1A1FA

Dsnr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA03
2YTJA 2YTEA 2MKDA 1BBOA 2GLIA 1TF6A 2ENCA 2EM8A 2EOIA 2WBTA 2DRPA 2BB8A 2YTOA 2E72A 1LLMC 1AAYA 2JPAA 1X3CA 2EMIA 2LV2A 2EMAA 4X9JA 4R2SA 1TF3A 2EMLA 2EMHA 2YTDA 1A1GA 3MHSC 2EE8A 2LT7A 2GHFA 2M9AA 2EN3A 2EPAA 2ENHA 2EQ0A 4F6MA 2EOFA 2RPCA 5KL3A 4R2DA 2EM7A 2EM0A 2ENAA 2MDGA 1JK2A 1TN9A 1A1LA 5KL6A 2EM5A 2YRHA 4IJDA 2LVHA 4IS1C 2EL6A 3VHTB 2CTDA 2EM4A 2A25A 4R2CA 2EOHA 2EOYA 4R2EA 2EPRA 1X5WA 2D9HA 2EOMA 3EPLA 2DLKA 5KL2A 2EL4A 2MKNA 2EL5A 4R2QA 1UBDC 2EN8A 2EM9A 3UK3C 1WJPA 2EOXA 1A1KA 1G2FC 2HGHA 2EM2A 3MHHC 2EN1A 2EMXA 1RMDA 2EQ1A 3EPKA 2EOSA 2RSIA 2EMCA 2EPZA 2NABA 2EOEA 1DGCA 2CSHA 2LO3A 2EJ4A 2YU8A 1A1FA 1YSAC 2WBSA 2YTFA 1ZR9A 2YTIA 1X6HA 2EPCA 3EPJA 2EORA 2EN7A 2ELZA 1JK1A 2EPXA 1A1JA 2EM6A 1MEYC 2YRMA 1X6EA 2YTGA 1A1HA 1ZU1A 4GZNC 2YTNA 2YU5A 5KL7A 2EMGA 2EMYA 2EQ3A 4F6NA 1YUIA 4R2AA 2EMKA 2EPUA 2PRTA 1G2DC 2YSPA 5KL4A 1YUJA 2LCEA 4WSGA 2EOZA 2WBUA 4M9VC 1UN6B 2ADRA 2ELYA 2EOQA 2EN6A 2EMFA 4R2RA 1A1IA 2J7JA 1ZAAC 2EM3A 1F2IG 1KJKA 2EN4A 2YRKA 1NCSA 2YSOA 2YTQA 2EMBA 4R2PA 2EP3A 2DGCA 5KL5A 2DLQA 3M99B 1B69A 2EPPA 2WCC3 2EMWA 2EMZA 2CT1A 1BB8A 2JP9A 2EN2A 2EOJA 2EOOA 2R1FA 2VRDA 2YTPA 3EPHA 2I13A 4FK5C 1Z1BA 4F2JC 1X6FA 2DMIA 1P47A
chains in the Genus database with same CATH superfamily
4JI5E 2V86A 1BBOA 2EPNA 4LF6E 4WXDA 2GLIA 2N3HA 4X64E 2G7HA 2WBTA 3K6QA 4YHHE 3VYXA 2JPAA 2EMIA 2L2MA 1TF3A 2EMHA 2HJJA 4O4KA 1N36E 1A1GA 2GHFA 4DUYE 1XMQE 2EPLX 4JI0E 2ENHA 4JYAE 4F6MA 2EOFA 5AC5A 4DR5E 4DV6E 2MDGA 4LFCE 2JXPA 5BR8E 1IMUA 4P78A 3MSWA 3EQ1A 4Q35B 2YRHA 4B3ME 4JI7E 2LE2A 2KOUA 4R03A 4DR4E 2K7IA 4WPYA 3VHTB 2CTDA 4KWYA 1EKZA 2GPIA 4R2CA 2V8QB 2EOYA 4BHBA 3IWBA 4LF7E 1X5WA 4R2QA 4L5NC 3ECRA 4BHCA 1UBDC 2ODRD 2EOXA 2VQFE 1QNTA 2MC6A 2DB2A 3C6MA 4BC7A 1O0WA 2EOSA 2RSIA 3BGHA 2LTSA 4HEIA 1DGCA 2CSHA 1UHZA 2YU8A 1A1FA 1YSAC 2YTFA 1ZR9A 1X6HA 2EPCA 1J5EE 2EN7A 