1A1FA

Dsnr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA03
2EMFA 2EMZA 2EOSA 2ELZA 2EL4A 2EM7A 2EN2A 2EQ3A 4IJDA 2RPCA 4M9VC 2YTEA 2EMAA 2EOOA 2ELYA 2CSHA 2LCEA 5KL4A 2YTOA 2EOHA 2YTIA 2I13A 2BB8A 4X9JA 4FK5C 1TN9A 2YU8A 2EMGA 1WJPA 1A1GA 2VRDA 2YTGA 3MHHC 1ZU1A 2YRHA 2YTJA 2DGCA 1ZAAC 4R2EA 2EOQA 2YTFA 2EE8A 2EN4A 2YTQA 2EMHA 2EQ0A 1X6HA 2J7JA 2MKNA 3EPLA 2CT1A 2WBSA 2GHFA 2CTDA 2EOFA 2EMYA 4R2PA 1X6FA 2GLIA 3M99B 1B69A 2EM2A 2LVHA 2D9HA 3UK3C 2R1FA 1A1KA 2EOMA 1YSAC 2EMIA 5KL6A 2EMWA 2EMXA 2PRTA 1UBDC 5KL5A 2EJ4A 4R2SA 1A1IA 2EP3A 3EPKA 2YRMA 5KL7A 2DLKA 2DMIA 1A1LA 2E72A 1LLMC 4F6NA 2EN7A 1A1HA 2EMKA 2EPPA 1X6EA 4R2RA 2EN8A 2DRPA 1ZR9A 2ENCA 1AAYA 2EMLA 2A25A 1TF3A 2MKDA 2LV2A 3MHSC 2EM9A 2EPAA 3VHTB 1P47A 4IS1C 2LO3A 2EM8A 2EOJA 4F2JC 2EMCA 2EN3A 2EOXA 1G2DC 4R2DA 2YU5A 2EL6A 4F6MA 2YSPA 2M9AA 2YTNA 1UN6B 1JK2A 2EN1A 2YSOA 2WCC3 1YUIA 2ADRA 4WSGA 5KL2A 4R2AA 1DGCA 1X3CA 2WBTA 2MDGA 2YRKA 2EPXA 3EPHA 1KJKA 1RMDA 1X5WA 1TF6A 2JP9A 2EOYA 1A1JA 1BBOA 2JPAA 2EN6A 2ENAA 1BB8A 2EQ1A 1A1FA 2WBUA 3EPJA 1F2IG 4GZNC 2EPUA 2EM4A 2EM6A 2EPZA 2HGHA 2EM5A 2NABA 2YTDA 1NCSA 2EM0A 4R2CA 2EPRA 2YTPA 2RSIA 2EL5A 1Z1BA 1YUJA 2EMBA 2EOEA 2EOIA 2EOZA 2EORA 2DLQA 1JK1A 2ENHA 5KL3A 1G2FC 4R2QA 2EPCA 2EM3A 2LT7A 1MEYC
chains in the Genus database with same CATH superfamily
2UU9E 2ELZA 2EL4A 4IJDA 1T4OA 3VYYA 4DUZE 5LL6R 5AE3A 4X8WA 2JYAA 4DV4E 1FJGE 2BB8A 2UUCE 4DV0E 2DMYA 4WFTA 1TN9A 2YU8A 3KWRA 2YRHA 4B3TE 2EOQA 4DR3E 1WHQA 3J80C 1DI2A 2RS6A 4N4RB 2MKNA 2CT1A 1HNXE 2GHFA 1N36E 2CTDA 1X6FA 3ADLA 2LJHA 2ZM6E 4B3ME 1YYOA 2B7VA 4DR4E 5KL6A 2PRTA 2EJ4A 4AQYE 1X48A 2EP3A 1N33E 3EPKA 3EQ1A 4DV2E 2FV4B 2L2MA 2YRMA 3BF2A 3QG5C 5KL7A 4LF7E 1LLMC 4F6NA 3DF6A 5AASA 4LF8E 2EPPA 4KHPE 3LMLA 1ZR9A 4DR6E 2A25A 1RQ0A 1N3GA 2JWOA 3JTZA 1EKZA 4R03A 4DV3E 4JI5E 2B9DA 4LTYA 4M30A 2YTNA 2LUPB 1GZ6A 1IBLE 5LMUE 2YSOA 2WCC3 4X64E 5IWAE 4F54A 2L33A 4RH8A 4WSGA 