1A1FA

Dsnr (zif268 variant) zinc finger-dna complex (gacc site)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
84
structure length
84
Chain Sequence
RPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*AP*CP*C)-3')
total genus 26
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1a1fA03
2EPUA 4F6MA 3EPJA 4IJDA 2ELZA 2WBTA 1YUIA 2E72A 2DMIA 2I13A 1X6EA 1ZU1A 2YTPA 2EORA 2EM0A 2PRTA 4IS1C 2EMKA 2DLKA 2WCC3 2EM7A 4F6NA 2EOIA 2EOZA 2YU8A 2D9HA 2LO3A 4R2SA 2EMZA 1BB8A 2MKDA 2EQ3A 2DGCA 2CT1A 2EM9A 2EOYA 1YUJA 2EMHA 2A25A 2EM3A 2EMIA 2YTJA 2R1FA 2YTDA 3M99B 2EQ0A 2DRPA 2NABA 5KL6A 2EMBA 2EOSA 4R2DA 2EN2A 2LT7A 5KL3A 2EP3A 1A1JA 2WBSA 2BB8A 2EOJA 2M9AA 2JP9A 5KL2A 1B69A 2EN6A 1X6HA 2EL4A 2YRKA 1LLMC 2EE8A 4R2CA 1X3CA 1RMDA 2EPZA 2MKNA 2YSOA 1X5WA 1KJKA 2GLIA 2LV2A 2YTNA 2EMGA 1A1KA 1TF6A 2ELYA 1DGCA 2RSIA 2YTQA 2EQ1A 4X9JA 3EPLA 1Z1BA 1G2FC 2GHFA 2YSPA 4R2RA 1AAYA 2EN4A 2EOQA 2YTOA 2WBUA 2CSHA 3VHTB 4F2JC 1A1IA 1F2IG 1A1GA 1YSAC 2EM8A 2YTGA 2EN1A 2EN7A 2EMAA 1A1LA 1A1FA 2J7JA 1P47A 3EPKA 2EPAA 2JPAA 2EPCA 2LVHA 2EPXA 1JK2A 2EMFA 2EN3A 2EM2A 4M9VC 2YTIA 2MDGA 2EM6A 2EPPA 2HGHA 1MEYC 2EOOA 2ENAA 2EL5A 2YTFA 2ENCA 2EM4A 2LCEA 3MHSC 1WJPA 1JK1A 1UBDC 2EOMA 2VRDA 2EMYA 2EMWA 2EMCA 4R2QA 4R2EA 2EM5A 2CTDA 2DLQA 2EPRA 1NCSA 1TF3A 2YTEA 2ENHA 2ADRA 3EPHA 1ZR9A 1TN9A 2EMXA 2YRMA 5KL4A 1ZAAC 2EOFA 1X6FA 2EMLA 2RPCA 2YRHA 3UK3C 2EJ4A 5KL7A 4R2PA 4WSGA 2EL6A 2EOXA 4R2AA 1A1HA 1G2DC 2YU5A 3MHHC 2EOEA 1BBOA 5KL5A 4GZNC 1UN6B 4FK5C 2EN8A 2EOHA
chains in the Genus database with same CATH superfamily
2B3TB 4DUZE 2JOBA 2FV4B 2UXDE 4B3ME 1AH5A 4DUYE 4DKKA 1ZU1A 3IWBA 4F54A 3F6GA 2EMKA 2EOZA 2JWOA 4X64E 4DR6E 4X65E 2DGCA 2V83A 1PJSA 3HPZA 3KZZA 2YTJA 2F8BA 1SFEA 3M99B 2EQ0A 4BHCA 2LUPB 5AASA 4B3TE 2EN2A 4ZYEA 2FTXB 4BMJA 4WYQB 1B69A 2EN6A 1LLMC 2LJUA 4R2CA 3HTXA 4F9CB 3HQ1A 1A1KA 1TF6A 2BBGA 2RSIA 4WFTA 1Z1BA 1T4OA 2LTRA 4LF7E 2EN4A 2EOQA 1IBME 1GTKA 2CSHA 1YSAC 3C6KA 