1A1FA

Dsnr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 26
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA03
2EOOA 2YU5A 2EOSA 3UK3C 2EP3A 2EN7A 2EM8A 1A1LA 1ZR9A 1DGCA 2EPUA 5KL2A 2WBSA 1G2DC 2RSIA 2JP9A 2ELZA 2EPXA 2MDGA 2PRTA 2ELYA 1WJPA 2DLKA 2EMCA 2RPCA 2VRDA 3EPKA 3VHTB 2YTOA 5KL5A 2BB8A 2EN3A 2DGCA 2R1FA 1A1GA 4R2PA 1ZAAC 2DRPA 1YSAC 1RMDA 5KL3A 2EMBA 2M9AA 2EL5A 4F2JC 2EMWA 2EOEA 2EPZA 1MEYC 1P47A 2EMIA 4IJDA 1JK1A 2LCEA 1A1JA 2LT7A 1BB8A 2EMAA 2YRKA 2ENAA 2GHFA 4X9JA 2EQ0A 2YTQA 1YUIA 2EPCA 4R2SA 4R2QA 2EM4A 2EN1A 2WBTA 4F6NA 2EE8A 1F2IG 2DLQA 2WCC3 2EL6A 2EMHA 2EM9A 2EM7A 2EN2A 4R2RA 1A1IA 2MKNA 2EMXA 2EOYA 2D9HA 1X5WA 1AAYA 2EMLA 5KL6A 2CSHA 4F6MA 2EORA 2EQ1A 2MKDA 2EQ3A 2J7JA 1X6HA 2EOFA 3M99B 1LLMC 3MHSC 2E72A 2EM2A 1B69A 2DMIA 1TF6A 1A1FA 2YRHA 2EM6A 4IS1C 2LV2A 1NCSA 4GZNC 4R2AA 2EMZA 2EMKA 2EN6A 2EMGA 2EMFA 5KL7A 2EPAA 4R2CA 2EM5A 2YTNA 2EOJA 3EPHA 2CTDA 3EPLA 2YTJA 2YTEA 2ADRA 1UBDC 1X6FA 2YTIA 1UN6B 5KL4A 2YRMA 2ENHA 4WSGA 1ZU1A 1A1HA 1TF3A 2YTFA 2EPPA 2GLIA 2YSPA 1X3CA 2A25A 2EOZA 4R2DA 2EJ4A 1TN9A 2YTDA 1X6EA 2LVHA 4R2EA 2HGHA 3MHHC 2CT1A 2I13A 4M9VC 2YTPA 1JK2A 1A1KA 2EOHA 2EM3A 2EOIA 4FK5C 2EN8A 2EOQA 2EL4A 1YUJA 2EN4A 2LO3A 2EOXA 2EM0A 2YU8A 1Z1BA 1BBOA 2EMYA 2ENCA 2WBUA 2YSOA 2EPRA 2JPAA 2EOMA 1KJKA 3EPJA 2YTGA 1G2FC 2NABA
chains in the Genus database with same CATH superfamily
5LL6R 1A1LA 1HNWE 4WXDA 4M30A 4O5GA 2Q8UA 2JOXA 2EPXA 3T1HE 2MDGA 2PRTA 2CPNA 2ELYA 4LFBE 1WJPA 2RTXA 2DLKA 4OX9E 2RPCA 1IBME 2B3TB 3EPKA 4DUZE 1A1GA 4R2PA 1RMDA 3AV0A 5AASA 2B7TA 1MEYC 4GEQB 4Q35B 4DV7E 1YYOA 2K7IA 2G7HA 3C6MA 4R2QA 4JI4E 3EQ1A 2BBGA 3IWBA 3J7Yp 4B3RE 1F2IG 3J81C 2EL6A 4R03A 1WRJA 2EM9A 4KZSA 4O43A 2M4IA 4B3TE 2ZM6E 2UXCE 1XMOE 2KHXA 2L8TA 2EOFA 3HXLA 1LLMC 1XNQE 1A1FA 2YRHA 2EM6A 2YT4A 2LV2A 4JI8E 4R2AA 2EN6A 5AC5A 4Q28A 4LF7E 2RSMA 3ADGA 1NEIA 2VQEE 3EPHA 1EH7A 4LF5E 1UILA 2ADRA 2YTEA 2JY9A 1AH5A 2RS7A 