2UXBE 3C4TA 1DGCA 2VQEE 2WBTA 4BCAA 2NUEA 2R76A 3J7Yp 5LLQA 1QU6A 1RMDA 4X66E 4DR5E 1RC7A 2LTSA 2MC6A 1A1JA 1YZ9A 2EQ1A 1I94E 5CFFE 3HTXA 4KZSA 3EPJA 2YZTA 5A6BA 1F2IG 1YYWA 2EM4A 4X62E 2EPZA 1HR0E 1YYKA 3ADGA 2K7IA 4WX9A 1X49A 2EPRA 2YTPA 2RSIA 4GEQB 1Z1BA 2EMBA 4JI6E 2EOIA 4LF4E 4DV5E 1XMQE 2EPCA 3OMLA 2EMZA 1HNWE 1QNTA 2CSHA 4NXNE 4X65E 4JI8E 2YTOA 4FK5C 2I9IA 4DUYE 1WJPA 2V89A 3F6GA 4JI0E 2UXDE 4JI2E 3THNA 3F6HA 3VK6A 2DGCA 4DKKA 4R2EA 4P7DA 3AV0A 2EN4A 1T38A 2EMHA 4M0VA 3BBGA 2H36X 4LF9E 1NEIA 2EOFA 4ZYDA 4R2PA 4LFCE 4ZYHA 3HQ1A 4BHCA 3HPZA 3FIGA 4WYQB 4BHBA 2MC5A 5AC5A 2VQFE 2L3JA 1GTKA 4LF6E 2R1FA 2EWLA 2EOMA 2EMIA 2EMWA 2EPLX 4WSPA 2LMZA 3IWBA 1DQ3A 2DLKA 2EPMX 3K6QA 2EN7A 2V86A 2JVAA 2CPNA 2HC5A 4DMIA 4R2RA 3J7AG 1UILA 4TUIA 2DRPA 1PJTA 2ENCA 2HHHE 1EH8A 2EMLA 2MKDA 4LFAE 4HTGA 3MHSC 2JR1A 3VHTB 5DNYA 4F2JC 2EOJA 2EMCA 2EN3A 1WRJA 2EOXA 4P78A 4F9AB 2RSMA 3LLHA 2N8XA 3THOB 1SFEA 2EL6A 1XMOE 4F6MA 3P1XA 2YSPA 4GKJE 4O24A 4Q28A 5A69A 1SR9A 2G7HA 1J5EE 2V85A 5KL2A 4R2AA 4B3SE 2N3GA 2EPXA 4LU9A 1TF6A 2JP9A 4BMJA 2EOYA 2EZ6A 2JPAA 1BB8A 1IQOA 2WBUA 4DV7E 3C6KA 4GZNC 1PKPA 2HGHA 2FTXB 4RHBB 3BGHA 4LF5E 4MLVA 1NCSA 4OX9E 2EPNA 5A6JA 2EOEA 1T4LB 2EOZA 2YWQA 5TSEA 4M2ZA 2BBGA 2RPCA 3MSWA 4M9VC 2YTEA 2EOOA 2F8BA 2ELYA 5FLXC 2LCEA 2WZOA 5KL4A 3TQMA 2EOHA 2YTIA 3AUZA 2GPIA 2I13A 2RTXA 4X9JA 2E1MA 1A1GA 2VRDA 2LUQA 1KYQA 5IXMB 1ZAAC 2DB2A 4JI1E 2EE8A 2YTQA 4DR7E 1EH6A 1ZBTA 1X6HA 2EQ0A 2J7JA 3ZOQB 5A2QC 3EPLA 2WBSA 1EH7A 2EMYA 4WXDA 1YPNA 2GLIA 4L5NC 2L2NA 2EM2A 2LVHA 1MGTA 4DV6E 2B7TA 3ADIA 1UBDC 5KL5A 4JI3E 4R2SA 1A1IA 4LFBE 1IMUA 4HEIA 2L2KB 2DMIA 1A1LA 2E72A 4B3RE 4K0KE 2VE7C 4DR2E 3ADJA 1A1HA 1X6EA 4YHHE 2EN8A 4J8ZA 4NXME 4TUGA 5A6AA 5IT9C 1X47A 2JOBA 4O4KA 2LV2A 1P47A 4IS1C 2EM8A 4NHRA 1G2DC 4WXCA 1N32E 2EPOA 1N34E 2HJJA 5F3WA 2YPNA 2L6MA 4F9BB 2M9AA 4O5GA 2L8TA 1JK2A 3T1YE 2EN1A 5A6BD 1YUIA 1O0WA 2ADRA 4F9CB 1GQEA 1WXRA 1X3CA 