5IWAE 2KHXA 2LTRA 1JK1A 3ADLA 2YRMA 3JU0A 2RTXA 2YTNA 3ADJA 3THOB 4DKKA 2EMGA 3H09A 1T4LB 3HTXA 4WFTA 1N3GA 2L2KB 2DSYA 3J7AG 2FTXB 4MLQA 2LCEA 2VF1A 3VK6A 5T6JA 3KZZA 2EOQA 4BBYA 2EMFA 3LMLA 4DR6E 2NUFA 2EM3A 1F2IG 2JOXA 3L00A 4R2PA 2RS7A 4DV1E 2V85A 3ADGA 5FLXC 2EPPA 1B69A 4OX9E 5LLQA 3LLHA 3HQ1A 2I13A 1Z1BA 1T38A 4B3SE 1X6FA 2FGGA 1IQSA 2DMIA 5LL6R 1I94E 2YTEA 2B9DA 2HHHE 4J8ZA 2NA2A 2YTOA 2E72A 2VE7C 1LLMC 1AAYA 1HR0E 5CFFE 2UUAE 3HPSA 2EPMX 4R8OA 2V89A 4X9JA 2B7VA 5A6BD 1RC7A 1EH8A 2LT7A 2EQ0A 2L6MA 4GKJE 2RPCA 5KL3A 2EM7A 2EM0A 3BIDA 1JK2A 4BMJA 3T1HE 1TN9A 1ZBTA 3HXLA 4LU9A 4IJDA 4F9AB 5IXMB 1PKPA 5AE2A 2I9IA 4DR7E 4Q28A 4NXME 5A2QC 4B3TE 4R2EA 4I8OA 2EPRA 1IBME 2DLKA 5KL2A 2EL5A 1XNQE 5ADZA 3F6GA 1WHNA 2EN8A 2EM9A 1WJPA 3UK3C 2B3TB 1A1KA 3AV0A 2HGHA 5A6BA 3ADIA 1RMDA 5LMUE 1EH6A 3J7Yp 4LFBE 4NXNE 2NUEA 4JI1E 4WYQB 4F54A 1IBKE 1YZ9A 2EJ4A 1WHQA 2H36X 4DV3E 1GZ6A 1T4NA 4NHRA 1KYQA 2EPXA 1A1JA 2HC5A 2YTGA 2F4VE 1ZU1A 5KL7A 4NZVA 4F6NA 4R2AA 4X8WA 2EMKA 4AQYE 2PRTA 2RQLA 3TQMA 4YY3E 4DV7E 1YUJA 3OTOE 3VYYA 2L33A 4LF5E 1UN6B 1T39A 1A1IA 4X65E 1RQ0A 1FJGE 5AC4A 2EN4A 2YPNA 1NCSA 4X66E 2L3CA 2EMBA 4K0KE 3KWRA 4BS9A 1ZBQA 3M99B 4DR1E 2WCC3 5TSEA 1PDAA 2UUCE 1BB8A 2VRDA 2YTPA 1XMOE 5IV8B 4JI8E 1L4SA 2JWOA 4FK5C 4OOGC 2KONA 1EH7A 3DF6A 2YTJA 2MKDA 5F3WA 1YFHA 2L2NA 4GEQB 2UU9E 4RH8A 2ENCA 4HTGA 2DRPA 2BB8A 4M0VA 1MGTA 2EPKX 2JOBA 4JI2E 3THNA 4BCAA 2EMLA 2LRSA 2YTDA 1STUA 1UILA 4B3RE 2V88A 5LMNE 1GQEA 2V87A 2LUQA 4R2DA 5A6AA 3J80C 2LVHA 4F9BB 4WX9A 4LF8E 2EM4A 2UXBE 4DV2E 2EOHA 1YYOA 4M2ZA 4BC9A 3EPLA 2EOMA 3C4TA 2MKNA 4P7DA 2LUPB 1G2FC 1SFEA 5A6JA 2EM2A 2EN1A 5AE3A 2EMXA 1IBLE 4N4RB 3EPKA 3IWDA 2NABA 2EPZA 4O5GA 2EOEA 1AH5A 2LO3A 1PJSA 1N34E 2WBSA 2YTIA 1FKAE 2EORA 4WXCA 2EM6A 2EPOA 4ZYEA 3JTZA 2EMYA 2UXDE 1YUIA 4JI4E 2EPUA 3T1YE 5A6KA 1G2DC 1N32E 2F8BA 2EOZA 2EWLA 4M9VC 3F6HA 2ADRA 2JVAA 5DNYA 4R2RA 1SR9A 2J7JA 1ZAAC 1KJKA 3P1XA 