3KSJA

The alkanesulfonate-binding protein ssua from xabthomonas axonopodis pv. citri bound to mes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
AEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrate transport protein
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Transport protein
total genus 94
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA02
2V25A 4GL0A 4R6HA 1NNKA 1SW5A 1O64A 2O68A 3EF7A 1A40A 1GR2A 1BP5A 4THIA 5HM4B 1SI1A 4HS7A 3PUZE 1POTA 4JB7A 2I6EA 5KDTA 1EZOA 2R71A 4LONB 1FTKA 2D3IA 1SDXA 1NKXA 3H4ZA 4LQ5A 3JZJA 4JWOA 1IQ7A 1O7TA 1H3DA 4IO2A 5AA3A 1US4A 1FTLA 3OD7A 3ECRA 1OLCA 3RN8A 1DTGA 2REGA 1LFGA 5FTHA 1D4NA 4H8IA 1OQGA 5TPAA 3MVXA 4Z7EA 5DVJA 2P0SA 2GH9A 4R75A 5H8FA 4RK9A 3IOVA 3Q25A 3N6TA 2DWHA 1TWYA 1YCJA 1S9TA 3FV2A 2I3VA 2Z22A 4XKPA 5L9OA 1FQEA 5B70A 4QSCA 2BJJX 1BTJA 1M5DA 3PUWE 4ZS9A 3IO6A 1URSA 1NL5A 3IL1B 1Q1KA 2D5WA 4OWDA 4MH5A 1B0HA 4GF8A 2O51A 3FJMA 3T9UA 1B3HA 1N7WA 2Q2AA 1FTJA 4WEPA 2ONSA 3TQLA 5DT6A 4OFOA 4GVOA 3H7MA 4RPOA 2OK2A 4G8HA 4R2BA 3LC8A 3K2DA 3RPWA 3ILUB 1N0TA 4LZ7A 3ODBA 4NF5A 1JW4A 2DYXA 3S2VA 4EF2A 1BIYA 4G4PA 4OEVA 3RY3A 1SW1A 1B51A 4PETA 4NF8A 3P7IA 3K0VA 3SDFA 2ZYOA 1HSEA 3VV5A 1VFDA 1Y1ZA 2I48A 2Q89A 2LAOA 3IB0A 3MZ1A 3O29A 3O6HA 2B65A 5TU0A 4R2FA 4Q8RA 3BKIB 4GXAA 3OEKA 3PU5A 3MWBA 4KYEA 3HHGA 5AA2D 3O28A 4ZEKA 4PFTA 2ZYMA 4E0XA 3LSXA 5ITPA 2UXAA 3K6UA 1XVYA 3MVWA 4ZZAA 1P1OA 4POXA 1JEUA 2AYSA 5K2YA 5KCJB 4HW8A 2YLNA 3MBPA 4EQBA 1QJMA 1A8FA 1SI0A 4G8MA 4IB2A 4G68B 1Y20A 4F1YA 5IKBA 5L8DA 2OBGA 3E4RA 5EYFA 3O66A 3TTLA 2G29A 3G3GA 2WKYA 5CC2A 4M1VA 1H45A 1IXIA 5ISUA 1XHYA 2DVCA 3MAMA 1MM7A 4KCDA 3HN0A 3FATA 3FIRA 3C34A 1MXXA 4P0GA 3SEUA 3H6TA 2DWAA 5I57B 4XKQA 4R6KA 1B1XA 3O97A 4TQUQ 2I49A 3SEYA 3BBRA 5DYHA 4H5FA 5I56A 1OLAA 1J1NA 3V5AA 3K6XA 4NE4A 1A99A 2D21A 2HAUA 4RPNA 4UA8A 3CVGA 4F1VA 3TUSA 3D4CA 1Y4CA 3LUYA 2KLFA 4LVQA 5CMMA 2I4BA 3S9LC 4ECFA 3V83A 5IAIA 1MQIA 1B0LA 3C9HA 2ZMBA 1OMPA 3OEMA 1SVXB 2Z8DA 4JSDA 2DOJA 3SERA 4FAJA 3I6VA 3TTMA 2Q88A 4DCYA 2XXWA 3B7DA 1OIBA 3HCQA 4GD5A 2RKMA 4K3FA 1MM6A 2PYYA 2O7UA 3UGWA 4GFRA 2XD2A 5K2XA 2ZYNA 4I62A 4FEBA 1FTMA 1SYIA 1YTVA 3ZKKA 2Z8FA 1AMFA 3BFTA 1B52A 1UQWA 3EN3A 4C1TA 4NF6B 2E1SA 1AOVA 3LSWA 2F35A 4OHNA 4N07A 2ONKE 4QFKA 2NXOA 4DIGA 2A5TB 4ELOA 1QULA 4U4SA 3TKDA 4WKMA 2ZNUA 4LQ2A 3KSXA 5A5XA 3SESA 1M5BA 2DWIA 1GTKA 4UACA 4GQOA 4OTEA 3SETA 1MXYA 1LGBC 1FQFA 3OOAA 4JWYA 2OCUA 4AB5A 1LAXA 4G2ZA 5F7VA 3IOUA 2B3BA 1II5A 3MQ9A 4F39A 1LLSA 3B6WA 1TXFA 3TODA 1URDA 4JWXA 2P1SA 2QSXA 4RK2A 1AL3A 3H6UA 3TQWA 4ELQA 1HSLA 1QUIA 1R1NA 2PVUA 4OVJA 4I9DA 2GHBA 3K1MA 2XHDA 1B3FA 4YB6A 3JV9A 5I84A 4O3BA 3PMVA 1ZU0A 5H8QB 4BDNA 3CRBA 4NEDA 3TTNA 3RLFE 1KWHA 3A09A 4ZEIA 1SW4A 3T9VA 3G3FA 3VLWA 2O6AA 2XX7A 5CM6A 4F3PA 2XXXA 2P2AA 2DVZA 4OENA 2DE4A 4IGTA 3MP1A 1US5A 4QSDA 2REJA 1HSJA 2RCAA 1PDAA 1MY1A 3MVZA 3VFJA 2F7CA 5DEXB 4HCYA 3T96B 1XOCA 5DVIA 4X1DA 1JNFA 4LATA 2HCAA 3TCFA 2UVIA 3GLBA 4H67A 4RJZA 1XS5A 4OZ9A 3SKPA 2H4IA 2V3UA 4HCWA 2V3QA 5JTYA 3DM0A 2G93A 1A7LA 3C36A 3O6IA 4YKPA 3C33A 3FZVA 4QFOA 2F78A 3EQ1A 5ELVA 3VLVA 3PMWA 2HFBA 2RCBA 2UVHA 4F3BA 3G3JA 2OWSA 3PMXA 3GZGA 3HPIA 2HEUA 1AIVA 3TCGA 3TTKA 4JXIA 2FYIA 2ALUA 3GBBA 2GFEA 1MQJA 1LAHE 1UIUA 4F1UA 3LBSA 3H3GA 4QF9A 4MFIA 3TZAA 2RC8A 3VXCA 1B2HA 3S9MC 4R6YA 4DXBA 3K6WA 4YU0A 1SQYA 1MXUA 1I6QA 2A5SA 3ILTB 5KCJA 2IEEA 3SEXA 1UTBB 1H43A 1OVTA 1IXGA 2ABHA 4KD5A 1B7UA 2OLBA 3LSLA 4G68A 4YMBA 5DVFA 5B7DA 1R9QA 3KG2A 1DTZA 3FV1A 3UP9A 2V3TA 1MDQA 3RT8A 4YKJA 3S9NC 4OQOA 4MBPA 3E9XA 1SYHA 2I4CA 4RYAA 1QW0A 5CMCA 3QUFA 1LCTA 3O6GA 2H99A 3CFLA 2DQVA 1LBBA 5I57A 4IGRA 3W9WA 4U4XA 3U93A 5I2NB 3FVNA 4TLMB 4F31B 3ONMA 3IK6B 2F6PA 1FW0A 1B5IA 1MQDA 2XX8A 1LB9A 2DWJA 3U94A 3RUMA 2CMOA 3T93B 3A3UA 1FTOA 1ZLQA 4ESXA 3KN3A 3DP8A 4JBZA 2QS3A 4R73A 4I1DA 3FASA 3M3LA 2YPNA 3H6VA 4P11A 4IO7A 3DP6A 4OETA 4FJPA 3DP4A 1ZIUA 4PE5B 1Y3PA 5JEIA 1ZBMA 1B7ZA 3N5LA 4E0WA 2I3WA 1MQHA 2O69A 4G8NA 4EUOA 2ZNSA 2R9JA 3VVDA 1O63A 4OERA 5LOMA 3R7XA 4FORA 2V93A 4EQ9A 5CBSA 1A55A 3IAZA 3MW0A 3IX1A 4EXKA 1JVXA 4OFLA 3WAEA 4BLAA 3B6TA 3R26A 3CSBA 1FQAA 5EHSA 1GV8A 4HTGA 2DP8A 3PPOA 1B46A 3PD9A 3OENA 2QMWA 1BLFA 3QIMA 1MS7A 3EPEA 1B3EA 3K4UA 4Q5TA 1QKBA 5H8SA 4L17A 1MG1A 2NWJA 3TCHA 3EHTA 4IY5A 3ZKLA 1TT1A 3RTFB 3THIA 3IO4A 5KDTB 1POY1 1A8EA 4KR5A 1ZKBA 1JETA 2ONRA 3LR1A 5AA4B 3IOWA 4OEUA 3TTRA 4R9GA 3MUQA 2Y7RA 3R6UA 3FJ7A 4R9FA 2RC9A 4O3AA 4X9TA 1GVCA 1MXZA 2GRVA 4F29A 3KOSA 5TPAB 2PX1A 3CSGA 4X48A 5H8FB 2VP1A 4PFYA 1P1UA 4YICA 3KSJA 3TDJA 3TPAA 2OJTA 2X7PA 1NNTA 1IXCA 3IJXB 4ZEBA 1LAFE 3ZSFA 2X26A 3HV1A 1N76A 3G3IA 1NMUA 1LFIA 5DEXA 1B5JA 5CMBA 4AQ4A 5AE4A 3OO7A 4Q30B 4I8CA 2AL4A 3B6QA 1IZ1A 4U23A 3D4GA 4FE8A 1DSNA 4ZE9A 3I3VA 2QRYA 5I59B 1R9LA 4ND9A 1F9BA 3T9XB 2Q2CA 5M2VA 1IEJA 4ZEFA 5AA2B 4XTCQ 1USYH 3TEPA 3Q29A 4GOTA 2HQ0A 4C1UA 2AIXA 2H98A 2THIA 2DXRA 2F6GA 1ANFA 3OSRA 5BUUA 4F19A 3KJ7A 4KHZE 5FTIA 2QS4A 4IO5A 2OZZA 3TMGA 1QUKA 4QFLA 4YAHX 1NNFA 1D9VA 3EHSA 1RKMA 3SEVA 3L6HA 1LFHA 1LAGE 1SW2A 3RNNA 1USYE 3VVFA 1OQHA 3W15C 2I58A 4ELRA 2I0BA 4QHQA 1T0KA 4H0WA 4Z0IA 3PPQA 1YPNA 4TOZA 4F22A 1EH3A 3VXBA 4ELPA 1ZTYA 2VHAA 3N26A 4PP0A 3H06B 1R6ZA 4QRZA 2QS1A 1JW5A 1LCFA 5I58B 1ZJLA 3K01A 5BWJA 3UN6A 1D3KA 2YJPA 4GIZA 4F2QA 3T9HB 3AXFA 2ZNTA 3WAFA 3KJTA 3S9EA 4FIMA 1N04A 1B5HA 5ICQA 3I5OA 1GGGA 2XXTA 3PPRA 4O3CA 3KOTA 4G77A 3H03A 2F36A 2XD3A 4YB5A 1DMBA 1FQDA 4KCCA 2UYFA 4X1BA 1UTHB 5I56B 5I2NA 1S7YA 4WEDA 4F2OA 4MLQA 1P1WA 1I6BA 3PD8A 4WXJA 4RA1A 4NWDA 3N6UA 2HZKA 4EDPA 3ZS6A 2XXQA 4GXSB 4M4GA 3QK6A 2F7BA 1BKAA 2Y84A 2O84X 5CMKA 1I6AA 1RYOA 1IUDA 1MPCA 3QYTA 3USDA 1MY4A 1B3GA 1P1QA 4LZ5A 1IITA 4IO4A 2DS9A 2PMSA 3Q26A 4FEDA 3QAXA 4QFNA 1MH3A 3LSFB 3DELB 4DXUA 2ZXTA 2Z23A 3T22A 3F11A 4MLVA 4U1OA 3FVOA 3HO7A 5H8NB 1NNPA 2HZLA 4KPTA 2H25A 2GHAA 1B7HA 1JW1A 1OVBA 2UYEA 4YZZA 1I69A 4OXVA 2NUVA 2VGQA 4LA9A 1N84A 2FNCA 1ATGA 5J1DA 4ZE8A 3MC2A 1SBPA 1YAEA 5TP9B 4BDQA 1JQFA 3MP6A 4Q0CA 2R6GE 5A5XB 4OESA 1N3WA 4H65A 2UVJA 4LP2B 2XX9A 1WVJA 3M8UA 1NFTA 1P99A 2QPQA 1WODA 3G3KA 4NWCA 2AL5A 2W7YA 3IB2A 4ZDMA 4DCXA 4EQ7A 3PUXE 3Q28A 1XC1A 1DPPA 3K00A 1S50A 5AA4A 3M3FA 3O2AA 4RNSA 3PV0E 1M5FA 1NH7A 3MZ9A 4XKNA 3CFXA 1D9YA 1UIVA 2F7AA 2PBWA 1B4HA 4RY1A 1EZ9A 3RTWB 3RT6B 5FHMA 1Q35A 5EHMA 5FHNA 4EF1A 1MXVA 1Y4TA 2E0SA 5ITOA 4KQPA 3HSTA 2Y7KA 1Z7ME 4IO6A 4NF4B 1XT8A 1LB8A 4XKRA 1MXWA 1ELJA 2NVUB 2FA7A 4FATA 3GBAA 1NH8A 3A3CA 2RF1A 3OSQA 3CIJA 4YB7A 5DTBA 1ZMGA 3MVYA 4KYSA 3UK4A 3QSLA 3C35A 1JEVA 2H5YA 3MJNA 2DE3A 3IR1A 5I59A 3H6WA 3M3KA 3OELA 4U2RA 5ICTA 3KEIA 4ZEDA 4BDRA 3PUYE 4IY6A 5JTYB 2QMXA 5H8HB 2B3FA 2XXVA 3TAJA 2XXPA 3RGYA 3V89B 4F3SA 3VE1B 5AA2A 3RQTA 3CR9A 3FUZA 1PC3A 4NF6A 5I2KB 1B4ZA 4N13A 3N94A 3IJOB 3QXMA 4LUBA 2A5TA 1B1HA 2DXYA 3UIFA 4PFWA 3DLNA 4XIGQ 2O7IA 3OO6A 1QUJA 1VFEA 4ISUA 4DDDA 3T66A 4BDLA 1TFDA 3PPPA 4ONYA 2Y7IA 3S4UA 4POWA 1AH5A 3MPKA 2VD2A 1QVSA 1QKAA 5HBCA 4N6PA 3CG3A 4BDMA 1CE2A 1IIWA 1FCKA 3Q27A 3FXUA 3PUVE 1MPBA 3W9VA 2F5XA 5I58A 2V84A 5L9SA 2UVGA 3KN8A 3JYRA 1Y3NA 4GRKA 4QSEA 1VSOA 1M5CA 1B40A 1LSTA 4RXLA 1CB6A 4EXLA 1PB9A 1N7XA 2M8CA 5CBRA 2ZYKA 4ESWA 1B05A 5H8QA 1A54A 2O1MA 3PGFA 4DXCA 4JSOA 1L5TA 1VR5A 4U21A 1UTHA 5F1QA 3E13X 4H6DA 4NTLA 3MZBA 4PQJA 3HHFA 2VOZA 2NOOA 2I0CA 3OMBA 3CFZA 3KN7A 2OWTA 3U92A 4H1XA 2VD3A 4R72A 4H5GA 5KZTA 1SD3A 2Z8EA 2F97A 4AB6A 3MPLA 2PT2A 1Y3QA 1B58A 3KGCA 3FVGA 4YKIA 3BFUA 3C4MA 3TELA 3KFMA 4QFPA 3MP8A 3IOTA 4JDFA 2QL3A 4NF5B 1M5EA 1WDNA 1MH4A 1P1NA 3TFLA 3CG1A 4YKKA 1FQCA 3UA8A 4NF8B 3IORA 4KI0E 3OO9A 2HXWA 1PBQA 5H8NA 2HAVA 2H9BA 1N3XA 1MQGA 3U72A 3FJGA 2QJEA 3E3KA 2Y7WA 4OFJA 4H8JA 2XXYA 1VE4A 1B6HA 3G7WA 3VLUA 4PFUA 5JK4A 2O1LA 1B3LA 5TP9A 4IO3A 3OO8A 2QS2A 3QUJA 5AA1A 2XXHA 2DE2A 1UTBA 1MY3A 1MY0A 3SEWA 4BDOA 4MF3A 4GL8A 1PB8A 4R74A 4ZZEA 2ANJA 1Y9UA 4FECA 3O9PA 3TYHA 2CZLA 5L9MA 1MY2A 1Y1MA 2DSFA 3K02A 3C32A 3EHUA 2Q8JA 3FXRA 4KFQA 1EZPA 2XXUA 2PT1A 1H44A 4GLIA 4NF4A 3G3HA 4DZ1A 3FVKA 3L6GA 3V8XB 3C31A 1MRPA 5CRYA 1MPDA 4F18A 1FQBA 1EU8A 3KZGA 3GXAA 4KYDA 3VDFA 3PPNA 5HPQA 3U1OA 3K6VA 4XXUA 3VVEA 1LBCA 4F3GA 1IXHA 1H76A 2XXIA 2XXRA 1MDP1 3U8QA 3OXNA 1TFAA 1B9JA 1B32A 1XVXA 2Y7PA 5FHOA 1PB7A 1Z7NE 2F34A 2IA4A 4DE8A 3UORA 2RINA 1DOTA 4YMAA 4ZECA 4GWOA 1PEBA 3FXQA 4NMYA 4C0RA 5H8HA 2F8DA 4TLLB 2X7QA 3K1NA 5CI5A 3K1PA 2ESNA 4G68C 3IB1A 2Q9TA 3CI8A 1URGA 3FGSA 5I2KA 4DLDA 4U22A 2RC7A 4OMBA 3KBRA 4P0IA 1JVYA 1PBPA 4LZ8A 4OYVA 1DPEA 3FD3A 1RYXA 4U1ZA
chains in the Genus database with same CATH superfamily
2FHYA 2V25A 3VKHA 4GL0A 4R6HA 1IMDA 3HJQA 4WW0A 1NNKA 1O64A 1SW5A 2C9OA 2O68A 3EF7A 1A40A 1IN6A 3TWLA 4HLQA 2XXKA 2LHGA 1GR2A 1BP5A 4THIA 5HM4B 1SI1A 4HS7A 4LJAA 3PUZE 4LJ6A 1POTA 5EYHA 4JB7A 1NSFA 1OTRA 2I6EA 3W0FA 5KDTA 1SXJD 2ZZWA 4X66M 1NUXA 2JZ0A 1EZOA 4DR2M 2R71A 3L26A 2QBYB 1FTKA 4LONB 2D3IA 1SDXA 1NKXA 3H4ZA 2R8TA 4LQ5A 3JZJA 2WEFA 5KPZA 4JWOA 4DR3M 1IQ7A 1O7TA 1H3DA 3AL0C 4IO2A 5AA3A 1US4A 1FTLA 3OD7A 3ECRA 5FLXS 1OLCA 4HE1A 4FBPA 3GLFA 3HGIA 3RN8A 1DTGA 2REGA 1Z6TA 2XF3A 1LFGA 2DDKA 1YZ0A 2G3QA 3H4MA 5EQ9A 2EKFA 5FTHA 1D4NA 4H8IA 3T15A 4JI4M 4G6ZA 1OQGA 5TPAA 2F5QA 3MVXA 4H45A 4NXNM 2DZOB 4NXMM 4Z7EA 5DVJA 2P0SA 3IFAA 2GH9A 4R75A 5H8FA 1QGXA 1HQYE 4RK9A 1N75A 3IOVA 3B89A 3N6TA 3K1JA 2DWHA 3Q25A 1TWYA 1D0KA 3TQSA 1YCJA 1S9TA 2L2DA 2V1CA 4I3EA 1YUBA 3FV2A 2I3VA 2Z22A 4XKPA 5L9OA 1WHCA 1FQEA 1GJSA 5B70A 4QSCA 2BJJX 1BTJA 1M5DA 3PUWE 4ZS9A 3IO6A 2DWZB 1URSA 1NL5A 3IL1B 1Z59A 1Q1KA 1DO2A 2D5WA 4OWDA 4MH5A 2KR0A 3U60B 2QVUA 2L7IA 3GRRA 5EQTA 1B0HA 4GF8A 2O51A 3FJMA 3T9UA 4UN2B 1B3HA 3T1YM 5FTMA 1N7WA 2Q2AA 1TDZA 1FTJA 4WEPA 1L2BA 2ONSA 1QQWA 2DENA 4IBJA 3TQLA 2P3NA 5DT6A 3FUVA 3B7QA 5EXXA 5L8RF 4OFOA 4GVOA 3H7MA 4CGYB 3SYLA 4B7HA 1HNXM 4RPOA 3B7ZA 2OK2A 4G8HA 4R2BA 3LC8A 3JR5A 3K2DA 3RPWA 3W0LB 3ILUB 4OW0A 3U6MA 1N0TA 1RDYA 3TL4X 2VQFM 3EIEA 4LZ7A 1IN7A 4HL4A 3ODBA 4NF5A 1JW4A 4DV6M 1GJTA 2DYXA 3S2VA 4EF2A 2L7HA 4LZJA 1BIYA 1WGLA 1EYKA 3OTOM 4G4PA 4OEVA 3RY3A 1SW1A 3SBJA 1B51A 2DZLA 4PETA 4B3SM 4NF8A 3P7IA 5KO3A 2HAKA 2CUZA 3K0VA 2O5RA 1OIZA 3SDFA 2ZYOA 1HSEA 3VV5A 1VFDA 1N34M 4LFBM 1NV6A 1VG5A 1Y1ZA 2I48A 2Q89A 2A5YB 2LAOA 2ZTDA 2CE7A 3L27A 3IB0A 3MZ1A 1NUYA 3O29A 5T3JA 3O6HA 2B65A 5TU0A 4L78A 2R44A 4R2FA 4Q8RA 3BKIB 4CIZA 4GXAA 3OEKA 3PU5A 3MWBA 1D0MA 4KYEA 1MN3A 5FTLA 3HHGA 4I40A 4MEVA 2LTUA 5AA2D 3O28A 4ZEKA 4PFTA 1IXRC 2Z8YM 2ZYMA 3HU3A 1NNJA 4E0XA 3LSXA 5ITPA 2UXAA 2CHVA 3K6UA 1XVYA 3HHXA 3MVWA 3FUUA 1ZV1A 4ZZAA 1P1OA 5IZ7D 2RGHA 2CP8A 2XZFA 4POXA 4MGHA 1EYIA 2DZNB 1JEUA 2AYSA 5K2YA 5KCJB 3THGA 1NV7A 4HW8A 2YLNA 4OVQA 3J2PB 3MBPA 4LZZA 4EQBA 1FPIA 1QJMA 1A8FA 1SI0A 1AIPC 4G8MA 4IB2A 1PJQA 4G68B 2RKOA 1Y20A 3T1BA 1FSAA 1IBLM 2HL7A 3PNVA 3C3DA 4KLNA 4DV1M 2FS1A 4F1YA 3BOSA 2KQZA 4BLCA 4GWUA 4JI0M 3FUWA 5IKBA 5L8DA 1XXHE 3E4RA 2OBGA 3SATA 1ZMWA 4LF5M 4XBOA 5EYFA 2K9DA 4GC9A 3O66A 5BR8M 3TTLA 2G29A 3G3GA 2WKYA 5CC2A 3GLGB 4M1VA 5ET6A 1H45A 1PJIA 4GH9A 1IXIA 5ISUA 1XHYA 2DVCA 3MAMA 1MM7A 2JZ1A 3FE3A 3T0JA 3SHFA 3BIGA 3KOZE 4KCDA 3HN0A 3FATA 3FIRA 3C34A 2Q2EB 1MXXA 2ZBKB 4P0GA 3SEUA 3H6TA 4R3DA 2DWAA 2D7GA 4GKKM 3U5ZB 5I57B 4XKQA 3KC0A 4R6KA 1B1XA 3O97A 2HXRA 4TQUQ 3KDSE 2I49A 1NI9A 3SEYA 3BBRA 5DYHA 4H5FA 5I56A 1OLAA 1J1NA 3V5AA 3ISPA 2B4LA 3K6XA 4NE4A 4P9KA 2XZUA 4P47A 1TDHA 3TWMA 1A99A 2D21A 2MKZA 4PBQA 2HAUA 4RPNA 4AKHA 2P3VA 4UA8A 3CVGA 5F24A 3DZDA 4F1VA 4IBEA 3TUSA 4PCZA 3D4CA 1TH3A 4II7A 1Y4CA 4OANA 3LUYA 1T3TA 2J5YA 2KLFA 4LVQA 4GWYA 5CMMA 4DV5M 2LVAA 4AW4A 2I4BA 4B3MM 3S9LC 4ECFA 3V83A 5IAIA 1MQIA 2DWLA 1FPJA 5DYGA 1B0LA 3C9HA 2L4FA 2ZMBA 1N77A 1OMPA 1G3IA 1Q3CA 3OEMA 1LBVA 1SVXB 2Z8DA 4JSDA 3RPLA 3E9SA 2DOJA 3SERA 4FAJA 3AOEA 4FWHA 3I6VA 3KS8A 