4XTCQ 1S50A 1MY3A 5B7DA 1OLAA 4GF8A 3OO7A 1A54A 1TWYA 2QRYA 2X26A 1MQHA 2Y7RA 4LQ5A 2NUVA 4U23A 4RXLA 1LFGA 3C31A 4MBPA 3B6TA 4F29A 1JVXA 5H8HB 4H8JA 1PB7A 4QSDA 2PBWA 4YKIA 3N94A 3MQ9A 3K1MA 5ICQA 2I0BA 1SYHA 1OQGA 5AA2B 1JW1A 2DWJA 4XIGQ 4IO7A 5I84A 1XC1A 3SDFA 4MLQA 1FQAA 4R9FA 1DPEA 4E0XA 2NWJA 1MM6A 3C35A 2HAVA 4NMYA 1PDAA 1FQDA 3OELA 3FJ7A 2Z23A 3RUMA 3EHUA 3PPPA 1ZTYA 5DYHA 3OO6A 1B05A 2QSXA 4F3BA 3TKDA 3LR1A 5CMKA 1B0HA 1XT8A 1VSOA 4QFKA 1H45A 4OYVA 3G3KA 3FXRA 3RNNA 2Z8DA 3PMVA 1MXXA 1R9QA 1HSEA 4FATA 1P1UA 3PPNA 3LSFB 1B1HA 1FTKA 5EYFA 4G8NA 1D4NA 4K3FA 4FECA 4H67A 1F9BA 3FJGA 2PT2A 5AA4A 3BBRA 5I2NB 1B3GA 4H1XA 4YICA 4Q8RA 4BLAA 1XVXA 4NTLA 3LC8A 1Z7NE 3T9UA 1IXIA 2I6EA 3O6GA 3BFUA 4LZ5A 1MPBA 1OLCA 1DOTA 3AXFA 1MH3A 4ZS9A 1EU8A 3OEMA 5ITOA 2O7IA 4GFRA 3N5LA 2GHAA 3PMWA 2V3UA 3PPRA 4I1DA 3VLVA 1A40A 3V83A 1PBQA 3CFLA 2H4IA 3U93A 4ELOA 2F5XA 2THIA 4JWYA 3FXQA 3CFXA 2HFBA 3T9XB 3FV2A 3K00A 4U4XA 3HV1A 2F35A 3N6UA 3TODA 2R71A 2Z8EA 1MPCA 3FGSA 4KYEA 4IO6A 1NNTA 3H7MA 1Y3NA 2AL5A 2ZYKA 3M3KA 1ELJA 5EHSA 4PFTA 2O69A 3TTRA 5KDTA 4YKJA 3ILTB 2XXHA 1LSTA 3VFJA 2ZXTA 3S9EA 1NNPA 3W9VA 3DELB 4RYAA 2H25A 5TP9A 4ONYA 2REGA 1B3FA 2I58A 4IGRA 3GZGA 3IOVA 3VXBA 1IUDA 2Y84A 1O63A 3MP8A 1A8EA 2NVUB 4RNSA 5F7VA 5ELVA 3DP6A 3JZJA 2UVIA 3CIJA 3HCQA 2OLBA 1BKAA 4OFOA 1MY4A 2ALUA 1M5DA 1SW1A 2XX7A 2H5YA 3MC2A 2XXTA 1B3EA 2PYYA 4QFPA 4FORA 5CC2A 1UQWA 3THIA 1PC3A 3TZAA 1LBBA 4YMAA 5A5XB 3DLNA 5I56A 4DDDA 1LCTA 2V93A 2Y7KA 5H8QA 3G3GA 3MZBA 2OZZA 1H3DA 1JQFA 1QUJA 1FTLA 5I57B 1PB8A 3RT6B 5H8FB 5BWJA 1B4ZA 4F39A 3PUZE 3O6HA 1UTHA 4LZ8A 2I49A 3T9HB 3RGYA 1FW0A 5HBCA 3KFMA 1PB9A 4JXIA 2UVGA 4RK2A 4R9GA 4O3BA 3ECRA 4TLLB 1SDXA 3D4CA 4F3PA 4O3CA 1YAEA 5FTIA 1MDQA 2P1SA 3A09A 3A3UA 5FHOA 3CFZA 1B32A 1YPNA 3UA8A 1OMPA 3C34A 2UXAA 3QIMA 1MH4A 2XXXA 1L5TA 2FNCA 3VV5A 4OHNA 4PP0A 5K2YA 3C4MA 1O64A 4DIGA 4NF5B 5I2NA 3E3KA 4NWDA 2WKYA 3MP1A 2ZNSA 1Q35A 3MW0A 1EZPA 2ABHA 3UGWA 3IR1A 2O7UA 1NFTA 5IKBA 3FIRA 3ONMA 3RY3A 1TXFA 4G8HA 2O1MA 2RF1A 4EQBA 4OWDA 4KYSA 3HHFA 4ZEIA 2E0SA 4NF4B 3OD7A 4QFNA 1MQDA 3VVDA 3K01A 1N76A 3PD9A 4R72A 3TYHA 1Y4TA 1SW5A 4LZ7A 4EF2A 1Q1KA 4GOTA 2I4BA 4YB6A 3TCHA 1OIBA 2RCBA 2DSFA 3IJXB 4OMBA 4GWOA 1BLFA 3MBPA 2DVCA 4XXUA 1LCFA 4AB5A 4OETA 4F1YA 3KN3A 4IO3A 4WEDA 3HHGA 3C36A 3QAXA 3OO9A 2QL3A 1VE4A 3RLFE 4F3SA 2D3IA 3FVOA 4GLIA 3A3CA 3N26A 4BDRA 4R73A 1XHYA 4H6DA 3OXNA 3KOTA 4U1OA 5AE4A 1MQGA 4U21A 3U92A 4EQ9A 2GHBA 4RK9A 4R2FA 5KCJB 4X9TA 4YKPA 1P1NA 5JK4A 4IY6A 1B46A 1H43A 4GL0A 1IIWA 3EQ1A 4Z7EA 4GXSB 3S9NC 3V8XB 3MWBA 1B4HA 3U1OA 2FA7A 4GRKA 1B7HA 1MDP1 1I69A 5A5XA 1LAXA 1JETA 1EZ9A 2YJPA 1AH5A 2F7CA 2UVJA 2ONRA 1MG1A 1TFAA 1B5IA 1MQIA 4L17A 1QJMA 4RY1A 5DTBA 4AQ4A 2NXOA 2VP1A 2XXUA 4ZEDA 4FAJA 1FTJA 3H6UA 1LAHE 5I57A 4BDLA 4F18A 1URGA 1AIVA 5H8FA
chains in the Genus database with same CATH superfamily
1ZKBA 5FBPA 2P2AA 1FQBA 3HFUA 2HZLA 2HXWA 4ZZAA 4NXMM 4OERA 1SG9A 4QOSA 4IR8A 3AOEA 3H6VA 1WGLA 5CBRA 2ZTDA 2XGNA 4PE5B 4DV5M 1K9YA 1YTVA 5EQTA 4QSEA 2IA4A 5IAIA 1HNWM 2VD3A 2ZZWA 1QZMA 3LVWA 2ZMBA 1Q3CA 3C3DA 1WODA 4PAIA 4NOOB 1B1XA 2V25A 5H8SA 1OAIA 3G3HA 3SEXA 3Q28A 2PFYA 1B5HA 3WAEA 3L2AA 4I5SA 1A8FA 1HQYE 3KSXA 3L6HA 1MXUA 4LJ6A 5L8DA 3U72A 5FTHA 3A29A 1CB6A 1J09A 3C3EA 3FUWA 3QYTA 3UIFA 4NAPA 3SEUA 3BFTA 1IY0A 2W7YA 1T0KA 2UUCM 4JI7M 2XZUA 4DZ1A 1RYOA 5EQ7A 2L7IA 1XS5A 4NX1A 3E4RA 1FCKA 3MAMA 4DXUA 1XC8A 3KN8A 2GRVA 1R6BX 4NF5A 3EPEA 1NV5A 4XGIA 3QAUA 4MM3B 3B9PA 3PVSA 1MXYA 5HM4B 4KQPA 4GC5A 4M0DA 4FCVA 1B3HA 2C99A 2H99A 5CMBA 3GP1A 2V3TA 1DGGA 1UTBA 5CRYA 4XBOA 3UJNA 2YPNA 1G41A 3UORA 1R5LA 2QS4A 3QYEA 2GQFA 2QVUA 1HQCA 4N6PA 1MQJA 1P99A 2QMWA 4O7MA 4MLVA 3T22A 1BK4A 1R1NA 1NNFA 4IJFA 4G68B 4BDNA 2B3TA 1G8PA 1LTMA 3SEWA 1R2YA 3U8QA 2JY8A 1QW0A 3SETA 4ZE9A 2KRUA 3ZKLA 1DMBA 1IMAA 1XHBA 3R7XA 4QHTA 3FYCA 4BDOA 3SARA 3KGCA 4OENA 4MX6A 3WHKA 2DAIA 3HHZA 4LRTA 2PFZA 4JI0M 2BJIA 3ODBA 4QOZC 3KSJA 5H8NB 2WEFA 4GVOA 3EHSA 3T1YM 5EP1A 4JSDA 4RNAA 3HPIA 3KP0E 4X1BA 4LJ9A 4TQUQ 5ET8A 1HNXM 5L9OA 4RA1A 4OFJA 2R6FA 4R74A 4DLDA 1POTA 4XK8F 3ZKKA 3MVXA 3PNYA 4JI4M 2OK2A 4H5GA 3KJTA 4IY5A 4BDMA 1SW4A 4Q5TA 2LVQD 3KEIA 4DV1M 3DM0A 2APLA 4LGYA 5E6JA 4WXJA 1NUYA 2QS2A 2DOJA 3H6WA 5F24A 1FBFA 4ESWA 4N07A 2WSEF 2K6BA 2F5OA 1N04A 4L8RC 2UYEA 4OZ9A 3IORA 2Y7WA 4YU0A 4H65A 3A42A 3WAFA 3U6SA 3PU5A 4WURA 1LLSA 2Z22A 2KA6B 2WBDA 4GHLA 3J80S 4R75A 2X49A 2CV0A 3ZS6A 3KFUG 1GVCA 1Z59A 2O5RA 2DENA 3PUWE 2C96A 4Q30B 4JVIA 4II7A 2R46A 3LV0A 4AI6A 3GQ4A 4UN2B 3U5ZB 4U2RA 1QUIA 3I5OA 4L4UA 1I6AA 4PE3A 1IXHA 2Y5KA 4QBAA 1TDZA 1EIJA 5E26A 1IMEA 4NF6A 1NUXA 4OVPA 3M7GA 4DV0M 2RRUA 1MY2A 3LUYA 1ZMUA 4JVCA 2JY5A 2KR0A 3VLUA 3K6UA 1GL7A 3GLGE 4B7HA 2R9JA 4XKRA 1B7UA 4O8MA 1M5EA 3PGFA 3Q27A 2VF8A 3FD9A 5KCJA 4X04A 3CR9A 8CATA 4FIMA 2OO9A 4DI3D 3GQ3A 1RKMA 2HHHM 1ZLQA 2M8CA 2LNHC 1DGFA 2X8AA 3HHXA 1LFIA 1G0HA 4KCDA 3B7ZA 2UXDM 3KC0A 4PFRA 1N77A 1N36M 1M5FA 5KQ8A 5TPAB 5KPTA 1ZMGA 1XNQM 2F5SA 4EXKA 3EN3A 3O66A 3T9VA 2VD2A 4BLCA 3TELA 1SQYA 5JI2E 1FQCA 1URSA 3PD8A 4JWXA 4YZZA 4DXCA 3A98B 2CE7A 3OO8A 3U6PA 4U22A 3MYUA 3D8LA 3AKZA 1LB9A 1T6OA 2Y21A 3DFZA 1VEKA 4QF9A 5JEIA 2XXYA 1MXVA 5ET6A 2L6OA 4IB2A 4P17A 2XD2A 4N8YA 5ITQA 3GLBA 3IG8A 3B7DA 1QAMA 1CNQA 2DZLA 5CMMA 1QULA 4LVQA 1FTMA 2WZJA 2HAUA 2CEAA 1Y1ZA 2EUCA 4LF5M 3S4UA 4LCBA 2XWVA 4XKPA 3T38A 4N91A 1Y20A 3UN6A 2VIIA 4DR2M 1MX0A 4P11A 5LMUM 4ZDMA 3IB0A 1JEUA 4EXLA 1AOVA 2NQ8C 4A3VB 1XB2B 3TAJA 4PAKA 1LBZA 2I7PA 3PXGA 1Y1MA 5FHNA 1GKIA 2ONSA 5H8HA 5FLXS 2PT1A 1FJ9A 4D80A 3BIHA 3MPKA 1H44A 1EH3A 3RGPA 2FE8A 3LCUA 2VHAA 1TH3A 3FV1A 2OPFA 3VKHA 1IITA 1HJPA 1NNJA 4I9DA 3FZVA 5AA2A 3E9SA 2D5WA 3W0FA 5HPQA 1LFHA 4FCTA 4C1TA 4G4PA 5JTYB 4D81A 2YFQA 4IO5A 5I2KB 3RYDA 2Z8FA 2KZUA 4XKQA 5A5LA 4G68C 3SASA 3R26A 5CMCA 4PFBA 5DVJA 3C58A 2HEUA 2OOAA 4OTEA 3SBJA 4POWA 1P3QQ 2PX1A 2L09A 5IZ7D 1TTEA 2DWIA 5K2XA 3GRUA 3MZ9A 1D0MA 3AFHA 2DE2A 4ZE8A 5BUUA 2Q2AA 4PF8A 4OVZB 1MM7A 2F78A 3W0LB 2V3QA 3GRVA 1OVTA 3SEVA 3GLGA 4GBWA 2ZBKB 1VFEA 4DV2M 3U61A 4YAHX 4I8CA 2M60A 1FBGA 5AA2D 1N34M 3EKIA 2UU9M 3UK6A 3VE1B 1EYIA 3RE8A 4FE8A 4KD5A 4NG7A 1OQHA 4NF8B 5CBSA 3RTFB 4MFIA 4LATA 1AL3A 4L6V6 4ESXA 3LMMA 4L16A 1B2HA 2D7HA 3FJMA 4OFLA 3JV9A 1ZBMA 4GITA 4LF6M 2WYKA 4QFOA 2K0BX 3RGSA 2FS1A 4L78A 5JI3E 3R6UA 1J5EM 1VFDA 1GVNA 3OSRA 1TH4A 1GR2A 1Y9UA 2DQVA 3T6PA 4B08A 3ZC7B 2YLNA 4JSOA 3ILUB 2J5YA 4AS5A 1QQWA 2YQZA 3IECA 4LFCM 1D0KA 3MP6A 1NNUC 3L6GA 4KYDA 4KI0E 3R8FA 4OW0A 3OSQA 1PM5A 1IBMM 3EHTA 2AIXA 2CHGA 1A5TA 1OVBA 2B4LA 1L8QA 1JQJC 5B70A 4M9XA 3O2AA 4DCYA 3FBPA 3E78A 2F97A 4DUYM 4NEDA 3DP4A 3IJOB 3GBBA 1SXJB 3O28A 1BP5A 1A99A 2ESNA 2LXEA 4P0GA 1R6ZA 4PBQA 1DK4A 1HT2E 3KXEC 4LJAA 3IB1A 1YCJA 4NRWA 3W15C 1FPDA 5I5PA 2DWZB 3K92A 1A7LA 2F36A 1GO5A 3GLIB 4QHQA 4UACA 4M4GA 2Z4RA 4P0IA 1E9SA 1BTJA 2O84X 2F3BA 1OIPA 3QK6A 2XLJA 3FVNA 1XOCA 2I7NA 4B3RM 4EUOA 4LY6A 4DCXA 3SYLA 2V84A 2DKLA 1DGHA 2XX9A 3M8UA 3ZSFA 2A5TB 2NOOA 3QSLA 3NWLA 4QNRA 2F6GA 2K9DA 3L25A 4FJPA 2GH9A 3MHVC 4LZZA 4B7GA 4I62A 4N81A 3RPWA 1FQEA 1FPJA 3BXWA 1NH7A 3H06B 2XXWA 3FVGA 5DT6A 1NVMA 1II5A 3T93B 1LAFE 1B58A 4F3GA 1NH8A 5KPZA 3QUJA 4DV7M 3U6CA 3KOSA 1BIYA 3HKPA 1FPEA 4JXJA 5AA3A 1XWIA 3TDJA 1B52A 1YSYA 5EQAA 4UA8A 4F1UA 5EYGA 2KRKA 4MHFA 5EHMA 4NQ8A 4R6KA 1WIVA 4HE0A 3HU1A 5AA4B 1AMFA 2R18A 5TPAA 1W5SA 2GNOA 2G29A 4AKIA 3F92A 3H03A 1NV8A 1EE8A 3TPAA 1NSFA 2QFLA 4ZZEA 4GL8A 3VXCA 3K02A 1NL5A 3EF7A 3E46A 1O7TA 3MVYA 2KDLA 3C9HA 1MXZA 1SI1A 2AL4A 4P1LA 4ANRA 1P1QA 1P1WA 4ELPA 2DI0A 3MK6A 1ANFA 3K1PA 4Z6YA 1R2ZA 1FSAA 1ZJLA 2UXCM 4DV4M 4R6YA 4LONB 3IX1A 3O6IA 2P3VA 3GPUA 3HO7A 1IXGA 2QNJA 1KA1A 2D7GA 4DR3M 3IOWA 4IBGA 1MY1A 2ONKE 3HSTA 2DVZA 4OEVA 3BKIB 1VG5A 3GRYA 1NV2A 2CUZA 4OX9M 2CP8A 1BVSA 4JVDA 1N0TA 2V1UA 3QUFA 1N84A 4MCOA 4MB7A 2LTUA 1SVXB 3VVEA 3LQRA 4F31B 5I58B 4JWOA 4L15A 4LGMA 3TTNA 3SKPA 1NUZA 3KZGA 4FEBA 3V5AA 4MIJA 1VDLA 4PFIA 5BPVA 2VF7A 4DE8A 3L29A 1L1TA 1ZMVA 1SYIA 1TFDA 3Q25A 2R4EA 3FTFA 4UABA 1GV8A 4F2OA 4IBIA 4OVRA 1GABA 3CF6E 1QKAA 2CZLA 1OFHA 2JJKA 3HU2A 2LVAA 4I3EA 1JW5A 2WBBA 4PFYA 4WEPA 2WSFF 2XXPA 4IO4A 5JTYA 2DS9A 2F7AA 2CHVA 3K9PA 1GTKA 1UIUA 3HY5A 4O94A 5I2KA 4JI8M 4QSCA 4YMBA 1IN6A 5ET7A 2QCUA 5FHMA 2ZYOA 4MH5A 3TQLA 1SD3A 3BOSA 1D9VA 5EXXA 3FXUA 2CFOA 2UXBM 5DEXB 1IN8A 1R7RA 1H76A 3U60B 3FVKA 3AOEC 4G77A 1V92A 1DV0A 1AWBA 3IL1B 4MGZE 4OA4A 2HAKA 4FBPA 5FTNA 1N7WA 4LP2B 1PJIA 2Q74A 1IY1A 3SAWA 2RC7A 1LBCA 4PBHA 2JY7A 2B65A 3FATA 4PFUA 4CISA 3SAVA 3ISPA 2AHMA 1D0LA 5ICTA 1CUKA 2IEEA 3TEPA 3K4UA 5L9SA 2I4CA 5LOMA 1DTGA 1QDRA 4G4QA 4B3MM 2DHRA 3K2LA 2ANJA 3N6TA 2P0SA 1YLAA 2XSZA 3KS4A 5L9MA 4NF8A 3S9LC 2HZKA 2BJJX 4THIA 4OVSA 4G8MA 2OOBA 1VQ1A 3HJ8A 1LGBC 2L5VA 1ZMWA 1S7YA 1EFUB 3J7AS 1SBPA 5ITPA 1D9YA 1R9LA 1NKXA 4OVJA 4OEUA 3KP1E 3RTWB 1F4IA 5ITTA 1Z5AA 2OWTA 2EO2A 3HJSA 1SW2A 1SXJC 5I56B 2DXRA 2QS3A 2DE4A 1DO2A 5J16A 2ZAOA 1QAOA 2Q2CA 3OENA 3CSBA 1LBXA 1FPIA 4ND9A 4IIWA 4GIPA 3HGIA 2CZHA 1Y4CA 5H8QB 1Z5CA 2W82A 2VOZA 1USYE 1XVYA 1VR5A 1IBLM 4OESA 3CF0A 3UK4A 4WKMA 2QJEA 3KVWA 1FQFA 4NHBA 2CRUA 3SEYA 1JVYA 3PUXE 4TOZA 1UTHB 3I6VA 5DVIA 4F19A 2OWSA 2XSZD 3FD3A 1SI0A 2QHOB 3ZCBB 1NUWA 4ELRA 2QQ8A 1DO0A 1TT1A 4BDQA 3KOWE 4H46A 3GLIA 4G3OA 4KHZE 4GD5A 1PRBA 4O3AA 2R44A 1LBYA 1DCUA 2QVVA 4NF4A 2G93A 2DVWB 3K6VA 4XEQA 4Q0CA 3G3JA 2M5ZA 3DZDA 3TQSA 3GLHB 2R62A 1ZAEA 3LUZA 4U1ZA 4FVMA 4F2LA 1B0LA 2A5TA 4HCYA 4CHTB 4C1UA 2JZ0A 3D4GA 2C98A 1QDTA 4E0WA 5FTLA 3PFIA 1FPLA 3FTEA 2R4JA 4R2BA 5M2VA 1IM2A 4I81A 4ZEFA 3KDSE 4GBVA 1L2CA 2Y7IA 2Q8MA 4GIZA 2E1SA 2Y0QA 2KHHA 3B50A 4EDPA 1NV3A 5DVFA 3MPLA 4MEVA 1N3WA 1WVJA 3C32A 4ZEBA 4Z8XA 4OXVA 2KLFA 2O51A 4ISUA 4PETA 2V4CA 1FBPA 1S3SA 1MPDA 3IOTA 2Z3XA 3SHGB 4DR1M 2H98A 1I4WA 2RCAA 3VDFA 3PTYA 2OCUA 2BJWA 4LFBM 4EF1A 2R65A 3TE6A 4JB7A 3E13X 3TWKA 4QFLA 2D7EA 2EA0A 3TUSA 1FTOA 2A5YB 1G3IA 3U65A 4FCWA 2DXIA 2MH8A 1MN3A 4DBGB 2HL7A 3TWMA 4AB6A 3GQ5A 1GJTA 1LV7A 4LJ8A 4KFQA 3RT8A 5IT9S 5EP2A 1DTZA 2VDBB 2F8DA 3VDUA 1WDNA 5BR8M 2BWEA 5FTMA 3PV0E 3LSXA 3MZ1A 4F1IA 1NV4A 3IK6B 3A45A 4GWYA 3DA1A 3H3GA 2FFJA 1Q9DA 2I3VA 5DFLA 2J7OA 3K9OA 1IXSB 4BB9A 3BIGA 4C0RA 3LBSA 4JI5M 1QZEA 1IXCA 4MMPA 1Q02A 3IO4A 5AA1A 4MNCA 4GX3A 1IN7A 1QKBA 2C5RA 2OBGA 5A2QS 4HTGA 4XFEA 5I58A 2VQEM 4KXPA 4NWCA 3F11A 4HLQA 2XXKA 5FTKA 2BWBA 1LAGE 2DZNB 2MJ5B 1M5CA 2O6AA 2XH9A 3T96B 3W9WA 2OJTA 3Q29A 1KFVA 3CGWA 1RU3A 3S2VA 1KZ8A 1DBZA 4PCDA 3FUUA 4HCWA 3H4MA 2G3QA 3TTMA 1MRPA 1OKSA 1H6UA 3G3IA 1ZU0A 1MJGM 3H6TA 4N15A 4LF8M 4H5FA 4OANA 1I6BA 4F2QA 3B6QA 2XXIA 3AL0C 2RGOA 2RC9A 3TTLA 1OTRA 2ZAMA 4B3TM 4DR6M 4H0WA 3M6AA 3NBIA 3GYYA 4NC6A 2XHDA 1URDA 5DEXA 2R0IA 4M0WA 3VLWA 3IFCA 3U60A 4IBDA 4MGKE 3SERA 3UGJA 3PPQA 2Q88A 2Y0TA 4PF6A 3T1HM 2DXYA 1Q3BA 1HSJA 5CI5A 1D3KA 4FEDA 3ZH9B 2DWLA 2J7NA 3B6WA 4N13A 4HW8A 3O97A 3USDA 1Y3QA 2Y7PA 3TCGA 5TU0A 2DAGA 4IBFA 1I6QA 2MKZA 2DWMA 2YR0A 2P5TA 2DYXA 1EYKA 2DE3A 1SPIA 2LVOC 2PVUA 3SYKA 5CM6A 3AV0A 3L27A 2X7QA 1QUKA 2F6PA 4P16A 3GO8A 1HSLA 5ITXA 5LDZA 