4M30A 2YT4A 2DGCA 4X62E 5KL5A 4ZYHA 4L8NA 4MLVA 3JAMC 2E1MA 1PJQA 2YWQA 2UUBE 2MC5A 4KHPE 5IT9C 3BF2A 1WRJA 2JP9A 1XNRE 2EOJA 2EOOA 2R1FA 3EPHA 1PJTA 2ODRC 3HPZA 4F2JC 1YPNA 1P47A 3ZOQB 3FIGA 2LMZA 2ZM6E 1TF6A 1HNZE 2EM8A 2EOIA 2FV4B 1IQOA 2YZTA 2JR1A 1X3CA 2LV2A 2EMAA 1YYWA 2VQEE 4DV4E 4R2SA 2NUGA 2UXCE 3MHSC 2EE8A 3OMLA 3J81C 4KZSA 2M9AA 2EN3A 2EPAA 2DIXA 3BBGA 3KZYA 2ENAA 4ZYGA 4JI6E 3DJWA 1T4OA 2L92A 1DI2A 1A1LA 5KL6A 4F9CB 2EM5A 1BBGA 2EZ6A 3RMPA 4LFAE 1X49A 4ZYDA 4IS1C 2EL6A 2A25A 4JI3E 4DMIA 2L3JA 4GKKE 4LF4E 2D9HA 1YYKA 2LBSB 2EL4A 1J26A 2DMYA 2LJHA 3MHHC 2N8XA 2B7TA 2E5LE 2EQ1A 2M1SA 2CPNA 2EMCA 2RS6A 2WZOA 2MDRA 4TUGA 2IHR1 3QG5C 1DQ3A 4DUZE 2JYAA 4LTYA 3EPJA 5AE1A 4TUIA 2ELZA 1MEYC 3AUZA 3C6KA 1X6EA 2L8TA 4DR2E 1A1HA 4GZNC 1N33E 2YU5A 2JY9A 2M7QA 2EQ3A 2N3GA 1GTKA 1HNXE 2LJUA 3C4BA 4JV5E 1NEIA 2YSPA 5KL4A 4WSGA 2M4IA 5AASA 1X48A 2WBUA 4DV0E 2ELYA 2EN6A 2Q8UA 4RHBB 2BBGA 2YRKA 2YSOA 4WSPA 2YTQA 2EP3A 4DR3E 1WXRA 2K4VA 4O43A 5A69A 2DLQA 4LF9E 2V83A 2RSMA 2EMWA 2EMZA 2CT1A 2EN2A 1HNWE 3IWCA 4O24A 1QU6A 4DV5E 1X47A 2R76A
chains in the Genus database with same CATH topology
2YTJA 2YTEA 2MKDA 1BBOA 2GLIA 1TF6A 2ENCA 2EM8A 2EOIA 2WBTA 2DRPA 2BB8A 2YTOA 2E72A 1LLMC 1AAYA 2JPAA 1X3CA 2EMIA 2LV2A 2EMAA 4X9JA 4R2SA 1TF3A 2EMLA 2EMHA 2YTDA 1A1GA 3MHSC 2EE8A 2LT7A 2GHFA 2M9AA 2EN3A 2EPAA 2ENHA 2EQ0A 4F6MA 2EOFA 2RPCA 5KL3A 4R2DA 2EM7A 2EM0A 2ENAA 2MDGA 1JK2A 1TN9A 1A1LA 5KL6A 2EM5A 2YRHA 4IJDA 2LVHA 4IS1C 2EL6A 3VHTB 2CTDA 2EM4A 2A25A 4R2CA 2EOHA 2EOYA 4R2EA 2EPRA 1X5WA 2D9HA 2EOMA 3EPLA 2DLKA 5KL2A 2EL4A 2MKNA 2EL5A 4R2QA 1UBDC 2EN8A 2EM9A 3UK3C 1WJPA 2EOXA 1A1KA 1G2FC 2HGHA 2EM2A 3MHHC 2EN1A 2EMXA 1RMDA 2EQ1A 3EPKA 2EOSA 2RSIA 2EMCA 2EPZA 2NABA 2EOEA 1DGCA 2CSHA 2LO3A 2EJ4A 2YU8A 1A1FA 1YSAC 2WBSA 2YTFA 1ZR9A 2YTIA 1X6HA 2EPCA 3EPJA 2EORA 2EN7A 2ELZA 1JK1A 2EPXA 1A1JA 2EM6A 1MEYC 2YRMA 1X6EA 2YTGA 1A1HA 1ZU1A 4GZNC 2YTNA 2YU5A 