2RTXA

Solution structure of the ggq domain of yaej protein from escherichia coli
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKARRPTRSGPSSGENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase YaeJ
publication title Identification of residues required for stalled-ribosome rescue in the codon-independent release factor YaeJ
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 20
structure length 121
sequence length 121
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2013-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2rtxA00
1X48A 2RS7A 1WHQA 2NUFA 4X66E 2UUCE 1IBME 4X8WA 4KHPE 1ZBTA 4JI8E 1RQ0A 4DV0E 2RSMA 5IWAE 2LRSA 4X65E 4JYAE 4NXME 1PKPA 2L2MA 2JY9A 2UUAE 3ADJA 4M2ZA 1EKZA 1YZ9A 2DIXA 4DUYE 4LFAE 2LUQA 1HNWE 3OTOE 4JI7E 4YHHE 4JI2E 1UHZA 4DR2E 1T4NA 5LMUE 2HHHE 1DI2A 2YT4A 3J7Yp 4DV7E 3T1YE 2B7VA 1N32E 2IHR1 1FKAE 2UXBE 3ADLA 3ADGA 4DV4E 4B3TE 4JI6E 1WHNA 1XNQE 2JVAA 4JI1E 2RS6A 2RTXA 4DR4E 5CFFE 3C4BA 4LF6E 4DR1E 2L33A 1HR0E 4DR6E 4GKJE 3P1XA 1J26A 4JI0E 4DKKA 4WFTA 2LTRA 4K0KE 1O0WA 1YYOA 4DV2E 1YYKA 1T4LB 4B3RE 1X49A 4DV5E 2ZM6E 1YYWA 1I94E 3T1HE 4LFBE 2L3JA 2NUEA 2LUPB 1STUA 1N36E 2LTSA 4LF5E 1FJGE 2B7TA 3VYYA 4LF4E 2DMYA 4DUZE 2UU9E 2L3CA 2N3GA 4JI4E 2F4VE 3ADIA 1XNRE 4WYQB 2VQEE 2LJHA 2L2KB 4LFCE 5BR8E 1IBLE 4B3ME 2NA2A 3C4TA 4DV3E 1QU6A 4DV1E 4OX9E 2N3HA 1N34E 1GQEA 4JI5E 1N33E 4X62E 1XMOE 2EZ6A 3VYXA 4OOGC 4DR5E 2DB2A 2MDRA 2NUGA 1HNXE 2B3TB 1HNZE 1RC7A 1T4OA 2L2NA 1J5EE 4LF8E 4AQYE 2VQFE 2CPNA 4DR3E 2UUBE 4JI3E 2UXCE 4DV6E 4LF7E 5LMNE 2UXDE 3LLHA 2KHXA 1IBKE 4JV5E 1UILA 4X64E 4LF9E 1X47A 2LBSB 4DR7E 4B3SE 3HTXA 4GKKE 1XMQE 2E5LE 4YY3E 4M30A 4NXNE
chains in the Genus database with same CATH superfamily
2VF1A 4X8WA 4TUGA 4DV0E 2K7IA 4NXME 5FLXC 2JY9A 2DMIA 2ADRA 3THOB 2DIXA 4DUYE 5ADZA 3FIGA 1BBOA 4WXDA 1PJTA 1UHZA 1UN6B 1ZU1A 3HPZA 5LMUE 1DI2A 2VE7C 4DV7E 3F6HA 1FKAE 2UXBE 2V86A 3ADGA 3JU0A 4DV4E 2MDGA 1XNQE 3JAMC 2EJ4A 2EM2A 2RQLA 2DGCA 3K6QA 2EPOA 5CFFE 2YTNA 1HR0E 2EOYA 2HGHA 2LV2A 3ECRA 2LTRA 1UBDC 4F9CB 4J8ZA 4WXCA 1X49A 3KWRA 4R2QA 4IJDA 3LMLA 2YTIA 2EQ0A 3HQ1A 3J81C 2LUPB 1STUA 2BBGA 2EE8A 