2MDGA 2ODRC 4I8OA 5LMNE 2F4VE 1YFHA 1X5WA 1T39A 1KJKA 2KONA 2YT4A 2VF1A 1BBOA 4JI4E 2M4IA 4GKKE 1A1FA 2EPKX 2KOUA 1UHZA 5AE2A 2FGGA 1PDAA 4BC9A 1PJSA 3T1HE 1IBME 1STUA 2NABA 2YTDA 1FKAE 2UUBE 4DR1E 1YUJA 1JK1A 1UN6B 2DLQA 1PJQA 2ENHA 2LTRA 5KL3A 3C6MA 4ZYGA 1MEYC 4Q35B 2EMFA 2EOSA 2EM7A 2EN2A 2EQ3A 4BBYA 4KWYA 4BC7A 2EMAA 2NUGA 2LJUA 2RS7A 2RQLA 1WHNA 2IHR1 2V88A 2M7QA 4JI7E 2V83A 5AE1A 2EMGA 3KZZA 2E5LE 2M1SA 2YTGA 3MHHC 1ZU1A 2YTJA 2JXPA 2LRSA 2V87A 2NA2A 2ODRD 2YTFA 3HPSA 2NUFA 1IBKE 1ZBQA 2B3TB 3KZYA 3BIDA 3M99B 1B69A 2JY9A 3ECRA 4JYAE 2K4VA 4L8NA 2D9HA 3UK3C 5ADZA 1A1KA 1YSAC 2EMXA 1XNRE 2UUAE 4O43A 4ZYEA 3JAMC 1IQSA 3RMPA 2L92A 4YY3E 2EMKA 4MLQA 4BS9A 2UXCE 1HNZE 3JU0A 2V8QB 2DIXA 1AAYA 1TF3A 2EM9A 2EPAA 4DV1E 2Q8UA 2LO3A 1J26A 5BR8E 4R2DA 2LBSB 2YU5A 3HXLA 5A6KA 3VYXA 1XNQE 4NZVA 2MDRA 2DSYA 4OOGC 3C4BA 3DJWA 3EPHA 2YRKA 2L3CA 4R8OA 4JV5E 2EN6A 2ENAA 3IWCA 2N3HA 2EPUA 2EM6A 1T4NA 5IV8B 2EM5A 3H09A 2LE2A 4WPYA 2EM0A 2KHXA 3L00A 4R2CA 3IWDA 5T6JA 1L4SA 5AC4A 2EL5A 1BBGA 2EORA 3J81C 1G2FC 3OTOE 4R2QA 2JOXA 2EM3A 2LT7A 1AH5A
chains in the Genus database with same CATH topology
2EMFA 2EMZA 2EOSA 2ELZA 2EL4A 2EM7A 2EN2A 2EQ3A 4IJDA 2RPCA 4M9VC 2YTEA 2EMAA 2EOOA 2ELYA 2CSHA 2LCEA 5KL4A 2YTOA 2EOHA 2YTIA 2I13A 2BB8A 4X9JA 4FK5C 1TN9A 2YU8A 2EMGA 1WJPA 1A1GA 2VRDA 2YTGA 3MHHC 1ZU1A 2YRHA 2YTJA 2DGCA 1ZAAC 4R2EA 2EOQA 2YTFA 2EE8A 2EN4A 2YTQA 2EMHA 2EQ0A 1X6HA 2J7JA 2MKNA 3EPLA 2CT1A 2WBSA 2GHFA 2CTDA 2EOFA 2EMYA 4R2PA 1X6FA 2GLIA 3M99B 1B69A 2EM2A 2LVHA 2D9HA 3UK3C 2R1FA 1A1KA 2EOMA 1YSAC 2EMIA 5KL6A 2EMWA 2EMXA 2PRTA 1UBDC 5KL5A 2EJ4A 4R2SA 1A1IA 2EP3A 3EPKA 2YRMA 5KL7A 2DLKA 2DMIA 1A1LA 2E72A 1LLMC 4F6NA 2EN7A 1A1HA 2EMKA 2EPPA 1X6EA 4R2RA 2EN8A 2DRPA 1ZR9A 2ENCA 1AAYA 2EMLA 2A25A 1TF3A 2MKDA 2LV2A 3MHSC 2EM9A 2EPAA 3VHTB 1P47A 4IS1C 2LO3A 2EM8A 2EOJA 4F2JC 2EMCA 2EN3A 2EOXA 1G2DC 4R2DA 2YU5A 2EL6A 4F6MA 2YSPA 2M9AA 2YTNA 1UN6B 