2EN1A 1J5EE 2V86A 4KWYA 1A1LA 1P47A 3J7AG 2R76A 2B7VA 3VYYA 2EM2A 4M9VC 1N34E 2EPPA 2EOOA 1T4NA 2LCEA 1JK1A 1UBDC 2LRSA 4DR2E 2CTDA 2YTEA 2ENHA 4M0VA 1RQ0A 5T6JA 2DSYA 2G7HA 2RSMA 2EWLA 5KL4A 3ADLA 2EOFA 1X6FA 2N8XA 2YRHA 1WXRA 2KONA 5KL7A 4R2PA 4DV6E 2VQEE 1IBKE 2EOXA 4R2AA 2ZM6E 4AQYE 1A1HA 2UUBE 4TUIA 1X47A 2HJJA 4Q35B 4OOGC 5LMUE 4FK5C 1ZBQA 2YWQA 3EPJA 2F4VE 1EH8A 1YUIA 2E72A 2I13A 1X6EA 4YY3E 2YTPA 2PRTA 4IS1C 1N36E 4JI3E 2DLKA 2WZOA 2EM7A 4BBYA 3DJWA 2D9HA 2LO3A 4R2SA 2EQ3A 4R8OA 2EM9A 1YUJA 1GQEA 2A25A 2VF1A 2R1FA 4B3SE 2ODRD 4I8OA 4ZYDA 5KL6A 1EKZA 2EMBA 1HNZE 1PJTA 4DR5E 1QNTA 4DV7E 5KL3A 1A1JA 4BC7A 5LMNE 2BB8A 1GZ6A 2M9AA 4M30A 5A6AA 5KL2A 4JYAE 2YRKA 1N32E 1IBLE 2HC5A 1RMDA 2EPZA 3H09A 2YSOA 5TSEA 2UXBE 5BR8E 4WXDA 1N3GA 2ELYA 1PDAA 4X9JA 4TUGA 4HEIA 1G2FC 2L2MA 4O5GA 2GHFA 2GPIA 3THNA 4R2RA 1A1GA 2EM8A 1I94E 3OMLA 1XNRE 1XMQE 4GKJE 2L92A 2J7JA 3EPKA 1EH6A 5LL6R 3TQMA 2N3GA 4RHBB 2LVHA 4JI4E 1HNWE 2EMFA 2L8TA 3DF6A 5LLQA 5DNYA 4R03A 5IV8B 2EN3A 2L3JA 1WHQA 2HGHA 3AV0A 4WXCA 3BF2A 4LF6E 5IWAE 2EMWA 2DMYA 2EMCA 4O43A 4WSPA 5AE1A 4F9BB 2KHXA 4DR4E 3J7Yp 4JV5E 2Q8UA 1IMUA 3KWRA 4RH8A 2KOUA 4B3RE 2M4IA 2L33A 2EMLA 2RPCA 4DV3E 3LLHA 2ODRC 4DV5E 4LF4E 2HHHE 2UXCE 4LF5E 1G2DC 2EPOA 3MHHC 1J26A 3K6QA 1UN6B 2EN8A 4DV0E 1DQ3A 4MLVA 2L3CA 4ZYGA 1FKAE 5A6JA 2UUAE 4IJDA 2ELZA 2JXPA 2WBTA 3FIGA 2MC5A 2EORA 1UILA 5A2QC 4F6NA 2YU8A 1BB8A 2MKDA 4L5NC 1L4SA 2EMHA 4P7DA 5AE3A 2EM3A 5A69A 1T38A 2JY9A 2LBSB 4LFAE 2DRPA 2NABA 5A6BD 4NXME 2EOSA 2LT7A 2EP3A 2V87A 2K7IA 2EL4A 5ADZA 4OX9E 4YHHE 1X3CA 2L6MA 1X48A 3KZYA 2NA2A 1IQSA 4DR1E 2LJHA 1XNQE 2GLIA 2LV2A 4O24A 5A6BA 1RC7A 1DGCA 2VE7C 3RMPA 2YTQA 3EPLA 2V89A 2JR1A 1QU6A 2H36X 4F9AB 3VYXA 4NHRA 1A1IA 2WBUA 4F2JC 5IT9C 4O4KA 3VHTB 2DIXA 3ADJA 2YTGA 4BCAA 2EN7A 1BBGA 4DV2E 1A1FA 2EPAA 2EPCA 2MDRA 3ADIA 2YTIA 2N3HA 2MDGA 2EM6A 2ENAA 4P78A 2YTFA 5A6KA 1WRJA 2ENCA 2EM4A 2EPMX 1YZ9A 5FLXC 1WJPA 2FGGA 5IXMB 2EOMA 3JU0A 2VRDA 