1N36E 2YU8A 4LF5E 1EH8A 5AC5A 3VYYA 2PRTA 4DUZE 1QNTA 2E1MA 5LL6R 2RPCA 4JI4E 1AAYA 2F4VE 3BBGA 3EPJA 4O5GA 2EMKA 1EH7A 3L00A 1A1IA 1L4SA 2YSOA 2LCEA 2EPKX 2NA2A 3C4TA 4DV3E 2LE2A 2EPXA 3IWDA 4GEQB 1N34E 4R2EA 1XMOE 2EZ6A 2FV4B 4L5NC 4OOGC 3OMLA 2EMCA 1HNXE 1F2IG 1RC7A 1X6HA 2EMYA 2L92A 4AQYE 2EMAA 1WXRA 2MKNA 2UXCE 3H09A 2EPAA 1MGTA 4R2SA 2EMWA 2L8TA 4LF7E 5LMNE 2EPRA 3LLHA 2EPNA 3EPLA 2EM7A 2M1SA 2YSPA 2M7QA 1X47A 1JK2A 2ELYA 1IMUA 2E5LE 4M30A 4MLQA 1AH5A 2CSHA 3VK6A 5A6JA 1X3CA 2KOUA 2RS7A 1DGCA 2YTOA 4X66E 2UUCE 4JI8E 1RQ0A 2WZOA 2RSMA 1IQSA 2M4IA 2R1FA 1PJSA 2EOFA 3BGHA 2UUAE 1TF3A 2K4VA 2V85A 2YTPA 5AE2A 2R76A 3ZOQB 4BC9A 4JI2E 1NEIA 1KJKA 2HHHE 3T1YE 5AC4A 2YZTA 3ADLA 2V88A 1X6FA 2WCC3 2EWLA 1LLMC 2EORA 3IWCA 4DR4E 2ODRD 3C4BA 2I9IA 3M99B 4DR6E 4GKJE 1A1FA 4F2JC 2EQ1A 3EPHA 4JI0E 3C6MA 2WBSA 2JWOA 5KL2A 4WFTA 2V83A 1YYOA 2ODRC 2YU5A 3MSWA 4RHBB 4B3RE 5AE1A 4DV5E 4IS1C 1YYWA 4Q28A 2EMZA 4R2CA 2LT7A 2LO3A 4ZYGA 2NABA 1JK1A 4LF4E 3BIDA 2EN7A 2UU9E 2YTEA 2N3GA 2V87A 2EN1A 2EOJA 2EOIA 2MC6A 1YFHA 2VQEE 2LJHA 2L2KB 5KL6A 4R03A 4LFCE 3EQ1A 4ZYEA 3JTZA 4BMJA 3IWBA 2EOOA 2HC5A 1QU6A 4ZYDA 4OX9E 4NHRA 4JI5E 1GQEA 1N33E 4X62E 3J7AG 3KZYA 1T38A 4R8OA 4BHCA 5F3WA 1GTKA 3QG5C 2EPMX 2NUGA 2B3TB 1SR9A 4LF8E 5T6JA 2VQFE 4DR3E 2UUBE 2EOSA 5KL7A 1BB8A 2N8XA 1IBKE 4JV5E 1UILA 4LF9E 1B69A 5KL5A 2EPPA 2ENAA 2DRPA 3RMPA 4DR7E 4FK5C 1XMQE 4KZSA 1PJQA 4L8NA 1XNRE 2EM3A 3TQMA 2EOHA 2H36X 1ZAAC 5A6AA 1IBME 4KHPE 1ZBTA 5A6BD 3DJWA 4BC7A 5IWAE 2EL5A 2KONA 3UK3C 2YTQA 2EN8A 2EN2A 3ADJA 1YZ9A 4LFAE 2LUQA 1HNWE 3OTOE 4JI7E 2E72A 2EMIA 2YTGA 1T4NA 2JXPA 2YT4A 3VHTB 3J7Yp 2B7VA 2HJJA 2IHR1 2DLQA 2JYAA 4B3TE 1WHNA 2M9AA 3HXLA 5AE3A 2ENHA 5TSEA 1BBGA 1A1LA 2V8QB 4HEIA 4JI1E 2RTXA 4R2PA 2WBTA 1WJPA 2EOZA 4LF6E 3F6GA 3DF6A 2A25A 4GZNC 4BBYA 5A69A 1EH6A 1YUJA 2LMZA 4ZYHA 2EMHA 2EM9A 4Q35B 4DV2E 1T4LB 1YYKA 1YUIA 2CT1A 4BCAA 5DNYA 4BHBA 4F9AB 2ZM6E 3THNA 3T1HE 1A1GA 2JOBA 4O43A 5IT9C 2GLIA 4M9VC 2LTSA 1FJGE 3J80C 2ENCA 2VRDA 1A1HA 2JPAA 4WX9A 4M0VA 1TN9A 2LVHA 2EPUA 2EM6A 4TUIA 1P47A 2YRMA 2EMFA 2EOXA 2J7JA 3BF2A 5KL3A 2YTJA 2Q8UA 2I13A 3KZZA 2GPIA 2JR1A 4DV1E 2JP9A 2G7HA 