2Q8JA 3QXMA 1ZQ9A 4JI3M 3IOUA 4ECFA 3TMGA 2FH0A 2LWXA 1NV9A 2QBYB 1C1KA 4I40A 5I59B 1X37A 2JXNA 1OQYA 2XF3A 2R6GE 2PMSA 1E9RA 4RPOA 4Y28F 4FD2A 1FJGM 3W68A 4DR5M 2REJA 2BNKA 2I3WA 4AW4A 3M3FA 2F7BA 3IO6A 2FYIA 1G71A 4DV3M 3FASA 2ZYMA 2L2DA 3C33A 2F5NA 3KBRA 4JYAM 3FUZA 5ISUA 1DSNA 3TQWA 3SC3A 2Y5LA 2CZIA 4G4NA 1GGGA 4B7FA 4PDHA 4IO2A 4LA9A 1CE2A 4U4SA 3T0JA 3HZJA 1POY1 2F34A 1Z7ME 4M1VA 1MU5A 2CMOA 2RKMA 3GBAA 2QZ4A 4NGUA 1K3WA 4JN6A 3CG3A 2KNVA 2FIEA 4G68A 1PGYA 4HS7A 1FPKA 3E9XA 1QUTA 2Q9TA 4YB5A 4TLMB 1B6HA 2JZ1A 2RKOA 4P8BA 4DI4B 3HX3A 3GPPA 3H4ZA 3Q26A 2UUAM 3FUTA 2JA2A 4ELQA 2ZZXA 1Z5BA 1M5BA 2ZZVA 3KC1A 3SESA 5DYIA 4LJ4A 1G0IA 3U94A 4QHSA 2FIXA 2XFSA 4S12A 2CZKA 3GXAA 3OOAA 4GXAA 5H8NA 1TGUA 3GPYA 2ZYNA 2ZNTA 1IXZA 1Y8GA 4RKUF 1S9TA 2O68A 5J1DA 2EJSA 3KBZA 2GQ1A 2ERCA 3IAZA 4OVTA 2D21A 3FTDA 4ZEKA 2XXQA 2JUJA 1B5JA 1D2NA 3KJ7A 5IZ3B 3KS8A 1B40A 3V89B 1JNFA 2UYFA 2O1LA 2CEYA 3KOYE 2DWNA 4PQJA 1PBPA 1NJFA 4F1VA 4R6HA 2QPAA 2XEPA 5EYHA 3LSWA 1Q39A 5KZTA 3O9PA 3PUYE 3IB2A 3PMXA 4ITQA 2XWKA 3K2DA 1GLNA 2LBCA 1B51A 1NV1A 1IXRC 1UTBB 4P3LA 1HT1E 2FNAA 1UIVA 3LW5F 3K1JA 2I48A 3SFZA 3NBXX 2F4VM 2UVHA 4MNIA 1E32A 3VK8A 2B3BA 4YB7A 2GFEA 3A46A 1YUBA 4AG5A 4H45A 3OMBA 1ZV1A 2F5QA 1JR3E 4DUZM 1MY0A 1DPPA 3CVGA 4GWZA 4KCCA 4LF9M 4RPNA 4RF0A 4FWDA 3U5ZA 1KWHA 2LAOA 1MXWA 4X1DA 1TF0B 2DHYA 1RDYA 3TL4X 2X7PA 4AS4A 1QVSA 1XNRM 1RDZA 3MJNA 1IXSA 1ZIUA 2RC8A 1A55A 2QMXA 1FPFA 4GWWA 3P7IA 4RJZA 3MVZA 2HCAA 4LJ5A 4O7IA 2HHMA 2K47A 2P3NA 3IFAA 4IGTA 2CV1A 3J27B 1VEJA 3MUQA 2DAEA 3GRRA 4XKNA 3B89A 1VEGA 2DWHA 2QS1A 2HQ0A 3JYRA 5EQ8A 4LQ2A 3K6WA 2H9BA 1NNKA 5IZ1A 3FXBA 4OQOA 4AG6A 5ESYA 4DXBA 2A5SA 1N7XA 1Y3PA 3TTKA 1FJ6A 3CHGA 1R4GA 3DP8A 4LUBA 5F1QA 2KQZA 1IMDA 4ZECA 1EZOA 2XX8A 3T66A 4Z0IA 3R9XB 2C9CA 1IY2A 2VGQA 1OAOC 4W5WA 4GMQA 1QYRA 3CI8A 4Q7JA 2XWIA 2XXVA 4EQ7A 2Q89A 1IQ7A 3KG2A 2G5GX 4H8IA 2QVRA 2RGHA 3PUVE 3UP9A 2EKKA 1NMUA 4N6DA 4QRZA 3HN0A 4X8RA 4KPTA 1P1OA 2RINA 3OEKA 1QUSA 3G7WA 3B7QA 4YKKA 1SXJE 1WXQA 4JI6M 1B9JA 1US4A 2QP9X 2WSCF 4AZFA 4POXA 1JW4A 1JB0F 1QGXA 2B3FA 3GLIE 1JP4A 1PEBA 2VT5A 3LSLA 3SHFA 1YE9A 2DZOB 4NF6B 4CIZA 2DWAA 1XMOM 1MS7A 4KR5A 1NV7A 3VVFA 1D9QA 4JDFA 1US5A 3S9MC 1FRPA 3ILKA 3I51A 3IHPA 4X48A 2FVZA 3K0VA 2C9OA 3CSGA 2QPQA 3KOZE 2XD3A 1NV6A 1QAQA 2HXRA 4G6ZA 3J81S 4I4LA 4IBEA 2XXRA 3O29A 4ZPXA 3TFLA 3HJQA 3U6LA 1DGBA 1RYXA 1K3XA 4G61A 2Q2EB 2Z7JA 4RF1A 2AYSA 4PFWA 2H5XA 4AKGA 2I0CA 3U6MA 3C9PA 1HNZM 4NE4A 1B3LA 4TUWA 3CG1A 3RQTA 2QBYA 3MVWA 5I59A 1J1NA 5KDTB 3PPOA 2X4AA 1N3XA 4HE1A 4NSOB 3NOHA 4N6KA 1IEJA 5ET5A 1JEVA 4F22A 2ZNUA 3Q8XA 5I3SA 4MF3A 3RN8A 4MGIE 3VKGA 4I3YA 3M3LA 4G2ZA 4LG2A 3TCFA 1JR3A 4CGYB 1ATGA 1USYH 3ZQJA 5TP9B 4GH9A 4GQOA 1LB8A 1IZ1A 2DP8A 3CRBA 1B7ZA 3K1NA 3K6XA 3KN7A 4LZJA 4OVZA 2H1RA 3G3FA 3I3VA 2LHGA 4JBZA 4XTCQ 1S50A 1NY6A 1MY3A 5B7DA 1NHWC 4M9SA 3QMFA 4LN5A 3Q8GA 5EQ9A 1OLAA 4PC9A 3U6EA 4GF8A 3OO7A 1A54A 3TWLA 1TWYA 4PT5A 3FE3A 2QRYA 1WGNA 3RFWA 2X26A 2VQFM 1MQHA 5IZZA 2Y7RA 4LQ5A 5KO3A 2NUVA 4P47A 7CATA 3SMPA 4U23A 3T15A 4RXLA 1AIPC 1LFGA 3C31A 2LVNC 4MBPA 3B6TA 1UM8A 4F29A 3M0EA 4X62M 1JVXA 3UMMA 5H8HB 4H8JA 1PB7A 4QSDA 2PBWA 3B7NA 3MJ5A 4JV5M 3LCVB 4YKIA 3FUXA 1JR3D 3N94A 2PCRA 3MQ9A 3K1MA 1FPBA 5ICQA 2I0BA 1SYHA 1OQGA 5AA2B 4X65M 2O25A 1JW1A 3CF2A 2DWJA 4XIGQ 4IO7A 5I84A 1N32M 5I7IA 1XC1A 4FW9A 1FPGA 3SDFA 3U6QA 1FQAA 4MLQA 4R9FA 5IZ3A 1DPEA 4E0XA 1I94M 4MGHA 2MR9A 1OJLA 1PJJA 1MM6A 2NWJA 4REZA 3C35A 5LMNM 2HAVA 4NMYA 2DAKA 3KOXE 1PDAA 1FQDA 1SXJA 3B74A 3OELA 3FJ7A 2Z23A 4CJ6A 3RPLB 3RUMA 3EHUA 3PPPA 2O01F 4HL4A 4IBKA 1ZTYA 4NN3A 5DYHA 3OO6A 1L2BA 1B05A 2QSXA 4GWXA 4F3BA 3TKDA 3LR1A 5CMKA 3CTWB 4GRIA 4GKJM 3LVVA 1B0HA 1XT8A 5LTCA 2LH0A 3GLGB 1VSOA 1NV0A 4HE2A 4QFKA 4QNMA 3U61B 1H45A 4OYVA 3G3KA 3FXRA 3RNNA 2HPGA 2Z8DA 3PMVA 3D1RA 1MXXA 3SZPA 3VK7A 1R9QA 1HSEA 4FATA 3GPXA 1P1UA 5ITUA 5IREB 3PPNA 3LSFB 1B1HA 1RDXA 1FTKA 2F5PA 5EYFA 4IBJA 3GLFB 3UZUA 1SXJD 5ITXE 4I8OA 4G8NA 1D4NA 3T1BA 4K3FA 4FECA 2JY6B 4H67A 4OU7A 2R8TA 3K8ZA 1F9BA 1NJGA 4PDGA 3FJGA 2PT2A 5AA4A 3BBRA 4IBCA 5I2NB 1B3GA 3L26A 4H1XA 4YICA 1XXHB 2JNHA 4LF7M 4Q8RA 4AQYM 4BLAA 1XVXA 2JWSA 3MMPA 3KW6A 4NTLA 3LC8A 1Z7NE 3T9UA 1NY5A 1IXIA 2I6EA 3O6GA 3BFUA 1GJSA 1MPBA 2B4MA 4LZ5A 1OLCA 2HWJA 1KYIA 1DOTA 1INPA 3AXFA 1MH3A 2CEXA 4ZS9A 1WJ7A 1EU8A 2XA5A 1IMCA 2DNAA 3OEMA 5ITOA 2DAMA 1TDHA 2O7IA 4GFRA 3N5LA 2GHAA 1LBWA 3PMWA 2CHQA 3VDPA 2V3UA 3PPRA 4G4OA 4I1DA 1DGHB 3V76A 1OIZA 3SAUA 1XI6A 3VLVA 1A40A 4PD2A 4FWHA 3V83A 1PBQA 3CFLA 4N4UA 1FTAA 5FSWA 2H4IA 3U93A 3OTOM 4ELOA 2KZSA 2F5XA 2THIA 2YNMD 4JWYA 2CWBA 3GLHE 3FXQA 3CFXA 5H37D 2HFBA 3THGA 5ITRA 4IBBA 3T9XB 4LRSA 3FV2A 3K00A 4U4XA 3HV1A 2MROB 2F35A 3N6UA 3TODA 2R71A 2Z8EA 3PNVA 1MPCA 1K82A 3FGSA 2L4FA 1EYJA 4KYEA 4IO6A 1NNTA 3H7MA 4WP2A 4KT0F 2QSFX 4PGNA 1LEVA 1V34A 1Y3NA 2AL5A 2ZYKA 3M3KA 1ELJA 5EHSA 4PFTA 2O69A 3TTRA 5KDTA 4YKJA 4R71A 3GLFE 3J2PB 3ILTB 2XXHA 1LSTA 3VFJA 2ZXTA 4BBAA 4PDDA 3S9EA 1NNPA 3W9VA 1YXIA 3DELB 4RYAA 4PDIA 2H25A 4NL4H 4EIWA 4PGPA 5TP9A 1XXHE 4ONYA 4QXDA 4MH0E 2REGA 3DOAA 4KODA 1B3FA 2I58A 4IGRA 4MAGA 3FRIA 3GZGA 3IOVA 2VPOA 3VXBA 1IUDA 2Y84A 5IM2A 3VLFB 1VDDA 1O63A 3MP8A 1A8EA 2NVUB 2E5LM 4RNSA 5F7VA 2KEBA 3AOGA 1UFZA 5ELVA 1NO1A 3DP6A 3JZJA 3HHWA 3VFDA 2UVIA 3CIJA 3HCQA 3J7BA 2OLBA 3U6OA 5FTJA 1BKAA 3E79A 4OFOA 3EIEA 1MY4A 2ALUA 1M5DA 1SW1A 2XX7A 2H5YA 5KQDA 3MC2A 4PTKA 2EKFA 2XXTA 1B3EA 2PYYA 1IQPA 4QFPA 4FORA 5CC2A 1NHGC 4GHAA 1UQWA 4PAFA 3THIA 1PC3A 5C18A 4KO8A 3TZAA 1LBBA 1YYZA 4YMAA 4X64M 5A5XB 1E94E 2OQ4A 3DLNA 5EXSA 5I56A 2L7HA 4DDDA 1L1ZA 2CV2A 2WX9A 3I04M 1LCTA 2V93A 2Y7KA 1J7KA 5H8QA 2KNAA 3G3GA 3MZBA 2OZZA 1H3DA 1JQFA 1QUJA 1FTLA 5I57B 1PB8A 3RT6B 4GX4A 5H8FB 3QWLA 4KHPM 4NSRA 5BWJA 1B4ZA 4F39A 5EP4A 1FBDA 3D8BA 3PUZE 3O6HA 2FBPA 1UTHA 4LZ8A 2I49A 3RPLA 2HCBA 3FKEA 3T9HB 3RGYA 1FW0A 3L28A 1Z6TA 5IGAA 2KNZA 3W67A 5HBCA 3KFMA 5T3JA 1PB9A 4JXIA 2UVGA 2FHYA 4RK2A 4R9GA 3WHLA 4O3BA 1C7YA 2N35A 3AJIB 1QVRA 3GLHA 1IMBA 3ECRA 4FWGA 4TLLB 1SDXA 1KA0A 3D4CA 4F3PA 1L2DA 4O3CA 1YAEA 5FTIA 1FBHA 1WHCA 3BBZA 1MDQA 2VPNA 2P1SA 3A09A 1IN5A 3A3UA 5FHOA 5F3WA 3CFZA 4GKKM 1B32A 1YPNA 3UA8A 1OMPA 4N17A 4NF0A 3C34A 2WYPA 3GLFA 2UXAA 3QIMA 1N75A 2FOIC 1MH4A 2OWZA 2XXXA 1IBKM 1FBEA 1L5TA 2FNCA 2Y20A 3VV5A 4OHNA 5EP3A 4PP0A 3JAMS 5K2YA 3C4MA 1NI9A 1O64A 4DIGA 4NF5B 2OX3A 5I2NA 3FUVA 4K0KM 3E3KA 1XXHA 4NWDA 5DNYA 2WKYA 3MP1A 1G4AE 2ZNSA 1Q35A 2QENA 3MW0A 1EZPA 4D82A 2ABHA 3ROJA 1IFYA 3UGWA 3IR1A 2O7UA 4P1EA 1ORYB 3QYBA 1NFTA 5IKBA 3FIRA 3U6DA 3ONMA 3EIHA 3RY3A 1TXFA 4NRVA 4G8HA 2O1MA 2RF1A 4EQBA 4OWDA 2V1CA 4KYSA 2R45A 4M9ZA 3HHFA 1W5TA 4ZEIA 4YY3M 5ITYA 2E0SA 4NF4B 3OD7A 4QFNA 1MQDA 3VVDA 4LJ7A 4OVQA 4GEWA 3K01A 1PJQA 3LQQA 4KLNA 5EJCA 1N76A 2LHCA 3PD9A 1N78A 4GWUA 1SW5A 1Y4TA 4GX6A 4R72A 3TYHA 4LZ7A 4P56A 4EF2A 1Q1KA 4GOTA 2I4BA 5GKNA 4GWSA 5IWAM 4YB6A 3TCHA 1OIBA 2RCBA 5KPRA 3FYDA 3I4YA 4IJEA 4MGYE 2BJVA 2DSFA 3IJXB 4OMBA 4GWOA 1N33M 2HKJA 4AKHA 1BLFA 3MBPA 2DVCA 4XXUA 1LCFA 1KSFX 3HU3A 1VDWA 4AB5A 2F3DA 3I4VA 1LBVA 4OETA 4R7GA 4F1YA 2ZTCA 4X66M 3H4JA 2Z8YM 2Z4SA 2XZFA 1QANA 1WR1B 3KN3A 4IO3A 4B3SM 4WEDA 4HXVA 1GL6A 3TPZA 3HHGA 4G4RA 1HR0M 4YHHM 4DR7M 3C36A 4WW0A 5C1BA 1AUAA 3QAXA 3OO9A 3MSTA 3JR5A 2QL3A 1VE4A 3RLFE 1XMQM 4F3SA 2D3IA 3FVOA 1K9ZA 2V6ZM 4JI2M 3B8BA 4JI1M 4GLIA 3A3CA 1TR8A 5EXPA 2ZANA 3N26A 4DV6M 4BDRA 4R73A 4MJOA 5DW8A 4LFAM 1XHYA 4H6DA 3OXNA 3KOTA 2G8LA 4U1OA 5AE4A 1MQGA 1PJSA 4U21A 3U92A 4EQ9A 1T3TA 3IG5A 2GHBA 3JR4A 4XF5A 4N8GA 3I01M 4RK9A 3SATA 2L4EA 4R2FA 1IMFA 5KCJB 4NXNM 4X9TA 4YKPA 1P1NA 2KW0A 5JK4A 4GC9A 5DYGA 2LVPC 4MNPA 4IY6A 1B46A 1H43A 2UUBM 3HHYA 4GL0A 1PJTA 4HEOA 1IIWA 3EQ1A 5L8RF 1OFIA 4GXSB 2DDKA 4Z7EA 3S9NC 1YZ0A 3V8XB 3MWBA 1FNNA 1B4HA 3U1OA 2XFTA 2FA7A 4GRKA 1B7HA 1MDP1 1IN4A 1I69A 5A5XA 2KXEA 1LAXA 4R3DA 4P9KA 1JETA 1EZ9A 1V33A 2YJPA 1AH5A 2F7CA 4PCZA 1G59A 2UVJA 1T43A 2ONRA 1FBCA 1MG1A 1TH2A 1TFAA 1B5IA 1MQIA 3HWSA 2JP7A 2ZM6M 1QJMA 4L17A 4RY1A 5DTBA 4AQ4A 2NXOA 2XWOA 3FRHA 4DR4M 3FTCA 2VP1A 2XXUA 2MGWA 4ZEDA 4FAJA 1FTJA 3H6UA 1LAHE 5I57A 4BDLA 3E21A 4F18A 5EXTA 1URGA 1AIVA 5H8FA 4LF4M 3SMSA
chains in the Genus database with same CATH topology
1ZKBA 2P2AA 1FQBA 2HZLA 2HXWA 4ZZAA 4NXMM 4OERA 4QOSA 3AOEA 3H6VA 5CBRA 2XGNA 4PE5B 4DV5M 1YTVA 5EQTA 4QSEA 2IA4A 5IAIA 1HNWM 2VD3A 1QZMA 3LVWA 2ZMBA 1Q3CA 1WODA 4NOOB 1B1XA 2V25A 5H8SA 3G3HA 3SEXA 3Q28A 1B5HA 3WAEA 3L2AA 4I5SA 1A8FA 1HQYE 3KSXA 3L6HA 1MXUA 4LJ6A 5L8DA 3U72A 5FTHA 1CB6A 1J09A 3FUWA 3QYTA 3UIFA 3SEUA 3BFTA 1IY0A 2W7YA 1T0KA 2UUCM 4JI7M 2XZUA 4DZ1A 1RYOA 2L7IA 1XS5A 3E4RA 1FCKA 3MAMA 4DXUA 1XC8A 3KN8A 2GRVA 1R6BX 4NF5A 3EPEA 4XGIA 3QAUA 4MM3B 3B9PA 3PVSA 1MXYA 5HM4B 4KQPA 4GC5A 4M0DA 4FCVA 1B3HA 2C99A 2H99A 5CMBA 3GP1A 2V3TA 1DGGA 1UTBA 5CRYA 4XBOA 3UJNA 2YPNA 1G41A 3UORA 2QS4A 1HQCA 4N6PA 1MQJA 1P99A 2QMWA 4MLVA 3T22A 1R1NA 1NNFA 4IJFA 4G68B 4BDNA 1G8PA 3SEWA 1R2YA 3U8QA 1QW0A 3SETA 4ZE9A 2KRUA 3ZKLA 1DMBA 1XHBA 3R7XA 4QHTA 3FYCA 4BDOA 3SARA 3KGCA 4OENA 3WHKA 3HHZA 4LRTA 4JI0M 3ODBA 4QOZC 3KSJA 5H8NB 4GVOA 3EHSA 3T1YM 5EP1A 4JSDA 4RNAA 3HPIA 3KP0E 4X1BA 4LJ9A 4TQUQ 1HNXM 5L9OA 4RA1A 4OFJA 4R74A 4DLDA 1POTA 3ZKKA 3MVXA 3PNYA 4JI4M 2OK2A 4H5GA 3KJTA 4IY5A 4BDMA 1SW4A 4Q5TA 3KEIA 4DV1M 3DM0A 4LGYA 5E6JA 4WXJA 2QS2A 2DOJA 3H6WA 4ESWA 4N07A 1N04A 2F5OA 2UYEA 4L8RC 4OZ9A 3IORA 2Y7WA 4YU0A 4H65A 3A42A 3WAFA 3U6SA 3PU5A 4WURA 1LLSA 2Z22A 2KA6B 4GHLA 3J80S 4R75A 2X49A 2CV0A 3ZS6A 3KFUG 1GVCA 1Z59A 2O5RA 3PUWE 4Q30B 2C96A 4II7A 2R46A 4AI6A 3GQ4A 3U5ZB 4U2RA 1QUIA 3I5OA 4L4UA 1I6AA 1IXHA 1TDZA 5E26A 4NF6A 3M7GA 4DV0M 3LUYA 1MY2A 3VLUA 3K6UA 1GL7A 4B7HA 2R9JA 4XKRA 1B7UA 1M5EA 3PGFA 3Q27A 3FD9A 5KCJA 3CR9A 8CATA 4FIMA 3GQ3A 1RKMA 2HHHM 1ZLQA 2M8CA 2LNHC 1DGFA 2X8AA 3HHXA 1LFIA 4KCDA 2UXDM 1N77A 1N36M 1M5FA 5KQ8A 5TPAB 5KPTA 1ZMGA 1XNQM 2F5SA 4EXKA 3EN3A 3O66A 3T9VA 2VD2A 4BLCA 3TELA 1SQYA 5JI2E 1FQCA 1URSA 3PD8A 4JWXA 4YZZA 4DXCA 3A98B 2CE7A 3OO8A 3U6PA 4U22A 3D8LA 3AKZA 1LB9A 3DFZA 2Y21A 4QF9A 5JEIA 2XXYA 1MXVA 2L6OA 4IB2A 2XD2A 5ITQA 3GLBA 3IG8A 3B7DA 1QAMA 5CMMA 1QULA 4LVQA 1FTMA 2HAUA 2CEAA 1Y1ZA 2EUCA 4LF5M 3S4UA 4LCBA 4XKPA 3T38A 3UN6A 1Y20A 2VIIA 4DR2M 1MX0A 4P11A 5LMUM 4ZDMA 3IB0A 1JEUA 4EXLA 1AOVA 2NQ8C 4A3VB 3TAJA 2I7PA 3PXGA 1Y1MA 5FHNA 1GKIA 2ONSA 5H8HA 5FLXS 2PT1A 4D80A 3MPKA 1H44A 1EH3A 3RGPA 2FE8A 2VHAA 1TH3A 3FV1A 2OPFA 3VKHA 1IITA 1NNJA 4I9DA 3FZVA 5AA2A 3E9SA 2D5WA 3W0FA 5HPQA 1LFHA 4FCTA 4C1TA 4G4PA 5JTYB 2YFQA 4D81A 4IO5A 5I2KB 2Z8FA 2KZUA 4XKQA 4G68C 3SASA 3R26A 5CMCA 5DVJA 3C58A 2HEUA 4OTEA 4POWA 3SBJA 2PX1A 2L09A 5IZ7D 2DWIA 5K2XA 3GRUA 3MZ9A 3AFHA 2DE2A 4ZE8A 5BUUA 2Q2AA 4OVZB 1MM7A 2F78A 3W0LB 2V3QA 3GRVA 1OVTA 3SEVA 3GLGA 2ZBKB 1VFEA 4DV2M 3U61A 4YAHX 4I8CA 2M60A 5AA2D 1N34M 2UU9M 3UK6A 3VE1B 3RE8A 4FE8A 4KD5A 1OQHA 4NF8B 5CBSA 3RTFB 4MFIA 4LATA 1AL3A 4ESXA 3LMMA 4L16A 1B2HA 2D7HA 3FJMA 4OFLA 3JV9A 1ZBMA 4GITA 4LF6M 4QFOA 3RGSA 4L78A 5JI3E 3R6UA 1J5EM 1VFDA 1GVNA 3OSRA 1TH4A 1GR2A 1Y9UA 2DQVA 