1TF3A 2MC6A 4P7DA 2NUEA 4JI6E 2GLIA 1N36E 2UUAE 1X3CA 2A25A 2NA2A 1X49A 2GPIA 2N3GA 3BF2A 3MHHC 2L3JA 2YZTA 1YYWA 4DV5E 5FLXC 4FK5C 2L2NA 1JK2A 2EOQA 2EL4A 3RMPA 1Z1BA 2UUCE 4WYQB 3ADLA 1L4SA 4WXCA 2V85A 2YWQA 2ODRD 3JAMC 2EMYA 2WBUA 3EPJA 4GKJE 1IQSA 1SR9A 2NABA 3C6KA 2EP3A 2EN7A 2L3CA 3BGHA 3IWCA 1DGCA 2EPUA 5KL2A 1PJSA 4I8OA 1I94E 4DR6E 2L6MA 3HTXA 2JWOA 2BB8A 4TUIA 1XMQE 1EH8A 1YFHA 1ZAAC 2MDRA 2DRPA 5A6KA 2V89A 1N33E 2IHR1 4F2JC 5A6AA 4DV4E 5CFFE 2EMIA 2LE2A 4JYAE 4IJDA 1A1JA 2LT7A 2YRKA 3K6QA 4BBYA 2EPCA 5A6JA 4R2SA 1YUIA 4LF6E 2WBTA 4F6NA 4F9AB 1X48A 4X65E 4KWYA 1YZ9A 2EM7A 2UU9E 1A1IA 2RQLA 5AE2A 2EOYA 4DMIA 1AAYA 2EMLA 5KL6A 3VK6A 2EQ1A 5IWAE 2MKDA 2JXPA 2EQ3A 2EM2A 4LU9A 2N3HA 4GKKE 1TF6A 1T39A 4IS1C 5IXMB 4X66E 3KZYA 1WHQA 1ZBTA 1HNZE 2RS6A 2V87A 3OTOE 5KL7A 1IBKE 1STUA 4DV3E 4WFTA 1GQEA 2B9DA 2DB2A 5A2QC 3ADJA 2NUFA 1UN6B 3AUZA 3JU0A 2WZOA 3H09A 4F54A 2YRMA 4N4RB 1N3GA 1ZU1A 1ZBQA 2K4VA 3TQMA 1N34E 1RC7A 2LMZA 5TSEA 1XNRE 2HC5A 4R2DA 2LVHA 4O24A 4R2EA 2HGHA 5T6JA 1T4OA 1A1KA 1FKAE 2EOHA 3F6HA 1T4LB 1KYQA 2EN8A 1YUJA 4JI7E 3ADIA 2LO3A 2EOXA 2EM0A 2ODRC 3C4TA 2EZ6A 3L00A 4JI5E 4JI0E 2KOUA 2ENCA 4DUYE 4ZYHA 3KWRA 2EPRA 3P1XA 3UK3C 1G2FC 2EOOA 2YU5A 4BHBA 2EM8A 4ZYEA 1ZR9A 4LF4E 5LMUE 3QG5C 2EWLA 2WBSA 1G2DC 2JP9A 1PKPA 4NXME 1IQOA 2LJUA 2EMCA 2E5LE 3VHTB 2YTOA 5KL5A 2R1FA 3MSWA 4BC7A 3J7AG 1HR0E 2LUQA 1YSAC 4M2ZA 4BMJA 2V88A 2E1MA 4TUGA 2V8QB 2EMBA 3HPZA 2F4VE 2EL5A 3J80C 2EOEA 4O4KA 3ECRA 4BC9A 1P47A 1T4NA 2V83A 1JK1A 3ZOQB 2DIXA 2EMAA 4LFAE 3HQ1A 2ENAA 2GHFA 4X9JA 3VYYA 5IV8B 4JI1E 4R8OA 1DI2A 2EM4A 2EE8A 3HPSA 2DLQA 2WCC3 2UXBE 2EN2A 4R2RA 3T1YE 2EMXA 1N32E 2D9HA 4NZVA 2JOBA 1X5WA 3C4BA 4DV0E 2EORA 2HHHE 4P78A 2UUBE 2HJJA 2B7VA 5AC4A 1HNXE 2J7JA 2LTRA 2LJHA 3M99B 4DR7E 2YPNA 4OOGC 2E72A 4DR3E 1NCSA 4X62E 2EPLX 2EMZA 3THNA 1EKZA 2JVAA 2JR1A 4M0VA 2L92A 2YTNA 2VQFE 2CTDA 3EPLA 1UBDC 1X6FA 2FGGA 2YTIA 5DNYA 4WPYA 2V86A 5F3WA 