1XMOE 4BHBA 4DR3E 2L2NA 2NUFA 1YFHA 4DR7E 2EPNA 1PKPA 2UUCE 1YPNA 2ADRA 4LFCE 4M2ZA 4NZVA 2YRMA 1ZAAC 4N4RB 2LE2A 3UK3C 2EJ4A 1PJQA 2EL6A 5AE2A 2YPNA 3JTZA 2DB2A 2EOEA 3P1XA 4JI6E 3OTOE 2EPLX 3F6HA 3MSWA 2EPUA 2V88A 4F6MA 2JYAA 4X8WA 5AC4A 4JI2E 1YYKA 3C4BA 2NUEA 3T1HE 2NUGA 4K0KE 2DMIA 1X49A 4X62E 1FJGE 2EM0A 4JI5E 2WCC3 3EQ1A 4BC9A 2EOIA 2EZ6A 2EMZA 2CT1A 2EOYA 2IHR1 3IWDA 4LF8E 1IQOA 5AC5A 4KZSA 2EMIA 2RS7A 4HTGA 4LU9A 3C6MA 3J81C 1YYOA 2YTDA 4LF9E 4JI1E 4R2DA 1EH7A 4JI0E 1MGTA 1SR9A 4JI7E 4Q28A 2EOJA 2RQLA 2WBSA 4LTYA 2JP9A 1X6HA 2CPNA 2LTSA 4WPYA 2EE8A 2RS6A 3JAMC 2MKNA 4JI8E 1X5WA 2I9IA 1KJKA 2JVAA 2JOXA 2YTNA 2EMGA 1T39A 3VK6A 1DI2A 2EQ1A 3ADGA 4WX9A 4X66E 4LFBE 3BBGA 2YSPA 3L00A 2B7TA 1AAYA 2YTOA 1F2IG 1HNXE 2EMAA 3BIDA 3IWCA 1NEIA 5F3WA 3HPSA 3ECRA 4J8ZA 1O0WA 2YT4A 2V85A 2JPAA 2EPXA 1JK2A 5CFFE 2M1SA 4DMIA 4NXNE 3C4TA 4MLQA 1KYQA 3ZOQB 1WHNA 1MEYC 3AUZA 4BS9A 1N33E 2EL5A 4GKKE 2VQFE 4KHPE 1ZBTA 3MHSC 4GEQB 1UHZA 2L2KB 2E5LE 2EMYA 4R2QA 3BGHA 4R2EA 2EM5A 1T4LB 2DLQA 2EPRA 1NCSA 2V8QB 1TF3A 2EPKX 2B9DA 2M7QA 4ZYHA 3QG5C 2MC6A 1HR0E 3EPHA 1ZR9A 1TN9A 2EMXA 4DV1E 2RTXA 2LUQA 3T1YE 4L8NA 2K4VA 3LMLA 2YZTA 1YYWA 1STUA 2LMZA 4WSGA 3THOB 4DV4E 3J80C 2YU5A 1BBOA 2UU9E 5KL5A 2E1MA 4GZNC 3HXLA 2EOHA
chains in the Genus database with same CATH topology
2EPUA 4F6MA 3EPJA 4IJDA 2ELZA 2WBTA 1YUIA 2E72A 2DMIA 2I13A 1X6EA 1ZU1A 2YTPA 2EORA 2EM0A 2PRTA 4IS1C 2EMKA 2DLKA 2WCC3 2EM7A 4F6NA 2EOIA 2EOZA 2YU8A 2D9HA 2LO3A 4R2SA 2EMZA 1BB8A 2MKDA 2EQ3A 2DGCA 2CT1A 2EM9A 2EOYA 1YUJA 2EMHA 2A25A 2EM3A 2EMIA 2YTJA 2R1FA 2YTDA 3M99B 2EQ0A 2DRPA 2NABA 5KL6A 2EMBA 2EOSA 4R2DA 2EN2A 2LT7A 5KL3A 2EP3A 1A1JA 2WBSA 2BB8A 2EOJA 2M9AA 2JP9A 5KL2A 1B69A 2EN6A 1X6HA 2EL4A 2YRKA 1LLMC 2EE8A 4R2CA 1X3CA 1RMDA 2EPZA 2MKNA 2YSOA 1X5WA 1KJKA 2GLIA 2LV2A 2YTNA 2EMGA 1A1KA 1TF6A 2ELYA 1DGCA 2RSIA 2YTQA 2EQ1A 4X9JA 3EPLA 1Z1BA 1G2FC 2GHFA 2YSPA 4R2RA 1AAYA 2EN4A 2EOQA 2YTOA 2WBUA 2CSHA 3VHTB 