4B08A 3ZC7B 2YLNA 4JSOA 3ILUB 1QQWA 2YQZA 4LFCM 3MP6A 1NNUC 3L6GA 4KYDA 4KI0E 3R8FA 4OW0A 3OSQA 1PM5A 1IBMM 3EHTA 2AIXA 2CHGA 1OVBA 1L8QA 1JQJC 5B70A 4M9XA 3O2AA 4DCYA 2F97A 4DUYM 4NEDA 3DP4A 3IJOB 3GBBA 1SXJB 3O28A 1BP5A 1A99A 2ESNA 2LXEA 4P0GA 1R6ZA 1HT2E 3KXEC 4LJAA 3IB1A 1YCJA 4NRWA 3W15C 2DWZB 3K92A 1A7LA 2F36A 3GLIB 4QHQA 4UACA 4M4GA 2Z4RA 4P0IA 1E9SA 1BTJA 2O84X 3QK6A 2XLJA 3FVNA 1XOCA 2I7NA 4B3RM 4EUOA 4LY6A 4DCXA 3SYLA 2V84A 1DGHA 2XX9A 3M8UA 3ZSFA 2A5TB 2NOOA 3QSLA 3NWLA 4QNRA 2F6GA 3L25A 4FJPA 2GH9A 3MHVC 4LZZA 4B7GA 4I62A 3RPWA 1FQEA 1NH7A 3H06B 2XXWA 3FVGA 5DT6A 1NVMA 1II5A 3T93B 1LAFE 1B58A 4F3GA 1NH8A 5KPZA 3QUJA 4DV7M 3U6CA 3KOSA 1BIYA 3HKPA 4JXJA 5AA3A 1XWIA 3TDJA 1B52A 1YSYA 4UA8A 4F1UA 2KRKA 5EHMA 4R6KA 3HU1A 5AA4B 1AMFA 2R18A 5TPAA 1W5SA 2G29A 4AKIA 3H03A 1EE8A 3TPAA 1NSFA 4ZZEA 4GL8A 3VXCA 3K02A 1NL5A 3EF7A 1O7TA 3MVYA 3C9HA 1MXZA 1SI1A 2AL4A 4ELPA 1P1WA 1P1QA 3MK6A 1ANFA 3K1PA 4Z6YA 1R2ZA 1ZJLA 2UXCM 4DV4M 4R6YA 4LONB 3IX1A 3O6IA 3GPUA 3HO7A 1IXGA 2D7GA 4DR3M 3IOWA 4IBGA 1MY1A 2ONKE 3HSTA 2DVZA 4OEVA 3BKIB 3GRYA 2CUZA 4OX9M 1N0TA 2V1UA 3QUFA 1N84A 4MB7A 1SVXB 4F31B 3VVEA 3LQRA 5I58B 4JWOA 4L15A 4LGMA 3TTNA 3SKPA 3KZGA 4FEBA 3V5AA 5BPVA 4DE8A 3L29A 1L1TA 3Q25A 1SYIA 1TFDA 2R4EA 3FTFA 1GV8A 4F2OA 4IBIA 3CF6E 1QKAA 2CZLA 1OFHA 3HU2A 1JW5A 4PFYA 4WEPA 2XXPA 4IO4A 5JTYA 2DS9A 2F7AA 2CHVA 1UIUA 1GTKA 5I2KA 4JI8M 4QSCA 4YMBA 1IN6A 2QCUA 5FHMA 2ZYOA 4MH5A 3TQLA 1SD3A 3BOSA 1D9VA 5EXXA 3FXUA 2CFOA 2UXBM 5DEXB 1IN8A 1R7RA 1H76A 3U60B 3FVKA 3AOEC 4G77A 3IL1B 4MGZE 4LP2B 5FTNA 1N7WA 1PJIA 1IY1A 3SAWA 2RC7A 1LBCA 2B65A 3FATA 4PFUA 4CISA 3SAVA 2AHMA 5ICTA 2IEEA 3TEPA 3K4UA 5L9SA 2I4CA 5LOMA 1DTGA 4G4QA 4B3MM 2DHRA 3K2LA 2ANJA 3N6TA 2P0SA 2XSZA 3KS4A 5L9MA 4NF8A 3S9LC 2HZKA 2BJJX 4THIA 4G8MA 3HJ8A 1LGBC 1S7YA 3J7AS 5ITPA 1SBPA 1D9YA 1R9LA 1NKXA 4OVJA 4OEUA 3KP1E 3RTWB 5ITTA 1Z5AA 2OWTA 2EO2A 3HJSA 1SW2A 1SXJC 5I56B 2DXRA 2QS3A 2DE4A 1DO2A 2ZAOA 1QAOA 2Q2CA 3OENA 3CSBA 4ND9A 4IIWA 4GIPA 3HGIA 1Y4CA 5H8QB 1Z5CA 2W82A 2VOZA 1USYE 1XVYA 1VR5A 1IBLM 4OESA 3CF0A 3UK4A 4WKMA 2QJEA 3KVWA 1FQFA 3SEYA 1JVYA 3PUXE 4TOZA 1UTHB 3I6VA 5DVIA 4F19A 2OWSA 2XSZD 3FD3A 1SI0A 3ZCBB 4ELRA 1DO0A 1TT1A 4BDQA 3KOWE 3GLIA 4KHZE 4GD5A 4O3AA 4NF4A 2G93A 2DVWB 3K6VA 4Q0CA 3G3JA 2M5ZA 3DZDA 3TQSA 3GLHB 2R62A 1ZAEA 4U1ZA 4FVMA 1B0LA 2A5TA 4HCYA 4CHTB 4C1UA 4E0WA 3D4GA 2C98A 5FTLA 3PFIA 3FTEA 2R4JA 4R2BA 5M2VA 1IM2A 4I81A 4ZEFA 3KDSE 1L2CA 2Y7IA 4GIZA 2E1SA 2Y0QA 4EDPA 5DVFA 3MPLA 1N3WA 1WVJA 3C32A 4ZEBA 4Z8XA 4OXVA 2KLFA 2O51A 4ISUA 4PETA 1S3SA 1MPDA 3IOTA 2Z3XA 3SHGB 4DR1M 2H98A 1I4WA 2RCAA 3VDFA 2OCUA 2BJWA 4LFBM 4EF1A 2R65A 3TE6A 4JB7A 3E13X 3TWKA 4QFLA 2D7EA 2EA0A 3TUSA 1FTOA 2A5YB 1G3IA 4FCWA 2DXIA 2HL7A 3TWMA 4AB6A 3GQ5A 1LV7A 4LJ8A 4KFQA 3RT8A 5IT9S 5EP2A 1DTZA 2F8DA 3VDUA 1WDNA 5BR8M 5FTMA 3PV0E 3LSXA 3MZ1A 3IK6B 3A45A 3DA1A 3H3GA 2FFJA 2I3VA 4BB9A 2J7OA 4C0RA 1IXSB 3LBSA 4JI5M 1IXCA 3IO4A 5AA1A 1IN7A 1QKBA 2C5RA 2OBGA 5A2QS 4HTGA 5I58A 2VQEM 4NWCA 3F11A 4HLQA 5FTKA 1LAGE 2DZNB 1M5CA 2O6AA 2XH9A 3T96B 3W9WA 2OJTA 3Q29A 1KFVA 3S2VA 3FUUA 4HCWA 3H4MA 3TTMA 1MRPA 1H6UA 3G3IA 1ZU0A 3H6TA 4LF8M 4H5FA 1I6BA 4F2QA 3B6QA 2XXIA 3AL0C 2RGOA 2RC9A 3TTLA 2ZAMA 4B3TM 4DR6M 4H0WA 3M6AA 3NBIA 2XHDA 1URDA 5DEXA 4M0WA 3VLWA 3U60A 4IBDA 4MGKE 3SERA 3UGJA 3PPQA 2Q88A 2Y0TA 3T1HM 2DXYA 1Q3BA 1HSJA 5CI5A 1D3KA 4FEDA 3ZH9B 2DWLA 2J7NA 3B6WA 4N13A 4HW8A 3O97A 3USDA 1Y3QA 2Y7PA 3TCGA 5TU0A 4IBFA 1I6QA 2DWMA 2YR0A 2P5TA 2DYXA 2DE3A 2PVUA 3SYKA 5CM6A 3AV0A 3L27A 2X7QA 1QUKA 2F6PA 4P16A 3GO8A 1HSLA 5ITXA 2Q8JA 3QXMA 1ZQ9A 4JI3M 3IOUA 4ECFA 3TMGA 2LWXA 2QBYB 1C1KA 5I59B 1X37A 2XF3A 2R6GE 2PMSA 1E9RA 4RPOA 4FD2A 1FJGM 4DR5M 2REJA 2BNKA 2I3WA 4AW4A 3M3FA 2F7BA 3IO6A 2FYIA 4DV3M 3FASA 2ZYMA 3C33A 2F5NA 3KBRA 4JYAM 3FUZA 5ISUA 1DSNA 3TQWA 3SC3A 4G4NA 1GGGA 4B7FA 4IO2A 4LA9A 1CE2A 4U4SA 1POY1 2F34A 1Z7ME 4M1VA 1MU5A 2CMOA 2RKMA 3GBAA 2QZ4A 1K3WA 4JN6A 3CG3A 4G68A 4HS7A 3E9XA 2Q9TA 4YB5A 4TLMB 1B6HA 2RKOA 3GPPA 3H4ZA 3Q26A 2UUAM 3FUTA 2JA2A 4ELQA 1Z5BA 1M5BA 3SESA 5DYIA 4LJ4A 3U94A 4QHSA 2XFSA 4S12A 3GXAA 3OOAA 4GXAA 5H8NA 1TGUA 3GPYA 2ZYNA 2ZNTA 1IXZA 1S9TA 2O68A 5J1DA 2ERCA 3IAZA 2D21A 3FTDA 4ZEKA 2XXQA 1B5JA 1D2NA 3KJ7A 3KS8A 1B40A 3V89B 1JNFA 2UYFA 2O1LA 3KOYE 2DWNA 4PQJA 1PBPA 1NJFA 4F1VA 4R6HA 2QPAA 2XEPA 3LSWA 1Q39A 5KZTA 3O9PA 3PUYE 3IB2A 3PMXA 4ITQA 3K2DA 1GLNA 1B51A 1UTBB 1IXRC 1HT1E 2FNAA 1UIVA 2I48A 3K1JA 3SFZA 2F4VM 2UVHA 1E32A 3VK8A 2B3BA 4YB7A 2GFEA 3A46A 1YUBA 4AG5A 3OMBA 2F5QA 4DUZM 1MY0A 1DPPA 3CVGA 4KCCA 4LF9M 4RPNA 4RF0A 4FWDA 3U5ZA 1KWHA 2LAOA 1MXWA 4X1DA 3TL4X 2X7PA 1QVSA 1XNRM 3MJNA 1ZIUA 2RC8A 1A55A 2QMXA 3P7IA 4RJZA 3MVZA 2HCAA 4LJ5A 2K47A 4IGTA 2CV1A 3J27B 3MUQA 3GRRA 4XKNA 2DWHA 2QS1A 2HQ0A 3JYRA 4LQ2A 3K6WA 2H9BA 1NNKA 4OQOA 4AG6A 4DXBA 2A5SA 1N7XA 1Y3PA 3TTKA 3DP8A 4LUBA 5F1QA 4ZECA 1EZOA 2XX8A 3T66A 4Z0IA 3R9XB 2C9CA 1IY2A 2VGQA 4W5WA 4GMQA 1QYRA 3CI8A 2XXVA 4EQ7A 2Q89A 1IQ7A 3KG2A 2G5GX 4H8IA 2RGHA 3PUVE 3UP9A 1NMUA 4QRZA 3HN0A 4KPTA 1P1OA 2RINA 3OEKA 3G7WA 4YKKA 1SXJE 1WXQA 4JI6M 1B9JA 1US4A 2QP9X 4AZFA 4POXA 1JW4A 2B3FA 1PEBA 3LSLA 3SHFA 1YE9A 2DZOB 4NF6B 2DWAA 1XMOM 1MS7A 4KR5A 3VVFA 4JDFA 1US5A 3S9MC 3ILKA 3I51A 4X48A 3K0VA 2C9OA 3CSGA 2QPQA 3KOZE 2XD3A 1QAQA 4G6ZA 3J81S 4I4LA 4IBEA 2XXRA 3O29A 4ZPXA 3TFLA 3HJQA 3U6LA 1DGBA 1RYXA 1K3XA 2Q2EB 2Z7JA 4RF1A 2AYSA 4PFWA 4AKGA 2I0CA 3U6MA 1HNZM 4NE4A 1B3LA 4TUWA 3CG1A 3RQTA 2QBYA 3MVWA 5I59A 1J1NA 5KDTB 3PPOA 2X4AA 1N3XA 4NSOB 1IEJA 1JEVA 4F22A 2ZNUA 3Q8XA 4MF3A 3RN8A 4MGIE 3VKGA 3M3LA 4G2ZA 4LG2A 3TCFA 1JR3A 4CGYB 1ATGA 1USYH 5TP9B 4GH9A 4GQOA 1LB8A 1IZ1A 2DP8A 3CRBA 1B7ZA 3K1NA 3K6XA 3KN7A 4LZJA 4OVZA 2H1RA 3G3FA 3I3VA 4JBZA 4XTCQ 1S50A 1NY6A 1MY3A 5B7DA 1NHWC 4M9SA 1OLAA 3U6EA 4GF8A 3OO7A 1A54A 3TWLA 1TWYA 4PT5A 2QRYA 3RFWA 2X26A 2VQFM 1MQHA 2Y7RA 4LQ5A 5KO3A 2NUVA 7CATA 3SMPA 4U23A 3T15A 4RXLA 1LFGA 3C31A 4MBPA 3B6TA 1UM8A 4F29A 3M0EA 4X62M 1JVXA 3UMMA 5H8HB 4H8JA 1PB7A 4QSDA 2PBWA 3MJ5A 4JV5M 4YKIA 3FUXA 1JR3D 3N94A 3MQ9A 3K1MA 5ICQA 2I0BA 1SYHA 1OQGA 5AA2B 4X65M 1JW1A 3CF2A 2DWJA 4XIGQ 4IO7A 5I84A 1N32M 1XC1A 4FW9A 3SDFA 3U6QA 1FQAA 4MLQA 4R9FA 1DPEA 4E0XA 1I94M 4MGHA 1OJLA 1PJJA 1MM6A 2NWJA 4REZA 3C35A 5LMNM 2HAVA 4NMYA 3KOXE 1PDAA 1FQDA 1SXJA 3OELA 3FJ7A 2Z23A 3RUMA 3EHUA 3PPPA 4IBKA 4HL4A 1ZTYA 5DYHA 3OO6A 1L2BA 1B05A 2QSXA 4F3BA 3TKDA 3LR1A 5CMKA 3CTWB 4GRIA 4GKJM 3LVVA 1B0HA 1XT8A 2LH0A 3GLGB 1VSOA 4QFKA 4QNMA 3U61B 1H45A 4OYVA 3G3KA 3FXRA 3RNNA 2Z8DA 3PMVA 1MXXA 3VK7A 1R9QA 1HSEA 4FATA 3GPXA 1P1UA 5ITUA 5IREB 3PPNA 3LSFB 1B1HA 1FTKA 2F5PA 5EYFA 4IBJA 3GLFB 3UZUA 1SXJD 5ITXE 4I8OA 4G8NA 1D4NA 4K3FA 4FECA 4H67A 4OU7A 3K8ZA 1F9BA 1NJGA 4PDGA 3FJGA 2PT2A 5AA4A 3BBRA 4IBCA 5I2NB 1B3GA 3L26A 4H1XA 4YICA 1XXHB 4LF7M 4Q8RA 4AQYM 4BLAA 1XVXA 3KW6A 4NTLA 3LC8A 1Z7NE 3T9UA 1NY5A 1IXIA 2I6EA 3O6GA 3BFUA 4LZ5A 1MPBA 1OLCA 1KYIA 1DOTA 3AXFA 1MH3A 4ZS9A 1EU8A 3OEMA 5ITOA 2O7IA 1TDHA 4GFRA 3N5LA 2GHAA 3PMWA 2CHQA 3VDPA 2V3UA 3PPRA 4G4OA 4I1DA 1DGHB 3SAUA 3VLVA 1A40A 4PD2A 4FWHA 3V83A 1PBQA 3CFLA 5FSWA 2H4IA 3U93A 3OTOM 4ELOA 2KZSA 2F5XA 2THIA 2YNMD 4JWYA 3FXQA 3CFXA 5H37D 2HFBA 3THGA 5ITRA 4IBBA 3T9XB 4LRSA 3FV2A 3K00A 4U4XA 3HV1A 2F35A 3N6UA 3TODA 2R71A 2Z8EA 3PNVA 1MPCA 1K82A 3FGSA 4KYEA 4IO6A 1NNTA 3H7MA 1Y3NA 2AL5A 2ZYKA 3M3KA 1ELJA 5EHSA 4PFTA 2O69A 3TTRA 5KDTA 4YKJA 3J2PB 3ILTB 2XXHA 1LSTA 3VFJA 2ZXTA 4BBAA 3S9EA 1NNPA 3W9VA 3DELB 4RYAA 4PDIA 2H25A 4NL4H 4EIWA 5TP9A 4ONYA 4MH0E 2REGA 3DOAA 4KODA 1B3FA 2I58A 4IGRA 3GZGA 3IOVA 3VXBA 1IUDA 2Y84A 3VLFB 1VDDA 1O63A 3MP8A 1A8EA 2NVUB 2E5LM 4RNSA 5F7VA 2KEBA 3AOGA 5ELVA 3DP6A 3JZJA 3HHWA 3VFDA 2UVIA 3CIJA 3HCQA 3J7BA 2OLBA 3U6OA 5FTJA 1BKAA 4OFOA 3EIEA 1MY4A 2ALUA 1M5DA 1SW1A 2XX7A 2H5YA 5KQDA 3MC2A 2XXTA 1B3EA 2PYYA 1IQPA 4QFPA 4FORA 5CC2A 1NHGC 4GHAA 1UQWA 3THIA 1PC3A 5C18A 4KO8A 3TZAA 1LBBA 4YMAA 4X64M 5A5XB 1E94E 2OQ4A 3DLNA 5EXSA 5I56A 2L7HA 4DDDA 1L1ZA 2CV2A 1LCTA 2V93A 2Y7KA 1J7KA 5H8QA 3G3GA 3MZBA 2OZZA 1H3DA 1JQFA 1QUJA 1FTLA 5I57B 1PB8A 3RT6B 5H8FB 3QWLA 4KHPM 4NSRA 5BWJA 1B4ZA 4F39A 5EP4A 3D8BA 3PUZE 3O6HA 1UTHA 4LZ8A 2I49A 3T9HB 2HCBA 3FKEA 3RGYA 1FW0A 3L28A 1Z6TA 5HBCA 3KFMA 1PB9A 4JXIA 2UVGA 4RK2A 4R9GA 3WHLA 4O3BA 3AJIB 1QVRA 3GLHA 3ECRA 4FWGA 4TLLB 1SDXA 3D4CA 4F3PA 1L2DA 4O3CA 1YAEA 5FTIA 1MDQA 2P1SA 3A09A 1IN5A 3A3UA 5FHOA 5F3WA 3CFZA 4GKKM 1B32A 1YPNA 3UA8A 1OMPA 3C34A 3GLFA 2UXAA 3QIMA 1N75A 2FOIC 1MH4A 2XXXA 1IBKM 1L5TA 2FNCA 2Y20A 3VV5A 4OHNA 5EP3A 4PP0A 3JAMS 5K2YA 3C4MA 1O64A 4DIGA 4NF5B 5I2NA 3FUVA 4K0KM 3E3KA 1XXHA 4NWDA 5DNYA 2WKYA 3MP1A 1G4AE 2ZNSA 1Q35A 2QENA 3MW0A 1EZPA 2ABHA 4D82A 3UGWA 3IR1A 2O7UA 1ORYB 1NFTA 5IKBA 3FIRA 3U6DA 3ONMA 3EIHA 3RY3A 1TXFA 4NRVA 4G8HA 2O1MA 2RF1A 4EQBA 4OWDA 2V1CA 4KYSA 2R45A 4M9ZA 3HHFA 1W5TA 4ZEIA 4YY3M 5ITYA 2E0SA 4NF4B 3OD7A 4QFNA 1MQDA 3VVDA 4LJ7A 3K01A 3LQQA 4KLNA 5EJCA 1N76A 3PD9A 1N78A 4R72A 1SW5A 1Y4TA 3TYHA 4LZ7A 4EF2A 1Q1KA 4GOTA 2I4BA 5GKNA 5IWAM 4YB6A 3TCHA 1OIBA 2RCBA 5KPRA 3FYDA 3I4YA 4IJEA 4MGYE 2BJVA 2DSFA 3IJXB 4OMBA 4GWOA 1N33M 2HKJA 4AKHA 1BLFA 3MBPA 2DVCA 4XXUA 1LCFA 1KSFX 3HU3A 4AB5A 3I4VA 4OETA 4R7GA 4F1YA 4X66M 2Z4SA 2XZFA 1QANA 3KN3A 4IO3A 4B3SM 4WEDA 1GL6A 3TPZA 3HHGA 4G4RA 1HR0M 4YHHM 4DR7M 3C36A 4WW0A 5C1BA 3QAXA 3OO9A 3JR5A 2QL3A 1VE4A 3RLFE 1XMQM 4F3SA 2D3IA 3FVOA 2V6ZM 4JI2M 4JI1M 4GLIA 3A3CA 5EXPA 2ZANA 3N26A 4DV6M 4BDRA 4R73A 4LFAM 1XHYA 4H6DA 3OXNA 3KOTA 2G8LA 4U1OA 5AE4A 1MQGA 4U21A 3U92A 4EQ9A 1T3TA 3IG5A 2GHBA 3JR4A 4RK9A 3SATA 4R2FA 5KCJB 4NXNM 4X9TA 4YKPA 1P1NA 2KW0A 5JK4A 4GC9A 5DYGA 4IY6A 1B46A 1H43A 3HHYA 2UUBM 4GL0A 1IIWA 3EQ1A 4Z7EA 1OFIA 4GXSB 3S9NC 3V8XB 3MWBA 1FNNA 1B4HA 3U1OA 2XFTA 2FA7A 4GRKA 1B7HA 1MDP1 1IN4A 1I69A 5A5XA 2KXEA 1LAXA 4R3DA 1JETA 1EZ9A 2YJPA 1AH5A 2F7CA 4PCZA 2UVJA 1G59A 2ONRA 1MG1A 1TH2A 1TFAA 1B5IA 1MQIA 3HWSA 2ZM6M 1QJMA 4L17A 4RY1A 5DTBA 4AQ4A 2NXOA 4DR4M 3FTCA 2VP1A 2XXUA 4ZEDA 4FAJA 1FTJA 3H6UA 1LAHE 5I57A 4BDLA 4F18A 5EXTA 1URGA 1AIVA 5H8FA 4LF4M 3SMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKB A;  2P2A A;  1FQB A;  2HZL A;  2HXW A;  4ZZA A;  4OER A;  3H6V A;  5CBR A;  4PE5 B;  1YTV A;  4QSE A;  2IA4 A;  5IAI A;  2VD3 A;  2ZMB A;  1WOD A;  1B1X A;  2V25 A;  5H8S A;  3G3H A;  3SEX A;  3Q28 A;  1B5H A;  3WAE A;  1A8F A;  3KSX A;  3L6H A;  1MXU A;  3U72 A;  5L8D A;  5FTH A;  1CB6 A;  3QYT A;  3UIF A;  3SEU A;  3BFT A;  2W7Y A;  1T0K A;  4DZ1 A;  1RYO A;  1XS5 A;  3E4R A;  1FCK A;  3MAM A;  4DXU A;  3KN8 A;  2GRV A;  4NF5 A;  3EPE A;  1MXY A;  5HM4 B;  4KQP A;  1B3H A;  5CMB A;  2H99 A;  2V3T A;  1UTB A;  5CRY A;  2YPN A;  3UOR A;  2QS4 A;  4N6P A;  1MQJ A;  1P99 A;  2QMW A;  4MLV A;  3T22 A;  1R1N A;  1NNF A;  4G68 B;  4BDN A;  3SEW A;  3U8Q A;  1QW0 A;  3SET A;  4ZE9 A;  3ZKL A;  1DMB A;  3R7X A;  4BDO A;  3KGC A;  4OEN A;  3ODB A;  3KSJ A;  5H8N B;  4GVO A;  3EHS A;  4JSD A;  3HPI A;  4X1B A;  4TQU Q;  5L9O A;  4RA1 A;  4OFJ A;  4R74 A;  4DLD A;  