2RTXA

Solution structure of the ggq domain of yaej protein from escherichia coli
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKARRPTRSGPSSGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase YaeJ
publication title Identification of residues required for stalled-ribosome rescue in the codon-independent release factor YaeJ
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 121
sequence length 121
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rtxA00
2DIXA 4B3SE 1J5EE 4JI5E 1RQ0A 1ZBTA 4NXNE 3OTOE 2NA2A 1T4LB 2DB2A 2RTXA 4DV3E 3T1HE 4JV5E 4DR1E 1FJGE 2UUAE 3J7Yp 1UILA 1YYOA 1XNRE 2B7VA 2IHR1 4DV0E 4B3RE 4DV5E 4DV7E 1WHQA 2UUCE 2NUFA 1XNQE 1STUA 2RSMA 2DMYA 4DKKA 1HNZE 2JVAA 2N3HA 4X8WA 1N32E 4LF9E 3C4BA 4OOGC 4JI3E 4K0KE 4NXME 2B3TB 1QU6A 3ADIA 1YZ9A 2KHXA 4DV2E 1YYWA 2MDRA 2LJHA 2CPNA 1EKZA 1DI2A 1UHZA 5BR8E 4DR4E 2UXBE 1FKAE 3VYXA 2L2MA 2LUQA 2JY9A 1T4NA 1N36E 4M2ZA 5LMUE 1N34E 4X64E 4LF4E 4JYAE 2L33A 4GKKE 4DR5E 3ADLA 2N3GA 5CFFE 4YHHE 2L3JA 4DR2E 4B3TE 1HR0E 1X49A 2L3CA 1O0WA 1X47A 4JI7E 4X66E 2YT4A 5LMNE 1T4OA 1IBKE 1XMQE 3ADJA 4X65E 4LF5E 4X62E 4DR3E 2LTRA 2L2KB 2E5LE 2B7TA 4B3ME 2RS7A 3ADGA 3P1XA 1HNWE 1RC7A 4WFTA 3T1YE 1WHNA 3LLHA 2HHHE 2F4VE 1X48A 1YYKA 2NUEA 3HTXA 4DR6E 5IWAE 4JI8E 4M30A 2ZM6E 2VQFE 4LFAE 4JI4E 1IBME 4JI0E 4OX9E 2LBSB 1I94E 3C4TA 2EZ6A 1N33E 1PKPA 1GQEA 2LTSA 4LF7E 2UU9E 4LF8E 2RS6A 3VYYA 4DR7E 1IBLE 4AQYE 2LUPB 1HNXE 4DV4E 4GKJE 4KHPE 2VQEE 4DV1E 1J26A 2NUGA 4LFBE 1XMOE 4WYQB 4JI1E 4JI2E 2UXDE 4LF6E 2L2NA 4DUZE 2LRSA 4DUYE 2UXCE 4LFCE 4JI6E 4DV6E 2UUBE 4YY3E
chains in the Genus database with same CATH superfamily
1J5EE 4ZYGA 1ZBTA 1Z1BA 2EOEA 2M1SA 2EM3A 2EOQA 4O24A 1IQSA 2WBSA 2DB2A 4DV3E 2MKDA 4JV5E 1PJTA 1ZU1A 1BB8A 2B7VA 2IHR1 1DQ3A 2VRDA 4O43A 1WXRA 1UBDC 4BHBA 2RSMA 4X8WA 1WJPA 3J80C 1N32E 1ZR9A 3C4BA 2EOYA 3ADIA 1F2IG 2EPZA 2LVHA 2R1FA 4NZVA 2EMAA 3THNA 2MDRA 1T39A 3HXLA 2ENAA 2EJ4A 2VF1A 5LL6R 4F6NA 5BR8E 2BB8A 4LTYA 3VYXA 4RH8A 2YTDA 1GZ6A 4R2AA 5AE1A 3J7AG 2YTIA 4FK5C 1A1LA 4LF4E 1NCSA 1SR9A 2L33A 5TSEA 4JYAE 2HJJA 4DR5E 2ENCA 2EMZA 2HGHA 5CFFE 2L3JA 2EOZA 2LCEA 1HR0E 