3KSJA

The alkanesulfonate-binding protein ssua from xabthomonas axonopodis pv. citri bound to mes
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
AEPAQLRIGYQKAVSSLVLAKQHRLLEQRFPRTKITWVEFPAGPQLLEALNVGSIDLGGAGDIPPLFAQAAGADLLYVGWVPPTPKAETILVPSKSALRTVADLKGKRIAFQKGSSAHNLLLRVLAKSGLSMRDITPLYLSPANARAAFAAGQVDAWAIWDPWYSALTLDGSARLLANGEGLGLTGGFFLSSRRYATAWGPFVQQVMGTLNQADGLLERDRAGSIKTLAQVSGLPPAVVERTLAHRPPASVQPLSAQVIKAQQATADLFYAQRLLPKRVLVAPAVWRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nitrate transport protein
publication title The crystallographic structure of the SsuA protein reveals how alkanesulfonates enter into the cell
rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 94
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2009-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.450 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3ksjA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ksjA02
4ISUA 4OFJA 3C35A 5I84A 3PUXE 3K02A 4P11A 4KHZE 3BFUA 4PETA 3SDFA 4HS7A 3RNNA 1UTHB 2VD3A 4XTCQ 4OZ9A 2RKMA 2DVZA 3O28A 3KN8A 2ONRA 2V93A 2QJEA 1LFGA 4KR5A 4JWXA 3L6GA 2P1SA 2H98A 1XC1A 2UYFA 2UXAA 1DPPA 4P0IA 3PUVE 3IB1A 3SEXA 4G68B 3TMGA 5I2NA 1IEJA 3OMBA 2ABHA 3CG3A 4H6DA 5K2XA 3L6HA 1QVSA 3N6TA 1B3FA 3S9MC 3EN3A 1HSJA 2ZNUA 3M3FA 4O3CA 3C31A 1B51A 1R9QA 4EQ7A 1N04A 3TTNA 2CMOA 4JB7A 3PUWE 4MLQA 4C0RA 3EQ1A 4F18A 2QS2A 4ESWA 4MBPA 3FATA 1POY1 1Y1ZA 1D9VA 2HZKA 2B65A 4H65A 4NF6A 1LBBA 3TODA 5BWJA 1SW1A 2G29A 3KJTA 3VLWA 5KDTB 3I5OA 4ONYA 4Z0IA 1FTKA 5ITPA 3E4RA 3VDFA 4R6YA 5CI5A 3TEPA 2V3UA 1OQHA 1MXVA 4R2FA 4ZECA 5I57B 3PD8A 4OETA 1S9TA 2F8DA 4KFQA 3VE1B 3KBRA 3RUMA 4NE4A 3Q29A 3V89B 2LAOA 3K0VA 3OSQA 2QL3A 5L8DA 4OFLA 1SDXA 4LP2B 5L9MA 5AA1A 1JW5A 4U4XA 4ZZAA 4MLVA 1XS5A 3O6GA 3HSTA 1SD3A 4OERA 3LC8A 1VR5A 4KYEA 1JVXA 2O68A 1B5HA 4GXAA 1B7HA 5DVIA 2VP1A 4F31B 1AOVA 3G7WA 5F7VA 4RPOA 3QAXA 3E13X 3MPKA 4R9GA 1QUKA 1LLSA 4OENA 1MY4A 3LUYA 2XX7A 2DXYA 3G3GA 1H3DA 1A8EA 4KYSA 3H6UA 2KLFA 4NTLA 1PBPA 1XHYA 3VLVA 3O97A 2ONKE 4LA9A 3KSXA 1T0KA 5JTYB 4JDFA 4H8JA 2OWSA 1MM7A 2ZYMA 1TFAA 3G3FA 1UTBB 5CBSA 1M5EA 4H5FA 4QFKA 3U93A 2XXYA 1B4HA 1LCTA 4GLIA 4MFIA 3H6TA 1MQIA 4OWDA 3MQ9A 4JXIA 5KCJA 4FEDA 4NWCA 4Q8RA 4RXLA 4IY6A 4XXUA 3MWBA 1USYH 3B7DA 5H8FB 3G3JA 1FTJA 2ONSA 3K1NA 4F1UA 5FHMA 4PFWA 2DXRA 1MXXA 4OTEA 3ZS6A 3DLNA 3JV9A 4LQ2A 3UIFA 2DQVA 3FXRA 1OMPA 4MH5A 2X7QA 3FXQA 3CR9A 3K6UA 1H44A 2P0SA 4FJPA 1FTMA 1NFTA 2XHDA 3KGCA 4DDDA 5I58A 4DLDA 2Y7WA 3N5LA 2QPQA 4WKMA 1NNPA 4XKQA 2OJTA 1LFHA 3CRBA 4YMAA 1MQDA 2I58A 3MZ9A 1N84A 1JVYA 1XOCA 3UA8A 1RKMA 5DEXB 2PT2A 4ZE8A 1TFDA 4DZ1A 2DWAA 3MW0A 3C33A 3TTKA 3VVDA 4ELOA 4UACA 1MH3A 3S2VA 1MXYA 1DMBA 2D3IA 2H5YA 4H8IA 1BP5A 3PPQA 2QMXA 1A40A 3PV0E 2ALUA 3VXBA 3TELA 1JNFA 4F2OA 1MDQA 3RQTA 4JWOA 2GHAA 4PE5B 4KPTA 1EZPA 1B3GA 3S9NC 1N3XA 1OLAA 2Q2AA 3ONMA 1GGGA 2PX1A 2VHAA 3H06B 3BKIB 4F3GA 3LSLA 1DSNA 1POTA 4ELQA 2OBGA 3O9PA 3O6HA 1MY3A 5A5XB 2V25A 3THIA 1JEUA 2Z23A 5F1QA 3Q27A 5JEIA 1NKXA 3D4CA 2F7CA 3C34A 5EHSA 2I49A 3O6IA 3BFTA 3PU5A 3HO7A 1MXUA 1RYOA 4N13A 2REGA 4O3AA 4QSDA 5FHOA 3H6WA 1UIVA 4I1DA 1BKAA 2HAUA 3N26A 4IGTA 3TPAA 2OCUA 4POWA 1Q35A 3UORA 1I6BA 1A54A 1MM6A 1L5TA 1LSTA 3U1OA 2WKYA 3ODBA 3IR1A 3K2DA 1GV8A 5CMKA 3PGFA 1QULA 3VXCA 1B40A 1O7TA 4IO7A 5I56B 4QFOA 4JWYA 1Y3NA 3I3VA 3S4UA 4X48A 1EZ9A 3DELB 3FVOA 2Y7KA 4H5GA 1B1HA 3PUYE 1KWHA 4M4GA 3G3KA 4C1TA 1M5DA 4G8MA 2R6GE 3ECRA 3FGSA 3CFZA 4IO4A 1NNTA 2DWHA 3PMXA 3OOAA 3PMWA 2XXWA 4LUBA 4M1VA 3MC2A 4N07A 1M5FA 3TCHA 4OHNA 2DE4A 5TU0A 1JW1A 4BDMA 3C4MA 3C9HA 3BBRA 2DYXA 4U1OA 1LB9A 4IO2A 3FUZA 4F22A 4PFTA 4NMYA 3FD3A 4IY5A 5DVFA 1FTLA 2ZNTA 1LAGE 1B7UA 3W9VA 3FZVA 4ELRA 2XXHA 4NF5B 3UN6A 4LQ5A 4U1ZA 4OMBA 1AIVA 4H1XA 4OFOA 3IOTA 3ILTB 1NNKA 2XXIA 3Q26A 2E1SA 2I48A 1Y1MA 3EHSA 4BDOA 3EHUA 3MP8A 4I8CA 2Q9TA 3U8QA 3IB0A 1URDA 3PPOA 1OVBA 2AIXA 5H8QA 1H45A 1FW0A 1Z7ME 4QFLA 3FVKA 1USYE 1XT8A 4YICA 2I3VA 1JETA 4GIZA 4R75A 3MAMA 4R72A 3OENA 4GF8A 2PBWA 4PQJA 3OELA 1OIBA 3AXFA 5CC2A 5TP9A 5CMMA 2O6AA 3QSLA 3RPWA 1I6AA 5HM4B 4Z7EA 3RGYA 2XXUA 1D9YA 1CB6A 1MXWA 2THIA 4YKJA 1B3HA 2QMWA 1SYIA 2RC7A 4R6HA 2HFBA 2W7YA 4KD5A 4BLAA 4U2RA 4IB2A 3OO7A 1B3LA 2Y7IA 3KN3A 1TXFA 2QSXA 2QS1A 4F2QA 1ANFA 4NF4A 2Y7PA 1DTGA 1BLFA 5AA2A 2F34A 4RA1A 1H43A 1LB8A 1A99A 1P99A 2H25A 1MY2A 2DVCA 1RYXA 5M2VA 1LAHE 2H9BA 1A55A 3RTFB 5ITOA 4ZDMA 2XD3A 4RYAA 1PB9A 2D5WA 4IO6A 3UGWA 1LFIA 3TTMA 2NOOA 5I2NB 2AL5A 1QW0A 1QKAA 1TWYA 1GVCA 3WAFA 1URSA 2PVUA 4XKPA 4E0XA 1HSLA 2O69A 2PT1A 4Q0CA 5AA4A 1A8FA 4PFYA 5I2KA 5B70A 4EQBA 3RN8A 5EYFA 4NF8A 3HPIA 1MG1A 3MVZA 4KYDA 2O7IA 1B6HA 4G2ZA 1B32A 4U21A 3K6VA 3CSBA 2HCAA 2Z22A 3WAEA 1IXHA 2DSFA 3LSXA 4NF6B 1R9LA 4XKNA 2BJJX 4TQUQ 2O7UA 3MP1A 3LBSA 2DS9A 1B5IA 1NH7A 1Y4TA 2HEUA 2IA4A 3PUZE 3H03A 3GBBA 1VFDA 3O29A 3C36A 3TAJA 4FATA 1HSEA 1ZJLA 3Q28A 3U72A 2O84X 3QIMA 4F3PA 3TQWA 4PP0A 4NWDA 5L9SA 3V83A 4GRKA 1VE4A 3A09A 4DXBA 1GTKA 4OYVA 1N7XA 4YB5A 1IIWA 1AL3A 2H99A 5H8HA 4X9TA 4YKIA 3ZKKA 2F7BA 3QK6A 5CMBA 5DVJA 3DM0A 3LR1A 2E0SA 3TTRA 4FE8A 4ZZEA 1SBPA 5CBRA 3VLUA 1IQ7A 4FIMA 4FORA 1Z7NE 4G77A 1ZBMA 5TPAA 4KCCA 3PPNA 1YPNA 4HCYA 2GH9A 3W15C 4F19A 3T9UA 4E0WA 3B6WA 1B9JA 3PPPA 4LVQA 3JZJA 3TCGA 3IO4A 3DP8A 3VFJA 3FVNA 5CMCA 2D21A 1FQDA 1SYHA 4GD5A 4GL8A 1SW4A 2A5TA 1NNFA 1IXCA 2Q2CA 3IJOB 4EF2A 4AB6A 3SESA 1B58A 4X1BA 1MRPA 3OO6A 3T93B 1JQFA 3HN0A 4OVJA 1PC3A 2ZXTA 2V3TA 2R71A 3C32A 3R6UA 4AB5A 4OESA 4Q30B 4QRZA 1MQHA 3RLFE 5FHNA 4NEDA 1N76A 3KOSA 5IAIA 4EXLA 4QFNA 2V84A 3H3GA 3T96B 3IJXB 2XX8A 5KCJB 1Q1KA 2RF1A 3RT6B 3KSJA 1FQBA 4OEUA 3TCFA 2XX9A 4QSEA 3TKDA 1R6ZA 4F39A 3MZ1A 4U23A 1M5CA 5H8NA 1WVJA 4G68C 2O1MA 4ZS9A 3IO6A 2Q88A 2A5SA 4IO5A 3H6VA 3OSRA 3MUQA 2PMSA 2DE2A 2RC9A 1ZMGA 3EHTA 3KOTA 3KFMA 4HCWA 1N7WA 3G3IA 4JSDA 4KCDA 4EQ9A 4DE8A 1P1UA 4DXUA 1B0LA 3PPRA 5I58B 4QF9A 4QSCA 2DWIA 3S9EA 3TYHA 1IITA 4F1YA 2HQ0A 3U94A 1UTHA 1QJMA 2RCAA 1PB8A 4ZEKA 2A5TB 3T9HB 1MPCA 5ISUA 3SEVA 4UA8A 4ND9A 4ZEBA 3SKPA 3TTLA 2H4IA 2ANJA 3KJ7A 4ELPA 1LAFE 3FXUA 4LONB 4GWOA 4R73A 3CFLA 4LATA 1OQGA 4BDNA 3N94A 2VOZA 3OEMA 3KZGA 4Q5TA 3VV5A 1OVTA 1SW5A 2Z8DA 2I6EA 1MH4A 4G68A 2I0BA 1AH5A 2NXOA 2ZMBA 3GZGA 4ESXA 2Q89A 4YZZA 3MPLA 2XXPA 1LCFA 4HW8A 2DE3A 1UQWA 3CSGA 4RNSA 3V8XB 1JW4A 3K01A 4YKPA 1NH8A 5DYHA 4I62A 3H7MA 5CM6A 1II5A 4KQPA 3RTWB 4BDRA 3GBAA 5H8SA 5AA2D 3TQLA 4HTGA 1XVYA 1WODA 1FQEA 3JYRA 2R9JA 5KDTA 3A3CA 1D3KA 3T66A 2XXRA 1MPBA 4YU0A 1J1NA 3R26A 4X1DA 3G3HA 1H76A 5DT6A 1B7ZA 4IO3A 1NMUA 1I69A 5I57A 4DXCA 1YAEA 2HXWA 2B3BA 5I59A 2M8CA 2Q8JA 4K3FA 3M3LA 3U92A 3F11A 3B6QA 1YTVA 2HZLA 2Z8FA 4YKKA 4G8HA 2XD2A 1B4ZA 1MQJA 3QUFA 3R7XA 4AQ4A 5LOMA 1ZIUA 3S9LC 2GFEA 3OD7A 3PD9A 1ELJA 3LSFB 3EPEA 3IL1B 1FCKA 3FASA 5AA3A 4WXJA 1VSOA 2F6PA 1SQYA 4G4PA 1A7LA 1N3WA 1PB7A 4TLLB 1ATGA 3B6TA 3E3KA 2I4CA 4QFPA 1WDNA 3FJ7A 3O2AA 2IEEA 1PEBA 2PYYA 3T9VA 4FAJA 2UVIA 1ZLQA 4H67A 1NL5A 4QHQA 4RPNA 2VGQA 1FTOA 4GQOA 1DOTA 4F29A 2NWJA 4ZEIA 2AL4A 5JTYA 3OO8A 2F5XA 2V3QA 2FYIA 2I4BA 1UTBA 4JBZA 1BIYA 1QUJA 3KG2A 3W9WA 2UVHA 1EU8A 2X26A 1OLCA 1DPEA 3P7IA 5I59B 3RT8A 5H8QB 3IOUA 1IUDA 3TDJA 3D4GA 4TOZA 1MY0A 1R1NA 1URGA 5K2YA 5J1DA 3DP6A 3O66A 5HPQA 5H8FA 5L9OA 1MS7A 1Y4CA 2Z8EA 5IKBA 1B5JA 3TUSA 4BDLA 3FVGA 3M3KA 5ICQA 5TP9B 2FNCA 3T9XB 4R6KA 1EH3A 4WEPA 3VVEA 4EF1A 3OO9A 1FQFA 1JEVA 3QUJA 2RC8A 2UVGA 4XIGQ 2XXQA 4OEVA 4ECFA 2OZZA 3IOWA 4ZEFA 1S7YA 2DWJA 3KN7A 2HAVA 1BTJA 4WEDA 1MQGA 4I9DA 3H4ZA 3MVYA 3CG1A 4NF4B 3ILUB 3USDA 2OWTA 3IX1A 2G93A 1B52A 2AYSA 4RJZA 5AA2B 1ZKBA 2XXXA 4DCYA 4GVOA 4FECA 2B3FA 2OLBA 5DEXA 1N0TA 3CVGA 4F3SA 1D4NA 2F6GA 4OQOA 4EUOA 2ZNSA 1QKBA 4DCXA 3K6WA 2O1LA 1UIUA 2XXVA 3MVWA 4LZ7A 3K6XA 1MXZA 4KI0E 3Q25A 3SEUA 2F97A 5CRYA 4MF3A 3V5AA 2ZYNA 3HCQA 1ZU0A 1B1XA 4U22A 1US5A 4RY1A 3MJNA 2Y7RA 3IOVA 2DP8A 5AA4B 1Y9UA 4GFRA 5I2KB 2FA7A 3SETA 1IZ1A 4IGRA 5A5XA 1Y3QA 4NF8B 3UK4A 4ZEDA 3FJMA 1PDAA 5AE4A 2P2AA 2XXTA 4U4SA 2GRVA 4F3BA 3FJGA 3I6VA 4LZ5A 4N6PA 3N6UA 3E9XA 4THIA 3PMVA 3RY3A 4F1VA 4R2BA 4DIGA 1SI0A 2QRYA 4GOTA 1ZTYA 4YB6A 1P1QA 4H0WA 5B7DA 1O63A 4GL0A 3MP6A 1Y20A 2F78A 3IAZA 1IXGA 3OXNA 5I56A 3MBPA 1I6QA 2I0CA 2F36A 2X7PA 1DTZA 2RINA 1QUIA 3HHGA 2UVJA 3SERA 2YJPA 1S50A 4YAHX 2QS4A 2F7AA 5EHMA 5H8HB 4OXVA 2NVUB 1MPDA 1F9BA 4RK9A 3FV1A 1MY1A 3FV2A 4JSOA 5KZTA 2QS3A 1FQCA 4GXSB 1P1OA 1P1NA 4PFUA 3K1MA 1B2HA 1YCJA 4LZ8A 4YB7A 2YPNA 5DTBA 5TPAB 3ZKLA 1M5BA 4XKRA 1LGBC 4L17A 4POXA 1B46A 4RK2A 5HBCA 1MDP1 4P0GA 4NF5A 3HV1A 3K4UA 1Y3PA 3GXAA 1B05A 1FQAA 5FTIA 4BDQA 3EF7A 1SVXB 1SW2A 3UP9A 3QYTA 2YLNA 3KEIA 1XVXA 2OK2A 3IORA 3K00A 1B3EA 3VVFA 4G8NA 4YMBA 3CIJA 1LBCA 3SEYA 1EZOA 3HHFA 3ZSFA 5BUUA 2GHBA 2RCBA 1O64A 1VFEA 3OEKA 5JK4A 3DP4A 3CI8A 3T22A 1TT1A 2ESNA 4FEBA 2Y84A 1P1WA 1SI1A 2DOJA 4O3BA 3IK6B 3MZBA 4C1UA 3QXMA 3TZAA 4R9FA 3LSWA 4ZE9A 2ZYOA 2F35A 2O51A 3FIRA 5ELVA 2UYEA 1US4A 1CE2A 3MVXA 3GLBA 1IXIA 2NUVA 3IB2A 1B0HA 1GR2A 5H8NB 4R74A 4EDPA 5ICTA 5FTHA 4TLMB 4EXKA 1PBQA 3TFLA 1LAXA 2VD2A 3A3UA 2CZLA 1AMFA 3M8UA 2I3WA 2REJA 3K1PA 2ZYKA 3SEWA 3CFXA
chains in the Genus database with same CATH superfamily
1DGBA 2Z7JA 2X8AA 4ISUA 4OFJA 3C35A 5I84A 2UUCM 3PUXE 2OO9A 3K02A 4P11A 3TWLA 2DAGA 4KHZE 3BFUA 4PETA 1Y8GA 3C3EA 5I3SA 3SDFA 4HS7A 5E26A 3RNNA 2HKJA 1IMCA 1UTHB 1LEVA 2VD3A 2JUJA 4LFBM 4XTCQ 4OZ9A 8CATA 4PF8A 2HPGA 4IBKA 2XZUA 4OX9M 2RKMA 1L8QA 2DVZA 3O28A 3KN8A 2ONRA 2V93A 2CV2A 2QJEA 1LFGA 4KR5A 4JWXA 3KVWA 3L6GA 2P1SA 2H98A 3DFZA 2M60A 1XC1A 2UYFA 1KZ8A 2UXAA 1DPPA 4P0IA 2KDLA 3U6EA 2V4CA 3PUVE 4JI3M 3IB1A 3SEXA 4G68B 4YY3M 3TMGA 5I2NA 1IEJA 4L15A 3OMBA 1FJ9A 2ABHA 1QGXA 3U65A 1JR3D 1OAOC 3KOWE 3CG3A 1FBCA 1IY2A 4H6DA 4MGYE 5K2XA 2AHMA 3B74A 2FHYA 3L6HA 5FTKA 1QVSA 3N6TA 1FPGA 1B3FA 3S9MC 3EN3A 2C96A 4DV6M 3SHGB 1HSJA 2ZNUA 3M3FA 1G0IA 4O3CA 2CEAA 4LZZA 3C31A 1B51A 1R9QA 5FBPA 4GBWA 4EQ7A 1N04A 1K82A 3TTNA 1XC8A 2XLJA 4MIJA 1NJGA 2WBBA 2VPNA 2WYPA 2CMOA 4JB7A 3PUWE 4MLQA 4PDHA 2CFOA 4C0RA 3EQ1A 4FBPA 4F18A 4JI4M 2R4EA 1NV5A 2X4AA 2QS2A 4ESWA 4MBPA 3FATA 4LJ5A 4JI5M 1POY1 1Y1ZA 1D9VA 1P3QQ 5LMUM 2HZKA 1G8PA 2B65A 4H65A 3F92A 1FBHA 4AW4A 1QAMA 4NF6A 1LBBA 3TODA 1PRBA 5BWJA 1SW1A 2G29A 4IIWA 3KJTA 3VLWA 5KDTB 3I5OA 2OQ4A 2DKLA 1ZMWA 1Z5CA 4ONYA 4JI0M 2JWSA 3W0FA 1IQPA 4Z0IA 4HEOA 2BWEA 1FTKA 5ITPA 3E4RA 3VDFA 4R6YA 5CI5A 4GWXA 3TEPA 2V3UA 2LVQD 1OQHA 2Y5KA 1MXVA 4P16A 3T15A 4JVIA 4R2FA 3KDSE 4A3VB 3I04M 1R5LA 4ZECA 5I57B 2C9OA 1Z6TA 4WW0A 3FRHA 3PD8A 4OETA 2DZOB 1S9TA 1V92A 2QVRA 5C18A 2DAMA 3U6SA 2F8DA 4KFQA 3VE1B 1HJPA 3KBRA 3RUMA 4XK8F 4FD2A 3Q29A 4NE4A 3V89B 2LAOA 3K0VA 3AOEC 3OSQA 2QL3A 5L8DA 4P17A 3ZQJA 2BJWA 1WXQA 3T1YM 1SDXA 4OFLA 4GWZA 4LP2B 5L9MA 5AA1A 1HQYE 1JW5A 4U4XA 4ZZAA 4MLVA 1XS5A 3O6GA 5EXXA 2LNHC 3HSTA 1SD3A 4OERA 3LC8A 1KFVA 4D82A 1VR5A 4KYEA 5EP2A 1JVXA 4NF0A 2O68A 1B5HA 5FTMA 3RE8A 4GXAA 3J81S 3L27A 5ITXE 1B7HA 5DVIA 4OVPA 2VP1A 4F31B 1AOVA 2GNOA 1NUXA 3D1RA 3G7WA 5F7VA 2GQFA 2A5YB 4RPOA 1PJSA 4LF9M 3QAXA 2Y0QA 2ZTCA 1H6UA 4FWGA 4I5SA 3E13X 3T1BA 3MPKA 2ZANA 4WP2A 3CFXA 4R9GA 3R8FA 1QUKA 2ZTDA 3VK8A 2DAKA 1LLSA 4KLNA 2DHRA 1RDZA 2CZHA 1JB0F 4OENA 3FUXA 3A42A 2Q74A 1SXJD 1MY4A 3LUYA 2XWIA 2KNAA 4NSOB 2XX7A 2DXYA 3G3GA 1H3DA 1PJJA 2D7EA 1A8EA 4KYSA 3H6UA 2KLFA 1G71A 4NTLA 3L28A 2DVWB 3SYLA 1PBPA 1XHYA 3VLVA 3O97A 2UUAM 2ONKE 4LA9A 2K0BX 1FBGA 3KSXA 2XH9A 1GJTA 1T0KA 5JTYB 2OX3A 2HAKA 4H8JA 2OWSA 4JDFA 1MM7A 3SHFA 2ZYMA 1QAQA 3ROJA 1DCUA 4DI3D 2VQFM 1TFAA 3AOEA 3G3FA 3SASA 1UTBB 5CBSA 1N33M 3QYBA 1M5EA 1DBZA 4H5FA 4FVMA 4QFKA 5ITTA 3U93A 4FCWA 3B50A 2XXYA 4ANRA 1B4HA 1LCTA 2EUCA 4GLIA 3T0JA 5EXSA 4MFIA 2DI0A 5ESYA 4PAKA 1HR0M 3IG8A 2FOIC 2XA5A 3H6TA 1MQIA 4PCZA 4OWDA 3MQ9A 4JXIA 1FPBA 1Z5AA 1VEGA 3AJIB 4FEDA 5KCJA 4NWCA 4DV4M 4Q8RA 4NQ8A 4RXLA 4RKUF 2XFTA 1T6OA 