1JK2A 2EN1A 2YSOA 2WCC3 1YUIA 2ADRA 4WSGA 5KL2A 4R2AA 1DGCA 1X3CA 2WBTA 2MDGA 2YRKA 2EPXA 3EPHA 1KJKA 1RMDA 1X5WA 1TF6A 2JP9A 2EOYA 1A1JA 1BBOA 2JPAA 2EN6A 2ENAA 1BB8A 2EQ1A 1A1FA 2WBUA 3EPJA 1F2IG 4GZNC 2EPUA 2EM4A 2EM6A 2EPZA 2HGHA 2EM5A 2NABA 2YTDA 1NCSA 2EM0A 4R2CA 2EPRA 2YTPA 2RSIA 2EL5A 1Z1BA 1YUJA 2EMBA 2EOEA 2EOIA 2EOZA 2EORA 2DLQA 1JK1A 2ENHA 5KL3A 1G2FC 4R2QA 2EPCA 2EM3A 2LT7A 1MEYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMF A;  2EMZ A;  2EOS A;  2ELZ A;  2EL4 A;  2EM7 A;  2EN2 A;  2EQ3 A;  4IJD A;  2RPC A;  4M9V C;  2YTE A;  2EMA A;  2EOO A;  2ELY A;  2CSH A;  2LCE A;  5KL4 A;  2YTO A;  2EOH A;  2YTI A;  2I13 A;  2BB8 A;  4X9J A;  4FK5 C;  1TN9 A;  2YU8 A;  2EMG A;  1WJP A;  1A1G A;  2VRD A;  2YTG A;  3MHH C;  1ZU1 A;  2YRH A;  2YTJ A;  2DGC A;  1ZAA C;  4R2E A;  2EOQ A;  2YTF A;  2EE8 A;  2EN4 A;  2YTQ A;  2EMH A;  2EQ0 A;  1X6H A;  2J7J A;  2MKN A;  3EPL A;  2CT1 A;  2WBS A;  2GHF A;  2CTD A;  2EOF A;  2EMY A;  4R2P A;  1X6F A;  2GLI A;  3M99 B;  1B69 A;  2EM2 A;  2LVH A;  2D9H A;  3UK3 C;  2R1F A;  1A1K A;  2EOM A;  1YSA C;  2EMI A;  5KL6 A;  2EMW A;  2EMX A;  2PRT A;  1UBD C;  5KL5 A;  2EJ4 A;  4R2S A;  1A1I A;  2EP3 A;  3EPK A;  2YRM A;  5KL7 A;  2DLK A;  2DMI A;  1A1L A;  2E72 A;  1LLM C;  4F6N A;  2EN7 A;  1A1H A;  2EMK A;  2EPP A;  1X6E A;  4R2R A;  2EN8 A;  2DRP A;  1ZR9 A;  2ENC A;  1AAY A;  2EML A;  2A25 A;  1TF3 A;  2MKD A;  2LV2 A;  3MHS C;  2EM9 A;  2EPA A;  3VHT B;  1P47 A;  4IS1 C;  2LO3 A;  2EM8 A;  2EOJ A;  4F2J C;  2EMC A;  2EN3 A;  2EOX A;  1G2D C;  4R2D A;  2YU5 A;  2EL6 A;  4F6M A;  2YSP A;  2M9A A;  2YTN A;  1UN6 B;  1JK2 A;  2EN1 A;  2YSO A;  2WCC 3;  1YUI A;  2ADR A;  4WSG A;  5KL2 A;  4R2A A;  1DGC A;  1X3C A;  2WBT A;  2MDG A;  2YRK A;  2EPX A;  3EPH A;  1KJK A;  1RMD A;  1X5W A;  1TF6 A;  2JP9 A;  2EOY A;  1A1J A;  1BBO A;  2JPA A;  2EN6 A;  2ENA A;  1BB8 A;  2EQ1 A;  1A1F A;  2WBU