1X49A 2L3CA 5KL4A 1X47A 4O4KA 3EPKA 2F8BA 4X66E 2MDGA 1YSAC 4I8OA 2KONA 1YFHA 1XMQE 3ADJA 2ELYA 2LTRA 3BGHA 4HTGA 2MC5A 2HC5A 2EN4A 2EN3A 2V87A 2RS7A 3ADGA 3P1XA 3ZOQB 3T1YE 1WHNA 1YYKA 3HTXA 2EN6A 2EMCA 2EPNA 3BIDA 2FTXB 4Q28A 2VQFE 2RSIA 2EOMA 4LFAE 1GQEA 1ZBQA 1HNXE 4RHBB 4BC9A 2Q8UA 3F6HA 3IWDA 1J26A 1PJQA 1XMOE 4J8ZA 4WYQB 2EMYA 2UXDE 4LF6E 2L2NA 3VK6A 4BBYA 2D9HA 4DUYE 2UXCE 4DV6E 2YTJA 3OMLA 4KZSA 4MLVA 1QNTA 4B3SE 4NXNE 2NA2A 1X6FA 2NABA 2FGGA 2RTXA 2DMIA 2DGCA 2LJUA 3JU0A 1FJGE 2EPKX 1UILA 4X9JA 2YTOA 1G2DC 4NHRA 3C6MA 4R2PA 2EPCA 2YTNA 4R2DA 4B3RE 4DV5E 4F9BB 5A2QC 4DV7E 5AE3A 1XNQE 2NUFA 4F9AB 2M9AA 2JVAA 2M4IA 2RPCA 2GPIA 4OOGC 1BBGA 2EQ3A 4DV2E 2YSOA 1YYWA 2CTDA 1B69A 2FV4B 4M9VC 1AH5A 2K7IA 4L5NC 2EP3A 2I13A 2MC6A 1A1GA 1DI2A 1UHZA 2EPRA 2K4VA 2JYAA 1FKAE 4N4RB 1T4NA 1N36E 1RMDA 4M2ZA 2LT7A 5KL5A 5KL7A 4MLQA 1A1FA 1IMUA 2WCC3 1A1JA 2YPNA 2WBTA 2YU5A 1KYQA 2N3GA 4YHHE 5A6KA 5AC4A 1MGTA 2YRKA 2ENHA 2JR1A 2YT4A 1IBKE 5F3WA 1TF6A 5ADZA 2YTQA 4DR3E 4IS1C 2EE8A 2EM6A 2E5LE 2JPAA 4B3ME 2ELZA 5T6JA 3EPLA 1RC7A 3LLHA 5A6BA 4DR6E 4DMIA 2LBSB 2YSPA 5AC5A 2EZ6A 1PKPA 4BMJA 2M7QA 2RS6A 3JAMC 2EORA 2YRHA 1IBLE 2YTPA 2LUPB 1AAYA 2YTGA 4KHPE 1G2FC 4BS9A 2CSHA 3DF6A 4DV1E 4KWYA 4F54A 4R03A 2EMFA 2EN2A 4JI2E 2EMBA 2EN1A 3EQ1A 4R2SA 4JI6E 5KL3A 2EOXA 2GLIA 4LU9A 4YY3E 4R2RA 1X3CA 4JI5E 3MHHC 1EH8A 5KL6A 1T4LB 3T1HE 1LLMC 2UUAE 2JOBA 3UK3C 2L8TA 1N3GA 4M0VA 3K6QA 2VE7C 3RMPA 1WHQA 2LO3A 1STUA 2EMGA 2DMYA 2N3HA 2YZTA 4LF9E 2EPMX 4BCAA 2A25A 1SFEA 2EPUA 2EMXA 4NXME 1QU6A 5LLQA 1YZ9A 3F6GA 1A1KA 4Q35B 2EMIA 1YUIA 3IWCA 2LJHA 2CPNA 1GTKA 2EOFA 3THOB 2EOIA 1EKZA 1ZAAC 2ADRA 4ZYHA 4DR4E 1KJKA 2YTFA 2JY9A 2E72A 1P47A 2L92A 4BC7A 2EPLX 1A1HA 3DJWA 5IXMB 4TUGA 2MKNA 1YUJA 2EMWA 2JXPA 4GKKE 4WSGA 4L8NA 4P7DA 3HPSA 2EOSA 4DR2E 2DRPA 3C6KA 2PRTA 2WZOA 4JI7E 4WX9A 2LE2A 2V88A 1A1IA 2JOXA 4ZYDA 1YPNA 2LV2A 3AUZA 2L6MA 4R2QA 4GEQB 5FLXC 2EOHA 2JWOA 4WFTA 2F4VE 2EM9A 4HEIA 1X48A 2EOOA 5IWAE 2EM2A 4JI8E 3LMLA 2ZM6E 4BHCA 1JK1A 4OX9E 4JI4E 4JI0E 3C4TA 1PDAA 2WBUA 4P78A 3BBGA 1JK2A 4LF7E 5AE2A 4DR7E 4AQYE 2V8QB 4DV4E 1TN9A 4GKJE 3ECRA 2EMHA 3JTZA 4F2JC 