2RTXA

Solution structure of the ggq domain of yaej protein from escherichia coli
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKARRPTRSGPSSGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of residues required for stalled-ribosome rescue in the codon-independent release factor YaeJ
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase YaeJ
total genus 20
structure length 121
sequence length 121
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rtxA00
1J5EE 1WHQA 1RQ0A 1N33E 1N32E 2RS6A 2B7TA 4DR3E 4JI2E 2JY9A 1YYKA 3VYYA 4KHPE 1GQEA 2DMYA 1YYOA 3ADGA 4JI7E 1HNXE 4LF9E 3ADJA 4LF5E 2RSMA 2LUPB 4DV3E 1X47A 3J7Yp 2RS7A 4JV5E 3HTXA 2B7VA 4B3TE 4DR7E 1I94E 2KHXA 1UHZA 4NXNE 1IBLE 2UU9E 2UXDE 2UUAE 3OTOE 4WFTA 2L2MA 4WYQB 1RC7A 2F4VE 1UILA 4OOGC 4DV0E 4LFAE 4B3SE 1QU6A 4YHHE 2LUQA 2LTSA 1T4NA 4DV5E 1DI2A 4LF7E 4OX9E 4B3ME 4DR6E 4DV7E 4X66E 4NXME 3LLHA 1XMQE 4DV2E 1T4LB 1X49A 4LFCE 4LF8E 4DV6E 1YYWA 2LTRA 4LFBE 3T1YE 5BR8E 2UUBE 2NUEA 5IWAE 5LMUE 1FJGE 4LF6E 1XNQE 4GKKE 1HR0E 4K0KE 2NA2A 4JI0E 3T1HE 4DR4E 2RTXA 1T4OA 2UUCE 1HNZE 3C4BA 4DV1E 2ZM6E 2N3HA 4DKKA 4X62E 1N34E 1N36E 2LRSA 4JI4E 3VYXA 2L3JA 4DR5E 1X48A 4YY3E 2EZ6A 5LMNE 4X8WA 2L33A 4JI3E 2L2NA 2NUFA 2MDRA 2IHR1 4JYAE 4DUZE 3P1XA 2HHHE 2UXCE 1O0WA 1STUA 4DR2E 4JI5E 1FKAE 1HNWE 4X64E 1IBKE 1IBME 4LF4E 2VQFE 3C4TA 4DV4E 2NUGA 1J26A 2E5LE 2LJHA 3ADLA 2N3GA 4JI1E 2DIXA 4GKJE 4JI6E 4X65E 2UXBE 4AQYE 4DR1E 1XMOE 5CFFE 4DUYE 1EKZA 1YZ9A 3ADIA 2L2KB 4JI8E 2LBSB 1XNRE 2CPNA 2L3CA 4B3RE 2VQEE 1WHNA 2JVAA 2DB2A 1ZBTA 4M30A 2YT4A 4M2ZA 2B3TB 1PKPA
chains in the Genus database with same CATH superfamily
4IJDA 1DQ3A 3JAMC 1N33E 2EMZA 4DMIA 2B7TA 1A1JA 1TF3A 1YSAC 1X6FA 3VYYA 3C6KA 4P78A 2EPXA 4JI7E 2EPZA 2JYAA 2EOEA 4R8OA 2EOIA 4LF9E 4DV3E 3J7Yp 3HPZA 3HTXA 4B3TE 4DR7E 3H09A 2EPMX 4Q35B 1UHZA 5LLQA 1WRJA 2RSIA 3BIDA 2EMFA 5A6BA 1IBLE 2EOQA 2L2MA 2YTFA 4DV0E 2M4IA 2EN2A 1KYQA 4B3SE 1QU6A 4BHBA 2EOFA 2MDGA 2JOBA 2JWOA 1JK1A 2EP3A 2EOMA 2YZTA 1PJTA 2MC6A 2YRHA 4DR6E 1WJPA 4O43A 5AE1A 1T39A 2CTDA 1T4LB 4DV6E 3T1YE 2FV4B 2FTXB 2V85A 2EL4A 4LF6E 4WSGA 1XNQE 3T1HE 1PJSA 5FLXC 