4WSGA 1A1HA 5A6BD 2YTFA 2EPPA 1SFEA 2DMYA 4AQYE 1TN9A 2YTDA 4DR4E 1X6EA 1O0WA 2EOIA 4X8WA 2EN4A 4ZYGA 4JI3E 2JYAA 1YPNA 4LF9E 1J5EE 2L2KB 1KJKA 3OMLA 2EOMA 2LBSB 5BR8E 3IWDA 2YTGA 2EPMX 4B3ME 3F6GA 1IBLE 2EOSA 2L2MA 4NXNE 4YY3E 4HTGA 3LMLA 4JI2E 1EH6A 1PJTA 4BS9A 1RQ0A 1WHNA 1X47A 2DSYA 2RSIA 5AE1A 2ELZA 4J8ZA 2VRDA 1QNTA 4MLVA 2DGCA 2EN3A 4L8NA 4LF8E 4HEIA 4DKKA 3VYXA 4KHPE 4BCAA 2L33A 2EPKX 5A6BA 2M9AA 5KL3A 2EMWA 2EPZA 2M1SA 3FIGA 1IMUA 4DV2E 1MGTA 4RH8A 2LRSA 2H36X 2LCEA 3JTZA 1BB8A 1QU6A 5LLQA 5AE3A 4LTYA 2EQ0A 4DR2E 2YTQA 3BBGA 2EN1A 4B3SE 3DF6A 2EPNA 2LTSA 1GTKA 4L5NC 1T38A 2EMHA 4MLQA 4K0KE 2MKNA 4JV5E 2MC5A 4F6MA 2CSHA 1PDAA 1FJGE 2FTXB 4F9CB 2M7QA 1X6HA 2F8BA 5ADZA 3DJWA 3MHSC 4WX9A 1B69A 2DMIA 4BHCA 5LMNE 4DR5E 4GZNC 2EMKA 2EMGA 4DV6E 1J26A 2UXDE 4DV1E 1WXRA 2EMFA 2EPAA 3LLHA 4R2CA 2EM5A 2EOJA 2FV4B 3BIDA 2YTJA 1DQ3A 1BBGA 4YHHE 5KL4A 4WSPA 2ENHA 2N8XA 5IT9C 2VE7C 2YSPA 4LFCE 4X64E 2EOZA 2EJ4A 4RHBB 4ZYDA 4F9BB 4DR1E 2NUGA 1UHZA 2CT1A 4M9VC 1YYKA 2YTPA 2LUPB 2EM3A 1GZ6A 3KZZA 2YU8A 5A69A 1BBOA 2I9IA 3THOB 2R76A 1PJQA 2EPOA 2YSOA 2KONA 4NHRA 2JPAA 2I13A 2VF1A
chains in the Genus database with same CATH topology
2EOOA 2YU5A 2EOSA 3UK3C 2EP3A 2EN7A 2EM8A 1A1LA 1ZR9A 1DGCA 2EPUA 5KL2A 2WBSA 1G2DC 2RSIA 2JP9A 2ELZA 2EPXA 2MDGA 2PRTA 2ELYA 1WJPA 2DLKA 2EMCA 2RPCA 2VRDA 3EPKA 3VHTB 2YTOA 5KL5A 2BB8A 2EN3A 2DGCA 2R1FA 1A1GA 4R2PA 1ZAAC 2DRPA 1YSAC 1RMDA 5KL3A 2EMBA 2M9AA 2EL5A 4F2JC 2EMWA 2EOEA 2EPZA 1MEYC 1P47A 2EMIA 4IJDA 1JK1A 2LCEA 1A1JA 2LT7A 1BB8A 2EMAA 2YRKA 2ENAA 2GHFA 4X9JA 2EQ0A 2YTQA 1YUIA 2EPCA 4R2SA 4R2QA 2EM4A 2EN1A 2WBTA 4F6NA 2EE8A 1F2IG 2DLQA 2WCC3 2EL6A 2EMHA 2EM9A 2EM7A 2EN2A 4R2RA 1A1IA 2MKNA 2EMXA 2EOYA 2D9HA 1X5WA 1AAYA 2EMLA 5KL6A 2CSHA 4F6MA 2EORA 2EQ1A 2MKDA 2EQ3A 2J7JA 1X6HA 2EOFA 3M99B 1LLMC 3MHSC 2E72A 2EM2A 1B69A 2DMIA 1TF6A 1A1FA 2YRHA 2EM6A 4IS1C 2LV2A 1NCSA 4GZNC 4R2AA 2EMZA 2EMKA 2EN6A 2EMGA 2EMFA 