4F2JC 1A1IA 1F2IG 1A1GA 1YSAC 2EM8A 2YTGA 2EN1A 2EN7A 2EMAA 1A1LA 1A1FA 2J7JA 1P47A 3EPKA 2EPAA 2JPAA 2EPCA 2LVHA 2EPXA 1JK2A 2EMFA 2EN3A 2EM2A 4M9VC 2YTIA 2MDGA 2EM6A 2EPPA 2HGHA 1MEYC 2EOOA 2ENAA 2EL5A 2YTFA 2ENCA 2EM4A 2LCEA 3MHSC 1WJPA 1JK1A 1UBDC 2EOMA 2VRDA 2EMYA 2EMWA 2EMCA 4R2QA 4R2EA 2EM5A 2CTDA 2DLQA 2EPRA 1NCSA 1TF3A 2YTEA 2ENHA 2ADRA 3EPHA 1ZR9A 1TN9A 2EMXA 2YRMA 5KL4A 1ZAAC 2EOFA 1X6FA 2EMLA 2RPCA 2YRHA 3UK3C 2EJ4A 5KL7A 4R2PA 4WSGA 2EL6A 2EOXA 4R2AA 1A1HA 1G2DC 2YU5A 3MHHC 2EOEA 1BBOA 5KL5A 4GZNC 1UN6B 4FK5C 2EN8A 2EOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPU A;  4F6M A;  3EPJ A;  4IJD A;  2ELZ A;  2WBT A;  1YUI A;  2E72 A;  2DMI A;  2I13 A;  1X6E A;  1ZU1 A;  2YTP A;  2EOR A;  2EM0 A;  2PRT A;  4IS1 C;  2EMK A;  2DLK A;  2WCC 3;  2EM7 A;  4F6N A;  2EOI A;  2EOZ A;  2YU8 A;  2D9H A;  2LO3 A;  4R2S A;  2EMZ A;  1BB8 A;  2MKD A;  2EQ3 A;  2DGC A;  2CT1 A;  2EM9 A;  2EOY A;  1YUJ A;  2EMH A;  2A25 A;  2EM3 A;  2EMI A;  2YTJ A;  2R1F A;  2YTD A;  3M99 B;  2EQ0 A;  2DRP A;  2NAB A;  5KL6 A;  2EMB A;  2EOS A;  4R2D A;  2EN2 A;  2LT7 A;  5KL3 A;  2EP3 A;  1A1J A;  2WBS A;  2BB8 A;  2EOJ A;  2M9A A;  2JP9 A;  5KL2 A;  1B69 A;  2EN6 A;  1X6H A;  2EL4 A;  2YRK A;  1LLM C;  2EE8 A;  4R2C A;  1X3C A;  1RMD A;  2EPZ A;  2MKN A;  2YSO A;  1X5W A;  1KJK A;  2GLI A;  2LV2 A;  2YTN A;  2EMG A;  1A1K A;  1TF6 A;  2ELY A;  1DGC A;  2RSI A;  2YTQ A;  2EQ1 A;  4X9J A;  3EPL A;  1Z1B A;  1G2F C;  2GHF A;  2YSP A;  4R2R A;  1AAY A;  2EN4 A;  2EOQ A;  2YTO A;  2WBU A;  2CSH A;  3VHT B;  4F2J C;  1A1I A;  1F2I G;  1A1G A;  1YSA C;  2EM8 A;  2YTG A;  2EN1 A;  2EN7 A;  2EMA A;  1A1L A;  1A1F A;  2J7J A;  1P47 A;  3EPK A;  2EPA A;  2JPA A;  2EPC A;  2LVH A;  2EPX A;  1JK2 A;  2EMF A;  2EN3 A;  2EM2 A;  4M9V C;  2YTI A;  2MDG A;  2EM6 A;  2EPP A;  2HGH A;  1MEY C;  2EOO A;  2ENA A;  2EL5 A;  2YTF A;  2ENC A;  2EM4 A;  2LCE A;  3MHS C;  1WJP A;  1JK1 A;  1UBD