1POT A;  3ZKK A;  3MVX A;  2OK2 A;  4H5G A;  3KJT A;  4IY5 A;  4BDM A;  1SW4 A;  4Q5T A;  3KEI A;  3DM0 A;  4WXJ A;  2QS2 A;  2DOJ A;  3H6W A;  4ESW A;  4N07 A;  1N04 A;  2UYE A;  4OZ9 A;  3IOR A;  2Y7W A;  4YU0 A;  4H65 A;  3WAF A;  3PU5 A;  1LLS A;  2Z22 A;  4R75 A;  3ZS6 A;  1GVC A;  4Q30 B;  3PUW E;  4U2R A;  1QUI A;  3I5O A;  1I6A A;  1IXH A;  4NF6 A;  3LUY A;  1MY2 A;  3VLU A;  3K6U A;  2R9J A;  4XKR A;  1B7U A;  1M5E A;  3PGF A;  3Q27 A;  5KCJ A;  3CR9 A;  4FIM A;  1RKM A;  1ZLQ A;  2M8C A;  1LFI A;  4KCD A;  1M5F A;  5TPA B;  1ZMG A;  4EXK A;  3EN3 A;  3O66 A;  3T9V A;  2VD2 A;  3TEL A;  1SQY A;  1FQC A;  4YZZ A;  1URS A;  3PD8 A;  4JWX A;  4DXC A;  3OO8 A;  4U22 A;  1LB9 A;  4QF9 A;  5JEI A;  2XXY A;  1MXV A;  4IB2 A;  2XD2 A;  3GLB A;  3B7D A;  5CMM A;  1QUL A;  4LVQ A;  1FTM A;  2HAU A;  1Y1Z A;  3S4U A;  4XKP A;  3UN6 A;  1Y20 A;  4P11 A;  4ZDM A;  3IB0 A;  1JEU A;  4EXL A;  1AOV A;  3TAJ A;  1Y1M A;  5FHN A;  2ONS A;  5H8H A;  2PT1 A;  3MPK A;  1H44 A;  1EH3 A;  2VHA A;  3FV1 A;  1IIT A;  4I9D A;  3FZV A;  5AA2 A;  2D5W A;  5HPQ A;  1LFH A;  4C1T A;  4G4P A;  5JTY B;  4IO5 A;  5I2K B;  2Z8F A;  4XKQ A;  4G68 C;  5CMC A;  3R26 A;  5DVJ A;  2HEU A;  4OTE A;  4POW A;  2PX1 A;  2DWI A;  5K2X A;  3MZ9 A;  2DE2 A;  4ZE8 A;  5BUU A;  2Q2A A;  1MM7 A;  2F78 A;  2V3Q A;  1OVT A;  3SEV A;  1VFE A;  4YAH X;  4I8C A;  5AA2 D;  3VE1 B;  4FE8 A;  4KD5 A;  1OQH A;  4NF8 B;  5CBS A;  3RTF B;  4MFI A;  4LAT A;  1AL3 A;  4ESX A;  1B2H A;  3FJM A;  4OFL A;  3JV9 A;  1ZBM A;  4QFO A;  3R6U A;  1VFD A;  3OSR A;  1GR2 A;  1Y9U A;  2DQV A;  2YLN A;  4JSO A;  3ILU B;  3MP6 A;  3L6G A;  4KYD A;  4KI0 E;  3OSQ A;  3EHT A;  2AIX A;  1OVB A;  5B70 A;  3O2A A;  4DCY A;  2F97 A;  4NED A;  3DP4 A;  3IJO B;  3GBB A;  3O28 A;  1BP5 A;  1A99 A;  2ESN A;  4P0G A;  1R6Z A;  3IB1 A;  1YCJ A;  3W15 C;  1A7L A;  2F36 A;  4QHQ A;  4UAC A;  4M4G A;  4P0I A;  1BTJ A;  2O84 X;  3QK6 A;  3FVN A;  1XOC A;  4EUO A;  4DCX A;  2V84 A;  2XX9 A;  3M8U A;  3ZSF A;  2A5T B;  2NOO A;  3QSL A;  2F6G A;  4FJP A;  2GH9 A;  4I62 A;  3RPW A;  1FQE A;  1NH7 A;  3H06 B;  2XXW A;  3FVG A;  5DT6 A;  1II5 A;  3T93 B;  1LAF E;  1B58 A;  4F3G A;  1NH8 A;  3QUJ A;  3KOS A;  1BIY A;  5AA3 A;  3TDJ A;  1B52 A;  4UA8 A;  4F1U A;  5EHM A;  4R6K A;  5AA4 B;  1AMF A;  5TPA A;  2G29 A;  3H03 A;  3TPA A;  4ZZE A;  4GL8 A;  3VXC A;  3K02 A;  1NL5 A;  3EF7 A;  1O7T A;  3MVY A;  3C9H A;  1MXZ A;  1SI1 A;  2AL4 A;  4ELP A;  1P1W A;  1P1Q A;  1ANF A;  3K1P A;  1ZJL A;  4R6Y A;  4LON B;  3IX1 A;  3O6I A;  3HO7 A;  1IXG A;  3IOW A;  1MY1 A;  2ONK E;  3HST A;  2DVZ A;  4OEV A;  3BKI B;  1N0T A;  3QUF A;  1N84 A;  1SVX B;  4F31 B;  3VVE A;  5I58 B;  4JWO A;  3TTN A;  3SKP A;  3KZG A;  4FEB A;  3V5A A;  4DE8 A;  3Q25 A;  1SYI A;  1TFD A;  1GV8 A;  4F2O A;  1QKA A;  2CZL A;  1JW5 A;  4PFY A;  4WEP A;  2XXP A;  4IO4 A;  5JTY A;  2DS9 A;  2F7A A;  1UIU A;  1GTK A;  5I2K A;  4QSC A;  4YMB A;  5FHM A;  2ZYO A;  4MH5 A;  3TQL A;  1SD3 A;  1D9V A;  3FXU A;  5DEX B;  1H76 A;  3FVK A;  4G77 A;  3IL1 B;  4LP2 B;  1N7W A;  2RC7 A;  1LBC A;  2B65 A;  3FAT A;  4PFU A;  5ICT A;  2IEE A;  3TEP A;  3K4U A;  5L9S A;  2I4C A;  5LOM A;  1DTG A;  2ANJ A;  3N6T A;  2P0S A;  5L9M A;  4NF8 A;  3S9L C;  2HZK A;  2BJJ X;  4THI A;  4G8M A;  1LGB C;  1S7Y A;  5ITP A;  1SBP A;  1D9Y A;  1R9L A;  1NKX A;  4OVJ A;  4OEU A;  3RTW B;  2OWT A;  1SW2 A;  5I56 B;  2DXR A;  2QS3 A;  2DE4 A;  2Q2C A;  3OEN A;  3CSB A;  4ND9 A;  1Y4C A;  5H8Q B;  2VOZ A;  1USY E;  1XVY A;  1VR5 A;  4OES A;  3UK4 A;  4WKM A;  2QJE A;  1FQF A;  3SEY A;  1JVY A;  3PUX E;  4TOZ A;  1UTH B;  3I6V A;  5DVI A;  4F19 A;  2OWS A;  3FD3 A;  1SI0 A;  4ELR A;  1TT1 A;  4BDQ A;  4KHZ E;  4GD5 A;  4O3A A;  4NF4 A;  2G93 A;  3K6V A;  4Q0C A;  3G3J A;  4U1Z A;  1B0L A;  2A5T A;  4HCY A;  4C1U A;  4E0W A;  3D4G A;  4R2B A;  5M2V A;  4ZEF A;  2Y7I A;  4GIZ A;  2E1S A;  4EDP A;  5DVF A;  3MPL A;  1N3W A;  1WVJ A;  3C32 A;  4ZEB A;  4OXV A;  2KLF A;  2O51 A;  4ISU A;  4PET A;  1MPD A;  3IOT A;  2H98 A;  2RCA A;  3VDF A;  2OCU A;  4EF1 A;  4JB7 A;  3E13 X;  4QFL A;  3TUS A;  1FTO A;  4AB6 A;  4KFQ A;  3RT8 A;  1DTZ A;  2F8D A;  1WDN A;  3PV0 E;  3LSX A;  3MZ1 A;  3IK6 B;  3H3G A;  2I3V A;  4C0R A;  3LBS A;  1IXC A;  3IO4 A;  5AA1 A;  1QKB A;  2OBG A;  4HTG A;  5I58 A;  4NWC A;  3F11 A;  1LAG E;  1M5C A;  2O6A A;  3T96 B;  3W9W A;  2OJT A;  3Q29 A;  3S2V A;  4HCW A;  3TTM A;  1MRP A;  3G3I A;  1ZU0 A;  3H6T A;  4H5F A;  1I6B A;  4F2Q A;  3B6Q A;  2XXI A;  2RC9 A;  3TTL A;  4H0W A;  2XHD A;  1URD A;  5DEX A;  3VLW A;  3SER A;  3PPQ A;  2Q88 A;  2DXY A;  1HSJ A;  5CI5 A;  1D3K A;  4FED A;  3B6W A;  4N13 A;  4HW8 A;  3O97 A;  3USD A;  1Y3Q A;  2Y7P A;  3TCG A;  5TU0 A;  1I6Q A;  2DYX A;  2DE3 A;  2PVU A;  5CM6 A;  2X7Q A;  1QUK A;  2F6P A;  1HSL A;  2Q8J A;  3QXM A;  3IOU A;  4ECF A;  3TMG A;  5I59 B;  2R6G E;  2PMS A;  4RPO A;  2REJ A;  2I3W A;  3M3F A;  2F7B A;  3IO6 A;  2FYI A;  3FAS A;  2ZYM A;  3C33 A;  3KBR A;  3FUZ A;  5ISU A;  1DSN A;  3TQW A;  1GGG A;  4IO2 A;  4LA9 A;  1CE2 A;  4U4S A;  1POY 1;  2F34 A;  1Z7M E;  4M1V A;  2CMO A;  2RKM A;  3GBA A;  3CG3 A;  4G68 A;  4HS7 A;  3E9X A;  2Q9T A;  4YB5 A;  4TLM B;  1B6H A;  3H4Z A;  3Q26 A;  4ELQ A;  1M5B A;  3SES A;  3U94 A;  3GXA A;  4GXA A;  3OOA A;  5H8N A;  2ZYN A;  2ZNT A;  1S9T A;  2O68 A;  5J1D A;  3IAZ A;  2D21 A;  4ZEK A;  2XXQ A;  1B5J A;  3KJ7 A;  1B40 A;  3V89 B;  1JNF A;  2UYF A;  2O1L A;  4PQJ A;  1PBP A;  4F1V A;  4R6H A;  3LSW A;  5KZT A;  3O9P A;  3PUY E;  3IB2 A;  3PMX A;  3K2D A;  1B51 A;  1UTB B;  1UIV A;  2I48 A;  2UVH A;  2B3B A;  4YB7 A;  2GFE A;  3OMB A;  1MY0 A;  1DPP A;  3CVG A;  4KCC A;  4RPN A;  1KWH A;  2LAO A;  1MXW A;  4X1D A;  2X7P A;  1QVS A;  3MJN A;  1ZIU A;  2RC8 A;  1A55 A;  2QMX A;  3P7I A;  4RJZ A;  3MVZ A;  2HCA A;  4IGT A;  3MUQ A;  4XKN A;  2DWH A;  2QS1 A;  2HQ0 A;  3JYR A;  4LQ2 A;  3K6W A;  2H9B A;  1NNK A;  4OQO A;  4DXB A;  2A5S A;  1N7X A;  1Y3P A;  3TTK A;  3DP8 A;  4LUB A;  5F1Q A;  4ZEC A;  1EZO A;  2XX8 A;  3T66 A;  4Z0I A;  2VGQ A;  3CI8 A;  2XXV A;  4EQ7 A;  2Q89 A;  1IQ7 A;  3KG2 A;  4H8I A;  3PUV E;  3UP9 A;  1NMU A;  4QRZ A;  3HN0 A;  4KPT A;  1P1O A;  2RIN A;  3OEK A;  3G7W A;  4YKK A;  1B9J A;  1US4 A;  4POX A;  1JW4 A;  2B3F A;  1PEB A;  3LSL A;  4NF6 B;  2DWA A;  1MS7 A;  4KR5 A;  3VVF A;  4JDF A;  1US5 A;  3S9M C;  4X48 A;  3K0V A;  3CSG A;  2QPQ A;  2XD3 A;  2XXR A;  3O29 A;  3TFL A;  1RYX A;  2AYS A;  4PFW A;  2I0C A;  4NE4 A;  1B3L A;  3CG1 A;  3RQT A;  3MVW A;  5I59 A;  1J1N A;  5KDT B;  3PPO A;  1N3X A;  1IEJ A;  1JEV A;  4F22 A;  2ZNU A;  4MF3 A;  3RN8 A;  3M3L A;  4G2Z A;  3TCF A;  1USY H;  1ATG A;  5TP9 B;  4GQO A;  1LB8 A;  1IZ1 A;  2DP8 A;  3CRB A;  1B7Z A;  3K1N A;  3K6X A;  3KN7 A;  3G3F A;  3I3V A;  4JBZ A;  4XTC Q;  1S50 A;  1MY3 A;  5B7D A;  1OLA A;  4GF8 A;  3OO7 A;  1A54 A;  1TWY A;  2QRY A;  2X26 A;  1MQH A;  2Y7R A;  4LQ5 A;  2NUV A;  4U23 A;  4RXL A;  1LFG A;  3C31 A;  4MBP A;  3B6T A;  4F29 A;  1JVX A;  5H8H B;  4H8J A;  1PB7 A;  4QSD A;  2PBW A;  4YKI A;  3N94 A;  3MQ9 A;  3K1M A;  5ICQ A;  2I0B A;  1SYH A;  1OQG A;  5AA2 B;  1JW1 A;  2DWJ A;  4XIG Q;  4IO7 A;  5I84 A;  1XC1 A;  3SDF A;  4MLQ A;  1FQA A;  4R9F A;  1DPE A;  4E0X A;  2NWJ A;  1MM6 A;  3C35 A;  2HAV A;  4NMY A;  1PDA A;  1FQD A;  3OEL A;  3FJ7 A;  2Z23 A;  3RUM A;  3EHU A;  3PPP A;  1ZTY A;  5DYH A;  3OO6 A;  1B05 A;  2QSX A;  4F3B A;  3TKD A;  3LR1 A;  5CMK A;  1B0H A;  1XT8 A;  1VSO A;  4QFK A;  1H45 A;  4OYV A;  3G3K A;  3FXR A;  3RNN A;  2Z8D A;  3PMV A;  1MXX A;  1R9Q A;  1HSE A;  4FAT A;  1P1U A;  3PPN A;  3LSF B;  1B1H A;  1FTK A;  5EYF A;  4G8N A;  1D4N A;  4K3F A;  4FEC A;  4H67 A;  1F9B A;  3FJG A;  2PT2 A;  5AA4 A;  3BBR A;  5I2N B;  1B3G A;  4H1X A;  4YIC A;  4Q8R A;  4BLA A;  1XVX A;  4NTL A;  3LC8 A;  1Z7N E;  3T9U A;  1IXI A;  2I6E A;  3O6G A;  3BFU A;  4LZ5 A;  1MPB A;  1OLC A;  1DOT A;  3AXF A;  1MH3 A;  4ZS9 A;  1EU8 A;  3OEM A;  5ITO A;  2O7I A;  4GFR A;  3N5L A;  2GHA A;  3PMW A;  2V3U A;  3PPR A;  4I1D A;  3VLV A;  1A40 A;  3V83 A;  1PBQ A;  3CFL A;  2H4I A;  3U93 A;  4ELO A;  2F5X A;  2THI A;  4JWY A;  3FXQ A;  3CFX A;  2HFB A;  3T9X B;  3FV2 A;  3K00 A;  4U4X A;  3HV1 A;  2F35 A;  3N6U A;  3TOD A;  2R71 A;  2Z8E A;  1MPC A;  3FGS A;  4KYE A;  4IO6 A;  1NNT A;  3H7M A;  1Y3N A;  2AL5 A;  2ZYK A;  3M3K A;  1ELJ A;  5EHS A;  4PFT A;  2O69 A;  3TTR A;  5KDT A;  4YKJ A;  3ILT B;  2XXH A;  1LST A;  3VFJ A;  2ZXT A;  3S9E A;  1NNP A;  3W9V A;  3DEL B;  4RYA A;  2H25 A;  5TP9 A;  4ONY A;  2REG A;  1B3F A;  2I58 A;  4IGR A;  3GZG A;  3IOV A;  3VXB A;  1IUD A;  2Y84 A;  1O63 A;  3MP8 A;  1A8E A;  2NVU B;  4RNS A;  5F7V A;  5ELV A;  3DP6 A;  3JZJ A;  2UVI A;  3CIJ A;  3HCQ A;  2OLB A;  1BKA A;  4OFO A;  1MY4 A;  2ALU A;  1M5D A;  1SW1 A;  2XX7 A;  2H5Y A;  3MC2 A;  2XXT A;  1B3E A;  2PYY A;  4QFP A;  4FOR A;  5CC2 A;  1UQW A;  3THI A;  1PC3 A;  3TZA A;  1LBB A;  4YMA A;  5A5X B;  3DLN A;  5I56 A;  4DDD A;  1LCT A;  2V93 A;  2Y7K A;  5H8Q A;  3G3G A;  3MZB A;  2OZZ A;  1H3D A;  1JQF A;  1QUJ A;  1FTL A;  5I57 B;  1PB8 A;  3RT6 B;  5H8F B;  5BWJ A;  1B4Z A;  4F39 A;  3PUZ E;  3O6H A;  1UTH A;  4LZ8 A;  2I49 A;  3T9H B;  3RGY A;  1FW0 A;  5HBC A;  3KFM A;  1PB9 A;  4JXI A;  2UVG A;  4RK2 A;  4R9G A;  4O3B A;  3ECR A;  4TLL B;  1SDX A;  3D4C A;  4F3P A;  4O3C A;  1YAE A;  5FTI A;  1MDQ A;  2P1S A;  3A09 A;  3A3U A;  5FHO A;  3CFZ A;  1B32 A;  1YPN A;  3UA8 A;  1OMP A;  3C34 A;  2UXA A;  3QIM A;  1MH4 A;  2XXX A;  1L5T A;  2FNC A;  3VV5 A;  4OHN A;  4PP0 A;  5K2Y A;  3C4M A;  1O64 A;  4DIG A;  4NF5 B;  5I2N A;  3E3K A;  4NWD A;  2WKY A;  3MP1 A;  2ZNS A;  1Q35 A;  3MW0 A;  1EZP A;  2ABH A;  3UGW A;  3IR1 A;  2O7U A;  1NFT A;  5IKB A;  3FIR A;  3ONM A;  3RY3 A;  1TXF A;  4G8H A;  2O1M A;  2RF1 A;  4EQB A;  4OWD A;  4KYS A;  3HHF A;  4ZEI A;  2E0S A;  4NF4 B;  3OD7 A;  4QFN A;  1MQD A;  3VVD A;  3K01 A;  1N76 A;  3PD9 A;  4R72 A;  3TYH A;  1Y4T A;  1SW5 A;  4LZ7 A;  4EF2 A;  1Q1K A;  4GOT A;  2I4B A;  4YB6 A;  3TCH A;  1OIB A;  2RCB A;  2DSF A;  3IJX B;  4OMB A;  4GWO A;  1BLF A;  3MBP A;  2DVC A;  4XXU A;  1LCF A;  4AB5 A;  4OET A;  4F1Y A;  3KN3 A;  4IO3 A;  4WED A;  3HHG A;  3C36 A;  3QAX A;  3OO9 A;  2QL3 A;  1VE4 A;  3RLF E;  4F3S A;  2D3I A;  3FVO A;  4GLI A;  3A3C A;  3N26 A;  4BDR A;  4R73 A;  1XHY A;  4H6D A;  3OXN A;  3KOT A;  4U1O A;  5AE4 A;  1MQG A;  4U21 A;  3U92 A;  4EQ9 A;  2GHB A;  4RK9 A;  4R2F A;  5KCJ B;  4X9T A;  4YKP A;  1P1N A;  5JK4 A;  4IY6 A;  1B46 A;  1H43 A;  4GL0 A;  1IIW A;  3EQ1 A;  4Z7E A;  4GXS B;  3S9N C;  3V8X B;  3MWB A;  1B4H A;  3U1O A;  2FA7 A;  4GRK A;  1B7H A;  1MDP 1;  1I69 A;  5A5X A;  1LAX A;  1JET A;  1EZ9 A;  2YJP A;  1AH5 A;  2F7C A;  2UVJ A;  2ONR A;  1MG1 A;  1TFA A;  1B5I A;  1MQI A;  4L17 A;  1QJM A;  4RY1 A;  5DTB A;  4AQ4 A;  2NXO A;  2VP1 A;  2XXU A;  4ZED A;  4FAJ A;  1FTJ A;  3H6U A;  1LAH E;  5I57 A;  4BDL A;  4F18 A;  1URG A;  1AIV A;  5H8F A; 