5KL7A 2EPAA 4R2CA 2EM5A 2YTNA 2EOJA 3EPHA 2CTDA 3EPLA 2YTJA 2YTEA 2ADRA 1UBDC 1X6FA 2YTIA 1UN6B 5KL4A 2YRMA 2ENHA 4WSGA 1ZU1A 1A1HA 1TF3A 2YTFA 2EPPA 2GLIA 2YSPA 1X3CA 2A25A 2EOZA 4R2DA 2EJ4A 1TN9A 2YTDA 1X6EA 2LVHA 4R2EA 2HGHA 3MHHC 2CT1A 2I13A 4M9VC 2YTPA 1JK2A 1A1KA 2EOHA 2EM3A 2EOIA 4FK5C 2EN8A 2EOQA 2EL4A 1YUJA 2EN4A 2LO3A 2EOXA 2EM0A 2YU8A 1Z1BA 1BBOA 2EMYA 2ENCA 2WBUA 2YSOA 2EPRA 2JPAA 2EOMA 1KJKA 3EPJA 2YTGA 1G2FC 2NABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOO A;  2YU5 A;  2EOS A;  3UK3 C;  2EP3 A;  2EN7 A;  2EM8 A;  1A1L A;  1ZR9 A;  1DGC A;  2EPU A;  5KL2 A;  2WBS A;  1G2D C;  2RSI A;  2JP9 A;  2ELZ A;  2EPX A;  2MDG A;  2PRT A;  2ELY A;  1WJP A;  2DLK A;  2EMC A;  2RPC A;  2VRD A;  3EPK A;  3VHT B;  2YTO A;  5KL5 A;  2BB8 A;  2EN3 A;  2DGC A;  2R1F A;  1A1G A;  4R2P A;  1ZAA C;  2DRP A;  1YSA C;  1RMD A;  5KL3 A;  2EMB A;  2M9A A;  2EL5 A;  4F2J C;  2EMW A;  2EOE A;  2EPZ A;  1MEY C;  1P47 A;  2EMI A;  4IJD A;  1JK1 A;  2LCE A;  1A1J A;  2LT7 A;  1BB8 A;  2EMA A;  2YRK A;  2ENA A;  2GHF A;  4X9J A;  2EQ0 A;  2YTQ A;  1YUI A;  2EPC A;  4R2S A;  4R2Q A;  2EM4 A;  2EN1 A;  2WBT A;  4F6N A;  2EE8 A;  1F2I G;  2DLQ A;  2WCC 3;  2EL6 A;  2EMH A;  2EM9 A;  2EM7 A;  2EN2 A;  4R2R A;  1A1I A;  2MKN A;  2EMX A;  2EOY A;  2D9H A;  1X5W A;  1AAY A;  2EML A;  5KL6 A;  2CSH A;  4F6M A;  2EOR A;  2EQ1 A;  2MKD A;  2EQ3 A;  2J7J A;  1X6H A;  2EOF A;  3M99 B;  1LLM C;  3MHS C;  2E72 A;  2EM2 A;  1B69 A;  2DMI A;  1TF6 A;  1A1F A;  2YRH A;  2EM6 A;  4IS1 C;  2LV2 A;  1NCS A;  4GZN C;  4R2A A;  2EMZ A;  2EMK A;  2EN6 A;  2EMG A;  2EMF A;  5KL7 A;  2EPA A;  4R2C A;  2EM5 A;  2YTN A;  2EOJ A;  3EPH A;  2CTD A;  3EPL A;  2YTJ A;  2YTE A;  2ADR A;  1UBD C;  1X6F A;  2YTI A;  1UN6 B;  5KL4 A;  2YRM A;  2ENH A;  4WSG A;  1ZU1 A;  1A1H A;  1TF3 A;  2YTF A;  2EPP A;  2GLI A;  2YSP A;  1X3C A;  2A25 A;  2EOZ A;  4R2D A;  2EJ4 A;  1TN9 A;  