A;  3EPJ A;  1F2I G;  4GZN C;  2EPU A;  2EM4 A;  2EM6 A;  2EPZ A;  2HGH A;  2EM5 A;  2NAB A;  2YTD A;  1NCS A;  2EM0 A;  4R2C A;  2EPR A;  2YTP A;  2RSI A;  2EL5 A;  1Z1B A;  1YUJ A;  2EMB A;  2EOE A;  2EOI A;  2EOZ A;  2EOR A;  2DLQ A;  1JK1 A;  2ENH A;  5KL3 A;  1G2F C;  4R2Q A;  2EPC A;  2EM3 A;  2LT7 A;  1MEY C; 
#chains in the Genus database with same CATH topology
 2UU9 E;  2ELZ A;  2EL4 A;  4IJD A;  1T4O A;  3VYY A;  4DUZ E;  5LL6 R;  5AE3 A;  4X8W A;  2JYA A;  4DV4 E;  1FJG E;  2BB8 A;  2UUC E;  4DV0 E;  2DMY A;  4WFT A;  1TN9 A;  2YU8 A;  3KWR A;  2YRH A;  4B3T E;  2EOQ A;  4DR3 E;  1WHQ A;  3J80 C;  1DI2 A;  2RS6 A;  4N4R B;  2MKN A;  2CT1 A;  1HNX E;  2GHF A;  1N36 E;  2CTD A;  1X6F A;  3ADL A;  2LJH A;  2ZM6 E;  4B3M E;  1YYO A;  2B7V A;  4DR4 E;  5KL6 A;  2PRT A;  2EJ4 A;  4AQY E;  1X48 A;  2EP3 A;  1N33 E;  3EPK A;  3EQ1 A;  4DV2 E;  2FV4 B;  2L2M A;  2YRM A;  3BF2 A;  3QG5 C;  5KL7 A;  4LF7 E;  1LLM C;  4F6N A;  3DF6 A;  5AAS A;  4LF8 E;  2EPP A;  4KHP E;  3LML A;  1ZR9 A;  4DR6 E;  2A25 A;  1RQ0 A;  1N3G A;  2JWO A;  3JTZ A;  1EKZ A;  4R03 A;  4DV3 E;  4JI5 E;  2B9D A;  4LTY A;  4M30 A;  2YTN A;  2LUP B;  1GZ6 A;  1IBL E;  5LMU E;  2YSO A;  2WCC 3;  4X64 E;  5IWA E;  4F54 A;  2L33 A;  4RH8 A;  4WSG A;  2UXB E;  3C4T A;  1DGC A;  2VQE E;  2WBT A;  4BCA A;  2NUE A;  2R76 A;  3J7Y p;  5LLQ A;  1QU6 A;  1RMD A;  4X66 E;  4DR5 E;  1RC7 A;  2LTS A;  2MC6 A;  1A1J A;  1YZ9 A;  2EQ1 A;  1I94 E;  5CFF E;  3HTX A;  4KZS A;  3EPJ A;  2YZT A;  5A6B A;  1F2I G;  1YYW A;  2EM4 A;  4X62 E;  2EPZ A;  1HR0 E;  1YYK A;  3ADG A;  2K7I A;  4WX9 A;  1X49 A;  2EPR A;  2YTP A;  2RSI A;  4GEQ B;  1Z1B A;  2EMB A;  4JI6 E;  2EOI A;  4LF4 E;  4DV5 E;  1XMQ E;  2EPC A;  3OML A;  2EMZ A;  1HNW E;  1QNT A;  2CSH A;  4NXN E;  4X65 E;  4JI8 E;  2YTO A;  4FK5 C;  2I9I A;  4DUY E;  1WJP A;  2V89 A;  3F6G A;  4JI0 E;  2UXD E;  4JI2 E;  3THN A;  