2NUGA 2R76A 4LFBE 3FIGA 3J81C 2LRSA 2V86A 2EM7A 3EPHA 2EN8A 2EOJA 2GHFA 2UUBE 1TF3A 2DIXA 1EH6A 1RQ0A 4R2CA 3OTOE 2KOUA 3HPZA 2ODRD 4F9CB 5A69A 2EPOA 4DR1E 1WRJA 3J7Yp 1YYOA 1XNRE 2EQ0A 4DV0E 1UN6B 1BBOA 1MEYC 2UUCE 2V89A 2EL5A 2E1MA 4O5GA 2J7JA 4DKKA 5AASA 1HNZE 2DLKA 2B9DA 3KWRA 3HQ1A 1PJSA 4JI3E 3L00A 4K0KE 2EQ1A 2B3TB 2EL4A 2KHXA 3IWBA 2EMKA 2I9IA 5IV8B 2YRMA 2DLQA 5IT9C 2UXBE 1NEIA 2L2MA 2LUQA 2EN7A 4WSPA 4WXDA 4F6MA 2EMLA 2EM8A 3BF2A 4WPYA 2BBGA 2YTEA 5LMUE 4WXCA 1N34E 4X64E 5DNYA 3MHSC 1T38A 3ADLA 1IQOA 4B3TE 1X5WA 3M99B 2JP9A 4GZNC 2ODRC 5A6JA 1O0WA 3EPJA 3QG5C 4TUIA 4ZYEA 1T4OA 5LMNE 1L4SA 2YWQA 2G7HA 4X65E 3AV0A 4LF5E 4X62E 2EPAA 2L2KB 2B7TA 2EPPA 2LMZA 1HNWE 2HHHE 5A6BD 2V83A 2NUEA 1DGCA 3TQMA 1EH7A 3KZZA 4R2EA 2EM0A 2RQLA 2V85A 4M30A 4IJDA 1IBME 1I94E 1N33E 2CT1A 2LTSA 2UU9E 4LF8E 3VYYA 5A6AA 1X6HA 2YU8A 2N8XA 3KZYA 3MSWA 2VQEE 1X6EA 2EPXA 2EL6A 4R8OA 2EWLA 3H09A 4JI1E 5KL2A 4DUZE 3VHTB 4LFCE 2H36X 2EM5A 2EM4A 2DSYA
chains in the Genus database with same CATH topology
2DIXA 4B3SE 1J5EE 4JI5E 1RQ0A 1ZBTA 4NXNE 3OTOE 2M1SA 2NA2A 2FGGA 2KOUA 1T4LB 2DB2A 2RTXA 4DV3E 3HPZA 3T1HE 2ODRD 4F9CB 4JV5E 3JU0A 4DR1E 1FJGE 2UUAE 2JOBA 1UILA 3J7Yp 1YYOA 1XNRE 2B7VA 2IHR1 2L8TA 4M0VA 3K6QA 1DQ3A 4DV0E 4B3RE 2VE7C 4DV5E 3RMPA 4F9BB 5A2QC 4DV7E 1WXRA 1WHQA 5AE3A 2NUFA 2V89A 2UUCE 1XNQE 1STUA 2RSMA 2DMYA 2E1MA 4DKKA 2JVAA 2N3HA 2YZTA 4X8WA 4F9AB 5AASA 3J80C 2B9DA 3KWRA 2M4IA 4LF9E 1N32E 3HQ1A 4BCAA 1HNZE 3C4BA 4OOGC 4JI3E 4K0KE 4NXME 2B3TB 1QU6A 3ADIA 1YZ9A 2KHXA 3F6GA 4DV2E 3IWBA 1YYWA 2FV4B 2MDRA 3HXLA 3IWCA 2LJHA 2CPNA 4L5NC 2MC6A 1EKZA 2VF1A 5LL6R 1DI2A 1UHZA 2K4VA 5BR8E 5IT9C 4DR4E 2UXBE 1FKAE 4LTYA 3VYXA 2L2MA 2LUQA 2JY9A 1T4NA 4WSPA 1N36E 2L92A 4M2ZA 1GZ6A 3J7AG 4BC7A 5AE1A 4WPYA 3DJWA 5LMUE 4TUGA 1N34E 4X64E 5DNYA 4LF4E 1SR9A 2L33A 4JYAE 4GKKE 4DR5E 4L8NA 3ADLA 4P7DA 2N3GA 3HPSA 5CFFE 4YHHE 2L3JA 4DR2E 4B3TE 2WZOA 1X49A 2ODRC 2L3CA 1HR0E 1O0WA 1X47A 4JI7E 2F8BA 2LE2A 2V88A 2JR1A 4X66E 4TUIA 2YT4A 5LMNE 1T4OA 5F3WA 1IBKE 2JOXA 5ADZA 4I8OA 2KONA 2G7HA 3ADJA 3AV0A 4X65E 4X62E 4DR3E 1XMQE 4LF5E 3AUZA 2L6MA 2LTRA 2L2KB 2E5LE 2B7TA 