4PGNA 4IY6A 4XXUA 3K92A 1KYIA 3MWBA 1USYH 3B7DA 2X49A 4GITA 4G4RA 5H8FB 1TDZA 1L2DA 3G3JA 5IZ3A 1L2CA 1FTJA 4PDDA 2JZ1A 3J2PB 4N6DA 2ONSA 3Q8XA 3K1NA 4QXDA 5EP1A 2L7IA 4F1UA 1OQYA 5FHMA 3GYYA 4PFWA 2OOBA 2DXRA 1D0KA 1MXXA 4OTEA 3T1HM 3ZS6A 3DLNA 3JV9A 4LQ2A 3VLFB 3UIFA 4NL4H 3IECA 2DQVA 2KQZA 1OMPA 3U60B 3FXRA 4MH5A 2X7QA 2D7GA 3FXQA 1TGUA 1FPKA 3CR9A 4R71A 1H44A 3K6UA 4N6KA 3M6AA 2JJKA 2P0SA 4FJPA 1K3XA 1FTMA 1IY0A 3HZJA 4UN2B 4Z6YA 3GQ3A 1NFTA 3VKHA 2XHDA 1G59A 3KGCA 4DDDA 5I58A 2VIIA 2L09A 4DLDA 2Y7WA 3MHVC 3N5LA 2QPQA 1EYIA 4WKMA 3CHGA 1NNPA 4XKQA 4FCTA 2OJTA 1LFHA 5GKNA 3CF0A 3HHZA 1FSAA 3SMPA 3CRBA 1UM8A 2OOAA 4YMAA 2B4LA 4G3OA 1NUWA 1C1KA 4GWWA 2WSCF 4GWSA 2CZIA 1L1ZA 1AIPC 3KW6A 2DWMA 4BB9A 1MQDA 4X66M 1OTRA 2I58A 2R44A 2V1CA 1IN5A 5EQTA 2CP8A 1N84A 1JVYA 3MZ9A 1XOCA 3UA8A 1RKMA 5DEXB 2PT2A 4ZE8A 2H5XA 1TFDA 4DZ1A 2DWAA 3MW0A 3C33A 3TTKA 3VVDA 4ELOA 4GX4A 2P3NA 2RGOA 3I4YA 2XZFA 3KBZA 4UACA 1MH3A 1LBXA 2FNAA 2Z8YM 3S2VA 1MXYA 3AKZA 1DMBA 2J7NA 2MH8A 3KXEC 3UK6A 1Z59A 2D3IA 2H5YA 4G4NA 3GPYA 1WIVA 4H8IA 1BP5A 3PPQA 2QMXA 1A40A 4QHSA 3PV0E 2ALUA 3VXBA 3TELA 1JNFA 1JP4A 1K9YA 4F2OA 2BJIA 4AZFA 4GKJM 3NBIA 4PE3A 1MJGM 1TF0B 1MDQA 3RQTA 2XWKA 4Y28F 4JWOA 4QBAA 2GHAA 4PE5B 1FPEA 4KPTA 1B3GA 1EZPA 3S9NC 4JI7M 1NSFA 1N3XA 3VFDA 3E21A 1NNJA 1OLAA 2Q2AA 3ONMA 1GGGA 2PX1A 2BWBA 2VHAA 1IMFA 1TH3A 4GKKM 2H1RA 3H06B 3BKIB 2KHHA 3HX3A 4F3GA 3LSLA 2G5GX 4DV3M 1FBEA 4LJAA 5IM2A 1DSNA 2PFZA 1POTA 4ELQA 1IXSA 1YXIA 2KW0A 5KPRA 2ZZWA 2OBGA 2F5QA 3O9PA 4DR3M 3GLHE 3M7GA 3O6HA 2CHGA 4O94A 4NXNM 1MY3A 3THIA 3MMPA 2V25A 4F1IA 5A5XB 1JEUA 2Z23A 5F1QA 3Q27A 4IBFA 5JEIA 1NKXA 4LJ8A 1CNQA 1PJQA 3MK6A 3D4CA 2F7CA 1BVSA 3C34A 5EHSA 2I49A 3KC1A 3O6IA 1GL7A 3BFTA 4OU7A 4W5WA 2QNJA 3PU5A 3LMMA 3CTWB 3HO7A 1FBDA 3KC0A 1MXUA 4IBGA 3HJ8A 3GRVA 1RYOA 3U61B 4N13A 2REGA 5LDZA 4O3AA 4QSDA 2JY7A 3LUZA 5FHOA 3H6WA 2BJVA 1UIVA 2C98A 4I1DA 3LQRA 1OJLA 1BKAA 4AS5A 1NV9A 1R4GA 2HAUA 5JI2E 3GLGB 3GLHA 3N26A 4IGTA 3TPAA 2OCUA 2L7HA 4M9SA 4POWA 1Q35A 3UORA 1SXJB 1I6BA 1A54A 1MM6A 1L5TA 3CF2A 1LSTA 3U1OA 4DR2M 2WKYA 3SBJA 3ODBA 3IR1A 2HHMA 1PJIA 3K2DA 4DV0M 1GV8A 5CMKA 4DUZM 2QBYA 1QULA 5LMNM 3PGFA 2R6FA 5EQ9A 3VXCA 1B40A 1O7TA 4IO7A 5I56B 1E94E 4QFOA 4JWYA 1Y3NA 3I3VA 3S4UA 4X48A 1EZ9A 2CHVA 2R46A 1FJ6A 3DELB 1Q39A 3FVOA 3AFHA 2Y7KA 4H5GA 1NVMA 1B1HA 1QVRA 1N36M 2Z4RA 3PUYE 4QNRA 1KWHA 4N8YA 4M4GA 3G3KA 4C1TA 4LF8M 4HXVA 3ZC7B 1BK4A 1M5DA 4G8MA 2R6GE 2CEXA 1FBFA 2MJ5B 2HL7A 3ECRA 1N75A 3RFWA 3FGSA 3CFZA 4IO4A 5C1BA 1ZMVA 1NNTA 2KXEA 2DWHA 2FE8A 3PMXA 1EE8A 1Q02A 1XXHA 3OOAA 3PMWA 2XXWA 1K9ZA 2RGHA 4LUBA 4M1VA 1AWBA 5ITYA 3MC2A 1VEKA 2QVUA 4N07A 4LJ7A 1M5FA 2DXIA 3TCHA 4OHNA 2DE4A 5TU0A 3PNVA 1JW1A 7CATA 4BDMA 3C4MA 3LVVA 3C9HA 3BBRA 1XMQM 2DYXA 3JR5A 3GLFB 1QYRA 1R2ZA 4L4UA 1LBYA 4U1OA 5FTNA 1FBPA 1EYJA 1ZV1A 4II7A 1LB9A 4IO2A 1NHGC 4B3MM 3FUZA 4F22A 4PFTA 1NV8A 4NMYA 3FD3A 1IMEA 4IY5A 1WGNA 5DVFA 4IBEA 1FTLA 2ZNTA 3D8LA 3GO8A 3IG5A 4B7GA 1LAGE 1B7UA 2KRUA 3W9VA 2L4FA 3FZVA 4ELRA 2XXHA 2WSEF 4JXJA 4DV1M 4NF5B 3UN6A 4LQ5A 4U1ZA 4OMBA 1AIVA 4H1XA 3C3DA 2L4EA 2EA0A 3THGA 4OFOA 3IOTA 4AG6A 3ILTB 3GRYA 1NNKA 2LXEA 2XXIA 3Q26A 3A46A 2E1SA 2I48A 4DV7M 4DV5M 1Y1MA 3EHSA 4BDOA 3EHUA 1Z5BA 3MP8A 4I8CA 1IBLM 2Q9TA 1VQ1A 3U8QA 2UXBM 3FUWA 3IB0A 4GBVA 4UABA 1NNUC 2O01F 1E9SA 3SMSA 1URDA 3PPOA 5H37D 1OVBA 2AIXA 5H8QA 1H45A 1FW0A 2DENA 1Q3BA 1Z7ME 1TH4A 4QFLA 5ITRA 3FVKA 1USYE 1XT8A 4TUWA 5EQAA 4YICA 2I3VA 1JETA 4GIZA 3B7NA 4R75A 4PFIA 4PAFA 3T6PA 3MAMA 4R72A 3OENA 4PBHA 4GF8A 4PQJA 3OELA 3GPXA 4DI4B 4NG7A 5IZ7D 1OIBA 3AXFA 1NV4A 5CC2A 1TR8A 3HJSA 4G4QA 1T3TA 2ZM6M 5TP9A 5CMMA 2L5VA 5KPZA 2Q8MA 2D7HA 3L2AA 2O6AA 3QSLA 3RPWA 1I6AA 5HM4B 4Z7EA 3RGYA 1QZMA 2EJSA 1OIPA 1IM2A 1LBWA 1D9YA 2XXUA 4KO8A 1CB6A 1MXWA 2THIA 4YKJA 1B3HA 2QMWA 1SYIA 3GLIB 2RC7A 4R6HA 1GABA 2HFBA 2R0IA 3HWSA 2W7YA 4KD5A 4P47A 3B89A 4BLAA 4OW0A 3GQ4A 4U2RA 4IB2A 3OO7A 1B3LA 1GLNA 2Y7IA 3FD9A 4MMPA 2O5RA 3KN3A 5F24A 4LFCM 3SFZA 3V76A 1TXFA 2QSXA 2QS1A 4F2QA 1ANFA 1SPIA 4NF4A 2Y7PA 1EYKA 1DTGA 3U5ZA 4LN5A 3U6PA 4CGYB 1BLFA 1DO2A 5ITQA 5AA2A 2F34A 4RA1A 4NN3A 1H43A 4L6V6 4PD2A 2YQZA 3LVWA 1LB8A 1A99A 1P99A 2H25A 2RKOA 4GHLA 4WURA 4IBDA 1MY2A 1A5TA 2DVCA 1G41A 1OFIA 4I4LA 1RYXA 5M2VA 1QDTA 1LAHE 4X04A 4G6ZA 4X62M 2LBCA 4REZA 1L1TA 2H9BA 1A55A 1R2YA 3A29A 3RTFB 5ITOA 3PXGA 1KA1A 1S3SA 4ZDMA 1VG5A 2XD3A 4RYAA 1DGHA 1PB9A 2D5WA 4XEQA 4O7IA 4IO6A 3UGWA 1LFIA 3TTMA 2NOOA 3VK7A 1HNWM 1DGFA 3C9PA 2I7NA 1QW0A 2AL5A 5I2NB 1QKAA 1TWYA 4LJ6A 1GVCA 3WAFA 2E5LM 3EIHA 4LG2A 2OWZA 3FTCA 3KP1E 1URSA 2PVUA 4LGMA 4XKPA 4E0XA 1WGLA 1HSLA 2O69A 2PT1A 4N4UA 4Q0CA 5AA4A 3DOAA 1A8FA 4PFYA 4RF0A 3HU1A 1D0LA 5I2KA 5B70A 4P56A 4EQBA 3RN8A 5IT9S 5EYFA 1OAIA 4NF8A 2CUZA 3HPIA 1MN3A 4NXMM 1MG1A 3BIGA 1V33A 3MVZA 4HE0A 4KYDA 2O7IA 1B6HA 4G2ZA 1B32A 2QENA 5ET8A 4U21A 4P3LA 2F3DA 5ITXA 3FRIA 3K6VA 4H46A 2LH0A 4MB7A 1GL6A 3QWLA 3CSBA 1AUAA 2HCAA 2Z22A 4LJ9A 3WAEA 4PAIA 1IXHA 2DSFA 3U6OA 2OPFA 3R9XB 5DNYA 3LSXA 4NF6B 1R9LA 4N8GA 4XKNA 4AKGA 2BJJX 4TQUQ 2O7UA 3MP1A 3LBSA 3U6LA 1B5IA 1NH7A 2DS9A 1Y4TA 2GQ1A 2HEUA 5J16A 4IBJA 1IBKM 4JYAM 2IA4A 1X37A 4GX6A 2APLA 3PUZE 2XSZA 4JV5M 4P1EA 2XGNA 2KNZA 3H03A 5F3WA 3BBZA 4L78A 3GBBA 1G0HA 4DUYM 1VFDA 3J27B 2F4VM 3O29A 3FKEA 1D2NA 3C36A 1XB2B 3SAUA 3TAJA 4FATA 1HSEA 1RDYA 1ZJLA 3Q28A 4MJOA 2KZSA 3U72A 2FVZA 2O84X 3QIMA 4F3PA 3UGJA 3TQWA 3KOXE 4PP0A 4NWDA 5L9SA 3V83A 1VE4A 4GRKA 3A09A 1TH2A 4DXBA 1GTKA 4OYVA 2CHQA 1QDRA 1N7XA 5DFLA 3LCUA 3K9OA 4YB5A 1IIWA 4I8OA 1AL3A 2H99A 4P9KA 5H8HA 5FTLA 4X9TA 4YKIA 3ZKKA 3MYUA 2ZBKB 2F7BA 3QK6A 5CMBA 2Y20A 3B7QA 5DVJA 3DM0A 4DR1M 2NQ8C 2FS1A 5DW8A 4N91A 3LR1A 2E0SA 3TTRA 4FE8A 2FIEA 4ZZEA 1SBPA 5LTCA 2O25A 2KRKA 2KA6B 5CBRA 1PJTA 2HWJA 3VLUA 1IQ7A 2DHYA 5EP4A 3EKIA 4FIMA 4Q7JA 4FORA 1Z7NE 4G77A 1ZBMA 4HL4A 5TPAA 4KCCA 3PPNA 1YPNA 4ZPXA 4HCYA 4M0WA 2GH9A 3W15C 2CE7A 2DWZB 4PT5A 1EIJA 4F19A 2V1UA 3T9UA 2UU9M 3B6WA 1B9JA 4E0WA 3GLGE 5BPVA 3K2LA 2VT5A 1NJFA 4B3TM 3PFIA 3PPPA 4LVQA 2C99A 3JZJA 3TCGA 3IO4A 3DP8A 4PF6A 4AG5A 3FVNA 1SXJE 3VFJA 5CMCA 3AOGA 4K0KM 2D21A 1FQDA 2LVNC 1SYHA 3KS4A 4GD5A 4GL8A 1SW4A 2A5TA 4JVDA 3SZPA 1NNFA 1IXCA 4PFBA 3HHXA 2Q2CA 3IJOB 4MCOA 1IMBA 1YYZA 4EF2A 2Y21A 1VDWA 4AB6A 1QUTA 1TTEA 2MGWA 4MGKE 3SESA 2UXDM 1B58A 4X1BA 4I3EA 4XBOA 1MRPA 3OO6A 4MM3B 2ZZXA 3T93B 3TQSA 1JQFA 3HN0A 3HHYA 4OVJA 1PC3A 2ZXTA 2P5TA 2V3TA 2R71A 3DA1A 1IXZA 5EYGA 3C32A 3R6UA 3UZUA 4OANA 5KQDA 4AB5A 4PCDA 4OVZA 4OESA 4Q30B 4QRZA 2WEFA 3FTFA 1MQHA 3RLFE 5FHNA 4NEDA 2JA2A 1N76A 3KOSA 2B3TA 4NRVA 4EXLA 5IAIA 4QFNA 2V84A 3H3GA 3U6MA 3T96B 3IJXB 4XF5A 2XX8A 5KCJB 3B8BA 1Q1KA 3LQQA 2RF1A 4N17A 3RT6B 3T38A 2Y5LA 1FPFA 3KSJA 4NHBA 1FQBA 4OEUA 5BR8M 3TCFA 2XX9A 4QSEA 4OVTA 3TKDA 1R6ZA 5KQ8A 2QQ8A 4F39A 3MZ1A 4GIPA 3VDUA 4U23A 2M5ZA 1M5CA 4DR7M 2VPOA 5H8NA 1WVJA 5IZ3B 4MHFA 4MGHA 4AI6A 4G68C 2O1MA 4ZS9A 3IO6A 2Q88A 2A5SA 4IO5A 1J5EM 3H6VA 3OSRA 3RPLA 3HY5A 2J7OA 3MUQA 5IREB 5IZ1A 4MGIE 1N32M 2PMSA 2DE2A 2RC9A 3KOZE 4NGUA 2G8LA 1ZMGA 3A98B 3EHTA 3KOTA 1EFUB 3KFMA 4HCWA 1N7WA 3G3IA 3WHKA 4JSDA 3FTDA 4CHTB 3MSTA 4DV2M 4KCDA 4DE8A 4EQ9A 4GHAA 1P1UA 4DXUA 1B0LA 3PPRA 5I58B 4QF9A 4QSCA 3RGPA 2DWIA 2C9CA 4GRIA 3S9EA 3TYHA 1IITA 4OA4A 1HNXM 4F1YA 2HQ0A 3U94A 1UTHA 2V6ZM 2F5OA 1QJMA 2RCAA 1CUKA 1PB8A 4ZEKA 2A5TB 3SAWA 3T9HB 3ILKA 4DR4M 1LTMA 4YHHM 1MPCA 5ISUA 3GPPA 4UA8A 4ND9A 4ZEBA 3SEVA 3SKPA 2LTUA 3D8BA 2JZ0A 2H4IA 2ANJA 3TTLA 3KJ7A 2XXKA 1LAFE 3FXUA 2JY8A 4ELPA 4LONB 1FPLA 1FNNA 4GWOA 4R73A 3CFLA 4LATA 4MNPA 1OQGA 4QHTA 3LV0A 4BDNA 3K8ZA 5EXTA 3N94A 1TDHA 3J80S 3LW5F 2VOZA 5L8RF 3SAVA 3U6QA 3FUTA 3KFUG 3OEMA 3KZGA 1XHBA 4Q5TA 2QPAA 3VV5A 1OVTA 1SW5A 2Z8DA 2I6EA 1MH4A 4G68A 2I0BA 4X64M 4R3DA 1AH5A 2NXOA 1F4IA 3HKPA 4KT0F 2ZMBA 3DZDA 3GZGA 2QZ4A 1Q3CA 3AV0A 4ESXA 2Q89A 2DNAA 3GLIE 2P3VA 4YZZA 4NAPA 3MPLA 4KXPA 1T43A 2XXPA 1LCFA 4HW8A 2R18A 4GMQA 5I5PA 2DE3A 2CRUA 1QAOA 1UQWA 2JNHA 3CSGA 4RNSA 3V8XB 4G4OA 2QHOB 4LF5M 2EKKA 4FCVA 3TPZA 1JW4A 3K01A 4YKPA 3K9PA 1NH8A 5DYHA 4I62A 1N34M 3H7MA 5CM6A 3A45A 1II5A 4KQPA 1IXSB 3Q8GA 1N77A 3FXBA 3RTWB 3HU3A 4PFRA 4BDRA 4PGPA 3GBAA 5H8SA 3QAUA 5AA2D 3NWLA 4O8MA 4NOOB 3TQLA 4HTGA 2PFYA 1XVYA 1WODA 1GKIA 3NOHA 1FQEA 2EO2A 4LRSA 1NV6A 3JYRA 4LGYA 2R9JA 5T3JA 4MAGA 5KDTA 3A3CA 4PTKA 1D3KA 1J7KA 3T66A 2CZKA 2XXRA 1MPBA 4R7GA 4YU0A 1J1NA 4FW9A 1QANA 3R26A 4X1DA 3FYDA 4HE1A 2WBDA 3G3HA 3J7AS 1H76A 2MR9A 1YE9A 3GLHB 5DT6A 1B7ZA 4IO3A 1NMUA 1I69A 2YFQA 5I57A 4DXCA 1YAEA 2HXWA 1HT2E 1DK4A 5KPTA 2B3BA 5I59A 2M8CA 2Q8JA 4K3FA 4KODA 3M3LA 3U92A 3EIEA 3F11A 3K1JA 3B6QA 5EQ7A 1LBZA 1YTVA 1WR1B 2HZLA 2Z8FA 4YKKA 2W82A 2MROB 2DAIA 4L8RC 2J5YA 1D0MA 4BLCA 4I3YA 4G8HA 5EJCA 2QBYB 2XD2A 1B4ZA 1MQJA 1GO5A 1VDDA 3QUFA 3R7XA 4M9XA 4DBGB 1SG9A 1MU5A 1GJSA 2DWNA 4AQ4A 1MX0A 1QZEA 4IBBA 5LOMA 1RDXA 1ZIUA 3S9LC 4OVRA 1QQWA 4NRWA 2GFEA 3OD7A 3SC3A 2CWBA 3PD9A 3H4JA 1ELJA 4PBQA 2WYKA 3VKGA 3LSFB 3EPEA 5E6JA 3IL1B 1FCKA 1OKSA 3FASA 4MEVA 5AA3A 4AS4A 2UXCM 4WXJA 1VSOA 1XXHB 1NV0A 2F6PA 1SQYA 4G4PA 5DYIA 3FBPA 4G61A 1A7LA 1N3WA 1PB7A 4TLLB 4AKHA 3ZH9B 1ATGA 4MNCA 3B6TA 2R45A 1UFZA 3E3KA 2I4CA 4NX1A 1XMOM 4NC6A 2VF8A 4QFPA 1WDNA 3FJ7A 3O2AA 2KR0A 2IEEA 3L25A 4QOSA 3H4MA 1PEBA 2PYYA 2XSZD 3T9VA 4FAJA 2UVIA 1IN7A 1NV1A 1ZLQA 4H67A 1NL5A 4QHQA 5DYGA 4EIWA 1D9QA 4QNMA 1E32A 4RPNA 2VGQA 1FPJA 4LY6A 1FTOA 2UUBM 4M0DA 4GQOA 1DOTA 4F29A 2NWJA 4ZEIA 2AL4A 5JTYA 3OO8A 2F5XA 4LRTA 1ZMUA 3E46A 4O7MA 4CIZA 2V3QA 1YZ0A 2FYIA 2I4BA 2QCUA 4KHPM 1UTBA 4JBZA 5IGAA 2ZAMA 1BIYA 1QUJA 3KG2A 4MGZE 4GH9A 1OFHA 3FUUA 3W9WA 2Z3XA 1XNRM 2UVHA 5ET5A 3BXWA 1EU8A 2X26A 1OLCA 4L16A 4PDIA 1DPEA 2DDKA 3P7IA 5I59B 3RT8A 1K3WA 4B3RM 3SARA 5H8QB 4Z8XA 3IOUA 1IUDA 5EP3A 3HFUA 2Z4SA 3WHLA 3TDJA 3D4GA 4TOZA 1MY0A 4LF7M 1R1NA 1JR3E 1URGA 4GC9A 5K2YA 4LJ4A 3W68A 3W67A 2LHCA 5J1DA 3DP6A 3O66A 5HPQA 3HHWA 2ERCA 3GRUA 4P8BA 5H8FA 5L9OA 3JR4A 1MS7A 4OVQA 5FSWA 1Y4CA 2FBPA 2Z8EA 5IKBA 2LVOC 1B5JA 3TUSA 4BDLA 3FVGA 2FH0A 1FPIA 3BIHA 3ISPA 3M3KA 5ICQA 1IN6A 2FNCA 1NO1A 5TP9B 3T9XB 5ITUA 3GQ5A 5EXPA 4AQYM 4R6KA 1PM5A 4JI6M 1EH3A 1LBVA 4WEPA 3VVEA 4EF1A 1R6BX 1PGYA 3OO9A 1FQFA 1JEVA 1JR3A 3CGWA 1KA0A 3QUJA 2XFSA 3U60A 2RC8A 2UVGA 1XWIA 3SYKA 4XIGQ 2XXQA 4RNAA 4OEVA 4GC5A 4ECFA 2R8TA 2OZZA 2JY6B 3CF6E 3IOWA 4ZEFA 1S7YA 2WZJA 2DWJA 1FPDA 3E9SA 3KN7A 1VDLA 2HAVA 1L2BA 1VEJA 1BTJA 3L26A 2QVVA 4WEDA 4LF4M 1MQGA 4I9DA 3H4ZA 3MVYA 1NI9A 3CG1A 4NF4B 1GVNA 3W0LB 3ILUB 3USDA 2OWTA 3U5ZB 3MJ5A 3IX1A 4QOZC 2G93A 4DR6M 1B52A 2AYSA 2JY5A 2VQEM 4RJZA 5AA2B 1ZKBA 2FIXA 2XXXA 4DCYA 3I4VA 4GVOA 3U6DA 4M9ZA 4FECA 2LHGA 3U6CA 2B3FA 4MNIA 1XNQM 2OLBA 2K9DA 5DEXA 4LFAM 1N0TA 3CVGA 4LF6M 4PDGA 3KS8A 1FRPA 4F3SA 4HE2A 1D4NA 4IBIA 3NBXX 2F6GA 4OQOA 4EUOA 3B9PA 2ZNSA 4I81A 1HQCA 1QKBA 4DCXA 3K6WA 2LVPC 2O1LA 3AL0C 1UIUA 1DGGA 2XXVA 3MVWA 4LZ7A 3FUVA 1SXJC 1G3IA 1MXZA 1NV2A 3K6XA 4KI0E 3Q25A 3SEUA 2LWXA 2QFLA 2F97A 3IFCA 5CRYA 1DGHB 4MF3A 2QSFX 4D80A 3V5AA 2ZYNA 3HCQA 1ZU0A 1B1XA 4IJFA 5FTJA 4U22A 3C58A 1NHWC 3TL4X 1US5A 2R4JA 3GPUA 1LV7A 4RY1A 4ITQA 3MJNA 2Y7RA 3IOVA 3QMFA 1IXRC 2DP8A 5AA4B 1Y9UA 2EKFA 4GFRA 2B4MA 4MX6A 5I2KB 2FA7A 3SETA 1YLAA 1IZ1A 4IGRA 2JP7A 3SATA 5A5XA 1Y3QA 4NF8B 2XF3A 1IMDA 3UK4A 2C5RA 1FJGM 4ZEDA 4DR5M 4JN6A 1PDAA 3FJMA 3IFAA 1WJ7A 4F2LA 4JVCA 3PTYA 5AE4A 4JI8M 2P2AA 2XXTA 4U4SA 5ET7A 2GRVA 1J09A 4B7HA 4F3BA 3B7ZA 1NY6A 3U61A 3FJGA 3I6VA 1IY1A 4FWDA 1DV0A 4LZ5A 3ZCBB 4N6PA 3N6UA 3E9XA 4THIA 2KEBA 3PMVA 5A5LA 3RY3A 2F3BA 4F1VA 4R2BA 4DIGA 2Y0TA 1SI0A 2QRYA 4S12A 3GLGA 4GOTA 1ZTYA 4PC9A 1YUBA 5JI3E 4YB6A 1P1QA 4H0WA 1SXJA 3FTEA 2WX9A 5B7DA 4I40A 1N78A 5A2QS 1XI6A 1W5SA 1NUYA 1O63A 3TE6A 4FWHA 2R65A 4GX3A 4GL0A 3MP6A 2PCRA 1Q9DA 3L29A 1Y20A 2F78A 3IAZA 1IXGA 2KNVA 4JI1M 3OXNA 3JAMS 2F5NA 3MBPA 5FLXS 1I6QA 