5KL7A 2EMGA 2EMYA 2EQ3A 4F6NA 1YUIA 4R2AA 2EMKA 2EPUA 2PRTA 1G2DC 2YSPA 5KL4A 1YUJA 2LCEA 4WSGA 2EOZA 2WBUA 4M9VC 1UN6B 2ADRA 2ELYA 2EOQA 2EN6A 2EMFA 4R2RA 1A1IA 2J7JA 1ZAAC 2EM3A 1F2IG 1KJKA 2EN4A 2YRKA 1NCSA 2YSOA 2YTQA 2EMBA 4R2PA 2EP3A 2DGCA 5KL5A 2DLQA 3M99B 1B69A 2EPPA 2WCC3 2EMWA 2EMZA 2CT1A 1BB8A 2JP9A 2EN2A 2EOJA 2EOOA 2R1FA 2VRDA 2YTPA 3EPHA 2I13A 4FK5C 1Z1BA 4F2JC 1X6FA 2DMIA 1P47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTJ A;  2YTE A;  2MKD A;  1BBO A;  2GLI A;  1TF6 A;  2ENC A;  2EM8 A;  2EOI A;  2WBT A;  2DRP A;  2BB8 A;  2YTO A;  2E72 A;  1LLM C;  1AAY A;  2JPA A;  1X3C A;  2EMI A;  2LV2 A;  2EMA A;  4X9J A;  4R2S A;  1TF3 A;  2EML A;  2EMH A;  2YTD A;  1A1G A;  3MHS C;  2EE8 A;  2LT7 A;  2GHF A;  2M9A A;  2EN3 A;  2EPA A;  2ENH A;  2EQ0 A;  4F6M A;  2EOF A;  2RPC A;  5KL3 A;  4R2D A;  2EM7 A;  2EM0 A;  2ENA A;  2MDG A;  1JK2 A;  1TN9 A;  1A1L A;  5KL6 A;  2EM5 A;  2YRH A;  4IJD A;  2LVH A;  4IS1 C;  2EL6 A;  3VHT B;  2CTD A;  2EM4 A;  2A25 A;  4R2C A;  2EOH A;  2EOY A;  4R2E A;  2EPR A;  1X5W A;  2D9H A;  2EOM A;  3EPL A;  2DLK A;  5KL2 A;  2EL4 A;  2MKN A;  2EL5 A;  4R2Q A;  1UBD C;  2EN8 A;  2EM9 A;  3UK3 C;  1WJP A;  2EOX A;  1A1K A;  1G2F C;  2HGH A;  2EM2 A;  3MHH C;  2EN1 A;  2EMX A;  1RMD A;  2EQ1 A;  3EPK A;  2EOS A;  2RSI A;  2EMC A;  2EPZ A;  2NAB A;  2EOE A;  1DGC A;  2CSH A;  2LO3 A;  2EJ4 A;  2YU8 A;  1A1F A;  1YSA C;  2WBS A;  2YTF A;  1ZR9 A;  2YTI A;  1X6H A;  2EPC A;  3EPJ A;  2EOR A;  2EN7 A;  2ELZ A;  1JK1 A;  2EPX A;  1A1J A;  2EM6 A;  1MEY C;  2YRM A;  1X6E A;  2YTG A;  1A1H A;  1ZU1 A;  4GZN C;  2YTN A;  2YU5 A;  5KL7 A;  2EMG A;  2EMY A;  2EQ3 A;  4F6N A;  1YUI A;  4R2A A;  2EMK A;  2EPU A;  2PRT A;  1G2D C;  2YSP A;  5KL4 A;  1YUJ A;  2LCE A;  4WSG A;  2EOZ A;  2WBU A;  4M9V C;  1UN6 B;  2ADR A;  2ELY A;  2EOQ A;  2EN6 A;  2EMF A;  4R2R A;  1A1I A;  2J7J A;  1ZAA C;  2EM3 A;  1F2I