C;  2EOM A;  2VRD A;  2EMY A;  2EMW A;  2EMC A;  4R2Q A;  4R2E A;  2EM5 A;  2CTD A;  2DLQ A;  2EPR A;  1NCS A;  1TF3 A;  2YTE A;  2ENH A;  2ADR A;  3EPH A;  1ZR9 A;  1TN9 A;  2EMX A;  2YRM A;  5KL4 A;  1ZAA C;  2EOF A;  1X6F A;  2EML A;  2RPC A;  2YRH A;  3UK3 C;  2EJ4 A;  5KL7 A;  4R2P A;  4WSG A;  2EL6 A;  2EOX A;  4R2A A;  1A1H A;  1G2D C;  2YU5 A;  3MHH C;  2EOE A;  1BBO A;  5KL5 A;  4GZN C;  1UN6 B;  4FK5 C;  2EN8 A;  2EOH A; 
#chains in the Genus database with same CATH topology
 2B3T B;  4DUZ E;  2JOB A;  2FV4 B;  2UXD E;  4B3M E;  1AH5 A;  4DUY E;  4DKK A;  1ZU1 A;  3IWB A;  4F54 A;  3F6G A;  2EMK A;  2EOZ A;  2JWO A;  4X64 E;  4DR6 E;  4X65 E;  2DGC A;  2V83 A;  1PJS A;  3HPZ A;  3KZZ A;  2YTJ A;  2F8B A;  1SFE A;  3M99 B;  2EQ0 A;  4BHC A;  2LUP B;  5AAS A;  4B3T E;  2EN2 A;  4ZYE A;  2FTX B;  4BMJ A;  4WYQ B;  1B69 A;  2EN6 A;  1LLM C;  2LJU A;  4R2C A;  3HTX A;  4F9C B;  3HQ1 A;  1A1K A;  1TF6 A;  2BBG A;  2RSI A;  4WFT A;  1Z1B A;  1T4O A;  2LTR A;  4LF7 E;  2EN4 A;  2EOQ A;  1IBM E;  1GTK A;  2CSH A;  1YSA C;  3C6K A;  2EN1 A;  1J5E E;  2V86 A;  4KWY A;  1A1L A;  1P47 A;  3J7A G;  2R76 A;  2B7V A;  3VYY A;  2EM2 A;  4M9V C;  1N34 E;  2EPP A;  2EOO A;  1T4N A;  2LCE A;  1JK1 A;  1UBD C;  2LRS A;  4DR2 E;  2CTD A;  2YTE A;  2ENH A;  4M0V A;  1RQ0 A;  5T6J A;  2DSY A;  2G7H A;  2RSM A;  2EWL A;  5KL4 A;  3ADL A;  2EOF A;  1X6F A;  2N8X A;  2YRH A;  1WXR A;  2KON A;  5KL7 A;  4R2P A;  4DV6 E;  2VQE E;  1IBK E;  2EOX A;  4R2A A;  2ZM6 E;  4AQY E;  1A1H A;  2UUB E;  4TUI A;  1X47 A;  2HJJ A;  4Q35 B;  4OOG C;  5LMU E;  4FK5 C;  1ZBQ A;  2YWQ A;  3EPJ A;  2F4V E;  1EH8 A;  1YUI A;  2E72 A;  2I13 A;  1X6E A;  4YY3 E;  2YTP A;  2PRT A;  4IS1 C;  1N36 E;  4JI3 E;  2DLK A;  2WZO A;  2EM7 A;  4BBY A;  3DJW A;  2D9H A;  2LO3 A;  4R2S A;  2EQ3 A;  4R8O A;  2EM9 A;  1YUJ A;  1GQE A;  2A25 A;  2VF1 A;  2R1F A;  4B3S E;  2ODR D;  4I8O A;  4ZYD A;  5KL6 A;  