2I0CA 5I56A 2F36A 2X7PA 1DTZA 2RINA 1QUIA 3HHGA 2UVJA 3TWKA 1NV3A 3SERA 2YJPA 1S50A 2KZUA 2R62A 3J7BA 4B08A 3GLFE 4YAHX 3GRRA 2L2DA 2QS4A 2DWLA 3KP0E 4MH0E 3PVSA 3BOSA 2F7AA 5EHMA 4OXVA 5H8HB 3HU2A 2NVUB 1MPDA 1F9BA 4AKIA 4RK9A 4IBCA 2K47A 3FV1A 1MY1A 3FV2A 1ORYB 1HT1E 2F5PA 4JSOA 5KZTA 1INPA 2XWVA 3VDPA 2QS3A 2G3QA 3FYCA 1FQCA 4GXSB 1NY5A 1P1NA 1P1OA 2XWOA 4PFUA 3E79A 3K1MA 1B2HA 1YCJA 2BNKA 3OTOM 4LZ8A 5KO3A 4YB7A 3FE3A 1ZQ9A 2YPNA 2ZAOA 4RF1A 5DTBA 3UMMA 5TPAB 3ZKLA 1C7YA 4CISA 2DAEA 1M5BA 3GLFA 4XKRA 2QP9X 1R7RA 4LCBA 1WHCA 3RGSA 1LGBC 4L17A 4POXA 5I7IA 4HLQA 1B46A 2JXNA 4RK2A 5HBCA 2YR0A 1MDP1 4LZJA 1ZAEA 2DZLA 2I7PA 4P0GA 5EYHA 3M0EA 4NF5A 1YSYA 3HV1A 4P1LA 3K4UA 1Y3PA 3GXAA 2CV1A 1B05A 1FQAA 1E9RA 5FTIA 4BDQA 1JQJC 3EF7A 1SVXB 1SW2A 3UP9A 2DZNB 3QYTA 5EQ8A 2N35A 2YLNA 2F5SA 3KEIA 1XVXA 2OK2A 3IORA 3K00A 4BBAA 1B3EA 3VVFA 1IN4A 4G8NA 4YMBA 3CIJA 4D81A 1RU3A 4IJEA 1LBCA 5ET6A 3SEYA 1EZOA 3HHFA 4CJ6A 3ZSFA 2LVAA 5BUUA 1QUSA 2VF7A 1W5TA 4H45A 2HCBA 1IN8A 3RYDA 2GHBA 4JI2M 2RCBA 3UJNA 1O64A 1VFEA 3OEKA 5JK4A 3IHPA 4OVSA 3DP4A 1IMAA 3TWMA 3CI8A 3E78A 3T22A 4IR8A 1I4WA 1TT1A 2ESNA 2HHHM 2MKZA 4FEBA 2Y84A 1P1WA 4OVZB 4NSRA 1SI1A 2DOJA 4O3BA 3LCVB 3IK6B 3MZBA 4C1UA 3QXMA 3TZAA 4R9FA 4XGIA 1FTAA 1HNZM 1XXHE 3LSWA 4ZE9A 2ZYOA 2F35A 1V34A 1IFYA 2XEPA 3PNYA 3QYEA 1NV7A 2VDBB 2O51A 3FIRA 5ELVA 1DO0A 3I01M 4X65M 2HXRA 3I51A 2UYEA 1US4A 1CE2A 3MVXA 4N81A 4XFEA 3GLBA 4GEWA 3KOYE 2YNMD 2WSFF 1IXIA 2NUVA 4N15A 3IB2A 1G4AE 1B0HA 4B7FA 1IBMM 1GR2A 2FFJA 2CEYA 5H8NB 1NUZA 4R74A 4EDPA 2ZZVA 5ICTA 5FTHA 3GP1A 4TLMB 2L6OA 4EXKA 1PBQA 3TFLA 1LAXA 1I94M 1KSFX 4B3SM 1OIZA 3RPLB 4GWUA 2RRUA 3GLIA 2VD2A 3A3UA 4GWYA 2CZLA 5IWAM 2CV0A 2Q2EB 1AMFA 2K6BA 3M8UA 5IZZA 2I3WA 4X8RA 2REJA 3HJQA 3K1PA 2ZYKA 3SEWA 3HGIA 2PBWA
chains in the Genus database with same CATH topology
1DGBA 2Z7JA 2X8AA 4ISUA 4OFJA 3C35A 5I84A 2UUCM 3PUXE 3K02A 4P11A 3TWLA 4KHZE 3BFUA 4PETA 3SDFA 4HS7A 5E26A 3RNNA 2HKJA 1UTHB 2VD3A 4LFBM 4XTCQ 4OZ9A 8CATA 4IBKA 2XZUA 4OX9M 2RKMA 1L8QA 2DVZA 3O28A 3KN8A 2ONRA 2V93A 2CV2A 2QJEA 1LFGA 4KR5A 4JWXA 3KVWA 3L6GA 2P1SA 2H98A 3DFZA 2M60A 1XC1A 2UYFA 2UXAA 1DPPA 4P0IA 3U6EA 3PUVE 4JI3M 3IB1A 3SEXA 4G68B 4YY3M 3TMGA 5I2NA 1IEJA 4L15A 3OMBA 2ABHA 1JR3D 3KOWE 3CG3A 4H6DA 1IY2A 4MGYE 5K2XA 2AHMA 3L6HA 5FTKA 1QVSA 3N6TA 1B3FA 3S9MC 3EN3A 2C96A 4DV6M 3SHGB 1HSJA 2ZNUA 3M3FA 4O3CA 2CEAA 4LZZA 3C31A 1B51A 1R9QA 4EQ7A 1N04A 1K82A 3TTNA 1XC8A 2XLJA 1NJGA 2CMOA 4JB7A 3PUWE 4MLQA 2CFOA 4C0RA 3EQ1A 4F18A 4JI4M 2R4EA 2X4AA 2QS2A 4ESWA 4MBPA 3FATA 4LJ5A 4JI5M 1POY1 1Y1ZA 1D9VA 5LMUM 2HZKA 1G8PA 2B65A 4H65A 4AW4A 1QAMA 4NF6A 1LBBA 3TODA 5BWJA 1SW1A 2G29A 4IIWA 3KJTA 3VLWA 5KDTB 3I5OA 2OQ4A 1Z5CA 4ONYA 4JI0M 3W0FA 1IQPA 4Z0IA 1FTKA 5ITPA 3E4RA 3VDFA 4R6YA 5CI5A 3TEPA 2V3UA 1OQHA 1MXVA 4P16A 3T15A 4R2FA 3KDSE 4A3VB 4ZECA 5I57B 2C9OA 1Z6TA 4WW0A 3PD8A 4OETA 2DZOB 1S9TA 5C18A 3U6SA 2F8DA 4KFQA 3VE1B 3KBRA 3RUMA 4FD2A 3Q29A 4NE4A 3V89B 2LAOA 3K0VA 3AOEC 3OSQA 2QL3A 5L8DA 2BJWA 1WXQA 3T1YM 1SDXA 4OFLA 4LP2B 5L9MA 5AA1A 1HQYE 1JW5A 4U4XA 4ZZAA 4MLVA 1XS5A 3O6GA 5EXXA 2LNHC 3HSTA 1SD3A 4OERA 3LC8A 1KFVA 4D82A 1VR5A 4KYEA 5EP2A 1JVXA 2O68A 1B5HA 5FTMA 3RE8A 4GXAA 3J81S 3L27A 5ITXE 1B7HA 5DVIA 2VP1A 4F31B 1AOVA 3G7WA 5F7VA 2A5YB 4RPOA 4LF9M 3QAXA 2Y0QA 1H6UA 4FWGA 4I5SA 3E13X 3MPKA 2ZANA 3CFXA 4R9GA 3R8FA 1QUKA 3VK8A 1LLSA 4KLNA 2DHRA 4OENA 3FUXA 3A42A 1SXJD 1MY4A 3LUYA 4NSOB 2XX7A 2DXYA 3G3GA 1H3DA 1PJJA 2D7EA 1A8EA 4KYSA 3H6UA 2KLFA 4NTLA 3L28A 2DVWB 3SYLA 1PBPA 1XHYA 3VLVA 3O97A 2UUAM 2ONKE 4LA9A 3KSXA 2XH9A 1T0KA 5JTYB 4JDFA 4H8JA 2OWSA 1MM7A 3SHFA 2ZYMA 1QAQA 2VQFM 1TFAA 3AOEA 3G3FA 3SASA 1UTBB 5CBSA 1N33M 1M5EA 4H5FA 4FVMA 4QFKA 5ITTA 3U93A 4FCWA 2XXYA 1B4HA 1LCTA 2EUCA 4GLIA 5EXSA 4MFIA 1HR0M 3IG8A 2FOIC 3H6TA 1MQIA 4PCZA 4OWDA 3MQ9A 4JXIA 1Z5AA 3AJIB 4FEDA 5KCJA 4NWCA 4DV4M 4Q8RA 4RXLA 2XFTA 4IY6A 4XXUA 3K92A 1KYIA 3MWBA 1USYH 3B7DA 2X49A 4GITA 4G4RA 5H8FB 1TDZA 1L2DA 3G3JA 1L2CA 1FTJA 3J2PB 2ONSA 3Q8XA 3K1NA 5EP1A 2L7IA 4F1UA 5FHMA 4PFWA 2DXRA 1MXXA 4OTEA 3T1HM 3ZS6A 3DLNA 3JV9A 4LQ2A 3VLFB 3UIFA 4NL4H 2DQVA 3FXRA 1OMPA 3U60B 4MH5A 2X7QA 2D7GA 3FXQA 1TGUA 3CR9A 3K6UA 1H44A 3M6AA 2P0SA 4FJPA 1K3XA 1FTMA 1IY0A 4Z6YA 3GQ3A 1NFTA 3VKHA 2XHDA 1G59A 3KGCA 4DDDA 5I58A 2VIIA 2L09A 4DLDA 2Y7WA 3MHVC 3N5LA 2QPQA 4WKMA 1NNPA 4XKQA 4FCTA 2OJTA 1LFHA 5GKNA 3CF0A 3HHZA 3SMPA 3CRBA 1UM8A 4YMAA 1C1KA 1L1ZA 3KW6A 2DWMA 4BB9A 1MQDA 4X66M 2I58A 2V1CA 1IN5A 5EQTA 3MZ9A 1N84A 1JVYA 1XOCA 3UA8A 1RKMA 5DEXB 2PT2A 4ZE8A 1TFDA 4DZ1A 2DWAA 3MW0A 3C33A 3TTKA 3VVDA 4ELOA 2RGOA 3I4YA 2XZFA 4UACA 1MH3A 2FNAA 3S2VA 1MXYA 3AKZA 1DMBA 2J7NA 2D3IA 2H5YA 3UK6A 3KXEC 1Z59A 4G4NA 3GPYA 4H8IA 1BP5A 3PPQA 2QMXA 1A40A 4QHSA 3PV0E 2ALUA 3VXBA 3TELA 1JNFA 4F2OA 4AZFA 4GKJM 3NBIA 1MDQA 3RQTA 4JWOA 2GHAA 4PE5B 4KPTA 1EZPA 1B3GA 3S9NC 4JI7M 1NSFA 1N3XA 3VFDA 1NNJA 1OLAA 2Q2AA 3ONMA 1GGGA 2PX1A 2VHAA 1TH3A 4GKKM 2H1RA 3H06B 3BKIB 4F3GA 3LSLA 2G5GX 4DV3M 4LJAA 1DSNA 1POTA 4ELQA 2KW0A 5KPRA 2OBGA 2F5QA 3O9PA 4DR3M 3M7GA 3O6HA 2CHGA 4NXNM 1MY3A 3THIA 2V25A 5A5XB 1JEUA 2Z23A 5F1QA 3Q27A 4IBFA 5JEIA 1NKXA 4LJ8A 3MK6A 3D4CA 2F7CA 3C34A 5EHSA 2I49A 3O6IA 1GL7A 3BFTA 4OU7A 4W5WA 3PU5A 3LMMA 3CTWB 3HO7A 1MXUA 4IBGA 3HJ8A 3GRVA 1RYOA 3U61B 4N13A 2REGA 4O3AA 4QSDA 5FHOA 3H6WA 2BJVA 1UIVA 2C98A 4I1DA 3LQRA 1OJLA 1BKAA 2HAUA 5JI2E 3GLGB 3GLHA 3N26A 4IGTA 3TPAA 2OCUA 2L7HA 4M9SA 4POWA 1Q35A 3UORA 1SXJB 1I6BA 1A54A 1MM6A 1L5TA 3CF2A 1LSTA 3U1OA 4DR2M 2WKYA 3SBJA 3ODBA 3IR1A 1PJIA 3K2DA 4DV0M 1GV8A 5CMKA 4DUZM 2QBYA 1QULA 5LMNM 3PGFA 3VXCA 1B40A 1O7TA 4IO7A 5I56B 1E94E 4QFOA 4JWYA 1Y3NA 3I3VA 3S4UA 4X48A 1EZ9A 2CHVA 2R46A 3DELB 1Q39A 3FVOA 3AFHA 2Y7KA 4H5GA 1NVMA 1B1HA 1QVRA 1N36M 2Z4RA 3PUYE 4QNRA 1KWHA 4M4GA 3G3KA 4C1TA 4LF8M 3ZC7B 1M5DA 4G8MA 2R6GE 2HL7A 3ECRA 1N75A 3RFWA 3FGSA 3CFZA 4IO4A 5C1BA 1NNTA 2KXEA 2DWHA 2FE8A 3PMXA 1EE8A 1XXHA 3OOAA 3PMWA 2XXWA 4LUBA 2RGHA 4M1VA 5ITYA 3MC2A 4N07A 4LJ7A 1M5FA 2DXIA 3TCHA 4OHNA 2DE4A 5TU0A 3PNVA 1JW1A 7CATA 4BDMA 3C4MA 3LVVA 3C9HA 3BBRA 1XMQM 2DYXA 3JR5A 3GLFB 1QYRA 1R2ZA 4L4UA 4U1OA 5FTNA 1LB9A 4II7A 4IO2A 1NHGC 4B3MM 3FUZA 4F22A 4PFTA 4NMYA 3FD3A 4IY5A 5DVFA 4IBEA 1FTLA 2ZNTA 3D8LA 3GO8A 3IG5A 4B7GA 1LAGE 1B7UA 2KRUA 3W9VA 3FZVA 4ELRA 2XXHA 4NF5B 4JXJA 4DV1M 3UN6A 4LQ5A 4U1ZA 4OMBA 1AIVA 4H1XA 2EA0A 3THGA 4OFOA 3IOTA 4AG6A 3ILTB 3GRYA 1NNKA 2LXEA 2XXIA 3Q26A 3A46A 2E1SA 2I48A 4DV7M 4DV5M 1Y1MA 3EHSA 4BDOA 3EHUA 1Z5BA 3MP8A 4I8CA 1IBLM 2Q9TA 3U8QA 2UXBM 3FUWA 3IB0A 1NNUC 1E9SA 3SMSA 1URDA 3PPOA 5H37D 1OVBA 2AIXA 5H8QA 1H45A 1FW0A 1Q3BA 1Z7ME 1TH4A 4QFLA 5ITRA 3FVKA 1USYE 1XT8A 4TUWA 4YICA 2I3VA 1JETA 4GIZA 4R75A 3MAMA 4R72A 3OENA 4GF8A 4PQJA 3OELA 3GPXA 5IZ7D 1OIBA 3AXFA 5CC2A 3HJSA 4G4QA 1T3TA 2ZM6M 5TP9A 5CMMA 5KPZA 2D7HA 3L2AA 2O6AA 3QSLA 3RPWA 1I6AA 5HM4B 4Z7EA 3RGYA 1QZMA 2XXUA 1IM2A 1D9YA 4KO8A 1CB6A 1MXWA 2THIA 4YKJA 1B3HA 2QMWA 1SYIA 3GLIB 2RC7A 4R6HA 2HFBA 3HWSA 2W7YA 4KD5A 4BLAA 4OW0A 3GQ4A 4U2RA 4IB2A 3OO7A 1B3LA 1GLNA 2Y7IA 3FD9A 2O5RA 3KN3A 4LFCM 3SFZA 1TXFA 2QSXA 2QS1A 4F2QA 1ANFA 4NF4A 2Y7PA 1DTGA 3U5ZA 3U6PA 4CGYB 1BLFA 1DO2A 5ITQA 5AA2A 2F34A 4RA1A 1H43A 4PD2A 2YQZA 3LVWA 1LB8A 1A99A 1P99A 2H25A 2RKOA 4GHLA 4WURA 4IBDA 1MY2A 2DVCA 1G41A 1OFIA 4I4LA 1RYXA 5M2VA 1LAHE 4G6ZA 4X62M 4REZA 1L1TA 2H9BA 1A55A 1R2YA 3RTFB 5ITOA 3PXGA 1S3SA 4ZDMA 2XD3A 4RYAA 1DGHA 1PB9A 2D5WA 4IO6A 3UGWA 1LFIA 3TTMA 2NOOA 3VK7A 1HNWM 1DGFA 5I2NB 2I7NA 1QW0A 2AL5A 1QKAA 1TWYA 4LJ6A 1GVCA 3WAFA 2E5LM 3EIHA 4LG2A 3FTCA 3KP1E 1URSA 2PVUA 4LGMA 4XKPA 4E0XA 1HSLA 2O69A 2PT1A 4Q0CA 5AA4A 3DOAA 1A8FA 4PFYA 4RF0A 3HU1A 5I2KA 5B70A 4EQBA 3RN8A 5IT9S 5EYFA 4NF8A 2CUZA 3HPIA 4NXMM 1MG1A 3MVZA 4KYDA 2O7IA 1B6HA 4G2ZA 1B32A 2QENA 4U21A 5ITXA 3K6VA 2LH0A 4MB7A 1GL6A 3QWLA 3CSBA 2HCAA 2Z22A 4LJ9A 3WAEA 1IXHA 2DSFA 3U6OA 2OPFA 3R9XB 5DNYA 3LSXA 4NF6B 1R9LA 4XKNA 4AKGA 2BJJX 4TQUQ 2O7UA 3MP1A 3LBSA 3U6LA 1B5IA 1NH7A 2DS9A 1Y4TA 2HEUA 4IBJA 1IBKM 4JYAM 2IA4A 1X37A 3PUZE 2XSZA 4JV5M 2XGNA 3H03A 5F3WA 4L78A 3GBBA 4DUYM 1VFDA 3J27B 2F4VM 3O29A 3FKEA 1D2NA 3C36A 3SAUA 3TAJA 4FATA 1HSEA 1ZJLA 3Q28A 2KZSA 3U72A 2O84X 3QIMA 4F3PA 3UGJA 3TQWA 3KOXE 4PP0A 4NWDA 5L9SA 3V83A 1VE4A 4GRKA 3A09A 1TH2A 4DXBA 1GTKA 4OYVA 2CHQA 1N7XA 4YB5A 1IIWA 4I8OA 1AL3A 2H99A 5H8HA 5FTLA 4X9TA 4YKIA 3ZKKA 2ZBKB 2F7BA 3QK6A 5CMBA 2Y20A 5DVJA 3DM0A 4DR1M 2NQ8C 3LR1A 2E0SA 3TTRA 4FE8A 4ZZEA 1SBPA 2KRKA 2KA6B 5CBRA 3VLUA 1IQ7A 5EP4A 4FIMA 4FORA 1Z7NE 4G77A 1ZBMA 4HL4A 5TPAA 4KCCA 3PPNA 1YPNA 4ZPXA 4HCYA 4M0WA 2GH9A 3W15C 2CE7A 2DWZB 4PT5A 4F19A 2V1UA 3T9UA 2UU9M 3B6WA 1B9JA 4E0WA 5BPVA 3K2LA 1NJFA 4B3TM 3PFIA 3PPPA 4LVQA 2C99A 3JZJA 3TCGA 3IO4A 3DP8A 4AG5A 3FVNA 1SXJE 3VFJA 5CMCA 3AOGA 4K0KM 2D21A 1FQDA 1SYHA 3KS4A 4GD5A 4GL8A 1SW4A 2A5TA 1NNFA 1IXCA 3HHXA 2Q2CA 3IJOB 4EF2A 2Y21A 4AB6A 4MGKE 3SESA 2UXDM 1B58A 4X1BA 4XBOA 1MRPA 3OO6A 4MM3B 3T93B 3TQSA 1JQFA 3HN0A 3HHYA 4OVJA 1PC3A 2ZXTA 2P5TA 2V3TA 2R71A 3DA1A 1IXZA 3C32A 3R6UA 3UZUA 5KQDA 4AB5A 4OVZA 4OESA 4Q30B 4QRZA 3FTFA 1MQHA 3RLFE 5FHNA 4NEDA 2JA2A 1N76A 3KOSA 4NRVA 4EXLA 5IAIA 4QFNA 2V84A 3H3GA 3U6MA 3T96B 3IJXB 2XX8A 5KCJB 1Q1KA 3LQQA 2RF1A 3RT6B 3T38A 3KSJA 1FQBA 4OEUA 5BR8M 3TCFA 2XX9A 4QSEA 3TKDA 1R6ZA 5KQ8A 4F39A 3MZ1A 4GIPA 3VDUA 4U23A 2M5ZA 1M5CA 4DR7M 5H8NA 1WVJA 4MGHA 4AI6A 4G68C 2O1MA 4ZS9A 3IO6A 2Q88A 2A5SA 4IO5A 1J5EM 3H6VA 3OSRA 2J7OA 3MUQA 5IREB 4MGIE 1N32M 2PMSA 2DE2A 2RC9A 3KOZE 2G8LA 1ZMGA 3A98B 3EHTA 3KOTA 3KFMA 4HCWA 1N7WA 3G3IA 3WHKA 4JSDA 3FTDA 4CHTB 4DV2M 4KCDA 4DE8A 4EQ9A 4GHAA 1P1UA 4DXUA 1B0LA 3PPRA 5I58B 4QF9A 4QSCA 3RGPA 2DWIA 2C9CA 4GRIA 3S9EA 3TYHA 1IITA 1HNXM 4F1YA 2HQ0A 3U94A 1UTHA 2V6ZM 2F5OA 1QJMA 2RCAA 1PB8A 4ZEKA 2A5TB 3SAWA 3T9HB 3ILKA 4DR4M 4YHHM 1MPCA 5ISUA 3GPPA 4UA8A 4ND9A 4ZEBA 3SEVA 3SKPA 3D8BA 3TTLA 2H4IA 2ANJA 3KJ7A 4ELPA 1LAFE 3FXUA 4LONB 1FNNA 4GWOA 4R73A 3CFLA 4LATA 1OQGA 4QHTA 4BDNA 3K8ZA 5EXTA 3N94A 1TDHA 3J80S 2VOZA 3SAVA 3U6QA 3FUTA 3KFUG 3OEMA 3KZGA 1XHBA 4Q5TA 2QPAA 3VV5A 1OVTA 1SW5A 2Z8DA 2I6EA 1MH4A 4G68A 2I0BA 4X64M 4R3DA 1AH5A 2NXOA 3HKPA 2ZMBA 3DZDA 3GZGA 2QZ4A 1Q3CA 3AV0A 4ESXA 2Q89A 4YZZA 3MPLA 2XXPA 1LCFA 4HW8A 2R18A 4GMQA 2DE3A 1QAOA 1UQWA 3CSGA 4RNSA 3V8XB 4G4OA 4LF5M 4FCVA 3TPZA 1JW4A 3K01A 4YKPA 1NH8A 5DYHA 4I62A 1N34M 3H7MA 5CM6A 3A45A 1II5A 4KQPA 1IXSB 1N77A 3RTWB 3HU3A 4BDRA 3GBAA 5H8SA 3QAUA 5AA2D 3NWLA 4NOOB 3TQLA 4HTGA 1XVYA 1WODA 1GKIA 1FQEA 2EO2A 4LRSA 3JYRA 4LGYA 2R9JA 5KDTA 3A3CA 1D3KA 1J7KA 3T66A 2XXRA 1MPBA 4R7GA 4YU0A 1J1NA 4FW9A 1QANA 3R26A 4X1DA 3FYDA 3G3HA 3J7AS 1H76A 1YE9A 3GLHB 5DT6A 1B7ZA 4IO3A 1NMUA 1I69A 2YFQA 5I57A 4DXCA 1YAEA 2HXWA 1HT2E 5KPTA 2B3BA 5I59A 2M8CA 2Q8JA 4K3FA 4KODA 3M3LA 3U92A 3EIEA 3F11A 3K1JA 3B6QA 1YTVA 2HZLA 2Z8FA 4YKKA 2W82A 4L8RC 4BLCA 4G8HA 5EJCA 2QBYB 2XD2A 1B4ZA 1MQJA 1VDDA 3QUFA 3R7XA 4M9XA 1MU5A 2DWNA 4AQ4A 1MX0A 4IBBA 5LOMA 1ZIUA 3S9LC 1QQWA 4NRWA 2GFEA 3OD7A 3SC3A 3PD9A 1ELJA 3VKGA 3LSFB 3EPEA 5E6JA 3IL1B 1FCKA 3FASA 5AA3A 2UXCM 4WXJA 1VSOA 1XXHB 2F6PA 1SQYA 4G4PA 5DYIA 1A7LA 1N3WA 1PB7A 4TLLB 4AKHA 3ZH9B 1ATGA 3B6TA 2R45A 3E3KA 2I4CA 1XMOM 4QFPA 1WDNA 3FJ7A 3O2AA 2IEEA 3L25A 4QOSA 3H4MA 1PEBA 2PYYA 2XSZD 3T9VA 4FAJA 2UVIA 1IN7A 1ZLQA 4H67A 1NL5A 4QHQA 5DYGA 4EIWA 4QNMA 1E32A 4RPNA 2VGQA 4LY6A 1FTOA 2UUBM 4M0DA 4GQOA 1DOTA 4F29A 2NWJA 4ZEIA 2AL4A 5JTYA 3OO8A 2F5XA 4LRTA 2V3QA 2FYIA 2I4BA 2QCUA 4KHPM 1UTBA 4JBZA 2ZAMA 1BIYA 1QUJA 3KG2A 4MGZE 4GH9A 1OFHA 3FUUA 3W9WA 2Z3XA 1XNRM 2UVHA 1EU8A 2X26A 1OLCA 4L16A 4PDIA 1DPEA 3P7IA 5I59B 3RT8A 1K3WA 4B3RM 3SARA 5H8QB 4Z8XA 3IOUA 1IUDA 5EP3A 2Z4SA 3WHLA 3TDJA 3D4GA 4TOZA 1MY0A 4LF7M 1R1NA 1URGA 4GC9A 5K2YA 4LJ4A 5J1DA 3DP6A 3O66A 5HPQA 3HHWA 2ERCA 3GRUA 5H8FA 5L9OA 3JR4A 1MS7A 5FSWA 1Y4CA 2Z8EA 