3TTMA 1XMOM 2Q88A 4DCYA 2XXWA 3B7DA 3FTDA 1OIBA 4NC6A 3PTYA 3HCQA 4GD5A 2RKMA 4K3FA 1MM6A 2KZSA 2UXBM 2O7UA 2HKJA 2K47A 2PYYA 3UGWA 2CRUA 4GFRA 1G71A 2XD2A 2VF8A 1RDXA 5K2XA 2ZYNA 4I62A 4PAFA 3PVSA 4FEBA 2Z7JA 1FTMA 3LV0A 3J81S 1SYIA 1FBHA 2DAMA 1YTVA 1IXSB 4L15A 5DYIA 3ZKKA 4AKIA 4FCTA 4LG2A 2YNMD 2Z8FA 2WYKA 1X37A 4AZFA 1AMFA 3BFTA 4FCWA 1B52A 1UQWA 3EN3A 4C1TA 3MHVC 3GQ4A 4NF6B 2E1SA 1AOVA 3LSWA 1KA0A 2F35A 2LHCA 4N07A 3HJSA 2UUCM 4OHNA 2ONKE 4QFKA 4DV3M 2NXOA 4DIGA 2A5TB 2VIIA 2XWIA 2QNJA 1QUTA 1FPKA 4PE3A 2RRUA 3HY5A 4ELOA 3IECA 1HT2E 1QULA 3K2LA 4U4SA 4KHPM 3TKDA 3B74A 1NY6A 4WKMA 4GBWA 4I3YA 2ZNUA 4N6KA 4NL4H 4LQ2A 3MJ5A 3KSXA 5A5XA 3SESA 1M5BA 2DWIA 5DW8A 5KQ8A 1GTKA 3BIHA 4GQOA 4UACA 4OTEA 3SETA 1MXYA 3KP0E 1LGBC 4PD2A 1FQFA 4D80A 2FIXA 3OOAA 2W82A 4JWYA 2OCUA 4PCDA 4AB5A 1LAXA 4G2ZA 2JXNA 2C9CA 5F7VA 3IOUA 1DGFA 2B3BA 5I3SA 4PF6A 4DBGB 5IZZA 1II5A 3MQ9A 4MM3B 2OQ4A 4F39A 2EO2A 2F5PA 2H1RA 3E78A 5FSWA 2FBPA 4L16A 1LLSA 3B6WA 4OVPA 1TXFA 1JB0F 2OWZA 3TODA 4IBFA 4AKGA 1URDA 4JWXA 2P1SA 2QSXA 4RK2A 1AL3A 5EJCA 3H6UA 3TQWA 3SMSA 4IBIA 4ELQA 1Z5CA 1HSLA 1QUIA 1R1NA 3HU1A 4K0KM 1DBZA 2PVUA 4OVJA 4LF6M 3ZCBB 3T1HM 5BPVA 3JR4A 4G4RA 4I9DA 2GHBA 4PFRA 5FTNA 3K1MA 2XHDA 1B3FA 4YB6A 3JV9A 5I84A 5ITXA 4O3BA 2HPGA 3PMVA 2BJVA 3M6AA 1ZU0A 2V4CA 2L4EA 5IWAM 1JP4A 4PDDA 5H8QB 2CWBA 4BDNA 2VF7A 1R4GA 3CRBA 1DGHB 4NEDA 2QVRA 3TTNA 3RLFE 1KWHA 3A09A 4ZEIA 1SW4A 3T9VA 3G3FA 3VLWA 2O6AA 1RU3A 2XX7A 5CM6A 4F3PA 1F4IA 2XXXA 4IBGA 4OVTA 1OJLA 2P2AA 3KOWE 2DVZA 5EQ7A 1NHWC 3GLFE 4OENA 2DE4A 2QFLA 1MJGM 2M60A 4IGTA 3MP1A 1US5A 4QSDA 2REJA 1HSJA 3WHKA 2RCAA 1PDAA 1MY1A 4QBAA 3MVZA 1VQ1A 3VFJA 1NV1A 4DR5M 4UABA 3U60A 2F7CA 5DEXB 1VDLA 2CHQA 1DK4A 4HCYA 3T96B 1XOCA 1SXJC 5DVIA 7CATA 4X1DA 1JNFA 3GPXA 4LATA 4X04A 2HCAA 1HT1E 3TCFA 1Z5AA 2JY5A 2UVIA 3GLBA 1KYIA 4H67A 2XWKA 2X8AA 4RJZA 3CF0A 4L8RC 5ET7A 1XS5A 4OZ9A 3SASA 3SKPA 2H4IA 2V3UA 4HCWA 3E46A 4GITA 2HHHM 2V3QA 2XA5A 5JTYA 3DM0A 2XSZA 4N81A 3IG8A 2G93A 1A7LA 3FD9A 3C36A 3O6IA 4YKPA 4GHLA 3C33A 2WBBA 1XWIA 1E32A 1NVMA 3FZVA 2FVZA 2F78A 4DV4M 4QFOA 3GRYA 4LFAM 3EQ1A 4JVDA 5ELVA 5C1BA 3VLVA 2F5SA 3PMWA 4M9XA 2C5RA 4NRVA 2HFBA 2RCBA 4MNIA 2UVHA 1UM8A 3A45A 4F3BA 3G3JA 4PGNA 2JUJA 2JJKA 1QANA 2OWSA 1Q9DA 3PMXA 2UXDM 3GZGA 3HPIA 2HEUA 1AIVA 3PNYA 2K0BX 1WIVA 3J27B 2D7HA 3TCGA 3KVWA 2Z4RA 1ZAEA 3TTKA 2Y21A 2UUBM 4JXIA 2FYIA 4HXVA 1PJSA 3HHZA 2ALUA 3GBBA 4FW9A 2FNAA 2GFEA 2XSZD 1MQJA 1LAHE 1T6OA 4DUYM 1UIUA 5EP1A 4QHTA 4ITQA 4OVZB 5ITUA 1E9RA 4F1UA 1R2YA 5GKNA 3LBSA 3H3GA 5IZ1A 4GMQA 4MFIA 4QF9A 4HE0A 3TZAA 2RC8A 1D0LA 3VXCA 1B2HA 3S9MC 4R6YA 2YFQA 2WZJA 4DXBA 3LW5F 3K6WA 4YU0A 1SQYA 1MXUA 1I6QA 2XH9A 2A5SA 3ILTB 3F92A 5KCJA 2IEEA 4CISA 2WSCF 3SEXA 1UTBB 1H43A 1PGYA 1FPBA 1IXGA 1OVTA 3GLIB 2ABHA 1B7UA 4KD5A 2OLBA 3LSLA 4G68A 4DR1M 2MJ5B 4YMBA 5DVFA 4NSRA 1BVSA 5B7DA 1G41A 4DR6M 4AG5A 2LVPC 1R9QA 3KG2A 2KHHA 3TPZA 3LVVA 1DTZA 2XLJA 4RNAA 2D7EA 1GL6A 3FV1A 2DHYA 1LV7A 3UP9A 3SHGB 4MH0E 2V3TA 1MDQA 3RT8A 1NHGC 4YKJA 3S9NC 3GLGA 4GC5A 3FTCA 4OQOA 4MBPA 2VPOA 3E9XA 1SYHA 2I4CA 4RYAA 1QW0A 5CMCA 3QUFA 3GP1A 1LCTA 3Q8XA 2YR0A 3O6GA 1NJGA 3K9PA 2H99A 3CFLA 2DQVA 4N91A 1LBBA 2FFJA 1DGGA 1Y8GA 5I57A 4IGRA 1L2DA 3FUXA 4KODA 3W9WA 4U4XA 3U93A 3I4VA 5I2NB 3LQRA 3FVNA 3I04M 3A46A 3ONMA 4TLMB 3IK6B 2F6PA 4F31B 2Q74A 1FW0A 2VPNA 1B5IA 1MQDA 2XX8A 4IR8A 2AHMA 1LB9A 2DWJA 1NJFA 3U94A 5E26A 3RUMA 2CMOA 3T93B 1LBZA 3T38A 1FTOA 3A3UA 1ZLQA 4ESXA 4ANRA 3KN3A 3DP8A 5FTKA 4IBCA 4JBZA 2QS3A 5E6JA 4R73A 4G4QA 4I1DA 3FASA 2EUCA 3FRHA 3B50A 3M3LA 2YPNA 4XFEA 3H6VA 1W5SA 1HNWM 3D1RA 2LWXA 3K92A 4P11A 3LQQA 5KPTA 4IO7A 3EIHA 3DP6A 4OETA 4FJPA 1NV4A 3DP4A 3GLHB 1ZIUA 4PE5B 1YLAA 4M0WA 1XI6A 1Y3PA 3SARA 5JEIA 1N36M 1K3WA 2QENA 1ZBMA 1B7ZA 5IZ3A 3N5LA 1HR0M 4E0WA 2I3WA 1MQHA 2O69A 4G8NA 4EUOA 2ZNSA 2R9JA 4LJ9A 1L1ZA 3VVDA 1O63A 4OERA 1KFVA 4B7FA 5LOMA 4XGIA 1IN5A 4FORA 2V93A 3R7XA 4EQ9A 5CBSA 1IY1A 2ERCA 1A55A 3IAZA 4GRIA 3MW0A 5C18A 3IX1A 4XF5A 4EXKA 2CV0A 3FYDA 1JVXA 4OFLA 1RDZA 5DFLA 3WAEA 4BLAA 1IXSA 3B6TA 3R26A 3CSBA 1FQAA 5EHSA 1GV8A 4HTGA 3R8FA 4P8BA 2DP8A 4GEWA 2P5TA 2K6BA 3PPOA 1WR1B 4P17A 4QXDA 3SC3A 4MX6A 4L4UA 1B46A 1SXJB 3M0EA 3GO8A 3U6DA 4LF9M 4NSOB 1FBEA 3PD9A 2DVWB 3OENA 2QMWA 4MMPA 3SFZA 1BLFA 1NUZA 2MGWA 2R46A 5ITTA 3QIMA 1MS7A 3EPEA 1A5TA 1B3EA 3K4UA 4Q5TA 2EA0A 1QKBA 2OO9A 5H8SA 4L17A 3RYDA 3KP1E 3U61A 4DI3D 1MG1A 2NWJA 2QPAA 4AI6A 3TCHA 3EHTA 4PAIA 4IY5A 1G0HA 3ZKLA 2DAEA 1TT1A 3ROJA 4IJEA 4P56A 3RTFB 3THIA 1VDDA 3IO4A 5EP4A 2M5ZA 2LVQD 5KDTB 1FPEA 3CF2A 1POY1 1A8EA 4KR5A 4B7GA 1ZKBA 1JETA 2ONRA 3LR1A 2WSFF 5AA4B 3IOWA 4OEUA 3TTRA 4RKUF 1TGUA 1PM5A 1FBGA 4FWDA 3AJIB 3KBZA 5LMUM 2QSFX 3UGJA 3MUQA 4R9GA 2Y7RA 3R6UA 1K3XA 3ZH9B 3FJ7A 4KT0F 4R9FA 4MNPA 3CHGA 2RC9A 5IT9S 4O3AA 1QUSA 4X9TA 1GVCA 4I8OA 4QNMA 1MXZA 3HHYA 2GRVA 1QZMA 4F29A 2KNAA 1JR3A 4GHAA 1NV3A 4NF0A 3KOSA 5TPAB 3U6PA 2PX1A 5LTCA 3CSGA 4X48A 2CZIA 3LUZA 4P3LA 5H8FB 4I5SA 3QAUA 1FTAA 2VP1A 1OQYA 4PFYA 2F4VM 1P1UA 1DGHA 4YICA 4CHTB 2F5NA 1I4WA 2MH8A 3DOAA 1JQJC 1XNRM 3KSJA 3TDJA 3TPAA 2OJTA 5FTJA 1NNTA 2X7PA 3A42A 3QYBA 4Y28F 1FJ9A 1IXCA 3IJXB 4ZEBA 1XNQM 4PT5A 3CF6E 1INPA 1LAFE 3ZSFA 4O94A 2X26A 3HV1A 1N76A 3G3IA 1NMUA 5ITQA 1QVRA 1LFIA 4NGUA 5DEXA 1B5JA 5ITXE 1N32M 4LJ7A 5CMBA 2L09A 2ZM6M 4XK8F 4AQ4A 5AE4A 1FRPA 2CZHA 3OO7A 4Q30B 4I8CA 4GX3A 1NV8A 2AL4A 3B6QA 1IZ1A 2X49A 4U23A 3D4GA 4FE8A 1DSNA 4ZE9A 2CV2A 3I3VA 2QRYA 5I59B 4IBBA 1FPGA 1R9LA 1ZQ9A 2KZUA 2KW0A 4MGKE 1OIPA 4ND9A 4RF0A 2CZKA 2WBDA 2DHRA 1F9BA 3T9XB 1IMAA 5LDZA 2Q2CA 4PAKA 5H37D 1VEJA 1WJ7A 5M2VA 1IEJA 4ZEFA 1XC8A 5AA2B 2CHGA 3U6OA 1QZEA 5I7IA 4XTCQ 1USYH 1G0IA 3GYYA 3LMMA 3TEPA 3Q29A 1K9YA 4GOTA 2HQ0A 2XWOA 4C1UA 2LH0A 5F3WA 2AIXA 2H98A 3H4JA 3UK6A 2THIA 2DXRA 3B8BA 3TWKA 2F6GA 1ANFA 3OSRA 1PJTA 4R7GA 5BUUA 4QHSA 1R6BX 4F19A 3KJ7A 4KHZE 5FTIA 2QS4A 4LGYA 2DNAA 4IO5A 3NBIA 2OZZA 3TMGA 1QUKA 4QFLA 1UFZA 4YAHX 1NNFA 1HNZM 1D9VA 3EHSA 1D2NA 1RKMA 2ZZVA 3SEVA 3L6HA 2OPFA 1LFHA 1GO5A 1NV0A 3VDPA 5IREB 1LBXA 3U6QA 1LAGE 1SW2A 3RNNA 1ZMVA 1USYE 3VVFA 1OQHA 3W15C 2BWEA 2ZAMA 2I58A 4ELRA 2I0BA 4DV2M 3HJ8A 2KA6B 4H0WA 4MHFA 4QHQA 4Z0IA 1T0KA 2NQ8C 3PPQA 1YPNA 4TOZA 4F22A 1EH3A 3VXBA 4ELPA 1ZTYA 4MGYE 1ZMUA 8CATA 4JN6A 1N33M 2VHAA 2C96A 4JI8M 4PC9A 3N26A 4PP0A 5EXPA 1WXQA 1QAQA 1Q3BA 2XFTA 3H06B 2QBYA 4LN5A 1R6ZA 4QRZA 2QS1A 3GLIA 4LFCM 1IXZA 4AS4A 1JW5A 1LCFA 4KO8A 1ZJLA 2BJIA 5I58B 3K01A 4WURA 5BWJA 3W68A 3UN6A 4S12A 2O25A 1D3KA 4O8MA 3L25A 3QMFA 2Q8MA 3GPYA 2N35A 2YJPA 4GIZA 1OFHA 3T9HB 5JI3E 4F2QA 3AXFA 2ZNTA 3WAFA 3KJTA 2UXCM 2JY7A 4GX4A 1TF0B 3S9EA 4LF7M 1S3SA 1C7YA 4FIMA 3VK7A 3SMPA 1N04A 3KOYE 1IMFA 1B5HA 5ICQA 3I5OA 1GGGA 2XXTA 3PPRA 2ZAOA 4MJOA 4N17A 4O3CA 3KOTA 4G77A 4XEQA 1YSYA 3H03A 2F36A 2ZZXA 2XD3A 4YB5A 1DMBA 4X62M 2GNOA 1FQDA 3LCUA 3VLFB 4KCCA 4LJ8A 1V34A 2UYFA 3GQ5A 4X1BA 2B3TA 1UTHB 4LJ4A 5I56B 2KRUA 1C1KA 3UJNA 2DWMA 5I2NA 3B7NA 1S7YA 4WEDA 4F2OA 4MLQA 1IMBA 3FXBA 1P1WA 1I6BA 3PD8A 4WXJA 4RA1A 3GLGE 1VEGA 1J5EM 4NWDA 3N6UA 2HZKA 4EDPA 3ZS6A 2XXQA 4GXSB 4M4GA 3QK6A 4L6V6 4AQYM 2F7BA 2BJWA 1BKAA 1OAOC 2Y84A 4HE2A 2O84X 2R65A 1HQCA 5CMKA 1I6AA 1RYOA 3M7GA 4N4UA 2XEPA 3KW6A 1IUDA 1MPCA 1LTMA 3QYTA 1QAOA 3USDA 5FBPA 1MY4A 1B3GA 1P1QA 1NUWA 3KC1A 4LZ5A 1IY0A 3GLHA 1IITA 4B3RM 4IO4A 1ORYB 2DS9A 2PMSA 3Q26A 4FEDA 3I51A 3QAXA 4X8RA 1PRBA 4F2LA 2F3DA 4I4LA 2R4JA 4QFNA 3V76A 1MH3A 3LSFB 3DELB 4DXUA 2ZXTA 2Z23A 3T22A 3F11A 4PTKA 4MLVA 4U1OA 3VKGA 2C99A 3Q8GA 1L2CA 3FVOA 3HO7A 5H8NB 2PFYA 1NNPA 2R0IA 1KZ8A 2HZLA 4KPTA 2H25A 1SPIA 2GHAA 3NBXX 3D8BA 4YHHM 4N8YA 1IY2A 1B7HA 1JW1A 1G4AE 1OVBA 3U6EA 1FBPA 1TR8A 1SXJA 1NY5A 2UYEA 4YZZA 5IM2A 1VDWA 1I69A 4YY3M 3A98B 4OXVA 2NUVA 2VGQA 4LA9A 3DA1A 1N84A 2KDLA 2FNCA 2VT5A 1XXHB 2I7NA 4TUWA 4GKJM 1ATGA 5J1DA 5KPRA 4ZE8A 3MC2A 1SBPA 1YAEA 5TP9B 4BDQA 2KNVA 5ESYA 2FOIC 1XB2B 3IHPA 1JQFA 3MP6A 5KQDA 4GX6A 4Q0CA 2R6GE 3BBZA 5A5XB 2OOBA 2R4EA 2X4AA 4OESA 4GWWA 1N3WA 4H65A 1CNQA 2JY6B 2UVJA 4BB9A 4GWXA 4LP2B 2XX9A 1WGNA 1WVJA 3M8UA 3AKZA 1NFTA 1P99A 2QPQA 1WODA 2QHOB 4JVCA 3AOGA 3L28A 3G3KA 4NWCA 4H46A 2Z4SA 2AL5A 2W7YA 3RGPA 3IB2A 3AFHA 4ZDMA 4DCXA 4EQ7A 3PUXE 4NOOB 3Q28A 1XC1A 3C9PA 1QDRA 1DPPA 3K00A 1S50A 5JI2E 4OX9M 5AA4A 4JI7M 3TE6A 1LBWA 3M3FA 3U65A 3O2AA 5EYGA 4FWGA 4RNSA 2DAGA 3PV0E 3HWSA 1YE9A 1FBFA 1M5FA 1NH7A 3MZ9A 4XKNA 4AS5A 3CFXA 2DWNA 1D9YA 5EP2A 1UIVA 1KSFX 2F7AA 4A3VB 1B4HA 2PBWA 4NAPA 4RY1A 1EZ9A 3I01M 2HHMA 4IJFA 1FNNA 3RTWB 3RT6B 5FHMA 5EXSA 1Q35A 1LEVA 2J7NA 5EHMA 2O01F 3SAUA 4JV5M 2Y0TA 5FHNA 4M9ZA 1DCUA 4EF1A 1MXVA 4HEOA 4REZA 3U5ZA 4JI2M 1Y4TA 2E0SA 1XHBA 5ITOA 4KQPA 3HSTA 2JY8A 4PFBA 1XMQM 2Y7KA 1Z7ME 4IO6A 4NF4B 5DNYA 1GL7A 1GVNA 2QZ4A 5EP3A 3FTEA 1XT8A 2FIEA 2PFZA 1LB8A 1YXIA 4XKRA 2FE8A 5I5PA 4MAGA 2F5OA 4JI1M 2DI0A 1MXWA 1ELJA 1EIJA 2RGOA 2KRKA 3KFUG 2NVUB 2FA7A 2R62A 4FATA 3GBAA 4IBKA 1NH8A 2L5VA 1R2ZA 3A3CA 3B9PA 2JA2A 4OA4A 3ILKA 2R6FA 1JR3E 2RF1A 3OSQA 3W67A 3CIJA 4YB7A 2FH0A 5DTBA 4I81A 4LY6A 1ZMGA 3MVYA 2CEYA 3IG5A 2PCRA 4KYSA 3UK4A 3QSLA 4GWZA 3FUTA 3C35A 1JEVA 3VK8A 3AV0A 4NRWA 4JI6M 2HCBA 2H5YA 3MJNA 2DE3A 4LCBA 4JXJA 3IR1A 5I59A 3H6WA 3M3KA 3OELA 1TH4A 4U2RA 2MROB 5ICTA 3KEIA 4ZEDA 1IQPA 3PUYE 4F1IA 4M9SA 2GQ1A 2E5LM 2QMXA 4IY6A 5H8HB 1Q39A 3GRUA 3KS4A 2B3FA 2JP7A 5EXTA 2XXVA 4JYAM 5IGAA 4DI4B 3TAJA 2XXPA 1FPDA 3RGYA 3V89B 3U6LA 4F3SA 3VE1B 5AA2A 2LXEA 3RQTA 3CR9A 3HFUA 4P16A 2WYPA 3FUZA 1PC3A 3SZPA 4ZPXA 4BBAA 4NF6A 5I2KB 2OX3A 1B4ZA 4N13A 3N94A 1L1TA 2CFOA 3RE8A 3IJOB 3QXMA 1H6UA 4LUBA 2A5TA 1TH2A 2LBCA 1B1HA 2CEXA 2G5GX 2DXYA 4AG6A 3UIFA 4N15A 4LJ5A 4PFWA 3FYCA 3L2AA 2QP9X 2Y5KA 3UZUA 2QQ8A 4BDRA 3DLNA 4LGMA 1GLNA 3RFWA 4MCOA 4XIGQ 1D9QA 2O7IA 3OO6A 5EQ8A 1QUJA 1VFEA 4ISUA 4DDDA 3BXWA 3ZC7B 3T66A 4BDLA 1TFDA 3PPPA 4ONYA 2Y7IA 4RF1A 3S4UA 2B4MA 4POWA 1AH5A 3MPKA 2VD2A 1PJJA 4N6DA 4MIJA 3SAVA 1QVSA 4P1EA 1QKAA 4GWSA 5HBCA 2UU9M 3HX3A 1IN8A 3E21A 1DV0A 4N6PA 1GKIA 3CG3A 4BDMA 1NV2A 1CE2A 1IIWA 4B3TM 1FCKA 3Q27A 3FXUA 3PUVE 1MPBA 4NX1A 3W9VA 3U6SA 2F5XA 1OKSA 5I58A 2VDBB 1TTEA 2V84A 5L9SA 2UVGA 1FPFA 3KN8A 3JYRA 1Y3NA 2F3BA 4GRKA 4PF8A 3GLFB 4QSEA 1VSOA 1M5CA 4FD2A 1B40A 4M0DA 1E9SA 2V6ZM 1LSTA 1QYRA 4RXLA 4MNCA 1CB6A 4EXLA 3AOEC 1PB9A 3J80S 1N7XA 2M8CA 5CBRA 2ZYKA 4ESWA 3GLIE 4N8GA 1B05A 1DO0A 3GRVA 5H8QA 1FBDA 1R7RA 1A54A 2O1MA 3PGFA 4LRSA 4DXCA 4G4OA 2H5XA 1LBYA 4JSOA 3R9XB 1L5TA 1SG9A 1VR5A 1MU5A 1QDTA 4NQ8A 3GQ3A 4U21A 3KXEC 1UTHA 5F1QA 4G3OA 2UUAM 3E13X 4QOZC 4PDGA 1NO1A 3QWLA 4H6DA 4NTLA 3MZBA 4PQJA 3HHFA 2VOZA 2NOOA 3HHWA 2I0CA 1N78A 4JVIA 2CV1A 2DAKA 5A5LA 3HKPA 3OMBA 1CUKA 3CFZA 3KN7A 1JR3D 2OWTA 1FPLA 3PXGA 3U92A 2WSEF 2VD3A 4H1XA 4O7MA 1YYZA 4R72A 4H5GA 5KZTA 2APLA 1SD3A 3SAWA 5EQAA 2Z8EA 3GPUA 2F97A 2KNZA 3MPLA 4AB6A 2PT2A 2DAIA 1Y3QA 1GABA 1B58A 1G59A 3KGCA 3FVGA 4MGIE 4YKIA 3BFUA 3C4MA 3TELA 4OVSA 4MGZE 5ET5A 1E94E 3KFMA 4QFPA 4Q7JA 5ITYA 3MP8A 2L6OA 3IOTA 4JDFA 1L8QA 2XGNA 2QL3A 4JI3M 2EKKA 2Z3XA 4NF5B 1M5EA 1G8PA 4LF8M 1WDNA 2XFSA 5IZ3B 1MH4A 2CEAA 1I94M 1P1NA 3MK6A 2LVOC 3TFLA 1IBKM 3CG1A 4YKKA 1K82A 4W5WA 1FQCA 3UA8A 4NF8B 1OAIA 2DKLA 5ITRA 3IORA 1IN4A 4KI0E 3OO9A 2HXWA 1K9ZA 3LVWA 1PBQA 5H8NA 2HAVA 2H9BA 3CGWA 2Y20A 1N3XA 1VEKA 2BNKA 1MQGA 3U72A 4OU7A 3FJGA 4JI5M 3FKEA 4PDHA 5ET8A 3GLHE 3T6PA 2DXIA 2QJEA 3MMPA 3A29A 3E3KA 2Y7WA 4OFJA 4H8JA 2G8LA 2XXYA 1VE4A 3CTWB 1B6HA 2XWVA 3G7WA 3VLUA 4OVZA 4PFUA 1XXHA 4IBDA 3GPPA 3WHLA 5JK4A 3VFDA 2O1LA 4Z8XA 1B3LA 2Y0QA 3U61B 5TP9A 2HWJA 4IO3A 3OO8A 2QS2A 3QUJA 5AA1A 2KXEA 1FJGM 4G4NA 2XXHA 2DE2A 1UTBA 1J09A 1FBCA 1MY3A 1MY0A 2R18A 4PBHA 3SEWA 1EE8A 1IFYA 4BDOA 5LMNM 4MF3A 1SXJE 4GL8A 1PB8A 4R74A 1HJPA 1BK4A 4ZZEA 2ANJA 1AUAA 2QCUA 1Y9UA 4FECA 3SYKA 3O9PA 3L29A 3QYEA 3TYHA 2CZLA 2Y5LA 2R45A 2C98A 4IIWA 4Z6YA 3U6CA 2J7OA 3C58A 5L9MA 1MY2A 1Y1MA 1R5LA 3RGSA 2DSFA 3K02A 3C32A 3EHUA 2WX9A 1MX0A 3K8ZA 1NV5A 3FXRA 2Q8JA 4FCVA 4DUZM 4KFQA 1EZPA 1KA1A 3K9OA 4GIPA 3D8LA 2XXUA 1EFUB 1Q02A 3J7BA 1H44A 2PT1A 4QNRA 2YQZA 4GLIA 4NF4A 3G3HA 3MYUA 4DZ1A 3FVKA 3PFIA 3L6GA 4WP2A 3V8XB 3C31A 1MRPA 5CRYA 1FJ6A 1MPDA 4F18A 2I7PA 4GBVA 1FQBA 1EU8A 3NOHA 3KZGA 3GXAA 4KYDA 3LCVB 1T43A 4KXPA 1OFIA 4DV0M 3VDFA 3PPNA 5HPQA 3U1OA 4P1LA 4O7IA 5J16A 3K6VA 4XXUA 2ZTCA 3VVEA 4R71A 1QAMA 1LBCA 4F3GA 5A2QS 1IXHA 1V92A 1H76A 2XXIA 4D82A 4X64M 2XXRA 4PFIA 4MB7A 1MDP1 1IMCA 3HU2A 3U8QA 3OXNA 1TFAA 4NHBA 4LRTA 1DGBA 2JWSA 1B9JA 2JNHA 3RPLB 2LNHC 1B32A 3JAMS 1XVXA 3J7AS 2EJSA 4PGPA 3VDUA 2Y7PA 4OVRA 5FHOA 1PB7A 2GQFA 3UMMA 1NNUC 1W5TA 1Z7NE 2F34A 2IA4A 4DE8A 4NG7A 3UORA 2RINA 1V33A 1DOTA 3MSTA 1P3QQ 3I4YA 4FVMA 4QOSA 2KEBA 4YMAA 4ZECA 4GWOA 1PEBA 3FXQA 4NMYA 4C0RA 4NN3A 5H8HA 2F8DA 4TLLB 1Z5BA 2BWBA 4X65M 4G61A 3KOXE 2X7QA 3K1NA 5CI5A 2VQEM 1J7KA 3IFCA 3K1PA 2ESNA 4DV7M 3FRIA 4G68C 3IB1A 3FBPA 3NWLA 2Q9TA 2QVVA 3CI8A 3ZQJA 2ZANA 3E79A 1URGA 3FGSA 5I2KA 4CJ6A 2LVNC 4PDIA 4DR4M 4DLDA 3HZJA 2RC7A 4U22A 4B08A 1IMEA 2OOAA 3EKIA 4D81A 2V1UA 4DR7M 2MR9A 4EIWA 1EYJA 4OMBA 3KBRA 1NV9A 3DFZA 1AWBA 4P0IA 4LF4M 5JTYB 3FTFA 1JVYA 1PBPA 4LZ8A 4OYVA 1IM2A 1DPEA 3FD3A 3C3EA 1IBMM 1RYXA 4U1ZA