3VYXA 2EN6A 4DR5E 2YWQA 2MDRA 1ZBQA 4HTGA 4MLVA 2CPNA 2LJUA 1KYQA 4R2RA 2YPNA 2EOMA 2UXDE 3MHHC 4X64E 1G2DC 4WSPA 1YSAC 4B3SE 5A6KA 4GKKE 2EPCA 4LTYA 4YY3E 2CTDA 4R2DA 4RH8A 2EMXA 1YPNA 1X48A 2EL4A 1WHQA 2NUFA 2EP3A 5AASA 2LRSA 3AUZA 4X65E 4JYAE 1PKPA 2L2MA 2DSYA 2EL6A 1DQ3A 4N4RB 2YRKA 1A1KA 4M2ZA 1EKZA 4P78A 3C6KA 4P7DA 2FGGA 4YHHE 2MC5A 2MKDA 4DR2E 2YRHA 2V89A 1N32E 4JI6E 2EOEA 2FTXB 2EM5A 2EM4A 1N3GA 2JVAA 1GZ6A 2RS6A 4BS9A 4R2AA 2L6MA 2L33A 4DR1E 1J26A 3P1XA 2EMGA 2EOQA 4F6NA 5A2QC 1ZR9A 1Z1BA 2D9HA 4DKKA 1G2FC 4K0KE 1O0WA 3AV0A 5LLQA 1MEYC 3MHSC 1PDAA 4WPYA 1RMDA 1WRJA 4KWYA 1X6EA 2EPLX 2L3JA 1I94E 2NUEA 4LFBE 2WBUA 1X5WA 5IXMB 2B7TA 2RSIA 2DMYA 2B9DA 2JOXA 4WSGA 2L3CA 4DMIA 2ELZA 1A1JA 2YTFA 3ADIA 2YTDA 4WYQB 1IQOA 4X9JA 5KL4A 4F6MA 3EPKA 2EPZA 5BR8E 4F9BB 5IV8B 2EMLA 1IBLE 1TF6A 4B3ME 2EMBA 2F8BA 4F54A 2EM0A 2N3HA 3HPSA 1SFEA 2BB8A 4O4KA 4LU9A 2DLKA 4O24A 2GHFA 2EQ3A 2DB2A 1HNZE 1T4OA 2L2NA 1J5EE 2EM8A 4JI3E 2EN4A 4DV6E 5A6BA 2EN3A 1T39A 2KHXA 4NZVA 4I8OA 2LBSB 1NCSA 3HTXA 4NXNE
chains in the Genus database with same CATH topology
2VF1A 1X48A 2KOUA 2RS7A 1WHQA 2NUFA 2H36X 4X66E 1IBME 4X8WA 2UUCE 1ZBTA 4JI8E 1RQ0A 2WZOA 2RSMA 3DJWA 4BC7A 5IWAE 4TUGA 4DV0E 5AASA 2KONA 2LRSA 3AUZA 4X65E 4JYAE 2M4IA 4KHPE 4NXME 5FLXC 1PKPA 2L2MA 2DSYA 1DQ3A 2JY9A 2UUAE 3ADJA 4M2ZA 1EKZA 4P78A 2K4VA 1YZ9A 2DIXA 4DUYE 5ADZA 3FIGA 4P7DA 4LFAE 2LUQA 1HNWE 2V85A 5AE2A 3OTOE 4BC9A 2FGGA 4JI7E 3ZOQB 4YHHE 4JI2E 1UHZA 2MC5A 3HPZA 4DR2E 1T4NA 5LMUE 2HHHE 2VE7C 1DI2A 2YT4A 3F6HA 3J7Yp 4DV7E 2V89A 3T1YE 2B7VA 2YZTA 1N32E 2IHR1 1FKAE 2UXBE 3ADLA 2V86A 2V88A 3ADGA 3JU0A 4DV4E 4B3TE 4JI6E 1WHNA 3HXLA 2EWLA 2FTXB 5AE3A 1XNQE 3JAMC 2V8QB 2JVAA 1GZ6A 4JI1E 2RS6A 2RTXA 3IWCA 3K6QA 4BS9A 4DR4E 5CFFE 2ODRD 3C4BA 4LF6E 2L6MA 2L33A 4DR1E 1HR0E 4DR6E 3P1XA 3F6GA 4GKJE 1J26A 3DF6A 5A2QC 4BBYA 4JI0E 2JWOA 4DKKA 4WFTA 2LTRA 4K0KE 2LMZA 1O0WA 3AV0A 2V83A 1YYOA 4DV2E 1YYKA 1T4LB 2ODRC 3MSWA 4F9CB 4J8ZA 4NXNE 4B3RE 1X49A 4BCAA 3KWRA 5AE1A 4DV5E 4WPYA 5DNYA 2ZM6E 4F9AB 3LMLA 1I94E 4Q28A 3T1HE 2L3JA 1YYWA 3HQ1A 2JOBA 5IT9C 2NUEA 4LFBE 3J81C 2LUPB 1STUA 1N36E 2LTSA 4LF5E 1FJGE 