5IKBA 1B5JA 3TUSA 4BDLA 3FVGA 3M3KA 5ICQA 1IN6A 2FNCA 5TP9B 3T9XB 5ITUA 3GQ5A 5EXPA 4AQYM 4R6KA 1PM5A 4JI6M 1EH3A 4WEPA 3VVEA 4EF1A 1R6BX 3OO9A 1FQFA 1JEVA 1JR3A 3QUJA 2XFSA 3U60A 2RC8A 2UVGA 1XWIA 3SYKA 4XIGQ 2XXQA 4RNAA 4OEVA 4GC5A 4ECFA 2OZZA 3CF6E 3IOWA 4ZEFA 1S7YA 2DWJA 3E9SA 3KN7A 2HAVA 1L2BA 1BTJA 3L26A 4WEDA 4LF4M 1MQGA 4I9DA 3H4ZA 3MVYA 3CG1A 4NF4B 1GVNA 3W0LB 3ILUB 3USDA 2OWTA 3U5ZB 3MJ5A 3IX1A 4QOZC 2G93A 4DR6M 1B52A 2AYSA 2VQEM 4RJZA 5AA2B 1ZKBA 2XXXA 4DCYA 3I4VA 4GVOA 3U6DA 4M9ZA 4FECA 3U6CA 2B3FA 1XNQM 2OLBA 5DEXA 4LFAM 1N0TA 3CVGA 4LF6M 4PDGA 3KS8A 4F3SA 1D4NA 4IBIA 2F6GA 4OQOA 4EUOA 3B9PA 2ZNSA 4I81A 1HQCA 1QKBA 4DCXA 3K6WA 2O1LA 3AL0C 1UIUA 1DGGA 2XXVA 3MVWA 4LZ7A 3FUVA 1SXJC 1G3IA 1MXZA 3K6XA 4KI0E 3Q25A 3SEUA 2LWXA 2F97A 5CRYA 1DGHB 4MF3A 4D80A 3V5AA 2ZYNA 3HCQA 1ZU0A 1B1XA 4IJFA 5FTJA 4U22A 3C58A 1NHWC 3TL4X 1US5A 2R4JA 3GPUA 1LV7A 4RY1A 4ITQA 3MJNA 2Y7RA 3IOVA 1IXRC 2DP8A 5AA4B 1Y9UA 4GFRA 5I2KB 2FA7A 3SETA 1IZ1A 4IGRA 3SATA 5A5XA 1Y3QA 4NF8B 2XF3A 3UK4A 2C5RA 1FJGM 4ZEDA 4DR5M 4JN6A 1PDAA 3FJMA 5AE4A 4JI8M 2P2AA 2XXTA 4U4SA 2GRVA 1J09A 4B7HA 4F3BA 1NY6A 3U61A 3FJGA 3I6VA 1IY1A 4FWDA 4LZ5A 3ZCBB 4N6PA 3N6UA 3E9XA 4THIA 2KEBA 3PMVA 3RY3A 4F1VA 4R2BA 4DIGA 2Y0TA 1SI0A 2QRYA 4S12A 3GLGA 4GOTA 1ZTYA 1YUBA 5JI3E 4YB6A 1P1QA 4H0WA 1SXJA 3FTEA 5B7DA 1N78A 5A2QS 1W5SA 1O63A 3TE6A 4FWHA 2R65A 4GL0A 3MP6A 3L29A 1Y20A 2F78A 3IAZA 1IXGA 4JI1M 3OXNA 3JAMS 2F5NA 3MBPA 5FLXS 1I6QA 2I0CA 5I56A 2F36A 2X7PA 1DTZA 2RINA 1QUIA 3HHGA 2UVJA 3TWKA 3SERA 2YJPA 1S50A 2KZUA 2R62A 3J7BA 4B08A 4YAHX 3GRRA 2QS4A 2DWLA 3KP0E 4MH0E 3PVSA 3BOSA 2F7AA 5EHMA 4OXVA 5H8HB 3HU2A 2NVUB 1MPDA 1F9BA 4AKIA 4RK9A 4IBCA 2K47A 3FV1A 1MY1A 3FV2A 1ORYB 1HT1E 2F5PA 4JSOA 5KZTA 3VDPA 2QS3A 3FYCA 1FQCA 4GXSB 1NY5A 1P1NA 1P1OA 4PFUA 3K1MA 1B2HA 1YCJA 2BNKA 3OTOM 4LZ8A 5KO3A 4YB7A 1ZQ9A 2YPNA 2ZAOA 4RF1A 5DTBA 3UMMA 5TPAB 3ZKLA 4CISA 1M5BA 3GLFA 4XKRA 2QP9X 1R7RA 4LCBA 3RGSA 1LGBC 4L17A 4POXA 4HLQA 1B46A 4RK2A 5HBCA 2YR0A 1MDP1 4LZJA 1ZAEA 2I7PA 4P0GA 3M0EA 4NF5A 1YSYA 3HV1A 3K4UA 1Y3PA 3GXAA 2CV1A 1B05A 1FQAA 1E9RA 5FTIA 4BDQA 1JQJC 3EF7A 1SVXB 1SW2A 3UP9A 2DZNB 3QYTA 2YLNA 2F5SA 3KEIA 1XVXA 2OK2A 3IORA 3K00A 4BBAA 1B3EA 3VVFA 1IN4A 4G8NA 4YMBA 3CIJA 4D81A 4IJEA 1LBCA 3SEYA 1EZOA 3HHFA 3ZSFA 5BUUA 1W5TA 2HCBA 1IN8A 2GHBA 4JI2M 2RCBA 3UJNA 1O64A 1VFEA 3OEKA 5JK4A 3DP4A 3TWMA 3CI8A 3T22A 1I4WA 1TT1A 2ESNA 2HHHM 4FEBA 2Y84A 1P1WA 4OVZB 4NSRA 1SI1A 2DOJA 4O3BA 3IK6B 3MZBA 4C1UA 3QXMA 3TZAA 4R9FA 4XGIA 1HNZM 3LSWA 4ZE9A 2ZYOA 2F35A 2XEPA 3PNYA 2O51A 3FIRA 5ELVA 1DO0A 4X65M 3I51A 2UYEA 1US4A 1CE2A 3MVXA 3GLBA 3KOYE 2YNMD 1IXIA 2NUVA 3IB2A 1G4AE 1B0HA 4B7FA 1IBMM 1GR2A 2FFJA 5H8NB 4R74A 4EDPA 5ICTA 5FTHA 3GP1A 4TLMB 2L6OA 4EXKA 1PBQA 3TFLA 1LAXA 1I94M 1KSFX 4B3SM 3GLIA 2VD2A 3A3UA 2CZLA 5IWAM 2CV0A 2Q2EB 1AMFA 3M8UA 2I3WA 2REJA 3HJQA 3K1PA 2ZYKA 3SEWA 3HGIA 2PBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISU A;  4OFJ A;  3C35 A;  5I84 A;  3PUX E;  3K02 A;  4P11 A;  4KHZ E;  3BFU A;  4PET A;  3SDF A;  4HS7 A;  3RNN A;  1UTH B;  2VD3 A;  4XTC Q;  4OZ9 A;  2RKM A;  2DVZ A;  3O28 A;  3KN8 A;  2ONR A;  2V93 A;  2QJE A;  1LFG A;  4KR5 A;  4JWX A;  3L6G A;  2P1S A;  2H98 A;  1XC1 A;  2UYF A;  2UXA A;  1DPP A;  4P0I A;  3PUV E;  3IB1 A;  3SEX A;  4G68 B;  3TMG A;  5I2N A;  1IEJ A;  3OMB A;  2ABH A;  3CG3 A;  4H6D A;  5K2X A;  3L6H A;  1QVS A;  3N6T A;  1B3F A;  3S9M C;  3EN3 A;  1HSJ A;  2ZNU A;  3M3F A;  4O3C A;  3C31 A;  1B51 A;  1R9Q A;  4EQ7 A;  1N04 A;  3TTN A;  2CMO A;  4JB7 A;  3PUW E;  4MLQ A;  4C0R A;  3EQ1 A;  4F18 A;  2QS2 A;  4ESW A;  4MBP A;  3FAT A;  1POY 1;  1Y1Z A;  1D9V A;  2HZK A;  2B65 A;  4H65 A;  4NF6 A;  1LBB A;  3TOD A;  5BWJ A;  1SW1 A;  2G29 A;  3KJT A;  3VLW A;  5KDT B;  3I5O A;  4ONY A;  4Z0I A;  1FTK A;  5ITP A;  3E4R A;  3VDF A;  4R6Y A;  5CI5 A;  3TEP A;  2V3U A;  1OQH A;  1MXV A;  4R2F A;  4ZEC A;  5I57 B;  3PD8 A;  4OET A;  1S9T A;  2F8D A;  4KFQ A;  3VE1 B;  3KBR A;  3RUM A;  4NE4 A;  3Q29 A;  3V89 B;  2LAO A;  3K0V A;  3OSQ A;  2QL3 A;  5L8D A;  4OFL A;  1SDX A;  4LP2 B;  5L9M A;  5AA1 A;  1JW5 A;  4U4X A;  4ZZA A;  4MLV A;  1XS5 A;  3O6G A;  3HST A;  1SD3 A;  4OER A;  3LC8 A;  1VR5 A;  4KYE A;  1JVX A;  2O68 A;  1B5H A;  4GXA A;  1B7H A;  5DVI A;  2VP1 A;  4F31 B;  1AOV A;  3G7W A;  5F7V A;  4RPO A;  3QAX A;  3E13 X;  3MPK A;  4R9G A;  1QUK A;  1LLS A;  4OEN A;  1MY4 A;  3LUY A;  2XX7 A;  2DXY A;  3G3G A;  1H3D A;  1A8E A;  4KYS A;  3H6U A;  2KLF A;  4NTL A;  1PBP A;  1XHY A;  3VLV A;  3O97 A;  2ONK E;  4LA9 A;  3KSX A;  1T0K A;  5JTY B;  4JDF A;  4H8J A;  2OWS A;  1MM7 A;  2ZYM A;  1TFA A;  3G3F A;  1UTB B;  5CBS A;  1M5E A;  4H5F A;  4QFK A;  3U93 A;  2XXY A;  1B4H A;  1LCT A;  4GLI A;  4MFI A;  3H6T A;  1MQI A;  4OWD A;  3MQ9 A;  4JXI A;  5KCJ A;  4FED A;  4NWC A;  4Q8R A;  4RXL A;  4IY6 A;  4XXU A;  3MWB A;  1USY H;  3B7D A;  5H8F B;  3G3J A;  1FTJ A;  2ONS A;  3K1N A;  4F1U A;  5FHM A;  4PFW A;  2DXR A;  1MXX A;  4OTE A;  3ZS6 A;  3DLN A;  3JV9 A;  4LQ2 A;  3UIF A;  2DQV A;  3FXR A;  1OMP A;  4MH5 A;  2X7Q A;  3FXQ A;  3CR9 A;  3K6U A;  1H44 A;  2P0S A;  4FJP A;  1FTM A;  1NFT A;  2XHD A;  3KGC A;  4DDD A;  5I58 A;  4DLD A;  2Y7W A;  3N5L A;  2QPQ A;  4WKM A;  1NNP A;  4XKQ A;  2OJT A;  1LFH A;  3CRB A;  4YMA A;  1MQD A;  2I58 A;  3MZ9 A;  1N84 A;  1JVY A;  1XOC A;  3UA8 A;  1RKM A;  5DEX B;  2PT2 A;  4ZE8 A;  1TFD A;  4DZ1 A;  2DWA A;  3MW0 A;  3C33 A;  3TTK A;  3VVD A;  4ELO A;  4UAC A;  1MH3 A;  3S2V A;  1MXY A;  1DMB A;  2D3I A;  2H5Y A;  4H8I A;  1BP5 A;  3PPQ A;  2QMX A;  1A40 A;  3PV0 E;  2ALU A;  3VXB A;  3TEL A;  1JNF A;  4F2O A;  1MDQ A;  3RQT A;  4JWO A;  2GHA A;  4PE5 B;  4KPT A;  1EZP A;  1B3G A;  3S9N C;  1N3X A;  1OLA A;  2Q2A A;  3ONM A;  1GGG A;  2PX1 A;  2VHA A;  3H06 B;  3BKI B;  4F3G A;  3LSL A;  1DSN A;  1POT A;  4ELQ A;  2OBG A;  3O9P A;  3O6H A;  1MY3 A;  5A5X B;  2V25 A;  3THI A;  1JEU A;  2Z23 A;  5F1Q A;  3Q27 A;  5JEI A;  1NKX A;  3D4C A;  2F7C A;  3C34 A;  5EHS A;  2I49 A;  3O6I A;  3BFT A;  3PU5 A;  3HO7 A;  1MXU A;  1RYO A;  4N13 A;  2REG A;  4O3A A;  4QSD A;  5FHO A;  3H6W A;  1UIV A;  4I1D A;  1BKA A;  2HAU A;  3N26 A;  4IGT A;  3TPA A;  2OCU A;  4POW A;  1Q35 A;  3UOR A;  1I6B A;  1A54 A;  1MM6 A;  1L5T A;  1LST A;  3U1O A;  2WKY A;  3ODB A;  3IR1 A;  3K2D A;  1GV8 A;  5CMK A;  3PGF A;  1QUL A;  3VXC A;  1B40 A;  1O7T A;  4IO7 A;  5I56 B;  4QFO A;  4JWY A;  1Y3N A;  3I3V A;  3S4U A;  4X48 A;  1EZ9 A;  3DEL B;  3FVO A;  2Y7K A;  4H5G A;  1B1H A;  3PUY E;  1KWH A;  4M4G A;  3G3K A;  4C1T A;  1M5D A;  4G8M A;  2R6G E;  3ECR A;  3FGS A;  3CFZ A;  4IO4 A;  1NNT A;  2DWH A;  3PMX A;  3OOA A;  3PMW A;  2XXW A;  4LUB A;  4M1V A;  3MC2 A;  4N07 A;  1M5F A;  3TCH A;  4OHN A;  2DE4 A;  5TU0 A;  1JW1 A;  4BDM A;  3C4M A;  3C9H A;  3BBR A;  2DYX A;  4U1O A;  1LB9 A;  4IO2 A;  3FUZ A;  4F22 A;  4PFT A;  4NMY A;  3FD3 A;  4IY5 A;  5DVF A;  1FTL A;  2ZNT A;  1LAG E;  1B7U A;  3W9V A;  3FZV A;  4ELR A;  2XXH A;  4NF5 B;  3UN6 A;  4LQ5 A;  4U1Z A;  4OMB A;  1AIV A;  4H1X A;  4OFO A;  3IOT A;  3ILT B;  1NNK A;  2XXI A;  3Q26 A;  2E1S A;  2I48 A;  1Y1M A;  3EHS A;  4BDO A;  3EHU A;  3MP8 A;  4I8C A;  2Q9T A;  3U8Q A;  3IB0 A;  1URD A;  3PPO A;  1OVB A;  2AIX A;  5H8Q A;  1H45 A;  1FW0 A;  1Z7M E;  4QFL A;  3FVK A;  1USY E;  1XT8 A;  4YIC A;  2I3V A;  1JET A;  4GIZ A;  4R75 A;  3MAM A;  4R72 A;  3OEN A;  4GF8 A;  2PBW A;  4PQJ A;  3OEL A;  1OIB A;  3AXF A;  5CC2 A;  5TP9 A;  5CMM A;  2O6A A;  3QSL A;  3RPW A;  1I6A A;  5HM4 B;  4Z7E A;  3RGY A;  2XXU A;  1D9Y A;  1CB6 A;  1MXW A;  2THI A;  4YKJ A;  1B3H A;  2QMW A;  1SYI A;  2RC7 A;  4R6H A;  2HFB A;  2W7Y A;  4KD5 A;  4BLA A;  4U2R A;  4IB2 A;  3OO7 A;  1B3L A;  2Y7I A;  3KN3 A;  1TXF A;  2QSX A;  2QS1 A;  4F2Q A;  1ANF A;  4NF4 A;  2Y7P A;  1DTG A;  1BLF A;  5AA2 A;  2F34 A;  4RA1 A;  1H43 A;  1LB8 A;  1A99 A;  1P99 A;  2H25 A;  1MY2 A;  2DVC A;  1RYX A;  5M2V A;  1LAH E;  2H9B A;  1A55 A;  3RTF B;  5ITO A;  4ZDM A;  2XD3 A;  4RYA A;  1PB9 A;  2D5W A;  4IO6 A;  3UGW A;  1LFI A;  3TTM A;  2NOO A;  5I2N B;  2AL5 A;  1QW0 A;  1QKA A;  1TWY A;  1GVC A;  3WAF A;  1URS A;  2PVU A;  4XKP A;  4E0X A;  1HSL A;  2O69 A;  2PT1 A;  4Q0C A;  5AA4 A;  1A8F A;  4PFY A;  5I2K A;  5B70 A;  4EQB A;  3RN8 A;  5EYF A;  4NF8 A;  3HPI A;  1MG1 A;  3MVZ A;  4KYD A;  2O7I A;  1B6H A;  4G2Z A;  1B32 A;  4U21 A;  3K6V A;  3CSB A;  2HCA A;  2Z22 A;  3WAE A;  1IXH A;  2DSF A;  3LSX A;  4NF6 B;  1R9L A;  4XKN A;  2BJJ X;  4TQU Q;  2O7U A;  3MP1 A;  3LBS A;  2DS9 A;  1B5I A;  1NH7 A;  1Y4T A;  2HEU A;  2IA4 A;  3PUZ E;  3H03 A;  3GBB A;  1VFD A;  3O29 A;  3C36 A;  3TAJ A;  4FAT A;  1HSE A;  1ZJL A;  3Q28 A;  3U72 A;  2O84 X;  3QIM A;  4F3P A;  3TQW A;  4PP0 A;  4NWD A;  5L9S A;  3V83 A;  4GRK A;  1VE4 A;  3A09 A;  4DXB A;  1GTK A;  4OYV A;  1N7X A;  4YB5 A;  1IIW A;  1AL3 A;  2H99 A;  5H8H A;  4X9T A;  4YKI A;  3ZKK A;  2F7B A;  3QK6 A;  5CMB A;  5DVJ A;  3DM0 A;  3LR1 A;  2E0S A;  3TTR A;  4FE8 A;  4ZZE A;  1SBP A;  5CBR A;  3VLU A;  1IQ7 A;  4FIM A;  4FOR A;  1Z7N E;  4G77 A;  1ZBM A;  5TPA A;  4KCC A;  3PPN A;  1YPN A;  4HCY A;  2GH9 A;  3W15 C;  4F19 A;  3T9U A;  4E0W A;  3B6W A;  1B9J A;  3PPP A;  4LVQ A;  3JZJ A;  3TCG A;  3IO4 A;  3DP8 A;  3VFJ A;  3FVN A;  5CMC A;  2D21 A;  1FQD A;  1SYH A;  4GD5 A;  4GL8 A;  1SW4 A;  2A5T A;  1NNF A;  1IXC A;  2Q2C A;  3IJO B;  4EF2 A;  4AB6 A;  3SES A;  1B58 A;  4X1B A;  1MRP A;  3OO6 A;  3T93 B;  1JQF A;  3HN0 A;  4OVJ A;  1PC3 A;  2ZXT A;  2V3T A;  2R71 A;  3C32 A;  3R6U A;  4AB5 A;  4OES A;  4Q30 B;  4QRZ A;  1MQH A;  3RLF E;  5FHN A;  4NED A;  1N76 A;  3KOS A;  5IAI A;  4EXL A;  4QFN A;  2V84 A;  3H3G A;  3T96 B;  3IJX B;  2XX8 A;  5KCJ B;  1Q1K A;  2RF1 A;  3RT6 B;  3KSJ A;  1FQB A;  4OEU A;  3TCF A;  2XX9 A;  4QSE A;  3TKD A;  1R6Z A;  4F39 A;  3MZ1 A;  4U23 A;  1M5C A;  5H8N A;  1WVJ A;  4G68 C;  2O1M A;  4ZS9 A;  3IO6 A;  2Q88 A;  2A5S A;  4IO5 A;  3H6V A;  3OSR A;  3MUQ A;  2PMS A;  2DE2 A;  2RC9 A;  1ZMG A;  3EHT A;  3KOT A;  3KFM A;  4HCW A;  1N7W A;  3G3I A;  4JSD A;  4KCD A;  4EQ9 A;  4DE8 A;  1P1U A;  4DXU A;  1B0L A;  3PPR A;  5I58 B;  4QF9 A;  4QSC A;  2DWI A;  3S9E A;  3TYH A;  1IIT A;  4F1Y A;  2HQ0 A;  3U94 A;  1UTH A;  1QJM A;  2RCA A;  1PB8 A;  4ZEK A;  2A5T B;  3T9H B;  1MPC A;  5ISU A;  3SEV A;  4UA8 A;  4ND9 A;  4ZEB A;  3SKP A;  3TTL A;  2H4I A;  2ANJ A;  3KJ7 A;  4ELP A;  1LAF E;  3FXU A;  4LON B;  4GWO A;  4R73 A;  3CFL A;  4LAT A;  1OQG A;  4BDN A;  3N94 A;  2VOZ A;  3OEM A;  3KZG A;  4Q5T A;  3VV5 A;  1OVT A;  1SW5 A;  2Z8D A;  2I6E A;  1MH4 A;  4G68 A;  2I0B A;  1AH5 A;  2NXO A;  2ZMB A;  3GZG A;  4ESX A;  2Q89 A;  4YZZ A;  3MPL A;  2XXP A;  1LCF A;  4HW8 A;  2DE3 A;  1UQW A;  3CSG A;  4RNS A;  3V8X B;  1JW4 A;  3K01 A;  4YKP A;  1NH8 A;  5DYH A;  4I62 A;  3H7M A;  5CM6 A;  1II5 A;  4KQP A;  3RTW B;  4BDR A;  3GBA A;  5H8S A;  5AA2 D;  3TQL A;  4HTG A;  1XVY A;  1WOD A;  1FQE A;  3JYR A;  2R9J A;  5KDT A;  3A3C A;  1D3K A;  3T66 A;  2XXR A;  1MPB A;  4YU0 A;  1J1N A;  3R26 A;  4X1D A;  3G3H A;  1H76 A;  5DT6 A;  1B7Z A;  4IO3 A;  1NMU A;  1I69 A;  5I57 A;  4DXC A;  1YAE A;  2HXW A;  2B3B A;  5I59 A;  2M8C A;  2Q8J A;  4K3F A;  3M3L A;  3U92 A;  3F11 A;  3B6Q A;  1YTV A;  2HZL A;  2Z8F A;  4YKK A;  4G8H A;  2XD2 A;  1B4Z A;  1MQJ A;  3QUF A;  3R7X A;  4AQ4 A;  5LOM A;  1ZIU A;  3S9L C;  2GFE A;  3OD7 A;  3PD9 A;  1ELJ A;  3LSF B;  3EPE A;  3IL1 B;  1FCK A;  3FAS A;  5AA3 A;  4WXJ A;  1VSO A;  2F6P A;  1SQY A;  4G4P A;  1A7L A;  1N3W A;  1PB7 A;  4TLL B;  1ATG A;  3B6T A;  3E3K