chains in the Genus database with same CATH topology
2V25A 3VKHA 4GL0A 4R6HA 3HJQA 4WW0A 1NNKA 1O64A 1SW5A 2C9OA 2O68A 3EF7A 1A40A 1IN6A 3TWLA 4HLQA 1GR2A 1BP5A 4THIA 5HM4B 1SI1A 4HS7A 4LJAA 3PUZE 4LJ6A 1POTA 4JB7A 1NSFA 2I6EA 3W0FA 5KDTA 1SXJD 4X66M 1EZOA 4DR2M 2R71A 3L26A 2QBYB 1FTKA 4LONB 2D3IA 1SDXA 1NKXA 3H4ZA 4LQ5A 3JZJA 5KPZA 4JWOA 4DR3M 1IQ7A 1O7TA 1H3DA 3AL0C 4IO2A 5AA3A 1US4A 1FTLA 3OD7A 3ECRA 5FLXS 1OLCA 3GLFA 3HGIA 3RN8A 1DTGA 2REGA 1Z6TA 2XF3A 1LFGA 3H4MA 5FTHA 1D4NA 4H8IA 3T15A 4JI4M 4G6ZA 1OQGA 5TPAA 2F5QA 3MVXA 4NXNM 2DZOB 4NXMM 4Z7EA 5DVJA 2P0SA 2GH9A 4R75A 5H8FA 1HQYE 4RK9A 1N75A 3IOVA 3Q25A 3N6TA 3K1JA 2DWHA 1TWYA 3TQSA 1YCJA 1S9TA 2V1CA 1YUBA 3FV2A 2I3VA 2Z22A 4XKPA 5L9OA 1FQEA 5B70A 4QSCA 2BJJX 1BTJA 1M5DA 3PUWE 4ZS9A 3IO6A 2DWZB 1URSA 1NL5A 3IL1B 1Z59A 1Q1KA 1DO2A 2D5WA 4OWDA 4MH5A 3U60B 2L7IA 3GRRA 5EQTA 1B0HA 4GF8A 2O51A 3FJMA 3T9UA 1B3HA 3T1YM 5FTMA 1N7WA 2Q2AA 1TDZA 1FTJA 4WEPA 1L2BA 2ONSA 1QQWA 4IBJA 3TQLA 5DT6A 3FUVA 5EXXA 4OFOA 4GVOA 3H7MA 4CGYB 3SYLA 4B7HA 1HNXM 4RPOA 2OK2A 4G8HA 4R2BA 3LC8A 3JR5A 3K2DA 3RPWA 3W0LB 3ILUB 4OW0A 3U6MA 1N0TA 3TL4X 2VQFM 3EIEA 4LZ7A 1IN7A 4HL4A 3ODBA 4NF5A 1JW4A 4DV6M 2DYXA 3S2VA 4EF2A 2L7HA 4LZJA 1BIYA 3OTOM 4G4PA 4OEVA 3RY3A 1SW1A 3SBJA 1B51A 4PETA 4B3SM 4NF8A 3P7IA 5KO3A 2CUZA 3K0VA 2O5RA 3SDFA 2ZYOA 1HSEA 3VV5A 1VFDA 1N34M 4LFBM 1Y1ZA 2I48A 2Q89A 2A5YB 2LAOA 2CE7A 3L27A 3IB0A 3MZ1A 3O29A 3O6HA 2B65A 5TU0A 4L78A 4R2FA 4Q8RA 3BKIB 4GXAA 3OEKA 3PU5A 3MWBA 4KYEA 5FTLA 3HHGA 5AA2D 3O28A 4ZEKA 4PFTA 1IXRC 2ZYMA 4E0XA 3HU3A 1NNJA 3LSXA 5ITPA 2UXAA 2CHVA 3K6UA 1XVYA 3HHXA 3MVWA 3FUUA 4ZZAA 1P1OA 5IZ7D 2RGHA 2XZFA 4POXA 4MGHA 2DZNB 1JEUA 2AYSA 5K2YA 5KCJB 3THGA 4HW8A 2YLNA 3J2PB 3MBPA 4LZZA 4EQBA 1QJMA 1A8FA 1SI0A 4G8MA 4IB2A 4G68B 2RKOA 1Y20A 1IBLM 2HL7A 3PNVA 4KLNA 4DV1M 4F1YA 3BOSA 4BLCA 4JI0M 3FUWA 5IKBA 5L8DA 2OBGA 3E4RA 3SATA 4LF5M 4XBOA 5EYFA 4GC9A 3O66A 5BR8M 3TTLA 2G29A 3G3GA 2WKYA 5CC2A 3GLGB 4M1VA 1H45A 1PJIA 4GH9A 1IXIA 5ISUA 1XHYA 2DVCA 3MAMA 1MM7A 3SHFA 4KCDA 3KOZE 3HN0A 3FATA 3FIRA 3C34A 2Q2EB 1MXXA 2ZBKB 4P0GA 3SEUA 3H6TA 4R3DA 2DWAA 2D7GA 4GKKM 3U5ZB 5I57B 4XKQA 4R6KA 1B1XA 3O97A 4TQUQ 3KDSE 2I49A 3SEYA 3BBRA 5DYHA 4H5FA 5I56A 1OLAA 1J1NA 3V5AA 3K6XA 4NE4A 2XZUA 1TDHA 3TWMA 1A99A 2D21A 2HAUA 4RPNA 4AKHA 4UA8A 3CVGA 3DZDA 4F1VA 4IBEA 3TUSA 4PCZA 3D4CA 1TH3A 4II7A 1Y4CA 3LUYA 1T3TA 2KLFA 4LVQA 5CMMA 4DV5M 4AW4A 2I4BA 4B3MM 3S9LC 4ECFA 3V83A 5IAIA 1MQIA 2DWLA 5DYGA 1B0LA 3C9HA 2ZMBA 1N77A 1OMPA 1G3IA 1Q3CA 3OEMA 1SVXB 2Z8DA 4JSDA 3E9SA 2DOJA 3SERA 4FAJA 3AOEA 4FWHA 3I6VA 3KS8A 3TTMA 1XMOM 2Q88A 4DCYA 2XXWA 3B7DA 3FTDA 1OIBA 3HCQA 4GD5A 2RKMA 4K3FA 1MM6A 2KZSA 2UXBM 2O7UA 2HKJA 2K47A 2PYYA 3UGWA 4GFRA 2XD2A 5K2XA 2ZYNA 4I62A 3PVSA 4FEBA 2Z7JA 1FTMA 3J81S 1SYIA 1YTVA 1IXSB 4L15A 5DYIA 3ZKKA 4AKIA 4FCTA 4LG2A 2YNMD 2Z8FA 1X37A 4AZFA 1AMFA 3BFTA 4FCWA 1B52A 1UQWA 3EN3A 4C1TA 3MHVC 3GQ4A 4NF6B 2E1SA 1AOVA 3LSWA 2F35A 4OHNA 4N07A 3HJSA 2UUCM 2ONKE 4QFKA 4DV3M 2NXOA 4DIGA 2A5TB 2VIIA 4ELOA 1HT2E 1QULA 3K2LA 4U4SA 4KHPM 3TKDA 1NY6A 4WKMA 2ZNUA 4NL4H 4LQ2A 3MJ5A 3KSXA 5A5XA 3SESA 1M5BA 2DWIA 5KQ8A 1GTKA 4UACA 4GQOA 4OTEA 3SETA 1MXYA 3KP0E 1LGBC 4PD2A 1FQFA 4D80A 3OOAA 2W82A 4JWYA 2OCUA 4AB5A 1LAXA 4G2ZA 2C9CA 5F7VA 3IOUA 1DGFA 2B3BA 1II5A 3MQ9A 4MM3B 2OQ4A 4F39A 2EO2A 2F5PA 2H1RA 5FSWA 4L16A 1LLSA 3B6WA 1TXFA 3TODA 4IBFA 4AKGA 1URDA 4JWXA 2P1SA 2QSXA 4RK2A 1AL3A 5EJCA 3H6UA 3TQWA 3SMSA 4IBIA 4ELQA 1Z5CA 1HSLA 1QUIA 1R1NA 3HU1A 4K0KM 2PVUA 4OVJA 4LF6M 3ZCBB 3T1HM 5BPVA 3JR4A 4G4RA 4I9DA 2GHBA 5FTNA 3K1MA 2XHDA 1B3FA 4YB6A 3JV9A 5I84A 5ITXA 4O3BA 3PMVA 2BJVA 3M6AA 1ZU0A 5IWAM 5H8QB 4BDNA 3CRBA 1DGHB 4NEDA 3TTNA 3RLFE 1KWHA 3A09A 4ZEIA 1SW4A 3T9VA 3G3FA 3VLWA 2O6AA 2XX7A 5CM6A 4F3PA 2XXXA 4IBGA 1OJLA 2P2AA 3KOWE 2DVZA 1NHWC 4OENA 2DE4A 2M60A 4IGTA 3MP1A 1US5A 4QSDA 2REJA 1HSJA 3WHKA 2RCAA 1PDAA 1MY1A 3MVZA 3VFJA 4DR5M 3U60A 2F7CA 5DEXB 2CHQA 4HCYA 3T96B 1XOCA 1SXJC 5DVIA 7CATA 4X1DA 1JNFA 3GPXA 4LATA 2HCAA 1HT1E 3TCFA 1Z5AA 2UVIA 3GLBA 1KYIA 4H67A 2X8AA 4RJZA 3CF0A 4L8RC 1XS5A 4OZ9A 3SASA 3SKPA 2H4IA 2V3UA 4HCWA 4GITA 2HHHM 2V3QA 5JTYA 3DM0A 2XSZA 3IG8A 2G93A 1A7LA 3FD9A 3C36A 3O6IA 4YKPA 4GHLA 3C33A 1XWIA 1E32A 1NVMA 3FZVA 4QFOA 2F78A 4DV4M 3GRYA 4LFAM 3EQ1A 5ELVA 5C1BA 3VLVA 2F5SA 3PMWA 4M9XA 2C5RA 4NRVA 2HFBA 2RCBA 2UVHA 1UM8A 3A45A 4F3BA 3G3JA 1QANA 2OWSA 3PMXA 2UXDM 3GZGA 3HPIA 2HEUA 1AIVA 3PNYA 3J27B 2D7HA 3TCGA 3KVWA 2Z4RA 1ZAEA 3TTKA 2Y21A 2UUBM 4JXIA 2FYIA 3HHZA 2ALUA 3GBBA 4FW9A 2FNAA 2GFEA 2XSZD 1MQJA 1LAHE 4DUYM 1UIUA 5EP1A 4QHTA 4ITQA 4OVZB 5ITUA 1E9RA 4F1UA 1R2YA 5GKNA 3LBSA 3H3GA 4GMQA 4MFIA 4QF9A 3TZAA 2RC8A 3VXCA 1B2HA 3S9MC 4R6YA 2YFQA 4DXBA 3K6WA 4YU0A 1SQYA 1MXUA 1I6QA 2XH9A 2A5SA 3ILTB 5KCJA 2IEEA 4CISA 3SEXA 1UTBB 1H43A 1OVTA 1IXGA 2ABHA 3GLIB 4KD5A 1B7UA 2OLBA 3LSLA 4G68A 4DR1M 4YMBA 5DVFA 4NSRA 5B7DA 1G41A 4DR6M 4AG5A 1R9QA 3KG2A 3TPZA 3LVVA 1DTZA 2XLJA 4RNAA 2D7EA 1GL6A 3FV1A 1LV7A 3UP9A 3SHGB 4MH0E 2V3TA 1MDQA 3RT8A 1NHGC 4YKJA 3S9NC 3GLGA 4GC5A 3FTCA 4OQOA 4MBPA 3E9XA 1SYHA 2I4CA 4RYAA 1QW0A 5CMCA 3QUFA 3GP1A 1LCTA 3Q8XA 2YR0A 3O6GA 1NJGA 2H99A 3CFLA 2DQVA 1LBBA 2FFJA 1DGGA 5I57A 4IGRA 1L2DA 3FUXA 4KODA 3W9WA 4U4XA 3U93A 3I4VA 5I2NB 3LQRA 3FVNA 3A46A 4TLMB 3ONMA 4F31B 3IK6B 2F6PA 1FW0A 1B5IA 1MQDA 2XX8A 2AHMA 1LB9A 2DWJA 1NJFA 3U94A 5E26A 3RUMA 2CMOA 3T93B 3T38A 1FTOA 3A3UA 1ZLQA 4ESXA 3KN3A 3DP8A 5FTKA 4IBCA 4JBZA 2QS3A 5E6JA 4R73A 4G4QA 4I1DA 3FASA 2EUCA 3M3LA 2YPNA 3H6VA 1W5SA 1HNWM 2LWXA 3K92A 4P11A 3LQQA 5KPTA 4IO7A 3EIHA 3DP6A 4OETA 4FJPA 3DP4A 3GLHB 1ZIUA 4PE5B 4M0WA 1Y3PA 5JEIA 3SARA 1N36M 1K3WA 2QENA 1ZBMA 1B7ZA 3N5LA 1HR0M 4E0WA 2I3WA 1MQHA 2O69A 4G8NA 4EUOA 2ZNSA 2R9JA 4LJ9A 1L1ZA 3VVDA 1O63A 4OERA 1KFVA 4B7FA 5LOMA 4XGIA 1IN5A 4FORA 2V93A 3R7XA 4EQ9A 5CBSA 1IY1A 2ERCA 1A55A 3IAZA 4GRIA 3MW0A 5C18A 3IX1A 4EXKA 2CV0A 3FYDA 1JVXA 4OFLA 3WAEA 4BLAA 3B6TA 3R26A 3CSBA 1FQAA 5EHSA 1GV8A 4HTGA 3R8FA 2DP8A 3PPOA 2P5TA 3SC3A 4L4UA 1B46A 1SXJB 3M0EA 3GO8A 3U6DA 4LF9M 4NSOB 3PD9A 2DVWB 3OENA 2QMWA 3SFZA 1BLFA 2R46A 5ITTA 3QIMA 1MS7A 3EPEA 1B3EA 3K4UA 4Q5TA 2EA0A 1QKBA 5H8SA 4L17A 3KP1E 3U61A 1MG1A 2NWJA 2QPAA 4AI6A 3TCHA 3EHTA 4IY5A 3ZKLA 1TT1A 3RTFB 4IJEA 3THIA 1VDDA 3IO4A 5EP4A 2M5ZA 5KDTB 3CF2A 1POY1 1A8EA 4KR5A 4B7GA 1ZKBA 1JETA 2ONRA 3LR1A 5AA4B 3IOWA 4OEUA 3TTRA 1TGUA 1PM5A 4FWDA 3AJIB 5LMUM 3UGJA 3MUQA 4R9GA 2Y7RA 3R6UA 1K3XA 3ZH9B 3FJ7A 4R9FA 2RC9A 5IT9S 4O3AA 4X9TA 1GVCA 4I8OA 4QNMA 1MXZA 3HHYA 2GRVA 1QZMA 4F29A 1JR3A 4GHAA 3KOSA 5TPAB 3U6PA 2PX1A 3CSGA 4X48A 5H8FB 4I5SA 3QAUA 2VP1A 4PFYA 2F4VM 1P1UA 1DGHA 4YICA 4CHTB 2F5NA 1I4WA 3DOAA 1JQJC 1XNRM 3KSJA 3TDJA 3TPAA 2OJTA 5FTJA 1NNTA 2X7PA 3A42A 1IXCA 3IJXB 4ZEBA 1XNQM 4PT5A 3CF6E 1LAFE 3ZSFA 2X26A 3HV1A 1N76A 3G3IA 1NMUA 5ITQA 1QVRA 1LFIA 5DEXA 1B5JA 5ITXE 1N32M 4LJ7A 5CMBA 2L09A 2ZM6M 4AQ4A 5AE4A 3OO7A 4Q30B 4I8CA 2AL4A 3B6QA 1IZ1A 2X49A 4U23A 3D4GA 4FE8A 1DSNA 4ZE9A 2CV2A 3I3VA 2QRYA 5I59B 4IBBA 1R9LA 1ZQ9A 2KZUA 2KW0A 4MGKE 4ND9A 4RF0A 2DHRA 1F9BA 3T9XB 2Q2CA 5H37D 5M2VA 1IEJA 4ZEFA 1XC8A 5AA2B 2CHGA 3U6OA 4XTCQ 1USYH 3LMMA 3TEPA 3Q29A 4GOTA 2HQ0A 4C1UA 2LH0A 5F3WA 2AIXA 2H98A 3UK6A 2THIA 2DXRA 3TWKA 2F6GA 1ANFA 3OSRA 4R7GA 5BUUA 4QHSA 1R6BX 4F19A 3KJ7A 4KHZE 5FTIA 2QS4A 4LGYA 4IO5A 3NBIA 2OZZA 3TMGA 1QUKA 4QFLA 4YAHX 1NNFA 1HNZM 1D9VA 3EHSA 1D2NA 1RKMA 3SEVA 3L6HA 2OPFA 1LFHA 3VDPA 5IREB 3U6QA 1LAGE 1SW2A 3RNNA 1USYE 3VVFA 1OQHA 3W15C 2ZAMA 2I58A 4ELRA 2I0BA 4DV2M 3HJ8A 2KA6B 4H0WA 4QHQA 4Z0IA 1T0KA 2NQ8C 3PPQA 1YPNA 4TOZA 4F22A 1EH3A 3VXBA 4ELPA 1ZTYA 4MGYE 8CATA 4JN6A 1N33M 2VHAA 2C96A 4JI8M 3N26A 4PP0A 5EXPA 1WXQA 1QAQA 1Q3BA 2XFTA 3H06B 2QBYA 1R6ZA 4QRZA 2QS1A 3GLIA 4LFCM 1IXZA 1JW5A 1LCFA 4KO8A 1ZJLA 5I58B 3K01A 4WURA 5BWJA 3UN6A 4S12A 1D3KA 3L25A 3GPYA 2YJPA 4GIZA 1OFHA 3T9HB 5JI3E 4F2QA 3AXFA 2ZNTA 3WAFA 3KJTA 2UXCM 3S9EA 4LF7M 1S3SA 4FIMA 3VK7A 3SMPA 1N04A 3KOYE 1B5HA 5ICQA 3I5OA 1GGGA 2XXTA 3PPRA 2ZAOA 4O3CA 3KOTA 4G77A 1YSYA 3H03A 2F36A 2XD3A 4YB5A 1DMBA 4X62M 1FQDA 3VLFB 4KCCA 4LJ8A 2UYFA 3GQ5A 4X1BA 1UTHB 4LJ4A 5I56B 2KRUA 1C1KA 3UJNA 2DWMA 5I2NA 1S7YA 4WEDA 4F2OA 4MLQA 1P1WA 1I6BA 3PD8A 4WXJA 4RA1A 1J5EM 4NWDA 3N6UA 2HZKA 4EDPA 3ZS6A 2XXQA 4GXSB 4M4GA 3QK6A 4AQYM 2F7BA 2BJWA 1BKAA 2Y84A 2O84X 2R65A 1HQCA 5CMKA 1I6AA 1RYOA 3M7GA 2XEPA 3KW6A 1IUDA 1MPCA 3QYTA 1QAOA 3USDA 1MY4A 1B3GA 1P1QA 4LZ5A 1IY0A 3GLHA 1IITA 4B3RM 4IO4A 1ORYB 2DS9A 2PMSA 3Q26A 4FEDA 3I51A 3QAXA 4QFNA 4I4LA 2R4JA 1MH3A 3LSFB 3DELB 4DXUA 2ZXTA 2Z23A 3T22A 3F11A 4MLVA 4U1OA 3VKGA 2C99A 1L2CA 3FVOA 3HO7A 5H8NB 1NNPA 2HZLA 4KPTA 2H25A 2GHAA 3D8BA 4YHHM 1IY2A 1B7HA 1JW1A 1G4AE 1OVBA 3U6EA 2UYEA 1SXJA 1NY5A 4YZZA 1I69A 4YY3M 3A98B 4OXVA 2NUVA 2VGQA 4LA9A 3DA1A 1N84A 2FNCA 1XXHB 2I7NA 4TUWA 4GKJM 1ATGA 5J1DA 5KPRA 4ZE8A 3MC2A 1SBPA 1YAEA 5TP9B 4BDQA 2FOIC 1JQFA 3MP6A 5KQDA 4Q0CA 2R6GE 5A5XB 2R4EA 2X4AA 4OESA 1N3WA 4H65A 2UVJA 4BB9A 4LP2B 2XX9A 1WVJA 3M8UA 3AKZA 1NFTA 1P99A 2QPQA 1WODA 3AOGA 3L28A 3G3KA 4NWCA 2Z4SA 2AL5A 2W7YA 3RGPA 3IB2A 3AFHA 4ZDMA 4DCXA 4EQ7A 3PUXE 4NOOB 3Q28A 1XC1A 1DPPA 3K00A 1S50A 5JI2E 4OX9M 5AA4A 4JI7M 3TE6A 3M3FA 3O2AA 4FWGA 4RNSA 3PV0E 3HWSA 1YE9A 1M5FA 1NH7A 3MZ9A 4XKNA 3CFXA 2DWNA 1D9YA 5EP2A 1UIVA 1KSFX 2F7AA 4A3VB 1B4HA 2PBWA 4RY1A 1EZ9A 4IJFA 1FNNA 3RTWB 3RT6B 5FHMA 5EXSA 1Q35A 2J7NA 5EHMA 3SAUA 4JV5M 2Y0TA 5FHNA 4M9ZA 4EF1A 1MXVA 3U5ZA 4REZA 4JI2M 1Y4TA 2E0SA 1XHBA 5ITOA 4KQPA 3HSTA 1XMQM 2Y7KA 1Z7ME 4IO6A 4NF4B 5DNYA 1GL7A 1GVNA 2QZ4A 5EP3A 3FTEA 1XT8A 1LB8A 4XKRA 2FE8A 2F5OA 4JI1M 1MXWA 1ELJA 2RGOA 2KRKA 3KFUG 2NVUB 2FA7A 2R62A 4FATA 3GBAA 4IBKA 1NH8A 1R2ZA 3A3CA 3B9PA 2JA2A 3ILKA 2RF1A 3OSQA 3CIJA 4YB7A 5DTBA 4I81A 4LY6A 1ZMGA 3MVYA 3IG5A 4KYSA 3UK4A 3QSLA 3FUTA 3C35A 1JEVA 3VK8A 3AV0A 4NRWA 4JI6M 2HCBA 2H5YA 3MJNA 2DE3A 4LCBA 4JXJA 3IR1A 5I59A 3H6WA 3M3KA 3OELA 1TH4A 4U2RA 5ICTA 3KEIA 4ZEDA 1IQPA 3PUYE 4IY6A 4M9SA 5JTYB 2E5LM 2QMXA 5H8HB 4BDRA 1Q39A 3GRUA 3KS4A 2B3FA 2XXVA 5EXTA 4JYAM 3TAJA 2XXPA 3RGYA 3V89B 3U6LA 4F3SA 3VE1B 5AA2A 2LXEA 3RQTA 3CR9A 4P16A 3FUZA 1PC3A 4ZPXA 4BBAA 4NF6A 5I2KB 1B4ZA 4N13A 3N94A 1L1TA 2CFOA 3RE8A 3IJOB 3QXMA 1H6UA 4LUBA 2A5TA 1TH2A 1B1HA 2G5GX 2DXYA 4AG6A 3UIFA 4LJ5A 4PFWA 3FYCA 3L2AA 2QP9X 3UZUA 3DLNA 4LGMA 1GLNA 3RFWA 4XIGQ 2O7IA 3OO6A 1QUJA 1VFEA 4ISUA 4DDDA 