2UUCE 4BMJA 3C4BA 4DKKA 2LJUA 4X62E 1RMDA 2LRSA 2ODRD 5ADZA 5KL3A 1SR9A 2EOYA 4WXCA 4WX9A 2L2NA 2EMAA 2NUFA 2EMXA 2EPKX 4J8ZA 4L8NA 4F9BB 1O0WA 5KL4A 1ZU1A 2EQ0A 2YRKA 4L5NC 1HNWE 2CT1A 1ZAAC 3C4TA 4DV4E 3JU0A 1YUIA 2YTGA 3ADLA 5KL2A 3C6MA 2EPAA 2N3GA 3DF6A 2LE2A 3RMPA 3EPHA 4X65E 1PDAA 2EN1A 2UXBE 4MLQA 2LO3A 5CFFE 4DR1E 1EKZA 3THNA 2EN4A 1BBGA 3ADIA 4ZYHA 4X9JA 1GTKA 2CPNA 1XNRE 3J80C 3ZOQB 1N3GA 2LMZA 3M99B 5TSEA 1T38A 2DB2A 2YU5A 2EMIA 4M30A 1IQOA 3MHSC 3IWDA 4GZNC 1WHQA 2EN3A 2ENHA 2K4VA 2EM7A 2DRPA 2GPIA 2HJJA 3HPSA 2JY9A 1GQEA 3ADGA 4BC9A 1YFHA 3L00A 4R2EA 4O24A 2CSHA 3IWCA 4JV5E 2KHXA 2V88A 4M9VC 4F6MA 2J7JA 2EN6A 2UUAE 1YPNA 4WFTA 3OTOE 4WYQB 2M9AA 2F4VE 4OOGC 2R76A 2L92A 4O5GA 4LU9A 5A6AA 2YTEA 2LUQA 2EM3A 2EM6A 3K6QA 3MSWA 2V89A 1DI2A 4LF7E 2DSYA 3J81C 5IXMB 4X66E 1UBDC 4LTYA 4WPYA 2K7IA 2GHFA 2LTRA 4ZYDA 2ELYA 3AV0A 5IV8B 2LVHA 5A6JA 2EOHA 2EJ4A 4GKKE 4K0KE 2EPRA 2H36X 1UN6B 2RPCA 1A1LA 3QG5C 2YTQA 4DV1E 1N34E 2EMBA 4JI4E 1X48A 1ZR9A 2EE8A 2JP9A 4X8WA 4JI3E 4HEIA 4JYAE 3THOB 5A6BD 2HHHE 2LT7A 4DR2E 4JI5E 1X6HA 4F6NA 2EM9A 4MLVA 3VK6A 2Q8UA 4LF4E 1J26A 2E5LE 4IS1C 4R03A 1PJQA 4JI1E 4BS9A 2EM8A 4GKJE 4JI6E 4AQYE 4N4RB 2BBGA 2V83A 1IQSA 3KWRA 1XMOE 2YTIA 2EMHA 2YPNA 1EH7A 2YTJA 2L3CA 4B3RE 4RH8A 5A6KA 1G2FC 3F6GA 4F2JC 2JR1A 1MGTA 2JVAA 2EL6A 1X6EA 4GEQB 2B3TB 1PKPA 2EMGA 1J5EE 2JXPA 1RQ0A 4R2QA 1JK2A 3F6HA 1NEIA 2EPCA 2EOZA 2RS6A 2V8QB 3AUZA 2EN8A 4JI2E 2EOJA 1A1IA 2JOXA 1YYOA 1B69A 3J7AG 1A1HA 1X3CA 2RSMA 4LF5E 4HTGA 2EM2A 4WXDA 5KL7A 4P7DA 4BCAA 2EOSA 4NXNE 4TUGA 2UU9E 1QNTA 2UXDE 1AH5A 2EWLA 3BBGA 3OMLA 1RC7A 1UILA 1BB8A 2EMCA 4M0VA 4LFAE 4R2CA 3KZYA 4YHHE 2ENAA 1A1KA 1SFEA 4NHRA 2YTPA 2LTSA 1T4NA 4NZVA 2I9IA 4DV5E 2MC5A 1L4SA 2V86A 2EPPA 2YTOA 4DV7E 4B3ME 4DV2E 4LF8E 3TQMA 1YYWA 1G2DC 2NABA 2NUEA 5AASA 5IWAE 5LMUE 2YTDA 3KZZA 1HR0E 4JI0E 5KL6A 2YSPA 2EM0A 3EQ1A 1IMUA 2RTXA 2PRTA 1T4OA 4KZSA 1HNZE 3BF2A 2ZM6E 3VYXA 1N36E 2ADRA 2D9HA 2L3JA 4DR5E 4I8OA 4R2DA 5LMNE 1P47A 2L33A 2WBSA 2EOOA 4F9CB 2IHR1 3P1XA 2EMYA 5KL5A 1STUA 3MHHC 2L6MA 2N8XA 2KONA 1IBKE 1IBME 2DGCA 1EH6A 2NUGA 1DGCA 2EN7A 2GLIA 4RHBB 2EPNA 2FGGA 1NCSA 