A;  2I4C A;  4QFP A;  1WDN A;  3FJ7 A;  3O2A A;  2IEE A;  1PEB A;  2PYY A;  3T9V A;  4FAJ A;  2UVI A;  1ZLQ A;  4H67 A;  1NL5 A;  4QHQ A;  4RPN A;  2VGQ A;  1FTO A;  4GQO A;  1DOT A;  4F29 A;  2NWJ A;  4ZEI A;  2AL4 A;  5JTY A;  3OO8 A;  2F5X A;  2V3Q A;  2FYI A;  2I4B A;  1UTB A;  4JBZ A;  1BIY A;  1QUJ A;  3KG2 A;  3W9W A;  2UVH A;  1EU8 A;  2X26 A;  1OLC A;  1DPE A;  3P7I A;  5I59 B;  3RT8 A;  5H8Q B;  3IOU A;  1IUD A;  3TDJ A;  3D4G A;  4TOZ A;  1MY0 A;  1R1N A;  1URG A;  5K2Y A;  5J1D A;  3DP6 A;  3O66 A;  5HPQ A;  5H8F A;  5L9O A;  1MS7 A;  1Y4C A;  2Z8E A;  5IKB A;  1B5J A;  3TUS A;  4BDL A;  3FVG A;  3M3K A;  5ICQ A;  5TP9 B;  2FNC A;  3T9X B;  4R6K A;  1EH3 A;  4WEP A;  3VVE A;  4EF1 A;  3OO9 A;  1FQF A;  1JEV A;  3QUJ A;  2RC8 A;  2UVG A;  4XIG Q;  2XXQ A;  4OEV A;  4ECF A;  2OZZ A;  3IOW A;  4ZEF A;  1S7Y A;  2DWJ A;  3KN7 A;  2HAV A;  1BTJ A;  4WED A;  1MQG A;  4I9D A;  3H4Z A;  3MVY A;  3CG1 A;  4NF4 B;  3ILU B;  3USD A;  2OWT A;  3IX1 A;  2G93 A;  1B52 A;  2AYS A;  4RJZ A;  5AA2 B;  1ZKB A;  2XXX A;  4DCY A;  4GVO A;  4FEC A;  2B3F A;  2OLB A;  5DEX A;  1N0T A;  3CVG A;  4F3S A;  1D4N A;  2F6G A;  4OQO A;  4EUO A;  2ZNS A;  1QKB A;  4DCX A;  3K6W A;  2O1L A;  1UIU A;  2XXV A;  3MVW A;  4LZ7 A;  3K6X A;  1MXZ A;  4KI0 E;  3Q25 A;  3SEU A;  2F97 A;  5CRY A;  4MF3 A;  3V5A A;  2ZYN A;  3HCQ A;  1ZU0 A;  1B1X A;  4U22 A;  1US5 A;  4RY1 A;  3MJN A;  2Y7R A;  3IOV A;  2DP8 A;  5AA4 B;  1Y9U A;  4GFR A;  5I2K B;  2FA7 A;  3SET A;  1IZ1 A;  4IGR A;  5A5X A;  1Y3Q A;  4NF8 B;  3UK4 A;  4ZED A;  3FJM A;  1PDA A;  5AE4 A;  2P2A A;  2XXT A;  4U4S A;  2GRV A;  4F3B A;  3FJG A;  3I6V A;  4LZ5 A;  4N6P A;  3N6U A;  3E9X A;  4THI A;  3PMV A;  3RY3 A;  4F1V A;  4R2B A;  4DIG A;  1SI0 A;  2QRY A;  4GOT A;  1ZTY A;  4YB6 A;  1P1Q A;  4H0W A;  5B7D A;  1O63 A;  4GL0 A;  3MP6 A;  1Y20 A;  2F78 A;  3IAZ A;  1IXG A;  3OXN A;  5I56 A;  3MBP A;  1I6Q A;  2I0C A;  2F36 A;  2X7P A;  1DTZ A;  2RIN A;  1QUI A;  3HHG A;  2UVJ A;  3SER A;  2YJP A;  1S50 A;  4YAH X;  2QS4 A;  2F7A A;  5EHM A;  5H8H B;  4OXV A;  2NVU B;  1MPD A;  1F9B A;  4RK9 A;  3FV1 A;  1MY1 A;  3FV2 A;  4JSO A;  5KZT A;  2QS3 A;  1FQC A;  4GXS B;  1P1O A;  1P1N A;  4PFU A;  3K1M A;  1B2H A;  1YCJ A;  4LZ8 A;  4YB7 A;  2YPN A;  5DTB A;  5TPA B;  3ZKL A;  1M5B A;  4XKR A;  1LGB C;  4L17 A;  4POX A;  1B46 A;  4RK2 A;  5HBC A;  1MDP 1;  4P0G A;  4NF5 A;  3HV1 A;  3K4U A;  1Y3P A;  3GXA A;  1B05 A;  1FQA A;  5FTI A;  4BDQ A;  3EF7 A;  1SVX B;  1SW2 A;  3UP9 A;  3QYT A;  2YLN A;  3KEI A;  1XVX A;  2OK2 A;  3IOR A;  3K00 A;  1B3E A;  3VVF A;  4G8N A;  4YMB A;  3CIJ A;  1LBC A;  3SEY A;  1EZO A;  3HHF A;  3ZSF A;  5BUU A;  2GHB A;  2RCB A;  1O64 A;  1VFE A;  3OEK A;  5JK4 A;  3DP4 A;  3CI8 A;  3T22 A;  1TT1 A;  2ESN A;  4FEB A;  2Y84 A;  1P1W A;  1SI1 A;  2DOJ A;  4O3B A;  3IK6 B;  3MZB A;  4C1U A;  3QXM A;  3TZA A;  4R9F A;  3LSW A;  4ZE9 A;  2ZYO A;  2F35 A;  2O51 A;  3FIR A;  5ELV A;  2UYE A;  1US4 A;  1CE2 A;  3MVX A;  3GLB A;  1IXI A;  2NUV A;  3IB2 A;  1B0H A;  1GR2 A;  5H8N B;  4R74 A;  4EDP A;  5ICT A;  5FTH A;  4TLM B;  4EXK A;  1PBQ A;  3TFL A;  1LAX A;  2VD2 A;  3A3U A;  2CZL A;  1AMF A;  3M8U A;  2I3W A;  2REJ A;  3K1P A;  2ZYK A;  3SEW A;  3CFX A; 
#chains in the Genus database with same CATH topology
 1DGB A;  2Z7J A;  2X8A A;  4ISU A;  4OFJ A;  3C35 A;  5I84 A;  2UUC M;  3PUX E;  2OO9 A;  3K02 A;  4P11 A;  3TWL A;  2DAG A;  4KHZ E;  3BFU A;  4PET A;  1Y8G A;  3C3E A;  5I3S A;  3SDF A;  4HS7 A;  5E26 A;  3RNN A;  2HKJ A;  1IMC A;  1UTH B;  1LEV A;  2VD3 A;  2JUJ A;  4LFB M;  4XTC Q;  4OZ9 A;  8CAT A;  4PF8 A;  2HPG A;  4IBK A;  2XZU A;  4OX9 M;  2RKM A;  1L8Q A;  2DVZ A;  3O28 A;  3KN8 A;  2ONR A;  2V93 A;  2CV2 A;  2QJE A;  1LFG A;  4KR5 A;  4JWX A;  3KVW A;  3L6G A;  2P1S A;  2H98 A;  3DFZ A;  2M60 A;  1XC1 A;  2UYF A;  1KZ8 A;  2UXA A;  1DPP A;  4P0I A;  2KDL A;  3U6E A;  2V4C A;  3PUV E;  4JI3 M;  3IB1 A;  3SEX A;  4G68 B;  4YY3 M;  3TMG A;  5I2N A;  1IEJ A;  4L15 A;  3OMB A;  1FJ9 A;  2ABH A;  1QGX A;  3U65 A;  1JR3 D;  1OAO C;  3KOW E;  3CG3 A;  1FBC A;  1IY2 A;  4H6D A;  4MGY E;  5K2X A;  2AHM A;  3B74 A;  2FHY A;  3L6H A;  5FTK A;  1QVS A;  3N6T A;  1FPG A;  1B3F A;  3S9M C;  3EN3 A;  2C96 A;  4DV6 M;  3SHG B;  1HSJ A;  2ZNU A;  3M3F A;  1G0I A;  4O3C A;  2CEA A;  4LZZ A;  3C31 A;  1B51 A;  1R9Q A;  5FBP A;  4GBW A;  4EQ7 A;  1N04 A;  1K82 A;  3TTN A;  1XC8 A;  2XLJ A;  4MIJ A;  1NJG A;  2WBB A;  2VPN A;  2WYP A;  2CMO A;  4JB7 A;  3PUW E;  4MLQ A;  4PDH A;  2CFO A;  4C0R A;  3EQ1 A;  4FBP A;  4F18 A;  4JI4 M;  2R4E A;  1NV5 A;  2X4A A;  2QS2 A;  4ESW A;  4MBP A;  3FAT A;  4LJ5 A;  4JI5 M;  1POY 1;  1Y1Z A;  1D9V A;  1P3Q Q;  5LMU M;  2HZK A;  1G8P A;  2B65 A;  4H65 A;  3F92 A;  1FBH A;  4AW4 A;  1QAM A;  4NF6 A;  1LBB A;  3TOD A;  1PRB A;  5BWJ A;  1SW1 A;  2G29 A;  4IIW A;  3KJT A;  3VLW A;  5KDT B;  3I5O A;  2OQ4 A;  2DKL A;  1ZMW A;  1Z5C A;  4ONY A;  4JI0 M;  2JWS A;  3W0F A;  1IQP A;  4Z0I A;  4HEO A;  2BWE A;  1FTK A;  5ITP A;  3E4R A;  3VDF A;  4R6Y A;  5CI5 A;  4GWX A;  3TEP A;  2V3U A;  2LVQ D;  1OQH A;  2Y5K A;  1MXV A;  4P16 A;  3T15 A;  4JVI A;  4R2F A;  3KDS E;  4A3V B;  3I04 M;  1R5L A;  4ZEC A;  5I57 B;  2C9O A;  1Z6T A;  4WW0 A;  3FRH A;  3PD8 A;  4OET A;  2DZO B;  1S9T A;  1V92 A;  2QVR A;  5C18 A;  2DAM A;  3U6S A;  2F8D A;  4KFQ A;  3VE1 B;  1HJP A;  3KBR A;  3RUM A;  4XK8 F;  4FD2 A;  3Q29 A;  4NE4 A;  3V89 B;  2LAO A;  3K0V A;  3AOE C;  3OSQ A;  2QL3 A;  5L8D A;  4P17 A;  3ZQJ A;  2BJW A;  1WXQ A;  3T1Y M;  1SDX A;  4OFL A;  4GWZ A;  4LP2 B;  5L9M A;  5AA1 A;  1HQY E;  1JW5 A;  4U4X A;  4ZZA A;  4MLV A;  1XS5 A;  3O6G A;  5EXX A;  2LNH C;  3HST A;  1SD3 A;  4OER A;  3LC8 A;  1KFV A;  4D82 A;  1VR5 A;  4KYE A;  5EP2 A;  1JVX A;  4NF0 A;  2O68 A;  1B5H A;  5FTM A;  3RE8 A;  4GXA A;  3J81 S;  3L27 A;  5ITX E;  1B7H A;  5DVI A;  4OVP A;  2VP1 A;  4F31 B;  1AOV A;  2GNO A;  1NUX A;  3D1R A;  3G7W A;  5F7V A;  2GQF A;  2A5Y B;  4RPO A;  1PJS A;  4LF9 M;  3QAX A;  2Y0Q A;  2ZTC A;  1H6U A;  4FWG A;  4I5S A;  3E13 X;  3T1B A;  3MPK A;  2ZAN A;  4WP2 A;  3CFX A;  4R9G A;  3R8F A;  1QUK A;  2ZTD A;  3VK8 A;  2DAK A;  1LLS A;  4KLN A;  2DHR A;  1RDZ A;  2CZH A;  1JB0 F;  4OEN A;  3FUX A;  3A42 A;  2Q74 A;  1SXJ D;  1MY4 A;  3LUY A;  2XWI A;  2KNA A;  4NSO B;  2XX7 A;  2DXY A;  3G3G A;  1H3D A;  1PJJ A;  2D7E A;  1A8E A;  4KYS A;  3H6U A;  2KLF A;  1G71 A;  4NTL A;  3L28 A;  2DVW B;  3SYL A;  1PBP A;  1XHY A;  3VLV A;  3O97 A;  2UUA M;  2ONK E;  4LA9 A;  2K0B X;  1FBG A;  3KSX A;  2XH9 A;  1GJT A;  1T0K A;  5JTY B;  2OX3 A;  2HAK A;  4H8J A;  2OWS A;  4JDF A;  1MM7 A;  3SHF A;  2ZYM A;  1QAQ A;  3ROJ A;  1DCU A;  4DI3 D;  2VQF M;  1TFA A;  3AOE A;  3G3F A;  3SAS A;  1UTB B;  5CBS A;  1N33 M;  3QYB A;  1M5E A;  1DBZ A;  4H5F A;  4FVM A;  4QFK A;  5ITT A;  3U93 A;  4FCW A;  3B50 A;  2XXY A;  4ANR A;  1B4H A;  1LCT A;  2EUC A;  4GLI A;  3T0J A;  5EXS A;  4MFI A;  2DI0 A;  5ESY A;  4PAK A;  1HR0 M;  3IG8 A;  2FOI C;  2XA5 A;  3H6T A;  1MQI A;  4PCZ A;  4OWD A;  3MQ9 A;  4JXI A;  1FPB A;  1Z5A A;  1VEG A;  3AJI B;  4FED A;  5KCJ A;  4NWC A;  4DV4 M;  4Q8R A;  4NQ8 A;  4RXL A;  4RKU F;  2XFT A;  1T6O A;  4PGN A;  4IY6 A;  4XXU A;  3K92 A;  1KYI A;  3MWB A;  1USY H;  3B7D A;  2X49 A;  4GIT A;  4G4R A;  5H8F B;  1TDZ A;  1L2D A;  3G3J A;  5IZ3 A;  1L2C A;  1FTJ A;  4PDD A;  2JZ1 A;  3J2P B;  4N6D A;  2ONS A;  3Q8X A;  3K1N A;  4QXD A;  5EP1 A;  2L7I A;  4F1U A;  1OQY A;  5FHM A;  3GYY A;  4PFW A;  2OOB A;  2DXR A;  1D0K A;  1MXX A;  4OTE A;  3T1H M;  3ZS6 A;  3DLN A;  3JV9 A;  4LQ2 A;  3VLF B;  3UIF A;  4NL4 H;  3IEC A;  2DQV A;  2KQZ A;  1OMP A;  3U60 B;  3FXR A;  4MH5 A;  2X7Q A;  2D7G A;  3FXQ A;  1TGU A;  1FPK A;  3CR9 A;  4R71 A;  1H44 A;  3K6U A;  4N6K A;  3M6A A;  2JJK A;  2P0S A;  4FJP A;  1K3X A;  1FTM A;  1IY0 A;  3HZJ A;  4UN2 B;  4Z6Y A;  3GQ3 A;  1NFT A;  3VKH A;  2XHD A;  1G59 A;  3KGC A;  4DDD A;  5I58 A;  2VII A;  2L09 A;  4DLD A;  2Y7W A;  3MHV C;  3N5L A;  2QPQ A;  1EYI A;  4WKM A;  3CHG A;  1NNP A;  4XKQ A;  4FCT A;  2OJT A;  1LFH A;  5GKN A;  3CF0 A;  3HHZ A;  1FSA A;  3SMP A;  3CRB A;  1UM8 A;  2OOA A;  4YMA A;  2B4L A;  4G3O A;  1NUW A;  1C1K A;  4GWW A;  2WSC F;  4GWS A;  2CZI A;  1L1Z A;  1AIP C;  3KW6 A;  2DWM A;  4BB9 A;  1MQD A;  4X66 M;  1OTR A;  2I58 A;  2R44 A;  2V1C A;  1IN5 A;  5EQT A;  2CP8 A;  1N84 A;  1JVY A;  3MZ9 A;  1XOC A;  3UA8 A;  1RKM A;  5DEX B;  2PT2 A;  4ZE8 A;  2H5X A;  1TFD A;  4DZ1 A;  2DWA A;  3MW0 A;  3C33 A;  3TTK A;  3VVD A;  4ELO A;  4GX4 A;  2P3N A;  2RGO A;  3I4Y A;  2XZF A;  3KBZ A;  4UAC A;  1MH3 A;  1LBX A;  2FNA A;  2Z8Y M;  3S2V A;  1MXY A;  3AKZ A;  1DMB A;  2J7N A;  2MH8 A;  3KXE C;  3UK6 A;  1Z59 A;  2D3I A;  2H5Y A;  4G4N A;  3GPY A;  1WIV A;  4H8I A;  1BP5 A;  3PPQ A;  2QMX A;  1A40 A;  4QHS A;  3PV0 E;  2ALU A;  3VXB A;  3TEL A;  1JNF A;  1JP4 A;  1K9Y A;  4F2O A;  2BJI A;  4AZF A;  4GKJ M;  3NBI A;  4PE3 A;  1MJG M;  1TF0 B;  1MDQ A;  3RQT A;  2XWK A;  4Y28 F;  4JWO A;  4QBA A;  2GHA A;  4PE5 B;  1FPE A;  4KPT A;  1B3G A;  1EZP A;  3S9N C;  4JI7 M;  1NSF A;  1N3X A;  3VFD A;  3E21 A;  1NNJ A;  1OLA A;  2Q2A A;  3ONM A;  1GGG A;  2PX1 A;  2BWB A;  2VHA A;  1IMF A;  1TH3 A;  4GKK M;  2H1R A;  3H06 B;  3BKI B;  2KHH A;  3HX3 A;  4F3G A;  3LSL A;  2G5G X;  4DV3 M;  1FBE A;  4LJA A;  5IM2 A;  1DSN A;  2PFZ A;  1POT A;  4ELQ A;  1IXS A;  1YXI A;  2KW0 A;  5KPR A;  2ZZW A;  2OBG A;  2F5Q A;  3O9P A;  4DR3 M;  3GLH E;  3M7G A;  3O6H A;  2CHG A;  4O94 A;  4NXN M;  1MY3 A;  3THI A;  3MMP A;  2V25 A;  4F1I A;  5A5X B;  1JEU A;  2Z23 A;  5F1Q A;  3Q27 A;  4IBF A;  5JEI A;  1NKX A;  4LJ8 A;  1CNQ A;  1PJQ A;  3MK6 A;  3D4C A;  2F7C A;  1BVS A;  3C34 A;  5EHS A;  2I49 A;  3KC1 A;  3O6I A;  1GL7 A;  3BFT A;  4OU7 A;  4W5W A;  2QNJ A;  3PU5 A;  3LMM A;  3CTW B;  3HO7 A;  1FBD A;  3KC0 A;  1MXU A;  4IBG A;  3HJ8 A;  3GRV A;  1RYO A;  3U61 B;  4N13 A;  2REG A;  5LDZ A;  4O3A A;  4QSD A;  2JY7 A;  3LUZ A;  5FHO A;  3H6W A;  2BJV A;  1UIV A;  2C98 A;  4I1D A;  3LQR A;  1OJL A;  1BKA A;  4AS5 A;  1NV9 A;  1R4G A;  2HAU A;  5JI2 E;  3GLG B;  3GLH A;  3N26 A;  4IGT A;  3TPA A;  2OCU A;  2L7H A;  4M9S A;  4POW A;  1Q35 A;  3UOR A;  1SXJ B;  1I6B A;  1A54 A;  1MM6 A;  1L5T A;  3CF2 A;  1LST A;  3U1O A;  4DR2 M;  2WKY A;  3SBJ A;  3ODB A;  3IR1 A;  2HHM A;  1PJI A;  3K2D A;  4DV0 M;  1GV8 A;  5CMK A;  4DUZ M;  2QBY A;  1QUL A;  5LMN M;  3PGF A;  2R6F A;  5EQ9 A;  3VXC A;  1B40 A;  1O7T A;  4IO7 A;  5I56 B;  1E94 E;  4QFO A;  4JWY A;  1Y3N A;  3I3V A;  3S4U A;  4X48 A;  1EZ9 A;  2CHV A;  2R46 A;  1FJ6 A;  3DEL B;  1Q39 A;  3FVO A;  3AFH A;  2Y7K A;  4H5G A;  1NVM A;  1B1H A;  1QVR A;  1N36 M;  2Z4R A;  3PUY E;  4QNR A;  1KWH A;  4N8Y A;  4M4G A;  3G3K A;  4C1T A;  4LF8 M;  4HXV A;  3ZC7 B;  1BK4 A;  1M5D A;  4G8M A;  2R6G E;  2CEX A;  1FBF A;  2MJ5 B;  2HL7 A;  3ECR A;  1N75 A;  3RFW A;  3FGS A;  3CFZ A;  4IO4 A;  5C1B A;  1ZMV A;  1NNT A;  2KXE A;  2DWH A;  2FE8 A;  3PMX A;  1EE8 A;  1Q02 A;  1XXH A;  3OOA A;  3PMW A;  2XXW A;  1K9Z A;  2RGH A;  4LUB A;  4M1V A;  1AWB A;  5ITY A;  3MC2 A;  1VEK A;  2QVU A;  4N07 A;  4LJ7 A;  1M5F A;  2DXI A;  3TCH A;  4OHN A;  2DE4 A;  5TU0 A;  3PNV A;  1JW1 A;  7CAT A;  4BDM A;  3C4M A;  3LVV A;  3C9H A;  3BBR A;  1XMQ M;  2DYX A;  3JR5 A;  3GLF B;  1QYR A;  1R2Z A;  4L4U A;  1LBY A;  4U1O A;  5FTN A;  1FBP A;  1EYJ A;  1ZV1 A;  4II7 A;  1LB9 A;  4IO2 A;  1NHG C;  4B3M M;  3FUZ A;  4F22 A;  4PFT A;  1NV8 A;  4NMY A;  3FD3 A;  1IME A;  4IY5 A;  