3ZC7B 3T66A 4BDLA 1TFDA 3PPPA 4ONYA 2Y7IA 4RF1A 3S4UA 4POWA 1AH5A 3MPKA 2VD2A 1PJJA 3SAVA 1QVSA 1QKAA 5HBCA 2UU9M 1IN8A 4N6PA 1GKIA 3CG3A 4BDMA 1CE2A 1IIWA 4B3TM 1FCKA 3Q27A 3FXUA 3PUVE 1MPBA 3W9VA 3U6SA 2F5XA 5I58A 2V84A 5L9SA 2UVGA 3KN8A 3JYRA 1Y3NA 4GRKA 3GLFB 4QSEA 1VSOA 1M5CA 4FD2A 1B40A 4M0DA 1E9SA 2V6ZM 1LSTA 1QYRA 4RXLA 1CB6A 4EXLA 3AOEC 1PB9A 3J80S 1N7XA 2M8CA 5CBRA 2ZYKA 4ESWA 1B05A 1DO0A 3GRVA 5H8QA 1R7RA 1A54A 2O1MA 3PGFA 4LRSA 4DXCA 4G4OA 4JSOA 3R9XB 1L5TA 1VR5A 1MU5A 3GQ3A 4U21A 3KXEC 1UTHA 5F1QA 2UUAM 3E13X 4QOZC 4PDGA 3QWLA 4H6DA 4NTLA 3MZBA 4PQJA 3HHFA 2VOZA 2NOOA 3HHWA 2I0CA 1N78A 2CV1A 3HKPA 3OMBA 3CFZA 3KN7A 1JR3D 2OWTA 3PXGA 3U92A 4H1XA 2VD3A 4R72A 4H5GA 5KZTA 1SD3A 3SAWA 2Z8EA 3GPUA 2F97A 4AB6A 3MPLA 2PT2A 1Y3QA 1B58A 1G59A 3KGCA 3FVGA 4MGIE 4YKIA 3BFUA 3C4MA 3TELA 4MGZE 1E94E 3KFMA 4QFPA 5ITYA 3MP8A 2L6OA 3IOTA 4JDFA 1L8QA 2XGNA 2QL3A 4JI3M 2Z3XA 4NF5B 1M5EA 1G8PA 4LF8M 1WDNA 2XFSA 1MH4A 2CEAA 1I94M 1P1NA 3MK6A 3TFLA 1IBKM 3CG1A 4YKKA 1K82A 4W5WA 1FQCA 3UA8A 4NF8B 5ITRA 3IORA 1IN4A 4KI0E 3OO9A 2HXWA 3LVWA 1PBQA 5H8NA 2HAVA 2H9BA 2Y20A 1N3XA 2BNKA 1MQGA 3U72A 4OU7A 3FJGA 4JI5M 3FKEA 2DXIA 2QJEA 3E3KA 2Y7WA 4OFJA 4H8JA 2G8LA 2XXYA 1VE4A 3CTWB 1B6HA 3G7WA 3VLUA 4OVZA 4PFUA 1XXHA 4IBDA 3GPPA 3WHLA 5JK4A 3VFDA 2O1LA 4Z8XA 1B3LA 2Y0QA 3U61B 5TP9A 4IO3A 3OO8A 2QS2A 3QUJA 5AA1A 2KXEA 1FJGM 4G4NA 2XXHA 2DE2A 1UTBA 1J09A 1MY3A 1MY0A 2R18A 3SEWA 1EE8A 4BDOA 5LMNM 4MF3A 1SXJE 4GL8A 1PB8A 4R74A 4ZZEA 2ANJA 1Y9UA 2QCUA 4FECA 3SYKA 3O9PA 3L29A 3TYHA 2CZLA 2R45A 2C98A 4IIWA 4Z6YA 3U6CA 2J7OA 3C58A 5L9MA 1MY2A 1Y1MA 3RGSA 2DSFA 3K02A 3C32A 3EHUA 1MX0A 3K8ZA 3FXRA 2Q8JA 4FCVA 4DUZM 4KFQA 1EZPA 4GIPA 2XXUA 3D8LA 2PT1A 3J7BA 1H44A 4QNRA 2YQZA 4GLIA 4NF4A 3G3HA 4DZ1A 3FVKA 3PFIA 3L6GA 3V8XB 3C31A 1MRPA 5CRYA 1MPDA 4F18A 2I7PA 1FQBA 1EU8A 3KZGA 3GXAA 4KYDA 1OFIA 4DV0M 3VDFA 3PPNA 5HPQA 3U1OA 3K6VA 4XXUA 3VVEA 1QAMA 1LBCA 4F3GA 5A2QS 1IXHA 1H76A 2XXIA 4D82A 4X64M 2XXRA 4MB7A 1MDP1 3U8QA 3HU2A 3OXNA 1TFAA 4LRTA 1DGBA 1B9JA 2LNHC 1B32A 3JAMS 1XVXA 3J7AS 3VDUA 2Y7PA 5FHOA 1PB7A 3UMMA 1NNUC 1W5TA 1Z7NE 2F34A 2IA4A 4DE8A 3UORA 2RINA 1DOTA 4FVMA 3I4YA 4QOSA 2KEBA 4YMAA 4ZECA 4GWOA 1PEBA 3FXQA 4NMYA 4C0RA 5H8HA 2F8DA 4TLLB 1Z5BA 4X65M 3KOXE 2X7QA 3K1NA 5CI5A 2VQEM 1J7KA 3K1PA 2ESNA 4DV7M 4G68C 3IB1A 3NWLA 2Q9TA 3CI8A 2ZANA 1URGA 3FGSA 5I2KA 4PDIA 4DR4M 4DLDA 4U22A 2RC7A 4B08A 4D81A 2V1UA 4DR7M 4EIWA 4OMBA 3KBRA 3DFZA 4P0IA 4LF4M 3FTFA 1JVYA 1PBPA 4LZ8A 4OYVA 1IM2A 1DPEA 3FD3A 1IBMM 1RYXA 4U1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V25 A;  4GL0 A;  4R6H A;  1NNK A;  1SW5 A;  1O64 A;  2O68 A;  3EF7 A;  1A40 A;  1GR2 A;  1BP5 A;  4THI A;  5HM4 B;  1SI1 A;  4HS7 A;  3PUZ E;  1POT A;  4JB7 A;  2I6E A;  5KDT A;  1EZO A;  2R71 A;  4LON B;  1FTK A;  2D3I A;  1SDX A;  1NKX A;  3H4Z A;  4LQ5 A;  3JZJ A;  4JWO A;  1IQ7 A;  1O7T A;  1H3D A;  4IO2 A;  5AA3 A;  1US4 A;  1FTL A;  3OD7 A;  3ECR A;  1OLC A;  3RN8 A;  1DTG A;  2REG A;  1LFG A;  5FTH A;  1D4N A;  4H8I A;  1OQG A;  5TPA A;  3MVX A;  4Z7E A;  5DVJ A;  2P0S A;  2GH9 A;  4R75 A;  5H8F A;  4RK9 A;  3IOV A;  3Q25 A;  3N6T A;  2DWH A;  1TWY A;  1YCJ A;  1S9T A;  3FV2 A;  2I3V A;  2Z22 A;  4XKP A;  5L9O A;  1FQE A;  5B70 A;  4QSC A;  2BJJ X;  1BTJ A;  1M5D A;  3PUW E;  4ZS9 A;  3IO6 A;  1URS A;  1NL5 A;  3IL1 B;  1Q1K A;  2D5W A;  4OWD A;  4MH5 A;  1B0H A;  4GF8 A;  2O51 A;  3FJM A;  3T9U A;  1B3H A;  1N7W A;  2Q2A A;  1FTJ A;  4WEP A;  2ONS A;  3TQL A;  5DT6 A;  4OFO A;  4GVO A;  3H7M A;  4RPO A;  2OK2 A;  4G8H A;  4R2B A;  3LC8 A;  3K2D A;  3RPW A;  3ILU B;  1N0T A;  4LZ7 A;  3ODB A;  4NF5 A;  1JW4 A;  2DYX A;  3S2V A;  4EF2 A;  1BIY A;  4G4P A;  4OEV A;  3RY3 A;  1SW1 A;  1B51 A;  4PET A;  4NF8 A;  3P7I A;  3K0V A;  3SDF A;  2ZYO A;  1HSE A;  3VV5 A;  1VFD A;  1Y1Z A;  2I48 A;  2Q89 A;  2LAO A;  3IB0 A;  3MZ1 A;  3O29 A;  3O6H A;  2B65 A;  5TU0 A;  4R2F A;  4Q8R A;  3BKI B;  4GXA A;  3OEK A;  3PU5 A;  3MWB A;  4KYE A;  3HHG A;  5AA2 D;  3O28 A;  4ZEK A;  4PFT A;  2ZYM A;  4E0X A;  3LSX A;  5ITP A;  2UXA A;  3K6U A;  1XVY A;  3MVW A;  4ZZA A;  1P1O A;  4POX A;  1JEU A;  2AYS A;  5K2Y A;  5KCJ B;  4HW8 A;  2YLN A;  3MBP A;  4EQB A;  1QJM A;  1A8F A;  1SI0 A;  4G8M A;  4IB2 A;  4G68 B;  1Y20 A;  4F1Y A;  5IKB A;  5L8D A;  2OBG A;  3E4R A;  5EYF A;  3O66 A;  3TTL A;  2G29 A;  3G3G A;  2WKY A;  5CC2 A;  4M1V A;  1H45 A;  1IXI A;  5ISU A;  1XHY A;  2DVC A;  3MAM A;  1MM7 A;  4KCD A;  3HN0 A;  3FAT A;  3FIR A;  3C34 A;  1MXX A;  4P0G A;  3SEU A;  3H6T A;  2DWA A;  5I57 B;  4XKQ A;  4R6K A;  1B1X A;  3O97 A;  4TQU Q;  2I49 A;  3SEY A;  3BBR A;  5DYH A;  4H5F A;  5I56 A;  1OLA A;  1J1N A;  3V5A A;  3K6X A;  4NE4 A;  1A99 A;  2D21 A;  2HAU A;  4RPN A;  4UA8 A;  3CVG A;  4F1V A;  3TUS A;  3D4C A;  1Y4C A;  3LUY A;  2KLF A;  4LVQ A;  5CMM A;  2I4B A;  3S9L C;  4ECF A;  3V83 A;  5IAI A;  1MQI A;  1B0L A;  3C9H A;  2ZMB A;  1OMP A;  3OEM A;  1SVX B;  2Z8D A;  4JSD A;  2DOJ A;  3SER A;  4FAJ A;  3I6V A;  3TTM A;  2Q88 A;  4DCY A;  2XXW A;  3B7D A;  1OIB A;  3HCQ A;  4GD5 A;  2RKM A;  4K3F A;  1MM6 A;  2PYY A;  2O7U A;  3UGW A;  4GFR A;  2XD2 A;  5K2X A;  2ZYN A;  4I62 A;  4FEB A;  1FTM A;  1SYI A;  1YTV A;  3ZKK A;  2Z8F A;  1AMF A;  3BFT A;  1B52 A;  1UQW A;  3EN3 A;  4C1T A;  4NF6 B;  2E1S A;  1AOV A;  3LSW A;  2F35 A;  4OHN A;  4N07 A;  2ONK E;  4QFK A;  2NXO A;  4DIG A;  2A5T B;  4ELO A;  1QUL A;  4U4S A;  3TKD A;  4WKM A;  2ZNU A;  4LQ2 A;  3KSX A;  5A5X A;  3SES A;  1M5B A;  2DWI A;  1GTK A;  4UAC A;  4GQO A;  4OTE A;  3SET A;  1MXY A;  1LGB C;  1FQF A;  3OOA A;  4JWY A;  2OCU A;  4AB5 A;  1LAX A;  4G2Z A;  5F7V A;  3IOU A;  2B3B A;  1II5 A;  3MQ9 A;  4F39 A;  1LLS A;  3B6W A;  1TXF A;  3TOD A;  1URD A;  4JWX A;  2P1S A;  2QSX A;  4RK2 A;  1AL3 A;  3H6U A;  3TQW A;  4ELQ A;  1HSL A;  1QUI A;  1R1N A;  2PVU A;  4OVJ A;  4I9D A;  2GHB A;  3K1M A;  2XHD A;  1B3F A;  4YB6 A;  3JV9 A;  5I84 A;  4O3B A;  3PMV A;  1ZU0 A;  5H8Q B;  4BDN A;  3CRB A;  4NED A;  3TTN A;  3RLF E;  1KWH A;  3A09 A;  4ZEI A;  1SW4 A;  3T9V A;  3G3F A;  3VLW A;  2O6A A;  2XX7 A;  5CM6 A;  4F3P A;  2XXX A;  2P2A A;  2DVZ A;  4OEN A;  2DE4 A;  4IGT A;  3MP1 A;  1US5 A;  4QSD A;  2REJ A;  1HSJ A;  2RCA A;  1PDA A;  1MY1 A;  3MVZ A;  3VFJ A;  2F7C A;  5DEX B;  4HCY A;  3T96 B;  1XOC A;  5DVI A;  4X1D A;  1JNF A;  4LAT A;  2HCA A;  3TCF A;  2UVI A;  3GLB A;  4H67 A;  4RJZ A;  1XS5 A;  4OZ9 A;  3SKP A;  2H4I A;  2V3U A;  4HCW A;  2V3Q A;  5JTY A;  3DM0 A;  2G93 A;  1A7L A;  3C36 A;  3O6I A;  4YKP A;  3C33 A;  3FZV A;  4QFO A;  2F78 A;  3EQ1 A;  5ELV A;  3VLV A;  3PMW A;  2HFB A;  2RCB A;  2UVH A;  4F3B A;  3G3J A;  2OWS A;  3PMX A;  3GZG A;  3HPI A;  2HEU A;  1AIV A;  3TCG A;  3TTK A;  4JXI A;  2FYI A;  2ALU A;  3GBB A;  2GFE A;  1MQJ A;  1LAH E;  1UIU A;  4F1U A;  3LBS A;  3H3G A;  4QF9 A;  4MFI A;  3TZA A;  2RC8 A;  3VXC A;  1B2H A;  3S9M C;  4R6Y A;  4DXB A;  3K6W A;  4YU0 A;  1SQY A;  1MXU A;  1I6Q A;  2A5S A;  3ILT B;  5KCJ A;  2IEE A;  3SEX A;  1UTB B;  1H43 A;  1OVT A;  1IXG A;  2ABH A;  4KD5 A;  1B7U A;  2OLB A;  3LSL A;  4G68 A;  4YMB A;  5DVF A;  5B7D A;  1R9Q A;  3KG2 A;  1DTZ A;  3FV1 A;  3UP9 A;  2V3T A;  1MDQ A;  3RT8 A;  4YKJ A;  3S9N C;  4OQO A;  4MBP A;  3E9X A;  1SYH A;  2I4C A;  4RYA A;  1QW0 A;  5CMC A;  3QUF A;  1LCT A;  3O6G A;  2H99 A;  3CFL A;  2DQV A;  1LBB A;  5I57 A;  4IGR A;  3W9W A;  4U4X A;  3U93 A;  5I2N B;  3FVN A;  4TLM B;  4F31 B;  3ONM A;  3IK6 B;  2F6P A;  1FW0 A;  1B5I A;  1MQD A;  2XX8 A;  1LB9 A;  2DWJ A;  3U94 A;  3RUM A;  2CMO A;  3T93 B;  3A3U A;  1FTO A;  1ZLQ A;  4ESX A;  3KN3 A;  3DP8 A;  4JBZ A;  2QS3 A;  4R73 A;  4I1D A;  3FAS A;  3M3L A;  2YPN A;  3H6V A;  4P11 A;  4IO7 A;  3DP6 A;  4OET A;  4FJP A;  3DP4 A;  1ZIU A;  4PE5 B;  1Y3P A;  5JEI A;  1ZBM A;  1B7Z A;  3N5L A;  4E0W A;  2I3W A;  1MQH A;  2O69 A;  4G8N A;  4EUO A;  2ZNS A;  2R9J A;  3VVD A;  1O63 A;  4OER A;  5LOM A;  3R7X A;  4FOR A;  2V93 A;  4EQ9 A;  5CBS A;  1A55 A;  3IAZ A;  3MW0 A;  3IX1 A;  4EXK A;  1JVX A;  4OFL A;  3WAE A;  4BLA A;  3B6T A;  3R26 A;  3CSB A;  1FQA A;  5EHS A;  1GV8 A;  4HTG A;  2DP8 A;  3PPO A;  1B46 A;  3PD9 A;  3OEN A;  2QMW A;  1BLF A;  3QIM A;  1MS7 A;  3EPE A;  1B3E A;  3K4U A;  4Q5T A;  1QKB A;  5H8S A;  4L17 A;  1MG1 A;  2NWJ A;  3TCH A;  3EHT A;  4IY5 A;  3ZKL A;  1TT1 A;  3RTF B;  3THI A;  3IO4 A;  5KDT B;  1POY 1;  1A8E A;  4KR5 A;  1ZKB A;  1JET A;  2ONR A;  3LR1 A;  5AA4 B;  3IOW A;  4OEU A;  3TTR A;  4R9G A;  3MUQ A;  2Y7R A;  3R6U A;  3FJ7 A;  4R9F A;  2RC9 A;  4O3A A;  4X9T A;  1GVC A;  1MXZ A;  2GRV A;  4F29 A;  3KOS A;  5TPA B;  2PX1 A;  3CSG A;  4X48 A;  5H8F B;  2VP1 A;  4PFY A;  1P1U A;  4YIC A;  3KSJ A;  3TDJ A;  3TPA A;  2OJT A;  2X7P A;  1NNT A;  1IXC A;  3IJX B;  4ZEB A;  1LAF E;  3ZSF A;  2X26 A;  3HV1 A;  1N76 A;  3G3I A;  1NMU A;  1LFI A;  5DEX A;  1B5J A;  5CMB A;  4AQ4 A;  5AE4 A;  3OO7 A;  4Q30 B;  4I8C A;  2AL4 A;  3B6Q A;  1IZ1 A;  4U23 A;  3D4G A;  4FE8 A;  1DSN A;  4ZE9 A;  3I3V A;  2QRY A;  5I59 B;  1R9L A;  4ND9 A;  1F9B A;  3T9X B;  2Q2C A;  5M2V A;  1IEJ A;  4ZEF A;  5AA2 B;  4XTC Q;  1USY H;  3TEP A;  3Q29 A;  4GOT A;  2HQ0 A;  4C1U A;  2AIX A;  2H98 A;  2THI A;  2DXR A;  2F6G A;  1ANF A;  3OSR A;  5BUU A;  4F19 A;  3KJ7 A;  4KHZ E;  5FTI A;  2QS4 A;  4IO5 A;  2OZZ A;  3TMG A;  1QUK A;  4QFL A;  4YAH X;  1NNF A;  1D9V A;  3EHS A;  1RKM A;  3SEV A;  3L6H A;  1LFH A;  1LAG E;  1SW2 A;  3RNN A;  1USY E;  3VVF A;  1OQH A;  3W15 C;  2I58 A;  4ELR A;  2I0B A;  4QHQ A;  1T0K A;  4H0W A;  4Z0I A;  3PPQ A;  1YPN A;  4TOZ A;  4F22 A;  1EH3 A;  3VXB A;  4ELP A;  1ZTY A;  2VHA A;  3N26 A;  4PP0 A;  3H06 B;  1R6Z A;  4QRZ A;  2QS1 A;  1JW5 A;  1LCF A;  5I58 B;  1ZJL A;  3K01 A;  5BWJ A;  3UN6 A;  1D3K A;  2YJP A;  4GIZ A;  4F2Q A;  3T9H B;  3AXF A;  2ZNT A;  3WAF A;  3KJT A;  3S9E A;  4FIM A;  1N04 A;  1B5H A;  5ICQ A;  3I5O A;  1GGG A;  2XXT A;  3PPR A;  4O3C A;  3KOT A;  4G77 A;  3H03 A;  2F36 A;  2XD3 A;  4YB5 A;  1DMB A;  1FQD A;  4KCC A;  2UYF A;  4X1B A;  1UTH B;  5I56 B;  5I2N A;  1S7Y A;  4WED A;  4F2O A;  4MLQ A;  1P1W A;  1I6B A;  3PD8 A;  4WXJ A;  4RA1 A;  4NWD A;  3N6U A;  2HZK A;  4EDP A;  3ZS6 A;  2XXQ A;  4GXS B;  4M4G A;  3QK6 A;  2F7B A;  1BKA A;  2Y84 A;  2O84 X;  5CMK A;  1I6A A;  1RYO A;  1IUD A;  1MPC A;  3QYT A;  3USD A;  1MY4 A;  1B3G A;  1P1Q A;  4LZ5 A;  1IIT A;  4IO4 A;  2DS9 A;  2PMS A;  3Q26 A;  4FED A;  3QAX A;  4QFN A;  1MH3 A;  3LSF B;  3DEL B;  4DXU A;  2ZXT A;  2Z23 A;  3T22 A;  3F11 A;  4MLV A;  4U1O A;  3FVO A;  3HO7 A;  5H8N B;  1NNP A;  2HZL A;  4KPT A;  2H25 A;  2GHA A;  1B7H A;  1JW1 A;  1OVB A;  2UYE A;  4YZZ A;  1I69 A;  4OXV A;  2NUV A;  2VGQ A;  4LA9 A;  1N84 A;  2FNC A;  1ATG A;  5J1D A;  4ZE8 A;  3MC2 A;  1SBP A;  1YAE A;  5TP9 B;  4BDQ A;  1JQF A;  3MP6 A;  4Q0C A;  2R6G E;  5A5X B;  4OES A;  1N3W A;  4H65 A;  2UVJ A;  4LP2 B;  2XX9 A;  1WVJ A;  3M8U A;  1NFT A;  1P99 A;  2QPQ A;  1WOD A;  3G3K A;  4NWC A;  2AL5 A;  2W7Y A;  3IB2 A;  4ZDM A;  4DCX A;  4EQ7 A;  3PUX E;  3Q28 A;  1XC1 A;  1DPP A;  3K00 A;  1S50 A;  5AA4 A;  3M3F A;  3O2A A;  4RNS A;  3PV0 E;  1M5F A;  1NH7 A;  3MZ9 A;  4XKN A;  3CFX A;  1D9Y A;  1UIV A;  2F7A A;  2PBW A;  1B4H A;  4RY1 A;  1EZ9 A;  3RTW B;  3RT6 B;  5FHM A;  1Q35 A;  5EHM A;  5FHN A;  4EF1 A;  1MXV A;  1Y4T A;  2E0S A;  5ITO A;  4KQP A;  3HST A;  2Y7K A;  1Z7M E;  4IO6 A;  4NF4 B;  1XT8 A;  1LB8 A;  4XKR A;  1MXW A;  1ELJ A;  2NVU B;  2FA7 A;  4FAT A;  3GBA A;  1NH8 A;  3A3C A;  2RF1 