2L8TA 2L2KB 3EPLA 2LBSB 5F3WA 2WBTA 2VQEE 3EPJA 3VHTB 1TN9A 1ZBTA 2WCC3 2V87A 2BB8A 2MKNA 5LL6R 2YT4A 1A1FA 2I13A 1N32E 2E1MA 3DJWA 2R1FA 4DR3E 1YUJA 2EMKA 2G7HA 1YYKA 4KHPE 2EM4A 4O4KA 3HXLA 2EQ3A 2DMYA 2YTNA 2ENCA 1HNXE 1X5WA 2VF1A 2MKDA 2EMLA 3ADJA 2ODRC 2LUPB 2LCEA 1X47A 2EMWA 3HQ1A 2RS7A 4F9AB 2B7VA 1I94E 5AE2A 2DLKA 2M1SA 5AC4A 2HC5A 4F54A 1AAYA 1EH8A 2YRMA 2E72A 2YSOA 2A25A 5AC5A 5A69A 2LV2A 2VRDA 2DMIA 1BBOA 5T6JA 5IT9C 2EPLX 2JPAA 2HGHA 4OX9E 1F2IG 4NXME 3BGHA 3LLHA 2RQLA 1XMQE 4LFCE 1X49A 5AE3A 4LFBE 4FK5C 4R2AA 5BR8E 2UUBE 4BHCA 1FJGE 2EOXA 2DLQA 1TF6A 2M7QA 1KJKA 2NA2A 2VE7C 4TUIA 4DR4E 1MEYC 3ECRA 4KWYA 2EORA 3LMLA 3UK3C 2N3HA 2WZOA 5DNYA 4YY3E 2EZ6A 2B9DA 4ZYGA 1LLMC 3FIGA 1GZ6A 2MDRA 4ZYEA 3JTZA 4DUZE 2F8BA 4Q28A 2UXCE 2ELZA 2EM5A 4BC7A 1A1GA 3EPKA 4R2RA 1FKAE 4X64E 1ZBQA 2EPUA 4WSPA 1Z1BA 2EL5A 2VQFE 2LJHA 4R2PA 1WXRA 2DIXA 2KOUA 4DUYE 1YZ9A 2WBUA 5A2QC 2EPOA 2YWQA 4JI8E 2YU8A 4R2SA 1WHNA 4BBYA 3IWBA 2EQ1A 4M2ZA
chains in the Genus database with same CATH topology
1J5EE 1DQ3A 1WHQA 3JAMC 1RQ0A 1N33E 1N32E 2E1MA 3F6HA 3DJWA 2K4VA 4DMIA 2RS6A 2V8QB 2B7TA 3AUZA 4DR3E 3HPSA 4JI2E 2JY9A 1YYKA 2G7HA 3VYYA 4KHPE 1GQEA 3HXLA 2DMYA 2JOXA 1YYOA 4P78A 3ADGA 4R8OA 4JI7E 1HNXE 2VF1A 3J7AG 4LF9E 3ADJA 4BC9A 2ODRC 4LF5E 2RSMA 2LUPB 4DV3E 1X47A 3J7Yp 3HPZA 2RS7A 3HQ1A 3IWCA 4P7DA 2B7VA 4F9AB 4B3TE 3HTXA 4DR7E 3H09A 4BCAA 1I94E 2KHXA 5AE2A 1UHZA 2M1SA 2V88A 4NXNE 4F54A 1IBLE 4TUGA 2UU9E 2UXDE 2UUAE 3OTOE 4WFTA 2EWLA 2L2MA 4WYQB 3OMLA 1RC7A 1UILA 2F4VE 4OOGC 4M0VA 4DV0E 4LFAE 2M4IA 4B3SE 1QU6A 4YHHE 2L92A 4LU9A 2LUQA 5T6JA 3K6QA 2JOBA 2JWOA 5IT9C 2LTSA 1T4NA 3MSWA 2V89A 4DV5E 1DI2A 2YZTA 2MC5A 2MC6A 2DSYA 3J81C 2V86A 4B3ME 4DV7E 4X66E 4LF7E 4OX9E 4DR6E 4NXME 5AE1A 3LLHA 4LTYA 4WPYA 1XMQE 4DV2E 1T4LB 1X49A 4LFCE 4LF8E 4DV6E 5AE3A 1YYWA 2LTRA 4LFBE 4JV5E 3T1YE 2V85A 2FV4B 2FTXB 3AV0A 5BR8E 2UUBE 5AASA 5IWAE 5LMUE 1FJGE 4LF6E 2NUEA 1XNQE 4GKKE 2M7QA 1HR0E 4K0KE 2NA2A 2VE7C 4JI0E 2H36X 4TUIA 3T1HE 5FLXC 4DR4E 2RTXA 1T4OA 2UUCE 4KZSA 4BMJA 1HNZE 3LMLA 3C4BA 2ZM6E 4DV1E 2N3HA 2WZOA 4DKKA 4X62E 1N34E 2LRSA 1N36E 4JI4E 3VYXA 2L3JA 4DR5E 