#chains in the Genus database with same CATH topology
 1ZKB A;  5FBP A;  2P2A A;  1FQB A;  3HFU A;  2HZL A;  2HXW A;  4ZZA A;  4NXM M;  4OER A;  1SG9 A;  4QOS A;  4IR8 A;  3AOE A;  3H6V A;  1WGL A;  5CBR A;  2ZTD A;  2XGN A;  4PE5 B;  4DV5 M;  1K9Y A;  1YTV A;  5EQT A;  4QSE A;  2IA4 A;  5IAI A;  1HNW M;  2VD3 A;  2ZZW A;  1QZM A;  3LVW A;  2ZMB A;  1Q3C A;  3C3D A;  1WOD A;  4PAI A;  4NOO B;  1B1X A;  2V25 A;  5H8S A;  1OAI A;  3G3H A;  3SEX A;  3Q28 A;  2PFY A;  1B5H A;  3WAE A;  3L2A A;  4I5S A;  1A8F A;  1HQY E;  3KSX A;  3L6H A;  1MXU A;  4LJ6 A;  5L8D A;  3U72 A;  5FTH A;  3A29 A;  1CB6 A;  1J09 A;  3C3E A;  3FUW A;  3QYT A;  3UIF A;  4NAP A;  3SEU A;  3BFT A;  1IY0 A;  2W7Y A;  1T0K A;  2UUC M;  4JI7 M;  2XZU A;  4DZ1 A;  1RYO A;  5EQ7 A;  2L7I A;  1XS5 A;  4NX1 A;  3E4R A;  1FCK A;  3MAM A;  4DXU A;  1XC8 A;  3KN8 A;  2GRV A;  1R6B X;  4NF5 A;  3EPE A;  1NV5 A;  4XGI A;  3QAU A;  4MM3 B;  3B9P A;  3PVS A;  1MXY A;  5HM4 B;  4KQP A;  4GC5 A;  4M0D A;  4FCV A;  1B3H A;  2C99 A;  2H99 A;  5CMB A;  3GP1 A;  2V3T A;  1DGG A;  1UTB A;  5CRY A;  4XBO A;  3UJN A;  2YPN A;  1G41 A;  3UOR A;  1R5L A;  2QS4 A;  3QYE A;  2GQF A;  2QVU A;  1HQC A;  4N6P A;  1MQJ A;  1P99 A;  2QMW A;  4O7M A;  4MLV A;  3T22 A;  1BK4 A;  1R1N A;  1NNF A;  4IJF A;  4G68 B;  4BDN A;  2B3T A;  1G8P A;  1LTM A;  3SEW A;  1R2Y A;  3U8Q A;  2JY8 A;  1QW0 A;  3SET A;  4ZE9 A;  2KRU A;  3ZKL A;  1DMB A;  1IMA A;  1XHB A;  3R7X A;  4QHT A;  3FYC A;  4BDO A;  3SAR A;  3KGC A;  4OEN A;  4MX6 A;  3WHK A;  2DAI A;  3HHZ A;  4LRT A;  2PFZ A;  4JI0 M;  2BJI A;  3ODB A;  4QOZ C;  3KSJ A;  5H8N B;  2WEF A;  4GVO A;  3EHS A;  3T1Y M;  5EP1 A;  4JSD A;  4RNA A;  3HPI A;  3KP0 E;  4X1B A;  4LJ9 A;  4TQU Q;  5ET8 A;  1HNX M;  5L9O A;  4RA1 A;  4OFJ A;  2R6F A;  4R74 A;  4DLD A;  1POT A;  4XK8 F;  3ZKK A;  3MVX A;  3PNY A;  4JI4 M;  2OK2 A;  4H5G A;  3KJT A;  4IY5 A;  4BDM A;  1SW4 A;  4Q5T A;  2LVQ D;  3KEI A;  4DV1 M;  3DM0 A;  2APL A;  4LGY A;  5E6J A;  4WXJ A;  1NUY A;  2QS2 A;  2DOJ A;  3H6W A;  5F24 A;  1FBF A;  4ESW A;  4N07 A;  2WSE F;  2K6B A;  2F5O A;  1N04 A;  4L8R C;  2UYE A;  4OZ9 A;  3IOR A;  2Y7W A;  4YU0 A;  4H65 A;  3A42 A;  3WAF A;  3U6S A;  3PU5 A;  4WUR A;  1LLS A;  2Z22 A;  2KA6 B;  2WBD A;  4GHL A;  3J80 S;  4R75 A;  2X49 A;  2CV0 A;  3ZS6 A;  3KFU G;  1GVC A;  1Z59 A;  2O5R A;  2DEN A;  3PUW E;  2C96 A;  4Q30 B;  4JVI A;  4II7 A;  2R46 A;  3LV0 A;  4AI6 A;  3GQ4 A;  4UN2 B;  3U5Z B;  4U2R A;  1QUI A;  3I5O A;  4L4U A;  1I6A A;  4PE3 A;  1IXH A;  2Y5K A;  4QBA A;  1TDZ A;  1EIJ A;  5E26 A;  1IME A;  4NF6 A;  1NUX A;  4OVP A;  3M7G A;  4DV0 M;  2RRU A;  1MY2 A;  3LUY A;  1ZMU A;  4JVC A;  2JY5 A;  2KR0 A;  3VLU A;  3K6U A;  1GL7 A;  3GLG E;  4B7H A;  2R9J A;  4XKR A;  1B7U A;  4O8M A;  1M5E A;  3PGF A;  3Q27 A;  2VF8 A;  3FD9 A;  5KCJ A;  4X04 A;  3CR9 A;  8CAT A;  4FIM A;  2OO9 A;  4DI3 D;  3GQ3 A;  1RKM A;  2HHH M;  1ZLQ A;  2M8C A;  2LNH C;  1DGF A;  2X8A A;  3HHX A;  1LFI A;  1G0H A;  4KCD A;  3B7Z A;  2UXD M;  3KC0 A;  4PFR A;  1N77 A;  1N36 M;  1M5F A;  5KQ8 A;  5TPA B;  5KPT A;  1ZMG A;  1XNQ M;  2F5S A;  4EXK A;  3EN3 A;  3O66 A;  3T9V A;  2VD2 A;  4BLC A;  3TEL A;  1SQY A;  5JI2 E;  1FQC A;  1URS A;  3PD8 A;  4JWX A;  4YZZ A;  4DXC A;  3A98 B;  2CE7 A;  3OO8 A;  3U6P A;  4U22 A;  3MYU A;  3D8L A;  3AKZ A;  1LB9 A;  1T6O A;  2Y21 A;  3DFZ A;  1VEK A;  4QF9 A;  5JEI A;  2XXY A;  1MXV A;  5ET6 A;  2L6O A;  4IB2 A;  4P17 A;  2XD2 A;  4N8Y A;  5ITQ A;  3GLB A;  3IG8 A;  3B7D A;  1QAM A;  1CNQ A;  2DZL A;  5CMM A;  1QUL A;  4LVQ A;  1FTM A;  2WZJ A;  2HAU A;  2CEA A;  1Y1Z A;  2EUC A;  4LF5 M;  3S4U A;  4LCB A;  2XWV A;  4XKP A;  3T38 A;  4N91 A;  1Y20 A;  3UN6 A;  2VII A;  4DR2 M;  1MX0 A;  4P11 A;  5LMU M;  4ZDM A;  3IB0 A;  1JEU A;  4EXL A;  1AOV A;  2NQ8 C;  4A3V B;  1XB2 B;  3TAJ A;  4PAK A;  1LBZ A;  2I7P A;  3PXG A;  1Y1M A;  5FHN A;  1GKI A;  2ONS A;  5H8H A;  5FLX S;  2PT1 A;  1FJ9 A;  4D80 A;  3BIH A;  3MPK A;  1H44 A;  1EH3 A;  3RGP A;  2FE8 A;  3LCU A;  2VHA A;  1TH3 A;  3FV1 A;  2OPF A;  3VKH A;  1IIT A;  1HJP A;  1NNJ A;  4I9D A;  3FZV A;  5AA2 A;  3E9S A;  2D5W A;  3W0F A;  5HPQ A;  1LFH A;  4FCT A;  4C1T A;  4G4P A;  5JTY B;  4D81 A;  2YFQ A;  4IO5 A;  5I2K B;  3RYD A;  2Z8F A;  2KZU A;  4XKQ A;  5A5L A;  4G68 C;  3SAS A;  3R26 A;  5CMC A;  4PFB A;  5DVJ A;  3C58 A;  2HEU A;  2OOA A;  4OTE A;  3SBJ A;  4POW A;  1P3Q Q;  2PX1 A;  2L09 A;  5IZ7 D;  1TTE A;  2DWI A;  5K2X A;  3GRU A;  3MZ9 A;  1D0M A;  3AFH A;  2DE2 A;  4ZE8 A;  5BUU A;  2Q2A A;  4PF8 A;  4OVZ B;  1MM7 A;  2F78 A;  3W0L B;  2V3Q A;  3GRV A;  1OVT A;  3SEV A;  3GLG A;  4GBW A;  2ZBK B;  1VFE A;  4DV2 M;  3U61 A;  4YAH X;  4I8C A;  2M60 A;  1FBG A;  5AA2 D;  1N34 M;  3EKI A;  2UU9 M;  3UK6 A;  3VE1 B;  1EYI A;  3RE8 A;  4FE8 A;  4KD5 A;  4NG7 A;  1OQH A;  4NF8 B;  5CBS A;  3RTF B;  4MFI A;  4LAT A;  1AL3 A;  4L6V 6;  4ESX A;  3LMM A;  4L16 A;  1B2H A;  2D7H A;  3FJM A;  4OFL A;  3JV9 A;  1ZBM A;  4GIT A;  4LF6 M;  2WYK A;  4QFO A;  2K0B X;  3RGS A;  2FS1 A;  4L78 A;  5JI3 E;  3R6U A;  1J5E M;  1VFD A;  1GVN A;  3OSR A;  1TH4 A;  1GR2 A;  1Y9U A;  2DQV A;  3T6P A;  4B08 A;  3ZC7 B;  2YLN A;  4JSO A;  3ILU B;  2J5Y A;  4AS5 A;  1QQW A;  2YQZ A;  3IEC A;  4LFC M;  1D0K A;  3MP6 A;  1NNU C;  3L6G A;  4KYD A;  4KI0 E;  3R8F A;  4OW0 A;  3OSQ A;  1PM5 A;  1IBM M;  3EHT A;  2AIX A;  2CHG A;  1A5T A;  1OVB A;  2B4L A;  1L8Q A;  1JQJ C;  5B70 A;  4M9X A;  3O2A A;  4DCY A;  3FBP A;  3E78 A;  2F97 A;  4DUY M;  4NED A;  3DP4 A;  3IJO B;  3GBB A;  1SXJ B;  3O28 A;  1BP5 A;  1A99 A;  2ESN A;  2LXE A;  4P0G A;  1R6Z A;  4PBQ A;  1DK4 A;  1HT2 E;  3KXE C;  4LJA A;  3IB1 A;  1YCJ A;  4NRW A;  3W15 C;  1FPD A;  5I5P A;  2DWZ B;  3K92 A;  1A7L A;  2F36 A;  1GO5 A;  3GLI B;  4QHQ A;  4UAC A;  4M4G A;  2Z4R A;  4P0I A;  1E9S A;  1BTJ A;  2O84 X;  2F3B A;  1OIP A;  3QK6 A;  2XLJ A;  3FVN A;  1XOC A;  2I7N A;  4B3R M;  4EUO A;  4LY6 A;  4DCX A;  3SYL A;  2V84 A;  2DKL A;  1DGH A;  2XX9 A;  3M8U A;  3ZSF A;  2A5T B;  2NOO A;  3QSL A;  3NWL A;  4QNR A;  2F6G A;  2K9D A;  3L25 A;  4FJP A;  2GH9 A;  3MHV C;  4LZZ A;  4B7G A;  4I62 A;  4N81 A;  3RPW A;  1FQE A;  1FPJ A;  3BXW A;  1NH7 A;  3H06 B;  2XXW A;  3FVG A;  5DT6 A;  1NVM A;  1II5 A;  3T93 B;  1LAF E;  1B58 A;  4F3G A;  1NH8 A;  5KPZ A;  3QUJ A;  4DV7 M;  3U6C A;  3KOS A;  1BIY A;  3HKP A;  1FPE A;  4JXJ A;  5AA3 A;  1XWI A;  3TDJ A;  1B52 A;  1YSY A;  5EQA A;  4UA8 A;  4F1U A;  5EYG A;  2KRK A;  4MHF A;  5EHM A;  4NQ8 A;  4R6K A;  1WIV A;  4HE0 A;  3HU1 A;  5AA4 B;  1AMF A;  2R18 A;  5TPA A;  1W5S A;  2GNO A;  2G29 A;  4AKI A;  3F92 A;  3H03 A;  1NV8 A;  1EE8 A;  3TPA A;  1NSF A;  2QFL A;  4ZZE A;  4GL8 A;  3VXC A;  3K02 A;  1NL5 A;  3EF7 A;  3E46 A;  1O7T A;  3MVY A;  2KDL A;  3C9H A;  1MXZ A;  1SI1 A;  2AL4 A;  4P1L A;  4ANR A;  1P1Q A;  1P1W A;  4ELP A;  2DI0 A;  3MK6 A;  1ANF A;  3K1P A;  4Z6Y A;  1R2Z A;  1FSA A;  1ZJL A;  2UXC M;  4DV4 M;  4R6Y A;  4LON B;  3IX1 A;  3O6I A;  2P3V A;  3GPU A;  3HO7 A;  1IXG A;  2QNJ A;  1KA1 A;  2D7G A;  4DR3 M;  3IOW A;  4IBG A;  1MY1 A;  2ONK E;  3HST A;  2DVZ A;  4OEV A;  3BKI B;  1VG5 A;  3GRY A;  1NV2 A;  2CUZ A;  4OX9 M;  2CP8 A;  1BVS A;  4JVD A;  1N0T A;  2V1U A;  3QUF A;  1N84 A;  4MCO A;  4MB7 A;  2LTU A;  1SVX B;  3VVE A;  3LQR A;  4F31 B;  5I58 B;  4JWO A;  4L15 A;  4LGM A;  3TTN A;  3SKP A;  1NUZ A;  3KZG A;  4FEB A;  3V5A A;  4MIJ A;  1VDL A;  4PFI A;  5BPV A;  2VF7 A;  4DE8 A;  3L29 A;  1L1T A;  1ZMV A;  1SYI A;  1TFD A;  3Q25 A;  2R4E A;  3FTF A;  4UAB A;  1GV8 A;  4F2O A;  4IBI A;  4OVR A;  1GAB A;  3CF6 E;  1QKA A;  2CZL A;  1OFH A;  2JJK A;  3HU2 A;  2LVA A;  4I3E A;  1JW5 A;  2WBB A;  4PFY A;  4WEP A;  2WSF F;  2XXP A;  4IO4 A;  5JTY A;  2DS9 A;  2F7A A;  2CHV A;  3K9P A;  1GTK A;  1UIU A;  3HY5 A;  4O94 A;  5I2K A;  4JI8 M;  4QSC A;  4YMB A;  1IN6 A;  5ET7 A;  2QCU A;  5FHM A;  2ZYO A;  4MH5 A;  3TQL A;  1SD3 A;  3BOS A;  1D9V A;  5EXX A;  3FXU A;  2CFO A;  2UXB M;  5DEX B;  1IN8 A;  1R7R A;  1H76 A;  3U60 B;  3FVK A;  3AOE C;  4G77 A;  1V92 A;  1DV0 A;  1AWB A;  3IL1 B;  4MGZ E;  4OA4 A;  2HAK A;  4FBP A;  5FTN A;  1N7W A;  4LP2 B;  1PJI A;  2Q74 A;  1IY1 A;  3SAW A;  2RC7 A;  1LBC A;  4PBH A;  2JY7 A;  2B65 A;  3FAT A;  4PFU A;  4CIS A;  3SAV A;  3ISP A;  2AHM A;  1D0L A;  5ICT A;  1CUK A;  2IEE A;  3TEP A;  3K4U A;  5L9S A;  2I4C A;  5LOM A;  1DTG A;  1QDR A;  4G4Q A;  4B3M M;  2DHR A;  3K2L A;  2ANJ A;  3N6T A;  2P0S A;  1YLA A;  2XSZ A;  3KS4 A;  5L9M A;  4NF8 A;  3S9L C;  2HZK A;  2BJJ X;  4THI A;  4OVS A;  4G8M A;  2OOB A;  1VQ1 A;  3HJ8 A;  1LGB C;  2L5V A;  1ZMW A;  1S7Y A;  1EFU B;  3J7A S;  1SBP A;  5ITP A;  1D9Y A;  1R9L A;  1NKX A;  4OVJ A;  4OEU A;  3KP1 E;  3RTW B;  1F4I A;  5ITT A;  1Z5A A;  2OWT A;  2EO2 A;  3HJS A;  1SW2 A;  1SXJ C;  5I56 B;  2DXR A;  2QS3 A;  2DE4 A;  1DO2 A;  5J16 A;  2ZAO A;  1QAO A;  2Q2C A;  3OEN A;  3CSB A;  1LBX A;  1FPI A;  4ND9 A;  4IIW A;  4GIP A;  3HGI A;  2CZH A;  1Y4C A;  5H8Q B;  1Z5C A;  2W82 A;  2VOZ A;  1USY E;  1XVY A;  1VR5 A;  1IBL M;  4OES A;  3CF0 A;  3UK4 A;  4WKM A;  2QJE A;  3KVW A;  1FQF A;  4NHB A;  2CRU A;  3SEY A;  1JVY A;  3PUX E;  4TOZ A;  1UTH B;  3I6V A;  5DVI A;  4F19 A;  2OWS A;  2XSZ D;  3FD3 A;  1SI0 A;  2QHO B;  3ZCB B;  1NUW A;  4ELR A;  2QQ8 A;  1DO0 A;  1TT1 A;  4BDQ A;  3KOW E;  4H46 A;  3GLI A;  4G3O A;  4KHZ E;  4GD5 A;  1PRB A;  4O3A A;  2R44 A;  1LBY A;  1DCU A;  2QVV A;  4NF4 A;  2G93 A;  2DVW B;  3K6V A;  4XEQ A;  4Q0C A;  3G3J A;  2M5Z A;  3DZD A;  3TQS A;  3GLH B;  2R62 A;  1ZAE A;  3LUZ A;  4U1Z A;  4FVM A;  4F2L A;  1B0L A;  2A5T A;  4HCY A;  4CHT B;  4C1U A;  2JZ0 A;  3D4G A;  2C98 A;  1QDT A;  4E0W A;  5FTL A;  3PFI A;  1FPL A;  3FTE A;  2R4J A;  4R2B A;  5M2V A;  1IM2 A;  4I81 A;  4ZEF A;  3KDS E;  4GBV A;  1L2C A;  2Y7I A;  2Q8M A;  4GIZ A;  2E1S A;  2Y0Q A;  2KHH A;  3B50 A;  4EDP A;  1NV3 A;  5DVF A;  3MPL A;  4MEV A;  1N3W A;  1WVJ A;  3C32 A;  4ZEB A;  4Z8X A;  4OXV A;  2KLF A;  2O51 A;  4ISU A;  4PET A;  2V4C A;  1FBP A;  1S3S A;  1MPD A;  3IOT A;  2Z3X A;  3SHG B;  4DR1 M;  2H98 A;  1I4W A;  2RCA A;  3VDF A;  3PTY A;  2OCU A;  2BJW A;  4LFB M;  4EF1 A;  2R65 A;  3TE6 A;  4JB7 A;  3E13 X;  3TWK A;  4QFL A;  2D7E A;  2EA0 A;  3TUS A;  1FTO A;  2A5Y B;  1G3I A;  3U65 A;  4FCW A;  2DXI A;  2MH8 A;  1MN3 A;  4DBG B;  2HL7 A;  3TWM A;  4AB6 A;  3GQ5 A;  1GJT A;  1LV7 A;  4LJ8 A;  4KFQ A;  3RT8 A;  5IT9 S;  5EP2 A;  1DTZ A;  2VDB B;  2F8D A;  3VDU A;  1WDN A;  5BR8 M;  2BWE A;  5FTM A;  3PV0 E;  3LSX A;  3MZ1 A;  4F1I A;  1NV4 A;  