A;  3OSQ A;  3CIJ A;  4YB7 A;  5DTB A;  1ZMG A;  3MVY A;  4KYS A;  3UK4 A;  3QSL A;  3C35 A;  1JEV A;  2H5Y A;  3MJN A;  2DE3 A;  3IR1 A;  5I59 A;  3H6W A;  3M3K A;  3OEL A;  4U2R A;  5ICT A;  3KEI A;  4ZED A;  4BDR A;  3PUY E;  4IY6 A;  5JTY B;  2QMX A;  5H8H B;  2B3F A;  2XXV A;  3TAJ A;  2XXP A;  3RGY A;  3V89 B;  4F3S A;  3VE1 B;  5AA2 A;  3RQT A;  3CR9 A;  3FUZ A;  1PC3 A;  4NF6 A;  5I2K B;  1B4Z A;  4N13 A;  3N94 A;  3IJO B;  3QXM A;  4LUB A;  2A5T A;  1B1H A;  2DXY A;  3UIF A;  4PFW A;  3DLN A;  4XIG Q;  2O7I A;  3OO6 A;  1QUJ A;  1VFE A;  4ISU A;  4DDD A;  3T66 A;  4BDL A;  1TFD A;  3PPP A;  4ONY A;  2Y7I A;  3S4U A;  4POW A;  1AH5 A;  3MPK A;  2VD2 A;  1QVS A;  1QKA A;  5HBC A;  4N6P A;  3CG3 A;  4BDM A;  1CE2 A;  1IIW A;  1FCK A;  3Q27 A;  3FXU A;  3PUV E;  1MPB A;  3W9V A;  2F5X A;  5I58 A;  2V84 A;  5L9S A;  2UVG A;  3KN8 A;  3JYR A;  1Y3N A;  4GRK A;  4QSE A;  1VSO A;  1M5C A;  1B40 A;  1LST A;  4RXL A;  1CB6 A;  4EXL A;  1PB9 A;  1N7X A;  2M8C A;  5CBR A;  2ZYK A;  4ESW A;  1B05 A;  5H8Q A;  1A54 A;  2O1M A;  3PGF A;  4DXC A;  4JSO A;  1L5T A;  1VR5 A;  4U21 A;  1UTH A;  5F1Q A;  3E13 X;  4H6D A;  4NTL A;  3MZB A;  4PQJ A;  3HHF A;  2VOZ A;  2NOO A;  2I0C A;  3OMB A;  3CFZ A;  3KN7 A;  2OWT A;  3U92 A;  4H1X A;  2VD3 A;  4R72 A;  4H5G A;  5KZT A;  1SD3 A;  2Z8E A;  2F97 A;  4AB6 A;  3MPL A;  2PT2 A;  1Y3Q A;  1B58 A;  3KGC A;  3FVG A;  4YKI A;  3BFU A;  3C4M A;  3TEL A;  3KFM A;  4QFP A;  3MP8 A;  3IOT A;  4JDF A;  2QL3 A;  4NF5 B;  1M5E A;  1WDN A;  1MH4 A;  1P1N A;  3TFL A;  3CG1 A;  4YKK A;  1FQC A;  3UA8 A;  4NF8 B;  3IOR A;  4KI0 E;  3OO9 A;  2HXW A;  1PBQ A;  5H8N A;  2HAV A;  2H9B A;  1N3X A;  1MQG A;  3U72 A;  3FJG A;  2QJE A;  3E3K A;  2Y7W A;  4OFJ A;  4H8J A;  2XXY A;  1VE4 A;  1B6H A;  3G7W A;  3VLU A;  4PFU A;  5JK4 A;  2O1L A;  1B3L A;  5TP9 A;  4IO3 A;  3OO8 A;  2QS2 A;  3QUJ A;  5AA1 A;  2XXH A;  2DE2 A;  1UTB A;  1MY3 A;  1MY0 A;  3SEW A;  4BDO A;  4MF3 A;  4GL8 A;  1PB8 A;  4R74 A;  4ZZE A;  2ANJ A;  1Y9U A;  4FEC A;  3O9P A;  3TYH A;  2CZL A;  5L9M A;  1MY2 A;  1Y1M A;  2DSF A;  3K02 A;  3C32 A;  3EHU A;  2Q8J A;  3FXR A;  4KFQ A;  1EZP A;  2XXU A;  2PT1 A;  1H44 A;  4GLI A;  4NF4 A;  3G3H A;  4DZ1 A;  3FVK A;  3L6G A;  3V8X B;  3C31 A;  1MRP A;  5CRY A;  1MPD A;  4F18 A;  1FQB A;  1EU8 A;  3KZG A;  3GXA A;  4KYD A;  3VDF A;  3PPN A;  5HPQ A;  3U1O A;  3K6V A;  4XXU A;  3VVE A;  1LBC A;  4F3G A;  1IXH A;  1H76 A;  2XXI A;  2XXR A;  1MDP 1;  3U8Q A;  3OXN A;  1TFA A;  1B9J A;  1B32 A;  1XVX A;  2Y7P A;  5FHO A;  1PB7 A;  1Z7N E;  2F34 A;  2IA4 A;  4DE8 A;  3UOR A;  2RIN A;  1DOT A;  4YMA A;  4ZEC A;  4GWO A;  1PEB A;  3FXQ A;  4NMY A;  4C0R A;  5H8H A;  2F8D A;  4TLL B;  2X7Q A;  3K1N A;  5CI5 A;  3K1P A;  2ESN A;  4G68 C;  3IB1 A;  2Q9T A;  3CI8 A;  1URG A;  3FGS A;  5I2K A;  4DLD A;  4U22 A;  2RC7 A;  4OMB A;  3KBR A;  4P0I A;  1JVY A;  1PBP A;  4LZ8 A;  4OYV A;  1DPE A;  3FD3 A;  1RYX A;  4U1Z A; 
#chains in the Genus database with same CATH topology
 2FHY A;  2V25 A;  3VKH A;  4GL0 A;  4R6H A;  1IMD A;  3HJQ A;  4WW0 A;  1NNK A;  1O64 A;  1SW5 A;  2C9O A;  2O68 A;  3EF7 A;  1A40 A;  1IN6 A;  3TWL A;  4HLQ A;  2XXK A;  2LHG A;  1GR2 A;  1BP5 A;  4THI A;  5HM4 B;  1SI1 A;  4HS7 A;  4LJA A;  3PUZ E;  4LJ6 A;  1POT A;  5EYH A;  4JB7 A;  1NSF A;  1OTR A;  2I6E A;  3W0F A;  5KDT A;  1SXJ D;  2ZZW A;  4X66 M;  1NUX A;  2JZ0 A;  1EZO A;  4DR2 M;  2R71 A;  3L26 A;  2QBY B;  1FTK A;  4LON B;  2D3I A;  1SDX A;  1NKX A;  3H4Z A;  2R8T A;  4LQ5 A;  3JZJ A;  2WEF A;  5KPZ A;  4JWO A;  4DR3 M;  1IQ7 A;  1O7T A;  1H3D A;  3AL0 C;  4IO2 A;  5AA3 A;  1US4 A;  1FTL A;  3OD7 A;  3ECR A;  5FLX S;  1OLC A;  4HE1 A;  4FBP A;  3GLF A;  3HGI A;  3RN8 A;  1DTG A;  2REG A;  1Z6T A;  2XF3 A;  1LFG A;  2DDK A;  1YZ0 A;  2G3Q A;  3H4M A;  5EQ9 A;  2EKF A;  5FTH A;  1D4N A;  4H8I A;  3T15 A;  4JI4 M;  4G6Z A;  1OQG A;  5TPA A;  2F5Q A;  3MVX A;  4H45 A;  4NXN M;  2DZO B;  4NXM M;  4Z7E A;  5DVJ A;  2P0S A;  3IFA A;  2GH9 A;  4R75 A;  5H8F A;  1QGX A;  1HQY E;  4RK9 A;  1N75 A;  3IOV A;  3B89 A;  3N6T A;  3K1J A;  2DWH A;  3Q25 A;  1TWY A;  1D0K A;  3TQS A;  1YCJ A;  1S9T A;  2L2D A;  2V1C A;  4I3E A;  1YUB A;  3FV2 A;  2I3V A;  2Z22 A;  4XKP A;  5L9O A;  1WHC A;  1FQE A;  1GJS A;  5B70 A;  4QSC A;  2BJJ X;  1BTJ A;  1M5D A;  3PUW E;  4ZS9 A;  3IO6 A;  2DWZ B;  1URS A;  1NL5 A;  3IL1 B;  1Z59 A;  1Q1K A;  1DO2 A;  2D5W A;  4OWD A;  4MH5 A;  2KR0 A;  3U60 B;  2QVU A;  2L7I A;  3GRR A;  5EQT A;  1B0H A;  4GF8 A;  2O51 A;  3FJM A;  3T9U A;  4UN2 B;  1B3H A;  3T1Y M;  5FTM A;  1N7W A;  2Q2A A;  1TDZ A;  1FTJ A;  4WEP A;  1L2B A;  2ONS A;  1QQW A;  2DEN A;  4IBJ A;  3TQL A;  2P3N A;  5DT6 A;  3FUV A;  3B7Q A;  5EXX A;  5L8R F;  4OFO A;  4GVO A;  3H7M A;  4CGY B;  3SYL A;  4B7H A;  1HNX M;  4RPO A;  3B7Z A;  2OK2 A;  4G8H A;  4R2B A;  3LC8 A;  3JR5 A;  3K2D A;  3RPW A;  3W0L B;  3ILU B;  4OW0 A;  3U6M A;  1N0T A;  1RDY A;  3TL4 X;  2VQF M;  3EIE A;  4LZ7 A;  1IN7 A;  4HL4 A;  3ODB A;  4NF5 A;  1JW4 A;  4DV6 M;  1GJT A;  2DYX A;  3S2V A;  4EF2 A;  2L7H A;  4LZJ A;  1BIY A;  1WGL A;  1EYK A;  3OTO M;  4G4P A;  4OEV A;  3RY3 A;  1SW1 A;  3SBJ A;  1B51 A;  2DZL A;  4PET A;  4B3S M;  4NF8 A;  3P7I A;  5KO3 A;  2HAK A;  2CUZ A;  3K0V A;  2O5R A;  1OIZ A;  3SDF A;  2ZYO A;  1HSE A;  3VV5 A;  1VFD A;  1N34 M;  4LFB M;  1NV6 A;  1VG5 A;  1Y1Z A;  2I48 A;  2Q89 A;  2A5Y B;  2LAO A;  2ZTD A;  2CE7 A;  3L27 A;  3IB0 A;  3MZ1 A;  1NUY A;  3O29 A;  5T3J A;  3O6H A;  2B65 A;  5TU0 A;  4L78 A;  2R44 A;  4R2F A;  4Q8R A;  3BKI B;  4CIZ A;  4GXA A;  3OEK A;  3PU5 A;  3MWB A;  1D0M A;  4KYE A;  1MN3 A;  5FTL A;  3HHG A;  4I40 A;  4MEV A;  2LTU A;  5AA2 D;  3O28 A;  4ZEK A;  4PFT A;  1IXR C;  2Z8Y M;  2ZYM A;  3HU3 A;  1NNJ A;  4E0X A;  3LSX A;  5ITP A;  2UXA A;  2CHV A;  3K6U A;  1XVY A;  3HHX A;  3MVW A;  3FUU A;  1ZV1 A;  4ZZA A;  1P1O A;  5IZ7 D;  2RGH A;  2CP8 A;  2XZF A;  4POX A;  4MGH A;  1EYI A;  2DZN B;  1JEU A;  2AYS A;  5K2Y A;  5KCJ B;  3THG A;  1NV7 A;  4HW8 A;  2YLN A;  4OVQ A;  3J2P B;  3MBP A;  4LZZ A;  4EQB A;  1FPI A;  1QJM A;  1A8F A;  1SI0 A;  1AIP C;  4G8M A;  4IB2 A;  1PJQ A;  4G68 B;  2RKO A;  1Y20 A;  3T1B A;  1FSA A;  1IBL M;  2HL7 A;  3PNV A;  3C3D A;  4KLN A;  4DV1 M;  2FS1 A;  4F1Y A;  3BOS A;  2KQZ A;  4BLC A;  4GWU A;  4JI0 M;  3FUW A;  5IKB A;  5L8D A;  1XXH E;  3E4R A;  2OBG A;  3SAT A;  1ZMW A;  4LF5 M;  4XBO A;  5EYF A;  2K9D A;  4GC9 A;  3O66 A;  5BR8 M;  3TTL A;  2G29 A;  3G3G A;  2WKY A;  5CC2 A;  3GLG B;  4M1V A;  5ET6 A;  1H45 A;  1PJI A;  4GH9 A;  1IXI A;  5ISU A;  1XHY A;  2DVC A;  3MAM A;  1MM7 A;  2JZ1 A;  3FE3 A;  3T0J A;  3SHF A;  3BIG A;  3KOZ E;  4KCD A;  3HN0 A;  3FAT A;  3FIR A;  3C34 A;  2Q2E B;  1MXX A;  2ZBK B;  4P0G A;  3SEU A;  3H6T A;  4R3D A;  2DWA A;  2D7G A;  4GKK M;  3U5Z B;  5I57 B;  4XKQ A;  3KC0 A;  4R6K A;  1B1X A;  3O97 A;  2HXR A;  4TQU Q;  3KDS E;  2I49 A;  1NI9 A;  3SEY A;  3BBR A;  5DYH A;  4H5F A;  5I56 A;  1OLA A;  1J1N A;  3V5A A;  3ISP A;  2B4L A;  3K6X A;  4NE4 A;  4P9K A;  2XZU A;  4P47 A;  1TDH A;  3TWM A;  1A99 A;  2D21 A;  2MKZ A;  4PBQ A;  2HAU A;  4RPN A;  4AKH A;  2P3V A;  4UA8 A;  3CVG A;  5F24 A;  3DZD A;  4F1V A;  4IBE A;  3TUS A;  4PCZ A;  3D4C A;  1TH3 A;  4II7 A;  1Y4C A;  4OAN A;  3LUY A;  1T3T A;  2J5Y A;  2KLF A;  4LVQ A;  4GWY A;  5CMM A;  4DV5 M;  2LVA A;  4AW4 A;  2I4B A;  4B3M M;  3S9L C;  4ECF A;  3V83 A;  5IAI A;  1MQI A;  2DWL A;  1FPJ A;  5DYG A;  1B0L A;  3C9H A;  2L4F A;  2ZMB A;  1N77 A;  1OMP A;  1G3I A;  1Q3C A;  3OEM A;  1LBV A;  1SVX B;  2Z8D A;  4JSD A;  3RPL A;  3E9S A;  2DOJ A;  3SER A;  4FAJ A;  3AOE A;  4FWH A;  3I6V A;  3KS8 A;  3TTM A;  1XMO M;  2Q88 A;  4DCY A;  2XXW A;  3B7D A;  3FTD A;  1OIB A;  4NC6 A;  3PTY A;  3HCQ A;  4GD5 A;  2RKM A;  4K3F A;  1MM6 A;  2KZS A;  2UXB M;  2O7U A;  2HKJ A;  2K47 A;  2PYY A;  3UGW A;  2CRU A;  4GFR A;  1G71 A;  2XD2 A;  2VF8 A;  1RDX A;  5K2X A;  2ZYN A;  4I62 A;  4PAF A;  3PVS A;  4FEB A;  2Z7J A;  1FTM A;  3LV0 A;  3J81 S;  1SYI A;  1FBH A;  2DAM A;  1YTV A;  1IXS B;  4L15 A;  5DYI A;  3ZKK A;  4AKI A;  4FCT A;  4LG2 A;  2YNM D;  2Z8F A;  2WYK A;  1X37 A;  4AZF A;  1AMF A;  3BFT A;  4FCW A;  1B52 A;  1UQW A;  3EN3 A;  4C1T A;  3MHV C;  3GQ4 A;  4NF6 B;  2E1S A;  1AOV A;  3LSW A;  1KA0 A;  2F35 A;  2LHC A;  4N07 A;  3HJS A;  2UUC M;  4OHN A;  2ONK E;  4QFK A;  4DV3 M;  2NXO A;  4DIG A;  2A5T B;  2VII A;  2XWI A;  2QNJ A;  1QUT A;  1FPK A;  4PE3 A;  2RRU A;  3HY5 A;  4ELO A;  3IEC A;  1HT2 E;  1QUL A;  3K2L A;  4U4S A;  4KHP M;  3TKD A;  3B74 A;  1NY6 A;  4WKM A;  4GBW A;  4I3Y A;  2ZNU A;  4N6K A;  4NL4 H;  4LQ2 A;  3MJ5 A;  3KSX A;  5A5X A;  3SES A;  1M5B A;  2DWI A;  5DW8 A;  5KQ8 A;  1GTK A;  3BIH A;  4GQO A;  4UAC A;  4OTE A;  3SET A;  1MXY A;  3KP0 E;  1LGB C;  4PD2 A;  1FQF A;  4D80 A;  2FIX A;  3OOA A;  2W82 A;  4JWY A;  2OCU A;  4PCD A;  4AB5 A;  1LAX A;  4G2Z A;  2JXN A;  2C9C A;  5F7V A;  3IOU A;  1DGF A;  2B3B A;  5I3S A;  4PF6 A;  4DBG B;  5IZZ A;  1II5 A;  3MQ9 A;  4MM3 B;  2OQ4 A;  4F39 A;  2EO2 A;  2F5P A;  2H1R A;  3E78 A;  5FSW A;  2FBP A;  4L16 A;  1LLS A;  3B6W A;  4OVP A;  1TXF A;  1JB0 F;  2OWZ A;  3TOD A;  4IBF A;  4AKG A;  1URD A;  4JWX A;  2P1S A;  2QSX A;  4RK2 A;  1AL3 A;  5EJC A;  3H6U A;  3TQW A;  3SMS A;  4IBI A;  4ELQ A;  1Z5C A;  1HSL A;  1QUI A;  1R1N A;  3HU1 A;  4K0K M;  1DBZ A;  2PVU A;  4OVJ A;  4LF6 M;  3ZCB B;  3T1H M;  5BPV A;  3JR4 A;  4G4R A;  4I9D A;  2GHB A;  4PFR A;  5FTN A;  3K1M A;  2XHD A;  1B3F A;  4YB6 A;  3JV9 A;  5I84 A;  5ITX A;  4O3B A;  2HPG A;  3PMV A;  2BJV A;  3M6A A;  1ZU0 A;  2V4C A;  2L4E A;  5IWA M;  1JP4 A;  4PDD A;  5H8Q B;  2CWB A;  4BDN A;  2VF7 A;  1R4G A;  3CRB A;  1DGH B;  4NED A;  2QVR A;  3TTN A;  3RLF E;  1KWH A;  3A09 A;  4ZEI A;  1SW4 A;  3T9V A;  3G3F A;  3VLW A;  2O6A A;  1RU3 A;  2XX7 A;  5CM6 A;  4F3P A;  1F4I A;  2XXX A;  4IBG A;  4OVT A;  1OJL A;  2P2A A;  3KOW E;  2DVZ A;  5EQ7 A;  1NHW C;  3GLF E;  4OEN A;  2DE4 A;  2QFL A;  1MJG M;  2M60 A;  4IGT A;  3MP1 A;  1US5 A;  4QSD A;  2REJ A;  1HSJ A;  3WHK A;  2RCA A;  1PDA A;  1MY1 A;  4QBA A;  3MVZ A;  1VQ1 A;  3VFJ A;  1NV1 A;  4DR5 M;  4UAB A;  3U60 A;  2F7C A;  5DEX B;  1VDL A;  2CHQ A;  1DK4 A;  4HCY A;  3T96 B;  1XOC A;  1SXJ C;  5DVI A;  7CAT A;  4X1D A;  1JNF A;  3GPX A;  4LAT A;  4X04 A;  2HCA A;  1HT1 E;  3TCF A;  1Z5A A;  2JY5 A;  2UVI A;  3GLB A;  1KYI A;  4H67 A;  2XWK A;  2X8A A;  4RJZ A;  3CF0 A;  4L8R C;  5ET7 A;  1XS5 A;  4OZ9 A;  3SAS A;  3SKP A;  2H4I A;  2V3U A;  4HCW A;  3E46 A;  4GIT A;  2HHH M;  2V3Q A;  2XA5 A;  5JTY A;  3DM0 A;  2XSZ A;  4N81 A;  3IG8 A;  2G93 A;  1A7L A;  3FD9 A;  3C36 A;  3O6I A;  4YKP A;  4GHL A;  3C33 A;  2WBB A;  1XWI A;  1E32 A;  1NVM A;  3FZV A;  2FVZ A;  2F78 A;  4DV4 M;  4QFO A;  3GRY A;  4LFA M;  3EQ1 A;  4JVD A;  5ELV A;  5C1B A;  3VLV A;  2F5S A;  3PMW A;  4M9X A;  2C5R A;  4NRV A;  2HFB A;  2RCB A;  4MNI A;  2UVH A;  1UM8 A;  3A45 A;  4F3B A;  3G3J A;  4PGN A;  2JUJ A;  2JJK A;  1QAN A;  2OWS A;  1Q9D A;  3PMX A;  2UXD M;  3GZG A;  3HPI A;  2HEU A;  1AIV A;  3PNY A;  2K0B X;  1WIV A;  3J27 B;  2D7H A;  3TCG A;  3KVW A;  2Z4R A;  1ZAE A;  3TTK A;  2Y21 A;  2UUB M;  4JXI A;  2FYI A;  4HXV A;  1PJS A;  3HHZ A;  2ALU A;  3GBB A;  4FW9 A;  2FNA A;  2GFE A;  2XSZ D;  1MQJ A;  1LAH E;  1T6O A;  4DUY M;  1UIU A;  5EP1 A;  4QHT A;  4ITQ A;  4OVZ B;  5ITU A;  1E9R A;  4F1U A;  1R2Y A;  5GKN A;  3LBS A;  3H3G A;  5IZ1 A;  4GMQ A;  4MFI A;  4QF9 A;  4HE0 A;  3TZA A;  2RC8 A;  1D0L A;  3VXC A;  1B2H A;  3S9M C;  4R6Y A;  2YFQ A;  2WZJ A;  4DXB A;  3LW5 F;  3K6W A;  4YU0 A;  1SQY A;  1MXU A;  1I6Q A;  2XH9 A;  2A5S A;  3ILT B;  3F92 A;  5KCJ A;  2IEE A;  4CIS A;  2WSC F;  3SEX A;  1UTB B;  1H43 A;  1PGY A;  1FPB A;  1IXG A;  1OVT A;  3GLI B;  2ABH A;  1B7U A;  4KD5 A;  2OLB A;  3LSL A;  4G68 A;  4DR1 M;  2MJ5 B;  4YMB A;  5DVF A;  4NSR A;  1BVS A;  5B7D A;  1G41 A;  4DR6 M;  4AG5 A;  2LVP C;  1R9Q A;  3KG2 A;  2KHH A;  3TPZ A;  3LVV A;  1DTZ A;  2XLJ A;  4RNA A;  2D7E A;  1GL6 A;  3FV1 A;  2DHY A;  1LV7 A;  3UP9 A;  3SHG B;  4MH0 E;  2V3T A;  1MDQ A;  3RT8 A;  1NHG C;  4YKJ A;  3S9N C;  3GLG A;  4GC5 A;  3FTC A;  4OQO A;  4MBP A;  2VPO A;  3E9X A;  1SYH A;  2I4C A;  4RYA A;  1QW0 A;  5CMC A;  3QUF A;  3GP1 A;  1LCT A;  3Q8X A;  2YR0 A;  3O6G A;  1NJG A;  3K9P A;  2H99 A;  3CFL A;  2DQV A;  4N91 A;  1LBB A;  2FFJ A;  1DGG A;  1Y8G A;  5I57 A;  4IGR A;  1L2D A;  3FUX A;  4KOD A;  3W9W A;  4U4X A;  3U93 A;  3I4V A;  5I2N B;  3LQR A;  3FVN A;  3I04 M;  3A46 A;  3ONM A;  4TLM B;  3IK6 B;  2F6P A;  4F31 B;  2Q74 A;  1FW0 A;  2VPN A;  1B5I A;  1MQD A;  2XX8 A;  4IR8 A;  2AHM A;  1LB9 A;  2DWJ A;  1NJF A;  3U94 A;  5E26 A;  3RUM A;  2CMO A;  3T93 B;  1LBZ A;  3T38 A;  1FTO A;  3A3U A;  1ZLQ A;  4ESX A;  4ANR A;  3KN3 A;  3DP8 A;  5FTK A;  4IBC A;  4JBZ A;  2QS3 A;  5E6J A;  4R73 A;  4G4Q A;  4I1D A;  3FAS A;  2EUC A;  3FRH A;  3B50 A;  3M3L A;  2YPN A;  4XFE A;  3H6V A;  1W5S A;  1HNW M;  3D1R A;  2LWX A;  3K92 A;  4P11 A;  3LQQ A;  5KPT A;  4IO7 A;  3EIH A;  3DP6 A;  4OET A;  4FJP A;  1NV4 A;  3DP4 A;  3GLH B;  1ZIU A;  4PE5 B;  1YLA A;  4M0W A;  1XI6 A;  1Y3P A;  3SAR A;  5JEI A;  1N36 M;  1K3W A;  2QEN A;  1ZBM A;  1B7Z A;  5IZ3 A;  3N5L A;  1HR0 M;  4E0W A;  2I3W A;  1MQH A;  2O69 A;  4G8N A;  4EUO A;  2ZNS A;  2R9J A;  4LJ9 A;  1L1Z A;  3VVD A;  1O63 A;  4OER A;  1KFV A;  4B7F A;  5LOM A;  4XGI A;  1IN5 A;  4FOR A;  2V93 A;  3R7X A;  4EQ9 A;  5CBS A;  1IY1 A;  2ERC A;  1A55 A;  3IAZ A;  4GRI A;  3MW0 A;  5C18 A;  3IX1 A;  4XF5 A;  4EXK A;  2CV0 A;  3FYD A;  1JVX A;  4OFL A;  1RDZ A;  5DFL A;  3WAE A;  4BLA A;  1IXS A;  3B6T A;  3R26 A;  3CSB A;  1FQA A;  5EHS A;  1GV8 A;  4HTG A;  3R8F A;  4P8B A;  2DP8 A;  4GEW A;  2P5T A;  2K6B A;  3PPO A;  1WR1 B;  4P17 A;  4QXD A;  3SC3 A;  4MX6 A;  4L4U A;  1B46 A;  1SXJ B;  3M0E A;  3GO8 A;  3U6D A;  4LF9 M;  4NSO B;  1FBE A;  3PD9 A;  2DVW B;  3OEN A;  2QMW A;  4MMP A;  3SFZ A;  1BLF A;  1NUZ A;  2MGW A;  2R46 A;  5ITT A;  3QIM A;  1MS7 A;  3EPE A;  1A5T A;  1B3E A;  3K4U A;  4Q5T A;  2EA0 A;  1QKB A;  2OO9 A;  5H8S A;  4L17 A;  3RYD A;  3KP1 E;  3U61 A;  4DI3 D;  1MG1 A;  2NWJ A;  2QPA A;  4AI6 A;  3TCH A;  3EHT A;  4PAI A;  4IY5 A;  1G0H A;  3ZKL A;  2DAE A;  1TT1 A;  3ROJ A;  4IJE A;  4P56 A;  3RTF B;  3THI A;  1VDD A;  3IO4 A;  5EP4 A;  2M5Z A;  2LVQ D;  5KDT B;  1FPE A;  3CF2 A;  1POY 1;  1A8E A;  4KR5 A;  4B7G A;  1ZKB A;  1JET A;  2ONR A;  3LR1 A;  2WSF F;  5AA4 B;  3IOW A;  4OEU A;  3TTR A;  4RKU F;  1TGU A;  1PM5 A;  1FBG A;  4FWD A;  3AJI B;  3KBZ A;  5LMU M;  2QSF X;  3UGJ A;  3MUQ A;  4R9G A;  2Y7R A;  3R6U A;  1K3X A;  3ZH9 B;  3FJ7 A;  4KT0 F;  4R9F A;  4MNP A;  3CHG A;  2RC9 A;  5IT9 S;  4O3A A;  1QUS A;  4X9T A;  1GVC A;  4I8O A;  4QNM A;  1MXZ A;  3HHY A;  2GRV A;  1QZM A;  4F29 A;  2KNA A;  1JR3 A;  4GHA A;  1NV3 A;  4NF0 A;  3KOS A;  5TPA B;  3U6P A;  2PX1 A;  5LTC A;  3CSG A;  4X48 A;  2CZI A;  3LUZ A;  4P3L A;  5H8F B;  4I5S A;  3QAU A;  1FTA A;  2VP1 A;  1OQY A;  4PFY A;  2F4V M;  1P1U A;  1DGH A;  4YIC A;  4CHT B;  2F5N A;  1I4W A;  2MH8 A;  3DOA A;  1JQJ C;  1XNR M;  3KSJ A;  3TDJ A;  3TPA A;  2OJT A;  5FTJ A;  1NNT A;  2X7P A;  3A42 A;  3QYB A;  4Y28 F;  1FJ9 A;  1IXC A;  3IJX B;  4ZEB A;  1XNQ M;  4PT5 A;  3CF6 E;  1INP A;  1LAF E;  3ZSF A;  4O94 A;  2X26 A;  3HV1 A;  1N76 A;  3G3I A;  1NMU A;  5ITQ A;  1QVR A;  1LFI A;  4NGU A;  5DEX A;  1B5J A;  5ITX E;  1N32 M;  4LJ7 A;  5CMB A;  2L09 A;  2ZM6 M;  4XK8 F;  4AQ4 A;  5AE4 A;  1FRP A;  2CZH A;  3OO7 A;  4Q30 B;  4I8C A;  4GX3 A;  1NV8 A;  2AL4 A;  3B6Q A;  1IZ1 A;  2X49 A;  4U23 A;  3D4G A;  4FE8 A;  1DSN A;  4ZE9 A;  2CV2 A;  3I3V A;  2QRY A;  5I59 B;  4IBB A;  1FPG A;  1R9L A;  1ZQ9 A;  2KZU A;  2KW0 A;  4MGK E;  1OIP A;  4ND9 A;  4RF0 A;  2CZK A;  2WBD A;  2DHR A;  1F9B A;  3T9X B;  1IMA A;  5LDZ A;  2Q2C A;  4PAK A;  5H37 D;  1VEJ A;  1WJ7 A;  5M2V A;  1IEJ A;  4ZEF A;  1XC8 A;  5AA2 B;  2CHG A;  3U6O A;  1QZE A;  5I7I A;  4XTC Q;  1USY H;  1G0I A;  3GYY A;  3LMM A;  3TEP A;  3Q29 A;  1K9Y A;  4GOT A;  2HQ0 A;  2XWO A;  4C1U A;  2LH0 A;  5F3W A;  2AIX A;  2H98 A;  3H4J A;  3UK6 A;  2THI A;  2DXR A;  3B8B A;  3TWK A;  2F6G A;  1ANF A;  3OSR A;  1PJT A;  4R7G A;  5BUU A;  4QHS A;  1R6B X;  4F19 A;  3KJ7 A;  4KHZ E;  5FTI A;  2QS4 A;  4LGY A;  2DNA A;  4IO5 A;  3NBI A;  2OZZ A;  3TMG A;  1QUK A;  4QFL A;  1UFZ A;  4YAH X;  1NNF A;  1HNZ M;  1D9V A;  3EHS A;  1D2N A;  1RKM A;  2ZZV A;  3SEV A;  3L6H A;  2OPF A;  1LFH A;  1GO5 A;  1NV0 A;  3VDP A;  5IRE B;  1LBX A;  3U6Q A;  1LAG E;  1SW2 A;  3RNN A;  1ZMV A;  1USY E;  3VVF A;  1OQH A;  3W15 C;  2BWE A;  2ZAM A;  2I58 A;  4ELR A;  2I0B A;  4DV2 M;  3HJ8 A;  2KA6 B;  4H0W A;  4MHF A;  4QHQ A;  4Z0I A;  1T0K A;  2NQ8 C;  3PPQ A;  1YPN A;  4TOZ A;  4F22 A;  1EH3 A;  3VXB A;  4ELP A;  1ZTY A;  4MGY E;  1ZMU A;  8CAT A;  4JN6 A;  1N33 M;  2VHA A;  2C96 A;  4JI8 M;  4PC9 A;  3N26 A;  4PP0 A;  5EXP A;  1WXQ A;  1QAQ A;  1Q3B A;  2XFT A;  3H06 B;  2QBY A;  4LN5 A;  1R6Z A;  4QRZ A;  2QS1 A;  3GLI A;  4LFC M;  1IXZ A;  4AS4 A;  1JW5 A;  1LCF A;  4KO8 A;  1ZJL A;  2BJI A;  5I58 B;  3K01 A;  4WUR A;  5BWJ A;  3W68 A;  3UN6 A;  4S12 A;  2O25 A;  1D3K A;  4O8M A;  3L25 A;  3QMF A;  2Q8M A;  3GPY A;  2N35 A;  2YJP A;  4GIZ A;  1OFH A;  3T9H B;  5JI3 E;  4F2Q A;  3AXF A;  2ZNT A;  3WAF A;  3KJT A;  2UXC M;  2JY7 A;  4GX4 A;  1TF0 B;  3S9E A;  4LF7 M;  1S3S A;  1C7Y A;  4FIM A;  3VK7 A;  3SMP A;  1N04 A;  3KOY E;  1IMF A;  1B5H A;  5ICQ A;  3I5O A;  1GGG A;  2XXT A;  3PPR A;  2ZAO A;  4MJO A;  4N17 A;  4O3C A;  3KOT A;  4G77 A;  4XEQ A;  1YSY A;  3H03 A;  2F36 A;  2ZZX A;  2XD3 A;  4YB5 A;  1DMB A;  4X62 M;  2GNO A;  1FQD A;  3LCU A;  3VLF B;  4KCC A;  4LJ8 A;  1V34 A;  2UYF A;  3GQ5 A;  4X1B A;  2B3T A;  1UTH B;  4LJ4 A;  5I56 B;  2KRU A;  1C1K A;  3UJN A;  2DWM A;  5I2N A;  3B7N A;  1S7Y A;  4WED A;  4F2O A;  4MLQ A;  1IMB A;  3FXB A;  1P1W A;  1I6B A;  3PD8 A;  4WXJ A;  4RA1 A;  3GLG E;  1VEG A;  1J5E M;  4NWD A;  3N6U A;  2HZK A;  4EDP A;  3ZS6 A;  2XXQ A;  4GXS B;  4M4G A;  3QK6 A;  4L6V 6;  4AQY M;  2F7B A;  2BJW A;  1BKA A;  1OAO C;  2Y84 A;  4HE2 A;  2O84 X;  2R65 A;  1HQC A;  5CMK A;  1I6A A;  1RYO A;  3M7G A;  4N4U A;  2XEP A;  3KW6 A;  1IUD A;  1MPC A;  1LTM A;  3QYT A;  1QAO A;  3USD A;  5FBP A;  1MY4 A;  1B3G A;  1P1Q A;  1NUW A;  3KC1 A;  4LZ5 A;  1IY0 A;  3GLH A;  1IIT A;  4B3R M;  4IO4 A;  1ORY B;  2DS9 A;  2PMS A;  3Q26 A;  4FED A;  3I51 A;  3QAX A;  4X8R A;  1PRB A;  4F2L A;  2F3D A;  4I4L A;  2R4J A;  4QFN A;  3V76 A;  1MH3 A;  3LSF B;  3DEL B;  4DXU A;  2ZXT A;  2Z23 A;  3T22 A;  3F11 A;  4PTK A;  4MLV A;  4U1O A;  3VKG A;  2C99 A;  3Q8G A;  1L2C A;  3FVO A;  3HO7 A;  5H8N B;  2PFY A;  1NNP A;  2R0I A;  1KZ8 A;  2HZL A;  4KPT A;  2H25 A;  1SPI A;  2GHA A;  3NBX X;  3D8B A;  4YHH M;  4N8Y A;  1IY2 A;  1B7H A;  1JW1 A;  1G4A E;  1OVB A;  3U6E A;  1FBP A;  1TR8 A;  1SXJ A;  1NY5 A;  2UYE A;  4YZZ A;  5IM2 A;  1VDW A;  1I69 A;  4YY3 M;  3A98 B;  4OXV A;  2NUV A;  2VGQ A;  4LA9 A;  3DA1 A;  1N84 A;  2KDL A;  2FNC A;  2VT5 A;  1XXH B;  2I7N A;  4TUW A;  4GKJ M;  1ATG A;  5J1D A;  5KPR A;  4ZE8 A;  3MC2 A;  1SBP A;  1YAE A;  5TP9 B;  4BDQ A;  2KNV A;  5ESY A;  2FOI C;  1XB2 B;  3IHP A;  1JQF A;  3MP6 A;  5KQD A;  4GX6 A;  4Q0C A;  2R6G E;  3BBZ A;  5A5X B;  2OOB A;  2R4E A;  2X4A A;  4OES A;  4GWW A;  1N3W A;  4H65 A;  1CNQ A;  2JY6 B;  2UVJ A;  4BB9 A;  4GWX A;  4LP2 B;  2XX9 A;  1WGN A;  1WVJ A;  3M8U A;  3AKZ A;  1NFT A;  1P99 A;  2QPQ A;  1WOD A;  2QHO B;  4JVC A;  3AOG A;  3L28 A;  3G3K A;  4NWC A;  4H46 A;  2Z4S A;  2AL5 A;  2W7Y A;  3RGP A;  3IB2 A;  3AFH A;  4ZDM A;  4DCX A;  4EQ7 A;  3PUX E;  4NOO B;  3Q28 A;  1XC1 A;  3C9P A;  1QDR A;  1DPP A;  3K00 A;  1S50 A;  5JI2 E;  4OX9 M;  5AA4 A;  4JI7 M;  3TE6 A;  1LBW A;  3M3F A;  3U65 A;  3O2A A;  5EYG A;  4FWG A;  4RNS A;  2DAG A;  3PV0 E;  3HWS A;  1YE9 A;  1FBF A;  1M5F A;  1NH7 A;  3MZ9 A;  4XKN A;  4AS5 A;  3CFX A;  2DWN A;  1D9Y A;  5EP2 A;  1UIV A;  1KSF X;  2F7A A;  4A3V B;  1B4H A;  2PBW A;  4NAP A;  4RY1 A;  1EZ9 A;  3I01 M;  2HHM A;  4IJF A;  1FNN A;  3RTW B;  3RT6 B;  5FHM A;  5EXS A;  1Q35 A;  1LEV A;  2J7N A;  5EHM A;  2O01 F;  3SAU A;  4JV5 M;  2Y0T A;  5FHN A;  4M9Z A;  1DCU A;  4EF1 A;  1MXV A;  4HEO A;  4REZ A;  3U5Z A;  4JI2 M;  1Y4T A;  2E0S A;  1XHB A;  5ITO A;  4KQP A;  3HST A;  2JY8 A;  4PFB A;  1XMQ M;  2Y7K A;  1Z7M E;  4IO6 A;  4NF4 B;  5DNY A;  1GL7 A;  1GVN A;  2QZ4 A;  5EP3 A;  3FTE A;  1XT8 A;  2FIE A;  2PFZ A;  1LB8 A;  1YXI A;  4XKR A;  2FE8 A;  5I5P A;  4MAG A;  2F5O A;  4JI1 M;  2DI0 A;  1MXW A;  1ELJ A;  1EIJ A;  2RGO A;  2KRK A;  3KFU G;  2NVU B;  2FA7 A;  2R62 A;  4FAT A;  3GBA A;  4IBK A;  1NH8 A;  2L5V A;  1R2Z A;  3A3C A;  3B9P A;  2JA2 A;  4OA4 A;  3ILK A;  2R6F A;  1JR3 E;  2RF1 A;  3OSQ A;  3W67 A;  3CIJ A;  4YB7 A;  2FH0 A;  5DTB A;  4I81 A;  4LY6 A;  1ZMG A;  3MVY A;  2CEY A;  3IG5 A;  2PCR A;  4KYS A;  3UK4 A;  3QSL A;  4GWZ A;  3FUT A;  3C35 A;  1JEV A;  3VK8 A;  3AV0 A;  4NRW A;  4JI6 M;  2HCB A;  2H5Y A;  3MJN A;  2DE3 A;  4LCB A;  4JXJ A;  3IR1 A;  5I59 A;  3H6W A;  3M3K A;  3OEL A;  1TH4 A;  4U2R A;  2MRO B;  5ICT A;  3KEI A;  4ZED A;  1IQP A;  3PUY E;  4F1I A;  4M9S A;  2GQ1 A;  2E5L M;  2QMX A;  4IY6 A;  5H8H B;  1Q39 A;  3GRU A;  3KS4 A;  2B3F A;  2JP7 A;  5EXT A;  2XXV A;  4JYA M;  5IGA A;  4DI4 B;  3TAJ A;  2XXP A;  1FPD A;  3RGY A;  3V89 B;  3U6L A;  4F3S A;  3VE1 B;  5AA2 A;  2LXE A;  3RQT A;  3CR9 A;  3HFU A;  4P16 A;  2WYP A;  3FUZ A;  1PC3 A;  3SZP A;  4ZPX A;  4BBA A;  4NF6 A;  5I2K B;  2OX3 A;  1B4Z A;  4N13 A;  3N94 A;  1L1T A;  2CFO A;  3RE8 A;  3IJO B;  3QXM A;  1H6U A;  4LUB A;  2A5T A;  1TH2 A;  2LBC A;  1B1H A;  2CEX A;  2G5G X;  2DXY A;  4AG6 A;  3UIF A;  4N15 A;  4LJ5 A;  4PFW A;  3FYC A;  3L2A A;  2QP9 X;  2Y5K A;  3UZU A;  2QQ8 A;  4BDR A;  3DLN A;  4LGM A;  1GLN A;  3RFW A;  4MCO A;  4XIG Q;  1D9Q A;  2O7I A;  3OO6 A;  5EQ8 A;  1QUJ A;  1VFE A;  4ISU A;  4DDD A;  3BXW A;  3ZC7 B;  3T66 A;  4BDL A;  1TFD A;  3PPP A;  4ONY A;  2Y7I A;  4RF1 A;  3S4U A;  2B4M A;  4POW A;  1AH5 A;  3MPK A;  2VD2 A;  1PJJ A;  4N6D A;  4MIJ A;  3SAV A;  1QVS A;  4P1E A;  1QKA A;  4GWS A;  5HBC A;  2UU9 M;  3HX3 A;  1IN8 A;  3E21 A;  1DV0 A;  4N6P A;  1GKI A;  3CG3 A;  4BDM A;  1NV2 A;  1CE2 A;  1IIW A;  4B3T M;  1FCK A;  3Q27 A;  3FXU A;  3PUV E;  1MPB A;  4NX1 A;  3W9V A;  3U6S A;  2F5X A;  1OKS A;  5I58 A;  2VDB B;  1TTE A;  2V84 A;  5L9S A;  2UVG A;  1FPF A;  3KN8 A;  3JYR A;  1Y3N A;  2F3B A;  4GRK A;  4PF8 A;  3GLF B;  4QSE A;  1VSO A;  1M5C A;  4FD2 A;  1B40 A;  4M0D A;  1E9S A;  2V6Z M;  1LST A;  1QYR A;  4RXL A;  4MNC A;  1CB6 A;  4EXL A;  3AOE C;  1PB9 A;  3J80 S;  1N7X A;  2M8C A;  5CBR A;  2ZYK A;  4ESW A;  3GLI E;  4N8G A;  1B05 A;  1DO0 A;  3GRV A;  5H8Q A;  1FBD A;  1R7R A;  1A54 A;  2O1M A;  3PGF A;  4LRS A;  4DXC A;  4G4O A;  2H5X A;  1LBY A;  4JSO A;  3R9X B;  1L5T