1X48A 2ODRD 5DNYA 5ADZA 4YY3E 4I8OA 1SR9A 5LMNE 2EZ6A 4X8WA 2B9DA 2L33A 4JI3E 2L2NA 3FIGA 2NUFA 1GZ6A 2MDRA 4F9CB 2IHR1 3JTZA 4J8ZA 4L8NA 4F9BB 2F8BA 4Q28A 4DUZE 4JYAE 3P1XA 2HHHE 2UXCE 1O0WA 1STUA 4BC7A 4DR2E 4JI5E 4L5NC 1FKAE 2L6MA 4X64E 1HNWE 2KONA 1ZBQA 3VK6A 4WSPA 1IBKE 1IBME 4LF4E 2VQFE 3C4TA 4DV4E 3JU0A 2NUGA 1J26A 2E5LE 2LJHA 4R03A 3ADLA 1WXRA 2N3GA 3DF6A 4JI1E 4BS9A 4M2ZA 2DIXA 2LE2A 3RMPA 4GKJE 2KOUA 2FGGA 4JI6E 4X65E 2UXBE 4AQYE 2L8TA 2V83A 3KWRA 5CFFE 4DUYE 4DR1E 1XMOE 1EKZA 1YZ9A 5A2QC 3ADIA 2L2KB 4JI8E 2LBSB 5F3WA 1XNRE 2CPNA 2L3CA 4B3RE 3J80C 3ZOQB 2VQEE 1WHNA 2LMZA 3F6GA 2JR1A 4BBYA 2JVAA 2DB2A 1ZBTA 4M30A 2V87A 5LL6R 3IWBA 3IWDA 2YT4A 4GEQB 2B3TB 1PKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E E;  1WHQ A;  1RQ0 A;  1N33 E;  1N32 E;  2RS6 A;  2B7T A;  4DR3 E;  4JI2 E;  2JY9 A;  1YYK A;  3VYY A;  4KHP E;  1GQE A;  2DMY A;  1YYO A;  3ADG A;  4JI7 E;  1HNX E;  4LF9 E;  3ADJ A;  4LF5 E;  2RSM A;  2LUP B;  4DV3 E;  1X47 A;  3J7Y p;  2RS7 A;  4JV5 E;  3HTX A;  2B7V A;  4B3T E;  4DR7 E;  1I94 E;  2KHX A;  1UHZ A;  4NXN E;  1IBL E;  2UU9 E;  2UXD E;  2UUA E;  3OTO E;  4WFT A;  2L2M A;  4WYQ B;  1RC7 A;  2F4V E;  1UIL A;  4OOG C;  4DV0 E;  4LFA E;  4B3S E;  1QU6 A;  4YHH E;  2LUQ A;  2LTS A;  1T4N A;  4DV5 E;  1DI2 A;  4LF7 E;  4OX9 E;  4B3M E;  4DR6 E;  4DV7 E;  4X66 E;  4NXM E;  3LLH A;  1XMQ E;  4DV2 E;  1T4L B;  1X49 A;  4LFC E;  4LF8 E;  4DV6 E;  1YYW A;  2LTR A;  4LFB E;  3T1Y E;  5BR8 E;  2UUB E;  2NUE A;  5IWA E;  5LMU E;  1FJG E;  4LF6 E;  1XNQ E;  4GKK E;  1HR0 E;  4K0K E;  2NA2 A;  4JI0 E;  3T1H E;  4DR4 E;  2RTX A;  1T4O A;  2UUC E;  1HNZ E;  3C4B A;  4DV1 E;  2ZM6 E;  2N3H A;  4DKK A;  4X62 E;  1N34 E;  1N36 E;  2LRS A;  4JI4 E;  3VYX A;  2L3J A;  4DR5 E;  1X48 A;  4YY3 E;  2EZ6 A;  5LMN E;  4X8W A;  2L33 A;  4JI3 E;  2L2N A;  2NUF A;  2MDR A;  2IHR 1;  4JYA E;  4DUZ E;  3P1X A;  2HHH E;  2UXC E;  1O0W A;  1STU A;  4DR2 E;  4JI5 E;  1FKA E;  1HNW E;  4X64 E;  1IBK E;  1IBM E;  4LF4 E;  2VQF E;  3C4T A;  4DV4 E;  2NUG A;  1J26 A;  2E5L E;  2LJH A;  3ADL A;  2N3G A;  4JI1 E;  2DIX A;  4GKJ E;  4JI6 E;  4X65 E;  2UXB E;  4AQY E;  4DR1 E;  1XMO E;  5CFF E;  4DUY E;  1EKZ A;  1YZ9 A;  3ADI A;  2L2K B;  4JI8 E;  2LBS B;  1XNR E;  2CPN A;  2L3C A;  4B3R E;  2VQE E;  1WHN A;  2JVA A;  2DB2 A;  1ZBT A;  4M30 A;  2YT4 A;  4M2Z A;  2B3T B;  1PKP A; 