3IK6 B;  3A45 A;  4GWY A;  3DA1 A;  3H3G A;  2FFJ A;  1Q9D A;  2I3V A;  5DFL A;  2J7O A;  3K9O A;  1IXS B;  4BB9 A;  3BIG A;  4C0R A;  3LBS A;  4JI5 M;  1QZE A;  1IXC A;  4MMP A;  1Q02 A;  3IO4 A;  5AA1 A;  4MNC A;  4GX3 A;  1IN7 A;  1QKB A;  2C5R A;  2OBG A;  5A2Q S;  4HTG A;  4XFE A;  5I58 A;  2VQE M;  4KXP A;  4NWC A;  3F11 A;  4HLQ A;  2XXK A;  5FTK A;  2BWB A;  1LAG E;  2DZN B;  2MJ5 B;  1M5C A;  2O6A A;  2XH9 A;  3T96 B;  3W9W A;  2OJT A;  3Q29 A;  1KFV A;  3CGW A;  1RU3 A;  3S2V A;  1KZ8 A;  1DBZ A;  4PCD A;  3FUU A;  4HCW A;  3H4M A;  2G3Q A;  3TTM A;  1MRP A;  1OKS A;  1H6U A;  3G3I A;  1ZU0 A;  1MJG M;  3H6T A;  4N15 A;  4LF8 M;  4H5F A;  4OAN A;  1I6B A;  4F2Q A;  3B6Q A;  2XXI A;  3AL0 C;  2RGO A;  2RC9 A;  3TTL A;  1OTR A;  2ZAM A;  4B3T M;  4DR6 M;  4H0W A;  3M6A A;  3NBI A;  3GYY A;  4NC6 A;  2XHD A;  1URD A;  5DEX A;  2R0I A;  4M0W A;  3VLW A;  3IFC A;  3U60 A;  4IBD A;  4MGK E;  3SER A;  3UGJ A;  3PPQ A;  2Q88 A;  2Y0T A;  4PF6 A;  3T1H M;  2DXY A;  1Q3B A;  1HSJ A;  5CI5 A;  1D3K A;  4FED A;  3ZH9 B;  2DWL A;  2J7N A;  3B6W A;  4N13 A;  4HW8 A;  3O97 A;  3USD A;  1Y3Q A;  2Y7P A;  3TCG A;  5TU0 A;  2DAG A;  4IBF A;  1I6Q A;  2MKZ A;  2DWM A;  2YR0 A;  2P5T A;  2DYX A;  1EYK A;  2DE3 A;  1SPI A;  2LVO C;  2PVU A;  3SYK A;  5CM6 A;  3AV0 A;  3L27 A;  2X7Q A;  1QUK A;  2F6P A;  4P16 A;  3GO8 A;  1HSL A;  5ITX A;  5LDZ A;  2Q8J A;  3QXM A;  1ZQ9 A;  4JI3 M;  3IOU A;  4ECF A;  3TMG A;  2FH0 A;  2LWX A;  1NV9 A;  2QBY B;  1C1K A;  4I40 A;  5I59 B;  1X37 A;  2JXN A;  1OQY A;  2XF3 A;  2R6G E;  2PMS A;  1E9R A;  4RPO A;  4Y28 F;  4FD2 A;  1FJG M;  3W68 A;  4DR5 M;  2REJ A;  2BNK A;  2I3W A;  4AW4 A;  3M3F A;  2F7B A;  3IO6 A;  2FYI A;  1G71 A;  4DV3 M;  3FAS A;  2ZYM A;  2L2D A;  3C33 A;  2F5N A;  3KBR A;  4JYA M;  3FUZ A;  5ISU A;  1DSN A;  3TQW A;  3SC3 A;  2Y5L A;  2CZI A;  4G4N A;  1GGG A;  4B7F A;  4PDH A;  4IO2 A;  4LA9 A;  1CE2 A;  4U4S A;  3T0J A;  3HZJ A;  1POY 1;  2F34 A;  1Z7M E;  4M1V A;  1MU5 A;  2CMO A;  2RKM A;  3GBA A;  2QZ4 A;  4NGU A;  1K3W A;  4JN6 A;  3CG3 A;  2KNV A;  2FIE A;  4G68 A;  1PGY A;  4HS7 A;  1FPK A;  3E9X A;  1QUT A;  2Q9T A;  4YB5 A;  4TLM B;  1B6H A;  2JZ1 A;  2RKO A;  4P8B A;  4DI4 B;  3HX3 A;  3GPP A;  3H4Z A;  3Q26 A;  2UUA M;  3FUT A;  2JA2 A;  4ELQ A;  2ZZX A;  1Z5B A;  1M5B A;  2ZZV A;  3KC1 A;  3SES A;  5DYI A;  4LJ4 A;  1G0I A;  3U94 A;  4QHS A;  2FIX A;  2XFS A;  4S12 A;  2CZK A;  3GXA A;  3OOA A;  4GXA A;  5H8N A;  1TGU A;  3GPY A;  2ZYN A;  2ZNT A;  1IXZ A;  1Y8G A;  4RKU F;  1S9T A;  2O68 A;  5J1D A;  2EJS A;  3KBZ A;  2GQ1 A;  2ERC A;  3IAZ A;  4OVT A;  2D21 A;  3FTD A;  4ZEK A;  2XXQ A;  2JUJ A;  1B5J A;  1D2N A;  3KJ7 A;  5IZ3 B;  3KS8 A;  1B40 A;  3V89 B;  1JNF A;  2UYF A;  2O1L A;  2CEY A;  3KOY E;  2DWN A;  4PQJ A;  1PBP A;  1NJF A;  4F1V A;  4R6H A;  2QPA A;  2XEP A;  5EYH A;  3LSW A;  1Q39 A;  5KZT A;  3O9P A;  3PUY E;  3IB2 A;  3PMX A;  4ITQ A;  2XWK A;  3K2D A;  1GLN A;  2LBC A;  1B51 A;  1NV1 A;  1IXR C;  1UTB B;  4P3L A;  1HT1 E;  2FNA A;  1UIV A;  3LW5 F;  3K1J A;  2I48 A;  3SFZ A;  3NBX X;  2F4V M;  2UVH A;  4MNI A;  1E32 A;  3VK8 A;  2B3B A;  4YB7 A;  2GFE A;  3A46 A;  1YUB A;  4AG5 A;  4H45 A;  3OMB A;  1ZV1 A;  2F5Q A;  1JR3 E;  4DUZ M;  1MY0 A;  1DPP A;  3CVG A;  4GWZ A;  4KCC A;  4LF9 M;  4RPN A;  4RF0 A;  4FWD A;  3U5Z A;  1KWH A;  2LAO A;  1MXW A;  4X1D A;  1TF0 B;  2DHY A;  1RDY A;  3TL4 X;  2X7P A;  4AS4 A;  1QVS A;  1XNR M;  1RDZ A;  3MJN A;  1IXS A;  1ZIU A;  2RC8 A;  1A55 A;  2QMX A;  1FPF A;  4GWW A;  3P7I A;  4RJZ A;  3MVZ A;  2HCA A;  4LJ5 A;  4O7I A;  2HHM A;  2K47 A;  2P3N A;  3IFA A;  4IGT A;  2CV1 A;  3J27 B;  1VEJ A;  3MUQ A;  2DAE A;  3GRR A;  4XKN A;  3B89 A;  1VEG A;  2DWH A;  2QS1 A;  2HQ0 A;  3JYR A;  5EQ8 A;  4LQ2 A;  3K6W A;  2H9B A;  1NNK A;  5IZ1 A;  3FXB A;  4OQO A;  4AG6 A;  5ESY A;  4DXB A;  2A5S A;  1N7X A;  1Y3P A;  3TTK A;  1FJ6 A;  3CHG A;  1R4G A;  3DP8 A;  4LUB A;  5F1Q A;  2KQZ A;  1IMD A;  4ZEC A;  1EZO A;  2XX8 A;  3T66 A;  4Z0I A;  3R9X B;  2C9C A;  1IY2 A;  2VGQ A;  1OAO C;  4W5W A;  4GMQ A;  1QYR A;  3CI8 A;  4Q7J A;  2XWI A;  2XXV A;  4EQ7 A;  2Q89 A;  1IQ7 A;  3KG2 A;  2G5G X;  4H8I A;  2QVR A;  2RGH A;  3PUV E;  3UP9 A;  2EKK A;  1NMU A;  4N6D A;  4QRZ A;  3HN0 A;  4X8R A;  4KPT A;  1P1O A;  2RIN A;  3OEK A;  1QUS A;  3G7W A;  3B7Q A;  4YKK A;  1SXJ E;  1WXQ A;  4JI6 M;  1B9J A;  1US4 A;  2QP9 X;  2WSC F;  4AZF A;  4POX A;  1JW4 A;  1JB0 F;  1QGX A;  2B3F A;  3GLI E;  1JP4 A;  1PEB A;  2VT5 A;  3LSL A;  3SHF A;  1YE9 A;  2DZO B;  4NF6 B;  4CIZ A;  2DWA A;  1XMO M;  1MS7 A;  4KR5 A;  1NV7 A;  3VVF A;  1D9Q A;  4JDF A;  1US5 A;  3S9M C;  1FRP A;  3ILK A;  3I51 A;  3IHP A;  4X48 A;  2FVZ A;  3K0V A;  2C9O A;  3CSG A;  2QPQ A;  3KOZ E;  2XD3 A;  1NV6 A;  1QAQ A;  2HXR A;  4G6Z A;  3J81 S;  4I4L A;  4IBE A;  2XXR A;  3O29 A;  4ZPX A;  3TFL A;  3HJQ A;  3U6L A;  1DGB A;  1RYX A;  1K3X A;  4G61 A;  2Q2E B;  2Z7J A;  4RF1 A;  2AYS A;  4PFW A;  2H5X A;  4AKG A;  2I0C A;  3U6M A;  3C9P A;  1HNZ M;  4NE4 A;  1B3L A;  4TUW A;  3CG1 A;  3RQT A;  2QBY A;  3MVW A;  5I59 A;  1J1N A;  5KDT B;  3PPO A;  2X4A A;  1N3X A;  4HE1 A;  4NSO B;  3NOH A;  4N6K A;  1IEJ A;  5ET5 A;  1JEV A;  4F22 A;  2ZNU A;  3Q8X A;  5I3S A;  4MF3 A;  3RN8 A;  4MGI E;  3VKG A;  4I3Y A;  3M3L A;  4G2Z A;  4LG2 A;  3TCF A;  1JR3 A;  4CGY B;  1ATG A;  1USY H;  3ZQJ A;  5TP9 B;  4GH9 A;  4GQO A;  1LB8 A;  1IZ1 A;  2DP8 A;  3CRB A;  1B7Z A;  3K1N A;  3K6X A;  3KN7 A;  4LZJ A;  4OVZ A;  2H1R A;  3G3F A;  3I3V A;  2LHG A;  4JBZ A;  4XTC Q;  1S50 A;  1NY6 A;  1MY3 A;  5B7D A;  1NHW C;  4M9S A;  3QMF A;  4LN5 A;  3Q8G A;  5EQ9 A;  1OLA A;  4PC9 A;  3U6E A;  4GF8 A;  3OO7 A;  1A54 A;  3TWL A;  1TWY A;  4PT5 A;  3FE3 A;  2QRY A;  1WGN A;  3RFW A;  2X26 A;  2VQF M;  1MQH A;  5IZZ A;  2Y7R A;  4LQ5 A;  5KO3 A;  2NUV A;  4P47 A;  7CAT A;  3SMP A;  4U23 A;  3T15 A;  4RXL A;  1AIP C;  1LFG A;  3C31 A;  2LVN C;  4MBP A;  3B6T A;  1UM8 A;  4F29 A;  3M0E A;  4X62 M;  1JVX A;  3UMM A;  5H8H B;  4H8J A;  1PB7 A;  4QSD A;  2PBW A;  3B7N A;  3MJ5 A;  4JV5 M;  3LCV B;  4YKI A;  3FUX A;  1JR3 D;  3N94 A;  2PCR A;  3MQ9 A;  3K1M A;  1FPB A;  5ICQ A;  2I0B A;  1SYH A;  1OQG A;  5AA2 B;  4X65 M;  2O25 A;  1JW1 A;  3CF2 A;  2DWJ A;  4XIG Q;  4IO7 A;  5I84 A;  1N32 M;  5I7I A;  1XC1 A;  4FW9 A;  1FPG A;  3SDF A;  3U6Q A;  1FQA A;  4MLQ A;  4R9F A;  5IZ3 A;  1DPE A;  4E0X A;  1I94 M;  4MGH A;  2MR9 A;  1OJL A;  1PJJ A;  1MM6 A;  2NWJ A;  4REZ A;  3C35 A;  5LMN M;  2HAV A;  4NMY A;  2DAK A;  3KOX E;  1PDA A;  1FQD A;  1SXJ A;  3B74 A;  3OEL A;  3FJ7 A;  2Z23 A;  4CJ6 A;  3RPL B;  3RUM A;  3EHU A;  3PPP A;  2O01 F;  4HL4 A;  4IBK A;  1ZTY A;  4NN3 A;  5DYH A;  3OO6 A;  1L2B A;  1B05 A;  2QSX A;  4GWX A;  4F3B A;  3TKD A;  3LR1 A;  5CMK A;  3CTW B;  4GRI A;  4GKJ M;  3LVV A;  1B0H A;  1XT8 A;  5LTC A;  2LH0 A;  3GLG B;  1VSO A;  1NV0 A;  4HE2 A;  4QFK A;  4QNM A;  3U61 B;  1H45 A;  4OYV A;  3G3K A;  3FXR A;  3RNN A;  2HPG A;  2Z8D A;  3PMV A;  3D1R A;  1MXX A;  3SZP A;  3VK7 A;  1R9Q A;  1HSE A;  4FAT A;  3GPX A;  1P1U A;  5ITU A;  5IRE B;  3PPN A;  3LSF B;  1B1H A;  1RDX A;  1FTK A;  2F5P A;  5EYF A;  4IBJ A;  3GLF B;  3UZU A;  1SXJ D;  5ITX E;  4I8O A;  4G8N A;  1D4N A;  3T1B A;  4K3F A;  4FEC A;  2JY6 B;  4H67 A;  4OU7 A;  2R8T A;  3K8Z A;  1F9B A;  1NJG A;  4PDG A;  3FJG A;  2PT2 A;  5AA4 A;  3BBR A;  4IBC A;  5I2N B;  1B3G A;  3L26 A;  4H1X A;  4YIC A;  1XXH B;  2JNH A;  4LF7 M;  4Q8R A;  4AQY M;  4BLA A;  1XVX A;  2JWS A;  3MMP A;  3KW6 A;  4NTL A;  3LC8 A;  1Z7N E;  3T9U A;  1NY5 A;  1IXI A;  2I6E A;  3O6G A;  3BFU A;  1GJS A;  1MPB A;  2B4M A;  4LZ5 A;  1OLC A;  2HWJ A;  1KYI A;  1DOT A;  1INP A;  3AXF A;  1MH3 A;  2CEX A;  4ZS9 A;  1WJ7 A;  1EU8 A;  2XA5 A;  1IMC A;  2DNA A;  3OEM A;  5ITO A;  2DAM A;  1TDH A;  2O7I A;  4GFR A;  3N5L A;  2GHA A;  1LBW A;  3PMW A;  2CHQ A;  3VDP A;  2V3U A;  3PPR A;  4G4O A;  4I1D A;  1DGH B;  3V76 A;  1OIZ A;  3SAU A;  1XI6 A;  3VLV A;  1A40 A;  4PD2 A;  4FWH A;  3V83 A;  1PBQ A;  3CFL A;  4N4U A;  1FTA A;  5FSW A;  2H4I A;  3U93 A;  3OTO M;  4ELO A;  2KZS A;  2F5X A;  2THI A;  2YNM D;  4JWY A;  2CWB A;  3GLH E;  3FXQ A;  3CFX A;  5H37 D;  2HFB A;  3THG A;  5ITR A;  4IBB A;  3T9X B;  4LRS A;  3FV2 A;  3K00 A;  4U4X A;  3HV1 A;  2MRO B;  2F35 A;  3N6U A;  3TOD A;  2R71 A;  2Z8E A;  3PNV A;  1MPC A;  1K82 A;  3FGS A;  2L4F A;  1EYJ A;  4KYE A;  4IO6 A;  1NNT A;  3H7M A;  4WP2 A;  4KT0 F;  2QSF X;  4PGN A;  1LEV A;  1V34 A;  1Y3N A;  2AL5 A;  2ZYK A;  3M3K A;  1ELJ A;  5EHS A;  4PFT A;  2O69 A;  3TTR A;  5KDT A;  4YKJ A;  4R71 A;  3GLF E;  3J2P B;  3ILT B;  2XXH A;  1LST A;  3VFJ A;  2ZXT A;  4BBA A;  4PDD A;  3S9E A;  1NNP A;  3W9V A;  1YXI A;  3DEL B;  4RYA A;  4PDI A;  2H25 A;  4NL4 H;  4EIW A;  4PGP A;  5TP9 A;  1XXH E;  4ONY A;  4QXD A;  4MH0 E;  2REG A;  3DOA A;  4KOD A;  1B3F A;  2I58 A;  4IGR A;  4MAG A;  3FRI A;  3GZG A;  3IOV A;  2VPO A;  3VXB A;  1IUD A;  2Y84 A;  5IM2 A;  3VLF B;  1VDD A;  1O63 A;  3MP8 A;  1A8E A;  2NVU B;  2E5L M;  4RNS A;  5F7V A;  2KEB A;  3AOG A;  1UFZ A;  5ELV A;  1NO1 A;  3DP6 A;  3JZJ A;  3HHW A;  3VFD A;  2UVI A;  3CIJ A;  3HCQ A;  3J7B A;  2OLB A;  3U6O A;  5FTJ A;  1BKA A;  3E79 A;  4OFO A;  3EIE A;  1MY4 A;  2ALU A;  1M5D A;  1SW1 A;  2XX7 A;  2H5Y A;  5KQD A;  3MC2 A;  4PTK A;  2EKF A;  2XXT A;  1B3E A;  2PYY A;  1IQP A;  4QFP A;  4FOR A;  5CC2 A;  1NHG C;  4GHA A;  1UQW A;  4PAF A;  3THI A;  1PC3 A;  5C18 A;  4KO8 A;  3TZA A;  1LBB A;  1YYZ A;  4YMA A;  4X64 M;  5A5X B;  1E94 E;  2OQ4 A;  3DLN A;  5EXS A;  5I56 A;  2L7H A;  4DDD A;  1L1Z A;  2CV2 A;  2WX9 A;  3I04 M;  1LCT A;  2V93 A;  2Y7K A;  1J7K A;  5H8Q A;  2KNA A;  3G3G A;  3MZB A;  2OZZ A;  1H3D A;  1JQF A;  1QUJ A;  1FTL A;  5I57 B;  1PB8 A;  3RT6 B;  4GX4 A;  5H8F B;  3QWL A;  4KHP M;  4NSR A;  5BWJ A;  1B4Z A;  4F39 A;  5EP4 A;  1FBD A;  3D8B A;  3PUZ E;  3O6H A;  2FBP A;  1UTH A;  4LZ8 A;  2I49 A;  3RPL A;  2HCB A;  3FKE A;  3T9H B;  3RGY A;  1FW0 A;  3L28 A;  1Z6T A;  5IGA A;  2KNZ A;  3W67 A;  5HBC A;  3KFM A;  5T3J A;  1PB9 A;  4JXI A;  2UVG A;  2FHY A;  4RK2 A;  4R9G A;  3WHL A;  4O3B A;  1C7Y A;  2N35 A;  3AJI B;  1QVR A;  3GLH A;  1IMB A;  3ECR A;  4FWG A;  4TLL B;  1SDX A;  1KA0 A;  3D4C A;  4F3P A;  1L2D A;  4O3C A;  1YAE A;  5FTI A;  1FBH A;  1WHC A;  3BBZ A;  1MDQ A;  2VPN A;  2P1S A;  3A09 A;  1IN5 A;  3A3U A;  5FHO A;  5F3W A;  3CFZ A;  4GKK M;  1B32 A;  1YPN A;  3UA8 A;  1OMP A;  4N17 A;  4NF0 A;  3C34 A;  2WYP A;  3GLF A;  2UXA A;  3QIM A;  1N75 A;  2FOI C;  1MH4 A;  2OWZ A;  2XXX A;  1IBK M;  1FBE A;  1L5T A;  2FNC A;  2Y20 A;  3VV5 A;  4OHN A;  5EP3 A;  4PP0 A;  3JAM S;  5K2Y A;  3C4M A;  1NI9 A;  1O64 A;  4DIG A;  4NF5 B;  2OX3 A;  5I2N A;  3FUV A;  4K0K M;  3E3K A;  1XXH A;  4NWD A;  5DNY A;  2WKY A;  3MP1 A;  1G4A E;  2ZNS A;  1Q35 A;  2QEN A;  3MW0 A;  1EZP A;  4D82 A;  2ABH A;  3ROJ A;  1IFY A;  3UGW A;  3IR1 A;  2O7U A;  4P1E A;  1ORY B;  3QYB A;  1NFT A;  5IKB A;  3FIR A;  3U6D A;  3ONM A;  3EIH A;  3RY3 A;  1TXF A;  4NRV A;  4G8H A;  2O1M A;  2RF1 A;  4EQB A;  4OWD A;  2V1C A;  4KYS A;  2R45 A;  4M9Z A;  3HHF A;  1W5T A;  4ZEI A;  4YY3 M;  5ITY A;  2E0S A;  4NF4 B;  3OD7 A;  4QFN A;  1MQD A;  3VVD A;  4LJ7 A;  4OVQ A;  4GEW A;  3K01 A;  1PJQ A;  3LQQ A;  4KLN A;  5EJC A;  1N76 A;  2LHC A;  3PD9 A;  1N78 A;  4GWU A;  1SW5 A;  1Y4T A;  4GX6 A;  4R72 A;  3TYH A;  4LZ7 A;  4P56 A;  4EF2 A;  1Q1K A;  4GOT A;  2I4B A;  5GKN A;  4GWS A;  5IWA M;  4YB6 A;  3TCH A;  1OIB A;  2RCB A;  5KPR A;  3FYD A;  3I4Y A;  4IJE A;  4MGY E;  2BJV A;  2DSF A;  3IJX B;  4OMB A;  4GWO A;  1N33 M;  2HKJ A;  4AKH A;  1BLF A;  3MBP A;  2DVC A;  4XXU A;  1LCF A;  1KSF X;  3HU3 A;  1VDW A;  4AB5 A;  2F3D A;  3I4V A;  1LBV A;  4OET A;  4R7G A;  4F1Y A;  2ZTC A;  4X66 M;  3H4J A;  2Z8Y M;  2Z4S A;  2XZF A;  1QAN A;  1WR1 B;  3KN3 A;  4IO3 A;  4B3S M;  4WED A;  4HXV A;  1GL6 A;  3TPZ A;  3HHG A;  4G4R A;  1HR0 M;  4YHH M;  4DR7 M;  3C36 A;  4WW0 A;  5C1B A;  1AUA A;  3QAX A;  3OO9 A;  3MST A;  3JR5 A;  2QL3 A;  1VE4 A;  3RLF E;  1XMQ M;  4F3S A;  2D3I A;  3FVO A;  1K9Z A;  2V6Z M;  4JI2 M;  3B8B A;  4JI1 M;  4GLI A;  3A3C A;  1TR8 A;  5EXP A;  2ZAN A;  3N26 A;  4DV6 M;  4BDR A;  4R73 A;  4MJO A;  5DW8 A;  4LFA M;  1XHY A;  4H6D A;  3OXN A;  3KOT A;  2G8L A;  4U1O A;  5AE4 A;  1MQG A;  1PJS A;  4U21 A;  3U92 A;  4EQ9 A;  1T3T A;  3IG5 A;  2GHB A;  3JR4 A;  4XF5 A;  4N8G A;  3I01 M;  4RK9 A;  3SAT A;  2L4E A;  4R2F A;  1IMF A;  5KCJ B;  4NXN M;  4X9T A;  4YKP A;  1P1N A;  2KW0 A;  5JK4 A;  4GC9 A;  5DYG A;  2LVP C;  4MNP A;  4IY6 A;  1B46 A;  1H43 A;  2UUB M;  3HHY A;  4GL0 A;  1PJT A;  4HEO A;  1IIW A;  3EQ1 A;  5L8R F;  1OFI A;  4GXS B;  2DDK A;  4Z7E A;  3S9N C;  1YZ0 A;  3V8X B;  3MWB A;  1FNN A;  1B4H A;  3U1O A;  2XFT A;  2FA7 A;  4GRK A;  1B7H A;  1MDP 1;  1IN4 A;  1I69 A;  5A5X A;  2KXE A;  1LAX A;  4R3D A;  4P9K A;  1JET A;  1EZ9 A;  1V33 A;  2YJP A;  1AH5 A;  2F7C A;  4PCZ A;  1G59 A;  2UVJ A;  1T43 A;  2ONR A;  1FBC A;  1MG1 A;  1TH2 A;  1TFA A;  1B5I A;  1MQI A;  3HWS A;  2JP7 A;  2ZM6 M;  1QJM A;  4L17 A;  4RY1 A;  5DTB A;  4AQ4 A;  2NXO A;  2XWO A;  3FRH A;  4DR4 M;  3FTC A;  2VP1 A;  2XXU A;  2MGW A;  4ZED A;  4FAJ A;  1FTJ A;  3H6U A;  1LAH E;  5I57 A;  4BDL A;  3E21 A;  4F18 A;  5EXT A;  1URG A;  1AIV A;  5H8F A;  4LF4 M;  3SMS A; 
#chains in the Genus database with same CATH homology
 1ZKB A;  2P2A A;  1FQB A;  2HZL A;  2HXW A;  4ZZA A;  4NXM M;  4OER A;  4QOS A;  3AOE A;  3H6V A;  5CBR A;  2XGN A;  4PE5 B;  4DV5 M;  1YTV A;  5EQT A;  4QSE A;  2IA4 A;  5IAI A;  1HNW M;  2VD3 A;  1QZM A;  3LVW A;  2ZMB A;  1Q3C A;  1WOD A;  4NOO B;  1B1X A;  2V25 A;  5H8S A;  3G3H A;  3SEX A;  3Q28 A;  1B5H A;  3WAE A;  3L2A A;  4I5S A;  1A8F A;  1HQY E;  3KSX A;  3L6H A;  1MXU A;  4LJ6 A;  5L8D A;  3U72 A;  5FTH A;  1CB6 A;  1J09 A;  3FUW A;  3QYT A;  3UIF A;  3SEU A;  3BFT A;  1IY0 A;  2W7Y A;  1T0K A;  2UUC M;  4JI7 M;  2XZU A;  4DZ1 A;  1RYO A;  2L7I A;  1XS5 A;  3E4R A;  1FCK A;  3MAM A;  4DXU A;  1XC8 A;  3KN8 A;  2GRV A;  1R6B X;  4NF5 A;  3EPE A;  4XGI A;  3QAU A;  4MM3 B;  3B9P A;  3PVS A;  1MXY A;  5HM4 B;  4KQP A;  4GC5 A;  4M0D A;  4FCV A;  1B3H A;  2C99 A;  2H99 A;  5CMB A;  3GP1 A;  2V3T A;  1DGG A;  1UTB A;  5CRY A;  4XBO A;  3UJN A;  2YPN A;  1G41 A;  3UOR A;  2QS4 A;  1HQC A;  4N6P A;  1MQJ A;  1P99 A;  2QMW A;  4MLV A;  3T22 A;  1R1N A;  1NNF A;  4IJF A;  4G68 B;  4BDN A;  1G8P A;  3SEW A;  1R2Y A;  3U8Q A;  1QW0 A;  3SET A;  4ZE9 A;  2KRU A;  3ZKL A;  1DMB A;  1XHB A;  3R7X A;  4QHT A;  3FYC A;  4BDO A;  3SAR A;  3KGC A;  4OEN A;  3WHK A;  3HHZ A;  4LRT A;  4JI0 M;  3ODB A;  4QOZ C;  3KSJ A;  5H8N B;  4GVO A;  3EHS A;  3T1Y M;  5EP1 A;  4JSD A;  4RNA A;  3HPI A;  3KP0 E;  4X1B A;  4LJ9 A;  4TQU Q;  1HNX M;  5L9O A;  4RA1 A;  4OFJ A;  4R74 A;  4DLD A;  1POT A;  3ZKK A;  3MVX A;  3PNY A;  4JI4 M;  2OK2 A;  4H5G A;  3KJT A;  4IY5 A;  4BDM A;  1SW4 A;  4Q5T A;  3KEI A;  4DV1 M;  3DM0 A;  4LGY A;  5E6J A;  4WXJ A;  2QS2 A;  2DOJ A;  3H6W A;  4ESW A;  4N07 A;  1N04 A;  2F5O A;  2UYE A;  4L8R C;  4OZ9 A;  3IOR A;  2Y7W A;  4YU0 A;  4H65 A;  3A42 A;  3WAF A;  3U6S A;  3PU5 A;  4WUR A;  1LLS A;  2Z22 A;  2KA6 B;  4GHL A;  3J80 S;  4R75 A;  2X49 A;  2CV0 A;  3ZS6 A;  3KFU G;  1GVC A;  1Z59 A;  2O5R A;  3PUW E;  4Q30 B;  2C96 A;  4II7 A;  2R46 A;  4AI6 A;  3GQ4 A;  3U5Z B;  4U2R A;  1QUI A;  3I5O A;  4L4U A;  1I6A A;  1IXH A;  1TDZ A;  5E26 A;  4NF6 A;  3M7G A;  4DV0 M;  3LUY A;  1MY2 A;  3VLU A;  3K6U A;  1GL7 A;  4B7H A;  2R9J A;  4XKR A;  1B7U A;  1M5E A;  3PGF A;  3Q27 A;  3FD9 A;  5KCJ A;  3CR9 A;  8CAT A;  4FIM A;  3GQ3 A;  1RKM A;  2HHH M;  1ZLQ A;  2M8C A;  2LNH C;  1DGF A;  2X8A A;  3HHX A;  1LFI A;  4KCD A;  2UXD M;  1N77 A;  1N36 M;  1M5F A;  5KQ8 A;  5TPA B;  5KPT A;  1ZMG A;  1XNQ M;  2F5S A;  4EXK A;  3EN3 A;  3O66 A;  3T9V A;  2VD2 A;  4BLC A;  3TEL A;  1SQY A;  5JI2 E;  1FQC A;  1URS A;  3PD8 A;  4JWX A;  4YZZ A;  4DXC A;  3A98 B;  2CE7 A;  3OO8 A;  3U6P A;  4U22 A;  3D8L A;  3AKZ A;  1LB9 A;  3DFZ A;  2Y21 A;  4QF9 A;  5JEI A;  2XXY A;  1MXV A;  2L6O A;  4IB2 A;  2XD2 A;  5ITQ A;  3GLB A;  3IG8 A;  3B7D A;  1QAM A;  5CMM A;  1QUL A;  4LVQ A;  1FTM A;  2HAU A;  2CEA A;  1Y1Z A;  2EUC A;  4LF5 M;  3S4U A;  4LCB A;  4XKP A;  3T38 A;  3UN6 A;  1Y20 A;  2VII A;  4DR2 M;  1MX0 A;  4P11 A;  5LMU M;  4ZDM A;  3IB0 A;  1JEU A;  4EXL A;  1AOV A;  2NQ8 C;  4A3V B;  3TAJ A;  2I7P A;  3PXG A;  1Y1M A;  5FHN A;  1GKI A;  2ONS A;  5H8H A;  5FLX S;  2PT1 A;  4D80 A;  3MPK A;  1H44 A;  1EH3 A;  3RGP A;  2FE8 A;  2VHA A;  1TH3 A;  3FV1 A;  2OPF A;  3VKH A;  1IIT A;  1NNJ A;  4I9D A;  3FZV A;  5AA2 A;  3E9S A;  2D5W A;  3W0F A;  5HPQ A;  1LFH A;  4FCT A;  4C1T A;  4G4P A;  5JTY B;  2YFQ A;  4D81 A;  4IO5 A;  5I2K B;  2Z8F A;  2KZU A;  4XKQ A;  4G68 C;  3SAS A;  3R26 A;  5CMC A;  5DVJ A;  3C58 A;  2HEU A;  4OTE A;  4POW A;  3SBJ A;  2PX1 A;  2L09 A;  5IZ7 D;  2DWI A;  5K2X A;  3GRU A;  3MZ9 A;  3AFH A;  2DE2 A;  4ZE8 A;  5BUU A;  2Q2A A;  4OVZ B;  1MM7 A;  2F78 A;  3W0L B;  2V3Q A;  3GRV A;  1OVT A;  3SEV A;  3GLG A;  2ZBK B;  1VFE A;  4DV2 M;  3U61 A;  4YAH X;  4I8C A;  2M60 A;  5AA2 D;  1N34 M;  2UU9 M;  3UK6 A;  3VE1 B;  3RE8 A;  4FE8 A;  4KD5 A;  1OQH A;  4NF8 B;  5CBS A;  3RTF B;  4MFI A;  4LAT A;  1AL3 A;  4ESX A;  3LMM A;  4L16 A;  1B2H A;  2D7H A;  3FJM A;  4OFL A;  3JV9 A;  1ZBM A;  4GIT A;  4LF6 M;  4QFO A;  3RGS A;  4L78 A;  5JI3 E;  3R6U A;  1J5E M;  1VFD A;  1GVN A;  3OSR A;  1TH4 A;  1GR2 A;  1Y9U A;  2DQV A;  4B08 A;  3ZC7 B;  2YLN A;  4JSO A;  3ILU B;  1QQW A;  2YQZ A;  4LFC M;  3MP6 A;  1NNU C;  3L6G A;  4KYD A;  4KI0 E;  3R8F A;  4OW0 A;  3OSQ A;  1PM5 A;  1IBM M;  3EHT A;  2AIX A;  2CHG A;  1OVB A;  1L8Q A;  1JQJ C;  5B70 A;  4M9X A;  3O2A A;  4DCY A;  2F97 A;  4DUY M;  4NED A;  3DP4 A;  3IJO B;  3GBB A;  1SXJ B;  3O28 A;  1BP5 A;  1A99 A;  2ESN A;  2LXE A;  4P0G A;  1R6Z A;  1HT2 E;  3KXE C;  4LJA A;  3IB1 A;  1YCJ A;  4NRW A;  3W15 C;  2DWZ B;  3K92 A;  1A7L A;  2F36 A;  3GLI B;  4QHQ A;  4UAC A;  4M4G A;  2Z4R A;  4P0I A;  1E9S A;  1BTJ A;  2O84 X;  3QK6 A;  2XLJ A;  3FVN A;  1XOC A;  2I7N A;  4B3R M;  4EUO A;  4LY6 A;  4DCX A;  3SYL A;  2V84 A;  1DGH A;  2XX9 A;  3M8U A;  3ZSF A;  2A5T B;  2NOO A;  3QSL A;  3NWL A;  4QNR A;  2F6G A;  3L25 A;  4FJP A;  2GH9 A;  3MHV C;  4LZZ A;  4B7G A;  4I62 A;  3RPW A;  1FQE A;  1NH7 A;  3H06 B;  2XXW A;  3FVG A;  5DT6 A;  1NVM A;  1II5 A;  3T93 B;  1LAF E;  1B58 A;  4F3G A;  1NH8 A;  5KPZ A;  3QUJ A;  4DV7 M;  3U6C A;  3KOS A;  1BIY A;  3HKP A;  4JXJ A;  5AA3 A;  1XWI A;  3TDJ A;  1B52 A;  1YSY A;  4UA8 A;  4F1U A;  2KRK A;  5EHM A;  4R6K A;  3HU1 A;  5AA4 B;  1AMF A;  2R18 A;  5TPA A;  1W5S A;  2G29 A;  4AKI A;  3H03 A;  1EE8 A;  3TPA A;  1NSF A;  4ZZE A;  4GL8 A;  3VXC A;  3K02 A;  1NL5 A;  3EF7 A;  1O7T A;  3MVY A;  3C9H A;  1MXZ A;  1SI1 A;  2AL4 A;  4ELP A;  1P1W A;  1P1Q A;  3MK6 A;  1ANF A;  3K1P A;  4Z6Y A;  1R2Z A;  1ZJL A;  2UXC M;  4DV4 M;  4R6Y A;  4LON B;  3IX1 A;  3O6I A;  3GPU A;  3HO7 A;  1IXG A;  2D7G A;  4DR3 M;  3IOW A;  4IBG A;  1MY1 A;  2ONK E;  3HST A;  2DVZ A;  4OEV A;  3BKI B;  3GRY A;  2CUZ A;  4OX9 M;  1N0T A;  2V1U A;  3QUF A;  1N84 A;  4MB7 A;  1SVX B;  4F31 B;  3VVE A;  3LQR A;  5I58 B;  4JWO A;  4L15 A;  4LGM A;  3TTN A;  3SKP A;  3KZG A;  4FEB A;  3V5A A;  5BPV A;  4DE8 A;  3L29 A;  1L1T A;  3Q25 A;  1SYI A;  1TFD A;  2R4E A;  3FTF A;  1GV8 A;  4F2O A;  4IBI A;  3CF6 E;  1QKA A;  2CZL A;  1OFH A;  3HU2 A;  1JW5 A;  4PFY A;  4WEP A;  2XXP A;  4IO4 A;  5JTY A;  2DS9 A;  2F7A A;  2CHV A;  1UIU A;  1GTK A;  5I2K A;  4JI8 M;  4QSC A;  4YMB A;  1IN6 A;  2QCU A;  5FHM A;  2ZYO A;  4MH5 A;  3TQL A;  1SD3 A;  3BOS A;  1D9V A;  5EXX A;  3FXU A;  2CFO A;  2UXB M;  5DEX B;  1IN8 A;  1R7R A;  1H76 A;  3U60 B;  3FVK A;  3AOE C;  4G77 A;  3IL1 B;  4MGZ E;  4LP2 B;  5FTN A;  1N7W A;  1PJI A;  1IY1 A;  3SAW A;  2RC7 A;  1LBC A;  2B65 A;  3FAT A;  4PFU A;  4CIS A;  3SAV A;  2AHM A;  5ICT A;  2IEE A;  3TEP A;  3K4U A;  5L9S A;  2I4C A;  5LOM A;  1DTG A;  4G4Q A;  4B3M M;  2DHR A;  3K2L A;  2ANJ A;  3N6T A;  2P0S A;  2XSZ A;  3KS4 A;  5L9M A;  4NF8 A;  3S9L C;  2HZK A;  2BJJ X;  4THI A;  4G8M A;  3HJ8 A;  1LGB C;  1S7Y A;  3J7A S;  5ITP A;  1SBP A;  1D9Y A;  1R9L A;  1NKX A;  4OVJ A;  4OEU A;  3KP1 E;  3RTW B;  5ITT A;  1Z5A A;  2OWT A;  2EO2 A;  3HJS A;  1SW2 A;  1SXJ C;  5I56 B;  2DXR A;  2QS3 A;  2DE4 A;  1DO2 A;  2ZAO A;  1QAO A;  2Q2C A;  3OEN A;  3CSB A;  4ND9 A;  4IIW A;  4GIP A;  3HGI A;  1Y4C A;  5H8Q B;  1Z5C A;  2W82 A;  2VOZ A;  1USY E;  1XVY A;  1VR5 A;  1IBL M;  4OES A;  3CF0 A;  3UK4 A;  4WKM A;  2QJE A;  3KVW A;  1FQF A;  3SEY A;  1JVY A;  3PUX E;  4TOZ A;  1UTH B;  3I6V A;  5DVI A;  4F19 A;  2OWS A;  2XSZ D;  3FD3 A;  1SI0 A;  3ZCB B;  4ELR A;  1DO0 A;  1TT1 A;  4BDQ A;  3KOW E;  3GLI A;  4KHZ E;  4GD5 A;  4O3A A;  4NF4 A;  2G93 A;  2DVW B;  3K6V A;  4Q0C A;  3G3J A;  2M5Z A;  3DZD A;  3TQS A;  3GLH B;  2R62 A;  1ZAE A;  4U1Z A;  4FVM A;  1B0L A;  2A5T A;  4HCY A;  4CHT B;  4C1U A;  4E0W A;  3D4G A;  2C98 A;  5FTL A;  3PFI A;  3FTE A;  2R4J A;  4R2B A;  5M2V A;  1IM2 A;  4I81 A;  4ZEF A;  3KDS E;  1L2C A;  2Y7I A;  4GIZ A;  2E1S A;  2Y0Q A;  4EDP A;  5DVF A;  3MPL A;  1N3W A;  1WVJ A;  3C32 A;  4ZEB A;  4Z8X A;  4OXV A;  2KLF A;  2O51 A;  4ISU A;  4PET A;  1S3S A;  1MPD A;  3IOT A;  2Z3X A;  3SHG B;  4DR1 M;  2H98 A;  1I4W A;  2RCA A;  3VDF A;  2OCU A;  2BJW A;  4LFB M;  4EF1 A;  2R65 A;  3TE6 A;  4JB7 A;  3E13 X;  3TWK A;  4QFL A;  2D7E A;  2EA0 A;  3TUS A;  