G;  1KJK A;  2EN4 A;  2YRK A;  1NCS A;  2YSO A;  2YTQ A;  2EMB A;  4R2P A;  2EP3 A;  2DGC A;  5KL5 A;  2DLQ A;  3M99 B;  1B69 A;  2EPP A;  2WCC 3;  2EMW A;  2EMZ A;  2CT1 A;  1BB8 A;  2JP9 A;  2EN2 A;  2EOJ A;  2EOO A;  2R1F A;  2VRD A;  2YTP A;  3EPH A;  2I13 A;  4FK5 C;  1Z1B A;  4F2J C;  1X6F A;  2DMI A;  1P47 A; 
#chains in the Genus database with same CATH topology
 4JI5 E;  2V86 A;  1BBO A;  2EPN A;  4LF6 E;  4WXD A;  2GLI A;  2N3H A;  4X64 E;  2G7H A;  2WBT A;  3K6Q A;  4YHH E;  3VYX A;  2JPA A;  2EMI A;  2L2M A;  1TF3 A;  2EMH A;  2HJJ A;  4O4K A;  1N36 E;  1A1G A;  2GHF A;  4DUY E;  1XMQ E;  2EPL X;  4JI0 E;  2ENH A;  4JYA E;  4F6M A;  2EOF A;  5AC5 A;  4DR5 E;  4DV6 E;  2MDG A;  4LFC E;  2JXP A;  5BR8 E;  1IMU A;  4P78 A;  3MSW A;  3EQ1 A;  4Q35 B;  2YRH A;  4B3M E;  4JI7 E;  2LE2 A;  2KOU A;  4R03 A;  4DR4 E;  2K7I A;  4WPY A;  3VHT B;  2CTD A;  4KWY A;  1EKZ A;  2GPI A;  4R2C A;  2V8Q B;  2EOY A;  4BHB A;  3IWB A;  4LF7 E;  1X5W A;  4R2Q A;  4L5N C;  3ECR A;  4BHC A;  1UBD C;  2ODR D;  2EOX A;  2VQF E;  1QNT A;  2MC6 A;  2DB2 A;  3C6M A;  4BC7 A;  1O0W A;  2EOS A;  2RSI A;  3BGH A;  2LTS A;  4HEI A;  1DGC A;  2CSH A;  1UHZ A;  2YU8 A;  1A1F A;  1YSA C;  2YTF A;  1ZR9 A;  1X6H A;  2EPC A;  1J5E E;  2EN7 A;  5IWA E;  2KHX A;  2LTR A;  1JK1 A;  3ADL A;  2YRM A;  3JU0 A;  2RTX A;  2YTN A;  3ADJ A;  3THO B;  4DKK A;  2EMG A;  3H09 A;  1T4L B;  3HTX A;  4WFT A;  1N3G A;  2L2K B;  2DSY A;  3J7A G;  2FTX B;  4MLQ A;  2LCE A;  2VF1 A;  3VK6 A;  5T6J A;  3KZZ A;  2EOQ A;  4BBY A;  2EMF A;  3LML A;  4DR6 E;  2NUF A;  2EM3 A;  1F2I G;  2JOX A;  3L00 A;  4R2P A;  2RS7 A;  4DV1 E;  2V85 A;  3ADG A;  5FLX C;  2EPP A;  1B69 A;  4OX9 E;  5LLQ A;  3LLH A;  3HQ1 A;  2I13 A;  1Z1B A;  1T38 A;  4B3S E;  1X6F A;  2FGG A;  1IQS A;  2DMI A;  5LL6 R;  1I94 E;  2YTE A;  2B9D A;  2HHH E;  4J8Z A;  2NA2 A;  2YTO A;  2E72 A;  2VE7 C;  1LLM C;  