1WGN A;  5DVF A;  4IBE A;  1FTL A;  2ZNT A;  3D8L A;  3GO8 A;  3IG5 A;  4B7G A;  1LAG E;  1B7U A;  2KRU A;  3W9V A;  2L4F A;  3FZV A;  4ELR A;  2XXH A;  2WSE F;  4JXJ A;  4DV1 M;  4NF5 B;  3UN6 A;  4LQ5 A;  4U1Z A;  4OMB A;  1AIV A;  4H1X A;  3C3D A;  2L4E A;  2EA0 A;  3THG A;  4OFO A;  3IOT A;  4AG6 A;  3ILT B;  3GRY A;  1NNK A;  2LXE A;  2XXI A;  3Q26 A;  3A46 A;  2E1S A;  2I48 A;  4DV7 M;  4DV5 M;  1Y1M A;  3EHS A;  4BDO A;  3EHU A;  1Z5B A;  3MP8 A;  4I8C A;  1IBL M;  2Q9T A;  1VQ1 A;  3U8Q A;  2UXB M;  3FUW A;  3IB0 A;  4GBV A;  4UAB A;  1NNU C;  2O01 F;  1E9S A;  3SMS A;  1URD A;  3PPO A;  5H37 D;  1OVB A;  2AIX A;  5H8Q A;  1H45 A;  1FW0 A;  2DEN A;  1Q3B A;  1Z7M E;  1TH4 A;  4QFL A;  5ITR A;  3FVK A;  1USY E;  1XT8 A;  4TUW A;  5EQA A;  4YIC A;  2I3V A;  1JET A;  4GIZ A;  3B7N A;  4R75 A;  4PFI A;  4PAF A;  3T6P A;  3MAM A;  4R72 A;  3OEN A;  4PBH A;  4GF8 A;  4PQJ A;  3OEL A;  3GPX A;  4DI4 B;  4NG7 A;  5IZ7 D;  1OIB A;  3AXF A;  1NV4 A;  5CC2 A;  1TR8 A;  3HJS A;  4G4Q A;  1T3T A;  2ZM6 M;  5TP9 A;  5CMM A;  2L5V A;  5KPZ A;  2Q8M A;  2D7H A;  3L2A A;  2O6A A;  3QSL A;  3RPW A;  1I6A A;  5HM4 B;  4Z7E A;  3RGY A;  1QZM A;  2EJS A;  1OIP A;  1IM2 A;  1LBW A;  1D9Y A;  2XXU A;  4KO8 A;  1CB6 A;  1MXW A;  2THI A;  4YKJ A;  1B3H A;  2QMW A;  1SYI A;  3GLI B;  2RC7 A;  4R6H A;  1GAB A;  2HFB A;  2R0I A;  3HWS A;  2W7Y A;  4KD5 A;  4P47 A;  3B89 A;  4BLA A;  4OW0 A;  3GQ4 A;  4U2R A;  4IB2 A;  3OO7 A;  1B3L A;  1GLN A;  2Y7I A;  3FD9 A;  4MMP A;  2O5R A;  3KN3 A;  5F24 A;  4LFC M;  3SFZ A;  3V76 A;  1TXF A;  2QSX A;  2QS1 A;  4F2Q A;  1ANF A;  1SPI A;  4NF4 A;  2Y7P A;  1EYK A;  1DTG A;  3U5Z A;  4LN5 A;  3U6P A;  4CGY B;  1BLF A;  1DO2 A;  5ITQ A;  5AA2 A;  2F34 A;  4RA1 A;  4NN3 A;  1H43 A;  4L6V 6;  4PD2 A;  2YQZ A;  3LVW A;  1LB8 A;  1A99 A;  1P99 A;  2H25 A;  2RKO A;  4GHL A;  4WUR A;  4IBD A;  1MY2 A;  1A5T A;  2DVC A;  1G41 A;  1OFI A;  4I4L A;  1RYX A;  5M2V A;  1QDT A;  1LAH E;  4X04 A;  4G6Z A;  4X62 M;  2LBC A;  4REZ A;  1L1T A;  2H9B A;  1A55 A;  1R2Y A;  3A29 A;  3RTF B;  5ITO A;  3PXG A;  1KA1 A;  1S3S A;  4ZDM A;  1VG5 A;  2XD3 A;  4RYA A;  1DGH A;  1PB9 A;  2D5W A;  4XEQ A;  4O7I A;  4IO6 A;  3UGW A;  1LFI A;  3TTM A;  2NOO A;  3VK7 A;  1HNW M;  1DGF A;  3C9P A;  2I7N A;  1QW0 A;  2AL5 A;  5I2N B;  1QKA A;  1TWY A;  4LJ6 A;  1GVC A;  3WAF A;  2E5L M;  3EIH A;  4LG2 A;  2OWZ A;  3FTC A;  3KP1 E;  1URS A;  2PVU A;  4LGM A;  4XKP A;  4E0X A;  1WGL A;  1HSL A;  2O69 A;  2PT1 A;  4N4U A;  4Q0C A;  5AA4 A;  3DOA A;  1A8F A;  4PFY A;  4RF0 A;  3HU1 A;  1D0L A;  5I2K A;  5B70 A;  4P56 A;  4EQB A;  3RN8 A;  5IT9 S;  5EYF A;  1OAI A;  4NF8 A;  2CUZ A;  3HPI A;  1MN3 A;  4NXM M;  1MG1 A;  3BIG A;  1V33 A;  3MVZ A;  4HE0 A;  4KYD A;  2O7I A;  1B6H A;  4G2Z A;  1B32 A;  2QEN A;  5ET8 A;  4U21 A;  4P3L A;  2F3D A;  5ITX A;  3FRI A;  3K6V A;  4H46 A;  2LH0 A;  4MB7 A;  1GL6 A;  3QWL A;  3CSB A;  1AUA A;  2HCA A;  2Z22 A;  4LJ9 A;  3WAE A;  4PAI A;  1IXH A;  2DSF A;  3U6O A;  2OPF A;  3R9X B;  5DNY A;  3LSX A;  4NF6 B;  1R9L A;  4N8G A;  4XKN A;  4AKG A;  2BJJ X;  4TQU Q;  2O7U A;  3MP1 A;  3LBS A;  3U6L A;  1B5I A;  1NH7 A;  2DS9 A;  1Y4T A;  2GQ1 A;  2HEU A;  5J16 A;  4IBJ A;  1IBK M;  4JYA M;  2IA4 A;  1X37 A;  4GX6 A;  2APL A;  3PUZ E;  2XSZ A;  4JV5 M;  4P1E A;  2XGN A;  2KNZ A;  3H03 A;  5F3W A;  3BBZ A;  4L78 A;  3GBB A;  1G0H A;  4DUY M;  1VFD A;  3J27 B;  2F4V M;  3O29 A;  3FKE A;  1D2N A;  3C36 A;  1XB2 B;  3SAU A;  3TAJ A;  4FAT A;  1HSE A;  1RDY A;  1ZJL A;  3Q28 A;  4MJO A;  2KZS A;  3U72 A;  2FVZ A;  2O84 X;  3QIM A;  4F3P A;  3UGJ A;  3TQW A;  3KOX E;  4PP0 A;  4NWD A;  5L9S A;  3V83 A;  1VE4 A;  4GRK A;  3A09 A;  1TH2 A;  4DXB A;  1GTK A;  4OYV A;  2CHQ A;  1QDR A;  1N7X A;  5DFL A;  3LCU A;  3K9O A;  4YB5 A;  1IIW A;  4I8O A;  1AL3 A;  2H99 A;  4P9K A;  5H8H A;  5FTL A;  4X9T A;  4YKI A;  3ZKK A;  3MYU A;  2ZBK B;  2F7B A;  3QK6 A;  5CMB A;  2Y20 A;  3B7Q A;  5DVJ A;  3DM0 A;  4DR1 M;  2NQ8 C;  2FS1 A;  5DW8 A;  4N91 A;  3LR1 A;  2E0S A;  3TTR A;  4FE8 A;  2FIE A;  4ZZE A;  1SBP A;  5LTC A;  2O25 A;  2KRK A;  2KA6 B;  5CBR A;  1PJT A;  2HWJ A;  3VLU A;  1IQ7 A;  2DHY A;  5EP4 A;  3EKI A;  4FIM A;  4Q7J A;  4FOR A;  1Z7N E;  4G77 A;  1ZBM A;  4HL4 A;  5TPA A;  4KCC A;  3PPN A;  1YPN A;  4ZPX A;  4HCY A;  4M0W A;  2GH9 A;  3W15 C;  2CE7 A;  2DWZ B;  4PT5 A;  1EIJ A;  4F19 A;  2V1U A;  3T9U A;  2UU9 M;  3B6W A;  1B9J A;  4E0W A;  3GLG E;  5BPV A;  3K2L A;  2VT5 A;  1NJF A;  4B3T M;  3PFI A;  3PPP A;  4LVQ A;  2C99 A;  3JZJ A;  3TCG A;  3IO4 A;  3DP8 A;  4PF6 A;  4AG5 A;  3FVN A;  1SXJ E;  3VFJ A;  5CMC A;  3AOG A;  4K0K M;  2D21 A;  1FQD A;  2LVN C;  1SYH A;  3KS4 A;  4GD5 A;  4GL8 A;  1SW4 A;  2A5T A;  4JVD A;  3SZP A;  1NNF A;  1IXC A;  4PFB A;  3HHX A;  2Q2C A;  3IJO B;  4MCO A;  1IMB A;  1YYZ A;  4EF2 A;  2Y21 A;  1VDW A;  4AB6 A;  1QUT A;  1TTE A;  2MGW A;  4MGK E;  3SES A;  2UXD M;  1B58 A;  4X1B A;  4I3E A;  4XBO A;  1MRP A;  3OO6 A;  4MM3 B;  2ZZX A;  3T93 B;  3TQS A;  1JQF A;  3HN0 A;  3HHY A;  4OVJ A;  1PC3 A;  2ZXT A;  2P5T A;  2V3T A;  2R71 A;  3DA1 A;  1IXZ A;  5EYG A;  3C32 A;  3R6U A;  3UZU A;  4OAN A;  5KQD A;  4AB5 A;  4PCD A;  4OVZ A;  4OES A;  4Q30 B;  4QRZ A;  2WEF A;  3FTF A;  1MQH A;  3RLF E;  5FHN A;  4NED A;  2JA2 A;  1N76 A;  3KOS A;  2B3T A;  4NRV A;  4EXL A;  5IAI A;  4QFN A;  2V84 A;  3H3G A;  3U6M A;  3T96 B;  3IJX B;  4XF5 A;  2XX8 A;  5KCJ B;  3B8B A;  1Q1K A;  3LQQ A;  2RF1 A;  4N17 A;  3RT6 B;  3T38 A;  2Y5L A;  1FPF A;  3KSJ A;  4NHB A;  1FQB A;  4OEU A;  5BR8 M;  3TCF A;  2XX9 A;  4QSE A;  4OVT A;  3TKD A;  1R6Z A;  5KQ8 A;  2QQ8 A;  4F39 A;  3MZ1 A;  4GIP A;  3VDU A;  4U23 A;  2M5Z A;  1M5C A;  4DR7 M;  2VPO A;  5H8N A;  1WVJ A;  5IZ3 B;  4MHF A;  4MGH A;  4AI6 A;  4G68 C;  2O1M A;  4ZS9 A;  3IO6 A;  2Q88 A;  2A5S A;  4IO5 A;  1J5E M;  3H6V A;  3OSR A;  3RPL A;  3HY5 A;  2J7O A;  3MUQ A;  5IRE B;  5IZ1 A;  4MGI E;  1N32 M;  2PMS A;  2DE2 A;  2RC9 A;  3KOZ E;  4NGU A;  2G8L A;  1ZMG A;  3A98 B;  3EHT A;  3KOT A;  1EFU B;  3KFM A;  4HCW A;  1N7W A;  3G3I A;  3WHK A;  4JSD A;  3FTD A;  4CHT B;  3MST A;  4DV2 M;  4KCD A;  4DE8 A;  4EQ9 A;  4GHA A;  1P1U A;  4DXU A;  1B0L A;  3PPR A;  5I58 B;  4QF9 A;  4QSC A;  3RGP A;  2DWI A;  2C9C A;  4GRI A;  3S9E A;  3TYH A;  1IIT A;  4OA4 A;  1HNX M;  4F1Y A;  2HQ0 A;  3U94 A;  1UTH A;  2V6Z M;  2F5O A;  1QJM A;  2RCA A;  1CUK A;  1PB8 A;  4ZEK A;  2A5T B;  3SAW A;  3T9H B;  3ILK A;  4DR4 M;  1LTM A;  4YHH M;  1MPC A;  5ISU A;  3GPP A;  4UA8 A;  4ND9 A;  4ZEB A;  3SEV A;  3SKP A;  2LTU A;  3D8B A;  2JZ0 A;  2H4I A;  2ANJ A;  3TTL A;  3KJ7 A;  2XXK A;  1LAF E;  3FXU A;  2JY8 A;  4ELP A;  4LON B;  1FPL A;  1FNN A;  4GWO A;  4R73 A;  3CFL A;  4LAT A;  4MNP A;  1OQG A;  4QHT A;  3LV0 A;  4BDN A;  3K8Z A;  5EXT A;  3N94 A;  1TDH A;  3J80 S;  3LW5 F;  2VOZ A;  5L8R F;  3SAV A;  3U6Q A;  3FUT A;  3KFU G;  3OEM A;  3KZG A;  1XHB A;  4Q5T A;  2QPA A;  3VV5 A;  1OVT A;  1SW5 A;  2Z8D A;  2I6E A;  1MH4 A;  4G68 A;  2I0B A;  4X64 M;  4R3D A;  1AH5 A;  2NXO A;  1F4I A;  3HKP A;  4KT0 F;  2ZMB A;  3DZD A;  3GZG A;  2QZ4 A;  1Q3C A;  3AV0 A;  4ESX A;  2Q89 A;  2DNA A;  3GLI E;  2P3V A;  4YZZ A;  4NAP A;  3MPL A;  4KXP A;  1T43 A;  2XXP A;  1LCF A;  4HW8 A;  2R18 A;  4GMQ A;  5I5P A;  2DE3 A;  2CRU A;  1QAO A;  1UQW A;  2JNH A;  3CSG A;  4RNS A;  3V8X B;  4G4O A;  2QHO B;  4LF5 M;  2EKK A;  4FCV A;  3TPZ A;  1JW4 A;  3K01 A;  4YKP A;  3K9P A;  1NH8 A;  5DYH A;  4I62 A;  1N34 M;  3H7M A;  5CM6 A;  3A45 A;  1II5 A;  4KQP A;  1IXS B;  3Q8G A;  1N77 A;  3FXB A;  3RTW B;  3HU3 A;  4PFR A;  4BDR A;  4PGP A;  3GBA A;  5H8S A;  3QAU A;  5AA2 D;  3NWL A;  4O8M A;  4NOO B;  3TQL A;  4HTG A;  2PFY A;  1XVY A;  1WOD A;  1GKI A;  3NOH A;  1FQE A;  2EO2 A;  4LRS A;  1NV6 A;  3JYR A;  4LGY A;  2R9J A;  5T3J A;  4MAG A;  5KDT A;  3A3C A;  4PTK A;  1D3K A;  1J7K A;  3T66 A;  2CZK A;  2XXR A;  1MPB A;  4R7G A;  4YU0 A;  1J1N A;  4FW9 A;  1QAN A;  3R26 A;  4X1D A;  3FYD A;  4HE1 A;  2WBD A;  3G3H A;  3J7A S;  1H76 A;  2MR9 A;  1YE9 A;  3GLH B;  5DT6 A;  1B7Z A;  4IO3 A;  1NMU A;  1I69 A;  2YFQ A;  5I57 A;  4DXC A;  1YAE A;  2HXW A;  1HT2 E;  1DK4 A;  5KPT A;  2B3B A;  5I59 A;  2M8C A;  2Q8J A;  4K3F A;  4KOD A;  3M3L A;  3U92 A;  3EIE A;  3F11 A;  3K1J A;  3B6Q A;  5EQ7 A;  1LBZ A;  1YTV A;  1WR1 B;  2HZL A;  2Z8F A;  4YKK A;  2W82 A;  2MRO B;  2DAI A;  4L8R C;  2J5Y A;  1D0M A;  4BLC A;  4I3Y A;  4G8H A;  5EJC A;  2QBY B;  2XD2 A;  1B4Z A;  1MQJ A;  1GO5 A;  1VDD A;  3QUF A;  3R7X A;  4M9X A;  4DBG B;  1SG9 A;  1MU5 A;  1GJS A;  2DWN A;  4AQ4 A;  1MX0 A;  1QZE A;  4IBB A;  5LOM A;  1RDX A;  1ZIU A;  3S9L C;  4OVR A;  1QQW A;  4NRW A;  2GFE A;  3OD7 A;  3SC3 A;  2CWB A;  3PD9 A;  3H4J A;  1ELJ A;  4PBQ A;  2WYK A;  3VKG A;  3LSF B;  3EPE A;  5E6J A;  3IL1 B;  1FCK A;  1OKS A;  3FAS A;  4MEV A;  5AA3 A;  4AS4 A;  2UXC M;  4WXJ A;  1VSO A;  1XXH B;  1NV0 A;  2F6P A;  1SQY A;  4G4P A;  5DYI A;  3FBP A;  4G61 A;  1A7L A;  1N3W A;  1PB7 A;  4TLL B;  4AKH A;  3ZH9 B;  1ATG A;  4MNC A;  3B6T A;  2R45 A;  1UFZ A;  3E3K A;  2I4C A;  4NX1 A;  1XMO M;  4NC6 A;  2VF8 A;  4QFP A;  1WDN A;  3FJ7 A;  3O2A A;  2KR0 A;  2IEE A;  3L25 A;  4QOS A;  3H4M A;  1PEB A;  2PYY A;  2XSZ D;  3T9V A;  4FAJ A;  2UVI A;  1IN7 A;  1NV1 A;  1ZLQ A;  4H67 A;  1NL5 A;  4QHQ A;  5DYG A;  4EIW A;  1D9Q A;  4QNM A;  1E32 A;  4RPN A;  2VGQ A;  1FPJ A;  4LY6 A;  1FTO A;  2UUB M;  4M0D A;  4GQO A;  1DOT A;  4F29 A;  2NWJ A;  4ZEI A;  2AL4 A;  5JTY A;  3OO8 A;  2F5X A;  4LRT A;  1ZMU A;  3E46 A;  4O7M A;  4CIZ A;  2V3Q A;  1YZ0 A;  2FYI A;  2I4B A;  2QCU A;  4KHP M;  1UTB A;  4JBZ A;  5IGA A;  2ZAM A;  1BIY A;  1QUJ A;  3KG2 A;  4MGZ E;  4GH9 A;  1OFH A;  3FUU A;  3W9W A;  2Z3X A;  1XNR M;  2UVH A;  5ET5 A;  3BXW A;  1EU8 A;  2X26 A;  1OLC A;  4L16 A;  4PDI A;  1DPE A;  2DDK A;  3P7I A;  5I59 B;  3RT8 A;  1K3W A;  4B3R M;  3SAR A;  5H8Q B;  4Z8X A;  3IOU A;  1IUD A;  5EP3 A;  3HFU A;  2Z4S A;  3WHL A;  3TDJ A;  3D4G A;  4TOZ A;  1MY0 A;  4LF7 M;  1R1N A;  1JR3 E;  1URG A;  4GC9 A;  5K2Y A;  4LJ4 A;  3W68 A;  3W67 A;  2LHC A;  5J1D A;  3DP6 A;  3O66 A;  5HPQ A;  3HHW A;  2ERC A;  3GRU A;  4P8B A;  5H8F A;  5L9O A;  3JR4 A;  1MS7 A;  4OVQ A;  5FSW A;  1Y4C A;  2FBP A;  2Z8E A;  5IKB A;  2LVO C;  1B5J A;  3TUS A;  4BDL A;  3FVG A;  2FH0 A;  1FPI A;  3BIH A;  3ISP A;  3M3K A;  5ICQ A;  1IN6 A;  2FNC A;  1NO1 A;  5TP9 B;  3T9X B;  5ITU A;  3GQ5 A;  5EXP A;  4AQY M;  4R6K A;  1PM5 A;  4JI6 M;  1EH3 A;  1LBV A;  4WEP A;  3VVE A;  4EF1 A;  1R6B X;  1PGY A;  3OO9 A;  1FQF A;  1JEV A;  1JR3 A;  3CGW A;  1KA0 A;  3QUJ A;  2XFS A;  3U60 A;  2RC8 A;  2UVG A;  1XWI A;  3SYK A;  4XIG Q;  2XXQ A;  4RNA A;  4OEV A;  4GC5 A;  4ECF A;  2R8T A;  2OZZ A;  2JY6 B;  3CF6 E;  3IOW A;  4ZEF A;  1S7Y A;  2WZJ A;  2DWJ A;  1FPD A;  3E9S A;  3KN7 A;  1VDL A;  2HAV A;  1L2B A;  1VEJ A;  1BTJ A;  3L26 A;  2QVV A;  4WED A;  4LF4 M;  1MQG A;  4I9D A;  3H4Z A;  3MVY A;  1NI9 A;  3CG1 A;  4NF4 B;  1GVN A;  3W0L B;  3ILU B;  3USD A;  2OWT A;  3U5Z B;  3MJ5 A;  3IX1 A;  4QOZ C;  2G93 A;  4DR6 M;  1B52 A;  2AYS A;  2JY5 A;  2VQE M;  4RJZ A;  5AA2 B;  1ZKB A;  2FIX A;  2XXX A;  4DCY A;  3I4V A;  4GVO A;  3U6D A;  4M9Z A;  4FEC A;  2LHG A;  3U6C A;  2B3F A;  4MNI A;  1XNQ M;  2OLB A;  2K9D A;  5DEX A;  4LFA M;  1N0T A;  3CVG A;  4LF6 M;  4PDG A;  3KS8 A;  1FRP A;  4F3S A;  4HE2 A;  1D4N A;  4IBI A;  3NBX X;  2F6G A;  4OQO A;  4EUO A;  3B9P A;  2ZNS A;  4I81 A;  1HQC A;  1QKB A;  4DCX A;  3K6W A;  2LVP C;  2O1L A;  