2B7TA 3VYYA 4LF4E 3J80C 2DMYA 4DUZE 2B9DA 2JOXA 2L3CA 2UU9E 2E1MA 4M0VA 2N3GA 5LL6R 4DMIA 2V87A 4JI4E 2F4VE 4TUIA 3ADIA 1XNRE 2MC6A 4WYQB 2VQEE 2LJHA 2L2KB 4R03A 5BR8E 4F9BB 1IBLE 4LFCE 3JTZA 4BMJA 4B3ME 2NA2A 3IWBA 3C4TA 2F8BA 4DV3E 1QU6A 2LE2A 2JR1A 3IWDA 4DV1E 4F54A 4OX9E 4GEQB 2N3HA 1N34E 1GQEA 2G7HA 4JI5E 1N33E 3HPSA 4X62E 1XMOE 2EZ6A 3J7AG 2FV4B 4LU9A 4R8OA 4L5NC 4OOGC 3OMLA 4DR5E 5F3WA 3VYXA 2DB2A 2MDRA 2NUGA 1HNXE 2B3TB 1HNZE 1RC7A 1T4OA 1ZBQA 2L2NA 1J5EE 1SR9A 4LF8E 5T6JA 2L92A 4AQYE 2VQFE 2CPNA 1WXRA 4DR3E 2UUBE 3H09A 4JI3E 2UXCE 4DV6E 2L8TA 4LF7E 5LMNE 2UXDE 3LLHA 2KHXA 1IBKE 4JV5E 1UILA 4X64E 4LF9E 2M1SA 4I8OA 4WSPA 2M7QA 1X47A 3RMPA 2LBSB 4DR7E 4B3SE 3HTXA 4GKKE 1XMQE 4KZSA 4LTYA 2E5LE 4YY3E 4M30A 4L8NA 3VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X48 A;  2RS7 A;  1WHQ A;  2NUF A;  4X66 E;  2UUC E;  1IBM E;  4X8W A;  4KHP E;  1ZBT A;  4JI8 E;  1RQ0 A;  4DV0 E;  2RSM A;  5IWA E;  2LRS A;  4X65 E;  4JYA E;  4NXM E;  1PKP A;  2L2M A;  2JY9 A;  2UUA E;  3ADJ A;  4M2Z A;  1EKZ A;  1YZ9 A;  2DIX A;  4DUY E;  4LFA E;  2LUQ A;  1HNW E;  3OTO E;  4JI7 E;  4YHH E;  4JI2 E;  1UHZ A;  4DR2 E;  1T4N A;  5LMU E;  2HHH E;  1DI2 A;  2YT4 A;  3J7Y p;  4DV7 E;  3T1Y E;  2B7V A;  1N32 E;  2IHR 1;  1FKA E;  2UXB E;  3ADL A;  3ADG A;  4DV4 E;  4B3T E;  4JI6 E;  1WHN A;  1XNQ E;  2JVA A;  4JI1 E;  2RS6 A;  2RTX A;  4DR4 E;  5CFF E;  3C4B A;  4LF6 E;  4DR1 E;  2L33 A;  1HR0 E;  4DR6 E;  4GKJ E;  3P1X A;  1J26 A;  4JI0 E;  4DKK A;  4WFT A;  2LTR A;  4K0K E;  1O0W A;  1YYO A;  4DV2 E;  1YYK A;  1T4L B;  4B3R E;  1X49 A;  4DV5 E;  2ZM6 E;  1YYW A;  1I94 E;  3T1H E;  4LFB E;  2L3J A;  2NUE A;  2LUP B;  1STU A;  1N36 E;  2LTS A;  4LF5 E;  1FJG E;  2B7T A;  3VYY A;  4LF4 E;  2DMY A;  4DUZ E;  2UU9 E;  2L3C A;  2N3G A;  4JI4 E;  2F4V E;  3ADI A;  1XNR E;  4WYQ B;  2VQE E;  2LJH A;  2L2K B;  4LFC E;  5BR8 E;  1IBL E;  4B3M E;  2NA2 A;  3C4T A;  4DV3 E;  1QU6 A;  4DV1 E;  4OX9 E;  2N3H A;  1N34 E;  1GQE A;  4JI5 E;  1N33 E;  4X62 E;  1XMO E;  2EZ6 A;  3VYX A;  4OOG C;  4DR5 E;  2DB2 A;  2MDR A;  2NUG A;  1HNX E;  2B3T B;  1HNZ E;  1RC7 A;  1T4O A;  2L2N A;  1J5E E;  4LF8 E;  4AQY E;  2VQF E;  2CPN A;  4DR3 E;  2UUB E;  4JI3 E;  2UXC E;  4DV6 E;  4LF7 E;  5LMN E;  2UXD E;  3LLH A;  2KHX A;  1IBK E;  4JV5 E;  1UIL A;  4X64 E;  4LF9 E;  1X47 A;  2LBS B;  4DR7 E;  4B3S E;  3HTX A;  4GKK E;  1XMQ E;  2E5L E;  4YY3 E;  4M30 A;  4NXN E; 