#chains in the Genus database with same CATH topology
 4IJD A;  1DQ3 A;  3JAM C;  1N33 E;  2EMZ A;  4DMI A;  2B7T A;  1A1J A;  1TF3 A;  1YSA C;  1X6F A;  3VYY A;  3C6K A;  4P78 A;  2EPX A;  4JI7 E;  2EPZ A;  2JYA A;  2EOE A;  4R8O A;  2EOI A;  4LF9 E;  4DV3 E;  3J7Y p;  3HPZ A;  3HTX A;  4B3T E;  4DR7 E;  3H09 A;  2EPM X;  4Q35 B;  1UHZ A;  5LLQ A;  1WRJ A;  2RSI A;  3BID A;  2EMF A;  5A6B A;  1IBL E;  2EOQ A;  2L2M A;  2YTF A;  4DV0 E;  2M4I A;  2EN2 A;  1KYQ A;  4B3S E;  1QU6 A;  4BHB A;  2EOF A;  2MDG A;  2JOB A;  2JWO A;  1JK1 A;  2EP3 A;  2EOM A;  2YZT A;  1PJT A;  2MC6 A;  2YRH A;  4DR6 E;  1WJP A;  4O43 A;  5AE1 A;  1T39 A;  2CTD A;  1T4L B;  4DV6 E;  3T1Y E;  2FV4 B;  2FTX B;  2V85 A;  2EL4 A;  4LF6 E;  4WSG A;  1XNQ E;  3T1H E;  1PJS A;  5FLX C;  2UUC E;  4BMJ A;  3C4B A;  4DKK A;  2LJU A;  4X62 E;  1RMD A;  2LRS A;  2ODR D;  5ADZ A;  5KL3 A;  1SR9 A;  2EOY A;  4WXC A;  4WX9 A;  2L2N A;  2EMA A;  2NUF A;  2EMX A;  2EPK X;  4J8Z A;  4L8N A;  4F9B B;  1O0W A;  5KL4 A;  1ZU1 A;  2EQ0 A;  2YRK A;  4L5N C;  1HNW E;  2CT1 A;  1ZAA C;  3C4T A;  4DV4 E;  3JU0 A;  1YUI A;  2YTG A;  3ADL A;  5KL2 A;  3C6M A;  2EPA A;  2N3G A;  3DF6 A;  2LE2 A;  3RMP A;  3EPH A;  4X65 E;  1PDA A;  2EN1 A;  2UXB E;  4MLQ A;  2LO3 A;  5CFF E;  4DR1 E;  1EKZ A;  3THN A;  2EN4 A;  1BBG A;  3ADI A;  4ZYH A;  4X9J A;  1GTK A;  2CPN A;  1XNR E;  3J80 C;  3ZOQ B;  1N3G A;  2LMZ A;  3M99 B;  5TSE A;  1T38 A;  2DB2 A;  2YU5 A;  2EMI A;  4M30 A;  1IQO A;  3MHS C;  3IWD A;  4GZN C;  1WHQ A;  2EN3 A;  2ENH A;  2K4V A;  2EM7 A;  2DRP A;  2GPI A;  2HJJ A;  3HPS A;  2JY9 A;  1GQE A;  3ADG A;  4BC9 A;  1YFH A;  3L00 A;  4R2E A;  4O24 A;  2CSH A;  3IWC A;  4JV5 E;  2KHX A;  2V88 A;  4M9V C;  4F6M A;  2J7J A;  2EN6 A;  2UUA E;  1YPN A;  4WFT A;  3OTO E;  4WYQ B;  2M9A A;  2F4V E;  4OOG C;  2R76 A;  2L92 A;  4O5G A;  4LU9 