3AL0 C;  1UIU A;  1DGG A;  2XXV A;  3MVW A;  4LZ7 A;  3FUV A;  1SXJ C;  1G3I A;  1MXZ A;  1NV2 A;  3K6X A;  4KI0 E;  3Q25 A;  3SEU A;  2LWX A;  2QFL A;  2F97 A;  3IFC A;  5CRY A;  1DGH B;  4MF3 A;  2QSF X;  4D80 A;  3V5A A;  2ZYN A;  3HCQ A;  1ZU0 A;  1B1X A;  4IJF A;  5FTJ A;  4U22 A;  3C58 A;  1NHW C;  3TL4 X;  1US5 A;  2R4J A;  3GPU A;  1LV7 A;  4RY1 A;  4ITQ A;  3MJN A;  2Y7R A;  3IOV A;  3QMF A;  1IXR C;  2DP8 A;  5AA4 B;  1Y9U A;  2EKF A;  4GFR A;  2B4M A;  4MX6 A;  5I2K B;  2FA7 A;  3SET A;  1YLA A;  1IZ1 A;  4IGR A;  2JP7 A;  3SAT A;  5A5X A;  1Y3Q A;  4NF8 B;  2XF3 A;  1IMD A;  3UK4 A;  2C5R A;  1FJG M;  4ZED A;  4DR5 M;  4JN6 A;  1PDA A;  3FJM A;  3IFA A;  1WJ7 A;  4F2L A;  4JVC A;  3PTY A;  5AE4 A;  4JI8 M;  2P2A A;  2XXT A;  4U4S A;  5ET7 A;  2GRV A;  1J09 A;  4B7H A;  4F3B A;  3B7Z A;  1NY6 A;  3U61 A;  3FJG A;  3I6V A;  1IY1 A;  4FWD A;  1DV0 A;  4LZ5 A;  3ZCB B;  4N6P A;  3N6U A;  3E9X A;  4THI A;  2KEB A;  3PMV A;  5A5L A;  3RY3 A;  2F3B A;  4F1V A;  4R2B A;  4DIG A;  2Y0T A;  1SI0 A;  2QRY A;  4S12 A;  3GLG A;  4GOT A;  1ZTY A;  4PC9 A;  1YUB A;  5JI3 E;  4YB6 A;  1P1Q A;  4H0W A;  1SXJ A;  3FTE A;  2WX9 A;  5B7D A;  4I40 A;  1N78 A;  5A2Q S;  1XI6 A;  1W5S A;  1NUY A;  1O63 A;  3TE6 A;  4FWH A;  2R65 A;  4GX3 A;  4GL0 A;  3MP6 A;  2PCR A;  1Q9D A;  3L29 A;  1Y20 A;  2F78 A;  3IAZ A;  1IXG A;  2KNV A;  4JI1 M;  3OXN A;  3JAM S;  2F5N A;  3MBP A;  5FLX S;  1I6Q A;  2I0C A;  5I56 A;  2F36 A;  2X7P A;  1DTZ A;  2RIN A;  1QUI A;  3HHG A;  2UVJ A;  3TWK A;  1NV3 A;  3SER A;  2YJP A;  1S50 A;  2KZU A;  2R62 A;  3J7B A;  4B08 A;  3GLF E;  4YAH X;  3GRR A;  2L2D A;  2QS4 A;  2DWL A;  3KP0 E;  4MH0 E;  3PVS A;  3BOS A;  2F7A A;  5EHM A;  4OXV A;  5H8H B;  3HU2 A;  2NVU B;  1MPD A;  1F9B A;  4AKI A;  4RK9 A;  4IBC A;  2K47 A;  3FV1 A;  1MY1 A;  3FV2 A;  1ORY B;  1HT1 E;  2F5P A;  4JSO A;  5KZT A;  1INP A;  2XWV A;  3VDP A;  2QS3 A;  2G3Q A;  3FYC A;  1FQC A;  4GXS B;  1NY5 A;  1P1N A;  1P1O A;  2XWO A;  4PFU A;  3E79 A;  3K1M A;  1B2H A;  1YCJ A;  2BNK A;  3OTO M;  4LZ8 A;  5KO3 A;  4YB7 A;  3FE3 A;  1ZQ9 A;  2YPN A;  2ZAO A;  4RF1 A;  5DTB A;  3UMM A;  5TPA B;  3ZKL A;  1C7Y A;  4CIS A;  2DAE A;  1M5B A;  3GLF A;  4XKR A;  2QP9 X;  1R7R A;  4LCB A;  1WHC A;  3RGS A;  1LGB C;  4L17 A;  4POX A;  5I7I A;  4HLQ A;  1B46 A;  2JXN A;  4RK2 A;  5HBC A;  2YR0 A;  1MDP 1;  4LZJ A;  1ZAE A;  2DZL A;  2I7P A;  4P0G A;  5EYH A;  3M0E A;  4NF5 A;  1YSY A;  3HV1 A;  4P1L A;  3K4U A;  1Y3P A;  3GXA A;  2CV1 A;  1B05 A;  1FQA A;  1E9R A;  5FTI A;  4BDQ A;  1JQJ C;  3EF7 A;  1SVX B;  1SW2 A;  3UP9 A;  2DZN B;  3QYT A;  5EQ8 A;  2N35 A;  2YLN A;  2F5S A;  3KEI A;  1XVX A;  2OK2 A;  3IOR A;  3K00 A;  4BBA A;  1B3E A;  3VVF A;  1IN4 A;  4G8N A;  4YMB A;  3CIJ A;  4D81 A;  1RU3 A;  4IJE A;  1LBC A;  5ET6 A;  3SEY A;  1EZO A;  3HHF A;  4CJ6 A;  3ZSF A;  2LVA A;  5BUU A;  1QUS A;  2VF7 A;  1W5T A;  4H45 A;  2HCB A;  1IN8 A;  3RYD A;  2GHB A;  4JI2 M;  2RCB A;  3UJN A;  1O64 A;  1VFE A;  3OEK A;  5JK4 A;  3IHP A;  4OVS A;  3DP4 A;  1IMA A;  3TWM A;  3CI8 A;  3E78 A;  3T22 A;  4IR8 A;  1I4W A;  1TT1 A;  2ESN A;  2HHH M;  2MKZ A;  4FEB A;  2Y84 A;  1P1W A;  4OVZ B;  4NSR A;  1SI1 A;  2DOJ A;  4O3B A;  3LCV B;  3IK6 B;  3MZB A;  4C1U A;  3QXM A;  3TZA A;  4R9F A;  4XGI A;  1FTA A;  1HNZ M;  1XXH E;  3LSW A;  4ZE9 A;  2ZYO A;  2F35 A;  1V34 A;  1IFY A;  2XEP A;  3PNY A;  3QYE A;  1NV7 A;  2VDB B;  2O51 A;  3FIR A;  5ELV A;  1DO0 A;  3I01 M;  4X65 M;  2HXR A;  3I51 A;  2UYE A;  1US4 A;  1CE2 A;  3MVX A;  4N81 A;  4XFE A;  3GLB A;  4GEW A;  3KOY E;  2YNM D;  2WSF F;  1IXI A;  2NUV A;  4N15 A;  3IB2 A;  1G4A E;  1B0H A;  4B7F A;  1IBM M;  1GR2 A;  2FFJ A;  2CEY A;  5H8N B;  1NUZ A;  4R74 A;  4EDP A;  2ZZV A;  5ICT A;  5FTH A;  3GP1 A;  4TLM B;  2L6O A;  4EXK A;  1PBQ A;  3TFL A;  1LAX A;  1I94 M;  1KSF X;  4B3S M;  1OIZ A;  3RPL B;  4GWU A;  2RRU A;  3GLI A;  2VD2 A;  3A3U A;  4GWY A;  2CZL A;  5IWA M;  2CV0 A;  2Q2E B;  1AMF A;  2K6B A;  3M8U A;  5IZZ A;  2I3W A;  4X8R A;  2REJ A;  3HJQ A;  3K1P A;  2ZYK A;  3SEW A;  3HGI A;  2PBW A; 
#chains in the Genus database with same CATH homology
 1DGB A;  2Z7J A;  2X8A A;  4ISU A;  4OFJ A;  3C35 A;  5I84 A;  2UUC M;  3PUX E;  3K02 A;  4P11 A;  3TWL A;  4KHZ E;  3BFU A;  4PET A;  3SDF A;  4HS7 A;  5E26 A;  3RNN A;  2HKJ A;  1UTH B;  2VD3 A;  4LFB M;  4XTC Q;  4OZ9 A;  8CAT A;  4IBK A;  2XZU A;  4OX9 M;  2RKM A;  1L8Q A;  2DVZ A;  3O28 A;  3KN8 A;  2ONR A;  2V93 A;  2CV2 A;  2QJE A;  1LFG A;  4KR5 A;  4JWX A;  3KVW A;  3L6G A;  2P1S A;  2H98 A;  3DFZ A;  2M60 A;  1XC1 A;  2UYF A;  2UXA A;  1DPP A;  4P0I A;  3U6E A;  3PUV E;  4JI3 M;  3IB1 A;  3SEX A;  4G68 B;  4YY3 M;  3TMG A;  5I2N A;  1IEJ A;  4L15 A;  3OMB A;  2ABH A;  1JR3 D;  3KOW E;  3CG3 A;  4H6D A;  1IY2 A;  4MGY E;  5K2X A;  2AHM A;  3L6H A;  5FTK A;  1QVS A;  3N6T A;  1B3F A;  3S9M C;  3EN3 A;  2C96 A;  4DV6 M;  3SHG B;  1HSJ A;  2ZNU A;  3M3F A;  4O3C A;  2CEA A;  4LZZ A;  3C31 A;  1B51 A;  1R9Q A;  4EQ7 A;  1N04 A;  1K82 A;  3TTN A;  1XC8 A;  2XLJ A;  1NJG A;  2CMO A;  4JB7 A;  3PUW E;  4MLQ A;  2CFO A;  4C0R A;  3EQ1 A;  4F18 A;  4JI4 M;  2R4E A;  2X4A A;  2QS2 A;  4ESW A;  4MBP A;  3FAT A;  4LJ5 A;  4JI5 M;  1POY 1;  1Y1Z A;  1D9V A;  5LMU M;  2HZK A;  1G8P A;  2B65 A;  4H65 A;  4AW4 A;  1QAM A;  4NF6 A;  1LBB A;  3TOD A;  5BWJ A;  1SW1 A;  2G29 A;  4IIW A;  3KJT A;  3VLW A;  5KDT B;  3I5O A;  2OQ4 A;  1Z5C A;  4ONY A;  4JI0 M;  3W0F A;  1IQP A;  4Z0I A;  1FTK A;  5ITP A;  3E4R A;  3VDF A;  4R6Y A;  5CI5 A;  3TEP A;  2V3U A;  1OQH A;  1MXV A;  4P16 A;  3T15 A;  4R2F A;  3KDS E;  4A3V B;  4ZEC A;  5I57 B;  2C9O A;  1Z6T A;  4WW0 A;  3PD8 A;  4OET A;  2DZO B;  1S9T A;  5C18 A;  3U6S A;  2F8D A;  4KFQ A;  3VE1 B;  3KBR A;  3RUM A;  4FD2 A;  3Q29 A;  4NE4 A;  3V89 B;  2LAO A;  3K0V A;  3AOE C;  3OSQ A;  2QL3 A;  5L8D A;  2BJW A;  1WXQ A;  3T1Y M;  1SDX A;  4OFL A;  4LP2 B;  5L9M A;  5AA1 A;  1HQY E;  1JW5 A;  4U4X A;  4ZZA A;  4MLV A;  1XS5 A;  3O6G A;  5EXX A;  2LNH C;  3HST A;  1SD3 A;  4OER A;  3LC8 A;  1KFV A;  4D82 A;  1VR5 A;  4KYE A;  5EP2 A;  1JVX A;  2O68 A;  1B5H A;  5FTM A;  3RE8 A;  4GXA A;  3J81 S;  3L27 A;  5ITX E;  1B7H A;  5DVI A;  2VP1 A;  4F31 B;  1AOV A;  3G7W A;  5F7V A;  2A5Y B;  4RPO A;  4LF9 M;  3QAX A;  2Y0Q A;  1H6U A;  4FWG A;  4I5S A;  3E13 X;  3MPK A;  2ZAN A;  3CFX A;  4R9G A;  3R8F A;  1QUK A;  3VK8 A;  1LLS A;  4KLN A;  2DHR A;  4OEN A;  3FUX A;  3A42 A;  1SXJ D;  1MY4 A;  3LUY A;  4NSO B;  2XX7 A;  2DXY A;  3G3G A;  1H3D A;  1PJJ A;  2D7E A;  1A8E A;  4KYS A;  3H6U A;  2KLF A;  4NTL A;  3L28 A;  2DVW B;  3SYL A;  1PBP A;  1XHY A;  3VLV A;  3O97 A;  2UUA M;  2ONK E;  4LA9 A;  3KSX A;  2XH9 A;  1T0K A;  5JTY B;  4JDF A;  4H8J A;  2OWS A;  1MM7 A;  3SHF A;  2ZYM A;  1QAQ A;  2VQF M;  1TFA A;  3AOE A;  3G3F A;  3SAS A;  1UTB B;  5CBS A;  1N33 M;  1M5E A;  4H5F A;  4FVM A;  4QFK A;  5ITT A;  3U93 A;  4FCW A;  2XXY A;  1B4H A;  1LCT A;  2EUC A;  4GLI A;  5EXS A;  4MFI A;  1HR0 M;  3IG8 A;  2FOI C;  3H6T A;  1MQI A;  4PCZ A;  4OWD A;  3MQ9 A;  4JXI A;  1Z5A A;  3AJI B;  4FED A;  5KCJ A;  4NWC A;  4DV4 M;  4Q8R A;  4RXL A;  2XFT A;  4IY6 A;  4XXU A;  3K92 A;  1KYI A;  3MWB A;  1USY H;  3B7D A;  2X49 A;  4GIT A;  4G4R A;  5H8F B;  1TDZ A;  1L2D A;  3G3J A;  1L2C A;  1FTJ A;  3J2P B;  2ONS A;  3Q8X A;  3K1N A;  5EP1 A;  2L7I A;  4F1U A;  5FHM A;  4PFW A;  2DXR A;  1MXX A;  4OTE A;  3T1H M;  3ZS6 A;  3DLN A;  3JV9 A;  4LQ2 A;  3VLF B;  3UIF A;  4NL4 H;  2DQV A;  3FXR A;  1OMP A;  3U60 B;  4MH5 A;  2X7Q A;  2D7G A;  3FXQ A;  1TGU A;  3CR9 A;  3K6U A;  1H44 A;  3M6A A;  2P0S A;  4FJP A;  1K3X A;  1FTM A;  1IY0 A;  4Z6Y A;  3GQ3 A;  1NFT A;  3VKH A;  2XHD A;  1G59 A;  3KGC A;  4DDD A;  5I58 A;  2VII A;  2L09 A;  4DLD A;  2Y7W A;  3MHV C;  3N5L A;  2QPQ A;  4WKM A;  1NNP A;  4XKQ A;  4FCT A;  2OJT A;  1LFH A;  5GKN A;  3CF0 A;  3HHZ A;  3SMP A;  3CRB A;  1UM8 A;  4YMA A;  1C1K A;  1L1Z A;  3KW6 A;  2DWM A;  4BB9 A;  1MQD A;  4X66 M;  2I58 A;  2V1C A;  1IN5 A;  5EQT A;  3MZ9 A;  1N84 A;  1JVY A;  1XOC A;  3UA8 A;  1RKM A;  5DEX B;  2PT2 A;  4ZE8 A;  1TFD A;  4DZ1 A;  2DWA A;  3MW0 A;  3C33 A;  3TTK A;  3VVD A;  4ELO A;  2RGO A;  3I4Y A;  2XZF A;  4UAC A;  1MH3 A;  2FNA A;  3S2V A;  1MXY A;  3AKZ A;  1DMB A;  2J7N A;  2D3I A;  2H5Y A;  3UK6 A;  3KXE C;  1Z59 A;  4G4N A;  3GPY A;  4H8I A;  1BP5 A;  3PPQ A;  2QMX A;  1A40 A;  4QHS A;  3PV0 E;  2ALU A;  3VXB A;  3TEL A;  1JNF A;  4F2O A;  4AZF A;  4GKJ M;  3NBI A;  1MDQ A;  3RQT A;  4JWO A;  2GHA A;  4PE5 B;  4KPT A;  1EZP A;  1B3G A;  3S9N C;  4JI7 M;  1NSF A;  1N3X A;  3VFD A;  1NNJ A;  1OLA A;  2Q2A A;  3ONM A;  1GGG A;  2PX1 A;  2VHA A;  1TH3 A;  4GKK M;  2H1R A;  3H06 B;  3BKI B;  4F3G A;  3LSL A;  2G5G X;  4DV3 M;  4LJA A;  1DSN A;  1POT A;  4ELQ A;  2KW0 A;  5KPR A;  2OBG A;  2F5Q A;  3O9P A;  4DR3 M;  3M7G A;  3O6H A;  2CHG A;  4NXN M;  1MY3 A;  3THI A;  2V25 A;  5A5X B;  1JEU A;  2Z23 A;  5F1Q A;  3Q27 A;  4IBF A;  5JEI A;  1NKX A;  4LJ8 A;  3MK6 A;  3D4C A;  2F7C A;  3C34 A;  5EHS A;  2I49 A;  3O6I A;  1GL7 A;  3BFT A;  4OU7 A;  4W5W A;  3PU5 A;  3LMM A;  3CTW B;  3HO7 A;  1MXU A;  4IBG A;  3HJ8 A;  3GRV A;  1RYO A;  3U61 B;  4N13 A;  2REG A;  4O3A A;  4QSD A;  5FHO A;  3H6W A;  2BJV A;  1UIV A;  2C98 A;  4I1D A;  3LQR A;  1OJL A;  1BKA A;  2HAU A;  5JI2 E;  3GLG B;  3GLH A;  3N26 A;  4IGT A;  3TPA A;  2OCU A;  2L7H A;  4M9S A;  4POW A;  1Q35 A;  3UOR A;  1SXJ B;  1I6B A;  1A54 A;  1MM6 A;  1L5T A;  3CF2 A;  1LST A;  3U1O A;  4DR2 M;  2WKY A;  3SBJ A;  3ODB A;  3IR1 A;  1PJI A;  3K2D A;  4DV0 M;  1GV8 A;  5CMK A;  4DUZ M;  2QBY A;  1QUL A;  5LMN M;  3PGF A;  3VXC A;  1B40 A;  1O7T A;  4IO7 A;  5I56 B;  1E94 E;  4QFO A;  4JWY A;  1Y3N A;  3I3V A;  3S4U A;  4X48 A;  1EZ9 A;  2CHV A;  2R46 A;  3DEL B;  1Q39 A;  3FVO A;  3AFH A;  2Y7K A;  4H5G A;  1NVM A;  1B1H A;  1QVR A;  1N36 M;  2Z4R A;  3PUY E;  4QNR A;  1KWH A;  4M4G A;  3G3K A;  4C1T A;  4LF8 M;  3ZC7 B;  1M5D A;  4G8M A;  2R6G E;  2HL7 A;  3ECR A;  1N75 A;  3RFW A;  3FGS A;  3CFZ A;  4IO4 A;  5C1B A;  1NNT A;  2KXE A;  2DWH A;  2FE8 A;  3PMX A;  1EE8 A;  1XXH A;  3OOA A;  3PMW A;  2XXW A;  4LUB A;  2RGH A;  4M1V A;  5ITY A;  3MC2 A;  4N07 A;  4LJ7 A;  1M5F A;  2DXI A;  3TCH A;  4OHN A;  2DE4 A;  5TU0 A;  3PNV A;  1JW1 A;  7CAT A;  4BDM A;  3C4M A;  3LVV A;  3C9H A;  3BBR A;  1XMQ M;  2DYX A;  3JR5 A;  3GLF B;  1QYR A;  1R2Z A;  4L4U A;  4U1O A;  5FTN A;  1LB9 A;  4II7 A;  4IO2 A;  1NHG C;  4B3M M;  3FUZ A;  4F22 A;  4PFT A;  4NMY A;  3FD3 A;  4IY5 A;  5DVF A;  4IBE A;  1FTL A;  2ZNT A;  3D8L A;  3GO8 A;  3IG5 A;  4B7G A;  1LAG E;  1B7U A;  2KRU A;  3W9V A;  3FZV A;  4ELR A;  2XXH A;  4NF5 B;  4JXJ A;  4DV1 M;  3UN6 A;  4LQ5 A;  4U1Z A;  4OMB A;  1AIV A;  4H1X A;  2EA0 A;  3THG A;  4OFO A;  3IOT A;  4AG6 A;  3ILT B;  3GRY A;  1NNK A;  2LXE A;  2XXI A;  3Q26 A;  3A46 A;  2E1S A;  2I48 A;  4DV7 M;  4DV5 M;  1Y1M A;  3EHS A;  4BDO A;  3EHU A;  1Z5B A;  3MP8 A;  4I8C A;  1IBL M;  2Q9T A;  3U8Q A;  2UXB M;  3FUW A;  3IB0 A;  1NNU C;  1E9S A;  3SMS A;  1URD A;  3PPO A;  5H37 D;  1OVB A;  2AIX A;  5H8Q A;  1H45 A;  1FW0 A;  1Q3B A;  1Z7M E;  1TH4 A;  4QFL A;  5ITR A;  3FVK A;  1USY E;  1XT8 A;  4TUW A;  4YIC A;  2I3V A;  1JET A;  4GIZ A;  4R75 A;  3MAM A;  4R72 A;  3OEN A;  4GF8 A;  4PQJ A;  3OEL A;  3GPX A;  5IZ7 D;  1OIB A;  3AXF A;  5CC2 A;  3HJS A;  4G4Q A;  1T3T A;  2ZM6 M;  5TP9 A;  5CMM A;  5KPZ A;  2D7H A;  3L2A A;  2O6A A;  3QSL A;  3RPW A;  1I6A A;  5HM4 B;  4Z7E A;  3RGY A;  1QZM