1EKZ A;  2EMB A;  1HNZ E;  1PJT A;  4DR5 E;  1QNT A;  4DV7 E;  5KL3 A;  1A1J A;  4BC7 A;  5LMN E;  2BB8 A;  1GZ6 A;  2M9A A;  4M30 A;  5A6A A;  5KL2 A;  4JYA E;  2YRK A;  1N32 E;  1IBL E;  2HC5 A;  1RMD A;  2EPZ A;  3H09 A;  2YSO A;  5TSE A;  2UXB E;  5BR8 E;  4WXD A;  1N3G A;  2ELY A;  1PDA A;  4X9J A;  4TUG A;  4HEI A;  1G2F C;  2L2M A;  4O5G A;  2GHF A;  2GPI A;  3THN A;  4R2R A;  1A1G A;  2EM8 A;  1I94 E;  3OML A;  1XNR E;  1XMQ E;  4GKJ E;  2L92 A;  2J7J A;  3EPK A;  1EH6 A;  5LL6 R;  3TQM A;  2N3G A;  4RHB B;  2LVH A;  4JI4 E;  1HNW E;  2EMF A;  2L8T A;  3DF6 A;  5LLQ A;  5DNY A;  4R03 A;  5IV8 B;  2EN3 A;  2L3J A;  1WHQ A;  2HGH A;  3AV0 A;  4WXC A;  3BF2 A;  4LF6 E;  5IWA E;  2EMW A;  2DMY A;  2EMC A;  4O43 A;  4WSP A;  5AE1 A;  4F9B B;  2KHX A;  4DR4 E;  3J7Y p;  4JV5 E;  2Q8U A;  1IMU A;  3KWR A;  4RH8 A;  2KOU A;  4B3R E;  2M4I A;  2L33 A;  2EML A;  2RPC A;  4DV3 E;  3LLH A;  2ODR C;  4DV5 E;  4LF4 E;  2HHH E;  2UXC E;  4LF5 E;  1G2D C;  2EPO A;  3MHH C;  1J26 A;  3K6Q A;  1UN6 B;  2EN8 A;  4DV0 E;  1DQ3 A;  4MLV A;  2L3C A;  4ZYG A;  1FKA E;  5A6J A;  2UUA E;  4IJD A;  2ELZ A;  2JXP A;  2WBT A;  3FIG A;  2MC5 A;  2EOR A;  1UIL A;  5A2Q C;  4F6N A;  2YU8 A;  1BB8 A;  2MKD A;  4L5N C;  1L4S A;  2EMH A;  4P7D A;  5AE3 A;  2EM3 A;  5A69 A;  1T38 A;  2JY9 A;  2LBS B;  4LFA E;  2DRP A;  2NAB A;  5A6B D;  4NXM E;  2EOS A;  2LT7 A;  2EP3 A;  2V87 A;  2K7I A;  2EL4 A;  5ADZ A;  4OX9 E;  4YHH E;  1X3C A;  2L6M A;  1X48 A;  3KZY A;  2NA2 A;  1IQS A;  4DR1 E;  2LJH A;  1XNQ E;  2GLI A;  2LV2 A;  4O24 A;  5A6B A;  1RC7 A;  1DGC A;  2VE7 C;  3RMP A;  2YTQ A;  3EPL A;  2V89 A;  2JR1 A;  1QU6 A;  2H36 X;  4F9A B;  3VYX A;  4NHR A;  1A1I A;  2WBU A;  4F2J C;  5IT9 C;  4O4K A;  3VHT B;  2DIX A;  3ADJ A;  2YTG A;  4BCA A;  2EN7 A;  1BBG A;  4DV2 E;  1A1F A;  2EPA A;  2EPC A;  2MDR A;  3ADI A;  2YTI A;  2N3H A;  2MDG A;  2EM6 A;  2ENA A;  4P78 A;  2YTF A;  5A6K A;  