A;  5A6A A;  2YTE A;  2LUQ A;  2EM3 A;  2EM6 A;  3K6Q A;  3MSW A;  2V89 A;  1DI2 A;  4LF7 E;  2DSY A;  3J81 C;  5IXM B;  4X66 E;  1UBD C;  4LTY A;  4WPY A;  2K7I A;  2GHF A;  2LTR A;  4ZYD A;  2ELY A;  3AV0 A;  5IV8 B;  2LVH A;  5A6J A;  2EOH A;  2EJ4 A;  4GKK E;  4K0K E;  2EPR A;  2H36 X;  1UN6 B;  2RPC A;  1A1L A;  3QG5 C;  2YTQ A;  4DV1 E;  1N34 E;  2EMB A;  4JI4 E;  1X48 A;  1ZR9 A;  2EE8 A;  2JP9 A;  4X8W A;  4JI3 E;  4HEI A;  4JYA E;  3THO B;  5A6B D;  2HHH E;  2LT7 A;  4DR2 E;  4JI5 E;  1X6H A;  4F6N A;  2EM9 A;  4MLV A;  3VK6 A;  2Q8U A;  4LF4 E;  1J26 A;  2E5L E;  4IS1 C;  4R03 A;  1PJQ A;  4JI1 E;  4BS9 A;  2EM8 A;  4GKJ E;  4JI6 E;  4AQY E;  4N4R B;  2BBG A;  2V83 A;  1IQS A;  3KWR A;  1XMO E;  2YTI A;  2EMH A;  2YPN A;  1EH7 A;  2YTJ A;  2L3C A;  4B3R E;  4RH8 A;  5A6K A;  1G2F C;  3F6G A;  4F2J C;  2JR1 A;  1MGT A;  2JVA A;  2EL6 A;  1X6E A;  4GEQ B;  2B3T B;  1PKP A;  2EMG A;  1J5E E;  2JXP A;  1RQ0 A;  4R2Q A;  1JK2 A;  3F6H A;  1NEI A;  2EPC A;  2EOZ A;  2RS6 A;  2V8Q B;  3AUZ A;  2EN8 A;  4JI2 E;  2EOJ A;  1A1I A;  2JOX A;  1YYO A;  1B69 A;  3J7A G;  1A1H A;  1X3C A;  2RSM A;  4LF5 E;  4HTG A;  2EM2 A;  4WXD A;  5KL7 A;  4P7D A;  4BCA A;  2EOS A;  4NXN E;  4TUG A;  2UU9 E;  1QNT A;  2UXD E;  1AH5 A;  2EWL A;  3BBG A;  3OML A;  1RC7 A;  1UIL A;  1BB8 A;  2EMC A;  4M0V A;  4LFA E;  4R2C A;  3KZY A;  4YHH E;  2ENA A;  1A1K A;  1SFE A;  4NHR A;  2YTP A;  2LTS A;  1T4N A;  4NZV A;  2I9I A;  4DV5 E;  2MC5 A;  1L4S A;  2V86 A;  2EPP A;  2YTO A;  4DV7 E;  4B3M E;  4DV2 E;  4LF8 E;  3TQM A;  1YYW A;  1G2D C;  2NAB A;  2NUE A;  5AAS A;  5IWA E;  5LMU E;  2YTD A;  3KZZ A;  1HR0 E;  4JI0 E;  5KL6 A;  2YSP A;  2EM0 A;  3EQ1 A;  1IMU A;  2RTX A;  2PRT A;  1T4O A;  4KZS A;  1HNZ E;  3BF2 A;  2ZM6 E;  3VYX A;  1N36 E;  2ADR A;  2D9H A;  2L3J A;  4DR5 E;  4I8O A;  4R2D A;  5LMN E;  1P47 A;  2L33 A;  2WBS A;  2EOO A;  4F9C B;  2IHR 1;  3P1X A;  2EMY A;  5KL5 A;  1STU A;  3MHH C;  2L6M A;  2N8X A;  2KON A;  1IBK E;  1IBM E;  2DGC A;  1EH6 A;  2NUG A;  1DGC A;  2EN7 A;  2GLI A;  4RHB B;  2EPN A;  2FGG A;  1NCS A;  2L8T A;  2L2K