A;  2XXU A;  1IM2 A;  1D9Y A;  4KO8 A;  1CB6 A;  1MXW A;  2THI A;  4YKJ A;  1B3H A;  2QMW A;  1SYI A;  3GLI B;  2RC7 A;  4R6H A;  2HFB A;  3HWS A;  2W7Y A;  4KD5 A;  4BLA A;  4OW0 A;  3GQ4 A;  4U2R A;  4IB2 A;  3OO7 A;  1B3L A;  1GLN A;  2Y7I A;  3FD9 A;  2O5R A;  3KN3 A;  4LFC M;  3SFZ A;  1TXF A;  2QSX A;  2QS1 A;  4F2Q A;  1ANF A;  4NF4 A;  2Y7P A;  1DTG A;  3U5Z A;  3U6P A;  4CGY B;  1BLF A;  1DO2 A;  5ITQ A;  5AA2 A;  2F34 A;  4RA1 A;  1H43 A;  4PD2 A;  2YQZ A;  3LVW A;  1LB8 A;  1A99 A;  1P99 A;  2H25 A;  2RKO A;  4GHL A;  4WUR A;  4IBD A;  1MY2 A;  2DVC A;  1G41 A;  1OFI A;  4I4L A;  1RYX A;  5M2V A;  1LAH E;  4G6Z A;  4X62 M;  4REZ A;  1L1T A;  2H9B A;  1A55 A;  1R2Y A;  3RTF B;  5ITO A;  3PXG A;  1S3S A;  4ZDM A;  2XD3 A;  4RYA A;  1DGH A;  1PB9 A;  2D5W A;  4IO6 A;  3UGW A;  1LFI A;  3TTM A;  2NOO A;  3VK7 A;  1HNW M;  1DGF A;  5I2N B;  2I7N A;  1QW0 A;  2AL5 A;  1QKA A;  1TWY A;  4LJ6 A;  1GVC A;  3WAF A;  2E5L M;  3EIH A;  4LG2 A;  3FTC A;  3KP1 E;  1URS A;  2PVU A;  4LGM A;  4XKP A;  4E0X A;  1HSL A;  2O69 A;  2PT1 A;  4Q0C A;  5AA4 A;  3DOA A;  1A8F A;  4PFY A;  4RF0 A;  3HU1 A;  5I2K A;  5B70 A;  4EQB A;  3RN8 A;  5IT9 S;  5EYF A;  4NF8 A;  2CUZ A;  3HPI A;  4NXM M;  1MG1 A;  3MVZ A;  4KYD A;  2O7I A;  1B6H A;  4G2Z A;  1B32 A;  2QEN A;  4U21 A;  5ITX A;  3K6V A;  2LH0 A;  4MB7 A;  1GL6 A;  3QWL A;  3CSB A;  2HCA A;  2Z22 A;  4LJ9 A;  3WAE A;  1IXH A;  2DSF A;  3U6O A;  2OPF A;  3R9X B;  5DNY A;  3LSX A;  4NF6 B;  1R9L A;  4XKN A;  4AKG A;  2BJJ X;  4TQU Q;  2O7U A;  3MP1 A;  3LBS A;  3U6L A;  1B5I A;  1NH7 A;  2DS9 A;  1Y4T A;  2HEU A;  4IBJ A;  1IBK M;  4JYA M;  2IA4 A;  1X37 A;  3PUZ E;  2XSZ A;  4JV5 M;  2XGN A;  3H03 A;  5F3W A;  4L78 A;  3GBB A;  4DUY M;  1VFD A;  3J27 B;  2F4V M;  3O29 A;  3FKE A;  1D2N A;  3C36 A;  3SAU A;  3TAJ A;  4FAT A;  1HSE A;  1ZJL A;  3Q28 A;  2KZS A;  3U72 A;  2O84 X;  3QIM A;  4F3P A;  3UGJ A;  3TQW A;  3KOX E;  4PP0 A;  4NWD A;  5L9S A;  3V83 A;  1VE4 A;  4GRK A;  3A09 A;  1TH2 A;  4DXB A;  1GTK A;  4OYV A;  2CHQ A;  1N7X A;  4YB5 A;  1IIW A;  4I8O A;  1AL3 A;  2H99 A;  5H8H A;  5FTL A;  4X9T A;  4YKI A;  3ZKK A;  2ZBK B;  2F7B A;  3QK6 A;  5CMB A;  2Y20 A;  5DVJ A;  3DM0 A;  4DR1 M;  2NQ8 C;  3LR1 A;  2E0S A;  3TTR A;  4FE8 A;  4ZZE A;  1SBP A;  2KRK A;  2KA6 B;  5CBR A;  3VLU A;  1IQ7 A;  5EP4 A;  4FIM A;  4FOR A;  1Z7N E;  4G77 A;  1ZBM A;  4HL4 A;  5TPA A;  4KCC A;  3PPN A;  1YPN A;  4ZPX A;  4HCY A;  4M0W A;  2GH9 A;  3W15 C;  2CE7 A;  2DWZ B;  4PT5 A;  4F19 A;  2V1U A;  3T9U A;  2UU9 M;  3B6W A;  1B9J A;  4E0W A;  5BPV A;  3K2L A;  1NJF A;  4B3T M;  3PFI A;  3PPP A;  4LVQ A;  2C99 A;  3JZJ A;  3TCG A;  3IO4 A;  3DP8 A;  4AG5 A;  3FVN A;  1SXJ E;  3VFJ A;  5CMC A;  3AOG A;  4K0K M;  2D21 A;  1FQD A;  1SYH A;  3KS4 A;  4GD5 A;  4GL8 A;  1SW4 A;  2A5T A;  1NNF A;  1IXC A;  3HHX A;  2Q2C A;  3IJO B;  4EF2 A;  2Y21 A;  4AB6 A;  4MGK E;  3SES A;  2UXD M;  1B58 A;  4X1B A;  4XBO A;  1MRP A;  3OO6 A;  4MM3 B;  3T93 B;  3TQS A;  1JQF A;  3HN0 A;  3HHY A;  4OVJ A;  1PC3 A;  2ZXT A;  2P5T A;  2V3T A;  2R71 A;  3DA1 A;  1IXZ A;  3C32 A;  3R6U A;  3UZU A;  5KQD A;  4AB5 A;  4OVZ A;  4OES A;  4Q30 B;  4QRZ A;  3FTF A;  1MQH A;  3RLF E;  5FHN A;  4NED A;  2JA2 A;  1N76 A;  3KOS A;  4NRV A;  4EXL A;  5IAI A;  4QFN A;  2V84 A;  3H3G A;  3U6M A;  3T96 B;  3IJX B;  2XX8 A;  5KCJ B;  1Q1K A;  3LQQ A;  2RF1 A;  3RT6 B;  3T38 A;  3KSJ A;  1FQB A;  4OEU A;  5BR8 M;  3TCF A;  2XX9 A;  4QSE A;  3TKD A;  1R6Z A;  5KQ8 A;  4F39 A;  3MZ1 A;  4GIP A;  3VDU A;  4U23 A;  2M5Z A;  1M5C A;  4DR7 M;  5H8N A;  1WVJ A;  4MGH A;  4AI6 A;  4G68 C;  2O1M A;  4ZS9 A;  3IO6 A;  2Q88 A;  2A5S A;  4IO5 A;  1J5E M;  3H6V A;  3OSR A;  2J7O A;  3MUQ A;  5IRE B;  4MGI E;  1N32 M;  2PMS A;  2DE2 A;  2RC9 A;  3KOZ E;  2G8L A;  1ZMG A;  3A98 B;  3EHT A;  3KOT A;  3KFM A;  4HCW A;  1N7W A;  3G3I A;  3WHK A;  4JSD A;  3FTD A;  4CHT B;  4DV2 M;  4KCD A;  4DE8 A;  4EQ9 A;  4GHA A;  1P1U A;  4DXU A;  1B0L A;  3PPR A;  5I58 B;  4QF9 A;  4QSC A;  3RGP A;  2DWI A;  2C9C A;  4GRI A;  3S9E A;  3TYH A;  1IIT A;  1HNX M;  4F1Y A;  2HQ0 A;  3U94 A;  1UTH A;  2V6Z M;  2F5O A;  1QJM A;  2RCA A;  1PB8 A;  4ZEK A;  2A5T B;  3SAW A;  3T9H B;  3ILK A;  4DR4 M;  4YHH M;  1MPC A;  5ISU A;  3GPP A;  4UA8 A;  4ND9 A;  4ZEB A;  3SEV A;  3SKP A;  3D8B A;  3TTL A;  2H4I A;  2ANJ A;  3KJ7 A;  4ELP A;  1LAF E;  3FXU A;  4LON B;  1FNN A;  4GWO A;  4R73 A;  3CFL A;  4LAT A;  1OQG A;  4QHT A;  4BDN A;  3K8Z A;  5EXT A;  3N94 A;  1TDH A;  3J80 S;  2VOZ A;  3SAV A;  3U6Q A;  3FUT A;  3KFU G;  3OEM A;  3KZG A;  1XHB A;  4Q5T A;  2QPA A;  3VV5 A;  1OVT A;  1SW5 A;  2Z8D A;  2I6E A;  1MH4 A;  4G68 A;  2I0B A;  4X64 M;  4R3D A;  1AH5 A;  2NXO A;  3HKP A;  2ZMB A;  3DZD A;  3GZG A;  2QZ4 A;  1Q3C A;  3AV0 A;  4ESX A;  2Q89 A;  4YZZ A;  3MPL A;  2XXP A;  1LCF A;  4HW8 A;  2R18 A;  4GMQ A;  2DE3 A;  1QAO A;  1UQW A;  3CSG A;  4RNS A;  3V8X B;  4G4O A;  4LF5 M;  4FCV A;  3TPZ A;  1JW4 A;  3K01 A;  4YKP A;  1NH8 A;  5DYH A;  4I62 A;  1N34 M;  3H7M A;  5CM6 A;  3A45 A;  1II5 A;  4KQP A;  1IXS B;  1N77 A;  3RTW B;  3HU3 A;  4BDR A;  3GBA A;  5H8S A;  3QAU A;  5AA2 D;  3NWL A;  4NOO B;  3TQL A;  4HTG A;  1XVY A;  1WOD A;  1GKI A;  1FQE A;  2EO2 A;  4LRS A;  3JYR A;  4LGY A;  2R9J A;  5KDT A;  3A3C A;  1D3K A;  1J7K A;  3T66 A;  2XXR A;  1MPB A;  4R7G A;  4YU0 A;  1J1N A;  4FW9 A;  1QAN A;  3R26 A;  4X1D A;  3FYD A;  3G3H A;  3J7A S;  1H76 A;  1YE9 A;  3GLH B;  5DT6 A;  1B7Z A;  4IO3 A;  1NMU A;  1I69 A;  2YFQ A;  5I57 A;  4DXC A;  1YAE A;  2HXW A;  1HT2 E;  5KPT A;  2B3B A;  5I59 A;  2M8C A;  2Q8J A;  4K3F A;  4KOD A;  3M3L A;  3U92 A;  3EIE A;  3F11 A;  3K1J A;  3B6Q A;  1YTV A;  2HZL A;  2Z8F A;  4YKK A;  2W82 A;  4L8R C;  4BLC A;  4G8H A;  5EJC A;  2QBY B;  2XD2 A;  1B4Z A;  1MQJ A;  1VDD A;  3QUF A;  3R7X A;  4M9X A;  1MU5 A;  2DWN A;  4AQ4 A;  1MX0 A;  4IBB A;  5LOM A;  1ZIU A;  3S9L C;  1QQW A;  4NRW A;  2GFE A;  3OD7 A;  3SC3 A;  3PD9 A;  1ELJ A;  3VKG A;  3LSF B;  3EPE A;  5E6J A;  3IL1 B;  1FCK A;  3FAS A;  5AA3 A;  2UXC M;  4WXJ A;  1VSO A;  1XXH B;  2F6P A;  1SQY A;  4G4P A;  5DYI A;  1A7L A;  1N3W A;  1PB7 A;  4TLL B;  4AKH A;  3ZH9 B;  1ATG A;  3B6T A;  2R45 A;  3E3K A;  2I4C A;  1XMO M;  4QFP A;  1WDN A;  3FJ7 A;  3O2A A;  2IEE A;  3L25 A;  4QOS A;  3H4M A;  1PEB A;  2PYY A;  2XSZ D;  3T9V A;  4FAJ A;  2UVI A;  1IN7 A;  1ZLQ A;  4H67 A;  1NL5 A;  4QHQ A;  5DYG A;  4EIW A;  4QNM A;  1E32 A;  4RPN A;  2VGQ A;  4LY6 A;  1FTO A;  2UUB M;  4M0D A;  4GQO A;  1DOT A;  4F29 A;  2NWJ A;  4ZEI A;  2AL4 A;  5JTY A;  3OO8 A;  2F5X A;  4LRT A;  2V3Q A;  2FYI A;  2I4B A;  2QCU A;  4KHP M;  1UTB A;  4JBZ A;  2ZAM A;  1BIY A;  1QUJ A;  3KG2 A;  4MGZ E;  4GH9 A;  1OFH A;  3FUU A;  3W9W A;  2Z3X A;  1XNR M;  2UVH A;  1EU8 A;  2X26 A;  1OLC A;  4L16 A;  4PDI A;  1DPE A;  3P7I A;  5I59 B;  3RT8 A;  1K3W A;  4B3R M;  3SAR A;  5H8Q B;  4Z8X A;  3IOU A;  1IUD A;  5EP3 A;  2Z4S A;  3WHL A;  3TDJ A;  3D4G A;  4TOZ A;  1MY0 A;  4LF7 M;  1R1N A;  1URG A;  4GC9 A;  5K2Y A;  4LJ4 A;  5J1D A;  3DP6 A;  3O66 A;  5HPQ A;  3HHW A;  2ERC A;  3GRU A;  5H8F A;  5L9O A;  3JR4 A;  1MS7 A;  5FSW A;  1Y4C A;  2Z8E A;  5IKB A;  1B5J A;  3TUS A;  4BDL A;  3FVG A;  3M3K A;  5ICQ A;  1IN6 A;  2FNC A;  5TP9 B;  3T9X B;  5ITU A;  3GQ5 A;  5EXP A;  4AQY M;  4R6K A;  1PM5 A;  4JI6 M;  1EH3 A;  4WEP A;  3VVE A;  4EF1 A;  1R6B X;  3OO9 A;  1FQF A;  1JEV A;  1JR3 A;  3QUJ A;  2XFS A;  3U60 A;  2RC8 A;  2UVG A;  1XWI A;  3SYK A;  4XIG Q;  2XXQ A;  4RNA A;  4OEV A;  4GC5 A;  4ECF A;  2OZZ A;  3CF6 E;  3IOW A;  4ZEF A;  1S7Y A;  2DWJ A;  3E9S A;  3KN7 A;  2HAV A;  1L2B A;  1BTJ A;  3L26 A;  4WED A;  4LF4 M;  1MQG A;  4I9D A;  3H4Z A;  3MVY A;  3CG1 A;  4NF4 B;  1GVN A;  3W0L B;  3ILU B;  3USD A;  2OWT A;  3U5Z B;  3MJ5 A;  3IX1 A;  4QOZ C;  2G93 A;  4DR6 M;  1B52 A;  2AYS A;  2VQE M;  4RJZ A;  5AA2 B;  1ZKB A;  2XXX A;  4DCY A;  3I4V A;  4GVO A;  3U6D A;  4M9Z A;  4FEC A;  3U6C A;  2B3F A;  1XNQ M;  2OLB A;  5DEX A;  4LFA M;  1N0T A;  3CVG A;  4LF6 M;  4PDG A;  3KS8 A;  4F3S A;  1D4N A;  4IBI A;  2F6G A;  4OQO A;  4EUO A;  3B9P A;  2ZNS A;  4I81 A;  1HQC A;  1QKB A;  4DCX A;  3K6W A;  2O1L A;  3AL0 C;  1UIU A;  1DGG A;  2XXV A;  3MVW A;  4LZ7 A;  3FUV A;  1SXJ C;  1G3I A;  1MXZ A;  3K6X A;  4KI0 E;  3Q25 A;  3SEU A;  2LWX A;  2F97 A;  5CRY A;  1DGH B;  4MF3 A;  4D80 A;  3V5A A;  2ZYN A;  3HCQ A;  1ZU0 A;  1B1X A;  4IJF A;  5FTJ A;  4U22 A;  3C58 A;  1NHW C;  3TL4 X;  1US5 A;  2R4J A;  3GPU A;  1LV7 A;  4RY1 A;  4ITQ A;  3MJN A;  2Y7R A;  3IOV A;  1IXR C;  2DP8 A;  5AA4 B;  1Y9U A;  4GFR A;  5I2K B;  2FA7 A;  3SET A;  1IZ1 A;  4IGR A;  3SAT A;  5A5X A;  1Y3Q A;  4NF8 B;  2XF3 A;  3UK4 A;  2C5R A;  1FJG M;  4ZED A;  4DR5 M;  4JN6 A;  1PDA A;  3FJM A;  5AE4 A;  4JI8 M;  2P2A A;  2XXT A;  4U4S A;  2GRV A;  1J09 A;  4B7H A;  4F3B A;  1NY6 A;  3U61 A;  3FJG A;  3I6V A;  1IY1 A;  4FWD A;  4LZ5 A;  3ZCB B;  4N6P A;  3N6U A;  3E9X A;  4THI A;  2KEB A;  3PMV A;  3RY3 A;  4F1V A;  4R2B A;  4DIG A;  2Y0T A;  1SI0 A;  2QRY A;  4S12 A;  3GLG A;  4GOT A;  1ZTY A;  1YUB A;  5JI3 E;  4YB6 A;  1P1Q A;  4H0W A;  1SXJ A;  3FTE A;  5B7D A;  1N78 A;  5A2Q S;  1W5S A;  1O63 A;  3TE6 A;  4FWH A;  2R65 A;  4GL0 A;  3MP6 A;  3L29 A;  1Y20 A;  2F78 A;  3IAZ A;  1IXG A;  4JI1 M;  3OXN A;  3JAM S;  2F5N A;  3MBP A;  5FLX S;  1I6Q A;  2I0C A;  5I56 A;  2F36 A;  2X7P A;  1DTZ A;  2RIN A;  1QUI A;  3HHG A;  2UVJ A;  3TWK A;  3SER A;  2YJP A;  1S50 A;  2KZU A;  2R62 A;  3J7B A;  4B08 A;  4YAH X;  3GRR A;  2QS4 A;  2DWL A;  3KP0 E;  4MH0 E;  3PVS A;  3BOS A;  2F7A A;  5EHM A;  4OXV A;  5H8H B;  3HU2 A;  2NVU B;  1MPD A;  1F9B A;  4AKI A;  4RK9 A;  4IBC A;  2K47 A;  3FV1 A;  1MY1 A;  3FV2 A;  1ORY B;  1HT1 E;  2F5P A;  4JSO A;  5KZT A;  3VDP A;  2QS3 A;  3FYC A;  1FQC A;  4GXS B;  1NY5 A;  1P1N A;  1P1O A;  4PFU A;  3K1M A;  1B2H A;  1YCJ A;  2BNK A;  3OTO M;  4LZ8 A;  5KO3 A;  4YB7 A;  1ZQ9 A;  2YPN A;  2ZAO A;  4RF1 A;  5DTB A;  3UMM A;  5TPA B;  3ZKL A;  4CIS A;  1M5B A;  3GLF A;  4XKR A;  2QP9 X;  1R7R A;  4LCB A;  3RGS A;  1LGB C;  4L17 A;  4POX A;  4HLQ A;  1B46 A;  4RK2 A;  5HBC A;  2YR0 A;  1MDP 1;  4LZJ A;  1ZAE A;  2I7P A;  4P0G A;  3M0E A;  4NF5 A;  1YSY A;  3HV1 A;  3K4U A;  1Y3P A;  3GXA A;  2CV1 A;  1B05 A;  1FQA A;  1E9R A;  5FTI A;  4BDQ A;  1JQJ C;  3EF7 A;  1SVX B;  1SW2 A;  3UP9 A;  2DZN B;  3QYT A;  2YLN A;  2F5S A;  3KEI A;  1XVX A;  2OK2 A;  3IOR A;  3K00 A;  4BBA A;  1B3E A;  3VVF A;  1IN4 A;  4G8N A;  4YMB A;  3CIJ A;  4D81 A;  4IJE A;  1LBC A;  3SEY A;  1EZO A;  3HHF A;  3ZSF A;  5BUU A;  1W5T A;  2HCB A;  1IN8 A;  2GHB A;  4JI2 M;  2RCB A;  3UJN A;  1O64 A;  1VFE A;  3OEK A;  5JK4 A;  3DP4 A;  3TWM A;  3CI8 A;  3T22 A;  1I4W A;  1TT1 A;  2ESN A;  2HHH M;  4FEB A;  2Y84 A;  1P1W A;  4OVZ B;  4NSR A;  1SI1 A;  2DOJ A;  4O3B A;  3IK6 B;  3MZB A;  4C1U A;  3QXM A;  3TZA A;  4R9F A;  4XGI A;  1HNZ M;  3LSW A;  4ZE9 A;  2ZYO A;  2F35 A;  2XEP A;  3PNY A;  2O51 A;  3FIR A;  5ELV A;  1DO0 A;  4X65 M;  3I51 A;  2UYE A;  1US4 A;  1CE2 A;  3MVX A;  3GLB A;  3KOY E;  2YNM D;  1IXI A;  2NUV A;  3IB2 A;  1G4A E;  1B0H A;  4B7F A;  1IBM M;  1GR2 A;  2FFJ A;  5H8N B;  4R74 A;  4EDP A;  5ICT A;  5FTH A;  3GP1 A;  4TLM B;  2L6O A;  4EXK A;  1PBQ A;  3TFL A;  1LAX A;  1I94 M;  1KSF X;  4B3S M;  3GLI A;  2VD2 A;  3A3U A;  2CZL A;  5IWA M;  2CV0 A;  2Q2E B;  1AMF A;  3M8U A;  2I3W A;  2REJ A;  3HJQ A;  3K1P A;  2ZYK A;  3SEW A;  3HGI A;  2PBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...