2YTD A;  1X6E A;  2LVH A;  4R2E A;  2HGH A;  3MHH C;  2CT1 A;  2I13 A;  4M9V C;  2YTP A;  1JK2 A;  1A1K A;  2EOH A;  2EM3 A;  2EOI A;  4FK5 C;  2EN8 A;  2EOQ A;  2EL4 A;  1YUJ A;  2EN4 A;  2LO3 A;  2EOX A;  2EM0 A;  2YU8 A;  1Z1B A;  1BBO A;  2EMY A;  2ENC A;  2WBU A;  2YSO A;  2EPR A;  2JPA A;  2EOM A;  1KJK A;  3EPJ A;  2YTG A;  1G2F C;  2NAB A; 
#chains in the Genus database with same CATH topology
 5LL6 R;  1A1L A;  1HNW E;  4WXD A;  4M30 A;  4O5G A;  2Q8U A;  2JOX A;  2EPX A;  3T1H E;  2MDG A;  2PRT A;  2CPN A;  2ELY A;  4LFB E;  1WJP A;  2RTX A;  2DLK A;  4OX9 E;  2RPC A;  1IBM E;  2B3T B;  3EPK A;  4DUZ E;  1A1G A;  4R2P A;  1RMD A;  3AV0 A;  5AAS A;  2B7T A;  1MEY C;  4GEQ B;  4Q35 B;  4DV7 E;  1YYO A;  2K7I A;  2G7H A;  3C6M A;  4R2Q A;  4JI4 E;  3EQ1 A;  2BBG A;  3IWB A;  3J7Y p;  4B3R E;  1F2I G;  3J81 C;  2EL6 A;  4R03 A;  1WRJ A;  2EM9 A;  4KZS A;  4O43 A;  2M4I A;  4B3T E;  2ZM6 E;  2UXC E;  1XMO E;  2KHX A;  2L8T A;  2EOF A;  3HXL A;  1LLM C;  1XNQ E;  1A1F A;  2YRH A;  2EM6 A;  2YT4 A;  2LV2 A;  4JI8 E;  4R2A A;  2EN6 A;  5AC5 A;  4Q28 A;  4LF7 E;  2RSM A;  3ADG A;  1NEI A;  2VQE E;  3EPH A;  1EH7 A;  4LF5 E;  1UIL A;  2ADR A;  2YTE A;  2JY9 A;  1AH5 A;  2RS7 A;  1TF3 A;  2MC6 A;  4P7D A;  2NUE A;  4JI6 E;  2GLI A;  1N36 E;  2UUA E;  1X3C A;  2A25 A;  2NA2 A;  1X49 A;  2GPI A;  2N3G A;  3BF2 A;  3MHH C;  2L3J A;  2YZT A;  1YYW A;  4DV5 E;  5FLX C;  4FK5 C;  2L2N A;  1JK2 A;  2EOQ A;  2EL4 A;  3RMP A;  1Z1B A;  2UUC E;  4WYQ B;  3ADL A;  1L4S A;  4WXC A;  2V85 A;  2YWQ A;  2ODR D;  3JAM C;  2EMY A;  2WBU A;  3EPJ A;  4GKJ E;  1IQS A;  1SR9 A;  2NAB A;  3C6K A;  2EP3 A;  2EN7 A;  2L3C A;  3BGH A;  3IWC A;  1DGC A;  2EPU A;  5KL2 A;  1PJS A;  4I8O A;  1I94 E;  4DR6 E;  2L6M A;  3HTX A;  2JWO A;  2BB8 A;  4TUI A;  1XMQ E;  1EH8 A;  1YFH A;  1ZAA C;  2MDR A;  2DRP A;  5A6K A;  2V89 A;  1N33 E;  2IHR 1;  4F2J C;  5A6A A;  4DV4 