A;  1SG9 A;  1VR5 A;  1MU5 A;  1QDT A;  4NQ8 A;  3GQ3 A;  4U21 A;  3KXE C;  1UTH A;  5F1Q A;  4G3O A;  2UUA M;  3E13 X;  4QOZ C;  4PDG A;  1NO1 A;  3QWL A;  4H6D A;  4NTL A;  3MZB A;  4PQJ A;  3HHF A;  2VOZ A;  2NOO A;  3HHW A;  2I0C A;  1N78 A;  4JVI A;  2CV1 A;  2DAK A;  5A5L A;  3HKP A;  3OMB A;  1CUK A;  3CFZ A;  3KN7 A;  1JR3 D;  2OWT A;  1FPL A;  3PXG A;  3U92 A;  2WSE F;  2VD3 A;  4H1X A;  4O7M A;  1YYZ A;  4R72 A;  4H5G A;  5KZT A;  2APL A;  1SD3 A;  3SAW A;  5EQA A;  2Z8E A;  3GPU A;  2F97 A;  2KNZ A;  3MPL A;  4AB6 A;  2PT2 A;  2DAI A;  1Y3Q A;  1GAB A;  1B58 A;  1G59 A;  3KGC A;  3FVG A;  4MGI E;  4YKI A;  3BFU A;  3C4M A;  3TEL A;  4OVS A;  4MGZ E;  5ET5 A;  1E94 E;  3KFM A;  4QFP A;  4Q7J A;  5ITY A;  3MP8 A;  2L6O A;  3IOT A;  4JDF A;  1L8Q A;  2XGN A;  2QL3 A;  4JI3 M;  2EKK A;  2Z3X A;  4NF5 B;  1M5E A;  1G8P A;  4LF8 M;  1WDN A;  2XFS A;  5IZ3 B;  1MH4 A;  2CEA A;  1I94 M;  1P1N A;  3MK6 A;  2LVO C;  3TFL A;  1IBK M;  3CG1 A;  4YKK A;  1K82 A;  4W5W A;  1FQC A;  3UA8 A;  4NF8 B;  1OAI A;  2DKL A;  5ITR A;  3IOR A;  1IN4 A;  4KI0 E;  3OO9 A;  2HXW A;  1K9Z A;  3LVW A;  1PBQ A;  5H8N A;  2HAV A;  2H9B A;  3CGW A;  2Y20 A;  1N3X A;  1VEK A;  2BNK A;  1MQG A;  3U72 A;  4OU7 A;  3FJG A;  4JI5 M;  3FKE A;  4PDH A;  5ET8 A;  3GLH E;  3T6P A;  2DXI A;  2QJE A;  3MMP A;  3A29 A;  3E3K A;  2Y7W A;  4OFJ A;  4H8J A;  2G8L A;  2XXY A;  1VE4 A;  3CTW B;  1B6H A;  2XWV A;  3G7W A;  3VLU A;  4OVZ A;  4PFU A;  1XXH A;  4IBD A;  3GPP A;  3WHL A;  5JK4 A;  3VFD A;  2O1L A;  4Z8X A;  1B3L A;  2Y0Q A;  3U61 B;  5TP9 A;  2HWJ A;  4IO3 A;  3OO8 A;  2QS2 A;  3QUJ A;  5AA1 A;  2KXE A;  1FJG M;  4G4N A;  2XXH A;  2DE2 A;  1UTB A;  1J09 A;  1FBC A;  1MY3 A;  1MY0 A;  2R18 A;  4PBH A;  3SEW A;  1EE8 A;  1IFY A;  4BDO A;  5LMN M;  4MF3 A;  1SXJ E;  4GL8 A;  1PB8 A;  4R74 A;  1HJP A;  1BK4 A;  4ZZE A;  2ANJ A;  1AUA A;  2QCU A;  1Y9U A;  4FEC A;  3SYK A;  3O9P A;  3L29 A;  3QYE A;  3TYH A;  2CZL A;  2Y5L A;  2R45 A;  2C98 A;  4IIW A;  4Z6Y A;  3U6C A;  2J7O A;  3C58 A;  5L9M A;  1MY2 A;  1Y1M A;  1R5L A;  3RGS A;  2DSF A;  3K02 A;  3C32 A;  3EHU A;  2WX9 A;  1MX0 A;  3K8Z A;  1NV5 A;  3FXR A;  2Q8J A;  4FCV A;  4DUZ M;  4KFQ A;  1EZP A;  1KA1 A;  3K9O A;  4GIP A;  3D8L A;  2XXU A;  1EFU B;  1Q02 A;  3J7B A;  1H44 A;  2PT1 A;  4QNR A;  2YQZ A;  4GLI A;  4NF4 A;  3G3H A;  3MYU A;  4DZ1 A;  3FVK A;  3PFI A;  3L6G A;  4WP2 A;  3V8X B;  3C31 A;  1MRP A;  5CRY A;  1FJ6 A;  1MPD A;  4F18 A;  2I7P A;  4GBV A;  1FQB A;  1EU8 A;  3NOH A;  3KZG A;  3GXA A;  4KYD A;  3LCV B;  1T43 A;  4KXP A;  1OFI A;  4DV0 M;  3VDF A;  3PPN A;  5HPQ A;  3U1O A;  4P1L A;  4O7I A;  5J16 A;  3K6V A;  4XXU A;  2ZTC A;  3VVE A;  4R71 A;  1QAM A;  1LBC A;  4F3G A;  5A2Q S;  1IXH A;  1V92 A;  1H76 A;  2XXI A;  4D82 A;  4X64 M;  2XXR A;  4PFI A;  4MB7 A;  1MDP 1;  1IMC A;  3HU2 A;  3U8Q A;  3OXN A;  1TFA A;  4NHB A;  4LRT A;  1DGB A;  2JWS A;  1B9J A;  2JNH A;  3RPL B;  2LNH C;  1B32 A;  3JAM S;  1XVX A;  3J7A S;  2EJS A;  4PGP A;  3VDU A;  2Y7P A;  4OVR A;  5FHO A;  1PB7 A;  2GQF A;  3UMM A;  1NNU C;  1W5T A;  1Z7N E;  2F34 A;  2IA4 A;  4DE8 A;  4NG7 A;  3UOR A;  2RIN A;  1V33 A;  1DOT A;  3MST A;  1P3Q Q;  3I4Y A;  4FVM A;  4QOS A;  2KEB A;  4YMA A;  4ZEC A;  4GWO A;  1PEB A;  3FXQ A;  4NMY A;  4C0R A;  4NN3 A;  5H8H A;  2F8D A;  4TLL B;  1Z5B A;  2BWB A;  4X65 M;  4G61 A;  3KOX E;  2X7Q A;  3K1N A;  5CI5 A;  2VQE M;  1J7K A;  3IFC A;  3K1P A;  2ESN A;  4DV7 M;  3FRI A;  4G68 C;  3IB1 A;  3FBP A;  3NWL A;  2Q9T A;  2QVV A;  3CI8 A;  3ZQJ A;  2ZAN A;  3E79 A;  1URG A;  3FGS A;  5I2K A;  4CJ6 A;  2LVN C;  4PDI A;  4DR4 M;  4DLD A;  3HZJ A;  2RC7 A;  4U22 A;  4B08 A;  1IME A;  2OOA A;  3EKI A;  4D81 A;  2V1U A;  4DR7 M;  2MR9 A;  4EIW A;  1EYJ A;  4OMB A;  3KBR A;  1NV9 A;  3DFZ A;  1AWB A;  4P0I A;  4LF4 M;  5JTY B;  3FTF A;  1JVY A;  1PBP A;  4LZ8 A;  4OYV A;  1IM2 A;  1DPE A;  3FD3 A;  3C3E A;  1IBM M;  1RYX A;  4U1Z A; 
#chains in the Genus database with same CATH homology
 2V25 A;  3VKH A;  4GL0 A;  4R6H A;  3HJQ A;  4WW0 A;  1NNK A;  1O64 A;  1SW5 A;  2C9O A;  2O68 A;  3EF7 A;  1A40 A;  1IN6 A;  3TWL A;  4HLQ A;  1GR2 A;  1BP5 A;  4THI A;  5HM4 B;  1SI1 A;  4HS7 A;  4LJA A;  3PUZ E;  4LJ6 A;  1POT A;  4JB7 A;  1NSF A;  2I6E A;  3W0F A;  5KDT A;  1SXJ D;  4X66 M;  1EZO A;  4DR2 M;  2R71 A;  3L26 A;  2QBY B;  1FTK A;  4LON B;  2D3I A;  1SDX A;  1NKX A;  3H4Z A;  4LQ5 A;  3JZJ A;  5KPZ A;  4JWO A;  4DR3 M;  1IQ7 A;  1O7T A;  1H3D A;  3AL0 C;  4IO2 A;  5AA3 A;  1US4 A;  1FTL A;  3OD7 A;  3ECR A;  5FLX S;  1OLC A;  3GLF A;  3HGI A;  3RN8 A;  1DTG A;  2REG A;  1Z6T A;  2XF3 A;  1LFG A;  3H4M A;  5FTH A;  1D4N A;  4H8I A;  3T15 A;  4JI4 M;  4G6Z A;  1OQG A;  5TPA A;  2F5Q A;  3MVX A;  4NXN M;  2DZO B;  4NXM M;  4Z7E A;  5DVJ A;  2P0S A;  2GH9 A;  4R75 A;  5H8F A;  1HQY E;  4RK9 A;  1N75 A;  3IOV A;  3Q25 A;  3N6T A;  3K1J A;  2DWH A;  1TWY A;  3TQS A;  1YCJ A;  1S9T A;  2V1C A;  1YUB A;  3FV2 A;  2I3V A;  2Z22 A;  4XKP A;  5L9O A;  1FQE A;  5B70 A;  4QSC A;  2BJJ X;  1BTJ A;  1M5D A;  3PUW E;  4ZS9 A;  3IO6 A;  2DWZ B;  1URS A;  1NL5 A;  3IL1 B;  1Z59 A;  1Q1K A;  1DO2 A;  2D5W A;  4OWD A;  4MH5 A;  3U60 B;  2L7I A;  3GRR A;  5EQT A;  1B0H A;  4GF8 A;  2O51 A;  3FJM A;  3T9U A;  1B3H A;  3T1Y M;  5FTM A;  1N7W A;  2Q2A A;  1TDZ A;  1FTJ A;  4WEP A;  1L2B A;  2ONS A;  1QQW A;  4IBJ A;  3TQL A;  5DT6 A;  3FUV A;  5EXX A;  4OFO A;  4GVO A;  3H7M A;  4CGY B;  3SYL A;  4B7H A;  1HNX M;  4RPO A;  2OK2 A;  4G8H A;  4R2B A;  3LC8 A;  3JR5 A;  3K2D A;  3RPW A;  3W0L B;  3ILU B;  4OW0 A;  3U6M A;  1N0T A;  3TL4 X;  2VQF M;  3EIE A;  4LZ7 A;  1IN7 A;  4HL4 A;  3ODB A;  4NF5 A;  1JW4 A;  4DV6 M;  2DYX A;  3S2V A;  4EF2 A;  2L7H A;  4LZJ A;  1BIY A;  3OTO M;  4G4P A;  4OEV A;  3RY3 A;  1SW1 A;  3SBJ A;  1B51 A;  4PET A;  4B3S M;  4NF8 A;  3P7I A;  5KO3 A;  2CUZ A;  3K0V A;  2O5R A;  3SDF A;  2ZYO A;  1HSE A;  3VV5 A;  1VFD A;  1N34 M;  4LFB M;  1Y1Z A;  2I48 A;  2Q89 A;  2A5Y B;  2LAO A;  2CE7 A;  3L27 A;  3IB0 A;  3MZ1 A;  3O29 A;  3O6H A;  2B65 A;  5TU0 A;  4L78 A;  4R2F A;  4Q8R A;  3BKI B;  4GXA A;  3OEK A;  3PU5 A;  3MWB A;  4KYE A;  5FTL A;  3HHG A;  5AA2 D;  3O28 A;  4ZEK A;  4PFT A;  1IXR C;  2ZYM A;  4E0X A;  3HU3 A;  1NNJ A;  3LSX A;  5ITP A;  2UXA A;  2CHV A;  3K6U A;  1XVY A;  3HHX A;  3MVW A;  3FUU A;  4ZZA A;  1P1O A;  5IZ7 D;  2RGH A;  2XZF A;  4POX A;  4MGH A;  2DZN B;  1JEU A;  2AYS A;  5K2Y A;  5KCJ B;  3THG A;  4HW8 A;  2YLN A;  3J2P B;  3MBP A;  4LZZ A;  4EQB A;  1QJM A;  1A8F A;  1SI0 A;  4G8M A;  4IB2 A;  4G68 B;  2RKO A;  1Y20 A;  1IBL M;  2HL7 A;  3PNV A;  4KLN A;  4DV1 M;  4F1Y A;  3BOS A;  4BLC A;  4JI0 M;  3FUW A;  5IKB A;  5L8D A;  2OBG A;  3E4R A;  3SAT A;  4LF5 M;  4XBO A;  5EYF A;  4GC9 A;  3O66 A;  5BR8 M;  3TTL A;  2G29 A;  3G3G A;  2WKY A;  5CC2 A;  3GLG B;  4M1V A;  1H45 A;  1PJI A;  4GH9 A;  1IXI A;  5ISU A;  1XHY A;  2DVC A;  3MAM A;  1MM7 A;  3SHF A;  4KCD A;  3KOZ E;  3HN0 A;  3FAT A;  3FIR A;  3C34 A;  2Q2E B;  1MXX A;  2ZBK B;  4P0G A;  3SEU A;  3H6T A;  4R3D A;  2DWA A;  2D7G A;  4GKK M;  3U5Z B;  5I57 B;  4XKQ A;  4R6K A;  1B1X A;  3O97 A;  4TQU Q;  3KDS E;  2I49 A;  3SEY A;  3BBR A;  5DYH A;  4H5F A;  5I56 A;  1OLA A;  1J1N A;  3V5A A;  3K6X A;  4NE4 A;  2XZU A;  1TDH A;  3TWM A;  1A99 A;  2D21 A;  2HAU A;  4RPN A;  4AKH A;  4UA8 A;  3CVG A;  3DZD A;  4F1V A;  4IBE A;  3TUS A;  4PCZ A;  3D4C A;  1TH3 A;  4II7 A;  1Y4C A;  3LUY A;  1T3T A;  2KLF A;  4LVQ A;  5CMM A;  4DV5 M;  4AW4 A;  2I4B A;  4B3M M;  3S9L C;  4ECF A;  3V83 A;  5IAI A;  1MQI A;  2DWL A;  5DYG A;  1B0L A;  3C9H A;  2ZMB A;  1N77 A;  1OMP A;  1G3I A;  1Q3C A;  3OEM A;  1SVX B;  2Z8D A;  4JSD A;  3E9S A;  2DOJ A;  3SER A;  4FAJ A;  3AOE A;  4FWH A;  3I6V A;  3KS8 A;  3TTM A;  1XMO M;  2Q88 A;  4DCY A;  2XXW A;  3B7D A;  3FTD A;  1OIB A;  3HCQ A;  4GD5 A;  2RKM A;  4K3F A;  1MM6 A;  2KZS A;  2UXB M;  2O7U A;  2HKJ A;  2K47 A;  2PYY A;  3UGW A;  4GFR A;  2XD2 A;  5K2X A;  2ZYN A;  4I62 A;  3PVS A;  4FEB A;  2Z7J A;  1FTM A;  3J81 S;  1SYI A;  1YTV A;  1IXS B;  4L15 A;  5DYI A;  3ZKK A;  4AKI A;  4FCT A;  4LG2 A;  2YNM D;  2Z8F A;  1X37 A;  4AZF A;  1AMF A;  3BFT A;  4FCW A;  1B52 A;  1UQW A;  3EN3 A;  4C1T A;  3MHV C;  3GQ4 A;  4NF6 B;  2E1S A;  1AOV A;  3LSW A;  2F35 A;  4OHN A;  4N07 A;  3HJS A;  2UUC M;  2ONK E;  4QFK A;  4DV3 M;  2NXO A;  4DIG A;  2A5T B;  2VII A;  4ELO A;  1HT2 E;  1QUL A;  3K2L A;  4U4S A;  4KHP M;  3TKD A;  1NY6 A;  4WKM A;  2ZNU A;  4NL4 H;  4LQ2 A;  3MJ5 A;  3KSX A;  5A5X A;  3SES A;  1M5B A;  2DWI A;  5KQ8 A;  1GTK A;  4UAC A;  4GQO A;  4OTE A;  3SET A;  1MXY A;  3KP0 E;  1LGB C;  4PD2 A;  1FQF A;  4D80 A;  3OOA A;  2W82 A;  4JWY A;  2OCU A;  4AB5 A;  1LAX A;  4G2Z A;  2C9C A;  5F7V A;  3IOU A;  1DGF A;  2B3B A;  1II5 A;  3MQ9 A;  4MM3 B;  2OQ4 A;  4F39 A;  2EO2 A;  2F5P A;  2H1R A;  5FSW A;  4L16 A;  1LLS A;  3B6W A;  1TXF A;  3TOD A;  4IBF A;  4AKG A;  1URD A;  4JWX A;  2P1S A;  2QSX A;  4RK2 A;  1AL3 A;  5EJC A;  3H6U A;  3TQW A;  3SMS A;  4IBI A;  4ELQ A;  1Z5C A;  1HSL A;  1QUI A;  1R1N A;  3HU1 A;  4K0K M;  2PVU A;  4OVJ A;  4LF6 M;  3ZCB B;  3T1H M;  5BPV A;  3JR4 A;  4G4R A;  4I9D A;  2GHB A;  5FTN A;  3K1M A;  2XHD A;  1B3F A;  4YB6 A;  3JV9 A;  5I84 A;  5ITX A;  4O3B A;  3PMV A;  2BJV A;  3M6A A;  1ZU0 A;  5IWA M;  5H8Q B;  4BDN A;  3CRB A;  1DGH B;  4NED A;  3TTN A;  3RLF E;  1KWH A;  3A09 A;  4ZEI A;  1SW4 A;  3T9V A;  3G3F A;  3VLW A;  2O6A A;  2XX7 A;  5CM6 A;  4F3P A;  2XXX A;  4IBG A;  1OJL A;  2P2A A;  3KOW E;  2DVZ A;  1NHW C;  4OEN A;  2DE4 A;  2M60 A;  4IGT A;  3MP1 A;  1US5 A;  4QSD A;  2REJ A;  1HSJ A;  3WHK A;  2RCA A;  1PDA A;  1MY1 A;  3MVZ A;  3VFJ A;  4DR5 M;  3U60 A;  2F7C A;  5DEX B;  2CHQ A;  4HCY A;  3T96 B;  1XOC A;  1SXJ C;  5DVI A;  7CAT A;  4X1D A;  1JNF A;  3GPX A;  4LAT A;  2HCA A;  1HT1 E;  3TCF A;  1Z5A A;  2UVI A;  3GLB A;  1KYI A;  4H67 A;  2X8A A;  4RJZ A;  3CF0 A;  4L8R C;  1XS5 A;  4OZ9 A;  3SAS A;  3SKP A;  2H4I A;  2V3U A;  4HCW A;  4GIT A;  2HHH M;  2V3Q A;  5JTY A;  3DM0 A;  2XSZ A;  3IG8 A;  2G93 A;  1A7L A;  3FD9 A;  3C36 A;  3O6I A;  4YKP A;  4GHL A;  3C33 A;  1XWI A;  1E32 A;  1NVM A;  3FZV A;  4QFO A;  2F78 A;  4DV4 M;  3GRY A;  4LFA M;  3EQ1 A;  5ELV A;  5C1B A;  3VLV A;  2F5S A;  3PMW A;  4M9X A;  2C5R A;  4NRV A;  2HFB A;  2RCB A;  2UVH A;  1UM8 A;  3A45 A;  4F3B A;  3G3J A;  1QAN A;  2OWS A;  3PMX A;  2UXD M;  3GZG A;  3HPI A;  2HEU A;  1AIV A;  3PNY A;  3J27 B;  2D7H A;  3TCG A;  3KVW A;  2Z4R A;  1ZAE A;  3TTK A;  2Y21 A;  2UUB M;  4JXI A;  2FYI A;  3HHZ A;  2ALU A;  3GBB A;  4FW9 A;  2FNA A;  2GFE A;  2XSZ D;  1MQJ A;  1LAH E;  4DUY M;  1UIU A;  5EP1 A;  4QHT A;  4ITQ A;  4OVZ B;  5ITU A;  1E9R A;  4F1U A;  1R2Y A;  5GKN A;  3LBS A;  3H3G A;  4GMQ A;  4MFI A;  4QF9 A;  3TZA A;  2RC8 A;  3VXC A;  1B2H A;  3S9M C;  4R6Y A;  2YFQ A;  4DXB A;  3K6W A;  4YU0 A;  1SQY A;  1MXU A;  1I6Q A;  2XH9 A;  2A5S A;  3ILT B;  5KCJ A;  2IEE A;  4CIS A;  3SEX A;  1UTB B;  1H43 A;  1OVT A;  1IXG A;  2ABH A;  3GLI B;  4KD5 A;  1B7U A;  2OLB A;  3LSL A;  4G68 A;  4DR1 M;  4YMB A;  5DVF A;  4NSR A;  5B7D A;  1G41 A;  4DR6 M;  4AG5 A;  1R9Q A;  3KG2 A;  3TPZ A;  3LVV A;  1DTZ A;  2XLJ A;  4RNA A;  2D7E A;  1GL6 A;  3FV1 A;  1LV7 A;  3UP9 A;  3SHG B;  4MH0 E;  2V3T A;  1MDQ A;  3RT8 A;  1NHG C;  4YKJ A;  3S9N C;  3GLG A;  4GC5 A;  3FTC A;  4OQO A;  4MBP A;  3E9X A;  1SYH A;  2I4C A;  4RYA A;  1QW0 A;  5CMC A;  3QUF