#chains in the Genus database with same CATH topology
 2VF1 A;  4X8W A;  4TUG A;  4DV0 E;  2K7I A;  4NXM E;  5FLX C;  2JY9 A;  2DMI A;  2ADR A;  3THO B;  2DIX A;  4DUY E;  5ADZ A;  3FIG A;  1BBO A;  4WXD A;  1PJT A;  1UHZ A;  1UN6 B;  1ZU1 A;  3HPZ A;  5LMU E;  1DI2 A;  2VE7 C;  4DV7 E;  3F6H A;  1FKA E;  2UXB E;  2V86 A;  3ADG A;  3JU0 A;  4DV4 E;  2MDG A;  1XNQ E;  3JAM C;  2EJ4 A;  2EM2 A;  2RQL A;  2DGC A;  3K6Q A;  2EPO A;  5CFF E;  2YTN A;  1HR0 E;  2EOY A;  2HGH A;  2LV2 A;  3ECR A;  2LTR A;  1UBD C;  4F9C B;  4J8Z A;  4WXC A;  1X49 A;  3KWR A;  4R2Q A;  4IJD A;  3LML A;  2YTI A;  2EQ0 A;  3HQ1 A;  3J81 C;  2LUP B;  1STU A;  2BBG A;  2EE8 A;  1N36 E;  2YU8 A;  4LF5 E;  1EH8 A;  5AC5 A;  3VYY A;  2PRT A;  4DUZ E;  1QNT A;  2E1M A;  5LL6 R;  2RPC A;  4JI4 E;  1AAY A;  2F4V E;  3BBG A;  3EPJ A;  4O5G A;  2EMK A;  1EH7 A;  3L00 A;  1A1I A;  1L4S A;  2YSO A;  2LCE A;  2EPK X;  2NA2 A;  3C4T A;  4DV3 E;  2LE2 A;  2EPX A;  3IWD A;  4GEQ B;  1N34 E;  4R2E A;  1XMO E;  2EZ6 A;  2FV4 B;  4L5N C;  4OOG C;  3OML A;  2EMC A;  1HNX E;  1F2I G;  1RC7 A;  1X6H A;  2EMY A;  2L92 A;  4AQY E;  2EMA A;  1WXR A;  2MKN A;  2UXC E;  3H09 A;  2EPA A;  1MGT A;  4R2S A;  2EMW A;  2L8T A;  4LF7 E;  5LMN E;  2EPR A;  3LLH A;  2EPN A;  3EPL A;  2EM7 A;  2M1S A;  2YSP A;  2M7Q A;  1X47 A;  1JK2 A;  2ELY A;  1IMU A;  2E5L E;  4M30 A;  4MLQ A;  1AH5 A;  2CSH A;  3VK6 A;  5A6J A;  1X3C A;  2KOU A;  2RS7 A;  1DGC A;  2YTO A;  4X66 E;  2UUC E;  4JI8 E;  1RQ0 A;  2WZO A;  2RSM A;  1IQS A;  2M4I A;  2R1F A;  1PJS A;  2EOF A;  3BGH A;  2UUA E;  1TF3 A;  2K4V A;  2V85 A;  2YTP A;  5AE2 A;  2R76 A;  3ZOQ B;  4BC9 A;  4JI2 E;  1NEI A;  1KJK A;  2HHH E;  3T1Y E;  5AC4 A;  2YZT A;  3ADL A;  2V88 A;  1X6F A;  2WCC 3;  2EWL A;  1LLM C;  2EOR A;  3IWC A;  4DR4 E;  2ODR D;  3C4B A;  2I9I A;  