E;  5CFF E;  2EMI A;  2LE2 A;  4JYA E;  4IJD A;  1A1J A;  2LT7 A;  2YRK A;  3K6Q A;  4BBY A;  2EPC A;  5A6J A;  4R2S A;  1YUI A;  4LF6 E;  2WBT A;  4F6N A;  4F9A B;  1X48 A;  4X65 E;  4KWY A;  1YZ9 A;  2EM7 A;  2UU9 E;  1A1I A;  2RQL A;  5AE2 A;  2EOY A;  4DMI A;  1AAY A;  2EML A;  5KL6 A;  3VK6 A;  2EQ1 A;  5IWA E;  2MKD A;  2JXP A;  2EQ3 A;  2EM2 A;  4LU9 A;  2N3H A;  4GKK E;  1TF6 A;  1T39 A;  4IS1 C;  5IXM B;  4X66 E;  3KZY A;  1WHQ A;  1ZBT A;  1HNZ E;  2RS6 A;  2V87 A;  3OTO E;  5KL7 A;  1IBK E;  1STU A;  4DV3 E;  4WFT A;  1GQE A;  2B9D A;  2DB2 A;  5A2Q C;  3ADJ A;  2NUF A;  1UN6 B;  3AUZ A;  3JU0 A;  2WZO A;  3H09 A;  4F54 A;  2YRM A;  4N4R B;  1N3G A;  1ZU1 A;  1ZBQ A;  2K4V A;  3TQM A;  1N34 E;  1RC7 A;  2LMZ A;  5TSE A;  1XNR E;  2HC5 A;  4R2D A;  2LVH A;  4O24 A;  4R2E A;  2HGH A;  5T6J A;  1T4O A;  1A1K A;  1FKA E;  2EOH A;  3F6H A;  1T4L B;  1KYQ A;  2EN8 A;  1YUJ A;  4JI7 E;  3ADI A;  2LO3 A;  2EOX A;  2EM0 A;  2ODR C;  3C4T A;  2EZ6 A;  3L00 A;  4JI5 E;  4JI0 E;  2KOU A;  2ENC A;  4DUY E;  4ZYH A;  3KWR A;  2EPR A;  3P1X A;  3UK3 C;  1G2F C;  2EOO A;  2YU5 A;  4BHB A;  2EM8 A;  4ZYE A;  1ZR9 A;  4LF4 E;  5LMU E;  3QG5 C;  2EWL A;  2WBS A;  1G2D C;  2JP9 A;  1PKP A;  4NXM E;  1IQO A;  2LJU A;  2EMC A;  2E5L E;  3VHT B;  2YTO A;  5KL5 A;  2R1F A;  3MSW A;  4BC7 A;  3J7A G;  1HR0 E;  2LUQ A;  1YSA C;  4M2Z A;  4BMJ A;  2V88 A;  2E1M A;  4TUG A;  2V8Q B;  2EMB A;  3HPZ A;  2F4V E;  2EL5 A;  3J80 C;  2EOE A;  4O4K A;  3ECR A;  4BC9 A;  1P47 A;  1T4N A;  2V83 A;  1JK1 A;  3ZOQ B;  2DIX A;  2EMA A;  4LFA E;  3HQ1 A;  2ENA A;  2GHF A;  4X9J A;  3VYY A;  5IV8 B;  4JI1 E;  4R8O A;  1DI2 A;  2EM4 A;  2EE8 A;  3HPS A;  2DLQ A;  2WCC 3;  2UXB E;  2EN2 A;  4R2R A;  3T1Y E;  2EMX A;  1N32 E;  2D9H A;  4NZV A;  2JOB A;  1X5W A;  3C4B A;  4DV0 E;  2EOR A;  2HHH E;  4P78 A;  2UUB E;  2HJJ A;  2B7V A;  5AC4 A;  1HNX E;  2J7J A;  2LTR A;  