1AAY A;  1HR0 E;  5CFF E;  2UUA E;  3HPS A;  2EPM X;  4R8O A;  2V89 A;  4X9J A;  2B7V A;  5A6B D;  1RC7 A;  1EH8 A;  2LT7 A;  2EQ0 A;  2L6M A;  4GKJ E;  2RPC A;  5KL3 A;  2EM7 A;  2EM0 A;  3BID A;  1JK2 A;  4BMJ A;  3T1H E;  1TN9 A;  1ZBT A;  3HXL A;  4LU9 A;  4IJD A;  4F9A B;  5IXM B;  1PKP A;  5AE2 A;  2I9I A;  4DR7 E;  4Q28 A;  4NXM E;  5A2Q C;  4B3T E;  4R2E A;  4I8O A;  2EPR A;  1IBM E;  2DLK A;  5KL2 A;  2EL5 A;  1XNQ E;  5ADZ A;  3F6G A;  1WHN A;  2EN8 A;  2EM9 A;  1WJP A;  3UK3 C;  2B3T B;  1A1K A;  3AV0 A;  2HGH A;  5A6B A;  3ADI A;  1RMD A;  5LMU E;  1EH6 A;  3J7Y p;  4LFB E;  4NXN E;  2NUE A;  4JI1 E;  4WYQ B;  4F54 A;  1IBK E;  1YZ9 A;  2EJ4 A;  1WHQ A;  2H36 X;  4DV3 E;  1GZ6 A;  1T4N A;  4NHR A;  1KYQ A;  2EPX A;  1A1J A;  2HC5 A;  2YTG A;  2F4V E;  1ZU1 A;  5KL7 A;  4NZV A;  4F6N A;  4R2A A;  4X8W A;  2EMK A;  4AQY E;  2PRT A;  2RQL A;  3TQM A;  4YY3 E;  4DV7 E;  1YUJ A;  3OTO E;  3VYY A;  2L33 A;  4LF5 E;  1UN6 B;  1T39 A;  1A1I A;  4X65 E;  1RQ0 A;  1FJG E;  5AC4 A;  2EN4 A;  2YPN A;  1NCS A;  4X66 E;  2L3C A;  2EMB A;  4K0K E;  3KWR A;  4BS9 A;  1ZBQ A;  3M99 B;  4DR1 E;  2WCC 3;  5TSE A;  1PDA A;  2UUC E;  1BB8 A;  2VRD A;  2YTP A;  1XMO E;  5IV8 B;  4JI8 E;  1L4S A;  2JWO A;  4FK5 C;  4OOG C;  2KON A;  1EH7 A;  3DF6 A;  2YTJ A;  2MKD A;  5F3W A;  1YFH A;  2L2N A;  4GEQ B;  2UU9 E;  4RH8 A;  2ENC A;  4HTG A;  2DRP A;  2BB8 A;  4M0V A;  1MGT A;  2EPK X;  2JOB A;  4JI2 E;  3THN A;  4BCA A;  2EML A;  2LRS A;  2YTD A;  1STU A;  1UIL A;  4B3R E;  2V88 A;  5LMN E;  1GQE A;  2V87 A;  2LUQ A;  4R2D A;  5A6A A;  3J80 C;  2LVH A;  4F9B B;  4WX9 A;  4LF8 E;  2EM4 A;  2UXB E;  4DV2 E;  2EOH A;  1YYO A;  4M2Z A;  4BC9 A;  3EPL A;  2EOM A;  3C4T A;  2MKN A;  4P7D A;  2LUP B;  1G2F C;  1SFE A;  5A6J A;  2EM2 A;  2EN1 A;  5AE3 A;  2EMX A;  1IBL E;  4N4R B;  3EPK A;  3IWD A;  2NAB A;  2EPZ A;  4O5G A;  2EOE A;  1AH5 A;  2LO3 