3F6H A;  3VK6 A;  2DGC A;  4DKK A;  4R2E A;  4P7D A;  3AV0 A;  2EN4 A;  1T38 A;  2EMH A;  4M0V A;  3BBG A;  2H36 X;  4LF9 E;  1NEI A;  2EOF A;  4ZYD A;  4R2P A;  4LFC E;  4ZYH A;  3HQ1 A;  4BHC A;  3HPZ A;  3FIG A;  4WYQ B;  4BHB A;  2MC5 A;  5AC5 A;  2VQF E;  2L3J A;  1GTK A;  4LF6 E;  2R1F A;  2EWL A;  2EOM A;  2EMI A;  2EMW A;  2EPL X;  4WSP A;  2LMZ A;  3IWB A;  1DQ3 A;  2DLK A;  2EPM X;  3K6Q A;  2EN7 A;  2V86 A;  2JVA A;  2CPN A;  2HC5 A;  4DMI A;  4R2R A;  3J7A G;  1UIL A;  4TUI A;  2DRP A;  1PJT A;  2ENC A;  2HHH E;  1EH8 A;  2EML A;  2MKD A;  4LFA E;  4HTG A;  3MHS C;  2JR1 A;  3VHT B;  5DNY A;  4F2J C;  2EOJ A;  2EMC A;  2EN3 A;  1WRJ A;  2EOX A;  4P78 A;  4F9A B;  2RSM A;  3LLH A;  2N8X A;  3THO B;  1SFE A;  2EL6 A;  1XMO E;  4F6M A;  3P1X A;  2YSP A;  4GKJ E;  4O24 A;  4Q28 A;  5A69 A;  1SR9 A;  2G7H A;  1J5E E;  2V85 A;  5KL2 A;  4R2A A;  4B3S E;  2N3G A;  2EPX A;  4LU9 A;  1TF6 A;  2JP9 A;  4BMJ A;  2EOY A;  2EZ6 A;  2JPA A;  1BB8 A;  1IQO A;  2WBU A;  4DV7 E;  3C6K A;  4GZN C;  1PKP A;  2HGH A;  2FTX B;  4RHB B;  3BGH A;  4LF5 E;  4MLV A;  1NCS A;  4OX9 E;  2EPN A;  5A6J A;  2EOE A;  1T4L B;  2EOZ A;  2YWQ A;  5TSE A;  4M2Z A;  2BBG A;  2RPC A;  3MSW A;  4M9V C;  2YTE A;  2EOO A;  2F8B A;  2ELY A;  5FLX C;  2LCE A;  2WZO A;  5KL4 A;  3TQM A;  2EOH A;  2YTI A;  3AUZ A;  2GPI A;  2I13 A;  2RTX A;  4X9J A;  2E1M A;  1A1G A;  2VRD A;  2LUQ A;  1KYQ A;  5IXM B;  1ZAA C;  2DB2 A;  4JI1 E;  2EE8 A;  2YTQ A;  4DR7 E;  1EH6 A;  1ZBT A;  1X6H A;  2EQ0 A;  2J7J A;  3ZOQ B;  5A2Q C;  3EPL A;  2WBS A;  1EH7 A;  2EMY A;  4WXD A;  1YPN A;  2GLI A;  4L5N C;  2L2N A;  2EM2 A;  2LVH A;  1MGT A;  4DV6 E;  2B7T A;  3ADI A;  1UBD C;  5KL5 A;  4JI3 E;  4R2S A;  1A1I A;  4LFB E;  1IMU A;  4HEI A;  2L2K B;  2DMI A;  1A1L A;  2E72 A;  4B3R E;  4K0K E;  2VE7 C;  4DR2 E;  3ADJ A;  1A1H A;  1X6E A;  4YHH E;  2EN8 A;  4J8Z A;  4NXM E;  4TUG