B;  3EPL A;  2LBS B;  5F3W A;  2WBT A;  2VQE E;  3EPJ A;  3VHT B;  1TN9 A;  1ZBT A;  2WCC 3;  2V87 A;  2BB8 A;  2MKN A;  5LL6 R;  2YT4 A;  1A1F A;  2I13 A;  1N32 E;  2E1M A;  3DJW A;  2R1F A;  4DR3 E;  1YUJ A;  2EMK A;  2G7H A;  1YYK A;  4KHP E;  2EM4 A;  4O4K A;  3HXL A;  2EQ3 A;  2DMY A;  2YTN A;  2ENC A;  1HNX E;  1X5W A;  2VF1 A;  2MKD A;  2EML A;  3ADJ A;  2ODR C;  2LUP B;  2LCE A;  1X47 A;  2EMW A;  3HQ1 A;  2RS7 A;  4F9A B;  2B7V A;  1I94 E;  5AE2 A;  2DLK A;  2M1S A;  5AC4 A;  2HC5 A;  4F54 A;  1AAY A;  1EH8 A;  2YRM A;  2E72 A;  2YSO A;  2A25 A;  5AC5 A;  5A69 A;  2LV2 A;  2VRD A;  2DMI A;  1BBO A;  5T6J A;  5IT9 C;  2EPL X;  2JPA A;  2HGH A;  4OX9 E;  1F2I G;  4NXM E;  3BGH A;  3LLH A;  2RQL A;  1XMQ E;  4LFC E;  1X49 A;  5AE3 A;  4LFB E;  4FK5 C;  4R2A A;  5BR8 E;  2UUB E;  4BHC A;  1FJG E;  2EOX A;  2DLQ A;  1TF6 A;  2M7Q A;  1KJK A;  2NA2 A;  2VE7 C;  4TUI A;  4DR4 E;  1MEY C;  3ECR A;  4KWY A;  2EOR A;  3LML A;  3UK3 C;  2N3H A;  2WZO A;  5DNY A;  4YY3 E;  2EZ6 A;  2B9D A;  4ZYG A;  1LLM C;  3FIG A;  1GZ6 A;  2MDR A;  4ZYE A;  3JTZ A;  4DUZ E;  2F8B A;  4Q28 A;  2UXC E;  2ELZ A;  2EM5 A;  4BC7 A;  1A1G A;  3EPK A;  4R2R A;  1FKA E;  4X64 E;  1ZBQ A;  2EPU A;  4WSP A;  1Z1B A;  2EL5 A;  2VQF E;  2LJH A;  4R2P A;  1WXR A;  2DIX A;  2KOU A;  4DUY E;  1YZ9 A;  2WBU A;  5A2Q C;  2EPO A;  2YWQ A;  4JI8 E;  2YU8 A;  4R2S A;  1WHN A;  4BBY A;  3IWB A;  2EQ1 A;  4M2Z A; 
#chains in the Genus database with same CATH homology
 1J5E E;  1DQ3 A;  1WHQ A;  3JAM C;  1RQ0 A;  1N33 E;  1N32 E;  2E1M A;  3F6H A;  3DJW A;  2K4V A;  4DMI A;  2RS6 A;  2V8Q B;  2B7T A;  3AUZ A;  4DR3 E;  3HPS A;  4JI2 E;  2JY9 A;  1YYK A;  2G7H A;  3VYY A;  4KHP E;  1GQE A;  3HXL A;  2DMY A;  2JOX A;  1YYO A;  4P78 A;  3ADG A;  4R8O A;  4JI7 E;  1HNX E;  2VF1 A;  3J7A G;  4LF9 E;  3ADJ A;  4BC9 A;  2ODR C;  4LF5 E;  2RSM A;  2LUP B;  4DV3 E;  1X47 A;  3J7Y p;  3HPZ A;  2RS7 A;  3HQ1 A;  3IWC A;  4P7D A;  2B7V A;  4F9A B;  4B3T E;  3HTX A;  4DR7 E;  3H09 A;  4BCA A;  1I94 E;  2KHX A;  5AE2 A;  1UHZ A;  2M1S A;  2V88 A;  4NXN E;  4F54 A;  1IBL E;  4TUG