A;  1PJS A;  1N34 E;  2WBS A;  2YTI A;  1FKA E;  2EOR A;  4WXC A;  2EM6 A;  2EPO A;  4ZYE A;  3JTZ A;  2EMY A;  2UXD E;  1YUI A;  4JI4 E;  2EPU A;  3T1Y E;  5A6K A;  1G2D C;  1N32 E;  2F8B A;  2EOZ A;  2EWL A;  4M9V C;  3F6H A;  2ADR A;  2JVA A;  5DNY A;  4R2R A;  1SR9 A;  2J7J A;  1ZAA C;  1KJK A;  3P1X A;  4M30 A;  2YT4 A;  2DGC A;  4X62 E;  5KL5 A;  4ZYH A;  4L8N A;  4MLV A;  3JAM C;  2E1M A;  1PJQ A;  2YWQ A;  2UUB E;  2MC5 A;  4KHP E;  5IT9 C;  3BF2 A;  1WRJ A;  2JP9 A;  1XNR E;  2EOJ A;  2EOO A;  2R1F A;  3EPH A;  1PJT A;  2ODR C;  3HPZ A;  4F2J C;  1YPN A;  1P47 A;  3ZOQ B;  3FIG A;  2LMZ A;  2ZM6 E;  1TF6 A;  1HNZ E;  2EM8 A;  2EOI A;  2FV4 B;  1IQO A;  2YZT A;  2JR1 A;  1X3C A;  2LV2 A;  2EMA A;  1YYW A;  2VQE E;  4DV4 E;  4R2S A;  2NUG A;  2UXC E;  3MHS C;  2EE8 A;  3OML A;  3J81 C;  4KZS A;  2M9A A;  2EN3 A;  2EPA A;  2DIX A;  3BBG A;  3KZY A;  2ENA A;  4ZYG A;  4JI6 E;  3DJW A;  1T4O A;  2L92 A;  1DI2 A;  1A1L A;  5KL6 A;  4F9C B;  2EM5 A;  1BBG A;  2EZ6 A;  3RMP A;  4LFA E;  1X49 A;  4ZYD A;  4IS1 C;  2EL6 A;  2A25 A;  4JI3 E;  4DMI A;  2L3J A;  4GKK E;  4LF4 E;  2D9H A;  1YYK A;  2LBS B;  2EL4 A;  1J26 A;  2DMY A;  2LJH A;  3MHH C;  2N8X A;  2B7T A;  2E5L E;  2EQ1 A;  2M1S A;  2CPN A;  2EMC A;  2RS6 A;  2WZO A;  2MDR A;  4TUG A;  2IHR 1;  3QG5 C;  1DQ3 A;  4DUZ E;  2JYA A;  4LTY A;  3EPJ A;  5AE1 A;  4TUI A;  2ELZ A;  1MEY C;  3AUZ A;  3C6K A;  1X6E A;  2L8T A;  4DR2 E;  1A1H A;  4GZN C;  1N33 E;  2YU5 A;  2JY9 A;  2M7Q A;  2EQ3 A;  2N3G A;  1GTK A;  1HNX E;  2LJU A;  3C4B A;  4JV5 E;  1NEI A;  2YSP A;  5KL4 A;  4WSG A;  2M4I A;  5AAS A;  1X48 A;  2WBU A;  4DV0 E;  2ELY A;  2EN6 A;  2Q8U A;  4RHB B;  2BBG A;  2YRK A;  2YSO A;  4WSP A;  2YTQ A;  2EP3 A;  4DR3 E;  1WXR A;  2K4V A;  4O43 A;  5A69 A;  2DLQ A;  4LF9 E;  2V83 A;  2RSM A;  2EMW A;  2EMZ A;  2CT1 A;  2EN2 A;  1HNW E;  3IWC A;  4O24 A;  1QU6 A;  4DV5 E;  1X47 A;  2R76 A; 