A;  5A6A A;  5IT9 C;  1X47 A;  2JOB A;  4O4K A;  2LV2 A;  1P47 A;  4IS1 C;  2EM8 A;  4NHR A;  1G2D C;  4WXC A;  1N32 E;  2EPO A;  1N34 E;  2HJJ A;  5F3W A;  2YPN A;  2L6M A;  4F9B B;  2M9A A;  4O5G A;  2L8T A;  1JK2 A;  3T1Y E;  2EN1 A;  5A6B D;  1YUI A;  1O0W A;  2ADR A;  4F9C B;  1GQE A;  1WXR A;  1X3C A;  2MDG A;  2ODR C;  4I8O A;  5LMN E;  2F4V E;  1YFH A;  1X5W A;  1T39 A;  1KJK A;  2KON A;  2YT4 A;  2VF1 A;  1BBO A;  4JI4 E;  2M4I A;  4GKK E;  1A1F A;  2EPK X;  2KOU A;  1UHZ A;  5AE2 A;  2FGG A;  1PDA A;  4BC9 A;  1PJS A;  3T1H E;  1IBM E;  1STU A;  2NAB A;  2YTD A;  1FKA E;  2UUB E;  4DR1 E;  1YUJ A;  1JK1 A;  1UN6 B;  2DLQ A;  1PJQ A;  2ENH A;  2LTR A;  5KL3 A;  3C6M A;  4ZYG A;  1MEY C;  4Q35 B;  2EMF A;  2EOS A;  2EM7 A;  2EN2 A;  2EQ3 A;  4BBY A;  4KWY A;  4BC7 A;  2EMA A;  2NUG A;  2LJU A;  2RS7 A;  2RQL A;  1WHN A;  2IHR 1;  2V88 A;  2M7Q A;  4JI7 E;  2V83 A;  5AE1 A;  2EMG A;  3KZZ A;  2E5L E;  2M1S A;  2YTG A;  3MHH C;  1ZU1 A;  2YTJ A;  2JXP A;  2LRS A;  2V87 A;  2NA2 A;  2ODR D;  2YTF A;  3HPS A;  2NUF A;  1IBK E;  1ZBQ A;  2B3T B;  3KZY A;  3BID A;  3M99 B;  1B69 A;  2JY9 A;  3ECR A;  4JYA E;  2K4V A;  4L8N A;  2D9H A;  3UK3 C;  5ADZ A;  1A1K A;  1YSA C;  2EMX A;  1XNR E;  2UUA E;  4O43 A;  4ZYE A;  3JAM C;  1IQS A;  3RMP A;  2L92 A;  4YY3 E;  2EMK A;  4MLQ A;  4BS9 A;  2UXC E;  1HNZ E;  3JU0 A;  2V8Q B;  2DIX A;  1AAY A;  1TF3 A;  2EM9 A;  2EPA A;  4DV1 E;  2Q8U A;  2LO3 A;  1J26 A;  5BR8 E;  4R2D A;  2LBS B;  2YU5 A;  3HXL A;  5A6K A;  3VYX A;  1XNQ E;  4NZV A;  2MDR A;  2DSY A;  4OOG C;  3C4B A;  3DJW A;  3EPH A;  2YRK A;  2L3C A;  4R8O A;  4JV5 E;  2EN6 A;  2ENA A;  3IWC A;  2N3H A;  2EPU A;  2EM6 A;  1T4N A;  5IV8 B;  2EM5 A;  3H09 A;  2LE2 A;  4WPY A;  2EM0 A;  2KHX A;  3L00 A;  4R2C A;  3IWD A;  5T6J A;  1L4S A;  5AC4 A;  2EL5 A;  1BBG A;  2EOR A;  3J81 C;  1G2F C;  3OTO E;  4R2Q A;  2JOX A;  2EM3 A;  2LT7 A;  1AH5 A; 