2LJH A;  3M99 B;  4DR7 E;  2YPN A;  4OOG C;  2E72 A;  4DR3 E;  1NCS A;  4X62 E;  2EPL X;  2EMZ A;  3THN A;  1EKZ A;  2JVA A;  2JR1 A;  4M0V A;  2L92 A;  2YTN A;  2VQF E;  2CTD A;  3EPL A;  1UBD C;  1X6F A;  2FGG A;  2YTI A;  5DNY A;  4WPY A;  2V86 A;  5F3W A;  4WSG A;  1A1H A;  5A6B D;  2YTF A;  2EPP A;  1SFE A;  2DMY A;  4AQY E;  1TN9 A;  2YTD A;  4DR4 E;  1X6E A;  1O0W A;  2EOI A;  4X8W A;  2EN4 A;  4ZYG A;  4JI3 E;  2JYA A;  1YPN A;  4LF9 E;  1J5E E;  2L2K B;  1KJK A;  3OML A;  2EOM A;  2LBS B;  5BR8 E;  3IWD A;  2YTG A;  2EPM X;  4B3M E;  3F6G A;  1IBL E;  2EOS A;  2L2M A;  4NXN E;  4YY3 E;  4HTG A;  3LML A;  4JI2 E;  1EH6 A;  1PJT A;  4BS9 A;  1RQ0 A;  1WHN A;  1X47 A;  2DSY A;  2RSI A;  5AE1 A;  2ELZ A;  4J8Z A;  2VRD A;  1QNT A;  4MLV A;  2DGC A;  2EN3 A;  4L8N A;  4LF8 E;  4HEI A;  4DKK A;  3VYX A;  4KHP E;  4BCA A;  2L33 A;  2EPK X;  5A6B A;  2M9A A;  5KL3 A;  2EMW A;  2EPZ A;  2M1S A;  3FIG A;  1IMU A;  4DV2 E;  1MGT A;  4RH8 A;  2LRS A;  2H36 X;  2LCE A;  3JTZ A;  1BB8 A;  1QU6 A;  5LLQ A;  5AE3 A;  4LTY A;  2EQ0 A;  4DR2 E;  2YTQ A;  3BBG A;  2EN1 A;  4B3S E;  3DF6 A;  2EPN A;  2LTS A;  1GTK A;  4L5N C;  1T38 A;  2EMH A;  4MLQ A;  4K0K E;  2MKN A;  4JV5 E;  2MC5 A;  4F6M A;  2CSH A;  1PDA A;  1FJG E;  2FTX B;  4F9C B;  2M7Q A;  1X6H A;  2F8B A;  5ADZ A;  3DJW A;  3MHS C;  4WX9 A;  1B69 A;  2DMI A;  4BHC A;  5LMN E;  4DR5 E;  4GZN C;  2EMK A;  2EMG A;  4DV6 E;  1J26 A;  2UXD E;  4DV1 E;  1WXR A;  2EMF A;  2EPA A;  3LLH A;  4R2C A;  2EM5 A;  2EOJ A;  2FV4 B;  3BID A;  2YTJ A;  1DQ3 A;  1BBG A;  4YHH E;  5KL4 A;  4WSP A;  2ENH A;  2N8X A;  5IT9 C;  2VE7 C;  2YSP A;  4LFC E;  4X64 E;  2EOZ A;  2EJ4 A;  4RHB B;  4ZYD A;  4F9B B;  4DR1 E;  2NUG A;  1UHZ A;  2CT1 A;  4M9V C;  1YYK A;  2YTP A;  2LUP B;  2EM3 A;  1GZ6 A;  3KZZ A;  2YU8 A;  5A69 A;  1BBO A;  2I9I A;  3THO B;  2R76 A;  1PJQ A;  2EPO A;  2YSO A;  2KON A;  4NHR A;  2JPA A;  2I13 A;  2VF1 A; 