1WRJ A;  2ENC A;  2EM4 A;  2EPM X;  1YZ9 A;  5FLX C;  1WJP A;  2FGG A;  5IXM B;  2EOM A;  3JU0 A;  2VRD A;  1XMO E;  4BHB A;  4DR3 E;  2L2N A;  2NUF A;  1YFH A;  4DR7 E;  2EPN A;  1PKP A;  2UUC E;  1YPN A;  2ADR A;  4LFC E;  4M2Z A;  4NZV A;  2YRM A;  1ZAA C;  4N4R B;  2LE2 A;  3UK3 C;  2EJ4 A;  1PJQ A;  2EL6 A;  5AE2 A;  2YPN A;  3JTZ A;  2DB2 A;  2EOE A;  3P1X A;  4JI6 E;  3OTO E;  2EPL X;  3F6H A;  3MSW A;  2EPU A;  2V88 A;  4F6M A;  2JYA A;  4X8W A;  5AC4 A;  4JI2 E;  1YYK A;  3C4B A;  2NUE A;  3T1H E;  2NUG A;  4K0K E;  2DMI A;  1X49 A;  4X62 E;  1FJG E;  2EM0 A;  4JI5 E;  2WCC 3;  3EQ1 A;  4BC9 A;  2EOI A;  2EZ6 A;  2EMZ A;  2CT1 A;  2EOY A;  2IHR 1;  3IWD A;  4LF8 E;  1IQO A;  5AC5 A;  4KZS A;  2EMI A;  2RS7 A;  4HTG A;  4LU9 A;  3C6M A;  3J81 C;  1YYO A;  2YTD A;  4LF9 E;  4JI1 E;  4R2D A;  1EH7 A;  4JI0 E;  1MGT A;  1SR9 A;  4JI7 E;  4Q28 A;  2EOJ A;  2RQL A;  2WBS A;  4LTY A;  2JP9 A;  1X6H A;  2CPN A;  2LTS A;  4WPY A;  2EE8 A;  2RS6 A;  3JAM C;  2MKN A;  4JI8 E;  1X5W A;  2I9I A;  1KJK A;  2JVA A;  2JOX A;  2YTN A;  2EMG A;  1T39 A;  3VK6 A;  1DI2 A;  2EQ1 A;  3ADG A;  4WX9 A;  4X66 E;  4LFB E;  3BBG A;  2YSP A;  3L00 A;  2B7T A;  1AAY A;  2YTO A;  1F2I G;  1HNX E;  2EMA A;  3BID A;  3IWC A;  1NEI A;  5F3W A;  3HPS A;  3ECR A;  4J8Z A;  1O0W A;  2YT4 A;  2V85 A;  2JPA A;  2EPX A;  1JK2 A;  5CFF E;  2M1S A;  4DMI A;  4NXN E;  3C4T A;  4MLQ A;  1KYQ A;  3ZOQ B;  1WHN A;  1MEY C;  3AUZ A;  4BS9 A;  1N33 E;  2EL5 A;  4GKK E;  2VQF E;  4KHP E;  1ZBT A;  3MHS C;  4GEQ B;  1UHZ A;  2L2K B;  2E5L E;  2EMY A;  4R2Q A;  3BGH A;  4R2E A;  2EM5 A;  1T4L B;  2DLQ A;  2EPR A;  1NCS A;  2V8Q B;  1TF3 A;  2EPK X;  2B9D A;  2M7Q A;  4ZYH A;  3QG5 C;  2MC6 A;  1HR0 E;  3EPH A;  1ZR9 A;  1TN9 A;  2EMX A;  4DV1 E;  2RTX A;  2LUQ A;  3T1Y E;  4L8N A;  2K4V A;  3LML A;  2YZT A;  1YYW A;  1STU A;  2LMZ A;  4WSG A;  3THO B;  4DV4 E;  3J80 C;  2YU5 A;  1BBO A;  2UU9 E;  5KL5 A;  2E1M A;  4GZN C;  3HXL A;  2EOH A; 