#chains in the Genus database with same CATH homology
 2YTJ A;  2YTE A;  2MKD A;  1BBO A;  2GLI A;  1TF6 A;  2ENC A;  2EM8 A;  2EOI A;  2WBT A;  2DRP A;  2BB8 A;  2YTO A;  2E72 A;  1LLM C;  1AAY A;  2JPA A;  1X3C A;  2EMI A;  2LV2 A;  2EMA A;  4X9J A;  4R2S A;  1TF3 A;  2EML A;  2EMH A;  2YTD A;  1A1G A;  3MHS C;  2EE8 A;  2LT7 A;  2GHF A;  2M9A A;  2EN3 A;  2EPA A;  2ENH A;  2EQ0 A;  4F6M A;  2EOF A;  2RPC A;  5KL3 A;  4R2D A;  2EM7 A;  2EM0 A;  2ENA A;  2MDG A;  1JK2 A;  1TN9 A;  1A1L A;  5KL6 A;  2EM5 A;  2YRH A;  4IJD A;  2LVH A;  4IS1 C;  2EL6 A;  3VHT B;  2CTD A;  2EM4 A;  2A25 A;  4R2C A;  2EOH A;  2EOY A;  4R2E A;  2EPR A;  1X5W A;  2D9H A;  2EOM A;  3EPL A;  2DLK A;  5KL2 A;  2EL4 A;  2MKN A;  2EL5 A;  4R2Q A;  1UBD C;  2EN8 A;  2EM9 A;  3UK3 C;  1WJP A;  2EOX A;  1A1K A;  1G2F C;  2HGH A;  2EM2 A;  3MHH C;  2EN1 A;  2EMX A;  1RMD A;  2EQ1 A;  3EPK A;  2EOS A;  2RSI A;  2EMC A;  2EPZ A;  2NAB A;  2EOE A;  1DGC A;  2CSH A;  2LO3 A;  2EJ4 A;  2YU8 A;  1A1F A;  1YSA C;  2WBS A;  2YTF A;  1ZR9 A;  2YTI A;  1X6H A;  2EPC A;  3EPJ A;  2EOR A;  2EN7 A;  2ELZ A;  1JK1 A;  2EPX A;  1A1J A;  2EM6 A;  1MEY C;  2YRM A;  1X6E A;  2YTG A;  1A1H A;  1ZU1 A;  4GZN C;  2YTN A;  2YU5 A;  5KL7 A;  2EMG A;  2EMY A;  2EQ3 A;  4F6N A;  1YUI A;  4R2A A;  2EMK A;  2EPU A;  2PRT A;  1G2D C;  2YSP A;  5KL4 A;  1YUJ A;  2LCE A;  4WSG A;  2EOZ A;  2WBU A;  4M9V C;  1UN6 B;  2ADR A;  2ELY A;  2EOQ A;  2EN6 A;  2EMF A;  4R2R A;  1A1I A;  2J7J A;  1ZAA C;  2EM3 A;  1F2I G;  1KJK A;  2EN4 A;  2YRK A;  1NCS A;  2YSO A;  2YTQ A;  2EMB A;  4R2P A;  2EP3 A;  2DGC A;  5KL5 A;  2DLQ A;  3M99 B;  1B69 A;  2EPP A;  2WCC 3;  2EMW A;  2EMZ A;  2CT1 A;  1BB8 A;  2JP9 A;  2EN2 A;  2EOJ A;  2EOO A;  2R1F A;  2VRD A;  2YTP A;  3EPH A;  2I13 A;  4FK5 C;  1Z1B A;  4F2J C;  1X6F A;  2DMI A;  1P47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...