#chains in the Genus database with same CATH homology
 2EOO A;  2YU5 A;  2EOS A;  3UK3 C;  2EP3 A;  2EN7 A;  2EM8 A;  1A1L A;  1ZR9 A;  1DGC A;  2EPU A;  5KL2 A;  2WBS A;  1G2D C;  2RSI A;  2JP9 A;  2ELZ A;  2EPX A;  2MDG A;  2PRT A;  2ELY A;  1WJP A;  2DLK A;  2EMC A;  2RPC A;  2VRD A;  3EPK A;  3VHT B;  2YTO A;  5KL5 A;  2BB8 A;  2EN3 A;  2DGC A;  2R1F A;  1A1G A;  4R2P A;  1ZAA C;  2DRP A;  1YSA C;  1RMD A;  5KL3 A;  2EMB A;  2M9A A;  2EL5 A;  4F2J C;  2EMW A;  2EOE A;  2EPZ A;  1MEY C;  1P47 A;  2EMI A;  4IJD A;  1JK1 A;  2LCE A;  1A1J A;  2LT7 A;  1BB8 A;  2EMA A;  2YRK A;  2ENA A;  2GHF A;  4X9J A;  2EQ0 A;  2YTQ A;  1YUI A;  2EPC A;  4R2S A;  4R2Q A;  2EM4 A;  2EN1 A;  2WBT A;  4F6N A;  2EE8 A;  1F2I G;  2DLQ A;  2WCC 3;  2EL6 A;  2EMH A;  2EM9 A;  2EM7 A;  2EN2 A;  4R2R A;  1A1I A;  2MKN A;  2EMX A;  2EOY A;  2D9H A;  1X5W A;  1AAY A;  2EML A;  5KL6 A;  2CSH A;  4F6M A;  2EOR A;  2EQ1 A;  2MKD A;  2EQ3 A;  2J7J A;  1X6H A;  2EOF A;  3M99 B;  1LLM C;  3MHS C;  2E72 A;  2EM2 A;  1B69 A;  2DMI A;  1TF6 A;  1A1F A;  2YRH A;  2EM6 A;  4IS1 C;  2LV2 A;  1NCS A;  4GZN C;  4R2A A;  2EMZ A;  2EMK A;  2EN6 A;  2EMG A;  2EMF A;  5KL7 A;  2EPA A;  4R2C A;  2EM5 A;  2YTN A;  2EOJ A;  3EPH A;  2CTD A;  3EPL A;  2YTJ A;  2YTE A;  2ADR A;  1UBD C;  1X6F A;  2YTI A;  1UN6 B;  5KL4 A;  2YRM A;  2ENH A;  4WSG A;  1ZU1 A;  1A1H A;  1TF3 A;  2YTF A;  2EPP A;  2GLI A;  2YSP A;  1X3C A;  2A25 A;  2EOZ A;  4R2D A;  2EJ4 A;  1TN9 A;  2YTD A;  1X6E A;  2LVH A;  4R2E A;  2HGH A;  3MHH C;  2CT1 A;  2I13 A;  4M9V C;  2YTP A;  1JK2 A;  1A1K A;  2EOH A;  2EM3 A;  2EOI A;  4FK5 C;  2EN8 A;  2EOQ A;  2EL4 A;  1YUJ A;  2EN4 A;  2LO3 A;  2EOX A;  2EM0 A;  2YU8 A;  1Z1B A;  1BBO A;  2EMY A;  2ENC A;  2WBU A;  2YSO A;  2EPR A;  2JPA A;  2EOM A;  1KJK A;  3EPJ A;  2YTG A;  1G2F C;  2NAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...