#chains in the Genus database with same CATH homology
 2EPU A;  4F6M A;  3EPJ A;  4IJD A;  2ELZ A;  2WBT A;  1YUI A;  2E72 A;  2DMI A;  2I13 A;  1X6E A;  1ZU1 A;  2YTP A;  2EOR A;  2EM0 A;  2PRT A;  4IS1 C;  2EMK A;  2DLK A;  2WCC 3;  2EM7 A;  4F6N A;  2EOI A;  2EOZ A;  2YU8 A;  2D9H A;  2LO3 A;  4R2S A;  2EMZ A;  1BB8 A;  2MKD A;  2EQ3 A;  2DGC A;  2CT1 A;  2EM9 A;  2EOY A;  1YUJ A;  2EMH A;  2A25 A;  2EM3 A;  2EMI A;  2YTJ A;  2R1F A;  2YTD A;  3M99 B;  2EQ0 A;  2DRP A;  2NAB A;  5KL6 A;  2EMB A;  2EOS A;  4R2D A;  2EN2 A;  2LT7 A;  5KL3 A;  2EP3 A;  1A1J A;  2WBS A;  2BB8 A;  2EOJ A;  2M9A A;  2JP9 A;  5KL2 A;  1B69 A;  2EN6 A;  1X6H A;  2EL4 A;  2YRK A;  1LLM C;  2EE8 A;  4R2C A;  1X3C A;  1RMD A;  2EPZ A;  2MKN A;  2YSO A;  1X5W A;  1KJK A;  2GLI A;  2LV2 A;  2YTN A;  2EMG A;  1A1K A;  1TF6 A;  2ELY A;  1DGC A;  2RSI A;  2YTQ A;  2EQ1 A;  4X9J A;  3EPL A;  1Z1B A;  1G2F C;  2GHF A;  2YSP A;  4R2R A;  1AAY A;  2EN4 A;  2EOQ A;  2YTO A;  2WBU A;  2CSH A;  3VHT B;  4F2J C;  1A1I A;  1F2I G;  1A1G A;  1YSA C;  2EM8 A;  2YTG A;  2EN1 A;  2EN7 A;  2EMA A;  1A1L A;  1A1F A;  2J7J A;  1P47 A;  3EPK A;  2EPA A;  2JPA A;  2EPC A;  2LVH A;  2EPX A;  1JK2 A;  2EMF A;  2EN3 A;  2EM2 A;  4M9V C;  2YTI A;  2MDG A;  2EM6 A;  2EPP A;  2HGH A;  1MEY C;  2EOO A;  2ENA A;  2EL5 A;  2YTF A;  2ENC A;  2EM4 A;  2LCE A;  3MHS C;  1WJP A;  1JK1 A;  1UBD C;  2EOM A;  2VRD A;  2EMY A;  2EMW A;  2EMC A;  4R2Q A;  4R2E A;  2EM5 A;  2CTD A;  2DLQ A;  2EPR A;  1NCS A;  1TF3 A;  2YTE A;  2ENH A;  2ADR A;  3EPH A;  1ZR9 A;  1TN9 A;  2EMX A;  2YRM A;  5KL4 A;  1ZAA C;  2EOF A;  1X6F A;  2EML A;  2RPC A;  2YRH A;  3UK3 C;  2EJ4 A;  5KL7 A;  4R2P A;  4WSG A;  2EL6 A;  2EOX A;  4R2A A;  1A1H A;  1G2D C;  2YU5 A;  3MHH C;  2EOE A;  1BBO A;  5KL5 A;  4GZN C;  1UN6 B;  4FK5 C;  2EN8 A;  2EOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...