3M99 B;  4DR6 E;  4GKJ E;  1A1F A;  4F2J C;  2EQ1 A;  3EPH A;  4JI0 E;  3C6M A;  2WBS A;  2JWO A;  5KL2 A;  4WFT A;  2V83 A;  1YYO A;  2ODR C;  2YU5 A;  3MSW A;  4RHB B;  4B3R E;  5AE1 A;  4DV5 E;  4IS1 C;  1YYW A;  4Q28 A;  2EMZ A;  4R2C A;  2LT7 A;  2LO3 A;  4ZYG A;  2NAB A;  1JK1 A;  4LF4 E;  3BID A;  2EN7 A;  2UU9 E;  2YTE A;  2N3G A;  2V87 A;  2EN1 A;  2EOJ A;  2EOI A;  2MC6 A;  1YFH A;  2VQE E;  2LJH A;  2L2K B;  5KL6 A;  4R03 A;  4LFC E;  3EQ1 A;  4ZYE A;  3JTZ A;  4BMJ A;  3IWB A;  2EOO A;  2HC5 A;  1QU6 A;  4ZYD A;  4OX9 E;  4NHR A;  4JI5 E;  1GQE A;  1N33 E;  4X62 E;  3J7A G;  3KZY A;  1T38 A;  4R8O A;  4BHC A;  5F3W A;  1GTK A;  3QG5 C;  2EPM X;  2NUG A;  2B3T B;  1SR9 A;  4LF8 E;  5T6J A;  2VQF E;  4DR3 E;  2UUB E;  2EOS A;  5KL7 A;  1BB8 A;  2N8X A;  1IBK E;  4JV5 E;  1UIL A;  4LF9 E;  1B69 A;  5KL5 A;  2EPP A;  2ENA A;  2DRP A;  3RMP A;  4DR7 E;  4FK5 C;  1XMQ E;  4KZS A;  1PJQ A;  4L8N A;  1XNR E;  2EM3 A;  3TQM A;  2EOH A;  2H36 X;  1ZAA C;  5A6A A;  1IBM E;  4KHP E;  1ZBT A;  5A6B D;  3DJW A;  4BC7 A;  5IWA E;  2EL5 A;  2KON A;  3UK3 C;  2YTQ A;  2EN8 A;  2EN2 A;  3ADJ A;  1YZ9 A;  4LFA E;  2LUQ A;  1HNW E;  3OTO E;  4JI7 E;  2E72 A;  2EMI A;  2YTG A;  1T4N A;  2JXP A;  2YT4 A;  3VHT B;  3J7Y p;  2B7V A;  2HJJ A;  2IHR 1;  2DLQ A;  2JYA A;  4B3T E;  1WHN A;  2M9A A;  3HXL A;  5AE3 A;  2ENH A;  5TSE A;  1BBG A;  1A1L A;  2V8Q B;  4HEI A;  4JI1 E;  2RTX A;  4R2P A;  2WBT A;  1WJP A;  2EOZ A;  4LF6 E;  3F6G A;  3DF6 A;  2A25 A;  4GZN C;  4BBY A;  5A69 A;  1EH6 A;  1YUJ A;  2LMZ A;  4ZYH A;  2EMH A;  2EM9 A;  4Q35 B;  4DV2 E;  1T4L B;  1YYK A;  1YUI A;  2CT1 A;  4BCA A;  5DNY A;  4BHB A;  4F9A B;  2ZM6 E;  3THN A;  3T1H E;  1A1G A;  2JOB A;  4O43 A;  5IT9 C;  2GLI A;  4M9V C;  2LTS A;  1FJG E;  3J80 C;  2ENC A;  2VRD A;  1A1H A;  2JPA A;  4WX9 A;  4M0V A;  1TN9 A;  2LVH A;  2EPU A;  2EM6 A;  4TUI A;  1P47 A;  2YRM A;  2EMF A;  2EOX A;  2J7J A;  3BF2 A;  5KL3 A;  2YTJ A;  2Q8U A;  2I13 A;  3KZZ A;  2GPI A;  2JR1 A;  4DV1 E;  2JP9 A;  2G7H A;  3VYX A;  2EN6 A;  4DR5 E;  2YWQ A;  2MDR A;  1ZBQ A;  4HTG A;  4MLV A;  2CPN A;  