A;  2UU9 E;  2UXD E;  2UUA E;  3OTO E;  4WFT A;  2EWL A;  2L2M A;  4WYQ B;  3OML A;  1RC7 A;  1UIL A;  2F4V E;  4OOG C;  4M0V A;  4DV0 E;  4LFA E;  2M4I A;  4B3S E;  1QU6 A;  4YHH E;  2L92 A;  4LU9 A;  2LUQ A;  5T6J A;  3K6Q A;  2JOB A;  2JWO A;  5IT9 C;  2LTS A;  1T4N A;  3MSW A;  2V89 A;  4DV5 E;  1DI2 A;  2YZT A;  2MC5 A;  2MC6 A;  2DSY A;  3J81 C;  2V86 A;  4B3M E;  4DV7 E;  4X66 E;  4LF7 E;  4OX9 E;  4DR6 E;  4NXM E;  5AE1 A;  3LLH A;  4LTY A;  4WPY A;  1XMQ E;  4DV2 E;  1T4L B;  1X49 A;  4LFC E;  4LF8 E;  4DV6 E;  5AE3 A;  1YYW A;  2LTR A;  4LFB E;  4JV5 E;  3T1Y E;  2V85 A;  2FV4 B;  2FTX B;  3AV0 A;  5BR8 E;  2UUB E;  5AAS A;  5IWA E;  5LMU E;  1FJG E;  4LF6 E;  2NUE A;  1XNQ E;  4GKK E;  2M7Q A;  1HR0 E;  4K0K E;  2NA2 A;  2VE7 C;  4JI0 E;  2H36 X;  4TUI A;  3T1H E;  5FLX C;  4DR4 E;  2RTX A;  1T4O A;  2UUC E;  4KZS A;  4BMJ A;  1HNZ E;  3LML A;  3C4B A;  2ZM6 E;  4DV1 E;  2N3H A;  2WZO A;  4DKK A;  4X62 E;  1N34 E;  2LRS A;  1N36 E;  4JI4 E;  3VYX A;  2L3J A;  4DR5 E;  1X48 A;  2ODR D;  5DNY A;  5ADZ A;  4YY3 E;  4I8O A;  1SR9 A;  5LMN E;  2EZ6 A;  4X8W A;  2B9D A;  2L33 A;  4JI3 E;  2L2N A;  3FIG A;  2NUF A;  1GZ6 A;  2MDR A;  4F9C B;  2IHR 1;  3JTZ A;  4J8Z A;  4L8N A;  4F9B B;  2F8B A;  4Q28 A;  4DUZ E;  4JYA E;  3P1X A;  2HHH E;  2UXC E;  1O0W A;  1STU A;  4BC7 A;  4DR2 E;  4JI5 E;  4L5N C;  1FKA E;  2L6M A;  4X64 E;  1HNW E;  2KON A;  1ZBQ A;  3VK6 A;  4WSP A;  1IBK E;  1IBM E;  4LF4 E;  2VQF E;  3C4T A;  4DV4 E;  3JU0 A;  2NUG A;  1J26 A;  2E5L E;  2LJH A;  4R03 A;  3ADL A;  1WXR A;  2N3G A;  3DF6 A;  4JI1 E;  4BS9 A;  4M2Z A;  2DIX A;  2LE2 A;  3RMP A;  4GKJ E;  2KOU A;  2FGG A;  4JI6 E;  4X65 E;  2UXB E;  4AQY E;  2L8T A;  2V83 A;  3KWR A;  5CFF E;  4DUY E;  4DR1 E;  1XMO E;  1EKZ A;  1YZ9 A;  5A2Q C;  3ADI A;  2L2K B;  4JI8 E;  2LBS B;  5F3W A;  1XNR E;  2CPN A;  2L3C A;  4B3R E;  3J80 C;  3ZOQ B;  2VQE E;  1WHN A;  2LMZ A;  3F6G A;  2JR1 A;  4BBY A;  2JVA A;  2DB2 A;  1ZBT A;  4M30 A;  2V87 A;  5LL6 R;  3IWB A;  3IWD A;  2YT4 A;  4GEQ B;  2B3T B;  1PKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...