2MC5A 4GEQB 5FLXC 4B3ME 2LMZA 2RS7A 2V87A 3ADGA 3P1XA 3ZOQB 5T6JA 1HNWE 2JWOA 4WFTA 3T1YE 1WHNA 3LLHA 2V83A 1RC7A 2HHHE 2F4VE 1X48A 1YYKA 2NUEA 3HTXA 4DR6E 5IWAE 4JI8E 4DMIA 3LMLA 4M30A 2ZM6E 2V85A 2FTXB 4Q28A 2VQFE 4LFAE 4JI4E 1IBME 4JI0E 4OX9E 2LBSB 1I94E 3C4TA 2EZ6A 1N33E 1PKPA 1GQEA 2LTSA 4P78A 2M7QA 4BMJA 2RS6A 2UU9E 5AE2A 1ZBQA 3VYYA 4LF7E 4LF8E 3JAMC 4DR7E 1IBLE 4AQYE 2LUPB 1HNXE 2V8QB 4DV4E 4BC9A 3MSWA 4GKJE 4KHPE 2VQEE 4BS9A 3DF6A 4DV1E 3JTZA 3F6HA 3IWDA 4R8OA 4F54A 4R03A 2NUGA 1J26A 4LFBE 2EWLA 3FIGA 3H09A 1XMOE 4J8ZA 4WYQB 4JI1E 4JI2E 2UXDE 3J81C 4LF6E 2L2NA 4DUZE 2LRSA 3VK6A 4BBYA 4DUYE 2V86A 4LFCE 4JI6E 2H36X 4DV6E 3OMLA 2UXCE 4KZSA 2UUBE 2DSYA 4LU9A 4YY3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIX A;  4B3S E;  1J5E E;  4JI5 E;  1RQ0 A;  1ZBT A;  4NXN E;  3OTO E;  2NA2 A;  1T4L B;  2DB2 A;  2RTX A;  4DV3 E;  3T1H E;  4JV5 E;  4DR1 E;  1FJG E;  2UUA E;  3J7Y p;  1UIL A;  1YYO A;  1XNR E;  2B7V A;  2IHR 1;  4DV0 E;  4B3R E;  4DV5 E;  4DV7 E;  1WHQ A;  2UUC E;  2NUF A;  1XNQ E;  1STU A;  2RSM A;  2DMY A;  4DKK A;  1HNZ E;  2JVA A;  2N3H A;  4X8W A;  1N32 E;  4LF9 E;  3C4B A;  4OOG C;  4JI3 E;  4K0K E;  4NXM E;  2B3T B;  1QU6 A;  3ADI A;  1YZ9 A;  2KHX A;  4DV2 E;  1YYW A;  2MDR A;  2LJH A;  2CPN A;  1EKZ A;  1DI2 A;  1UHZ A;  5BR8 E;  4DR4 E;  2UXB E;  1FKA E;  3VYX A;  2L2M A;  2LUQ A;  2JY9 A;  1T4N A;  1N36 E;  4M2Z A;  5LMU E;  1N34 E;  4X64 E;  4LF4 E;  4JYA E;  2L33 A;  4GKK E;  4DR5 E;  3ADL A;  2N3G A;  5CFF E;  4YHH E;  2L3J A;  4DR2 E;  4B3T E;  1HR0 E;  1X49 A;  2L3C A;  1O0W A;  1X47 A;  4JI7 E;  4X66 E;  2YT4 A;  5LMN E;  1T4O A;  1IBK E;  1XMQ E;  3ADJ A;  4X65 E;  4LF5 E;  4X62 E;  4DR3 E;  2LTR A;  2L2K B;  2E5L E;  2B7T A;  4B3M E;  2RS7 A;  3ADG A;  3P1X A;  1HNW E;  1RC7 A;  4WFT A;  3T1Y E;  1WHN A;  3LLH A;  2HHH E;  2F4V E;  1X48 A;  1YYK A;  2NUE A;  3HTX A;  4DR6 E;  5IWA E;  4JI8 E;  4M30 A;  2ZM6 E;  2VQF E;  4LFA E;  4JI4 E;  1IBM E;  4JI0 E;  4OX9 E;  2LBS B;  1I94 E;  3C4T A;  2EZ6 A;  1N33 E;  1PKP A;  1GQE A;  2LTS A;  4LF7 E;  2UU9 E;  4LF8 E;  2RS6 A;  3VYY A;  4DR7 E;  1IBL E;  4AQY E;  2LUP B;  1HNX E;  4DV4 E;  4GKJ E;  4KHP E;  2VQE E;  4DV1 E;  1J26 A;  2NUG A;  4LFB E;  1XMO E;  4WYQ B;  4JI1 E;  4JI2 E;  2UXD E;  4LF6 E;  2L2N A;  4DUZ E;  2LRS A;  4DUY E;  2UXC E;  4LFC E;  4JI6 E;  4DV6 E;  2UUB E;  4YY3 E; 