2LJU A;  1KYQ A;  4R2R A;  2YPN A;  2EOM A;  2UXD E;  3MHH C;  4X64 E;  1G2D C;  4WSP A;  1YSA C;  4B3S E;  5A6K A;  4GKK E;  2EPC A;  4LTY A;  4YY3 E;  2CTD A;  4R2D A;  4RH8 A;  2EMX A;  1YPN A;  1X48 A;  2EL4 A;  1WHQ A;  2NUF A;  2EP3 A;  5AAS A;  2LRS A;  3AUZ A;  4X65 E;  4JYA E;  1PKP A;  2L2M A;  2DSY A;  2EL6 A;  1DQ3 A;  4N4R B;  2YRK A;  1A1K A;  4M2Z A;  1EKZ A;  4P78 A;  3C6K A;  4P7D A;  2FGG A;  4YHH E;  2MC5 A;  2MKD A;  4DR2 E;  2YRH A;  2V89 A;  1N32 E;  4JI6 E;  2EOE A;  2FTX B;  2EM5 A;  2EM4 A;  1N3G A;  2JVA A;  1GZ6 A;  2RS6 A;  4BS9 A;  4R2A A;  2L6M A;  2L33 A;  4DR1 E;  1J26 A;  3P1X A;  2EMG A;  2EOQ A;  4F6N A;  5A2Q C;  1ZR9 A;  1Z1B A;  2D9H A;  4DKK A;  1G2F C;  4K0K E;  1O0W A;  3AV0 A;  5LLQ A;  1MEY C;  3MHS C;  1PDA A;  4WPY A;  1RMD A;  1WRJ A;  4KWY A;  1X6E A;  2EPL X;  2L3J A;  1I94 E;  2NUE A;  4LFB E;  2WBU A;  1X5W A;  5IXM B;  2B7T A;  2RSI A;  2DMY A;  2B9D A;  2JOX A;  4WSG A;  2L3C A;  4DMI A;  2ELZ A;  1A1J A;  2YTF A;  3ADI A;  2YTD A;  4WYQ B;  1IQO A;  4X9J A;  5KL4 A;  4F6M A;  3EPK A;  2EPZ A;  5BR8 E;  4F9B B;  5IV8 B;  2EML A;  1IBL E;  1TF6 A;  4B3M E;  2EMB A;  2F8B A;  4F54 A;  2EM0 A;  2N3H A;  3HPS A;  1SFE A;  2BB8 A;  4O4K A;  4LU9 A;  2DLK A;  4O24 A;  2GHF A;  2EQ3 A;  2DB2 A;  1HNZ E;  1T4O A;  2L2N A;  1J5E E;  2EM8 A;  4JI3 E;  2EN4 A;  4DV6 E;  5A6B A;  2EN3 A;  1T39 A;  2KHX A;  4NZV A;  4I8O A;  2LBS B;  1NCS A;  3HTX A;  4NXN E; 
#chains in the Genus database with same CATH homology
 2VF1 A;  1X48 A;  2KOU A;  2RS7 A;  1WHQ A;  2NUF A;  2H36 X;  4X66 E;  1IBM E;  4X8W A;  2UUC E;  1ZBT A;  4JI8 E;  1RQ0 A;  2WZO A;  2RSM A;  3DJW A;  4BC7 A;  5IWA E;  4TUG A;  4DV0 E;  5AAS A;  2KON A;  2LRS A;  3AUZ A;  4X65 E;  4JYA E;  2M4I A;  4KHP E;  4NXM E;  5FLX C;  1PKP A;  2L2M A;  2DSY A;  1DQ3 A;  2JY9 A;  2UUA E;  3ADJ A;  4M2Z A;  1EKZ A;  4P78 A;  2K4V A;  1YZ9 A;  2DIX A;  4DUY E;  5ADZ A;  3FIG A;  4P7D A;  4LFA E;  2LUQ A;  1HNW E;  2V85 A;  5AE2 A;  3OTO E;  4BC9 A;  2FGG A;  4JI7 E;  3ZOQ B;  4YHH E;  4JI2 E;  1UHZ A;  2MC5 A;  3HPZ A;  4DR2 E;  1T4N A;  5LMU E;  