A;  3GP1 A;  1LCT A;  3Q8X A;  2YR0 A;  3O6G A;  1NJG A;  2H99 A;  3CFL A;  2DQV A;  1LBB A;  2FFJ A;  1DGG A;  5I57 A;  4IGR A;  1L2D A;  3FUX A;  4KOD A;  3W9W A;  4U4X A;  3U93 A;  3I4V A;  5I2N B;  3LQR A;  3FVN A;  3A46 A;  4TLM B;  3ONM A;  4F31 B;  3IK6 B;  2F6P A;  1FW0 A;  1B5I A;  1MQD A;  2XX8 A;  2AHM A;  1LB9 A;  2DWJ A;  1NJF A;  3U94 A;  5E26 A;  3RUM A;  2CMO A;  3T93 B;  3T38 A;  1FTO A;  3A3U A;  1ZLQ A;  4ESX A;  3KN3 A;  3DP8 A;  5FTK A;  4IBC A;  4JBZ A;  2QS3 A;  5E6J A;  4R73 A;  4G4Q A;  4I1D A;  3FAS A;  2EUC A;  3M3L A;  2YPN A;  3H6V A;  1W5S A;  1HNW M;  2LWX A;  3K92 A;  4P11 A;  3LQQ A;  5KPT A;  4IO7 A;  3EIH A;  3DP6 A;  4OET A;  4FJP A;  3DP4 A;  3GLH B;  1ZIU A;  4PE5 B;  4M0W A;  1Y3P A;  5JEI A;  3SAR A;  1N36 M;  1K3W A;  2QEN A;  1ZBM A;  1B7Z A;  3N5L A;  1HR0 M;  4E0W A;  2I3W A;  1MQH A;  2O69 A;  4G8N A;  4EUO A;  2ZNS A;  2R9J A;  4LJ9 A;  1L1Z A;  3VVD A;  1O63 A;  4OER A;  1KFV A;  4B7F A;  5LOM A;  4XGI A;  1IN5 A;  4FOR A;  2V93 A;  3R7X A;  4EQ9 A;  5CBS A;  1IY1 A;  2ERC A;  1A55 A;  3IAZ A;  4GRI A;  3MW0 A;  5C18 A;  3IX1 A;  4EXK A;  2CV0 A;  3FYD A;  1JVX A;  4OFL A;  3WAE A;  4BLA A;  3B6T A;  3R26 A;  3CSB A;  1FQA A;  5EHS A;  1GV8 A;  4HTG A;  3R8F A;  2DP8 A;  3PPO A;  2P5T A;  3SC3 A;  4L4U A;  1B46 A;  1SXJ B;  3M0E A;  3GO8 A;  3U6D A;  4LF9 M;  4NSO B;  3PD9 A;  2DVW B;  3OEN A;  2QMW A;  3SFZ A;  1BLF A;  2R46 A;  5ITT A;  3QIM A;  1MS7 A;  3EPE A;  1B3E A;  3K4U A;  4Q5T A;  2EA0 A;  1QKB A;  5H8S A;  4L17 A;  3KP1 E;  3U61 A;  1MG1 A;  2NWJ A;  2QPA A;  4AI6 A;  3TCH A;  3EHT A;  4IY5 A;  3ZKL A;  1TT1 A;  3RTF B;  4IJE A;  3THI A;  1VDD A;  3IO4 A;  5EP4 A;  2M5Z A;  5KDT B;  3CF2 A;  1POY 1;  1A8E A;  4KR5 A;  4B7G A;  1ZKB A;  1JET A;  2ONR A;  3LR1 A;  5AA4 B;  3IOW A;  4OEU A;  3TTR A;  1TGU A;  1PM5 A;  4FWD A;  3AJI B;  5LMU M;  3UGJ A;  3MUQ A;  4R9G A;  2Y7R A;  3R6U A;  1K3X A;  3ZH9 B;  3FJ7 A;  4R9F A;  2RC9 A;  5IT9 S;  4O3A A;  4X9T A;  1GVC A;  4I8O A;  4QNM A;  1MXZ A;  3HHY A;  2GRV A;  1QZM A;  4F29 A;  1JR3 A;  4GHA A;  3KOS A;  5TPA B;  3U6P A;  2PX1 A;  3CSG A;  4X48 A;  5H8F B;  4I5S A;  3QAU A;  2VP1 A;  4PFY A;  2F4V M;  1P1U A;  1DGH A;  4YIC A;  4CHT B;  2F5N A;  1I4W A;  3DOA A;  1JQJ C;  1XNR M;  3KSJ A;  3TDJ A;  3TPA A;  2OJT A;  5FTJ A;  1NNT A;  2X7P A;  3A42 A;  1IXC A;  3IJX B;  4ZEB A;  1XNQ M;  4PT5 A;  3CF6 E;  1LAF E;  3ZSF A;  2X26 A;  3HV1 A;  1N76 A;  3G3I A;  1NMU A;  5ITQ A;  1QVR A;  1LFI A;  5DEX A;  1B5J A;  5ITX E;  1N32 M;  4LJ7 A;  5CMB A;  2L09 A;  2ZM6 M;  4AQ4 A;  5AE4 A;  3OO7 A;  4Q30 B;  4I8C A;  2AL4 A;  3B6Q A;  1IZ1 A;  2X49 A;  4U23 A;  3D4G A;  4FE8 A;  1DSN A;  4ZE9 A;  2CV2 A;  3I3V A;  2QRY A;  5I59 B;  4IBB A;  1R9L A;  1ZQ9 A;  2KZU A;  2KW0 A;  4MGK E;  4ND9 A;  4RF0 A;  2DHR A;  1F9B A;  3T9X B;  2Q2C A;  5H37 D;  5M2V A;  1IEJ A;  4ZEF A;  1XC8 A;  5AA2 B;  2CHG A;  3U6O A;  4XTC Q;  1USY H;  3LMM A;  3TEP A;  3Q29 A;  4GOT A;  2HQ0 A;  4C1U A;  2LH0 A;  5F3W A;  2AIX A;  2H98 A;  3UK6 A;  2THI A;  2DXR A;  3TWK A;  2F6G A;  1ANF A;  3OSR A;  4R7G A;  5BUU A;  4QHS A;  1R6B X;  4F19 A;  3KJ7 A;  4KHZ E;  5FTI A;  2QS4 A;  4LGY A;  4IO5 A;  3NBI A;  2OZZ A;  3TMG A;  1QUK A;  4QFL A;  4YAH X;  1NNF A;  1HNZ M;  1D9V A;  3EHS A;  1D2N A;  1RKM A;  3SEV A;  3L6H A;  2OPF A;  1LFH A;  3VDP A;  5IRE B;  3U6Q A;  1LAG E;  1SW2 A;  3RNN A;  1USY E;  3VVF A;  1OQH A;  3W15 C;  2ZAM A;  2I58 A;  4ELR A;  2I0B A;  4DV2 M;  3HJ8 A;  2KA6 B;  4H0W A;  4QHQ A;  4Z0I A;  1T0K A;  2NQ8 C;  3PPQ A;  1YPN A;  4TOZ A;  4F22 A;  1EH3 A;  3VXB A;  4ELP A;  1ZTY A;  4MGY E;  8CAT A;  4JN6 A;  1N33 M;  2VHA A;  2C96 A;  4JI8 M;  3N26 A;  4PP0 A;  5EXP A;  1WXQ A;  1QAQ A;  1Q3B A;  2XFT A;  3H06 B;  2QBY A;  1R6Z A;  4QRZ A;  2QS1 A;  3GLI A;  4LFC M;  1IXZ A;  1JW5 A;  1LCF A;  4KO8 A;  1ZJL A;  5I58 B;  3K01 A;  4WUR A;  5BWJ A;  3UN6 A;  4S12 A;  1D3K A;  3L25 A;  3GPY A;  2YJP A;  4GIZ A;  1OFH A;  3T9H B;  5JI3 E;  4F2Q A;  3AXF A;  2ZNT A;  3WAF A;  3KJT A;  2UXC M;  3S9E A;  4LF7 M;  1S3S A;  4FIM A;  3VK7 A;  3SMP A;  1N04 A;  3KOY E;  1B5H A;  5ICQ A;  3I5O A;  1GGG A;  2XXT A;  3PPR A;  2ZAO A;  4O3C A;  3KOT A;  4G77 A;  1YSY A;  3H03 A;  2F36 A;  2XD3 A;  4YB5 A;  1DMB A;  4X62 M;  1FQD A;  3VLF B;  4KCC A;  4LJ8 A;  2UYF A;  3GQ5 A;  4X1B A;  1UTH B;  4LJ4 A;  5I56 B;  2KRU A;  1C1K A;  3UJN A;  2DWM A;  5I2N A;  1S7Y A;  4WED A;  4F2O A;  4MLQ A;  1P1W A;  1I6B A;  3PD8 A;  4WXJ A;  4RA1 A;  1J5E M;  4NWD A;  3N6U A;  2HZK A;  4EDP A;  3ZS6 A;  2XXQ A;  4GXS B;  4M4G A;  3QK6 A;  4AQY M;  2F7B A;  2BJW A;  1BKA A;  2Y84 A;  2O84 X;  2R65 A;  1HQC A;  5CMK A;  1I6A A;  1RYO A;  3M7G A;  2XEP A;  3KW6 A;  1IUD A;  1MPC A;  3QYT A;  1QAO A;  3USD A;  1MY4 A;  1B3G A;  1P1Q A;  4LZ5 A;  1IY0 A;  3GLH A;  1IIT A;  4B3R M;  4IO4 A;  1ORY B;  2DS9 A;  2PMS A;  3Q26 A;  4FED A;  3I51 A;  3QAX A;  4QFN A;  4I4L A;  2R4J A;  1MH3 A;  3LSF B;  3DEL B;  4DXU A;  2ZXT A;  2Z23 A;  3T22 A;  3F11 A;  4MLV A;  4U1O A;  3VKG A;  2C99 A;  1L2C A;  3FVO A;  3HO7 A;  5H8N B;  1NNP A;  2HZL A;  4KPT A;  2H25 A;  2GHA A;  3D8B A;  4YHH M;  1IY2 A;  1B7H A;  1JW1 A;  1G4A E;  1OVB A;  3U6E A;  2UYE A;  1SXJ A;  1NY5 A;  4YZZ A;  1I69 A;  4YY3 M;  3A98 B;  4OXV A;  2NUV A;  2VGQ A;  4LA9 A;  3DA1 A;  1N84 A;  2FNC A;  1XXH B;  2I7N A;  4TUW A;  4GKJ M;  1ATG A;  5J1D A;  5KPR A;  4ZE8 A;  3MC2 A;  1SBP A;  1YAE A;  5TP9 B;  4BDQ A;  2FOI C;  1JQF A;  3MP6 A;  5KQD A;  4Q0C A;  2R6G E;  5A5X B;  2R4E A;  2X4A A;  4OES A;  1N3W A;  4H65 A;  2UVJ A;  4BB9 A;  4LP2 B;  2XX9 A;  1WVJ A;  3M8U A;  3AKZ A;  1NFT A;  1P99 A;  2QPQ A;  1WOD A;  3AOG A;  3L28 A;  3G3K A;  4NWC A;  2Z4S A;  2AL5 A;  2W7Y A;  3RGP A;  3IB2 A;  3AFH A;  4ZDM A;  4DCX A;  4EQ7 A;  3PUX E;  4NOO B;  3Q28 A;  1XC1 A;  1DPP A;  3K00 A;  1S50 A;  5JI2 E;  4OX9 M;  5AA4 A;  4JI7 M;  3TE6 A;  3M3F A;  3O2A A;  4FWG A;  4RNS A;  3PV0 E;  3HWS A;  1YE9 A;  1M5F A;  1NH7 A;  3MZ9 A;  4XKN A;  3CFX A;  2DWN A;  1D9Y A;  5EP2 A;  1UIV A;  1KSF X;  2F7A A;  4A3V B;  1B4H A;  2PBW A;  4RY1 A;  1EZ9 A;  4IJF A;  1FNN A;  3RTW B;  3RT6 B;  5FHM A;  5EXS A;  1Q35 A;  2J7N A;  5EHM A;  3SAU A;  4JV5 M;  2Y0T A;  5FHN A;  4M9Z A;  4EF1 A;  1MXV A;  3U5Z A;  4REZ A;  4JI2 M;  1Y4T A;  2E0S A;  1XHB A;  5ITO A;  4KQP A;  3HST A;  1XMQ M;  2Y7K A;  1Z7M E;  4IO6 A;  4NF4 B;  5DNY A;  1GL7 A;  1GVN A;  2QZ4 A;  5EP3 A;  3FTE A;  1XT8 A;  1LB8 A;  4XKR A;  2FE8 A;  2F5O A;  4JI1 M;  1MXW A;  1ELJ A;  2RGO A;  2KRK A;  3KFU G;  2NVU B;  2FA7 A;  2R62 A;  4FAT A;  3GBA A;  4IBK A;  1NH8 A;  1R2Z A;  3A3C A;  3B9P A;  2JA2 A;  3ILK A;  2RF1 A;  3OSQ A;  3CIJ A;  4YB7 A;  5DTB A;  4I81 A;  4LY6 A;  1ZMG A;  3MVY A;  3IG5 A;  4KYS A;  3UK4 A;  3QSL A;  3FUT A;  3C35 A;  1JEV A;  3VK8 A;  3AV0 A;  4NRW A;  4JI6 M;  2HCB A;  2H5Y A;  3MJN A;  2DE3 A;  4LCB A;  4JXJ A;  3IR1 A;  5I59 A;  3H6W A;  3M3K A;  3OEL A;  1TH4 A;  4U2R A;  5ICT A;  3KEI A;  4ZED A;  1IQP A;  3PUY E;  4IY6 A;  4M9S A;  5JTY B;  2E5L M;  2QMX A;  5H8H B;  4BDR A;  1Q39 A;  3GRU A;  3KS4 A;  2B3F A;  2XXV A;  5EXT A;  4JYA M;  3TAJ A;  2XXP A;  3RGY A;  3V89 B;  3U6L A;  4F3S A;  3VE1 B;  5AA2 A;  2LXE A;  3RQT A;  3CR9 A;  4P16 A;  3FUZ A;  1PC3 A;  4ZPX A;  4BBA A;  4NF6 A;  5I2K B;  1B4Z A;  4N13 A;  3N94 A;  1L1T A;  2CFO A;  3RE8 A;  3IJO B;  3QXM A;  1H6U A;  4LUB A;  2A5T A;  1TH2 A;  1B1H A;  2G5G X;  2DXY A;  4AG6 A;  3UIF A;  4LJ5 A;  4PFW A;  3FYC A;  3L2A A;  2QP9 X;  3UZU A;  3DLN A;  4LGM A;  1GLN A;  3RFW A;  4XIG Q;  2O7I A;  3OO6 A;  1QUJ A;  1VFE A;  4ISU A;  4DDD A;  3ZC7 B;  3T66 A;  4BDL A;  1TFD A;  3PPP A;  4ONY A;  2Y7I A;  4RF1 A;  3S4U A;  4POW A;  1AH5 A;  3MPK A;  2VD2 A;  1PJJ A;  3SAV A;  1QVS A;  1QKA A;  5HBC A;  2UU9 M;  1IN8 A;  4N6P A;  1GKI A;  3CG3 A;  4BDM A;  1CE2 A;  1IIW A;  4B3T M;  1FCK A;  3Q27 A;  3FXU A;  3PUV E;  1MPB A;  3W9V A;  3U6S A;  2F5X A;  5I58 A;  2V84 A;  5L9S A;  2UVG A;  3KN8 A;  3JYR A;  1Y3N A;  4GRK A;  3GLF B;  4QSE A;  1VSO A;  1M5C A;  4FD2 A;  1B40 A;  4M0D A;  1E9S A;  2V6Z M;  1LST A;  1QYR A;  4RXL A;  1CB6 A;  4EXL A;  3AOE C;  1PB9 A;  3J80 S;  1N7X A;  2M8C A;  5CBR A;  2ZYK A;  4ESW A;  1B05 A;  1DO0 A;  3GRV A;  5H8Q A;  1R7R A;  1A54 A;  2O1M A;  3PGF A;  4LRS A;  4DXC A;  4G4O A;  4JSO A;  3R9X B;  1L5T A;  1VR5 A;  1MU5 A;  3GQ3 A;  4U21 A;  3KXE C;  1UTH A;  5F1Q A;  2UUA M;  3E13 X;  4QOZ C;  4PDG A;  3QWL A;  4H6D A;  4NTL A;  3MZB A;  4PQJ A;  3HHF A;  2VOZ A;  2NOO A;  3HHW A;  2I0C A;  1N78 A;  2CV1 A;  3HKP A;  3OMB A;  3CFZ A;  3KN7 A;  1JR3 D;  2OWT A;  3PXG A;  3U92 A;  4H1X A;  2VD3 A;  4R72 A;  4H5G A;  5KZT A;  1SD3 A;  3SAW A;  2Z8E A;  3GPU A;  2F97 A;  4AB6 A;  3MPL A;  2PT2 A;  1Y3Q A;  1B58 A;  1G59 A;  3KGC A;  3FVG A;  4MGI E;  4YKI A;  3BFU A;  3C4M A;  3TEL A;  4MGZ E;  1E94 E;  3KFM A;  4QFP A;  5ITY A;  3MP8 A;  2L6O A;  3IOT A;  4JDF A;  1L8Q A;  2XGN A;  2QL3 A;  4JI3 M;  2Z3X A;  4NF5 B;  1M5E A;  1G8P A;  4LF8 M;  1WDN A;  2XFS A;  1MH4 A;  2CEA A;  1I94 M;  1P1N A;  3MK6 A;  3TFL A;  1IBK M;  3CG1 A;  4YKK A;  1K82 A;  4W5W A;  1FQC A;  3UA8 A;  4NF8 B;  5ITR A;  3IOR A;  1IN4 A;  4KI0 E;  3OO9 A;  2HXW A;  3LVW A;  1PBQ A;  5H8N A;  2HAV A;  2H9B A;  2Y20 A;  1N3X A;  2BNK A;  1MQG A;  3U72 A;  4OU7 A;  3FJG A;  4JI5 M;  3FKE A;  2DXI A;  2QJE A;  3E3K A;  2Y7W A;  4OFJ A;  4H8J A;  2G8L A;  2XXY A;  1VE4 A;  3CTW B;  1B6H A;  3G7W A;  3VLU A;  4OVZ A;  4PFU A;  1XXH A;  4IBD A;  3GPP A;  3WHL A;  5JK4 A;  3VFD A;  2O1L A;  4Z8X A;  1B3L A;  2Y0Q A;  3U61 B;  5TP9 A;  4IO3 A;  3OO8 A;  2QS2 A;  3QUJ A;  5AA1 A;  2KXE A;  1FJG M;  4G4N A;  2XXH A;  2DE2 A;  1UTB A;  1J09 A;  1MY3 A;  1MY0 A;  2R18 A;  3SEW A;  1EE8 A;  4BDO A;  5LMN M;  4MF3 A;  1SXJ E;  4GL8 A;  1PB8 A;  4R74 A;  4ZZE A;  2ANJ A;  1Y9U A;  2QCU A;  4FEC A;  3SYK A;  3O9P A;  3L29 A;  3TYH A;  2CZL A;  2R45 A;  2C98 A;  4IIW A;  4Z6Y A;  3U6C A;  2J7O A;  3C58 A;  5L9M A;  1MY2 A;  1Y1M A;  3RGS A;  2DSF A;  3K02 A;  3C32 A;  3EHU A;  1MX0 A;  3K8Z A;  3FXR A;  2Q8J A;  4FCV A;  4DUZ M;  4KFQ A;  1EZP A;  4GIP A;  2XXU A;  3D8L A;  2PT1 A;  3J7B A;  1H44 A;  4QNR A;  2YQZ A;  4GLI A;  4NF4 A;  3G3H A;  4DZ1 A;  3FVK A;  3PFI A;  3L6G A;  3V8X B;  3C31 A;  1MRP A;  5CRY A;  1MPD A;  4F18 A;  2I7P A;  1FQB A;  1EU8 A;  3KZG A;  3GXA A;  4KYD A;  1OFI A;  4DV0 M;  3VDF A;  3PPN A;  5HPQ A;  3U1O A;  3K6V A;  4XXU A;  3VVE A;  1QAM A;  1LBC A;  4F3G A;  5A2Q S;  1IXH A;  1H76 A;  2XXI A;  4D82 A;  4X64 M;  2XXR A;  4MB7 A;  1MDP 1;  3U8Q A;  3HU2 A;  3OXN A;  1TFA A;  4LRT A;  1DGB A;  1B9J A;  2LNH C;  1B32 A;  3JAM S;  1XVX A;  3J7A S;  3VDU A;  2Y7P A;  5FHO A;  1PB7 A;  3UMM A;  1NNU C;  1W5T A;  1Z7N E;  2F34 A;  2IA4 A;  4DE8 A;  3UOR A;  2RIN A;  1DOT A;  4FVM A;  3I4Y A;  4QOS A;  2KEB A;  4YMA A;  4ZEC A;  4GWO A;  1PEB A;  3FXQ A;  4NMY A;  4C0R A;  5H8H A;  2F8D A;  4TLL B;  1Z5B A;  4X65 M;  3KOX E;  2X7Q A;  3K1N A;  5CI5 A;  2VQE M;  1J7K A;  3K1P A;  2ESN A;  4DV7 M;  4G68 C;  3IB1 A;  3NWL A;  2Q9T A;  3CI8 A;  2ZAN A;  1URG A;  3FGS A;  5I2K A;  4PDI A;  4DR4 M;  4DLD A;  4U22 A;  2RC7 A;  4B08 A;  4D81 A;  2V1U A;  4DR7 M;  4EIW A;  4OMB A;  3KBR A;  3DFZ A;  4P0I A;  4LF4 M;  3FTF A;  1JVY A;  1PBP A;  4LZ8 A;  4OYV A;  1IM2 A;  1DPE A;  3FD3 A;  1IBM M;  1RYX A;  4U1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...