#chains in the Genus database with same CATH topology
 1J5E E;  4ZYG A;  1ZBT A;  1Z1B A;  2EOE A;  2M1S A;  2EM3 A;  2EOQ A;  4O24 A;  1IQS A;  2WBS A;  2DB2 A;  4DV3 E;  2MKD A;  4JV5 E;  1PJT A;  1ZU1 A;  1BB8 A;  2B7V A;  2IHR 1;  1DQ3 A;  2VRD A;  4O43 A;  1WXR A;  1UBD C;  4BHB A;  2RSM A;  4X8W A;  1WJP A;  3J80 C;  1N32 E;  1ZR9 A;  3C4B A;  2EOY A;  3ADI A;  1F2I G;  2EPZ A;  2LVH A;  2R1F A;  4NZV A;  2EMA A;  3THN A;  2MDR A;  1T39 A;  3HXL A;  2ENA A;  2EJ4 A;  2VF1 A;  5LL6 R;  4F6N A;  5BR8 E;  2BB8 A;  4LTY A;  3VYX A;  4RH8 A;  2YTD A;  1GZ6 A;  4R2A A;  5AE1 A;  3J7A G;  2YTI A;  4FK5 C;  1A1L A;  4LF4 E;  1NCS A;  1SR9 A;  2L33 A;  5TSE A;  4JYA E;  2HJJ A;  4DR5 E;  2ENC A;  2EMZ A;  2HGH A;  5CFF E;  2L3J A;  2EOZ A;  2LCE A;  1HR0 E;  1X49 A;  2L3C A;  5KL4 A;  1X47 A;  4O4K A;  3EPK A;  2F8B A;  4X66 E;  2MDG A;  1YSA C;  4I8O A;  2KON A;  1YFH A;  1XMQ E;  3ADJ A;  2ELY A;  2LTR A;  3BGH A;  4HTG A;  2MC5 A;  2HC5 A;  2EN4 A;  2EN3 A;  2V87 A;  2RS7 A;  3ADG A;  3P1X A;  3ZOQ B;  3T1Y E;  1WHN A;  1YYK A;  3HTX A;  2EN6 A;  2EMC A;  2EPN A;  3BID A;  2FTX B;  4Q28 A;  2VQF E;  2RSI A;  2EOM A;  4LFA E;  1GQE A;  1ZBQ A;  1HNX E;  4RHB B;  4BC9 A;  2Q8U A;  3F6H A;  3IWD A;  1J26 A;  1PJQ A;  1XMO E;  4J8Z A;  4WYQ B;  2EMY A;  2UXD E;  4LF6 E;  2L2N A;  3VK6 A;  4BBY A;  2D9H A;  4DUY E;  2UXC E;  4DV6 E;  2YTJ A;  3OML A;  4KZS A;  4MLV A;  1QNT A;  4B3S E;  4NXN E;  2NA2 A;  1X6F A;  2NAB A;  2FGG A;  2RTX A;  2DMI A;  2DGC A;  2LJU A;  3JU0 A;  1FJG E;  2EPK X;  1UIL A;  4X9J A;  2YTO A;  1G2D C;  4NHR A;  3C6M A;  4R2P A;  2EPC A;  2YTN A;  4R2D A;  4B3R E;  4DV5 E;  4F9B B;  5A2Q C;  4DV7 E;  5AE3 A;  1XNQ E;  2NUF A;  4F9A B;  2M9A A;  2JVA A;  2M4I A;  2RPC A;  2GPI A;  4OOG C;  1BBG A;  2EQ3 A;  4DV2 E;  2YSO A;  1YYW A;  2CTD A;  1B69 A;  2FV4 B;  4M9V