2HHH E;  2VE7 C;  1DI2 A;  2YT4 A;  3F6H A;  3J7Y p;  4DV7 E;  2V89 A;  3T1Y E;  2B7V A;  2YZT A;  1N32 E;  2IHR 1;  1FKA E;  2UXB E;  3ADL A;  2V86 A;  2V88 A;  3ADG A;  3JU0 A;  4DV4 E;  4B3T E;  4JI6 E;  1WHN A;  3HXL A;  2EWL A;  2FTX B;  5AE3 A;  1XNQ E;  3JAM C;  2V8Q B;  2JVA A;  1GZ6 A;  4JI1 E;  2RS6 A;  2RTX A;  3IWC A;  3K6Q A;  4BS9 A;  4DR4 E;  5CFF E;  2ODR D;  3C4B A;  4LF6 E;  2L6M A;  2L33 A;  4DR1 E;  1HR0 E;  4DR6 E;  3P1X A;  3F6G A;  4GKJ E;  1J26 A;  3DF6 A;  5A2Q C;  4BBY A;  4JI0 E;  2JWO A;  4DKK A;  4WFT A;  2LTR A;  4K0K E;  2LMZ A;  1O0W A;  3AV0 A;  2V83 A;  1YYO A;  4DV2 E;  1YYK A;  1T4L B;  2ODR C;  3MSW A;  4F9C B;  4J8Z A;  4NXN E;  4B3R E;  1X49 A;  4BCA A;  3KWR A;  5AE1 A;  4DV5 E;  4WPY A;  5DNY A;  2ZM6 E;  4F9A B;  3LML A;  1I94 E;  4Q28 A;  3T1H E;  2L3J A;  1YYW A;  3HQ1 A;  2JOB A;  5IT9 C;  2NUE A;  4LFB E;  3J81 C;  2LUP B;  1STU A;  1N36 E;  2LTS A;  4LF5 E;  1FJG E;  2B7T A;  3VYY A;  4LF4 E;  3J80 C;  2DMY A;  4DUZ E;  2B9D A;  2JOX A;  2L3C A;  2UU9 E;  2E1M A;  4M0V A;  2N3G A;  5LL6 R;  4DMI A;  2V87 A;  4JI4 E;  2F4V E;  4TUI A;  3ADI A;  1XNR E;  2MC6 A;  4WYQ B;  2VQE E;  2LJH A;  2L2K B;  4R03 A;  5BR8 E;  4F9B B;  1IBL E;  4LFC E;  3JTZ A;  4BMJ A;  4B3M E;  2NA2 A;  3IWB A;  3C4T A;  2F8B A;  4DV3 E;  1QU6 A;  2LE2 A;  2JR1 A;  3IWD A;  4DV1 E;  4F54 A;  4OX9 E;  4GEQ B;  2N3H A;  1N34 E;  1GQE A;  2G7H A;  4JI5 E;  1N33 E;  3HPS A;  4X62 E;  1XMO E;  2EZ6 A;  3J7A G;  2FV4 B;  4LU9 A;  4R8O A;  4L5N C;  4OOG C;  3OML A;  4DR5 E;  5F3W A;  3VYX A;  2DB2 A;  2MDR A;  2NUG A;  1HNX E;  2B3T B;  1HNZ E;  1RC7 A;  1T4O A;  1ZBQ A;  2L2N A;  1J5E E;  1SR9 A;  4LF8 E;  5T6J A;  2L92 A;  4AQY E;  2VQF E;  2CPN A;  1WXR A;  4DR3 E;  2UUB E;  3H09 A;  4JI3 E;  2UXC E;  4DV6 E;  2L8T A;  4LF7 E;  5LMN E;  2UXD E;  3LLH A;  2KHX A;  1IBK E;  4JV5 E;  1UIL A;  4X64 E;  4LF9 E;  2M1S A;  4I8O A;  4WSP A;  2M7Q A;  1X47 A;  3RMP A;  2LBS B;  4DR7 E;  4B3S E;  3HTX A;  4GKK E;  1XMQ E;  4KZS A;  4LTY A;  2E5L E;  4YY3 E;  4M30 A;  4L8N A;  3VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...