1FTO A;  2A5Y B;  1G3I A;  4FCW A;  2DXI A;  2HL7 A;  3TWM A;  4AB6 A;  3GQ5 A;  1LV7 A;  4LJ8 A;  4KFQ A;  3RT8 A;  5IT9 S;  5EP2 A;  1DTZ A;  2F8D A;  3VDU A;  1WDN A;  5BR8 M;  5FTM A;  3PV0 E;  3LSX A;  3MZ1 A;  3IK6 B;  3A45 A;  3DA1 A;  3H3G A;  2FFJ A;  2I3V A;  4BB9 A;  2J7O A;  4C0R A;  1IXS B;  3LBS A;  4JI5 M;  1IXC A;  3IO4 A;  5AA1 A;  1IN7 A;  1QKB A;  2C5R A;  2OBG A;  5A2Q S;  4HTG A;  5I58 A;  2VQE M;  4NWC A;  3F11 A;  4HLQ A;  5FTK A;  1LAG E;  2DZN B;  1M5C A;  2O6A A;  2XH9 A;  3T96 B;  3W9W A;  2OJT A;  3Q29 A;  1KFV A;  3S2V A;  3FUU A;  4HCW A;  3H4M A;  3TTM A;  1MRP A;  1H6U A;  3G3I A;  1ZU0 A;  3H6T A;  4LF8 M;  4H5F A;  1I6B A;  4F2Q A;  3B6Q A;  2XXI A;  3AL0 C;  2RGO A;  2RC9 A;  3TTL A;  2ZAM A;  4B3T M;  4DR6 M;  4H0W A;  3M6A A;  3NBI A;  2XHD A;  1URD A;  5DEX A;  4M0W A;  3VLW A;  3U60 A;  4IBD A;  4MGK E;  3SER A;  3UGJ A;  3PPQ A;  2Q88 A;  2Y0T A;  3T1H M;  2DXY A;  1Q3B A;  1HSJ A;  5CI5 A;  1D3K A;  4FED A;  3ZH9 B;  2DWL A;  2J7N A;  3B6W A;  4N13 A;  4HW8 A;  3O97 A;  3USD A;  1Y3Q A;  2Y7P A;  3TCG A;  5TU0 A;  4IBF A;  1I6Q A;  2DWM A;  2YR0 A;  2P5T A;  2DYX A;  2DE3 A;  2PVU A;  3SYK A;  5CM6 A;  3AV0 A;  3L27 A;  2X7Q A;  1QUK A;  2F6P A;  4P16 A;  3GO8 A;  1HSL A;  5ITX A;  2Q8J A;  3QXM A;  1ZQ9 A;  4JI3 M;  3IOU A;  4ECF A;  3TMG A;  2LWX A;  2QBY B;  1C1K A;  5I59 B;  1X37 A;  2XF3 A;  2R6G E;  2PMS A;  1E9R A;  4RPO A;  4FD2 A;  1FJG M;  4DR5 M;  2REJ A;  2BNK A;  2I3W A;  4AW4 A;  3M3F A;  2F7B A;  3IO6 A;  2FYI A;  4DV3 M;  3FAS A;  2ZYM A;  3C33 A;  2F5N A;  3KBR A;  4JYA M;  3FUZ A;  5ISU A;  1DSN A;  3TQW A;  3SC3 A;  4G4N A;  1GGG A;  4B7F A;  4IO2 A;  4LA9 A;  1CE2 A;  4U4S A;  1POY 1;  2F34 A;  1Z7M E;  4M1V A;  1MU5 A;  2CMO A;  2RKM A;  3GBA A;  2QZ4 A;  1K3W A;  4JN6 A;  3CG3 A;  4G68 A;  4HS7 A;  3E9X A;  2Q9T A;  4YB5 A;  4TLM B;  1B6H A;  2RKO A;  3GPP A;  3H4Z A;  3Q26 A;  2UUA M;  3FUT A;  2JA2 A;  4ELQ A;  1Z5B A;  1M5B A;  3SES A;  5DYI A;  4LJ4 A;  3U94 A;  4QHS A;  2XFS A;  4S12 A;  3GXA A;  3OOA A;  4GXA A;  5H8N A;  1TGU A;  3GPY A;  2ZYN A;  2ZNT A;  1IXZ A;  1S9T A;  2O68 A;  5J1D A;  2ERC A;  3IAZ A;  2D21 A;  3FTD A;  4ZEK A;  2XXQ A;  1B5J A;  1D2N A;  3KJ7 A;  3KS8 A;  1B40 A;  3V89 B;  1JNF A;  2UYF A;  2O1L A;  3KOY E;  2DWN A;  4PQJ A;  1PBP A;  1NJF A;  4F1V A;  4R6H A;  2QPA A;  2XEP A;  3LSW A;  1Q39 A;  5KZT A;  3O9P A;  3PUY E;  3IB2 A;  3PMX A;  4ITQ A;  3K2D A;  1GLN A;  1B51 A;  1UTB B;  1IXR C;  1HT1 E;  2FNA A;  1UIV A;  2I48 A;  3K1J A;  3SFZ A;  2F4V M;  2UVH A;  1E32 A;  3VK8 A;  2B3B A;  4YB7 A;  2GFE A;  3A46 A;  1YUB A;  4AG5 A;  3OMB A;  2F5Q A;  4DUZ M;  1MY0 A;  1DPP A;  3CVG A;  4KCC A;  4LF9 M;  4RPN A;  4RF0 A;  4FWD A;  3U5Z A;  1KWH A;  2LAO A;  1MXW A;  4X1D A;  3TL4 X;  2X7P A;  1QVS A;  1XNR M;  3MJN A;  1ZIU A;  2RC8 A;  1A55 A;  2QMX A;  3P7I A;  4RJZ A;  3MVZ A;  2HCA A;  4LJ5 A;  2K47 A;  4IGT A;  2CV1 A;  3J27 B;  3MUQ A;  3GRR A;  4XKN A;  2DWH A;  2QS1 A;  2HQ0 A;  3JYR A;  4LQ2 A;  3K6W A;  2H9B A;  1NNK A;  4OQO A;  4AG6 A;  4DXB A;  2A5S A;  1N7X A;  1Y3P A;  3TTK A;  3DP8 A;  4LUB A;  5F1Q A;  4ZEC A;  1EZO A;  2XX8 A;  3T66 A;  4Z0I A;  3R9X B;  2C9C A;  1IY2 A;  2VGQ A;  4W5W A;  4GMQ A;  1QYR A;  3CI8 A;  2XXV A;  4EQ7 A;  2Q89 A;  1IQ7 A;  3KG2 A;  2G5G X;  4H8I A;  2RGH A;  3PUV E;  3UP9 A;  1NMU A;  4QRZ A;  3HN0 A;  4KPT A;  1P1O A;  2RIN A;  3OEK A;  3G7W A;  4YKK A;  1SXJ E;  1WXQ A;  4JI6 M;  1B9J A;  1US4 A;  2QP9 X;  4AZF A;  4POX A;  1JW4 A;  2B3F A;  1PEB A;  3LSL A;  3SHF A;  1YE9 A;  2DZO B;  4NF6 B;  2DWA A;  1XMO M;  1MS7 A;  4KR5 A;  3VVF A;  4JDF A;  1US5 A;  3S9M C;  3ILK A;  3I51 A;  4X48 A;  3K0V A;  2C9O A;  3CSG A;  2QPQ A;  3KOZ E;  2XD3 A;  1QAQ A;  4G6Z A;  3J81 S;  4I4L A;  4IBE A;  2XXR A;  3O29 A;  4ZPX A;  3TFL A;  3HJQ A;  3U6L A;  1DGB A;  1RYX A;  1K3X A;  2Q2E B;  2Z7J A;  4RF1 A;  2AYS A;  4PFW A;  4AKG A;  2I0C A;  3U6M A;  1HNZ M;  4NE4 A;  1B3L A;  4TUW A;  3CG1 A;  3RQT A;  2QBY A;  3MVW A;  5I59 A;  1J1N A;  5KDT B;  3PPO A;  2X4A A;  1N3X A;  4NSO B;  1IEJ A;  1JEV A;  4F22 A;  2ZNU A;  3Q8X A;  4MF3 A;  3RN8 A;  4MGI E;  3VKG A;  3M3L A;  4G2Z A;  4LG2 A;  3TCF A;  1JR3 A;  4CGY B;  1ATG A;  1USY H;  5TP9 B;  4GH9 A;  4GQO A;  1LB8 A;  1IZ1 A;  2DP8 A;  3CRB A;  1B7Z A;  3K1N A;  3K6X A;  3KN7 A;  4LZJ A;  4OVZ A;  2H1R A;  3G3F A;  3I3V A;  4JBZ A;  4XTC Q;  1S50 A;  1NY6 A;  1MY3 A;  5B7D A;  1NHW C;  4M9S A;  1OLA A;  3U6E A;  4GF8 A;  3OO7 A;  1A54 A;  3TWL A;  1TWY A;  4PT5 A;  2QRY A;  3RFW A;  2X26 A;  2VQF M;  1MQH A;  2Y7R A;  4LQ5 A;  5KO3 A;  2NUV A;  7CAT A;  3SMP A;  4U23 A;  3T15 A;  4RXL A;  1LFG A;  3C31 A;  4MBP A;  3B6T A;  1UM8 A;  4F29 A;  3M0E A;  4X62 M;  1JVX A;  3UMM A;  5H8H B;  4H8J A;  1PB7 A;  4QSD A;  2PBW A;  3MJ5 A;  4JV5 M;  4YKI A;  3FUX A;  1JR3 D;  3N94 A;  3MQ9 A;  3K1M A;  5ICQ A;  2I0B A;  1SYH A;  1OQG A;  5AA2 B;  4X65 M;  1JW1 A;  3CF2 A;  2DWJ A;  4XIG Q;  4IO7 A;  5I84 A;  1N32 M;  1XC1 A;  4FW9 A;  3SDF A;  3U6Q A;  1FQA A;  4MLQ A;  4R9F A;  1DPE A;  4E0X A;  1I94 M;  4MGH A;  1OJL A;  1PJJ A;  1MM6 A;  2NWJ A;  4REZ A;  3C35 A;  5LMN M;  2HAV A;  4NMY A;  3KOX E;  1PDA A;  1FQD A;  1SXJ A;  3OEL A;  3FJ7 A;  2Z23 A;  3RUM A;  3EHU A;  3PPP A;  4IBK A;  4HL4 A;  1ZTY A;  5DYH A;  3OO6 A;  1L2B A;  1B05 A;  2QSX A;  4F3B A;  3TKD A;  3LR1 A;  5CMK A;  3CTW B;  4GRI A;  4GKJ M;  3LVV A;  1B0H A;  1XT8 A;  2LH0 A;  3GLG B;  1VSO A;  4QFK A;  4QNM A;  3U61 B;  1H45 A;  4OYV A;  3G3K A;  3FXR A;  3RNN A;  2Z8D A;  3PMV A;  1MXX A;  3VK7 A;  1R9Q A;  1HSE A;  4FAT A;  3GPX A;  1P1U A;  5ITU A;  5IRE B;  3PPN A;  3LSF B;  1B1H A;  1FTK A;  2F5P A;  5EYF A;  4IBJ A;  3GLF B;  3UZU A;  1SXJ D;  5ITX E;  4I8O A;  4G8N A;  1D4N A;  4K3F A;  4FEC A;  4H67 A;  4OU7 A;  3K8Z A;  1F9B A;  1NJG A;  4PDG A;  3FJG A;  2PT2 A;  5AA4 A;  3BBR A;  4IBC A;  5I2N B;  1B3G A;  3L26 A;  4H1X A;  4YIC A;  1XXH B;  4LF7 M;  4Q8R A;  4AQY M;  4BLA A;  1XVX A;  3KW6 A;  4NTL A;  3LC8 A;  1Z7N E;  3T9U A;  1NY5 A;  1IXI A;  2I6E A;  3O6G A;  3BFU A;  4LZ5 A;  1MPB A;  1OLC A;  1KYI A;  1DOT A;  3AXF A;  1MH3 A;  4ZS9 A;  1EU8 A;  3OEM A;  5ITO A;  2O7I A;  1TDH A;  4GFR A;  3N5L A;  2GHA A;  3PMW A;  2CHQ A;  3VDP A;  2V3U A;  3PPR A;  4G4O A;  4I1D A;  1DGH B;  3SAU A;  3VLV A;  1A40 A;  4PD2 A;  4FWH A;  3V83 A;  1PBQ A;  3CFL A;  5FSW A;  2H4I A;  3U93 A;  3OTO M;  4ELO A;  2KZS A;  2F5X A;  2THI A;  2YNM D;  4JWY A;  3FXQ A;  3CFX A;  5H37 D;  2HFB A;  3THG A;  5ITR A;  4IBB A;  3T9X B;  4LRS A;  3FV2 A;  3K00 A;  4U4X A;  3HV1 A;  2F35 A;  3N6U A;  3TOD A;  2R71 A;  2Z8E A;  3PNV A;  1MPC A;  1K82 A;  3FGS A;  4KYE A;  4IO6 A;  1NNT A;  3H7M A;  1Y3N A;  2AL5 A;  2ZYK A;  3M3K A;  1ELJ A;  5EHS A;  4PFT A;  2O69 A;  3TTR A;  5KDT A;  4YKJ A;  3J2P B;  3ILT B;  2XXH A;  1LST A;  3VFJ A;  2ZXT A;  4BBA A;  3S9E A;  1NNP A;  3W9V A;  3DEL B;  4RYA A;  4PDI A;  2H25 A;  4NL4 H;  4EIW A;  5TP9 A;  4ONY A;  4MH0 E;  2REG A;  3DOA A;  4KOD A;  1B3F A;  2I58 A;  4IGR A;  3GZG A;  3IOV A;  3VXB A;  1IUD A;  2Y84 A;  3VLF B;  1VDD A;  1O63 A;  3MP8 A;  1A8E A;  2NVU B;  2E5L M;  4RNS A;  5F7V A;  2KEB A;  3AOG A;  5ELV A;  3DP6 A;  3JZJ A;  3HHW A;  3VFD A;  2UVI A;  3CIJ A;  3HCQ A;  3J7B A;  2OLB A;  3U6O A;  5FTJ A;  1BKA A;  4OFO A;  3EIE A;  1MY4 A;  2ALU A;  1M5D A;  1SW1 A;  2XX7 A;  2H5Y A;  5KQD A;  3MC2 A;  2XXT A;  1B3E A;  2PYY A;  1IQP A;  4QFP A;  4FOR A;  5CC2 A;  1NHG C;  4GHA A;  1UQW A;  3THI A;  1PC3 A;  5C18 A;  4KO8 A;  3TZA A;  1LBB A;  4YMA A;  4X64 M;  5A5X B;  1E94 E;  2OQ4 A;  3DLN A;  5EXS A;  5I56 A;  2L7H A;  4DDD A;  1L1Z A;  2CV2 A;  1LCT A;  2V93 A;  2Y7K A;  1J7K A;  5H8Q A;  3G3G A;  3MZB A;  2OZZ A;  1H3D A;  1JQF A;  1QUJ A;  1FTL A;  5I57 B;  1PB8 A;  3RT6 B;  5H8F B;  3QWL A;  4KHP M;  4NSR A;  5BWJ A;  1B4Z A;  4F39 A;  5EP4 A;  3D8B A;  3PUZ E;  3O6H A;  1UTH A;  4LZ8 A;  2I49 A;  3T9H B;  2HCB A;  3FKE A;  3RGY A;  1FW0 A;  3L28 A;  1Z6T A;  5HBC A;  3KFM A;  1PB9 A;  4JXI A;  2UVG A;  4RK2 A;  4R9G A;  3WHL A;  4O3B A;  3AJI B;  1QVR A;  3GLH A;  3ECR A;  4FWG A;  4TLL B;  1SDX A;  3D4C A;  4F3P A;  1L2D A;  4O3C A;  1YAE A;  5FTI A;  1MDQ A;  2P1S A;  3A09 A;  1IN5 A;  3A3U A;  5FHO A;  5F3W A;  3CFZ A;  4GKK M;  1B32 A;  1YPN A;  3UA8 A;  1OMP A;  3C34 A;  3GLF A;  2UXA A;  3QIM A;  1N75 A;  2FOI C;  1MH4 A;  2XXX A;  1IBK M;  1L5T A;  2FNC A;  2Y20 A;  3VV5 A;  4OHN A;  5EP3 A;  4PP0 A;  3JAM S;  5K2Y A;  3C4M A;  1O64 A;  4DIG A;  4NF5 B;  5I2N A;  3FUV A;  4K0K M;  3E3K A;  1XXH A;  4NWD A;  5DNY A;  2WKY A;  3MP1 A;  1G4A E;  2ZNS A;  1Q35 A;  2QEN A;  3MW0 A;  1EZP A;  2ABH A;  4D82 A;  3UGW A;  3IR1 A;  2O7U A;  1ORY B;  1NFT A;  5IKB A;  3FIR A;  3U6D A;  3ONM A;  3EIH A;  3RY3 A;  1TXF A;  4NRV A;  4G8H A;  2O1M A;  2RF1 A;  4EQB A;  4OWD A;  2V1C A;  4KYS A;  2R45 A;  4M9Z A;  3HHF A;  1W5T A;  4ZEI A;  4YY3 M;  5ITY A;  2E0S A;  4NF4 B;  3OD7 A;  4QFN A;  1MQD A;  3VVD A;  4LJ7 A;  3K01 A;  3LQQ A;  4KLN A;  5EJC A;  1N76 A;  3PD9 A;  1N78 A;  4R72 A;  1SW5 A;  1Y4T A;  3TYH A;  4LZ7 A;  4EF2 A;  1Q1K A;  4GOT A;  2I4B A;  5GKN A;  5IWA M;  4YB6 A;  3TCH A;  1OIB A;  2RCB A;  5KPR A;  3FYD A;  3I4Y A;  4IJE A;  4MGY E;  2BJV A;  2DSF A;  3IJX B;  4OMB A;  4GWO A;  1N33 M;  2HKJ A;  4AKH A;  1BLF A;  3MBP A;  2DVC A;  4XXU A;  1LCF A;  1KSF X;  3HU3 A;  4AB5 A;  3I4V A;  4OET A;  4R7G A;  4F1Y A;  4X66 M;  2Z4S A;  2XZF A;  1QAN A;  3KN3 A;  4IO3 A;  4B3S M;  4WED A;  1GL6 A;  3TPZ A;  3HHG A;  4G4R A;  1HR0 M;  4YHH M;  4DR7 M;  3C36 A;  4WW0 A;  5C1B A;  3QAX A;  3OO9 A;  3JR5 A;  2QL3 A;  1VE4 A;  3RLF E;  1XMQ M;  4F3S A;  2D3I A;  3FVO A;  2V6Z M;  4JI2 M;  4JI1 M;  4GLI A;  3A3C A;  5EXP A;  2ZAN A;  3N26 A;  4DV6 M;  4BDR A;  4R73 A;  4LFA M;  1XHY A;  4H6D A;  3OXN A;  3KOT A;  2G8L A;  4U1O A;  5AE4 A;  1MQG A;  4U21 A;  3U92 A;  4EQ9 A;  1T3T A;  3IG5 A;  2GHB A;  3JR4 A;  4RK9 A;  3SAT A;  4R2F A;  5KCJ B;  4NXN M;  4X9T A;  4YKP A;  1P1N A;  2KW0 A;  5JK4 A;  4GC9 A;  5DYG A;  4IY6 A;  1B46 A;  1H43 A;  3HHY A;  2UUB M;  4GL0 A;  1IIW A;  3EQ1 A;  4Z7E A;  1OFI A;  4GXS B;  3S9N C;  3V8X B;  3MWB A;  1FNN A;  1B4H A;  3U1O A;  2XFT A;  2FA7 A;  4GRK A;  1B7H A;  1MDP 1;  1IN4 A;  1I69 A;  5A5X A;  2KXE A;  1LAX A;  4R3D A;  1JET A;  1EZ9 A;  2YJP A;  1AH5 A;  2F7C A;  4PCZ A;  2UVJ A;  1G59 A;  2ONR A;  1MG1 A;  1TH2 A;  1TFA A;  1B5I A;  1MQI A;  3HWS A;  2ZM6 M;  1QJM A;  4L17 A;  4RY1 A;  5DTB A;  4AQ4 A;  2NXO A;  4DR4 M;  3FTC A;  2VP1 A;  2XXU A;  4ZED A;  4FAJ A;  1FTJ A;  3H6U A;  1LAH E;  5I57 A;  4BDL A;  4F18 A;  5EXT A;  1URG A;  1AIV A;  5H8F A;  4LF4 M;  3SMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...