C;  1AH5 A;  2K7I A;  4L5N C;  2EP3 A;  2I13 A;  2MC6 A;  1A1G A;  1DI2 A;  1UHZ A;  2EPR A;  2K4V A;  2JYA A;  1FKA E;  4N4R B;  1T4N A;  1N36 E;  1RMD A;  4M2Z A;  2LT7 A;  5KL5 A;  5KL7 A;  4MLQ A;  1A1F A;  1IMU A;  2WCC 3;  1A1J A;  2YPN A;  2WBT A;  2YU5 A;  1KYQ A;  2N3G A;  4YHH E;  5A6K A;  5AC4 A;  1MGT A;  2YRK A;  2ENH A;  2JR1 A;  2YT4 A;  1IBK E;  5F3W A;  1TF6 A;  5ADZ A;  2YTQ A;  4DR3 E;  4IS1 C;  2EE8 A;  2EM6 A;  2E5L E;  2JPA A;  4B3M E;  2ELZ A;  5T6J A;  3EPL A;  1RC7 A;  3LLH A;  5A6B A;  4DR6 E;  4DMI A;  2LBS B;  2YSP A;  5AC5 A;  2EZ6 A;  1PKP A;  4BMJ A;  2M7Q A;  2RS6 A;  3JAM C;  2EOR A;  2YRH A;  1IBL E;  2YTP A;  2LUP B;  1AAY A;  2YTG A;  4KHP E;  1G2F C;  4BS9 A;  2CSH A;  3DF6 A;  4DV1 E;  4KWY A;  4F54 A;  4R03 A;  2EMF A;  2EN2 A;  4JI2 E;  2EMB A;  2EN1 A;  3EQ1 A;  4R2S A;  4JI6 E;  5KL3 A;  2EOX A;  2GLI A;  4LU9 A;  4YY3 E;  4R2R A;  1X3C A;  4JI5 E;  3MHH C;  1EH8 A;  5KL6 A;  1T4L B;  3T1H E;  1LLM C;  2UUA E;  2JOB A;  3UK3 C;  2L8T A;  1N3G A;  4M0V A;  3K6Q A;  2VE7 C;  3RMP A;  1WHQ A;  2LO3 A;  1STU A;  2EMG A;  2DMY A;  2N3H A;  2YZT A;  4LF9 E;  2EPM X;  4BCA A;  2A25 A;  1SFE A;  2EPU A;  2EMX A;  4NXM E;  1QU6 A;  5LLQ A;  1YZ9 A;  3F6G A;  1A1K A;  4Q35 B;  2EMI A;  1YUI A;  3IWC A;  2LJH A;  2CPN A;  1GTK A;  2EOF A;  3THO B;  2EOI A;  1EKZ A;  1ZAA C;  2ADR A;  4ZYH A;  4DR4 E;  1KJK A;  2YTF A;  2JY9 A;  2E72 A;  1P47 A;  2L92 A;  4BC7 A;  2EPL X;  1A1H A;  3DJW A;  5IXM B;  4TUG A;  2MKN A;  1YUJ A;  2EMW A;  2JXP A;  4GKK E;  4WSG A;  4L8N A;  4P7D A;  3HPS A;  2EOS A;  4DR2 E;  2DRP A;  3C6K A;  2PRT A;  2WZO A;  4JI7 E;  4WX9 A;  2LE2 A;  2V88 A;  1A1I A;  2JOX A;  4ZYD A;  1YPN A;  2LV2 A;  3AUZ A;  2L6M A;  4R2Q A;  4GEQ B;  5FLX C;  2EOH A;  2JWO A;  4WFT A;  2F4V E;  2EM9 A;  4HEI A;  1X48 A;  2EOO A;  5IWA E;  2EM2 A;  4JI8 E;  3LML A;  2ZM6 E;  4BHC A;  1JK1 A;  4OX9 E;  4JI4 E;  4JI0 E;  3C4T A;  1PDA A;  2WBU A;  4P78 A;  3BBG A;  1JK2 A;  4LF7 E;  5AE2 A;  4DR7 E;  4AQY E;  2V8Q B;  4DV4 E;  1TN9 A;  4GKJ E;  3ECR A;  2EMH A;  3JTZ A;  4F2J C;  2NUG A;  2R76 