#chains in the Genus database with same CATH homology
 2EMF A;  2EMZ A;  2EOS A;  2ELZ A;  2EL4 A;  2EM7 A;  2EN2 A;  2EQ3 A;  4IJD A;  2RPC A;  4M9V C;  2YTE A;  2EMA A;  2EOO A;  2ELY A;  2CSH A;  2LCE A;  5KL4 A;  2YTO A;  2EOH A;  2YTI A;  2I13 A;  2BB8 A;  4X9J A;  4FK5 C;  1TN9 A;  2YU8 A;  2EMG A;  1WJP A;  1A1G A;  2VRD A;  2YTG A;  3MHH C;  1ZU1 A;  2YRH A;  2YTJ A;  2DGC A;  1ZAA C;  4R2E A;  2EOQ A;  2YTF A;  2EE8 A;  2EN4 A;  2YTQ A;  2EMH A;  2EQ0 A;  1X6H A;  2J7J A;  2MKN A;  3EPL A;  2CT1 A;  2WBS A;  2GHF A;  2CTD A;  2EOF A;  2EMY A;  4R2P A;  1X6F A;  2GLI A;  3M99 B;  1B69 A;  2EM2 A;  2LVH A;  2D9H A;  3UK3 C;  2R1F A;  1A1K A;  2EOM A;  1YSA C;  2EMI A;  5KL6 A;  2EMW A;  2EMX A;  2PRT A;  1UBD C;  5KL5 A;  2EJ4 A;  4R2S A;  1A1I A;  2EP3 A;  3EPK A;  2YRM A;  5KL7 A;  2DLK A;  2DMI A;  1A1L A;  2E72 A;  1LLM C;  4F6N A;  2EN7 A;  1A1H A;  2EMK A;  2EPP A;  1X6E A;  4R2R A;  2EN8 A;  2DRP A;  1ZR9 A;  2ENC A;  1AAY A;  2EML A;  2A25 A;  1TF3 A;  2MKD A;  2LV2 A;  3MHS C;  2EM9 A;  2EPA A;  3VHT B;  1P47 A;  4IS1 C;  2LO3 A;  2EM8 A;  2EOJ A;  4F2J C;  2EMC A;  2EN3 A;  2EOX A;  1G2D C;  4R2D A;  2YU5 A;  2EL6 A;  4F6M A;  2YSP A;  2M9A A;  2YTN A;  1UN6 B;  1JK2 A;  2EN1 A;  2YSO A;  2WCC 3;  1YUI A;  2ADR A;  4WSG A;  5KL2 A;  4R2A A;  1DGC A;  1X3C A;  2WBT A;  2MDG A;  2YRK A;  2EPX A;  3EPH A;  1KJK A;  1RMD A;  1X5W A;  1TF6 A;  2JP9 A;  2EOY A;  1A1J A;  1BBO A;  2JPA A;  2EN6 A;  2ENA A;  1BB8 A;  2EQ1 A;  1A1F A;  2WBU A;  3EPJ A;  1F2I G;  4GZN C;  2EPU A;  2EM4 A;  2EM6 A;  2EPZ A;  2HGH A;  2EM5 A;  2NAB A;  2YTD A;  1NCS A;  2EM0 A;  4R2C A;  2EPR A;  2YTP A;  2RSI A;  2EL5 A;  1Z1B A;  1YUJ A;  2EMB A;  2EOE A;  2EOI A;  2EOZ A;  2EOR A;  2DLQ A;  1JK1 A;  2ENH A;  5KL3 A;  1G2F C;  4R2Q A;  2EPC A;  2EM3 A;  2LT7 A;  1MEY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...