A;  4LFB E;  3FIG A;  3J81 C;  2LRS A;  2V86 A;  2EM7 A;  3EPH A;  2EN8 A;  2EOJ A;  2GHF A;  2UUB E;  1TF3 A;  2DIX A;  1EH6 A;  1RQ0 A;  4R2C A;  3OTO E;  2KOU A;  3HPZ A;  2ODR D;  4F9C B;  5A69 A;  2EPO A;  4DR1 E;  1WRJ A;  3J7Y p;  1YYO A;  1XNR E;  2EQ0 A;  4DV0 E;  1UN6 B;  1BBO A;  1MEY C;  2UUC E;  2V89 A;  2EL5 A;  2E1M A;  4O5G A;  2J7J A;  4DKK A;  5AAS A;  1HNZ E;  2DLK A;  2B9D A;  3KWR A;  3HQ1 A;  1PJS A;  4JI3 E;  3L00 A;  4K0K E;  2EQ1 A;  2B3T B;  2EL4 A;  2KHX A;  3IWB A;  2EMK A;  2I9I A;  5IV8 B;  2YRM A;  2DLQ A;  5IT9 C;  2UXB E;  1NEI A;  2L2M A;  2LUQ A;  2EN7 A;  4WSP A;  4WXD A;  4F6M A;  2EML A;  2EM8 A;  3BF2 A;  4WPY A;  2BBG A;  2YTE A;  5LMU E;  4WXC A;  1N34 E;  4X64 E;  5DNY A;  3MHS C;  1T38 A;  3ADL A;  1IQO A;  4B3T E;  1X5W A;  3M99 B;  2JP9 A;  4GZN C;  2ODR C;  5A6J A;  1O0W A;  3EPJ A;  3QG5 C;  4TUI A;  4ZYE A;  1T4O A;  5LMN E;  1L4S A;  2YWQ A;  2G7H A;  4X65 E;  3AV0 A;  4LF5 E;  4X62 E;  2EPA A;  2L2K B;  2B7T A;  2EPP A;  2LMZ A;  1HNW E;  2HHH E;  5A6B D;  2V83 A;  2NUE A;  1DGC A;  3TQM A;  1EH7 A;  3KZZ A;  4R2E A;  2EM0 A;  2RQL A;  2V85 A;  4M30 A;  4IJD A;  1IBM E;  1I94 E;  1N33 E;  2CT1 A;  2LTS A;  2UU9 E;  4LF8 E;  3VYY A;  5A6A A;  1X6H A;  2YU8 A;  2N8X A;  3KZY A;  3MSW A;  2VQE E;  1X6E A;  2EPX A;  2EL6 A;  4R8O A;  2EWL A;  3H09 A;  4JI1 E;  5KL2 A;  4DUZ E;  3VHT B;  4LFC E;  2H36 X;  2EM5 A;  2EM4 A;  2DSY A; 
#chains in the Genus database with same CATH homology
 2DIX A;  4B3S E;  1J5E E;  4JI5 E;  1RQ0 A;  1ZBT A;  4NXN E;  3OTO E;  2M1S A;  2NA2 A;  2FGG A;  2KOU A;  1T4L B;  2DB2 A;  2RTX A;  4DV3 E;  3HPZ A;  3T1H E;  2ODR D;  4F9C B;  4JV5 E;  3JU0 A;  4DR1 E;  1FJG E;  2UUA E;  2JOB A;  1UIL A;  3J7Y p;  1YYO A;  1XNR E;  2B7V A;  2IHR 1;  2L8T A;  4M0V A;  3K6Q A;  1DQ3 A;  4DV0 E;  4B3R E;  2VE7 C;  4DV5 E;  3RMP A;  4F9B B;  5A2Q C;  4DV7 E;  1WXR A;  1WHQ A;  5AE3 A;  2NUF A;  2V89 A;  2UUC E;  1XNQ E;  1STU A;  2RSM A;  2DMY A;  2E1M A;  4DKK A;  2JVA A;  2N3H A;  2YZT A;  4X8W A;  4F9A B;  5AAS A;  3J80 C;  2B9D A;  3KWR A;  2M4I A;  4LF9 E;  1N32 E;  3HQ1 A;  4BCA A;  1HNZ E;  3C4B A;  4OOG C;  4JI3 E;  4K0K E;  4NXM E;  2B3T B;  1QU6 A;  3ADI A;  1YZ9 A;  2KHX A;  3F6G A;  4DV2 E;  3IWB A;  1YYW A;  2FV4 B;  2MDR A;  3HXL A;  3IWC A;  2LJH A;  2CPN A;  4L5N C;  2MC6 A;  1EKZ A;  2VF1 A;  5LL6 R;  1DI2 A;  1UHZ A;  2K4V A;  5BR8 E;  5IT9 C;  4DR4 E;  2UXB E;  1FKA E;  4LTY A;  3VYX A;  2L2M A;  2LUQ A;  2JY9 A;  1T4N A;  4WSP A;  1N36 E;  2L92 A;  4M2Z A;  1GZ6 A;  3J7A G;  4BC7 A;  5AE1 A;  4WPY A;  3DJW A;  5LMU E;  4TUG A;  1N34 E;  4X64 E;  5DNY A;  4LF4 E;  1SR9 A;  2L33 A;  4JYA E;  4GKK E;  4DR5 E;  4L8N A;  3ADL A;  4P7D A;  2N3G A;  3HPS A;  5CFF E;  4YHH E;  2L3J A;  4DR2 E;  4B3T E;  2WZO A;  1X49 A;  2ODR C;  2L3C A;  1HR0 E;  1O0W A;  1X47 A;  4JI7 E;  2F8B A;  2LE2 A;  2V88 A;  2JR1 A;  4X66 E;  4TUI A;  2YT4 A;  5LMN E;  1T4O A;  5F3W A;  1IBK E;  2JOX A;  5ADZ A;  4I8O A;  2KON A;  2G7H A;  3ADJ A;  3AV0 A;  4X65 E;  4X62 E;  4DR3 E;  1XMQ E;  4LF5 E;  3AUZ A;  2L6M A;  2LTR A;  2L2K B;  2E5L E;  2B7T A;  2MC5 A;  4GEQ B;  5FLX C;  4B3M E;  2LMZ A;  2RS7 A;  2V87 A;  3ADG A;  3P1X A;  3ZOQ B;  5T6J A;  1HNW E;  2JWO A;  4WFT A;  3T1Y E;  1WHN A;  3LLH A;  2V83 A;  1RC7 A;  2HHH E;  2F4V E;  1X48 A;  1YYK A;  2NUE A;  3HTX A;  4DR6 E;  5IWA E;  4JI8 E;  4DMI A;  3LML A;  4M30 A;  2ZM6 E;  2V85 A;  2FTX B;  4Q28 A;  2VQF E;  4LFA E;  4JI4 E;  1IBM E;  4JI0 E;  4OX9 E;  2LBS B;  1I94 E;  3C4T A;  2EZ6 A;  1N33 E;  1PKP A;  1GQE A;  2LTS A;  4P78 A;  2M7Q A;  4BMJ A;  2RS6 A;  2UU9 E;  5AE2 A;  1ZBQ A;  3VYY A;  4LF7 E;  4LF8 E;  3JAM C;  4DR7 E;  1IBL E;  4AQY E;  2LUP B;  1HNX E;  2V8Q B;  4DV4 E;  4BC9 A;  3MSW A;  4GKJ E;  4KHP E;  2VQE E;  4BS9 A;  3DF6 A;  4DV1 E;  3JTZ A;  3F6H A;  3IWD A;  4R8O A;  4F54 A;  4R03 A;  2NUG A;  1J26 A;  4LFB E;  2EWL A;  3FIG A;  3H09 A;  1XMO E;  4J8Z A;  4WYQ B;  4JI1 E;  4JI2 E;  2UXD E;  3J81 C;  4LF6 E;  2L2N A;  4DUZ E;  2LRS A;  3VK6 A;  4BBY A;  4DUY E;  2V86 A;  4LFC E;  4JI6 E;  2H36 X;  4DV6 E;  3OML A;  2UXC E;  4KZS A;  2UUB E;  2DSY A;  4LU9 A;  4YY3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...